data_2LNA
# 
_entry.id   2LNA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LNA         
RCSB  RCSB102592   
BMRB  18156        
WWPDB D_1000102592 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
18156   BMRB     unspecified . 
HR6741A TargetDB unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LNA 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2011-12-20 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ramelot, T.A.'                                   1  
'Yang, Y.'                                        2  
'Lee, H.'                                         3  
'Janua, H.'                                       4  
'Kohan, E.'                                       5  
'Shastry, R.'                                     6  
'Acton, T.B.'                                     7  
'Xiao, R.'                                        8  
'Everett, J.K.'                                   9  
'Prestegard, J.H.'                                10 
'Montelione, G.T.'                                11 
'Kennedy, M.A.'                                   12 
'Northeast Structural Genomics Consortium (NESG)' 13 
'Mitochondrial Protein Partnership (MPP)'         14 
# 
_citation.id                        primary 
_citation.title                     
;NMR structure and MD simulations of the AAA protease intermembrane space domain indicates peripheral membrane localization within the hexaoligomer.
;
_citation.journal_abbrev            'Febs Lett.' 
_citation.journal_volume            587 
_citation.page_first                3522 
_citation.page_last                 3528 
_citation.year                      2013 
_citation.journal_id_ASTM           FEBLAL 
_citation.country                   NE 
_citation.journal_id_ISSN           0014-5793 
_citation.journal_id_CSD            0165 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24055473 
_citation.pdbx_database_id_DOI      10.1016/j.febslet.2013.09.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ramelot, T.A.'    1 
primary 'Yang, Y.'         2 
primary 'Sahu, I.D.'       3 
primary 'Lee, H.W.'        4 
primary 'Xiao, R.'         5 
primary 'Lorigan, G.A.'    6 
primary 'Montelione, G.T.' 7 
primary 'Kennedy, M.A.'    8 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'AFG3-like protein 2' 
_entity.formula_weight             11493.874 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    3.4.24.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'UNP residues 164-251' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Paraplegin-like protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHSHMKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQE
LGIEGENRVPVVYIAESDG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHSHMKRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQE
LGIEGENRVPVVYIAESDG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         HR6741A 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  SER n 
1 10 HIS n 
1 11 MET n 
1 12 LYS n 
1 13 ARG n 
1 14 SER n 
1 15 GLY n 
1 16 ARG n 
1 17 GLU n 
1 18 ILE n 
1 19 THR n 
1 20 TRP n 
1 21 LYS n 
1 22 ASP n 
1 23 PHE n 
1 24 VAL n 
1 25 ASN n 
1 26 ASN n 
1 27 TYR n 
1 28 LEU n 
1 29 SER n 
1 30 LYS n 
1 31 GLY n 
1 32 VAL n 
1 33 VAL n 
1 34 ASP n 
1 35 ARG n 
1 36 LEU n 
1 37 GLU n 
1 38 VAL n 
1 39 VAL n 
1 40 ASN n 
1 41 LYS n 
1 42 ARG n 
1 43 PHE n 
1 44 VAL n 
1 45 ARG n 
1 46 VAL n 
1 47 THR n 
1 48 PHE n 
1 49 THR n 
1 50 PRO n 
1 51 GLY n 
1 52 LYS n 
1 53 THR n 
1 54 PRO n 
1 55 VAL n 
1 56 ASP n 
1 57 GLY n 
1 58 GLN n 
1 59 TYR n 
1 60 VAL n 
1 61 TRP n 
1 62 PHE n 
1 63 ASN n 
1 64 ILE n 
1 65 GLY n 
1 66 SER n 
1 67 VAL n 
1 68 ASP n 
1 69 THR n 
1 70 PHE n 
1 71 GLU n 
1 72 ARG n 
1 73 ASN n 
1 74 LEU n 
1 75 GLU n 
1 76 THR n 
1 77 LEU n 
1 78 GLN n 
1 79 GLN n 
1 80 GLU n 
1 81 LEU n 
1 82 GLY n 
1 83 ILE n 
1 84 GLU n 
1 85 GLY n 
1 86 GLU n 
1 87 ASN n 
1 88 ARG n 
1 89 VAL n 
1 90 PRO n 
1 91 VAL n 
1 92 VAL n 
1 93 TYR n 
1 94 ILE n 
1 95 ALA n 
1 96 GLU n 
1 97 SER n 
1 98 ASP n 
1 99 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 AFG3L2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pMgK' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET15_NESG 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AFG32_HUMAN 
_struct_ref.pdbx_db_accession          Q9Y4W6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KRSGREITWKDFVNNYLSKGVVDRLEVVNKRFVRVTFTPGKTPVDGQYVWFNIGSVDTFERNLETLQQELGIEGENRVPV
VYIAESDG
;
_struct_ref.pdbx_align_begin           164 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LNA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 12 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 99 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9Y4W6 
_struct_ref_seq.db_align_beg                  164 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  251 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       12 
_struct_ref_seq.pdbx_auth_seq_align_end       99 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LNA MET A 1  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 1  1  
1 2LNA GLY A 2  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 2  2  
1 2LNA HIS A 3  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 3  3  
1 2LNA HIS A 4  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 4  4  
1 2LNA HIS A 5  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 5  5  
1 2LNA HIS A 6  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 6  6  
1 2LNA HIS A 7  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 7  7  
1 2LNA HIS A 8  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 8  8  
1 2LNA SER A 9  ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 9  9  
1 2LNA HIS A 10 ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 10 10 
1 2LNA MET A 11 ? UNP Q9Y4W6 ? ? 'EXPRESSION TAG' 11 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'           
1 2  1 '2D 1H-13C HSQC'           
1 3  1 '3D HNCO'                  
1 4  1 '3D CBCA(CO)NH'            
1 5  1 '3D HNCACB'                
1 6  1 '3D 1H-13C arom NOESY'     
1 7  1 '3D 1H-13C NOESYaliph'     
1 8  1 '3D 1H-15N NOESY'          
1 9  2 '2D 1H-13C HSQC aliphatic' 
1 10 2 '2D 1H-15N hetNOE'         
1 11 1 '3D HN(CO)CA'              
1 12 1 '3D HCCH-TOCSY'            
1 13 1 '3D HCCH-COSY'             
1 14 1 '3D H(CCO)NH'              
1 15 1 '3D C(CO)NH'               
1 16 1 '3D HBHA(CO)NH'            
1 17 3 '4D CC-HMQC-NOESY-HMQC'    
1 18 3 '2D 1H-15N HSQC'           
1 19 3 '3D CCH-TOCSY'             
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 200 mM sodium chloride, 20 mM MES, 5 mM calcium chloride, 10 mM DTT, 10 uM DSS, 0.02 % sodium azide, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;1.0 mM NC5 HR6741A, 200 mM sodium chloride, 20 mM MES, 5 mM calcium chloride, 10 mM DTT, 10 uM DSS, 0.02 % sodium azide, 90% H2O/10% D2O
;
2 '90% H2O/10% D2O' 
;0.7 mM [U-100% 13C; U-100% 15N] HR6741A, 200 mM sodium chloride, 20 mM MES, 5 mM calcium chloride, 10 mM DTT, 10 uM DSS, 0.02 % sodium azide, 100% D2O
;
3 '100% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
850 Bruker AvanceIII 1 'Bruker AvanceIII' 
600 Varian INOVA     2 'Varian INOVA'     
600 Bruker AvanceIII 3 'Bruker AvanceIII' 
# 
_pdbx_nmr_refine.entry_id           2LNA 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'CNS refinement in explicit water + two sets of NH RDCs' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LNA 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LNA 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNS           1.3             1  
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS           1.3             2  
'Brunger, Adams, Clore, Gros, Nilges and Read'      'geometry optimization'     CNS           1.3             3  
'Guntert, Mumenthaler and Wuthrich'                 refinement                  CYANA         3.0             4  
'Guntert, Mumenthaler and Wuthrich'                 'geometry optimization'     CYANA         3.0             5  
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA         3.0             6  
'Huang, Tejero, Powers and Montelione'              'data analysis'             AutoStructure 2.1             7  
'Huang, Tejero, Powers and Montelione'              refinement                  AutoStructure 2.1             8  
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe       '2008 linux9'   9  
'Bruker Biospin'                                    collection                  TOPSPIN       '2.1.4 and 3.1' 10 
Varian                                              collection                  VNMRJ         ?               11 
'Bahrami, Markley, Assadi, and Eghbalnia'           'chemical shift assignment' PINE          ?               12 
Goddard                                             'data analysis'             SPARKY        3.113           13 
'Shen, Cornilescu, Delaglio and Bax'                'geometry optimization'     TALOS+        1.2009.0721.18  14 
'PALES (Zweckstetter, Bax)'                         'geometry optimization'     PALES         2000            15 
'Bhattacharya, Montelione'                          'structure solution'        PSVS          1.4             16 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH    2.25            17 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LNA 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LNA 
_struct.title                     
;Solution NMR Structure of the mitochondrial inner membrane domain (residues 164-251), FtsH_ext, from the paraplegin-like protein AFG3L2 from Homo sapiens, Northeast Structural Genomics Consortium Target HR6741A
;
_struct.pdbx_descriptor           'AFG3-like protein 2 (E.C.3.4.24.-)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            Y 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LNA 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;Structural Genomics, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM (NESG), PSI-Biology, Protein Structure Initiative, MPP, HYDROLASE, Mitochondrial Protein Partnership
;
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 19 ? TYR A 27 ? THR A 19 TYR A 27 1 ? 9  
HELX_P HELX_P2 2 LEU A 28 ? GLY A 31 ? LEU A 28 GLY A 31 5 ? 4  
HELX_P HELX_P3 3 SER A 66 ? LEU A 81 ? SER A 66 LEU A 81 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 16 ? GLU A 17 ? ARG A 16 GLU A 17 
A 2 VAL A 60 ? ASN A 63 ? VAL A 60 ASN A 63 
A 3 PHE A 43 ? PHE A 48 ? PHE A 43 PHE A 48 
A 4 VAL A 33 ? VAL A 39 ? VAL A 33 VAL A 39 
A 5 VAL A 91 ? TYR A 93 ? VAL A 91 TYR A 93 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ARG A 16 ? N ARG A 16 O TRP A 61 ? O TRP A 61 
A 2 3 O PHE A 62 ? O PHE A 62 N VAL A 44 ? N VAL A 44 
A 3 4 O ARG A 45 ? O ARG A 45 N GLU A 37 ? N GLU A 37 
A 4 5 N VAL A 38 ? N VAL A 38 O VAL A 92 ? O VAL A 92 
# 
_atom_sites.entry_id                    2LNA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1  ? 19.317  10.450  17.814  1.00 0.00 ? 1  MET A N    1  
ATOM 2     C CA   . MET A 1 1  ? 18.534  9.350   18.397  1.00 0.00 ? 1  MET A CA   1  
ATOM 3     C C    . MET A 1 1  ? 17.047  9.704   18.326  1.00 0.00 ? 1  MET A C    1  
ATOM 4     O O    . MET A 1 1  ? 16.607  10.665  18.970  1.00 0.00 ? 1  MET A O    1  
ATOM 5     C CB   . MET A 1 1  ? 18.943  9.093   19.871  1.00 0.00 ? 1  MET A CB   1  
ATOM 6     C CG   . MET A 1 1  ? 20.421  8.779   20.104  1.00 0.00 ? 1  MET A CG   1  
ATOM 7     S SD   . MET A 1 1  ? 20.795  8.652   21.869  1.00 0.00 ? 1  MET A SD   1  
ATOM 8     C CE   . MET A 1 1  ? 22.575  8.422   21.859  1.00 0.00 ? 1  MET A CE   1  
ATOM 9     H H1   . MET A 1 1  ? 19.047  10.593  16.823  1.00 0.00 ? 1  MET A H1   1  
ATOM 10    H H2   . MET A 1 1  ? 20.334  10.238  17.857  1.00 0.00 ? 1  MET A H2   1  
ATOM 11    H H3   . MET A 1 1  ? 19.136  11.328  18.336  1.00 0.00 ? 1  MET A H3   1  
ATOM 12    H HA   . MET A 1 1  ? 18.727  8.461   17.807  1.00 0.00 ? 1  MET A HA   1  
ATOM 13    H HB2  . MET A 1 1  ? 18.703  9.976   20.452  1.00 0.00 ? 1  MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1  ? 18.359  8.264   20.259  1.00 0.00 ? 1  MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1  ? 20.668  7.839   19.625  1.00 0.00 ? 1  MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1  ? 21.023  9.571   19.673  1.00 0.00 ? 1  MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1  ? 23.051  9.263   21.373  1.00 0.00 ? 1  MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1  ? 22.820  7.511   21.328  1.00 0.00 ? 1  MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1  ? 22.931  8.350   22.875  1.00 0.00 ? 1  MET A HE3  1  
ATOM 20    N N    . GLY A 1 2  ? 16.273  8.917   17.551  1.00 0.00 ? 2  GLY A N    1  
ATOM 21    C CA   . GLY A 1 2  ? 14.826  9.108   17.429  1.00 0.00 ? 2  GLY A CA   1  
ATOM 22    C C    . GLY A 1 2  ? 14.043  8.645   18.647  1.00 0.00 ? 2  GLY A C    1  
ATOM 23    O O    . GLY A 1 2  ? 12.812  8.785   18.671  1.00 0.00 ? 2  GLY A O    1  
ATOM 24    H H    . GLY A 1 2  ? 16.696  8.184   17.051  1.00 0.00 ? 2  GLY A H    1  
ATOM 25    H HA2  . GLY A 1 2  ? 14.615  10.156  17.264  1.00 0.00 ? 2  GLY A HA2  1  
ATOM 26    H HA3  . GLY A 1 2  ? 14.482  8.551   16.570  1.00 0.00 ? 2  GLY A HA3  1  
ATOM 27    N N    . HIS A 1 3  ? 14.762  8.089   19.648  1.00 0.00 ? 3  HIS A N    1  
ATOM 28    C CA   . HIS A 1 3  ? 14.175  7.616   20.905  1.00 0.00 ? 3  HIS A CA   1  
ATOM 29    C C    . HIS A 1 3  ? 13.601  8.793   21.718  1.00 0.00 ? 3  HIS A C    1  
ATOM 30    O O    . HIS A 1 3  ? 12.514  8.677   22.279  1.00 0.00 ? 3  HIS A O    1  
ATOM 31    C CB   . HIS A 1 3  ? 15.227  6.825   21.730  1.00 0.00 ? 3  HIS A CB   1  
ATOM 32    C CG   . HIS A 1 3  ? 14.678  6.176   22.976  1.00 0.00 ? 3  HIS A CG   1  
ATOM 33    N ND1  . HIS A 1 3  ? 14.794  6.724   24.233  1.00 0.00 ? 3  HIS A ND1  1  
ATOM 34    C CD2  . HIS A 1 3  ? 13.995  5.017   23.144  1.00 0.00 ? 3  HIS A CD2  1  
ATOM 35    C CE1  . HIS A 1 3  ? 14.213  5.931   25.111  1.00 0.00 ? 3  HIS A CE1  1  
ATOM 36    N NE2  . HIS A 1 3  ? 13.724  4.895   24.476  1.00 0.00 ? 3  HIS A NE2  1  
ATOM 37    H H    . HIS A 1 3  ? 15.725  7.984   19.523  1.00 0.00 ? 3  HIS A H    1  
ATOM 38    H HA   . HIS A 1 3  ? 13.360  6.943   20.649  1.00 0.00 ? 3  HIS A HA   1  
ATOM 39    H HB2  . HIS A 1 3  ? 15.641  6.039   21.109  1.00 0.00 ? 3  HIS A HB2  1  
ATOM 40    H HB3  . HIS A 1 3  ? 16.031  7.489   22.026  1.00 0.00 ? 3  HIS A HB3  1  
ATOM 41    H HD1  . HIS A 1 3  ? 15.223  7.580   24.453  1.00 0.00 ? 3  HIS A HD1  1  
ATOM 42    H HD2  . HIS A 1 3  ? 13.719  4.315   22.374  1.00 0.00 ? 3  HIS A HD2  1  
ATOM 43    H HE1  . HIS A 1 3  ? 14.150  6.106   26.173  1.00 0.00 ? 3  HIS A HE1  1  
ATOM 44    H HE2  . HIS A 1 3  ? 13.338  4.103   24.906  1.00 0.00 ? 3  HIS A HE2  1  
ATOM 45    N N    . HIS A 1 4  ? 14.338  9.931   21.765  1.00 0.00 ? 4  HIS A N    1  
ATOM 46    C CA   . HIS A 1 4  ? 13.892  11.129  22.516  1.00 0.00 ? 4  HIS A CA   1  
ATOM 47    C C    . HIS A 1 4  ? 13.055  12.076  21.628  1.00 0.00 ? 4  HIS A C    1  
ATOM 48    O O    . HIS A 1 4  ? 13.569  13.019  21.016  1.00 0.00 ? 4  HIS A O    1  
ATOM 49    C CB   . HIS A 1 4  ? 15.084  11.858  23.228  1.00 0.00 ? 4  HIS A CB   1  
ATOM 50    C CG   . HIS A 1 4  ? 16.342  12.111  22.420  1.00 0.00 ? 4  HIS A CG   1  
ATOM 51    N ND1  . HIS A 1 4  ? 17.579  11.617  22.794  1.00 0.00 ? 4  HIS A ND1  1  
ATOM 52    C CD2  . HIS A 1 4  ? 16.577  12.850  21.308  1.00 0.00 ? 4  HIS A CD2  1  
ATOM 53    C CE1  . HIS A 1 4  ? 18.500  12.052  21.958  1.00 0.00 ? 4  HIS A CE1  1  
ATOM 54    N NE2  . HIS A 1 4  ? 17.918  12.793  21.049  1.00 0.00 ? 4  HIS A NE2  1  
ATOM 55    H H    . HIS A 1 4  ? 15.188  9.971   21.272  1.00 0.00 ? 4  HIS A H    1  
ATOM 56    H HA   . HIS A 1 4  ? 13.223  10.770  23.305  1.00 0.00 ? 4  HIS A HA   1  
ATOM 57    H HB2  . HIS A 1 4  ? 14.740  12.819  23.584  1.00 0.00 ? 4  HIS A HB2  1  
ATOM 58    H HB3  . HIS A 1 4  ? 15.372  11.271  24.097  1.00 0.00 ? 4  HIS A HB3  1  
ATOM 59    H HD1  . HIS A 1 4  ? 17.756  11.037  23.571  1.00 0.00 ? 4  HIS A HD1  1  
ATOM 60    H HD2  . HIS A 1 4  ? 15.841  13.387  20.729  1.00 0.00 ? 4  HIS A HD2  1  
ATOM 61    H HE1  . HIS A 1 4  ? 19.557  11.830  22.010  1.00 0.00 ? 4  HIS A HE1  1  
ATOM 62    H HE2  . HIS A 1 4  ? 18.384  13.305  20.355  1.00 0.00 ? 4  HIS A HE2  1  
ATOM 63    N N    . HIS A 1 5  ? 11.752  11.766  21.525  1.00 0.00 ? 5  HIS A N    1  
ATOM 64    C CA   . HIS A 1 5  ? 10.753  12.611  20.830  1.00 0.00 ? 5  HIS A CA   1  
ATOM 65    C C    . HIS A 1 5  ? 9.449   12.662  21.635  1.00 0.00 ? 5  HIS A C    1  
ATOM 66    O O    . HIS A 1 5  ? 9.334   12.020  22.685  1.00 0.00 ? 5  HIS A O    1  
ATOM 67    C CB   . HIS A 1 5  ? 10.503  12.117  19.369  1.00 0.00 ? 5  HIS A CB   1  
ATOM 68    C CG   . HIS A 1 5  ? 11.535  12.611  18.393  1.00 0.00 ? 5  HIS A CG   1  
ATOM 69    N ND1  . HIS A 1 5  ? 11.500  13.881  17.867  1.00 0.00 ? 5  HIS A ND1  1  
ATOM 70    C CD2  . HIS A 1 5  ? 12.645  12.034  17.883  1.00 0.00 ? 5  HIS A CD2  1  
ATOM 71    C CE1  . HIS A 1 5  ? 12.538  14.061  17.090  1.00 0.00 ? 5  HIS A CE1  1  
ATOM 72    N NE2  . HIS A 1 5  ? 13.248  12.958  17.082  1.00 0.00 ? 5  HIS A NE2  1  
ATOM 73    H H    . HIS A 1 5  ? 11.441  10.931  21.940  1.00 0.00 ? 5  HIS A H    1  
ATOM 74    H HA   . HIS A 1 5  ? 11.145  13.628  20.795  1.00 0.00 ? 5  HIS A HA   1  
ATOM 75    H HB2  . HIS A 1 5  ? 10.515  11.036  19.350  1.00 0.00 ? 5  HIS A HB2  1  
ATOM 76    H HB3  . HIS A 1 5  ? 9.534   12.461  19.019  1.00 0.00 ? 5  HIS A HB3  1  
ATOM 77    H HD1  . HIS A 1 5  ? 10.808  14.553  18.036  1.00 0.00 ? 5  HIS A HD1  1  
ATOM 78    H HD2  . HIS A 1 5  ? 12.996  11.031  18.075  1.00 0.00 ? 5  HIS A HD2  1  
ATOM 79    H HE1  . HIS A 1 5  ? 12.776  14.966  16.556  1.00 0.00 ? 5  HIS A HE1  1  
ATOM 80    H HE2  . HIS A 1 5  ? 14.155  12.886  16.726  1.00 0.00 ? 5  HIS A HE2  1  
ATOM 81    N N    . HIS A 1 6  ? 8.485   13.461  21.143  1.00 0.00 ? 6  HIS A N    1  
ATOM 82    C CA   . HIS A 1 6  ? 7.177   13.648  21.791  1.00 0.00 ? 6  HIS A CA   1  
ATOM 83    C C    . HIS A 1 6  ? 6.346   12.344  21.770  1.00 0.00 ? 6  HIS A C    1  
ATOM 84    O O    . HIS A 1 6  ? 5.707   11.999  20.770  1.00 0.00 ? 6  HIS A O    1  
ATOM 85    C CB   . HIS A 1 6  ? 6.419   14.847  21.155  1.00 0.00 ? 6  HIS A CB   1  
ATOM 86    C CG   . HIS A 1 6  ? 6.373   14.872  19.643  1.00 0.00 ? 6  HIS A CG   1  
ATOM 87    N ND1  . HIS A 1 6  ? 7.268   15.598  18.875  1.00 0.00 ? 6  HIS A ND1  1  
ATOM 88    C CD2  . HIS A 1 6  ? 5.528   14.288  18.755  1.00 0.00 ? 6  HIS A CD2  1  
ATOM 89    C CE1  . HIS A 1 6  ? 6.966   15.457  17.603  1.00 0.00 ? 6  HIS A CE1  1  
ATOM 90    N NE2  . HIS A 1 6  ? 5.923   14.670  17.503  1.00 0.00 ? 6  HIS A NE2  1  
ATOM 91    H H    . HIS A 1 6  ? 8.666   13.949  20.315  1.00 0.00 ? 6  HIS A H    1  
ATOM 92    H HA   . HIS A 1 6  ? 7.380   13.898  22.833  1.00 0.00 ? 6  HIS A HA   1  
ATOM 93    H HB2  . HIS A 1 6  ? 5.395   14.851  21.513  1.00 0.00 ? 6  HIS A HB2  1  
ATOM 94    H HB3  . HIS A 1 6  ? 6.890   15.769  21.483  1.00 0.00 ? 6  HIS A HB3  1  
ATOM 95    H HD1  . HIS A 1 6  ? 8.002   16.155  19.218  1.00 0.00 ? 6  HIS A HD1  1  
ATOM 96    H HD2  . HIS A 1 6  ? 4.694   13.644  18.993  1.00 0.00 ? 6  HIS A HD2  1  
ATOM 97    H HE1  . HIS A 1 6  ? 7.495   15.909  16.777  1.00 0.00 ? 6  HIS A HE1  1  
ATOM 98    H HE2  . HIS A 1 6  ? 5.442   14.472  16.670  1.00 0.00 ? 6  HIS A HE2  1  
ATOM 99    N N    . HIS A 1 7  ? 6.422   11.605  22.884  1.00 0.00 ? 7  HIS A N    1  
ATOM 100   C CA   . HIS A 1 7  ? 5.694   10.342  23.085  1.00 0.00 ? 7  HIS A CA   1  
ATOM 101   C C    . HIS A 1 7  ? 4.262   10.638  23.546  1.00 0.00 ? 7  HIS A C    1  
ATOM 102   O O    . HIS A 1 7  ? 3.303   10.017  23.070  1.00 0.00 ? 7  HIS A O    1  
ATOM 103   C CB   . HIS A 1 7  ? 6.430   9.476   24.129  1.00 0.00 ? 7  HIS A CB   1  
ATOM 104   C CG   . HIS A 1 7  ? 7.836   9.117   23.738  1.00 0.00 ? 7  HIS A CG   1  
ATOM 105   N ND1  . HIS A 1 7  ? 8.942   9.665   24.336  1.00 0.00 ? 7  HIS A ND1  1  
ATOM 106   C CD2  . HIS A 1 7  ? 8.312   8.252   22.813  1.00 0.00 ? 7  HIS A CD2  1  
ATOM 107   C CE1  . HIS A 1 7  ? 10.024  9.153   23.807  1.00 0.00 ? 7  HIS A CE1  1  
ATOM 108   N NE2  . HIS A 1 7  ? 9.673   8.293   22.882  1.00 0.00 ? 7  HIS A NE2  1  
ATOM 109   H H    . HIS A 1 7  ? 6.989   11.931  23.611  1.00 0.00 ? 7  HIS A H    1  
ATOM 110   H HA   . HIS A 1 7  ? 5.658   9.802   22.140  1.00 0.00 ? 7  HIS A HA   1  
ATOM 111   H HB2  . HIS A 1 7  ? 6.478   10.015  25.067  1.00 0.00 ? 7  HIS A HB2  1  
ATOM 112   H HB3  . HIS A 1 7  ? 5.885   8.551   24.287  1.00 0.00 ? 7  HIS A HB3  1  
ATOM 113   H HD1  . HIS A 1 7  ? 8.936   10.347  25.041  1.00 0.00 ? 7  HIS A HD1  1  
ATOM 114   H HD2  . HIS A 1 7  ? 7.725   7.645   22.138  1.00 0.00 ? 7  HIS A HD2  1  
ATOM 115   H HE1  . HIS A 1 7  ? 11.038  9.399   24.083  1.00 0.00 ? 7  HIS A HE1  1  
ATOM 116   H HE2  . HIS A 1 7  ? 10.279  7.937   22.196  1.00 0.00 ? 7  HIS A HE2  1  
ATOM 117   N N    . HIS A 1 8  ? 4.143   11.614  24.469  1.00 0.00 ? 8  HIS A N    1  
ATOM 118   C CA   . HIS A 1 8  ? 2.848   12.068  25.007  1.00 0.00 ? 8  HIS A CA   1  
ATOM 119   C C    . HIS A 1 8  ? 2.283   13.174  24.091  1.00 0.00 ? 8  HIS A C    1  
ATOM 120   O O    . HIS A 1 8  ? 2.209   14.349  24.462  1.00 0.00 ? 8  HIS A O    1  
ATOM 121   C CB   . HIS A 1 8  ? 3.008   12.550  26.477  1.00 0.00 ? 8  HIS A CB   1  
ATOM 122   C CG   . HIS A 1 8  ? 1.706   12.754  27.208  1.00 0.00 ? 8  HIS A CG   1  
ATOM 123   N ND1  . HIS A 1 8  ? 1.072   13.978  27.313  1.00 0.00 ? 8  HIS A ND1  1  
ATOM 124   C CD2  . HIS A 1 8  ? 0.924   11.880  27.888  1.00 0.00 ? 8  HIS A CD2  1  
ATOM 125   C CE1  . HIS A 1 8  ? -0.029  13.839  28.022  1.00 0.00 ? 8  HIS A CE1  1  
ATOM 126   N NE2  . HIS A 1 8  ? -0.141  12.580  28.382  1.00 0.00 ? 8  HIS A NE2  1  
ATOM 127   H H    . HIS A 1 8  ? 4.959   12.052  24.781  1.00 0.00 ? 8  HIS A H    1  
ATOM 128   H HA   . HIS A 1 8  ? 2.163   11.218  24.987  1.00 0.00 ? 8  HIS A HA   1  
ATOM 129   H HB2  . HIS A 1 8  ? 3.579   11.812  27.026  1.00 0.00 ? 8  HIS A HB2  1  
ATOM 130   H HB3  . HIS A 1 8  ? 3.551   13.486  26.492  1.00 0.00 ? 8  HIS A HB3  1  
ATOM 131   H HD1  . HIS A 1 8  ? 1.382   14.822  26.921  1.00 0.00 ? 8  HIS A HD1  1  
ATOM 132   H HD2  . HIS A 1 8  ? 1.104   10.822  28.013  1.00 0.00 ? 8  HIS A HD2  1  
ATOM 133   H HE1  . HIS A 1 8  ? -0.723  14.627  28.272  1.00 0.00 ? 8  HIS A HE1  1  
ATOM 134   H HE2  . HIS A 1 8  ? -0.743  12.256  29.083  1.00 0.00 ? 8  HIS A HE2  1  
ATOM 135   N N    . SER A 1 9  ? 1.956   12.760  22.864  1.00 0.00 ? 9  SER A N    1  
ATOM 136   C CA   . SER A 1 9  ? 1.348   13.597  21.818  1.00 0.00 ? 9  SER A CA   1  
ATOM 137   C C    . SER A 1 9  ? 0.534   12.674  20.904  1.00 0.00 ? 9  SER A C    1  
ATOM 138   O O    . SER A 1 9  ? 0.941   11.522  20.675  1.00 0.00 ? 9  SER A O    1  
ATOM 139   C CB   . SER A 1 9  ? 2.431   14.348  20.990  1.00 0.00 ? 9  SER A CB   1  
ATOM 140   O OG   . SER A 1 9  ? 3.168   15.266  21.782  1.00 0.00 ? 9  SER A OG   1  
ATOM 141   H H    . SER A 1 9  ? 2.127   11.815  22.641  1.00 0.00 ? 9  SER A H    1  
ATOM 142   H HA   . SER A 1 9  ? 0.680   14.318  22.286  1.00 0.00 ? 9  SER A HA   1  
ATOM 143   H HB2  . SER A 1 9  ? 3.129   13.633  20.575  1.00 0.00 ? 9  SER A HB2  1  
ATOM 144   H HB3  . SER A 1 9  ? 1.961   14.895  20.180  1.00 0.00 ? 9  SER A HB3  1  
ATOM 145   H HG   . SER A 1 9  ? 2.768   15.329  22.658  1.00 0.00 ? 9  SER A HG   1  
ATOM 146   N N    . HIS A 1 10 ? -0.612  13.168  20.398  1.00 0.00 ? 10 HIS A N    1  
ATOM 147   C CA   . HIS A 1 10 ? -1.486  12.375  19.519  1.00 0.00 ? 10 HIS A CA   1  
ATOM 148   C C    . HIS A 1 10 ? -0.795  12.108  18.169  1.00 0.00 ? 10 HIS A C    1  
ATOM 149   O O    . HIS A 1 10 ? -0.012  12.943  17.687  1.00 0.00 ? 10 HIS A O    1  
ATOM 150   C CB   . HIS A 1 10 ? -2.865  13.067  19.293  1.00 0.00 ? 10 HIS A CB   1  
ATOM 151   C CG   . HIS A 1 10 ? -2.817  14.308  18.436  1.00 0.00 ? 10 HIS A CG   1  
ATOM 152   N ND1  . HIS A 1 10 ? -3.214  14.327  17.114  1.00 0.00 ? 10 HIS A ND1  1  
ATOM 153   C CD2  . HIS A 1 10 ? -2.437  15.577  18.721  1.00 0.00 ? 10 HIS A CD2  1  
ATOM 154   C CE1  . HIS A 1 10 ? -3.068  15.542  16.633  1.00 0.00 ? 10 HIS A CE1  1  
ATOM 155   N NE2  . HIS A 1 10 ? -2.602  16.316  17.585  1.00 0.00 ? 10 HIS A NE2  1  
ATOM 156   H H    . HIS A 1 10 ? -0.869  14.087  20.621  1.00 0.00 ? 10 HIS A H    1  
ATOM 157   H HA   . HIS A 1 10 ? -1.656  11.421  20.015  1.00 0.00 ? 10 HIS A HA   1  
ATOM 158   H HB2  . HIS A 1 10 ? -3.542  12.366  18.817  1.00 0.00 ? 10 HIS A HB2  1  
ATOM 159   H HB3  . HIS A 1 10 ? -3.280  13.344  20.256  1.00 0.00 ? 10 HIS A HB3  1  
ATOM 160   H HD1  . HIS A 1 10 ? -3.564  13.562  16.603  1.00 0.00 ? 10 HIS A HD1  1  
ATOM 161   H HD2  . HIS A 1 10 ? -2.060  15.936  19.669  1.00 0.00 ? 10 HIS A HD2  1  
ATOM 162   H HE1  . HIS A 1 10 ? -3.305  15.853  15.626  1.00 0.00 ? 10 HIS A HE1  1  
ATOM 163   H HE2  . HIS A 1 10 ? -2.239  17.216  17.441  1.00 0.00 ? 10 HIS A HE2  1  
ATOM 164   N N    . MET A 1 11 ? -1.086  10.931  17.596  1.00 0.00 ? 11 MET A N    1  
ATOM 165   C CA   . MET A 1 11 ? -0.662  10.549  16.248  1.00 0.00 ? 11 MET A CA   1  
ATOM 166   C C    . MET A 1 11 ? -1.293  11.531  15.246  1.00 0.00 ? 11 MET A C    1  
ATOM 167   O O    . MET A 1 11 ? -2.498  11.454  14.967  1.00 0.00 ? 11 MET A O    1  
ATOM 168   C CB   . MET A 1 11 ? -1.095  9.087   15.950  1.00 0.00 ? 11 MET A CB   1  
ATOM 169   C CG   . MET A 1 11 ? -0.667  8.523   14.585  1.00 0.00 ? 11 MET A CG   1  
ATOM 170   S SD   . MET A 1 11 ? -1.227  6.813   14.360  1.00 0.00 ? 11 MET A SD   1  
ATOM 171   C CE   . MET A 1 11 ? -0.625  6.419   12.717  1.00 0.00 ? 11 MET A CE   1  
ATOM 172   H H    . MET A 1 11 ? -1.611  10.291  18.109  1.00 0.00 ? 11 MET A H    1  
ATOM 173   H HA   . MET A 1 11 ? 0.426   10.616  16.202  1.00 0.00 ? 11 MET A HA   1  
ATOM 174   H HB2  . MET A 1 11 ? -0.677  8.439   16.713  1.00 0.00 ? 11 MET A HB2  1  
ATOM 175   H HB3  . MET A 1 11 ? -2.177  9.026   16.014  1.00 0.00 ? 11 MET A HB3  1  
ATOM 176   H HG2  . MET A 1 11 ? -1.097  9.133   13.799  1.00 0.00 ? 11 MET A HG2  1  
ATOM 177   H HG3  . MET A 1 11 ? 0.413   8.547   14.507  1.00 0.00 ? 11 MET A HG3  1  
ATOM 178   H HE1  . MET A 1 11 ? -1.058  7.099   11.997  1.00 0.00 ? 11 MET A HE1  1  
ATOM 179   H HE2  . MET A 1 11 ? -0.906  5.408   12.466  1.00 0.00 ? 11 MET A HE2  1  
ATOM 180   H HE3  . MET A 1 11 ? 0.454   6.509   12.692  1.00 0.00 ? 11 MET A HE3  1  
ATOM 181   N N    . LYS A 1 12 ? -0.481  12.517  14.838  1.00 0.00 ? 12 LYS A N    1  
ATOM 182   C CA   . LYS A 1 12 ? -0.814  13.534  13.820  1.00 0.00 ? 12 LYS A CA   1  
ATOM 183   C C    . LYS A 1 12 ? -1.126  12.862  12.448  1.00 0.00 ? 12 LYS A C    1  
ATOM 184   O O    . LYS A 1 12 ? -0.335  12.909  11.492  1.00 0.00 ? 12 LYS A O    1  
ATOM 185   C CB   . LYS A 1 12 ? 0.330   14.626  13.754  1.00 0.00 ? 12 LYS A CB   1  
ATOM 186   C CG   . LYS A 1 12 ? 1.725   14.213  13.165  1.00 0.00 ? 12 LYS A CG   1  
ATOM 187   C CD   . LYS A 1 12 ? 2.349   12.939  13.788  1.00 0.00 ? 12 LYS A CD   1  
ATOM 188   C CE   . LYS A 1 12 ? 3.742   12.622  13.230  1.00 0.00 ? 12 LYS A CE   1  
ATOM 189   N NZ   . LYS A 1 12 ? 3.737   12.460  11.753  1.00 0.00 ? 12 LYS A NZ   1  
ATOM 190   H H    . LYS A 1 12 ? 0.392   12.583  15.276  1.00 0.00 ? 12 LYS A H    1  
ATOM 191   H HA   . LYS A 1 12 ? -1.731  14.028  14.159  1.00 0.00 ? 12 LYS A HA   1  
ATOM 192   H HB2  . LYS A 1 12 ? -0.031  15.460  13.163  1.00 0.00 ? 12 LYS A HB2  1  
ATOM 193   H HB3  . LYS A 1 12 ? 0.498   14.991  14.760  1.00 0.00 ? 12 LYS A HB3  1  
ATOM 194   H HG2  . LYS A 1 12 ? 1.602   14.041  12.103  1.00 0.00 ? 12 LYS A HG2  1  
ATOM 195   H HG3  . LYS A 1 12 ? 2.416   15.041  13.301  1.00 0.00 ? 12 LYS A HG3  1  
ATOM 196   H HD2  . LYS A 1 12 ? 2.426   13.078  14.864  1.00 0.00 ? 12 LYS A HD2  1  
ATOM 197   H HD3  . LYS A 1 12 ? 1.690   12.102  13.590  1.00 0.00 ? 12 LYS A HD3  1  
ATOM 198   H HE2  . LYS A 1 12 ? 4.421   13.428  13.490  1.00 0.00 ? 12 LYS A HE2  1  
ATOM 199   H HE3  . LYS A 1 12 ? 4.098   11.704  13.682  1.00 0.00 ? 12 LYS A HE3  1  
ATOM 200   H HZ1  . LYS A 1 12 ? 4.682   12.183  11.420  1.00 0.00 ? 12 LYS A HZ1  1  
ATOM 201   H HZ2  . LYS A 1 12 ? 3.473   13.356  11.294  1.00 0.00 ? 12 LYS A HZ2  1  
ATOM 202   H HZ3  . LYS A 1 12 ? 3.057   11.728  11.475  1.00 0.00 ? 12 LYS A HZ3  1  
ATOM 203   N N    . ARG A 1 13 ? -2.315  12.233  12.402  1.00 0.00 ? 13 ARG A N    1  
ATOM 204   C CA   . ARG A 1 13 ? -2.777  11.326  11.344  1.00 0.00 ? 13 ARG A CA   1  
ATOM 205   C C    . ARG A 1 13 ? -1.826  10.117  11.174  1.00 0.00 ? 13 ARG A C    1  
ATOM 206   O O    . ARG A 1 13 ? -2.143  9.004   11.605  1.00 0.00 ? 13 ARG A O    1  
ATOM 207   C CB   . ARG A 1 13 ? -3.022  12.066  9.999   1.00 0.00 ? 13 ARG A CB   1  
ATOM 208   C CG   . ARG A 1 13 ? -3.889  11.282  8.981   1.00 0.00 ? 13 ARG A CG   1  
ATOM 209   C CD   . ARG A 1 13 ? -5.403  11.381  9.253   1.00 0.00 ? 13 ARG A CD   1  
ATOM 210   N NE   . ARG A 1 13 ? -5.783  10.889  10.598  1.00 0.00 ? 13 ARG A NE   1  
ATOM 211   C CZ   . ARG A 1 13 ? -6.396  11.620  11.549  1.00 0.00 ? 13 ARG A CZ   1  
ATOM 212   N NH1  . ARG A 1 13 ? -6.719  12.890  11.334  1.00 0.00 ? 13 ARG A NH1  1  
ATOM 213   N NH2  . ARG A 1 13 ? -6.682  11.066  12.713  1.00 0.00 ? 13 ARG A NH2  1  
ATOM 214   H H    . ARG A 1 13 ? -2.938  12.393  13.150  1.00 0.00 ? 13 ARG A H    1  
ATOM 215   H HA   . ARG A 1 13 ? -3.730  10.941  11.689  1.00 0.00 ? 13 ARG A HA   1  
ATOM 216   H HB2  . ARG A 1 13 ? -3.513  13.013  10.208  1.00 0.00 ? 13 ARG A HB2  1  
ATOM 217   H HB3  . ARG A 1 13 ? -2.060  12.280  9.541   1.00 0.00 ? 13 ARG A HB3  1  
ATOM 218   H HG2  . ARG A 1 13 ? -3.694  11.674  7.990   1.00 0.00 ? 13 ARG A HG2  1  
ATOM 219   H HG3  . ARG A 1 13 ? -3.594  10.241  9.003   1.00 0.00 ? 13 ARG A HG3  1  
ATOM 220   H HD2  . ARG A 1 13 ? -5.709  12.416  9.146   1.00 0.00 ? 13 ARG A HD2  1  
ATOM 221   H HD3  . ARG A 1 13 ? -5.929  10.786  8.511   1.00 0.00 ? 13 ARG A HD3  1  
ATOM 222   H HE   . ARG A 1 13 ? -5.554  9.954   10.811  1.00 0.00 ? 13 ARG A HE   1  
ATOM 223   H HH11 . ARG A 1 13 ? -6.506  13.322  10.456  1.00 0.00 ? 13 ARG A HH11 1  
ATOM 224   H HH12 . ARG A 1 13 ? -7.177  13.424  12.052  1.00 0.00 ? 13 ARG A HH12 1  
ATOM 225   H HH21 . ARG A 1 13 ? -6.437  10.111  12.892  1.00 0.00 ? 13 ARG A HH21 1  
ATOM 226   H HH22 . ARG A 1 13 ? -7.139  11.602  13.431  1.00 0.00 ? 13 ARG A HH22 1  
ATOM 227   N N    . SER A 1 14 ? -0.667  10.376  10.561  1.00 0.00 ? 14 SER A N    1  
ATOM 228   C CA   . SER A 1 14 ? 0.403   9.401   10.333  1.00 0.00 ? 14 SER A CA   1  
ATOM 229   C C    . SER A 1 14 ? 1.694   10.165  9.989   1.00 0.00 ? 14 SER A C    1  
ATOM 230   O O    . SER A 1 14 ? 2.750   9.959   10.608  1.00 0.00 ? 14 SER A O    1  
ATOM 231   C CB   . SER A 1 14 ? 0.016   8.424   9.197   1.00 0.00 ? 14 SER A CB   1  
ATOM 232   O OG   . SER A 1 14 ? 1.112   7.626   8.792   1.00 0.00 ? 14 SER A OG   1  
ATOM 233   H H    . SER A 1 14 ? -0.518  11.290  10.249  1.00 0.00 ? 14 SER A H    1  
ATOM 234   H HA   . SER A 1 14 ? 0.565   8.843   11.251  1.00 0.00 ? 14 SER A HA   1  
ATOM 235   H HB2  . SER A 1 14 ? -0.773  7.770   9.540   1.00 0.00 ? 14 SER A HB2  1  
ATOM 236   H HB3  . SER A 1 14 ? -0.337  8.987   8.341   1.00 0.00 ? 14 SER A HB3  1  
ATOM 237   H HG   . SER A 1 14 ? 1.321   7.814   7.873   1.00 0.00 ? 14 SER A HG   1  
ATOM 238   N N    . GLY A 1 15 ? 1.579   11.080  9.013   1.00 0.00 ? 15 GLY A N    1  
ATOM 239   C CA   . GLY A 1 15 ? 2.705   11.886  8.542   1.00 0.00 ? 15 GLY A CA   1  
ATOM 240   C C    . GLY A 1 15 ? 2.316   12.719  7.330   1.00 0.00 ? 15 GLY A C    1  
ATOM 241   O O    . GLY A 1 15 ? 1.394   13.535  7.432   1.00 0.00 ? 15 GLY A O    1  
ATOM 242   H H    . GLY A 1 15 ? 0.703   11.210  8.599   1.00 0.00 ? 15 GLY A H    1  
ATOM 243   H HA2  . GLY A 1 15 ? 3.025   12.552  9.339   1.00 0.00 ? 15 GLY A HA2  1  
ATOM 244   H HA3  . GLY A 1 15 ? 3.530   11.238  8.282   1.00 0.00 ? 15 GLY A HA3  1  
ATOM 245   N N    . ARG A 1 16 ? 2.967   12.478  6.170   1.00 0.00 ? 16 ARG A N    1  
ATOM 246   C CA   . ARG A 1 16 ? 2.736   13.264  4.943   1.00 0.00 ? 16 ARG A CA   1  
ATOM 247   C C    . ARG A 1 16 ? 1.710   12.554  4.053   1.00 0.00 ? 16 ARG A C    1  
ATOM 248   O O    . ARG A 1 16 ? 1.827   11.351  3.798   1.00 0.00 ? 16 ARG A O    1  
ATOM 249   C CB   . ARG A 1 16 ? 4.050   13.492  4.141   1.00 0.00 ? 16 ARG A CB   1  
ATOM 250   C CG   . ARG A 1 16 ? 3.880   14.459  2.934   1.00 0.00 ? 16 ARG A CG   1  
ATOM 251   C CD   . ARG A 1 16 ? 5.143   14.604  2.062   1.00 0.00 ? 16 ARG A CD   1  
ATOM 252   N NE   . ARG A 1 16 ? 5.428   13.383  1.281   1.00 0.00 ? 16 ARG A NE   1  
ATOM 253   C CZ   . ARG A 1 16 ? 6.506   12.597  1.416   1.00 0.00 ? 16 ARG A CZ   1  
ATOM 254   N NH1  . ARG A 1 16 ? 7.448   12.858  2.315   1.00 0.00 ? 16 ARG A NH1  1  
ATOM 255   N NH2  . ARG A 1 16 ? 6.628   11.543  0.643   1.00 0.00 ? 16 ARG A NH2  1  
ATOM 256   H H    . ARG A 1 16 ? 3.591   11.723  6.135   1.00 0.00 ? 16 ARG A H    1  
ATOM 257   H HA   . ARG A 1 16 ? 2.340   14.237  5.239   1.00 0.00 ? 16 ARG A HA   1  
ATOM 258   H HB2  . ARG A 1 16 ? 4.795   13.908  4.811   1.00 0.00 ? 16 ARG A HB2  1  
ATOM 259   H HB3  . ARG A 1 16 ? 4.411   12.538  3.774   1.00 0.00 ? 16 ARG A HB3  1  
ATOM 260   H HG2  . ARG A 1 16 ? 3.077   14.094  2.305   1.00 0.00 ? 16 ARG A HG2  1  
ATOM 261   H HG3  . ARG A 1 16 ? 3.609   15.437  3.314   1.00 0.00 ? 16 ARG A HG3  1  
ATOM 262   H HD2  . ARG A 1 16 ? 4.993   15.424  1.371   1.00 0.00 ? 16 ARG A HD2  1  
ATOM 263   H HD3  . ARG A 1 16 ? 5.989   14.832  2.701   1.00 0.00 ? 16 ARG A HD3  1  
ATOM 264   H HE   . ARG A 1 16 ? 4.766   13.133  0.598   1.00 0.00 ? 16 ARG A HE   1  
ATOM 265   H HH11 . ARG A 1 16 ? 7.373   13.658  2.911   1.00 0.00 ? 16 ARG A HH11 1  
ATOM 266   H HH12 . ARG A 1 16 ? 8.249   12.252  2.395   1.00 0.00 ? 16 ARG A HH12 1  
ATOM 267   H HH21 . ARG A 1 16 ? 5.920   11.330  -0.034  1.00 0.00 ? 16 ARG A HH21 1  
ATOM 268   H HH22 . ARG A 1 16 ? 7.426   10.941  0.736   1.00 0.00 ? 16 ARG A HH22 1  
ATOM 269   N N    . GLU A 1 17 ? 0.716   13.313  3.591   1.00 0.00 ? 17 GLU A N    1  
ATOM 270   C CA   . GLU A 1 17 ? -0.323  12.832  2.683   1.00 0.00 ? 17 GLU A CA   1  
ATOM 271   C C    . GLU A 1 17 ? 0.263   12.743  1.264   1.00 0.00 ? 17 GLU A C    1  
ATOM 272   O O    . GLU A 1 17 ? 0.841   13.716  0.759   1.00 0.00 ? 17 GLU A O    1  
ATOM 273   C CB   . GLU A 1 17 ? -1.540  13.799  2.759   1.00 0.00 ? 17 GLU A CB   1  
ATOM 274   C CG   . GLU A 1 17 ? -2.845  13.320  2.064   1.00 0.00 ? 17 GLU A CG   1  
ATOM 275   C CD   . GLU A 1 17 ? -2.965  13.716  0.585   1.00 0.00 ? 17 GLU A CD   1  
ATOM 276   O OE1  . GLU A 1 17 ? -3.188  14.914  0.300   1.00 0.00 ? 17 GLU A OE1  1  
ATOM 277   O OE2  . GLU A 1 17 ? -2.830  12.845  -0.289  1.00 0.00 ? 17 GLU A OE2  1  
ATOM 278   H H    . GLU A 1 17 ? 0.679   14.249  3.872   1.00 0.00 ? 17 GLU A H    1  
ATOM 279   H HA   . GLU A 1 17 ? -0.639  11.840  3.019   1.00 0.00 ? 17 GLU A HA   1  
ATOM 280   H HB2  . GLU A 1 17 ? -1.766  13.966  3.811   1.00 0.00 ? 17 GLU A HB2  1  
ATOM 281   H HB3  . GLU A 1 17 ? -1.250  14.754  2.332   1.00 0.00 ? 17 GLU A HB3  1  
ATOM 282   H HG2  . GLU A 1 17 ? -2.896  12.239  2.147   1.00 0.00 ? 17 GLU A HG2  1  
ATOM 283   H HG3  . GLU A 1 17 ? -3.692  13.739  2.596   1.00 0.00 ? 17 GLU A HG3  1  
ATOM 284   N N    . ILE A 1 18 ? 0.134   11.561  0.655   1.00 0.00 ? 18 ILE A N    1  
ATOM 285   C CA   . ILE A 1 18 ? 0.637   11.252  -0.690  1.00 0.00 ? 18 ILE A CA   1  
ATOM 286   C C    . ILE A 1 18 ? -0.528  10.691  -1.519  1.00 0.00 ? 18 ILE A C    1  
ATOM 287   O O    . ILE A 1 18 ? -1.575  10.326  -0.969  1.00 0.00 ? 18 ILE A O    1  
ATOM 288   C CB   . ILE A 1 18 ? 1.820   10.193  -0.659  1.00 0.00 ? 18 ILE A CB   1  
ATOM 289   C CG1  . ILE A 1 18 ? 1.320   8.778   -0.182  1.00 0.00 ? 18 ILE A CG1  1  
ATOM 290   C CG2  . ILE A 1 18 ? 2.991   10.691  0.231   1.00 0.00 ? 18 ILE A CG2  1  
ATOM 291   C CD1  . ILE A 1 18 ? 2.351   7.670   -0.296  1.00 0.00 ? 18 ILE A CD1  1  
ATOM 292   H H    . ILE A 1 18 ? -0.358  10.859  1.118   1.00 0.00 ? 18 ILE A H    1  
ATOM 293   H HA   . ILE A 1 18 ? 0.996   12.171  -1.160  1.00 0.00 ? 18 ILE A HA   1  
ATOM 294   H HB   . ILE A 1 18 ? 2.204   10.098  -1.675  1.00 0.00 ? 18 ILE A HB   1  
ATOM 295   H HG12 . ILE A 1 18 ? 1.014   8.835   0.853   1.00 0.00 ? 18 ILE A HG12 1  
ATOM 296   H HG13 . ILE A 1 18 ? 0.464   8.485   -0.781  1.00 0.00 ? 18 ILE A HG13 1  
ATOM 297   H HG21 . ILE A 1 18 ? 3.339   11.654  -0.123  1.00 0.00 ? 18 ILE A HG21 1  
ATOM 298   H HG22 . ILE A 1 18 ? 3.813   9.984   0.187   1.00 0.00 ? 18 ILE A HG22 1  
ATOM 299   H HG23 . ILE A 1 18 ? 2.657   10.785  1.254   1.00 0.00 ? 18 ILE A HG23 1  
ATOM 300   H HD11 . ILE A 1 18 ? 3.223   7.917   0.291   1.00 0.00 ? 18 ILE A HD11 1  
ATOM 301   H HD12 . ILE A 1 18 ? 2.637   7.551   -1.332  1.00 0.00 ? 18 ILE A HD12 1  
ATOM 302   H HD13 . ILE A 1 18 ? 1.925   6.744   0.065   1.00 0.00 ? 18 ILE A HD13 1  
ATOM 303   N N    . THR A 1 19 ? -0.342  10.604  -2.833  1.00 0.00 ? 19 THR A N    1  
ATOM 304   C CA   . THR A 1 19 ? -1.322  9.973   -3.728  1.00 0.00 ? 19 THR A CA   1  
ATOM 305   C C    . THR A 1 19 ? -0.916  8.510   -3.994  1.00 0.00 ? 19 THR A C    1  
ATOM 306   O O    . THR A 1 19 ? 0.255   8.144   -3.809  1.00 0.00 ? 19 THR A O    1  
ATOM 307   C CB   . THR A 1 19 ? -1.482  10.780  -5.060  1.00 0.00 ? 19 THR A CB   1  
ATOM 308   O OG1  . THR A 1 19 ? -2.503  10.194  -5.867  1.00 0.00 ? 19 THR A OG1  1  
ATOM 309   C CG2  . THR A 1 19 ? -0.187  10.867  -5.874  1.00 0.00 ? 19 THR A CG2  1  
ATOM 310   H H    . THR A 1 19 ? 0.490   10.945  -3.216  1.00 0.00 ? 19 THR A H    1  
ATOM 311   H HA   . THR A 1 19 ? -2.289  9.969   -3.226  1.00 0.00 ? 19 THR A HA   1  
ATOM 312   H HB   . THR A 1 19 ? -1.792  11.792  -4.808  1.00 0.00 ? 19 THR A HB   1  
ATOM 313   H HG1  . THR A 1 19 ? -3.130  10.876  -6.128  1.00 0.00 ? 19 THR A HG1  1  
ATOM 314   H HG21 . THR A 1 19 ? -0.342  11.487  -6.748  1.00 0.00 ? 19 THR A HG21 1  
ATOM 315   H HG22 . THR A 1 19 ? 0.113   9.880   -6.191  1.00 0.00 ? 19 THR A HG22 1  
ATOM 316   H HG23 . THR A 1 19 ? 0.602   11.302  -5.266  1.00 0.00 ? 19 THR A HG23 1  
ATOM 317   N N    . TRP A 1 20 ? -1.911  7.691   -4.390  1.00 0.00 ? 20 TRP A N    1  
ATOM 318   C CA   . TRP A 1 20 ? -1.738  6.255   -4.699  1.00 0.00 ? 20 TRP A CA   1  
ATOM 319   C C    . TRP A 1 20 ? -0.623  6.045   -5.745  1.00 0.00 ? 20 TRP A C    1  
ATOM 320   O O    . TRP A 1 20 ? 0.241   5.201   -5.555  1.00 0.00 ? 20 TRP A O    1  
ATOM 321   C CB   . TRP A 1 20 ? -3.088  5.650   -5.189  1.00 0.00 ? 20 TRP A CB   1  
ATOM 322   C CG   . TRP A 1 20 ? -3.042  4.194   -5.625  1.00 0.00 ? 20 TRP A CG   1  
ATOM 323   C CD1  . TRP A 1 20 ? -3.048  3.720   -6.906  1.00 0.00 ? 20 TRP A CD1  1  
ATOM 324   C CD2  . TRP A 1 20 ? -2.995  3.031   -4.781  1.00 0.00 ? 20 TRP A CD2  1  
ATOM 325   N NE1  . TRP A 1 20 ? -3.004  2.353   -6.909  1.00 0.00 ? 20 TRP A NE1  1  
ATOM 326   C CE2  . TRP A 1 20 ? -2.970  1.904   -5.624  1.00 0.00 ? 20 TRP A CE2  1  
ATOM 327   C CE3  . TRP A 1 20 ? -2.954  2.829   -3.405  1.00 0.00 ? 20 TRP A CE3  1  
ATOM 328   C CZ2  . TRP A 1 20 ? -2.937  0.604   -5.136  1.00 0.00 ? 20 TRP A CZ2  1  
ATOM 329   C CZ3  . TRP A 1 20 ? -2.915  1.534   -2.921  1.00 0.00 ? 20 TRP A CZ3  1  
ATOM 330   C CH2  . TRP A 1 20 ? -2.900  0.438   -3.784  1.00 0.00 ? 20 TRP A CH2  1  
ATOM 331   H H    . TRP A 1 20 ? -2.805  8.076   -4.447  1.00 0.00 ? 20 TRP A H    1  
ATOM 332   H HA   . TRP A 1 20 ? -1.450  5.761   -3.775  1.00 0.00 ? 20 TRP A HA   1  
ATOM 333   H HB2  . TRP A 1 20 ? -3.815  5.723   -4.386  1.00 0.00 ? 20 TRP A HB2  1  
ATOM 334   H HB3  . TRP A 1 20 ? -3.450  6.239   -6.027  1.00 0.00 ? 20 TRP A HB3  1  
ATOM 335   H HD1  . TRP A 1 20 ? -3.079  4.347   -7.785  1.00 0.00 ? 20 TRP A HD1  1  
ATOM 336   H HE1  . TRP A 1 20 ? -3.000  1.788   -7.705  1.00 0.00 ? 20 TRP A HE1  1  
ATOM 337   H HE3  . TRP A 1 20 ? -2.966  3.662   -2.718  1.00 0.00 ? 20 TRP A HE3  1  
ATOM 338   H HZ2  . TRP A 1 20 ? -2.928  -0.254  -5.797  1.00 0.00 ? 20 TRP A HZ2  1  
ATOM 339   H HZ3  . TRP A 1 20 ? -2.885  1.363   -1.855  1.00 0.00 ? 20 TRP A HZ3  1  
ATOM 340   H HH2  . TRP A 1 20 ? -2.869  -0.557  -3.359  1.00 0.00 ? 20 TRP A HH2  1  
ATOM 341   N N    . LYS A 1 21 ? -0.645  6.856   -6.820  1.00 0.00 ? 21 LYS A N    1  
ATOM 342   C CA   . LYS A 1 21 ? 0.326   6.768   -7.932  1.00 0.00 ? 21 LYS A CA   1  
ATOM 343   C C    . LYS A 1 21 ? 1.783   7.013   -7.454  1.00 0.00 ? 21 LYS A C    1  
ATOM 344   O O    . LYS A 1 21 ? 2.711   6.321   -7.899  1.00 0.00 ? 21 LYS A O    1  
ATOM 345   C CB   . LYS A 1 21 ? -0.079  7.763   -9.055  1.00 0.00 ? 21 LYS A CB   1  
ATOM 346   C CG   . LYS A 1 21 ? 0.810   7.723   -10.322 1.00 0.00 ? 21 LYS A CG   1  
ATOM 347   C CD   . LYS A 1 21 ? 0.282   8.634   -11.458 1.00 0.00 ? 21 LYS A CD   1  
ATOM 348   C CE   . LYS A 1 21 ? 0.198   10.120  -11.059 1.00 0.00 ? 21 LYS A CE   1  
ATOM 349   N NZ   . LYS A 1 21 ? -0.338  10.970  -12.156 1.00 0.00 ? 21 LYS A NZ   1  
ATOM 350   H H    . LYS A 1 21 ? -1.354  7.536   -6.874  1.00 0.00 ? 21 LYS A H    1  
ATOM 351   H HA   . LYS A 1 21 ? 0.259   5.759   -8.332  1.00 0.00 ? 21 LYS A HA   1  
ATOM 352   H HB2  . LYS A 1 21 ? -1.099  7.542   -9.354  1.00 0.00 ? 21 LYS A HB2  1  
ATOM 353   H HB3  . LYS A 1 21 ? -0.056  8.772   -8.651  1.00 0.00 ? 21 LYS A HB3  1  
ATOM 354   H HG2  . LYS A 1 21 ? 1.815   8.037   -10.059 1.00 0.00 ? 21 LYS A HG2  1  
ATOM 355   H HG3  . LYS A 1 21 ? 0.846   6.699   -10.683 1.00 0.00 ? 21 LYS A HG3  1  
ATOM 356   H HD2  . LYS A 1 21 ? 0.944   8.546   -12.314 1.00 0.00 ? 21 LYS A HD2  1  
ATOM 357   H HD3  . LYS A 1 21 ? -0.707  8.293   -11.747 1.00 0.00 ? 21 LYS A HD3  1  
ATOM 358   H HE2  . LYS A 1 21 ? -0.453  10.220  -10.199 1.00 0.00 ? 21 LYS A HE2  1  
ATOM 359   H HE3  . LYS A 1 21 ? 1.188   10.476  -10.795 1.00 0.00 ? 21 LYS A HE3  1  
ATOM 360   H HZ1  . LYS A 1 21 ? -1.316  10.697  -12.377 1.00 0.00 ? 21 LYS A HZ1  1  
ATOM 361   H HZ2  . LYS A 1 21 ? 0.245   10.858  -13.012 1.00 0.00 ? 21 LYS A HZ2  1  
ATOM 362   H HZ3  . LYS A 1 21 ? -0.323  11.972  -11.874 1.00 0.00 ? 21 LYS A HZ3  1  
ATOM 363   N N    . ASP A 1 22 ? 1.962   7.985   -6.527  1.00 0.00 ? 22 ASP A N    1  
ATOM 364   C CA   . ASP A 1 22 ? 3.266   8.326   -5.907  1.00 0.00 ? 22 ASP A CA   1  
ATOM 365   C C    . ASP A 1 22 ? 3.762   7.168   -5.034  1.00 0.00 ? 22 ASP A C    1  
ATOM 366   O O    . ASP A 1 22 ? 4.946   6.809   -5.065  1.00 0.00 ? 22 ASP A O    1  
ATOM 367   C CB   . ASP A 1 22 ? 3.109   9.614   -5.046  1.00 0.00 ? 22 ASP A CB   1  
ATOM 368   C CG   . ASP A 1 22 ? 4.395   10.022  -4.296  1.00 0.00 ? 22 ASP A CG   1  
ATOM 369   O OD1  . ASP A 1 22 ? 5.282   10.648  -4.918  1.00 0.00 ? 22 ASP A OD1  1  
ATOM 370   O OD2  . ASP A 1 22 ? 4.520   9.745   -3.079  1.00 0.00 ? 22 ASP A OD2  1  
ATOM 371   H H    . ASP A 1 22 ? 1.205   8.511   -6.228  1.00 0.00 ? 22 ASP A H    1  
ATOM 372   H HA   . ASP A 1 22 ? 3.983   8.516   -6.700  1.00 0.00 ? 22 ASP A HA   1  
ATOM 373   H HB2  . ASP A 1 22 ? 2.823   10.440  -5.697  1.00 0.00 ? 22 ASP A HB2  1  
ATOM 374   H HB3  . ASP A 1 22 ? 2.310   9.464   -4.325  1.00 0.00 ? 22 ASP A HB3  1  
ATOM 375   N N    . PHE A 1 23 ? 2.812   6.599   -4.256  1.00 0.00 ? 23 PHE A N    1  
ATOM 376   C CA   . PHE A 1 23 ? 3.032   5.418   -3.411  1.00 0.00 ? 23 PHE A CA   1  
ATOM 377   C C    . PHE A 1 23 ? 3.644   4.267   -4.229  1.00 0.00 ? 23 PHE A C    1  
ATOM 378   O O    . PHE A 1 23 ? 4.686   3.734   -3.858  1.00 0.00 ? 23 PHE A O    1  
ATOM 379   C CB   . PHE A 1 23 ? 1.694   4.978   -2.727  1.00 0.00 ? 23 PHE A CB   1  
ATOM 380   C CG   . PHE A 1 23 ? 1.700   3.556   -2.168  1.00 0.00 ? 23 PHE A CG   1  
ATOM 381   C CD1  . PHE A 1 23 ? 2.636   3.165   -1.207  1.00 0.00 ? 23 PHE A CD1  1  
ATOM 382   C CD2  . PHE A 1 23 ? 0.797   2.593   -2.639  1.00 0.00 ? 23 PHE A CD2  1  
ATOM 383   C CE1  . PHE A 1 23 ? 2.663   1.872   -0.734  1.00 0.00 ? 23 PHE A CE1  1  
ATOM 384   C CE2  . PHE A 1 23 ? 0.834   1.301   -2.162  1.00 0.00 ? 23 PHE A CE2  1  
ATOM 385   C CZ   . PHE A 1 23 ? 1.767   0.945   -1.214  1.00 0.00 ? 23 PHE A CZ   1  
ATOM 386   H H    . PHE A 1 23 ? 1.921   7.005   -4.257  1.00 0.00 ? 23 PHE A H    1  
ATOM 387   H HA   . PHE A 1 23 ? 3.733   5.710   -2.641  1.00 0.00 ? 23 PHE A HA   1  
ATOM 388   H HB2  . PHE A 1 23 ? 1.479   5.651   -1.906  1.00 0.00 ? 23 PHE A HB2  1  
ATOM 389   H HB3  . PHE A 1 23 ? 0.887   5.055   -3.450  1.00 0.00 ? 23 PHE A HB3  1  
ATOM 390   H HD1  . PHE A 1 23 ? 3.345   3.889   -0.824  1.00 0.00 ? 23 PHE A HD1  1  
ATOM 391   H HD2  . PHE A 1 23 ? 0.059   2.866   -3.383  1.00 0.00 ? 23 PHE A HD2  1  
ATOM 392   H HE1  . PHE A 1 23 ? 3.396   1.580   0.013   1.00 0.00 ? 23 PHE A HE1  1  
ATOM 393   H HE2  . PHE A 1 23 ? 0.130   0.563   -2.532  1.00 0.00 ? 23 PHE A HE2  1  
ATOM 394   H HZ   . PHE A 1 23 ? 1.795   -0.074  -0.840  1.00 0.00 ? 23 PHE A HZ   1  
ATOM 395   N N    . VAL A 1 24 ? 2.981   3.916   -5.341  1.00 0.00 ? 24 VAL A N    1  
ATOM 396   C CA   . VAL A 1 24 ? 3.370   2.781   -6.191  1.00 0.00 ? 24 VAL A CA   1  
ATOM 397   C C    . VAL A 1 24 ? 4.804   2.946   -6.717  1.00 0.00 ? 24 VAL A C    1  
ATOM 398   O O    . VAL A 1 24 ? 5.664   2.096   -6.481  1.00 0.00 ? 24 VAL A O    1  
ATOM 399   C CB   . VAL A 1 24 ? 2.391   2.626   -7.405  1.00 0.00 ? 24 VAL A CB   1  
ATOM 400   C CG1  . VAL A 1 24 ? 2.785   1.433   -8.313  1.00 0.00 ? 24 VAL A CG1  1  
ATOM 401   C CG2  . VAL A 1 24 ? 0.929   2.513   -6.916  1.00 0.00 ? 24 VAL A CG2  1  
ATOM 402   H H    . VAL A 1 24 ? 2.196   4.448   -5.604  1.00 0.00 ? 24 VAL A H    1  
ATOM 403   H HA   . VAL A 1 24 ? 3.309   1.880   -5.587  1.00 0.00 ? 24 VAL A HA   1  
ATOM 404   H HB   . VAL A 1 24 ? 2.464   3.530   -8.007  1.00 0.00 ? 24 VAL A HB   1  
ATOM 405   H HG11 . VAL A 1 24 ? 3.790   1.577   -8.696  1.00 0.00 ? 24 VAL A HG11 1  
ATOM 406   H HG12 . VAL A 1 24 ? 2.099   1.363   -9.148  1.00 0.00 ? 24 VAL A HG12 1  
ATOM 407   H HG13 . VAL A 1 24 ? 2.748   0.513   -7.745  1.00 0.00 ? 24 VAL A HG13 1  
ATOM 408   H HG21 . VAL A 1 24 ? 0.842   1.694   -6.216  1.00 0.00 ? 24 VAL A HG21 1  
ATOM 409   H HG22 . VAL A 1 24 ? 0.266   2.341   -7.754  1.00 0.00 ? 24 VAL A HG22 1  
ATOM 410   H HG23 . VAL A 1 24 ? 0.641   3.426   -6.421  1.00 0.00 ? 24 VAL A HG23 1  
ATOM 411   N N    . ASN A 1 25 ? 5.038   4.085   -7.378  1.00 0.00 ? 25 ASN A N    1  
ATOM 412   C CA   . ASN A 1 25 ? 6.270   4.339   -8.140  1.00 0.00 ? 25 ASN A CA   1  
ATOM 413   C C    . ASN A 1 25 ? 7.482   4.559   -7.224  1.00 0.00 ? 25 ASN A C    1  
ATOM 414   O O    . ASN A 1 25 ? 8.517   3.912   -7.409  1.00 0.00 ? 25 ASN A O    1  
ATOM 415   C CB   . ASN A 1 25 ? 6.073   5.544   -9.099  1.00 0.00 ? 25 ASN A CB   1  
ATOM 416   C CG   . ASN A 1 25 ? 5.112   5.223   -10.245 1.00 0.00 ? 25 ASN A CG   1  
ATOM 417   O OD1  . ASN A 1 25 ? 5.080   4.098   -10.753 1.00 0.00 ? 25 ASN A OD1  1  
ATOM 418   N ND2  . ASN A 1 25 ? 4.306   6.188   -10.646 1.00 0.00 ? 25 ASN A ND2  1  
ATOM 419   H H    . ASN A 1 25 ? 4.354   4.784   -7.348  1.00 0.00 ? 25 ASN A H    1  
ATOM 420   H HA   . ASN A 1 25 ? 6.459   3.453   -8.745  1.00 0.00 ? 25 ASN A HA   1  
ATOM 421   H HB2  . ASN A 1 25 ? 5.682   6.389   -8.539  1.00 0.00 ? 25 ASN A HB2  1  
ATOM 422   H HB3  . ASN A 1 25 ? 7.027   5.828   -9.534  1.00 0.00 ? 25 ASN A HB3  1  
ATOM 423   H HD21 . ASN A 1 25 ? 4.354   7.054   -10.191 1.00 0.00 ? 25 ASN A HD21 1  
ATOM 424   H HD22 . ASN A 1 25 ? 3.696   5.998   -11.387 1.00 0.00 ? 25 ASN A HD22 1  
ATOM 425   N N    . ASN A 1 26 ? 7.344   5.439   -6.219  1.00 0.00 ? 26 ASN A N    1  
ATOM 426   C CA   . ASN A 1 26 ? 8.482   5.877   -5.378  1.00 0.00 ? 26 ASN A CA   1  
ATOM 427   C C    . ASN A 1 26 ? 8.685   4.989   -4.141  1.00 0.00 ? 26 ASN A C    1  
ATOM 428   O O    . ASN A 1 26 ? 9.738   5.088   -3.503  1.00 0.00 ? 26 ASN A O    1  
ATOM 429   C CB   . ASN A 1 26 ? 8.299   7.364   -4.949  1.00 0.00 ? 26 ASN A CB   1  
ATOM 430   C CG   . ASN A 1 26 ? 8.373   8.349   -6.121  1.00 0.00 ? 26 ASN A CG   1  
ATOM 431   O OD1  . ASN A 1 26 ? 9.014   8.088   -7.141  1.00 0.00 ? 26 ASN A OD1  1  
ATOM 432   N ND2  . ASN A 1 26 ? 7.731   9.494   -5.984  1.00 0.00 ? 26 ASN A ND2  1  
ATOM 433   H H    . ASN A 1 26 ? 6.462   5.822   -6.023  1.00 0.00 ? 26 ASN A H    1  
ATOM 434   H HA   . ASN A 1 26 ? 9.388   5.812   -5.983  1.00 0.00 ? 26 ASN A HA   1  
ATOM 435   H HB2  . ASN A 1 26 ? 7.337   7.481   -4.461  1.00 0.00 ? 26 ASN A HB2  1  
ATOM 436   H HB3  . ASN A 1 26 ? 9.080   7.635   -4.243  1.00 0.00 ? 26 ASN A HB3  1  
ATOM 437   H HD21 . ASN A 1 26 ? 7.248   9.655   -5.145  1.00 0.00 ? 26 ASN A HD21 1  
ATOM 438   H HD22 . ASN A 1 26 ? 7.784   10.144  -6.711  1.00 0.00 ? 26 ASN A HD22 1  
ATOM 439   N N    . TYR A 1 27 ? 7.706   4.126   -3.778  1.00 0.00 ? 27 TYR A N    1  
ATOM 440   C CA   . TYR A 1 27 ? 7.804   3.311   -2.537  1.00 0.00 ? 27 TYR A CA   1  
ATOM 441   C C    . TYR A 1 27 ? 7.576   1.802   -2.782  1.00 0.00 ? 27 TYR A C    1  
ATOM 442   O O    . TYR A 1 27 ? 8.488   0.984   -2.559  1.00 0.00 ? 27 TYR A O    1  
ATOM 443   C CB   . TYR A 1 27 ? 6.817   3.855   -1.461  1.00 0.00 ? 27 TYR A CB   1  
ATOM 444   C CG   . TYR A 1 27 ? 7.060   5.322   -1.091  1.00 0.00 ? 27 TYR A CG   1  
ATOM 445   C CD1  . TYR A 1 27 ? 8.303   5.729   -0.597  1.00 0.00 ? 27 TYR A CD1  1  
ATOM 446   C CD2  . TYR A 1 27 ? 6.076   6.302   -1.263  1.00 0.00 ? 27 TYR A CD2  1  
ATOM 447   C CE1  . TYR A 1 27 ? 8.549   7.045   -0.283  1.00 0.00 ? 27 TYR A CE1  1  
ATOM 448   C CE2  . TYR A 1 27 ? 6.326   7.623   -0.954  1.00 0.00 ? 27 TYR A CE2  1  
ATOM 449   C CZ   . TYR A 1 27 ? 7.561   7.984   -0.465  1.00 0.00 ? 27 TYR A CZ   1  
ATOM 450   O OH   . TYR A 1 27 ? 7.822   9.296   -0.166  1.00 0.00 ? 27 TYR A OH   1  
ATOM 451   H H    . TYR A 1 27 ? 6.898   4.059   -4.331  1.00 0.00 ? 27 TYR A H    1  
ATOM 452   H HA   . TYR A 1 27 ? 8.813   3.425   -2.145  1.00 0.00 ? 27 TYR A HA   1  
ATOM 453   H HB2  . TYR A 1 27 ? 5.800   3.757   -1.827  1.00 0.00 ? 27 TYR A HB2  1  
ATOM 454   H HB3  . TYR A 1 27 ? 6.915   3.270   -0.554  1.00 0.00 ? 27 TYR A HB3  1  
ATOM 455   H HD1  . TYR A 1 27 ? 9.083   4.992   -0.451  1.00 0.00 ? 27 TYR A HD1  1  
ATOM 456   H HD2  . TYR A 1 27 ? 5.105   6.016   -1.638  1.00 0.00 ? 27 TYR A HD2  1  
ATOM 457   H HE1  . TYR A 1 27 ? 9.521   7.338   0.099   1.00 0.00 ? 27 TYR A HE1  1  
ATOM 458   H HE2  . TYR A 1 27 ? 5.550   8.371   -1.096  1.00 0.00 ? 27 TYR A HE2  1  
ATOM 459   H HH   . TYR A 1 27 ? 8.695   9.530   -0.503  1.00 0.00 ? 27 TYR A HH   1  
ATOM 460   N N    . LEU A 1 28 ? 6.348   1.446   -3.207  1.00 0.00 ? 28 LEU A N    1  
ATOM 461   C CA   . LEU A 1 28 ? 5.891   0.040   -3.306  1.00 0.00 ? 28 LEU A CA   1  
ATOM 462   C C    . LEU A 1 28 ? 6.779   -0.813  -4.238  1.00 0.00 ? 28 LEU A C    1  
ATOM 463   O O    . LEU A 1 28 ? 7.242   -1.896  -3.845  1.00 0.00 ? 28 LEU A O    1  
ATOM 464   C CB   . LEU A 1 28 ? 4.416   -0.020  -3.772  1.00 0.00 ? 28 LEU A CB   1  
ATOM 465   C CG   . LEU A 1 28 ? 3.757   -1.436  -3.708  1.00 0.00 ? 28 LEU A CG   1  
ATOM 466   C CD1  . LEU A 1 28 ? 3.725   -1.974  -2.265  1.00 0.00 ? 28 LEU A CD1  1  
ATOM 467   C CD2  . LEU A 1 28 ? 2.352   -1.433  -4.322  1.00 0.00 ? 28 LEU A CD2  1  
ATOM 468   H H    . LEU A 1 28 ? 5.713   2.158   -3.404  1.00 0.00 ? 28 LEU A H    1  
ATOM 469   H HA   . LEU A 1 28 ? 5.947   -0.381  -2.304  1.00 0.00 ? 28 LEU A HA   1  
ATOM 470   H HB2  . LEU A 1 28 ? 3.834   0.661   -3.154  1.00 0.00 ? 28 LEU A HB2  1  
ATOM 471   H HB3  . LEU A 1 28 ? 4.366   0.335   -4.799  1.00 0.00 ? 28 LEU A HB3  1  
ATOM 472   H HG   . LEU A 1 28 ? 4.358   -2.125  -4.286  1.00 0.00 ? 28 LEU A HG   1  
ATOM 473   H HD11 . LEU A 1 28 ? 3.172   -1.297  -1.626  1.00 0.00 ? 28 LEU A HD11 1  
ATOM 474   H HD12 . LEU A 1 28 ? 4.734   -2.075  -1.890  1.00 0.00 ? 28 LEU A HD12 1  
ATOM 475   H HD13 . LEU A 1 28 ? 3.247   -2.946  -2.250  1.00 0.00 ? 28 LEU A HD13 1  
ATOM 476   H HD21 . LEU A 1 28 ? 2.408   -1.100  -5.350  1.00 0.00 ? 28 LEU A HD21 1  
ATOM 477   H HD22 . LEU A 1 28 ? 1.704   -0.768  -3.764  1.00 0.00 ? 28 LEU A HD22 1  
ATOM 478   H HD23 . LEU A 1 28 ? 1.942   -2.435  -4.299  1.00 0.00 ? 28 LEU A HD23 1  
ATOM 479   N N    . SER A 1 29 ? 7.024   -0.297  -5.452  1.00 0.00 ? 29 SER A N    1  
ATOM 480   C CA   . SER A 1 29 ? 7.834   -0.987  -6.473  1.00 0.00 ? 29 SER A CA   1  
ATOM 481   C C    . SER A 1 29 ? 9.327   -1.022  -6.086  1.00 0.00 ? 29 SER A C    1  
ATOM 482   O O    . SER A 1 29 ? 10.094  -1.835  -6.615  1.00 0.00 ? 29 SER A O    1  
ATOM 483   C CB   . SER A 1 29 ? 7.653   -0.291  -7.837  1.00 0.00 ? 29 SER A CB   1  
ATOM 484   O OG   . SER A 1 29 ? 8.083   1.061   -7.781  1.00 0.00 ? 29 SER A OG   1  
ATOM 485   H H    . SER A 1 29 ? 6.653   0.582   -5.667  1.00 0.00 ? 29 SER A H    1  
ATOM 486   H HA   . SER A 1 29 ? 7.473   -2.010  -6.552  1.00 0.00 ? 29 SER A HA   1  
ATOM 487   H HB2  . SER A 1 29 ? 8.225   -0.812  -8.594  1.00 0.00 ? 29 SER A HB2  1  
ATOM 488   H HB3  . SER A 1 29 ? 6.608   -0.305  -8.114  1.00 0.00 ? 29 SER A HB3  1  
ATOM 489   H HG   . SER A 1 29 ? 7.349   1.616   -7.509  1.00 0.00 ? 29 SER A HG   1  
ATOM 490   N N    . LYS A 1 30 ? 9.728   -0.136  -5.145  1.00 0.00 ? 30 LYS A N    1  
ATOM 491   C CA   . LYS A 1 30 ? 11.126  -0.005  -4.696  1.00 0.00 ? 30 LYS A CA   1  
ATOM 492   C C    . LYS A 1 30 ? 11.436  -1.006  -3.557  1.00 0.00 ? 30 LYS A C    1  
ATOM 493   O O    . LYS A 1 30 ? 12.592  -1.135  -3.141  1.00 0.00 ? 30 LYS A O    1  
ATOM 494   C CB   . LYS A 1 30 ? 11.373  1.445   -4.205  1.00 0.00 ? 30 LYS A CB   1  
ATOM 495   C CG   . LYS A 1 30 ? 11.048  2.554   -5.231  1.00 0.00 ? 30 LYS A CG   1  
ATOM 496   C CD   . LYS A 1 30 ? 11.968  2.550   -6.474  1.00 0.00 ? 30 LYS A CD   1  
ATOM 497   C CE   . LYS A 1 30 ? 11.717  3.768   -7.385  1.00 0.00 ? 30 LYS A CE   1  
ATOM 498   N NZ   . LYS A 1 30 ? 12.599  3.772   -8.579  1.00 0.00 ? 30 LYS A NZ   1  
ATOM 499   H H    . LYS A 1 30 ? 9.066   0.440   -4.708  1.00 0.00 ? 30 LYS A H    1  
ATOM 500   H HA   . LYS A 1 30 ? 11.781  -0.210  -5.539  1.00 0.00 ? 30 LYS A HA   1  
ATOM 501   H HB2  . LYS A 1 30 ? 10.763  1.622   -3.322  1.00 0.00 ? 30 LYS A HB2  1  
ATOM 502   H HB3  . LYS A 1 30 ? 12.414  1.547   -3.920  1.00 0.00 ? 30 LYS A HB3  1  
ATOM 503   H HG2  . LYS A 1 30 ? 10.023  2.428   -5.560  1.00 0.00 ? 30 LYS A HG2  1  
ATOM 504   H HG3  . LYS A 1 30 ? 11.137  3.517   -4.734  1.00 0.00 ? 30 LYS A HG3  1  
ATOM 505   H HD2  . LYS A 1 30 ? 13.003  2.570   -6.148  1.00 0.00 ? 30 LYS A HD2  1  
ATOM 506   H HD3  . LYS A 1 30 ? 11.793  1.643   -7.042  1.00 0.00 ? 30 LYS A HD3  1  
ATOM 507   H HE2  . LYS A 1 30 ? 10.689  3.750   -7.721  1.00 0.00 ? 30 LYS A HE2  1  
ATOM 508   H HE3  . LYS A 1 30 ? 11.891  4.676   -6.821  1.00 0.00 ? 30 LYS A HE3  1  
ATOM 509   H HZ1  . LYS A 1 30 ? 13.596  3.760   -8.296  1.00 0.00 ? 30 LYS A HZ1  1  
ATOM 510   H HZ2  . LYS A 1 30 ? 12.423  4.623   -9.150  1.00 0.00 ? 30 LYS A HZ2  1  
ATOM 511   H HZ3  . LYS A 1 30 ? 12.408  2.938   -9.167  1.00 0.00 ? 30 LYS A HZ3  1  
ATOM 512   N N    . GLY A 1 31 ? 10.384  -1.700  -3.057  1.00 0.00 ? 31 GLY A N    1  
ATOM 513   C CA   . GLY A 1 31 ? 10.514  -2.668  -1.958  1.00 0.00 ? 31 GLY A CA   1  
ATOM 514   C C    . GLY A 1 31 ? 10.835  -2.056  -0.596  1.00 0.00 ? 31 GLY A C    1  
ATOM 515   O O    . GLY A 1 31 ? 11.184  -2.785  0.341   1.00 0.00 ? 31 GLY A O    1  
ATOM 516   H H    . GLY A 1 31 ? 9.505   -1.594  -3.479  1.00 0.00 ? 31 GLY A H    1  
ATOM 517   H HA2  . GLY A 1 31 ? 9.580   -3.204  -1.875  1.00 0.00 ? 31 GLY A HA2  1  
ATOM 518   H HA3  . GLY A 1 31 ? 11.291  -3.384  -2.212  1.00 0.00 ? 31 GLY A HA3  1  
ATOM 519   N N    . VAL A 1 32 ? 10.699  -0.716  -0.467  1.00 0.00 ? 32 VAL A N    1  
ATOM 520   C CA   . VAL A 1 32 ? 11.007  0.007   0.791   1.00 0.00 ? 32 VAL A CA   1  
ATOM 521   C C    . VAL A 1 32 ? 9.786   0.031   1.737   1.00 0.00 ? 32 VAL A C    1  
ATOM 522   O O    . VAL A 1 32 ? 9.866   0.554   2.851   1.00 0.00 ? 32 VAL A O    1  
ATOM 523   C CB   . VAL A 1 32 ? 11.532  1.471   0.518   1.00 0.00 ? 32 VAL A CB   1  
ATOM 524   C CG1  . VAL A 1 32 ? 12.788  1.443   -0.388  1.00 0.00 ? 32 VAL A CG1  1  
ATOM 525   C CG2  . VAL A 1 32 ? 10.429  2.382   -0.073  1.00 0.00 ? 32 VAL A CG2  1  
ATOM 526   H H    . VAL A 1 32 ? 10.370  -0.197  -1.231  1.00 0.00 ? 32 VAL A H    1  
ATOM 527   H HA   . VAL A 1 32 ? 11.803  -0.536  1.300   1.00 0.00 ? 32 VAL A HA   1  
ATOM 528   H HB   . VAL A 1 32 ? 11.836  1.898   1.473   1.00 0.00 ? 32 VAL A HB   1  
ATOM 529   H HG11 . VAL A 1 32 ? 12.542  0.996   -1.346  1.00 0.00 ? 32 VAL A HG11 1  
ATOM 530   H HG12 . VAL A 1 32 ? 13.567  0.857   0.084   1.00 0.00 ? 32 VAL A HG12 1  
ATOM 531   H HG13 . VAL A 1 32 ? 13.152  2.451   -0.548  1.00 0.00 ? 32 VAL A HG13 1  
ATOM 532   H HG21 . VAL A 1 32 ? 9.599   2.444   0.620   1.00 0.00 ? 32 VAL A HG21 1  
ATOM 533   H HG22 . VAL A 1 32 ? 10.077  1.974   -1.012  1.00 0.00 ? 32 VAL A HG22 1  
ATOM 534   H HG23 . VAL A 1 32 ? 10.821  3.379   -0.241  1.00 0.00 ? 32 VAL A HG23 1  
ATOM 535   N N    . VAL A 1 33 ? 8.676   -0.578  1.278   1.00 0.00 ? 33 VAL A N    1  
ATOM 536   C CA   . VAL A 1 33 ? 7.430   -0.712  2.046   1.00 0.00 ? 33 VAL A CA   1  
ATOM 537   C C    . VAL A 1 33 ? 7.386   -2.102  2.690   1.00 0.00 ? 33 VAL A C    1  
ATOM 538   O O    . VAL A 1 33 ? 7.570   -3.111  2.004   1.00 0.00 ? 33 VAL A O    1  
ATOM 539   C CB   . VAL A 1 33 ? 6.160   -0.513  1.137   1.00 0.00 ? 33 VAL A CB   1  
ATOM 540   C CG1  . VAL A 1 33 ? 4.840   -0.644  1.944   1.00 0.00 ? 33 VAL A CG1  1  
ATOM 541   C CG2  . VAL A 1 33 ? 6.222   0.839   0.405   1.00 0.00 ? 33 VAL A CG2  1  
ATOM 542   H H    . VAL A 1 33 ? 8.717   -1.004  0.401   1.00 0.00 ? 33 VAL A H    1  
ATOM 543   H HA   . VAL A 1 33 ? 7.420   0.051   2.826   1.00 0.00 ? 33 VAL A HA   1  
ATOM 544   H HB   . VAL A 1 33 ? 6.162   -1.294  0.382   1.00 0.00 ? 33 VAL A HB   1  
ATOM 545   H HG11 . VAL A 1 33 ? 4.785   -1.626  2.405   1.00 0.00 ? 33 VAL A HG11 1  
ATOM 546   H HG12 . VAL A 1 33 ? 3.991   -0.516  1.285   1.00 0.00 ? 33 VAL A HG12 1  
ATOM 547   H HG13 . VAL A 1 33 ? 4.809   0.112   2.717   1.00 0.00 ? 33 VAL A HG13 1  
ATOM 548   H HG21 . VAL A 1 33 ? 6.240   1.645   1.128   1.00 0.00 ? 33 VAL A HG21 1  
ATOM 549   H HG22 . VAL A 1 33 ? 5.352   0.954   -0.233  1.00 0.00 ? 33 VAL A HG22 1  
ATOM 550   H HG23 . VAL A 1 33 ? 7.117   0.888   -0.204  1.00 0.00 ? 33 VAL A HG23 1  
ATOM 551   N N    . ASP A 1 34 ? 7.149   -2.129  4.003   1.00 0.00 ? 34 ASP A N    1  
ATOM 552   C CA   . ASP A 1 34 ? 7.057   -3.360  4.797   1.00 0.00 ? 34 ASP A CA   1  
ATOM 553   C C    . ASP A 1 34 ? 5.619   -3.897  4.757   1.00 0.00 ? 34 ASP A C    1  
ATOM 554   O O    . ASP A 1 34 ? 5.377   -5.052  4.398   1.00 0.00 ? 34 ASP A O    1  
ATOM 555   C CB   . ASP A 1 34 ? 7.479   -3.063  6.256   1.00 0.00 ? 34 ASP A CB   1  
ATOM 556   C CG   . ASP A 1 34 ? 7.521   -4.317  7.141   1.00 0.00 ? 34 ASP A CG   1  
ATOM 557   O OD1  . ASP A 1 34 ? 8.542   -5.037  7.123   1.00 0.00 ? 34 ASP A OD1  1  
ATOM 558   O OD2  . ASP A 1 34 ? 6.538   -4.594  7.859   1.00 0.00 ? 34 ASP A OD2  1  
ATOM 559   H H    . ASP A 1 34 ? 7.002   -1.284  4.454   1.00 0.00 ? 34 ASP A H    1  
ATOM 560   H HA   . ASP A 1 34 ? 7.731   -4.099  4.374   1.00 0.00 ? 34 ASP A HA   1  
ATOM 561   H HB2  . ASP A 1 34 ? 8.470   -2.616  6.250   1.00 0.00 ? 34 ASP A HB2  1  
ATOM 562   H HB3  . ASP A 1 34 ? 6.790   -2.345  6.690   1.00 0.00 ? 34 ASP A HB3  1  
ATOM 563   N N    . ARG A 1 35 ? 4.671   -3.007  5.091   1.00 0.00 ? 35 ARG A N    1  
ATOM 564   C CA   . ARG A 1 35 ? 3.248   -3.357  5.238   1.00 0.00 ? 35 ARG A CA   1  
ATOM 565   C C    . ARG A 1 35 ? 2.368   -2.119  5.043   1.00 0.00 ? 35 ARG A C    1  
ATOM 566   O O    . ARG A 1 35 ? 2.857   -0.985  5.057   1.00 0.00 ? 35 ARG A O    1  
ATOM 567   C CB   . ARG A 1 35 ? 2.984   -4.050  6.611   1.00 0.00 ? 35 ARG A CB   1  
ATOM 568   C CG   . ARG A 1 35 ? 3.314   -3.217  7.867   1.00 0.00 ? 35 ARG A CG   1  
ATOM 569   C CD   . ARG A 1 35 ? 3.142   -4.023  9.169   1.00 0.00 ? 35 ARG A CD   1  
ATOM 570   N NE   . ARG A 1 35 ? 4.036   -5.203  9.220   1.00 0.00 ? 35 ARG A NE   1  
ATOM 571   C CZ   . ARG A 1 35 ? 4.097   -6.106  10.220  1.00 0.00 ? 35 ARG A CZ   1  
ATOM 572   N NH1  . ARG A 1 35 ? 3.315   -6.007  11.294  1.00 0.00 ? 35 ARG A NH1  1  
ATOM 573   N NH2  . ARG A 1 35 ? 4.968   -7.106  10.140  1.00 0.00 ? 35 ARG A NH2  1  
ATOM 574   H H    . ARG A 1 35 ? 4.942   -2.067  5.186   1.00 0.00 ? 35 ARG A H    1  
ATOM 575   H HA   . ARG A 1 35 ? 3.000   -4.061  4.444   1.00 0.00 ? 35 ARG A HA   1  
ATOM 576   H HB2  . ARG A 1 35 ? 1.939   -4.338  6.661   1.00 0.00 ? 35 ARG A HB2  1  
ATOM 577   H HB3  . ARG A 1 35 ? 3.583   -4.956  6.646   1.00 0.00 ? 35 ARG A HB3  1  
ATOM 578   H HG2  . ARG A 1 35 ? 4.342   -2.880  7.799   1.00 0.00 ? 35 ARG A HG2  1  
ATOM 579   H HG3  . ARG A 1 35 ? 2.657   -2.353  7.897   1.00 0.00 ? 35 ARG A HG3  1  
ATOM 580   H HD2  . ARG A 1 35 ? 3.369   -3.381  10.011  1.00 0.00 ? 35 ARG A HD2  1  
ATOM 581   H HD3  . ARG A 1 35 ? 2.113   -4.357  9.244   1.00 0.00 ? 35 ARG A HD3  1  
ATOM 582   H HE   . ARG A 1 35 ? 4.636   -5.331  8.450   1.00 0.00 ? 35 ARG A HE   1  
ATOM 583   H HH11 . ARG A 1 35 ? 2.661   -5.252  11.377  1.00 0.00 ? 35 ARG A HH11 1  
ATOM 584   H HH12 . ARG A 1 35 ? 3.379   -6.691  12.030  1.00 0.00 ? 35 ARG A HH12 1  
ATOM 585   H HH21 . ARG A 1 35 ? 5.571   -7.187  9.340   1.00 0.00 ? 35 ARG A HH21 1  
ATOM 586   H HH22 . ARG A 1 35 ? 5.027   -7.785  10.878  1.00 0.00 ? 35 ARG A HH22 1  
ATOM 587   N N    . LEU A 1 36 ? 1.071   -2.358  4.815   1.00 0.00 ? 36 LEU A N    1  
ATOM 588   C CA   . LEU A 1 36 ? 0.064   -1.305  4.647   1.00 0.00 ? 36 LEU A CA   1  
ATOM 589   C C    . LEU A 1 36 ? -0.984  -1.441  5.747   1.00 0.00 ? 36 LEU A C    1  
ATOM 590   O O    . LEU A 1 36 ? -1.830  -2.340  5.720   1.00 0.00 ? 36 LEU A O    1  
ATOM 591   C CB   . LEU A 1 36 ? -0.571  -1.387  3.235   1.00 0.00 ? 36 LEU A CB   1  
ATOM 592   C CG   . LEU A 1 36 ? 0.376   -1.000  2.060   1.00 0.00 ? 36 LEU A CG   1  
ATOM 593   C CD1  . LEU A 1 36 ? -0.358  -1.079  0.715   1.00 0.00 ? 36 LEU A CD1  1  
ATOM 594   C CD2  . LEU A 1 36 ? 1.010   0.397   2.287   1.00 0.00 ? 36 LEU A CD2  1  
ATOM 595   H H    . LEU A 1 36 ? 0.771   -3.286  4.761   1.00 0.00 ? 36 LEU A H    1  
ATOM 596   H HA   . LEU A 1 36 ? 0.554   -0.337  4.751   1.00 0.00 ? 36 LEU A HA   1  
ATOM 597   H HB2  . LEU A 1 36 ? -0.918  -2.404  3.076   1.00 0.00 ? 36 LEU A HB2  1  
ATOM 598   H HB3  . LEU A 1 36 ? -1.434  -0.729  3.203   1.00 0.00 ? 36 LEU A HB3  1  
ATOM 599   H HG   . LEU A 1 36 ? 1.188   -1.719  2.020   1.00 0.00 ? 36 LEU A HG   1  
ATOM 600   H HD11 . LEU A 1 36 ? 0.332   -0.869  -0.091  1.00 0.00 ? 36 LEU A HD11 1  
ATOM 601   H HD12 . LEU A 1 36 ? -1.169  -0.365  0.688   1.00 0.00 ? 36 LEU A HD12 1  
ATOM 602   H HD13 . LEU A 1 36 ? -0.757  -2.077  0.582   1.00 0.00 ? 36 LEU A HD13 1  
ATOM 603   H HD21 . LEU A 1 36 ? 1.677   0.633   1.466   1.00 0.00 ? 36 LEU A HD21 1  
ATOM 604   H HD22 . LEU A 1 36 ? 1.581   0.390   3.208   1.00 0.00 ? 36 LEU A HD22 1  
ATOM 605   H HD23 . LEU A 1 36 ? 0.241   1.154   2.351   1.00 0.00 ? 36 LEU A HD23 1  
ATOM 606   N N    . GLU A 1 37 ? -0.890  -0.545  6.727   1.00 0.00 ? 37 GLU A N    1  
ATOM 607   C CA   . GLU A 1 37 ? -1.726  -0.556  7.923   1.00 0.00 ? 37 GLU A CA   1  
ATOM 608   C C    . GLU A 1 37 ? -2.893  0.427   7.749   1.00 0.00 ? 37 GLU A C    1  
ATOM 609   O O    . GLU A 1 37 ? -2.708  1.642   7.808   1.00 0.00 ? 37 GLU A O    1  
ATOM 610   C CB   . GLU A 1 37 ? -0.855  -0.219  9.156   1.00 0.00 ? 37 GLU A CB   1  
ATOM 611   C CG   . GLU A 1 37 ? 0.262   -1.255  9.419   1.00 0.00 ? 37 GLU A CG   1  
ATOM 612   C CD   . GLU A 1 37 ? 1.060   -0.984  10.699  1.00 0.00 ? 37 GLU A CD   1  
ATOM 613   O OE1  . GLU A 1 37 ? 0.486   -1.091  11.802  1.00 0.00 ? 37 GLU A OE1  1  
ATOM 614   O OE2  . GLU A 1 37 ? 2.262   -0.663  10.617  1.00 0.00 ? 37 GLU A OE2  1  
ATOM 615   H H    . GLU A 1 37 ? -0.228  0.171   6.634   1.00 0.00 ? 37 GLU A H    1  
ATOM 616   H HA   . GLU A 1 37 ? -2.129  -1.560  8.051   1.00 0.00 ? 37 GLU A HA   1  
ATOM 617   H HB2  . GLU A 1 37 ? -0.395  0.754   9.004   1.00 0.00 ? 37 GLU A HB2  1  
ATOM 618   H HB3  . GLU A 1 37 ? -1.488  -0.169  10.033  1.00 0.00 ? 37 GLU A HB3  1  
ATOM 619   H HG2  . GLU A 1 37 ? -0.187  -2.241  9.500   1.00 0.00 ? 37 GLU A HG2  1  
ATOM 620   H HG3  . GLU A 1 37 ? 0.940   -1.254  8.567   1.00 0.00 ? 37 GLU A HG3  1  
ATOM 621   N N    . VAL A 1 38 ? -4.098  -0.126  7.564   1.00 0.00 ? 38 VAL A N    1  
ATOM 622   C CA   . VAL A 1 38 ? -5.306  0.640   7.230   1.00 0.00 ? 38 VAL A CA   1  
ATOM 623   C C    . VAL A 1 38 ? -5.896  1.203   8.536   1.00 0.00 ? 38 VAL A C    1  
ATOM 624   O O    . VAL A 1 38 ? -6.670  0.517   9.209   1.00 0.00 ? 38 VAL A O    1  
ATOM 625   C CB   . VAL A 1 38 ? -6.365  -0.279  6.494   1.00 0.00 ? 38 VAL A CB   1  
ATOM 626   C CG1  . VAL A 1 38 ? -7.576  0.538   5.989   1.00 0.00 ? 38 VAL A CG1  1  
ATOM 627   C CG2  . VAL A 1 38 ? -5.710  -1.092  5.345   1.00 0.00 ? 38 VAL A CG2  1  
ATOM 628   H H    . VAL A 1 38 ? -4.202  -1.079  7.755   1.00 0.00 ? 38 VAL A H    1  
ATOM 629   H HA   . VAL A 1 38 ? -5.038  1.462   6.568   1.00 0.00 ? 38 VAL A HA   1  
ATOM 630   H HB   . VAL A 1 38 ? -6.742  -0.994  7.223   1.00 0.00 ? 38 VAL A HB   1  
ATOM 631   H HG11 . VAL A 1 38 ? -8.295  -0.119  5.515   1.00 0.00 ? 38 VAL A HG11 1  
ATOM 632   H HG12 . VAL A 1 38 ? -7.245  1.278   5.270   1.00 0.00 ? 38 VAL A HG12 1  
ATOM 633   H HG13 . VAL A 1 38 ? -8.050  1.044   6.822   1.00 0.00 ? 38 VAL A HG13 1  
ATOM 634   H HG21 . VAL A 1 38 ? -6.449  -1.732  4.876   1.00 0.00 ? 38 VAL A HG21 1  
ATOM 635   H HG22 . VAL A 1 38 ? -4.909  -1.705  5.741   1.00 0.00 ? 38 VAL A HG22 1  
ATOM 636   H HG23 . VAL A 1 38 ? -5.303  -0.417  4.601   1.00 0.00 ? 38 VAL A HG23 1  
ATOM 637   N N    . VAL A 1 39 ? -5.507  2.442   8.907   1.00 0.00 ? 39 VAL A N    1  
ATOM 638   C CA   . VAL A 1 39 ? -5.808  3.010   10.235  1.00 0.00 ? 39 VAL A CA   1  
ATOM 639   C C    . VAL A 1 39 ? -7.225  3.613   10.264  1.00 0.00 ? 39 VAL A C    1  
ATOM 640   O O    . VAL A 1 39 ? -7.549  4.520   9.475   1.00 0.00 ? 39 VAL A O    1  
ATOM 641   C CB   . VAL A 1 39 ? -4.750  4.091   10.666  1.00 0.00 ? 39 VAL A CB   1  
ATOM 642   C CG1  . VAL A 1 39 ? -5.053  4.659   12.082  1.00 0.00 ? 39 VAL A CG1  1  
ATOM 643   C CG2  . VAL A 1 39 ? -3.306  3.530   10.586  1.00 0.00 ? 39 VAL A CG2  1  
ATOM 644   H H    . VAL A 1 39 ? -5.046  3.016   8.264   1.00 0.00 ? 39 VAL A H    1  
ATOM 645   H HA   . VAL A 1 39 ? -5.762  2.196   10.959  1.00 0.00 ? 39 VAL A HA   1  
ATOM 646   H HB   . VAL A 1 39 ? -4.819  4.917   9.959   1.00 0.00 ? 39 VAL A HB   1  
ATOM 647   H HG11 . VAL A 1 39 ? -6.041  5.108   12.097  1.00 0.00 ? 39 VAL A HG11 1  
ATOM 648   H HG12 . VAL A 1 39 ? -4.322  5.413   12.341  1.00 0.00 ? 39 VAL A HG12 1  
ATOM 649   H HG13 . VAL A 1 39 ? -5.016  3.861   12.816  1.00 0.00 ? 39 VAL A HG13 1  
ATOM 650   H HG21 . VAL A 1 39 ? -2.597  4.304   10.855  1.00 0.00 ? 39 VAL A HG21 1  
ATOM 651   H HG22 . VAL A 1 39 ? -3.097  3.193   9.576   1.00 0.00 ? 39 VAL A HG22 1  
ATOM 652   H HG23 . VAL A 1 39 ? -3.200  2.697   11.267  1.00 0.00 ? 39 VAL A HG23 1  
ATOM 653   N N    . ASN A 1 40 ? -8.058  3.065   11.181  1.00 0.00 ? 40 ASN A N    1  
ATOM 654   C CA   . ASN A 1 40 ? -9.484  3.426   11.385  1.00 0.00 ? 40 ASN A CA   1  
ATOM 655   C C    . ASN A 1 40 ? -10.321 3.322   10.098  1.00 0.00 ? 40 ASN A C    1  
ATOM 656   O O    . ASN A 1 40 ? -11.397 3.917   10.006  1.00 0.00 ? 40 ASN A O    1  
ATOM 657   C CB   . ASN A 1 40 ? -9.594  4.819   12.070  1.00 0.00 ? 40 ASN A CB   1  
ATOM 658   C CG   . ASN A 1 40 ? -9.067  4.807   13.516  1.00 0.00 ? 40 ASN A CG   1  
ATOM 659   O OD1  . ASN A 1 40 ? -8.174  4.031   13.871  1.00 0.00 ? 40 ASN A OD1  1  
ATOM 660   N ND2  . ASN A 1 40 ? -9.615  5.660   14.363  1.00 0.00 ? 40 ASN A ND2  1  
ATOM 661   H H    . ASN A 1 40 ? -7.685  2.392   11.786  1.00 0.00 ? 40 ASN A H    1  
ATOM 662   H HA   . ASN A 1 40 ? -9.880  2.688   12.070  1.00 0.00 ? 40 ASN A HA   1  
ATOM 663   H HB2  . ASN A 1 40 ? -9.023  5.543   11.502  1.00 0.00 ? 40 ASN A HB2  1  
ATOM 664   H HB3  . ASN A 1 40 ? -10.633 5.131   12.092  1.00 0.00 ? 40 ASN A HB3  1  
ATOM 665   H HD21 . ASN A 1 40 ? -10.320 6.258   14.033  1.00 0.00 ? 40 ASN A HD21 1  
ATOM 666   H HD22 . ASN A 1 40 ? -9.314  5.641   15.294  1.00 0.00 ? 40 ASN A HD22 1  
ATOM 667   N N    . LYS A 1 41 ? -9.812  2.522   9.125   1.00 0.00 ? 41 LYS A N    1  
ATOM 668   C CA   . LYS A 1 41 ? -10.395 2.342   7.766   1.00 0.00 ? 41 LYS A CA   1  
ATOM 669   C C    . LYS A 1 41 ? -10.585 3.660   6.968   1.00 0.00 ? 41 LYS A C    1  
ATOM 670   O O    . LYS A 1 41 ? -11.112 3.638   5.853   1.00 0.00 ? 41 LYS A O    1  
ATOM 671   C CB   . LYS A 1 41 ? -11.712 1.529   7.855   1.00 0.00 ? 41 LYS A CB   1  
ATOM 672   C CG   . LYS A 1 41 ? -11.513 0.077   8.353   1.00 0.00 ? 41 LYS A CG   1  
ATOM 673   C CD   . LYS A 1 41 ? -12.832 -0.729  8.389   1.00 0.00 ? 41 LYS A CD   1  
ATOM 674   C CE   . LYS A 1 41 ? -12.628 -2.181  8.842   1.00 0.00 ? 41 LYS A CE   1  
ATOM 675   N NZ   . LYS A 1 41 ? -13.905 -2.936  8.871   1.00 0.00 ? 41 LYS A NZ   1  
ATOM 676   H H    . LYS A 1 41 ? -9.018  1.990   9.354   1.00 0.00 ? 41 LYS A H    1  
ATOM 677   H HA   . LYS A 1 41 ? -9.678  1.748   7.210   1.00 0.00 ? 41 LYS A HA   1  
ATOM 678   H HB2  . LYS A 1 41 ? -12.384 2.040   8.537   1.00 0.00 ? 41 LYS A HB2  1  
ATOM 679   H HB3  . LYS A 1 41 ? -12.174 1.492   6.875   1.00 0.00 ? 41 LYS A HB3  1  
ATOM 680   H HG2  . LYS A 1 41 ? -10.815 -0.426  7.690   1.00 0.00 ? 41 LYS A HG2  1  
ATOM 681   H HG3  . LYS A 1 41 ? -11.089 0.103   9.354   1.00 0.00 ? 41 LYS A HG3  1  
ATOM 682   H HD2  . LYS A 1 41 ? -13.519 -0.247  9.073   1.00 0.00 ? 41 LYS A HD2  1  
ATOM 683   H HD3  . LYS A 1 41 ? -13.269 -0.735  7.395   1.00 0.00 ? 41 LYS A HD3  1  
ATOM 684   H HE2  . LYS A 1 41 ? -11.951 -2.676  8.159   1.00 0.00 ? 41 LYS A HE2  1  
ATOM 685   H HE3  . LYS A 1 41 ? -12.198 -2.184  9.836   1.00 0.00 ? 41 LYS A HE3  1  
ATOM 686   H HZ1  . LYS A 1 41 ? -13.729 -3.931  9.116   1.00 0.00 ? 41 LYS A HZ1  1  
ATOM 687   H HZ2  . LYS A 1 41 ? -14.364 -2.896  7.941   1.00 0.00 ? 41 LYS A HZ2  1  
ATOM 688   H HZ3  . LYS A 1 41 ? -14.546 -2.532  9.577   1.00 0.00 ? 41 LYS A HZ3  1  
ATOM 689   N N    . ARG A 1 42 ? -10.110 4.788   7.525   1.00 0.00 ? 42 ARG A N    1  
ATOM 690   C CA   . ARG A 1 42 ? -10.223 6.118   6.910   1.00 0.00 ? 42 ARG A CA   1  
ATOM 691   C C    . ARG A 1 42 ? -9.156  6.251   5.816   1.00 0.00 ? 42 ARG A C    1  
ATOM 692   O O    . ARG A 1 42 ? -9.407  6.752   4.711   1.00 0.00 ? 42 ARG A O    1  
ATOM 693   C CB   . ARG A 1 42 ? -9.995  7.214   7.988   1.00 0.00 ? 42 ARG A CB   1  
ATOM 694   C CG   . ARG A 1 42 ? -10.986 7.206   9.178   1.00 0.00 ? 42 ARG A CG   1  
ATOM 695   C CD   . ARG A 1 42 ? -10.638 8.295   10.215  1.00 0.00 ? 42 ARG A CD   1  
ATOM 696   N NE   . ARG A 1 42 ? -11.586 8.351   11.346  1.00 0.00 ? 42 ARG A NE   1  
ATOM 697   C CZ   . ARG A 1 42 ? -12.213 9.461   11.788  1.00 0.00 ? 42 ARG A CZ   1  
ATOM 698   N NH1  . ARG A 1 42 ? -12.012 10.641  11.207  1.00 0.00 ? 42 ARG A NH1  1  
ATOM 699   N NH2  . ARG A 1 42 ? -13.038 9.381   12.821  1.00 0.00 ? 42 ARG A NH2  1  
ATOM 700   H H    . ARG A 1 42 ? -9.641  4.722   8.383   1.00 0.00 ? 42 ARG A H    1  
ATOM 701   H HA   . ARG A 1 42 ? -11.212 6.230   6.477   1.00 0.00 ? 42 ARG A HA   1  
ATOM 702   H HB2  . ARG A 1 42 ? -8.993  7.097   8.391   1.00 0.00 ? 42 ARG A HB2  1  
ATOM 703   H HB3  . ARG A 1 42 ? -10.058 8.186   7.510   1.00 0.00 ? 42 ARG A HB3  1  
ATOM 704   H HG2  . ARG A 1 42 ? -11.989 7.384   8.803   1.00 0.00 ? 42 ARG A HG2  1  
ATOM 705   H HG3  . ARG A 1 42 ? -10.955 6.234   9.660   1.00 0.00 ? 42 ARG A HG3  1  
ATOM 706   H HD2  . ARG A 1 42 ? -9.654  8.089   10.617  1.00 0.00 ? 42 ARG A HD2  1  
ATOM 707   H HD3  . ARG A 1 42 ? -10.620 9.258   9.718   1.00 0.00 ? 42 ARG A HD3  1  
ATOM 708   H HE   . ARG A 1 42 ? -11.761 7.511   11.816  1.00 0.00 ? 42 ARG A HE   1  
ATOM 709   H HH11 . ARG A 1 42 ? -11.386 10.720  10.430  1.00 0.00 ? 42 ARG A HH11 1  
ATOM 710   H HH12 . ARG A 1 42 ? -12.488 11.460  11.551  1.00 0.00 ? 42 ARG A HH12 1  
ATOM 711   H HH21 . ARG A 1 42 ? -13.197 8.498   13.273  1.00 0.00 ? 42 ARG A HH21 1  
ATOM 712   H HH22 . ARG A 1 42 ? -13.511 10.203  13.156  1.00 0.00 ? 42 ARG A HH22 1  
ATOM 713   N N    . PHE A 1 43 ? -7.967  5.743   6.153   1.00 0.00 ? 43 PHE A N    1  
ATOM 714   C CA   . PHE A 1 43 ? -6.758  5.893   5.354   1.00 0.00 ? 43 PHE A CA   1  
ATOM 715   C C    . PHE A 1 43 ? -5.847  4.693   5.600   1.00 0.00 ? 43 PHE A C    1  
ATOM 716   O O    . PHE A 1 43 ? -6.109  3.867   6.481   1.00 0.00 ? 43 PHE A O    1  
ATOM 717   C CB   . PHE A 1 43 ? -6.030  7.230   5.697   1.00 0.00 ? 43 PHE A CB   1  
ATOM 718   C CG   . PHE A 1 43 ? -5.422  7.320   7.104   1.00 0.00 ? 43 PHE A CG   1  
ATOM 719   C CD1  . PHE A 1 43 ? -6.226  7.565   8.218   1.00 0.00 ? 43 PHE A CD1  1  
ATOM 720   C CD2  . PHE A 1 43 ? -4.045  7.166   7.309   1.00 0.00 ? 43 PHE A CD2  1  
ATOM 721   C CE1  . PHE A 1 43 ? -5.680  7.655   9.481   1.00 0.00 ? 43 PHE A CE1  1  
ATOM 722   C CE2  . PHE A 1 43 ? -3.502  7.259   8.574   1.00 0.00 ? 43 PHE A CE2  1  
ATOM 723   C CZ   . PHE A 1 43 ? -4.319  7.504   9.656   1.00 0.00 ? 43 PHE A CZ   1  
ATOM 724   H H    . PHE A 1 43 ? -7.907  5.187   6.959   1.00 0.00 ? 43 PHE A H    1  
ATOM 725   H HA   . PHE A 1 43 ? -7.040  5.900   4.301   1.00 0.00 ? 43 PHE A HA   1  
ATOM 726   H HB2  . PHE A 1 43 ? -5.234  7.384   4.978   1.00 0.00 ? 43 PHE A HB2  1  
ATOM 727   H HB3  . PHE A 1 43 ? -6.740  8.043   5.590   1.00 0.00 ? 43 PHE A HB3  1  
ATOM 728   H HD1  . PHE A 1 43 ? -7.294  7.684   8.089   1.00 0.00 ? 43 PHE A HD1  1  
ATOM 729   H HD2  . PHE A 1 43 ? -3.396  6.975   6.463   1.00 0.00 ? 43 PHE A HD2  1  
ATOM 730   H HE1  . PHE A 1 43 ? -6.316  7.849   10.337  1.00 0.00 ? 43 PHE A HE1  1  
ATOM 731   H HE2  . PHE A 1 43 ? -2.433  7.140   8.719   1.00 0.00 ? 43 PHE A HE2  1  
ATOM 732   H HZ   . PHE A 1 43 ? -3.889  7.578   10.652  1.00 0.00 ? 43 PHE A HZ   1  
ATOM 733   N N    . VAL A 1 44 ? -4.770  4.625   4.822   1.00 0.00 ? 44 VAL A N    1  
ATOM 734   C CA   . VAL A 1 44 ? -3.740  3.593   4.931   1.00 0.00 ? 44 VAL A CA   1  
ATOM 735   C C    . VAL A 1 44 ? -2.396  4.273   5.171   1.00 0.00 ? 44 VAL A C    1  
ATOM 736   O O    . VAL A 1 44 ? -2.039  5.211   4.453   1.00 0.00 ? 44 VAL A O    1  
ATOM 737   C CB   . VAL A 1 44 ? -3.659  2.714   3.630   1.00 0.00 ? 44 VAL A CB   1  
ATOM 738   C CG1  . VAL A 1 44 ? -2.554  1.636   3.739   1.00 0.00 ? 44 VAL A CG1  1  
ATOM 739   C CG2  . VAL A 1 44 ? -5.025  2.077   3.316   1.00 0.00 ? 44 VAL A CG2  1  
ATOM 740   H H    . VAL A 1 44 ? -4.648  5.323   4.155   1.00 0.00 ? 44 VAL A H    1  
ATOM 741   H HA   . VAL A 1 44 ? -3.975  2.942   5.774   1.00 0.00 ? 44 VAL A HA   1  
ATOM 742   H HB   . VAL A 1 44 ? -3.401  3.366   2.799   1.00 0.00 ? 44 VAL A HB   1  
ATOM 743   H HG11 . VAL A 1 44 ? -1.592  2.108   3.906   1.00 0.00 ? 44 VAL A HG11 1  
ATOM 744   H HG12 . VAL A 1 44 ? -2.510  1.059   2.824   1.00 0.00 ? 44 VAL A HG12 1  
ATOM 745   H HG13 . VAL A 1 44 ? -2.772  0.972   4.567   1.00 0.00 ? 44 VAL A HG13 1  
ATOM 746   H HG21 . VAL A 1 44 ? -4.967  1.510   2.396   1.00 0.00 ? 44 VAL A HG21 1  
ATOM 747   H HG22 . VAL A 1 44 ? -5.775  2.853   3.207   1.00 0.00 ? 44 VAL A HG22 1  
ATOM 748   H HG23 . VAL A 1 44 ? -5.315  1.416   4.122   1.00 0.00 ? 44 VAL A HG23 1  
ATOM 749   N N    . ARG A 1 45 ? -1.663  3.784   6.174   1.00 0.00 ? 45 ARG A N    1  
ATOM 750   C CA   . ARG A 1 45 ? -0.308  4.221   6.465   1.00 0.00 ? 45 ARG A CA   1  
ATOM 751   C C    . ARG A 1 45 ? 0.649   3.323   5.682   1.00 0.00 ? 45 ARG A C    1  
ATOM 752   O O    . ARG A 1 45 ? 0.562   2.084   5.757   1.00 0.00 ? 45 ARG A O    1  
ATOM 753   C CB   . ARG A 1 45 ? 0.008   4.141   7.984   1.00 0.00 ? 45 ARG A CB   1  
ATOM 754   C CG   . ARG A 1 45 ? 1.474   4.509   8.336   1.00 0.00 ? 45 ARG A CG   1  
ATOM 755   C CD   . ARG A 1 45 ? 1.752   4.542   9.845   1.00 0.00 ? 45 ARG A CD   1  
ATOM 756   N NE   . ARG A 1 45 ? 1.607   3.225   10.490  1.00 0.00 ? 45 ARG A NE   1  
ATOM 757   C CZ   . ARG A 1 45 ? 1.607   3.028   11.820  1.00 0.00 ? 45 ARG A CZ   1  
ATOM 758   N NH1  . ARG A 1 45 ? 1.741   4.049   12.669  1.00 0.00 ? 45 ARG A NH1  1  
ATOM 759   N NH2  . ARG A 1 45 ? 1.505   1.802   12.298  1.00 0.00 ? 45 ARG A NH2  1  
ATOM 760   H H    . ARG A 1 45 ? -2.020  3.042   6.685   1.00 0.00 ? 45 ARG A H    1  
ATOM 761   H HA   . ARG A 1 45 ? -0.197  5.255   6.132   1.00 0.00 ? 45 ARG A HA   1  
ATOM 762   H HB2  . ARG A 1 45 ? -0.653  4.820   8.512   1.00 0.00 ? 45 ARG A HB2  1  
ATOM 763   H HB3  . ARG A 1 45 ? -0.185  3.131   8.331   1.00 0.00 ? 45 ARG A HB3  1  
ATOM 764   H HG2  . ARG A 1 45 ? 2.138   3.783   7.881   1.00 0.00 ? 45 ARG A HG2  1  
ATOM 765   H HG3  . ARG A 1 45 ? 1.692   5.489   7.921   1.00 0.00 ? 45 ARG A HG3  1  
ATOM 766   H HD2  . ARG A 1 45 ? 2.766   4.892   10.004  1.00 0.00 ? 45 ARG A HD2  1  
ATOM 767   H HD3  . ARG A 1 45 ? 1.063   5.241   10.310  1.00 0.00 ? 45 ARG A HD3  1  
ATOM 768   H HE   . ARG A 1 45 ? 1.509   2.444   9.899   1.00 0.00 ? 45 ARG A HE   1  
ATOM 769   H HH11 . ARG A 1 45 ? 1.840   4.988   12.326  1.00 0.00 ? 45 ARG A HH11 1  
ATOM 770   H HH12 . ARG A 1 45 ? 1.737   3.880   13.659  1.00 0.00 ? 45 ARG A HH12 1  
ATOM 771   H HH21 . ARG A 1 45 ? 1.428   1.022   11.675  1.00 0.00 ? 45 ARG A HH21 1  
ATOM 772   H HH22 . ARG A 1 45 ? 1.503   1.646   13.290  1.00 0.00 ? 45 ARG A HH22 1  
ATOM 773   N N    . VAL A 1 46 ? 1.531   3.961   4.920   1.00 0.00 ? 46 VAL A N    1  
ATOM 774   C CA   . VAL A 1 46 ? 2.628   3.285   4.247   1.00 0.00 ? 46 VAL A CA   1  
ATOM 775   C C    . VAL A 1 46 ? 3.734   3.093   5.279   1.00 0.00 ? 46 VAL A C    1  
ATOM 776   O O    . VAL A 1 46 ? 4.391   4.063   5.694   1.00 0.00 ? 46 VAL A O    1  
ATOM 777   C CB   . VAL A 1 46 ? 3.164   4.119   3.029   1.00 0.00 ? 46 VAL A CB   1  
ATOM 778   C CG1  . VAL A 1 46 ? 4.313   3.386   2.292   1.00 0.00 ? 46 VAL A CG1  1  
ATOM 779   C CG2  . VAL A 1 46 ? 2.014   4.488   2.065   1.00 0.00 ? 46 VAL A CG2  1  
ATOM 780   H H    . VAL A 1 46 ? 1.442   4.926   4.831   1.00 0.00 ? 46 VAL A H    1  
ATOM 781   H HA   . VAL A 1 46 ? 2.284   2.318   3.885   1.00 0.00 ? 46 VAL A HA   1  
ATOM 782   H HB   . VAL A 1 46 ? 3.570   5.052   3.419   1.00 0.00 ? 46 VAL A HB   1  
ATOM 783   H HG11 . VAL A 1 46 ? 4.671   3.991   1.468   1.00 0.00 ? 46 VAL A HG11 1  
ATOM 784   H HG12 . VAL A 1 46 ? 3.956   2.439   1.907   1.00 0.00 ? 46 VAL A HG12 1  
ATOM 785   H HG13 . VAL A 1 46 ? 5.132   3.200   2.979   1.00 0.00 ? 46 VAL A HG13 1  
ATOM 786   H HG21 . VAL A 1 46 ? 1.567   3.582   1.668   1.00 0.00 ? 46 VAL A HG21 1  
ATOM 787   H HG22 . VAL A 1 46 ? 2.395   5.086   1.247   1.00 0.00 ? 46 VAL A HG22 1  
ATOM 788   H HG23 . VAL A 1 46 ? 1.256   5.052   2.596   1.00 0.00 ? 46 VAL A HG23 1  
ATOM 789   N N    . THR A 1 47 ? 3.901   1.847   5.719   1.00 0.00 ? 47 THR A N    1  
ATOM 790   C CA   . THR A 1 47 ? 4.902   1.480   6.702   1.00 0.00 ? 47 THR A CA   1  
ATOM 791   C C    . THR A 1 47 ? 6.189   1.153   5.958   1.00 0.00 ? 47 THR A C    1  
ATOM 792   O O    . THR A 1 47 ? 6.177   0.325   5.049   1.00 0.00 ? 47 THR A O    1  
ATOM 793   C CB   . THR A 1 47 ? 4.435   0.260   7.551   1.00 0.00 ? 47 THR A CB   1  
ATOM 794   O OG1  . THR A 1 47 ? 3.178   0.573   8.169   1.00 0.00 ? 47 THR A OG1  1  
ATOM 795   C CG2  . THR A 1 47 ? 5.463   -0.160  8.631   1.00 0.00 ? 47 THR A CG2  1  
ATOM 796   H H    . THR A 1 47 ? 3.361   1.129   5.337   1.00 0.00 ? 47 THR A H    1  
ATOM 797   H HA   . THR A 1 47 ? 5.063   2.327   7.371   1.00 0.00 ? 47 THR A HA   1  
ATOM 798   H HB   . THR A 1 47 ? 4.278   -0.580  6.881   1.00 0.00 ? 47 THR A HB   1  
ATOM 799   H HG1  . THR A 1 47 ? 2.851   -0.200  8.640   1.00 0.00 ? 47 THR A HG1  1  
ATOM 800   H HG21 . THR A 1 47 ? 5.623   0.655   9.324   1.00 0.00 ? 47 THR A HG21 1  
ATOM 801   H HG22 . THR A 1 47 ? 6.402   -0.419  8.159   1.00 0.00 ? 47 THR A HG22 1  
ATOM 802   H HG23 . THR A 1 47 ? 5.091   -1.021  9.175   1.00 0.00 ? 47 THR A HG23 1  
ATOM 803   N N    . PHE A 1 48 ? 7.269   1.853   6.304   1.00 0.00 ? 48 PHE A N    1  
ATOM 804   C CA   . PHE A 1 48 ? 8.592   1.601   5.736   1.00 0.00 ? 48 PHE A CA   1  
ATOM 805   C C    . PHE A 1 48 ? 9.260   0.445   6.478   1.00 0.00 ? 48 PHE A C    1  
ATOM 806   O O    . PHE A 1 48 ? 9.018   0.247   7.685   1.00 0.00 ? 48 PHE A O    1  
ATOM 807   C CB   . PHE A 1 48 ? 9.464   2.872   5.805   1.00 0.00 ? 48 PHE A CB   1  
ATOM 808   C CG   . PHE A 1 48 ? 8.913   4.032   4.976   1.00 0.00 ? 48 PHE A CG   1  
ATOM 809   C CD1  . PHE A 1 48 ? 7.973   4.920   5.514   1.00 0.00 ? 48 PHE A CD1  1  
ATOM 810   C CD2  . PHE A 1 48 ? 9.322   4.227   3.657   1.00 0.00 ? 48 PHE A CD2  1  
ATOM 811   C CE1  . PHE A 1 48 ? 7.469   5.960   4.760   1.00 0.00 ? 48 PHE A CE1  1  
ATOM 812   C CE2  . PHE A 1 48 ? 8.813   5.268   2.908   1.00 0.00 ? 48 PHE A CE2  1  
ATOM 813   C CZ   . PHE A 1 48 ? 7.888   6.133   3.459   1.00 0.00 ? 48 PHE A CZ   1  
ATOM 814   H H    . PHE A 1 48 ? 7.167   2.554   6.980   1.00 0.00 ? 48 PHE A H    1  
ATOM 815   H HA   . PHE A 1 48 ? 8.466   1.321   4.689   1.00 0.00 ? 48 PHE A HA   1  
ATOM 816   H HB2  . PHE A 1 48 ? 9.537   3.198   6.838   1.00 0.00 ? 48 PHE A HB2  1  
ATOM 817   H HB3  . PHE A 1 48 ? 10.465  2.647   5.444   1.00 0.00 ? 48 PHE A HB3  1  
ATOM 818   H HD1  . PHE A 1 48 ? 7.639   4.789   6.537   1.00 0.00 ? 48 PHE A HD1  1  
ATOM 819   H HD2  . PHE A 1 48 ? 10.047  3.552   3.215   1.00 0.00 ? 48 PHE A HD2  1  
ATOM 820   H HE1  . PHE A 1 48 ? 6.743   6.640   5.188   1.00 0.00 ? 48 PHE A HE1  1  
ATOM 821   H HE2  . PHE A 1 48 ? 9.140   5.410   1.884   1.00 0.00 ? 48 PHE A HE2  1  
ATOM 822   H HZ   . PHE A 1 48 ? 7.489   6.949   2.864   1.00 0.00 ? 48 PHE A HZ   1  
ATOM 823   N N    . THR A 1 49 ? 10.072  -0.319  5.735   1.00 0.00 ? 49 THR A N    1  
ATOM 824   C CA   . THR A 1 49 ? 10.857  -1.432  6.276   1.00 0.00 ? 49 THR A CA   1  
ATOM 825   C C    . THR A 1 49 ? 11.817  -0.912  7.384   1.00 0.00 ? 49 THR A C    1  
ATOM 826   O O    . THR A 1 49 ? 12.555  0.054   7.130   1.00 0.00 ? 49 THR A O    1  
ATOM 827   C CB   . THR A 1 49 ? 11.650  -2.159  5.134   1.00 0.00 ? 49 THR A CB   1  
ATOM 828   O OG1  . THR A 1 49 ? 12.455  -1.227  4.410   1.00 0.00 ? 49 THR A OG1  1  
ATOM 829   C CG2  . THR A 1 49 ? 10.713  -2.876  4.145   1.00 0.00 ? 49 THR A CG2  1  
ATOM 830   H H    . THR A 1 49 ? 10.142  -0.121  4.782   1.00 0.00 ? 49 THR A H    1  
ATOM 831   H HA   . THR A 1 49 ? 10.159  -2.141  6.711   1.00 0.00 ? 49 THR A HA   1  
ATOM 832   H HB   . THR A 1 49 ? 12.304  -2.901  5.583   1.00 0.00 ? 49 THR A HB   1  
ATOM 833   H HG1  . THR A 1 49 ? 11.889  -0.619  3.926   1.00 0.00 ? 49 THR A HG1  1  
ATOM 834   H HG21 . THR A 1 49 ? 11.297  -3.375  3.386   1.00 0.00 ? 49 THR A HG21 1  
ATOM 835   H HG22 . THR A 1 49 ? 10.054  -2.156  3.673   1.00 0.00 ? 49 THR A HG22 1  
ATOM 836   H HG23 . THR A 1 49 ? 10.115  -3.611  4.673   1.00 0.00 ? 49 THR A HG23 1  
ATOM 837   N N    . PRO A 1 50 ? 11.753  -1.490  8.642   1.00 0.00 ? 50 PRO A N    1  
ATOM 838   C CA   . PRO A 1 50 ? 12.598  -1.057  9.794   1.00 0.00 ? 50 PRO A CA   1  
ATOM 839   C C    . PRO A 1 50 ? 14.109  -0.969  9.456   1.00 0.00 ? 50 PRO A C    1  
ATOM 840   O O    . PRO A 1 50 ? 14.818  -1.983  9.427   1.00 0.00 ? 50 PRO A O    1  
ATOM 841   C CB   . PRO A 1 50 ? 12.300  -2.134  10.876  1.00 0.00 ? 50 PRO A CB   1  
ATOM 842   C CG   . PRO A 1 50 ? 10.907  -2.601  10.565  1.00 0.00 ? 50 PRO A CG   1  
ATOM 843   C CD   . PRO A 1 50 ? 10.813  -2.584  9.049   1.00 0.00 ? 50 PRO A CD   1  
ATOM 844   H HA   . PRO A 1 50 ? 12.266  -0.086  10.162  1.00 0.00 ? 50 PRO A HA   1  
ATOM 845   H HB2  . PRO A 1 50 ? 13.018  -2.955  10.804  1.00 0.00 ? 50 PRO A HB2  1  
ATOM 846   H HB3  . PRO A 1 50 ? 12.339  -1.705  11.871  1.00 0.00 ? 50 PRO A HB3  1  
ATOM 847   H HG2  . PRO A 1 50 ? 10.746  -3.605  10.955  1.00 0.00 ? 50 PRO A HG2  1  
ATOM 848   H HG3  . PRO A 1 50 ? 10.173  -1.920  10.987  1.00 0.00 ? 50 PRO A HG3  1  
ATOM 849   H HD2  . PRO A 1 50 ? 11.128  -3.534  8.632   1.00 0.00 ? 50 PRO A HD2  1  
ATOM 850   H HD3  . PRO A 1 50 ? 9.799   -2.359  8.728   1.00 0.00 ? 50 PRO A HD3  1  
ATOM 851   N N    . GLY A 1 51 ? 14.559  0.258   9.143   1.00 0.00 ? 51 GLY A N    1  
ATOM 852   C CA   . GLY A 1 51 ? 15.950  0.527   8.756   1.00 0.00 ? 51 GLY A CA   1  
ATOM 853   C C    . GLY A 1 51 ? 16.048  1.689   7.779   1.00 0.00 ? 51 GLY A C    1  
ATOM 854   O O    . GLY A 1 51 ? 16.979  2.502   7.859   1.00 0.00 ? 51 GLY A O    1  
ATOM 855   H H    . GLY A 1 51 ? 13.923  1.005   9.168   1.00 0.00 ? 51 GLY A H    1  
ATOM 856   H HA2  . GLY A 1 51 ? 16.523  0.758   9.647   1.00 0.00 ? 51 GLY A HA2  1  
ATOM 857   H HA3  . GLY A 1 51 ? 16.378  -0.352  8.286   1.00 0.00 ? 51 GLY A HA3  1  
ATOM 858   N N    . LYS A 1 52 ? 15.075  1.757   6.841   1.00 0.00 ? 52 LYS A N    1  
ATOM 859   C CA   . LYS A 1 52 ? 15.019  2.806   5.796   1.00 0.00 ? 52 LYS A CA   1  
ATOM 860   C C    . LYS A 1 52 ? 14.732  4.187   6.412   1.00 0.00 ? 52 LYS A C    1  
ATOM 861   O O    . LYS A 1 52 ? 15.499  5.141   6.215   1.00 0.00 ? 52 LYS A O    1  
ATOM 862   C CB   . LYS A 1 52 ? 13.943  2.450   4.723   1.00 0.00 ? 52 LYS A CB   1  
ATOM 863   C CG   . LYS A 1 52 ? 14.275  1.196   3.885   1.00 0.00 ? 52 LYS A CG   1  
ATOM 864   C CD   . LYS A 1 52 ? 15.611  1.323   3.114   1.00 0.00 ? 52 LYS A CD   1  
ATOM 865   C CE   . LYS A 1 52 ? 15.963  0.064   2.313   1.00 0.00 ? 52 LYS A CE   1  
ATOM 866   N NZ   . LYS A 1 52 ? 17.270  0.205   1.620   1.00 0.00 ? 52 LYS A NZ   1  
ATOM 867   H H    . LYS A 1 52 ? 14.375  1.071   6.849   1.00 0.00 ? 52 LYS A H    1  
ATOM 868   H HA   . LYS A 1 52 ? 15.993  2.837   5.315   1.00 0.00 ? 52 LYS A HA   1  
ATOM 869   H HB2  . LYS A 1 52 ? 12.993  2.280   5.223   1.00 0.00 ? 52 LYS A HB2  1  
ATOM 870   H HB3  . LYS A 1 52 ? 13.824  3.289   4.042   1.00 0.00 ? 52 LYS A HB3  1  
ATOM 871   H HG2  . LYS A 1 52 ? 14.333  0.343   4.552   1.00 0.00 ? 52 LYS A HG2  1  
ATOM 872   H HG3  . LYS A 1 52 ? 13.471  1.028   3.173   1.00 0.00 ? 52 LYS A HG3  1  
ATOM 873   H HD2  . LYS A 1 52 ? 15.545  2.157   2.428   1.00 0.00 ? 52 LYS A HD2  1  
ATOM 874   H HD3  . LYS A 1 52 ? 16.407  1.513   3.826   1.00 0.00 ? 52 LYS A HD3  1  
ATOM 875   H HE2  . LYS A 1 52 ? 16.017  -0.781  2.984   1.00 0.00 ? 52 LYS A HE2  1  
ATOM 876   H HE3  . LYS A 1 52 ? 15.195  -0.114  1.572   1.00 0.00 ? 52 LYS A HE3  1  
ATOM 877   H HZ1  . LYS A 1 52 ? 17.238  1.004   0.955   1.00 0.00 ? 52 LYS A HZ1  1  
ATOM 878   H HZ2  . LYS A 1 52 ? 17.493  -0.660  1.089   1.00 0.00 ? 52 LYS A HZ2  1  
ATOM 879   H HZ3  . LYS A 1 52 ? 18.029  0.377   2.309   1.00 0.00 ? 52 LYS A HZ3  1  
ATOM 880   N N    . THR A 1 53 ? 13.612  4.284   7.145   1.00 0.00 ? 53 THR A N    1  
ATOM 881   C CA   . THR A 1 53 ? 13.217  5.508   7.872   1.00 0.00 ? 53 THR A CA   1  
ATOM 882   C C    . THR A 1 53 ? 12.820  5.129   9.311   1.00 0.00 ? 53 THR A C    1  
ATOM 883   O O    . THR A 1 53 ? 12.120  4.126   9.495   1.00 0.00 ? 53 THR A O    1  
ATOM 884   C CB   . THR A 1 53 ? 12.009  6.249   7.180   1.00 0.00 ? 53 THR A CB   1  
ATOM 885   O OG1  . THR A 1 53 ? 10.844  5.410   7.166   1.00 0.00 ? 53 THR A OG1  1  
ATOM 886   C CG2  . THR A 1 53 ? 12.330  6.686   5.731   1.00 0.00 ? 53 THR A CG2  1  
ATOM 887   H H    . THR A 1 53 ? 13.025  3.501   7.210   1.00 0.00 ? 53 THR A H    1  
ATOM 888   H HA   . THR A 1 53 ? 14.066  6.188   7.902   1.00 0.00 ? 53 THR A HA   1  
ATOM 889   H HB   . THR A 1 53 ? 11.778  7.140   7.758   1.00 0.00 ? 53 THR A HB   1  
ATOM 890   H HG1  . THR A 1 53 ? 10.718  5.012   8.032   1.00 0.00 ? 53 THR A HG1  1  
ATOM 891   H HG21 . THR A 1 53 ? 11.475  7.197   5.303   1.00 0.00 ? 53 THR A HG21 1  
ATOM 892   H HG22 . THR A 1 53 ? 12.566  5.818   5.132   1.00 0.00 ? 53 THR A HG22 1  
ATOM 893   H HG23 . THR A 1 53 ? 13.179  7.359   5.733   1.00 0.00 ? 53 THR A HG23 1  
ATOM 894   N N    . PRO A 1 54 ? 13.272  5.889   10.357  1.00 0.00 ? 54 PRO A N    1  
ATOM 895   C CA   . PRO A 1 54 ? 12.777  5.714   11.748  1.00 0.00 ? 54 PRO A CA   1  
ATOM 896   C C    . PRO A 1 54 ? 11.326  6.228   11.920  1.00 0.00 ? 54 PRO A C    1  
ATOM 897   O O    . PRO A 1 54 ? 10.653  6.568   10.936  1.00 0.00 ? 54 PRO A O    1  
ATOM 898   C CB   . PRO A 1 54 ? 13.792  6.554   12.580  1.00 0.00 ? 54 PRO A CB   1  
ATOM 899   C CG   . PRO A 1 54 ? 14.260  7.615   11.636  1.00 0.00 ? 54 PRO A CG   1  
ATOM 900   C CD   . PRO A 1 54 ? 14.326  6.944   10.279  1.00 0.00 ? 54 PRO A CD   1  
ATOM 901   H HA   . PRO A 1 54 ? 12.820  4.672   12.057  1.00 0.00 ? 54 PRO A HA   1  
ATOM 902   H HB2  . PRO A 1 54 ? 13.310  6.983   13.460  1.00 0.00 ? 54 PRO A HB2  1  
ATOM 903   H HB3  . PRO A 1 54 ? 14.627  5.937   12.890  1.00 0.00 ? 54 PRO A HB3  1  
ATOM 904   H HG2  . PRO A 1 54 ? 13.550  8.443   11.627  1.00 0.00 ? 54 PRO A HG2  1  
ATOM 905   H HG3  . PRO A 1 54 ? 15.242  7.979   11.923  1.00 0.00 ? 54 PRO A HG3  1  
ATOM 906   H HD2  . PRO A 1 54 ? 14.102  7.653   9.490   1.00 0.00 ? 54 PRO A HD2  1  
ATOM 907   H HD3  . PRO A 1 54 ? 15.304  6.498   10.115  1.00 0.00 ? 54 PRO A HD3  1  
ATOM 908   N N    . VAL A 1 55 ? 10.860  6.280   13.180  1.00 0.00 ? 55 VAL A N    1  
ATOM 909   C CA   . VAL A 1 55 ? 9.562   6.902   13.540  1.00 0.00 ? 55 VAL A CA   1  
ATOM 910   C C    . VAL A 1 55 ? 9.626   8.416   13.228  1.00 0.00 ? 55 VAL A C    1  
ATOM 911   O O    . VAL A 1 55 ? 8.694   9.002   12.660  1.00 0.00 ? 55 VAL A O    1  
ATOM 912   C CB   . VAL A 1 55 ? 9.204   6.672   15.066  1.00 0.00 ? 55 VAL A CB   1  
ATOM 913   C CG1  . VAL A 1 55 ? 7.832   7.300   15.442  1.00 0.00 ? 55 VAL A CG1  1  
ATOM 914   C CG2  . VAL A 1 55 ? 9.249   5.161   15.426  1.00 0.00 ? 55 VAL A CG2  1  
ATOM 915   H H    . VAL A 1 55 ? 11.404  5.890   13.893  1.00 0.00 ? 55 VAL A H    1  
ATOM 916   H HA   . VAL A 1 55 ? 8.789   6.443   12.932  1.00 0.00 ? 55 VAL A HA   1  
ATOM 917   H HB   . VAL A 1 55 ? 9.963   7.172   15.664  1.00 0.00 ? 55 VAL A HB   1  
ATOM 918   H HG11 . VAL A 1 55 ? 7.045   6.837   14.860  1.00 0.00 ? 55 VAL A HG11 1  
ATOM 919   H HG12 . VAL A 1 55 ? 7.846   8.363   15.235  1.00 0.00 ? 55 VAL A HG12 1  
ATOM 920   H HG13 . VAL A 1 55 ? 7.629   7.149   16.497  1.00 0.00 ? 55 VAL A HG13 1  
ATOM 921   H HG21 . VAL A 1 55 ? 10.234  4.762   15.203  1.00 0.00 ? 55 VAL A HG21 1  
ATOM 922   H HG22 . VAL A 1 55 ? 8.509   4.623   14.848  1.00 0.00 ? 55 VAL A HG22 1  
ATOM 923   H HG23 . VAL A 1 55 ? 9.046   5.024   16.481  1.00 0.00 ? 55 VAL A HG23 1  
ATOM 924   N N    . ASP A 1 56 ? 10.788  9.013   13.573  1.00 0.00 ? 56 ASP A N    1  
ATOM 925   C CA   . ASP A 1 56 ? 11.119  10.423  13.282  1.00 0.00 ? 56 ASP A CA   1  
ATOM 926   C C    . ASP A 1 56 ? 11.378  10.642  11.763  1.00 0.00 ? 56 ASP A C    1  
ATOM 927   O O    . ASP A 1 56 ? 11.373  11.779  11.284  1.00 0.00 ? 56 ASP A O    1  
ATOM 928   C CB   . ASP A 1 56 ? 12.353  10.861  14.127  1.00 0.00 ? 56 ASP A CB   1  
ATOM 929   C CG   . ASP A 1 56 ? 12.772  12.330  13.896  1.00 0.00 ? 56 ASP A CG   1  
ATOM 930   O OD1  . ASP A 1 56 ? 11.911  13.226  14.038  1.00 0.00 ? 56 ASP A OD1  1  
ATOM 931   O OD2  . ASP A 1 56 ? 13.959  12.601  13.589  1.00 0.00 ? 56 ASP A OD2  1  
ATOM 932   H H    . ASP A 1 56 ? 11.452  8.477   14.052  1.00 0.00 ? 56 ASP A H    1  
ATOM 933   H HA   . ASP A 1 56 ? 10.264  11.026  13.579  1.00 0.00 ? 56 ASP A HA   1  
ATOM 934   H HB2  . ASP A 1 56 ? 12.120  10.737  15.183  1.00 0.00 ? 56 ASP A HB2  1  
ATOM 935   H HB3  . ASP A 1 56 ? 13.191  10.215  13.888  1.00 0.00 ? 56 ASP A HB3  1  
ATOM 936   N N    . GLY A 1 57 ? 11.577  9.535   11.015  1.00 0.00 ? 57 GLY A N    1  
ATOM 937   C CA   . GLY A 1 57 ? 11.729  9.574   9.552   1.00 0.00 ? 57 GLY A CA   1  
ATOM 938   C C    . GLY A 1 57 ? 10.458  10.012  8.838   1.00 0.00 ? 57 GLY A C    1  
ATOM 939   O O    . GLY A 1 57 ? 10.488  10.302  7.632   1.00 0.00 ? 57 GLY A O    1  
ATOM 940   H H    . GLY A 1 57 ? 11.612  8.671   11.465  1.00 0.00 ? 57 GLY A H    1  
ATOM 941   H HA2  . GLY A 1 57 ? 12.534  10.249  9.292   1.00 0.00 ? 57 GLY A HA2  1  
ATOM 942   H HA3  . GLY A 1 57 ? 11.989  8.582   9.214   1.00 0.00 ? 57 GLY A HA3  1  
ATOM 943   N N    . GLN A 1 58 ? 9.340   10.031  9.607   1.00 0.00 ? 58 GLN A N    1  
ATOM 944   C CA   . GLN A 1 58 ? 8.041   10.568  9.190   1.00 0.00 ? 58 GLN A CA   1  
ATOM 945   C C    . GLN A 1 58 ? 7.428   9.719   8.069   1.00 0.00 ? 58 GLN A C    1  
ATOM 946   O O    . GLN A 1 58 ? 7.740   9.901   6.884   1.00 0.00 ? 58 GLN A O    1  
ATOM 947   C CB   . GLN A 1 58 ? 8.132   12.078  8.803   1.00 0.00 ? 58 GLN A CB   1  
ATOM 948   C CG   . GLN A 1 58 ? 8.593   13.011  9.946   1.00 0.00 ? 58 GLN A CG   1  
ATOM 949   C CD   . GLN A 1 58 ? 7.704   12.961  11.201  1.00 0.00 ? 58 GLN A CD   1  
ATOM 950   O OE1  . GLN A 1 58 ? 6.492   12.747  11.124  1.00 0.00 ? 58 GLN A OE1  1  
ATOM 951   N NE2  . GLN A 1 58 ? 8.300   13.144  12.371  1.00 0.00 ? 58 GLN A NE2  1  
ATOM 952   H H    . GLN A 1 58 ? 9.399   9.650   10.511  1.00 0.00 ? 58 GLN A H    1  
ATOM 953   H HA   . GLN A 1 58 ? 7.394   10.485  10.057  1.00 0.00 ? 58 GLN A HA   1  
ATOM 954   H HB2  . GLN A 1 58 ? 8.834   12.178  7.983   1.00 0.00 ? 58 GLN A HB2  1  
ATOM 955   H HB3  . GLN A 1 58 ? 7.160   12.411  8.464   1.00 0.00 ? 58 GLN A HB3  1  
ATOM 956   H HG2  . GLN A 1 58 ? 9.600   12.739  10.231  1.00 0.00 ? 58 GLN A HG2  1  
ATOM 957   H HG3  . GLN A 1 58 ? 8.600   14.034  9.581   1.00 0.00 ? 58 GLN A HG3  1  
ATOM 958   H HE21 . GLN A 1 58 ? 9.267   13.306  12.383  1.00 0.00 ? 58 GLN A HE21 1  
ATOM 959   H HE22 . GLN A 1 58 ? 7.746   13.111  13.177  1.00 0.00 ? 58 GLN A HE22 1  
ATOM 960   N N    . TYR A 1 59 ? 6.580   8.766   8.480   1.00 0.00 ? 59 TYR A N    1  
ATOM 961   C CA   . TYR A 1 59 ? 5.853   7.876   7.570   1.00 0.00 ? 59 TYR A CA   1  
ATOM 962   C C    . TYR A 1 59 ? 4.859   8.659   6.710   1.00 0.00 ? 59 TYR A C    1  
ATOM 963   O O    . TYR A 1 59 ? 4.434   9.761   7.066   1.00 0.00 ? 59 TYR A O    1  
ATOM 964   C CB   . TYR A 1 59 ? 5.130   6.765   8.380   1.00 0.00 ? 59 TYR A CB   1  
ATOM 965   C CG   . TYR A 1 59 ? 6.047   5.631   8.880   1.00 0.00 ? 59 TYR A CG   1  
ATOM 966   C CD1  . TYR A 1 59 ? 7.407   5.836   9.171   1.00 0.00 ? 59 TYR A CD1  1  
ATOM 967   C CD2  . TYR A 1 59 ? 5.545   4.340   9.038   1.00 0.00 ? 59 TYR A CD2  1  
ATOM 968   C CE1  . TYR A 1 59 ? 8.212   4.797   9.598   1.00 0.00 ? 59 TYR A CE1  1  
ATOM 969   C CE2  . TYR A 1 59 ? 6.351   3.306   9.463   1.00 0.00 ? 59 TYR A CE2  1  
ATOM 970   C CZ   . TYR A 1 59 ? 7.678   3.537   9.739   1.00 0.00 ? 59 TYR A CZ   1  
ATOM 971   O OH   . TYR A 1 59 ? 8.478   2.492   10.159  1.00 0.00 ? 59 TYR A OH   1  
ATOM 972   H H    . TYR A 1 59 ? 6.431   8.660   9.440   1.00 0.00 ? 59 TYR A H    1  
ATOM 973   H HA   . TYR A 1 59 ? 6.586   7.412   6.914   1.00 0.00 ? 59 TYR A HA   1  
ATOM 974   H HB2  . TYR A 1 59 ? 4.655   7.208   9.250   1.00 0.00 ? 59 TYR A HB2  1  
ATOM 975   H HB3  . TYR A 1 59 ? 4.359   6.316   7.760   1.00 0.00 ? 59 TYR A HB3  1  
ATOM 976   H HD1  . TYR A 1 59 ? 7.826   6.826   9.063   1.00 0.00 ? 59 TYR A HD1  1  
ATOM 977   H HD2  . TYR A 1 59 ? 4.502   4.148   8.822   1.00 0.00 ? 59 TYR A HD2  1  
ATOM 978   H HE1  . TYR A 1 59 ? 9.262   4.974   9.812   1.00 0.00 ? 59 TYR A HE1  1  
ATOM 979   H HE2  . TYR A 1 59 ? 5.936   2.313   9.573   1.00 0.00 ? 59 TYR A HE2  1  
ATOM 980   H HH   . TYR A 1 59 ? 8.319   1.721   9.600   1.00 0.00 ? 59 TYR A HH   1  
ATOM 981   N N    . VAL A 1 60 ? 4.504   8.075   5.573   1.00 0.00 ? 60 VAL A N    1  
ATOM 982   C CA   . VAL A 1 60 ? 3.550   8.668   4.631   1.00 0.00 ? 60 VAL A CA   1  
ATOM 983   C C    . VAL A 1 60 ? 2.251   7.853   4.643   1.00 0.00 ? 60 VAL A C    1  
ATOM 984   O O    . VAL A 1 60 ? 2.220   6.741   5.180   1.00 0.00 ? 60 VAL A O    1  
ATOM 985   C CB   . VAL A 1 60 ? 4.169   8.771   3.188   1.00 0.00 ? 60 VAL A CB   1  
ATOM 986   C CG1  . VAL A 1 60 ? 5.396   9.714   3.189   1.00 0.00 ? 60 VAL A CG1  1  
ATOM 987   C CG2  . VAL A 1 60 ? 4.547   7.386   2.618   1.00 0.00 ? 60 VAL A CG2  1  
ATOM 988   H H    . VAL A 1 60 ? 4.883   7.197   5.360   1.00 0.00 ? 60 VAL A H    1  
ATOM 989   H HA   . VAL A 1 60 ? 3.312   9.678   4.969   1.00 0.00 ? 60 VAL A HA   1  
ATOM 990   H HB   . VAL A 1 60 ? 3.418   9.209   2.534   1.00 0.00 ? 60 VAL A HB   1  
ATOM 991   H HG11 . VAL A 1 60 ? 6.159   9.329   3.857   1.00 0.00 ? 60 VAL A HG11 1  
ATOM 992   H HG12 . VAL A 1 60 ? 5.098   10.701  3.522   1.00 0.00 ? 60 VAL A HG12 1  
ATOM 993   H HG13 . VAL A 1 60 ? 5.801   9.787   2.188   1.00 0.00 ? 60 VAL A HG13 1  
ATOM 994   H HG21 . VAL A 1 60 ? 4.980   7.497   1.630   1.00 0.00 ? 60 VAL A HG21 1  
ATOM 995   H HG22 . VAL A 1 60 ? 3.658   6.771   2.545   1.00 0.00 ? 60 VAL A HG22 1  
ATOM 996   H HG23 . VAL A 1 60 ? 5.261   6.899   3.269   1.00 0.00 ? 60 VAL A HG23 1  
ATOM 997   N N    . TRP A 1 61 ? 1.182   8.432   4.089   1.00 0.00 ? 61 TRP A N    1  
ATOM 998   C CA   . TRP A 1 61 ? -0.169  7.846   4.139   1.00 0.00 ? 61 TRP A CA   1  
ATOM 999   C C    . TRP A 1 61 ? -1.026  8.402   2.993   1.00 0.00 ? 61 TRP A C    1  
ATOM 1000  O O    . TRP A 1 61 ? -0.681  9.416   2.393   1.00 0.00 ? 61 TRP A O    1  
ATOM 1001  C CB   . TRP A 1 61 ? -0.842  8.158   5.510   1.00 0.00 ? 61 TRP A CB   1  
ATOM 1002  C CG   . TRP A 1 61 ? -1.093  9.637   5.754   1.00 0.00 ? 61 TRP A CG   1  
ATOM 1003  C CD1  . TRP A 1 61 ? -0.211  10.556  6.236   1.00 0.00 ? 61 TRP A CD1  1  
ATOM 1004  C CD2  . TRP A 1 61 ? -2.311  10.354  5.522   1.00 0.00 ? 61 TRP A CD2  1  
ATOM 1005  N NE1  . TRP A 1 61 ? -0.799  11.794  6.307   1.00 0.00 ? 61 TRP A NE1  1  
ATOM 1006  C CE2  . TRP A 1 61 ? -2.087  11.694  5.877   1.00 0.00 ? 61 TRP A CE2  1  
ATOM 1007  C CE3  . TRP A 1 61 ? -3.561  9.986   5.048   1.00 0.00 ? 61 TRP A CE3  1  
ATOM 1008  C CZ2  . TRP A 1 61 ? -3.073  12.664  5.766   1.00 0.00 ? 61 TRP A CZ2  1  
ATOM 1009  C CZ3  . TRP A 1 61 ? -4.537  10.943  4.940   1.00 0.00 ? 61 TRP A CZ3  1  
ATOM 1010  C CH2  . TRP A 1 61 ? -4.293  12.271  5.293   1.00 0.00 ? 61 TRP A CH2  1  
ATOM 1011  H H    . TRP A 1 61 ? 1.300   9.289   3.625   1.00 0.00 ? 61 TRP A H    1  
ATOM 1012  H HA   . TRP A 1 61 ? -0.083  6.769   4.016   1.00 0.00 ? 61 TRP A HA   1  
ATOM 1013  H HB2  . TRP A 1 61 ? -1.795  7.642   5.569   1.00 0.00 ? 61 TRP A HB2  1  
ATOM 1014  H HB3  . TRP A 1 61 ? -0.204  7.791   6.308   1.00 0.00 ? 61 TRP A HB3  1  
ATOM 1015  H HD1  . TRP A 1 61 ? 0.808   10.331  6.513   1.00 0.00 ? 61 TRP A HD1  1  
ATOM 1016  H HE1  . TRP A 1 61 ? -0.364  12.618  6.614   1.00 0.00 ? 61 TRP A HE1  1  
ATOM 1017  H HE3  . TRP A 1 61 ? -3.773  8.963   4.769   1.00 0.00 ? 61 TRP A HE3  1  
ATOM 1018  H HZ2  . TRP A 1 61 ? -2.893  13.695  6.037   1.00 0.00 ? 61 TRP A HZ2  1  
ATOM 1019  H HZ3  . TRP A 1 61 ? -5.513  10.670  4.571   1.00 0.00 ? 61 TRP A HZ3  1  
ATOM 1020  H HH2  . TRP A 1 61 ? -5.093  12.990  5.189   1.00 0.00 ? 61 TRP A HH2  1  
ATOM 1021  N N    . PHE A 1 62 ? -2.165  7.745   2.737   1.00 0.00 ? 62 PHE A N    1  
ATOM 1022  C CA   . PHE A 1 62 ? -3.147  8.183   1.729   1.00 0.00 ? 62 PHE A CA   1  
ATOM 1023  C C    . PHE A 1 62 ? -4.564  7.768   2.161   1.00 0.00 ? 62 PHE A C    1  
ATOM 1024  O O    . PHE A 1 62 ? -4.755  6.672   2.706   1.00 0.00 ? 62 PHE A O    1  
ATOM 1025  C CB   . PHE A 1 62 ? -2.794  7.612   0.316   1.00 0.00 ? 62 PHE A CB   1  
ATOM 1026  C CG   . PHE A 1 62 ? -2.583  6.095   0.255   1.00 0.00 ? 62 PHE A CG   1  
ATOM 1027  C CD1  . PHE A 1 62 ? -1.322  5.539   0.488   1.00 0.00 ? 62 PHE A CD1  1  
ATOM 1028  C CD2  . PHE A 1 62 ? -3.641  5.225   -0.024  1.00 0.00 ? 62 PHE A CD2  1  
ATOM 1029  C CE1  . PHE A 1 62 ? -1.129  4.171   0.444   1.00 0.00 ? 62 PHE A CE1  1  
ATOM 1030  C CE2  . PHE A 1 62 ? -3.440  3.860   -0.063  1.00 0.00 ? 62 PHE A CE2  1  
ATOM 1031  C CZ   . PHE A 1 62 ? -2.186  3.334   0.170   1.00 0.00 ? 62 PHE A CZ   1  
ATOM 1032  H H    . PHE A 1 62 ? -2.349  6.920   3.239   1.00 0.00 ? 62 PHE A H    1  
ATOM 1033  H HA   . PHE A 1 62 ? -3.111  9.274   1.685   1.00 0.00 ? 62 PHE A HA   1  
ATOM 1034  H HB2  . PHE A 1 62 ? -3.589  7.869   -0.376  1.00 0.00 ? 62 PHE A HB2  1  
ATOM 1035  H HB3  . PHE A 1 62 ? -1.883  8.091   -0.029  1.00 0.00 ? 62 PHE A HB3  1  
ATOM 1036  H HD1  . PHE A 1 62 ? -0.483  6.190   0.705   1.00 0.00 ? 62 PHE A HD1  1  
ATOM 1037  H HD2  . PHE A 1 62 ? -4.630  5.626   -0.210  1.00 0.00 ? 62 PHE A HD2  1  
ATOM 1038  H HE1  . PHE A 1 62 ? -0.144  3.753   0.625   1.00 0.00 ? 62 PHE A HE1  1  
ATOM 1039  H HE2  . PHE A 1 62 ? -4.269  3.197   -0.283  1.00 0.00 ? 62 PHE A HE2  1  
ATOM 1040  H HZ   . PHE A 1 62 ? -2.033  2.260   0.138   1.00 0.00 ? 62 PHE A HZ   1  
ATOM 1041  N N    . ASN A 1 63 ? -5.548  8.648   1.897   1.00 0.00 ? 63 ASN A N    1  
ATOM 1042  C CA   . ASN A 1 63 ? -6.972  8.379   2.166   1.00 0.00 ? 63 ASN A CA   1  
ATOM 1043  C C    . ASN A 1 63 ? -7.498  7.421   1.109   1.00 0.00 ? 63 ASN A C    1  
ATOM 1044  O O    . ASN A 1 63 ? -7.146  7.536   -0.071  1.00 0.00 ? 63 ASN A O    1  
ATOM 1045  C CB   . ASN A 1 63 ? -7.835  9.680   2.162   1.00 0.00 ? 63 ASN A CB   1  
ATOM 1046  C CG   . ASN A 1 63 ? -7.726  10.494  3.448   1.00 0.00 ? 63 ASN A CG   1  
ATOM 1047  O OD1  . ASN A 1 63 ? -7.553  9.944   4.535   1.00 0.00 ? 63 ASN A OD1  1  
ATOM 1048  N ND2  . ASN A 1 63 ? -7.856  11.805  3.347   1.00 0.00 ? 63 ASN A ND2  1  
ATOM 1049  H H    . ASN A 1 63 ? -5.307  9.472   1.440   1.00 0.00 ? 63 ASN A H    1  
ATOM 1050  H HA   . ASN A 1 63 ? -7.043  7.900   3.144   1.00 0.00 ? 63 ASN A HA   1  
ATOM 1051  H HB2  . ASN A 1 63 ? -7.526  10.309  1.332   1.00 0.00 ? 63 ASN A HB2  1  
ATOM 1052  H HB3  . ASN A 1 63 ? -8.880  9.421   2.026   1.00 0.00 ? 63 ASN A HB3  1  
ATOM 1053  H HD21 . ASN A 1 63 ? -8.012  12.189  2.456   1.00 0.00 ? 63 ASN A HD21 1  
ATOM 1054  H HD22 . ASN A 1 63 ? -7.791  12.340  4.160   1.00 0.00 ? 63 ASN A HD22 1  
ATOM 1055  N N    . ILE A 1 64 ? -8.331  6.477   1.538   1.00 0.00 ? 64 ILE A N    1  
ATOM 1056  C CA   . ILE A 1 64 ? -8.953  5.499   0.642   1.00 0.00 ? 64 ILE A CA   1  
ATOM 1057  C C    . ILE A 1 64 ? -10.472 5.698   0.614   1.00 0.00 ? 64 ILE A C    1  
ATOM 1058  O O    . ILE A 1 64 ? -11.067 5.718   -0.470  1.00 0.00 ? 64 ILE A O    1  
ATOM 1059  C CB   . ILE A 1 64 ? -8.580  4.024   1.046   1.00 0.00 ? 64 ILE A CB   1  
ATOM 1060  C CG1  . ILE A 1 64 ? -8.962  3.719   2.534   1.00 0.00 ? 64 ILE A CG1  1  
ATOM 1061  C CG2  . ILE A 1 64 ? -7.074  3.770   0.788   1.00 0.00 ? 64 ILE A CG2  1  
ATOM 1062  C CD1  . ILE A 1 64 ? -8.697  2.297   2.982   1.00 0.00 ? 64 ILE A CD1  1  
ATOM 1063  H H    . ILE A 1 64 ? -8.547  6.444   2.491   1.00 0.00 ? 64 ILE A H    1  
ATOM 1064  H HA   . ILE A 1 64 ? -8.574  5.669   -0.373  1.00 0.00 ? 64 ILE A HA   1  
ATOM 1065  H HB   . ILE A 1 64 ? -9.136  3.348   0.398   1.00 0.00 ? 64 ILE A HB   1  
ATOM 1066  H HG12 . ILE A 1 64 ? -8.406  4.375   3.190   1.00 0.00 ? 64 ILE A HG12 1  
ATOM 1067  H HG13 . ILE A 1 64 ? -10.020 3.909   2.670   1.00 0.00 ? 64 ILE A HG13 1  
ATOM 1068  H HG21 . ILE A 1 64 ? -6.844  3.950   -0.255  1.00 0.00 ? 64 ILE A HG21 1  
ATOM 1069  H HG22 . ILE A 1 64 ? -6.826  2.743   1.031   1.00 0.00 ? 64 ILE A HG22 1  
ATOM 1070  H HG23 . ILE A 1 64 ? -6.480  4.433   1.404   1.00 0.00 ? 64 ILE A HG23 1  
ATOM 1071  H HD11 . ILE A 1 64 ? -7.637  2.093   2.947   1.00 0.00 ? 64 ILE A HD11 1  
ATOM 1072  H HD12 . ILE A 1 64 ? -9.217  1.612   2.331   1.00 0.00 ? 64 ILE A HD12 1  
ATOM 1073  H HD13 . ILE A 1 64 ? -9.054  2.171   3.991   1.00 0.00 ? 64 ILE A HD13 1  
ATOM 1074  N N    . GLY A 1 65 ? -11.081 5.901   1.804   1.00 0.00 ? 65 GLY A N    1  
ATOM 1075  C CA   . GLY A 1 65 ? -12.537 5.922   1.944   1.00 0.00 ? 65 GLY A CA   1  
ATOM 1076  C C    . GLY A 1 65 ? -13.146 4.541   1.727   1.00 0.00 ? 65 GLY A C    1  
ATOM 1077  O O    . GLY A 1 65 ? -13.542 3.871   2.687   1.00 0.00 ? 65 GLY A O    1  
ATOM 1078  H H    . GLY A 1 65 ? -10.526 6.047   2.603   1.00 0.00 ? 65 GLY A H    1  
ATOM 1079  H HA2  . GLY A 1 65 ? -12.778 6.266   2.939   1.00 0.00 ? 65 GLY A HA2  1  
ATOM 1080  H HA3  . GLY A 1 65 ? -12.960 6.617   1.225   1.00 0.00 ? 65 GLY A HA3  1  
ATOM 1081  N N    . SER A 1 66 ? -13.194 4.121   0.454   1.00 0.00 ? 66 SER A N    1  
ATOM 1082  C CA   . SER A 1 66 ? -13.625 2.788   0.039   1.00 0.00 ? 66 SER A CA   1  
ATOM 1083  C C    . SER A 1 66 ? -12.462 1.793   0.232   1.00 0.00 ? 66 SER A C    1  
ATOM 1084  O O    . SER A 1 66 ? -11.540 1.743   -0.593  1.00 0.00 ? 66 SER A O    1  
ATOM 1085  C CB   . SER A 1 66 ? -14.069 2.848   -1.435  1.00 0.00 ? 66 SER A CB   1  
ATOM 1086  O OG   . SER A 1 66 ? -15.002 3.895   -1.642  1.00 0.00 ? 66 SER A OG   1  
ATOM 1087  H H    . SER A 1 66 ? -12.922 4.749   -0.247  1.00 0.00 ? 66 SER A H    1  
ATOM 1088  H HA   . SER A 1 66 ? -14.472 2.483   0.655   1.00 0.00 ? 66 SER A HA   1  
ATOM 1089  H HB2  . SER A 1 66 ? -13.209 3.039   -2.067  1.00 0.00 ? 66 SER A HB2  1  
ATOM 1090  H HB3  . SER A 1 66 ? -14.526 1.912   -1.727  1.00 0.00 ? 66 SER A HB3  1  
ATOM 1091  H HG   . SER A 1 66 ? -15.423 3.778   -2.502  1.00 0.00 ? 66 SER A HG   1  
ATOM 1092  N N    . VAL A 1 67 ? -12.489 1.071   1.371   1.00 0.00 ? 67 VAL A N    1  
ATOM 1093  C CA   . VAL A 1 67 ? -11.471 0.051   1.727   1.00 0.00 ? 67 VAL A CA   1  
ATOM 1094  C C    . VAL A 1 67 ? -11.409 -1.065  0.662   1.00 0.00 ? 67 VAL A C    1  
ATOM 1095  O O    . VAL A 1 67 ? -10.327 -1.544  0.318   1.00 0.00 ? 67 VAL A O    1  
ATOM 1096  C CB   . VAL A 1 67 ? -11.730 -0.584  3.154   1.00 0.00 ? 67 VAL A CB   1  
ATOM 1097  C CG1  . VAL A 1 67 ? -10.582 -1.549  3.576   1.00 0.00 ? 67 VAL A CG1  1  
ATOM 1098  C CG2  . VAL A 1 67 ? -11.945 0.513   4.224   1.00 0.00 ? 67 VAL A CG2  1  
ATOM 1099  H H    . VAL A 1 67 ? -13.205 1.266   2.006   1.00 0.00 ? 67 VAL A H    1  
ATOM 1100  H HA   . VAL A 1 67 ? -10.511 0.559   1.756   1.00 0.00 ? 67 VAL A HA   1  
ATOM 1101  H HB   . VAL A 1 67 ? -12.644 -1.170  3.094   1.00 0.00 ? 67 VAL A HB   1  
ATOM 1102  H HG11 . VAL A 1 67 ? -10.790 -1.968  4.553   1.00 0.00 ? 67 VAL A HG11 1  
ATOM 1103  H HG12 . VAL A 1 67 ? -9.644  -1.009  3.613   1.00 0.00 ? 67 VAL A HG12 1  
ATOM 1104  H HG13 . VAL A 1 67 ? -10.497 -2.355  2.854   1.00 0.00 ? 67 VAL A HG13 1  
ATOM 1105  H HG21 . VAL A 1 67 ? -11.059 1.129   4.301   1.00 0.00 ? 67 VAL A HG21 1  
ATOM 1106  H HG22 . VAL A 1 67 ? -12.148 0.054   5.187   1.00 0.00 ? 67 VAL A HG22 1  
ATOM 1107  H HG23 . VAL A 1 67 ? -12.788 1.136   3.947   1.00 0.00 ? 67 VAL A HG23 1  
ATOM 1108  N N    . ASP A 1 68 ? -12.592 -1.429  0.124   1.00 0.00 ? 68 ASP A N    1  
ATOM 1109  C CA   . ASP A 1 68 ? -12.751 -2.441  -0.934  1.00 0.00 ? 68 ASP A CA   1  
ATOM 1110  C C    . ASP A 1 68 ? -11.940 -2.058  -2.182  1.00 0.00 ? 68 ASP A C    1  
ATOM 1111  O O    . ASP A 1 68 ? -11.161 -2.865  -2.685  1.00 0.00 ? 68 ASP A O    1  
ATOM 1112  C CB   . ASP A 1 68 ? -14.258 -2.587  -1.287  1.00 0.00 ? 68 ASP A CB   1  
ATOM 1113  C CG   . ASP A 1 68 ? -14.524 -3.496  -2.502  1.00 0.00 ? 68 ASP A CG   1  
ATOM 1114  O OD1  . ASP A 1 68 ? -14.429 -4.731  -2.359  1.00 0.00 ? 68 ASP A OD1  1  
ATOM 1115  O OD2  . ASP A 1 68 ? -14.857 -2.985  -3.592  1.00 0.00 ? 68 ASP A OD2  1  
ATOM 1116  H H    . ASP A 1 68 ? -13.405 -0.989  0.435   1.00 0.00 ? 68 ASP A H    1  
ATOM 1117  H HA   . ASP A 1 68 ? -12.388 -3.392  -0.550  1.00 0.00 ? 68 ASP A HA   1  
ATOM 1118  H HB2  . ASP A 1 68 ? -14.777 -3.007  -0.428  1.00 0.00 ? 68 ASP A HB2  1  
ATOM 1119  H HB3  . ASP A 1 68 ? -14.678 -1.601  -1.482  1.00 0.00 ? 68 ASP A HB3  1  
ATOM 1120  N N    . THR A 1 69 ? -12.117 -0.796  -2.631  1.00 0.00 ? 69 THR A N    1  
ATOM 1121  C CA   . THR A 1 69 ? -11.438 -0.243  -3.809  1.00 0.00 ? 69 THR A CA   1  
ATOM 1122  C C    . THR A 1 69 ? -9.906  -0.303  -3.645  1.00 0.00 ? 69 THR A C    1  
ATOM 1123  O O    . THR A 1 69 ? -9.208  -0.738  -4.562  1.00 0.00 ? 69 THR A O    1  
ATOM 1124  C CB   . THR A 1 69 ? -11.902 1.227   -4.056  1.00 0.00 ? 69 THR A CB   1  
ATOM 1125  O OG1  . THR A 1 69 ? -13.336 1.265   -4.166  1.00 0.00 ? 69 THR A OG1  1  
ATOM 1126  C CG2  . THR A 1 69 ? -11.284 1.843   -5.322  1.00 0.00 ? 69 THR A CG2  1  
ATOM 1127  H H    . THR A 1 69 ? -12.724 -0.209  -2.136  1.00 0.00 ? 69 THR A H    1  
ATOM 1128  H HA   . THR A 1 69 ? -11.733 -0.844  -4.665  1.00 0.00 ? 69 THR A HA   1  
ATOM 1129  H HB   . THR A 1 69 ? -11.609 1.829   -3.194  1.00 0.00 ? 69 THR A HB   1  
ATOM 1130  H HG1  . THR A 1 69 ? -13.642 0.443   -4.565  1.00 0.00 ? 69 THR A HG1  1  
ATOM 1131  H HG21 . THR A 1 69 ? -10.204 1.868   -5.231  1.00 0.00 ? 69 THR A HG21 1  
ATOM 1132  H HG22 . THR A 1 69 ? -11.654 2.854   -5.448  1.00 0.00 ? 69 THR A HG22 1  
ATOM 1133  H HG23 . THR A 1 69 ? -11.553 1.254   -6.188  1.00 0.00 ? 69 THR A HG23 1  
ATOM 1134  N N    . PHE A 1 70 ? -9.416  0.116   -2.451  1.00 0.00 ? 70 PHE A N    1  
ATOM 1135  C CA   . PHE A 1 70 ? -7.989  0.024   -2.058  1.00 0.00 ? 70 PHE A CA   1  
ATOM 1136  C C    . PHE A 1 70 ? -7.432  -1.390  -2.300  1.00 0.00 ? 70 PHE A C    1  
ATOM 1137  O O    . PHE A 1 70 ? -6.388  -1.547  -2.938  1.00 0.00 ? 70 PHE A O    1  
ATOM 1138  C CB   . PHE A 1 70 ? -7.825  0.412   -0.553  1.00 0.00 ? 70 PHE A CB   1  
ATOM 1139  C CG   . PHE A 1 70 ? -6.504  -0.023  0.098   1.00 0.00 ? 70 PHE A CG   1  
ATOM 1140  C CD1  . PHE A 1 70 ? -5.285  0.532   -0.304  1.00 0.00 ? 70 PHE A CD1  1  
ATOM 1141  C CD2  . PHE A 1 70 ? -6.479  -1.014  1.089   1.00 0.00 ? 70 PHE A CD2  1  
ATOM 1142  C CE1  . PHE A 1 70 ? -4.095  0.112   0.261   1.00 0.00 ? 70 PHE A CE1  1  
ATOM 1143  C CE2  . PHE A 1 70 ? -5.286  -1.425  1.652   1.00 0.00 ? 70 PHE A CE2  1  
ATOM 1144  C CZ   . PHE A 1 70 ? -4.098  -0.865  1.238   1.00 0.00 ? 70 PHE A CZ   1  
ATOM 1145  H H    . PHE A 1 70 ? -10.039 0.510   -1.806  1.00 0.00 ? 70 PHE A H    1  
ATOM 1146  H HA   . PHE A 1 70 ? -7.438  0.737   -2.664  1.00 0.00 ? 70 PHE A HA   1  
ATOM 1147  H HB2  . PHE A 1 70 ? -7.896  1.488   -0.458  1.00 0.00 ? 70 PHE A HB2  1  
ATOM 1148  H HB3  . PHE A 1 70 ? -8.637  -0.033  0.009   1.00 0.00 ? 70 PHE A HB3  1  
ATOM 1149  H HD1  . PHE A 1 70 ? -5.274  1.299   -1.067  1.00 0.00 ? 70 PHE A HD1  1  
ATOM 1150  H HD2  . PHE A 1 70 ? -7.406  -1.461  1.423   1.00 0.00 ? 70 PHE A HD2  1  
ATOM 1151  H HE1  . PHE A 1 70 ? -3.156  0.553   -0.058  1.00 0.00 ? 70 PHE A HE1  1  
ATOM 1152  H HE2  . PHE A 1 70 ? -5.283  -2.191  2.422   1.00 0.00 ? 70 PHE A HE2  1  
ATOM 1153  H HZ   . PHE A 1 70 ? -3.161  -1.190  1.682   1.00 0.00 ? 70 PHE A HZ   1  
ATOM 1154  N N    . GLU A 1 71 ? -8.164  -2.396  -1.785  1.00 0.00 ? 71 GLU A N    1  
ATOM 1155  C CA   . GLU A 1 71 ? -7.735  -3.799  -1.797  1.00 0.00 ? 71 GLU A CA   1  
ATOM 1156  C C    . GLU A 1 71 ? -7.707  -4.369  -3.220  1.00 0.00 ? 71 GLU A C    1  
ATOM 1157  O O    . GLU A 1 71 ? -6.728  -5.014  -3.592  1.00 0.00 ? 71 GLU A O    1  
ATOM 1158  C CB   . GLU A 1 71 ? -8.654  -4.656  -0.904  1.00 0.00 ? 71 GLU A CB   1  
ATOM 1159  C CG   . GLU A 1 71 ? -8.660  -4.249  0.577   1.00 0.00 ? 71 GLU A CG   1  
ATOM 1160  C CD   . GLU A 1 71 ? -9.486  -5.215  1.423   1.00 0.00 ? 71 GLU A CD   1  
ATOM 1161  O OE1  . GLU A 1 71 ? -8.994  -6.337  1.676   1.00 0.00 ? 71 GLU A OE1  1  
ATOM 1162  O OE2  . GLU A 1 71 ? -10.629 -4.886  1.812   1.00 0.00 ? 71 GLU A OE2  1  
ATOM 1163  H H    . GLU A 1 71 ? -9.030  -2.180  -1.376  1.00 0.00 ? 71 GLU A H    1  
ATOM 1164  H HA   . GLU A 1 71 ? -6.725  -3.834  -1.387  1.00 0.00 ? 71 GLU A HA   1  
ATOM 1165  H HB2  . GLU A 1 71 ? -9.673  -4.591  -1.282  1.00 0.00 ? 71 GLU A HB2  1  
ATOM 1166  H HB3  . GLU A 1 71 ? -8.333  -5.693  -0.966  1.00 0.00 ? 71 GLU A HB3  1  
ATOM 1167  H HG2  . GLU A 1 71 ? -7.637  -4.239  0.948   1.00 0.00 ? 71 GLU A HG2  1  
ATOM 1168  H HG3  . GLU A 1 71 ? -9.073  -3.250  0.667   1.00 0.00 ? 71 GLU A HG3  1  
ATOM 1169  N N    . ARG A 1 72 ? -8.787  -4.105  -4.010  1.00 0.00 ? 72 ARG A N    1  
ATOM 1170  C CA   . ARG A 1 72 ? -8.904  -4.588  -5.405  1.00 0.00 ? 72 ARG A CA   1  
ATOM 1171  C C    . ARG A 1 72 ? -7.726  -4.070  -6.235  1.00 0.00 ? 72 ARG A C    1  
ATOM 1172  O O    . ARG A 1 72 ? -7.095  -4.828  -6.978  1.00 0.00 ? 72 ARG A O    1  
ATOM 1173  C CB   . ARG A 1 72 ? -10.226 -4.126  -6.091  1.00 0.00 ? 72 ARG A CB   1  
ATOM 1174  C CG   . ARG A 1 72 ? -11.534 -4.500  -5.367  1.00 0.00 ? 72 ARG A CG   1  
ATOM 1175  C CD   . ARG A 1 72 ? -12.788 -4.116  -6.191  1.00 0.00 ? 72 ARG A CD   1  
ATOM 1176  N NE   . ARG A 1 72 ? -12.627 -2.819  -6.898  1.00 0.00 ? 72 ARG A NE   1  
ATOM 1177  C CZ   . ARG A 1 72 ? -13.459 -1.766  -6.847  1.00 0.00 ? 72 ARG A CZ   1  
ATOM 1178  N NH1  . ARG A 1 72 ? -14.556 -1.789  -6.101  1.00 0.00 ? 72 ARG A NH1  1  
ATOM 1179  N NH2  . ARG A 1 72 ? -13.167 -0.680  -7.552  1.00 0.00 ? 72 ARG A NH2  1  
ATOM 1180  H H    . ARG A 1 72 ? -9.518  -3.563  -3.645  1.00 0.00 ? 72 ARG A H    1  
ATOM 1181  H HA   . ARG A 1 72 ? -8.879  -5.674  -5.383  1.00 0.00 ? 72 ARG A HA   1  
ATOM 1182  H HB2  . ARG A 1 72 ? -10.207 -3.045  -6.193  1.00 0.00 ? 72 ARG A HB2  1  
ATOM 1183  H HB3  . ARG A 1 72 ? -10.268 -4.559  -7.087  1.00 0.00 ? 72 ARG A HB3  1  
ATOM 1184  H HG2  . ARG A 1 72 ? -11.545 -5.569  -5.186  1.00 0.00 ? 72 ARG A HG2  1  
ATOM 1185  H HG3  . ARG A 1 72 ? -11.565 -3.982  -4.415  1.00 0.00 ? 72 ARG A HG3  1  
ATOM 1186  H HD2  . ARG A 1 72 ? -12.969 -4.887  -6.929  1.00 0.00 ? 72 ARG A HD2  1  
ATOM 1187  H HD3  . ARG A 1 72 ? -13.644 -4.059  -5.523  1.00 0.00 ? 72 ARG A HD3  1  
ATOM 1188  H HE   . ARG A 1 72 ? -11.843 -2.740  -7.480  1.00 0.00 ? 72 ARG A HE   1  
ATOM 1189  H HH11 . ARG A 1 72 ? -14.779 -2.606  -5.565  1.00 0.00 ? 72 ARG A HH11 1  
ATOM 1190  H HH12 . ARG A 1 72 ? -15.167 -0.989  -6.068  1.00 0.00 ? 72 ARG A HH12 1  
ATOM 1191  H HH21 . ARG A 1 72 ? -12.339 -0.654  -8.120  1.00 0.00 ? 72 ARG A HH21 1  
ATOM 1192  H HH22 . ARG A 1 72 ? -13.773 0.123   -7.525  1.00 0.00 ? 72 ARG A HH22 1  
ATOM 1193  N N    . ASN A 1 73 ? -7.443  -2.761  -6.071  1.00 0.00 ? 73 ASN A N    1  
ATOM 1194  C CA   . ASN A 1 73 ? -6.364  -2.066  -6.781  1.00 0.00 ? 73 ASN A CA   1  
ATOM 1195  C C    . ASN A 1 73 ? -5.003  -2.613  -6.360  1.00 0.00 ? 73 ASN A C    1  
ATOM 1196  O O    . ASN A 1 73 ? -4.147  -2.817  -7.205  1.00 0.00 ? 73 ASN A O    1  
ATOM 1197  C CB   . ASN A 1 73 ? -6.425  -0.534  -6.518  1.00 0.00 ? 73 ASN A CB   1  
ATOM 1198  C CG   . ASN A 1 73 ? -7.687  0.128   -7.078  1.00 0.00 ? 73 ASN A CG   1  
ATOM 1199  O OD1  . ASN A 1 73 ? -8.261  -0.320  -8.072  1.00 0.00 ? 73 ASN A OD1  1  
ATOM 1200  N ND2  . ASN A 1 73 ? -8.134  1.193   -6.442  1.00 0.00 ? 73 ASN A ND2  1  
ATOM 1201  H H    . ASN A 1 73 ? -7.975  -2.237  -5.434  1.00 0.00 ? 73 ASN A H    1  
ATOM 1202  H HA   . ASN A 1 73 ? -6.503  -2.241  -7.843  1.00 0.00 ? 73 ASN A HA   1  
ATOM 1203  H HB2  . ASN A 1 73 ? -6.392  -0.352  -5.447  1.00 0.00 ? 73 ASN A HB2  1  
ATOM 1204  H HB3  . ASN A 1 73 ? -5.568  -0.052  -6.977  1.00 0.00 ? 73 ASN A HB3  1  
ATOM 1205  H HD21 . ASN A 1 73 ? -7.645  1.500   -5.650  1.00 0.00 ? 73 ASN A HD21 1  
ATOM 1206  H HD22 . ASN A 1 73 ? -8.936  1.635   -6.787  1.00 0.00 ? 73 ASN A HD22 1  
ATOM 1207  N N    . LEU A 1 74 ? -4.828  -2.836  -5.042  1.00 0.00 ? 74 LEU A N    1  
ATOM 1208  C CA   . LEU A 1 74 ? -3.561  -3.318  -4.465  1.00 0.00 ? 74 LEU A CA   1  
ATOM 1209  C C    . LEU A 1 74 ? -3.184  -4.727  -4.975  1.00 0.00 ? 74 LEU A C    1  
ATOM 1210  O O    . LEU A 1 74 ? -2.062  -4.927  -5.436  1.00 0.00 ? 74 LEU A O    1  
ATOM 1211  C CB   . LEU A 1 74 ? -3.637  -3.289  -2.915  1.00 0.00 ? 74 LEU A CB   1  
ATOM 1212  C CG   . LEU A 1 74 ? -2.320  -3.651  -2.151  1.00 0.00 ? 74 LEU A CG   1  
ATOM 1213  C CD1  . LEU A 1 74 ? -1.157  -2.709  -2.537  1.00 0.00 ? 74 LEU A CD1  1  
ATOM 1214  C CD2  . LEU A 1 74 ? -2.554  -3.665  -0.630  1.00 0.00 ? 74 LEU A CD2  1  
ATOM 1215  H H    . LEU A 1 74 ? -5.558  -2.611  -4.428  1.00 0.00 ? 74 LEU A H    1  
ATOM 1216  H HA   . LEU A 1 74 ? -2.789  -2.621  -4.777  1.00 0.00 ? 74 LEU A HA   1  
ATOM 1217  H HB2  . LEU A 1 74 ? -3.946  -2.289  -2.614  1.00 0.00 ? 74 LEU A HB2  1  
ATOM 1218  H HB3  . LEU A 1 74 ? -4.416  -3.981  -2.603  1.00 0.00 ? 74 LEU A HB3  1  
ATOM 1219  H HG   . LEU A 1 74 ? -2.019  -4.652  -2.436  1.00 0.00 ? 74 LEU A HG   1  
ATOM 1220  H HD11 . LEU A 1 74 ? -1.424  -1.683  -2.317  1.00 0.00 ? 74 LEU A HD11 1  
ATOM 1221  H HD12 . LEU A 1 74 ? -0.946  -2.806  -3.593  1.00 0.00 ? 74 LEU A HD12 1  
ATOM 1222  H HD13 . LEU A 1 74 ? -0.270  -2.977  -1.976  1.00 0.00 ? 74 LEU A HD13 1  
ATOM 1223  H HD21 . LEU A 1 74 ? -1.637  -3.939  -0.120  1.00 0.00 ? 74 LEU A HD21 1  
ATOM 1224  H HD22 . LEU A 1 74 ? -3.322  -4.387  -0.387  1.00 0.00 ? 74 LEU A HD22 1  
ATOM 1225  H HD23 . LEU A 1 74 ? -2.866  -2.685  -0.295  1.00 0.00 ? 74 LEU A HD23 1  
ATOM 1226  N N    . GLU A 1 75 ? -4.130  -5.689  -4.900  1.00 0.00 ? 75 GLU A N    1  
ATOM 1227  C CA   . GLU A 1 75 ? -3.878  -7.097  -5.295  1.00 0.00 ? 75 GLU A CA   1  
ATOM 1228  C C    . GLU A 1 75 ? -3.660  -7.232  -6.819  1.00 0.00 ? 75 GLU A C    1  
ATOM 1229  O O    . GLU A 1 75 ? -2.844  -8.055  -7.265  1.00 0.00 ? 75 GLU A O    1  
ATOM 1230  C CB   . GLU A 1 75 ? -5.012  -8.024  -4.756  1.00 0.00 ? 75 GLU A CB   1  
ATOM 1231  C CG   . GLU A 1 75 ? -6.466  -7.710  -5.228  1.00 0.00 ? 75 GLU A CG   1  
ATOM 1232  C CD   . GLU A 1 75 ? -6.939  -8.534  -6.441  1.00 0.00 ? 75 GLU A CD   1  
ATOM 1233  O OE1  . GLU A 1 75 ? -7.339  -9.705  -6.253  1.00 0.00 ? 75 GLU A OE1  1  
ATOM 1234  O OE2  . GLU A 1 75 ? -6.927  -8.021  -7.575  1.00 0.00 ? 75 GLU A OE2  1  
ATOM 1235  H H    . GLU A 1 75 ? -5.013  -5.446  -4.553  1.00 0.00 ? 75 GLU A H    1  
ATOM 1236  H HA   . GLU A 1 75 ? -2.952  -7.391  -4.806  1.00 0.00 ? 75 GLU A HA   1  
ATOM 1237  H HB2  . GLU A 1 75 ? -4.782  -9.045  -5.035  1.00 0.00 ? 75 GLU A HB2  1  
ATOM 1238  H HB3  . GLU A 1 75 ? -4.995  -7.964  -3.671  1.00 0.00 ? 75 GLU A HB3  1  
ATOM 1239  H HG2  . GLU A 1 75 ? -7.153  -7.898  -4.404  1.00 0.00 ? 75 GLU A HG2  1  
ATOM 1240  H HG3  . GLU A 1 75 ? -6.528  -6.652  -5.476  1.00 0.00 ? 75 GLU A HG3  1  
ATOM 1241  N N    . THR A 1 76 ? -4.379  -6.395  -7.606  1.00 0.00 ? 76 THR A N    1  
ATOM 1242  C CA   . THR A 1 76 ? -4.157  -6.273  -9.063  1.00 0.00 ? 76 THR A CA   1  
ATOM 1243  C C    . THR A 1 76 ? -2.739  -5.724  -9.324  1.00 0.00 ? 76 THR A C    1  
ATOM 1244  O O    . THR A 1 76 ? -1.955  -6.309  -10.060 1.00 0.00 ? 76 THR A O    1  
ATOM 1245  C CB   . THR A 1 76 ? -5.208  -5.326  -9.748  1.00 0.00 ? 76 THR A CB   1  
ATOM 1246  O OG1  . THR A 1 76 ? -6.543  -5.794  -9.502  1.00 0.00 ? 76 THR A OG1  1  
ATOM 1247  C CG2  . THR A 1 76 ? -4.994  -5.214  -11.272 1.00 0.00 ? 76 THR A CG2  1  
ATOM 1248  H H    . THR A 1 76 ? -5.086  -5.859  -7.193  1.00 0.00 ? 76 THR A H    1  
ATOM 1249  H HA   . THR A 1 76 ? -4.249  -7.264  -9.499  1.00 0.00 ? 76 THR A HA   1  
ATOM 1250  H HB   . THR A 1 76 ? -5.113  -4.336  -9.313  1.00 0.00 ? 76 THR A HB   1  
ATOM 1251  H HG1  . THR A 1 76 ? -6.573  -6.234  -8.647  1.00 0.00 ? 76 THR A HG1  1  
ATOM 1252  H HG21 . THR A 1 76 ? -4.013  -4.802  -11.476 1.00 0.00 ? 76 THR A HG21 1  
ATOM 1253  H HG22 . THR A 1 76 ? -5.747  -4.565  -11.704 1.00 0.00 ? 76 THR A HG22 1  
ATOM 1254  H HG23 . THR A 1 76 ? -5.068  -6.193  -11.724 1.00 0.00 ? 76 THR A HG23 1  
ATOM 1255  N N    . LEU A 1 77 ? -2.443  -4.602  -8.659  1.00 0.00 ? 77 LEU A N    1  
ATOM 1256  C CA   . LEU A 1 77 ? -1.156  -3.888  -8.758  1.00 0.00 ? 77 LEU A CA   1  
ATOM 1257  C C    . LEU A 1 77 ? 0.048   -4.806  -8.493  1.00 0.00 ? 77 LEU A C    1  
ATOM 1258  O O    . LEU A 1 77 ? 1.057   -4.742  -9.202  1.00 0.00 ? 77 LEU A O    1  
ATOM 1259  C CB   . LEU A 1 77 ? -1.164  -2.723  -7.762  1.00 0.00 ? 77 LEU A CB   1  
ATOM 1260  C CG   . LEU A 1 77 ? 0.073   -1.797  -7.764  1.00 0.00 ? 77 LEU A CG   1  
ATOM 1261  C CD1  . LEU A 1 77 ? 0.300   -1.170  -9.156  1.00 0.00 ? 77 LEU A CD1  1  
ATOM 1262  C CD2  . LEU A 1 77 ? -0.086  -0.736  -6.676  1.00 0.00 ? 77 LEU A CD2  1  
ATOM 1263  H H    . LEU A 1 77 ? -3.150  -4.225  -8.101  1.00 0.00 ? 77 LEU A H    1  
ATOM 1264  H HA   . LEU A 1 77 ? -1.082  -3.487  -9.763  1.00 0.00 ? 77 LEU A HA   1  
ATOM 1265  H HB2  . LEU A 1 77 ? -2.045  -2.117  -7.965  1.00 0.00 ? 77 LEU A HB2  1  
ATOM 1266  H HB3  . LEU A 1 77 ? -1.276  -3.141  -6.763  1.00 0.00 ? 77 LEU A HB3  1  
ATOM 1267  H HG   . LEU A 1 77 ? 0.954   -2.377  -7.525  1.00 0.00 ? 77 LEU A HG   1  
ATOM 1268  H HD11 . LEU A 1 77 ? -0.559  -0.575  -9.442  1.00 0.00 ? 77 LEU A HD11 1  
ATOM 1269  H HD12 . LEU A 1 77 ? 0.450   -1.952  -9.890  1.00 0.00 ? 77 LEU A HD12 1  
ATOM 1270  H HD13 . LEU A 1 77 ? 1.178   -0.540  -9.133  1.00 0.00 ? 77 LEU A HD13 1  
ATOM 1271  H HD21 . LEU A 1 77 ? 0.814   -0.139  -6.625  1.00 0.00 ? 77 LEU A HD21 1  
ATOM 1272  H HD22 . LEU A 1 77 ? -0.243  -1.215  -5.715  1.00 0.00 ? 77 LEU A HD22 1  
ATOM 1273  H HD23 . LEU A 1 77 ? -0.928  -0.095  -6.899  1.00 0.00 ? 77 LEU A HD23 1  
ATOM 1274  N N    . GLN A 1 78 ? -0.095  -5.653  -7.468  1.00 0.00 ? 78 GLN A N    1  
ATOM 1275  C CA   . GLN A 1 78 ? 0.920   -6.628  -7.085  1.00 0.00 ? 78 GLN A CA   1  
ATOM 1276  C C    . GLN A 1 78 ? 1.127   -7.671  -8.197  1.00 0.00 ? 78 GLN A C    1  
ATOM 1277  O O    . GLN A 1 78 ? 2.265   -7.922  -8.590  1.00 0.00 ? 78 GLN A O    1  
ATOM 1278  C CB   . GLN A 1 78 ? 0.539   -7.283  -5.732  1.00 0.00 ? 78 GLN A CB   1  
ATOM 1279  C CG   . GLN A 1 78 ? 0.640   -6.311  -4.530  1.00 0.00 ? 78 GLN A CG   1  
ATOM 1280  C CD   . GLN A 1 78 ? 0.212   -6.944  -3.209  1.00 0.00 ? 78 GLN A CD   1  
ATOM 1281  O OE1  . GLN A 1 78 ? 1.030   -7.492  -2.465  1.00 0.00 ? 78 GLN A OE1  1  
ATOM 1282  N NE2  . GLN A 1 78 ? -1.077  -6.883  -2.908  1.00 0.00 ? 78 GLN A NE2  1  
ATOM 1283  H H    . GLN A 1 78 ? -0.921  -5.617  -6.949  1.00 0.00 ? 78 GLN A H    1  
ATOM 1284  H HA   . GLN A 1 78 ? 1.854   -6.085  -6.951  1.00 0.00 ? 78 GLN A HA   1  
ATOM 1285  H HB2  . GLN A 1 78 ? -0.478  -7.653  -5.794  1.00 0.00 ? 78 GLN A HB2  1  
ATOM 1286  H HB3  . GLN A 1 78 ? 1.201   -8.121  -5.542  1.00 0.00 ? 78 GLN A HB3  1  
ATOM 1287  H HG2  . GLN A 1 78 ? 1.669   -5.983  -4.438  1.00 0.00 ? 78 GLN A HG2  1  
ATOM 1288  H HG3  . GLN A 1 78 ? 0.014   -5.448  -4.727  1.00 0.00 ? 78 GLN A HG3  1  
ATOM 1289  H HE21 . GLN A 1 78 ? -1.684  -6.451  -3.544  1.00 0.00 ? 78 GLN A HE21 1  
ATOM 1290  H HE22 . GLN A 1 78 ? -1.375  -7.288  -2.067  1.00 0.00 ? 78 GLN A HE22 1  
ATOM 1291  N N    . GLN A 1 79 ? 0.024   -8.211  -8.769  1.00 0.00 ? 79 GLN A N    1  
ATOM 1292  C CA   . GLN A 1 79 ? 0.129   -9.260  -9.815  1.00 0.00 ? 79 GLN A CA   1  
ATOM 1293  C C    . GLN A 1 79 ? 0.688   -8.663  -11.144 1.00 0.00 ? 79 GLN A C    1  
ATOM 1294  O O    . GLN A 1 79 ? 1.312   -9.383  -11.941 1.00 0.00 ? 79 GLN A O    1  
ATOM 1295  C CB   . GLN A 1 79 ? -1.221  -10.005 -10.050 1.00 0.00 ? 79 GLN A CB   1  
ATOM 1296  C CG   . GLN A 1 79 ? -2.298  -9.224  -10.831 1.00 0.00 ? 79 GLN A CG   1  
ATOM 1297  C CD   . GLN A 1 79 ? -3.564  -10.033 -11.122 1.00 0.00 ? 79 GLN A CD   1  
ATOM 1298  O OE1  . GLN A 1 79 ? -3.951  -10.922 -10.356 1.00 0.00 ? 79 GLN A OE1  1  
ATOM 1299  N NE2  . GLN A 1 79 ? -4.221  -9.737  -12.233 1.00 0.00 ? 79 GLN A NE2  1  
ATOM 1300  H H    . GLN A 1 79 ? -0.866  -7.883  -8.496  1.00 0.00 ? 79 GLN A H    1  
ATOM 1301  H HA   . GLN A 1 79 ? 0.856   -9.987  -9.449  1.00 0.00 ? 79 GLN A HA   1  
ATOM 1302  H HB2  . GLN A 1 79 ? -1.013  -10.916 -10.599 1.00 0.00 ? 79 GLN A HB2  1  
ATOM 1303  H HB3  . GLN A 1 79 ? -1.636  -10.279 -9.086  1.00 0.00 ? 79 GLN A HB3  1  
ATOM 1304  H HG2  . GLN A 1 79 ? -2.589  -8.352  -10.252 1.00 0.00 ? 79 GLN A HG2  1  
ATOM 1305  H HG3  . GLN A 1 79 ? -1.873  -8.890  -11.775 1.00 0.00 ? 79 GLN A HG3  1  
ATOM 1306  H HE21 . GLN A 1 79 ? -3.868  -9.019  -12.807 1.00 0.00 ? 79 GLN A HE21 1  
ATOM 1307  H HE22 . GLN A 1 79 ? -5.036  -10.236 -12.436 1.00 0.00 ? 79 GLN A HE22 1  
ATOM 1308  N N    . GLU A 1 80 ? 0.460   -7.342  -11.359 1.00 0.00 ? 80 GLU A N    1  
ATOM 1309  C CA   . GLU A 1 80 ? 1.014   -6.580  -12.505 1.00 0.00 ? 80 GLU A CA   1  
ATOM 1310  C C    . GLU A 1 80 ? 2.533   -6.438  -12.378 1.00 0.00 ? 80 GLU A C    1  
ATOM 1311  O O    . GLU A 1 80 ? 3.275   -6.749  -13.311 1.00 0.00 ? 80 GLU A O    1  
ATOM 1312  C CB   . GLU A 1 80 ? 0.374   -5.169  -12.583 1.00 0.00 ? 80 GLU A CB   1  
ATOM 1313  C CG   . GLU A 1 80 ? -1.135  -5.169  -12.861 1.00 0.00 ? 80 GLU A CG   1  
ATOM 1314  C CD   . GLU A 1 80 ? -1.722  -3.756  -12.880 1.00 0.00 ? 80 GLU A CD   1  
ATOM 1315  O OE1  . GLU A 1 80 ? -1.681  -3.101  -13.938 1.00 0.00 ? 80 GLU A OE1  1  
ATOM 1316  O OE2  . GLU A 1 80 ? -2.206  -3.279  -11.836 1.00 0.00 ? 80 GLU A OE2  1  
ATOM 1317  H H    . GLU A 1 80 ? -0.124  -6.859  -10.737 1.00 0.00 ? 80 GLU A H    1  
ATOM 1318  H HA   . GLU A 1 80 ? 0.780   -7.122  -13.417 1.00 0.00 ? 80 GLU A HA   1  
ATOM 1319  H HB2  . GLU A 1 80 ? 0.545   -4.656  -11.640 1.00 0.00 ? 80 GLU A HB2  1  
ATOM 1320  H HB3  . GLU A 1 80 ? 0.860   -4.602  -13.373 1.00 0.00 ? 80 GLU A HB3  1  
ATOM 1321  H HG2  . GLU A 1 80 ? -1.316  -5.645  -13.823 1.00 0.00 ? 80 GLU A HG2  1  
ATOM 1322  H HG3  . GLU A 1 80 ? -1.632  -5.751  -12.092 1.00 0.00 ? 80 GLU A HG3  1  
ATOM 1323  N N    . LEU A 1 81 ? 2.979   -5.988  -11.191 1.00 0.00 ? 81 LEU A N    1  
ATOM 1324  C CA   . LEU A 1 81 ? 4.405   -5.713  -10.914 1.00 0.00 ? 81 LEU A CA   1  
ATOM 1325  C C    . LEU A 1 81 ? 5.182   -7.010  -10.569 1.00 0.00 ? 81 LEU A C    1  
ATOM 1326  O O    . LEU A 1 81 ? 6.370   -6.954  -10.216 1.00 0.00 ? 81 LEU A O    1  
ATOM 1327  C CB   . LEU A 1 81 ? 4.526   -4.661  -9.775  1.00 0.00 ? 81 LEU A CB   1  
ATOM 1328  C CG   . LEU A 1 81 ? 3.895   -3.252  -10.044 1.00 0.00 ? 81 LEU A CG   1  
ATOM 1329  C CD1  . LEU A 1 81 ? 4.045   -2.327  -8.810  1.00 0.00 ? 81 LEU A CD1  1  
ATOM 1330  C CD2  . LEU A 1 81 ? 4.484   -2.598  -11.317 1.00 0.00 ? 81 LEU A CD2  1  
ATOM 1331  H H    . LEU A 1 81 ? 2.327   -5.847  -10.472 1.00 0.00 ? 81 LEU A H    1  
ATOM 1332  H HA   . LEU A 1 81 ? 4.845   -5.296  -11.817 1.00 0.00 ? 81 LEU A HA   1  
ATOM 1333  H HB2  . LEU A 1 81 ? 4.054   -5.074  -8.888  1.00 0.00 ? 81 LEU A HB2  1  
ATOM 1334  H HB3  . LEU A 1 81 ? 5.579   -4.519  -9.553  1.00 0.00 ? 81 LEU A HB3  1  
ATOM 1335  H HG   . LEU A 1 81 ? 2.833   -3.379  -10.211 1.00 0.00 ? 81 LEU A HG   1  
ATOM 1336  H HD11 . LEU A 1 81 ? 3.579   -1.370  -9.011  1.00 0.00 ? 81 LEU A HD11 1  
ATOM 1337  H HD12 . LEU A 1 81 ? 5.093   -2.172  -8.581  1.00 0.00 ? 81 LEU A HD12 1  
ATOM 1338  H HD13 . LEU A 1 81 ? 3.558   -2.783  -7.957  1.00 0.00 ? 81 LEU A HD13 1  
ATOM 1339  H HD21 . LEU A 1 81 ? 4.279   -3.229  -12.173 1.00 0.00 ? 81 LEU A HD21 1  
ATOM 1340  H HD22 . LEU A 1 81 ? 5.554   -2.475  -11.212 1.00 0.00 ? 81 LEU A HD22 1  
ATOM 1341  H HD23 . LEU A 1 81 ? 4.025   -1.632  -11.477 1.00 0.00 ? 81 LEU A HD23 1  
ATOM 1342  N N    . GLY A 1 82 ? 4.499   -8.171  -10.673 1.00 0.00 ? 82 GLY A N    1  
ATOM 1343  C CA   . GLY A 1 82 ? 5.142   -9.480  -10.543 1.00 0.00 ? 82 GLY A CA   1  
ATOM 1344  C C    . GLY A 1 82 ? 5.417   -9.898  -9.104  1.00 0.00 ? 82 GLY A C    1  
ATOM 1345  O O    . GLY A 1 82 ? 6.255   -10.778 -8.868  1.00 0.00 ? 82 GLY A O    1  
ATOM 1346  H H    . GLY A 1 82 ? 3.534   -8.137  -10.843 1.00 0.00 ? 82 GLY A H    1  
ATOM 1347  H HA2  . GLY A 1 82 ? 4.489   -10.213 -10.988 1.00 0.00 ? 82 GLY A HA2  1  
ATOM 1348  H HA3  . GLY A 1 82 ? 6.077   -9.477  -11.094 1.00 0.00 ? 82 GLY A HA3  1  
ATOM 1349  N N    . ILE A 1 83 ? 4.706   -9.263  -8.153  1.00 0.00 ? 83 ILE A N    1  
ATOM 1350  C CA   . ILE A 1 83 ? 4.800   -9.570  -6.719  1.00 0.00 ? 83 ILE A CA   1  
ATOM 1351  C C    . ILE A 1 83 ? 4.201   -10.974 -6.447  1.00 0.00 ? 83 ILE A C    1  
ATOM 1352  O O    . ILE A 1 83 ? 3.016   -11.222 -6.696  1.00 0.00 ? 83 ILE A O    1  
ATOM 1353  C CB   . ILE A 1 83 ? 4.076   -8.461  -5.830  1.00 0.00 ? 83 ILE A CB   1  
ATOM 1354  C CG1  . ILE A 1 83 ? 4.981   -7.208  -5.584  1.00 0.00 ? 83 ILE A CG1  1  
ATOM 1355  C CG2  . ILE A 1 83 ? 3.562   -9.018  -4.485  1.00 0.00 ? 83 ILE A CG2  1  
ATOM 1356  C CD1  . ILE A 1 83 ? 5.244   -6.347  -6.795  1.00 0.00 ? 83 ILE A CD1  1  
ATOM 1357  H H    . ILE A 1 83 ? 4.059   -8.594  -8.442  1.00 0.00 ? 83 ILE A H    1  
ATOM 1358  H HA   . ILE A 1 83 ? 5.859   -9.578  -6.452  1.00 0.00 ? 83 ILE A HA   1  
ATOM 1359  H HB   . ILE A 1 83 ? 3.200   -8.136  -6.382  1.00 0.00 ? 83 ILE A HB   1  
ATOM 1360  H HG12 . ILE A 1 83 ? 4.522   -6.570  -4.845  1.00 0.00 ? 83 ILE A HG12 1  
ATOM 1361  H HG13 . ILE A 1 83 ? 5.939   -7.541  -5.210  1.00 0.00 ? 83 ILE A HG13 1  
ATOM 1362  H HG21 . ILE A 1 83 ? 3.119   -8.220  -3.897  1.00 0.00 ? 83 ILE A HG21 1  
ATOM 1363  H HG22 . ILE A 1 83 ? 4.382   -9.451  -3.932  1.00 0.00 ? 83 ILE A HG22 1  
ATOM 1364  H HG23 . ILE A 1 83 ? 2.811   -9.782  -4.660  1.00 0.00 ? 83 ILE A HG23 1  
ATOM 1365  H HD11 . ILE A 1 83 ? 5.855   -5.503  -6.506  1.00 0.00 ? 83 ILE A HD11 1  
ATOM 1366  H HD12 . ILE A 1 83 ? 4.307   -5.989  -7.199  1.00 0.00 ? 83 ILE A HD12 1  
ATOM 1367  H HD13 . ILE A 1 83 ? 5.765   -6.924  -7.547  1.00 0.00 ? 83 ILE A HD13 1  
ATOM 1368  N N    . GLU A 1 84 ? 5.057   -11.877 -5.961  1.00 0.00 ? 84 GLU A N    1  
ATOM 1369  C CA   . GLU A 1 84 ? 4.683   -13.226 -5.497  1.00 0.00 ? 84 GLU A CA   1  
ATOM 1370  C C    . GLU A 1 84 ? 4.656   -13.225 -3.958  1.00 0.00 ? 84 GLU A C    1  
ATOM 1371  O O    . GLU A 1 84 ? 4.875   -12.166 -3.346  1.00 0.00 ? 84 GLU A O    1  
ATOM 1372  C CB   . GLU A 1 84 ? 5.678   -14.276 -6.057  1.00 0.00 ? 84 GLU A CB   1  
ATOM 1373  C CG   . GLU A 1 84 ? 5.764   -14.278 -7.596  1.00 0.00 ? 84 GLU A CG   1  
ATOM 1374  C CD   . GLU A 1 84 ? 6.808   -15.259 -8.139  1.00 0.00 ? 84 GLU A CD   1  
ATOM 1375  O OE1  . GLU A 1 84 ? 8.009   -14.923 -8.123  1.00 0.00 ? 84 GLU A OE1  1  
ATOM 1376  O OE2  . GLU A 1 84 ? 6.440   -16.371 -8.575  1.00 0.00 ? 84 GLU A OE2  1  
ATOM 1377  H H    . GLU A 1 84 ? 5.999   -11.625 -5.901  1.00 0.00 ? 84 GLU A H    1  
ATOM 1378  H HA   . GLU A 1 84 ? 3.684   -13.455 -5.854  1.00 0.00 ? 84 GLU A HA   1  
ATOM 1379  H HB2  . GLU A 1 84 ? 6.669   -14.071 -5.656  1.00 0.00 ? 84 GLU A HB2  1  
ATOM 1380  H HB3  . GLU A 1 84 ? 5.374   -15.266 -5.730  1.00 0.00 ? 84 GLU A HB3  1  
ATOM 1381  H HG2  . GLU A 1 84 ? 4.788   -14.538 -7.999  1.00 0.00 ? 84 GLU A HG2  1  
ATOM 1382  H HG3  . GLU A 1 84 ? 6.020   -13.279 -7.931  1.00 0.00 ? 84 GLU A HG3  1  
ATOM 1383  N N    . GLY A 1 85 ? 4.345   -14.399 -3.361  1.00 0.00 ? 85 GLY A N    1  
ATOM 1384  C CA   . GLY A 1 85 ? 4.163   -14.573 -1.903  1.00 0.00 ? 85 GLY A CA   1  
ATOM 1385  C C    . GLY A 1 85 ? 5.176   -13.856 -1.003  1.00 0.00 ? 85 GLY A C    1  
ATOM 1386  O O    . GLY A 1 85 ? 4.800   -13.349 0.060   1.00 0.00 ? 85 GLY A O    1  
ATOM 1387  H H    . GLY A 1 85 ? 4.230   -15.189 -3.937  1.00 0.00 ? 85 GLY A H    1  
ATOM 1388  H HA2  . GLY A 1 85 ? 3.178   -14.223 -1.641  1.00 0.00 ? 85 GLY A HA2  1  
ATOM 1389  H HA3  . GLY A 1 85 ? 4.203   -15.635 -1.685  1.00 0.00 ? 85 GLY A HA3  1  
ATOM 1390  N N    . GLU A 1 86 ? 6.442   -13.794 -1.443  1.00 0.00 ? 86 GLU A N    1  
ATOM 1391  C CA   . GLU A 1 86 ? 7.549   -13.204 -0.662  1.00 0.00 ? 86 GLU A CA   1  
ATOM 1392  C C    . GLU A 1 86 ? 7.484   -11.662 -0.670  1.00 0.00 ? 86 GLU A C    1  
ATOM 1393  O O    . GLU A 1 86 ? 7.813   -11.018 0.330   1.00 0.00 ? 86 GLU A O    1  
ATOM 1394  C CB   . GLU A 1 86 ? 8.938   -13.666 -1.198  1.00 0.00 ? 86 GLU A CB   1  
ATOM 1395  C CG   . GLU A 1 86 ? 9.147   -15.202 -1.290  1.00 0.00 ? 86 GLU A CG   1  
ATOM 1396  C CD   . GLU A 1 86 ? 8.662   -15.821 -2.616  1.00 0.00 ? 86 GLU A CD   1  
ATOM 1397  O OE1  . GLU A 1 86 ? 7.461   -16.135 -2.747  1.00 0.00 ? 86 GLU A OE1  1  
ATOM 1398  O OE2  . GLU A 1 86 ? 9.489   -15.990 -3.539  1.00 0.00 ? 86 GLU A OE2  1  
ATOM 1399  H H    . GLU A 1 86 ? 6.642   -14.162 -2.331  1.00 0.00 ? 86 GLU A H    1  
ATOM 1400  H HA   . GLU A 1 86 ? 7.448   -13.546 0.366   1.00 0.00 ? 86 GLU A HA   1  
ATOM 1401  H HB2  . GLU A 1 86 ? 9.090   -13.242 -2.189  1.00 0.00 ? 86 GLU A HB2  1  
ATOM 1402  H HB3  . GLU A 1 86 ? 9.708   -13.260 -0.543  1.00 0.00 ? 86 GLU A HB3  1  
ATOM 1403  H HG2  . GLU A 1 86 ? 10.207  -15.419 -1.175  1.00 0.00 ? 86 GLU A HG2  1  
ATOM 1404  H HG3  . GLU A 1 86 ? 8.615   -15.673 -0.469  1.00 0.00 ? 86 GLU A HG3  1  
ATOM 1405  N N    . ASN A 1 87 ? 7.082   -11.076 -1.817  1.00 0.00 ? 87 ASN A N    1  
ATOM 1406  C CA   . ASN A 1 87 ? 6.986   -9.600  -1.986  1.00 0.00 ? 87 ASN A CA   1  
ATOM 1407  C C    . ASN A 1 87 ? 5.576   -9.076  -1.672  1.00 0.00 ? 87 ASN A C    1  
ATOM 1408  O O    . ASN A 1 87 ? 5.371   -7.851  -1.703  1.00 0.00 ? 87 ASN A O    1  
ATOM 1409  C CB   . ASN A 1 87 ? 7.416   -9.147  -3.424  1.00 0.00 ? 87 ASN A CB   1  
ATOM 1410  C CG   . ASN A 1 87 ? 8.919   -9.282  -3.700  1.00 0.00 ? 87 ASN A CG   1  
ATOM 1411  O OD1  . ASN A 1 87 ? 9.747   -9.273  -2.782  1.00 0.00 ? 87 ASN A OD1  1  
ATOM 1412  N ND2  . ASN A 1 87 ? 9.298   -9.332  -4.972  1.00 0.00 ? 87 ASN A ND2  1  
ATOM 1413  H H    . ASN A 1 87 ? 6.837   -11.648 -2.571  1.00 0.00 ? 87 ASN A H    1  
ATOM 1414  H HA   . ASN A 1 87 ? 7.668   -9.142  -1.272  1.00 0.00 ? 87 ASN A HA   1  
ATOM 1415  H HB2  . ASN A 1 87 ? 6.882   -9.743  -4.158  1.00 0.00 ? 87 ASN A HB2  1  
ATOM 1416  H HB3  . ASN A 1 87 ? 7.146   -8.103  -3.570  1.00 0.00 ? 87 ASN A HB3  1  
ATOM 1417  H HD21 . ASN A 1 87 ? 8.606   -9.278  -5.675  1.00 0.00 ? 87 ASN A HD21 1  
ATOM 1418  H HD22 . ASN A 1 87 ? 10.250  -9.445  -5.162  1.00 0.00 ? 87 ASN A HD22 1  
ATOM 1419  N N    . ARG A 1 88 ? 4.598   -9.987  -1.409  1.00 0.00 ? 88 ARG A N    1  
ATOM 1420  C CA   . ARG A 1 88 ? 3.229   -9.587  -1.003  1.00 0.00 ? 88 ARG A CA   1  
ATOM 1421  C C    . ARG A 1 88 ? 3.274   -8.756  0.280   1.00 0.00 ? 88 ARG A C    1  
ATOM 1422  O O    . ARG A 1 88 ? 3.850   -9.180  1.289   1.00 0.00 ? 88 ARG A O    1  
ATOM 1423  C CB   . ARG A 1 88 ? 2.272   -10.803 -0.844  1.00 0.00 ? 88 ARG A CB   1  
ATOM 1424  C CG   . ARG A 1 88 ? 1.850   -11.437 -2.183  1.00 0.00 ? 88 ARG A CG   1  
ATOM 1425  C CD   . ARG A 1 88 ? 0.865   -12.596 -2.004  1.00 0.00 ? 88 ARG A CD   1  
ATOM 1426  N NE   . ARG A 1 88 ? 0.525   -13.223 -3.297  1.00 0.00 ? 88 ARG A NE   1  
ATOM 1427  C CZ   . ARG A 1 88 ? 0.166   -14.507 -3.468  1.00 0.00 ? 88 ARG A CZ   1  
ATOM 1428  N NH1  . ARG A 1 88 ? 0.090   -15.347 -2.436  1.00 0.00 ? 88 ARG A NH1  1  
ATOM 1429  N NH2  . ARG A 1 88 ? -0.124  -14.947 -4.680  1.00 0.00 ? 88 ARG A NH2  1  
ATOM 1430  H H    . ARG A 1 88 ? 4.806   -10.945 -1.501  1.00 0.00 ? 88 ARG A H    1  
ATOM 1431  H HA   . ARG A 1 88 ? 2.844   -8.956  -1.806  1.00 0.00 ? 88 ARG A HA   1  
ATOM 1432  H HB2  . ARG A 1 88 ? 2.763   -11.562 -0.244  1.00 0.00 ? 88 ARG A HB2  1  
ATOM 1433  H HB3  . ARG A 1 88 ? 1.369   -10.483 -0.325  1.00 0.00 ? 88 ARG A HB3  1  
ATOM 1434  H HG2  . ARG A 1 88 ? 1.382   -10.675 -2.797  1.00 0.00 ? 88 ARG A HG2  1  
ATOM 1435  H HG3  . ARG A 1 88 ? 2.736   -11.803 -2.693  1.00 0.00 ? 88 ARG A HG3  1  
ATOM 1436  H HD2  . ARG A 1 88 ? 1.313   -13.339 -1.354  1.00 0.00 ? 88 ARG A HD2  1  
ATOM 1437  H HD3  . ARG A 1 88 ? -0.044  -12.220 -1.545  1.00 0.00 ? 88 ARG A HD3  1  
ATOM 1438  H HE   . ARG A 1 88 ? 0.564   -12.644 -4.094  1.00 0.00 ? 88 ARG A HE   1  
ATOM 1439  H HH11 . ARG A 1 88 ? 0.298   -15.031 -1.506  1.00 0.00 ? 88 ARG A HH11 1  
ATOM 1440  H HH12 . ARG A 1 88 ? -0.182  -16.306 -2.584  1.00 0.00 ? 88 ARG A HH12 1  
ATOM 1441  H HH21 . ARG A 1 88 ? -0.083  -14.324 -5.469  1.00 0.00 ? 88 ARG A HH21 1  
ATOM 1442  H HH22 . ARG A 1 88 ? -0.393  -15.903 -4.816  1.00 0.00 ? 88 ARG A HH22 1  
ATOM 1443  N N    . VAL A 1 89 ? 2.690   -7.557  0.198   1.00 0.00 ? 89 VAL A N    1  
ATOM 1444  C CA   . VAL A 1 89 ? 2.755   -6.540  1.249   1.00 0.00 ? 89 VAL A CA   1  
ATOM 1445  C C    . VAL A 1 89 ? 1.575   -6.734  2.226   1.00 0.00 ? 89 VAL A C    1  
ATOM 1446  O O    . VAL A 1 89 ? 0.426   -6.481  1.843   1.00 0.00 ? 89 VAL A O    1  
ATOM 1447  C CB   . VAL A 1 89 ? 2.767   -5.101  0.606   1.00 0.00 ? 89 VAL A CB   1  
ATOM 1448  C CG1  . VAL A 1 89 ? 2.798   -3.983  1.676   1.00 0.00 ? 89 VAL A CG1  1  
ATOM 1449  C CG2  . VAL A 1 89 ? 3.965   -4.976  -0.369  1.00 0.00 ? 89 VAL A CG2  1  
ATOM 1450  H H    . VAL A 1 89 ? 2.173   -7.355  -0.616  1.00 0.00 ? 89 VAL A H    1  
ATOM 1451  H HA   . VAL A 1 89 ? 3.693   -6.671  1.787   1.00 0.00 ? 89 VAL A HA   1  
ATOM 1452  H HB   . VAL A 1 89 ? 1.858   -4.982  0.025   1.00 0.00 ? 89 VAL A HB   1  
ATOM 1453  H HG11 . VAL A 1 89 ? 3.686   -4.080  2.287   1.00 0.00 ? 89 VAL A HG11 1  
ATOM 1454  H HG12 . VAL A 1 89 ? 1.921   -4.053  2.313   1.00 0.00 ? 89 VAL A HG12 1  
ATOM 1455  H HG13 . VAL A 1 89 ? 2.802   -3.011  1.194   1.00 0.00 ? 89 VAL A HG13 1  
ATOM 1456  H HG21 . VAL A 1 89 ? 3.979   -3.991  -0.808  1.00 0.00 ? 89 VAL A HG21 1  
ATOM 1457  H HG22 . VAL A 1 89 ? 3.878   -5.717  -1.156  1.00 0.00 ? 89 VAL A HG22 1  
ATOM 1458  H HG23 . VAL A 1 89 ? 4.891   -5.136  0.168   1.00 0.00 ? 89 VAL A HG23 1  
ATOM 1459  N N    . PRO A 1 90 ? 1.845   -7.217  3.490   1.00 0.00 ? 90 PRO A N    1  
ATOM 1460  C CA   . PRO A 1 90 ? 0.787   -7.549  4.480   1.00 0.00 ? 90 PRO A CA   1  
ATOM 1461  C C    . PRO A 1 90 ? -0.113  -6.339  4.815   1.00 0.00 ? 90 PRO A C    1  
ATOM 1462  O O    . PRO A 1 90 ? 0.370   -5.256  5.143   1.00 0.00 ? 90 PRO A O    1  
ATOM 1463  C CB   . PRO A 1 90 ? 1.577   -8.059  5.727   1.00 0.00 ? 90 PRO A CB   1  
ATOM 1464  C CG   . PRO A 1 90 ? 2.986   -7.577  5.537   1.00 0.00 ? 90 PRO A CG   1  
ATOM 1465  C CD   . PRO A 1 90 ? 3.205   -7.481  4.043   1.00 0.00 ? 90 PRO A CD   1  
ATOM 1466  H HA   . PRO A 1 90 ? 0.158   -8.356  4.103   1.00 0.00 ? 90 PRO A HA   1  
ATOM 1467  H HB2  . PRO A 1 90 ? 1.144   -7.663  6.649   1.00 0.00 ? 90 PRO A HB2  1  
ATOM 1468  H HB3  . PRO A 1 90 ? 1.559   -9.141  5.761   1.00 0.00 ? 90 PRO A HB3  1  
ATOM 1469  H HG2  . PRO A 1 90 ? 3.106   -6.602  6.000   1.00 0.00 ? 90 PRO A HG2  1  
ATOM 1470  H HG3  . PRO A 1 90 ? 3.693   -8.276  5.972   1.00 0.00 ? 90 PRO A HG3  1  
ATOM 1471  H HD2  . PRO A 1 90 ? 3.880   -6.665  3.811   1.00 0.00 ? 90 PRO A HD2  1  
ATOM 1472  H HD3  . PRO A 1 90 ? 3.602   -8.411  3.648   1.00 0.00 ? 90 PRO A HD3  1  
ATOM 1473  N N    . VAL A 1 91 ? -1.430  -6.561  4.724   1.00 0.00 ? 91 VAL A N    1  
ATOM 1474  C CA   . VAL A 1 91 ? -2.451  -5.532  4.947   1.00 0.00 ? 91 VAL A CA   1  
ATOM 1475  C C    . VAL A 1 91 ? -3.011  -5.722  6.362   1.00 0.00 ? 91 VAL A C    1  
ATOM 1476  O O    . VAL A 1 91 ? -3.723  -6.703  6.626   1.00 0.00 ? 91 VAL A O    1  
ATOM 1477  C CB   . VAL A 1 91 ? -3.601  -5.641  3.872   1.00 0.00 ? 91 VAL A CB   1  
ATOM 1478  C CG1  . VAL A 1 91 ? -4.658  -4.520  4.048   1.00 0.00 ? 91 VAL A CG1  1  
ATOM 1479  C CG2  . VAL A 1 91 ? -3.008  -5.646  2.442   1.00 0.00 ? 91 VAL A CG2  1  
ATOM 1480  H H    . VAL A 1 91 ? -1.728  -7.475  4.549   1.00 0.00 ? 91 VAL A H    1  
ATOM 1481  H HA   . VAL A 1 91 ? -1.990  -4.548  4.865   1.00 0.00 ? 91 VAL A HA   1  
ATOM 1482  H HB   . VAL A 1 91 ? -4.109  -6.593  4.018   1.00 0.00 ? 91 VAL A HB   1  
ATOM 1483  H HG11 . VAL A 1 91 ? -4.190  -3.551  3.929   1.00 0.00 ? 91 VAL A HG11 1  
ATOM 1484  H HG12 . VAL A 1 91 ? -5.101  -4.580  5.037   1.00 0.00 ? 91 VAL A HG12 1  
ATOM 1485  H HG13 . VAL A 1 91 ? -5.441  -4.633  3.307   1.00 0.00 ? 91 VAL A HG13 1  
ATOM 1486  H HG21 . VAL A 1 91 ? -2.471  -4.722  2.266   1.00 0.00 ? 91 VAL A HG21 1  
ATOM 1487  H HG22 . VAL A 1 91 ? -3.803  -5.742  1.713   1.00 0.00 ? 91 VAL A HG22 1  
ATOM 1488  H HG23 . VAL A 1 91 ? -2.324  -6.480  2.331   1.00 0.00 ? 91 VAL A HG23 1  
ATOM 1489  N N    . VAL A 1 92 ? -2.683  -4.789  7.273   1.00 0.00 ? 92 VAL A N    1  
ATOM 1490  C CA   . VAL A 1 92 ? -3.051  -4.889  8.696   1.00 0.00 ? 92 VAL A CA   1  
ATOM 1491  C C    . VAL A 1 92 ? -4.216  -3.931  8.957   1.00 0.00 ? 92 VAL A C    1  
ATOM 1492  O O    . VAL A 1 92 ? -4.041  -2.713  8.887   1.00 0.00 ? 92 VAL A O    1  
ATOM 1493  C CB   . VAL A 1 92 ? -1.851  -4.530  9.655   1.00 0.00 ? 92 VAL A CB   1  
ATOM 1494  C CG1  . VAL A 1 92 ? -2.243  -4.744  11.141  1.00 0.00 ? 92 VAL A CG1  1  
ATOM 1495  C CG2  . VAL A 1 92 ? -0.573  -5.324  9.283   1.00 0.00 ? 92 VAL A CG2  1  
ATOM 1496  H H    . VAL A 1 92 ? -2.243  -3.968  6.973   1.00 0.00 ? 92 VAL A H    1  
ATOM 1497  H HA   . VAL A 1 92 ? -3.367  -5.911  8.907   1.00 0.00 ? 92 VAL A HA   1  
ATOM 1498  H HB   . VAL A 1 92 ? -1.627  -3.472  9.527   1.00 0.00 ? 92 VAL A HB   1  
ATOM 1499  H HG11 . VAL A 1 92 ? -1.409  -4.491  11.784  1.00 0.00 ? 92 VAL A HG11 1  
ATOM 1500  H HG12 . VAL A 1 92 ? -2.515  -5.778  11.304  1.00 0.00 ? 92 VAL A HG12 1  
ATOM 1501  H HG13 . VAL A 1 92 ? -3.090  -4.112  11.394  1.00 0.00 ? 92 VAL A HG13 1  
ATOM 1502  H HG21 . VAL A 1 92 ? -0.296  -5.107  8.258   1.00 0.00 ? 92 VAL A HG21 1  
ATOM 1503  H HG22 . VAL A 1 92 ? -0.762  -6.385  9.383   1.00 0.00 ? 92 VAL A HG22 1  
ATOM 1504  H HG23 . VAL A 1 92 ? 0.241   -5.042  9.939   1.00 0.00 ? 92 VAL A HG23 1  
ATOM 1505  N N    . TYR A 1 93 ? -5.398  -4.483  9.240   1.00 0.00 ? 93 TYR A N    1  
ATOM 1506  C CA   . TYR A 1 93 ? -6.609  -3.688  9.476   1.00 0.00 ? 93 TYR A CA   1  
ATOM 1507  C C    . TYR A 1 93 ? -6.558  -3.128  10.900  1.00 0.00 ? 93 TYR A C    1  
ATOM 1508  O O    . TYR A 1 93 ? -6.378  -3.882  11.865  1.00 0.00 ? 93 TYR A O    1  
ATOM 1509  C CB   . TYR A 1 93 ? -7.872  -4.554  9.260   1.00 0.00 ? 93 TYR A CB   1  
ATOM 1510  C CG   . TYR A 1 93 ? -7.892  -5.216  7.876   1.00 0.00 ? 93 TYR A CG   1  
ATOM 1511  C CD1  . TYR A 1 93 ? -8.343  -4.523  6.746   1.00 0.00 ? 93 TYR A CD1  1  
ATOM 1512  C CD2  . TYR A 1 93 ? -7.417  -6.522  7.697   1.00 0.00 ? 93 TYR A CD2  1  
ATOM 1513  C CE1  . TYR A 1 93 ? -8.317  -5.110  5.492   1.00 0.00 ? 93 TYR A CE1  1  
ATOM 1514  C CE2  . TYR A 1 93 ? -7.397  -7.109  6.453   1.00 0.00 ? 93 TYR A CE2  1  
ATOM 1515  C CZ   . TYR A 1 93 ? -7.842  -6.405  5.355   1.00 0.00 ? 93 TYR A CZ   1  
ATOM 1516  O OH   . TYR A 1 93 ? -7.797  -6.997  4.111   1.00 0.00 ? 93 TYR A OH   1  
ATOM 1517  H H    . TYR A 1 93 ? -5.455  -5.456  9.324   1.00 0.00 ? 93 TYR A H    1  
ATOM 1518  H HA   . TYR A 1 93 ? -6.619  -2.866  8.762   1.00 0.00 ? 93 TYR A HA   1  
ATOM 1519  H HB2  . TYR A 1 93 ? -7.912  -5.333  10.016  1.00 0.00 ? 93 TYR A HB2  1  
ATOM 1520  H HB3  . TYR A 1 93 ? -8.758  -3.934  9.350   1.00 0.00 ? 93 TYR A HB3  1  
ATOM 1521  H HD1  . TYR A 1 93 ? -8.711  -3.510  6.857   1.00 0.00 ? 93 TYR A HD1  1  
ATOM 1522  H HD2  . TYR A 1 93 ? -7.067  -7.078  8.557   1.00 0.00 ? 93 TYR A HD2  1  
ATOM 1523  H HE1  . TYR A 1 93 ? -8.676  -4.557  4.627   1.00 0.00 ? 93 TYR A HE1  1  
ATOM 1524  H HE2  . TYR A 1 93 ? -7.028  -8.122  6.340   1.00 0.00 ? 93 TYR A HE2  1  
ATOM 1525  H HH   . TYR A 1 93 ? -7.590  -6.329  3.442   1.00 0.00 ? 93 TYR A HH   1  
ATOM 1526  N N    . ILE A 1 94 ? -6.683  -1.809  11.010  1.00 0.00 ? 94 ILE A N    1  
ATOM 1527  C CA   . ILE A 1 94 ? -6.616  -1.066  12.273  1.00 0.00 ? 94 ILE A CA   1  
ATOM 1528  C C    . ILE A 1 94 ? -7.912  -0.241  12.390  1.00 0.00 ? 94 ILE A C    1  
ATOM 1529  O O    . ILE A 1 94 ? -8.376  0.309   11.389  1.00 0.00 ? 94 ILE A O    1  
ATOM 1530  C CB   . ILE A 1 94 ? -5.358  -0.116  12.288  1.00 0.00 ? 94 ILE A CB   1  
ATOM 1531  C CG1  . ILE A 1 94 ? -4.026  -0.933  12.232  1.00 0.00 ? 94 ILE A CG1  1  
ATOM 1532  C CG2  . ILE A 1 94 ? -5.381  0.843   13.495  1.00 0.00 ? 94 ILE A CG2  1  
ATOM 1533  C CD1  . ILE A 1 94 ? -2.759  -0.102  12.326  1.00 0.00 ? 94 ILE A CD1  1  
ATOM 1534  H H    . ILE A 1 94 ? -6.868  -1.285  10.206  1.00 0.00 ? 94 ILE A H    1  
ATOM 1535  H HA   . ILE A 1 94 ? -6.549  -1.766  13.106  1.00 0.00 ? 94 ILE A HA   1  
ATOM 1536  H HB   . ILE A 1 94 ? -5.409  0.498   11.396  1.00 0.00 ? 94 ILE A HB   1  
ATOM 1537  H HG12 . ILE A 1 94 ? -4.008  -1.640  13.049  1.00 0.00 ? 94 ILE A HG12 1  
ATOM 1538  H HG13 . ILE A 1 94 ? -3.984  -1.484  11.298  1.00 0.00 ? 94 ILE A HG13 1  
ATOM 1539  H HG21 . ILE A 1 94 ? -5.353  0.273   14.416  1.00 0.00 ? 94 ILE A HG21 1  
ATOM 1540  H HG22 . ILE A 1 94 ? -6.288  1.437   13.477  1.00 0.00 ? 94 ILE A HG22 1  
ATOM 1541  H HG23 . ILE A 1 94 ? -4.526  1.506   13.460  1.00 0.00 ? 94 ILE A HG23 1  
ATOM 1542  H HD11 . ILE A 1 94 ? -2.704  0.374   13.296  1.00 0.00 ? 94 ILE A HD11 1  
ATOM 1543  H HD12 . ILE A 1 94 ? -2.759  0.651   11.551  1.00 0.00 ? 94 ILE A HD12 1  
ATOM 1544  H HD13 . ILE A 1 94 ? -1.902  -0.747  12.196  1.00 0.00 ? 94 ILE A HD13 1  
ATOM 1545  N N    . ALA A 1 95 ? -8.514  -0.204  13.591  1.00 0.00 ? 95 ALA A N    1  
ATOM 1546  C CA   . ALA A 1 95 ? -9.700  0.618   13.861  1.00 0.00 ? 95 ALA A CA   1  
ATOM 1547  C C    . ALA A 1 95 ? -9.880  0.831   15.368  1.00 0.00 ? 95 ALA A C    1  
ATOM 1548  O O    . ALA A 1 95 ? -10.496 0.006   16.054  1.00 0.00 ? 95 ALA A O    1  
ATOM 1549  C CB   . ALA A 1 95 ? -10.958 -0.005  13.219  1.00 0.00 ? 95 ALA A CB   1  
ATOM 1550  H H    . ALA A 1 95 ? -8.165  -0.778  14.304  1.00 0.00 ? 95 ALA A H    1  
ATOM 1551  H HA   . ALA A 1 95 ? -9.541  1.592   13.401  1.00 0.00 ? 95 ALA A HA   1  
ATOM 1552  H HB1  . ALA A 1 95 ? -10.794 -0.125  12.157  1.00 0.00 ? 95 ALA A HB1  1  
ATOM 1553  H HB2  . ALA A 1 95 ? -11.811 0.643   13.379  1.00 0.00 ? 95 ALA A HB2  1  
ATOM 1554  H HB3  . ALA A 1 95 ? -11.154 -0.973  13.662  1.00 0.00 ? 95 ALA A HB3  1  
ATOM 1555  N N    . GLU A 1 96 ? -9.286  1.921   15.884  1.00 0.00 ? 96 GLU A N    1  
ATOM 1556  C CA   . GLU A 1 96 ? -9.544  2.398   17.251  1.00 0.00 ? 96 GLU A CA   1  
ATOM 1557  C C    . GLU A 1 96 ? -10.793 3.296   17.235  1.00 0.00 ? 96 GLU A C    1  
ATOM 1558  O O    . GLU A 1 96 ? -10.903 4.200   16.398  1.00 0.00 ? 96 GLU A O    1  
ATOM 1559  C CB   . GLU A 1 96 ? -8.331  3.178   17.838  1.00 0.00 ? 96 GLU A CB   1  
ATOM 1560  C CG   . GLU A 1 96 ? -7.102  2.317   18.214  1.00 0.00 ? 96 GLU A CG   1  
ATOM 1561  C CD   . GLU A 1 96 ? -6.398  1.672   17.016  1.00 0.00 ? 96 GLU A CD   1  
ATOM 1562  O OE1  . GLU A 1 96 ? -5.737  2.408   16.256  1.00 0.00 ? 96 GLU A OE1  1  
ATOM 1563  O OE2  . GLU A 1 96 ? -6.484  0.437   16.834  1.00 0.00 ? 96 GLU A OE2  1  
ATOM 1564  H H    . GLU A 1 96 ? -8.658  2.421   15.322  1.00 0.00 ? 96 GLU A H    1  
ATOM 1565  H HA   . GLU A 1 96 ? -9.742  1.527   17.885  1.00 0.00 ? 96 GLU A HA   1  
ATOM 1566  H HB2  . GLU A 1 96 ? -8.014  3.922   17.114  1.00 0.00 ? 96 GLU A HB2  1  
ATOM 1567  H HB3  . GLU A 1 96 ? -8.660  3.698   18.736  1.00 0.00 ? 96 GLU A HB3  1  
ATOM 1568  H HG2  . GLU A 1 96 ? -6.379  2.948   18.727  1.00 0.00 ? 96 GLU A HG2  1  
ATOM 1569  H HG3  . GLU A 1 96 ? -7.424  1.541   18.896  1.00 0.00 ? 96 GLU A HG3  1  
ATOM 1570  N N    . SER A 1 97 ? -11.727 3.033   18.168  1.00 0.00 ? 97 SER A N    1  
ATOM 1571  C CA   . SER A 1 97 ? -12.959 3.826   18.340  1.00 0.00 ? 97 SER A CA   1  
ATOM 1572  C C    . SER A 1 97 ? -12.644 5.256   18.825  1.00 0.00 ? 97 SER A C    1  
ATOM 1573  O O    . SER A 1 97 ? -13.478 6.162   18.676  1.00 0.00 ? 97 SER A O    1  
ATOM 1574  C CB   . SER A 1 97 ? -13.924 3.114   19.321  1.00 0.00 ? 97 SER A CB   1  
ATOM 1575  O OG   . SER A 1 97 ? -15.155 3.821   19.464  1.00 0.00 ? 97 SER A OG   1  
ATOM 1576  H H    . SER A 1 97 ? -11.575 2.274   18.770  1.00 0.00 ? 97 SER A H    1  
ATOM 1577  H HA   . SER A 1 97 ? -13.441 3.895   17.373  1.00 0.00 ? 97 SER A HA   1  
ATOM 1578  H HB2  . SER A 1 97 ? -14.143 2.123   18.946  1.00 0.00 ? 97 SER A HB2  1  
ATOM 1579  H HB3  . SER A 1 97 ? -13.462 3.025   20.300  1.00 0.00 ? 97 SER A HB3  1  
ATOM 1580  H HG   . SER A 1 97 ? -15.101 4.658   18.984  1.00 0.00 ? 97 SER A HG   1  
ATOM 1581  N N    . ASP A 1 98 ? -11.429 5.426   19.388  1.00 0.00 ? 98 ASP A N    1  
ATOM 1582  C CA   . ASP A 1 98 ? -10.913 6.704   19.896  1.00 0.00 ? 98 ASP A CA   1  
ATOM 1583  C C    . ASP A 1 98 ? -10.837 7.769   18.785  1.00 0.00 ? 98 ASP A C    1  
ATOM 1584  O O    . ASP A 1 98 ? -11.066 8.957   19.039  1.00 0.00 ? 98 ASP A O    1  
ATOM 1585  C CB   . ASP A 1 98 ? -9.513  6.469   20.521  1.00 0.00 ? 98 ASP A CB   1  
ATOM 1586  C CG   . ASP A 1 98 ? -8.965  7.706   21.257  1.00 0.00 ? 98 ASP A CG   1  
ATOM 1587  O OD1  . ASP A 1 98 ? -9.271  7.872   22.454  1.00 0.00 ? 98 ASP A OD1  1  
ATOM 1588  O OD2  . ASP A 1 98 ? -8.212  8.506   20.655  1.00 0.00 ? 98 ASP A OD2  1  
ATOM 1589  H H    . ASP A 1 98 ? -10.847 4.637   19.468  1.00 0.00 ? 98 ASP A H    1  
ATOM 1590  H HA   . ASP A 1 98 ? -11.589 7.054   20.668  1.00 0.00 ? 98 ASP A HA   1  
ATOM 1591  H HB2  . ASP A 1 98 ? -9.581  5.646   21.228  1.00 0.00 ? 98 ASP A HB2  1  
ATOM 1592  H HB3  . ASP A 1 98 ? -8.809  6.179   19.740  1.00 0.00 ? 98 ASP A HB3  1  
ATOM 1593  N N    . GLY A 1 99 ? -10.500 7.325   17.559  1.00 0.00 ? 99 GLY A N    1  
ATOM 1594  C CA   . GLY A 1 99 ? -10.414 8.216   16.402  1.00 0.00 ? 99 GLY A CA   1  
ATOM 1595  C C    . GLY A 1 99 ? -11.741 8.278   15.648  1.00 0.00 ? 99 GLY A C    1  
ATOM 1596  O O    . GLY A 1 99 ? -11.949 7.480   14.710  1.00 0.00 ? 99 GLY A O    1  
ATOM 1597  O OXT  . GLY A 1 99 ? -12.595 9.116   16.000  1.00 0.00 ? 99 GLY A OXT  1  
ATOM 1598  H H    . GLY A 1 99 ? -10.309 6.370   17.435  1.00 0.00 ? 99 GLY A H    1  
ATOM 1599  H HA2  . GLY A 1 99 ? -10.125 9.215   16.721  1.00 0.00 ? 99 GLY A HA2  1  
ATOM 1600  H HA3  . GLY A 1 99 ? -9.645  7.839   15.740  1.00 0.00 ? 99 GLY A HA3  1  
ATOM 1601  N N    . MET A 1 1  ? 20.559  6.073   18.729  1.00 0.00 ? 1  MET A N    2  
ATOM 1602  C CA   . MET A 1 1  ? 19.525  5.438   17.875  1.00 0.00 ? 1  MET A CA   2  
ATOM 1603  C C    . MET A 1 1  ? 18.385  4.890   18.737  1.00 0.00 ? 1  MET A C    2  
ATOM 1604  O O    . MET A 1 1  ? 17.218  5.267   18.560  1.00 0.00 ? 1  MET A O    2  
ATOM 1605  C CB   . MET A 1 1  ? 20.148  4.298   17.018  1.00 0.00 ? 1  MET A CB   2  
ATOM 1606  C CG   . MET A 1 1  ? 19.135  3.471   16.202  1.00 0.00 ? 1  MET A CG   2  
ATOM 1607  S SD   . MET A 1 1  ? 19.918  2.183   15.210  1.00 0.00 ? 1  MET A SD   2  
ATOM 1608  C CE   . MET A 1 1  ? 18.494  1.326   14.538  1.00 0.00 ? 1  MET A CE   2  
ATOM 1609  H H1   . MET A 1 1  ? 20.924  5.391   19.423  1.00 0.00 ? 1  MET A H1   2  
ATOM 1610  H H2   . MET A 1 1  ? 20.155  6.883   19.240  1.00 0.00 ? 1  MET A H2   2  
ATOM 1611  H H3   . MET A 1 1  ? 21.352  6.410   18.145  1.00 0.00 ? 1  MET A H3   2  
ATOM 1612  H HA   . MET A 1 1  ? 19.128  6.203   17.215  1.00 0.00 ? 1  MET A HA   2  
ATOM 1613  H HB2  . MET A 1 1  ? 20.858  4.734   16.325  1.00 0.00 ? 1  MET A HB2  2  
ATOM 1614  H HB3  . MET A 1 1  ? 20.685  3.621   17.675  1.00 0.00 ? 1  MET A HB3  2  
ATOM 1615  H HG2  . MET A 1 1  ? 18.436  3.001   16.882  1.00 0.00 ? 1  MET A HG2  2  
ATOM 1616  H HG3  . MET A 1 1  ? 18.598  4.134   15.536  1.00 0.00 ? 1  MET A HG3  2  
ATOM 1617  H HE1  . MET A 1 1  ? 17.890  2.020   13.971  1.00 0.00 ? 1  MET A HE1  2  
ATOM 1618  H HE2  . MET A 1 1  ? 17.906  0.910   15.342  1.00 0.00 ? 1  MET A HE2  2  
ATOM 1619  H HE3  . MET A 1 1  ? 18.830  0.530   13.887  1.00 0.00 ? 1  MET A HE3  2  
ATOM 1620  N N    . GLY A 1 2  ? 18.742  4.003   19.682  1.00 0.00 ? 2  GLY A N    2  
ATOM 1621  C CA   . GLY A 1 2  ? 17.752  3.272   20.462  1.00 0.00 ? 2  GLY A CA   2  
ATOM 1622  C C    . GLY A 1 2  ? 17.062  2.208   19.624  1.00 0.00 ? 2  GLY A C    2  
ATOM 1623  O O    . GLY A 1 2  ? 15.934  2.410   19.161  1.00 0.00 ? 2  GLY A O    2  
ATOM 1624  H H    . GLY A 1 2  ? 19.694  3.849   19.857  1.00 0.00 ? 2  GLY A H    2  
ATOM 1625  H HA2  . GLY A 1 2  ? 18.250  2.798   21.299  1.00 0.00 ? 2  GLY A HA2  2  
ATOM 1626  H HA3  . GLY A 1 2  ? 17.014  3.965   20.848  1.00 0.00 ? 2  GLY A HA3  2  
ATOM 1627  N N    . HIS A 1 3  ? 17.751  1.069   19.421  1.00 0.00 ? 3  HIS A N    2  
ATOM 1628  C CA   . HIS A 1 3  ? 17.219  -0.064  18.636  1.00 0.00 ? 3  HIS A CA   2  
ATOM 1629  C C    . HIS A 1 3  ? 16.342  -0.992  19.502  1.00 0.00 ? 3  HIS A C    2  
ATOM 1630  O O    . HIS A 1 3  ? 16.102  -2.142  19.146  1.00 0.00 ? 3  HIS A O    2  
ATOM 1631  C CB   . HIS A 1 3  ? 18.374  -0.844  17.938  1.00 0.00 ? 3  HIS A CB   2  
ATOM 1632  C CG   . HIS A 1 3  ? 19.393  -1.507  18.848  1.00 0.00 ? 3  HIS A CG   2  
ATOM 1633  N ND1  . HIS A 1 3  ? 20.676  -1.027  19.011  1.00 0.00 ? 3  HIS A ND1  2  
ATOM 1634  C CD2  . HIS A 1 3  ? 19.330  -2.640  19.603  1.00 0.00 ? 3  HIS A CD2  2  
ATOM 1635  C CE1  . HIS A 1 3  ? 21.349  -1.823  19.818  1.00 0.00 ? 3  HIS A CE1  2  
ATOM 1636  N NE2  . HIS A 1 3  ? 20.559  -2.806  20.195  1.00 0.00 ? 3  HIS A NE2  2  
ATOM 1637  H H    . HIS A 1 3  ? 18.636  0.981   19.827  1.00 0.00 ? 3  HIS A H    2  
ATOM 1638  H HA   . HIS A 1 3  ? 16.575  0.347   17.860  1.00 0.00 ? 3  HIS A HA   2  
ATOM 1639  H HB2  . HIS A 1 3  ? 17.943  -1.625  17.322  1.00 0.00 ? 3  HIS A HB2  2  
ATOM 1640  H HB3  . HIS A 1 3  ? 18.906  -0.159  17.287  1.00 0.00 ? 3  HIS A HB3  2  
ATOM 1641  H HD1  . HIS A 1 3  ? 21.039  -0.215  18.596  1.00 0.00 ? 3  HIS A HD1  2  
ATOM 1642  H HD2  . HIS A 1 3  ? 18.473  -3.292  19.710  1.00 0.00 ? 3  HIS A HD2  2  
ATOM 1643  H HE1  . HIS A 1 3  ? 22.381  -1.701  20.108  1.00 0.00 ? 3  HIS A HE1  2  
ATOM 1644  H HE2  . HIS A 1 3  ? 20.762  -3.443  20.916  1.00 0.00 ? 3  HIS A HE2  2  
ATOM 1645  N N    . HIS A 1 4  ? 15.866  -0.479  20.649  1.00 0.00 ? 4  HIS A N    2  
ATOM 1646  C CA   . HIS A 1 4  ? 14.825  -1.130  21.461  1.00 0.00 ? 4  HIS A CA   2  
ATOM 1647  C C    . HIS A 1 4  ? 13.449  -0.950  20.790  1.00 0.00 ? 4  HIS A C    2  
ATOM 1648  O O    . HIS A 1 4  ? 13.368  -0.561  19.621  1.00 0.00 ? 4  HIS A O    2  
ATOM 1649  C CB   . HIS A 1 4  ? 14.817  -0.534  22.902  1.00 0.00 ? 4  HIS A CB   2  
ATOM 1650  C CG   . HIS A 1 4  ? 16.026  -0.877  23.724  1.00 0.00 ? 4  HIS A CG   2  
ATOM 1651  N ND1  . HIS A 1 4  ? 16.780  0.057   24.415  1.00 0.00 ? 4  HIS A ND1  2  
ATOM 1652  C CD2  . HIS A 1 4  ? 16.580  -2.076  24.004  1.00 0.00 ? 4  HIS A CD2  2  
ATOM 1653  C CE1  . HIS A 1 4  ? 17.742  -0.562  25.076  1.00 0.00 ? 4  HIS A CE1  2  
ATOM 1654  N NE2  . HIS A 1 4  ? 17.638  -1.852  24.841  1.00 0.00 ? 4  HIS A NE2  2  
ATOM 1655  H H    . HIS A 1 4  ? 16.226  0.372   20.962  1.00 0.00 ? 4  HIS A H    2  
ATOM 1656  H HA   . HIS A 1 4  ? 15.044  -2.192  21.510  1.00 0.00 ? 4  HIS A HA   2  
ATOM 1657  H HB2  . HIS A 1 4  ? 14.753  0.544   22.844  1.00 0.00 ? 4  HIS A HB2  2  
ATOM 1658  H HB3  . HIS A 1 4  ? 13.946  -0.902  23.437  1.00 0.00 ? 4  HIS A HB3  2  
ATOM 1659  H HD1  . HIS A 1 4  ? 16.635  1.026   24.420  1.00 0.00 ? 4  HIS A HD1  2  
ATOM 1660  H HD2  . HIS A 1 4  ? 16.243  -3.039  23.637  1.00 0.00 ? 4  HIS A HD2  2  
ATOM 1661  H HE1  . HIS A 1 4  ? 18.492  -0.089  25.701  1.00 0.00 ? 4  HIS A HE1  2  
ATOM 1662  H HE2  . HIS A 1 4  ? 18.263  -2.532  25.155  1.00 0.00 ? 4  HIS A HE2  2  
ATOM 1663  N N    . HIS A 1 5  ? 12.367  -1.275  21.518  1.00 0.00 ? 5  HIS A N    2  
ATOM 1664  C CA   . HIS A 1 5  ? 10.997  -0.965  21.077  1.00 0.00 ? 5  HIS A CA   2  
ATOM 1665  C C    . HIS A 1 5  ? 10.802  0.565   21.072  1.00 0.00 ? 5  HIS A C    2  
ATOM 1666  O O    . HIS A 1 5  ? 10.439  1.156   22.093  1.00 0.00 ? 5  HIS A O    2  
ATOM 1667  C CB   . HIS A 1 5  ? 9.939   -1.661  21.974  1.00 0.00 ? 5  HIS A CB   2  
ATOM 1668  C CG   . HIS A 1 5  ? 9.966   -3.167  21.916  1.00 0.00 ? 5  HIS A CG   2  
ATOM 1669  N ND1  . HIS A 1 5  ? 10.384  -3.961  22.963  1.00 0.00 ? 5  HIS A ND1  2  
ATOM 1670  C CD2  . HIS A 1 5  ? 9.580   -4.023  20.937  1.00 0.00 ? 5  HIS A CD2  2  
ATOM 1671  C CE1  . HIS A 1 5  ? 10.255  -5.229  22.632  1.00 0.00 ? 5  HIS A CE1  2  
ATOM 1672  N NE2  . HIS A 1 5  ? 9.769   -5.299  21.409  1.00 0.00 ? 5  HIS A NE2  2  
ATOM 1673  H H    . HIS A 1 5  ? 12.498  -1.742  22.368  1.00 0.00 ? 5  HIS A H    2  
ATOM 1674  H HA   . HIS A 1 5  ? 10.889  -1.332  20.059  1.00 0.00 ? 5  HIS A HA   2  
ATOM 1675  H HB2  . HIS A 1 5  ? 10.097  -1.366  23.006  1.00 0.00 ? 5  HIS A HB2  2  
ATOM 1676  H HB3  . HIS A 1 5  ? 8.949   -1.338  21.670  1.00 0.00 ? 5  HIS A HB3  2  
ATOM 1677  H HD1  . HIS A 1 5  ? 10.724  -3.639  23.826  1.00 0.00 ? 5  HIS A HD1  2  
ATOM 1678  H HD2  . HIS A 1 5  ? 9.191   -3.752  19.963  1.00 0.00 ? 5  HIS A HD2  2  
ATOM 1679  H HE1  . HIS A 1 5  ? 10.506  -6.073  23.259  1.00 0.00 ? 5  HIS A HE1  2  
ATOM 1680  H HE2  . HIS A 1 5  ? 9.354   -6.104  21.023  1.00 0.00 ? 5  HIS A HE2  2  
ATOM 1681  N N    . HIS A 1 6  ? 11.124  1.199   19.927  1.00 0.00 ? 6  HIS A N    2  
ATOM 1682  C CA   . HIS A 1 6  ? 11.070  2.657   19.764  1.00 0.00 ? 6  HIS A CA   2  
ATOM 1683  C C    . HIS A 1 6  ? 9.927   3.037   18.805  1.00 0.00 ? 6  HIS A C    2  
ATOM 1684  O O    . HIS A 1 6  ? 10.058  2.978   17.583  1.00 0.00 ? 6  HIS A O    2  
ATOM 1685  C CB   . HIS A 1 6  ? 12.454  3.216   19.309  1.00 0.00 ? 6  HIS A CB   2  
ATOM 1686  C CG   . HIS A 1 6  ? 12.919  2.822   17.928  1.00 0.00 ? 6  HIS A CG   2  
ATOM 1687  N ND1  . HIS A 1 6  ? 12.993  3.712   16.880  1.00 0.00 ? 6  HIS A ND1  2  
ATOM 1688  C CD2  . HIS A 1 6  ? 13.309  1.633   17.414  1.00 0.00 ? 6  HIS A CD2  2  
ATOM 1689  C CE1  . HIS A 1 6  ? 13.406  3.091   15.805  1.00 0.00 ? 6  HIS A CE1  2  
ATOM 1690  N NE2  . HIS A 1 6  ? 13.602  1.824   16.092  1.00 0.00 ? 6  HIS A NE2  2  
ATOM 1691  H H    . HIS A 1 6  ? 11.407  0.655   19.163  1.00 0.00 ? 6  HIS A H    2  
ATOM 1692  H HA   . HIS A 1 6  ? 10.844  3.090   20.737  1.00 0.00 ? 6  HIS A HA   2  
ATOM 1693  H HB2  . HIS A 1 6  ? 12.421  4.297   19.345  1.00 0.00 ? 6  HIS A HB2  2  
ATOM 1694  H HB3  . HIS A 1 6  ? 13.211  2.875   20.011  1.00 0.00 ? 6  HIS A HB3  2  
ATOM 1695  H HD1  . HIS A 1 6  ? 12.801  4.675   16.935  1.00 0.00 ? 6  HIS A HD1  2  
ATOM 1696  H HD2  . HIS A 1 6  ? 13.388  0.700   17.954  1.00 0.00 ? 6  HIS A HD2  2  
ATOM 1697  H HE1  . HIS A 1 6  ? 13.545  3.542   14.834  1.00 0.00 ? 6  HIS A HE1  2  
ATOM 1698  H HE2  . HIS A 1 6  ? 13.644  1.108   15.423  1.00 0.00 ? 6  HIS A HE2  2  
ATOM 1699  N N    . HIS A 1 7  ? 8.762   3.345   19.378  1.00 0.00 ? 7  HIS A N    2  
ATOM 1700  C CA   . HIS A 1 7  ? 7.576   3.791   18.626  1.00 0.00 ? 7  HIS A CA   2  
ATOM 1701  C C    . HIS A 1 7  ? 6.994   5.021   19.327  1.00 0.00 ? 7  HIS A C    2  
ATOM 1702  O O    . HIS A 1 7  ? 5.797   5.062   19.645  1.00 0.00 ? 7  HIS A O    2  
ATOM 1703  C CB   . HIS A 1 7  ? 6.519   2.647   18.496  1.00 0.00 ? 7  HIS A CB   2  
ATOM 1704  C CG   . HIS A 1 7  ? 6.912   1.534   17.552  1.00 0.00 ? 7  HIS A CG   2  
ATOM 1705  N ND1  . HIS A 1 7  ? 6.386   1.409   16.286  1.00 0.00 ? 7  HIS A ND1  2  
ATOM 1706  C CD2  . HIS A 1 7  ? 7.769   0.489   17.697  1.00 0.00 ? 7  HIS A CD2  2  
ATOM 1707  C CE1  . HIS A 1 7  ? 6.894   0.347   15.702  1.00 0.00 ? 7  HIS A CE1  2  
ATOM 1708  N NE2  . HIS A 1 7  ? 7.736   -0.231  16.531  1.00 0.00 ? 7  HIS A NE2  2  
ATOM 1709  H H    . HIS A 1 7  ? 8.697   3.288   20.355  1.00 0.00 ? 7  HIS A H    2  
ATOM 1710  H HA   . HIS A 1 7  ? 7.893   4.095   17.631  1.00 0.00 ? 7  HIS A HA   2  
ATOM 1711  H HB2  . HIS A 1 7  ? 6.348   2.205   19.471  1.00 0.00 ? 7  HIS A HB2  2  
ATOM 1712  H HB3  . HIS A 1 7  ? 5.581   3.069   18.141  1.00 0.00 ? 7  HIS A HB3  2  
ATOM 1713  H HD1  . HIS A 1 7  ? 5.750   2.023   15.869  1.00 0.00 ? 7  HIS A HD1  2  
ATOM 1714  H HD2  . HIS A 1 7  ? 8.377   0.273   18.567  1.00 0.00 ? 7  HIS A HD2  2  
ATOM 1715  H HE1  . HIS A 1 7  ? 6.663   0.010   14.703  1.00 0.00 ? 7  HIS A HE1  2  
ATOM 1716  H HE2  . HIS A 1 7  ? 8.387   -0.921  16.275  1.00 0.00 ? 7  HIS A HE2  2  
ATOM 1717  N N    . HIS A 1 8  ? 7.875   6.018   19.568  1.00 0.00 ? 8  HIS A N    2  
ATOM 1718  C CA   . HIS A 1 8  ? 7.525   7.284   20.233  1.00 0.00 ? 8  HIS A CA   2  
ATOM 1719  C C    . HIS A 1 8  ? 6.348   7.979   19.521  1.00 0.00 ? 8  HIS A C    2  
ATOM 1720  O O    . HIS A 1 8  ? 6.503   8.558   18.443  1.00 0.00 ? 8  HIS A O    2  
ATOM 1721  C CB   . HIS A 1 8  ? 8.761   8.222   20.310  1.00 0.00 ? 8  HIS A CB   2  
ATOM 1722  C CG   . HIS A 1 8  ? 8.470   9.610   20.841  1.00 0.00 ? 8  HIS A CG   2  
ATOM 1723  N ND1  . HIS A 1 8  ? 8.480   10.734  20.041  1.00 0.00 ? 8  HIS A ND1  2  
ATOM 1724  C CD2  . HIS A 1 8  ? 8.157   10.049  22.089  1.00 0.00 ? 8  HIS A CD2  2  
ATOM 1725  C CE1  . HIS A 1 8  ? 8.185   11.794  20.768  1.00 0.00 ? 8  HIS A CE1  2  
ATOM 1726  N NE2  . HIS A 1 8  ? 7.986   11.410  22.010  1.00 0.00 ? 8  HIS A NE2  2  
ATOM 1727  H H    . HIS A 1 8  ? 8.804   5.887   19.286  1.00 0.00 ? 8  HIS A H    2  
ATOM 1728  H HA   . HIS A 1 8  ? 7.223   7.034   21.248  1.00 0.00 ? 8  HIS A HA   2  
ATOM 1729  H HB2  . HIS A 1 8  ? 9.504   7.771   20.953  1.00 0.00 ? 8  HIS A HB2  2  
ATOM 1730  H HB3  . HIS A 1 8  ? 9.184   8.326   19.316  1.00 0.00 ? 8  HIS A HB3  2  
ATOM 1731  H HD1  . HIS A 1 8  ? 8.684   10.749  19.081  1.00 0.00 ? 8  HIS A HD1  2  
ATOM 1732  H HD2  . HIS A 1 8  ? 8.041   9.439   22.975  1.00 0.00 ? 8  HIS A HD2  2  
ATOM 1733  H HE1  . HIS A 1 8  ? 8.108   12.807  20.402  1.00 0.00 ? 8  HIS A HE1  2  
ATOM 1734  H HE2  . HIS A 1 8  ? 7.932   12.020  22.781  1.00 0.00 ? 8  HIS A HE2  2  
ATOM 1735  N N    . SER A 1 9  ? 5.171   7.852   20.133  1.00 0.00 ? 9  SER A N    2  
ATOM 1736  C CA   . SER A 1 9  ? 3.950   8.522   19.702  1.00 0.00 ? 9  SER A CA   2  
ATOM 1737  C C    . SER A 1 9  ? 4.010   10.019  20.077  1.00 0.00 ? 9  SER A C    2  
ATOM 1738  O O    . SER A 1 9  ? 4.592   10.382  21.110  1.00 0.00 ? 9  SER A O    2  
ATOM 1739  C CB   . SER A 1 9  ? 2.754   7.804   20.365  1.00 0.00 ? 9  SER A CB   2  
ATOM 1740  O OG   . SER A 1 9  ? 2.927   7.697   21.774  1.00 0.00 ? 9  SER A OG   2  
ATOM 1741  H H    . SER A 1 9  ? 5.120   7.273   20.925  1.00 0.00 ? 9  SER A H    2  
ATOM 1742  H HA   . SER A 1 9  ? 3.868   8.427   18.623  1.00 0.00 ? 9  SER A HA   2  
ATOM 1743  H HB2  . SER A 1 9  ? 1.841   8.350   20.171  1.00 0.00 ? 9  SER A HB2  2  
ATOM 1744  H HB3  . SER A 1 9  ? 2.659   6.804   19.955  1.00 0.00 ? 9  SER A HB3  2  
ATOM 1745  H HG   . SER A 1 9  ? 2.236   7.143   22.140  1.00 0.00 ? 9  SER A HG   2  
ATOM 1746  N N    . HIS A 1 10 ? 3.427   10.880  19.227  1.00 0.00 ? 10 HIS A N    2  
ATOM 1747  C CA   . HIS A 1 10 ? 3.437   12.342  19.420  1.00 0.00 ? 10 HIS A CA   2  
ATOM 1748  C C    . HIS A 1 10 ? 2.209   12.981  18.745  1.00 0.00 ? 10 HIS A C    2  
ATOM 1749  O O    . HIS A 1 10 ? 2.307   13.590  17.672  1.00 0.00 ? 10 HIS A O    2  
ATOM 1750  C CB   . HIS A 1 10 ? 4.790   12.970  18.943  1.00 0.00 ? 10 HIS A CB   2  
ATOM 1751  C CG   . HIS A 1 10 ? 5.277   12.499  17.598  1.00 0.00 ? 10 HIS A CG   2  
ATOM 1752  N ND1  . HIS A 1 10 ? 4.959   13.125  16.421  1.00 0.00 ? 10 HIS A ND1  2  
ATOM 1753  C CD2  . HIS A 1 10 ? 6.080   11.462  17.259  1.00 0.00 ? 10 HIS A CD2  2  
ATOM 1754  C CE1  . HIS A 1 10 ? 5.547   12.505  15.419  1.00 0.00 ? 10 HIS A CE1  2  
ATOM 1755  N NE2  . HIS A 1 10 ? 6.230   11.491  15.900  1.00 0.00 ? 10 HIS A NE2  2  
ATOM 1756  H H    . HIS A 1 10 ? 2.956   10.521  18.442  1.00 0.00 ? 10 HIS A H    2  
ATOM 1757  H HA   . HIS A 1 10 ? 3.344   12.529  20.488  1.00 0.00 ? 10 HIS A HA   2  
ATOM 1758  H HB2  . HIS A 1 10 ? 4.692   14.048  18.894  1.00 0.00 ? 10 HIS A HB2  2  
ATOM 1759  H HB3  . HIS A 1 10 ? 5.560   12.732  19.669  1.00 0.00 ? 10 HIS A HB3  2  
ATOM 1760  H HD1  . HIS A 1 10 ? 4.382   13.913  16.333  1.00 0.00 ? 10 HIS A HD1  2  
ATOM 1761  H HD2  . HIS A 1 10 ? 6.522   10.743  17.938  1.00 0.00 ? 10 HIS A HD2  2  
ATOM 1762  H HE1  . HIS A 1 10 ? 5.495   12.793  14.381  1.00 0.00 ? 10 HIS A HE1  2  
ATOM 1763  H HE2  . HIS A 1 10 ? 6.620   10.770  15.354  1.00 0.00 ? 10 HIS A HE2  2  
ATOM 1764  N N    . MET A 1 11 ? 1.044   12.783  19.409  1.00 0.00 ? 11 MET A N    2  
ATOM 1765  C CA   . MET A 1 11 ? -0.286  13.291  18.998  1.00 0.00 ? 11 MET A CA   2  
ATOM 1766  C C    . MET A 1 11 ? -0.679  12.827  17.569  1.00 0.00 ? 11 MET A C    2  
ATOM 1767  O O    . MET A 1 11 ? -1.276  11.758  17.404  1.00 0.00 ? 11 MET A O    2  
ATOM 1768  C CB   . MET A 1 11 ? -0.391  14.840  19.178  1.00 0.00 ? 11 MET A CB   2  
ATOM 1769  C CG   . MET A 1 11 ? -0.185  15.311  20.626  1.00 0.00 ? 11 MET A CG   2  
ATOM 1770  S SD   . MET A 1 11 ? -0.289  17.104  20.842  1.00 0.00 ? 11 MET A SD   2  
ATOM 1771  C CE   . MET A 1 11 ? 1.113   17.676  19.885  1.00 0.00 ? 11 MET A CE   2  
ATOM 1772  H H    . MET A 1 11 ? 1.083   12.245  20.228  1.00 0.00 ? 11 MET A H    2  
ATOM 1773  H HA   . MET A 1 11 ? -0.999  12.834  19.690  1.00 0.00 ? 11 MET A HA   2  
ATOM 1774  H HB2  . MET A 1 11 ? 0.354   15.317  18.556  1.00 0.00 ? 11 MET A HB2  2  
ATOM 1775  H HB3  . MET A 1 11 ? -1.373  15.167  18.856  1.00 0.00 ? 11 MET A HB3  2  
ATOM 1776  H HG2  . MET A 1 11 ? -0.941  14.855  21.253  1.00 0.00 ? 11 MET A HG2  2  
ATOM 1777  H HG3  . MET A 1 11 ? 0.790   14.982  20.960  1.00 0.00 ? 11 MET A HG3  2  
ATOM 1778  H HE1  . MET A 1 11 ? 2.021   17.223  20.259  1.00 0.00 ? 11 MET A HE1  2  
ATOM 1779  H HE2  . MET A 1 11 ? 1.189   18.750  19.967  1.00 0.00 ? 11 MET A HE2  2  
ATOM 1780  H HE3  . MET A 1 11 ? 0.975   17.405  18.848  1.00 0.00 ? 11 MET A HE3  2  
ATOM 1781  N N    . LYS A 1 12 ? -0.318  13.621  16.544  1.00 0.00 ? 12 LYS A N    2  
ATOM 1782  C CA   . LYS A 1 12 ? -0.675  13.356  15.131  1.00 0.00 ? 12 LYS A CA   2  
ATOM 1783  C C    . LYS A 1 12 ? 0.540   13.619  14.230  1.00 0.00 ? 12 LYS A C    2  
ATOM 1784  O O    . LYS A 1 12 ? 1.279   14.578  14.463  1.00 0.00 ? 12 LYS A O    2  
ATOM 1785  C CB   . LYS A 1 12 ? -1.845  14.273  14.669  1.00 0.00 ? 12 LYS A CB   2  
ATOM 1786  C CG   . LYS A 1 12 ? -3.152  14.116  15.467  1.00 0.00 ? 12 LYS A CG   2  
ATOM 1787  C CD   . LYS A 1 12 ? -4.290  14.996  14.910  1.00 0.00 ? 12 LYS A CD   2  
ATOM 1788  C CE   . LYS A 1 12 ? -5.605  14.827  15.691  1.00 0.00 ? 12 LYS A CE   2  
ATOM 1789  N NZ   . LYS A 1 12 ? -5.512  15.329  17.090  1.00 0.00 ? 12 LYS A NZ   2  
ATOM 1790  H H    . LYS A 1 12 ? 0.235   14.406  16.735  1.00 0.00 ? 12 LYS A H    2  
ATOM 1791  H HA   . LYS A 1 12 ? -0.975  12.312  15.033  1.00 0.00 ? 12 LYS A HA   2  
ATOM 1792  H HB2  . LYS A 1 12 ? -1.531  15.310  14.743  1.00 0.00 ? 12 LYS A HB2  2  
ATOM 1793  H HB3  . LYS A 1 12 ? -2.062  14.055  13.627  1.00 0.00 ? 12 LYS A HB3  2  
ATOM 1794  H HG2  . LYS A 1 12 ? -3.463  13.073  15.431  1.00 0.00 ? 12 LYS A HG2  2  
ATOM 1795  H HG3  . LYS A 1 12 ? -2.967  14.390  16.499  1.00 0.00 ? 12 LYS A HG3  2  
ATOM 1796  H HD2  . LYS A 1 12 ? -3.988  16.039  14.955  1.00 0.00 ? 12 LYS A HD2  2  
ATOM 1797  H HD3  . LYS A 1 12 ? -4.464  14.728  13.870  1.00 0.00 ? 12 LYS A HD3  2  
ATOM 1798  H HE2  . LYS A 1 12 ? -6.386  15.370  15.182  1.00 0.00 ? 12 LYS A HE2  2  
ATOM 1799  H HE3  . LYS A 1 12 ? -5.864  13.774  15.717  1.00 0.00 ? 12 LYS A HE3  2  
ATOM 1800  H HZ1  . LYS A 1 12 ? -4.735  14.861  17.592  1.00 0.00 ? 12 LYS A HZ1  2  
ATOM 1801  H HZ2  . LYS A 1 12 ? -6.399  15.142  17.596  1.00 0.00 ? 12 LYS A HZ2  2  
ATOM 1802  H HZ3  . LYS A 1 12 ? -5.339  16.356  17.093  1.00 0.00 ? 12 LYS A HZ3  2  
ATOM 1803  N N    . ARG A 1 13 ? 0.720   12.775  13.199  1.00 0.00 ? 13 ARG A N    2  
ATOM 1804  C CA   . ARG A 1 13 ? 1.759   12.962  12.178  1.00 0.00 ? 13 ARG A CA   2  
ATOM 1805  C C    . ARG A 1 13 ? 1.554   11.972  11.023  1.00 0.00 ? 13 ARG A C    2  
ATOM 1806  O O    . ARG A 1 13 ? 1.275   12.380  9.885   1.00 0.00 ? 13 ARG A O    2  
ATOM 1807  C CB   . ARG A 1 13 ? 3.184   12.775  12.786  1.00 0.00 ? 13 ARG A CB   2  
ATOM 1808  C CG   . ARG A 1 13 ? 4.371   12.947  11.802  1.00 0.00 ? 13 ARG A CG   2  
ATOM 1809  C CD   . ARG A 1 13 ? 4.482   14.368  11.207  1.00 0.00 ? 13 ARG A CD   2  
ATOM 1810  N NE   . ARG A 1 13 ? 3.525   14.622  10.108  1.00 0.00 ? 13 ARG A NE   2  
ATOM 1811  C CZ   . ARG A 1 13 ? 3.149   15.839  9.673   1.00 0.00 ? 13 ARG A CZ   2  
ATOM 1812  N NH1  . ARG A 1 13 ? 3.654   16.954  10.212  1.00 0.00 ? 13 ARG A NH1  2  
ATOM 1813  N NH2  . ARG A 1 13 ? 2.290   15.946  8.675   1.00 0.00 ? 13 ARG A NH2  2  
ATOM 1814  H H    . ARG A 1 13 ? 0.131   12.001  13.125  1.00 0.00 ? 13 ARG A H    2  
ATOM 1815  H HA   . ARG A 1 13 ? 1.672   13.974  11.789  1.00 0.00 ? 13 ARG A HA   2  
ATOM 1816  H HB2  . ARG A 1 13 ? 3.315   13.496  13.590  1.00 0.00 ? 13 ARG A HB2  2  
ATOM 1817  H HB3  . ARG A 1 13 ? 3.241   11.781  13.216  1.00 0.00 ? 13 ARG A HB3  2  
ATOM 1818  H HG2  . ARG A 1 13 ? 5.286   12.721  12.336  1.00 0.00 ? 13 ARG A HG2  2  
ATOM 1819  H HG3  . ARG A 1 13 ? 4.258   12.232  10.990  1.00 0.00 ? 13 ARG A HG3  2  
ATOM 1820  H HD2  . ARG A 1 13 ? 4.325   15.096  11.996  1.00 0.00 ? 13 ARG A HD2  2  
ATOM 1821  H HD3  . ARG A 1 13 ? 5.487   14.498  10.811  1.00 0.00 ? 13 ARG A HD3  2  
ATOM 1822  H HE   . ARG A 1 13 ? 3.130   13.828  9.676   1.00 0.00 ? 13 ARG A HE   2  
ATOM 1823  H HH11 . ARG A 1 13 ? 4.318   16.901  10.969  1.00 0.00 ? 13 ARG A HH11 2  
ATOM 1824  H HH12 . ARG A 1 13 ? 3.367   17.852  9.872   1.00 0.00 ? 13 ARG A HH12 2  
ATOM 1825  H HH21 . ARG A 1 13 ? 1.908   15.126  8.246   1.00 0.00 ? 13 ARG A HH21 2  
ATOM 1826  H HH22 . ARG A 1 13 ? 2.016   16.851  8.341   1.00 0.00 ? 13 ARG A HH22 2  
ATOM 1827  N N    . SER A 1 14 ? 1.685   10.667  11.354  1.00 0.00 ? 14 SER A N    2  
ATOM 1828  C CA   . SER A 1 14 ? 1.835   9.564   10.383  1.00 0.00 ? 14 SER A CA   2  
ATOM 1829  C C    . SER A 1 14 ? 3.160   9.734   9.610   1.00 0.00 ? 14 SER A C    2  
ATOM 1830  O O    . SER A 1 14 ? 4.117   8.974   9.805   1.00 0.00 ? 14 SER A O    2  
ATOM 1831  C CB   . SER A 1 14 ? 0.608   9.450   9.433   1.00 0.00 ? 14 SER A CB   2  
ATOM 1832  O OG   . SER A 1 14 ? -0.599  9.224   10.154  1.00 0.00 ? 14 SER A OG   2  
ATOM 1833  H H    . SER A 1 14 ? 1.680   10.437  12.307  1.00 0.00 ? 14 SER A H    2  
ATOM 1834  H HA   . SER A 1 14 ? 1.909   8.657   10.972  1.00 0.00 ? 14 SER A HA   2  
ATOM 1835  H HB2  . SER A 1 14 ? 0.501   10.371  8.869   1.00 0.00 ? 14 SER A HB2  2  
ATOM 1836  H HB3  . SER A 1 14 ? 0.761   8.630   8.748   1.00 0.00 ? 14 SER A HB3  2  
ATOM 1837  H HG   . SER A 1 14 ? -1.131  10.029  10.151  1.00 0.00 ? 14 SER A HG   2  
ATOM 1838  N N    . GLY A 1 15 ? 3.189   10.758  8.752   1.00 0.00 ? 15 GLY A N    2  
ATOM 1839  C CA   . GLY A 1 15 ? 4.388   11.195  8.062   1.00 0.00 ? 15 GLY A CA   2  
ATOM 1840  C C    . GLY A 1 15 ? 4.017   12.166  6.958   1.00 0.00 ? 15 GLY A C    2  
ATOM 1841  O O    . GLY A 1 15 ? 3.398   13.205  7.231   1.00 0.00 ? 15 GLY A O    2  
ATOM 1842  H H    . GLY A 1 15 ? 2.347   11.223  8.566   1.00 0.00 ? 15 GLY A H    2  
ATOM 1843  H HA2  . GLY A 1 15 ? 5.054   11.686  8.768   1.00 0.00 ? 15 GLY A HA2  2  
ATOM 1844  H HA3  . GLY A 1 15 ? 4.901   10.336  7.636   1.00 0.00 ? 15 GLY A HA3  2  
ATOM 1845  N N    . ARG A 1 16 ? 4.372   11.815  5.724   1.00 0.00 ? 16 ARG A N    2  
ATOM 1846  C CA   . ARG A 1 16 ? 4.037   12.604  4.529   1.00 0.00 ? 16 ARG A CA   2  
ATOM 1847  C C    . ARG A 1 16 ? 2.804   12.029  3.829   1.00 0.00 ? 16 ARG A C    2  
ATOM 1848  O O    . ARG A 1 16 ? 2.809   10.864  3.423   1.00 0.00 ? 16 ARG A O    2  
ATOM 1849  C CB   . ARG A 1 16 ? 5.243   12.637  3.563   1.00 0.00 ? 16 ARG A CB   2  
ATOM 1850  C CG   . ARG A 1 16 ? 6.450   13.451  4.079   1.00 0.00 ? 16 ARG A CG   2  
ATOM 1851  C CD   . ARG A 1 16 ? 6.077   14.907  4.403   1.00 0.00 ? 16 ARG A CD   2  
ATOM 1852  N NE   . ARG A 1 16 ? 7.245   15.737  4.717   1.00 0.00 ? 16 ARG A NE   2  
ATOM 1853  C CZ   . ARG A 1 16 ? 7.207   16.929  5.335   1.00 0.00 ? 16 ARG A CZ   2  
ATOM 1854  N NH1  . ARG A 1 16 ? 6.049   17.457  5.742   1.00 0.00 ? 16 ARG A NH1  2  
ATOM 1855  N NH2  . ARG A 1 16 ? 8.332   17.598  5.522   1.00 0.00 ? 16 ARG A NH2  2  
ATOM 1856  H H    . ARG A 1 16 ? 4.899   10.994  5.626   1.00 0.00 ? 16 ARG A H    2  
ATOM 1857  H HA   . ARG A 1 16 ? 3.811   13.623  4.843   1.00 0.00 ? 16 ARG A HA   2  
ATOM 1858  H HB2  . ARG A 1 16 ? 5.571   11.617  3.381   1.00 0.00 ? 16 ARG A HB2  2  
ATOM 1859  H HB3  . ARG A 1 16 ? 4.929   13.066  2.613   1.00 0.00 ? 16 ARG A HB3  2  
ATOM 1860  H HG2  . ARG A 1 16 ? 6.836   12.977  4.977   1.00 0.00 ? 16 ARG A HG2  2  
ATOM 1861  H HG3  . ARG A 1 16 ? 7.224   13.446  3.320   1.00 0.00 ? 16 ARG A HG3  2  
ATOM 1862  H HD2  . ARG A 1 16 ? 5.567   15.340  3.549   1.00 0.00 ? 16 ARG A HD2  2  
ATOM 1863  H HD3  . ARG A 1 16 ? 5.404   14.918  5.257   1.00 0.00 ? 16 ARG A HD3  2  
ATOM 1864  H HE   . ARG A 1 16 ? 8.118   15.384  4.444   1.00 0.00 ? 16 ARG A HE   2  
ATOM 1865  H HH11 . ARG A 1 16 ? 5.184   16.969  5.588   1.00 0.00 ? 16 ARG A HH11 2  
ATOM 1866  H HH12 . ARG A 1 16 ? 6.034   18.347  6.203   1.00 0.00 ? 16 ARG A HH12 2  
ATOM 1867  H HH21 . ARG A 1 16 ? 9.207   17.215  5.200   1.00 0.00 ? 16 ARG A HH21 2  
ATOM 1868  H HH22 . ARG A 1 16 ? 8.321   18.485  5.984   1.00 0.00 ? 16 ARG A HH22 2  
ATOM 1869  N N    . GLU A 1 17 ? 1.753   12.855  3.677   1.00 0.00 ? 17 GLU A N    2  
ATOM 1870  C CA   . GLU A 1 17 ? 0.553   12.449  2.960   1.00 0.00 ? 17 GLU A CA   2  
ATOM 1871  C C    . GLU A 1 17 ? 0.854   12.585  1.461   1.00 0.00 ? 17 GLU A C    2  
ATOM 1872  O O    . GLU A 1 17 ? 1.032   13.696  0.942   1.00 0.00 ? 17 GLU A O    2  
ATOM 1873  C CB   . GLU A 1 17 ? -0.681  13.298  3.356   1.00 0.00 ? 17 GLU A CB   2  
ATOM 1874  C CG   . GLU A 1 17 ? -2.007  12.807  2.727   1.00 0.00 ? 17 GLU A CG   2  
ATOM 1875  C CD   . GLU A 1 17 ? -3.197  13.721  3.049   1.00 0.00 ? 17 GLU A CD   2  
ATOM 1876  O OE1  . GLU A 1 17 ? -3.434  14.694  2.298   1.00 0.00 ? 17 GLU A OE1  2  
ATOM 1877  O OE2  . GLU A 1 17 ? -3.890  13.493  4.058   1.00 0.00 ? 17 GLU A OE2  2  
ATOM 1878  H H    . GLU A 1 17 ? 1.811   13.768  4.014   1.00 0.00 ? 17 GLU A H    2  
ATOM 1879  H HA   . GLU A 1 17 ? 0.353   11.398  3.203   1.00 0.00 ? 17 GLU A HA   2  
ATOM 1880  H HB2  . GLU A 1 17 ? -0.786  13.278  4.438   1.00 0.00 ? 17 GLU A HB2  2  
ATOM 1881  H HB3  . GLU A 1 17 ? -0.515  14.326  3.045   1.00 0.00 ? 17 GLU A HB3  2  
ATOM 1882  H HG2  . GLU A 1 17 ? -1.882  12.761  1.651   1.00 0.00 ? 17 GLU A HG2  2  
ATOM 1883  H HG3  . GLU A 1 17 ? -2.220  11.802  3.092   1.00 0.00 ? 17 GLU A HG3  2  
ATOM 1884  N N    . ILE A 1 18 ? 0.965   11.438  0.809   1.00 0.00 ? 18 ILE A N    2  
ATOM 1885  C CA   . ILE A 1 18 ? 1.217   11.312  -0.620  1.00 0.00 ? 18 ILE A CA   2  
ATOM 1886  C C    . ILE A 1 18 ? -0.087  10.903  -1.321  1.00 0.00 ? 18 ILE A C    2  
ATOM 1887  O O    . ILE A 1 18 ? -1.117  10.690  -0.670  1.00 0.00 ? 18 ILE A O    2  
ATOM 1888  C CB   . ILE A 1 18 ? 2.339   10.235  -0.875  1.00 0.00 ? 18 ILE A CB   2  
ATOM 1889  C CG1  . ILE A 1 18 ? 1.894   8.824   -0.345  1.00 0.00 ? 18 ILE A CG1  2  
ATOM 1890  C CG2  . ILE A 1 18 ? 3.679   10.678  -0.224  1.00 0.00 ? 18 ILE A CG2  2  
ATOM 1891  C CD1  . ILE A 1 18 ? 2.904   7.714   -0.560  1.00 0.00 ? 18 ILE A CD1  2  
ATOM 1892  H H    . ILE A 1 18 ? 0.869   10.617  1.320   1.00 0.00 ? 18 ILE A H    2  
ATOM 1893  H HA   . ILE A 1 18 ? 1.551   12.270  -1.019  1.00 0.00 ? 18 ILE A HA   2  
ATOM 1894  H HB   . ILE A 1 18 ? 2.502   10.173  -1.952  1.00 0.00 ? 18 ILE A HB   2  
ATOM 1895  H HG12 . ILE A 1 18 ? 1.707   8.885   0.721   1.00 0.00 ? 18 ILE A HG12 2  
ATOM 1896  H HG13 . ILE A 1 18 ? 0.977   8.529   -0.840  1.00 0.00 ? 18 ILE A HG13 2  
ATOM 1897  H HG21 . ILE A 1 18 ? 4.451   9.952   -0.442  1.00 0.00 ? 18 ILE A HG21 2  
ATOM 1898  H HG22 . ILE A 1 18 ? 3.556   10.755  0.850   1.00 0.00 ? 18 ILE A HG22 2  
ATOM 1899  H HG23 . ILE A 1 18 ? 3.979   11.643  -0.616  1.00 0.00 ? 18 ILE A HG23 2  
ATOM 1900  H HD11 . ILE A 1 18 ? 3.129   7.624   -1.612  1.00 0.00 ? 18 ILE A HD11 2  
ATOM 1901  H HD12 . ILE A 1 18 ? 2.496   6.781   -0.198  1.00 0.00 ? 18 ILE A HD12 2  
ATOM 1902  H HD13 . ILE A 1 18 ? 3.812   7.938   -0.017  1.00 0.00 ? 18 ILE A HD13 2  
ATOM 1903  N N    . THR A 1 19 ? -0.027  10.806  -2.645  1.00 0.00 ? 19 THR A N    2  
ATOM 1904  C CA   . THR A 1 19 ? -1.127  10.288  -3.463  1.00 0.00 ? 19 THR A CA   2  
ATOM 1905  C C    . THR A 1 19 ? -0.935  8.773   -3.663  1.00 0.00 ? 19 THR A C    2  
ATOM 1906  O O    . THR A 1 19 ? 0.162   8.250   -3.416  1.00 0.00 ? 19 THR A O    2  
ATOM 1907  C CB   . THR A 1 19 ? -1.172  11.020  -4.843  1.00 0.00 ? 19 THR A CB   2  
ATOM 1908  O OG1  . THR A 1 19 ? 0.057   10.809  -5.550  1.00 0.00 ? 19 THR A OG1  2  
ATOM 1909  C CG2  . THR A 1 19 ? -1.410  12.533  -4.684  1.00 0.00 ? 19 THR A CG2  2  
ATOM 1910  H H    . THR A 1 19 ? 0.796   11.083  -3.091  1.00 0.00 ? 19 THR A H    2  
ATOM 1911  H HA   . THR A 1 19 ? -2.074  10.463  -2.945  1.00 0.00 ? 19 THR A HA   2  
ATOM 1912  H HB   . THR A 1 19 ? -1.984  10.606  -5.432  1.00 0.00 ? 19 THR A HB   2  
ATOM 1913  H HG1  . THR A 1 19 ? 0.779   11.244  -5.075  1.00 0.00 ? 19 THR A HG1  2  
ATOM 1914  H HG21 . THR A 1 19 ? -2.352  12.704  -4.181  1.00 0.00 ? 19 THR A HG21 2  
ATOM 1915  H HG22 . THR A 1 19 ? -1.436  13.004  -5.659  1.00 0.00 ? 19 THR A HG22 2  
ATOM 1916  H HG23 . THR A 1 19 ? -0.610  12.970  -4.101  1.00 0.00 ? 19 THR A HG23 2  
ATOM 1917  N N    . TRP A 1 20 ? -2.011  8.074   -4.082  1.00 0.00 ? 20 TRP A N    2  
ATOM 1918  C CA   . TRP A 1 20 ? -1.941  6.655   -4.487  1.00 0.00 ? 20 TRP A CA   2  
ATOM 1919  C C    . TRP A 1 20 ? -0.950  6.498   -5.655  1.00 0.00 ? 20 TRP A C    2  
ATOM 1920  O O    . TRP A 1 20 ? -0.155  5.563   -5.668  1.00 0.00 ? 20 TRP A O    2  
ATOM 1921  C CB   . TRP A 1 20 ? -3.357  6.119   -4.861  1.00 0.00 ? 20 TRP A CB   2  
ATOM 1922  C CG   . TRP A 1 20 ? -3.389  4.704   -5.411  1.00 0.00 ? 20 TRP A CG   2  
ATOM 1923  C CD1  . TRP A 1 20 ? -3.701  4.335   -6.688  1.00 0.00 ? 20 TRP A CD1  2  
ATOM 1924  C CD2  . TRP A 1 20 ? -3.103  3.479   -4.710  1.00 0.00 ? 20 TRP A CD2  2  
ATOM 1925  N NE1  . TRP A 1 20 ? -3.637  2.977   -6.821  1.00 0.00 ? 20 TRP A NE1  2  
ATOM 1926  C CE2  . TRP A 1 20 ? -3.277  2.429   -5.625  1.00 0.00 ? 20 TRP A CE2  2  
ATOM 1927  C CE3  . TRP A 1 20 ? -2.722  3.172   -3.404  1.00 0.00 ? 20 TRP A CE3  2  
ATOM 1928  C CZ2  . TRP A 1 20 ? -3.088  1.096   -5.277  1.00 0.00 ? 20 TRP A CZ2  2  
ATOM 1929  C CZ3  . TRP A 1 20 ? -2.531  1.847   -3.058  1.00 0.00 ? 20 TRP A CZ3  2  
ATOM 1930  C CH2  . TRP A 1 20 ? -2.715  0.824   -3.992  1.00 0.00 ? 20 TRP A CH2  2  
ATOM 1931  H H    . TRP A 1 20 ? -2.875  8.527   -4.107  1.00 0.00 ? 20 TRP A H    2  
ATOM 1932  H HA   . TRP A 1 20 ? -1.565  6.093   -3.634  1.00 0.00 ? 20 TRP A HA   2  
ATOM 1933  H HB2  . TRP A 1 20 ? -3.981  6.130   -3.977  1.00 0.00 ? 20 TRP A HB2  2  
ATOM 1934  H HB3  . TRP A 1 20 ? -3.803  6.776   -5.601  1.00 0.00 ? 20 TRP A HB3  2  
ATOM 1935  H HD1  . TRP A 1 20 ? -3.965  5.030   -7.474  1.00 0.00 ? 20 TRP A HD1  2  
ATOM 1936  H HE1  . TRP A 1 20 ? -3.818  2.477   -7.645  1.00 0.00 ? 20 TRP A HE1  2  
ATOM 1937  H HE3  . TRP A 1 20 ? -2.570  3.952   -2.668  1.00 0.00 ? 20 TRP A HE3  2  
ATOM 1938  H HZ2  . TRP A 1 20 ? -3.230  0.296   -5.991  1.00 0.00 ? 20 TRP A HZ2  2  
ATOM 1939  H HZ3  . TRP A 1 20 ? -2.234  1.590   -2.046  1.00 0.00 ? 20 TRP A HZ3  2  
ATOM 1940  H HH2  . TRP A 1 20 ? -2.557  -0.200  -3.677  1.00 0.00 ? 20 TRP A HH2  2  
ATOM 1941  N N    . LYS A 1 21 ? -0.998  7.458   -6.607  1.00 0.00 ? 21 LYS A N    2  
ATOM 1942  C CA   . LYS A 1 21 ? -0.048  7.548   -7.735  1.00 0.00 ? 21 LYS A CA   2  
ATOM 1943  C C    . LYS A 1 21 ? 1.422   7.521   -7.250  1.00 0.00 ? 21 LYS A C    2  
ATOM 1944  O O    . LYS A 1 21 ? 2.198   6.637   -7.640  1.00 0.00 ? 21 LYS A O    2  
ATOM 1945  C CB   . LYS A 1 21 ? -0.324  8.848   -8.553  1.00 0.00 ? 21 LYS A CB   2  
ATOM 1946  C CG   . LYS A 1 21 ? 0.662   9.109   -9.727  1.00 0.00 ? 21 LYS A CG   2  
ATOM 1947  C CD   . LYS A 1 21 ? 0.655   8.004   -10.808 1.00 0.00 ? 21 LYS A CD   2  
ATOM 1948  C CE   . LYS A 1 21 ? -0.679  7.925   -11.565 1.00 0.00 ? 21 LYS A CE   2  
ATOM 1949  N NZ   . LYS A 1 21 ? -0.682  6.828   -12.561 1.00 0.00 ? 21 LYS A NZ   2  
ATOM 1950  H H    . LYS A 1 21 ? -1.722  8.116   -6.563  1.00 0.00 ? 21 LYS A H    2  
ATOM 1951  H HA   . LYS A 1 21 ? -0.225  6.688   -8.375  1.00 0.00 ? 21 LYS A HA   2  
ATOM 1952  H HB2  . LYS A 1 21 ? -1.332  8.800   -8.957  1.00 0.00 ? 21 LYS A HB2  2  
ATOM 1953  H HB3  . LYS A 1 21 ? -0.272  9.696   -7.879  1.00 0.00 ? 21 LYS A HB3  2  
ATOM 1954  H HG2  . LYS A 1 21 ? 0.399   10.051  -10.198 1.00 0.00 ? 21 LYS A HG2  2  
ATOM 1955  H HG3  . LYS A 1 21 ? 1.663   9.191   -9.319  1.00 0.00 ? 21 LYS A HG3  2  
ATOM 1956  H HD2  . LYS A 1 21 ? 1.447   8.211   -11.520 1.00 0.00 ? 21 LYS A HD2  2  
ATOM 1957  H HD3  . LYS A 1 21 ? 0.849   7.047   -10.338 1.00 0.00 ? 21 LYS A HD3  2  
ATOM 1958  H HE2  . LYS A 1 21 ? -1.479  7.755   -10.857 1.00 0.00 ? 21 LYS A HE2  2  
ATOM 1959  H HE3  . LYS A 1 21 ? -0.851  8.866   -12.078 1.00 0.00 ? 21 LYS A HE3  2  
ATOM 1960  H HZ1  . LYS A 1 21 ? -0.505  5.922   -12.087 1.00 0.00 ? 21 LYS A HZ1  2  
ATOM 1961  H HZ2  . LYS A 1 21 ? 0.066   6.983   -13.271 1.00 0.00 ? 21 LYS A HZ2  2  
ATOM 1962  H HZ3  . LYS A 1 21 ? -1.596  6.778   -13.045 1.00 0.00 ? 21 LYS A HZ3  2  
ATOM 1963  N N    . ASP A 1 22 ? 1.770   8.480   -6.371  1.00 0.00 ? 22 ASP A N    2  
ATOM 1964  C CA   . ASP A 1 22 ? 3.148   8.666   -5.873  1.00 0.00 ? 22 ASP A CA   2  
ATOM 1965  C C    . ASP A 1 22 ? 3.601   7.464   -5.037  1.00 0.00 ? 22 ASP A C    2  
ATOM 1966  O O    . ASP A 1 22 ? 4.780   7.093   -5.060  1.00 0.00 ? 22 ASP A O    2  
ATOM 1967  C CB   . ASP A 1 22 ? 3.235   9.962   -5.036  1.00 0.00 ? 22 ASP A CB   2  
ATOM 1968  C CG   . ASP A 1 22 ? 4.661   10.283  -4.550  1.00 0.00 ? 22 ASP A CG   2  
ATOM 1969  O OD1  . ASP A 1 22 ? 5.437   10.891  -5.321  1.00 0.00 ? 22 ASP A OD1  2  
ATOM 1970  O OD2  . ASP A 1 22 ? 5.005   9.943   -3.401  1.00 0.00 ? 22 ASP A OD2  2  
ATOM 1971  H H    . ASP A 1 22 ? 1.076   9.075   -6.022  1.00 0.00 ? 22 ASP A H    2  
ATOM 1972  H HA   . ASP A 1 22 ? 3.798   8.760   -6.739  1.00 0.00 ? 22 ASP A HA   2  
ATOM 1973  H HB2  . ASP A 1 22 ? 2.882   10.792  -5.641  1.00 0.00 ? 22 ASP A HB2  2  
ATOM 1974  H HB3  . ASP A 1 22 ? 2.577   9.875   -4.171  1.00 0.00 ? 22 ASP A HB3  2  
ATOM 1975  N N    . PHE A 1 23 ? 2.643   6.877   -4.300  1.00 0.00 ? 23 PHE A N    2  
ATOM 1976  C CA   . PHE A 1 23 ? 2.865   5.655   -3.525  1.00 0.00 ? 23 PHE A CA   2  
ATOM 1977  C C    . PHE A 1 23 ? 3.422   4.530   -4.406  1.00 0.00 ? 23 PHE A C    2  
ATOM 1978  O O    . PHE A 1 23 ? 4.477   3.973   -4.108  1.00 0.00 ? 23 PHE A O    2  
ATOM 1979  C CB   . PHE A 1 23 ? 1.563   5.180   -2.814  1.00 0.00 ? 23 PHE A CB   2  
ATOM 1980  C CG   . PHE A 1 23 ? 1.724   3.817   -2.127  1.00 0.00 ? 23 PHE A CG   2  
ATOM 1981  C CD1  . PHE A 1 23 ? 2.648   3.647   -1.093  1.00 0.00 ? 23 PHE A CD1  2  
ATOM 1982  C CD2  . PHE A 1 23 ? 1.005   2.702   -2.558  1.00 0.00 ? 23 PHE A CD2  2  
ATOM 1983  C CE1  . PHE A 1 23 ? 2.838   2.412   -0.515  1.00 0.00 ? 23 PHE A CE1  2  
ATOM 1984  C CE2  . PHE A 1 23 ? 1.204   1.467   -1.981  1.00 0.00 ? 23 PHE A CE2  2  
ATOM 1985  C CZ   . PHE A 1 23 ? 2.120   1.323   -0.959  1.00 0.00 ? 23 PHE A CZ   2  
ATOM 1986  H H    . PHE A 1 23 ? 1.767   7.305   -4.258  1.00 0.00 ? 23 PHE A H    2  
ATOM 1987  H HA   . PHE A 1 23 ? 3.601   5.893   -2.764  1.00 0.00 ? 23 PHE A HA   2  
ATOM 1988  H HB2  . PHE A 1 23 ? 1.287   5.907   -2.055  1.00 0.00 ? 23 PHE A HB2  2  
ATOM 1989  H HB3  . PHE A 1 23 ? 0.759   5.115   -3.542  1.00 0.00 ? 23 PHE A HB3  2  
ATOM 1990  H HD1  . PHE A 1 23 ? 3.216   4.501   -0.737  1.00 0.00 ? 23 PHE A HD1  2  
ATOM 1991  H HD2  . PHE A 1 23 ? 0.281   2.813   -3.358  1.00 0.00 ? 23 PHE A HD2  2  
ATOM 1992  H HE1  . PHE A 1 23 ? 3.555   2.295   0.287   1.00 0.00 ? 23 PHE A HE1  2  
ATOM 1993  H HE2  . PHE A 1 23 ? 0.640   0.610   -2.327  1.00 0.00 ? 23 PHE A HE2  2  
ATOM 1994  H HZ   . PHE A 1 23 ? 2.275   0.352   -0.507  1.00 0.00 ? 23 PHE A HZ   2  
ATOM 1995  N N    . VAL A 1 24 ? 2.709   4.223   -5.494  1.00 0.00 ? 24 VAL A N    2  
ATOM 1996  C CA   . VAL A 1 24 ? 3.052   3.098   -6.370  1.00 0.00 ? 24 VAL A CA   2  
ATOM 1997  C C    . VAL A 1 24 ? 4.408   3.337   -7.051  1.00 0.00 ? 24 VAL A C    2  
ATOM 1998  O O    . VAL A 1 24 ? 5.307   2.498   -6.979  1.00 0.00 ? 24 VAL A O    2  
ATOM 1999  C CB   . VAL A 1 24 ? 1.951   2.874   -7.459  1.00 0.00 ? 24 VAL A CB   2  
ATOM 2000  C CG1  . VAL A 1 24 ? 2.259   1.628   -8.321  1.00 0.00 ? 24 VAL A CG1  2  
ATOM 2001  C CG2  . VAL A 1 24 ? 0.552   2.782   -6.818  1.00 0.00 ? 24 VAL A CG2  2  
ATOM 2002  H H    . VAL A 1 24 ? 1.934   4.779   -5.723  1.00 0.00 ? 24 VAL A H    2  
ATOM 2003  H HA   . VAL A 1 24 ? 3.113   2.204   -5.752  1.00 0.00 ? 24 VAL A HA   2  
ATOM 2004  H HB   . VAL A 1 24 ? 1.953   3.742   -8.121  1.00 0.00 ? 24 VAL A HB   2  
ATOM 2005  H HG11 . VAL A 1 24 ? 2.310   0.747   -7.690  1.00 0.00 ? 24 VAL A HG11 2  
ATOM 2006  H HG12 . VAL A 1 24 ? 3.200   1.757   -8.833  1.00 0.00 ? 24 VAL A HG12 2  
ATOM 2007  H HG13 . VAL A 1 24 ? 1.471   1.496   -9.053  1.00 0.00 ? 24 VAL A HG13 2  
ATOM 2008  H HG21 . VAL A 1 24 ? 0.356   3.672   -6.244  1.00 0.00 ? 24 VAL A HG21 2  
ATOM 2009  H HG22 . VAL A 1 24 ? 0.503   1.919   -6.163  1.00 0.00 ? 24 VAL A HG22 2  
ATOM 2010  H HG23 . VAL A 1 24 ? -0.197  2.686   -7.590  1.00 0.00 ? 24 VAL A HG23 2  
ATOM 2011  N N    . ASN A 1 25 ? 4.535   4.522   -7.652  1.00 0.00 ? 25 ASN A N    2  
ATOM 2012  C CA   . ASN A 1 25 ? 5.675   4.894   -8.502  1.00 0.00 ? 25 ASN A CA   2  
ATOM 2013  C C    . ASN A 1 25 ? 6.987   4.992   -7.705  1.00 0.00 ? 25 ASN A C    2  
ATOM 2014  O O    . ASN A 1 25 ? 8.018   4.494   -8.153  1.00 0.00 ? 25 ASN A O    2  
ATOM 2015  C CB   . ASN A 1 25 ? 5.380   6.239   -9.237  1.00 0.00 ? 25 ASN A CB   2  
ATOM 2016  C CG   . ASN A 1 25 ? 4.190   6.164   -10.211 1.00 0.00 ? 25 ASN A CG   2  
ATOM 2017  O OD1  . ASN A 1 25 ? 3.261   5.381   -10.028 1.00 0.00 ? 25 ASN A OD1  2  
ATOM 2018  N ND2  . ASN A 1 25 ? 4.199   6.991   -11.246 1.00 0.00 ? 25 ASN A ND2  2  
ATOM 2019  H H    . ASN A 1 25 ? 3.823   5.177   -7.527  1.00 0.00 ? 25 ASN A H    2  
ATOM 2020  H HA   . ASN A 1 25 ? 5.788   4.117   -9.254  1.00 0.00 ? 25 ASN A HA   2  
ATOM 2021  H HB2  . ASN A 1 25 ? 5.165   7.011   -8.502  1.00 0.00 ? 25 ASN A HB2  2  
ATOM 2022  H HB3  . ASN A 1 25 ? 6.261   6.535   -9.800  1.00 0.00 ? 25 ASN A HB3  2  
ATOM 2023  H HD21 . ASN A 1 25 ? 4.954   7.603   -11.343 1.00 0.00 ? 25 ASN A HD21 2  
ATOM 2024  H HD22 . ASN A 1 25 ? 3.440   6.963   -11.869 1.00 0.00 ? 25 ASN A HD22 2  
ATOM 2025  N N    . ASN A 1 26 ? 6.944   5.643   -6.531  1.00 0.00 ? 26 ASN A N    2  
ATOM 2026  C CA   . ASN A 1 26 ? 8.156   5.972   -5.746  1.00 0.00 ? 26 ASN A CA   2  
ATOM 2027  C C    . ASN A 1 26 ? 8.465   4.932   -4.645  1.00 0.00 ? 26 ASN A C    2  
ATOM 2028  O O    . ASN A 1 26 ? 9.621   4.815   -4.225  1.00 0.00 ? 26 ASN A O    2  
ATOM 2029  C CB   . ASN A 1 26 ? 8.007   7.384   -5.097  1.00 0.00 ? 26 ASN A CB   2  
ATOM 2030  C CG   . ASN A 1 26 ? 7.766   8.523   -6.103  1.00 0.00 ? 26 ASN A CG   2  
ATOM 2031  O OD1  . ASN A 1 26 ? 7.147   8.334   -7.151  1.00 0.00 ? 26 ASN A OD1  2  
ATOM 2032  N ND2  . ASN A 1 26 ? 8.246   9.713   -5.785  1.00 0.00 ? 26 ASN A ND2  2  
ATOM 2033  H H    . ASN A 1 26 ? 6.082   5.965   -6.190  1.00 0.00 ? 26 ASN A H    2  
ATOM 2034  H HA   . ASN A 1 26 ? 9.004   6.006   -6.430  1.00 0.00 ? 26 ASN A HA   2  
ATOM 2035  H HB2  . ASN A 1 26 ? 7.171   7.370   -4.405  1.00 0.00 ? 26 ASN A HB2  2  
ATOM 2036  H HB3  . ASN A 1 26 ? 8.912   7.606   -4.539  1.00 0.00 ? 26 ASN A HB3  2  
ATOM 2037  H HD21 . ASN A 1 26 ? 8.724   9.801   -4.937  1.00 0.00 ? 26 ASN A HD21 2  
ATOM 2038  H HD22 . ASN A 1 26 ? 8.089   10.458  -6.402  1.00 0.00 ? 26 ASN A HD22 2  
ATOM 2039  N N    . TYR A 1 27 ? 7.457   4.185   -4.158  1.00 0.00 ? 27 TYR A N    2  
ATOM 2040  C CA   . TYR A 1 27 ? 7.617   3.330   -2.946  1.00 0.00 ? 27 TYR A CA   2  
ATOM 2041  C C    . TYR A 1 27 ? 7.307   1.847   -3.223  1.00 0.00 ? 27 TYR A C    2  
ATOM 2042  O O    . TYR A 1 27 ? 8.196   0.985   -3.108  1.00 0.00 ? 27 TYR A O    2  
ATOM 2043  C CB   . TYR A 1 27 ? 6.721   3.864   -1.789  1.00 0.00 ? 27 TYR A CB   2  
ATOM 2044  C CG   . TYR A 1 27 ? 7.027   5.317   -1.399  1.00 0.00 ? 27 TYR A CG   2  
ATOM 2045  C CD1  . TYR A 1 27 ? 8.176   5.637   -0.675  1.00 0.00 ? 27 TYR A CD1  2  
ATOM 2046  C CD2  . TYR A 1 27 ? 6.184   6.369   -1.768  1.00 0.00 ? 27 TYR A CD2  2  
ATOM 2047  C CE1  . TYR A 1 27 ? 8.463   6.941   -0.330  1.00 0.00 ? 27 TYR A CE1  2  
ATOM 2048  C CE2  . TYR A 1 27 ? 6.476   7.672   -1.423  1.00 0.00 ? 27 TYR A CE2  2  
ATOM 2049  C CZ   . TYR A 1 27 ? 7.611   7.949   -0.705  1.00 0.00 ? 27 TYR A CZ   2  
ATOM 2050  O OH   . TYR A 1 27 ? 7.896   9.243   -0.354  1.00 0.00 ? 27 TYR A OH   2  
ATOM 2051  H H    . TYR A 1 27 ? 6.593   4.201   -4.617  1.00 0.00 ? 27 TYR A H    2  
ATOM 2052  H HA   . TYR A 1 27 ? 8.657   3.395   -2.621  1.00 0.00 ? 27 TYR A HA   2  
ATOM 2053  H HB2  . TYR A 1 27 ? 5.676   3.799   -2.086  1.00 0.00 ? 27 TYR A HB2  2  
ATOM 2054  H HB3  . TYR A 1 27 ? 6.866   3.244   -0.909  1.00 0.00 ? 27 TYR A HB3  2  
ATOM 2055  H HD1  . TYR A 1 27 ? 8.856   4.844   -0.380  1.00 0.00 ? 27 TYR A HD1  2  
ATOM 2056  H HD2  . TYR A 1 27 ? 5.288   6.151   -2.336  1.00 0.00 ? 27 TYR A HD2  2  
ATOM 2057  H HE1  . TYR A 1 27 ? 9.356   7.163   0.238   1.00 0.00 ? 27 TYR A HE1  2  
ATOM 2058  H HE2  . TYR A 1 27 ? 5.808   8.471   -1.721  1.00 0.00 ? 27 TYR A HE2  2  
ATOM 2059  H HH   . TYR A 1 27 ? 8.848   9.382   -0.415  1.00 0.00 ? 27 TYR A HH   2  
ATOM 2060  N N    . LEU A 1 28 ? 6.035   1.571   -3.560  1.00 0.00 ? 28 LEU A N    2  
ATOM 2061  C CA   . LEU A 1 28 ? 5.504   0.208   -3.721  1.00 0.00 ? 28 LEU A CA   2  
ATOM 2062  C C    . LEU A 1 28 ? 6.317   -0.612  -4.737  1.00 0.00 ? 28 LEU A C    2  
ATOM 2063  O O    . LEU A 1 28 ? 6.732   -1.730  -4.431  1.00 0.00 ? 28 LEU A O    2  
ATOM 2064  C CB   . LEU A 1 28 ? 4.012   0.263   -4.136  1.00 0.00 ? 28 LEU A CB   2  
ATOM 2065  C CG   . LEU A 1 28 ? 3.273   -1.110  -4.264  1.00 0.00 ? 28 LEU A CG   2  
ATOM 2066  C CD1  . LEU A 1 28 ? 3.283   -1.898  -2.936  1.00 0.00 ? 28 LEU A CD1  2  
ATOM 2067  C CD2  . LEU A 1 28 ? 1.831   -0.918  -4.769  1.00 0.00 ? 28 LEU A CD2  2  
ATOM 2068  H H    . LEU A 1 28 ? 5.426   2.321   -3.684  1.00 0.00 ? 28 LEU A H    2  
ATOM 2069  H HA   . LEU A 1 28 ? 5.572   -0.274  -2.750  1.00 0.00 ? 28 LEU A HA   2  
ATOM 2070  H HB2  . LEU A 1 28 ? 3.478   0.873   -3.412  1.00 0.00 ? 28 LEU A HB2  2  
ATOM 2071  H HB3  . LEU A 1 28 ? 3.955   0.769   -5.097  1.00 0.00 ? 28 LEU A HB3  2  
ATOM 2072  H HG   . LEU A 1 28 ? 3.797   -1.714  -4.997  1.00 0.00 ? 28 LEU A HG   2  
ATOM 2073  H HD11 . LEU A 1 28 ? 2.795   -1.322  -2.159  1.00 0.00 ? 28 LEU A HD11 2  
ATOM 2074  H HD12 . LEU A 1 28 ? 4.304   -2.101  -2.641  1.00 0.00 ? 28 LEU A HD12 2  
ATOM 2075  H HD13 . LEU A 1 28 ? 2.764   -2.838  -3.067  1.00 0.00 ? 28 LEU A HD13 2  
ATOM 2076  H HD21 . LEU A 1 28 ? 1.266   -0.323  -4.062  1.00 0.00 ? 28 LEU A HD21 2  
ATOM 2077  H HD22 . LEU A 1 28 ? 1.356   -1.881  -4.890  1.00 0.00 ? 28 LEU A HD22 2  
ATOM 2078  H HD23 . LEU A 1 28 ? 1.846   -0.412  -5.727  1.00 0.00 ? 28 LEU A HD23 2  
ATOM 2079  N N    . SER A 1 29 ? 6.575   -0.023  -5.921  1.00 0.00 ? 29 SER A N    2  
ATOM 2080  C CA   . SER A 1 29 ? 7.314   -0.693  -7.014  1.00 0.00 ? 29 SER A CA   2  
ATOM 2081  C C    . SER A 1 29 ? 8.785   -1.001  -6.647  1.00 0.00 ? 29 SER A C    2  
ATOM 2082  O O    . SER A 1 29 ? 9.387   -1.913  -7.214  1.00 0.00 ? 29 SER A O    2  
ATOM 2083  C CB   . SER A 1 29 ? 7.243   0.173   -8.282  1.00 0.00 ? 29 SER A CB   2  
ATOM 2084  O OG   . SER A 1 29 ? 7.766   1.475   -8.050  1.00 0.00 ? 29 SER A OG   2  
ATOM 2085  H H    . SER A 1 29 ? 6.242   0.894   -6.079  1.00 0.00 ? 29 SER A H    2  
ATOM 2086  H HA   . SER A 1 29 ? 6.811   -1.637  -7.215  1.00 0.00 ? 29 SER A HA   2  
ATOM 2087  H HB2  . SER A 1 29 ? 7.808   -0.290  -9.084  1.00 0.00 ? 29 SER A HB2  2  
ATOM 2088  H HB3  . SER A 1 29 ? 6.212   0.268   -8.590  1.00 0.00 ? 29 SER A HB3  2  
ATOM 2089  H HG   . SER A 1 29 ? 7.041   2.114   -8.019  1.00 0.00 ? 29 SER A HG   2  
ATOM 2090  N N    . LYS A 1 30 ? 9.344   -0.256  -5.672  1.00 0.00 ? 30 LYS A N    2  
ATOM 2091  C CA   . LYS A 1 30 ? 10.740  -0.449  -5.211  1.00 0.00 ? 30 LYS A CA   2  
ATOM 2092  C C    . LYS A 1 30 ? 10.791  -1.481  -4.061  1.00 0.00 ? 30 LYS A C    2  
ATOM 2093  O O    . LYS A 1 30 ? 11.880  -1.829  -3.595  1.00 0.00 ? 30 LYS A O    2  
ATOM 2094  C CB   . LYS A 1 30 ? 11.389  0.897   -4.751  1.00 0.00 ? 30 LYS A CB   2  
ATOM 2095  C CG   . LYS A 1 30 ? 11.804  1.875   -5.879  1.00 0.00 ? 30 LYS A CG   2  
ATOM 2096  C CD   . LYS A 1 30 ? 10.608  2.582   -6.544  1.00 0.00 ? 30 LYS A CD   2  
ATOM 2097  C CE   . LYS A 1 30 ? 11.050  3.622   -7.584  1.00 0.00 ? 30 LYS A CE   2  
ATOM 2098  N NZ   . LYS A 1 30 ? 11.662  3.003   -8.787  1.00 0.00 ? 30 LYS A NZ   2  
ATOM 2099  H H    . LYS A 1 30 ? 8.785   0.391   -5.198  1.00 0.00 ? 30 LYS A H    2  
ATOM 2100  H HA   . LYS A 1 30 ? 11.317  -0.846  -6.047  1.00 0.00 ? 30 LYS A HA   2  
ATOM 2101  H HB2  . LYS A 1 30 ? 10.682  1.415   -4.108  1.00 0.00 ? 30 LYS A HB2  2  
ATOM 2102  H HB3  . LYS A 1 30 ? 12.277  0.675   -4.160  1.00 0.00 ? 30 LYS A HB3  2  
ATOM 2103  H HG2  . LYS A 1 30 ? 12.456  2.632   -5.457  1.00 0.00 ? 30 LYS A HG2  2  
ATOM 2104  H HG3  . LYS A 1 30 ? 12.357  1.327   -6.639  1.00 0.00 ? 30 LYS A HG3  2  
ATOM 2105  H HD2  . LYS A 1 30 ? 9.984   1.841   -7.034  1.00 0.00 ? 30 LYS A HD2  2  
ATOM 2106  H HD3  . LYS A 1 30 ? 10.028  3.080   -5.776  1.00 0.00 ? 30 LYS A HD3  2  
ATOM 2107  H HE2  . LYS A 1 30 ? 10.187  4.191   -7.895  1.00 0.00 ? 30 LYS A HE2  2  
ATOM 2108  H HE3  . LYS A 1 30 ? 11.772  4.293   -7.132  1.00 0.00 ? 30 LYS A HE3  2  
ATOM 2109  H HZ1  . LYS A 1 30 ? 10.996  2.337   -9.225  1.00 0.00 ? 30 LYS A HZ1  2  
ATOM 2110  H HZ2  . LYS A 1 30 ? 12.529  2.488   -8.530  1.00 0.00 ? 30 LYS A HZ2  2  
ATOM 2111  H HZ3  . LYS A 1 30 ? 11.905  3.737   -9.481  1.00 0.00 ? 30 LYS A HZ3  2  
ATOM 2112  N N    . GLY A 1 31 ? 9.603   -1.962  -3.622  1.00 0.00 ? 31 GLY A N    2  
ATOM 2113  C CA   . GLY A 1 31 ? 9.480   -2.921  -2.510  1.00 0.00 ? 31 GLY A CA   2  
ATOM 2114  C C    . GLY A 1 31 ? 9.962   -2.394  -1.155  1.00 0.00 ? 31 GLY A C    2  
ATOM 2115  O O    . GLY A 1 31 ? 10.209  -3.184  -0.236  1.00 0.00 ? 31 GLY A O    2  
ATOM 2116  H H    . GLY A 1 31 ? 8.793   -1.715  -4.110  1.00 0.00 ? 31 GLY A H    2  
ATOM 2117  H HA2  . GLY A 1 31 ? 8.435   -3.195  -2.410  1.00 0.00 ? 31 GLY A HA2  2  
ATOM 2118  H HA3  . GLY A 1 31 ? 10.040  -3.814  -2.760  1.00 0.00 ? 31 GLY A HA3  2  
ATOM 2119  N N    . VAL A 1 32 ? 10.064  -1.055  -1.009  1.00 0.00 ? 32 VAL A N    2  
ATOM 2120  C CA   . VAL A 1 32 ? 10.550  -0.424  0.243   1.00 0.00 ? 32 VAL A CA   2  
ATOM 2121  C C    . VAL A 1 32 ? 9.449   -0.381  1.323   1.00 0.00 ? 32 VAL A C    2  
ATOM 2122  O O    . VAL A 1 32 ? 9.683   0.078   2.446   1.00 0.00 ? 32 VAL A O    2  
ATOM 2123  C CB   . VAL A 1 32 ? 11.128  1.018   -0.015  1.00 0.00 ? 32 VAL A CB   2  
ATOM 2124  C CG1  . VAL A 1 32 ? 12.284  0.973   -1.042  1.00 0.00 ? 32 VAL A CG1  2  
ATOM 2125  C CG2  . VAL A 1 32 ? 10.030  2.017   -0.446  1.00 0.00 ? 32 VAL A CG2  2  
ATOM 2126  H H    . VAL A 1 32 ? 9.795   -0.477  -1.755  1.00 0.00 ? 32 VAL A H    2  
ATOM 2127  H HA   . VAL A 1 32 ? 11.361  -1.039  0.627   1.00 0.00 ? 32 VAL A HA   2  
ATOM 2128  H HB   . VAL A 1 32 ? 11.548  1.376   0.925   1.00 0.00 ? 32 VAL A HB   2  
ATOM 2129  H HG11 . VAL A 1 32 ? 11.920  0.597   -1.992  1.00 0.00 ? 32 VAL A HG11 2  
ATOM 2130  H HG12 . VAL A 1 32 ? 13.069  0.324   -0.680  1.00 0.00 ? 32 VAL A HG12 2  
ATOM 2131  H HG13 . VAL A 1 32 ? 12.684  1.968   -1.182  1.00 0.00 ? 32 VAL A HG13 2  
ATOM 2132  H HG21 . VAL A 1 32 ? 10.464  2.998   -0.592  1.00 0.00 ? 32 VAL A HG21 2  
ATOM 2133  H HG22 . VAL A 1 32 ? 9.269   2.077   0.322   1.00 0.00 ? 32 VAL A HG22 2  
ATOM 2134  H HG23 . VAL A 1 32 ? 9.575   1.689   -1.372  1.00 0.00 ? 32 VAL A HG23 2  
ATOM 2135  N N    . VAL A 1 33 ? 8.268   -0.907  0.970   1.00 0.00 ? 33 VAL A N    2  
ATOM 2136  C CA   . VAL A 1 33 ? 7.101   -0.972  1.846   1.00 0.00 ? 33 VAL A CA   2  
ATOM 2137  C C    . VAL A 1 33 ? 7.068   -2.351  2.534   1.00 0.00 ? 33 VAL A C    2  
ATOM 2138  O O    . VAL A 1 33 ? 7.292   -3.374  1.882   1.00 0.00 ? 33 VAL A O    2  
ATOM 2139  C CB   . VAL A 1 33 ? 5.777   -0.749  1.019   1.00 0.00 ? 33 VAL A CB   2  
ATOM 2140  C CG1  . VAL A 1 33 ? 4.529   -0.734  1.928   1.00 0.00 ? 33 VAL A CG1  2  
ATOM 2141  C CG2  . VAL A 1 33 ? 5.864   0.540   0.172   1.00 0.00 ? 33 VAL A CG2  2  
ATOM 2142  H H    . VAL A 1 33 ? 8.192   -1.308  0.085   1.00 0.00 ? 33 VAL A H    2  
ATOM 2143  H HA   . VAL A 1 33 ? 7.181   -0.186  2.601   1.00 0.00 ? 33 VAL A HA   2  
ATOM 2144  H HB   . VAL A 1 33 ? 5.670   -1.588  0.327   1.00 0.00 ? 33 VAL A HB   2  
ATOM 2145  H HG11 . VAL A 1 33 ? 4.455   -1.672  2.459   1.00 0.00 ? 33 VAL A HG11 2  
ATOM 2146  H HG12 . VAL A 1 33 ? 3.639   -0.599  1.325   1.00 0.00 ? 33 VAL A HG12 2  
ATOM 2147  H HG13 . VAL A 1 33 ? 4.601   0.077   2.643   1.00 0.00 ? 33 VAL A HG13 2  
ATOM 2148  H HG21 . VAL A 1 33 ? 6.722   0.485   -0.489  1.00 0.00 ? 33 VAL A HG21 2  
ATOM 2149  H HG22 . VAL A 1 33 ? 5.967   1.403   0.818   1.00 0.00 ? 33 VAL A HG22 2  
ATOM 2150  H HG23 . VAL A 1 33 ? 4.969   0.644   -0.426  1.00 0.00 ? 33 VAL A HG23 2  
ATOM 2151  N N    . ASP A 1 34 ? 6.807   -2.348  3.842   1.00 0.00 ? 34 ASP A N    2  
ATOM 2152  C CA   . ASP A 1 34 ? 6.626   -3.561  4.655   1.00 0.00 ? 34 ASP A CA   2  
ATOM 2153  C C    . ASP A 1 34 ? 5.195   -4.066  4.478   1.00 0.00 ? 34 ASP A C    2  
ATOM 2154  O O    . ASP A 1 34 ? 4.960   -5.213  4.090   1.00 0.00 ? 34 ASP A O    2  
ATOM 2155  C CB   . ASP A 1 34 ? 6.873   -3.204  6.147   1.00 0.00 ? 34 ASP A CB   2  
ATOM 2156  C CG   . ASP A 1 34 ? 6.898   -4.405  7.093   1.00 0.00 ? 34 ASP A CG   2  
ATOM 2157  O OD1  . ASP A 1 34 ? 7.983   -4.980  7.315   1.00 0.00 ? 34 ASP A OD1  2  
ATOM 2158  O OD2  . ASP A 1 34 ? 5.843   -4.764  7.646   1.00 0.00 ? 34 ASP A OD2  2  
ATOM 2159  H H    . ASP A 1 34 ? 6.705   -1.490  4.286   1.00 0.00 ? 34 ASP A H    2  
ATOM 2160  H HA   . ASP A 1 34 ? 7.341   -4.322  4.334   1.00 0.00 ? 34 ASP A HA   2  
ATOM 2161  H HB2  . ASP A 1 34 ? 7.825   -2.693  6.222   1.00 0.00 ? 34 ASP A HB2  2  
ATOM 2162  H HB3  . ASP A 1 34 ? 6.101   -2.510  6.480   1.00 0.00 ? 34 ASP A HB3  2  
ATOM 2163  N N    . ARG A 1 35 ? 4.255   -3.140  4.726   1.00 0.00 ? 35 ARG A N    2  
ATOM 2164  C CA   . ARG A 1 35 ? 2.817   -3.426  4.799   1.00 0.00 ? 35 ARG A CA   2  
ATOM 2165  C C    . ARG A 1 35 ? 2.019   -2.109  4.802   1.00 0.00 ? 35 ARG A C    2  
ATOM 2166  O O    . ARG A 1 35 ? 2.579   -1.027  5.034   1.00 0.00 ? 35 ARG A O    2  
ATOM 2167  C CB   . ARG A 1 35 ? 2.492   -4.294  6.049   1.00 0.00 ? 35 ARG A CB   2  
ATOM 2168  C CG   . ARG A 1 35 ? 2.663   -3.585  7.409   1.00 0.00 ? 35 ARG A CG   2  
ATOM 2169  C CD   . ARG A 1 35 ? 2.606   -4.566  8.592   1.00 0.00 ? 35 ARG A CD   2  
ATOM 2170  N NE   . ARG A 1 35 ? 2.573   -3.867  9.885   1.00 0.00 ? 35 ARG A NE   2  
ATOM 2171  C CZ   . ARG A 1 35 ? 3.637   -3.577  10.646  1.00 0.00 ? 35 ARG A CZ   2  
ATOM 2172  N NH1  . ARG A 1 35 ? 4.859   -3.925  10.264  1.00 0.00 ? 35 ARG A NH1  2  
ATOM 2173  N NH2  . ARG A 1 35 ? 3.466   -2.918  11.779  1.00 0.00 ? 35 ARG A NH2  2  
ATOM 2174  H H    . ARG A 1 35 ? 4.554   -2.214  4.821   1.00 0.00 ? 35 ARG A H    2  
ATOM 2175  H HA   . ARG A 1 35 ? 2.548   -3.980  3.903   1.00 0.00 ? 35 ARG A HA   2  
ATOM 2176  H HB2  . ARG A 1 35 ? 1.466   -4.642  5.975   1.00 0.00 ? 35 ARG A HB2  2  
ATOM 2177  H HB3  . ARG A 1 35 ? 3.145   -5.159  6.031   1.00 0.00 ? 35 ARG A HB3  2  
ATOM 2178  H HG2  . ARG A 1 35 ? 3.620   -3.074  7.425   1.00 0.00 ? 35 ARG A HG2  2  
ATOM 2179  H HG3  . ARG A 1 35 ? 1.872   -2.855  7.519   1.00 0.00 ? 35 ARG A HG3  2  
ATOM 2180  H HD2  . ARG A 1 35 ? 1.707   -5.165  8.507   1.00 0.00 ? 35 ARG A HD2  2  
ATOM 2181  H HD3  . ARG A 1 35 ? 3.470   -5.221  8.556   1.00 0.00 ? 35 ARG A HD3  2  
ATOM 2182  H HE   . ARG A 1 35 ? 1.687   -3.600  10.210  1.00 0.00 ? 35 ARG A HE   2  
ATOM 2183  H HH11 . ARG A 1 35 ? 5.001   -4.406  9.391   1.00 0.00 ? 35 ARG A HH11 2  
ATOM 2184  H HH12 . ARG A 1 35 ? 5.650   -3.703  10.839  1.00 0.00 ? 35 ARG A HH12 2  
ATOM 2185  H HH21 . ARG A 1 35 ? 2.543   -2.634  12.064  1.00 0.00 ? 35 ARG A HH21 2  
ATOM 2186  H HH22 . ARG A 1 35 ? 4.255   -2.697  12.357  1.00 0.00 ? 35 ARG A HH22 2  
ATOM 2187  N N    . LEU A 1 36 ? 0.710   -2.214  4.536   1.00 0.00 ? 36 LEU A N    2  
ATOM 2188  C CA   . LEU A 1 36 ? -0.208  -1.075  4.473   1.00 0.00 ? 36 LEU A CA   2  
ATOM 2189  C C    . LEU A 1 36 ? -1.264  -1.214  5.568   1.00 0.00 ? 36 LEU A C    2  
ATOM 2190  O O    . LEU A 1 36 ? -2.169  -2.049  5.476   1.00 0.00 ? 36 LEU A O    2  
ATOM 2191  C CB   . LEU A 1 36 ? -0.851  -0.990  3.064   1.00 0.00 ? 36 LEU A CB   2  
ATOM 2192  C CG   . LEU A 1 36 ? 0.119   -0.564  1.927   1.00 0.00 ? 36 LEU A CG   2  
ATOM 2193  C CD1  . LEU A 1 36 ? -0.614  -0.431  0.582   1.00 0.00 ? 36 LEU A CD1  2  
ATOM 2194  C CD2  . LEU A 1 36 ? 0.864   0.734   2.295   1.00 0.00 ? 36 LEU A CD2  2  
ATOM 2195  H H    . LEU A 1 36 ? 0.334   -3.101  4.399   1.00 0.00 ? 36 LEU A H    2  
ATOM 2196  H HA   . LEU A 1 36 ? 0.358   -0.159  4.651   1.00 0.00 ? 36 LEU A HA   2  
ATOM 2197  H HB2  . LEU A 1 36 ? -1.265  -1.966  2.818   1.00 0.00 ? 36 LEU A HB2  2  
ATOM 2198  H HB3  . LEU A 1 36 ? -1.670  -0.280  3.097   1.00 0.00 ? 36 LEU A HB3  2  
ATOM 2199  H HG   . LEU A 1 36 ? 0.866   -1.336  1.806   1.00 0.00 ? 36 LEU A HG   2  
ATOM 2200  H HD11 . LEU A 1 36 ? 0.094   -0.184  -0.199  1.00 0.00 ? 36 LEU A HD11 2  
ATOM 2201  H HD12 . LEU A 1 36 ? -1.364  0.350   0.641   1.00 0.00 ? 36 LEU A HD12 2  
ATOM 2202  H HD13 . LEU A 1 36 ? -1.094  -1.367  0.338   1.00 0.00 ? 36 LEU A HD13 2  
ATOM 2203  H HD21 . LEU A 1 36 ? 1.541   1.006   1.497   1.00 0.00 ? 36 LEU A HD21 2  
ATOM 2204  H HD22 . LEU A 1 36 ? 1.438   0.581   3.201   1.00 0.00 ? 36 LEU A HD22 2  
ATOM 2205  H HD23 . LEU A 1 36 ? 0.159   1.541   2.452   1.00 0.00 ? 36 LEU A HD23 2  
ATOM 2206  N N    . GLU A 1 37 ? -1.110  -0.404  6.619   1.00 0.00 ? 37 GLU A N    2  
ATOM 2207  C CA   . GLU A 1 37 ? -1.945  -0.461  7.814   1.00 0.00 ? 37 GLU A CA   2  
ATOM 2208  C C    . GLU A 1 37 ? -3.071  0.575   7.720   1.00 0.00 ? 37 GLU A C    2  
ATOM 2209  O O    . GLU A 1 37 ? -2.830  1.776   7.808   1.00 0.00 ? 37 GLU A O    2  
ATOM 2210  C CB   . GLU A 1 37 ? -1.058  -0.245  9.060   1.00 0.00 ? 37 GLU A CB   2  
ATOM 2211  C CG   . GLU A 1 37 ? 0.142   -1.213  9.132   1.00 0.00 ? 37 GLU A CG   2  
ATOM 2212  C CD   . GLU A 1 37 ? 0.745   -1.335  10.532  1.00 0.00 ? 37 GLU A CD   2  
ATOM 2213  O OE1  . GLU A 1 37 ? 0.307   -2.220  11.293  1.00 0.00 ? 37 GLU A OE1  2  
ATOM 2214  O OE2  . GLU A 1 37 ? 1.676   -0.580  10.873  1.00 0.00 ? 37 GLU A OE2  2  
ATOM 2215  H H    . GLU A 1 37 ? -0.400  0.270   6.585   1.00 0.00 ? 37 GLU A H    2  
ATOM 2216  H HA   . GLU A 1 37 ? -2.389  -1.459  7.875   1.00 0.00 ? 37 GLU A HA   2  
ATOM 2217  H HB2  . GLU A 1 37 ? -0.673  0.774   9.057   1.00 0.00 ? 37 GLU A HB2  2  
ATOM 2218  H HB3  . GLU A 1 37 ? -1.664  -0.380  9.945   1.00 0.00 ? 37 GLU A HB3  2  
ATOM 2219  H HG2  . GLU A 1 37 ? -0.173  -2.202  8.800   1.00 0.00 ? 37 GLU A HG2  2  
ATOM 2220  H HG3  . GLU A 1 37 ? 0.906   -0.856  8.452   1.00 0.00 ? 37 GLU A HG3  2  
ATOM 2221  N N    . VAL A 1 38 ? -4.306  0.081   7.566   1.00 0.00 ? 38 VAL A N    2  
ATOM 2222  C CA   . VAL A 1 38 ? -5.481  0.905   7.274   1.00 0.00 ? 38 VAL A CA   2  
ATOM 2223  C C    . VAL A 1 38 ? -6.121  1.324   8.611   1.00 0.00 ? 38 VAL A C    2  
ATOM 2224  O O    . VAL A 1 38 ? -6.913  0.571   9.189   1.00 0.00 ? 38 VAL A O    2  
ATOM 2225  C CB   . VAL A 1 38 ? -6.511  0.122   6.369   1.00 0.00 ? 38 VAL A CB   2  
ATOM 2226  C CG1  . VAL A 1 38 ? -7.579  1.067   5.786   1.00 0.00 ? 38 VAL A CG1  2  
ATOM 2227  C CG2  . VAL A 1 38 ? -5.789  -0.658  5.248   1.00 0.00 ? 38 VAL A CG2  2  
ATOM 2228  H H    . VAL A 1 38 ? -4.446  -0.868  7.736   1.00 0.00 ? 38 VAL A H    2  
ATOM 2229  H HA   . VAL A 1 38 ? -5.153  1.801   6.731   1.00 0.00 ? 38 VAL A HA   2  
ATOM 2230  H HB   . VAL A 1 38 ? -7.025  -0.610  6.995   1.00 0.00 ? 38 VAL A HB   2  
ATOM 2231  H HG11 . VAL A 1 38 ? -8.060  1.610   6.586   1.00 0.00 ? 38 VAL A HG11 2  
ATOM 2232  H HG12 . VAL A 1 38 ? -8.325  0.494   5.251   1.00 0.00 ? 38 VAL A HG12 2  
ATOM 2233  H HG13 . VAL A 1 38 ? -7.116  1.771   5.104   1.00 0.00 ? 38 VAL A HG13 2  
ATOM 2234  H HG21 . VAL A 1 38 ? -6.511  -1.220  4.666   1.00 0.00 ? 38 VAL A HG21 2  
ATOM 2235  H HG22 . VAL A 1 38 ? -5.077  -1.348  5.684   1.00 0.00 ? 38 VAL A HG22 2  
ATOM 2236  H HG23 . VAL A 1 38 ? -5.263  0.027   4.595   1.00 0.00 ? 38 VAL A HG23 2  
ATOM 2237  N N    . VAL A 1 39 ? -5.733  2.516   9.104   1.00 0.00 ? 39 VAL A N    2  
ATOM 2238  C CA   . VAL A 1 39 ? -6.091  3.000   10.442  1.00 0.00 ? 39 VAL A CA   2  
ATOM 2239  C C    . VAL A 1 39 ? -7.585  3.365   10.513  1.00 0.00 ? 39 VAL A C    2  
ATOM 2240  O O    . VAL A 1 39 ? -8.052  4.258   9.790   1.00 0.00 ? 39 VAL A O    2  
ATOM 2241  C CB   . VAL A 1 39 ? -5.207  4.232   10.848  1.00 0.00 ? 39 VAL A CB   2  
ATOM 2242  C CG1  . VAL A 1 39 ? -5.577  4.773   12.253  1.00 0.00 ? 39 VAL A CG1  2  
ATOM 2243  C CG2  . VAL A 1 39 ? -3.695  3.886   10.753  1.00 0.00 ? 39 VAL A CG2  2  
ATOM 2244  H H    . VAL A 1 39 ? -5.203  3.115   8.535   1.00 0.00 ? 39 VAL A H    2  
ATOM 2245  H HA   . VAL A 1 39 ? -5.886  2.193   11.146  1.00 0.00 ? 39 VAL A HA   2  
ATOM 2246  H HB   . VAL A 1 39 ? -5.406  5.029   10.135  1.00 0.00 ? 39 VAL A HB   2  
ATOM 2247  H HG11 . VAL A 1 39 ? -5.407  4.010   13.003  1.00 0.00 ? 39 VAL A HG11 2  
ATOM 2248  H HG12 . VAL A 1 39 ? -6.619  5.062   12.269  1.00 0.00 ? 39 VAL A HG12 2  
ATOM 2249  H HG13 . VAL A 1 39 ? -4.968  5.641   12.482  1.00 0.00 ? 39 VAL A HG13 2  
ATOM 2250  H HG21 . VAL A 1 39 ? -3.453  3.082   11.442  1.00 0.00 ? 39 VAL A HG21 2  
ATOM 2251  H HG22 . VAL A 1 39 ? -3.100  4.757   11.002  1.00 0.00 ? 39 VAL A HG22 2  
ATOM 2252  H HG23 . VAL A 1 39 ? -3.456  3.571   9.746   1.00 0.00 ? 39 VAL A HG23 2  
ATOM 2253  N N    . ASN A 1 40 ? -8.303  2.639   11.392  1.00 0.00 ? 40 ASN A N    2  
ATOM 2254  C CA   . ASN A 1 40 ? -9.766  2.735   11.595  1.00 0.00 ? 40 ASN A CA   2  
ATOM 2255  C C    . ASN A 1 40 ? -10.568 2.554   10.293  1.00 0.00 ? 40 ASN A C    2  
ATOM 2256  O O    . ASN A 1 40 ? -11.750 2.937   10.222  1.00 0.00 ? 40 ASN A O    2  
ATOM 2257  C CB   . ASN A 1 40 ? -10.164 4.045   12.340  1.00 0.00 ? 40 ASN A CB   2  
ATOM 2258  C CG   . ASN A 1 40 ? -9.741  4.053   13.814  1.00 0.00 ? 40 ASN A CG   2  
ATOM 2259  O OD1  . ASN A 1 40 ? -8.683  3.533   14.171  1.00 0.00 ? 40 ASN A OD1  2  
ATOM 2260  N ND2  . ASN A 1 40 ? -10.570 4.618   14.683  1.00 0.00 ? 40 ASN A ND2  2  
ATOM 2261  H H    . ASN A 1 40 ? -7.814  2.001   11.956  1.00 0.00 ? 40 ASN A H    2  
ATOM 2262  H HA   . ASN A 1 40 ? -10.025 1.897   12.228  1.00 0.00 ? 40 ASN A HA   2  
ATOM 2263  H HB2  . ASN A 1 40 ? -9.695  4.896   11.851  1.00 0.00 ? 40 ASN A HB2  2  
ATOM 2264  H HB3  . ASN A 1 40 ? -11.238 4.163   12.284  1.00 0.00 ? 40 ASN A HB3  2  
ATOM 2265  H HD21 . ASN A 1 40 ? -11.404 5.008   14.341  1.00 0.00 ? 40 ASN A HD21 2  
ATOM 2266  H HD22 . ASN A 1 40 ? -10.333 4.599   15.634  1.00 0.00 ? 40 ASN A HD22 2  
ATOM 2267  N N    . LYS A 1 41 ? -9.936  1.886   9.301   1.00 0.00 ? 41 LYS A N    2  
ATOM 2268  C CA   . LYS A 1 41 ? -10.447 1.738   7.927   1.00 0.00 ? 41 LYS A CA   2  
ATOM 2269  C C    . LYS A 1 41 ? -10.809 3.083   7.237   1.00 0.00 ? 41 LYS A C    2  
ATOM 2270  O O    . LYS A 1 41 ? -11.499 3.086   6.219   1.00 0.00 ? 41 LYS A O    2  
ATOM 2271  C CB   . LYS A 1 41 ? -11.640 0.739   7.906   1.00 0.00 ? 41 LYS A CB   2  
ATOM 2272  C CG   . LYS A 1 41 ? -11.285 -0.684  8.395   1.00 0.00 ? 41 LYS A CG   2  
ATOM 2273  C CD   . LYS A 1 41 ? -12.489 -1.663  8.412   1.00 0.00 ? 41 LYS A CD   2  
ATOM 2274  C CE   . LYS A 1 41 ? -13.025 -2.035  7.013   1.00 0.00 ? 41 LYS A CE   2  
ATOM 2275  N NZ   . LYS A 1 41 ? -13.804 -0.943  6.356   1.00 0.00 ? 41 LYS A NZ   2  
ATOM 2276  H H    . LYS A 1 41 ? -9.117  1.388   9.522   1.00 0.00 ? 41 LYS A H    2  
ATOM 2277  H HA   . LYS A 1 41 ? -9.641  1.300   7.357   1.00 0.00 ? 41 LYS A HA   2  
ATOM 2278  H HB2  . LYS A 1 41 ? -12.432 1.130   8.540   1.00 0.00 ? 41 LYS A HB2  2  
ATOM 2279  H HB3  . LYS A 1 41 ? -12.019 0.666   6.891   1.00 0.00 ? 41 LYS A HB3  2  
ATOM 2280  H HG2  . LYS A 1 41 ? -10.514 -1.096  7.748   1.00 0.00 ? 41 LYS A HG2  2  
ATOM 2281  H HG3  . LYS A 1 41 ? -10.883 -0.608  9.402   1.00 0.00 ? 41 LYS A HG3  2  
ATOM 2282  H HD2  . LYS A 1 41 ? -12.177 -2.575  8.908   1.00 0.00 ? 41 LYS A HD2  2  
ATOM 2283  H HD3  . LYS A 1 41 ? -13.299 -1.218  8.989   1.00 0.00 ? 41 LYS A HD3  2  
ATOM 2284  H HE2  . LYS A 1 41 ? -12.188 -2.288  6.375   1.00 0.00 ? 41 LYS A HE2  2  
ATOM 2285  H HE3  . LYS A 1 41 ? -13.665 -2.906  7.104   1.00 0.00 ? 41 LYS A HE3  2  
ATOM 2286  H HZ1  . LYS A 1 41 ? -14.262 -1.298  5.491   1.00 0.00 ? 41 LYS A HZ1  2  
ATOM 2287  H HZ2  . LYS A 1 41 ? -13.187 -0.149  6.106   1.00 0.00 ? 41 LYS A HZ2  2  
ATOM 2288  H HZ3  . LYS A 1 41 ? -14.546 -0.596  6.999   1.00 0.00 ? 41 LYS A HZ3  2  
ATOM 2289  N N    . ARG A 1 42 ? -10.317 4.216   7.766   1.00 0.00 ? 42 ARG A N    2  
ATOM 2290  C CA   . ARG A 1 42 ? -10.620 5.558   7.225   1.00 0.00 ? 42 ARG A CA   2  
ATOM 2291  C C    . ARG A 1 42 ? -9.574  5.964   6.190   1.00 0.00 ? 42 ARG A C    2  
ATOM 2292  O O    . ARG A 1 42 ? -9.903  6.558   5.164   1.00 0.00 ? 42 ARG A O    2  
ATOM 2293  C CB   . ARG A 1 42 ? -10.697 6.603   8.371   1.00 0.00 ? 42 ARG A CB   2  
ATOM 2294  C CG   . ARG A 1 42 ? -11.700 6.217   9.484   1.00 0.00 ? 42 ARG A CG   2  
ATOM 2295  C CD   . ARG A 1 42 ? -13.115 5.911   8.942   1.00 0.00 ? 42 ARG A CD   2  
ATOM 2296  N NE   . ARG A 1 42 ? -14.015 5.378   9.979   1.00 0.00 ? 42 ARG A NE   2  
ATOM 2297  C CZ   . ARG A 1 42 ? -15.109 4.627   9.743   1.00 0.00 ? 42 ARG A CZ   2  
ATOM 2298  N NH1  . ARG A 1 42 ? -15.448 4.276   8.494   1.00 0.00 ? 42 ARG A NH1  2  
ATOM 2299  N NH2  . ARG A 1 42 ? -15.851 4.234   10.758  1.00 0.00 ? 42 ARG A NH2  2  
ATOM 2300  H H    . ARG A 1 42 ? -9.746  4.156   8.554   1.00 0.00 ? 42 ARG A H    2  
ATOM 2301  H HA   . ARG A 1 42 ? -11.592 5.516   6.734   1.00 0.00 ? 42 ARG A HA   2  
ATOM 2302  H HB2  . ARG A 1 42 ? -9.712  6.711   8.824   1.00 0.00 ? 42 ARG A HB2  2  
ATOM 2303  H HB3  . ARG A 1 42 ? -10.995 7.564   7.962   1.00 0.00 ? 42 ARG A HB3  2  
ATOM 2304  H HG2  . ARG A 1 42 ? -11.327 5.337   9.990   1.00 0.00 ? 42 ARG A HG2  2  
ATOM 2305  H HG3  . ARG A 1 42 ? -11.763 7.032   10.197  1.00 0.00 ? 42 ARG A HG3  2  
ATOM 2306  H HD2  . ARG A 1 42 ? -13.542 6.822   8.547   1.00 0.00 ? 42 ARG A HD2  2  
ATOM 2307  H HD3  . ARG A 1 42 ? -13.035 5.181   8.146   1.00 0.00 ? 42 ARG A HD3  2  
ATOM 2308  H HE   . ARG A 1 42 ? -13.789 5.595   10.912  1.00 0.00 ? 42 ARG A HE   2  
ATOM 2309  H HH11 . ARG A 1 42 ? -14.898 4.586   7.714   1.00 0.00 ? 42 ARG A HH11 2  
ATOM 2310  H HH12 . ARG A 1 42 ? -16.265 3.711   8.332   1.00 0.00 ? 42 ARG A HH12 2  
ATOM 2311  H HH21 . ARG A 1 42 ? -15.608 4.503   11.694  1.00 0.00 ? 42 ARG A HH21 2  
ATOM 2312  H HH22 . ARG A 1 42 ? -16.664 3.669   10.602  1.00 0.00 ? 42 ARG A HH22 2  
ATOM 2313  N N    . PHE A 1 43 ? -8.327  5.587   6.456   1.00 0.00 ? 43 PHE A N    2  
ATOM 2314  C CA   . PHE A 1 43 ? -7.179  5.916   5.608   1.00 0.00 ? 43 PHE A CA   2  
ATOM 2315  C C    . PHE A 1 43 ? -6.103  4.844   5.778   1.00 0.00 ? 43 PHE A C    2  
ATOM 2316  O O    . PHE A 1 43 ? -6.127  4.083   6.753   1.00 0.00 ? 43 PHE A O    2  
ATOM 2317  C CB   . PHE A 1 43 ? -6.612  7.331   5.943   1.00 0.00 ? 43 PHE A CB   2  
ATOM 2318  C CG   . PHE A 1 43 ? -6.109  7.509   7.384   1.00 0.00 ? 43 PHE A CG   2  
ATOM 2319  C CD1  . PHE A 1 43 ? -6.983  7.892   8.404   1.00 0.00 ? 43 PHE A CD1  2  
ATOM 2320  C CD2  . PHE A 1 43 ? -4.766  7.306   7.715   1.00 0.00 ? 43 PHE A CD2  2  
ATOM 2321  C CE1  . PHE A 1 43 ? -6.531  8.067   9.696   1.00 0.00 ? 43 PHE A CE1  2  
ATOM 2322  C CE2  . PHE A 1 43 ? -4.313  7.484   9.009   1.00 0.00 ? 43 PHE A CE2  2  
ATOM 2323  C CZ   . PHE A 1 43 ? -5.196  7.865   9.999   1.00 0.00 ? 43 PHE A CZ   2  
ATOM 2324  H H    . PHE A 1 43 ? -8.167  5.015   7.239   1.00 0.00 ? 43 PHE A H    2  
ATOM 2325  H HA   . PHE A 1 43 ? -7.515  5.900   4.574   1.00 0.00 ? 43 PHE A HA   2  
ATOM 2326  H HB2  . PHE A 1 43 ? -5.787  7.548   5.270   1.00 0.00 ? 43 PHE A HB2  2  
ATOM 2327  H HB3  . PHE A 1 43 ? -7.389  8.066   5.770   1.00 0.00 ? 43 PHE A HB3  2  
ATOM 2328  H HD1  . PHE A 1 43 ? -8.031  8.051   8.174   1.00 0.00 ? 43 PHE A HD1  2  
ATOM 2329  H HD2  . PHE A 1 43 ? -4.066  7.009   6.940   1.00 0.00 ? 43 PHE A HD2  2  
ATOM 2330  H HE1  . PHE A 1 43 ? -7.221  8.366   10.474  1.00 0.00 ? 43 PHE A HE1  2  
ATOM 2331  H HE2  . PHE A 1 43 ? -3.269  7.321   9.246   1.00 0.00 ? 43 PHE A HE2  2  
ATOM 2332  H HZ   . PHE A 1 43 ? -4.846  8.004   11.012  1.00 0.00 ? 43 PHE A HZ   2  
ATOM 2333  N N    . VAL A 1 44 ? -5.147  4.807   4.843   1.00 0.00 ? 44 VAL A N    2  
ATOM 2334  C CA   . VAL A 1 44 ? -4.059  3.824   4.858   1.00 0.00 ? 44 VAL A CA   2  
ATOM 2335  C C    . VAL A 1 44 ? -2.748  4.532   5.182   1.00 0.00 ? 44 VAL A C    2  
ATOM 2336  O O    . VAL A 1 44 ? -2.420  5.551   4.569   1.00 0.00 ? 44 VAL A O    2  
ATOM 2337  C CB   . VAL A 1 44 ? -3.930  3.068   3.489   1.00 0.00 ? 44 VAL A CB   2  
ATOM 2338  C CG1  . VAL A 1 44 ? -2.826  1.991   3.560   1.00 0.00 ? 44 VAL A CG1  2  
ATOM 2339  C CG2  . VAL A 1 44 ? -5.278  2.450   3.081   1.00 0.00 ? 44 VAL A CG2  2  
ATOM 2340  H H    . VAL A 1 44 ? -5.146  5.496   4.146   1.00 0.00 ? 44 VAL A H    2  
ATOM 2341  H HA   . VAL A 1 44 ? -4.265  3.081   5.638   1.00 0.00 ? 44 VAL A HA   2  
ATOM 2342  H HB   . VAL A 1 44 ? -3.643  3.790   2.718   1.00 0.00 ? 44 VAL A HB   2  
ATOM 2343  H HG11 . VAL A 1 44 ? -3.071  1.266   4.327   1.00 0.00 ? 44 VAL A HG11 2  
ATOM 2344  H HG12 . VAL A 1 44 ? -1.877  2.454   3.799   1.00 0.00 ? 44 VAL A HG12 2  
ATOM 2345  H HG13 . VAL A 1 44 ? -2.741  1.487   2.605   1.00 0.00 ? 44 VAL A HG13 2  
ATOM 2346  H HG21 . VAL A 1 44 ? -6.029  3.228   3.014   1.00 0.00 ? 44 VAL A HG21 2  
ATOM 2347  H HG22 . VAL A 1 44 ? -5.589  1.722   3.819   1.00 0.00 ? 44 VAL A HG22 2  
ATOM 2348  H HG23 . VAL A 1 44 ? -5.190  1.964   2.117   1.00 0.00 ? 44 VAL A HG23 2  
ATOM 2349  N N    . ARG A 1 45 ? -2.007  3.987   6.147   1.00 0.00 ? 45 ARG A N    2  
ATOM 2350  C CA   . ARG A 1 45 ? -0.709  4.504   6.552   1.00 0.00 ? 45 ARG A CA   2  
ATOM 2351  C C    . ARG A 1 45 ? 0.344   3.432   6.239   1.00 0.00 ? 45 ARG A C    2  
ATOM 2352  O O    . ARG A 1 45 ? 0.177   2.259   6.581   1.00 0.00 ? 45 ARG A O    2  
ATOM 2353  C CB   . ARG A 1 45 ? -0.746  4.923   8.053   1.00 0.00 ? 45 ARG A CB   2  
ATOM 2354  C CG   . ARG A 1 45 ? 0.452   5.787   8.535   1.00 0.00 ? 45 ARG A CG   2  
ATOM 2355  C CD   . ARG A 1 45 ? 1.673   4.973   8.978   1.00 0.00 ? 45 ARG A CD   2  
ATOM 2356  N NE   . ARG A 1 45 ? 1.368   4.148   10.159  1.00 0.00 ? 45 ARG A NE   2  
ATOM 2357  C CZ   . ARG A 1 45 ? 1.539   2.824   10.260  1.00 0.00 ? 45 ARG A CZ   2  
ATOM 2358  N NH1  . ARG A 1 45 ? 2.024   2.119   9.245   1.00 0.00 ? 45 ARG A NH1  2  
ATOM 2359  N NH2  . ARG A 1 45 ? 1.205   2.215   11.383  1.00 0.00 ? 45 ARG A NH2  2  
ATOM 2360  H H    . ARG A 1 45 ? -2.336  3.187   6.589   1.00 0.00 ? 45 ARG A H    2  
ATOM 2361  H HA   . ARG A 1 45 ? -0.491  5.391   5.949   1.00 0.00 ? 45 ARG A HA   2  
ATOM 2362  H HB2  . ARG A 1 45 ? -1.654  5.493   8.222   1.00 0.00 ? 45 ARG A HB2  2  
ATOM 2363  H HB3  . ARG A 1 45 ? -0.795  4.028   8.666   1.00 0.00 ? 45 ARG A HB3  2  
ATOM 2364  H HG2  . ARG A 1 45 ? 0.753   6.447   7.731   1.00 0.00 ? 45 ARG A HG2  2  
ATOM 2365  H HG3  . ARG A 1 45 ? 0.124   6.393   9.372   1.00 0.00 ? 45 ARG A HG3  2  
ATOM 2366  H HD2  . ARG A 1 45 ? 1.992   4.333   8.157   1.00 0.00 ? 45 ARG A HD2  2  
ATOM 2367  H HD3  . ARG A 1 45 ? 2.476   5.651   9.228   1.00 0.00 ? 45 ARG A HD3  2  
ATOM 2368  H HE   . ARG A 1 45 ? 1.005   4.626   10.940  1.00 0.00 ? 45 ARG A HE   2  
ATOM 2369  H HH11 . ARG A 1 45 ? 2.272   2.568   8.387   1.00 0.00 ? 45 ARG A HH11 2  
ATOM 2370  H HH12 . ARG A 1 45 ? 2.147   1.125   9.338   1.00 0.00 ? 45 ARG A HH12 2  
ATOM 2371  H HH21 . ARG A 1 45 ? 0.828   2.744   12.147  1.00 0.00 ? 45 ARG A HH21 2  
ATOM 2372  H HH22 . ARG A 1 45 ? 1.326   1.224   11.475  1.00 0.00 ? 45 ARG A HH22 2  
ATOM 2373  N N    . VAL A 1 46 ? 1.422   3.880   5.607   1.00 0.00 ? 46 VAL A N    2  
ATOM 2374  C CA   . VAL A 1 46 ? 2.459   3.012   5.043   1.00 0.00 ? 46 VAL A CA   2  
ATOM 2375  C C    . VAL A 1 46 ? 3.526   2.710   6.098   1.00 0.00 ? 46 VAL A C    2  
ATOM 2376  O O    . VAL A 1 46 ? 4.078   3.631   6.711   1.00 0.00 ? 46 VAL A O    2  
ATOM 2377  C CB   . VAL A 1 46 ? 3.127   3.683   3.787   1.00 0.00 ? 46 VAL A CB   2  
ATOM 2378  C CG1  . VAL A 1 46 ? 4.190   2.772   3.128   1.00 0.00 ? 46 VAL A CG1  2  
ATOM 2379  C CG2  . VAL A 1 46 ? 2.056   4.132   2.761   1.00 0.00 ? 46 VAL A CG2  2  
ATOM 2380  H H    . VAL A 1 46 ? 1.526   4.849   5.565   1.00 0.00 ? 46 VAL A H    2  
ATOM 2381  H HA   . VAL A 1 46 ? 1.992   2.077   4.721   1.00 0.00 ? 46 VAL A HA   2  
ATOM 2382  H HB   . VAL A 1 46 ? 3.641   4.581   4.131   1.00 0.00 ? 46 VAL A HB   2  
ATOM 2383  H HG11 . VAL A 1 46 ? 4.957   2.524   3.847   1.00 0.00 ? 46 VAL A HG11 2  
ATOM 2384  H HG12 . VAL A 1 46 ? 4.643   3.289   2.290   1.00 0.00 ? 46 VAL A HG12 2  
ATOM 2385  H HG13 . VAL A 1 46 ? 3.722   1.861   2.773   1.00 0.00 ? 46 VAL A HG13 2  
ATOM 2386  H HG21 . VAL A 1 46 ? 2.536   4.629   1.926   1.00 0.00 ? 46 VAL A HG21 2  
ATOM 2387  H HG22 . VAL A 1 46 ? 1.365   4.820   3.232   1.00 0.00 ? 46 VAL A HG22 2  
ATOM 2388  H HG23 . VAL A 1 46 ? 1.509   3.273   2.397   1.00 0.00 ? 46 VAL A HG23 2  
ATOM 2389  N N    . THR A 1 47 ? 3.784   1.421   6.321   1.00 0.00 ? 47 THR A N    2  
ATOM 2390  C CA   . THR A 1 47 ? 4.940   0.956   7.084   1.00 0.00 ? 47 THR A CA   2  
ATOM 2391  C C    . THR A 1 47 ? 6.044   0.635   6.067   1.00 0.00 ? 47 THR A C    2  
ATOM 2392  O O    . THR A 1 47 ? 5.770   -0.027  5.066   1.00 0.00 ? 47 THR A O    2  
ATOM 2393  C CB   . THR A 1 47 ? 4.600   -0.334  7.906   1.00 0.00 ? 47 THR A CB   2  
ATOM 2394  O OG1  . THR A 1 47 ? 3.402   -0.144  8.663   1.00 0.00 ? 47 THR A OG1  2  
ATOM 2395  C CG2  . THR A 1 47 ? 5.736   -0.739  8.859   1.00 0.00 ? 47 THR A CG2  2  
ATOM 2396  H H    . THR A 1 47 ? 3.198   0.735   5.928   1.00 0.00 ? 47 THR A H    2  
ATOM 2397  H HA   . THR A 1 47 ? 5.271   1.745   7.764   1.00 0.00 ? 47 THR A HA   2  
ATOM 2398  H HB   . THR A 1 47 ? 4.424   -1.152  7.214   1.00 0.00 ? 47 THR A HB   2  
ATOM 2399  H HG1  . THR A 1 47 ? 3.355   -0.814  9.353   1.00 0.00 ? 47 THR A HG1  2  
ATOM 2400  H HG21 . THR A 1 47 ? 6.640   -0.924  8.295   1.00 0.00 ? 47 THR A HG21 2  
ATOM 2401  H HG22 . THR A 1 47 ? 5.461   -1.641  9.384   1.00 0.00 ? 47 THR A HG22 2  
ATOM 2402  H HG23 . THR A 1 47 ? 5.914   0.055   9.576   1.00 0.00 ? 47 THR A HG23 2  
ATOM 2403  N N    . PHE A 1 48 ? 7.247   1.159   6.289   1.00 0.00 ? 48 PHE A N    2  
ATOM 2404  C CA   . PHE A 1 48 ? 8.436   0.807   5.483   1.00 0.00 ? 48 PHE A CA   2  
ATOM 2405  C C    . PHE A 1 48 ? 9.129   -0.437  6.053   1.00 0.00 ? 48 PHE A C    2  
ATOM 2406  O O    . PHE A 1 48 ? 9.154   -0.627  7.274   1.00 0.00 ? 48 PHE A O    2  
ATOM 2407  C CB   . PHE A 1 48 ? 9.422   1.988   5.431   1.00 0.00 ? 48 PHE A CB   2  
ATOM 2408  C CG   . PHE A 1 48 ? 8.946   3.163   4.595   1.00 0.00 ? 48 PHE A CG   2  
ATOM 2409  C CD1  . PHE A 1 48 ? 8.143   4.158   5.142   1.00 0.00 ? 48 PHE A CD1  2  
ATOM 2410  C CD2  . PHE A 1 48 ? 9.301   3.265   3.250   1.00 0.00 ? 48 PHE A CD2  2  
ATOM 2411  C CE1  . PHE A 1 48 ? 7.713   5.215   4.372   1.00 0.00 ? 48 PHE A CE1  2  
ATOM 2412  C CE2  . PHE A 1 48 ? 8.870   4.321   2.485   1.00 0.00 ? 48 PHE A CE2  2  
ATOM 2413  C CZ   . PHE A 1 48 ? 8.077   5.298   3.044   1.00 0.00 ? 48 PHE A CZ   2  
ATOM 2414  H H    . PHE A 1 48 ? 7.321   1.829   7.002   1.00 0.00 ? 48 PHE A H    2  
ATOM 2415  H HA   . PHE A 1 48 ? 8.102   0.582   4.466   1.00 0.00 ? 48 PHE A HA   2  
ATOM 2416  H HB2  . PHE A 1 48 ? 9.605   2.347   6.441   1.00 0.00 ? 48 PHE A HB2  2  
ATOM 2417  H HB3  . PHE A 1 48 ? 10.369  1.648   5.019   1.00 0.00 ? 48 PHE A HB3  2  
ATOM 2418  H HD1  . PHE A 1 48 ? 7.854   4.099   6.186   1.00 0.00 ? 48 PHE A HD1  2  
ATOM 2419  H HD2  . PHE A 1 48 ? 9.927   2.498   2.804   1.00 0.00 ? 48 PHE A HD2  2  
ATOM 2420  H HE1  . PHE A 1 48 ? 7.091   5.986   4.808   1.00 0.00 ? 48 PHE A HE1  2  
ATOM 2421  H HE2  . PHE A 1 48 ? 9.155   4.386   1.445   1.00 0.00 ? 48 PHE A HE2  2  
ATOM 2422  H HZ   . PHE A 1 48 ? 7.734   6.128   2.441   1.00 0.00 ? 48 PHE A HZ   2  
ATOM 2423  N N    . THR A 1 49 ? 9.685   -1.282  5.158   1.00 0.00 ? 49 THR A N    2  
ATOM 2424  C CA   . THR A 1 49 ? 10.367  -2.531  5.548   1.00 0.00 ? 49 THR A CA   2  
ATOM 2425  C C    . THR A 1 49 ? 11.744  -2.213  6.181   1.00 0.00 ? 49 THR A C    2  
ATOM 2426  O O    . THR A 1 49 ? 12.407  -1.259  5.742   1.00 0.00 ? 49 THR A O    2  
ATOM 2427  C CB   . THR A 1 49 ? 10.477  -3.517  4.320   1.00 0.00 ? 49 THR A CB   2  
ATOM 2428  O OG1  . THR A 1 49 ? 10.862  -4.831  4.750   1.00 0.00 ? 49 THR A OG1  2  
ATOM 2429  C CG2  . THR A 1 49 ? 11.458  -3.033  3.241   1.00 0.00 ? 49 THR A CG2  2  
ATOM 2430  H H    . THR A 1 49 ? 9.639   -1.058  4.207   1.00 0.00 ? 49 THR A H    2  
ATOM 2431  H HA   . THR A 1 49 ? 9.745   -3.013  6.302   1.00 0.00 ? 49 THR A HA   2  
ATOM 2432  H HB   . THR A 1 49 ? 9.491   -3.597  3.872   1.00 0.00 ? 49 THR A HB   2  
ATOM 2433  H HG1  . THR A 1 49 ? 10.105  -5.262  5.166   1.00 0.00 ? 49 THR A HG1  2  
ATOM 2434  H HG21 . THR A 1 49 ? 12.458  -2.981  3.657   1.00 0.00 ? 49 THR A HG21 2  
ATOM 2435  H HG22 . THR A 1 49 ? 11.169  -2.051  2.890   1.00 0.00 ? 49 THR A HG22 2  
ATOM 2436  H HG23 . THR A 1 49 ? 11.457  -3.724  2.409   1.00 0.00 ? 49 THR A HG23 2  
ATOM 2437  N N    . PRO A 1 50 ? 12.174  -2.973  7.251   1.00 0.00 ? 50 PRO A N    2  
ATOM 2438  C CA   . PRO A 1 50 ? 13.409  -2.674  8.025   1.00 0.00 ? 50 PRO A CA   2  
ATOM 2439  C C    . PRO A 1 50 ? 14.665  -2.619  7.130   1.00 0.00 ? 50 PRO A C    2  
ATOM 2440  O O    . PRO A 1 50 ? 14.980  -3.586  6.440   1.00 0.00 ? 50 PRO A O    2  
ATOM 2441  C CB   . PRO A 1 50 ? 13.485  -3.834  9.060   1.00 0.00 ? 50 PRO A CB   2  
ATOM 2442  C CG   . PRO A 1 50 ? 12.606  -4.912  8.506   1.00 0.00 ? 50 PRO A CG   2  
ATOM 2443  C CD   . PRO A 1 50 ? 11.493  -4.176  7.800   1.00 0.00 ? 50 PRO A CD   2  
ATOM 2444  H HA   . PRO A 1 50 ? 13.303  -1.728  8.551   1.00 0.00 ? 50 PRO A HA   2  
ATOM 2445  H HB2  . PRO A 1 50 ? 14.511  -4.184  9.181   1.00 0.00 ? 50 PRO A HB2  2  
ATOM 2446  H HB3  . PRO A 1 50 ? 13.103  -3.502  10.021  1.00 0.00 ? 50 PRO A HB3  2  
ATOM 2447  H HG2  . PRO A 1 50 ? 13.166  -5.533  7.809   1.00 0.00 ? 50 PRO A HG2  2  
ATOM 2448  H HG3  . PRO A 1 50 ? 12.203  -5.520  9.307   1.00 0.00 ? 50 PRO A HG3  2  
ATOM 2449  H HD2  . PRO A 1 50 ? 11.071  -4.782  7.000   1.00 0.00 ? 50 PRO A HD2  2  
ATOM 2450  H HD3  . PRO A 1 50 ? 10.717  -3.887  8.497   1.00 0.00 ? 50 PRO A HD3  2  
ATOM 2451  N N    . GLY A 1 51 ? 15.343  -1.461  7.136   1.00 0.00 ? 51 GLY A N    2  
ATOM 2452  C CA   . GLY A 1 51 ? 16.499  -1.202  6.264   1.00 0.00 ? 51 GLY A CA   2  
ATOM 2453  C C    . GLY A 1 51 ? 16.180  -0.153  5.214   1.00 0.00 ? 51 GLY A C    2  
ATOM 2454  O O    . GLY A 1 51 ? 17.011  0.707   4.898   1.00 0.00 ? 51 GLY A O    2  
ATOM 2455  H H    . GLY A 1 51 ? 15.055  -0.757  7.754   1.00 0.00 ? 51 GLY A H    2  
ATOM 2456  H HA2  . GLY A 1 51 ? 17.324  -0.855  6.875   1.00 0.00 ? 51 GLY A HA2  2  
ATOM 2457  H HA3  . GLY A 1 51 ? 16.800  -2.116  5.761   1.00 0.00 ? 51 GLY A HA3  2  
ATOM 2458  N N    . LYS A 1 52 ? 14.954  -0.233  4.673   1.00 0.00 ? 52 LYS A N    2  
ATOM 2459  C CA   . LYS A 1 52 ? 14.415  0.753   3.721   1.00 0.00 ? 52 LYS A CA   2  
ATOM 2460  C C    . LYS A 1 52 ? 13.557  1.810   4.446   1.00 0.00 ? 52 LYS A C    2  
ATOM 2461  O O    . LYS A 1 52 ? 12.984  2.692   3.802   1.00 0.00 ? 52 LYS A O    2  
ATOM 2462  C CB   . LYS A 1 52 ? 13.579  0.041   2.624   1.00 0.00 ? 52 LYS A CB   2  
ATOM 2463  C CG   . LYS A 1 52 ? 14.332  -1.034  1.815   1.00 0.00 ? 52 LYS A CG   2  
ATOM 2464  C CD   . LYS A 1 52 ? 15.560  -0.470  1.075   1.00 0.00 ? 52 LYS A CD   2  
ATOM 2465  C CE   . LYS A 1 52 ? 16.336  -1.550  0.314   1.00 0.00 ? 52 LYS A CE   2  
ATOM 2466  N NZ   . LYS A 1 52 ? 16.782  -2.652  1.209   1.00 0.00 ? 52 LYS A NZ   2  
ATOM 2467  H H    . LYS A 1 52 ? 14.381  -0.985  4.938   1.00 0.00 ? 52 LYS A H    2  
ATOM 2468  H HA   . LYS A 1 52 ? 15.250  1.267   3.248   1.00 0.00 ? 52 LYS A HA   2  
ATOM 2469  H HB2  . LYS A 1 52 ? 12.721  -0.435  3.093   1.00 0.00 ? 52 LYS A HB2  2  
ATOM 2470  H HB3  . LYS A 1 52 ? 13.214  0.786   1.929   1.00 0.00 ? 52 LYS A HB3  2  
ATOM 2471  H HG2  . LYS A 1 52 ? 14.658  -1.815  2.491   1.00 0.00 ? 52 LYS A HG2  2  
ATOM 2472  H HG3  . LYS A 1 52 ? 13.651  -1.462  1.085   1.00 0.00 ? 52 LYS A HG3  2  
ATOM 2473  H HD2  . LYS A 1 52 ? 15.225  0.281   0.367   1.00 0.00 ? 52 LYS A HD2  2  
ATOM 2474  H HD3  . LYS A 1 52 ? 16.226  0.000   1.796   1.00 0.00 ? 52 LYS A HD3  2  
ATOM 2475  H HE2  . LYS A 1 52 ? 15.705  -1.962  -0.462  1.00 0.00 ? 52 LYS A HE2  2  
ATOM 2476  H HE3  . LYS A 1 52 ? 17.210  -1.099  -0.142  1.00 0.00 ? 52 LYS A HE3  2  
ATOM 2477  H HZ1  . LYS A 1 52 ? 17.332  -2.273  2.003   1.00 0.00 ? 52 LYS A HZ1  2  
ATOM 2478  H HZ2  . LYS A 1 52 ? 17.373  -3.327  0.679   1.00 0.00 ? 52 LYS A HZ2  2  
ATOM 2479  H HZ3  . LYS A 1 52 ? 15.958  -3.167  1.585   1.00 0.00 ? 52 LYS A HZ3  2  
ATOM 2480  N N    . THR A 1 53 ? 13.467  1.705   5.783   1.00 0.00 ? 53 THR A N    2  
ATOM 2481  C CA   . THR A 1 53 ? 12.711  2.640   6.619   1.00 0.00 ? 53 THR A CA   2  
ATOM 2482  C C    . THR A 1 53 ? 13.552  3.902   6.889   1.00 0.00 ? 53 THR A C    2  
ATOM 2483  O O    . THR A 1 53 ? 14.617  3.784   7.511   1.00 0.00 ? 53 THR A O    2  
ATOM 2484  C CB   . THR A 1 53 ? 12.306  1.970   7.968   1.00 0.00 ? 53 THR A CB   2  
ATOM 2485  O OG1  . THR A 1 53 ? 11.811  0.652   7.699   1.00 0.00 ? 53 THR A OG1  2  
ATOM 2486  C CG2  . THR A 1 53 ? 11.208  2.771   8.704   1.00 0.00 ? 53 THR A CG2  2  
ATOM 2487  H H    . THR A 1 53 ? 13.934  0.969   6.222   1.00 0.00 ? 53 THR A H    2  
ATOM 2488  H HA   . THR A 1 53 ? 11.802  2.907   6.089   1.00 0.00 ? 53 THR A HA   2  
ATOM 2489  H HB   . THR A 1 53 ? 13.183  1.885   8.610   1.00 0.00 ? 53 THR A HB   2  
ATOM 2490  H HG1  . THR A 1 53 ? 11.681  0.544   6.750   1.00 0.00 ? 53 THR A HG1  2  
ATOM 2491  H HG21 . THR A 1 53 ? 10.324  2.836   8.082   1.00 0.00 ? 53 THR A HG21 2  
ATOM 2492  H HG22 . THR A 1 53 ? 11.565  3.769   8.913   1.00 0.00 ? 53 THR A HG22 2  
ATOM 2493  H HG23 . THR A 1 53 ? 10.953  2.280   9.636   1.00 0.00 ? 53 THR A HG23 2  
ATOM 2494  N N    . PRO A 1 54 ? 13.114  5.116   6.395   1.00 0.00 ? 54 PRO A N    2  
ATOM 2495  C CA   . PRO A 1 54 ? 13.836  6.403   6.609   1.00 0.00 ? 54 PRO A CA   2  
ATOM 2496  C C    . PRO A 1 54 ? 14.238  6.615   8.084   1.00 0.00 ? 54 PRO A C    2  
ATOM 2497  O O    . PRO A 1 54 ? 13.367  6.647   8.952   1.00 0.00 ? 54 PRO A O    2  
ATOM 2498  C CB   . PRO A 1 54 ? 12.804  7.458   6.145   1.00 0.00 ? 54 PRO A CB   2  
ATOM 2499  C CG   . PRO A 1 54 ? 12.008  6.753   5.092   1.00 0.00 ? 54 PRO A CG   2  
ATOM 2500  C CD   . PRO A 1 54 ? 11.896  5.319   5.562   1.00 0.00 ? 54 PRO A CD   2  
ATOM 2501  H HA   . PRO A 1 54 ? 14.722  6.454   5.976   1.00 0.00 ? 54 PRO A HA   2  
ATOM 2502  H HB2  . PRO A 1 54 ? 12.165  7.767   6.977   1.00 0.00 ? 54 PRO A HB2  2  
ATOM 2503  H HB3  . PRO A 1 54 ? 13.303  8.322   5.723   1.00 0.00 ? 54 PRO A HB3  2  
ATOM 2504  H HG2  . PRO A 1 54 ? 11.025  7.205   5.004   1.00 0.00 ? 54 PRO A HG2  2  
ATOM 2505  H HG3  . PRO A 1 54 ? 12.525  6.792   4.138   1.00 0.00 ? 54 PRO A HG3  2  
ATOM 2506  H HD2  . PRO A 1 54 ? 11.001  5.173   6.156   1.00 0.00 ? 54 PRO A HD2  2  
ATOM 2507  H HD3  . PRO A 1 54 ? 11.895  4.640   4.719   1.00 0.00 ? 54 PRO A HD3  2  
ATOM 2508  N N    . VAL A 1 55 ? 15.560  6.760   8.321   1.00 0.00 ? 55 VAL A N    2  
ATOM 2509  C CA   . VAL A 1 55 ? 16.198  6.697   9.665   1.00 0.00 ? 55 VAL A CA   2  
ATOM 2510  C C    . VAL A 1 55 ? 15.554  7.654   10.704  1.00 0.00 ? 55 VAL A C    2  
ATOM 2511  O O    . VAL A 1 55 ? 15.479  7.328   11.896  1.00 0.00 ? 55 VAL A O    2  
ATOM 2512  C CB   . VAL A 1 55 ? 17.748  6.964   9.535   1.00 0.00 ? 55 VAL A CB   2  
ATOM 2513  C CG1  . VAL A 1 55 ? 18.036  8.377   8.978   1.00 0.00 ? 55 VAL A CG1  2  
ATOM 2514  C CG2  . VAL A 1 55 ? 18.497  6.720   10.871  1.00 0.00 ? 55 VAL A CG2  2  
ATOM 2515  H H    . VAL A 1 55 ? 16.143  6.921   7.548   1.00 0.00 ? 55 VAL A H    2  
ATOM 2516  H HA   . VAL A 1 55 ? 16.070  5.682   10.018  1.00 0.00 ? 55 VAL A HA   2  
ATOM 2517  H HB   . VAL A 1 55 ? 18.137  6.250   8.809   1.00 0.00 ? 55 VAL A HB   2  
ATOM 2518  H HG11 . VAL A 1 55 ? 19.104  8.524   8.875   1.00 0.00 ? 55 VAL A HG11 2  
ATOM 2519  H HG12 . VAL A 1 55 ? 17.635  9.125   9.650   1.00 0.00 ? 55 VAL A HG12 2  
ATOM 2520  H HG13 . VAL A 1 55 ? 17.566  8.485   8.009   1.00 0.00 ? 55 VAL A HG13 2  
ATOM 2521  H HG21 . VAL A 1 55 ? 18.342  5.698   11.190  1.00 0.00 ? 55 VAL A HG21 2  
ATOM 2522  H HG22 . VAL A 1 55 ? 18.124  7.394   11.632  1.00 0.00 ? 55 VAL A HG22 2  
ATOM 2523  H HG23 . VAL A 1 55 ? 19.558  6.888   10.734  1.00 0.00 ? 55 VAL A HG23 2  
ATOM 2524  N N    . ASP A 1 56 ? 15.064  8.807   10.221  1.00 0.00 ? 56 ASP A N    2  
ATOM 2525  C CA   . ASP A 1 56 ? 14.404  9.840   11.044  1.00 0.00 ? 56 ASP A CA   2  
ATOM 2526  C C    . ASP A 1 56 ? 13.115  9.282   11.689  1.00 0.00 ? 56 ASP A C    2  
ATOM 2527  O O    . ASP A 1 56 ? 12.820  9.554   12.860  1.00 0.00 ? 56 ASP A O    2  
ATOM 2528  C CB   . ASP A 1 56 ? 14.091  11.067  10.147  1.00 0.00 ? 56 ASP A CB   2  
ATOM 2529  C CG   . ASP A 1 56 ? 13.406  12.220  10.898  1.00 0.00 ? 56 ASP A CG   2  
ATOM 2530  O OD1  . ASP A 1 56 ? 12.165  12.220  10.992  1.00 0.00 ? 56 ASP A OD1  2  
ATOM 2531  O OD2  . ASP A 1 56 ? 14.104  13.121  11.411  1.00 0.00 ? 56 ASP A OD2  2  
ATOM 2532  H H    . ASP A 1 56 ? 15.138  8.965   9.264   1.00 0.00 ? 56 ASP A H    2  
ATOM 2533  H HA   . ASP A 1 56 ? 15.098  10.141  11.833  1.00 0.00 ? 56 ASP A HA   2  
ATOM 2534  H HB2  . ASP A 1 56 ? 15.022  11.435  9.722   1.00 0.00 ? 56 ASP A HB2  2  
ATOM 2535  H HB3  . ASP A 1 56 ? 13.449  10.756  9.327   1.00 0.00 ? 56 ASP A HB3  2  
ATOM 2536  N N    . GLY A 1 57 ? 12.376  8.481   10.902  1.00 0.00 ? 57 GLY A N    2  
ATOM 2537  C CA   . GLY A 1 57 ? 11.096  7.892   11.322  1.00 0.00 ? 57 GLY A CA   2  
ATOM 2538  C C    . GLY A 1 57 ? 9.929   8.405   10.495  1.00 0.00 ? 57 GLY A C    2  
ATOM 2539  O O    . GLY A 1 57 ? 8.765   8.269   10.898  1.00 0.00 ? 57 GLY A O    2  
ATOM 2540  H H    . GLY A 1 57 ? 12.710  8.284   10.006  1.00 0.00 ? 57 GLY A H    2  
ATOM 2541  H HA2  . GLY A 1 57 ? 11.158  6.818   11.208  1.00 0.00 ? 57 GLY A HA2  2  
ATOM 2542  H HA3  . GLY A 1 57 ? 10.913  8.117   12.367  1.00 0.00 ? 57 GLY A HA3  2  
ATOM 2543  N N    . GLN A 1 58 ? 10.244  9.005   9.330   1.00 0.00 ? 58 GLN A N    2  
ATOM 2544  C CA   . GLN A 1 58 ? 9.237   9.545   8.414   1.00 0.00 ? 58 GLN A CA   2  
ATOM 2545  C C    . GLN A 1 58 ? 8.598   8.414   7.604   1.00 0.00 ? 58 GLN A C    2  
ATOM 2546  O O    . GLN A 1 58 ? 9.219   7.865   6.683   1.00 0.00 ? 58 GLN A O    2  
ATOM 2547  C CB   . GLN A 1 58 ? 9.861   10.600  7.460   1.00 0.00 ? 58 GLN A CB   2  
ATOM 2548  C CG   . GLN A 1 58 ? 10.454  11.831  8.163   1.00 0.00 ? 58 GLN A CG   2  
ATOM 2549  C CD   . GLN A 1 58 ? 11.014  12.898  7.211   1.00 0.00 ? 58 GLN A CD   2  
ATOM 2550  O OE1  . GLN A 1 58 ? 11.977  13.587  7.538   1.00 0.00 ? 58 GLN A OE1  2  
ATOM 2551  N NE2  . GLN A 1 58 ? 10.387  13.079  6.049   1.00 0.00 ? 58 GLN A NE2  2  
ATOM 2552  H H    . GLN A 1 58 ? 11.188  9.082   9.084   1.00 0.00 ? 58 GLN A H    2  
ATOM 2553  H HA   . GLN A 1 58 ? 8.468   10.032  9.012   1.00 0.00 ? 58 GLN A HA   2  
ATOM 2554  H HB2  . GLN A 1 58 ? 10.652  10.126  6.884   1.00 0.00 ? 58 GLN A HB2  2  
ATOM 2555  H HB3  . GLN A 1 58 ? 9.097   10.945  6.769   1.00 0.00 ? 58 GLN A HB3  2  
ATOM 2556  H HG2  . GLN A 1 58 ? 9.683   12.294  8.769   1.00 0.00 ? 58 GLN A HG2  2  
ATOM 2557  H HG3  . GLN A 1 58 ? 11.256  11.499  8.816   1.00 0.00 ? 58 GLN A HG3  2  
ATOM 2558  H HE21 . GLN A 1 58 ? 9.601   12.528  5.846   1.00 0.00 ? 58 GLN A HE21 2  
ATOM 2559  H HE22 . GLN A 1 58 ? 10.736  13.763  5.441   1.00 0.00 ? 58 GLN A HE22 2  
ATOM 2560  N N    . TYR A 1 59 ? 7.380   8.036   7.992   1.00 0.00 ? 59 TYR A N    2  
ATOM 2561  C CA   . TYR A 1 59 ? 6.517   7.187   7.172   1.00 0.00 ? 59 TYR A CA   2  
ATOM 2562  C C    . TYR A 1 59 ? 5.820   8.059   6.120   1.00 0.00 ? 59 TYR A C    2  
ATOM 2563  O O    . TYR A 1 59 ? 5.979   9.286   6.097   1.00 0.00 ? 59 TYR A O    2  
ATOM 2564  C CB   . TYR A 1 59 ? 5.482   6.446   8.058   1.00 0.00 ? 59 TYR A CB   2  
ATOM 2565  C CG   . TYR A 1 59 ? 6.132   5.563   9.133   1.00 0.00 ? 59 TYR A CG   2  
ATOM 2566  C CD1  . TYR A 1 59 ? 6.690   4.322   8.805   1.00 0.00 ? 59 TYR A CD1  2  
ATOM 2567  C CD2  . TYR A 1 59 ? 6.203   5.972   10.470  1.00 0.00 ? 59 TYR A CD2  2  
ATOM 2568  C CE1  . TYR A 1 59 ? 7.284   3.529   9.765   1.00 0.00 ? 59 TYR A CE1  2  
ATOM 2569  C CE2  . TYR A 1 59 ? 6.800   5.177   11.433  1.00 0.00 ? 59 TYR A CE2  2  
ATOM 2570  C CZ   . TYR A 1 59 ? 7.337   3.957   11.077  1.00 0.00 ? 59 TYR A CZ   2  
ATOM 2571  O OH   . TYR A 1 59 ? 7.932   3.159   12.039  1.00 0.00 ? 59 TYR A OH   2  
ATOM 2572  H H    . TYR A 1 59 ? 7.047   8.340   8.862   1.00 0.00 ? 59 TYR A H    2  
ATOM 2573  H HA   . TYR A 1 59 ? 7.136   6.451   6.657   1.00 0.00 ? 59 TYR A HA   2  
ATOM 2574  H HB2  . TYR A 1 59 ? 4.846   7.175   8.555   1.00 0.00 ? 59 TYR A HB2  2  
ATOM 2575  H HB3  . TYR A 1 59 ? 4.861   5.811   7.437   1.00 0.00 ? 59 TYR A HB3  2  
ATOM 2576  H HD1  . TYR A 1 59 ? 6.649   3.980   7.778   1.00 0.00 ? 59 TYR A HD1  2  
ATOM 2577  H HD2  . TYR A 1 59 ? 5.782   6.928   10.751  1.00 0.00 ? 59 TYR A HD2  2  
ATOM 2578  H HE1  . TYR A 1 59 ? 7.709   2.574   9.486   1.00 0.00 ? 59 TYR A HE1  2  
ATOM 2579  H HE2  . TYR A 1 59 ? 6.841   5.515   12.463  1.00 0.00 ? 59 TYR A HE2  2  
ATOM 2580  H HH   . TYR A 1 59 ? 7.358   3.118   12.816  1.00 0.00 ? 59 TYR A HH   2  
ATOM 2581  N N    . VAL A 1 60 ? 5.095   7.415   5.220   1.00 0.00 ? 60 VAL A N    2  
ATOM 2582  C CA   . VAL A 1 60 ? 4.173   8.093   4.303   1.00 0.00 ? 60 VAL A CA   2  
ATOM 2583  C C    . VAL A 1 60 ? 2.776   7.500   4.496   1.00 0.00 ? 60 VAL A C    2  
ATOM 2584  O O    . VAL A 1 60 ? 2.619   6.511   5.220   1.00 0.00 ? 60 VAL A O    2  
ATOM 2585  C CB   . VAL A 1 60 ? 4.647   8.012   2.802   1.00 0.00 ? 60 VAL A CB   2  
ATOM 2586  C CG1  . VAL A 1 60 ? 5.955   8.806   2.580   1.00 0.00 ? 60 VAL A CG1  2  
ATOM 2587  C CG2  . VAL A 1 60 ? 4.806   6.552   2.320   1.00 0.00 ? 60 VAL A CG2  2  
ATOM 2588  H H    . VAL A 1 60 ? 5.167   6.440   5.167   1.00 0.00 ? 60 VAL A H    2  
ATOM 2589  H HA   . VAL A 1 60 ? 4.118   9.151   4.582   1.00 0.00 ? 60 VAL A HA   2  
ATOM 2590  H HB   . VAL A 1 60 ? 3.879   8.481   2.192   1.00 0.00 ? 60 VAL A HB   2  
ATOM 2591  H HG11 . VAL A 1 60 ? 5.808   9.842   2.863   1.00 0.00 ? 60 VAL A HG11 2  
ATOM 2592  H HG12 . VAL A 1 60 ? 6.235   8.766   1.535   1.00 0.00 ? 60 VAL A HG12 2  
ATOM 2593  H HG13 . VAL A 1 60 ? 6.755   8.383   3.178   1.00 0.00 ? 60 VAL A HG13 2  
ATOM 2594  H HG21 . VAL A 1 60 ? 3.849   6.051   2.359   1.00 0.00 ? 60 VAL A HG21 2  
ATOM 2595  H HG22 . VAL A 1 60 ? 5.510   6.024   2.954   1.00 0.00 ? 60 VAL A HG22 2  
ATOM 2596  H HG23 . VAL A 1 60 ? 5.167   6.535   1.298   1.00 0.00 ? 60 VAL A HG23 2  
ATOM 2597  N N    . TRP A 1 61 ? 1.762   8.128   3.890   1.00 0.00 ? 61 TRP A N    2  
ATOM 2598  C CA   . TRP A 1 61 ? 0.368   7.677   4.006   1.00 0.00 ? 61 TRP A CA   2  
ATOM 2599  C C    . TRP A 1 61 ? -0.499  8.342   2.951   1.00 0.00 ? 61 TRP A C    2  
ATOM 2600  O O    . TRP A 1 61 ? -0.150  9.393   2.426   1.00 0.00 ? 61 TRP A O    2  
ATOM 2601  C CB   . TRP A 1 61 ? -0.199  7.947   5.428   1.00 0.00 ? 61 TRP A CB   2  
ATOM 2602  C CG   . TRP A 1 61 ? -0.333  9.398   5.838   1.00 0.00 ? 61 TRP A CG   2  
ATOM 2603  C CD1  . TRP A 1 61 ? 0.670   10.307  6.038   1.00 0.00 ? 61 TRP A CD1  2  
ATOM 2604  C CD2  . TRP A 1 61 ? -1.554  10.077  6.145   1.00 0.00 ? 61 TRP A CD2  2  
ATOM 2605  N NE1  . TRP A 1 61 ? 0.140   11.503  6.449   1.00 0.00 ? 61 TRP A NE1  2  
ATOM 2606  C CE2  . TRP A 1 61 ? -1.225  11.384  6.522   1.00 0.00 ? 61 TRP A CE2  2  
ATOM 2607  C CE3  . TRP A 1 61 ? -2.897  9.695   6.135   1.00 0.00 ? 61 TRP A CE3  2  
ATOM 2608  C CZ2  . TRP A 1 61 ? -2.192  12.312  6.891   1.00 0.00 ? 61 TRP A CZ2  2  
ATOM 2609  C CZ3  . TRP A 1 61 ? -3.857  10.616  6.503   1.00 0.00 ? 61 TRP A CZ3  2  
ATOM 2610  C CH2  . TRP A 1 61 ? -3.499  11.914  6.876   1.00 0.00 ? 61 TRP A CH2  2  
ATOM 2611  H H    . TRP A 1 61 ? 1.951   8.926   3.350   1.00 0.00 ? 61 TRP A H    2  
ATOM 2612  H HA   . TRP A 1 61 ? 0.355   6.604   3.823   1.00 0.00 ? 61 TRP A HA   2  
ATOM 2613  H HB2  . TRP A 1 61 ? -1.179  7.490   5.506   1.00 0.00 ? 61 TRP A HB2  2  
ATOM 2614  H HB3  . TRP A 1 61 ? 0.454   7.466   6.149   1.00 0.00 ? 61 TRP A HB3  2  
ATOM 2615  H HD1  . TRP A 1 61 ? 1.721   10.100  5.891   1.00 0.00 ? 61 TRP A HD1  2  
ATOM 2616  H HE1  . TRP A 1 61 ? 0.652   12.315  6.656   1.00 0.00 ? 61 TRP A HE1  2  
ATOM 2617  H HE3  . TRP A 1 61 ? -3.189  8.694   5.845   1.00 0.00 ? 61 TRP A HE3  2  
ATOM 2618  H HZ2  . TRP A 1 61 ? -1.931  13.320  7.182   1.00 0.00 ? 61 TRP A HZ2  2  
ATOM 2619  H HZ3  . TRP A 1 61 ? -4.903  10.336  6.506   1.00 0.00 ? 61 TRP A HZ3  2  
ATOM 2620  H HH2  . TRP A 1 61 ? -4.283  12.608  7.160   1.00 0.00 ? 61 TRP A HH2  2  
ATOM 2621  N N    . PHE A 1 62 ? -1.638  7.724   2.652   1.00 0.00 ? 62 PHE A N    2  
ATOM 2622  C CA   . PHE A 1 62 ? -2.568  8.224   1.642   1.00 0.00 ? 62 PHE A CA   2  
ATOM 2623  C C    . PHE A 1 62 ? -4.012  7.936   2.061   1.00 0.00 ? 62 PHE A C    2  
ATOM 2624  O O    . PHE A 1 62 ? -4.293  6.967   2.787   1.00 0.00 ? 62 PHE A O    2  
ATOM 2625  C CB   . PHE A 1 62 ? -2.242  7.611   0.242   1.00 0.00 ? 62 PHE A CB   2  
ATOM 2626  C CG   . PHE A 1 62 ? -2.145  6.085   0.221   1.00 0.00 ? 62 PHE A CG   2  
ATOM 2627  C CD1  . PHE A 1 62 ? -0.932  5.443   0.481   1.00 0.00 ? 62 PHE A CD1  2  
ATOM 2628  C CD2  . PHE A 1 62 ? -3.264  5.296   -0.037  1.00 0.00 ? 62 PHE A CD2  2  
ATOM 2629  C CE1  . PHE A 1 62 ? -0.843  4.067   0.481   1.00 0.00 ? 62 PHE A CE1  2  
ATOM 2630  C CE2  . PHE A 1 62 ? -3.172  3.921   -0.032  1.00 0.00 ? 62 PHE A CE2  2  
ATOM 2631  C CZ   . PHE A 1 62 ? -1.962  3.307   0.227   1.00 0.00 ? 62 PHE A CZ   2  
ATOM 2632  H H    . PHE A 1 62 ? -1.864  6.889   3.121   1.00 0.00 ? 62 PHE A H    2  
ATOM 2633  H HA   . PHE A 1 62 ? -2.445  9.306   1.583   1.00 0.00 ? 62 PHE A HA   2  
ATOM 2634  H HB2  . PHE A 1 62 ? -3.007  7.910   -0.466  1.00 0.00 ? 62 PHE A HB2  2  
ATOM 2635  H HB3  . PHE A 1 62 ? -1.291  8.010   -0.100  1.00 0.00 ? 62 PHE A HB3  2  
ATOM 2636  H HD1  . PHE A 1 62 ? -0.048  6.040   0.680   1.00 0.00 ? 62 PHE A HD1  2  
ATOM 2637  H HD2  . PHE A 1 62 ? -4.216  5.771   -0.245  1.00 0.00 ? 62 PHE A HD2  2  
ATOM 2638  H HE1  . PHE A 1 62 ? 0.106   3.588   0.682   1.00 0.00 ? 62 PHE A HE1  2  
ATOM 2639  H HE2  . PHE A 1 62 ? -4.052  3.321   -0.234  1.00 0.00 ? 62 PHE A HE2  2  
ATOM 2640  H HZ   . PHE A 1 62 ? -1.894  2.227   0.234   1.00 0.00 ? 62 PHE A HZ   2  
ATOM 2641  N N    . ASN A 1 63 ? -4.914  8.802   1.607   1.00 0.00 ? 63 ASN A N    2  
ATOM 2642  C CA   . ASN A 1 63 ? -6.355  8.661   1.815   1.00 0.00 ? 63 ASN A CA   2  
ATOM 2643  C C    . ASN A 1 63 ? -6.939  7.709   0.754   1.00 0.00 ? 63 ASN A C    2  
ATOM 2644  O O    . ASN A 1 63 ? -6.404  7.605   -0.362  1.00 0.00 ? 63 ASN A O    2  
ATOM 2645  C CB   . ASN A 1 63 ? -7.024  10.060  1.731   1.00 0.00 ? 63 ASN A CB   2  
ATOM 2646  C CG   . ASN A 1 63 ? -6.434  11.099  2.706   1.00 0.00 ? 63 ASN A CG   2  
ATOM 2647  O OD1  . ASN A 1 63 ? -6.371  12.286  2.395   1.00 0.00 ? 63 ASN A OD1  2  
ATOM 2648  N ND2  . ASN A 1 63 ? -6.043  10.674  3.905   1.00 0.00 ? 63 ASN A ND2  2  
ATOM 2649  H H    . ASN A 1 63 ? -4.595  9.585   1.107   1.00 0.00 ? 63 ASN A H    2  
ATOM 2650  H HA   . ASN A 1 63 ? -6.521  8.244   2.806   1.00 0.00 ? 63 ASN A HA   2  
ATOM 2651  H HB2  . ASN A 1 63 ? -6.912  10.438  0.718   1.00 0.00 ? 63 ASN A HB2  2  
ATOM 2652  H HB3  . ASN A 1 63 ? -8.081  9.957   1.944   1.00 0.00 ? 63 ASN A HB3  2  
ATOM 2653  H HD21 . ASN A 1 63 ? -6.149  9.727   4.122   1.00 0.00 ? 63 ASN A HD21 2  
ATOM 2654  H HD22 . ASN A 1 63 ? -5.637  11.325  4.511   1.00 0.00 ? 63 ASN A HD22 2  
ATOM 2655  N N    . ILE A 1 64 ? -8.028  7.010   1.109   1.00 0.00 ? 64 ILE A N    2  
ATOM 2656  C CA   . ILE A 1 64 ? -8.723  6.068   0.207   1.00 0.00 ? 64 ILE A CA   2  
ATOM 2657  C C    . ILE A 1 64 ? -10.212 6.425   0.104   1.00 0.00 ? 64 ILE A C    2  
ATOM 2658  O O    . ILE A 1 64 ? -10.821 6.901   1.077   1.00 0.00 ? 64 ILE A O    2  
ATOM 2659  C CB   . ILE A 1 64 ? -8.560  4.566   0.669   1.00 0.00 ? 64 ILE A CB   2  
ATOM 2660  C CG1  . ILE A 1 64 ? -8.998  4.384   2.163   1.00 0.00 ? 64 ILE A CG1  2  
ATOM 2661  C CG2  . ILE A 1 64 ? -7.105  4.079   0.439   1.00 0.00 ? 64 ILE A CG2  2  
ATOM 2662  C CD1  . ILE A 1 64 ? -8.946  2.957   2.672   1.00 0.00 ? 64 ILE A CD1  2  
ATOM 2663  H H    . ILE A 1 64 ? -8.390  7.137   2.008   1.00 0.00 ? 64 ILE A H    2  
ATOM 2664  H HA   . ILE A 1 64 ? -8.286  6.164   -0.790  1.00 0.00 ? 64 ILE A HA   2  
ATOM 2665  H HB   . ILE A 1 64 ? -9.206  3.952   0.039   1.00 0.00 ? 64 ILE A HB   2  
ATOM 2666  H HG12 . ILE A 1 64 ? -8.349  4.975   2.800   1.00 0.00 ? 64 ILE A HG12 2  
ATOM 2667  H HG13 . ILE A 1 64 ? -10.014 4.735   2.283   1.00 0.00 ? 64 ILE A HG13 2  
ATOM 2668  H HG21 . ILE A 1 64 ? -6.848  4.181   -0.607  1.00 0.00 ? 64 ILE A HG21 2  
ATOM 2669  H HG22 . ILE A 1 64 ? -7.012  3.038   0.724   1.00 0.00 ? 64 ILE A HG22 2  
ATOM 2670  H HG23 . ILE A 1 64 ? -6.423  4.673   1.033   1.00 0.00 ? 64 ILE A HG23 2  
ATOM 2671  H HD11 . ILE A 1 64 ? -9.570  2.325   2.058   1.00 0.00 ? 64 ILE A HD11 2  
ATOM 2672  H HD12 . ILE A 1 64 ? -9.297  2.925   3.694   1.00 0.00 ? 64 ILE A HD12 2  
ATOM 2673  H HD13 . ILE A 1 64 ? -7.926  2.595   2.639   1.00 0.00 ? 64 ILE A HD13 2  
ATOM 2674  N N    . GLY A 1 65 ? -10.772 6.230   -1.102  1.00 0.00 ? 65 GLY A N    2  
ATOM 2675  C CA   . GLY A 1 65 ? -12.200 6.396   -1.344  1.00 0.00 ? 65 GLY A CA   2  
ATOM 2676  C C    . GLY A 1 65 ? -12.993 5.240   -0.751  1.00 0.00 ? 65 GLY A C    2  
ATOM 2677  O O    . GLY A 1 65 ? -13.941 5.446   0.012   1.00 0.00 ? 65 GLY A O    2  
ATOM 2678  H H    . GLY A 1 65 ? -10.193 5.968   -1.845  1.00 0.00 ? 65 GLY A H    2  
ATOM 2679  H HA2  . GLY A 1 65 ? -12.536 7.334   -0.912  1.00 0.00 ? 65 GLY A HA2  2  
ATOM 2680  H HA3  . GLY A 1 65 ? -12.369 6.426   -2.411  1.00 0.00 ? 65 GLY A HA3  2  
ATOM 2681  N N    . SER A 1 66 ? -12.594 4.013   -1.107  1.00 0.00 ? 66 SER A N    2  
ATOM 2682  C CA   . SER A 1 66 ? -13.187 2.781   -0.582  1.00 0.00 ? 66 SER A CA   2  
ATOM 2683  C C    . SER A 1 66 ? -12.065 1.840   -0.134  1.00 0.00 ? 66 SER A C    2  
ATOM 2684  O O    . SER A 1 66 ? -11.064 1.696   -0.846  1.00 0.00 ? 66 SER A O    2  
ATOM 2685  C CB   . SER A 1 66 ? -14.056 2.106   -1.657  1.00 0.00 ? 66 SER A CB   2  
ATOM 2686  O OG   . SER A 1 66 ? -15.026 3.006   -2.182  1.00 0.00 ? 66 SER A OG   2  
ATOM 2687  H H    . SER A 1 66 ? -11.853 3.931   -1.749  1.00 0.00 ? 66 SER A H    2  
ATOM 2688  H HA   . SER A 1 66 ? -13.812 3.029   0.277   1.00 0.00 ? 66 SER A HA   2  
ATOM 2689  H HB2  . SER A 1 66 ? -13.423 1.773   -2.472  1.00 0.00 ? 66 SER A HB2  2  
ATOM 2690  H HB3  . SER A 1 66 ? -14.567 1.253   -1.232  1.00 0.00 ? 66 SER A HB3  2  
ATOM 2691  H HG   . SER A 1 66 ? -14.582 3.809   -2.478  1.00 0.00 ? 66 SER A HG   2  
ATOM 2692  N N    . VAL A 1 67 ? -12.238 1.229   1.049   1.00 0.00 ? 67 VAL A N    2  
ATOM 2693  C CA   . VAL A 1 67 ? -11.312 0.215   1.600   1.00 0.00 ? 67 VAL A CA   2  
ATOM 2694  C C    . VAL A 1 67 ? -11.348 -1.071  0.745   1.00 0.00 ? 67 VAL A C    2  
ATOM 2695  O O    . VAL A 1 67 ? -10.314 -1.727  0.538   1.00 0.00 ? 67 VAL A O    2  
ATOM 2696  C CB   . VAL A 1 67 ? -11.658 -0.140  3.104   1.00 0.00 ? 67 VAL A CB   2  
ATOM 2697  C CG1  . VAL A 1 67 ? -10.498 -0.903  3.786   1.00 0.00 ? 67 VAL A CG1  2  
ATOM 2698  C CG2  . VAL A 1 67 ? -12.038 1.118   3.910   1.00 0.00 ? 67 VAL A CG2  2  
ATOM 2699  H H    . VAL A 1 67 ? -13.001 1.508   1.597   1.00 0.00 ? 67 VAL A H    2  
ATOM 2700  H HA   . VAL A 1 67 ? -10.307 0.633   1.568   1.00 0.00 ? 67 VAL A HA   2  
ATOM 2701  H HB   . VAL A 1 67 ? -12.527 -0.800  3.104   1.00 0.00 ? 67 VAL A HB   2  
ATOM 2702  H HG11 . VAL A 1 67 ? -9.605  -0.288  3.787   1.00 0.00 ? 67 VAL A HG11 2  
ATOM 2703  H HG12 . VAL A 1 67 ? -10.295 -1.819  3.247   1.00 0.00 ? 67 VAL A HG12 2  
ATOM 2704  H HG13 . VAL A 1 67 ? -10.764 -1.146  4.808   1.00 0.00 ? 67 VAL A HG13 2  
ATOM 2705  H HG21 . VAL A 1 67 ? -12.876 1.616   3.438   1.00 0.00 ? 67 VAL A HG21 2  
ATOM 2706  H HG22 . VAL A 1 67 ? -11.196 1.799   3.949   1.00 0.00 ? 67 VAL A HG22 2  
ATOM 2707  H HG23 . VAL A 1 67 ? -12.316 0.841   4.920   1.00 0.00 ? 67 VAL A HG23 2  
ATOM 2708  N N    . ASP A 1 68 ? -12.558 -1.416  0.259   1.00 0.00 ? 68 ASP A N    2  
ATOM 2709  C CA   . ASP A 1 68 ? -12.779 -2.586  -0.612  1.00 0.00 ? 68 ASP A CA   2  
ATOM 2710  C C    . ASP A 1 68 ? -12.098 -2.383  -1.976  1.00 0.00 ? 68 ASP A C    2  
ATOM 2711  O O    . ASP A 1 68 ? -11.379 -3.254  -2.441  1.00 0.00 ? 68 ASP A O    2  
ATOM 2712  C CB   . ASP A 1 68 ? -14.298 -2.858  -0.812  1.00 0.00 ? 68 ASP A CB   2  
ATOM 2713  C CG   . ASP A 1 68 ? -15.062 -3.085  0.504   1.00 0.00 ? 68 ASP A CG   2  
ATOM 2714  O OD1  . ASP A 1 68 ? -15.440 -2.090  1.154   1.00 0.00 ? 68 ASP A OD1  2  
ATOM 2715  O OD2  . ASP A 1 68 ? -15.294 -4.256  0.897   1.00 0.00 ? 68 ASP A OD2  2  
ATOM 2716  H H    . ASP A 1 68 ? -13.339 -0.872  0.500   1.00 0.00 ? 68 ASP A H    2  
ATOM 2717  H HA   . ASP A 1 68 ? -12.330 -3.448  -0.124  1.00 0.00 ? 68 ASP A HA   2  
ATOM 2718  H HB2  . ASP A 1 68 ? -14.748 -2.016  -1.329  1.00 0.00 ? 68 ASP A HB2  2  
ATOM 2719  H HB3  . ASP A 1 68 ? -14.416 -3.742  -1.435  1.00 0.00 ? 68 ASP A HB3  2  
ATOM 2720  N N    . THR A 1 69 ? -12.330 -1.220  -2.612  1.00 0.00 ? 69 THR A N    2  
ATOM 2721  C CA   . THR A 1 69 ? -11.706 -0.884  -3.906  1.00 0.00 ? 69 THR A CA   2  
ATOM 2722  C C    . THR A 1 69 ? -10.165 -0.808  -3.766  1.00 0.00 ? 69 THR A C    2  
ATOM 2723  O O    . THR A 1 69 ? -9.432  -1.224  -4.670  1.00 0.00 ? 69 THR A O    2  
ATOM 2724  C CB   . THR A 1 69 ? -12.277 0.456   -4.476  1.00 0.00 ? 69 THR A CB   2  
ATOM 2725  O OG1  . THR A 1 69 ? -13.715 0.401   -4.462  1.00 0.00 ? 69 THR A OG1  2  
ATOM 2726  C CG2  . THR A 1 69 ? -11.794 0.746   -5.910  1.00 0.00 ? 69 THR A CG2  2  
ATOM 2727  H H    . THR A 1 69 ? -12.947 -0.579  -2.213  1.00 0.00 ? 69 THR A H    2  
ATOM 2728  H HA   . THR A 1 69 ? -11.952 -1.680  -4.605  1.00 0.00 ? 69 THR A HA   2  
ATOM 2729  H HB   . THR A 1 69 ? -11.960 1.275   -3.831  1.00 0.00 ? 69 THR A HB   2  
ATOM 2730  H HG1  . THR A 1 69 ? -14.016 -0.412  -4.891  1.00 0.00 ? 69 THR A HG1  2  
ATOM 2731  H HG21 . THR A 1 69 ? -10.717 0.812   -5.925  1.00 0.00 ? 69 THR A HG21 2  
ATOM 2732  H HG22 . THR A 1 69 ? -12.208 1.683   -6.252  1.00 0.00 ? 69 THR A HG22 2  
ATOM 2733  H HG23 . THR A 1 69 ? -12.114 -0.052  -6.575  1.00 0.00 ? 69 THR A HG23 2  
ATOM 2734  N N    . PHE A 1 70 ? -9.697  -0.304  -2.599  1.00 0.00 ? 70 PHE A N    2  
ATOM 2735  C CA   . PHE A 1 70 ? -8.267  -0.257  -2.240  1.00 0.00 ? 70 PHE A CA   2  
ATOM 2736  C C    . PHE A 1 70 ? -7.614  -1.653  -2.344  1.00 0.00 ? 70 PHE A C    2  
ATOM 2737  O O    . PHE A 1 70 ? -6.647  -1.813  -3.093  1.00 0.00 ? 70 PHE A O    2  
ATOM 2738  C CB   . PHE A 1 70 ? -8.087  0.342   -0.809  1.00 0.00 ? 70 PHE A CB   2  
ATOM 2739  C CG   . PHE A 1 70 ? -6.703  0.115   -0.188  1.00 0.00 ? 70 PHE A CG   2  
ATOM 2740  C CD1  . PHE A 1 70 ? -5.573  0.743   -0.706  1.00 0.00 ? 70 PHE A CD1  2  
ATOM 2741  C CD2  . PHE A 1 70 ? -6.536  -0.762  0.891   1.00 0.00 ? 70 PHE A CD2  2  
ATOM 2742  C CE1  . PHE A 1 70 ? -4.327  0.508   -0.164  1.00 0.00 ? 70 PHE A CE1  2  
ATOM 2743  C CE2  . PHE A 1 70 ? -5.287  -0.996  1.427   1.00 0.00 ? 70 PHE A CE2  2  
ATOM 2744  C CZ   . PHE A 1 70 ? -4.184  -0.359  0.900   1.00 0.00 ? 70 PHE A CZ   2  
ATOM 2745  H H    . PHE A 1 70 ? -10.335 0.066   -1.958  1.00 0.00 ? 70 PHE A H    2  
ATOM 2746  H HA   . PHE A 1 70 ? -7.779  0.405   -2.949  1.00 0.00 ? 70 PHE A HA   2  
ATOM 2747  H HB2  . PHE A 1 70 ? -8.260  1.413   -0.850  1.00 0.00 ? 70 PHE A HB2  2  
ATOM 2748  H HB3  . PHE A 1 70 ? -8.834  -0.094  -0.151  1.00 0.00 ? 70 PHE A HB3  2  
ATOM 2749  H HD1  . PHE A 1 70 ? -5.677  1.427   -1.541  1.00 0.00 ? 70 PHE A HD1  2  
ATOM 2750  H HD2  . PHE A 1 70 ? -7.404  -1.262  1.310   1.00 0.00 ? 70 PHE A HD2  2  
ATOM 2751  H HE1  . PHE A 1 70 ? -3.457  1.005   -0.576  1.00 0.00 ? 70 PHE A HE1  2  
ATOM 2752  H HE2  . PHE A 1 70 ? -5.173  -1.679  2.258   1.00 0.00 ? 70 PHE A HE2  2  
ATOM 2753  H HZ   . PHE A 1 70 ? -3.205  -0.544  1.318   1.00 0.00 ? 70 PHE A HZ   2  
ATOM 2754  N N    . GLU A 1 71 ? -8.155  -2.647  -1.602  1.00 0.00 ? 71 GLU A N    2  
ATOM 2755  C CA   . GLU A 1 71 ? -7.562  -4.008  -1.547  1.00 0.00 ? 71 GLU A CA   2  
ATOM 2756  C C    . GLU A 1 71 ? -7.614  -4.699  -2.923  1.00 0.00 ? 71 GLU A C    2  
ATOM 2757  O O    . GLU A 1 71 ? -6.705  -5.459  -3.265  1.00 0.00 ? 71 GLU A O    2  
ATOM 2758  C CB   . GLU A 1 71 ? -8.258  -4.892  -0.468  1.00 0.00 ? 71 GLU A CB   2  
ATOM 2759  C CG   . GLU A 1 71 ? -9.769  -5.116  -0.696  1.00 0.00 ? 71 GLU A CG   2  
ATOM 2760  C CD   . GLU A 1 71 ? -10.408 -6.166  0.220   1.00 0.00 ? 71 GLU A CD   2  
ATOM 2761  O OE1  . GLU A 1 71 ? -10.425 -7.361  -0.156  1.00 0.00 ? 71 GLU A OE1  2  
ATOM 2762  O OE2  . GLU A 1 71 ? -10.926 -5.810  1.295   1.00 0.00 ? 71 GLU A OE2  2  
ATOM 2763  H H    . GLU A 1 71 ? -8.970  -2.463  -1.086  1.00 0.00 ? 71 GLU A H    2  
ATOM 2764  H HA   . GLU A 1 71 ? -6.514  -3.886  -1.276  1.00 0.00 ? 71 GLU A HA   2  
ATOM 2765  H HB2  . GLU A 1 71 ? -7.767  -5.861  -0.442  1.00 0.00 ? 71 GLU A HB2  2  
ATOM 2766  H HB3  . GLU A 1 71 ? -8.127  -4.419  0.498   1.00 0.00 ? 71 GLU A HB3  2  
ATOM 2767  H HG2  . GLU A 1 71 ? -10.281 -4.172  -0.545  1.00 0.00 ? 71 GLU A HG2  2  
ATOM 2768  H HG3  . GLU A 1 71 ? -9.919  -5.419  -1.728  1.00 0.00 ? 71 GLU A HG3  2  
ATOM 2769  N N    . ARG A 1 72 ? -8.674  -4.405  -3.710  1.00 0.00 ? 72 ARG A N    2  
ATOM 2770  C CA   . ARG A 1 72 ? -8.810  -4.921  -5.088  1.00 0.00 ? 72 ARG A CA   2  
ATOM 2771  C C    . ARG A 1 72 ? -7.640  -4.438  -5.959  1.00 0.00 ? 72 ARG A C    2  
ATOM 2772  O O    . ARG A 1 72 ? -6.894  -5.245  -6.535  1.00 0.00 ? 72 ARG A O    2  
ATOM 2773  C CB   . ARG A 1 72 ? -10.140 -4.466  -5.746  1.00 0.00 ? 72 ARG A CB   2  
ATOM 2774  C CG   . ARG A 1 72 ? -11.444 -4.918  -5.055  1.00 0.00 ? 72 ARG A CG   2  
ATOM 2775  C CD   . ARG A 1 72 ? -11.620 -6.444  -4.948  1.00 0.00 ? 72 ARG A CD   2  
ATOM 2776  N NE   . ARG A 1 72 ? -10.905 -7.024  -3.792  1.00 0.00 ? 72 ARG A NE   2  
ATOM 2777  C CZ   . ARG A 1 72 ? -10.231 -8.186  -3.799  1.00 0.00 ? 72 ARG A CZ   2  
ATOM 2778  N NH1  . ARG A 1 72 ? -10.156 -8.914  -4.908  1.00 0.00 ? 72 ARG A NH1  2  
ATOM 2779  N NH2  . ARG A 1 72 ? -9.673  -8.626  -2.685  1.00 0.00 ? 72 ARG A NH2  2  
ATOM 2780  H H    . ARG A 1 72 ? -9.387  -3.835  -3.348  1.00 0.00 ? 72 ARG A H    2  
ATOM 2781  H HA   . ARG A 1 72 ? -8.792  -6.004  -5.035  1.00 0.00 ? 72 ARG A HA   2  
ATOM 2782  H HB2  . ARG A 1 72 ? -10.149 -3.382  -5.781  1.00 0.00 ? 72 ARG A HB2  2  
ATOM 2783  H HB3  . ARG A 1 72 ? -10.160 -4.838  -6.767  1.00 0.00 ? 72 ARG A HB3  2  
ATOM 2784  H HG2  . ARG A 1 72 ? -11.466 -4.507  -4.059  1.00 0.00 ? 72 ARG A HG2  2  
ATOM 2785  H HG3  . ARG A 1 72 ? -12.278 -4.509  -5.618  1.00 0.00 ? 72 ARG A HG3  2  
ATOM 2786  H HD2  . ARG A 1 72 ? -12.677 -6.659  -4.834  1.00 0.00 ? 72 ARG A HD2  2  
ATOM 2787  H HD3  . ARG A 1 72 ? -11.265 -6.907  -5.866  1.00 0.00 ? 72 ARG A HD3  2  
ATOM 2788  H HE   . ARG A 1 72 ? -10.928 -6.507  -2.955  1.00 0.00 ? 72 ARG A HE   2  
ATOM 2789  H HH11 . ARG A 1 72 ? -10.598 -8.601  -5.759  1.00 0.00 ? 72 ARG A HH11 2  
ATOM 2790  H HH12 . ARG A 1 72 ? -9.654  -9.778  -4.902  1.00 0.00 ? 72 ARG A HH12 2  
ATOM 2791  H HH21 . ARG A 1 72 ? -9.747  -8.095  -1.834  1.00 0.00 ? 72 ARG A HH21 2  
ATOM 2792  H HH22 . ARG A 1 72 ? -9.170  -9.493  -2.687  1.00 0.00 ? 72 ARG A HH22 2  
ATOM 2793  N N    . ASN A 1 73 ? -7.472  -3.101  -5.993  1.00 0.00 ? 73 ASN A N    2  
ATOM 2794  C CA   . ASN A 1 73 ? -6.513  -2.416  -6.873  1.00 0.00 ? 73 ASN A CA   2  
ATOM 2795  C C    . ASN A 1 73 ? -5.084  -2.764  -6.468  1.00 0.00 ? 73 ASN A C    2  
ATOM 2796  O O    . ASN A 1 73 ? -4.249  -3.029  -7.323  1.00 0.00 ? 73 ASN A O    2  
ATOM 2797  C CB   . ASN A 1 73 ? -6.740  -0.871  -6.829  1.00 0.00 ? 73 ASN A CB   2  
ATOM 2798  C CG   . ASN A 1 73 ? -8.042  -0.393  -7.516  1.00 0.00 ? 73 ASN A CG   2  
ATOM 2799  O OD1  . ASN A 1 73 ? -8.095  0.706   -8.056  1.00 0.00 ? 73 ASN A OD1  2  
ATOM 2800  N ND2  . ASN A 1 73 ? -9.107  -1.196  -7.492  1.00 0.00 ? 73 ASN A ND2  2  
ATOM 2801  H H    . ASN A 1 73 ? -7.988  -2.553  -5.370  1.00 0.00 ? 73 ASN A H    2  
ATOM 2802  H HA   . ASN A 1 73 ? -6.686  -2.769  -7.887  1.00 0.00 ? 73 ASN A HA   2  
ATOM 2803  H HB2  . ASN A 1 73 ? -6.775  -0.549  -5.794  1.00 0.00 ? 73 ASN A HB2  2  
ATOM 2804  H HB3  . ASN A 1 73 ? -5.899  -0.375  -7.311  1.00 0.00 ? 73 ASN A HB3  2  
ATOM 2805  H HD21 . ASN A 1 73 ? -9.033  -2.063  -7.043  1.00 0.00 ? 73 ASN A HD21 2  
ATOM 2806  H HD22 . ASN A 1 73 ? -9.930  -0.886  -7.920  1.00 0.00 ? 73 ASN A HD22 2  
ATOM 2807  N N    . LEU A 1 74 ? -4.839  -2.778  -5.152  1.00 0.00 ? 74 LEU A N    2  
ATOM 2808  C CA   . LEU A 1 74 ? -3.533  -3.095  -4.561  1.00 0.00 ? 74 LEU A CA   2  
ATOM 2809  C C    . LEU A 1 74 ? -3.031  -4.501  -4.955  1.00 0.00 ? 74 LEU A C    2  
ATOM 2810  O O    . LEU A 1 74 ? -1.926  -4.621  -5.477  1.00 0.00 ? 74 LEU A O    2  
ATOM 2811  C CB   . LEU A 1 74 ? -3.604  -2.968  -3.017  1.00 0.00 ? 74 LEU A CB   2  
ATOM 2812  C CG   . LEU A 1 74 ? -2.286  -3.281  -2.244  1.00 0.00 ? 74 LEU A CG   2  
ATOM 2813  C CD1  . LEU A 1 74 ? -1.148  -2.300  -2.615  1.00 0.00 ? 74 LEU A CD1  2  
ATOM 2814  C CD2  . LEU A 1 74 ? -2.532  -3.306  -0.726  1.00 0.00 ? 74 LEU A CD2  2  
ATOM 2815  H H    . LEU A 1 74 ? -5.559  -2.523  -4.547  1.00 0.00 ? 74 LEU A H    2  
ATOM 2816  H HA   . LEU A 1 74 ? -2.826  -2.356  -4.930  1.00 0.00 ? 74 LEU A HA   2  
ATOM 2817  H HB2  . LEU A 1 74 ? -3.908  -1.953  -2.773  1.00 0.00 ? 74 LEU A HB2  2  
ATOM 2818  H HB3  . LEU A 1 74 ? -4.380  -3.644  -2.656  1.00 0.00 ? 74 LEU A HB3  2  
ATOM 2819  H HG   . LEU A 1 74 ? -1.947  -4.273  -2.528  1.00 0.00 ? 74 LEU A HG   2  
ATOM 2820  H HD11 . LEU A 1 74 ? -1.442  -1.286  -2.370  1.00 0.00 ? 74 LEU A HD11 2  
ATOM 2821  H HD12 . LEU A 1 74 ? -0.939  -2.366  -3.673  1.00 0.00 ? 74 LEU A HD12 2  
ATOM 2822  H HD13 . LEU A 1 74 ? -0.255  -2.555  -2.063  1.00 0.00 ? 74 LEU A HD13 2  
ATOM 2823  H HD21 . LEU A 1 74 ? -1.615  -3.563  -0.212  1.00 0.00 ? 74 LEU A HD21 2  
ATOM 2824  H HD22 . LEU A 1 74 ? -3.286  -4.046  -0.492  1.00 0.00 ? 74 LEU A HD22 2  
ATOM 2825  H HD23 . LEU A 1 74 ? -2.869  -2.334  -0.389  1.00 0.00 ? 74 LEU A HD23 2  
ATOM 2826  N N    . GLU A 1 75 ? -3.842  -5.547  -4.678  1.00 0.00 ? 75 GLU A N    2  
ATOM 2827  C CA   . GLU A 1 75 ? -3.467  -6.956  -4.981  1.00 0.00 ? 75 GLU A CA   2  
ATOM 2828  C C    . GLU A 1 75 ? -3.207  -7.171  -6.480  1.00 0.00 ? 75 GLU A C    2  
ATOM 2829  O O    . GLU A 1 75 ? -2.225  -7.827  -6.854  1.00 0.00 ? 75 GLU A O    2  
ATOM 2830  C CB   . GLU A 1 75 ? -4.543  -7.946  -4.492  1.00 0.00 ? 75 GLU A CB   2  
ATOM 2831  C CG   . GLU A 1 75 ? -4.702  -7.994  -2.966  1.00 0.00 ? 75 GLU A CG   2  
ATOM 2832  C CD   . GLU A 1 75 ? -5.715  -9.052  -2.520  1.00 0.00 ? 75 GLU A CD   2  
ATOM 2833  O OE1  . GLU A 1 75 ? -6.910  -8.734  -2.405  1.00 0.00 ? 75 GLU A OE1  2  
ATOM 2834  O OE2  . GLU A 1 75 ? -5.319  -10.219 -2.303  1.00 0.00 ? 75 GLU A OE2  2  
ATOM 2835  H H    . GLU A 1 75 ? -4.702  -5.356  -4.247  1.00 0.00 ? 75 GLU A H    2  
ATOM 2836  H HA   . GLU A 1 75 ? -2.543  -7.157  -4.444  1.00 0.00 ? 75 GLU A HA   2  
ATOM 2837  H HB2  . GLU A 1 75 ? -5.501  -7.671  -4.930  1.00 0.00 ? 75 GLU A HB2  2  
ATOM 2838  H HB3  . GLU A 1 75 ? -4.284  -8.943  -4.837  1.00 0.00 ? 75 GLU A HB3  2  
ATOM 2839  H HG2  . GLU A 1 75 ? -3.736  -8.215  -2.519  1.00 0.00 ? 75 GLU A HG2  2  
ATOM 2840  H HG3  . GLU A 1 75 ? -5.031  -7.020  -2.619  1.00 0.00 ? 75 GLU A HG3  2  
ATOM 2841  N N    . THR A 1 76 ? -4.072  -6.572  -7.320  1.00 0.00 ? 76 THR A N    2  
ATOM 2842  C CA   . THR A 1 76 ? -3.937  -6.647  -8.781  1.00 0.00 ? 76 THR A CA   2  
ATOM 2843  C C    . THR A 1 76 ? -2.578  -6.042  -9.190  1.00 0.00 ? 76 THR A C    2  
ATOM 2844  O O    . THR A 1 76 ? -1.753  -6.696  -9.816  1.00 0.00 ? 76 THR A O    2  
ATOM 2845  C CB   . THR A 1 76 ? -5.106  -5.888  -9.497  1.00 0.00 ? 76 THR A CB   2  
ATOM 2846  O OG1  . THR A 1 76 ? -6.369  -6.397  -9.050  1.00 0.00 ? 76 THR A OG1  2  
ATOM 2847  C CG2  . THR A 1 76 ? -5.036  -6.021  -11.026 1.00 0.00 ? 76 THR A CG2  2  
ATOM 2848  H H    . THR A 1 76 ? -4.786  -6.026  -6.933  1.00 0.00 ? 76 THR A H    2  
ATOM 2849  H HA   . THR A 1 76 ? -3.970  -7.694  -9.070  1.00 0.00 ? 76 THR A HA   2  
ATOM 2850  H HB   . THR A 1 76 ? -5.055  -4.834  -9.234  1.00 0.00 ? 76 THR A HB   2  
ATOM 2851  H HG1  . THR A 1 76 ? -6.354  -6.494  -8.089  1.00 0.00 ? 76 THR A HG1  2  
ATOM 2852  H HG21 . THR A 1 76 ? -5.853  -5.474  -11.478 1.00 0.00 ? 76 THR A HG21 2  
ATOM 2853  H HG22 . THR A 1 76 ? -5.100  -7.067  -11.305 1.00 0.00 ? 76 THR A HG22 2  
ATOM 2854  H HG23 . THR A 1 76 ? -4.101  -5.616  -11.388 1.00 0.00 ? 76 THR A HG23 2  
ATOM 2855  N N    . LEU A 1 77 ? -2.370  -4.812  -8.711  1.00 0.00 ? 77 LEU A N    2  
ATOM 2856  C CA   . LEU A 1 77 ? -1.163  -3.997  -8.925  1.00 0.00 ? 77 LEU A CA   2  
ATOM 2857  C C    . LEU A 1 77 ? 0.134   -4.722  -8.526  1.00 0.00 ? 77 LEU A C    2  
ATOM 2858  O O    . LEU A 1 77 ? 1.094   -4.707  -9.288  1.00 0.00 ? 77 LEU A O    2  
ATOM 2859  C CB   . LEU A 1 77 ? -1.325  -2.697  -8.120  1.00 0.00 ? 77 LEU A CB   2  
ATOM 2860  C CG   . LEU A 1 77 ? -0.200  -1.640  -8.216  1.00 0.00 ? 77 LEU A CG   2  
ATOM 2861  C CD1  . LEU A 1 77 ? 0.038   -1.170  -9.675  1.00 0.00 ? 77 LEU A CD1  2  
ATOM 2862  C CD2  . LEU A 1 77 ? -0.545  -0.463  -7.295  1.00 0.00 ? 77 LEU A CD2  2  
ATOM 2863  H H    . LEU A 1 77 ? -3.100  -4.410  -8.206  1.00 0.00 ? 77 LEU A H    2  
ATOM 2864  H HA   . LEU A 1 77 ? -1.123  -3.752  -9.982  1.00 0.00 ? 77 LEU A HA   2  
ATOM 2865  H HB2  . LEU A 1 77 ? -2.250  -2.224  -8.435  1.00 0.00 ? 77 LEU A HB2  2  
ATOM 2866  H HB3  . LEU A 1 77 ? -1.442  -2.971  -7.065  1.00 0.00 ? 77 LEU A HB3  2  
ATOM 2867  H HG   . LEU A 1 77 ? 0.728   -2.077  -7.859  1.00 0.00 ? 77 LEU A HG   2  
ATOM 2868  H HD11 . LEU A 1 77 ? 0.345   -2.009  -10.284 1.00 0.00 ? 77 LEU A HD11 2  
ATOM 2869  H HD12 . LEU A 1 77 ? 0.818   -0.420  -9.692  1.00 0.00 ? 77 LEU A HD12 2  
ATOM 2870  H HD13 . LEU A 1 77 ? -0.873  -0.747  -10.082 1.00 0.00 ? 77 LEU A HD13 2  
ATOM 2871  H HD21 . LEU A 1 77 ? -0.675  -0.817  -6.279  1.00 0.00 ? 77 LEU A HD21 2  
ATOM 2872  H HD22 . LEU A 1 77 ? -1.460  0.018   -7.625  1.00 0.00 ? 77 LEU A HD22 2  
ATOM 2873  H HD23 . LEU A 1 77 ? 0.260   0.253   -7.310  1.00 0.00 ? 77 LEU A HD23 2  
ATOM 2874  N N    . GLN A 1 78 ? 0.145   -5.359  -7.338  1.00 0.00 ? 78 GLN A N    2  
ATOM 2875  C CA   . GLN A 1 78 ? 1.320   -6.108  -6.835  1.00 0.00 ? 78 GLN A CA   2  
ATOM 2876  C C    . GLN A 1 78 ? 1.659   -7.278  -7.772  1.00 0.00 ? 78 GLN A C    2  
ATOM 2877  O O    . GLN A 1 78 ? 2.803   -7.440  -8.175  1.00 0.00 ? 78 GLN A O    2  
ATOM 2878  C CB   . GLN A 1 78 ? 1.087   -6.654  -5.404  1.00 0.00 ? 78 GLN A CB   2  
ATOM 2879  C CG   . GLN A 1 78 ? 0.938   -5.593  -4.293  1.00 0.00 ? 78 GLN A CG   2  
ATOM 2880  C CD   . GLN A 1 78 ? 0.978   -6.214  -2.896  1.00 0.00 ? 78 GLN A CD   2  
ATOM 2881  O OE1  . GLN A 1 78 ? 1.662   -7.208  -2.680  1.00 0.00 ? 78 GLN A OE1  2  
ATOM 2882  N NE2  . GLN A 1 78 ? 0.245   -5.667  -1.948  1.00 0.00 ? 78 GLN A NE2  2  
ATOM 2883  H H    . GLN A 1 78 ? -0.655  -5.327  -6.780  1.00 0.00 ? 78 GLN A H    2  
ATOM 2884  H HA   . GLN A 1 78 ? 2.165   -5.422  -6.816  1.00 0.00 ? 78 GLN A HA   2  
ATOM 2885  H HB2  . GLN A 1 78 ? 0.186   -7.265  -5.408  1.00 0.00 ? 78 GLN A HB2  2  
ATOM 2886  H HB3  . GLN A 1 78 ? 1.925   -7.297  -5.143  1.00 0.00 ? 78 GLN A HB3  2  
ATOM 2887  H HG2  . GLN A 1 78 ? 1.752   -4.878  -4.372  1.00 0.00 ? 78 GLN A HG2  2  
ATOM 2888  H HG3  . GLN A 1 78 ? -0.005  -5.075  -4.426  1.00 0.00 ? 78 GLN A HG3  2  
ATOM 2889  H HE21 . GLN A 1 78 ? -0.289  -4.885  -2.170  1.00 0.00 ? 78 GLN A HE21 2  
ATOM 2890  H HE22 . GLN A 1 78 ? 0.258   -6.082  -1.063  1.00 0.00 ? 78 GLN A HE22 2  
ATOM 2891  N N    . GLN A 1 79 ? 0.631   -8.054  -8.127  1.00 0.00 ? 79 GLN A N    2  
ATOM 2892  C CA   . GLN A 1 79 ? 0.782   -9.209  -9.025  1.00 0.00 ? 79 GLN A CA   2  
ATOM 2893  C C    . GLN A 1 79 ? 1.127   -8.761  -10.473 1.00 0.00 ? 79 GLN A C    2  
ATOM 2894  O O    . GLN A 1 79 ? 1.721   -9.533  -11.227 1.00 0.00 ? 79 GLN A O    2  
ATOM 2895  C CB   . GLN A 1 79 ? -0.468  -10.138 -8.959  1.00 0.00 ? 79 GLN A CB   2  
ATOM 2896  C CG   . GLN A 1 79 ? -0.470  -11.149 -7.774  1.00 0.00 ? 79 GLN A CG   2  
ATOM 2897  C CD   . GLN A 1 79 ? -0.611  -10.521 -6.381  1.00 0.00 ? 79 GLN A CD   2  
ATOM 2898  O OE1  . GLN A 1 79 ? -1.717  -10.388 -5.855  1.00 0.00 ? 79 GLN A OE1  2  
ATOM 2899  N NE2  . GLN A 1 79 ? 0.495   -10.105 -5.788  1.00 0.00 ? 79 GLN A NE2  2  
ATOM 2900  H H    . GLN A 1 79 ? -0.252  -7.817  -7.772  1.00 0.00 ? 79 GLN A H    2  
ATOM 2901  H HA   . GLN A 1 79 ? 1.644   -9.774  -8.657  1.00 0.00 ? 79 GLN A HA   2  
ATOM 2902  H HB2  . GLN A 1 79 ? -1.358  -9.525  -8.874  1.00 0.00 ? 79 GLN A HB2  2  
ATOM 2903  H HB3  . GLN A 1 79 ? -0.539  -10.709 -9.884  1.00 0.00 ? 79 GLN A HB3  2  
ATOM 2904  H HG2  . GLN A 1 79 ? -1.295  -11.834 -7.915  1.00 0.00 ? 79 GLN A HG2  2  
ATOM 2905  H HG3  . GLN A 1 79 ? 0.458   -11.710 -7.808  1.00 0.00 ? 79 GLN A HG3  2  
ATOM 2906  H HE21 . GLN A 1 79 ? 1.344   -10.209 -6.266  1.00 0.00 ? 79 GLN A HE21 2  
ATOM 2907  H HE22 . GLN A 1 79 ? 0.426   -9.694  -4.902  1.00 0.00 ? 79 GLN A HE22 2  
ATOM 2908  N N    . GLU A 1 80 ? 0.786   -7.505  -10.841 1.00 0.00 ? 80 GLU A N    2  
ATOM 2909  C CA   . GLU A 1 80 ? 1.254   -6.879  -12.103 1.00 0.00 ? 80 GLU A CA   2  
ATOM 2910  C C    . GLU A 1 80 ? 2.755   -6.546  -12.005 1.00 0.00 ? 80 GLU A C    2  
ATOM 2911  O O    . GLU A 1 80 ? 3.520   -6.796  -12.942 1.00 0.00 ? 80 GLU A O    2  
ATOM 2912  C CB   . GLU A 1 80 ? 0.442   -5.588  -12.424 1.00 0.00 ? 80 GLU A CB   2  
ATOM 2913  C CG   . GLU A 1 80 ? -1.048  -5.808  -12.765 1.00 0.00 ? 80 GLU A CG   2  
ATOM 2914  C CD   . GLU A 1 80 ? -1.280  -6.708  -13.998 1.00 0.00 ? 80 GLU A CD   2  
ATOM 2915  O OE1  . GLU A 1 80 ? -0.927  -6.292  -15.123 1.00 0.00 ? 80 GLU A OE1  2  
ATOM 2916  O OE2  . GLU A 1 80 ? -1.810  -7.833  -13.849 1.00 0.00 ? 80 GLU A OE2  2  
ATOM 2917  H H    . GLU A 1 80 ? 0.190   -6.984  -10.262 1.00 0.00 ? 80 GLU A H    2  
ATOM 2918  H HA   . GLU A 1 80 ? 1.104   -7.595  -12.910 1.00 0.00 ? 80 GLU A HA   2  
ATOM 2919  H HB2  . GLU A 1 80 ? 0.487   -4.929  -11.566 1.00 0.00 ? 80 GLU A HB2  2  
ATOM 2920  H HB3  . GLU A 1 80 ? 0.903   -5.084  -13.266 1.00 0.00 ? 80 GLU A HB3  2  
ATOM 2921  H HG2  . GLU A 1 80 ? -1.534  -6.254  -11.908 1.00 0.00 ? 80 GLU A HG2  2  
ATOM 2922  H HG3  . GLU A 1 80 ? -1.509  -4.842  -12.955 1.00 0.00 ? 80 GLU A HG3  2  
ATOM 2923  N N    . LEU A 1 81 ? 3.161   -5.998  -10.848 1.00 0.00 ? 81 LEU A N    2  
ATOM 2924  C CA   . LEU A 1 81 ? 4.563   -5.623  -10.559 1.00 0.00 ? 81 LEU A CA   2  
ATOM 2925  C C    . LEU A 1 81 ? 5.437   -6.878  -10.295 1.00 0.00 ? 81 LEU A C    2  
ATOM 2926  O O    . LEU A 1 81 ? 6.671   -6.796  -10.311 1.00 0.00 ? 81 LEU A O    2  
ATOM 2927  C CB   . LEU A 1 81 ? 4.614   -4.673  -9.321  1.00 0.00 ? 81 LEU A CB   2  
ATOM 2928  C CG   . LEU A 1 81 ? 3.889   -3.290  -9.454  1.00 0.00 ? 81 LEU A CG   2  
ATOM 2929  C CD1  . LEU A 1 81 ? 3.886   -2.520  -8.109  1.00 0.00 ? 81 LEU A CD1  2  
ATOM 2930  C CD2  . LEU A 1 81 ? 4.508   -2.437  -10.580 1.00 0.00 ? 81 LEU A CD2  2  
ATOM 2931  H H    . LEU A 1 81 ? 2.492   -5.851  -10.150 1.00 0.00 ? 81 LEU A H    2  
ATOM 2932  H HA   . LEU A 1 81 ? 4.957   -5.100  -11.426 1.00 0.00 ? 81 LEU A HA   2  
ATOM 2933  H HB2  . LEU A 1 81 ? 4.176   -5.204  -8.480  1.00 0.00 ? 81 LEU A HB2  2  
ATOM 2934  H HB3  . LEU A 1 81 ? 5.656   -4.483  -9.087  1.00 0.00 ? 81 LEU A HB3  2  
ATOM 2935  H HG   . LEU A 1 81 ? 2.853   -3.470  -9.719  1.00 0.00 ? 81 LEU A HG   2  
ATOM 2936  H HD11 . LEU A 1 81 ? 3.345   -1.590  -8.220  1.00 0.00 ? 81 LEU A HD11 2  
ATOM 2937  H HD12 . LEU A 1 81 ? 4.902   -2.307  -7.801  1.00 0.00 ? 81 LEU A HD12 2  
ATOM 2938  H HD13 . LEU A 1 81 ? 3.405   -3.122  -7.347  1.00 0.00 ? 81 LEU A HD13 2  
ATOM 2939  H HD21 . LEU A 1 81 ? 4.423   -2.959  -11.521 1.00 0.00 ? 81 LEU A HD21 2  
ATOM 2940  H HD22 . LEU A 1 81 ? 5.553   -2.248  -10.366 1.00 0.00 ? 81 LEU A HD22 2  
ATOM 2941  H HD23 . LEU A 1 81 ? 3.983   -1.491  -10.654 1.00 0.00 ? 81 LEU A HD23 2  
ATOM 2942  N N    . GLY A 1 82 ? 4.776   -8.030  -10.043 1.00 0.00 ? 82 GLY A N    2  
ATOM 2943  C CA   . GLY A 1 82 ? 5.451   -9.284  -9.698  1.00 0.00 ? 82 GLY A CA   2  
ATOM 2944  C C    . GLY A 1 82 ? 5.620   -9.474  -8.191  1.00 0.00 ? 82 GLY A C    2  
ATOM 2945  O O    . GLY A 1 82 ? 6.038   -10.546 -7.757  1.00 0.00 ? 82 GLY A O    2  
ATOM 2946  H H    . GLY A 1 82 ? 3.799   -8.023  -10.085 1.00 0.00 ? 82 GLY A H    2  
ATOM 2947  H HA2  . GLY A 1 82 ? 4.863   -10.107 -10.083 1.00 0.00 ? 82 GLY A HA2  2  
ATOM 2948  H HA3  . GLY A 1 82 ? 6.428   -9.312  -10.167 1.00 0.00 ? 82 GLY A HA3  2  
ATOM 2949  N N    . ILE A 1 83 ? 5.268   -8.428  -7.408  1.00 0.00 ? 83 ILE A N    2  
ATOM 2950  C CA   . ILE A 1 83 ? 5.384   -8.380  -5.935  1.00 0.00 ? 83 ILE A CA   2  
ATOM 2951  C C    . ILE A 1 83 ? 4.445   -9.423  -5.290  1.00 0.00 ? 83 ILE A C    2  
ATOM 2952  O O    . ILE A 1 83 ? 3.223   -9.225  -5.221  1.00 0.00 ? 83 ILE A O    2  
ATOM 2953  C CB   . ILE A 1 83 ? 5.043   -6.915  -5.429  1.00 0.00 ? 83 ILE A CB   2  
ATOM 2954  C CG1  . ILE A 1 83 ? 6.111   -5.902  -5.953  1.00 0.00 ? 83 ILE A CG1  2  
ATOM 2955  C CG2  . ILE A 1 83 ? 4.900   -6.829  -3.887  1.00 0.00 ? 83 ILE A CG2  2  
ATOM 2956  C CD1  . ILE A 1 83 ? 5.843   -4.454  -5.593  1.00 0.00 ? 83 ILE A CD1  2  
ATOM 2957  H H    . ILE A 1 83 ? 4.879   -7.645  -7.840  1.00 0.00 ? 83 ILE A H    2  
ATOM 2958  H HA   . ILE A 1 83 ? 6.415   -8.603  -5.667  1.00 0.00 ? 83 ILE A HA   2  
ATOM 2959  H HB   . ILE A 1 83 ? 4.078   -6.642  -5.854  1.00 0.00 ? 83 ILE A HB   2  
ATOM 2960  H HG12 . ILE A 1 83 ? 7.080   -6.158  -5.544  1.00 0.00 ? 83 ILE A HG12 2  
ATOM 2961  H HG13 . ILE A 1 83 ? 6.162   -5.963  -7.033  1.00 0.00 ? 83 ILE A HG13 2  
ATOM 2962  H HG21 . ILE A 1 83 ? 4.128   -7.515  -3.550  1.00 0.00 ? 83 ILE A HG21 2  
ATOM 2963  H HG22 . ILE A 1 83 ? 4.621   -5.822  -3.595  1.00 0.00 ? 83 ILE A HG22 2  
ATOM 2964  H HG23 . ILE A 1 83 ? 5.837   -7.090  -3.415  1.00 0.00 ? 83 ILE A HG23 2  
ATOM 2965  H HD11 . ILE A 1 83 ? 6.594   -3.830  -6.054  1.00 0.00 ? 83 ILE A HD11 2  
ATOM 2966  H HD12 . ILE A 1 83 ? 5.885   -4.330  -4.519  1.00 0.00 ? 83 ILE A HD12 2  
ATOM 2967  H HD13 . ILE A 1 83 ? 4.866   -4.163  -5.952  1.00 0.00 ? 83 ILE A HD13 2  
ATOM 2968  N N    . GLU A 1 84 ? 5.036   -10.556 -4.873  1.00 0.00 ? 84 GLU A N    2  
ATOM 2969  C CA   . GLU A 1 84 ? 4.316   -11.721 -4.319  1.00 0.00 ? 84 GLU A CA   2  
ATOM 2970  C C    . GLU A 1 84 ? 5.156   -12.380 -3.202  1.00 0.00 ? 84 GLU A C    2  
ATOM 2971  O O    . GLU A 1 84 ? 6.341   -12.055 -3.020  1.00 0.00 ? 84 GLU A O    2  
ATOM 2972  C CB   . GLU A 1 84 ? 4.004   -12.752 -5.448  1.00 0.00 ? 84 GLU A CB   2  
ATOM 2973  C CG   . GLU A 1 84 ? 3.012   -12.258 -6.525  1.00 0.00 ? 84 GLU A CG   2  
ATOM 2974  C CD   . GLU A 1 84 ? 2.827   -13.230 -7.696  1.00 0.00 ? 84 GLU A CD   2  
ATOM 2975  O OE1  . GLU A 1 84 ? 2.001   -14.169 -7.588  1.00 0.00 ? 84 GLU A OE1  2  
ATOM 2976  O OE2  . GLU A 1 84 ? 3.498   -13.063 -8.739  1.00 0.00 ? 84 GLU A OE2  2  
ATOM 2977  H H    . GLU A 1 84 ? 6.013   -10.620 -4.938  1.00 0.00 ? 84 GLU A H    2  
ATOM 2978  H HA   . GLU A 1 84 ? 3.382   -11.373 -3.881  1.00 0.00 ? 84 GLU A HA   2  
ATOM 2979  H HB2  . GLU A 1 84 ? 4.932   -13.011 -5.941  1.00 0.00 ? 84 GLU A HB2  2  
ATOM 2980  H HB3  . GLU A 1 84 ? 3.592   -13.657 -4.999  1.00 0.00 ? 84 GLU A HB3  2  
ATOM 2981  H HG2  . GLU A 1 84 ? 2.045   -12.091 -6.059  1.00 0.00 ? 84 GLU A HG2  2  
ATOM 2982  H HG3  . GLU A 1 84 ? 3.373   -11.312 -6.910  1.00 0.00 ? 84 GLU A HG3  2  
ATOM 2983  N N    . GLY A 1 85 ? 4.505   -13.286 -2.452  1.00 0.00 ? 85 GLY A N    2  
ATOM 2984  C CA   . GLY A 1 85 ? 5.134   -14.049 -1.375  1.00 0.00 ? 85 GLY A CA   2  
ATOM 2985  C C    . GLY A 1 85 ? 5.584   -13.188 -0.204  1.00 0.00 ? 85 GLY A C    2  
ATOM 2986  O O    . GLY A 1 85 ? 4.770   -12.488 0.393   1.00 0.00 ? 85 GLY A O    2  
ATOM 2987  H H    . GLY A 1 85 ? 3.565   -13.447 -2.642  1.00 0.00 ? 85 GLY A H    2  
ATOM 2988  H HA2  . GLY A 1 85 ? 4.404   -14.757 -1.011  1.00 0.00 ? 85 GLY A HA2  2  
ATOM 2989  H HA3  . GLY A 1 85 ? 5.977   -14.597 -1.774  1.00 0.00 ? 85 GLY A HA3  2  
ATOM 2990  N N    . GLU A 1 86 ? 6.883   -13.257 0.124   1.00 0.00 ? 86 GLU A N    2  
ATOM 2991  C CA   . GLU A 1 86 ? 7.504   -12.438 1.186   1.00 0.00 ? 86 GLU A CA   2  
ATOM 2992  C C    . GLU A 1 86 ? 7.675   -10.973 0.736   1.00 0.00 ? 86 GLU A C    2  
ATOM 2993  O O    . GLU A 1 86 ? 7.709   -10.059 1.571   1.00 0.00 ? 86 GLU A O    2  
ATOM 2994  C CB   . GLU A 1 86 ? 8.868   -13.048 1.594   1.00 0.00 ? 86 GLU A CB   2  
ATOM 2995  C CG   . GLU A 1 86 ? 8.780   -14.467 2.193   1.00 0.00 ? 86 GLU A CG   2  
ATOM 2996  C CD   . GLU A 1 86 ? 10.160  -15.082 2.475   1.00 0.00 ? 86 GLU A CD   2  
ATOM 2997  O OE1  . GLU A 1 86 ? 10.711  -14.859 3.580   1.00 0.00 ? 86 GLU A OE1  2  
ATOM 2998  O OE2  . GLU A 1 86 ? 10.714  -15.769 1.584   1.00 0.00 ? 86 GLU A OE2  2  
ATOM 2999  H H    . GLU A 1 86 ? 7.455   -13.887 -0.366  1.00 0.00 ? 86 GLU A H    2  
ATOM 3000  H HA   . GLU A 1 86 ? 6.843   -12.454 2.049   1.00 0.00 ? 86 GLU A HA   2  
ATOM 3001  H HB2  . GLU A 1 86 ? 9.511   -13.088 0.721   1.00 0.00 ? 86 GLU A HB2  2  
ATOM 3002  H HB3  . GLU A 1 86 ? 9.339   -12.401 2.333   1.00 0.00 ? 86 GLU A HB3  2  
ATOM 3003  H HG2  . GLU A 1 86 ? 8.215   -14.421 3.123   1.00 0.00 ? 86 GLU A HG2  2  
ATOM 3004  H HG3  . GLU A 1 86 ? 8.247   -15.104 1.498   1.00 0.00 ? 86 GLU A HG3  2  
ATOM 3005  N N    . ASN A 1 87 ? 7.766   -10.763 -0.594  1.00 0.00 ? 87 ASN A N    2  
ATOM 3006  C CA   . ASN A 1 87 ? 7.868   -9.416  -1.195  1.00 0.00 ? 87 ASN A CA   2  
ATOM 3007  C C    . ASN A 1 87 ? 6.506   -8.716  -1.171  1.00 0.00 ? 87 ASN A C    2  
ATOM 3008  O O    . ASN A 1 87 ? 6.441   -7.479  -1.204  1.00 0.00 ? 87 ASN A O    2  
ATOM 3009  C CB   . ASN A 1 87 ? 8.407   -9.498  -2.652  1.00 0.00 ? 87 ASN A CB   2  
ATOM 3010  C CG   . ASN A 1 87 ? 9.868   -9.950  -2.747  1.00 0.00 ? 87 ASN A CG   2  
ATOM 3011  O OD1  . ASN A 1 87 ? 10.664  -9.729  -1.834  1.00 0.00 ? 87 ASN A OD1  2  
ATOM 3012  N ND2  . ASN A 1 87 ? 10.238  -10.558 -3.861  1.00 0.00 ? 87 ASN A ND2  2  
ATOM 3013  H H    . ASN A 1 87 ? 7.744   -11.542 -1.194  1.00 0.00 ? 87 ASN A H    2  
ATOM 3014  H HA   . ASN A 1 87 ? 8.561   -8.831  -0.592  1.00 0.00 ? 87 ASN A HA   2  
ATOM 3015  H HB2  . ASN A 1 87 ? 7.799   -10.197 -3.217  1.00 0.00 ? 87 ASN A HB2  2  
ATOM 3016  H HB3  . ASN A 1 87 ? 8.328   -8.520  -3.115  1.00 0.00 ? 87 ASN A HB3  2  
ATOM 3017  H HD21 . ASN A 1 87 ? 9.570   -10.690 -4.561  1.00 0.00 ? 87 ASN A HD21 2  
ATOM 3018  H HD22 . ASN A 1 87 ? 11.169  -10.845 -3.943  1.00 0.00 ? 87 ASN A HD22 2  
ATOM 3019  N N    . ARG A 1 88 ? 5.430   -9.528  -1.104  1.00 0.00 ? 88 ARG A N    2  
ATOM 3020  C CA   . ARG A 1 88 ? 4.042   -9.053  -1.062  1.00 0.00 ? 88 ARG A CA   2  
ATOM 3021  C C    . ARG A 1 88 ? 3.824   -8.118  0.140   1.00 0.00 ? 88 ARG A C    2  
ATOM 3022  O O    . ARG A 1 88 ? 4.344   -8.380  1.225   1.00 0.00 ? 88 ARG A O    2  
ATOM 3023  C CB   . ARG A 1 88 ? 3.070   -10.258 -1.000  1.00 0.00 ? 88 ARG A CB   2  
ATOM 3024  C CG   . ARG A 1 88 ? 1.583   -9.887  -1.033  1.00 0.00 ? 88 ARG A CG   2  
ATOM 3025  C CD   . ARG A 1 88 ? 0.655   -11.103 -1.027  1.00 0.00 ? 88 ARG A CD   2  
ATOM 3026  N NE   . ARG A 1 88 ? 0.919   -12.018 -2.157  1.00 0.00 ? 88 ARG A NE   2  
ATOM 3027  C CZ   . ARG A 1 88 ? -0.018  -12.632 -2.895  1.00 0.00 ? 88 ARG A CZ   2  
ATOM 3028  N NH1  . ARG A 1 88 ? -1.320  -12.426 -2.660  1.00 0.00 ? 88 ARG A NH1  2  
ATOM 3029  N NH2  . ARG A 1 88 ? 0.359   -13.460 -3.856  1.00 0.00 ? 88 ARG A NH2  2  
ATOM 3030  H H    . ARG A 1 88 ? 5.589   -10.487 -1.072  1.00 0.00 ? 88 ARG A H    2  
ATOM 3031  H HA   . ARG A 1 88 ? 3.857   -8.500  -1.979  1.00 0.00 ? 88 ARG A HA   2  
ATOM 3032  H HB2  . ARG A 1 88 ? 3.271   -10.910 -1.844  1.00 0.00 ? 88 ARG A HB2  2  
ATOM 3033  H HB3  . ARG A 1 88 ? 3.259   -10.813 -0.089  1.00 0.00 ? 88 ARG A HB3  2  
ATOM 3034  H HG2  . ARG A 1 88 ? 1.361   -9.277  -0.168  1.00 0.00 ? 88 ARG A HG2  2  
ATOM 3035  H HG3  . ARG A 1 88 ? 1.392   -9.312  -1.928  1.00 0.00 ? 88 ARG A HG3  2  
ATOM 3036  H HD2  . ARG A 1 88 ? 0.798   -11.645 -0.100  1.00 0.00 ? 88 ARG A HD2  2  
ATOM 3037  H HD3  . ARG A 1 88 ? -0.370  -10.754 -1.078  1.00 0.00 ? 88 ARG A HD3  2  
ATOM 3038  H HE   . ARG A 1 88 ? 1.859   -12.205 -2.357  1.00 0.00 ? 88 ARG A HE   2  
ATOM 3039  H HH11 . ARG A 1 88 ? -1.612  -11.810 -1.918  1.00 0.00 ? 88 ARG A HH11 2  
ATOM 3040  H HH12 . ARG A 1 88 ? -2.013  -12.887 -3.217  1.00 0.00 ? 88 ARG A HH12 2  
ATOM 3041  H HH21 . ARG A 1 88 ? 1.332   -13.638 -4.021  1.00 0.00 ? 88 ARG A HH21 2  
ATOM 3042  H HH22 . ARG A 1 88 ? -0.327  -13.924 -4.421  1.00 0.00 ? 88 ARG A HH22 2  
ATOM 3043  N N    . VAL A 1 89 ? 3.097   -7.018  -0.091  1.00 0.00 ? 89 VAL A N    2  
ATOM 3044  C CA   . VAL A 1 89 ? 2.767   -6.004  0.918   1.00 0.00 ? 89 VAL A CA   2  
ATOM 3045  C C    . VAL A 1 89 ? 1.400   -6.344  1.576   1.00 0.00 ? 89 VAL A C    2  
ATOM 3046  O O    . VAL A 1 89 ? 0.348   -6.122  0.964   1.00 0.00 ? 89 VAL A O    2  
ATOM 3047  C CB   . VAL A 1 89 ? 2.744   -4.578  0.237   1.00 0.00 ? 89 VAL A CB   2  
ATOM 3048  C CG1  . VAL A 1 89 ? 2.268   -3.481  1.204   1.00 0.00 ? 89 VAL A CG1  2  
ATOM 3049  C CG2  . VAL A 1 89 ? 4.140   -4.235  -0.345  1.00 0.00 ? 89 VAL A CG2  2  
ATOM 3050  H H    . VAL A 1 89 ? 2.761   -6.881  -0.996  1.00 0.00 ? 89 VAL A H    2  
ATOM 3051  H HA   . VAL A 1 89 ? 3.545   -6.002  1.681   1.00 0.00 ? 89 VAL A HA   2  
ATOM 3052  H HB   . VAL A 1 89 ? 2.036   -4.613  -0.593  1.00 0.00 ? 89 VAL A HB   2  
ATOM 3053  H HG11 . VAL A 1 89 ? 1.280   -3.723  1.573   1.00 0.00 ? 89 VAL A HG11 2  
ATOM 3054  H HG12 . VAL A 1 89 ? 2.232   -2.526  0.696   1.00 0.00 ? 89 VAL A HG12 2  
ATOM 3055  H HG13 . VAL A 1 89 ? 2.952   -3.411  2.043   1.00 0.00 ? 89 VAL A HG13 2  
ATOM 3056  H HG21 . VAL A 1 89 ? 4.112   -3.266  -0.828  1.00 0.00 ? 89 VAL A HG21 2  
ATOM 3057  H HG22 . VAL A 1 89 ? 4.427   -4.985  -1.073  1.00 0.00 ? 89 VAL A HG22 2  
ATOM 3058  H HG23 . VAL A 1 89 ? 4.876   -4.212  0.449   1.00 0.00 ? 89 VAL A HG23 2  
ATOM 3059  N N    . PRO A 1 90 ? 1.394   -6.931  2.821   1.00 0.00 ? 90 PRO A N    2  
ATOM 3060  C CA   . PRO A 1 90 ? 0.145   -7.294  3.538   1.00 0.00 ? 90 PRO A CA   2  
ATOM 3061  C C    . PRO A 1 90 ? -0.655  -6.061  3.977   1.00 0.00 ? 90 PRO A C    2  
ATOM 3062  O O    . PRO A 1 90 ? -0.091  -4.991  4.182   1.00 0.00 ? 90 PRO A O    2  
ATOM 3063  C CB   . PRO A 1 90 ? 0.642   -8.117  4.763   1.00 0.00 ? 90 PRO A CB   2  
ATOM 3064  C CG   . PRO A 1 90 ? 2.066   -8.468  4.438   1.00 0.00 ? 90 PRO A CG   2  
ATOM 3065  C CD   . PRO A 1 90 ? 2.581   -7.312  3.626   1.00 0.00 ? 90 PRO A CD   2  
ATOM 3066  H HA   . PRO A 1 90 ? -0.486  -7.921  2.909   1.00 0.00 ? 90 PRO A HA   2  
ATOM 3067  H HB2  . PRO A 1 90 ? 0.589   -7.525  5.682   1.00 0.00 ? 90 PRO A HB2  2  
ATOM 3068  H HB3  . PRO A 1 90 ? 0.052   -9.018  4.878   1.00 0.00 ? 90 PRO A HB3  2  
ATOM 3069  H HG2  . PRO A 1 90 ? 2.640   -8.583  5.350   1.00 0.00 ? 90 PRO A HG2  2  
ATOM 3070  H HG3  . PRO A 1 90 ? 2.108   -9.381  3.852   1.00 0.00 ? 90 PRO A HG3  2  
ATOM 3071  H HD2  . PRO A 1 90 ? 2.900   -6.491  4.265   1.00 0.00 ? 90 PRO A HD2  2  
ATOM 3072  H HD3  . PRO A 1 90 ? 3.399   -7.628  2.992   1.00 0.00 ? 90 PRO A HD3  2  
ATOM 3073  N N    . VAL A 1 91 ? -1.965  -6.231  4.118   1.00 0.00 ? 91 VAL A N    2  
ATOM 3074  C CA   . VAL A 1 91 ? -2.870  -5.164  4.554   1.00 0.00 ? 91 VAL A CA   2  
ATOM 3075  C C    . VAL A 1 91 ? -3.316  -5.446  5.992   1.00 0.00 ? 91 VAL A C    2  
ATOM 3076  O O    . VAL A 1 91 ? -3.934  -6.483  6.254   1.00 0.00 ? 91 VAL A O    2  
ATOM 3077  C CB   . VAL A 1 91 ? -4.123  -5.051  3.612   1.00 0.00 ? 91 VAL A CB   2  
ATOM 3078  C CG1  . VAL A 1 91 ? -4.986  -3.839  3.994   1.00 0.00 ? 91 VAL A CG1  2  
ATOM 3079  C CG2  . VAL A 1 91 ? -3.705  -4.981  2.133   1.00 0.00 ? 91 VAL A CG2  2  
ATOM 3080  H H    . VAL A 1 91 ? -2.331  -7.116  3.933   1.00 0.00 ? 91 VAL A H    2  
ATOM 3081  H HA   . VAL A 1 91 ? -2.333  -4.210  4.525   1.00 0.00 ? 91 VAL A HA   2  
ATOM 3082  H HB   . VAL A 1 91 ? -4.732  -5.949  3.742   1.00 0.00 ? 91 VAL A HB   2  
ATOM 3083  H HG11 . VAL A 1 91 ? -5.847  -3.783  3.339   1.00 0.00 ? 91 VAL A HG11 2  
ATOM 3084  H HG12 . VAL A 1 91 ? -4.410  -2.924  3.900   1.00 0.00 ? 91 VAL A HG12 2  
ATOM 3085  H HG13 . VAL A 1 91 ? -5.328  -3.939  5.015   1.00 0.00 ? 91 VAL A HG13 2  
ATOM 3086  H HG21 . VAL A 1 91 ? -4.585  -4.949  1.502   1.00 0.00 ? 91 VAL A HG21 2  
ATOM 3087  H HG22 . VAL A 1 91 ? -3.121  -5.857  1.879   1.00 0.00 ? 91 VAL A HG22 2  
ATOM 3088  H HG23 . VAL A 1 91 ? -3.108  -4.094  1.956   1.00 0.00 ? 91 VAL A HG23 2  
ATOM 3089  N N    . VAL A 1 92 ? -2.992  -4.531  6.920   1.00 0.00 ? 92 VAL A N    2  
ATOM 3090  C CA   . VAL A 1 92 ? -3.341  -4.671  8.336   1.00 0.00 ? 92 VAL A CA   2  
ATOM 3091  C C    . VAL A 1 92 ? -4.474  -3.693  8.648   1.00 0.00 ? 92 VAL A C    2  
ATOM 3092  O O    . VAL A 1 92 ? -4.231  -2.503  8.848   1.00 0.00 ? 92 VAL A O    2  
ATOM 3093  C CB   . VAL A 1 92 ? -2.117  -4.393  9.284   1.00 0.00 ? 92 VAL A CB   2  
ATOM 3094  C CG1  . VAL A 1 92 ? -2.492  -4.603  10.771  1.00 0.00 ? 92 VAL A CG1  2  
ATOM 3095  C CG2  . VAL A 1 92 ? -0.911  -5.260  8.888   1.00 0.00 ? 92 VAL A CG2  2  
ATOM 3096  H H    . VAL A 1 92 ? -2.556  -3.705  6.638   1.00 0.00 ? 92 VAL A H    2  
ATOM 3097  H HA   . VAL A 1 92 ? -3.690  -5.695  8.516   1.00 0.00 ? 92 VAL A HA   2  
ATOM 3098  H HB   . VAL A 1 92 ? -1.823  -3.348  9.164   1.00 0.00 ? 92 VAL A HB   2  
ATOM 3099  H HG11 . VAL A 1 92 ? -1.630  -4.405  11.397  1.00 0.00 ? 92 VAL A HG11 2  
ATOM 3100  H HG12 . VAL A 1 92 ? -2.821  -5.623  10.932  1.00 0.00 ? 92 VAL A HG12 2  
ATOM 3101  H HG13 . VAL A 1 92 ? -3.291  -3.926  11.046  1.00 0.00 ? 92 VAL A HG13 2  
ATOM 3102  H HG21 . VAL A 1 92 ? -0.623  -5.035  7.869   1.00 0.00 ? 92 VAL A HG21 2  
ATOM 3103  H HG22 . VAL A 1 92 ? -1.169  -6.310  8.963   1.00 0.00 ? 92 VAL A HG22 2  
ATOM 3104  H HG23 . VAL A 1 92 ? -0.076  -5.049  9.544   1.00 0.00 ? 92 VAL A HG23 2  
ATOM 3105  N N    . TYR A 1 93 ? -5.708  -4.197  8.646   1.00 0.00 ? 93 TYR A N    2  
ATOM 3106  C CA   . TYR A 1 93 ? -6.889  -3.399  8.953   1.00 0.00 ? 93 TYR A CA   2  
ATOM 3107  C C    . TYR A 1 93 ? -6.917  -3.107  10.458  1.00 0.00 ? 93 TYR A C    2  
ATOM 3108  O O    . TYR A 1 93 ? -7.324  -3.959  11.263  1.00 0.00 ? 93 TYR A O    2  
ATOM 3109  C CB   . TYR A 1 93 ? -8.168  -4.144  8.504   1.00 0.00 ? 93 TYR A CB   2  
ATOM 3110  C CG   . TYR A 1 93 ? -8.202  -4.492  7.004   1.00 0.00 ? 93 TYR A CG   2  
ATOM 3111  C CD1  . TYR A 1 93 ? -8.645  -3.566  6.058   1.00 0.00 ? 93 TYR A CD1  2  
ATOM 3112  C CD2  . TYR A 1 93 ? -7.788  -5.748  6.540   1.00 0.00 ? 93 TYR A CD2  2  
ATOM 3113  C CE1  . TYR A 1 93 ? -8.676  -3.881  4.712   1.00 0.00 ? 93 TYR A CE1  2  
ATOM 3114  C CE2  . TYR A 1 93 ? -7.818  -6.060  5.196   1.00 0.00 ? 93 TYR A CE2  2  
ATOM 3115  C CZ   . TYR A 1 93 ? -8.263  -5.124  4.286   1.00 0.00 ? 93 TYR A CZ   2  
ATOM 3116  O OH   . TYR A 1 93 ? -8.289  -5.431  2.943   1.00 0.00 ? 93 TYR A OH   2  
ATOM 3117  H H    . TYR A 1 93 ? -5.826  -5.147  8.438   1.00 0.00 ? 93 TYR A H    2  
ATOM 3118  H HA   . TYR A 1 93 ? -6.818  -2.456  8.406   1.00 0.00 ? 93 TYR A HA   2  
ATOM 3119  H HB2  . TYR A 1 93 ? -8.251  -5.067  9.063   1.00 0.00 ? 93 TYR A HB2  2  
ATOM 3120  H HB3  . TYR A 1 93 ? -9.035  -3.529  8.727   1.00 0.00 ? 93 TYR A HB3  2  
ATOM 3121  H HD1  . TYR A 1 93 ? -8.971  -2.585  6.388   1.00 0.00 ? 93 TYR A HD1  2  
ATOM 3122  H HD2  . TYR A 1 93 ? -7.440  -6.483  7.255   1.00 0.00 ? 93 TYR A HD2  2  
ATOM 3123  H HE1  . TYR A 1 93 ? -9.024  -3.149  3.998   1.00 0.00 ? 93 TYR A HE1  2  
ATOM 3124  H HE2  . TYR A 1 93 ? -7.493  -7.038  4.860   1.00 0.00 ? 93 TYR A HE2  2  
ATOM 3125  H HH   . TYR A 1 93 ? -8.046  -4.654  2.430   1.00 0.00 ? 93 TYR A HH   2  
ATOM 3126  N N    . ILE A 1 94 ? -6.431  -1.915  10.824  1.00 0.00 ? 94 ILE A N    2  
ATOM 3127  C CA   . ILE A 1 94 ? -6.390  -1.452  12.213  1.00 0.00 ? 94 ILE A CA   2  
ATOM 3128  C C    . ILE A 1 94 ? -7.734  -0.776  12.521  1.00 0.00 ? 94 ILE A C    2  
ATOM 3129  O O    . ILE A 1 94 ? -8.294  -0.099  11.658  1.00 0.00 ? 94 ILE A O    2  
ATOM 3130  C CB   . ILE A 1 94 ? -5.178  -0.457  12.453  1.00 0.00 ? 94 ILE A CB   2  
ATOM 3131  C CG1  . ILE A 1 94 ? -3.812  -1.152  12.109  1.00 0.00 ? 94 ILE A CG1  2  
ATOM 3132  C CG2  . ILE A 1 94 ? -5.169  0.093   13.905  1.00 0.00 ? 94 ILE A CG2  2  
ATOM 3133  C CD1  . ILE A 1 94 ? -2.570  -0.324  12.403  1.00 0.00 ? 94 ILE A CD1  2  
ATOM 3134  H H    . ILE A 1 94 ? -6.140  -1.285  10.132  1.00 0.00 ? 94 ILE A H    2  
ATOM 3135  H HA   . ILE A 1 94 ? -6.263  -2.319  12.861  1.00 0.00 ? 94 ILE A HA   2  
ATOM 3136  H HB   . ILE A 1 94 ? -5.308  0.394   11.783  1.00 0.00 ? 94 ILE A HB   2  
ATOM 3137  H HG12 . ILE A 1 94 ? -3.720  -2.071  12.677  1.00 0.00 ? 94 ILE A HG12 2  
ATOM 3138  H HG13 . ILE A 1 94 ? -3.792  -1.395  11.054  1.00 0.00 ? 94 ILE A HG13 2  
ATOM 3139  H HG21 . ILE A 1 94 ? -4.363  0.808   14.027  1.00 0.00 ? 94 ILE A HG21 2  
ATOM 3140  H HG22 . ILE A 1 94 ? -5.031  -0.718  14.608  1.00 0.00 ? 94 ILE A HG22 2  
ATOM 3141  H HG23 . ILE A 1 94 ? -6.111  0.586   14.115  1.00 0.00 ? 94 ILE A HG23 2  
ATOM 3142  H HD11 . ILE A 1 94 ? -2.508  -0.120  13.465  1.00 0.00 ? 94 ILE A HD11 2  
ATOM 3143  H HD12 . ILE A 1 94 ? -2.613  0.609   11.859  1.00 0.00 ? 94 ILE A HD12 2  
ATOM 3144  H HD13 . ILE A 1 94 ? -1.693  -0.876  12.097  1.00 0.00 ? 94 ILE A HD13 2  
ATOM 3145  N N    . ALA A 1 95 ? -8.264  -1.005  13.724  1.00 0.00 ? 95 ALA A N    2  
ATOM 3146  C CA   . ALA A 1 95 ? -9.528  -0.416  14.173  1.00 0.00 ? 95 ALA A CA   2  
ATOM 3147  C C    . ALA A 1 95 ? -9.404  -0.023  15.648  1.00 0.00 ? 95 ALA A C    2  
ATOM 3148  O O    . ALA A 1 95 ? -9.765  -0.791  16.545  1.00 0.00 ? 95 ALA A O    2  
ATOM 3149  C CB   . ALA A 1 95 ? -10.680 -1.399  13.921  1.00 0.00 ? 95 ALA A CB   2  
ATOM 3150  H H    . ALA A 1 95 ? -7.797  -1.614  14.329  1.00 0.00 ? 95 ALA A H    2  
ATOM 3151  H HA   . ALA A 1 95 ? -9.722  0.493   13.593  1.00 0.00 ? 95 ALA A HA   2  
ATOM 3152  H HB1  . ALA A 1 95 ? -10.719 -1.643  12.866  1.00 0.00 ? 95 ALA A HB1  2  
ATOM 3153  H HB2  . ALA A 1 95 ? -11.621 -0.952  14.215  1.00 0.00 ? 95 ALA A HB2  2  
ATOM 3154  H HB3  . ALA A 1 95 ? -10.520 -2.304  14.489  1.00 0.00 ? 95 ALA A HB3  2  
ATOM 3155  N N    . GLU A 1 96 ? -8.822  1.163   15.881  1.00 0.00 ? 96 GLU A N    2  
ATOM 3156  C CA   . GLU A 1 96 ? -8.617  1.715   17.229  1.00 0.00 ? 96 GLU A CA   2  
ATOM 3157  C C    . GLU A 1 96 ? -9.942  2.312   17.733  1.00 0.00 ? 96 GLU A C    2  
ATOM 3158  O O    . GLU A 1 96 ? -10.206 3.505   17.558  1.00 0.00 ? 96 GLU A O    2  
ATOM 3159  C CB   . GLU A 1 96 ? -7.487  2.778   17.204  1.00 0.00 ? 96 GLU A CB   2  
ATOM 3160  C CG   . GLU A 1 96 ? -6.159  2.254   16.633  1.00 0.00 ? 96 GLU A CG   2  
ATOM 3161  C CD   . GLU A 1 96 ? -5.054  3.318   16.559  1.00 0.00 ? 96 GLU A CD   2  
ATOM 3162  O OE1  . GLU A 1 96 ? -5.027  4.103   15.593  1.00 0.00 ? 96 GLU A OE1  2  
ATOM 3163  O OE2  . GLU A 1 96 ? -4.204  3.376   17.470  1.00 0.00 ? 96 GLU A OE2  2  
ATOM 3164  H H    . GLU A 1 96 ? -8.530  1.690   15.111  1.00 0.00 ? 96 GLU A H    2  
ATOM 3165  H HA   . GLU A 1 96 ? -8.319  0.898   17.889  1.00 0.00 ? 96 GLU A HA   2  
ATOM 3166  H HB2  . GLU A 1 96 ? -7.811  3.623   16.598  1.00 0.00 ? 96 GLU A HB2  2  
ATOM 3167  H HB3  . GLU A 1 96 ? -7.312  3.126   18.215  1.00 0.00 ? 96 GLU A HB3  2  
ATOM 3168  H HG2  . GLU A 1 96 ? -5.815  1.431   17.254  1.00 0.00 ? 96 GLU A HG2  2  
ATOM 3169  H HG3  . GLU A 1 96 ? -6.345  1.874   15.634  1.00 0.00 ? 96 GLU A HG3  2  
ATOM 3170  N N    . SER A 1 97 ? -10.794 1.434   18.289  1.00 0.00 ? 97 SER A N    2  
ATOM 3171  C CA   . SER A 1 97 ? -12.131 1.788   18.784  1.00 0.00 ? 97 SER A CA   2  
ATOM 3172  C C    . SER A 1 97 ? -12.365 1.141   20.157  1.00 0.00 ? 97 SER A C    2  
ATOM 3173  O O    . SER A 1 97 ? -12.066 -0.047  20.351  1.00 0.00 ? 97 SER A O    2  
ATOM 3174  C CB   . SER A 1 97 ? -13.212 1.309   17.784  1.00 0.00 ? 97 SER A CB   2  
ATOM 3175  O OG   . SER A 1 97 ? -12.917 1.735   16.462  1.00 0.00 ? 97 SER A OG   2  
ATOM 3176  H H    . SER A 1 97 ? -10.508 0.498   18.366  1.00 0.00 ? 97 SER A H    2  
ATOM 3177  H HA   . SER A 1 97 ? -12.193 2.874   18.887  1.00 0.00 ? 97 SER A HA   2  
ATOM 3178  H HB2  . SER A 1 97 ? -13.266 0.228   17.788  1.00 0.00 ? 97 SER A HB2  2  
ATOM 3179  H HB3  . SER A 1 97 ? -14.177 1.714   18.066  1.00 0.00 ? 97 SER A HB3  2  
ATOM 3180  H HG   . SER A 1 97 ? -12.716 0.971   15.920  1.00 0.00 ? 97 SER A HG   2  
ATOM 3181  N N    . ASP A 1 98 ? -12.899 1.930   21.101  1.00 0.00 ? 98 ASP A N    2  
ATOM 3182  C CA   . ASP A 1 98 ? -13.257 1.459   22.460  1.00 0.00 ? 98 ASP A CA   2  
ATOM 3183  C C    . ASP A 1 98 ? -14.458 0.494   22.406  1.00 0.00 ? 98 ASP A C    2  
ATOM 3184  O O    . ASP A 1 98 ? -14.616 -0.361  23.279  1.00 0.00 ? 98 ASP A O    2  
ATOM 3185  C CB   . ASP A 1 98 ? -13.582 2.670   23.378  1.00 0.00 ? 98 ASP A CB   2  
ATOM 3186  C CG   . ASP A 1 98 ? -14.867 3.419   22.962  1.00 0.00 ? 98 ASP A CG   2  
ATOM 3187  O OD1  . ASP A 1 98 ? -14.856 4.093   21.913  1.00 0.00 ? 98 ASP A OD1  2  
ATOM 3188  O OD2  . ASP A 1 98 ? -15.893 3.330   23.676  1.00 0.00 ? 98 ASP A OD2  2  
ATOM 3189  H H    . ASP A 1 98 ? -13.066 2.872   20.880  1.00 0.00 ? 98 ASP A H    2  
ATOM 3190  H HA   . ASP A 1 98 ? -12.400 0.930   22.865  1.00 0.00 ? 98 ASP A HA   2  
ATOM 3191  H HB2  . ASP A 1 98 ? -13.687 2.324   24.402  1.00 0.00 ? 98 ASP A HB2  2  
ATOM 3192  H HB3  . ASP A 1 98 ? -12.749 3.370   23.348  1.00 0.00 ? 98 ASP A HB3  2  
ATOM 3193  N N    . GLY A 1 99 ? -15.289 0.657   21.365  1.00 0.00 ? 99 GLY A N    2  
ATOM 3194  C CA   . GLY A 1 99 ? -16.460 -0.188  21.131  1.00 0.00 ? 99 GLY A CA   2  
ATOM 3195  C C    . GLY A 1 99 ? -16.888 -0.165  19.663  1.00 0.00 ? 99 GLY A C    2  
ATOM 3196  O O    . GLY A 1 99 ? -16.622 0.844   18.978  1.00 0.00 ? 99 GLY A O    2  
ATOM 3197  O OXT  . GLY A 1 99 ? -17.494 -1.139  19.184  1.00 0.00 ? 99 GLY A OXT  2  
ATOM 3198  H H    . GLY A 1 99 ? -15.097 1.380   20.724  1.00 0.00 ? 99 GLY A H    2  
ATOM 3199  H HA2  . GLY A 1 99 ? -16.225 -1.208  21.420  1.00 0.00 ? 99 GLY A HA2  2  
ATOM 3200  H HA3  . GLY A 1 99 ? -17.279 0.169   21.742  1.00 0.00 ? 99 GLY A HA3  2  
ATOM 3201  N N    . MET A 1 1  ? 24.556  13.789  8.666   1.00 0.00 ? 1  MET A N    3  
ATOM 3202  C CA   . MET A 1 1  ? 24.046  15.166  8.515   1.00 0.00 ? 1  MET A CA   3  
ATOM 3203  C C    . MET A 1 1  ? 24.875  15.949  7.471   1.00 0.00 ? 1  MET A C    3  
ATOM 3204  O O    . MET A 1 1  ? 26.098  16.037  7.578   1.00 0.00 ? 1  MET A O    3  
ATOM 3205  C CB   . MET A 1 1  ? 24.001  15.892  9.894   1.00 0.00 ? 1  MET A CB   3  
ATOM 3206  C CG   . MET A 1 1  ? 25.338  16.016  10.643  1.00 0.00 ? 1  MET A CG   3  
ATOM 3207  S SD   . MET A 1 1  ? 25.166  16.893  12.215  1.00 0.00 ? 1  MET A SD   3  
ATOM 3208  C CE   . MET A 1 1  ? 26.852  16.929  12.810  1.00 0.00 ? 1  MET A CE   3  
ATOM 3209  H H1   . MET A 1 1  ? 24.428  13.259  7.775   1.00 0.00 ? 1  MET A H1   3  
ATOM 3210  H H2   . MET A 1 1  ? 24.044  13.303  9.423   1.00 0.00 ? 1  MET A H2   3  
ATOM 3211  H H3   . MET A 1 1  ? 25.570  13.807  8.899   1.00 0.00 ? 1  MET A H3   3  
ATOM 3212  H HA   . MET A 1 1  ? 23.022  15.078  8.146   1.00 0.00 ? 1  MET A HA   3  
ATOM 3213  H HB2  . MET A 1 1  ? 23.611  16.889  9.746   1.00 0.00 ? 1  MET A HB2  3  
ATOM 3214  H HB3  . MET A 1 1  ? 23.309  15.358  10.538  1.00 0.00 ? 1  MET A HB3  3  
ATOM 3215  H HG2  . MET A 1 1  ? 25.721  15.025  10.848  1.00 0.00 ? 1  MET A HG2  3  
ATOM 3216  H HG3  . MET A 1 1  ? 26.043  16.556  10.025  1.00 0.00 ? 1  MET A HG3  3  
ATOM 3217  H HE1  . MET A 1 1  ? 27.215  15.915  12.919  1.00 0.00 ? 1  MET A HE1  3  
ATOM 3218  H HE2  . MET A 1 1  ? 26.890  17.433  13.768  1.00 0.00 ? 1  MET A HE2  3  
ATOM 3219  H HE3  . MET A 1 1  ? 27.470  17.459  12.107  1.00 0.00 ? 1  MET A HE3  3  
ATOM 3220  N N    . GLY A 1 2  ? 24.186  16.482  6.446   1.00 0.00 ? 2  GLY A N    3  
ATOM 3221  C CA   . GLY A 1 2  ? 24.804  17.282  5.378   1.00 0.00 ? 2  GLY A CA   3  
ATOM 3222  C C    . GLY A 1 2  ? 24.175  18.666  5.250   1.00 0.00 ? 2  GLY A C    3  
ATOM 3223  O O    . GLY A 1 2  ? 24.771  19.572  4.668   1.00 0.00 ? 2  GLY A O    3  
ATOM 3224  H H    . GLY A 1 2  ? 23.223  16.315  6.401   1.00 0.00 ? 2  GLY A H    3  
ATOM 3225  H HA2  . GLY A 1 2  ? 25.862  17.396  5.568   1.00 0.00 ? 2  GLY A HA2  3  
ATOM 3226  H HA3  . GLY A 1 2  ? 24.671  16.760  4.440   1.00 0.00 ? 2  GLY A HA3  3  
ATOM 3227  N N    . HIS A 1 3  ? 22.966  18.825  5.814   1.00 0.00 ? 3  HIS A N    3  
ATOM 3228  C CA   . HIS A 1 3  ? 22.221  20.096  5.809   1.00 0.00 ? 3  HIS A CA   3  
ATOM 3229  C C    . HIS A 1 3  ? 22.632  20.961  7.019   1.00 0.00 ? 3  HIS A C    3  
ATOM 3230  O O    . HIS A 1 3  ? 21.929  21.022  8.041   1.00 0.00 ? 3  HIS A O    3  
ATOM 3231  C CB   . HIS A 1 3  ? 20.695  19.827  5.799   1.00 0.00 ? 3  HIS A CB   3  
ATOM 3232  C CG   . HIS A 1 3  ? 20.170  19.188  4.528   1.00 0.00 ? 3  HIS A CG   3  
ATOM 3233  N ND1  . HIS A 1 3  ? 19.678  19.915  3.462   1.00 0.00 ? 3  HIS A ND1  3  
ATOM 3234  C CD2  . HIS A 1 3  ? 20.063  17.886  4.159   1.00 0.00 ? 3  HIS A CD2  3  
ATOM 3235  C CE1  . HIS A 1 3  ? 19.287  19.091  2.503   1.00 0.00 ? 3  HIS A CE1  3  
ATOM 3236  N NE2  . HIS A 1 3  ? 19.505  17.857  2.903   1.00 0.00 ? 3  HIS A NE2  3  
ATOM 3237  H H    . HIS A 1 3  ? 22.561  18.056  6.254   1.00 0.00 ? 3  HIS A H    3  
ATOM 3238  H HA   . HIS A 1 3  ? 22.482  20.637  4.902   1.00 0.00 ? 3  HIS A HA   3  
ATOM 3239  H HB2  . HIS A 1 3  ? 20.449  19.166  6.626   1.00 0.00 ? 3  HIS A HB2  3  
ATOM 3240  H HB3  . HIS A 1 3  ? 20.170  20.763  5.945   1.00 0.00 ? 3  HIS A HB3  3  
ATOM 3241  H HD1  . HIS A 1 3  ? 19.622  20.897  3.412   1.00 0.00 ? 3  HIS A HD1  3  
ATOM 3242  H HD2  . HIS A 1 3  ? 20.351  17.027  4.753   1.00 0.00 ? 3  HIS A HD2  3  
ATOM 3243  H HE1  . HIS A 1 3  ? 18.854  19.382  1.558   1.00 0.00 ? 3  HIS A HE1  3  
ATOM 3244  H HE2  . HIS A 1 3  ? 19.464  17.063  2.316   1.00 0.00 ? 3  HIS A HE2  3  
ATOM 3245  N N    . HIS A 1 4  ? 23.812  21.589  6.906   1.00 0.00 ? 4  HIS A N    3  
ATOM 3246  C CA   . HIS A 1 4  ? 24.418  22.391  7.994   1.00 0.00 ? 4  HIS A CA   3  
ATOM 3247  C C    . HIS A 1 4  ? 24.088  23.880  7.840   1.00 0.00 ? 4  HIS A C    3  
ATOM 3248  O O    . HIS A 1 4  ? 23.905  24.583  8.833   1.00 0.00 ? 4  HIS A O    3  
ATOM 3249  C CB   . HIS A 1 4  ? 25.953  22.200  8.021   1.00 0.00 ? 4  HIS A CB   3  
ATOM 3250  C CG   . HIS A 1 4  ? 26.398  20.808  8.354   1.00 0.00 ? 4  HIS A CG   3  
ATOM 3251  N ND1  . HIS A 1 4  ? 26.701  20.392  9.633   1.00 0.00 ? 4  HIS A ND1  3  
ATOM 3252  C CD2  . HIS A 1 4  ? 26.583  19.729  7.567   1.00 0.00 ? 4  HIS A CD2  3  
ATOM 3253  C CE1  . HIS A 1 4  ? 27.064  19.130  9.607   1.00 0.00 ? 4  HIS A CE1  3  
ATOM 3254  N NE2  . HIS A 1 4  ? 26.999  18.701  8.365   1.00 0.00 ? 4  HIS A NE2  3  
ATOM 3255  H H    . HIS A 1 4  ? 24.295  21.517  6.051   1.00 0.00 ? 4  HIS A H    3  
ATOM 3256  H HA   . HIS A 1 4  ? 24.010  22.044  8.938   1.00 0.00 ? 4  HIS A HA   3  
ATOM 3257  H HB2  . HIS A 1 4  ? 26.362  22.447  7.046   1.00 0.00 ? 4  HIS A HB2  3  
ATOM 3258  H HB3  . HIS A 1 4  ? 26.387  22.869  8.758   1.00 0.00 ? 4  HIS A HB3  3  
ATOM 3259  H HD1  . HIS A 1 4  ? 26.683  20.956  10.436  1.00 0.00 ? 4  HIS A HD1  3  
ATOM 3260  H HD2  . HIS A 1 4  ? 26.451  19.695  6.492   1.00 0.00 ? 4  HIS A HD2  3  
ATOM 3261  H HE1  . HIS A 1 4  ? 27.369  18.542  10.461  1.00 0.00 ? 4  HIS A HE1  3  
ATOM 3262  H HE2  . HIS A 1 4  ? 27.385  17.858  8.043   1.00 0.00 ? 4  HIS A HE2  3  
ATOM 3263  N N    . HIS A 1 5  ? 24.052  24.357  6.588   1.00 0.00 ? 5  HIS A N    3  
ATOM 3264  C CA   . HIS A 1 5  ? 23.752  25.768  6.276   1.00 0.00 ? 5  HIS A CA   3  
ATOM 3265  C C    . HIS A 1 5  ? 22.259  26.062  6.490   1.00 0.00 ? 5  HIS A C    3  
ATOM 3266  O O    . HIS A 1 5  ? 21.883  27.101  7.039   1.00 0.00 ? 5  HIS A O    3  
ATOM 3267  C CB   . HIS A 1 5  ? 24.146  26.085  4.813   1.00 0.00 ? 5  HIS A CB   3  
ATOM 3268  C CG   . HIS A 1 5  ? 25.611  25.902  4.498   1.00 0.00 ? 5  HIS A CG   3  
ATOM 3269  N ND1  . HIS A 1 5  ? 26.074  25.477  3.272   1.00 0.00 ? 5  HIS A ND1  3  
ATOM 3270  C CD2  . HIS A 1 5  ? 26.715  26.126  5.250   1.00 0.00 ? 5  HIS A CD2  3  
ATOM 3271  C CE1  . HIS A 1 5  ? 27.390  25.437  3.287   1.00 0.00 ? 5  HIS A CE1  3  
ATOM 3272  N NE2  . HIS A 1 5  ? 27.806  25.832  4.471   1.00 0.00 ? 5  HIS A NE2  3  
ATOM 3273  H H    . HIS A 1 5  ? 24.230  23.738  5.848   1.00 0.00 ? 5  HIS A H    3  
ATOM 3274  H HA   . HIS A 1 5  ? 24.335  26.394  6.946   1.00 0.00 ? 5  HIS A HA   3  
ATOM 3275  H HB2  . HIS A 1 5  ? 23.586  25.436  4.149   1.00 0.00 ? 5  HIS A HB2  3  
ATOM 3276  H HB3  . HIS A 1 5  ? 23.889  27.113  4.592   1.00 0.00 ? 5  HIS A HB3  3  
ATOM 3277  H HD1  . HIS A 1 5  ? 25.518  25.238  2.502   1.00 0.00 ? 5  HIS A HD1  3  
ATOM 3278  H HD2  . HIS A 1 5  ? 26.734  26.484  6.271   1.00 0.00 ? 5  HIS A HD2  3  
ATOM 3279  H HE1  . HIS A 1 5  ? 28.022  25.142  2.461   1.00 0.00 ? 5  HIS A HE1  3  
ATOM 3280  H HE2  . HIS A 1 5  ? 28.710  25.666  4.820   1.00 0.00 ? 5  HIS A HE2  3  
ATOM 3281  N N    . HIS A 1 6  ? 21.429  25.126  6.027   1.00 0.00 ? 6  HIS A N    3  
ATOM 3282  C CA   . HIS A 1 6  ? 19.972  25.153  6.187   1.00 0.00 ? 6  HIS A CA   3  
ATOM 3283  C C    . HIS A 1 6  ? 19.548  23.801  6.764   1.00 0.00 ? 6  HIS A C    3  
ATOM 3284  O O    . HIS A 1 6  ? 19.623  22.790  6.072   1.00 0.00 ? 6  HIS A O    3  
ATOM 3285  C CB   . HIS A 1 6  ? 19.264  25.395  4.818   1.00 0.00 ? 6  HIS A CB   3  
ATOM 3286  C CG   . HIS A 1 6  ? 19.544  26.730  4.150   1.00 0.00 ? 6  HIS A CG   3  
ATOM 3287  N ND1  . HIS A 1 6  ? 19.594  26.889  2.778   1.00 0.00 ? 6  HIS A ND1  3  
ATOM 3288  C CD2  . HIS A 1 6  ? 19.727  27.973  4.663   1.00 0.00 ? 6  HIS A CD2  3  
ATOM 3289  C CE1  . HIS A 1 6  ? 19.787  28.158  2.482   1.00 0.00 ? 6  HIS A CE1  3  
ATOM 3290  N NE2  . HIS A 1 6  ? 19.873  28.837  3.605   1.00 0.00 ? 6  HIS A NE2  3  
ATOM 3291  H H    . HIS A 1 6  ? 21.819  24.365  5.556   1.00 0.00 ? 6  HIS A H    3  
ATOM 3292  H HA   . HIS A 1 6  ? 19.703  25.948  6.883   1.00 0.00 ? 6  HIS A HA   3  
ATOM 3293  H HB2  . HIS A 1 6  ? 19.571  24.621  4.128   1.00 0.00 ? 6  HIS A HB2  3  
ATOM 3294  H HB3  . HIS A 1 6  ? 18.189  25.322  4.958   1.00 0.00 ? 6  HIS A HB3  3  
ATOM 3295  H HD1  . HIS A 1 6  ? 19.520  26.169  2.116   1.00 0.00 ? 6  HIS A HD1  3  
ATOM 3296  H HD2  . HIS A 1 6  ? 19.739  28.234  5.715   1.00 0.00 ? 6  HIS A HD2  3  
ATOM 3297  H HE1  . HIS A 1 6  ? 19.857  28.575  1.483   1.00 0.00 ? 6  HIS A HE1  3  
ATOM 3298  H HE2  . HIS A 1 6  ? 20.159  29.771  3.673   1.00 0.00 ? 6  HIS A HE2  3  
ATOM 3299  N N    . HIS A 1 7  ? 19.122  23.772  8.034   1.00 0.00 ? 7  HIS A N    3  
ATOM 3300  C CA   . HIS A 1 7  ? 18.734  22.525  8.717   1.00 0.00 ? 7  HIS A CA   3  
ATOM 3301  C C    . HIS A 1 7  ? 17.227  22.224  8.498   1.00 0.00 ? 7  HIS A C    3  
ATOM 3302  O O    . HIS A 1 7  ? 16.419  22.320  9.423   1.00 0.00 ? 7  HIS A O    3  
ATOM 3303  C CB   . HIS A 1 7  ? 19.071  22.601  10.232  1.00 0.00 ? 7  HIS A CB   3  
ATOM 3304  C CG   . HIS A 1 7  ? 20.522  22.859  10.568  1.00 0.00 ? 7  HIS A CG   3  
ATOM 3305  N ND1  . HIS A 1 7  ? 21.417  21.861  10.881  1.00 0.00 ? 7  HIS A ND1  3  
ATOM 3306  C CD2  . HIS A 1 7  ? 21.217  24.014  10.672  1.00 0.00 ? 7  HIS A CD2  3  
ATOM 3307  C CE1  . HIS A 1 7  ? 22.586  22.385  11.167  1.00 0.00 ? 7  HIS A CE1  3  
ATOM 3308  N NE2  . HIS A 1 7  ? 22.495  23.689  11.049  1.00 0.00 ? 7  HIS A NE2  3  
ATOM 3309  H H    . HIS A 1 7  ? 19.057  24.616  8.530   1.00 0.00 ? 7  HIS A H    3  
ATOM 3310  H HA   . HIS A 1 7  ? 19.301  21.707  8.283   1.00 0.00 ? 7  HIS A HA   3  
ATOM 3311  H HB2  . HIS A 1 7  ? 18.489  23.396  10.683  1.00 0.00 ? 7  HIS A HB2  3  
ATOM 3312  H HB3  . HIS A 1 7  ? 18.783  21.663  10.699  1.00 0.00 ? 7  HIS A HB3  3  
ATOM 3313  H HD1  . HIS A 1 7  ? 21.223  20.911  10.892  1.00 0.00 ? 7  HIS A HD1  3  
ATOM 3314  H HD2  . HIS A 1 7  ? 20.832  25.014  10.504  1.00 0.00 ? 7  HIS A HD2  3  
ATOM 3315  H HE1  . HIS A 1 7  ? 23.473  21.836  11.451  1.00 0.00 ? 7  HIS A HE1  3  
ATOM 3316  H HE2  . HIS A 1 7  ? 23.265  24.292  10.990  1.00 0.00 ? 7  HIS A HE2  3  
ATOM 3317  N N    . HIS A 1 8  ? 16.848  21.893  7.249   1.00 0.00 ? 8  HIS A N    3  
ATOM 3318  C CA   . HIS A 1 8  ? 15.476  21.410  6.913   1.00 0.00 ? 8  HIS A CA   3  
ATOM 3319  C C    . HIS A 1 8  ? 15.495  19.877  6.720   1.00 0.00 ? 8  HIS A C    3  
ATOM 3320  O O    . HIS A 1 8  ? 14.606  19.290  6.093   1.00 0.00 ? 8  HIS A O    3  
ATOM 3321  C CB   . HIS A 1 8  ? 14.938  22.132  5.646   1.00 0.00 ? 8  HIS A CB   3  
ATOM 3322  C CG   . HIS A 1 8  ? 14.664  23.610  5.839   1.00 0.00 ? 8  HIS A CG   3  
ATOM 3323  N ND1  . HIS A 1 8  ? 13.442  24.196  5.577   1.00 0.00 ? 8  HIS A ND1  3  
ATOM 3324  C CD2  . HIS A 1 8  ? 15.460  24.616  6.276   1.00 0.00 ? 8  HIS A CD2  3  
ATOM 3325  C CE1  . HIS A 1 8  ? 13.502  25.480  5.841   1.00 0.00 ? 8  HIS A CE1  3  
ATOM 3326  N NE2  . HIS A 1 8  ? 14.711  25.764  6.265   1.00 0.00 ? 8  HIS A NE2  3  
ATOM 3327  H H    . HIS A 1 8  ? 17.504  21.981  6.521   1.00 0.00 ? 8  HIS A H    3  
ATOM 3328  H HA   . HIS A 1 8  ? 14.819  21.628  7.756   1.00 0.00 ? 8  HIS A HA   3  
ATOM 3329  H HB2  . HIS A 1 8  ? 15.663  22.035  4.848   1.00 0.00 ? 8  HIS A HB2  3  
ATOM 3330  H HB3  . HIS A 1 8  ? 14.013  21.659  5.335   1.00 0.00 ? 8  HIS A HB3  3  
ATOM 3331  H HD1  . HIS A 1 8  ? 12.649  23.737  5.241   1.00 0.00 ? 8  HIS A HD1  3  
ATOM 3332  H HD2  . HIS A 1 8  ? 16.499  24.530  6.574   1.00 0.00 ? 8  HIS A HD2  3  
ATOM 3333  H HE1  . HIS A 1 8  ? 12.684  26.183  5.752   1.00 0.00 ? 8  HIS A HE1  3  
ATOM 3334  H HE2  . HIS A 1 8  ? 14.975  26.621  6.666   1.00 0.00 ? 8  HIS A HE2  3  
ATOM 3335  N N    . SER A 1 9  ? 16.523  19.251  7.303   1.00 0.00 ? 9  SER A N    3  
ATOM 3336  C CA   . SER A 1 9  ? 16.799  17.817  7.187   1.00 0.00 ? 9  SER A CA   3  
ATOM 3337  C C    . SER A 1 9  ? 15.855  16.983  8.059   1.00 0.00 ? 9  SER A C    3  
ATOM 3338  O O    . SER A 1 9  ? 15.375  15.923  7.642   1.00 0.00 ? 9  SER A O    3  
ATOM 3339  C CB   . SER A 1 9  ? 18.258  17.586  7.589   1.00 0.00 ? 9  SER A CB   3  
ATOM 3340  O OG   . SER A 1 9  ? 18.563  18.253  8.805   1.00 0.00 ? 9  SER A OG   3  
ATOM 3341  H H    . SER A 1 9  ? 17.130  19.786  7.854   1.00 0.00 ? 9  SER A H    3  
ATOM 3342  H HA   . SER A 1 9  ? 16.672  17.532  6.151   1.00 0.00 ? 9  SER A HA   3  
ATOM 3343  H HB2  . SER A 1 9  ? 18.454  16.527  7.712   1.00 0.00 ? 9  SER A HB2  3  
ATOM 3344  H HB3  . SER A 1 9  ? 18.908  17.977  6.817   1.00 0.00 ? 9  SER A HB3  3  
ATOM 3345  H HG   . SER A 1 9  ? 19.480  18.090  9.047   1.00 0.00 ? 9  SER A HG   3  
ATOM 3346  N N    . HIS A 1 10 ? 15.606  17.465  9.283   1.00 0.00 ? 10 HIS A N    3  
ATOM 3347  C CA   . HIS A 1 10 ? 14.724  16.775  10.233  1.00 0.00 ? 10 HIS A CA   3  
ATOM 3348  C C    . HIS A 1 10 ? 13.262  17.057  9.869   1.00 0.00 ? 10 HIS A C    3  
ATOM 3349  O O    . HIS A 1 10 ? 12.516  16.127  9.536   1.00 0.00 ? 10 HIS A O    3  
ATOM 3350  C CB   . HIS A 1 10 ? 15.052  17.182  11.698  1.00 0.00 ? 10 HIS A CB   3  
ATOM 3351  C CG   . HIS A 1 10 ? 16.415  16.706  12.184  1.00 0.00 ? 10 HIS A CG   3  
ATOM 3352  N ND1  . HIS A 1 10 ? 16.635  16.145  13.425  1.00 0.00 ? 10 HIS A ND1  3  
ATOM 3353  C CD2  . HIS A 1 10 ? 17.622  16.708  11.572  1.00 0.00 ? 10 HIS A CD2  3  
ATOM 3354  C CE1  . HIS A 1 10 ? 17.914  15.841  13.550  1.00 0.00 ? 10 HIS A CE1  3  
ATOM 3355  N NE2  . HIS A 1 10 ? 18.531  16.167  12.439  1.00 0.00 ? 10 HIS A NE2  3  
ATOM 3356  H H    . HIS A 1 10 ? 16.023  18.313  9.552   1.00 0.00 ? 10 HIS A H    3  
ATOM 3357  H HA   . HIS A 1 10 ? 14.902  15.702  10.127  1.00 0.00 ? 10 HIS A HA   3  
ATOM 3358  H HB2  . HIS A 1 10 ? 15.040  18.266  11.782  1.00 0.00 ? 10 HIS A HB2  3  
ATOM 3359  H HB3  . HIS A 1 10 ? 14.299  16.773  12.359  1.00 0.00 ? 10 HIS A HB3  3  
ATOM 3360  H HD1  . HIS A 1 10 ? 15.957  16.009  14.123  1.00 0.00 ? 10 HIS A HD1  3  
ATOM 3361  H HD2  . HIS A 1 10 ? 17.829  17.075  10.570  1.00 0.00 ? 10 HIS A HD2  3  
ATOM 3362  H HE1  . HIS A 1 10 ? 18.377  15.387  14.414  1.00 0.00 ? 10 HIS A HE1  3  
ATOM 3363  H HE2  . HIS A 1 10 ? 19.506  16.165  12.316  1.00 0.00 ? 10 HIS A HE2  3  
ATOM 3364  N N    . MET A 1 11 ? 12.860  18.345  9.966   1.00 0.00 ? 11 MET A N    3  
ATOM 3365  C CA   . MET A 1 11 ? 11.533  18.856  9.533   1.00 0.00 ? 11 MET A CA   3  
ATOM 3366  C C    . MET A 1 11 ? 10.358  18.375  10.439  1.00 0.00 ? 11 MET A C    3  
ATOM 3367  O O    . MET A 1 11 ? 9.315   19.032  10.487  1.00 0.00 ? 11 MET A O    3  
ATOM 3368  C CB   . MET A 1 11 ? 11.281  18.527  8.018   1.00 0.00 ? 11 MET A CB   3  
ATOM 3369  C CG   . MET A 1 11 ? 9.920   18.962  7.447   1.00 0.00 ? 11 MET A CG   3  
ATOM 3370  S SD   . MET A 1 11 ? 9.611   20.732  7.642   1.00 0.00 ? 11 MET A SD   3  
ATOM 3371  C CE   . MET A 1 11 ? 8.002   20.917  6.881   1.00 0.00 ? 11 MET A CE   3  
ATOM 3372  H H    . MET A 1 11 ? 13.477  18.982  10.355  1.00 0.00 ? 11 MET A H    3  
ATOM 3373  H HA   . MET A 1 11 ? 11.592  19.936  9.635   1.00 0.00 ? 11 MET A HA   3  
ATOM 3374  H HB2  . MET A 1 11 ? 12.056  19.006  7.428   1.00 0.00 ? 11 MET A HB2  3  
ATOM 3375  H HB3  . MET A 1 11 ? 11.375  17.452  7.878   1.00 0.00 ? 11 MET A HB3  3  
ATOM 3376  H HG2  . MET A 1 11 ? 9.889   18.726  6.389   1.00 0.00 ? 11 MET A HG2  3  
ATOM 3377  H HG3  . MET A 1 11 ? 9.140   18.419  7.959   1.00 0.00 ? 11 MET A HG3  3  
ATOM 3378  H HE1  . MET A 1 11 ? 8.064   20.639  5.839   1.00 0.00 ? 11 MET A HE1  3  
ATOM 3379  H HE2  . MET A 1 11 ? 7.677   21.947  6.965   1.00 0.00 ? 11 MET A HE2  3  
ATOM 3380  H HE3  . MET A 1 11 ? 7.289   20.280  7.380   1.00 0.00 ? 11 MET A HE3  3  
ATOM 3381  N N    . LYS A 1 12 ? 10.574  17.274  11.207  1.00 0.00 ? 12 LYS A N    3  
ATOM 3382  C CA   . LYS A 1 12 ? 9.519   16.509  11.896  1.00 0.00 ? 12 LYS A CA   3  
ATOM 3383  C C    . LYS A 1 12 ? 8.414   16.133  10.891  1.00 0.00 ? 12 LYS A C    3  
ATOM 3384  O O    . LYS A 1 12 ? 7.321   16.710  10.889  1.00 0.00 ? 12 LYS A O    3  
ATOM 3385  C CB   . LYS A 1 12 ? 8.953   17.252  13.142  1.00 0.00 ? 12 LYS A CB   3  
ATOM 3386  C CG   . LYS A 1 12 ? 9.977   17.512  14.265  1.00 0.00 ? 12 LYS A CG   3  
ATOM 3387  C CD   . LYS A 1 12 ? 10.533  16.214  14.886  1.00 0.00 ? 12 LYS A CD   3  
ATOM 3388  C CE   . LYS A 1 12 ? 11.390  16.484  16.131  1.00 0.00 ? 12 LYS A CE   3  
ATOM 3389  N NZ   . LYS A 1 12 ? 10.632  17.173  17.221  1.00 0.00 ? 12 LYS A NZ   3  
ATOM 3390  H H    . LYS A 1 12 ? 11.488  16.971  11.320  1.00 0.00 ? 12 LYS A H    3  
ATOM 3391  H HA   . LYS A 1 12 ? 9.982   15.588  12.231  1.00 0.00 ? 12 LYS A HA   3  
ATOM 3392  H HB2  . LYS A 1 12 ? 8.555   18.208  12.827  1.00 0.00 ? 12 LYS A HB2  3  
ATOM 3393  H HB3  . LYS A 1 12 ? 8.140   16.667  13.560  1.00 0.00 ? 12 LYS A HB3  3  
ATOM 3394  H HG2  . LYS A 1 12 ? 10.804  18.077  13.854  1.00 0.00 ? 12 LYS A HG2  3  
ATOM 3395  H HG3  . LYS A 1 12 ? 9.499   18.097  15.043  1.00 0.00 ? 12 LYS A HG3  3  
ATOM 3396  H HD2  . LYS A 1 12 ? 9.705   15.565  15.164  1.00 0.00 ? 12 LYS A HD2  3  
ATOM 3397  H HD3  . LYS A 1 12 ? 11.143  15.706  14.145  1.00 0.00 ? 12 LYS A HD3  3  
ATOM 3398  H HE2  . LYS A 1 12 ? 11.760  15.543  16.513  1.00 0.00 ? 12 LYS A HE2  3  
ATOM 3399  H HE3  . LYS A 1 12 ? 12.232  17.105  15.851  1.00 0.00 ? 12 LYS A HE3  3  
ATOM 3400  H HZ1  . LYS A 1 12 ? 11.249  17.306  18.053  1.00 0.00 ? 12 LYS A HZ1  3  
ATOM 3401  H HZ2  . LYS A 1 12 ? 9.807   16.603  17.503  1.00 0.00 ? 12 LYS A HZ2  3  
ATOM 3402  H HZ3  . LYS A 1 12 ? 10.304  18.105  16.901  1.00 0.00 ? 12 LYS A HZ3  3  
ATOM 3403  N N    . ARG A 1 13 ? 8.734   15.157  10.036  1.00 0.00 ? 13 ARG A N    3  
ATOM 3404  C CA   . ARG A 1 13 ? 7.912   14.771  8.865   1.00 0.00 ? 13 ARG A CA   3  
ATOM 3405  C C    . ARG A 1 13 ? 6.810   13.757  9.259   1.00 0.00 ? 13 ARG A C    3  
ATOM 3406  O O    . ARG A 1 13 ? 6.411   12.928  8.429   1.00 0.00 ? 13 ARG A O    3  
ATOM 3407  C CB   . ARG A 1 13 ? 8.857   14.151  7.793   1.00 0.00 ? 13 ARG A CB   3  
ATOM 3408  C CG   . ARG A 1 13 ? 10.144  14.967  7.527   1.00 0.00 ? 13 ARG A CG   3  
ATOM 3409  C CD   . ARG A 1 13 ? 11.037  14.347  6.434   1.00 0.00 ? 13 ARG A CD   3  
ATOM 3410  N NE   . ARG A 1 13 ? 12.331  15.054  6.281   1.00 0.00 ? 13 ARG A NE   3  
ATOM 3411  C CZ   . ARG A 1 13 ? 12.928  15.344  5.103   1.00 0.00 ? 13 ARG A CZ   3  
ATOM 3412  N NH1  . ARG A 1 13 ? 12.352  15.007  3.945   1.00 0.00 ? 13 ARG A NH1  3  
ATOM 3413  N NH2  . ARG A 1 13 ? 14.111  15.946  5.100   1.00 0.00 ? 13 ARG A NH2  3  
ATOM 3414  H H    . ARG A 1 13 ? 9.560   14.661  10.201  1.00 0.00 ? 13 ARG A H    3  
ATOM 3415  H HA   . ARG A 1 13 ? 7.445   15.663  8.452   1.00 0.00 ? 13 ARG A HA   3  
ATOM 3416  H HB2  . ARG A 1 13 ? 9.149   13.157  8.119   1.00 0.00 ? 13 ARG A HB2  3  
ATOM 3417  H HB3  . ARG A 1 13 ? 8.311   14.059  6.858   1.00 0.00 ? 13 ARG A HB3  3  
ATOM 3418  H HG2  . ARG A 1 13 ? 9.868   15.971  7.226   1.00 0.00 ? 13 ARG A HG2  3  
ATOM 3419  H HG3  . ARG A 1 13 ? 10.710  15.021  8.449   1.00 0.00 ? 13 ARG A HG3  3  
ATOM 3420  H HD2  . ARG A 1 13 ? 11.246  13.316  6.701   1.00 0.00 ? 13 ARG A HD2  3  
ATOM 3421  H HD3  . ARG A 1 13 ? 10.500  14.367  5.492   1.00 0.00 ? 13 ARG A HD3  3  
ATOM 3422  H HE   . ARG A 1 13 ? 12.797  15.296  7.115   1.00 0.00 ? 13 ARG A HE   3  
ATOM 3423  H HH11 . ARG A 1 13 ? 11.463  14.538  3.937   1.00 0.00 ? 13 ARG A HH11 3  
ATOM 3424  H HH12 . ARG A 1 13 ? 12.793  15.237  3.074   1.00 0.00 ? 13 ARG A HH12 3  
ATOM 3425  H HH21 . ARG A 1 13 ? 14.554  16.184  5.965   1.00 0.00 ? 13 ARG A HH21 3  
ATOM 3426  H HH22 . ARG A 1 13 ? 14.563  16.175  4.234   1.00 0.00 ? 13 ARG A HH22 3  
ATOM 3427  N N    . SER A 1 14 ? 6.321   13.871  10.516  1.00 0.00 ? 14 SER A N    3  
ATOM 3428  C CA   . SER A 1 14 ? 5.419   12.909  11.181  1.00 0.00 ? 14 SER A CA   3  
ATOM 3429  C C    . SER A 1 14 ? 4.141   12.649  10.355  1.00 0.00 ? 14 SER A C    3  
ATOM 3430  O O    . SER A 1 14 ? 3.172   13.413  10.427  1.00 0.00 ? 14 SER A O    3  
ATOM 3431  C CB   . SER A 1 14 ? 5.082   13.434  12.607  1.00 0.00 ? 14 SER A CB   3  
ATOM 3432  O OG   . SER A 1 14 ? 4.232   12.557  13.348  1.00 0.00 ? 14 SER A OG   3  
ATOM 3433  H H    . SER A 1 14 ? 6.584   14.656  11.027  1.00 0.00 ? 14 SER A H    3  
ATOM 3434  H HA   . SER A 1 14 ? 5.965   11.977  11.282  1.00 0.00 ? 14 SER A HA   3  
ATOM 3435  H HB2  . SER A 1 14 ? 5.999   13.565  13.168  1.00 0.00 ? 14 SER A HB2  3  
ATOM 3436  H HB3  . SER A 1 14 ? 4.587   14.393  12.522  1.00 0.00 ? 14 SER A HB3  3  
ATOM 3437  H HG   . SER A 1 14 ? 4.519   11.647  13.225  1.00 0.00 ? 14 SER A HG   3  
ATOM 3438  N N    . GLY A 1 15 ? 4.200   11.580  9.527   1.00 0.00 ? 15 GLY A N    3  
ATOM 3439  C CA   . GLY A 1 15 ? 3.109   11.212  8.635   1.00 0.00 ? 15 GLY A CA   3  
ATOM 3440  C C    . GLY A 1 15 ? 2.897   12.234  7.530   1.00 0.00 ? 15 GLY A C    3  
ATOM 3441  O O    . GLY A 1 15 ? 1.987   13.072  7.622   1.00 0.00 ? 15 GLY A O    3  
ATOM 3442  H H    . GLY A 1 15 ? 5.022   11.037  9.522   1.00 0.00 ? 15 GLY A H    3  
ATOM 3443  H HA2  . GLY A 1 15 ? 3.340   10.252  8.186   1.00 0.00 ? 15 GLY A HA2  3  
ATOM 3444  H HA3  . GLY A 1 15 ? 2.195   11.107  9.211   1.00 0.00 ? 15 GLY A HA3  3  
ATOM 3445  N N    . ARG A 1 16 ? 3.731   12.167  6.478   1.00 0.00 ? 16 ARG A N    3  
ATOM 3446  C CA   . ARG A 1 16 ? 3.622   13.088  5.330   1.00 0.00 ? 16 ARG A CA   3  
ATOM 3447  C C    . ARG A 1 16 ? 2.566   12.525  4.367   1.00 0.00 ? 16 ARG A C    3  
ATOM 3448  O O    . ARG A 1 16 ? 2.640   11.353  3.988   1.00 0.00 ? 16 ARG A O    3  
ATOM 3449  C CB   . ARG A 1 16 ? 4.985   13.271  4.599   1.00 0.00 ? 16 ARG A CB   3  
ATOM 3450  C CG   . ARG A 1 16 ? 4.920   14.253  3.400   1.00 0.00 ? 16 ARG A CG   3  
ATOM 3451  C CD   . ARG A 1 16 ? 6.243   14.364  2.620   1.00 0.00 ? 16 ARG A CD   3  
ATOM 3452  N NE   . ARG A 1 16 ? 6.646   13.084  1.999   1.00 0.00 ? 16 ARG A NE   3  
ATOM 3453  C CZ   . ARG A 1 16 ? 6.275   12.660  0.777   1.00 0.00 ? 16 ARG A CZ   3  
ATOM 3454  N NH1  . ARG A 1 16 ? 5.470   13.387  0.005   1.00 0.00 ? 16 ARG A NH1  3  
ATOM 3455  N NH2  . ARG A 1 16 ? 6.746   11.518  0.320   1.00 0.00 ? 16 ARG A NH2  3  
ATOM 3456  H H    . ARG A 1 16 ? 4.371   11.424  6.432   1.00 0.00 ? 16 ARG A H    3  
ATOM 3457  H HA   . ARG A 1 16 ? 3.284   14.057  5.702   1.00 0.00 ? 16 ARG A HA   3  
ATOM 3458  H HB2  . ARG A 1 16 ? 5.717   13.644  5.311   1.00 0.00 ? 16 ARG A HB2  3  
ATOM 3459  H HB3  . ARG A 1 16 ? 5.322   12.308  4.233   1.00 0.00 ? 16 ARG A HB3  3  
ATOM 3460  H HG2  . ARG A 1 16 ? 4.150   13.915  2.715   1.00 0.00 ? 16 ARG A HG2  3  
ATOM 3461  H HG3  . ARG A 1 16 ? 4.648   15.237  3.770   1.00 0.00 ? 16 ARG A HG3  3  
ATOM 3462  H HD2  . ARG A 1 16 ? 6.132   15.115  1.844   1.00 0.00 ? 16 ARG A HD2  3  
ATOM 3463  H HD3  . ARG A 1 16 ? 7.027   14.679  3.298   1.00 0.00 ? 16 ARG A HD3  3  
ATOM 3464  H HE   . ARG A 1 16 ? 7.234   12.503  2.533   1.00 0.00 ? 16 ARG A HE   3  
ATOM 3465  H HH11 . ARG A 1 16 ? 5.124   14.271  0.324   1.00 0.00 ? 16 ARG A HH11 3  
ATOM 3466  H HH12 . ARG A 1 16 ? 5.204   13.051  -0.906  1.00 0.00 ? 16 ARG A HH12 3  
ATOM 3467  H HH21 . ARG A 1 16 ? 7.372   10.972  0.876   1.00 0.00 ? 16 ARG A HH21 3  
ATOM 3468  H HH22 . ARG A 1 16 ? 6.476   11.187  -0.588  1.00 0.00 ? 16 ARG A HH22 3  
ATOM 3469  N N    . GLU A 1 17 ? 1.574   13.346  3.996   1.00 0.00 ? 17 GLU A N    3  
ATOM 3470  C CA   . GLU A 1 17 ? 0.476   12.904  3.133   1.00 0.00 ? 17 GLU A CA   3  
ATOM 3471  C C    . GLU A 1 17 ? 0.973   12.745  1.685   1.00 0.00 ? 17 GLU A C    3  
ATOM 3472  O O    . GLU A 1 17 ? 1.298   13.727  1.022   1.00 0.00 ? 17 GLU A O    3  
ATOM 3473  C CB   . GLU A 1 17 ? -0.695  13.921  3.213   1.00 0.00 ? 17 GLU A CB   3  
ATOM 3474  C CG   . GLU A 1 17 ? -1.930  13.577  2.364   1.00 0.00 ? 17 GLU A CG   3  
ATOM 3475  C CD   . GLU A 1 17 ? -3.051  14.622  2.503   1.00 0.00 ? 17 GLU A CD   3  
ATOM 3476  O OE1  . GLU A 1 17 ? -3.862  14.526  3.448   1.00 0.00 ? 17 GLU A OE1  3  
ATOM 3477  O OE2  . GLU A 1 17 ? -3.126  15.553  1.672   1.00 0.00 ? 17 GLU A OE2  3  
ATOM 3478  H H    . GLU A 1 17 ? 1.589   14.279  4.298   1.00 0.00 ? 17 GLU A H    3  
ATOM 3479  H HA   . GLU A 1 17 ? 0.127   11.935  3.505   1.00 0.00 ? 17 GLU A HA   3  
ATOM 3480  H HB2  . GLU A 1 17 ? -1.007  14.001  4.248   1.00 0.00 ? 17 GLU A HB2  3  
ATOM 3481  H HB3  . GLU A 1 17 ? -0.327  14.893  2.894   1.00 0.00 ? 17 GLU A HB3  3  
ATOM 3482  H HG2  . GLU A 1 17 ? -1.626  13.517  1.323   1.00 0.00 ? 17 GLU A HG2  3  
ATOM 3483  H HG3  . GLU A 1 17 ? -2.311  12.604  2.668   1.00 0.00 ? 17 GLU A HG3  3  
ATOM 3484  N N    . ILE A 1 18 ? 1.069   11.493  1.235   1.00 0.00 ? 18 ILE A N    3  
ATOM 3485  C CA   . ILE A 1 18 ? 1.234   11.148  -0.179  1.00 0.00 ? 18 ILE A CA   3  
ATOM 3486  C C    . ILE A 1 18 ? -0.142  10.798  -0.759  1.00 0.00 ? 18 ILE A C    3  
ATOM 3487  O O    . ILE A 1 18 ? -1.138  10.748  -0.028  1.00 0.00 ? 18 ILE A O    3  
ATOM 3488  C CB   . ILE A 1 18 ? 2.219   9.934   -0.388  1.00 0.00 ? 18 ILE A CB   3  
ATOM 3489  C CG1  . ILE A 1 18 ? 1.625   8.605   0.193   1.00 0.00 ? 18 ILE A CG1  3  
ATOM 3490  C CG2  . ILE A 1 18 ? 3.603   10.240  0.230   1.00 0.00 ? 18 ILE A CG2  3  
ATOM 3491  C CD1  . ILE A 1 18 ? 2.432   7.366   -0.123  1.00 0.00 ? 18 ILE A CD1  3  
ATOM 3492  H H    . ILE A 1 18 ? 1.020   10.767  1.881   1.00 0.00 ? 18 ILE A H    3  
ATOM 3493  H HA   . ILE A 1 18 ? 1.634   12.012  -0.713  1.00 0.00 ? 18 ILE A HA   3  
ATOM 3494  H HB   . ILE A 1 18 ? 2.360   9.808   -1.457  1.00 0.00 ? 18 ILE A HB   3  
ATOM 3495  H HG12 . ILE A 1 18 ? 1.552   8.683   1.272   1.00 0.00 ? 18 ILE A HG12 3  
ATOM 3496  H HG13 . ILE A 1 18 ? 0.629   8.454   -0.208  1.00 0.00 ? 18 ILE A HG13 3  
ATOM 3497  H HG21 . ILE A 1 18 ? 4.012   11.139  -0.215  1.00 0.00 ? 18 ILE A HG21 3  
ATOM 3498  H HG22 . ILE A 1 18 ? 4.279   9.416   0.045   1.00 0.00 ? 18 ILE A HG22 3  
ATOM 3499  H HG23 . ILE A 1 18 ? 3.503   10.386  1.300   1.00 0.00 ? 18 ILE A HG23 3  
ATOM 3500  H HD11 . ILE A 1 18 ? 3.411   7.444   0.330   1.00 0.00 ? 18 ILE A HD11 3  
ATOM 3501  H HD12 . ILE A 1 18 ? 2.535   7.260   -1.192  1.00 0.00 ? 18 ILE A HD12 3  
ATOM 3502  H HD13 . ILE A 1 18 ? 1.925   6.499   0.276   1.00 0.00 ? 18 ILE A HD13 3  
ATOM 3503  N N    . THR A 1 19 ? -0.193  10.586  -2.072  1.00 0.00 ? 19 THR A N    3  
ATOM 3504  C CA   . THR A 1 19 ? -1.346  9.958   -2.741  1.00 0.00 ? 19 THR A CA   3  
ATOM 3505  C C    . THR A 1 19 ? -0.946  8.555   -3.248  1.00 0.00 ? 19 THR A C    3  
ATOM 3506  O O    . THR A 1 19 ? 0.247   8.205   -3.227  1.00 0.00 ? 19 THR A O    3  
ATOM 3507  C CB   . THR A 1 19 ? -1.889  10.856  -3.903  1.00 0.00 ? 19 THR A CB   3  
ATOM 3508  O OG1  . THR A 1 19 ? -0.834  11.237  -4.789  1.00 0.00 ? 19 THR A OG1  3  
ATOM 3509  C CG2  . THR A 1 19 ? -2.581  12.120  -3.372  1.00 0.00 ? 19 THR A CG2  3  
ATOM 3510  H H    . THR A 1 19 ? 0.563   10.883  -2.613  1.00 0.00 ? 19 THR A H    3  
ATOM 3511  H HA   . THR A 1 19 ? -2.148  9.826   -2.006  1.00 0.00 ? 19 THR A HA   3  
ATOM 3512  H HB   . THR A 1 19 ? -2.617  10.284  -4.471  1.00 0.00 ? 19 THR A HB   3  
ATOM 3513  H HG1  . THR A 1 19 ? -0.020  10.791  -4.542  1.00 0.00 ? 19 THR A HG1  3  
ATOM 3514  H HG21 . THR A 1 19 ? -3.419  11.847  -2.738  1.00 0.00 ? 19 THR A HG21 3  
ATOM 3515  H HG22 . THR A 1 19 ? -2.940  12.711  -4.203  1.00 0.00 ? 19 THR A HG22 3  
ATOM 3516  H HG23 . THR A 1 19 ? -1.878  12.706  -2.796  1.00 0.00 ? 19 THR A HG23 3  
ATOM 3517  N N    . TRP A 1 20 ? -1.956  7.773   -3.691  1.00 0.00 ? 20 TRP A N    3  
ATOM 3518  C CA   . TRP A 1 20 ? -1.780  6.384   -4.178  1.00 0.00 ? 20 TRP A CA   3  
ATOM 3519  C C    . TRP A 1 20 ? -0.707  6.299   -5.286  1.00 0.00 ? 20 TRP A C    3  
ATOM 3520  O O    . TRP A 1 20 ? 0.067   5.346   -5.309  1.00 0.00 ? 20 TRP A O    3  
ATOM 3521  C CB   . TRP A 1 20 ? -3.142  5.806   -4.657  1.00 0.00 ? 20 TRP A CB   3  
ATOM 3522  C CG   . TRP A 1 20 ? -3.089  4.429   -5.296  1.00 0.00 ? 20 TRP A CG   3  
ATOM 3523  C CD1  . TRP A 1 20 ? -3.146  4.154   -6.630  1.00 0.00 ? 20 TRP A CD1  3  
ATOM 3524  C CD2  . TRP A 1 20 ? -2.992  3.152   -4.636  1.00 0.00 ? 20 TRP A CD2  3  
ATOM 3525  N NE1  . TRP A 1 20 ? -3.089  2.806   -6.841  1.00 0.00 ? 20 TRP A NE1  3  
ATOM 3526  C CE2  . TRP A 1 20 ? -2.993  2.166   -5.637  1.00 0.00 ? 20 TRP A CE2  3  
ATOM 3527  C CE3  . TRP A 1 20 ? -2.908  2.751   -3.306  1.00 0.00 ? 20 TRP A CE3  3  
ATOM 3528  C CZ2  . TRP A 1 20 ? -2.907  0.808   -5.350  1.00 0.00 ? 20 TRP A CZ2  3  
ATOM 3529  C CZ3  . TRP A 1 20 ? -2.823  1.404   -3.018  1.00 0.00 ? 20 TRP A CZ3  3  
ATOM 3530  C CH2  . TRP A 1 20 ? -2.824  0.445   -4.035  1.00 0.00 ? 20 TRP A CH2  3  
ATOM 3531  H H    . TRP A 1 20 ? -2.860  8.152   -3.670  1.00 0.00 ? 20 TRP A H    3  
ATOM 3532  H HA   . TRP A 1 20 ? -1.434  5.795   -3.331  1.00 0.00 ? 20 TRP A HA   3  
ATOM 3533  H HB2  . TRP A 1 20 ? -3.810  5.736   -3.811  1.00 0.00 ? 20 TRP A HB2  3  
ATOM 3534  H HB3  . TRP A 1 20 ? -3.580  6.488   -5.378  1.00 0.00 ? 20 TRP A HB3  3  
ATOM 3535  H HD1  . TRP A 1 20 ? -3.229  4.906   -7.401  1.00 0.00 ? 20 TRP A HD1  3  
ATOM 3536  H HE1  . TRP A 1 20 ? -3.106  2.372   -7.717  1.00 0.00 ? 20 TRP A HE1  3  
ATOM 3537  H HE3  . TRP A 1 20 ? -2.901  3.477   -2.507  1.00 0.00 ? 20 TRP A HE3  3  
ATOM 3538  H HZ2  . TRP A 1 20 ? -2.907  0.058   -6.128  1.00 0.00 ? 20 TRP A HZ2  3  
ATOM 3539  H HZ3  . TRP A 1 20 ? -2.751  1.078   -1.986  1.00 0.00 ? 20 TRP A HZ3  3  
ATOM 3540  H HH2  . TRP A 1 20 ? -2.755  -0.600  -3.762  1.00 0.00 ? 20 TRP A HH2  3  
ATOM 3541  N N    . LYS A 1 21 ? -0.650  7.310   -6.172  1.00 0.00 ? 21 LYS A N    3  
ATOM 3542  C CA   . LYS A 1 21 ? 0.385   7.387   -7.228  1.00 0.00 ? 21 LYS A CA   3  
ATOM 3543  C C    . LYS A 1 21 ? 1.821   7.388   -6.650  1.00 0.00 ? 21 LYS A C    3  
ATOM 3544  O O    . LYS A 1 21 ? 2.676   6.644   -7.136  1.00 0.00 ? 21 LYS A O    3  
ATOM 3545  C CB   . LYS A 1 21 ? 0.155   8.612   -8.150  1.00 0.00 ? 21 LYS A CB   3  
ATOM 3546  C CG   . LYS A 1 21 ? 0.270   9.989   -7.467  1.00 0.00 ? 21 LYS A CG   3  
ATOM 3547  C CD   . LYS A 1 21 ? -0.110  11.170  -8.394  1.00 0.00 ? 21 LYS A CD   3  
ATOM 3548  C CE   . LYS A 1 21 ? 0.779   11.298  -9.650  1.00 0.00 ? 21 LYS A CE   3  
ATOM 3549  N NZ   . LYS A 1 21 ? 0.303   12.387  -10.566 1.00 0.00 ? 21 LYS A NZ   3  
ATOM 3550  H H    . LYS A 1 21 ? -1.355  7.990   -6.154  1.00 0.00 ? 21 LYS A H    3  
ATOM 3551  H HA   . LYS A 1 21 ? 0.271   6.488   -7.829  1.00 0.00 ? 21 LYS A HA   3  
ATOM 3552  H HB2  . LYS A 1 21 ? 0.877   8.571   -8.957  1.00 0.00 ? 21 LYS A HB2  3  
ATOM 3553  H HB3  . LYS A 1 21 ? -0.839  8.529   -8.578  1.00 0.00 ? 21 LYS A HB3  3  
ATOM 3554  H HG2  . LYS A 1 21 ? -0.391  9.999   -6.604  1.00 0.00 ? 21 LYS A HG2  3  
ATOM 3555  H HG3  . LYS A 1 21 ? 1.290   10.122  -7.121  1.00 0.00 ? 21 LYS A HG3  3  
ATOM 3556  H HD2  . LYS A 1 21 ? -1.137  11.044  -8.715  1.00 0.00 ? 21 LYS A HD2  3  
ATOM 3557  H HD3  . LYS A 1 21 ? -0.036  12.091  -7.823  1.00 0.00 ? 21 LYS A HD3  3  
ATOM 3558  H HE2  . LYS A 1 21 ? 1.791   11.523  -9.342  1.00 0.00 ? 21 LYS A HE2  3  
ATOM 3559  H HE3  . LYS A 1 21 ? 0.769   10.359  -10.189 1.00 0.00 ? 21 LYS A HE3  3  
ATOM 3560  H HZ1  . LYS A 1 21 ? -0.693  12.228  -10.829 1.00 0.00 ? 21 LYS A HZ1  3  
ATOM 3561  H HZ2  . LYS A 1 21 ? 0.883   12.407  -11.429 1.00 0.00 ? 21 LYS A HZ2  3  
ATOM 3562  H HZ3  . LYS A 1 21 ? 0.377   13.312  -10.093 1.00 0.00 ? 21 LYS A HZ3  3  
ATOM 3563  N N    . ASP A 1 22 ? 2.072   8.201   -5.603  1.00 0.00 ? 22 ASP A N    3  
ATOM 3564  C CA   . ASP A 1 22 ? 3.395   8.295   -4.953  1.00 0.00 ? 22 ASP A CA   3  
ATOM 3565  C C    . ASP A 1 22 ? 3.756   6.986   -4.252  1.00 0.00 ? 22 ASP A C    3  
ATOM 3566  O O    . ASP A 1 22 ? 4.930   6.583   -4.209  1.00 0.00 ? 22 ASP A O    3  
ATOM 3567  C CB   . ASP A 1 22 ? 3.408   9.444   -3.928  1.00 0.00 ? 22 ASP A CB   3  
ATOM 3568  C CG   . ASP A 1 22 ? 3.035   10.811  -4.525  1.00 0.00 ? 22 ASP A CG   3  
ATOM 3569  O OD1  . ASP A 1 22 ? 3.797   11.332  -5.365  1.00 0.00 ? 22 ASP A OD1  3  
ATOM 3570  O OD2  . ASP A 1 22 ? 1.975   11.365  -4.164  1.00 0.00 ? 22 ASP A OD2  3  
ATOM 3571  H H    . ASP A 1 22 ? 1.362   8.776   -5.251  1.00 0.00 ? 22 ASP A H    3  
ATOM 3572  H HA   . ASP A 1 22 ? 4.133   8.493   -5.722  1.00 0.00 ? 22 ASP A HA   3  
ATOM 3573  H HB2  . ASP A 1 22 ? 2.707   9.203   -3.137  1.00 0.00 ? 22 ASP A HB2  3  
ATOM 3574  H HB3  . ASP A 1 22 ? 4.400   9.519   -3.498  1.00 0.00 ? 22 ASP A HB3  3  
ATOM 3575  N N    . PHE A 1 23 ? 2.724   6.337   -3.696  1.00 0.00 ? 23 PHE A N    3  
ATOM 3576  C CA   . PHE A 1 23 ? 2.857   5.012   -3.106  1.00 0.00 ? 23 PHE A CA   3  
ATOM 3577  C C    . PHE A 1 23 ? 3.345   3.996   -4.159  1.00 0.00 ? 23 PHE A C    3  
ATOM 3578  O O    . PHE A 1 23 ? 4.408   3.419   -3.993  1.00 0.00 ? 23 PHE A O    3  
ATOM 3579  C CB   . PHE A 1 23 ? 1.527   4.552   -2.446  1.00 0.00 ? 23 PHE A CB   3  
ATOM 3580  C CG   . PHE A 1 23 ? 1.552   3.091   -1.997  1.00 0.00 ? 23 PHE A CG   3  
ATOM 3581  C CD1  . PHE A 1 23 ? 2.509   2.644   -1.089  1.00 0.00 ? 23 PHE A CD1  3  
ATOM 3582  C CD2  . PHE A 1 23 ? 0.648   2.173   -2.510  1.00 0.00 ? 23 PHE A CD2  3  
ATOM 3583  C CE1  . PHE A 1 23 ? 2.562   1.322   -0.719  1.00 0.00 ? 23 PHE A CE1  3  
ATOM 3584  C CE2  . PHE A 1 23 ? 0.694   0.853   -2.133  1.00 0.00 ? 23 PHE A CE2  3  
ATOM 3585  C CZ   . PHE A 1 23 ? 1.652   0.426   -1.239  1.00 0.00 ? 23 PHE A CZ   3  
ATOM 3586  H H    . PHE A 1 23 ? 1.851   6.785   -3.671  1.00 0.00 ? 23 PHE A H    3  
ATOM 3587  H HA   . PHE A 1 23 ? 3.616   5.086   -2.328  1.00 0.00 ? 23 PHE A HA   3  
ATOM 3588  H HB2  . PHE A 1 23 ? 1.331   5.162   -1.573  1.00 0.00 ? 23 PHE A HB2  3  
ATOM 3589  H HB3  . PHE A 1 23 ? 0.713   4.686   -3.155  1.00 0.00 ? 23 PHE A HB3  3  
ATOM 3590  H HD1  . PHE A 1 23 ? 3.223   3.351   -0.674  1.00 0.00 ? 23 PHE A HD1  3  
ATOM 3591  H HD2  . PHE A 1 23 ? -0.108  2.510   -3.215  1.00 0.00 ? 23 PHE A HD2  3  
ATOM 3592  H HE1  . PHE A 1 23 ? 3.307   0.991   -0.015  1.00 0.00 ? 23 PHE A HE1  3  
ATOM 3593  H HE2  . PHE A 1 23 ? -0.022  0.152   -2.546  1.00 0.00 ? 23 PHE A HE2  3  
ATOM 3594  H HZ   . PHE A 1 23 ? 1.691   -0.613  -0.951  1.00 0.00 ? 23 PHE A HZ   3  
ATOM 3595  N N    . VAL A 1 24 ? 2.588   3.833   -5.258  1.00 0.00 ? 24 VAL A N    3  
ATOM 3596  C CA   . VAL A 1 24 ? 2.882   2.831   -6.299  1.00 0.00 ? 24 VAL A CA   3  
ATOM 3597  C C    . VAL A 1 24 ? 4.280   3.037   -6.909  1.00 0.00 ? 24 VAL A C    3  
ATOM 3598  O O    . VAL A 1 24 ? 5.118   2.140   -6.851  1.00 0.00 ? 24 VAL A O    3  
ATOM 3599  C CB   . VAL A 1 24 ? 1.798   2.856   -7.439  1.00 0.00 ? 24 VAL A CB   3  
ATOM 3600  C CG1  . VAL A 1 24 ? 2.123   1.851   -8.572  1.00 0.00 ? 24 VAL A CG1  3  
ATOM 3601  C CG2  . VAL A 1 24 ? 0.400   2.593   -6.848  1.00 0.00 ? 24 VAL A CG2  3  
ATOM 3602  H H    . VAL A 1 24 ? 1.791   4.390   -5.365  1.00 0.00 ? 24 VAL A H    3  
ATOM 3603  H HA   . VAL A 1 24 ? 2.851   1.851   -5.825  1.00 0.00 ? 24 VAL A HA   3  
ATOM 3604  H HB   . VAL A 1 24 ? 1.792   3.856   -7.874  1.00 0.00 ? 24 VAL A HB   3  
ATOM 3605  H HG11 . VAL A 1 24 ? 3.077   2.101   -9.018  1.00 0.00 ? 24 VAL A HG11 3  
ATOM 3606  H HG12 . VAL A 1 24 ? 1.356   1.897   -9.336  1.00 0.00 ? 24 VAL A HG12 3  
ATOM 3607  H HG13 . VAL A 1 24 ? 2.168   0.845   -8.172  1.00 0.00 ? 24 VAL A HG13 3  
ATOM 3608  H HG21 . VAL A 1 24 ? 0.177   3.343   -6.100  1.00 0.00 ? 24 VAL A HG21 3  
ATOM 3609  H HG22 . VAL A 1 24 ? 0.376   1.614   -6.387  1.00 0.00 ? 24 VAL A HG22 3  
ATOM 3610  H HG23 . VAL A 1 24 ? -0.343  2.642   -7.629  1.00 0.00 ? 24 VAL A HG23 3  
ATOM 3611  N N    . ASN A 1 25 ? 4.507   4.237   -7.445  1.00 0.00 ? 25 ASN A N    3  
ATOM 3612  C CA   . ASN A 1 25 ? 5.729   4.581   -8.199  1.00 0.00 ? 25 ASN A CA   3  
ATOM 3613  C C    . ASN A 1 25 ? 6.990   4.470   -7.331  1.00 0.00 ? 25 ASN A C    3  
ATOM 3614  O O    . ASN A 1 25 ? 7.924   3.738   -7.659  1.00 0.00 ? 25 ASN A O    3  
ATOM 3615  C CB   . ASN A 1 25 ? 5.614   6.029   -8.758  1.00 0.00 ? 25 ASN A CB   3  
ATOM 3616  C CG   . ASN A 1 25 ? 4.430   6.225   -9.715  1.00 0.00 ? 25 ASN A CG   3  
ATOM 3617  O OD1  . ASN A 1 25 ? 4.041   5.311   -10.433 1.00 0.00 ? 25 ASN A OD1  3  
ATOM 3618  N ND2  . ASN A 1 25 ? 3.847   7.419   -9.727  1.00 0.00 ? 25 ASN A ND2  3  
ATOM 3619  H H    . ASN A 1 25 ? 3.823   4.924   -7.333  1.00 0.00 ? 25 ASN A H    3  
ATOM 3620  H HA   . ASN A 1 25 ? 5.810   3.891   -9.033  1.00 0.00 ? 25 ASN A HA   3  
ATOM 3621  H HB2  . ASN A 1 25 ? 5.500   6.720   -7.928  1.00 0.00 ? 25 ASN A HB2  3  
ATOM 3622  H HB3  . ASN A 1 25 ? 6.524   6.280   -9.292  1.00 0.00 ? 25 ASN A HB3  3  
ATOM 3623  H HD21 . ASN A 1 25 ? 4.194   8.111   -9.127  1.00 0.00 ? 25 ASN A HD21 3  
ATOM 3624  H HD22 . ASN A 1 25 ? 3.085   7.555   -10.328 1.00 0.00 ? 25 ASN A HD22 3  
ATOM 3625  N N    . ASN A 1 26 ? 6.988   5.199   -6.210  1.00 0.00 ? 26 ASN A N    3  
ATOM 3626  C CA   . ASN A 1 26 ? 8.191   5.408   -5.392  1.00 0.00 ? 26 ASN A CA   3  
ATOM 3627  C C    . ASN A 1 26 ? 8.438   4.264   -4.401  1.00 0.00 ? 26 ASN A C    3  
ATOM 3628  O O    . ASN A 1 26 ? 9.589   3.917   -4.120  1.00 0.00 ? 26 ASN A O    3  
ATOM 3629  C CB   . ASN A 1 26 ? 8.069   6.750   -4.616  1.00 0.00 ? 26 ASN A CB   3  
ATOM 3630  C CG   . ASN A 1 26 ? 7.836   7.967   -5.521  1.00 0.00 ? 26 ASN A CG   3  
ATOM 3631  O OD1  . ASN A 1 26 ? 7.071   8.871   -5.177  1.00 0.00 ? 26 ASN A OD1  3  
ATOM 3632  N ND2  . ASN A 1 26 ? 8.529   8.035   -6.653  1.00 0.00 ? 26 ASN A ND2  3  
ATOM 3633  H H    . ASN A 1 26 ? 6.147   5.612   -5.913  1.00 0.00 ? 26 ASN A H    3  
ATOM 3634  H HA   . ASN A 1 26 ? 9.046   5.479   -6.057  1.00 0.00 ? 26 ASN A HA   3  
ATOM 3635  H HB2  . ASN A 1 26 ? 7.240   6.681   -3.914  1.00 0.00 ? 26 ASN A HB2  3  
ATOM 3636  H HB3  . ASN A 1 26 ? 8.980   6.920   -4.052  1.00 0.00 ? 26 ASN A HB3  3  
ATOM 3637  H HD21 . ASN A 1 26 ? 9.160   7.312   -6.862  1.00 0.00 ? 26 ASN A HD21 3  
ATOM 3638  H HD22 . ASN A 1 26 ? 8.379   8.804   -7.239  1.00 0.00 ? 26 ASN A HD22 3  
ATOM 3639  N N    . TYR A 1 27 ? 7.355   3.669   -3.865  1.00 0.00 ? 27 TYR A N    3  
ATOM 3640  C CA   . TYR A 1 27 ? 7.434   2.832   -2.645  1.00 0.00 ? 27 TYR A CA   3  
ATOM 3641  C C    . TYR A 1 27 ? 7.099   1.344   -2.919  1.00 0.00 ? 27 TYR A C    3  
ATOM 3642  O O    . TYR A 1 27 ? 7.953   0.464   -2.706  1.00 0.00 ? 27 TYR A O    3  
ATOM 3643  C CB   . TYR A 1 27 ? 6.506   3.430   -1.544  1.00 0.00 ? 27 TYR A CB   3  
ATOM 3644  C CG   . TYR A 1 27 ? 6.814   4.895   -1.166  1.00 0.00 ? 27 TYR A CG   3  
ATOM 3645  C CD1  . TYR A 1 27 ? 8.135   5.362   -1.058  1.00 0.00 ? 27 TYR A CD1  3  
ATOM 3646  C CD2  . TYR A 1 27 ? 5.793   5.811   -0.913  1.00 0.00 ? 27 TYR A CD2  3  
ATOM 3647  C CE1  . TYR A 1 27 ? 8.407   6.673   -0.717  1.00 0.00 ? 27 TYR A CE1  3  
ATOM 3648  C CE2  . TYR A 1 27 ? 6.067   7.124   -0.568  1.00 0.00 ? 27 TYR A CE2  3  
ATOM 3649  C CZ   . TYR A 1 27 ? 7.373   7.548   -0.472  1.00 0.00 ? 27 TYR A CZ   3  
ATOM 3650  O OH   . TYR A 1 27 ? 7.649   8.849   -0.112  1.00 0.00 ? 27 TYR A OH   3  
ATOM 3651  H H    . TYR A 1 27 ? 6.493   3.756   -4.318  1.00 0.00 ? 27 TYR A H    3  
ATOM 3652  H HA   . TYR A 1 27 ? 8.458   2.876   -2.274  1.00 0.00 ? 27 TYR A HA   3  
ATOM 3653  H HB2  . TYR A 1 27 ? 5.478   3.381   -1.884  1.00 0.00 ? 27 TYR A HB2  3  
ATOM 3654  H HB3  . TYR A 1 27 ? 6.598   2.835   -0.639  1.00 0.00 ? 27 TYR A HB3  3  
ATOM 3655  H HD1  . TYR A 1 27 ? 8.953   4.682   -1.250  1.00 0.00 ? 27 TYR A HD1  3  
ATOM 3656  H HD2  . TYR A 1 27 ? 4.763   5.482   -0.990  1.00 0.00 ? 27 TYR A HD2  3  
ATOM 3657  H HE1  . TYR A 1 27 ? 9.435   7.009   -0.643  1.00 0.00 ? 27 TYR A HE1  3  
ATOM 3658  H HE2  . TYR A 1 27 ? 5.252   7.811   -0.380  1.00 0.00 ? 27 TYR A HE2  3  
ATOM 3659  H HH   . TYR A 1 27 ? 7.107   9.090   0.644   1.00 0.00 ? 27 TYR A HH   3  
ATOM 3660  N N    . LEU A 1 28 ? 5.855   1.078   -3.368  1.00 0.00 ? 28 LEU A N    3  
ATOM 3661  C CA   . LEU A 1 28 ? 5.339   -0.285  -3.641  1.00 0.00 ? 28 LEU A CA   3  
ATOM 3662  C C    . LEU A 1 28 ? 6.192   -1.000  -4.708  1.00 0.00 ? 28 LEU A C    3  
ATOM 3663  O O    . LEU A 1 28 ? 6.637   -2.134  -4.498  1.00 0.00 ? 28 LEU A O    3  
ATOM 3664  C CB   . LEU A 1 28 ? 3.856   -0.194  -4.107  1.00 0.00 ? 28 LEU A CB   3  
ATOM 3665  C CG   . LEU A 1 28 ? 3.147   -1.540  -4.495  1.00 0.00 ? 28 LEU A CG   3  
ATOM 3666  C CD1  . LEU A 1 28 ? 3.043   -2.509  -3.295  1.00 0.00 ? 28 LEU A CD1  3  
ATOM 3667  C CD2  . LEU A 1 28 ? 1.755   -1.272  -5.107  1.00 0.00 ? 28 LEU A CD2  3  
ATOM 3668  H H    . LEU A 1 28 ? 5.257   1.826   -3.513  1.00 0.00 ? 28 LEU A H    3  
ATOM 3669  H HA   . LEU A 1 28 ? 5.388   -0.850  -2.716  1.00 0.00 ? 28 LEU A HA   3  
ATOM 3670  H HB2  . LEU A 1 28 ? 3.283   0.274   -3.316  1.00 0.00 ? 28 LEU A HB2  3  
ATOM 3671  H HB3  . LEU A 1 28 ? 3.822   0.463   -4.973  1.00 0.00 ? 28 LEU A HB3  3  
ATOM 3672  H HG   . LEU A 1 28 ? 3.745   -2.033  -5.252  1.00 0.00 ? 28 LEU A HG   3  
ATOM 3673  H HD11 . LEU A 1 28 ? 2.475   -2.049  -2.495  1.00 0.00 ? 28 LEU A HD11 3  
ATOM 3674  H HD12 . LEU A 1 28 ? 4.033   -2.752  -2.934  1.00 0.00 ? 28 LEU A HD12 3  
ATOM 3675  H HD13 . LEU A 1 28 ? 2.550   -3.422  -3.605  1.00 0.00 ? 28 LEU A HD13 3  
ATOM 3676  H HD21 . LEU A 1 28 ? 1.124   -0.765  -4.386  1.00 0.00 ? 28 LEU A HD21 3  
ATOM 3677  H HD22 . LEU A 1 28 ? 1.294   -2.209  -5.391  1.00 0.00 ? 28 LEU A HD22 3  
ATOM 3678  H HD23 . LEU A 1 28 ? 1.856   -0.651  -5.988  1.00 0.00 ? 28 LEU A HD23 3  
ATOM 3679  N N    . SER A 1 29 ? 6.406   -0.312  -5.845  1.00 0.00 ? 29 SER A N    3  
ATOM 3680  C CA   . SER A 1 29 ? 7.225   -0.808  -6.968  1.00 0.00 ? 29 SER A CA   3  
ATOM 3681  C C    . SER A 1 29 ? 8.679   -1.107  -6.566  1.00 0.00 ? 29 SER A C    3  
ATOM 3682  O O    . SER A 1 29 ? 9.346   -1.905  -7.225  1.00 0.00 ? 29 SER A O    3  
ATOM 3683  C CB   . SER A 1 29 ? 7.191   0.221   -8.120  1.00 0.00 ? 29 SER A CB   3  
ATOM 3684  O OG   . SER A 1 29 ? 7.964   -0.185  -9.241  1.00 0.00 ? 29 SER A OG   3  
ATOM 3685  H H    . SER A 1 29 ? 5.954   0.551   -5.970  1.00 0.00 ? 29 SER A H    3  
ATOM 3686  H HA   . SER A 1 29 ? 6.770   -1.731  -7.316  1.00 0.00 ? 29 SER A HA   3  
ATOM 3687  H HB2  . SER A 1 29 ? 6.166   0.354   -8.445  1.00 0.00 ? 29 SER A HB2  3  
ATOM 3688  H HB3  . SER A 1 29 ? 7.572   1.172   -7.765  1.00 0.00 ? 29 SER A HB3  3  
ATOM 3689  H HG   . SER A 1 29 ? 8.259   -1.096  -9.119  1.00 0.00 ? 29 SER A HG   3  
ATOM 3690  N N    . LYS A 1 30 ? 9.173   -0.465  -5.499  1.00 0.00 ? 30 LYS A N    3  
ATOM 3691  C CA   . LYS A 1 30 ? 10.547  -0.680  -5.010  1.00 0.00 ? 30 LYS A CA   3  
ATOM 3692  C C    . LYS A 1 30 ? 10.577  -1.666  -3.818  1.00 0.00 ? 30 LYS A C    3  
ATOM 3693  O O    . LYS A 1 30 ? 11.659  -2.067  -3.390  1.00 0.00 ? 30 LYS A O    3  
ATOM 3694  C CB   . LYS A 1 30 ? 11.201  0.676   -4.623  1.00 0.00 ? 30 LYS A CB   3  
ATOM 3695  C CG   . LYS A 1 30 ? 11.812  1.496   -5.792  1.00 0.00 ? 30 LYS A CG   3  
ATOM 3696  C CD   . LYS A 1 30 ? 10.768  2.090   -6.761  1.00 0.00 ? 30 LYS A CD   3  
ATOM 3697  C CE   . LYS A 1 30 ? 11.425  2.944   -7.865  1.00 0.00 ? 30 LYS A CE   3  
ATOM 3698  N NZ   . LYS A 1 30 ? 10.426  3.497   -8.824  1.00 0.00 ? 30 LYS A NZ   3  
ATOM 3699  H H    . LYS A 1 30 ? 8.598   0.155   -5.001  1.00 0.00 ? 30 LYS A H    3  
ATOM 3700  H HA   . LYS A 1 30 ? 11.129  -1.123  -5.817  1.00 0.00 ? 30 LYS A HA   3  
ATOM 3701  H HB2  . LYS A 1 30 ? 10.449  1.294   -4.142  1.00 0.00 ? 30 LYS A HB2  3  
ATOM 3702  H HB3  . LYS A 1 30 ? 11.995  0.494   -3.899  1.00 0.00 ? 30 LYS A HB3  3  
ATOM 3703  H HG2  . LYS A 1 30 ? 12.386  2.312   -5.373  1.00 0.00 ? 30 LYS A HG2  3  
ATOM 3704  H HG3  . LYS A 1 30 ? 12.485  0.854   -6.355  1.00 0.00 ? 30 LYS A HG3  3  
ATOM 3705  H HD2  . LYS A 1 30 ? 10.212  1.279   -7.221  1.00 0.00 ? 30 LYS A HD2  3  
ATOM 3706  H HD3  . LYS A 1 30 ? 10.081  2.712   -6.194  1.00 0.00 ? 30 LYS A HD3  3  
ATOM 3707  H HE2  . LYS A 1 30 ? 11.955  3.769   -7.404  1.00 0.00 ? 30 LYS A HE2  3  
ATOM 3708  H HE3  . LYS A 1 30 ? 12.132  2.329   -8.412  1.00 0.00 ? 30 LYS A HE3  3  
ATOM 3709  H HZ1  . LYS A 1 30 ? 9.867   2.725   -9.246  1.00 0.00 ? 30 LYS A HZ1  3  
ATOM 3710  H HZ2  . LYS A 1 30 ? 10.906  4.011   -9.591  1.00 0.00 ? 30 LYS A HZ2  3  
ATOM 3711  H HZ3  . LYS A 1 30 ? 9.777   4.149   -8.333  1.00 0.00 ? 30 LYS A HZ3  3  
ATOM 3712  N N    . GLY A 1 31 ? 9.386   -2.072  -3.331  1.00 0.00 ? 31 GLY A N    3  
ATOM 3713  C CA   . GLY A 1 31 ? 9.246   -2.948  -2.151  1.00 0.00 ? 31 GLY A CA   3  
ATOM 3714  C C    . GLY A 1 31 ? 9.922   -2.420  -0.887  1.00 0.00 ? 31 GLY A C    3  
ATOM 3715  O O    . GLY A 1 31 ? 10.369  -3.199  -0.033  1.00 0.00 ? 31 GLY A O    3  
ATOM 3716  H H    . GLY A 1 31 ? 8.586   -1.833  -3.827  1.00 0.00 ? 31 GLY A H    3  
ATOM 3717  H HA2  . GLY A 1 31 ? 8.192   -3.070  -1.944  1.00 0.00 ? 31 GLY A HA2  3  
ATOM 3718  H HA3  . GLY A 1 31 ? 9.659   -3.920  -2.393  1.00 0.00 ? 31 GLY A HA3  3  
ATOM 3719  N N    . VAL A 1 32 ? 9.966   -1.080  -0.761  1.00 0.00 ? 32 VAL A N    3  
ATOM 3720  C CA   . VAL A 1 32 ? 10.562  -0.407  0.414   1.00 0.00 ? 32 VAL A CA   3  
ATOM 3721  C C    . VAL A 1 32 ? 9.560   -0.357  1.586   1.00 0.00 ? 32 VAL A C    3  
ATOM 3722  O O    . VAL A 1 32 ? 9.878   0.166   2.645   1.00 0.00 ? 32 VAL A O    3  
ATOM 3723  C CB   . VAL A 1 32 ? 11.056  1.046   0.076   1.00 0.00 ? 32 VAL A CB   3  
ATOM 3724  C CG1  . VAL A 1 32 ? 12.067  1.051   -1.086  1.00 0.00 ? 32 VAL A CG1  3  
ATOM 3725  C CG2  . VAL A 1 32 ? 9.891   2.016   -0.196  1.00 0.00 ? 32 VAL A CG2  3  
ATOM 3726  H H    . VAL A 1 32 ? 9.588   -0.532  -1.482  1.00 0.00 ? 32 VAL A H    3  
ATOM 3727  H HA   . VAL A 1 32 ? 11.424  -0.990  0.736   1.00 0.00 ? 32 VAL A HA   3  
ATOM 3728  H HB   . VAL A 1 32 ? 11.585  1.416   0.950   1.00 0.00 ? 32 VAL A HB   3  
ATOM 3729  H HG11 . VAL A 1 32 ? 11.606  0.638   -1.975  1.00 0.00 ? 32 VAL A HG11 3  
ATOM 3730  H HG12 . VAL A 1 32 ? 12.928  0.452   -0.824  1.00 0.00 ? 32 VAL A HG12 3  
ATOM 3731  H HG13 . VAL A 1 32 ? 12.390  2.064   -1.291  1.00 0.00 ? 32 VAL A HG13 3  
ATOM 3732  H HG21 . VAL A 1 32 ? 9.258   2.081   0.679   1.00 0.00 ? 32 VAL A HG21 3  
ATOM 3733  H HG22 . VAL A 1 32 ? 9.307   1.661   -1.036  1.00 0.00 ? 32 VAL A HG22 3  
ATOM 3734  H HG23 . VAL A 1 32 ? 10.278  3.002   -0.424  1.00 0.00 ? 32 VAL A HG23 3  
ATOM 3735  N N    . VAL A 1 33 ? 8.361   -0.921  1.368   1.00 0.00 ? 33 VAL A N    3  
ATOM 3736  C CA   . VAL A 1 33 ? 7.231   -0.864  2.306   1.00 0.00 ? 33 VAL A CA   3  
ATOM 3737  C C    . VAL A 1 33 ? 7.164   -2.170  3.123   1.00 0.00 ? 33 VAL A C    3  
ATOM 3738  O O    . VAL A 1 33 ? 7.151   -3.256  2.540   1.00 0.00 ? 33 VAL A O    3  
ATOM 3739  C CB   . VAL A 1 33 ? 5.884   -0.654  1.507   1.00 0.00 ? 33 VAL A CB   3  
ATOM 3740  C CG1  . VAL A 1 33 ? 4.673   -0.416  2.431   1.00 0.00 ? 33 VAL A CG1  3  
ATOM 3741  C CG2  . VAL A 1 33 ? 6.024   0.489   0.484   1.00 0.00 ? 33 VAL A CG2  3  
ATOM 3742  H H    . VAL A 1 33 ? 8.236   -1.416  0.538   1.00 0.00 ? 33 VAL A H    3  
ATOM 3743  H HA   . VAL A 1 33 ? 7.374   -0.017  2.981   1.00 0.00 ? 33 VAL A HA   3  
ATOM 3744  H HB   . VAL A 1 33 ? 5.685   -1.569  0.942   1.00 0.00 ? 33 VAL A HB   3  
ATOM 3745  H HG11 . VAL A 1 33 ? 4.556   -1.256  3.102   1.00 0.00 ? 33 VAL A HG11 3  
ATOM 3746  H HG12 . VAL A 1 33 ? 3.773   -0.316  1.835   1.00 0.00 ? 33 VAL A HG12 3  
ATOM 3747  H HG13 . VAL A 1 33 ? 4.819   0.488   3.011   1.00 0.00 ? 33 VAL A HG13 3  
ATOM 3748  H HG21 . VAL A 1 33 ? 6.225   1.422   0.997   1.00 0.00 ? 33 VAL A HG21 3  
ATOM 3749  H HG22 . VAL A 1 33 ? 5.110   0.585   -0.088  1.00 0.00 ? 33 VAL A HG22 3  
ATOM 3750  H HG23 . VAL A 1 33 ? 6.841   0.273   -0.191  1.00 0.00 ? 33 VAL A HG23 3  
ATOM 3751  N N    . ASP A 1 34 ? 7.099   -2.053  4.463   1.00 0.00 ? 34 ASP A N    3  
ATOM 3752  C CA   . ASP A 1 34 ? 6.971   -3.199  5.380   1.00 0.00 ? 34 ASP A CA   3  
ATOM 3753  C C    . ASP A 1 34 ? 5.525   -3.694  5.387   1.00 0.00 ? 34 ASP A C    3  
ATOM 3754  O O    . ASP A 1 34 ? 5.276   -4.893  5.292   1.00 0.00 ? 34 ASP A O    3  
ATOM 3755  C CB   . ASP A 1 34 ? 7.371   -2.788  6.825   1.00 0.00 ? 34 ASP A CB   3  
ATOM 3756  C CG   . ASP A 1 34 ? 7.309   -3.941  7.845   1.00 0.00 ? 34 ASP A CG   3  
ATOM 3757  O OD1  . ASP A 1 34 ? 8.229   -4.787  7.851   1.00 0.00 ? 34 ASP A OD1  3  
ATOM 3758  O OD2  . ASP A 1 34 ? 6.341   -4.008  8.638   1.00 0.00 ? 34 ASP A OD2  3  
ATOM 3759  H H    . ASP A 1 34 ? 7.068   -1.167  4.859   1.00 0.00 ? 34 ASP A H    3  
ATOM 3760  H HA   . ASP A 1 34 ? 7.633   -3.994  5.034   1.00 0.00 ? 34 ASP A HA   3  
ATOM 3761  H HB2  . ASP A 1 34 ? 8.384   -2.411  6.806   1.00 0.00 ? 34 ASP A HB2  3  
ATOM 3762  H HB3  . ASP A 1 34 ? 6.718   -1.983  7.163   1.00 0.00 ? 34 ASP A HB3  3  
ATOM 3763  N N    . ARG A 1 35 ? 4.585   -2.738  5.513   1.00 0.00 ? 35 ARG A N    3  
ATOM 3764  C CA   . ARG A 1 35 ? 3.148   -3.028  5.662   1.00 0.00 ? 35 ARG A CA   3  
ATOM 3765  C C    . ARG A 1 35 ? 2.293   -1.784  5.356   1.00 0.00 ? 35 ARG A C    3  
ATOM 3766  O O    . ARG A 1 35 ? 2.791   -0.648  5.321   1.00 0.00 ? 35 ARG A O    3  
ATOM 3767  C CB   . ARG A 1 35 ? 2.848   -3.538  7.097   1.00 0.00 ? 35 ARG A CB   3  
ATOM 3768  C CG   . ARG A 1 35 ? 3.144   -2.499  8.193   1.00 0.00 ? 35 ARG A CG   3  
ATOM 3769  C CD   . ARG A 1 35 ? 2.935   -3.035  9.606   1.00 0.00 ? 35 ARG A CD   3  
ATOM 3770  N NE   . ARG A 1 35 ? 3.203   -2.001  10.619  1.00 0.00 ? 35 ARG A NE   3  
ATOM 3771  C CZ   . ARG A 1 35 ? 4.352   -1.853  11.295  1.00 0.00 ? 35 ARG A CZ   3  
ATOM 3772  N NH1  . ARG A 1 35 ? 5.390   -2.660  11.076  1.00 0.00 ? 35 ARG A NH1  3  
ATOM 3773  N NH2  . ARG A 1 35 ? 4.465   -0.875  12.174  1.00 0.00 ? 35 ARG A NH2  3  
ATOM 3774  H H    . ARG A 1 35 ? 4.871   -1.802  5.515   1.00 0.00 ? 35 ARG A H    3  
ATOM 3775  H HA   . ARG A 1 35 ? 2.886   -3.807  4.948   1.00 0.00 ? 35 ARG A HA   3  
ATOM 3776  H HB2  . ARG A 1 35 ? 1.800   -3.823  7.165   1.00 0.00 ? 35 ARG A HB2  3  
ATOM 3777  H HB3  . ARG A 1 35 ? 3.455   -4.415  7.284   1.00 0.00 ? 35 ARG A HB3  3  
ATOM 3778  H HG2  . ARG A 1 35 ? 4.174   -2.175  8.099   1.00 0.00 ? 35 ARG A HG2  3  
ATOM 3779  H HG3  . ARG A 1 35 ? 2.492   -1.644  8.046   1.00 0.00 ? 35 ARG A HG3  3  
ATOM 3780  H HD2  . ARG A 1 35 ? 1.905   -3.365  9.710   1.00 0.00 ? 35 ARG A HD2  3  
ATOM 3781  H HD3  . ARG A 1 35 ? 3.594   -3.883  9.768   1.00 0.00 ? 35 ARG A HD3  3  
ATOM 3782  H HE   . ARG A 1 35 ? 2.476   -1.367  10.793  1.00 0.00 ? 35 ARG A HE   3  
ATOM 3783  H HH11 . ARG A 1 35 ? 5.328   -3.403  10.397  1.00 0.00 ? 35 ARG A HH11 3  
ATOM 3784  H HH12 . ARG A 1 35 ? 6.240   -2.535  11.588  1.00 0.00 ? 35 ARG A HH12 3  
ATOM 3785  H HH21 . ARG A 1 35 ? 3.694   -0.250  12.335  1.00 0.00 ? 35 ARG A HH21 3  
ATOM 3786  H HH22 . ARG A 1 35 ? 5.318   -0.755  12.684  1.00 0.00 ? 35 ARG A HH22 3  
ATOM 3787  N N    . LEU A 1 36 ? 0.991   -2.029  5.136   1.00 0.00 ? 36 LEU A N    3  
ATOM 3788  C CA   . LEU A 1 36 ? -0.019  -0.996  4.878   1.00 0.00 ? 36 LEU A CA   3  
ATOM 3789  C C    . LEU A 1 36 ? -1.072  -1.024  5.990   1.00 0.00 ? 36 LEU A C    3  
ATOM 3790  O O    . LEU A 1 36 ? -1.928  -1.910  6.034   1.00 0.00 ? 36 LEU A O    3  
ATOM 3791  C CB   . LEU A 1 36 ? -0.666  -1.230  3.492   1.00 0.00 ? 36 LEU A CB   3  
ATOM 3792  C CG   . LEU A 1 36 ? 0.237   -0.907  2.272   1.00 0.00 ? 36 LEU A CG   3  
ATOM 3793  C CD1  . LEU A 1 36 ? -0.505  -1.203  0.959   1.00 0.00 ? 36 LEU A CD1  3  
ATOM 3794  C CD2  . LEU A 1 36 ? 0.746   0.556   2.331   1.00 0.00 ? 36 LEU A CD2  3  
ATOM 3795  H H    . LEU A 1 36 ? 0.689   -2.956  5.141   1.00 0.00 ? 36 LEU A H    3  
ATOM 3796  H HA   . LEU A 1 36 ? 0.467   -0.022  4.881   1.00 0.00 ? 36 LEU A HA   3  
ATOM 3797  H HB2  . LEU A 1 36 ? -0.966  -2.275  3.426   1.00 0.00 ? 36 LEU A HB2  3  
ATOM 3798  H HB3  . LEU A 1 36 ? -1.560  -0.623  3.419   1.00 0.00 ? 36 LEU A HB3  3  
ATOM 3799  H HG   . LEU A 1 36 ? 1.106   -1.551  2.302   1.00 0.00 ? 36 LEU A HG   3  
ATOM 3800  H HD11 . LEU A 1 36 ? -0.859  -2.227  0.965   1.00 0.00 ? 36 LEU A HD11 3  
ATOM 3801  H HD12 . LEU A 1 36 ? 0.168   -1.076  0.125   1.00 0.00 ? 36 LEU A HD12 3  
ATOM 3802  H HD13 . LEU A 1 36 ? -1.348  -0.532  0.846   1.00 0.00 ? 36 LEU A HD13 3  
ATOM 3803  H HD21 . LEU A 1 36 ? 1.384   0.754   1.481   1.00 0.00 ? 36 LEU A HD21 3  
ATOM 3804  H HD22 . LEU A 1 36 ? 1.318   0.706   3.239   1.00 0.00 ? 36 LEU A HD22 3  
ATOM 3805  H HD23 . LEU A 1 36 ? -0.089  1.243   2.319   1.00 0.00 ? 36 LEU A HD23 3  
ATOM 3806  N N    . GLU A 1 37 ? -0.988  -0.038  6.886   1.00 0.00 ? 37 GLU A N    3  
ATOM 3807  C CA   . GLU A 1 37 ? -1.826  0.050   8.081   1.00 0.00 ? 37 GLU A CA   3  
ATOM 3808  C C    . GLU A 1 37 ? -3.130  0.793   7.748   1.00 0.00 ? 37 GLU A C    3  
ATOM 3809  O O    . GLU A 1 37 ? -3.140  2.020   7.670   1.00 0.00 ? 37 GLU A O    3  
ATOM 3810  C CB   . GLU A 1 37 ? -1.029  0.780   9.193   1.00 0.00 ? 37 GLU A CB   3  
ATOM 3811  C CG   . GLU A 1 37 ? 0.371   0.187   9.468   1.00 0.00 ? 37 GLU A CG   3  
ATOM 3812  C CD   . GLU A 1 37 ? 1.158   0.972   10.531  1.00 0.00 ? 37 GLU A CD   3  
ATOM 3813  O OE1  . GLU A 1 37 ? 1.435   2.175   10.312  1.00 0.00 ? 37 GLU A OE1  3  
ATOM 3814  O OE2  . GLU A 1 37 ? 1.495   0.404   11.588  1.00 0.00 ? 37 GLU A OE2  3  
ATOM 3815  H H    . GLU A 1 37 ? -0.332  0.676   6.729   1.00 0.00 ? 37 GLU A H    3  
ATOM 3816  H HA   . GLU A 1 37 ? -2.060  -0.962  8.417   1.00 0.00 ? 37 GLU A HA   3  
ATOM 3817  H HB2  . GLU A 1 37 ? -0.900  1.822   8.907   1.00 0.00 ? 37 GLU A HB2  3  
ATOM 3818  H HB3  . GLU A 1 37 ? -1.597  0.747   10.115  1.00 0.00 ? 37 GLU A HB3  3  
ATOM 3819  H HG2  . GLU A 1 37 ? 0.255   -0.844  9.790   1.00 0.00 ? 37 GLU A HG2  3  
ATOM 3820  H HG3  . GLU A 1 37 ? 0.941   0.196   8.544   1.00 0.00 ? 37 GLU A HG3  3  
ATOM 3821  N N    . VAL A 1 38 ? -4.233  0.044   7.569   1.00 0.00 ? 38 VAL A N    3  
ATOM 3822  C CA   . VAL A 1 38 ? -5.523  0.634   7.159   1.00 0.00 ? 38 VAL A CA   3  
ATOM 3823  C C    . VAL A 1 38 ? -6.268  1.050   8.432   1.00 0.00 ? 38 VAL A C    3  
ATOM 3824  O O    . VAL A 1 38 ? -6.981  0.245   9.048   1.00 0.00 ? 38 VAL A O    3  
ATOM 3825  C CB   . VAL A 1 38 ? -6.389  -0.361  6.308   1.00 0.00 ? 38 VAL A CB   3  
ATOM 3826  C CG1  . VAL A 1 38 ? -7.670  0.315   5.767   1.00 0.00 ? 38 VAL A CG1  3  
ATOM 3827  C CG2  . VAL A 1 38 ? -5.558  -0.982  5.169   1.00 0.00 ? 38 VAL A CG2  3  
ATOM 3828  H H    . VAL A 1 38 ? -4.203  -0.902  7.825   1.00 0.00 ? 38 VAL A H    3  
ATOM 3829  H HA   . VAL A 1 38 ? -5.321  1.526   6.551   1.00 0.00 ? 38 VAL A HA   3  
ATOM 3830  H HB   . VAL A 1 38 ? -6.702  -1.177  6.962   1.00 0.00 ? 38 VAL A HB   3  
ATOM 3831  H HG11 . VAL A 1 38 ? -8.265  0.678   6.594   1.00 0.00 ? 38 VAL A HG11 3  
ATOM 3832  H HG12 . VAL A 1 38 ? -8.253  -0.400  5.200   1.00 0.00 ? 38 VAL A HG12 3  
ATOM 3833  H HG13 . VAL A 1 38 ? -7.405  1.146   5.125   1.00 0.00 ? 38 VAL A HG13 3  
ATOM 3834  H HG21 . VAL A 1 38 ? -6.162  -1.695  4.621   1.00 0.00 ? 38 VAL A HG21 3  
ATOM 3835  H HG22 . VAL A 1 38 ? -4.697  -1.495  5.583   1.00 0.00 ? 38 VAL A HG22 3  
ATOM 3836  H HG23 . VAL A 1 38 ? -5.218  -0.209  4.494   1.00 0.00 ? 38 VAL A HG23 3  
ATOM 3837  N N    . VAL A 1 39 ? -6.052  2.308   8.841   1.00 0.00 ? 39 VAL A N    3  
ATOM 3838  C CA   . VAL A 1 39 ? -6.507  2.815   10.136  1.00 0.00 ? 39 VAL A CA   3  
ATOM 3839  C C    . VAL A 1 39 ? -7.888  3.470   9.983   1.00 0.00 ? 39 VAL A C    3  
ATOM 3840  O O    . VAL A 1 39 ? -8.056  4.410   9.196   1.00 0.00 ? 39 VAL A O    3  
ATOM 3841  C CB   . VAL A 1 39 ? -5.464  3.823   10.740  1.00 0.00 ? 39 VAL A CB   3  
ATOM 3842  C CG1  . VAL A 1 39 ? -5.862  4.278   12.162  1.00 0.00 ? 39 VAL A CG1  3  
ATOM 3843  C CG2  . VAL A 1 39 ? -4.043  3.211   10.728  1.00 0.00 ? 39 VAL A CG2  3  
ATOM 3844  H H    . VAL A 1 39 ? -5.577  2.927   8.242   1.00 0.00 ? 39 VAL A H    3  
ATOM 3845  H HA   . VAL A 1 39 ? -6.587  1.965   10.819  1.00 0.00 ? 39 VAL A HA   3  
ATOM 3846  H HB   . VAL A 1 39 ? -5.446  4.711   10.108  1.00 0.00 ? 39 VAL A HB   3  
ATOM 3847  H HG11 . VAL A 1 39 ? -6.833  4.756   12.135  1.00 0.00 ? 39 VAL A HG11 3  
ATOM 3848  H HG12 . VAL A 1 39 ? -5.134  4.989   12.535  1.00 0.00 ? 39 VAL A HG12 3  
ATOM 3849  H HG13 . VAL A 1 39 ? -5.901  3.426   12.830  1.00 0.00 ? 39 VAL A HG13 3  
ATOM 3850  H HG21 . VAL A 1 39 ? -3.327  3.929   11.107  1.00 0.00 ? 39 VAL A HG21 3  
ATOM 3851  H HG22 . VAL A 1 39 ? -3.773  2.945   9.713   1.00 0.00 ? 39 VAL A HG22 3  
ATOM 3852  H HG23 . VAL A 1 39 ? -4.014  2.321   11.345  1.00 0.00 ? 39 VAL A HG23 3  
ATOM 3853  N N    . ASN A 1 40 ? -8.867  2.911   10.718  1.00 0.00 ? 40 ASN A N    3  
ATOM 3854  C CA   . ASN A 1 40 ? -10.277 3.351   10.725  1.00 0.00 ? 40 ASN A CA   3  
ATOM 3855  C C    . ASN A 1 40 ? -10.916 3.289   9.342   1.00 0.00 ? 40 ASN A C    3  
ATOM 3856  O O    . ASN A 1 40 ? -11.972 3.885   9.117   1.00 0.00 ? 40 ASN A O    3  
ATOM 3857  C CB   . ASN A 1 40 ? -10.425 4.763   11.363  1.00 0.00 ? 40 ASN A CB   3  
ATOM 3858  C CG   . ASN A 1 40 ? -10.083 4.790   12.856  1.00 0.00 ? 40 ASN A CG   3  
ATOM 3859  O OD1  . ASN A 1 40 ? -9.226  4.036   13.326  1.00 0.00 ? 40 ASN A OD1  3  
ATOM 3860  N ND2  . ASN A 1 40 ? -10.747 5.647   13.615  1.00 0.00 ? 40 ASN A ND2  3  
ATOM 3861  H H    . ASN A 1 40 ? -8.626  2.178   11.315  1.00 0.00 ? 40 ASN A H    3  
ATOM 3862  H HA   . ASN A 1 40 ? -10.808 2.642   11.342  1.00 0.00 ? 40 ASN A HA   3  
ATOM 3863  H HB2  . ASN A 1 40 ? -9.768  5.464   10.856  1.00 0.00 ? 40 ASN A HB2  3  
ATOM 3864  H HB3  . ASN A 1 40 ? -11.451 5.095   11.237  1.00 0.00 ? 40 ASN A HB3  3  
ATOM 3865  H HD21 . ASN A 1 40 ? -11.420 6.213   13.195  1.00 0.00 ? 40 ASN A HD21 3  
ATOM 3866  H HD22 . ASN A 1 40 ? -10.531 5.677   14.566  1.00 0.00 ? 40 ASN A HD22 3  
ATOM 3867  N N    . LYS A 1 41 ? -10.279 2.507   8.443   1.00 0.00 ? 41 LYS A N    3  
ATOM 3868  C CA   . LYS A 1 41 ? -10.755 2.233   7.087   1.00 0.00 ? 41 LYS A CA   3  
ATOM 3869  C C    . LYS A 1 41 ? -11.028 3.520   6.259   1.00 0.00 ? 41 LYS A C    3  
ATOM 3870  O O    . LYS A 1 41 ? -11.742 3.485   5.250   1.00 0.00 ? 41 LYS A O    3  
ATOM 3871  C CB   . LYS A 1 41 ? -11.984 1.264   7.158   1.00 0.00 ? 41 LYS A CB   3  
ATOM 3872  C CG   . LYS A 1 41 ? -11.666 -0.182  7.653   1.00 0.00 ? 41 LYS A CG   3  
ATOM 3873  C CD   . LYS A 1 41 ? -11.285 -0.267  9.152   1.00 0.00 ? 41 LYS A CD   3  
ATOM 3874  C CE   . LYS A 1 41 ? -11.079 -1.706  9.642   1.00 0.00 ? 41 LYS A CE   3  
ATOM 3875  N NZ   . LYS A 1 41 ? -12.313 -2.524  9.516   1.00 0.00 ? 41 LYS A NZ   3  
ATOM 3876  H H    . LYS A 1 41 ? -9.484  2.016   8.723   1.00 0.00 ? 41 LYS A H    3  
ATOM 3877  H HA   . LYS A 1 41 ? -9.952  1.708   6.589   1.00 0.00 ? 41 LYS A HA   3  
ATOM 3878  H HB2  . LYS A 1 41 ? -12.736 1.690   7.820   1.00 0.00 ? 41 LYS A HB2  3  
ATOM 3879  H HB3  . LYS A 1 41 ? -12.418 1.187   6.166   1.00 0.00 ? 41 LYS A HB3  3  
ATOM 3880  H HG2  . LYS A 1 41 ? -12.536 -0.799  7.489   1.00 0.00 ? 41 LYS A HG2  3  
ATOM 3881  H HG3  . LYS A 1 41 ? -10.842 -0.576  7.065   1.00 0.00 ? 41 LYS A HG3  3  
ATOM 3882  H HD2  . LYS A 1 41 ? -10.361 0.285   9.302   1.00 0.00 ? 41 LYS A HD2  3  
ATOM 3883  H HD3  . LYS A 1 41 ? -12.067 0.198   9.737   1.00 0.00 ? 41 LYS A HD3  3  
ATOM 3884  H HE2  . LYS A 1 41 ? -10.295 -2.174  9.062   1.00 0.00 ? 41 LYS A HE2  3  
ATOM 3885  H HE3  . LYS A 1 41 ? -10.784 -1.686  10.683  1.00 0.00 ? 41 LYS A HE3  3  
ATOM 3886  H HZ1  . LYS A 1 41 ? -12.635 -2.546  8.523   1.00 0.00 ? 41 LYS A HZ1  3  
ATOM 3887  H HZ2  . LYS A 1 41 ? -13.073 -2.124  10.103  1.00 0.00 ? 41 LYS A HZ2  3  
ATOM 3888  H HZ3  . LYS A 1 41 ? -12.127 -3.498  9.827   1.00 0.00 ? 41 LYS A HZ3  3  
ATOM 3889  N N    . ARG A 1 42 ? -10.409 4.644   6.675   1.00 0.00 ? 42 ARG A N    3  
ATOM 3890  C CA   . ARG A 1 42 ? -10.527 5.956   6.005   1.00 0.00 ? 42 ARG A CA   3  
ATOM 3891  C C    . ARG A 1 42 ? -9.225  6.304   5.275   1.00 0.00 ? 42 ARG A C    3  
ATOM 3892  O O    . ARG A 1 42 ? -9.239  6.996   4.249   1.00 0.00 ? 42 ARG A O    3  
ATOM 3893  C CB   . ARG A 1 42 ? -10.874 7.046   7.049   1.00 0.00 ? 42 ARG A CB   3  
ATOM 3894  C CG   . ARG A 1 42 ? -12.271 6.882   7.688   1.00 0.00 ? 42 ARG A CG   3  
ATOM 3895  C CD   . ARG A 1 42 ? -12.573 7.955   8.745   1.00 0.00 ? 42 ARG A CD   3  
ATOM 3896  N NE   . ARG A 1 42 ? -13.912 7.785   9.327   1.00 0.00 ? 42 ARG A NE   3  
ATOM 3897  C CZ   . ARG A 1 42 ? -14.549 8.686   10.093  1.00 0.00 ? 42 ARG A CZ   3  
ATOM 3898  N NH1  . ARG A 1 42 ? -13.983 9.860   10.388  1.00 0.00 ? 42 ARG A NH1  3  
ATOM 3899  N NH2  . ARG A 1 42 ? -15.767 8.409   10.550  1.00 0.00 ? 42 ARG A NH2  3  
ATOM 3900  H H    . ARG A 1 42 ? -9.860  4.599   7.484   1.00 0.00 ? 42 ARG A H    3  
ATOM 3901  H HA   . ARG A 1 42 ? -11.330 5.908   5.269   1.00 0.00 ? 42 ARG A HA   3  
ATOM 3902  H HB2  . ARG A 1 42 ? -10.133 7.020   7.844   1.00 0.00 ? 42 ARG A HB2  3  
ATOM 3903  H HB3  . ARG A 1 42 ? -10.834 8.023   6.574   1.00 0.00 ? 42 ARG A HB3  3  
ATOM 3904  H HG2  . ARG A 1 42 ? -13.022 6.943   6.909   1.00 0.00 ? 42 ARG A HG2  3  
ATOM 3905  H HG3  . ARG A 1 42 ? -12.326 5.906   8.156   1.00 0.00 ? 42 ARG A HG3  3  
ATOM 3906  H HD2  . ARG A 1 42 ? -11.836 7.883   9.540   1.00 0.00 ? 42 ARG A HD2  3  
ATOM 3907  H HD3  . ARG A 1 42 ? -12.511 8.935   8.287   1.00 0.00 ? 42 ARG A HD3  3  
ATOM 3908  H HE   . ARG A 1 42 ? -14.359 6.930   9.148   1.00 0.00 ? 42 ARG A HE   3  
ATOM 3909  H HH11 . ARG A 1 42 ? -13.067 10.087  10.043  1.00 0.00 ? 42 ARG A HH11 3  
ATOM 3910  H HH12 . ARG A 1 42 ? -14.470 10.528  10.964  1.00 0.00 ? 42 ARG A HH12 3  
ATOM 3911  H HH21 . ARG A 1 42 ? -16.209 7.535   10.329  1.00 0.00 ? 42 ARG A HH21 3  
ATOM 3912  H HH22 . ARG A 1 42 ? -16.253 9.078   11.125  1.00 0.00 ? 42 ARG A HH22 3  
ATOM 3913  N N    . PHE A 1 43 ? -8.111  5.784   5.794   1.00 0.00 ? 43 PHE A N    3  
ATOM 3914  C CA   . PHE A 1 43 ? -6.774  6.048   5.254   1.00 0.00 ? 43 PHE A CA   3  
ATOM 3915  C C    . PHE A 1 43 ? -5.845  4.873   5.562   1.00 0.00 ? 43 PHE A C    3  
ATOM 3916  O O    . PHE A 1 43 ? -6.097  4.080   6.480   1.00 0.00 ? 43 PHE A O    3  
ATOM 3917  C CB   . PHE A 1 43 ? -6.191  7.382   5.812   1.00 0.00 ? 43 PHE A CB   3  
ATOM 3918  C CG   . PHE A 1 43 ? -5.995  7.427   7.332   1.00 0.00 ? 43 PHE A CG   3  
ATOM 3919  C CD1  . PHE A 1 43 ? -7.078  7.629   8.185   1.00 0.00 ? 43 PHE A CD1  3  
ATOM 3920  C CD2  . PHE A 1 43 ? -4.729  7.271   7.902   1.00 0.00 ? 43 PHE A CD2  3  
ATOM 3921  C CE1  . PHE A 1 43 ? -6.908  7.674   9.552   1.00 0.00 ? 43 PHE A CE1  3  
ATOM 3922  C CE2  . PHE A 1 43 ? -4.559  7.318   9.272   1.00 0.00 ? 43 PHE A CE2  3  
ATOM 3923  C CZ   . PHE A 1 43 ? -5.648  7.518   10.098  1.00 0.00 ? 43 PHE A CZ   3  
ATOM 3924  H H    . PHE A 1 43 ? -8.188  5.169   6.555   1.00 0.00 ? 43 PHE A H    3  
ATOM 3925  H HA   . PHE A 1 43 ? -6.865  6.130   4.172   1.00 0.00 ? 43 PHE A HA   3  
ATOM 3926  H HB2  . PHE A 1 43 ? -5.228  7.569   5.342   1.00 0.00 ? 43 PHE A HB2  3  
ATOM 3927  H HB3  . PHE A 1 43 ? -6.857  8.192   5.540   1.00 0.00 ? 43 PHE A HB3  3  
ATOM 3928  H HD1  . PHE A 1 43 ? -8.071  7.754   7.762   1.00 0.00 ? 43 PHE A HD1  3  
ATOM 3929  H HD2  . PHE A 1 43 ? -3.871  7.113   7.259   1.00 0.00 ? 43 PHE A HD2  3  
ATOM 3930  H HE1  . PHE A 1 43 ? -7.763  7.835   10.197  1.00 0.00 ? 43 PHE A HE1  3  
ATOM 3931  H HE2  . PHE A 1 43 ? -3.573  7.195   9.696   1.00 0.00 ? 43 PHE A HE2  3  
ATOM 3932  H HZ   . PHE A 1 43 ? -5.516  7.553   11.169  1.00 0.00 ? 43 PHE A HZ   3  
ATOM 3933  N N    . VAL A 1 44 ? -4.764  4.778   4.778   1.00 0.00 ? 44 VAL A N    3  
ATOM 3934  C CA   . VAL A 1 44 ? -3.763  3.719   4.898   1.00 0.00 ? 44 VAL A CA   3  
ATOM 3935  C C    . VAL A 1 44 ? -2.391  4.368   5.097   1.00 0.00 ? 44 VAL A C    3  
ATOM 3936  O O    . VAL A 1 44 ? -2.011  5.265   4.337   1.00 0.00 ? 44 VAL A O    3  
ATOM 3937  C CB   . VAL A 1 44 ? -3.741  2.802   3.625   1.00 0.00 ? 44 VAL A CB   3  
ATOM 3938  C CG1  . VAL A 1 44 ? -2.697  1.683   3.767   1.00 0.00 ? 44 VAL A CG1  3  
ATOM 3939  C CG2  . VAL A 1 44 ? -5.137  2.221   3.326   1.00 0.00 ? 44 VAL A CG2  3  
ATOM 3940  H H    . VAL A 1 44 ? -4.622  5.473   4.104   1.00 0.00 ? 44 VAL A H    3  
ATOM 3941  H HA   . VAL A 1 44 ? -4.000  3.102   5.769   1.00 0.00 ? 44 VAL A HA   3  
ATOM 3942  H HB   . VAL A 1 44 ? -3.448  3.420   2.769   1.00 0.00 ? 44 VAL A HB   3  
ATOM 3943  H HG11 . VAL A 1 44 ? -2.941  1.060   4.618   1.00 0.00 ? 44 VAL A HG11 3  
ATOM 3944  H HG12 . VAL A 1 44 ? -1.716  2.115   3.914   1.00 0.00 ? 44 VAL A HG12 3  
ATOM 3945  H HG13 . VAL A 1 44 ? -2.683  1.077   2.870   1.00 0.00 ? 44 VAL A HG13 3  
ATOM 3946  H HG21 . VAL A 1 44 ? -5.101  1.618   2.429   1.00 0.00 ? 44 VAL A HG21 3  
ATOM 3947  H HG22 . VAL A 1 44 ? -5.842  3.031   3.180   1.00 0.00 ? 44 VAL A HG22 3  
ATOM 3948  H HG23 . VAL A 1 44 ? -5.466  1.611   4.157   1.00 0.00 ? 44 VAL A HG23 3  
ATOM 3949  N N    . ARG A 1 45 ? -1.649  3.901   6.107   1.00 0.00 ? 45 ARG A N    3  
ATOM 3950  C CA   . ARG A 1 45 ? -0.329  4.433   6.432   1.00 0.00 ? 45 ARG A CA   3  
ATOM 3951  C C    . ARG A 1 45 ? 0.731   3.522   5.811   1.00 0.00 ? 45 ARG A C    3  
ATOM 3952  O O    . ARG A 1 45 ? 0.743   2.307   6.059   1.00 0.00 ? 45 ARG A O    3  
ATOM 3953  C CB   . ARG A 1 45 ? -0.140  4.538   7.968   1.00 0.00 ? 45 ARG A CB   3  
ATOM 3954  C CG   . ARG A 1 45 ? -1.248  5.339   8.692   1.00 0.00 ? 45 ARG A CG   3  
ATOM 3955  C CD   . ARG A 1 45 ? -0.952  5.552   10.193  1.00 0.00 ? 45 ARG A CD   3  
ATOM 3956  N NE   . ARG A 1 45 ? -0.625  4.290   10.900  1.00 0.00 ? 45 ARG A NE   3  
ATOM 3957  C CZ   . ARG A 1 45 ? -0.865  4.028   12.204  1.00 0.00 ? 45 ARG A CZ   3  
ATOM 3958  N NH1  . ARG A 1 45 ? -1.470  4.926   12.986  1.00 0.00 ? 45 ARG A NH1  3  
ATOM 3959  N NH2  . ARG A 1 45 ? -0.459  2.868   12.710  1.00 0.00 ? 45 ARG A NH2  3  
ATOM 3960  H H    . ARG A 1 45 ? -1.977  3.138   6.614   1.00 0.00 ? 45 ARG A H    3  
ATOM 3961  H HA   . ARG A 1 45 ? -0.240  5.434   6.000   1.00 0.00 ? 45 ARG A HA   3  
ATOM 3962  H HB2  . ARG A 1 45 ? -0.122  3.536   8.388   1.00 0.00 ? 45 ARG A HB2  3  
ATOM 3963  H HB3  . ARG A 1 45 ? 0.812   5.015   8.172   1.00 0.00 ? 45 ARG A HB3  3  
ATOM 3964  H HG2  . ARG A 1 45 ? -1.352  6.310   8.214   1.00 0.00 ? 45 ARG A HG2  3  
ATOM 3965  H HG3  . ARG A 1 45 ? -2.184  4.802   8.594   1.00 0.00 ? 45 ARG A HG3  3  
ATOM 3966  H HD2  . ARG A 1 45 ? -0.110  6.227   10.290  1.00 0.00 ? 45 ARG A HD2  3  
ATOM 3967  H HD3  . ARG A 1 45 ? -1.820  6.001   10.655  1.00 0.00 ? 45 ARG A HD3  3  
ATOM 3968  H HE   . ARG A 1 45 ? -0.185  3.593   10.366  1.00 0.00 ? 45 ARG A HE   3  
ATOM 3969  H HH11 . ARG A 1 45 ? -1.757  5.815   12.610  1.00 0.00 ? 45 ARG A HH11 3  
ATOM 3970  H HH12 . ARG A 1 45 ? -1.651  4.727   13.952  1.00 0.00 ? 45 ARG A HH12 3  
ATOM 3971  H HH21 . ARG A 1 45 ? 0.019   2.204   12.129  1.00 0.00 ? 45 ARG A HH21 3  
ATOM 3972  H HH22 . ARG A 1 45 ? -0.628  2.646   13.675  1.00 0.00 ? 45 ARG A HH22 3  
ATOM 3973  N N    . VAL A 1 46 ? 1.611   4.123   5.006   1.00 0.00 ? 46 VAL A N    3  
ATOM 3974  C CA   . VAL A 1 46 ? 2.710   3.404   4.374   1.00 0.00 ? 46 VAL A CA   3  
ATOM 3975  C C    . VAL A 1 46 ? 3.842   3.311   5.397   1.00 0.00 ? 46 VAL A C    3  
ATOM 3976  O O    . VAL A 1 46 ? 4.491   4.316   5.723   1.00 0.00 ? 46 VAL A O    3  
ATOM 3977  C CB   . VAL A 1 46 ? 3.214   4.118   3.068   1.00 0.00 ? 46 VAL A CB   3  
ATOM 3978  C CG1  . VAL A 1 46 ? 4.344   3.327   2.377   1.00 0.00 ? 46 VAL A CG1  3  
ATOM 3979  C CG2  . VAL A 1 46 ? 2.047   4.380   2.096   1.00 0.00 ? 46 VAL A CG2  3  
ATOM 3980  H H    . VAL A 1 46 ? 1.534   5.090   4.888   1.00 0.00 ? 46 VAL A H    3  
ATOM 3981  H HA   . VAL A 1 46 ? 2.367   2.399   4.106   1.00 0.00 ? 46 VAL A HA   3  
ATOM 3982  H HB   . VAL A 1 46 ? 3.621   5.082   3.358   1.00 0.00 ? 46 VAL A HB   3  
ATOM 3983  H HG11 . VAL A 1 46 ? 4.691   3.864   1.501   1.00 0.00 ? 46 VAL A HG11 3  
ATOM 3984  H HG12 . VAL A 1 46 ? 3.976   2.356   2.075   1.00 0.00 ? 46 VAL A HG12 3  
ATOM 3985  H HG13 . VAL A 1 46 ? 5.170   3.197   3.063   1.00 0.00 ? 46 VAL A HG13 3  
ATOM 3986  H HG21 . VAL A 1 46 ? 1.602   3.439   1.801   1.00 0.00 ? 46 VAL A HG21 3  
ATOM 3987  H HG22 . VAL A 1 46 ? 2.410   4.900   1.218   1.00 0.00 ? 46 VAL A HG22 3  
ATOM 3988  H HG23 . VAL A 1 46 ? 1.298   4.991   2.583   1.00 0.00 ? 46 VAL A HG23 3  
ATOM 3989  N N    . THR A 1 47 ? 4.043   2.100   5.922   1.00 0.00 ? 47 THR A N    3  
ATOM 3990  C CA   . THR A 1 47 ? 5.163   1.798   6.801   1.00 0.00 ? 47 THR A CA   3  
ATOM 3991  C C    . THR A 1 47 ? 6.274   1.255   5.917   1.00 0.00 ? 47 THR A C    3  
ATOM 3992  O O    . THR A 1 47 ? 6.018   0.363   5.123   1.00 0.00 ? 47 THR A O    3  
ATOM 3993  C CB   . THR A 1 47 ? 4.774   0.725   7.868   1.00 0.00 ? 47 THR A CB   3  
ATOM 3994  O OG1  . THR A 1 47 ? 3.606   1.138   8.588   1.00 0.00 ? 47 THR A OG1  3  
ATOM 3995  C CG2  . THR A 1 47 ? 5.908   0.447   8.870   1.00 0.00 ? 47 THR A CG2  3  
ATOM 3996  H H    . THR A 1 47 ? 3.445   1.359   5.671   1.00 0.00 ? 47 THR A H    3  
ATOM 3997  H HA   . THR A 1 47 ? 5.485   2.710   7.310   1.00 0.00 ? 47 THR A HA   3  
ATOM 3998  H HB   . THR A 1 47 ? 4.533   -0.206  7.351   1.00 0.00 ? 47 THR A HB   3  
ATOM 3999  H HG1  . THR A 1 47 ? 2.919   1.412   7.971   1.00 0.00 ? 47 THR A HG1  3  
ATOM 4000  H HG21 . THR A 1 47 ? 6.162   1.356   9.397   1.00 0.00 ? 47 THR A HG21 3  
ATOM 4001  H HG22 . THR A 1 47 ? 6.779   0.086   8.344   1.00 0.00 ? 47 THR A HG22 3  
ATOM 4002  H HG23 . THR A 1 47 ? 5.583   -0.302  9.583   1.00 0.00 ? 47 THR A HG23 3  
ATOM 4003  N N    . PHE A 1 48 ? 7.468   1.816   6.042   1.00 0.00 ? 48 PHE A N    3  
ATOM 4004  C CA   . PHE A 1 48 ? 8.649   1.337   5.314   1.00 0.00 ? 48 PHE A CA   3  
ATOM 4005  C C    . PHE A 1 48 ? 9.298   0.190   6.091   1.00 0.00 ? 48 PHE A C    3  
ATOM 4006  O O    . PHE A 1 48 ? 8.974   -0.023  7.266   1.00 0.00 ? 48 PHE A O    3  
ATOM 4007  C CB   . PHE A 1 48 ? 9.640   2.498   5.075   1.00 0.00 ? 48 PHE A CB   3  
ATOM 4008  C CG   . PHE A 1 48 ? 9.007   3.684   4.343   1.00 0.00 ? 48 PHE A CG   3  
ATOM 4009  C CD1  . PHE A 1 48 ? 8.572   3.556   3.027   1.00 0.00 ? 48 PHE A CD1  3  
ATOM 4010  C CD2  . PHE A 1 48 ? 8.822   4.911   4.980   1.00 0.00 ? 48 PHE A CD2  3  
ATOM 4011  C CE1  . PHE A 1 48 ? 7.981   4.615   2.373   1.00 0.00 ? 48 PHE A CE1  3  
ATOM 4012  C CE2  . PHE A 1 48 ? 8.225   5.972   4.325   1.00 0.00 ? 48 PHE A CE2  3  
ATOM 4013  C CZ   . PHE A 1 48 ? 7.805   5.821   3.018   1.00 0.00 ? 48 PHE A CZ   3  
ATOM 4014  H H    . PHE A 1 48 ? 7.544   2.563   6.670   1.00 0.00 ? 48 PHE A H    3  
ATOM 4015  H HA   . PHE A 1 48 ? 8.317   0.950   4.344   1.00 0.00 ? 48 PHE A HA   3  
ATOM 4016  H HB2  . PHE A 1 48 ? 10.022  2.841   6.028   1.00 0.00 ? 48 PHE A HB2  3  
ATOM 4017  H HB3  . PHE A 1 48 ? 10.470  2.140   4.473   1.00 0.00 ? 48 PHE A HB3  3  
ATOM 4018  H HD1  . PHE A 1 48 ? 8.705   2.610   2.508   1.00 0.00 ? 48 PHE A HD1  3  
ATOM 4019  H HD2  . PHE A 1 48 ? 9.155   5.032   6.005   1.00 0.00 ? 48 PHE A HD2  3  
ATOM 4020  H HE1  . PHE A 1 48 ? 7.653   4.496   1.350   1.00 0.00 ? 48 PHE A HE1  3  
ATOM 4021  H HE2  . PHE A 1 48 ? 8.089   6.918   4.836   1.00 0.00 ? 48 PHE A HE2  3  
ATOM 4022  H HZ   . PHE A 1 48 ? 7.338   6.649   2.500   1.00 0.00 ? 48 PHE A HZ   3  
ATOM 4023  N N    . THR A 1 49 ? 10.183  -0.566  5.430   1.00 0.00 ? 49 THR A N    3  
ATOM 4024  C CA   . THR A 1 49 ? 10.871  -1.708  6.054   1.00 0.00 ? 49 THR A CA   3  
ATOM 4025  C C    . THR A 1 49 ? 11.861  -1.204  7.145   1.00 0.00 ? 49 THR A C    3  
ATOM 4026  O O    . THR A 1 49 ? 12.521  -0.172  6.941   1.00 0.00 ? 49 THR A O    3  
ATOM 4027  C CB   . THR A 1 49 ? 11.564  -2.608  4.967   1.00 0.00 ? 49 THR A CB   3  
ATOM 4028  O OG1  . THR A 1 49 ? 12.142  -3.785  5.555   1.00 0.00 ? 49 THR A OG1  3  
ATOM 4029  C CG2  . THR A 1 49 ? 12.641  -1.864  4.184   1.00 0.00 ? 49 THR A CG2  3  
ATOM 4030  H H    . THR A 1 49 ? 10.394  -0.346  4.505   1.00 0.00 ? 49 THR A H    3  
ATOM 4031  H HA   . THR A 1 49 ? 10.105  -2.311  6.539   1.00 0.00 ? 49 THR A HA   3  
ATOM 4032  H HB   . THR A 1 49 ? 10.797  -2.928  4.266   1.00 0.00 ? 49 THR A HB   3  
ATOM 4033  H HG1  . THR A 1 49 ? 11.780  -4.568  5.127   1.00 0.00 ? 49 THR A HG1  3  
ATOM 4034  H HG21 . THR A 1 49 ? 12.214  -0.991  3.707   1.00 0.00 ? 49 THR A HG21 3  
ATOM 4035  H HG22 . THR A 1 49 ? 13.060  -2.512  3.431   1.00 0.00 ? 49 THR A HG22 3  
ATOM 4036  H HG23 . THR A 1 49 ? 13.428  -1.551  4.864   1.00 0.00 ? 49 THR A HG23 3  
ATOM 4037  N N    . PRO A 1 50 ? 11.935  -1.899  8.336   1.00 0.00 ? 50 PRO A N    3  
ATOM 4038  C CA   . PRO A 1 50 ? 12.677  -1.411  9.532   1.00 0.00 ? 50 PRO A CA   3  
ATOM 4039  C C    . PRO A 1 50 ? 14.151  -1.072  9.231   1.00 0.00 ? 50 PRO A C    3  
ATOM 4040  O O    . PRO A 1 50 ? 14.666  -0.042  9.688   1.00 0.00 ? 50 PRO A O    3  
ATOM 4041  C CB   . PRO A 1 50 ? 12.572  -2.599  10.539  1.00 0.00 ? 50 PRO A CB   3  
ATOM 4042  C CG   . PRO A 1 50 ? 12.191  -3.783  9.704   1.00 0.00 ? 50 PRO A CG   3  
ATOM 4043  C CD   . PRO A 1 50 ? 11.319  -3.227  8.605   1.00 0.00 ? 50 PRO A CD   3  
ATOM 4044  H HA   . PRO A 1 50 ? 12.190  -0.538  9.957   1.00 0.00 ? 50 PRO A HA   3  
ATOM 4045  H HB2  . PRO A 1 50 ? 13.523  -2.768  11.049  1.00 0.00 ? 50 PRO A HB2  3  
ATOM 4046  H HB3  . PRO A 1 50 ? 11.801  -2.399  11.275  1.00 0.00 ? 50 PRO A HB3  3  
ATOM 4047  H HG2  . PRO A 1 50 ? 13.081  -4.250  9.284   1.00 0.00 ? 50 PRO A HG2  3  
ATOM 4048  H HG3  . PRO A 1 50 ? 11.634  -4.503  10.292  1.00 0.00 ? 50 PRO A HG3  3  
ATOM 4049  H HD2  . PRO A 1 50 ? 11.365  -3.859  7.721   1.00 0.00 ? 50 PRO A HD2  3  
ATOM 4050  H HD3  . PRO A 1 50 ? 10.293  -3.116  8.932   1.00 0.00 ? 50 PRO A HD3  3  
ATOM 4051  N N    . GLY A 1 51 ? 14.803  -1.937  8.425   1.00 0.00 ? 51 GLY A N    3  
ATOM 4052  C CA   . GLY A 1 51 ? 16.219  -1.791  8.076   1.00 0.00 ? 51 GLY A CA   3  
ATOM 4053  C C    . GLY A 1 51 ? 16.519  -0.575  7.210   1.00 0.00 ? 51 GLY A C    3  
ATOM 4054  O O    . GLY A 1 51 ? 17.643  -0.056  7.241   1.00 0.00 ? 51 GLY A O    3  
ATOM 4055  H H    . GLY A 1 51 ? 14.302  -2.694  8.053   1.00 0.00 ? 51 GLY A H    3  
ATOM 4056  H HA2  . GLY A 1 51 ? 16.797  -1.724  8.995   1.00 0.00 ? 51 GLY A HA2  3  
ATOM 4057  H HA3  . GLY A 1 51 ? 16.535  -2.680  7.545   1.00 0.00 ? 51 GLY A HA3  3  
ATOM 4058  N N    . LYS A 1 52 ? 15.517  -0.115  6.447   1.00 0.00 ? 52 LYS A N    3  
ATOM 4059  C CA   . LYS A 1 52 ? 15.625  1.075   5.609   1.00 0.00 ? 52 LYS A CA   3  
ATOM 4060  C C    . LYS A 1 52 ? 15.513  2.345   6.468   1.00 0.00 ? 52 LYS A C    3  
ATOM 4061  O O    . LYS A 1 52 ? 16.419  3.177   6.466   1.00 0.00 ? 52 LYS A O    3  
ATOM 4062  C CB   . LYS A 1 52 ? 14.511  1.046   4.538   1.00 0.00 ? 52 LYS A CB   3  
ATOM 4063  C CG   . LYS A 1 52 ? 14.347  2.352   3.760   1.00 0.00 ? 52 LYS A CG   3  
ATOM 4064  C CD   . LYS A 1 52 ? 13.187  2.316   2.756   1.00 0.00 ? 52 LYS A CD   3  
ATOM 4065  C CE   . LYS A 1 52 ? 13.010  3.648   2.019   1.00 0.00 ? 52 LYS A CE   3  
ATOM 4066  N NZ   . LYS A 1 52 ? 14.239  4.037   1.273   1.00 0.00 ? 52 LYS A NZ   3  
ATOM 4067  H H    . LYS A 1 52 ? 14.668  -0.584  6.452   1.00 0.00 ? 52 LYS A H    3  
ATOM 4068  H HA   . LYS A 1 52 ? 16.595  1.059   5.111   1.00 0.00 ? 52 LYS A HA   3  
ATOM 4069  H HB2  . LYS A 1 52 ? 14.725  0.249   3.832   1.00 0.00 ? 52 LYS A HB2  3  
ATOM 4070  H HB3  . LYS A 1 52 ? 13.561  0.822   5.027   1.00 0.00 ? 52 LYS A HB3  3  
ATOM 4071  H HG2  . LYS A 1 52 ? 14.165  3.143   4.476   1.00 0.00 ? 52 LYS A HG2  3  
ATOM 4072  H HG3  . LYS A 1 52 ? 15.272  2.559   3.233   1.00 0.00 ? 52 LYS A HG3  3  
ATOM 4073  H HD2  . LYS A 1 52 ? 13.374  1.533   2.023   1.00 0.00 ? 52 LYS A HD2  3  
ATOM 4074  H HD3  . LYS A 1 52 ? 12.268  2.084   3.288   1.00 0.00 ? 52 LYS A HD3  3  
ATOM 4075  H HE2  . LYS A 1 52 ? 12.197  3.549   1.314   1.00 0.00 ? 52 LYS A HE2  3  
ATOM 4076  H HE3  . LYS A 1 52 ? 12.771  4.426   2.733   1.00 0.00 ? 52 LYS A HE3  3  
ATOM 4077  H HZ1  . LYS A 1 52 ? 15.042  4.131   1.928   1.00 0.00 ? 52 LYS A HZ1  3  
ATOM 4078  H HZ2  . LYS A 1 52 ? 14.093  4.949   0.792   1.00 0.00 ? 52 LYS A HZ2  3  
ATOM 4079  H HZ3  . LYS A 1 52 ? 14.472  3.319   0.562   1.00 0.00 ? 52 LYS A HZ3  3  
ATOM 4080  N N    . THR A 1 53 ? 14.384  2.477   7.187   1.00 0.00 ? 53 THR A N    3  
ATOM 4081  C CA   . THR A 1 53 ? 14.075  3.675   7.986   1.00 0.00 ? 53 THR A CA   3  
ATOM 4082  C C    . THR A 1 53 ? 15.077  3.824   9.163   1.00 0.00 ? 53 THR A C    3  
ATOM 4083  O O    . THR A 1 53 ? 15.206  2.901   9.975   1.00 0.00 ? 53 THR A O    3  
ATOM 4084  C CB   . THR A 1 53 ? 12.604  3.613   8.507   1.00 0.00 ? 53 THR A CB   3  
ATOM 4085  O OG1  . THR A 1 53 ? 11.727  3.415   7.386   1.00 0.00 ? 53 THR A OG1  3  
ATOM 4086  C CG2  . THR A 1 53 ? 12.175  4.893   9.256   1.00 0.00 ? 53 THR A CG2  3  
ATOM 4087  H H    . THR A 1 53 ? 13.738  1.739   7.186   1.00 0.00 ? 53 THR A H    3  
ATOM 4088  H HA   . THR A 1 53 ? 14.164  4.529   7.327   1.00 0.00 ? 53 THR A HA   3  
ATOM 4089  H HB   . THR A 1 53 ? 12.502  2.763   9.177   1.00 0.00 ? 53 THR A HB   3  
ATOM 4090  H HG1  . THR A 1 53 ? 10.988  2.855   7.652   1.00 0.00 ? 53 THR A HG1  3  
ATOM 4091  H HG21 . THR A 1 53 ? 12.819  5.056   10.109  1.00 0.00 ? 53 THR A HG21 3  
ATOM 4092  H HG22 . THR A 1 53 ? 11.152  4.795   9.597   1.00 0.00 ? 53 THR A HG22 3  
ATOM 4093  H HG23 . THR A 1 53 ? 12.243  5.745   8.589   1.00 0.00 ? 53 THR A HG23 3  
ATOM 4094  N N    . PRO A 1 54 ? 15.845  4.958   9.241   1.00 0.00 ? 54 PRO A N    3  
ATOM 4095  C CA   . PRO A 1 54 ? 16.807  5.214   10.333  1.00 0.00 ? 54 PRO A CA   3  
ATOM 4096  C C    . PRO A 1 54 ? 16.170  5.985   11.514  1.00 0.00 ? 54 PRO A C    3  
ATOM 4097  O O    . PRO A 1 54 ? 14.931  6.054   11.622  1.00 0.00 ? 54 PRO A O    3  
ATOM 4098  C CB   . PRO A 1 54 ? 17.892  6.034   9.599   1.00 0.00 ? 54 PRO A CB   3  
ATOM 4099  C CG   . PRO A 1 54 ? 17.164  6.799   8.524   1.00 0.00 ? 54 PRO A CG   3  
ATOM 4100  C CD   . PRO A 1 54 ? 15.853  6.077   8.264   1.00 0.00 ? 54 PRO A CD   3  
ATOM 4101  H HA   . PRO A 1 54 ? 17.240  4.294   10.706  1.00 0.00 ? 54 PRO A HA   3  
ATOM 4102  H HB2  . PRO A 1 54 ? 18.391  6.705   10.294  1.00 0.00 ? 54 PRO A HB2  3  
ATOM 4103  H HB3  . PRO A 1 54 ? 18.620  5.367   9.152   1.00 0.00 ? 54 PRO A HB3  3  
ATOM 4104  H HG2  . PRO A 1 54 ? 16.975  7.812   8.867   1.00 0.00 ? 54 PRO A HG2  3  
ATOM 4105  H HG3  . PRO A 1 54 ? 17.761  6.824   7.619   1.00 0.00 ? 54 PRO A HG3  3  
ATOM 4106  H HD2  . PRO A 1 54 ? 15.008  6.737   8.438   1.00 0.00 ? 54 PRO A HD2  3  
ATOM 4107  H HD3  . PRO A 1 54 ? 15.819  5.701   7.249   1.00 0.00 ? 54 PRO A HD3  3  
ATOM 4108  N N    . VAL A 1 55 ? 17.020  6.587   12.390  1.00 0.00 ? 55 VAL A N    3  
ATOM 4109  C CA   . VAL A 1 55 ? 16.549  7.361   13.571  1.00 0.00 ? 55 VAL A CA   3  
ATOM 4110  C C    . VAL A 1 55 ? 15.788  8.650   13.167  1.00 0.00 ? 55 VAL A C    3  
ATOM 4111  O O    . VAL A 1 55 ? 15.213  9.330   14.023  1.00 0.00 ? 55 VAL A O    3  
ATOM 4112  C CB   . VAL A 1 55 ? 17.724  7.733   14.547  1.00 0.00 ? 55 VAL A CB   3  
ATOM 4113  C CG1  . VAL A 1 55 ? 18.445  6.475   15.070  1.00 0.00 ? 55 VAL A CG1  3  
ATOM 4114  C CG2  . VAL A 1 55 ? 18.718  8.726   13.901  1.00 0.00 ? 55 VAL A CG2  3  
ATOM 4115  H H    . VAL A 1 55 ? 17.986  6.505   12.249  1.00 0.00 ? 55 VAL A H    3  
ATOM 4116  H HA   . VAL A 1 55 ? 15.854  6.722   14.115  1.00 0.00 ? 55 VAL A HA   3  
ATOM 4117  H HB   . VAL A 1 55 ? 17.285  8.227   15.405  1.00 0.00 ? 55 VAL A HB   3  
ATOM 4118  H HG11 . VAL A 1 55 ? 17.741  5.848   15.599  1.00 0.00 ? 55 VAL A HG11 3  
ATOM 4119  H HG12 . VAL A 1 55 ? 19.240  6.764   15.744  1.00 0.00 ? 55 VAL A HG12 3  
ATOM 4120  H HG13 . VAL A 1 55 ? 18.864  5.921   14.241  1.00 0.00 ? 55 VAL A HG13 3  
ATOM 4121  H HG21 . VAL A 1 55 ? 18.195  9.627   13.608  1.00 0.00 ? 55 VAL A HG21 3  
ATOM 4122  H HG22 . VAL A 1 55 ? 19.169  8.276   13.026  1.00 0.00 ? 55 VAL A HG22 3  
ATOM 4123  H HG23 . VAL A 1 55 ? 19.494  8.983   14.609  1.00 0.00 ? 55 VAL A HG23 3  
ATOM 4124  N N    . ASP A 1 56 ? 15.797  8.969   11.859  1.00 0.00 ? 56 ASP A N    3  
ATOM 4125  C CA   . ASP A 1 56 ? 15.080  10.123  11.277  1.00 0.00 ? 56 ASP A CA   3  
ATOM 4126  C C    . ASP A 1 56 ? 13.556  10.030  11.458  1.00 0.00 ? 56 ASP A C    3  
ATOM 4127  O O    . ASP A 1 56 ? 12.881  11.060  11.442  1.00 0.00 ? 56 ASP A O    3  
ATOM 4128  C CB   . ASP A 1 56 ? 15.429  10.256  9.777   1.00 0.00 ? 56 ASP A CB   3  
ATOM 4129  C CG   . ASP A 1 56 ? 16.896  10.645  9.548   1.00 0.00 ? 56 ASP A CG   3  
ATOM 4130  O OD1  . ASP A 1 56 ? 17.791  9.801   9.766   1.00 0.00 ? 56 ASP A OD1  3  
ATOM 4131  O OD2  . ASP A 1 56 ? 17.174  11.808  9.182   1.00 0.00 ? 56 ASP A OD2  3  
ATOM 4132  H H    . ASP A 1 56 ? 16.321  8.411   11.254  1.00 0.00 ? 56 ASP A H    3  
ATOM 4133  H HA   . ASP A 1 56 ? 15.429  11.013  11.796  1.00 0.00 ? 56 ASP A HA   3  
ATOM 4134  H HB2  . ASP A 1 56 ? 15.241  9.309   9.278   1.00 0.00 ? 56 ASP A HB2  3  
ATOM 4135  H HB3  . ASP A 1 56 ? 14.792  11.012  9.324   1.00 0.00 ? 56 ASP A HB3  3  
ATOM 4136  N N    . GLY A 1 57 ? 13.027  8.795   11.618  1.00 0.00 ? 57 GLY A N    3  
ATOM 4137  C CA   . GLY A 1 57 ? 11.594  8.577   11.854  1.00 0.00 ? 57 GLY A CA   3  
ATOM 4138  C C    . GLY A 1 57 ? 10.731  9.005   10.678  1.00 0.00 ? 57 GLY A C    3  
ATOM 4139  O O    . GLY A 1 57 ? 10.083  10.056  10.727  1.00 0.00 ? 57 GLY A O    3  
ATOM 4140  H H    . GLY A 1 57 ? 13.627  8.021   11.583  1.00 0.00 ? 57 GLY A H    3  
ATOM 4141  H HA2  . GLY A 1 57 ? 11.430  7.526   12.045  1.00 0.00 ? 57 GLY A HA2  3  
ATOM 4142  H HA3  . GLY A 1 57 ? 11.298  9.135   12.737  1.00 0.00 ? 57 GLY A HA3  3  
ATOM 4143  N N    . GLN A 1 58 ? 10.752  8.201   9.606   1.00 0.00 ? 58 GLN A N    3  
ATOM 4144  C CA   . GLN A 1 58 ? 10.044  8.508   8.355   1.00 0.00 ? 58 GLN A CA   3  
ATOM 4145  C C    . GLN A 1 58 ? 8.937   7.488   8.085   1.00 0.00 ? 58 GLN A C    3  
ATOM 4146  O O    . GLN A 1 58 ? 9.219   6.319   7.816   1.00 0.00 ? 58 GLN A O    3  
ATOM 4147  C CB   . GLN A 1 58 ? 11.031  8.555   7.159   1.00 0.00 ? 58 GLN A CB   3  
ATOM 4148  C CG   . GLN A 1 58 ? 10.369  8.880   5.796   1.00 0.00 ? 58 GLN A CG   3  
ATOM 4149  C CD   . GLN A 1 58 ? 9.556   10.182  5.783   1.00 0.00 ? 58 GLN A CD   3  
ATOM 4150  O OE1  . GLN A 1 58 ? 8.542   10.277  5.108   1.00 0.00 ? 58 GLN A OE1  3  
ATOM 4151  N NE2  . GLN A 1 58 ? 10.013  11.202  6.494   1.00 0.00 ? 58 GLN A NE2  3  
ATOM 4152  H H    . GLN A 1 58 ? 11.257  7.364   9.665   1.00 0.00 ? 58 GLN A H    3  
ATOM 4153  H HA   . GLN A 1 58 ? 9.588   9.494   8.458   1.00 0.00 ? 58 GLN A HA   3  
ATOM 4154  H HB2  . GLN A 1 58 ? 11.785  9.308   7.359   1.00 0.00 ? 58 GLN A HB2  3  
ATOM 4155  H HB3  . GLN A 1 58 ? 11.523  7.590   7.076   1.00 0.00 ? 58 GLN A HB3  3  
ATOM 4156  H HG2  . GLN A 1 58 ? 11.144  8.965   5.054   1.00 0.00 ? 58 GLN A HG2  3  
ATOM 4157  H HG3  . GLN A 1 58 ? 9.715   8.054   5.532   1.00 0.00 ? 58 GLN A HG3  3  
ATOM 4158  H HE21 . GLN A 1 58 ? 10.845  11.083  6.999   1.00 0.00 ? 58 GLN A HE21 3  
ATOM 4159  H HE22 . GLN A 1 58 ? 9.490   12.021  6.501   1.00 0.00 ? 58 GLN A HE22 3  
ATOM 4160  N N    . TYR A 1 59 ? 7.688   7.941   8.209   1.00 0.00 ? 59 TYR A N    3  
ATOM 4161  C CA   . TYR A 1 59 ? 6.503   7.240   7.697   1.00 0.00 ? 59 TYR A CA   3  
ATOM 4162  C C    . TYR A 1 59 ? 5.610   8.229   6.934   1.00 0.00 ? 59 TYR A C    3  
ATOM 4163  O O    . TYR A 1 59 ? 5.629   9.441   7.212   1.00 0.00 ? 59 TYR A O    3  
ATOM 4164  C CB   . TYR A 1 59 ? 5.718   6.538   8.828   1.00 0.00 ? 59 TYR A CB   3  
ATOM 4165  C CG   . TYR A 1 59 ? 5.141   7.444   9.932   1.00 0.00 ? 59 TYR A CG   3  
ATOM 4166  C CD1  . TYR A 1 59 ? 5.967   8.013   10.904  1.00 0.00 ? 59 TYR A CD1  3  
ATOM 4167  C CD2  . TYR A 1 59 ? 3.773   7.712   10.016  1.00 0.00 ? 59 TYR A CD2  3  
ATOM 4168  C CE1  . TYR A 1 59 ? 5.453   8.804   11.909  1.00 0.00 ? 59 TYR A CE1  3  
ATOM 4169  C CE2  . TYR A 1 59 ? 3.257   8.500   11.027  1.00 0.00 ? 59 TYR A CE2  3  
ATOM 4170  C CZ   . TYR A 1 59 ? 4.104   9.047   11.966  1.00 0.00 ? 59 TYR A CZ   3  
ATOM 4171  O OH   . TYR A 1 59 ? 3.594   9.833   12.973  1.00 0.00 ? 59 TYR A OH   3  
ATOM 4172  H H    . TYR A 1 59 ? 7.554   8.795   8.658   1.00 0.00 ? 59 TYR A H    3  
ATOM 4173  H HA   . TYR A 1 59 ? 6.841   6.480   6.988   1.00 0.00 ? 59 TYR A HA   3  
ATOM 4174  H HB2  . TYR A 1 59 ? 4.892   5.986   8.389   1.00 0.00 ? 59 TYR A HB2  3  
ATOM 4175  H HB3  . TYR A 1 59 ? 6.378   5.825   9.306   1.00 0.00 ? 59 TYR A HB3  3  
ATOM 4176  H HD1  . TYR A 1 59 ? 7.034   7.828   10.865  1.00 0.00 ? 59 TYR A HD1  3  
ATOM 4177  H HD2  . TYR A 1 59 ? 3.107   7.287   9.278   1.00 0.00 ? 59 TYR A HD2  3  
ATOM 4178  H HE1  . TYR A 1 59 ? 6.115   9.232   12.649  1.00 0.00 ? 59 TYR A HE1  3  
ATOM 4179  H HE2  . TYR A 1 59 ? 2.189   8.688   11.074  1.00 0.00 ? 59 TYR A HE2  3  
ATOM 4180  H HH   . TYR A 1 59 ? 2.878   9.364   13.409  1.00 0.00 ? 59 TYR A HH   3  
ATOM 4181  N N    . VAL A 1 60 ? 4.830   7.705   5.972   1.00 0.00 ? 60 VAL A N    3  
ATOM 4182  C CA   . VAL A 1 60 ? 3.868   8.502   5.183   1.00 0.00 ? 60 VAL A CA   3  
ATOM 4183  C C    . VAL A 1 60 ? 2.486   7.820   5.205   1.00 0.00 ? 60 VAL A C    3  
ATOM 4184  O O    . VAL A 1 60 ? 2.324   6.757   5.815   1.00 0.00 ? 60 VAL A O    3  
ATOM 4185  C CB   . VAL A 1 60 ? 4.370   8.732   3.701   1.00 0.00 ? 60 VAL A CB   3  
ATOM 4186  C CG1  . VAL A 1 60 ? 5.658   9.578   3.666   1.00 0.00 ? 60 VAL A CG1  3  
ATOM 4187  C CG2  . VAL A 1 60 ? 4.578   7.405   2.958   1.00 0.00 ? 60 VAL A CG2  3  
ATOM 4188  H H    . VAL A 1 60 ? 4.885   6.734   5.797   1.00 0.00 ? 60 VAL A H    3  
ATOM 4189  H HA   . VAL A 1 60 ? 3.757   9.478   5.658   1.00 0.00 ? 60 VAL A HA   3  
ATOM 4190  H HB   . VAL A 1 60 ? 3.600   9.294   3.172   1.00 0.00 ? 60 VAL A HB   3  
ATOM 4191  H HG11 . VAL A 1 60 ? 6.460   9.049   4.172   1.00 0.00 ? 60 VAL A HG11 3  
ATOM 4192  H HG12 . VAL A 1 60 ? 5.487   10.520  4.168   1.00 0.00 ? 60 VAL A HG12 3  
ATOM 4193  H HG13 . VAL A 1 60 ? 5.949   9.770   2.641   1.00 0.00 ? 60 VAL A HG13 3  
ATOM 4194  H HG21 . VAL A 1 60 ? 4.927   7.596   1.950   1.00 0.00 ? 60 VAL A HG21 3  
ATOM 4195  H HG22 . VAL A 1 60 ? 3.640   6.867   2.910   1.00 0.00 ? 60 VAL A HG22 3  
ATOM 4196  H HG23 . VAL A 1 60 ? 5.307   6.800   3.480   1.00 0.00 ? 60 VAL A HG23 3  
ATOM 4197  N N    . TRP A 1 61 ? 1.492   8.444   4.548   1.00 0.00 ? 61 TRP A N    3  
ATOM 4198  C CA   . TRP A 1 61 ? 0.106   7.927   4.504   1.00 0.00 ? 61 TRP A CA   3  
ATOM 4199  C C    . TRP A 1 61 ? -0.635  8.499   3.291   1.00 0.00 ? 61 TRP A C    3  
ATOM 4200  O O    . TRP A 1 61 ? -0.234  9.524   2.746   1.00 0.00 ? 61 TRP A O    3  
ATOM 4201  C CB   . TRP A 1 61 ? -0.671  8.288   5.805   1.00 0.00 ? 61 TRP A CB   3  
ATOM 4202  C CG   . TRP A 1 61 ? -0.908  9.776   5.997   1.00 0.00 ? 61 TRP A CG   3  
ATOM 4203  C CD1  . TRP A 1 61 ? 0.043   10.729  6.211   1.00 0.00 ? 61 TRP A CD1  3  
ATOM 4204  C CD2  . TRP A 1 61 ? -2.169  10.470  5.980   1.00 0.00 ? 61 TRP A CD2  3  
ATOM 4205  N NE1  . TRP A 1 61 ? -0.540  11.961  6.334   1.00 0.00 ? 61 TRP A NE1  3  
ATOM 4206  C CE2  . TRP A 1 61 ? -1.897  11.832  6.195   1.00 0.00 ? 61 TRP A CE2  3  
ATOM 4207  C CE3  . TRP A 1 61 ? -3.497  10.068  5.804   1.00 0.00 ? 61 TRP A CE3  3  
ATOM 4208  C CZ2  . TRP A 1 61 ? -2.901  12.796  6.245   1.00 0.00 ? 61 TRP A CZ2  3  
ATOM 4209  C CZ3  . TRP A 1 61 ? -4.496  11.024  5.851   1.00 0.00 ? 61 TRP A CZ3  3  
ATOM 4210  C CH2  . TRP A 1 61 ? -4.194  12.375  6.073   1.00 0.00 ? 61 TRP A CH2  3  
ATOM 4211  H H    . TRP A 1 61 ? 1.691   9.282   4.080   1.00 0.00 ? 61 TRP A H    3  
ATOM 4212  H HA   . TRP A 1 61 ? 0.149   6.843   4.404   1.00 0.00 ? 61 TRP A HA   3  
ATOM 4213  H HB2  . TRP A 1 61 ? -1.637  7.793   5.790   1.00 0.00 ? 61 TRP A HB2  3  
ATOM 4214  H HB3  . TRP A 1 61 ? -0.112  7.929   6.659   1.00 0.00 ? 61 TRP A HB3  3  
ATOM 4215  H HD1  . TRP A 1 61 ? 1.104   10.529  6.274   1.00 0.00 ? 61 TRP A HD1  3  
ATOM 4216  H HE1  . TRP A 1 61 ? -0.060  12.807  6.495   1.00 0.00 ? 61 TRP A HE1  3  
ATOM 4217  H HE3  . TRP A 1 61 ? -3.750  9.031   5.637   1.00 0.00 ? 61 TRP A HE3  3  
ATOM 4218  H HZ2  . TRP A 1 61 ? -2.682  13.841  6.413   1.00 0.00 ? 61 TRP A HZ2  3  
ATOM 4219  H HZ3  . TRP A 1 61 ? -5.530  10.735  5.724   1.00 0.00 ? 61 TRP A HZ3  3  
ATOM 4220  H HH2  . TRP A 1 61 ? -5.006  13.093  6.106   1.00 0.00 ? 61 TRP A HH2  3  
ATOM 4221  N N    . PHE A 1 62 ? -1.743  7.853   2.914   1.00 0.00 ? 62 PHE A N    3  
ATOM 4222  C CA   . PHE A 1 62 ? -2.623  8.321   1.831   1.00 0.00 ? 62 PHE A CA   3  
ATOM 4223  C C    . PHE A 1 62 ? -4.076  7.973   2.168   1.00 0.00 ? 62 PHE A C    3  
ATOM 4224  O O    . PHE A 1 62 ? -4.331  7.020   2.907   1.00 0.00 ? 62 PHE A O    3  
ATOM 4225  C CB   . PHE A 1 62 ? -2.204  7.700   0.465   1.00 0.00 ? 62 PHE A CB   3  
ATOM 4226  C CG   . PHE A 1 62 ? -2.253  6.169   0.396   1.00 0.00 ? 62 PHE A CG   3  
ATOM 4227  C CD1  . PHE A 1 62 ? -1.180  5.399   0.837   1.00 0.00 ? 62 PHE A CD1  3  
ATOM 4228  C CD2  . PHE A 1 62 ? -3.370  5.505   -0.110  1.00 0.00 ? 62 PHE A CD2  3  
ATOM 4229  C CE1  . PHE A 1 62 ? -1.220  4.019   0.777   1.00 0.00 ? 62 PHE A CE1  3  
ATOM 4230  C CE2  . PHE A 1 62 ? -3.408  4.127   -0.169  1.00 0.00 ? 62 PHE A CE2  3  
ATOM 4231  C CZ   . PHE A 1 62 ? -2.332  3.384   0.274   1.00 0.00 ? 62 PHE A CZ   3  
ATOM 4232  H H    . PHE A 1 62 ? -1.989  7.028   3.384   1.00 0.00 ? 62 PHE A H    3  
ATOM 4233  H HA   . PHE A 1 62 ? -2.538  9.408   1.769   1.00 0.00 ? 62 PHE A HA   3  
ATOM 4234  H HB2  . PHE A 1 62 ? -2.852  8.093   -0.310  1.00 0.00 ? 62 PHE A HB2  3  
ATOM 4235  H HB3  . PHE A 1 62 ? -1.188  8.013   0.241   1.00 0.00 ? 62 PHE A HB3  3  
ATOM 4236  H HD1  . PHE A 1 62 ? -0.299  5.895   1.237   1.00 0.00 ? 62 PHE A HD1  3  
ATOM 4237  H HD2  . PHE A 1 62 ? -4.218  6.082   -0.463  1.00 0.00 ? 62 PHE A HD2  3  
ATOM 4238  H HE1  . PHE A 1 62 ? -0.376  3.440   1.125   1.00 0.00 ? 62 PHE A HE1  3  
ATOM 4239  H HE2  . PHE A 1 62 ? -4.284  3.629   -0.568  1.00 0.00 ? 62 PHE A HE2  3  
ATOM 4240  H HZ   . PHE A 1 62 ? -2.364  2.306   0.227   1.00 0.00 ? 62 PHE A HZ   3  
ATOM 4241  N N    . ASN A 1 63 ? -5.024  8.750   1.625   1.00 0.00 ? 63 ASN A N    3  
ATOM 4242  C CA   . ASN A 1 63 ? -6.470  8.496   1.808   1.00 0.00 ? 63 ASN A CA   3  
ATOM 4243  C C    . ASN A 1 63 ? -6.957  7.390   0.847   1.00 0.00 ? 63 ASN A C    3  
ATOM 4244  O O    . ASN A 1 63 ? -6.372  7.180   -0.224  1.00 0.00 ? 63 ASN A O    3  
ATOM 4245  C CB   . ASN A 1 63 ? -7.296  9.796   1.584   1.00 0.00 ? 63 ASN A CB   3  
ATOM 4246  C CG   . ASN A 1 63 ? -7.237  10.365  0.149   1.00 0.00 ? 63 ASN A CG   3  
ATOM 4247  O OD1  . ASN A 1 63 ? -6.235  10.225  -0.548  1.00 0.00 ? 63 ASN A OD1  3  
ATOM 4248  N ND2  . ASN A 1 63 ? -8.310  11.013  -0.294  1.00 0.00 ? 63 ASN A ND2  3  
ATOM 4249  H H    . ASN A 1 63 ? -4.749  9.521   1.084   1.00 0.00 ? 63 ASN A H    3  
ATOM 4250  H HA   . ASN A 1 63 ? -6.621  8.160   2.832   1.00 0.00 ? 63 ASN A HA   3  
ATOM 4251  H HB2  . ASN A 1 63 ? -8.333  9.599   1.832   1.00 0.00 ? 63 ASN A HB2  3  
ATOM 4252  H HB3  . ASN A 1 63 ? -6.924  10.557  2.260   1.00 0.00 ? 63 ASN A HB3  3  
ATOM 4253  H HD21 . ASN A 1 63 ? -9.083  11.098  0.306   1.00 0.00 ? 63 ASN A HD21 3  
ATOM 4254  H HD22 . ASN A 1 63 ? -8.282  11.386  -1.198  1.00 0.00 ? 63 ASN A HD22 3  
ATOM 4255  N N    . ILE A 1 64 ? -8.020  6.675   1.249   1.00 0.00 ? 64 ILE A N    3  
ATOM 4256  C CA   . ILE A 1 64 ? -8.704  5.689   0.389   1.00 0.00 ? 64 ILE A CA   3  
ATOM 4257  C C    . ILE A 1 64 ? -10.202 6.018   0.326   1.00 0.00 ? 64 ILE A C    3  
ATOM 4258  O O    . ILE A 1 64 ? -10.782 6.500   1.311   1.00 0.00 ? 64 ILE A O    3  
ATOM 4259  C CB   . ILE A 1 64 ? -8.504  4.203   0.883   1.00 0.00 ? 64 ILE A CB   3  
ATOM 4260  C CG1  . ILE A 1 64 ? -8.955  4.033   2.373   1.00 0.00 ? 64 ILE A CG1  3  
ATOM 4261  C CG2  . ILE A 1 64 ? -7.041  3.745   0.678   1.00 0.00 ? 64 ILE A CG2  3  
ATOM 4262  C CD1  . ILE A 1 64 ? -8.891  2.609   2.901   1.00 0.00 ? 64 ILE A CD1  3  
ATOM 4263  H H    . ILE A 1 64 ? -8.374  6.823   2.153   1.00 0.00 ? 64 ILE A H    3  
ATOM 4264  H HA   . ILE A 1 64 ? -8.298  5.770   -0.621  1.00 0.00 ? 64 ILE A HA   3  
ATOM 4265  H HB   . ILE A 1 64 ? -9.129  3.564   0.260   1.00 0.00 ? 64 ILE A HB   3  
ATOM 4266  H HG12 . ILE A 1 64 ? -8.324  4.642   3.009   1.00 0.00 ? 64 ILE A HG12 3  
ATOM 4267  H HG13 . ILE A 1 64 ? -9.979  4.372   2.476   1.00 0.00 ? 64 ILE A HG13 3  
ATOM 4268  H HG21 . ILE A 1 64 ? -6.774  3.836   -0.366  1.00 0.00 ? 64 ILE A HG21 3  
ATOM 4269  H HG22 . ILE A 1 64 ? -6.934  2.708   0.978   1.00 0.00 ? 64 ILE A HG22 3  
ATOM 4270  H HG23 . ILE A 1 64 ? -6.375  4.357   1.273   1.00 0.00 ? 64 ILE A HG23 3  
ATOM 4271  H HD11 . ILE A 1 64 ? -7.869  2.256   2.868   1.00 0.00 ? 64 ILE A HD11 3  
ATOM 4272  H HD12 . ILE A 1 64 ? -9.514  1.965   2.298   1.00 0.00 ? 64 ILE A HD12 3  
ATOM 4273  H HD13 . ILE A 1 64 ? -9.240  2.591   3.923   1.00 0.00 ? 64 ILE A HD13 3  
ATOM 4274  N N    . GLY A 1 65 ? -10.806 5.784   -0.846  1.00 0.00 ? 65 GLY A N    3  
ATOM 4275  C CA   . GLY A 1 65 ? -12.244 5.947   -1.026  1.00 0.00 ? 65 GLY A CA   3  
ATOM 4276  C C    . GLY A 1 65 ? -13.008 4.778   -0.426  1.00 0.00 ? 65 GLY A C    3  
ATOM 4277  O O    . GLY A 1 65 ? -13.780 4.945   0.527   1.00 0.00 ? 65 GLY A O    3  
ATOM 4278  H H    . GLY A 1 65 ? -10.260 5.494   -1.605  1.00 0.00 ? 65 GLY A H    3  
ATOM 4279  H HA2  . GLY A 1 65 ? -12.569 6.876   -0.563  1.00 0.00 ? 65 GLY A HA2  3  
ATOM 4280  H HA3  . GLY A 1 65 ? -12.457 5.998   -2.083  1.00 0.00 ? 65 GLY A HA3  3  
ATOM 4281  N N    . SER A 1 66 ? -12.755 3.576   -0.964  1.00 0.00 ? 66 SER A N    3  
ATOM 4282  C CA   . SER A 1 66 ? -13.343 2.321   -0.470  1.00 0.00 ? 66 SER A CA   3  
ATOM 4283  C C    . SER A 1 66 ? -12.218 1.311   -0.207  1.00 0.00 ? 66 SER A C    3  
ATOM 4284  O O    . SER A 1 66 ? -11.327 1.149   -1.037  1.00 0.00 ? 66 SER A O    3  
ATOM 4285  C CB   . SER A 1 66 ? -14.346 1.756   -1.494  1.00 0.00 ? 66 SER A CB   3  
ATOM 4286  O OG   . SER A 1 66 ? -15.370 2.697   -1.787  1.00 0.00 ? 66 SER A OG   3  
ATOM 4287  H H    . SER A 1 66 ? -12.135 3.523   -1.722  1.00 0.00 ? 66 SER A H    3  
ATOM 4288  H HA   . SER A 1 66 ? -13.869 2.520   0.466   1.00 0.00 ? 66 SER A HA   3  
ATOM 4289  H HB2  . SER A 1 66 ? -13.827 1.514   -2.412  1.00 0.00 ? 66 SER A HB2  3  
ATOM 4290  H HB3  . SER A 1 66 ? -14.806 0.856   -1.101  1.00 0.00 ? 66 SER A HB3  3  
ATOM 4291  H HG   . SER A 1 66 ? -15.768 3.002   -0.968  1.00 0.00 ? 66 SER A HG   3  
ATOM 4292  N N    . VAL A 1 67 ? -12.281 0.650   0.962   1.00 0.00 ? 67 VAL A N    3  
ATOM 4293  C CA   . VAL A 1 67 ? -11.333 -0.415  1.374   1.00 0.00 ? 67 VAL A CA   3  
ATOM 4294  C C    . VAL A 1 67 ? -11.313 -1.573  0.364   1.00 0.00 ? 67 VAL A C    3  
ATOM 4295  O O    . VAL A 1 67 ? -10.248 -2.108  0.042   1.00 0.00 ? 67 VAL A O    3  
ATOM 4296  C CB   . VAL A 1 67 ? -11.706 -0.972  2.799   1.00 0.00 ? 67 VAL A CB   3  
ATOM 4297  C CG1  . VAL A 1 67 ? -10.761 -2.117  3.247   1.00 0.00 ? 67 VAL A CG1  3  
ATOM 4298  C CG2  . VAL A 1 67 ? -11.712 0.171   3.826   1.00 0.00 ? 67 VAL A CG2  3  
ATOM 4299  H H    . VAL A 1 67 ? -12.991 0.912   1.586   1.00 0.00 ? 67 VAL A H    3  
ATOM 4300  H HA   . VAL A 1 67 ? -10.340 0.026   1.428   1.00 0.00 ? 67 VAL A HA   3  
ATOM 4301  H HB   . VAL A 1 67 ? -12.716 -1.380  2.751   1.00 0.00 ? 67 VAL A HB   3  
ATOM 4302  H HG11 . VAL A 1 67 ? -10.824 -2.940  2.546   1.00 0.00 ? 67 VAL A HG11 3  
ATOM 4303  H HG12 . VAL A 1 67 ? -11.047 -2.471  4.229   1.00 0.00 ? 67 VAL A HG12 3  
ATOM 4304  H HG13 . VAL A 1 67 ? -9.738  -1.759  3.286   1.00 0.00 ? 67 VAL A HG13 3  
ATOM 4305  H HG21 . VAL A 1 67 ? -12.013 -0.209  4.795   1.00 0.00 ? 67 VAL A HG21 3  
ATOM 4306  H HG22 . VAL A 1 67 ? -12.414 0.938   3.516   1.00 0.00 ? 67 VAL A HG22 3  
ATOM 4307  H HG23 . VAL A 1 67 ? -10.724 0.605   3.906   1.00 0.00 ? 67 VAL A HG23 3  
ATOM 4308  N N    . ASP A 1 68 ? -12.512 -1.928  -0.130  1.00 0.00 ? 68 ASP A N    3  
ATOM 4309  C CA   . ASP A 1 68 ? -12.698 -2.994  -1.130  1.00 0.00 ? 68 ASP A CA   3  
ATOM 4310  C C    . ASP A 1 68 ? -12.013 -2.621  -2.451  1.00 0.00 ? 68 ASP A C    3  
ATOM 4311  O O    . ASP A 1 68 ? -11.372 -3.461  -3.071  1.00 0.00 ? 68 ASP A O    3  
ATOM 4312  C CB   . ASP A 1 68 ? -14.214 -3.281  -1.334  1.00 0.00 ? 68 ASP A CB   3  
ATOM 4313  C CG   . ASP A 1 68 ? -14.510 -4.365  -2.389  1.00 0.00 ? 68 ASP A CG   3  
ATOM 4314  O OD1  . ASP A 1 68 ? -14.341 -5.576  -2.096  1.00 0.00 ? 68 ASP A OD1  3  
ATOM 4315  O OD2  . ASP A 1 68 ? -14.879 -4.013  -3.531  1.00 0.00 ? 68 ASP A OD2  3  
ATOM 4316  H H    . ASP A 1 68 ? -13.307 -1.453  0.188   1.00 0.00 ? 68 ASP A H    3  
ATOM 4317  H HA   . ASP A 1 68 ? -12.225 -3.890  -0.735  1.00 0.00 ? 68 ASP A HA   3  
ATOM 4318  H HB2  . ASP A 1 68 ? -14.635 -3.607  -0.390  1.00 0.00 ? 68 ASP A HB2  3  
ATOM 4319  H HB3  . ASP A 1 68 ? -14.706 -2.358  -1.629  1.00 0.00 ? 68 ASP A HB3  3  
ATOM 4320  N N    . THR A 1 69 ? -12.117 -1.345  -2.854  1.00 0.00 ? 69 THR A N    3  
ATOM 4321  C CA   . THR A 1 69 ? -11.445 -0.856  -4.065  1.00 0.00 ? 69 THR A CA   3  
ATOM 4322  C C    . THR A 1 69 ? -9.912  -0.857  -3.866  1.00 0.00 ? 69 THR A C    3  
ATOM 4323  O O    . THR A 1 69 ? -9.182  -1.321  -4.736  1.00 0.00 ? 69 THR A O    3  
ATOM 4324  C CB   . THR A 1 69 ? -11.948 0.567   -4.463  1.00 0.00 ? 69 THR A CB   3  
ATOM 4325  O OG1  . THR A 1 69 ? -13.385 0.584   -4.471  1.00 0.00 ? 69 THR A OG1  3  
ATOM 4326  C CG2  . THR A 1 69 ? -11.441 1.005   -5.849  1.00 0.00 ? 69 THR A CG2  3  
ATOM 4327  H H    . THR A 1 69 ? -12.655 -0.724  -2.330  1.00 0.00 ? 69 THR A H    3  
ATOM 4328  H HA   . THR A 1 69 ? -11.694 -1.538  -4.880  1.00 0.00 ? 69 THR A HA   3  
ATOM 4329  H HB   . THR A 1 69 ? -11.604 1.287   -3.721  1.00 0.00 ? 69 THR A HB   3  
ATOM 4330  H HG1  . THR A 1 69 ? -13.721 -0.218  -4.892  1.00 0.00 ? 69 THR A HG1  3  
ATOM 4331  H HG21 . THR A 1 69 ? -10.360 1.019   -5.848  1.00 0.00 ? 69 THR A HG21 3  
ATOM 4332  H HG22 . THR A 1 69 ? -11.802 2.001   -6.071  1.00 0.00 ? 69 THR A HG22 3  
ATOM 4333  H HG23 . THR A 1 69 ? -11.794 0.319   -6.606  1.00 0.00 ? 69 THR A HG23 3  
ATOM 4334  N N    . PHE A 1 70 ? -9.454  -0.359  -2.692  1.00 0.00 ? 70 PHE A N    3  
ATOM 4335  C CA   . PHE A 1 70 ? -8.029  -0.350  -2.283  1.00 0.00 ? 70 PHE A CA   3  
ATOM 4336  C C    . PHE A 1 70 ? -7.368  -1.734  -2.420  1.00 0.00 ? 70 PHE A C    3  
ATOM 4337  O O    . PHE A 1 70 ? -6.314  -1.855  -3.049  1.00 0.00 ? 70 PHE A O    3  
ATOM 4338  C CB   . PHE A 1 70 ? -7.915  0.174   -0.811  1.00 0.00 ? 70 PHE A CB   3  
ATOM 4339  C CG   . PHE A 1 70 ? -6.567  -0.109  -0.115  1.00 0.00 ? 70 PHE A CG   3  
ATOM 4340  C CD1  . PHE A 1 70 ? -5.402  0.545   -0.509  1.00 0.00 ? 70 PHE A CD1  3  
ATOM 4341  C CD2  . PHE A 1 70 ? -6.477  -1.054  0.912   1.00 0.00 ? 70 PHE A CD2  3  
ATOM 4342  C CE1  . PHE A 1 70 ? -4.194  0.264   0.098   1.00 0.00 ? 70 PHE A CE1  3  
ATOM 4343  C CE2  . PHE A 1 70 ? -5.267  -1.330  1.520   1.00 0.00 ? 70 PHE A CE2  3  
ATOM 4344  C CZ   . PHE A 1 70 ? -4.126  -0.671  1.110   1.00 0.00 ? 70 PHE A CZ   3  
ATOM 4345  H H    . PHE A 1 70 ? -10.090 0.045   -2.077  1.00 0.00 ? 70 PHE A H    3  
ATOM 4346  H HA   . PHE A 1 70 ? -7.515  0.343   -2.935  1.00 0.00 ? 70 PHE A HA   3  
ATOM 4347  H HB2  . PHE A 1 70 ? -8.067  1.249   -0.810  1.00 0.00 ? 70 PHE A HB2  3  
ATOM 4348  H HB3  . PHE A 1 70 ? -8.707  -0.278  -0.217  1.00 0.00 ? 70 PHE A HB3  3  
ATOM 4349  H HD1  . PHE A 1 70 ? -5.451  1.287   -1.301  1.00 0.00 ? 70 PHE A HD1  3  
ATOM 4350  H HD2  . PHE A 1 70 ? -7.375  -1.572  1.237   1.00 0.00 ? 70 PHE A HD2  3  
ATOM 4351  H HE1  . PHE A 1 70 ? -3.302  0.779   -0.222  1.00 0.00 ? 70 PHE A HE1  3  
ATOM 4352  H HE2  . PHE A 1 70 ? -5.216  -2.063  2.311   1.00 0.00 ? 70 PHE A HE2  3  
ATOM 4353  H HZ   . PHE A 1 70 ? -3.178  -0.890  1.580   1.00 0.00 ? 70 PHE A HZ   3  
ATOM 4354  N N    . GLU A 1 71 ? -7.990  -2.755  -1.819  1.00 0.00 ? 71 GLU A N    3  
ATOM 4355  C CA   . GLU A 1 71 ? -7.416  -4.108  -1.760  1.00 0.00 ? 71 GLU A CA   3  
ATOM 4356  C C    . GLU A 1 71 ? -7.452  -4.779  -3.145  1.00 0.00 ? 71 GLU A C    3  
ATOM 4357  O O    . GLU A 1 71 ? -6.521  -5.500  -3.502  1.00 0.00 ? 71 GLU A O    3  
ATOM 4358  C CB   . GLU A 1 71 ? -8.147  -4.975  -0.701  1.00 0.00 ? 71 GLU A CB   3  
ATOM 4359  C CG   . GLU A 1 71 ? -9.635  -5.256  -1.017  1.00 0.00 ? 71 GLU A CG   3  
ATOM 4360  C CD   . GLU A 1 71 ? -10.335 -6.163  -0.001  1.00 0.00 ? 71 GLU A CD   3  
ATOM 4361  O OE1  . GLU A 1 71 ? -9.992  -7.365  0.067   1.00 0.00 ? 71 GLU A OE1  3  
ATOM 4362  O OE2  . GLU A 1 71 ? -11.236 -5.694  0.733   1.00 0.00 ? 71 GLU A OE2  3  
ATOM 4363  H H    . GLU A 1 71 ? -8.863  -2.593  -1.404  1.00 0.00 ? 71 GLU A H    3  
ATOM 4364  H HA   . GLU A 1 71 ? -6.374  -4.010  -1.468  1.00 0.00 ? 71 GLU A HA   3  
ATOM 4365  H HB2  . GLU A 1 71 ? -7.635  -5.929  -0.614  1.00 0.00 ? 71 GLU A HB2  3  
ATOM 4366  H HB3  . GLU A 1 71 ? -8.094  -4.467  0.252   1.00 0.00 ? 71 GLU A HB3  3  
ATOM 4367  H HG2  . GLU A 1 71 ? -10.161 -4.305  -1.064  1.00 0.00 ? 71 GLU A HG2  3  
ATOM 4368  H HG3  . GLU A 1 71 ? -9.702  -5.722  -1.997  1.00 0.00 ? 71 GLU A HG3  3  
ATOM 4369  N N    . ARG A 1 72 ? -8.520  -4.514  -3.926  1.00 0.00 ? 72 ARG A N    3  
ATOM 4370  C CA   . ARG A 1 72 ? -8.656  -5.049  -5.292  1.00 0.00 ? 72 ARG A CA   3  
ATOM 4371  C C    . ARG A 1 72 ? -7.594  -4.438  -6.220  1.00 0.00 ? 72 ARG A C    3  
ATOM 4372  O O    . ARG A 1 72 ? -7.021  -5.143  -7.060  1.00 0.00 ? 72 ARG A O    3  
ATOM 4373  C CB   . ARG A 1 72 ? -10.082 -4.817  -5.871  1.00 0.00 ? 72 ARG A CB   3  
ATOM 4374  C CG   . ARG A 1 72 ? -11.201 -5.671  -5.215  1.00 0.00 ? 72 ARG A CG   3  
ATOM 4375  C CD   . ARG A 1 72 ? -12.590 -5.463  -5.872  1.00 0.00 ? 72 ARG A CD   3  
ATOM 4376  N NE   . ARG A 1 72 ? -13.644 -6.221  -5.148  1.00 0.00 ? 72 ARG A NE   3  
ATOM 4377  C CZ   . ARG A 1 72 ? -14.642 -6.935  -5.712  1.00 0.00 ? 72 ARG A CZ   3  
ATOM 4378  N NH1  . ARG A 1 72 ? -14.756 -7.025  -7.039  1.00 0.00 ? 72 ARG A NH1  3  
ATOM 4379  N NH2  . ARG A 1 72 ? -15.519 -7.564  -4.932  1.00 0.00 ? 72 ARG A NH2  3  
ATOM 4380  H H    . ARG A 1 72 ? -9.231  -3.939  -3.567  1.00 0.00 ? 72 ARG A H    3  
ATOM 4381  H HA   . ARG A 1 72 ? -8.474  -6.118  -5.237  1.00 0.00 ? 72 ARG A HA   3  
ATOM 4382  H HB2  . ARG A 1 72 ? -10.337 -3.771  -5.746  1.00 0.00 ? 72 ARG A HB2  3  
ATOM 4383  H HB3  . ARG A 1 72 ? -10.067 -5.040  -6.934  1.00 0.00 ? 72 ARG A HB3  3  
ATOM 4384  H HG2  . ARG A 1 72 ? -10.936 -6.718  -5.293  1.00 0.00 ? 72 ARG A HG2  3  
ATOM 4385  H HG3  . ARG A 1 72 ? -11.268 -5.402  -4.168  1.00 0.00 ? 72 ARG A HG3  3  
ATOM 4386  H HD2  . ARG A 1 72 ? -12.840 -4.407  -5.841  1.00 0.00 ? 72 ARG A HD2  3  
ATOM 4387  H HD3  . ARG A 1 72 ? -12.551 -5.793  -6.903  1.00 0.00 ? 72 ARG A HD3  3  
ATOM 4388  H HE   . ARG A 1 72 ? -13.608 -6.175  -4.164  1.00 0.00 ? 72 ARG A HE   3  
ATOM 4389  H HH11 . ARG A 1 72 ? -14.094 -6.564  -7.637  1.00 0.00 ? 72 ARG A HH11 3  
ATOM 4390  H HH12 . ARG A 1 72 ? -15.495 -7.567  -7.449  1.00 0.00 ? 72 ARG A HH12 3  
ATOM 4391  H HH21 . ARG A 1 72 ? -15.439 -7.510  -3.930  1.00 0.00 ? 72 ARG A HH21 3  
ATOM 4392  H HH22 . ARG A 1 72 ? -16.259 -8.102  -5.339  1.00 0.00 ? 72 ARG A HH22 3  
ATOM 4393  N N    . ASN A 1 73 ? -7.324  -3.128  -6.053  1.00 0.00 ? 73 ASN A N    3  
ATOM 4394  C CA   . ASN A 1 73 ? -6.289  -2.417  -6.820  1.00 0.00 ? 73 ASN A CA   3  
ATOM 4395  C C    . ASN A 1 73 ? -4.907  -2.940  -6.448  1.00 0.00 ? 73 ASN A C    3  
ATOM 4396  O O    . ASN A 1 73 ? -4.158  -3.357  -7.322  1.00 0.00 ? 73 ASN A O    3  
ATOM 4397  C CB   . ASN A 1 73 ? -6.362  -0.881  -6.577  1.00 0.00 ? 73 ASN A CB   3  
ATOM 4398  C CG   . ASN A 1 73 ? -7.629  -0.233  -7.142  1.00 0.00 ? 73 ASN A CG   3  
ATOM 4399  O OD1  . ASN A 1 73 ? -8.183  -0.689  -8.135  1.00 0.00 ? 73 ASN A OD1  3  
ATOM 4400  N ND2  . ASN A 1 73 ? -8.092  0.830   -6.511  1.00 0.00 ? 73 ASN A ND2  3  
ATOM 4401  H H    . ASN A 1 73 ? -7.823  -2.615  -5.390  1.00 0.00 ? 73 ASN A H    3  
ATOM 4402  H HA   . ASN A 1 73 ? -6.464  -2.616  -7.879  1.00 0.00 ? 73 ASN A HA   3  
ATOM 4403  H HB2  . ASN A 1 73 ? -6.328  -0.687  -5.509  1.00 0.00 ? 73 ASN A HB2  3  
ATOM 4404  H HB3  . ASN A 1 73 ? -5.506  -0.404  -7.039  1.00 0.00 ? 73 ASN A HB3  3  
ATOM 4405  H HD21 . ASN A 1 73 ? -7.607  1.142   -5.717  1.00 0.00 ? 73 ASN A HD21 3  
ATOM 4406  H HD22 . ASN A 1 73 ? -8.886  1.269   -6.867  1.00 0.00 ? 73 ASN A HD22 3  
ATOM 4407  N N    . LEU A 1 74 ? -4.618  -2.952  -5.135  1.00 0.00 ? 74 LEU A N    3  
ATOM 4408  C CA   . LEU A 1 74 ? -3.326  -3.377  -4.577  1.00 0.00 ? 74 LEU A CA   3  
ATOM 4409  C C    . LEU A 1 74 ? -2.934  -4.778  -5.075  1.00 0.00 ? 74 LEU A C    3  
ATOM 4410  O O    . LEU A 1 74 ? -1.874  -4.946  -5.670  1.00 0.00 ? 74 LEU A O    3  
ATOM 4411  C CB   . LEU A 1 74 ? -3.387  -3.359  -3.022  1.00 0.00 ? 74 LEU A CB   3  
ATOM 4412  C CG   . LEU A 1 74 ? -2.064  -3.731  -2.280  1.00 0.00 ? 74 LEU A CG   3  
ATOM 4413  C CD1  . LEU A 1 74 ? -0.943  -2.700  -2.546  1.00 0.00 ? 74 LEU A CD1  3  
ATOM 4414  C CD2  . LEU A 1 74 ? -2.310  -3.920  -0.769  1.00 0.00 ? 74 LEU A CD2  3  
ATOM 4415  H H    . LEU A 1 74 ? -5.308  -2.660  -4.511  1.00 0.00 ? 74 LEU A H    3  
ATOM 4416  H HA   . LEU A 1 74 ? -2.575  -2.663  -4.905  1.00 0.00 ? 74 LEU A HA   3  
ATOM 4417  H HB2  . LEU A 1 74 ? -3.690  -2.364  -2.701  1.00 0.00 ? 74 LEU A HB2  3  
ATOM 4418  H HB3  . LEU A 1 74 ? -4.159  -4.057  -2.706  1.00 0.00 ? 74 LEU A HB3  3  
ATOM 4419  H HG   . LEU A 1 74 ? -1.714  -4.680  -2.667  1.00 0.00 ? 74 LEU A HG   3  
ATOM 4420  H HD11 . LEU A 1 74 ? -1.254  -1.716  -2.211  1.00 0.00 ? 74 LEU A HD11 3  
ATOM 4421  H HD12 . LEU A 1 74 ? -0.724  -2.665  -3.604  1.00 0.00 ? 74 LEU A HD12 3  
ATOM 4422  H HD13 . LEU A 1 74 ? -0.048  -2.991  -2.012  1.00 0.00 ? 74 LEU A HD13 3  
ATOM 4423  H HD21 . LEU A 1 74 ? -2.693  -3.003  -0.334  1.00 0.00 ? 74 LEU A HD21 3  
ATOM 4424  H HD22 . LEU A 1 74 ? -1.382  -4.187  -0.278  1.00 0.00 ? 74 LEU A HD22 3  
ATOM 4425  H HD23 . LEU A 1 74 ? -3.028  -4.714  -0.614  1.00 0.00 ? 74 LEU A HD23 3  
ATOM 4426  N N    . GLU A 1 75 ? -3.831  -5.749  -4.863  1.00 0.00 ? 75 GLU A N    3  
ATOM 4427  C CA   . GLU A 1 75 ? -3.594  -7.156  -5.222  1.00 0.00 ? 75 GLU A CA   3  
ATOM 4428  C C    . GLU A 1 75 ? -3.382  -7.357  -6.737  1.00 0.00 ? 75 GLU A C    3  
ATOM 4429  O O    . GLU A 1 75 ? -2.402  -7.991  -7.129  1.00 0.00 ? 75 GLU A O    3  
ATOM 4430  C CB   . GLU A 1 75 ? -4.756  -8.043  -4.720  1.00 0.00 ? 75 GLU A CB   3  
ATOM 4431  C CG   . GLU A 1 75 ? -4.798  -8.203  -3.189  1.00 0.00 ? 75 GLU A CG   3  
ATOM 4432  C CD   . GLU A 1 75 ? -3.512  -8.830  -2.631  1.00 0.00 ? 75 GLU A CD   3  
ATOM 4433  O OE1  . GLU A 1 75 ? -3.203  -9.983  -3.020  1.00 0.00 ? 75 GLU A OE1  3  
ATOM 4434  O OE2  . GLU A 1 75 ? -2.798  -8.189  -1.825  1.00 0.00 ? 75 GLU A OE2  3  
ATOM 4435  H H    . GLU A 1 75 ? -4.681  -5.501  -4.450  1.00 0.00 ? 75 GLU A H    3  
ATOM 4436  H HA   . GLU A 1 75 ? -2.682  -7.461  -4.712  1.00 0.00 ? 75 GLU A HA   3  
ATOM 4437  H HB2  . GLU A 1 75 ? -5.697  -7.605  -5.046  1.00 0.00 ? 75 GLU A HB2  3  
ATOM 4438  H HB3  . GLU A 1 75 ? -4.668  -9.030  -5.160  1.00 0.00 ? 75 GLU A HB3  3  
ATOM 4439  H HG2  . GLU A 1 75 ? -4.949  -7.224  -2.741  1.00 0.00 ? 75 GLU A HG2  3  
ATOM 4440  H HG3  . GLU A 1 75 ? -5.637  -8.837  -2.932  1.00 0.00 ? 75 GLU A HG3  3  
ATOM 4441  N N    . THR A 1 76 ? -4.278  -6.786  -7.566  1.00 0.00 ? 76 THR A N    3  
ATOM 4442  C CA   . THR A 1 76 ? -4.217  -6.942  -9.035  1.00 0.00 ? 76 THR A CA   3  
ATOM 4443  C C    . THR A 1 76 ? -2.928  -6.286  -9.587  1.00 0.00 ? 76 THR A C    3  
ATOM 4444  O O    . THR A 1 76 ? -2.159  -6.921  -10.308 1.00 0.00 ? 76 THR A O    3  
ATOM 4445  C CB   . THR A 1 76 ? -5.496  -6.335  -9.703  1.00 0.00 ? 76 THR A CB   3  
ATOM 4446  O OG1  . THR A 1 76 ? -6.661  -6.953  -9.129  1.00 0.00 ? 76 THR A OG1  3  
ATOM 4447  C CG2  . THR A 1 76 ? -5.531  -6.535  -11.224 1.00 0.00 ? 76 THR A CG2  3  
ATOM 4448  H H    . THR A 1 76 ? -4.971  -6.213  -7.174  1.00 0.00 ? 76 THR A H    3  
ATOM 4449  H HA   . THR A 1 76 ? -4.186  -8.006  -9.253  1.00 0.00 ? 76 THR A HA   3  
ATOM 4450  H HB   . THR A 1 76 ? -5.531  -5.268  -9.483  1.00 0.00 ? 76 THR A HB   3  
ATOM 4451  H HG1  . THR A 1 76 ? -6.613  -6.884  -8.165  1.00 0.00 ? 76 THR A HG1  3  
ATOM 4452  H HG21 . THR A 1 76 ? -4.663  -6.076  -11.675 1.00 0.00 ? 76 THR A HG21 3  
ATOM 4453  H HG22 . THR A 1 76 ? -6.422  -6.075  -11.628 1.00 0.00 ? 76 THR A HG22 3  
ATOM 4454  H HG23 . THR A 1 76 ? -5.540  -7.595  -11.458 1.00 0.00 ? 76 THR A HG23 3  
ATOM 4455  N N    . LEU A 1 77 ? -2.704  -5.025  -9.171  1.00 0.00 ? 77 LEU A N    3  
ATOM 4456  C CA   . LEU A 1 77 ? -1.475  -4.239  -9.444  1.00 0.00 ? 77 LEU A CA   3  
ATOM 4457  C C    . LEU A 1 77 ? -0.192  -5.013  -9.094  1.00 0.00 ? 77 LEU A C    3  
ATOM 4458  O O    . LEU A 1 77 ? 0.740   -5.053  -9.893  1.00 0.00 ? 77 LEU A O    3  
ATOM 4459  C CB   . LEU A 1 77 ? -1.538  -2.914  -8.640  1.00 0.00 ? 77 LEU A CB   3  
ATOM 4460  C CG   . LEU A 1 77 ? -0.335  -1.937  -8.747  1.00 0.00 ? 77 LEU A CG   3  
ATOM 4461  C CD1  . LEU A 1 77 ? -0.075  -1.488  -10.200 1.00 0.00 ? 77 LEU A CD1  3  
ATOM 4462  C CD2  . LEU A 1 77 ? -0.564  -0.724  -7.825  1.00 0.00 ? 77 LEU A CD2  3  
ATOM 4463  H H    . LEU A 1 77 ? -3.427  -4.585  -8.684  1.00 0.00 ? 77 LEU A H    3  
ATOM 4464  H HA   . LEU A 1 77 ? -1.468  -4.010  -10.503 1.00 0.00 ? 77 LEU A HA   3  
ATOM 4465  H HB2  . LEU A 1 77 ? -2.431  -2.383  -8.951  1.00 0.00 ? 77 LEU A HB2  3  
ATOM 4466  H HB3  . LEU A 1 77 ? -1.667  -3.177  -7.586  1.00 0.00 ? 77 LEU A HB3  3  
ATOM 4467  H HG   . LEU A 1 77 ? 0.557   -2.445  -8.401  1.00 0.00 ? 77 LEU A HG   3  
ATOM 4468  H HD11 . LEU A 1 77 ? 0.154   -2.350  -10.811 1.00 0.00 ? 77 LEU A HD11 3  
ATOM 4469  H HD12 . LEU A 1 77 ? 0.770   -0.811  -10.223 1.00 0.00 ? 77 LEU A HD12 3  
ATOM 4470  H HD13 . LEU A 1 77 ? -0.946  -0.984  -10.599 1.00 0.00 ? 77 LEU A HD13 3  
ATOM 4471  H HD21 . LEU A 1 77 ? -1.452  -0.182  -8.132  1.00 0.00 ? 77 LEU A HD21 3  
ATOM 4472  H HD22 . LEU A 1 77 ? 0.292   -0.063  -7.875  1.00 0.00 ? 77 LEU A HD22 3  
ATOM 4473  H HD23 . LEU A 1 77 ? -0.686  -1.059  -6.804  1.00 0.00 ? 77 LEU A HD23 3  
ATOM 4474  N N    . GLN A 1 78 ? -0.176  -5.644  -7.904  1.00 0.00 ? 78 GLN A N    3  
ATOM 4475  C CA   . GLN A 1 78 ? 0.968   -6.458  -7.444  1.00 0.00 ? 78 GLN A CA   3  
ATOM 4476  C C    . GLN A 1 78 ? 1.207   -7.650  -8.398  1.00 0.00 ? 78 GLN A C    3  
ATOM 4477  O O    . GLN A 1 78 ? 2.331   -7.871  -8.855  1.00 0.00 ? 78 GLN A O    3  
ATOM 4478  C CB   . GLN A 1 78 ? 0.742   -6.939  -5.974  1.00 0.00 ? 78 GLN A CB   3  
ATOM 4479  C CG   . GLN A 1 78 ? 0.993   -5.852  -4.892  1.00 0.00 ? 78 GLN A CG   3  
ATOM 4480  C CD   . GLN A 1 78 ? 0.655   -6.292  -3.455  1.00 0.00 ? 78 GLN A CD   3  
ATOM 4481  O OE1  . GLN A 1 78 ? 1.333   -5.904  -2.499  1.00 0.00 ? 78 GLN A OE1  3  
ATOM 4482  N NE2  . GLN A 1 78 ? -0.431  -7.041  -3.277  1.00 0.00 ? 78 GLN A NE2  3  
ATOM 4483  H H    . GLN A 1 78 ? -0.962  -5.580  -7.329  1.00 0.00 ? 78 GLN A H    3  
ATOM 4484  H HA   . GLN A 1 78 ? 1.853   -5.820  -7.469  1.00 0.00 ? 78 GLN A HA   3  
ATOM 4485  H HB2  . GLN A 1 78 ? -0.280  -7.286  -5.873  1.00 0.00 ? 78 GLN A HB2  3  
ATOM 4486  H HB3  . GLN A 1 78 ? 1.407   -7.776  -5.765  1.00 0.00 ? 78 GLN A HB3  3  
ATOM 4487  H HG2  . GLN A 1 78 ? 2.041   -5.570  -4.923  1.00 0.00 ? 78 GLN A HG2  3  
ATOM 4488  H HG3  . GLN A 1 78 ? 0.396   -4.981  -5.131  1.00 0.00 ? 78 GLN A HG3  3  
ATOM 4489  H HE21 . GLN A 1 78 ? -0.965  -7.285  -4.058  1.00 0.00 ? 78 GLN A HE21 3  
ATOM 4490  H HE22 . GLN A 1 78 ? -0.673  -7.297  -2.358  1.00 0.00 ? 78 GLN A HE22 3  
ATOM 4491  N N    . GLN A 1 79 ? 0.116   -8.352  -8.748  1.00 0.00 ? 79 GLN A N    3  
ATOM 4492  C CA   . GLN A 1 79 ? 0.161   -9.530  -9.648  1.00 0.00 ? 79 GLN A CA   3  
ATOM 4493  C C    . GLN A 1 79 ? 0.665   -9.135  -11.056 1.00 0.00 ? 79 GLN A C    3  
ATOM 4494  O O    . GLN A 1 79 ? 1.371   -9.912  -11.709 1.00 0.00 ? 79 GLN A O    3  
ATOM 4495  C CB   . GLN A 1 79 ? -1.236  -10.205 -9.751  1.00 0.00 ? 79 GLN A CB   3  
ATOM 4496  C CG   . GLN A 1 79 ? -1.776  -10.744 -8.410  1.00 0.00 ? 79 GLN A CG   3  
ATOM 4497  C CD   . GLN A 1 79 ? -3.222  -11.246 -8.487  1.00 0.00 ? 79 GLN A CD   3  
ATOM 4498  O OE1  . GLN A 1 79 ? -3.657  -11.780 -9.500  1.00 0.00 ? 79 GLN A OE1  3  
ATOM 4499  N NE2  . GLN A 1 79 ? -3.991  -11.043 -7.428  1.00 0.00 ? 79 GLN A NE2  3  
ATOM 4500  H H    . GLN A 1 79 ? -0.744  -8.041  -8.410  1.00 0.00 ? 79 GLN A H    3  
ATOM 4501  H HA   . GLN A 1 79 ? 0.862   -10.241 -9.221  1.00 0.00 ? 79 GLN A HA   3  
ATOM 4502  H HB2  . GLN A 1 79 ? -1.948  -9.476  -10.137 1.00 0.00 ? 79 GLN A HB2  3  
ATOM 4503  H HB3  . GLN A 1 79 ? -1.175  -11.030 -10.452 1.00 0.00 ? 79 GLN A HB3  3  
ATOM 4504  H HG2  . GLN A 1 79 ? -1.145  -11.571 -8.087  1.00 0.00 ? 79 GLN A HG2  3  
ATOM 4505  H HG3  . GLN A 1 79 ? -1.718  -9.955  -7.671  1.00 0.00 ? 79 GLN A HG3  3  
ATOM 4506  H HE21 . GLN A 1 79 ? -3.600  -10.597 -6.651  1.00 0.00 ? 79 GLN A HE21 3  
ATOM 4507  H HE22 . GLN A 1 79 ? -4.917  -11.365 -7.460  1.00 0.00 ? 79 GLN A HE22 3  
ATOM 4508  N N    . GLU A 1 80 ? 0.306   -7.923  -11.495 1.00 0.00 ? 80 GLU A N    3  
ATOM 4509  C CA   . GLU A 1 80 ? 0.708   -7.372  -12.800 1.00 0.00 ? 80 GLU A CA   3  
ATOM 4510  C C    . GLU A 1 80 ? 2.173   -6.908  -12.794 1.00 0.00 ? 80 GLU A C    3  
ATOM 4511  O O    . GLU A 1 80 ? 2.889   -7.103  -13.784 1.00 0.00 ? 80 GLU A O    3  
ATOM 4512  C CB   . GLU A 1 80 ? -0.237  -6.203  -13.185 1.00 0.00 ? 80 GLU A CB   3  
ATOM 4513  C CG   . GLU A 1 80 ? -1.698  -6.637  -13.434 1.00 0.00 ? 80 GLU A CG   3  
ATOM 4514  C CD   . GLU A 1 80 ? -2.643  -5.457  -13.710 1.00 0.00 ? 80 GLU A CD   3  
ATOM 4515  O OE1  . GLU A 1 80 ? -3.010  -4.747  -12.753 1.00 0.00 ? 80 GLU A OE1  3  
ATOM 4516  O OE2  . GLU A 1 80 ? -3.004  -5.225  -14.884 1.00 0.00 ? 80 GLU A OE2  3  
ATOM 4517  H H    . GLU A 1 80 ? -0.264  -7.367  -10.924 1.00 0.00 ? 80 GLU A H    3  
ATOM 4518  H HA   . GLU A 1 80 ? 0.599   -8.162  -13.542 1.00 0.00 ? 80 GLU A HA   3  
ATOM 4519  H HB2  . GLU A 1 80 ? -0.231  -5.468  -12.386 1.00 0.00 ? 80 GLU A HB2  3  
ATOM 4520  H HB3  . GLU A 1 80 ? 0.129   -5.731  -14.091 1.00 0.00 ? 80 GLU A HB3  3  
ATOM 4521  H HG2  . GLU A 1 80 ? -1.715  -7.317  -14.281 1.00 0.00 ? 80 GLU A HG2  3  
ATOM 4522  H HG3  . GLU A 1 80 ? -2.058  -7.174  -12.559 1.00 0.00 ? 80 GLU A HG3  3  
ATOM 4523  N N    . LEU A 1 81 ? 2.618   -6.294  -11.683 1.00 0.00 ? 81 LEU A N    3  
ATOM 4524  C CA   . LEU A 1 81 ? 4.020   -5.845  -11.527 1.00 0.00 ? 81 LEU A CA   3  
ATOM 4525  C C    . LEU A 1 81 ? 4.966   -7.049  -11.321 1.00 0.00 ? 81 LEU A C    3  
ATOM 4526  O O    . LEU A 1 81 ? 6.153   -6.960  -11.631 1.00 0.00 ? 81 LEU A O    3  
ATOM 4527  C CB   . LEU A 1 81 ? 4.158   -4.854  -10.320 1.00 0.00 ? 81 LEU A CB   3  
ATOM 4528  C CG   . LEU A 1 81 ? 3.451   -3.461  -10.460 1.00 0.00 ? 81 LEU A CG   3  
ATOM 4529  C CD1  . LEU A 1 81 ? 3.643   -2.596  -9.188  1.00 0.00 ? 81 LEU A CD1  3  
ATOM 4530  C CD2  . LEU A 1 81 ? 3.935   -2.713  -11.723 1.00 0.00 ? 81 LEU A CD2  3  
ATOM 4531  H H    . LEU A 1 81 ? 1.997   -6.138  -10.950 1.00 0.00 ? 81 LEU A H    3  
ATOM 4532  H HA   . LEU A 1 81 ? 4.311   -5.328  -12.439 1.00 0.00 ? 81 LEU A HA   3  
ATOM 4533  H HB2  . LEU A 1 81 ? 3.759   -5.345  -9.438  1.00 0.00 ? 81 LEU A HB2  3  
ATOM 4534  H HB3  . LEU A 1 81 ? 5.215   -4.673  -10.149 1.00 0.00 ? 81 LEU A HB3  3  
ATOM 4535  H HG   . LEU A 1 81 ? 2.386   -3.626  -10.574 1.00 0.00 ? 81 LEU A HG   3  
ATOM 4536  H HD11 . LEU A 1 81 ? 3.128   -1.652  -9.302  1.00 0.00 ? 81 LEU A HD11 3  
ATOM 4537  H HD12 . LEU A 1 81 ? 4.699   -2.408  -9.019  1.00 0.00 ? 81 LEU A HD12 3  
ATOM 4538  H HD13 . LEU A 1 81 ? 3.237   -3.119  -8.331  1.00 0.00 ? 81 LEU A HD13 3  
ATOM 4539  H HD21 . LEU A 1 81 ? 3.437   -1.753  -11.793 1.00 0.00 ? 81 LEU A HD21 3  
ATOM 4540  H HD22 . LEU A 1 81 ? 3.696   -3.295  -12.604 1.00 0.00 ? 81 LEU A HD22 3  
ATOM 4541  H HD23 . LEU A 1 81 ? 5.004   -2.559  -11.677 1.00 0.00 ? 81 LEU A HD23 3  
ATOM 4542  N N    . GLY A 1 82 ? 4.410   -8.191  -10.877 1.00 0.00 ? 82 GLY A N    3  
ATOM 4543  C CA   . GLY A 1 82 ? 5.212   -9.367  -10.504 1.00 0.00 ? 82 GLY A CA   3  
ATOM 4544  C C    . GLY A 1 82 ? 5.407   -9.503  -8.994  1.00 0.00 ? 82 GLY A C    3  
ATOM 4545  O O    . GLY A 1 82 ? 5.975   -10.490 -8.533  1.00 0.00 ? 82 GLY A O    3  
ATOM 4546  H H    . GLY A 1 82 ? 3.434   -8.245  -10.813 1.00 0.00 ? 82 GLY A H    3  
ATOM 4547  H HA2  . GLY A 1 82 ? 4.713   -10.253 -10.869 1.00 0.00 ? 82 GLY A HA2  3  
ATOM 4548  H HA3  . GLY A 1 82 ? 6.187   -9.306  -10.975 1.00 0.00 ? 82 GLY A HA3  3  
ATOM 4549  N N    . ILE A 1 83 ? 4.938   -8.496  -8.232  1.00 0.00 ? 83 ILE A N    3  
ATOM 4550  C CA   . ILE A 1 83 ? 5.006   -8.462  -6.761  1.00 0.00 ? 83 ILE A CA   3  
ATOM 4551  C C    . ILE A 1 83 ? 4.038   -9.512  -6.162  1.00 0.00 ? 83 ILE A C    3  
ATOM 4552  O O    . ILE A 1 83 ? 2.830   -9.465  -6.420  1.00 0.00 ? 83 ILE A O    3  
ATOM 4553  C CB   . ILE A 1 83 ? 4.632   -7.017  -6.240  1.00 0.00 ? 83 ILE A CB   3  
ATOM 4554  C CG1  . ILE A 1 83 ? 5.670   -5.958  -6.737  1.00 0.00 ? 83 ILE A CG1  3  
ATOM 4555  C CG2  . ILE A 1 83 ? 4.468   -6.971  -4.702  1.00 0.00 ? 83 ILE A CG2  3  
ATOM 4556  C CD1  . ILE A 1 83 ? 5.355   -4.521  -6.350  1.00 0.00 ? 83 ILE A CD1  3  
ATOM 4557  H H    . ILE A 1 83 ? 4.504   -7.740  -8.674  1.00 0.00 ? 83 ILE A H    3  
ATOM 4558  H HA   . ILE A 1 83 ? 6.029   -8.686  -6.457  1.00 0.00 ? 83 ILE A HA   3  
ATOM 4559  H HB   . ILE A 1 83 ? 3.663   -6.762  -6.666  1.00 0.00 ? 83 ILE A HB   3  
ATOM 4560  H HG12 . ILE A 1 83 ? 6.648   -6.192  -6.331  1.00 0.00 ? 83 ILE A HG12 3  
ATOM 4561  H HG13 . ILE A 1 83 ? 5.726   -5.996  -7.818  1.00 0.00 ? 83 ILE A HG13 3  
ATOM 4562  H HG21 . ILE A 1 83 ? 4.185   -5.974  -4.387  1.00 0.00 ? 83 ILE A HG21 3  
ATOM 4563  H HG22 . ILE A 1 83 ? 5.401   -7.243  -4.223  1.00 0.00 ? 83 ILE A HG22 3  
ATOM 4564  H HG23 . ILE A 1 83 ? 3.696   -7.669  -4.394  1.00 0.00 ? 83 ILE A HG23 3  
ATOM 4565  H HD11 . ILE A 1 83 ? 5.380   -4.418  -5.275  1.00 0.00 ? 83 ILE A HD11 3  
ATOM 4566  H HD12 . ILE A 1 83 ? 4.375   -4.250  -6.718  1.00 0.00 ? 83 ILE A HD12 3  
ATOM 4567  H HD13 . ILE A 1 83 ? 6.092   -3.864  -6.789  1.00 0.00 ? 83 ILE A HD13 3  
ATOM 4568  N N    . GLU A 1 84 ? 4.582   -10.454 -5.365  1.00 0.00 ? 84 GLU A N    3  
ATOM 4569  C CA   . GLU A 1 84 ? 3.791   -11.525 -4.728  1.00 0.00 ? 84 GLU A CA   3  
ATOM 4570  C C    . GLU A 1 84 ? 4.562   -12.165 -3.567  1.00 0.00 ? 84 GLU A C    3  
ATOM 4571  O O    . GLU A 1 84 ? 5.779   -11.990 -3.445  1.00 0.00 ? 84 GLU A O    3  
ATOM 4572  C CB   . GLU A 1 84 ? 3.385   -12.616 -5.769  1.00 0.00 ? 84 GLU A CB   3  
ATOM 4573  C CG   . GLU A 1 84 ? 4.567   -13.350 -6.449  1.00 0.00 ? 84 GLU A CG   3  
ATOM 4574  C CD   . GLU A 1 84 ? 4.119   -14.523 -7.344  1.00 0.00 ? 84 GLU A CD   3  
ATOM 4575  O OE1  . GLU A 1 84 ? 3.715   -14.280 -8.500  1.00 0.00 ? 84 GLU A OE1  3  
ATOM 4576  O OE2  . GLU A 1 84 ? 4.142   -15.685 -6.885  1.00 0.00 ? 84 GLU A OE2  3  
ATOM 4577  H H    . GLU A 1 84 ? 5.551   -10.431 -5.201  1.00 0.00 ? 84 GLU A H    3  
ATOM 4578  H HA   . GLU A 1 84 ? 2.888   -11.074 -4.326  1.00 0.00 ? 84 GLU A HA   3  
ATOM 4579  H HB2  . GLU A 1 84 ? 2.764   -13.358 -5.275  1.00 0.00 ? 84 GLU A HB2  3  
ATOM 4580  H HB3  . GLU A 1 84 ? 2.792   -12.144 -6.545  1.00 0.00 ? 84 GLU A HB3  3  
ATOM 4581  H HG2  . GLU A 1 84 ? 5.118   -12.636 -7.058  1.00 0.00 ? 84 GLU A HG2  3  
ATOM 4582  H HG3  . GLU A 1 84 ? 5.230   -13.729 -5.676  1.00 0.00 ? 84 GLU A HG3  3  
ATOM 4583  N N    . GLY A 1 85 ? 3.815   -12.876 -2.703  1.00 0.00 ? 85 GLY A N    3  
ATOM 4584  C CA   . GLY A 1 85 ? 4.381   -13.610 -1.579  1.00 0.00 ? 85 GLY A CA   3  
ATOM 4585  C C    . GLY A 1 85 ? 5.095   -12.723 -0.568  1.00 0.00 ? 85 GLY A C    3  
ATOM 4586  O O    . GLY A 1 85 ? 4.459   -11.923 0.128   1.00 0.00 ? 85 GLY A O    3  
ATOM 4587  H H    . GLY A 1 85 ? 2.848   -12.913 -2.841  1.00 0.00 ? 85 GLY A H    3  
ATOM 4588  H HA2  . GLY A 1 85 ? 3.578   -14.124 -1.077  1.00 0.00 ? 85 GLY A HA2  3  
ATOM 4589  H HA3  . GLY A 1 85 ? 5.073   -14.351 -1.962  1.00 0.00 ? 85 GLY A HA3  3  
ATOM 4590  N N    . GLU A 1 86 ? 6.430   -12.866 -0.515  1.00 0.00 ? 86 GLU A N    3  
ATOM 4591  C CA   . GLU A 1 86 ? 7.303   -12.107 0.400   1.00 0.00 ? 86 GLU A CA   3  
ATOM 4592  C C    . GLU A 1 86 ? 7.475   -10.651 -0.084  1.00 0.00 ? 86 GLU A C    3  
ATOM 4593  O O    . GLU A 1 86 ? 7.765   -9.754  0.709   1.00 0.00 ? 86 GLU A O    3  
ATOM 4594  C CB   . GLU A 1 86 ? 8.673   -12.830 0.514   1.00 0.00 ? 86 GLU A CB   3  
ATOM 4595  C CG   . GLU A 1 86 ? 8.584   -14.284 1.036   1.00 0.00 ? 86 GLU A CG   3  
ATOM 4596  C CD   . GLU A 1 86 ? 9.903   -15.071 0.905   1.00 0.00 ? 86 GLU A CD   3  
ATOM 4597  O OE1  . GLU A 1 86 ? 10.163  -15.653 -0.174  1.00 0.00 ? 86 GLU A OE1  3  
ATOM 4598  O OE2  . GLU A 1 86 ? 10.699  -15.099 1.876   1.00 0.00 ? 86 GLU A OE2  3  
ATOM 4599  H H    . GLU A 1 86 ? 6.847   -13.515 -1.115  1.00 0.00 ? 86 GLU A H    3  
ATOM 4600  H HA   . GLU A 1 86 ? 6.830   -12.091 1.376   1.00 0.00 ? 86 GLU A HA   3  
ATOM 4601  H HB2  . GLU A 1 86 ? 9.142   -12.846 -0.465  1.00 0.00 ? 86 GLU A HB2  3  
ATOM 4602  H HB3  . GLU A 1 86 ? 9.310   -12.267 1.190   1.00 0.00 ? 86 GLU A HB3  3  
ATOM 4603  H HG2  . GLU A 1 86 ? 8.294   -14.255 2.083   1.00 0.00 ? 86 GLU A HG2  3  
ATOM 4604  H HG3  . GLU A 1 86 ? 7.807   -14.811 0.484   1.00 0.00 ? 86 GLU A HG3  3  
ATOM 4605  N N    . ASN A 1 87 ? 7.278   -10.430 -1.393  1.00 0.00 ? 87 ASN A N    3  
ATOM 4606  C CA   . ASN A 1 87 ? 7.345   -9.086  -1.999  1.00 0.00 ? 87 ASN A CA   3  
ATOM 4607  C C    . ASN A 1 87 ? 5.986   -8.386  -1.820  1.00 0.00 ? 87 ASN A C    3  
ATOM 4608  O O    . ASN A 1 87 ? 5.924   -7.154  -1.751  1.00 0.00 ? 87 ASN A O    3  
ATOM 4609  C CB   . ASN A 1 87 ? 7.729   -9.220  -3.503  1.00 0.00 ? 87 ASN A CB   3  
ATOM 4610  C CG   . ASN A 1 87 ? 8.281   -7.943  -4.184  1.00 0.00 ? 87 ASN A CG   3  
ATOM 4611  O OD1  . ASN A 1 87 ? 9.209   -8.030  -4.979  1.00 0.00 ? 87 ASN A OD1  3  
ATOM 4612  N ND2  . ASN A 1 87 ? 7.700   -6.775  -3.956  1.00 0.00 ? 87 ASN A ND2  3  
ATOM 4613  H H    . ASN A 1 87 ? 7.088   -11.194 -1.970  1.00 0.00 ? 87 ASN A H    3  
ATOM 4614  H HA   . ASN A 1 87 ? 8.112   -8.514  -1.479  1.00 0.00 ? 87 ASN A HA   3  
ATOM 4615  H HB2  . ASN A 1 87 ? 8.486   -9.991  -3.584  1.00 0.00 ? 87 ASN A HB2  3  
ATOM 4616  H HB3  . ASN A 1 87 ? 6.856   -9.547  -4.060  1.00 0.00 ? 87 ASN A HB3  3  
ATOM 4617  H HD21 . ASN A 1 87 ? 6.935   -6.743  -3.362  1.00 0.00 ? 87 ASN A HD21 3  
ATOM 4618  H HD22 . ASN A 1 87 ? 8.074   -5.981  -4.395  1.00 0.00 ? 87 ASN A HD22 3  
ATOM 4619  N N    . ARG A 1 88 ? 4.901   -9.182  -1.711  1.00 0.00 ? 88 ARG A N    3  
ATOM 4620  C CA   . ARG A 1 88 ? 3.549   -8.647  -1.446  1.00 0.00 ? 88 ARG A CA   3  
ATOM 4621  C C    . ARG A 1 88 ? 3.513   -7.965  -0.078  1.00 0.00 ? 88 ARG A C    3  
ATOM 4622  O O    . ARG A 1 88 ? 3.845   -8.594  0.935   1.00 0.00 ? 88 ARG A O    3  
ATOM 4623  C CB   . ARG A 1 88 ? 2.470   -9.756  -1.517  1.00 0.00 ? 88 ARG A CB   3  
ATOM 4624  C CG   . ARG A 1 88 ? 1.085   -9.356  -0.937  1.00 0.00 ? 88 ARG A CG   3  
ATOM 4625  C CD   . ARG A 1 88 ? 0.012   -10.420 -1.201  1.00 0.00 ? 88 ARG A CD   3  
ATOM 4626  N NE   . ARG A 1 88 ? -0.346  -10.472 -2.632  1.00 0.00 ? 88 ARG A NE   3  
ATOM 4627  C CZ   . ARG A 1 88 ? -0.074  -11.470 -3.491  1.00 0.00 ? 88 ARG A CZ   3  
ATOM 4628  N NH1  . ARG A 1 88 ? 0.567   -12.570 -3.084  1.00 0.00 ? 88 ARG A NH1  3  
ATOM 4629  N NH2  . ARG A 1 88 ? -0.441  -11.333 -4.768  1.00 0.00 ? 88 ARG A NH2  3  
ATOM 4630  H H    . ARG A 1 88 ? 5.018   -10.148 -1.803  1.00 0.00 ? 88 ARG A H    3  
ATOM 4631  H HA   . ARG A 1 88 ? 3.343   -7.903  -2.219  1.00 0.00 ? 88 ARG A HA   3  
ATOM 4632  H HB2  . ARG A 1 88 ? 2.335   -10.038 -2.556  1.00 0.00 ? 88 ARG A HB2  3  
ATOM 4633  H HB3  . ARG A 1 88 ? 2.826   -10.624 -0.973  1.00 0.00 ? 88 ARG A HB3  3  
ATOM 4634  H HG2  . ARG A 1 88 ? 1.183   -9.217  0.136   1.00 0.00 ? 88 ARG A HG2  3  
ATOM 4635  H HG3  . ARG A 1 88 ? 0.771   -8.419  -1.385  1.00 0.00 ? 88 ARG A HG3  3  
ATOM 4636  H HD2  . ARG A 1 88 ? 0.376   -11.388 -0.874  1.00 0.00 ? 88 ARG A HD2  3  
ATOM 4637  H HD3  . ARG A 1 88 ? -0.878  -10.169 -0.633  1.00 0.00 ? 88 ARG A HD3  3  
ATOM 4638  H HE   . ARG A 1 88 ? -0.844  -9.703  -2.965  1.00 0.00 ? 88 ARG A HE   3  
ATOM 4639  H HH11 . ARG A 1 88 ? 0.857   -12.661 -2.120  1.00 0.00 ? 88 ARG A HH11 3  
ATOM 4640  H HH12 . ARG A 1 88 ? 0.766   -13.314 -3.728  1.00 0.00 ? 88 ARG A HH12 3  
ATOM 4641  H HH21 . ARG A 1 88 ? -0.915  -10.504 -5.068  1.00 0.00 ? 88 ARG A HH21 3  
ATOM 4642  H HH22 . ARG A 1 88 ? -0.259  -12.067 -5.428  1.00 0.00 ? 88 ARG A HH22 3  
ATOM 4643  N N    . VAL A 1 89 ? 3.122   -6.686  -0.065  1.00 0.00 ? 89 VAL A N    3  
ATOM 4644  C CA   . VAL A 1 89 ? 3.076   -5.876  1.152   1.00 0.00 ? 89 VAL A CA   3  
ATOM 4645  C C    . VAL A 1 89 ? 1.887   -6.321  2.050   1.00 0.00 ? 89 VAL A C    3  
ATOM 4646  O O    . VAL A 1 89 ? 0.739   -6.292  1.597   1.00 0.00 ? 89 VAL A O    3  
ATOM 4647  C CB   . VAL A 1 89 ? 2.969   -4.344  0.802   1.00 0.00 ? 89 VAL A CB   3  
ATOM 4648  C CG1  . VAL A 1 89 ? 2.860   -3.484  2.073   1.00 0.00 ? 89 VAL A CG1  3  
ATOM 4649  C CG2  . VAL A 1 89 ? 4.173   -3.900  -0.066  1.00 0.00 ? 89 VAL A CG2  3  
ATOM 4650  H H    . VAL A 1 89 ? 2.835   -6.277  -0.909  1.00 0.00 ? 89 VAL A H    3  
ATOM 4651  H HA   . VAL A 1 89 ? 4.011   -6.031  1.688   1.00 0.00 ? 89 VAL A HA   3  
ATOM 4652  H HB   . VAL A 1 89 ? 2.063   -4.195  0.219   1.00 0.00 ? 89 VAL A HB   3  
ATOM 4653  H HG11 . VAL A 1 89 ? 2.759   -2.437  1.802   1.00 0.00 ? 89 VAL A HG11 3  
ATOM 4654  H HG12 . VAL A 1 89 ? 3.743   -3.609  2.684   1.00 0.00 ? 89 VAL A HG12 3  
ATOM 4655  H HG13 . VAL A 1 89 ? 1.989   -3.783  2.641   1.00 0.00 ? 89 VAL A HG13 3  
ATOM 4656  H HG21 . VAL A 1 89 ? 5.098   -4.047  0.479   1.00 0.00 ? 89 VAL A HG21 3  
ATOM 4657  H HG22 . VAL A 1 89 ? 4.072   -2.854  -0.325  1.00 0.00 ? 89 VAL A HG22 3  
ATOM 4658  H HG23 . VAL A 1 89 ? 4.201   -4.487  -0.975  1.00 0.00 ? 89 VAL A HG23 3  
ATOM 4659  N N    . PRO A 1 90 ? 2.158   -6.787  3.317   1.00 0.00 ? 90 PRO A N    3  
ATOM 4660  C CA   . PRO A 1 90 ? 1.103   -7.160  4.295   1.00 0.00 ? 90 PRO A CA   3  
ATOM 4661  C C    . PRO A 1 90 ? 0.180   -5.983  4.642   1.00 0.00 ? 90 PRO A C    3  
ATOM 4662  O O    . PRO A 1 90 ? 0.638   -4.855  4.764   1.00 0.00 ? 90 PRO A O    3  
ATOM 4663  C CB   . PRO A 1 90 ? 1.907   -7.633  5.538   1.00 0.00 ? 90 PRO A CB   3  
ATOM 4664  C CG   . PRO A 1 90 ? 3.262   -7.987  5.009   1.00 0.00 ? 90 PRO A CG   3  
ATOM 4665  C CD   . PRO A 1 90 ? 3.511   -7.022  3.879   1.00 0.00 ? 90 PRO A CD   3  
ATOM 4666  H HA   . PRO A 1 90 ? 0.503   -7.987  3.915   1.00 0.00 ? 90 PRO A HA   3  
ATOM 4667  H HB2  . PRO A 1 90 ? 1.976   -6.833  6.281   1.00 0.00 ? 90 PRO A HB2  3  
ATOM 4668  H HB3  . PRO A 1 90 ? 1.442   -8.502  5.982   1.00 0.00 ? 90 PRO A HB3  3  
ATOM 4669  H HG2  . PRO A 1 90 ? 4.012   -7.864  5.787   1.00 0.00 ? 90 PRO A HG2  3  
ATOM 4670  H HG3  . PRO A 1 90 ? 3.272   -9.004  4.634   1.00 0.00 ? 90 PRO A HG3  3  
ATOM 4671  H HD2  . PRO A 1 90 ? 3.935   -6.092  4.246   1.00 0.00 ? 90 PRO A HD2  3  
ATOM 4672  H HD3  . PRO A 1 90 ? 4.169   -7.460  3.140   1.00 0.00 ? 90 PRO A HD3  3  
ATOM 4673  N N    . VAL A 1 91 ? -1.122  -6.258  4.792   1.00 0.00 ? 91 VAL A N    3  
ATOM 4674  C CA   . VAL A 1 91 ? -2.130  -5.223  5.079   1.00 0.00 ? 91 VAL A CA   3  
ATOM 4675  C C    . VAL A 1 91 ? -2.676  -5.416  6.505   1.00 0.00 ? 91 VAL A C    3  
ATOM 4676  O O    . VAL A 1 91 ? -3.315  -6.429  6.799   1.00 0.00 ? 91 VAL A O    3  
ATOM 4677  C CB   . VAL A 1 91 ? -3.279  -5.257  4.009   1.00 0.00 ? 91 VAL A CB   3  
ATOM 4678  C CG1  . VAL A 1 91 ? -4.337  -4.175  4.271   1.00 0.00 ? 91 VAL A CG1  3  
ATOM 4679  C CG2  . VAL A 1 91 ? -2.705  -5.129  2.579   1.00 0.00 ? 91 VAL A CG2  3  
ATOM 4680  H H    . VAL A 1 91 ? -1.415  -7.186  4.706   1.00 0.00 ? 91 VAL A H    3  
ATOM 4681  H HA   . VAL A 1 91 ? -1.646  -4.239  5.020   1.00 0.00 ? 91 VAL A HA   3  
ATOM 4682  H HB   . VAL A 1 91 ? -3.775  -6.229  4.079   1.00 0.00 ? 91 VAL A HB   3  
ATOM 4683  H HG11 . VAL A 1 91 ? -5.131  -4.259  3.537   1.00 0.00 ? 91 VAL A HG11 3  
ATOM 4684  H HG12 . VAL A 1 91 ? -3.891  -3.193  4.202   1.00 0.00 ? 91 VAL A HG12 3  
ATOM 4685  H HG13 . VAL A 1 91 ? -4.759  -4.310  5.258   1.00 0.00 ? 91 VAL A HG13 3  
ATOM 4686  H HG21 . VAL A 1 91 ? -2.200  -4.175  2.468   1.00 0.00 ? 91 VAL A HG21 3  
ATOM 4687  H HG22 . VAL A 1 91 ? -3.505  -5.197  1.854   1.00 0.00 ? 91 VAL A HG22 3  
ATOM 4688  H HG23 . VAL A 1 91 ? -1.998  -5.927  2.400   1.00 0.00 ? 91 VAL A HG23 3  
ATOM 4689  N N    . VAL A 1 92 ? -2.406  -4.431  7.379   1.00 0.00 ? 92 VAL A N    3  
ATOM 4690  C CA   . VAL A 1 92 ? -2.720  -4.490  8.813   1.00 0.00 ? 92 VAL A CA   3  
ATOM 4691  C C    . VAL A 1 92 ? -3.871  -3.520  9.114   1.00 0.00 ? 92 VAL A C    3  
ATOM 4692  O O    . VAL A 1 92 ? -3.654  -2.311  9.229   1.00 0.00 ? 92 VAL A O    3  
ATOM 4693  C CB   . VAL A 1 92 ? -1.450  -4.121  9.677   1.00 0.00 ? 92 VAL A CB   3  
ATOM 4694  C CG1  . VAL A 1 92 ? -1.728  -4.200  11.198  1.00 0.00 ? 92 VAL A CG1  3  
ATOM 4695  C CG2  . VAL A 1 92 ? -0.248  -4.999  9.282   1.00 0.00 ? 92 VAL A CG2  3  
ATOM 4696  H H    . VAL A 1 92 ? -2.013  -3.611  7.041   1.00 0.00 ? 92 VAL A H    3  
ATOM 4697  H HA   . VAL A 1 92 ? -3.028  -5.508  9.068   1.00 0.00 ? 92 VAL A HA   3  
ATOM 4698  H HB   . VAL A 1 92 ? -1.183  -3.085  9.452   1.00 0.00 ? 92 VAL A HB   3  
ATOM 4699  H HG11 . VAL A 1 92 ? -0.834  -3.933  11.748  1.00 0.00 ? 92 VAL A HG11 3  
ATOM 4700  H HG12 . VAL A 1 92 ? -2.028  -5.204  11.470  1.00 0.00 ? 92 VAL A HG12 3  
ATOM 4701  H HG13 . VAL A 1 92 ? -2.521  -3.510  11.459  1.00 0.00 ? 92 VAL A HG13 3  
ATOM 4702  H HG21 . VAL A 1 92 ? -0.030  -4.854  8.233   1.00 0.00 ? 92 VAL A HG21 3  
ATOM 4703  H HG22 . VAL A 1 92 ? -0.478  -6.043  9.460   1.00 0.00 ? 92 VAL A HG22 3  
ATOM 4704  H HG23 . VAL A 1 92 ? 0.619   -4.720  9.864   1.00 0.00 ? 92 VAL A HG23 3  
ATOM 4705  N N    . TYR A 1 93 ? -5.094  -4.048  9.192   1.00 0.00 ? 93 TYR A N    3  
ATOM 4706  C CA   . TYR A 1 93 ? -6.282  -3.261  9.542   1.00 0.00 ? 93 TYR A CA   3  
ATOM 4707  C C    . TYR A 1 93 ? -6.255  -2.883  11.027  1.00 0.00 ? 93 TYR A C    3  
ATOM 4708  O O    . TYR A 1 93 ? -6.293  -3.754  11.901  1.00 0.00 ? 93 TYR A O    3  
ATOM 4709  C CB   . TYR A 1 93 ? -7.568  -4.051  9.188   1.00 0.00 ? 93 TYR A CB   3  
ATOM 4710  C CG   . TYR A 1 93 ? -7.759  -4.244  7.674   1.00 0.00 ? 93 TYR A CG   3  
ATOM 4711  C CD1  . TYR A 1 93 ? -8.357  -3.259  6.902   1.00 0.00 ? 93 TYR A CD1  3  
ATOM 4712  C CD2  . TYR A 1 93 ? -7.291  -5.388  7.017   1.00 0.00 ? 93 TYR A CD2  3  
ATOM 4713  C CE1  . TYR A 1 93 ? -8.495  -3.403  5.539   1.00 0.00 ? 93 TYR A CE1  3  
ATOM 4714  C CE2  . TYR A 1 93 ? -7.424  -5.528  5.649   1.00 0.00 ? 93 TYR A CE2  3  
ATOM 4715  C CZ   . TYR A 1 93 ? -8.024  -4.529  4.916   1.00 0.00 ? 93 TYR A CZ   3  
ATOM 4716  O OH   . TYR A 1 93 ? -8.152  -4.657  3.549   1.00 0.00 ? 93 TYR A OH   3  
ATOM 4717  H H    . TYR A 1 93 ? -5.207  -5.002  8.996   1.00 0.00 ? 93 TYR A H    3  
ATOM 4718  H HA   . TYR A 1 93 ? -6.260  -2.346  8.948   1.00 0.00 ? 93 TYR A HA   3  
ATOM 4719  H HB2  . TYR A 1 93 ? -7.527  -5.028  9.655   1.00 0.00 ? 93 TYR A HB2  3  
ATOM 4720  H HB3  . TYR A 1 93 ? -8.437  -3.520  9.571   1.00 0.00 ? 93 TYR A HB3  3  
ATOM 4721  H HD1  . TYR A 1 93 ? -8.732  -2.362  7.385   1.00 0.00 ? 93 TYR A HD1  3  
ATOM 4722  H HD2  . TYR A 1 93 ? -6.821  -6.174  7.596   1.00 0.00 ? 93 TYR A HD2  3  
ATOM 4723  H HE1  . TYR A 1 93 ? -8.962  -2.619  4.968   1.00 0.00 ? 93 TYR A HE1  3  
ATOM 4724  H HE2  . TYR A 1 93 ? -7.056  -6.419  5.158   1.00 0.00 ? 93 TYR A HE2  3  
ATOM 4725  H HH   . TYR A 1 93 ? -7.888  -3.836  3.123   1.00 0.00 ? 93 TYR A HH   3  
ATOM 4726  N N    . ILE A 1 94 ? -6.148  -1.576  11.293  1.00 0.00 ? 94 ILE A N    3  
ATOM 4727  C CA   . ILE A 1 94 ? -6.140  -1.012  12.649  1.00 0.00 ? 94 ILE A CA   3  
ATOM 4728  C C    . ILE A 1 94 ? -7.486  -0.292  12.876  1.00 0.00 ? 94 ILE A C    3  
ATOM 4729  O O    . ILE A 1 94 ? -7.893  0.526   12.056  1.00 0.00 ? 94 ILE A O    3  
ATOM 4730  C CB   . ILE A 1 94 ? -4.923  -0.017  12.821  1.00 0.00 ? 94 ILE A CB   3  
ATOM 4731  C CG1  . ILE A 1 94 ? -3.566  -0.757  12.539  1.00 0.00 ? 94 ILE A CG1  3  
ATOM 4732  C CG2  . ILE A 1 94 ? -4.922  0.656   14.216  1.00 0.00 ? 94 ILE A CG2  3  
ATOM 4733  C CD1  . ILE A 1 94 ? -2.316  0.098   12.682  1.00 0.00 ? 94 ILE A CD1  3  
ATOM 4734  H H    . ILE A 1 94 ? -6.091  -0.950  10.544  1.00 0.00 ? 94 ILE A H    3  
ATOM 4735  H HA   . ILE A 1 94 ? -6.036  -1.821  13.370  1.00 0.00 ? 94 ILE A HA   3  
ATOM 4736  H HB   . ILE A 1 94 ? -5.035  0.776   12.081  1.00 0.00 ? 94 ILE A HB   3  
ATOM 4737  H HG12 . ILE A 1 94 ? -3.458  -1.593  13.225  1.00 0.00 ? 94 ILE A HG12 3  
ATOM 4738  H HG13 . ILE A 1 94 ? -3.577  -1.141  11.529  1.00 0.00 ? 94 ILE A HG13 3  
ATOM 4739  H HG21 . ILE A 1 94 ? -4.100  1.359   14.286  1.00 0.00 ? 94 ILE A HG21 3  
ATOM 4740  H HG22 . ILE A 1 94 ? -4.815  -0.092  14.993  1.00 0.00 ? 94 ILE A HG22 3  
ATOM 4741  H HG23 . ILE A 1 94 ? -5.852  1.188   14.365  1.00 0.00 ? 94 ILE A HG23 3  
ATOM 4742  H HD11 . ILE A 1 94 ? -2.379  0.948   12.018  1.00 0.00 ? 94 ILE A HD11 3  
ATOM 4743  H HD12 . ILE A 1 94 ? -1.448  -0.492  12.430  1.00 0.00 ? 94 ILE A HD12 3  
ATOM 4744  H HD13 . ILE A 1 94 ? -2.226  0.443   13.703  1.00 0.00 ? 94 ILE A HD13 3  
ATOM 4745  N N    . ALA A 1 95 ? -8.180  -0.629  13.967  1.00 0.00 ? 95 ALA A N    3  
ATOM 4746  C CA   . ALA A 1 95 ? -9.506  -0.072  14.288  1.00 0.00 ? 95 ALA A CA   3  
ATOM 4747  C C    . ALA A 1 95 ? -9.447  0.683   15.624  1.00 0.00 ? 95 ALA A C    3  
ATOM 4748  O O    . ALA A 1 95 ? -9.623  0.089   16.692  1.00 0.00 ? 95 ALA A O    3  
ATOM 4749  C CB   . ALA A 1 95 ? -10.545 -1.206  14.321  1.00 0.00 ? 95 ALA A CB   3  
ATOM 4750  H H    . ALA A 1 95 ? -7.786  -1.275  14.591  1.00 0.00 ? 95 ALA A H    3  
ATOM 4751  H HA   . ALA A 1 95 ? -9.802  0.627   13.504  1.00 0.00 ? 95 ALA A HA   3  
ATOM 4752  H HB1  . ALA A 1 95 ? -10.587 -1.692  13.354  1.00 0.00 ? 95 ALA A HB1  3  
ATOM 4753  H HB2  . ALA A 1 95 ? -11.521 -0.804  14.556  1.00 0.00 ? 95 ALA A HB2  3  
ATOM 4754  H HB3  . ALA A 1 95 ? -10.271 -1.938  15.072  1.00 0.00 ? 95 ALA A HB3  3  
ATOM 4755  N N    . GLU A 1 96 ? -9.138  1.978   15.558  1.00 0.00 ? 96 GLU A N    3  
ATOM 4756  C CA   . GLU A 1 96 ? -9.057  2.848   16.743  1.00 0.00 ? 96 GLU A CA   3  
ATOM 4757  C C    . GLU A 1 96 ? -10.378 3.604   16.912  1.00 0.00 ? 96 GLU A C    3  
ATOM 4758  O O    . GLU A 1 96 ? -10.621 4.573   16.201  1.00 0.00 ? 96 GLU A O    3  
ATOM 4759  C CB   . GLU A 1 96 ? -7.881  3.855   16.588  1.00 0.00 ? 96 GLU A CB   3  
ATOM 4760  C CG   . GLU A 1 96 ? -6.493  3.219   16.396  1.00 0.00 ? 96 GLU A CG   3  
ATOM 4761  C CD   . GLU A 1 96 ? -6.072  2.310   17.568  1.00 0.00 ? 96 GLU A CD   3  
ATOM 4762  O OE1  . GLU A 1 96 ? -5.651  2.835   18.621  1.00 0.00 ? 96 GLU A OE1  3  
ATOM 4763  O OE2  . GLU A 1 96 ? -6.162  1.062   17.447  1.00 0.00 ? 96 GLU A OE2  3  
ATOM 4764  H H    . GLU A 1 96 ? -8.970  2.379   14.673  1.00 0.00 ? 96 GLU A H    3  
ATOM 4765  H HA   . GLU A 1 96 ? -8.877  2.228   17.621  1.00 0.00 ? 96 GLU A HA   3  
ATOM 4766  H HB2  . GLU A 1 96 ? -8.076  4.486   15.729  1.00 0.00 ? 96 GLU A HB2  3  
ATOM 4767  H HB3  . GLU A 1 96 ? -7.841  4.481   17.471  1.00 0.00 ? 96 GLU A HB3  3  
ATOM 4768  H HG2  . GLU A 1 96 ? -6.505  2.637   15.481  1.00 0.00 ? 96 GLU A HG2  3  
ATOM 4769  H HG3  . GLU A 1 96 ? -5.758  4.011   16.291  1.00 0.00 ? 96 GLU A HG3  3  
ATOM 4770  N N    . SER A 1 97 ? -11.240 3.157   17.835  1.00 0.00 ? 97 SER A N    3  
ATOM 4771  C CA   . SER A 1 97 ? -12.550 3.790   18.045  1.00 0.00 ? 97 SER A CA   3  
ATOM 4772  C C    . SER A 1 97 ? -13.043 3.597   19.488  1.00 0.00 ? 97 SER A C    3  
ATOM 4773  O O    . SER A 1 97 ? -13.673 2.577   19.800  1.00 0.00 ? 97 SER A O    3  
ATOM 4774  C CB   . SER A 1 97 ? -13.575 3.247   17.006  1.00 0.00 ? 97 SER A CB   3  
ATOM 4775  O OG   . SER A 1 97 ? -13.667 1.827   17.032  1.00 0.00 ? 97 SER A OG   3  
ATOM 4776  H H    . SER A 1 97 ? -10.993 2.384   18.389  1.00 0.00 ? 97 SER A H    3  
ATOM 4777  H HA   . SER A 1 97 ? -12.431 4.863   17.878  1.00 0.00 ? 97 SER A HA   3  
ATOM 4778  H HB2  . SER A 1 97 ? -14.558 3.661   17.207  1.00 0.00 ? 97 SER A HB2  3  
ATOM 4779  H HB3  . SER A 1 97 ? -13.267 3.553   16.015  1.00 0.00 ? 97 SER A HB3  3  
ATOM 4780  H HG   . SER A 1 97 ? -13.502 1.510   17.925  1.00 0.00 ? 97 SER A HG   3  
ATOM 4781  N N    . ASP A 1 98 ? -12.711 4.583   20.353  1.00 0.00 ? 98 ASP A N    3  
ATOM 4782  C CA   . ASP A 1 98 ? -13.138 4.661   21.776  1.00 0.00 ? 98 ASP A CA   3  
ATOM 4783  C C    . ASP A 1 98 ? -12.512 3.529   22.627  1.00 0.00 ? 98 ASP A C    3  
ATOM 4784  O O    . ASP A 1 98 ? -11.659 3.784   23.479  1.00 0.00 ? 98 ASP A O    3  
ATOM 4785  C CB   . ASP A 1 98 ? -14.689 4.683   21.924  1.00 0.00 ? 98 ASP A CB   3  
ATOM 4786  C CG   . ASP A 1 98 ? -15.160 4.778   23.387  1.00 0.00 ? 98 ASP A CG   3  
ATOM 4787  O OD1  . ASP A 1 98 ? -15.144 5.890   23.957  1.00 0.00 ? 98 ASP A OD1  3  
ATOM 4788  O OD2  . ASP A 1 98 ? -15.510 3.734   23.987  1.00 0.00 ? 98 ASP A OD2  3  
ATOM 4789  H H    . ASP A 1 98 ? -12.135 5.298   20.019  1.00 0.00 ? 98 ASP A H    3  
ATOM 4790  H HA   . ASP A 1 98 ? -12.753 5.607   22.146  1.00 0.00 ? 98 ASP A HA   3  
ATOM 4791  H HB2  . ASP A 1 98 ? -15.080 5.539   21.377  1.00 0.00 ? 98 ASP A HB2  3  
ATOM 4792  H HB3  . ASP A 1 98 ? -15.096 3.781   21.476  1.00 0.00 ? 98 ASP A HB3  3  
ATOM 4793  N N    . GLY A 1 99 ? -12.979 2.298   22.407  1.00 0.00 ? 99 GLY A N    3  
ATOM 4794  C CA   . GLY A 1 99 ? -12.459 1.100   23.063  1.00 0.00 ? 99 GLY A CA   3  
ATOM 4795  C C    . GLY A 1 99 ? -12.875 -0.175  22.313  1.00 0.00 ? 99 GLY A C    3  
ATOM 4796  O O    . GLY A 1 99 ? -12.134 -1.176  22.358  1.00 0.00 ? 99 GLY A O    3  
ATOM 4797  O OXT  . GLY A 1 99 ? -13.954 -0.175  21.673  1.00 0.00 ? 99 GLY A OXT  3  
ATOM 4798  H H    . GLY A 1 99 ? -13.711 2.192   21.765  1.00 0.00 ? 99 GLY A H    3  
ATOM 4799  H HA2  . GLY A 1 99 ? -11.378 1.156   23.109  1.00 0.00 ? 99 GLY A HA2  3  
ATOM 4800  H HA3  . GLY A 1 99 ? -12.851 1.054   24.073  1.00 0.00 ? 99 GLY A HA3  3  
ATOM 4801  N N    . MET A 1 1  ? -5.917  18.068  -7.480  1.00 0.00 ? 1  MET A N    4  
ATOM 4802  C CA   . MET A 1 1  ? -5.666  19.488  -7.835  1.00 0.00 ? 1  MET A CA   4  
ATOM 4803  C C    . MET A 1 1  ? -5.135  19.572  -9.278  1.00 0.00 ? 1  MET A C    4  
ATOM 4804  O O    . MET A 1 1  ? -5.050  18.549  -9.969  1.00 0.00 ? 1  MET A O    4  
ATOM 4805  C CB   . MET A 1 1  ? -4.666  20.114  -6.828  1.00 0.00 ? 1  MET A CB   4  
ATOM 4806  C CG   . MET A 1 1  ? -5.137  20.099  -5.369  1.00 0.00 ? 1  MET A CG   4  
ATOM 4807  S SD   . MET A 1 1  ? -3.927  20.824  -4.237  1.00 0.00 ? 1  MET A SD   4  
ATOM 4808  C CE   . MET A 1 1  ? -4.714  20.595  -2.638  1.00 0.00 ? 1  MET A CE   4  
ATOM 4809  H H1   . MET A 1 1  ? -6.597  17.654  -8.139  1.00 0.00 ? 1  MET A H1   4  
ATOM 4810  H H2   . MET A 1 1  ? -6.298  17.989  -6.516  1.00 0.00 ? 1  MET A H2   4  
ATOM 4811  H H3   . MET A 1 1  ? -5.034  17.527  -7.535  1.00 0.00 ? 1  MET A H3   4  
ATOM 4812  H HA   . MET A 1 1  ? -6.610  20.016  -7.779  1.00 0.00 ? 1  MET A HA   4  
ATOM 4813  H HB2  . MET A 1 1  ? -3.730  19.570  -6.883  1.00 0.00 ? 1  MET A HB2  4  
ATOM 4814  H HB3  . MET A 1 1  ? -4.480  21.146  -7.113  1.00 0.00 ? 1  MET A HB3  4  
ATOM 4815  H HG2  . MET A 1 1  ? -6.061  20.662  -5.290  1.00 0.00 ? 1  MET A HG2  4  
ATOM 4816  H HG3  . MET A 1 1  ? -5.322  19.073  -5.070  1.00 0.00 ? 1  MET A HG3  4  
ATOM 4817  H HE1  . MET A 1 1  ? -4.862  19.539  -2.452  1.00 0.00 ? 1  MET A HE1  4  
ATOM 4818  H HE2  . MET A 1 1  ? -5.669  21.103  -2.629  1.00 0.00 ? 1  MET A HE2  4  
ATOM 4819  H HE3  . MET A 1 1  ? -4.083  21.006  -1.866  1.00 0.00 ? 1  MET A HE3  4  
ATOM 4820  N N    . GLY A 1 2  ? -4.799  20.797  -9.732  1.00 0.00 ? 2  GLY A N    4  
ATOM 4821  C CA   . GLY A 1 2  ? -4.230  21.020  -11.068 1.00 0.00 ? 2  GLY A CA   4  
ATOM 4822  C C    . GLY A 1 2  ? -2.790  20.502  -11.182 1.00 0.00 ? 2  GLY A C    4  
ATOM 4823  O O    . GLY A 1 2  ? -1.836  21.278  -11.056 1.00 0.00 ? 2  GLY A O    4  
ATOM 4824  H H    . GLY A 1 2  ? -4.942  21.569  -9.147  1.00 0.00 ? 2  GLY A H    4  
ATOM 4825  H HA2  . GLY A 1 2  ? -4.853  20.530  -11.812 1.00 0.00 ? 2  GLY A HA2  4  
ATOM 4826  H HA3  . GLY A 1 2  ? -4.238  22.083  -11.267 1.00 0.00 ? 2  GLY A HA3  4  
ATOM 4827  N N    . HIS A 1 3  ? -2.662  19.172  -11.416 1.00 0.00 ? 3  HIS A N    4  
ATOM 4828  C CA   . HIS A 1 3  ? -1.377  18.429  -11.454 1.00 0.00 ? 3  HIS A CA   4  
ATOM 4829  C C    . HIS A 1 3  ? -0.517  18.710  -10.195 1.00 0.00 ? 3  HIS A C    4  
ATOM 4830  O O    . HIS A 1 3  ? -0.708  18.070  -9.157  1.00 0.00 ? 3  HIS A O    4  
ATOM 4831  C CB   . HIS A 1 3  ? -0.590  18.689  -12.781 1.00 0.00 ? 3  HIS A CB   4  
ATOM 4832  C CG   . HIS A 1 3  ? -1.242  18.152  -14.026 1.00 0.00 ? 3  HIS A CG   4  
ATOM 4833  N ND1  . HIS A 1 3  ? -1.103  16.845  -14.442 1.00 0.00 ? 3  HIS A ND1  4  
ATOM 4834  C CD2  . HIS A 1 3  ? -2.013  18.757  -14.967 1.00 0.00 ? 3  HIS A CD2  4  
ATOM 4835  C CE1  . HIS A 1 3  ? -1.754  16.673  -15.574 1.00 0.00 ? 3  HIS A CE1  4  
ATOM 4836  N NE2  . HIS A 1 3  ? -2.313  17.814  -15.916 1.00 0.00 ? 3  HIS A NE2  4  
ATOM 4837  H H    . HIS A 1 3  ? -3.486  18.664  -11.574 1.00 0.00 ? 3  HIS A H    4  
ATOM 4838  H HA   . HIS A 1 3  ? -1.641  17.377  -11.422 1.00 0.00 ? 3  HIS A HA   4  
ATOM 4839  H HB2  . HIS A 1 3  ? -0.467  19.755  -12.911 1.00 0.00 ? 3  HIS A HB2  4  
ATOM 4840  H HB3  . HIS A 1 3  ? 0.394   18.236  -12.704 1.00 0.00 ? 3  HIS A HB3  4  
ATOM 4841  H HD1  . HIS A 1 3  ? -0.606  16.143  -13.972 1.00 0.00 ? 3  HIS A HD1  4  
ATOM 4842  H HD2  . HIS A 1 3  ? -2.345  19.786  -14.963 1.00 0.00 ? 3  HIS A HD2  4  
ATOM 4843  H HE1  . HIS A 1 3  ? -1.833  15.747  -16.122 1.00 0.00 ? 3  HIS A HE1  4  
ATOM 4844  H HE2  . HIS A 1 3  ? -2.710  18.002  -16.792 1.00 0.00 ? 3  HIS A HE2  4  
ATOM 4845  N N    . HIS A 1 4  ? 0.383   19.709  -10.296 1.00 0.00 ? 4  HIS A N    4  
ATOM 4846  C CA   . HIS A 1 4  ? 1.260   20.148  -9.204  1.00 0.00 ? 4  HIS A CA   4  
ATOM 4847  C C    . HIS A 1 4  ? 1.988   21.441  -9.648  1.00 0.00 ? 4  HIS A C    4  
ATOM 4848  O O    . HIS A 1 4  ? 2.875   21.413  -10.510 1.00 0.00 ? 4  HIS A O    4  
ATOM 4849  C CB   . HIS A 1 4  ? 2.272   19.033  -8.759  1.00 0.00 ? 4  HIS A CB   4  
ATOM 4850  C CG   . HIS A 1 4  ? 3.250   18.586  -9.817  1.00 0.00 ? 4  HIS A CG   4  
ATOM 4851  N ND1  . HIS A 1 4  ? 4.582   18.940  -9.801  1.00 0.00 ? 4  HIS A ND1  4  
ATOM 4852  C CD2  . HIS A 1 4  ? 3.090   17.808  -10.917 1.00 0.00 ? 4  HIS A CD2  4  
ATOM 4853  C CE1  . HIS A 1 4  ? 5.187   18.412  -10.842 1.00 0.00 ? 4  HIS A CE1  4  
ATOM 4854  N NE2  . HIS A 1 4  ? 4.310   17.722  -11.530 1.00 0.00 ? 4  HIS A NE2  4  
ATOM 4855  H H    . HIS A 1 4  ? 0.438   20.197  -11.142 1.00 0.00 ? 4  HIS A H    4  
ATOM 4856  H HA   . HIS A 1 4  ? 0.616   20.387  -8.357  1.00 0.00 ? 4  HIS A HA   4  
ATOM 4857  H HB2  . HIS A 1 4  ? 2.845   19.395  -7.912  1.00 0.00 ? 4  HIS A HB2  4  
ATOM 4858  H HB3  . HIS A 1 4  ? 1.713   18.159  -8.439  1.00 0.00 ? 4  HIS A HB3  4  
ATOM 4859  H HD1  . HIS A 1 4  ? 5.027   19.478  -9.112  1.00 0.00 ? 4  HIS A HD1  4  
ATOM 4860  H HD2  . HIS A 1 4  ? 2.170   17.353  -11.255 1.00 0.00 ? 4  HIS A HD2  4  
ATOM 4861  H HE1  . HIS A 1 4  ? 6.234   18.514  -11.083 1.00 0.00 ? 4  HIS A HE1  4  
ATOM 4862  H HE2  . HIS A 1 4  ? 4.527   17.137  -12.289 1.00 0.00 ? 4  HIS A HE2  4  
ATOM 4863  N N    . HIS A 1 5  ? 1.533   22.588  -9.126  1.00 0.00 ? 5  HIS A N    4  
ATOM 4864  C CA   . HIS A 1 5  ? 2.179   23.910  -9.326  1.00 0.00 ? 5  HIS A CA   4  
ATOM 4865  C C    . HIS A 1 5  ? 2.103   24.688  -8.007  1.00 0.00 ? 5  HIS A C    4  
ATOM 4866  O O    . HIS A 1 5  ? 1.161   24.480  -7.234  1.00 0.00 ? 5  HIS A O    4  
ATOM 4867  C CB   . HIS A 1 5  ? 1.505   24.708  -10.480 1.00 0.00 ? 5  HIS A CB   4  
ATOM 4868  C CG   . HIS A 1 5  ? 1.775   24.140  -11.853 1.00 0.00 ? 5  HIS A CG   4  
ATOM 4869  N ND1  . HIS A 1 5  ? 2.914   24.432  -12.569 1.00 0.00 ? 5  HIS A ND1  4  
ATOM 4870  C CD2  . HIS A 1 5  ? 1.067   23.282  -12.631 1.00 0.00 ? 5  HIS A CD2  4  
ATOM 4871  C CE1  . HIS A 1 5  ? 2.900   23.778  -13.708 1.00 0.00 ? 5  HIS A CE1  4  
ATOM 4872  N NE2  . HIS A 1 5  ? 1.790   23.074  -13.777 1.00 0.00 ? 5  HIS A NE2  4  
ATOM 4873  H H    . HIS A 1 5  ? 0.731   22.552  -8.564  1.00 0.00 ? 5  HIS A H    4  
ATOM 4874  H HA   . HIS A 1 5  ? 3.231   23.744  -9.568  1.00 0.00 ? 5  HIS A HA   4  
ATOM 4875  H HB2  . HIS A 1 5  ? 0.438   24.709  -10.326 1.00 0.00 ? 5  HIS A HB2  4  
ATOM 4876  H HB3  . HIS A 1 5  ? 1.863   25.733  -10.469 1.00 0.00 ? 5  HIS A HB3  4  
ATOM 4877  H HD1  . HIS A 1 5  ? 3.632   25.037  -12.278 1.00 0.00 ? 5  HIS A HD1  4  
ATOM 4878  H HD2  . HIS A 1 5  ? 0.112   22.832  -12.390 1.00 0.00 ? 5  HIS A HD2  4  
ATOM 4879  H HE1  . HIS A 1 5  ? 3.665   23.824  -14.467 1.00 0.00 ? 5  HIS A HE1  4  
ATOM 4880  H HE2  . HIS A 1 5  ? 1.426   22.704  -14.609 1.00 0.00 ? 5  HIS A HE2  4  
ATOM 4881  N N    . HIS A 1 6  ? 3.112   25.563  -7.756  1.00 0.00 ? 6  HIS A N    4  
ATOM 4882  C CA   . HIS A 1 6  ? 3.295   26.297  -6.475  1.00 0.00 ? 6  HIS A CA   4  
ATOM 4883  C C    . HIS A 1 6  ? 3.700   25.315  -5.347  1.00 0.00 ? 6  HIS A C    4  
ATOM 4884  O O    . HIS A 1 6  ? 3.218   24.181  -5.303  1.00 0.00 ? 6  HIS A O    4  
ATOM 4885  C CB   . HIS A 1 6  ? 2.025   27.127  -6.102  1.00 0.00 ? 6  HIS A CB   4  
ATOM 4886  C CG   . HIS A 1 6  ? 2.108   27.884  -4.804  1.00 0.00 ? 6  HIS A CG   4  
ATOM 4887  N ND1  . HIS A 1 6  ? 1.932   27.282  -3.577  1.00 0.00 ? 6  HIS A ND1  4  
ATOM 4888  C CD2  . HIS A 1 6  ? 2.327   29.194  -4.541  1.00 0.00 ? 6  HIS A CD2  4  
ATOM 4889  C CE1  . HIS A 1 6  ? 2.046   28.179  -2.623  1.00 0.00 ? 6  HIS A CE1  4  
ATOM 4890  N NE2  . HIS A 1 6  ? 2.280   29.347  -3.180  1.00 0.00 ? 6  HIS A NE2  4  
ATOM 4891  H H    . HIS A 1 6  ? 3.769   25.718  -8.469  1.00 0.00 ? 6  HIS A H    4  
ATOM 4892  H HA   . HIS A 1 6  ? 4.117   26.983  -6.636  1.00 0.00 ? 6  HIS A HA   4  
ATOM 4893  H HB2  . HIS A 1 6  ? 1.845   27.848  -6.888  1.00 0.00 ? 6  HIS A HB2  4  
ATOM 4894  H HB3  . HIS A 1 6  ? 1.167   26.463  -6.043  1.00 0.00 ? 6  HIS A HB3  4  
ATOM 4895  H HD1  . HIS A 1 6  ? 1.741   26.328  -3.429  1.00 0.00 ? 6  HIS A HD1  4  
ATOM 4896  H HD2  . HIS A 1 6  ? 2.504   29.979  -5.266  1.00 0.00 ? 6  HIS A HD2  4  
ATOM 4897  H HE1  . HIS A 1 6  ? 1.965   27.992  -1.560  1.00 0.00 ? 6  HIS A HE1  4  
ATOM 4898  H HE2  . HIS A 1 6  ? 2.569   30.148  -2.690  1.00 0.00 ? 6  HIS A HE2  4  
ATOM 4899  N N    . HIS A 1 7  ? 4.593   25.754  -4.438  1.00 0.00 ? 7  HIS A N    4  
ATOM 4900  C CA   . HIS A 1 7  ? 5.128   24.890  -3.365  1.00 0.00 ? 7  HIS A CA   4  
ATOM 4901  C C    . HIS A 1 7  ? 4.012   24.433  -2.402  1.00 0.00 ? 7  HIS A C    4  
ATOM 4902  O O    . HIS A 1 7  ? 3.186   25.232  -1.959  1.00 0.00 ? 7  HIS A O    4  
ATOM 4903  C CB   . HIS A 1 7  ? 6.267   25.599  -2.581  1.00 0.00 ? 7  HIS A CB   4  
ATOM 4904  C CG   . HIS A 1 7  ? 7.557   25.734  -3.354  1.00 0.00 ? 7  HIS A CG   4  
ATOM 4905  N ND1  . HIS A 1 7  ? 8.732   25.121  -2.968  1.00 0.00 ? 7  HIS A ND1  4  
ATOM 4906  C CD2  . HIS A 1 7  ? 7.856   26.411  -4.488  1.00 0.00 ? 7  HIS A CD2  4  
ATOM 4907  C CE1  . HIS A 1 7  ? 9.683   25.412  -3.829  1.00 0.00 ? 7  HIS A CE1  4  
ATOM 4908  N NE2  . HIS A 1 7  ? 9.180   26.191  -4.761  1.00 0.00 ? 7  HIS A NE2  4  
ATOM 4909  H H    . HIS A 1 7  ? 4.894   26.685  -4.482  1.00 0.00 ? 7  HIS A H    4  
ATOM 4910  H HA   . HIS A 1 7  ? 5.547   24.007  -3.849  1.00 0.00 ? 7  HIS A HA   4  
ATOM 4911  H HB2  . HIS A 1 7  ? 5.945   26.595  -2.300  1.00 0.00 ? 7  HIS A HB2  4  
ATOM 4912  H HB3  . HIS A 1 7  ? 6.483   25.039  -1.678  1.00 0.00 ? 7  HIS A HB3  4  
ATOM 4913  H HD1  . HIS A 1 7  ? 8.850   24.545  -2.183  1.00 0.00 ? 7  HIS A HD1  4  
ATOM 4914  H HD2  . HIS A 1 7  ? 7.176   27.008  -5.075  1.00 0.00 ? 7  HIS A HD2  4  
ATOM 4915  H HE1  . HIS A 1 7  ? 10.707  25.063  -3.784  1.00 0.00 ? 7  HIS A HE1  4  
ATOM 4916  H HE2  . HIS A 1 7  ? 9.602   26.351  -5.629  1.00 0.00 ? 7  HIS A HE2  4  
ATOM 4917  N N    . HIS A 1 8  ? 4.002   23.128  -2.124  1.00 0.00 ? 8  HIS A N    4  
ATOM 4918  C CA   . HIS A 1 8  ? 3.095   22.489  -1.147  1.00 0.00 ? 8  HIS A CA   4  
ATOM 4919  C C    . HIS A 1 8  ? 3.919   22.046  0.066   1.00 0.00 ? 8  HIS A C    4  
ATOM 4920  O O    . HIS A 1 8  ? 3.641   21.011  0.682   1.00 0.00 ? 8  HIS A O    4  
ATOM 4921  C CB   . HIS A 1 8  ? 2.343   21.293  -1.810  1.00 0.00 ? 8  HIS A CB   4  
ATOM 4922  C CG   . HIS A 1 8  ? 1.380   21.709  -2.893  1.00 0.00 ? 8  HIS A CG   4  
ATOM 4923  N ND1  . HIS A 1 8  ? 1.766   21.949  -4.195  1.00 0.00 ? 8  HIS A ND1  4  
ATOM 4924  C CD2  . HIS A 1 8  ? 0.044   21.937  -2.865  1.00 0.00 ? 8  HIS A CD2  4  
ATOM 4925  C CE1  . HIS A 1 8  ? 0.715   22.300  -4.908  1.00 0.00 ? 8  HIS A CE1  4  
ATOM 4926  N NE2  . HIS A 1 8  ? -0.338  22.300  -4.126  1.00 0.00 ? 8  HIS A NE2  4  
ATOM 4927  H H    . HIS A 1 8  ? 4.653   22.559  -2.589  1.00 0.00 ? 8  HIS A H    4  
ATOM 4928  H HA   . HIS A 1 8  ? 2.368   23.223  -0.801  1.00 0.00 ? 8  HIS A HA   4  
ATOM 4929  H HB2  . HIS A 1 8  ? 3.059   20.606  -2.249  1.00 0.00 ? 8  HIS A HB2  4  
ATOM 4930  H HB3  . HIS A 1 8  ? 1.773   20.759  -1.051  1.00 0.00 ? 8  HIS A HB3  4  
ATOM 4931  H HD1  . HIS A 1 8  ? 2.679   21.877  -4.546  1.00 0.00 ? 8  HIS A HD1  4  
ATOM 4932  H HD2  . HIS A 1 8  ? -0.602  21.857  -2.001  1.00 0.00 ? 8  HIS A HD2  4  
ATOM 4933  H HE1  . HIS A 1 8  ? 0.716   22.540  -5.962  1.00 0.00 ? 8  HIS A HE1  4  
ATOM 4934  H HE2  . HIS A 1 8  ? -1.261  22.402  -4.432  1.00 0.00 ? 8  HIS A HE2  4  
ATOM 4935  N N    . SER A 1 9  ? 4.910   22.884  0.430   1.00 0.00 ? 9  SER A N    4  
ATOM 4936  C CA   . SER A 1 9  ? 5.870   22.578  1.490   1.00 0.00 ? 9  SER A CA   4  
ATOM 4937  C C    . SER A 1 9  ? 5.226   22.722  2.882   1.00 0.00 ? 9  SER A C    4  
ATOM 4938  O O    . SER A 1 9  ? 5.314   23.779  3.525   1.00 0.00 ? 9  SER A O    4  
ATOM 4939  C CB   . SER A 1 9  ? 7.108   23.490  1.358   1.00 0.00 ? 9  SER A CB   4  
ATOM 4940  O OG   . SER A 1 9  ? 8.143   23.087  2.227   1.00 0.00 ? 9  SER A OG   4  
ATOM 4941  H H    . SER A 1 9  ? 4.995   23.741  -0.042  1.00 0.00 ? 9  SER A H    4  
ATOM 4942  H HA   . SER A 1 9  ? 6.188   21.544  1.359   1.00 0.00 ? 9  SER A HA   4  
ATOM 4943  H HB2  . SER A 1 9  ? 7.485   23.458  0.344   1.00 0.00 ? 9  SER A HB2  4  
ATOM 4944  H HB3  . SER A 1 9  ? 6.831   24.511  1.602   1.00 0.00 ? 9  SER A HB3  4  
ATOM 4945  H HG   . SER A 1 9  ? 8.649   22.378  1.814   1.00 0.00 ? 9  SER A HG   4  
ATOM 4946  N N    . HIS A 1 10 ? 4.537   21.659  3.310   1.00 0.00 ? 10 HIS A N    4  
ATOM 4947  C CA   . HIS A 1 10 ? 3.944   21.555  4.649   1.00 0.00 ? 10 HIS A CA   4  
ATOM 4948  C C    . HIS A 1 10 ? 4.828   20.614  5.473   1.00 0.00 ? 10 HIS A C    4  
ATOM 4949  O O    . HIS A 1 10 ? 4.561   19.409  5.588   1.00 0.00 ? 10 HIS A O    4  
ATOM 4950  C CB   . HIS A 1 10 ? 2.475   21.061  4.570   1.00 0.00 ? 10 HIS A CB   4  
ATOM 4951  C CG   . HIS A 1 10 ? 1.558   21.978  3.790   1.00 0.00 ? 10 HIS A CG   4  
ATOM 4952  N ND1  . HIS A 1 10 ? 1.048   23.151  4.309   1.00 0.00 ? 10 HIS A ND1  4  
ATOM 4953  C CD2  . HIS A 1 10 ? 1.068   21.898  2.523   1.00 0.00 ? 10 HIS A CD2  4  
ATOM 4954  C CE1  . HIS A 1 10 ? 0.288   23.738  3.403   1.00 0.00 ? 10 HIS A CE1  4  
ATOM 4955  N NE2  . HIS A 1 10 ? 0.284   23.000  2.318   1.00 0.00 ? 10 HIS A NE2  4  
ATOM 4956  H H    . HIS A 1 10 ? 4.447   20.898  2.700   1.00 0.00 ? 10 HIS A H    4  
ATOM 4957  H HA   . HIS A 1 10 ? 3.957   22.544  5.122   1.00 0.00 ? 10 HIS A HA   4  
ATOM 4958  H HB2  . HIS A 1 10 ? 2.452   20.085  4.099   1.00 0.00 ? 10 HIS A HB2  4  
ATOM 4959  H HB3  . HIS A 1 10 ? 2.074   20.973  5.573   1.00 0.00 ? 10 HIS A HB3  4  
ATOM 4960  H HD1  . HIS A 1 10 ? 1.215   23.501  5.211   1.00 0.00 ? 10 HIS A HD1  4  
ATOM 4961  H HD2  . HIS A 1 10 ? 1.257   21.107  1.806   1.00 0.00 ? 10 HIS A HD2  4  
ATOM 4962  H HE1  . HIS A 1 10 ? -0.238  24.673  3.526   1.00 0.00 ? 10 HIS A HE1  4  
ATOM 4963  H HE2  . HIS A 1 10 ? -0.191  23.221  1.487   1.00 0.00 ? 10 HIS A HE2  4  
ATOM 4964  N N    . MET A 1 11 ? 5.937   21.190  5.969   1.00 0.00 ? 11 MET A N    4  
ATOM 4965  C CA   . MET A 1 11 ? 6.992   20.459  6.689   1.00 0.00 ? 11 MET A CA   4  
ATOM 4966  C C    . MET A 1 11 ? 6.453   19.935  8.033   1.00 0.00 ? 11 MET A C    4  
ATOM 4967  O O    . MET A 1 11 ? 6.605   18.756  8.361   1.00 0.00 ? 11 MET A O    4  
ATOM 4968  C CB   . MET A 1 11 ? 8.221   21.381  6.914   1.00 0.00 ? 11 MET A CB   4  
ATOM 4969  C CG   . MET A 1 11 ? 8.793   22.007  5.627   1.00 0.00 ? 11 MET A CG   4  
ATOM 4970  S SD   . MET A 1 11 ? 9.226   20.780  4.369   1.00 0.00 ? 11 MET A SD   4  
ATOM 4971  C CE   . MET A 1 11 ? 10.507  19.826  5.189   1.00 0.00 ? 11 MET A CE   4  
ATOM 4972  H H    . MET A 1 11 ? 6.045   22.159  5.848   1.00 0.00 ? 11 MET A H    4  
ATOM 4973  H HA   . MET A 1 11 ? 7.289   19.617  6.072   1.00 0.00 ? 11 MET A HA   4  
ATOM 4974  H HB2  . MET A 1 11 ? 7.937   22.186  7.585   1.00 0.00 ? 11 MET A HB2  4  
ATOM 4975  H HB3  . MET A 1 11 ? 9.008   20.802  7.387   1.00 0.00 ? 11 MET A HB3  4  
ATOM 4976  H HG2  . MET A 1 11 ? 8.057   22.677  5.205   1.00 0.00 ? 11 MET A HG2  4  
ATOM 4977  H HG3  . MET A 1 11 ? 9.684   22.575  5.876   1.00 0.00 ? 11 MET A HG3  4  
ATOM 4978  H HE1  . MET A 1 11 ? 11.329  20.475  5.454   1.00 0.00 ? 11 MET A HE1  4  
ATOM 4979  H HE2  . MET A 1 11 ? 10.858  19.054  4.523   1.00 0.00 ? 11 MET A HE2  4  
ATOM 4980  H HE3  . MET A 1 11 ? 10.103  19.372  6.085   1.00 0.00 ? 11 MET A HE3  4  
ATOM 4981  N N    . LYS A 1 12 ? 5.804   20.839  8.784   1.00 0.00 ? 12 LYS A N    4  
ATOM 4982  C CA   . LYS A 1 12 ? 5.137   20.515  10.049  1.00 0.00 ? 12 LYS A CA   4  
ATOM 4983  C C    . LYS A 1 12 ? 3.769   19.888  9.737   1.00 0.00 ? 12 LYS A C    4  
ATOM 4984  O O    . LYS A 1 12 ? 2.803   20.596  9.442   1.00 0.00 ? 12 LYS A O    4  
ATOM 4985  C CB   . LYS A 1 12 ? 4.968   21.789  10.918  1.00 0.00 ? 12 LYS A CB   4  
ATOM 4986  C CG   . LYS A 1 12 ? 6.277   22.549  11.227  1.00 0.00 ? 12 LYS A CG   4  
ATOM 4987  C CD   . LYS A 1 12 ? 6.045   23.793  12.128  1.00 0.00 ? 12 LYS A CD   4  
ATOM 4988  C CE   . LYS A 1 12 ? 5.051   24.807  11.526  1.00 0.00 ? 12 LYS A CE   4  
ATOM 4989  N NZ   . LYS A 1 12 ? 4.842   25.981  12.421  1.00 0.00 ? 12 LYS A NZ   4  
ATOM 4990  H H    . LYS A 1 12 ? 5.759   21.759  8.462   1.00 0.00 ? 12 LYS A H    4  
ATOM 4991  H HA   . LYS A 1 12 ? 5.753   19.792  10.591  1.00 0.00 ? 12 LYS A HA   4  
ATOM 4992  H HB2  . LYS A 1 12 ? 4.297   22.471  10.402  1.00 0.00 ? 12 LYS A HB2  4  
ATOM 4993  H HB3  . LYS A 1 12 ? 4.511   21.507  11.861  1.00 0.00 ? 12 LYS A HB3  4  
ATOM 4994  H HG2  . LYS A 1 12 ? 6.959   21.873  11.733  1.00 0.00 ? 12 LYS A HG2  4  
ATOM 4995  H HG3  . LYS A 1 12 ? 6.731   22.869  10.292  1.00 0.00 ? 12 LYS A HG3  4  
ATOM 4996  H HD2  . LYS A 1 12 ? 5.659   23.463  13.086  1.00 0.00 ? 12 LYS A HD2  4  
ATOM 4997  H HD3  . LYS A 1 12 ? 6.995   24.291  12.288  1.00 0.00 ? 12 LYS A HD3  4  
ATOM 4998  H HE2  . LYS A 1 12 ? 5.430   25.158  10.574  1.00 0.00 ? 12 LYS A HE2  4  
ATOM 4999  H HE3  . LYS A 1 12 ? 4.098   24.317  11.368  1.00 0.00 ? 12 LYS A HE3  4  
ATOM 5000  H HZ1  . LYS A 1 12 ? 4.097   26.601  12.041  1.00 0.00 ? 12 LYS A HZ1  4  
ATOM 5001  H HZ2  . LYS A 1 12 ? 5.721   26.529  12.506  1.00 0.00 ? 12 LYS A HZ2  4  
ATOM 5002  H HZ3  . LYS A 1 12 ? 4.554   25.662  13.370  1.00 0.00 ? 12 LYS A HZ3  4  
ATOM 5003  N N    . ARG A 1 13 ? 3.741   18.555  9.723   1.00 0.00 ? 13 ARG A N    4  
ATOM 5004  C CA   . ARG A 1 13 ? 2.535   17.755  9.491   1.00 0.00 ? 13 ARG A CA   4  
ATOM 5005  C C    . ARG A 1 13 ? 2.816   16.329  9.976   1.00 0.00 ? 13 ARG A C    4  
ATOM 5006  O O    . ARG A 1 13 ? 3.856   15.757  9.616   1.00 0.00 ? 13 ARG A O    4  
ATOM 5007  C CB   . ARG A 1 13 ? 2.139   17.775  7.983   1.00 0.00 ? 13 ARG A CB   4  
ATOM 5008  C CG   . ARG A 1 13 ? 0.962   16.844  7.621   1.00 0.00 ? 13 ARG A CG   4  
ATOM 5009  C CD   . ARG A 1 13 ? 0.576   16.884  6.138   1.00 0.00 ? 13 ARG A CD   4  
ATOM 5010  N NE   . ARG A 1 13 ? -0.002  18.185  5.742   1.00 0.00 ? 13 ARG A NE   4  
ATOM 5011  C CZ   . ARG A 1 13 ? -1.084  18.349  4.957   1.00 0.00 ? 13 ARG A CZ   4  
ATOM 5012  N NH1  . ARG A 1 13 ? -1.751  17.308  4.476   1.00 0.00 ? 13 ARG A NH1  4  
ATOM 5013  N NH2  . ARG A 1 13 ? -1.510  19.574  4.683   1.00 0.00 ? 13 ARG A NH2  4  
ATOM 5014  H H    . ARG A 1 13 ? 4.585   18.074  9.877   1.00 0.00 ? 13 ARG A H    4  
ATOM 5015  H HA   . ARG A 1 13 ? 1.723   18.181  10.082  1.00 0.00 ? 13 ARG A HA   4  
ATOM 5016  H HB2  . ARG A 1 13 ? 1.866   18.789  7.710   1.00 0.00 ? 13 ARG A HB2  4  
ATOM 5017  H HB3  . ARG A 1 13 ? 3.003   17.483  7.392   1.00 0.00 ? 13 ARG A HB3  4  
ATOM 5018  H HG2  . ARG A 1 13 ? 1.241   15.826  7.878   1.00 0.00 ? 13 ARG A HG2  4  
ATOM 5019  H HG3  . ARG A 1 13 ? 0.101   17.127  8.215   1.00 0.00 ? 13 ARG A HG3  4  
ATOM 5020  H HD2  . ARG A 1 13 ? 1.461   16.701  5.537   1.00 0.00 ? 13 ARG A HD2  4  
ATOM 5021  H HD3  . ARG A 1 13 ? -0.146  16.099  5.949   1.00 0.00 ? 13 ARG A HD3  4  
ATOM 5022  H HE   . ARG A 1 13 ? 0.443   18.989  6.091   1.00 0.00 ? 13 ARG A HE   4  
ATOM 5023  H HH11 . ARG A 1 13 ? -1.453  16.378  4.687   1.00 0.00 ? 13 ARG A HH11 4  
ATOM 5024  H HH12 . ARG A 1 13 ? -2.557  17.451  3.893   1.00 0.00 ? 13 ARG A HH12 4  
ATOM 5025  H HH21 . ARG A 1 13 ? -1.023  20.372  5.048   1.00 0.00 ? 13 ARG A HH21 4  
ATOM 5026  H HH22 . ARG A 1 13 ? -2.316  19.708  4.097   1.00 0.00 ? 13 ARG A HH22 4  
ATOM 5027  N N    . SER A 1 14 ? 1.907   15.772  10.798  1.00 0.00 ? 14 SER A N    4  
ATOM 5028  C CA   . SER A 1 14 ? 2.065   14.438  11.393  1.00 0.00 ? 14 SER A CA   4  
ATOM 5029  C C    . SER A 1 14 ? 1.836   13.344  10.327  1.00 0.00 ? 14 SER A C    4  
ATOM 5030  O O    . SER A 1 14 ? 0.760   12.748  10.244  1.00 0.00 ? 14 SER A O    4  
ATOM 5031  C CB   . SER A 1 14 ? 1.100   14.277  12.596  1.00 0.00 ? 14 SER A CB   4  
ATOM 5032  O OG   . SER A 1 14 ? 1.323   15.285  13.572  1.00 0.00 ? 14 SER A OG   4  
ATOM 5033  H H    . SER A 1 14 ? 1.099   16.278  11.009  1.00 0.00 ? 14 SER A H    4  
ATOM 5034  H HA   . SER A 1 14 ? 3.087   14.354  11.753  1.00 0.00 ? 14 SER A HA   4  
ATOM 5035  H HB2  . SER A 1 14 ? 0.076   14.357  12.255  1.00 0.00 ? 14 SER A HB2  4  
ATOM 5036  H HB3  . SER A 1 14 ? 1.248   13.311  13.061  1.00 0.00 ? 14 SER A HB3  4  
ATOM 5037  H HG   . SER A 1 14 ? 0.691   15.172  14.294  1.00 0.00 ? 14 SER A HG   4  
ATOM 5038  N N    . GLY A 1 15 ? 2.870   13.117  9.503   1.00 0.00 ? 15 GLY A N    4  
ATOM 5039  C CA   . GLY A 1 15 ? 2.778   12.209  8.365   1.00 0.00 ? 15 GLY A CA   4  
ATOM 5040  C C    . GLY A 1 15 ? 2.385   12.951  7.089   1.00 0.00 ? 15 GLY A C    4  
ATOM 5041  O O    . GLY A 1 15 ? 1.415   13.717  7.092   1.00 0.00 ? 15 GLY A O    4  
ATOM 5042  H H    . GLY A 1 15 ? 3.713   13.593  9.667   1.00 0.00 ? 15 GLY A H    4  
ATOM 5043  H HA2  . GLY A 1 15 ? 3.743   11.734  8.231   1.00 0.00 ? 15 GLY A HA2  4  
ATOM 5044  H HA3  . GLY A 1 15 ? 2.042   11.437  8.565   1.00 0.00 ? 15 GLY A HA3  4  
ATOM 5045  N N    . ARG A 1 16 ? 3.096   12.686  5.983   1.00 0.00 ? 16 ARG A N    4  
ATOM 5046  C CA   . ARG A 1 16 ? 2.871   13.350  4.688   1.00 0.00 ? 16 ARG A CA   4  
ATOM 5047  C C    . ARG A 1 16 ? 1.777   12.592  3.929   1.00 0.00 ? 16 ARG A C    4  
ATOM 5048  O O    . ARG A 1 16 ? 1.912   11.385  3.701   1.00 0.00 ? 16 ARG A O    4  
ATOM 5049  C CB   . ARG A 1 16 ? 4.175   13.343  3.840   1.00 0.00 ? 16 ARG A CB   4  
ATOM 5050  C CG   . ARG A 1 16 ? 4.015   13.941  2.413   1.00 0.00 ? 16 ARG A CG   4  
ATOM 5051  C CD   . ARG A 1 16 ? 5.208   13.640  1.490   1.00 0.00 ? 16 ARG A CD   4  
ATOM 5052  N NE   . ARG A 1 16 ? 6.462   14.249  1.966   1.00 0.00 ? 16 ARG A NE   4  
ATOM 5053  C CZ   . ARG A 1 16 ? 7.694   13.755  1.764   1.00 0.00 ? 16 ARG A CZ   4  
ATOM 5054  N NH1  . ARG A 1 16 ? 7.883   12.617  1.100   1.00 0.00 ? 16 ARG A NH1  4  
ATOM 5055  N NH2  . ARG A 1 16 ? 8.737   14.421  2.236   1.00 0.00 ? 16 ARG A NH2  4  
ATOM 5056  H H    . ARG A 1 16 ? 3.732   11.954  5.998   1.00 0.00 ? 16 ARG A H    4  
ATOM 5057  H HA   . ARG A 1 16 ? 2.561   14.381  4.865   1.00 0.00 ? 16 ARG A HA   4  
ATOM 5058  H HB2  . ARG A 1 16 ? 4.932   13.914  4.365   1.00 0.00 ? 16 ARG A HB2  4  
ATOM 5059  H HB3  . ARG A 1 16 ? 4.525   12.317  3.747   1.00 0.00 ? 16 ARG A HB3  4  
ATOM 5060  H HG2  . ARG A 1 16 ? 3.119   13.530  1.956   1.00 0.00 ? 16 ARG A HG2  4  
ATOM 5061  H HG3  . ARG A 1 16 ? 3.901   15.015  2.499   1.00 0.00 ? 16 ARG A HG3  4  
ATOM 5062  H HD2  . ARG A 1 16 ? 5.337   12.564  1.429   1.00 0.00 ? 16 ARG A HD2  4  
ATOM 5063  H HD3  . ARG A 1 16 ? 4.987   14.021  0.498   1.00 0.00 ? 16 ARG A HD3  4  
ATOM 5064  H HE   . ARG A 1 16 ? 6.381   15.087  2.470   1.00 0.00 ? 16 ARG A HE   4  
ATOM 5065  H HH11 . ARG A 1 16 ? 7.100   12.109  0.732   1.00 0.00 ? 16 ARG A HH11 4  
ATOM 5066  H HH12 . ARG A 1 16 ? 8.812   12.261  0.962   1.00 0.00 ? 16 ARG A HH12 4  
ATOM 5067  H HH21 . ARG A 1 16 ? 8.606   15.289  2.730   1.00 0.00 ? 16 ARG A HH21 4  
ATOM 5068  H HH22 . ARG A 1 16 ? 9.670   14.071  2.097   1.00 0.00 ? 16 ARG A HH22 4  
ATOM 5069  N N    . GLU A 1 17 ? 0.697   13.290  3.543   1.00 0.00 ? 17 GLU A N    4  
ATOM 5070  C CA   . GLU A 1 17 ? -0.321  12.721  2.657   1.00 0.00 ? 17 GLU A CA   4  
ATOM 5071  C C    . GLU A 1 17 ? 0.253   12.693  1.230   1.00 0.00 ? 17 GLU A C    4  
ATOM 5072  O O    . GLU A 1 17 ? 0.847   13.672  0.773   1.00 0.00 ? 17 GLU A O    4  
ATOM 5073  C CB   . GLU A 1 17 ? -1.636  13.538  2.690   1.00 0.00 ? 17 GLU A CB   4  
ATOM 5074  C CG   . GLU A 1 17 ? -2.781  12.887  1.875   1.00 0.00 ? 17 GLU A CG   4  
ATOM 5075  C CD   . GLU A 1 17 ? -4.024  13.771  1.779   1.00 0.00 ? 17 GLU A CD   4  
ATOM 5076  O OE1  . GLU A 1 17 ? -4.858  13.733  2.703   1.00 0.00 ? 17 GLU A OE1  4  
ATOM 5077  O OE2  . GLU A 1 17 ? -4.163  14.513  0.780   1.00 0.00 ? 17 GLU A OE2  4  
ATOM 5078  H H    . GLU A 1 17 ? 0.597   14.215  3.839   1.00 0.00 ? 17 GLU A H    4  
ATOM 5079  H HA   . GLU A 1 17 ? -0.529  11.698  2.990   1.00 0.00 ? 17 GLU A HA   4  
ATOM 5080  H HB2  . GLU A 1 17 ? -1.964  13.643  3.722   1.00 0.00 ? 17 GLU A HB2  4  
ATOM 5081  H HB3  . GLU A 1 17 ? -1.447  14.529  2.285   1.00 0.00 ? 17 GLU A HB3  4  
ATOM 5082  H HG2  . GLU A 1 17 ? -2.420  12.675  0.868   1.00 0.00 ? 17 GLU A HG2  4  
ATOM 5083  H HG3  . GLU A 1 17 ? -3.053  11.939  2.339   1.00 0.00 ? 17 GLU A HG3  4  
ATOM 5084  N N    . ILE A 1 18 ? 0.098   11.562  0.553   1.00 0.00 ? 18 ILE A N    4  
ATOM 5085  C CA   . ILE A 1 18 ? 0.609   11.321  -0.800  1.00 0.00 ? 18 ILE A CA   4  
ATOM 5086  C C    . ILE A 1 18 ? -0.538  10.800  -1.659  1.00 0.00 ? 18 ILE A C    4  
ATOM 5087  O O    . ILE A 1 18 ? -1.607  10.459  -1.132  1.00 0.00 ? 18 ILE A O    4  
ATOM 5088  C CB   . ILE A 1 18 ? 1.800   10.283  -0.788  1.00 0.00 ? 18 ILE A CB   4  
ATOM 5089  C CG1  . ILE A 1 18 ? 1.339   8.868   -0.279  1.00 0.00 ? 18 ILE A CG1  4  
ATOM 5090  C CG2  . ILE A 1 18 ? 2.980   10.810  0.059   1.00 0.00 ? 18 ILE A CG2  4  
ATOM 5091  C CD1  . ILE A 1 18 ? 2.436   7.817   -0.269  1.00 0.00 ? 18 ILE A CD1  4  
ATOM 5092  H H    . ILE A 1 18 ? -0.414  10.851  0.970   1.00 0.00 ? 18 ILE A H    4  
ATOM 5093  H HA   . ILE A 1 18 ? 0.969   12.264  -1.228  1.00 0.00 ? 18 ILE A HA   4  
ATOM 5094  H HB   . ILE A 1 18 ? 2.161   10.181  -1.812  1.00 0.00 ? 18 ILE A HB   4  
ATOM 5095  H HG12 . ILE A 1 18 ? 0.964   8.953   0.732   1.00 0.00 ? 18 ILE A HG12 4  
ATOM 5096  H HG13 . ILE A 1 18 ? 0.540   8.501   -0.915  1.00 0.00 ? 18 ILE A HG13 4  
ATOM 5097  H HG21 . ILE A 1 18 ? 3.309   11.771  -0.318  1.00 0.00 ? 18 ILE A HG21 4  
ATOM 5098  H HG22 . ILE A 1 18 ? 3.810   10.113  0.013   1.00 0.00 ? 18 ILE A HG22 4  
ATOM 5099  H HG23 . ILE A 1 18 ? 2.669   10.921  1.092   1.00 0.00 ? 18 ILE A HG23 4  
ATOM 5100  H HD11 . ILE A 1 18 ? 3.231   8.126   0.391   1.00 0.00 ? 18 ILE A HD11 4  
ATOM 5101  H HD12 . ILE A 1 18 ? 2.826   7.696   -1.271  1.00 0.00 ? 18 ILE A HD12 4  
ATOM 5102  H HD13 . ILE A 1 18 ? 2.031   6.873   0.072   1.00 0.00 ? 18 ILE A HD13 4  
ATOM 5103  N N    . THR A 1 19 ? -0.320  10.743  -2.973  1.00 0.00 ? 19 THR A N    4  
ATOM 5104  C CA   . THR A 1 19 ? -1.273  10.132  -3.901  1.00 0.00 ? 19 THR A CA   4  
ATOM 5105  C C    . THR A 1 19 ? -1.012  8.617   -3.978  1.00 0.00 ? 19 THR A C    4  
ATOM 5106  O O    . THR A 1 19 ? 0.074   8.146   -3.586  1.00 0.00 ? 19 THR A O    4  
ATOM 5107  C CB   . THR A 1 19 ? -1.177  10.775  -5.326  1.00 0.00 ? 19 THR A CB   4  
ATOM 5108  O OG1  . THR A 1 19 ? 0.134   10.579  -5.876  1.00 0.00 ? 19 THR A OG1  4  
ATOM 5109  C CG2  . THR A 1 19 ? -1.498  12.281  -5.296  1.00 0.00 ? 19 THR A CG2  4  
ATOM 5110  H H    . THR A 1 19 ? 0.517   11.100  -3.331  1.00 0.00 ? 19 THR A H    4  
ATOM 5111  H HA   . THR A 1 19 ? -2.283  10.294  -3.523  1.00 0.00 ? 19 THR A HA   4  
ATOM 5112  H HB   . THR A 1 19 ? -1.896  10.288  -5.977  1.00 0.00 ? 19 THR A HB   4  
ATOM 5113  H HG1  . THR A 1 19 ? 0.239   11.130  -6.655  1.00 0.00 ? 19 THR A HG1  4  
ATOM 5114  H HG21 . THR A 1 19 ? -2.503  12.433  -4.928  1.00 0.00 ? 19 THR A HG21 4  
ATOM 5115  H HG22 . THR A 1 19 ? -1.419  12.688  -6.295  1.00 0.00 ? 19 THR A HG22 4  
ATOM 5116  H HG23 . THR A 1 19 ? -0.796  12.793  -4.647  1.00 0.00 ? 19 THR A HG23 4  
ATOM 5117  N N    . TRP A 1 20 ? -2.025  7.873   -4.460  1.00 0.00 ? 20 TRP A N    4  
ATOM 5118  C CA   . TRP A 1 20 ? -1.931  6.428   -4.721  1.00 0.00 ? 20 TRP A CA   4  
ATOM 5119  C C    . TRP A 1 20 ? -0.697  6.098   -5.579  1.00 0.00 ? 20 TRP A C    4  
ATOM 5120  O O    . TRP A 1 20 ? 0.080   5.219   -5.226  1.00 0.00 ? 20 TRP A O    4  
ATOM 5121  C CB   . TRP A 1 20 ? -3.229  5.907   -5.411  1.00 0.00 ? 20 TRP A CB   4  
ATOM 5122  C CG   . TRP A 1 20 ? -3.134  4.489   -5.932  1.00 0.00 ? 20 TRP A CG   4  
ATOM 5123  C CD1  . TRP A 1 20 ? -3.030  4.100   -7.237  1.00 0.00 ? 20 TRP A CD1  4  
ATOM 5124  C CD2  . TRP A 1 20 ? -3.092  3.282   -5.153  1.00 0.00 ? 20 TRP A CD2  4  
ATOM 5125  N NE1  . TRP A 1 20 ? -2.956  2.738   -7.316  1.00 0.00 ? 20 TRP A NE1  4  
ATOM 5126  C CE2  . TRP A 1 20 ? -2.991  2.212   -6.054  1.00 0.00 ? 20 TRP A CE2  4  
ATOM 5127  C CE3  . TRP A 1 20 ? -3.138  3.004   -3.788  1.00 0.00 ? 20 TRP A CE3  4  
ATOM 5128  C CZ2  . TRP A 1 20 ? -2.943  0.887   -5.640  1.00 0.00 ? 20 TRP A CZ2  4  
ATOM 5129  C CZ3  . TRP A 1 20 ? -3.083  1.687   -3.372  1.00 0.00 ? 20 TRP A CZ3  4  
ATOM 5130  C CH2  . TRP A 1 20 ? -2.987  0.642   -4.294  1.00 0.00 ? 20 TRP A CH2  4  
ATOM 5131  H H    . TRP A 1 20 ? -2.881  8.317   -4.595  1.00 0.00 ? 20 TRP A H    4  
ATOM 5132  H HA   . TRP A 1 20 ? -1.833  5.936   -3.755  1.00 0.00 ? 20 TRP A HA   4  
ATOM 5133  H HB2  . TRP A 1 20 ? -4.049  5.941   -4.701  1.00 0.00 ? 20 TRP A HB2  4  
ATOM 5134  H HB3  . TRP A 1 20 ? -3.473  6.555   -6.249  1.00 0.00 ? 20 TRP A HB3  4  
ATOM 5135  H HD1  . TRP A 1 20 ? -3.024  4.781   -8.076  1.00 0.00 ? 20 TRP A HD1  4  
ATOM 5136  H HE1  . TRP A 1 20 ? -2.883  2.224   -8.144  1.00 0.00 ? 20 TRP A HE1  4  
ATOM 5137  H HE3  . TRP A 1 20 ? -3.211  3.800   -3.058  1.00 0.00 ? 20 TRP A HE3  4  
ATOM 5138  H HZ2  . TRP A 1 20 ? -2.871  0.070   -6.347  1.00 0.00 ? 20 TRP A HZ2  4  
ATOM 5139  H HZ3  . TRP A 1 20 ? -3.116  1.458   -2.313  1.00 0.00 ? 20 TRP A HZ3  4  
ATOM 5140  H HH2  . TRP A 1 20 ? -2.948  -0.374  -3.925  1.00 0.00 ? 20 TRP A HH2  4  
ATOM 5141  N N    . LYS A 1 21 ? -0.524  6.841   -6.686  1.00 0.00 ? 21 LYS A N    4  
ATOM 5142  C CA   . LYS A 1 21 ? 0.550   6.578   -7.646  1.00 0.00 ? 21 LYS A CA   4  
ATOM 5143  C C    . LYS A 1 21 ? 1.914   7.043   -7.119  1.00 0.00 ? 21 LYS A C    4  
ATOM 5144  O O    . LYS A 1 21 ? 2.942   6.518   -7.561  1.00 0.00 ? 21 LYS A O    4  
ATOM 5145  C CB   . LYS A 1 21 ? 0.248   7.186   -9.033  1.00 0.00 ? 21 LYS A CB   4  
ATOM 5146  C CG   . LYS A 1 21 ? -0.950  6.521   -9.753  1.00 0.00 ? 21 LYS A CG   4  
ATOM 5147  C CD   . LYS A 1 21 ? -1.133  7.026   -11.205 1.00 0.00 ? 21 LYS A CD   4  
ATOM 5148  C CE   . LYS A 1 21 ? 0.058   6.677   -12.124 1.00 0.00 ? 21 LYS A CE   4  
ATOM 5149  N NZ   . LYS A 1 21 ? -0.115  7.237   -13.490 1.00 0.00 ? 21 LYS A NZ   4  
ATOM 5150  H H    . LYS A 1 21 ? -1.126  7.603   -6.834  1.00 0.00 ? 21 LYS A H    4  
ATOM 5151  H HA   . LYS A 1 21 ? 0.602   5.494   -7.764  1.00 0.00 ? 21 LYS A HA   4  
ATOM 5152  H HB2  . LYS A 1 21 ? 0.034   8.247   -8.913  1.00 0.00 ? 21 LYS A HB2  4  
ATOM 5153  H HB3  . LYS A 1 21 ? 1.124   7.081   -9.663  1.00 0.00 ? 21 LYS A HB3  4  
ATOM 5154  H HG2  . LYS A 1 21 ? -0.802  5.442   -9.771  1.00 0.00 ? 21 LYS A HG2  4  
ATOM 5155  H HG3  . LYS A 1 21 ? -1.853  6.737   -9.190  1.00 0.00 ? 21 LYS A HG3  4  
ATOM 5156  H HD2  . LYS A 1 21 ? -2.031  6.580   -11.623 1.00 0.00 ? 21 LYS A HD2  4  
ATOM 5157  H HD3  . LYS A 1 21 ? -1.256  8.102   -11.186 1.00 0.00 ? 21 LYS A HD3  4  
ATOM 5158  H HE2  . LYS A 1 21 ? 0.968   7.080   -11.697 1.00 0.00 ? 21 LYS A HE2  4  
ATOM 5159  H HE3  . LYS A 1 21 ? 0.147   5.600   -12.200 1.00 0.00 ? 21 LYS A HE3  4  
ATOM 5160  H HZ1  . LYS A 1 21 ? 0.681   6.955   -14.098 1.00 0.00 ? 21 LYS A HZ1  4  
ATOM 5161  H HZ2  . LYS A 1 21 ? -0.160  8.273   -13.458 1.00 0.00 ? 21 LYS A HZ2  4  
ATOM 5162  H HZ3  . LYS A 1 21 ? -0.992  6.879   -13.912 1.00 0.00 ? 21 LYS A HZ3  4  
ATOM 5163  N N    . ASP A 1 22 ? 1.945   8.019   -6.180  1.00 0.00 ? 22 ASP A N    4  
ATOM 5164  C CA   . ASP A 1 22 ? 3.191   8.422   -5.495  1.00 0.00 ? 22 ASP A CA   4  
ATOM 5165  C C    . ASP A 1 22 ? 3.698   7.257   -4.637  1.00 0.00 ? 22 ASP A C    4  
ATOM 5166  O O    . ASP A 1 22 ? 4.898   6.953   -4.616  1.00 0.00 ? 22 ASP A O    4  
ATOM 5167  C CB   . ASP A 1 22 ? 2.932   9.669   -4.609  1.00 0.00 ? 22 ASP A CB   4  
ATOM 5168  C CG   . ASP A 1 22 ? 4.220   10.254  -4.012  1.00 0.00 ? 22 ASP A CG   4  
ATOM 5169  O OD1  . ASP A 1 22 ? 4.642   9.834   -2.917  1.00 0.00 ? 22 ASP A OD1  4  
ATOM 5170  O OD2  . ASP A 1 22 ? 4.828   11.140  -4.653  1.00 0.00 ? 22 ASP A OD2  4  
ATOM 5171  H H    . ASP A 1 22 ? 1.138   8.508   -5.914  1.00 0.00 ? 22 ASP A H    4  
ATOM 5172  H HA   . ASP A 1 22 ? 3.932   8.668   -6.254  1.00 0.00 ? 22 ASP A HA   4  
ATOM 5173  H HB2  . ASP A 1 22 ? 2.450   10.435  -5.210  1.00 0.00 ? 22 ASP A HB2  4  
ATOM 5174  H HB3  . ASP A 1 22 ? 2.254   9.403   -3.798  1.00 0.00 ? 22 ASP A HB3  4  
ATOM 5175  N N    . PHE A 1 23 ? 2.736   6.614   -3.944  1.00 0.00 ? 23 PHE A N    4  
ATOM 5176  C CA   . PHE A 1 23 ? 2.965   5.381   -3.187  1.00 0.00 ? 23 PHE A CA   4  
ATOM 5177  C C    . PHE A 1 23 ? 3.548   4.280   -4.094  1.00 0.00 ? 23 PHE A C    4  
ATOM 5178  O O    . PHE A 1 23 ? 4.564   3.688   -3.751  1.00 0.00 ? 23 PHE A O    4  
ATOM 5179  C CB   . PHE A 1 23 ? 1.653   4.905   -2.490  1.00 0.00 ? 23 PHE A CB   4  
ATOM 5180  C CG   . PHE A 1 23 ? 1.686   3.458   -2.005  1.00 0.00 ? 23 PHE A CG   4  
ATOM 5181  C CD1  . PHE A 1 23 ? 2.633   3.035   -1.065  1.00 0.00 ? 23 PHE A CD1  4  
ATOM 5182  C CD2  . PHE A 1 23 ? 0.788   2.505   -2.508  1.00 0.00 ? 23 PHE A CD2  4  
ATOM 5183  C CE1  . PHE A 1 23 ? 2.683   1.722   -0.655  1.00 0.00 ? 23 PHE A CE1  4  
ATOM 5184  C CE2  . PHE A 1 23 ? 0.840   1.192   -2.086  1.00 0.00 ? 23 PHE A CE2  4  
ATOM 5185  C CZ   . PHE A 1 23 ? 1.787   0.805   -1.165  1.00 0.00 ? 23 PHE A CZ   4  
ATOM 5186  H H    . PHE A 1 23 ? 1.833   6.996   -3.949  1.00 0.00 ? 23 PHE A H    4  
ATOM 5187  H HA   . PHE A 1 23 ? 3.691   5.616   -2.417  1.00 0.00 ? 23 PHE A HA   4  
ATOM 5188  H HB2  . PHE A 1 23 ? 1.464   5.532   -1.628  1.00 0.00 ? 23 PHE A HB2  4  
ATOM 5189  H HB3  . PHE A 1 23 ? 0.824   5.015   -3.182  1.00 0.00 ? 23 PHE A HB3  4  
ATOM 5190  H HD1  . PHE A 1 23 ? 3.337   3.747   -0.660  1.00 0.00 ? 23 PHE A HD1  4  
ATOM 5191  H HD2  . PHE A 1 23 ? 0.043   2.802   -3.232  1.00 0.00 ? 23 PHE A HD2  4  
ATOM 5192  H HE1  . PHE A 1 23 ? 3.423   1.404   0.076   1.00 0.00 ? 23 PHE A HE1  4  
ATOM 5193  H HE2  . PHE A 1 23 ? 0.139   0.462   -2.479  1.00 0.00 ? 23 PHE A HE2  4  
ATOM 5194  H HZ   . PHE A 1 23 ? 1.829   -0.232  -0.832  1.00 0.00 ? 23 PHE A HZ   4  
ATOM 5195  N N    . VAL A 1 24 ? 2.899   4.025   -5.246  1.00 0.00 ? 24 VAL A N    4  
ATOM 5196  C CA   . VAL A 1 24 ? 3.319   2.965   -6.184  1.00 0.00 ? 24 VAL A CA   4  
ATOM 5197  C C    . VAL A 1 24 ? 4.771   3.186   -6.655  1.00 0.00 ? 24 VAL A C    4  
ATOM 5198  O O    . VAL A 1 24 ? 5.654   2.410   -6.317  1.00 0.00 ? 24 VAL A O    4  
ATOM 5199  C CB   . VAL A 1 24 ? 2.366   2.883   -7.438  1.00 0.00 ? 24 VAL A CB   4  
ATOM 5200  C CG1  . VAL A 1 24 ? 2.787   1.743   -8.400  1.00 0.00 ? 24 VAL A CG1  4  
ATOM 5201  C CG2  . VAL A 1 24 ? 0.894   2.733   -7.003  1.00 0.00 ? 24 VAL A CG2  4  
ATOM 5202  H H    . VAL A 1 24 ? 2.107   4.561   -5.471  1.00 0.00 ? 24 VAL A H    4  
ATOM 5203  H HA   . VAL A 1 24 ? 3.255   2.016   -5.652  1.00 0.00 ? 24 VAL A HA   4  
ATOM 5204  H HB   . VAL A 1 24 ? 2.453   3.821   -7.984  1.00 0.00 ? 24 VAL A HB   4  
ATOM 5205  H HG11 . VAL A 1 24 ? 3.799   1.906   -8.745  1.00 0.00 ? 24 VAL A HG11 4  
ATOM 5206  H HG12 . VAL A 1 24 ? 2.120   1.716   -9.251  1.00 0.00 ? 24 VAL A HG12 4  
ATOM 5207  H HG13 . VAL A 1 24 ? 2.735   0.788   -7.881  1.00 0.00 ? 24 VAL A HG13 4  
ATOM 5208  H HG21 . VAL A 1 24 ? 0.786   1.858   -6.375  1.00 0.00 ? 24 VAL A HG21 4  
ATOM 5209  H HG22 . VAL A 1 24 ? 0.254   2.631   -7.870  1.00 0.00 ? 24 VAL A HG22 4  
ATOM 5210  H HG23 . VAL A 1 24 ? 0.591   3.605   -6.442  1.00 0.00 ? 24 VAL A HG23 4  
ATOM 5211  N N    . ASN A 1 25 ? 5.000   4.321   -7.330  1.00 0.00 ? 25 ASN A N    4  
ATOM 5212  C CA   . ASN A 1 25 ? 6.240   4.578   -8.096  1.00 0.00 ? 25 ASN A CA   4  
ATOM 5213  C C    . ASN A 1 25 ? 7.463   4.729   -7.170  1.00 0.00 ? 25 ASN A C    4  
ATOM 5214  O O    . ASN A 1 25 ? 8.517   4.126   -7.412  1.00 0.00 ? 25 ASN A O    4  
ATOM 5215  C CB   . ASN A 1 25 ? 6.081   5.842   -8.986  1.00 0.00 ? 25 ASN A CB   4  
ATOM 5216  C CG   . ASN A 1 25 ? 5.025   5.720   -10.104 1.00 0.00 ? 25 ASN A CG   4  
ATOM 5217  O OD1  . ASN A 1 25 ? 5.190   6.284   -11.182 1.00 0.00 ? 25 ASN A OD1  4  
ATOM 5218  N ND2  . ASN A 1 25 ? 3.914   5.028   -9.864  1.00 0.00 ? 25 ASN A ND2  4  
ATOM 5219  H H    . ASN A 1 25 ? 4.313   5.019   -7.302  1.00 0.00 ? 25 ASN A H    4  
ATOM 5220  H HA   . ASN A 1 25 ? 6.400   3.719   -8.744  1.00 0.00 ? 25 ASN A HA   4  
ATOM 5221  H HB2  . ASN A 1 25 ? 5.804   6.683   -8.364  1.00 0.00 ? 25 ASN A HB2  4  
ATOM 5222  H HB3  . ASN A 1 25 ? 7.037   6.060   -9.453  1.00 0.00 ? 25 ASN A HB3  4  
ATOM 5223  H HD21 . ASN A 1 25 ? 3.793   4.615   -8.987  1.00 0.00 ? 25 ASN A HD21 4  
ATOM 5224  H HD22 . ASN A 1 25 ? 3.257   4.954   -10.586 1.00 0.00 ? 25 ASN A HD22 4  
ATOM 5225  N N    . ASN A 1 26 ? 7.301   5.519   -6.096  1.00 0.00 ? 26 ASN A N    4  
ATOM 5226  C CA   . ASN A 1 26 ? 8.419   5.897   -5.204  1.00 0.00 ? 26 ASN A CA   4  
ATOM 5227  C C    . ASN A 1 26 ? 8.671   4.827   -4.136  1.00 0.00 ? 26 ASN A C    4  
ATOM 5228  O O    . ASN A 1 26 ? 9.813   4.598   -3.738  1.00 0.00 ? 26 ASN A O    4  
ATOM 5229  C CB   . ASN A 1 26 ? 8.132   7.258   -4.507  1.00 0.00 ? 26 ASN A CB   4  
ATOM 5230  C CG   . ASN A 1 26 ? 7.846   8.404   -5.482  1.00 0.00 ? 26 ASN A CG   4  
ATOM 5231  O OD1  . ASN A 1 26 ? 8.337   8.431   -6.607  1.00 0.00 ? 26 ASN A OD1  4  
ATOM 5232  N ND2  . ASN A 1 26 ? 7.050   9.353   -5.050  1.00 0.00 ? 26 ASN A ND2  4  
ATOM 5233  H H    . ASN A 1 26 ? 6.414   5.873   -5.889  1.00 0.00 ? 26 ASN A H    4  
ATOM 5234  H HA   . ASN A 1 26 ? 9.318   6.004   -5.817  1.00 0.00 ? 26 ASN A HA   4  
ATOM 5235  H HB2  . ASN A 1 26 ? 7.272   7.150   -3.852  1.00 0.00 ? 26 ASN A HB2  4  
ATOM 5236  H HB3  . ASN A 1 26 ? 8.991   7.541   -3.906  1.00 0.00 ? 26 ASN A HB3  4  
ATOM 5237  H HD21 . ASN A 1 26 ? 6.684   9.277   -4.137  1.00 0.00 ? 26 ASN A HD21 4  
ATOM 5238  H HD22 . ASN A 1 26 ? 6.845   10.091  -5.653  1.00 0.00 ? 26 ASN A HD22 4  
ATOM 5239  N N    . TYR A 1 27 ? 7.611   4.160   -3.663  1.00 0.00 ? 27 TYR A N    4  
ATOM 5240  C CA   . TYR A 1 27 ? 7.701   3.330   -2.447  1.00 0.00 ? 27 TYR A CA   4  
ATOM 5241  C C    . TYR A 1 27 ? 7.541   1.834   -2.763  1.00 0.00 ? 27 TYR A C    4  
ATOM 5242  O O    . TYR A 1 27 ? 8.503   1.053   -2.618  1.00 0.00 ? 27 TYR A O    4  
ATOM 5243  C CB   . TYR A 1 27 ? 6.668   3.826   -1.389  1.00 0.00 ? 27 TYR A CB   4  
ATOM 5244  C CG   . TYR A 1 27 ? 6.921   5.271   -0.931  1.00 0.00 ? 27 TYR A CG   4  
ATOM 5245  C CD1  . TYR A 1 27 ? 7.974   5.567   -0.062  1.00 0.00 ? 27 TYR A CD1  4  
ATOM 5246  C CD2  . TYR A 1 27 ? 6.132   6.338   -1.377  1.00 0.00 ? 27 TYR A CD2  4  
ATOM 5247  C CE1  . TYR A 1 27 ? 8.223   6.858   0.341   1.00 0.00 ? 27 TYR A CE1  4  
ATOM 5248  C CE2  . TYR A 1 27 ? 6.386   7.640   -0.967  1.00 0.00 ? 27 TYR A CE2  4  
ATOM 5249  C CZ   . TYR A 1 27 ? 7.433   7.888   -0.109  1.00 0.00 ? 27 TYR A CZ   4  
ATOM 5250  O OH   . TYR A 1 27 ? 7.686   9.175   0.310   1.00 0.00 ? 27 TYR A OH   4  
ATOM 5251  H H    . TYR A 1 27 ? 6.762   4.198   -4.150  1.00 0.00 ? 27 TYR A H    4  
ATOM 5252  H HA   . TYR A 1 27 ? 8.696   3.470   -2.020  1.00 0.00 ? 27 TYR A HA   4  
ATOM 5253  H HB2  . TYR A 1 27 ? 5.668   3.768   -1.806  1.00 0.00 ? 27 TYR A HB2  4  
ATOM 5254  H HB3  . TYR A 1 27 ? 6.716   3.190   -0.514  1.00 0.00 ? 27 TYR A HB3  4  
ATOM 5255  H HD1  . TYR A 1 27 ? 8.604   4.763   0.301   1.00 0.00 ? 27 TYR A HD1  4  
ATOM 5256  H HD2  . TYR A 1 27 ? 5.312   6.140   -2.054  1.00 0.00 ? 27 TYR A HD2  4  
ATOM 5257  H HE1  . TYR A 1 27 ? 9.048   7.059   1.015   1.00 0.00 ? 27 TYR A HE1  4  
ATOM 5258  H HE2  . TYR A 1 27 ? 5.762   8.454   -1.321  1.00 0.00 ? 27 TYR A HE2  4  
ATOM 5259  H HH   . TYR A 1 27 ? 6.853   9.608   0.526   1.00 0.00 ? 27 TYR A HH   4  
ATOM 5260  N N    . LEU A 1 28 ? 6.333   1.447   -3.210  1.00 0.00 ? 28 LEU A N    4  
ATOM 5261  C CA   . LEU A 1 28 ? 5.943   0.032   -3.358  1.00 0.00 ? 28 LEU A CA   4  
ATOM 5262  C C    . LEU A 1 28 ? 6.782   -0.705  -4.421  1.00 0.00 ? 28 LEU A C    4  
ATOM 5263  O O    . LEU A 1 28 ? 7.287   -1.804  -4.159  1.00 0.00 ? 28 LEU A O    4  
ATOM 5264  C CB   . LEU A 1 28 ? 4.436   -0.103  -3.687  1.00 0.00 ? 28 LEU A CB   4  
ATOM 5265  C CG   . LEU A 1 28 ? 3.872   -1.552  -3.539  1.00 0.00 ? 28 LEU A CG   4  
ATOM 5266  C CD1  . LEU A 1 28 ? 4.053   -2.068  -2.092  1.00 0.00 ? 28 LEU A CD1  4  
ATOM 5267  C CD2  . LEU A 1 28 ? 2.402   -1.640  -3.981  1.00 0.00 ? 28 LEU A CD2  4  
ATOM 5268  H H    . LEU A 1 28 ? 5.672   2.140   -3.395  1.00 0.00 ? 28 LEU A H    4  
ATOM 5269  H HA   . LEU A 1 28 ? 6.121   -0.442  -2.393  1.00 0.00 ? 28 LEU A HA   4  
ATOM 5270  H HB2  . LEU A 1 28 ? 3.875   0.560   -3.027  1.00 0.00 ? 28 LEU A HB2  4  
ATOM 5271  H HB3  . LEU A 1 28 ? 4.275   0.227   -4.710  1.00 0.00 ? 28 LEU A HB3  4  
ATOM 5272  H HG   . LEU A 1 28 ? 4.443   -2.210  -4.185  1.00 0.00 ? 28 LEU A HG   4  
ATOM 5273  H HD11 . LEU A 1 28 ? 5.104   -2.090  -1.839  1.00 0.00 ? 28 LEU A HD11 4  
ATOM 5274  H HD12 . LEU A 1 28 ? 3.655   -3.067  -2.016  1.00 0.00 ? 28 LEU A HD12 4  
ATOM 5275  H HD13 . LEU A 1 28 ? 3.530   -1.423  -1.396  1.00 0.00 ? 28 LEU A HD13 4  
ATOM 5276  H HD21 . LEU A 1 28 ? 1.787   -1.007  -3.352  1.00 0.00 ? 28 LEU A HD21 4  
ATOM 5277  H HD22 . LEU A 1 28 ? 2.058   -2.664  -3.900  1.00 0.00 ? 28 LEU A HD22 4  
ATOM 5278  H HD23 . LEU A 1 28 ? 2.312   -1.318  -5.008  1.00 0.00 ? 28 LEU A HD23 4  
ATOM 5279  N N    . SER A 1 29 ? 6.921   -0.090  -5.604  1.00 0.00 ? 29 SER A N    4  
ATOM 5280  C CA   . SER A 1 29 ? 7.684   -0.654  -6.733  1.00 0.00 ? 29 SER A CA   4  
ATOM 5281  C C    . SER A 1 29 ? 9.196   -0.764  -6.427  1.00 0.00 ? 29 SER A C    4  
ATOM 5282  O O    . SER A 1 29 ? 9.908   -1.550  -7.062  1.00 0.00 ? 29 SER A O    4  
ATOM 5283  C CB   . SER A 1 29 ? 7.459   0.216   -7.989  1.00 0.00 ? 29 SER A CB   4  
ATOM 5284  O OG   . SER A 1 29 ? 6.078   0.356   -8.273  1.00 0.00 ? 29 SER A OG   4  
ATOM 5285  H H    . SER A 1 29 ? 6.471   0.761   -5.746  1.00 0.00 ? 29 SER A H    4  
ATOM 5286  H HA   . SER A 1 29 ? 7.293   -1.645  -6.923  1.00 0.00 ? 29 SER A HA   4  
ATOM 5287  H HB2  . SER A 1 29 ? 7.880   1.205   -7.832  1.00 0.00 ? 29 SER A HB2  4  
ATOM 5288  H HB3  . SER A 1 29 ? 7.940   -0.245  -8.841  1.00 0.00 ? 29 SER A HB3  4  
ATOM 5289  H HG   . SER A 1 29 ? 5.689   -0.513  -8.382  1.00 0.00 ? 29 SER A HG   4  
ATOM 5290  N N    . LYS A 1 30 ? 9.673   0.027   -5.443  1.00 0.00 ? 30 LYS A N    4  
ATOM 5291  C CA   . LYS A 1 30 ? 11.089  0.047   -5.015  1.00 0.00 ? 30 LYS A CA   4  
ATOM 5292  C C    . LYS A 1 30 ? 11.316  -0.822  -3.761  1.00 0.00 ? 30 LYS A C    4  
ATOM 5293  O O    . LYS A 1 30 ? 12.449  -0.935  -3.284  1.00 0.00 ? 30 LYS A O    4  
ATOM 5294  C CB   . LYS A 1 30 ? 11.540  1.512   -4.766  1.00 0.00 ? 30 LYS A CB   4  
ATOM 5295  C CG   . LYS A 1 30 ? 11.677  2.346   -6.058  1.00 0.00 ? 30 LYS A CG   4  
ATOM 5296  C CD   . LYS A 1 30 ? 12.124  3.797   -5.793  1.00 0.00 ? 30 LYS A CD   4  
ATOM 5297  C CE   . LYS A 1 30 ? 12.399  4.585   -7.083  1.00 0.00 ? 30 LYS A CE   4  
ATOM 5298  N NZ   . LYS A 1 30 ? 11.263  4.519   -8.045  1.00 0.00 ? 30 LYS A NZ   4  
ATOM 5299  H H    . LYS A 1 30 ? 9.046   0.608   -4.967  1.00 0.00 ? 30 LYS A H    4  
ATOM 5300  H HA   . LYS A 1 30 ? 11.690  -0.367  -5.824  1.00 0.00 ? 30 LYS A HA   4  
ATOM 5301  H HB2  . LYS A 1 30 ? 10.815  2.000   -4.117  1.00 0.00 ? 30 LYS A HB2  4  
ATOM 5302  H HB3  . LYS A 1 30 ? 12.504  1.509   -4.263  1.00 0.00 ? 30 LYS A HB3  4  
ATOM 5303  H HG2  . LYS A 1 30 ? 12.406  1.870   -6.706  1.00 0.00 ? 30 LYS A HG2  4  
ATOM 5304  H HG3  . LYS A 1 30 ? 10.715  2.362   -6.563  1.00 0.00 ? 30 LYS A HG3  4  
ATOM 5305  H HD2  . LYS A 1 30 ? 11.346  4.306   -5.235  1.00 0.00 ? 30 LYS A HD2  4  
ATOM 5306  H HD3  . LYS A 1 30 ? 13.031  3.779   -5.197  1.00 0.00 ? 30 LYS A HD3  4  
ATOM 5307  H HE2  . LYS A 1 30 ? 12.574  5.621   -6.829  1.00 0.00 ? 30 LYS A HE2  4  
ATOM 5308  H HE3  . LYS A 1 30 ? 13.281  4.182   -7.564  1.00 0.00 ? 30 LYS A HE3  4  
ATOM 5309  H HZ1  . LYS A 1 30 ? 11.462  5.112   -8.873  1.00 0.00 ? 30 LYS A HZ1  4  
ATOM 5310  H HZ2  . LYS A 1 30 ? 10.389  4.859   -7.596  1.00 0.00 ? 30 LYS A HZ2  4  
ATOM 5311  H HZ3  . LYS A 1 30 ? 11.118  3.544   -8.359  1.00 0.00 ? 30 LYS A HZ3  4  
ATOM 5312  N N    . GLY A 1 31 ? 10.226  -1.430  -3.248  1.00 0.00 ? 31 GLY A N    4  
ATOM 5313  C CA   . GLY A 1 31 ? 10.273  -2.317  -2.082  1.00 0.00 ? 31 GLY A CA   4  
ATOM 5314  C C    . GLY A 1 31 ? 10.768  -1.670  -0.785  1.00 0.00 ? 31 GLY A C    4  
ATOM 5315  O O    . GLY A 1 31 ? 11.226  -2.378  0.121   1.00 0.00 ? 31 GLY A O    4  
ATOM 5316  H H    . GLY A 1 31 ? 9.371   -1.319  -3.713  1.00 0.00 ? 31 GLY A H    4  
ATOM 5317  H HA2  . GLY A 1 31 ? 9.273   -2.687  -1.908  1.00 0.00 ? 31 GLY A HA2  4  
ATOM 5318  H HA3  . GLY A 1 31 ? 10.909  -3.163  -2.320  1.00 0.00 ? 31 GLY A HA3  4  
ATOM 5319  N N    . VAL A 1 32 ? 10.655  -0.325  -0.675  1.00 0.00 ? 32 VAL A N    4  
ATOM 5320  C CA   . VAL A 1 32 ? 11.074  0.419   0.541   1.00 0.00 ? 32 VAL A CA   4  
ATOM 5321  C C    . VAL A 1 32 ? 9.912   0.500   1.559   1.00 0.00 ? 32 VAL A C    4  
ATOM 5322  O O    . VAL A 1 32 ? 9.986   1.232   2.552   1.00 0.00 ? 32 VAL A O    4  
ATOM 5323  C CB   . VAL A 1 32 ? 11.631  1.851   0.188   1.00 0.00 ? 32 VAL A CB   4  
ATOM 5324  C CG1  . VAL A 1 32 ? 12.783  1.746   -0.837  1.00 0.00 ? 32 VAL A CG1  4  
ATOM 5325  C CG2  . VAL A 1 32 ? 10.527  2.811   -0.307  1.00 0.00 ? 32 VAL A CG2  4  
ATOM 5326  H H    . VAL A 1 32 ? 10.268  0.184   -1.421  1.00 0.00 ? 32 VAL A H    4  
ATOM 5327  H HA   . VAL A 1 32 ? 11.879  -0.141  1.011   1.00 0.00 ? 32 VAL A HA   4  
ATOM 5328  H HB   . VAL A 1 32 ? 12.052  2.274   1.104   1.00 0.00 ? 32 VAL A HB   4  
ATOM 5329  H HG11 . VAL A 1 32 ? 13.181  2.733   -1.047  1.00 0.00 ? 32 VAL A HG11 4  
ATOM 5330  H HG12 . VAL A 1 32 ? 12.415  1.309   -1.757  1.00 0.00 ? 32 VAL A HG12 4  
ATOM 5331  H HG13 . VAL A 1 32 ? 13.572  1.121   -0.436  1.00 0.00 ? 32 VAL A HG13 4  
ATOM 5332  H HG21 . VAL A 1 32 ? 9.769   2.918   0.458   1.00 0.00 ? 32 VAL A HG21 4  
ATOM 5333  H HG22 . VAL A 1 32 ? 10.072  2.413   -1.204  1.00 0.00 ? 32 VAL A HG22 4  
ATOM 5334  H HG23 . VAL A 1 32 ? 10.952  3.785   -0.521  1.00 0.00 ? 32 VAL A HG23 4  
ATOM 5335  N N    . VAL A 1 33 ? 8.861   -0.293  1.292   1.00 0.00 ? 33 VAL A N    4  
ATOM 5336  C CA   . VAL A 1 33 ? 7.709   -0.491  2.172   1.00 0.00 ? 33 VAL A CA   4  
ATOM 5337  C C    . VAL A 1 33 ? 7.891   -1.810  2.944   1.00 0.00 ? 33 VAL A C    4  
ATOM 5338  O O    . VAL A 1 33 ? 8.308   -2.819  2.356   1.00 0.00 ? 33 VAL A O    4  
ATOM 5339  C CB   . VAL A 1 33 ? 6.367   -0.544  1.336   1.00 0.00 ? 33 VAL A CB   4  
ATOM 5340  C CG1  . VAL A 1 33 ? 5.118   -0.711  2.237   1.00 0.00 ? 33 VAL A CG1  4  
ATOM 5341  C CG2  . VAL A 1 33 ? 6.225   0.709   0.450   1.00 0.00 ? 33 VAL A CG2  4  
ATOM 5342  H H    . VAL A 1 33 ? 8.868   -0.785  0.451   1.00 0.00 ? 33 VAL A H    4  
ATOM 5343  H HA   . VAL A 1 33 ? 7.655   0.338   2.874   1.00 0.00 ? 33 VAL A HA   4  
ATOM 5344  H HB   . VAL A 1 33 ? 6.414   -1.407  0.674   1.00 0.00 ? 33 VAL A HB   4  
ATOM 5345  H HG11 . VAL A 1 33 ? 5.200   -1.629  2.807   1.00 0.00 ? 33 VAL A HG11 4  
ATOM 5346  H HG12 . VAL A 1 33 ? 4.226   -0.751  1.625   1.00 0.00 ? 33 VAL A HG12 4  
ATOM 5347  H HG13 . VAL A 1 33 ? 5.047   0.127   2.919   1.00 0.00 ? 33 VAL A HG13 4  
ATOM 5348  H HG21 . VAL A 1 33 ? 6.187   1.596   1.071   1.00 0.00 ? 33 VAL A HG21 4  
ATOM 5349  H HG22 . VAL A 1 33 ? 5.312   0.646   -0.133  1.00 0.00 ? 33 VAL A HG22 4  
ATOM 5350  H HG23 . VAL A 1 33 ? 7.070   0.781   -0.223  1.00 0.00 ? 33 VAL A HG23 4  
ATOM 5351  N N    . ASP A 1 34 ? 7.601   -1.788  4.252   1.00 0.00 ? 34 ASP A N    4  
ATOM 5352  C CA   . ASP A 1 34 ? 7.571   -2.986  5.107   1.00 0.00 ? 34 ASP A CA   4  
ATOM 5353  C C    . ASP A 1 34 ? 6.165   -3.616  5.040   1.00 0.00 ? 34 ASP A C    4  
ATOM 5354  O O    . ASP A 1 34 ? 6.023   -4.818  4.794   1.00 0.00 ? 34 ASP A O    4  
ATOM 5355  C CB   . ASP A 1 34 ? 7.936   -2.594  6.561   1.00 0.00 ? 34 ASP A CB   4  
ATOM 5356  C CG   . ASP A 1 34 ? 7.973   -3.783  7.544   1.00 0.00 ? 34 ASP A CG   4  
ATOM 5357  O OD1  . ASP A 1 34 ? 8.994   -4.493  7.596   1.00 0.00 ? 34 ASP A OD1  4  
ATOM 5358  O OD2  . ASP A 1 34 ? 6.985   -4.005  8.280   1.00 0.00 ? 34 ASP A OD2  4  
ATOM 5359  H H    . ASP A 1 34 ? 7.383   -0.937  4.666   1.00 0.00 ? 34 ASP A H    4  
ATOM 5360  H HA   . ASP A 1 34 ? 8.306   -3.703  4.737   1.00 0.00 ? 34 ASP A HA   4  
ATOM 5361  H HB2  . ASP A 1 34 ? 8.910   -2.123  6.563   1.00 0.00 ? 34 ASP A HB2  4  
ATOM 5362  H HB3  . ASP A 1 34 ? 7.214   -1.865  6.918   1.00 0.00 ? 34 ASP A HB3  4  
ATOM 5363  N N    . ARG A 1 35 ? 5.141   -2.757  5.227   1.00 0.00 ? 35 ARG A N    4  
ATOM 5364  C CA   . ARG A 1 35 ? 3.717   -3.168  5.277   1.00 0.00 ? 35 ARG A CA   4  
ATOM 5365  C C    . ARG A 1 35 ? 2.774   -1.961  5.109   1.00 0.00 ? 35 ARG A C    4  
ATOM 5366  O O    . ARG A 1 35 ? 3.219   -0.809  5.073   1.00 0.00 ? 35 ARG A O    4  
ATOM 5367  C CB   . ARG A 1 35 ? 3.416   -3.916  6.614   1.00 0.00 ? 35 ARG A CB   4  
ATOM 5368  C CG   . ARG A 1 35 ? 3.660   -3.104  7.904   1.00 0.00 ? 35 ARG A CG   4  
ATOM 5369  C CD   . ARG A 1 35 ? 3.318   -3.905  9.173   1.00 0.00 ? 35 ARG A CD   4  
ATOM 5370  N NE   . ARG A 1 35 ? 4.044   -5.201  9.236   1.00 0.00 ? 35 ARG A NE   4  
ATOM 5371  C CZ   . ARG A 1 35 ? 4.850   -5.610  10.237  1.00 0.00 ? 35 ARG A CZ   4  
ATOM 5372  N NH1  . ARG A 1 35 ? 5.075   -4.840  11.290  1.00 0.00 ? 35 ARG A NH1  4  
ATOM 5373  N NH2  . ARG A 1 35 ? 5.419   -6.807  10.170  1.00 0.00 ? 35 ARG A NH2  4  
ATOM 5374  H H    . ARG A 1 35 ? 5.353   -1.803  5.301   1.00 0.00 ? 35 ARG A H    4  
ATOM 5375  H HA   . ARG A 1 35 ? 3.539   -3.848  4.436   1.00 0.00 ? 35 ARG A HA   4  
ATOM 5376  H HB2  . ARG A 1 35 ? 2.381   -4.242  6.608   1.00 0.00 ? 35 ARG A HB2  4  
ATOM 5377  H HB3  . ARG A 1 35 ? 4.047   -4.799  6.650   1.00 0.00 ? 35 ARG A HB3  4  
ATOM 5378  H HG2  . ARG A 1 35 ? 4.707   -2.815  7.945   1.00 0.00 ? 35 ARG A HG2  4  
ATOM 5379  H HG3  . ARG A 1 35 ? 3.047   -2.207  7.876   1.00 0.00 ? 35 ARG A HG3  4  
ATOM 5380  H HD2  . ARG A 1 35 ? 3.569   -3.308  10.041  1.00 0.00 ? 35 ARG A HD2  4  
ATOM 5381  H HD3  . ARG A 1 35 ? 2.255   -4.107  9.181   1.00 0.00 ? 35 ARG A HD3  4  
ATOM 5382  H HE   . ARG A 1 35 ? 3.908   -5.817  8.484   1.00 0.00 ? 35 ARG A HE   4  
ATOM 5383  H HH11 . ARG A 1 35 ? 4.640   -3.942  11.364  1.00 0.00 ? 35 ARG A HH11 4  
ATOM 5384  H HH12 . ARG A 1 35 ? 5.680   -5.160  12.028  1.00 0.00 ? 35 ARG A HH12 4  
ATOM 5385  H HH21 . ARG A 1 35 ? 5.250   -7.408  9.378   1.00 0.00 ? 35 ARG A HH21 4  
ATOM 5386  H HH22 . ARG A 1 35 ? 6.021   -7.120  10.908  1.00 0.00 ? 35 ARG A HH22 4  
ATOM 5387  N N    . LEU A 1 36 ? 1.467   -2.254  4.982   1.00 0.00 ? 36 LEU A N    4  
ATOM 5388  C CA   . LEU A 1 36 ? 0.399   -1.245  4.871   1.00 0.00 ? 36 LEU A CA   4  
ATOM 5389  C C    . LEU A 1 36 ? -0.595  -1.398  6.024   1.00 0.00 ? 36 LEU A C    4  
ATOM 5390  O O    . LEU A 1 36 ? -1.311  -2.398  6.100   1.00 0.00 ? 36 LEU A O    4  
ATOM 5391  C CB   . LEU A 1 36 ? -0.320  -1.383  3.505   1.00 0.00 ? 36 LEU A CB   4  
ATOM 5392  C CG   . LEU A 1 36 ? 0.547   -1.052  2.254   1.00 0.00 ? 36 LEU A CG   4  
ATOM 5393  C CD1  . LEU A 1 36 ? -0.275  -1.204  0.959   1.00 0.00 ? 36 LEU A CD1  4  
ATOM 5394  C CD2  . LEU A 1 36 ? 1.191   0.355   2.376   1.00 0.00 ? 36 LEU A CD2  4  
ATOM 5395  H H    . LEU A 1 36 ? 1.208   -3.197  4.940   1.00 0.00 ? 36 LEU A H    4  
ATOM 5396  H HA   . LEU A 1 36 ? 0.852   -0.251  4.927   1.00 0.00 ? 36 LEU A HA   4  
ATOM 5397  H HB2  . LEU A 1 36 ? -0.676  -2.404  3.414   1.00 0.00 ? 36 LEU A HB2  4  
ATOM 5398  H HB3  . LEU A 1 36 ? -1.184  -0.723  3.498   1.00 0.00 ? 36 LEU A HB3  4  
ATOM 5399  H HG   . LEU A 1 36 ? 1.358   -1.772  2.201   1.00 0.00 ? 36 LEU A HG   4  
ATOM 5400  H HD11 . LEU A 1 36 ? 0.356   -1.023  0.101   1.00 0.00 ? 36 LEU A HD11 4  
ATOM 5401  H HD12 . LEU A 1 36 ? -1.098  -0.500  0.953   1.00 0.00 ? 36 LEU A HD12 4  
ATOM 5402  H HD13 . LEU A 1 36 ? -0.672  -2.213  0.899   1.00 0.00 ? 36 LEU A HD13 4  
ATOM 5403  H HD21 . LEU A 1 36 ? 0.421   1.113   2.453   1.00 0.00 ? 36 LEU A HD21 4  
ATOM 5404  H HD22 . LEU A 1 36 ? 1.802   0.554   1.507   1.00 0.00 ? 36 LEU A HD22 4  
ATOM 5405  H HD23 . LEU A 1 36 ? 1.818   0.394   3.259   1.00 0.00 ? 36 LEU A HD23 4  
ATOM 5406  N N    . GLU A 1 37 ? -0.631  -0.399  6.911   1.00 0.00 ? 37 GLU A N    4  
ATOM 5407  C CA   . GLU A 1 37 ? -1.507  -0.381  8.090   1.00 0.00 ? 37 GLU A CA   4  
ATOM 5408  C C    . GLU A 1 37 ? -2.752  0.485   7.811   1.00 0.00 ? 37 GLU A C    4  
ATOM 5409  O O    . GLU A 1 37 ? -2.672  1.716   7.829   1.00 0.00 ? 37 GLU A O    4  
ATOM 5410  C CB   . GLU A 1 37 ? -0.721  0.156   9.313   1.00 0.00 ? 37 GLU A CB   4  
ATOM 5411  C CG   . GLU A 1 37 ? 0.550   -0.658  9.659   1.00 0.00 ? 37 GLU A CG   4  
ATOM 5412  C CD   . GLU A 1 37 ? 1.250   -0.146  10.924  1.00 0.00 ? 37 GLU A CD   4  
ATOM 5413  O OE1  . GLU A 1 37 ? 2.096   0.771   10.828  1.00 0.00 ? 37 GLU A OE1  4  
ATOM 5414  O OE2  . GLU A 1 37 ? 0.939   -0.634  12.030  1.00 0.00 ? 37 GLU A OE2  4  
ATOM 5415  H H    . GLU A 1 37 ? -0.037  0.366   6.768   1.00 0.00 ? 37 GLU A H    4  
ATOM 5416  H HA   . GLU A 1 37 ? -1.826  -1.403  8.305   1.00 0.00 ? 37 GLU A HA   4  
ATOM 5417  H HB2  . GLU A 1 37 ? -0.424  1.182   9.115   1.00 0.00 ? 37 GLU A HB2  4  
ATOM 5418  H HB3  . GLU A 1 37 ? -1.375  0.147   10.178  1.00 0.00 ? 37 GLU A HB3  4  
ATOM 5419  H HG2  . GLU A 1 37 ? 0.279   -1.704  9.799   1.00 0.00 ? 37 GLU A HG2  4  
ATOM 5420  H HG3  . GLU A 1 37 ? 1.243   -0.595  8.823   1.00 0.00 ? 37 GLU A HG3  4  
ATOM 5421  N N    . VAL A 1 38 ? -3.906  -0.154  7.575   1.00 0.00 ? 38 VAL A N    4  
ATOM 5422  C CA   . VAL A 1 38 ? -5.144  0.547   7.206   1.00 0.00 ? 38 VAL A CA   4  
ATOM 5423  C C    . VAL A 1 38 ? -5.862  0.964   8.504   1.00 0.00 ? 38 VAL A C    4  
ATOM 5424  O O    . VAL A 1 38 ? -6.515  0.140   9.161   1.00 0.00 ? 38 VAL A O    4  
ATOM 5425  C CB   . VAL A 1 38 ? -6.072  -0.346  6.302   1.00 0.00 ? 38 VAL A CB   4  
ATOM 5426  C CG1  . VAL A 1 38 ? -7.298  0.445   5.785   1.00 0.00 ? 38 VAL A CG1  4  
ATOM 5427  C CG2  . VAL A 1 38 ? -5.272  -0.970  5.135   1.00 0.00 ? 38 VAL A CG2  4  
ATOM 5428  H H    . VAL A 1 38 ? -3.952  -1.114  7.751   1.00 0.00 ? 38 VAL A H    4  
ATOM 5429  H HA   . VAL A 1 38 ? -4.882  1.445   6.641   1.00 0.00 ? 38 VAL A HA   4  
ATOM 5430  H HB   . VAL A 1 38 ? -6.448  -1.163  6.916   1.00 0.00 ? 38 VAL A HB   4  
ATOM 5431  H HG11 . VAL A 1 38 ? -7.920  -0.199  5.174   1.00 0.00 ? 38 VAL A HG11 4  
ATOM 5432  H HG12 . VAL A 1 38 ? -6.968  1.288   5.193   1.00 0.00 ? 38 VAL A HG12 4  
ATOM 5433  H HG13 . VAL A 1 38 ? -7.881  0.807   6.626   1.00 0.00 ? 38 VAL A HG13 4  
ATOM 5434  H HG21 . VAL A 1 38 ? -5.924  -1.586  4.525   1.00 0.00 ? 38 VAL A HG21 4  
ATOM 5435  H HG22 . VAL A 1 38 ? -4.471  -1.586  5.532   1.00 0.00 ? 38 VAL A HG22 4  
ATOM 5436  H HG23 . VAL A 1 38 ? -4.845  -0.189  4.521   1.00 0.00 ? 38 VAL A HG23 4  
ATOM 5437  N N    . VAL A 1 39 ? -5.695  2.241   8.882   1.00 0.00 ? 39 VAL A N    4  
ATOM 5438  C CA   . VAL A 1 39 ? -6.101  2.769   10.193  1.00 0.00 ? 39 VAL A CA   4  
ATOM 5439  C C    . VAL A 1 39 ? -7.552  3.279   10.139  1.00 0.00 ? 39 VAL A C    4  
ATOM 5440  O O    . VAL A 1 39 ? -7.889  4.134   9.296   1.00 0.00 ? 39 VAL A O    4  
ATOM 5441  C CB   . VAL A 1 39 ? -5.140  3.923   10.640  1.00 0.00 ? 39 VAL A CB   4  
ATOM 5442  C CG1  . VAL A 1 39 ? -5.540  4.513   12.016  1.00 0.00 ? 39 VAL A CG1  4  
ATOM 5443  C CG2  . VAL A 1 39 ? -3.666  3.442   10.629  1.00 0.00 ? 39 VAL A CG2  4  
ATOM 5444  H H    . VAL A 1 39 ? -5.299  2.874   8.247   1.00 0.00 ? 39 VAL A H    4  
ATOM 5445  H HA   . VAL A 1 39 ? -6.022  1.958   10.923  1.00 0.00 ? 39 VAL A HA   4  
ATOM 5446  H HB   . VAL A 1 39 ? -5.226  4.724   9.908   1.00 0.00 ? 39 VAL A HB   4  
ATOM 5447  H HG11 . VAL A 1 39 ? -6.551  4.906   11.968  1.00 0.00 ? 39 VAL A HG11 4  
ATOM 5448  H HG12 . VAL A 1 39 ? -4.866  5.315   12.285  1.00 0.00 ? 39 VAL A HG12 4  
ATOM 5449  H HG13 . VAL A 1 39 ? -5.495  3.741   12.775  1.00 0.00 ? 39 VAL A HG13 4  
ATOM 5450  H HG21 . VAL A 1 39 ? -3.539  2.630   11.334  1.00 0.00 ? 39 VAL A HG21 4  
ATOM 5451  H HG22 . VAL A 1 39 ? -3.010  4.258   10.906  1.00 0.00 ? 39 VAL A HG22 4  
ATOM 5452  H HG23 . VAL A 1 39 ? -3.400  3.095   9.636   1.00 0.00 ? 39 VAL A HG23 4  
ATOM 5453  N N    . ASN A 1 40 ? -8.393  2.712   11.033  1.00 0.00 ? 40 ASN A N    4  
ATOM 5454  C CA   . ASN A 1 40 ? -9.849  2.980   11.139  1.00 0.00 ? 40 ASN A CA   4  
ATOM 5455  C C    . ASN A 1 40 ? -10.601 2.772   9.811   1.00 0.00 ? 40 ASN A C    4  
ATOM 5456  O O    . ASN A 1 40 ? -11.740 3.226   9.673   1.00 0.00 ? 40 ASN A O    4  
ATOM 5457  C CB   . ASN A 1 40 ? -10.134 4.396   11.736  1.00 0.00 ? 40 ASN A CB   4  
ATOM 5458  C CG   . ASN A 1 40 ? -9.701  4.541   13.201  1.00 0.00 ? 40 ASN A CG   4  
ATOM 5459  O OD1  . ASN A 1 40 ? -9.633  3.570   13.945  1.00 0.00 ? 40 ASN A OD1  4  
ATOM 5460  N ND2  . ASN A 1 40 ? -9.482  5.758   13.649  1.00 0.00 ? 40 ASN A ND2  4  
ATOM 5461  H H    . ASN A 1 40 ? -8.012  2.083   11.667  1.00 0.00 ? 40 ASN A H    4  
ATOM 5462  H HA   . ASN A 1 40 ? -10.233 2.243   11.834  1.00 0.00 ? 40 ASN A HA   4  
ATOM 5463  H HB2  . ASN A 1 40 ? -9.615  5.141   11.150  1.00 0.00 ? 40 ASN A HB2  4  
ATOM 5464  H HB3  . ASN A 1 40 ? -11.201 4.594   11.682  1.00 0.00 ? 40 ASN A HB3  4  
ATOM 5465  H HD21 . ASN A 1 40 ? -9.606  6.509   13.035  1.00 0.00 ? 40 ASN A HD21 4  
ATOM 5466  H HD22 . ASN A 1 40 ? -9.214  5.862   14.586  1.00 0.00 ? 40 ASN A HD22 4  
ATOM 5467  N N    . LYS A 1 41 ? -9.967  2.030   8.871   1.00 0.00 ? 41 LYS A N    4  
ATOM 5468  C CA   . LYS A 1 41 ? -10.485 1.783   7.502   1.00 0.00 ? 41 LYS A CA   4  
ATOM 5469  C C    . LYS A 1 41 ? -10.762 3.088   6.698   1.00 0.00 ? 41 LYS A C    4  
ATOM 5470  O O    . LYS A 1 41 ? -11.429 3.059   5.668   1.00 0.00 ? 41 LYS A O    4  
ATOM 5471  C CB   . LYS A 1 41 ? -11.735 0.865   7.596   1.00 0.00 ? 41 LYS A CB   4  
ATOM 5472  C CG   . LYS A 1 41 ? -11.452 -0.506  8.256   1.00 0.00 ? 41 LYS A CG   4  
ATOM 5473  C CD   . LYS A 1 41 ? -12.731 -1.343  8.488   1.00 0.00 ? 41 LYS A CD   4  
ATOM 5474  C CE   . LYS A 1 41 ? -12.429 -2.708  9.124   1.00 0.00 ? 41 LYS A CE   4  
ATOM 5475  N NZ   . LYS A 1 41 ? -13.651 -3.524  9.323   1.00 0.00 ? 41 LYS A NZ   4  
ATOM 5476  H H    . LYS A 1 41 ? -9.141  1.564   9.126   1.00 0.00 ? 41 LYS A H    4  
ATOM 5477  H HA   . LYS A 1 41 ? -9.708  1.241   6.974   1.00 0.00 ? 41 LYS A HA   4  
ATOM 5478  H HB2  . LYS A 1 41 ? -12.501 1.376   8.170   1.00 0.00 ? 41 LYS A HB2  4  
ATOM 5479  H HB3  . LYS A 1 41 ? -12.112 0.688   6.595   1.00 0.00 ? 41 LYS A HB3  4  
ATOM 5480  H HG2  . LYS A 1 41 ? -10.779 -1.071  7.616   1.00 0.00 ? 41 LYS A HG2  4  
ATOM 5481  H HG3  . LYS A 1 41 ? -10.963 -0.340  9.214   1.00 0.00 ? 41 LYS A HG3  4  
ATOM 5482  H HD2  . LYS A 1 41 ? -13.399 -0.796  9.146   1.00 0.00 ? 41 LYS A HD2  4  
ATOM 5483  H HD3  . LYS A 1 41 ? -13.229 -1.505  7.537   1.00 0.00 ? 41 LYS A HD3  4  
ATOM 5484  H HE2  . LYS A 1 41 ? -11.755 -3.258  8.482   1.00 0.00 ? 41 LYS A HE2  4  
ATOM 5485  H HE3  . LYS A 1 41 ? -11.958 -2.554  10.087  1.00 0.00 ? 41 LYS A HE3  4  
ATOM 5486  H HZ1  . LYS A 1 41 ? -13.406 -4.429  9.773   1.00 0.00 ? 41 LYS A HZ1  4  
ATOM 5487  H HZ2  . LYS A 1 41 ? -14.110 -3.716  8.414   1.00 0.00 ? 41 LYS A HZ2  4  
ATOM 5488  H HZ3  . LYS A 1 41 ? -14.323 -3.023  9.939   1.00 0.00 ? 41 LYS A HZ3  4  
ATOM 5489  N N    . ARG A 1 42 ? -10.214 4.220   7.163   1.00 0.00 ? 42 ARG A N    4  
ATOM 5490  C CA   . ARG A 1 42 ? -10.379 5.531   6.505   1.00 0.00 ? 42 ARG A CA   4  
ATOM 5491  C C    . ARG A 1 42 ? -9.244  5.777   5.510   1.00 0.00 ? 42 ARG A C    4  
ATOM 5492  O O    . ARG A 1 42 ? -9.440  6.402   4.457   1.00 0.00 ? 42 ARG A O    4  
ATOM 5493  C CB   . ARG A 1 42 ? -10.403 6.648   7.578   1.00 0.00 ? 42 ARG A CB   4  
ATOM 5494  C CG   . ARG A 1 42 ? -11.566 6.534   8.583   1.00 0.00 ? 42 ARG A CG   4  
ATOM 5495  C CD   . ARG A 1 42 ? -11.546 7.616   9.675   1.00 0.00 ? 42 ARG A CD   4  
ATOM 5496  N NE   . ARG A 1 42 ? -12.739 7.516   10.533  1.00 0.00 ? 42 ARG A NE   4  
ATOM 5497  C CZ   . ARG A 1 42 ? -13.013 8.288   11.591  1.00 0.00 ? 42 ARG A CZ   4  
ATOM 5498  N NH1  . ARG A 1 42 ? -12.186 9.256   11.973  1.00 0.00 ? 42 ARG A NH1  4  
ATOM 5499  N NH2  . ARG A 1 42 ? -14.133 8.075   12.268  1.00 0.00 ? 42 ARG A NH2  4  
ATOM 5500  H H    . ARG A 1 42 ? -9.687  4.182   7.990   1.00 0.00 ? 42 ARG A H    4  
ATOM 5501  H HA   . ARG A 1 42 ? -11.326 5.534   5.968   1.00 0.00 ? 42 ARG A HA   4  
ATOM 5502  H HB2  . ARG A 1 42 ? -9.468  6.623   8.133   1.00 0.00 ? 42 ARG A HB2  4  
ATOM 5503  H HB3  . ARG A 1 42 ? -10.482 7.609   7.078   1.00 0.00 ? 42 ARG A HB3  4  
ATOM 5504  H HG2  . ARG A 1 42 ? -12.503 6.608   8.037   1.00 0.00 ? 42 ARG A HG2  4  
ATOM 5505  H HG3  . ARG A 1 42 ? -11.519 5.557   9.057   1.00 0.00 ? 42 ARG A HG3  4  
ATOM 5506  H HD2  . ARG A 1 42 ? -10.658 7.494   10.287  1.00 0.00 ? 42 ARG A HD2  4  
ATOM 5507  H HD3  . ARG A 1 42 ? -11.530 8.597   9.208   1.00 0.00 ? 42 ARG A HD3  4  
ATOM 5508  H HE   . ARG A 1 42 ? -13.388 6.817   10.297  1.00 0.00 ? 42 ARG A HE   4  
ATOM 5509  H HH11 . ARG A 1 42 ? -11.332 9.424   11.470  1.00 0.00 ? 42 ARG A HH11 4  
ATOM 5510  H HH12 . ARG A 1 42 ? -12.407 9.823   12.771  1.00 0.00 ? 42 ARG A HH12 4  
ATOM 5511  H HH21 . ARG A 1 42 ? -14.767 7.343   11.990  1.00 0.00 ? 42 ARG A HH21 4  
ATOM 5512  H HH22 . ARG A 1 42 ? -14.356 8.644   13.065  1.00 0.00 ? 42 ARG A HH22 4  
ATOM 5513  N N    . PHE A 1 43 ? -8.058  5.249   5.848   1.00 0.00 ? 43 PHE A N    4  
ATOM 5514  C CA   . PHE A 1 43 ? -6.831  5.487   5.087   1.00 0.00 ? 43 PHE A CA   4  
ATOM 5515  C C    . PHE A 1 43 ? -5.828  4.368   5.328   1.00 0.00 ? 43 PHE A C    4  
ATOM 5516  O O    . PHE A 1 43 ? -6.003  3.542   6.226   1.00 0.00 ? 43 PHE A O    4  
ATOM 5517  C CB   . PHE A 1 43 ? -6.208  6.859   5.449   1.00 0.00 ? 43 PHE A CB   4  
ATOM 5518  C CG   . PHE A 1 43 ? -5.696  7.002   6.880   1.00 0.00 ? 43 PHE A CG   4  
ATOM 5519  C CD1  . PHE A 1 43 ? -6.584  7.112   7.951   1.00 0.00 ? 43 PHE A CD1  4  
ATOM 5520  C CD2  . PHE A 1 43 ? -4.324  7.056   7.154   1.00 0.00 ? 43 PHE A CD2  4  
ATOM 5521  C CE1  . PHE A 1 43 ? -6.124  7.266   9.238   1.00 0.00 ? 43 PHE A CE1  4  
ATOM 5522  C CE2  . PHE A 1 43 ? -3.870  7.216   8.440   1.00 0.00 ? 43 PHE A CE2  4  
ATOM 5523  C CZ   . PHE A 1 43 ? -4.770  7.322   9.481   1.00 0.00 ? 43 PHE A CZ   4  
ATOM 5524  H H    . PHE A 1 43 ? -8.010  4.647   6.623   1.00 0.00 ? 43 PHE A H    4  
ATOM 5525  H HA   . PHE A 1 43 ? -7.090  5.487   4.031   1.00 0.00 ? 43 PHE A HA   4  
ATOM 5526  H HB2  . PHE A 1 43 ? -5.382  7.057   4.773   1.00 0.00 ? 43 PHE A HB2  4  
ATOM 5527  H HB3  . PHE A 1 43 ? -6.957  7.629   5.291   1.00 0.00 ? 43 PHE A HB3  4  
ATOM 5528  H HD1  . PHE A 1 43 ? -7.647  7.068   7.766   1.00 0.00 ? 43 PHE A HD1  4  
ATOM 5529  H HD2  . PHE A 1 43 ? -3.615  6.976   6.339   1.00 0.00 ? 43 PHE A HD2  4  
ATOM 5530  H HE1  . PHE A 1 43 ? -6.825  7.347   10.062  1.00 0.00 ? 43 PHE A HE1  4  
ATOM 5531  H HE2  . PHE A 1 43 ? -2.803  7.255   8.641   1.00 0.00 ? 43 PHE A HE2  4  
ATOM 5532  H HZ   . PHE A 1 43 ? -4.408  7.445   10.499  1.00 0.00 ? 43 PHE A HZ   4  
ATOM 5533  N N    . VAL A 1 44 ? -4.759  4.393   4.529   1.00 0.00 ? 44 VAL A N    4  
ATOM 5534  C CA   . VAL A 1 44 ? -3.668  3.427   4.581   1.00 0.00 ? 44 VAL A CA   4  
ATOM 5535  C C    . VAL A 1 44 ? -2.376  4.154   4.949   1.00 0.00 ? 44 VAL A C    4  
ATOM 5536  O O    . VAL A 1 44 ? -2.030  5.162   4.330   1.00 0.00 ? 44 VAL A O    4  
ATOM 5537  C CB   . VAL A 1 44 ? -3.497  2.697   3.204   1.00 0.00 ? 44 VAL A CB   4  
ATOM 5538  C CG1  . VAL A 1 44 ? -2.348  1.663   3.246   1.00 0.00 ? 44 VAL A CG1  4  
ATOM 5539  C CG2  . VAL A 1 44 ? -4.821  2.042   2.779   1.00 0.00 ? 44 VAL A CG2  4  
ATOM 5540  H H    . VAL A 1 44 ? -4.691  5.119   3.879   1.00 0.00 ? 44 VAL A H    4  
ATOM 5541  H HA   . VAL A 1 44 ? -3.895  2.673   5.340   1.00 0.00 ? 44 VAL A HA   4  
ATOM 5542  H HB   . VAL A 1 44 ? -3.241  3.443   2.451   1.00 0.00 ? 44 VAL A HB   4  
ATOM 5543  H HG11 . VAL A 1 44 ? -1.414  2.159   3.490   1.00 0.00 ? 44 VAL A HG11 4  
ATOM 5544  H HG12 . VAL A 1 44 ? -2.248  1.180   2.282   1.00 0.00 ? 44 VAL A HG12 4  
ATOM 5545  H HG13 . VAL A 1 44 ? -2.558  0.912   3.999   1.00 0.00 ? 44 VAL A HG13 4  
ATOM 5546  H HG21 . VAL A 1 44 ? -4.704  1.568   1.814   1.00 0.00 ? 44 VAL A HG21 4  
ATOM 5547  H HG22 . VAL A 1 44 ? -5.596  2.794   2.713   1.00 0.00 ? 44 VAL A HG22 4  
ATOM 5548  H HG23 . VAL A 1 44 ? -5.111  1.294   3.508   1.00 0.00 ? 44 VAL A HG23 4  
ATOM 5549  N N    . ARG A 1 45 ? -1.680  3.622   5.951   1.00 0.00 ? 45 ARG A N    4  
ATOM 5550  C CA   . ARG A 1 45 ? -0.391  4.123   6.419   1.00 0.00 ? 45 ARG A CA   4  
ATOM 5551  C C    . ARG A 1 45 ? 0.713   3.300   5.744   1.00 0.00 ? 45 ARG A C    4  
ATOM 5552  O O    . ARG A 1 45 ? 0.728   2.066   5.854   1.00 0.00 ? 45 ARG A O    4  
ATOM 5553  C CB   . ARG A 1 45 ? -0.299  3.981   7.959   1.00 0.00 ? 45 ARG A CB   4  
ATOM 5554  C CG   . ARG A 1 45 ? 1.042   4.447   8.569   1.00 0.00 ? 45 ARG A CG   4  
ATOM 5555  C CD   . ARG A 1 45 ? 1.218   4.016   10.030  1.00 0.00 ? 45 ARG A CD   4  
ATOM 5556  N NE   . ARG A 1 45 ? 0.178   4.552   10.923  1.00 0.00 ? 45 ARG A NE   4  
ATOM 5557  C CZ   . ARG A 1 45 ? -0.280  3.933   12.024  1.00 0.00 ? 45 ARG A CZ   4  
ATOM 5558  N NH1  . ARG A 1 45 ? 0.198   2.749   12.388  1.00 0.00 ? 45 ARG A NH1  4  
ATOM 5559  N NH2  . ARG A 1 45 ? -1.205  4.523   12.770  1.00 0.00 ? 45 ARG A NH2  4  
ATOM 5560  H H    . ARG A 1 45 ? -2.030  2.821   6.373   1.00 0.00 ? 45 ARG A H    4  
ATOM 5561  H HA   . ARG A 1 45 ? -0.292  5.175   6.148   1.00 0.00 ? 45 ARG A HA   4  
ATOM 5562  H HB2  . ARG A 1 45 ? -1.099  4.560   8.408   1.00 0.00 ? 45 ARG A HB2  4  
ATOM 5563  H HB3  . ARG A 1 45 ? -0.451  2.934   8.218   1.00 0.00 ? 45 ARG A HB3  4  
ATOM 5564  H HG2  . ARG A 1 45 ? 1.858   4.030   7.990   1.00 0.00 ? 45 ARG A HG2  4  
ATOM 5565  H HG3  . ARG A 1 45 ? 1.092   5.528   8.517   1.00 0.00 ? 45 ARG A HG3  4  
ATOM 5566  H HD2  . ARG A 1 45 ? 1.200   2.930   10.077  1.00 0.00 ? 45 ARG A HD2  4  
ATOM 5567  H HD3  . ARG A 1 45 ? 2.187   4.361   10.381  1.00 0.00 ? 45 ARG A HD3  4  
ATOM 5568  H HE   . ARG A 1 45 ? -0.211  5.421   10.684  1.00 0.00 ? 45 ARG A HE   4  
ATOM 5569  H HH11 . ARG A 1 45 ? 0.906   2.293   11.841  1.00 0.00 ? 45 ARG A HH11 4  
ATOM 5570  H HH12 . ARG A 1 45 ? -0.152  2.297   13.216  1.00 0.00 ? 45 ARG A HH12 4  
ATOM 5571  H HH21 . ARG A 1 45 ? -1.572  5.423   12.515  1.00 0.00 ? 45 ARG A HH21 4  
ATOM 5572  H HH22 . ARG A 1 45 ? -1.556  4.064   13.595  1.00 0.00 ? 45 ARG A HH22 4  
ATOM 5573  N N    . VAL A 1 46 ? 1.608   3.979   5.031   1.00 0.00 ? 46 VAL A N    4  
ATOM 5574  C CA   . VAL A 1 46 ? 2.756   3.347   4.375   1.00 0.00 ? 46 VAL A CA   4  
ATOM 5575  C C    . VAL A 1 46 ? 3.890   3.225   5.399   1.00 0.00 ? 46 VAL A C    4  
ATOM 5576  O O    . VAL A 1 46 ? 4.425   4.242   5.873   1.00 0.00 ? 46 VAL A O    4  
ATOM 5577  C CB   . VAL A 1 46 ? 3.244   4.156   3.120   1.00 0.00 ? 46 VAL A CB   4  
ATOM 5578  C CG1  . VAL A 1 46 ? 4.403   3.429   2.390   1.00 0.00 ? 46 VAL A CG1  4  
ATOM 5579  C CG2  . VAL A 1 46 ? 2.068   4.460   2.164   1.00 0.00 ? 46 VAL A CG2  4  
ATOM 5580  H H    . VAL A 1 46 ? 1.500   4.951   4.971   1.00 0.00 ? 46 VAL A H    4  
ATOM 5581  H HA   . VAL A 1 46 ? 2.461   2.352   4.045   1.00 0.00 ? 46 VAL A HA   4  
ATOM 5582  H HB   . VAL A 1 46 ? 3.634   5.114   3.476   1.00 0.00 ? 46 VAL A HB   4  
ATOM 5583  H HG11 . VAL A 1 46 ? 4.731   4.009   1.536   1.00 0.00 ? 46 VAL A HG11 4  
ATOM 5584  H HG12 . VAL A 1 46 ? 4.067   2.457   2.054   1.00 0.00 ? 46 VAL A HG12 4  
ATOM 5585  H HG13 . VAL A 1 46 ? 5.240   3.297   3.071   1.00 0.00 ? 46 VAL A HG13 4  
ATOM 5586  H HG21 . VAL A 1 46 ? 1.638   3.534   1.807   1.00 0.00 ? 46 VAL A HG21 4  
ATOM 5587  H HG22 . VAL A 1 46 ? 2.418   5.041   1.315   1.00 0.00 ? 46 VAL A HG22 4  
ATOM 5588  H HG23 . VAL A 1 46 ? 1.306   5.029   2.685   1.00 0.00 ? 46 VAL A HG23 4  
ATOM 5589  N N    . THR A 1 47 ? 4.207   1.986   5.778   1.00 0.00 ? 47 THR A N    4  
ATOM 5590  C CA   . THR A 1 47 ? 5.315   1.679   6.678   1.00 0.00 ? 47 THR A CA   4  
ATOM 5591  C C    . THR A 1 47 ? 6.580   1.453   5.846   1.00 0.00 ? 47 THR A C    4  
ATOM 5592  O O    . THR A 1 47 ? 6.524   0.778   4.831   1.00 0.00 ? 47 THR A O    4  
ATOM 5593  C CB   . THR A 1 47 ? 4.981   0.413   7.528   1.00 0.00 ? 47 THR A CB   4  
ATOM 5594  O OG1  . THR A 1 47 ? 3.779   0.645   8.284   1.00 0.00 ? 47 THR A OG1  4  
ATOM 5595  C CG2  . THR A 1 47 ? 6.121   0.014   8.481   1.00 0.00 ? 47 THR A CG2  4  
ATOM 5596  H H    . THR A 1 47 ? 3.693   1.235   5.420   1.00 0.00 ? 47 THR A H    4  
ATOM 5597  H HA   . THR A 1 47 ? 5.465   2.524   7.353   1.00 0.00 ? 47 THR A HA   4  
ATOM 5598  H HB   . THR A 1 47 ? 4.799   -0.410  6.849   1.00 0.00 ? 47 THR A HB   4  
ATOM 5599  H HG1  . THR A 1 47 ? 3.811   0.151   9.114   1.00 0.00 ? 47 THR A HG1  4  
ATOM 5600  H HG21 . THR A 1 47 ? 5.849   -0.889  9.015   1.00 0.00 ? 47 THR A HG21 4  
ATOM 5601  H HG22 . THR A 1 47 ? 6.302   0.807   9.194   1.00 0.00 ? 47 THR A HG22 4  
ATOM 5602  H HG23 . THR A 1 47 ? 7.027   -0.169  7.915   1.00 0.00 ? 47 THR A HG23 4  
ATOM 5603  N N    . PHE A 1 48 ? 7.686   2.080   6.252   1.00 0.00 ? 48 PHE A N    4  
ATOM 5604  C CA   . PHE A 1 48 ? 9.004   1.902   5.616   1.00 0.00 ? 48 PHE A CA   4  
ATOM 5605  C C    . PHE A 1 48 ? 9.708   0.664   6.188   1.00 0.00 ? 48 PHE A C    4  
ATOM 5606  O O    . PHE A 1 48 ? 9.521   0.342   7.370   1.00 0.00 ? 48 PHE A O    4  
ATOM 5607  C CB   . PHE A 1 48 ? 9.879   3.155   5.846   1.00 0.00 ? 48 PHE A CB   4  
ATOM 5608  C CG   . PHE A 1 48 ? 9.198   4.458   5.441   1.00 0.00 ? 48 PHE A CG   4  
ATOM 5609  C CD1  . PHE A 1 48 ? 9.269   4.932   4.133   1.00 0.00 ? 48 PHE A CD1  4  
ATOM 5610  C CD2  . PHE A 1 48 ? 8.480   5.212   6.372   1.00 0.00 ? 48 PHE A CD2  4  
ATOM 5611  C CE1  . PHE A 1 48 ? 8.653   6.112   3.771   1.00 0.00 ? 48 PHE A CE1  4  
ATOM 5612  C CE2  . PHE A 1 48 ? 7.866   6.389   6.001   1.00 0.00 ? 48 PHE A CE2  4  
ATOM 5613  C CZ   . PHE A 1 48 ? 7.954   6.841   4.705   1.00 0.00 ? 48 PHE A CZ   4  
ATOM 5614  H H    . PHE A 1 48 ? 7.601   2.716   6.994   1.00 0.00 ? 48 PHE A H    4  
ATOM 5615  H HA   . PHE A 1 48 ? 8.854   1.762   4.547   1.00 0.00 ? 48 PHE A HA   4  
ATOM 5616  H HB2  . PHE A 1 48 ? 10.136  3.223   6.903   1.00 0.00 ? 48 PHE A HB2  4  
ATOM 5617  H HB3  . PHE A 1 48 ? 10.795  3.061   5.274   1.00 0.00 ? 48 PHE A HB3  4  
ATOM 5618  H HD1  . PHE A 1 48 ? 9.817   4.363   3.389   1.00 0.00 ? 48 PHE A HD1  4  
ATOM 5619  H HD2  . PHE A 1 48 ? 8.408   4.869   7.395   1.00 0.00 ? 48 PHE A HD2  4  
ATOM 5620  H HE1  . PHE A 1 48 ? 8.722   6.470   2.752   1.00 0.00 ? 48 PHE A HE1  4  
ATOM 5621  H HE2  . PHE A 1 48 ? 7.314   6.962   6.733   1.00 0.00 ? 48 PHE A HE2  4  
ATOM 5622  H HZ   . PHE A 1 48 ? 7.467   7.770   4.419   1.00 0.00 ? 48 PHE A HZ   4  
ATOM 5623  N N    . THR A 1 49 ? 10.495  -0.020  5.342   1.00 0.00 ? 49 THR A N    4  
ATOM 5624  C CA   . THR A 1 49 ? 11.324  -1.169  5.747   1.00 0.00 ? 49 THR A CA   4  
ATOM 5625  C C    . THR A 1 49 ? 12.396  -0.718  6.794   1.00 0.00 ? 49 THR A C    4  
ATOM 5626  O O    . THR A 1 49 ? 12.922  0.394   6.663   1.00 0.00 ? 49 THR A O    4  
ATOM 5627  C CB   . THR A 1 49 ? 12.023  -1.808  4.483   1.00 0.00 ? 49 THR A CB   4  
ATOM 5628  O OG1  . THR A 1 49 ? 11.191  -1.646  3.329   1.00 0.00 ? 49 THR A OG1  4  
ATOM 5629  C CG2  . THR A 1 49 ? 12.302  -3.307  4.645   1.00 0.00 ? 49 THR A CG2  4  
ATOM 5630  H H    . THR A 1 49 ? 10.508  0.229   4.395   1.00 0.00 ? 49 THR A H    4  
ATOM 5631  H HA   . THR A 1 49 ? 10.669  -1.910  6.202   1.00 0.00 ? 49 THR A HA   4  
ATOM 5632  H HB   . THR A 1 49 ? 12.965  -1.306  4.314   1.00 0.00 ? 49 THR A HB   4  
ATOM 5633  H HG1  . THR A 1 49 ? 10.565  -2.379  3.278   1.00 0.00 ? 49 THR A HG1  4  
ATOM 5634  H HG21 . THR A 1 49 ? 11.370  -3.831  4.811   1.00 0.00 ? 49 THR A HG21 4  
ATOM 5635  H HG22 . THR A 1 49 ? 12.961  -3.470  5.489   1.00 0.00 ? 49 THR A HG22 4  
ATOM 5636  H HG23 . THR A 1 49 ? 12.770  -3.685  3.747   1.00 0.00 ? 49 THR A HG23 4  
ATOM 5637  N N    . PRO A 1 50 ? 12.708  -1.549  7.855   1.00 0.00 ? 50 PRO A N    4  
ATOM 5638  C CA   . PRO A 1 50 ? 13.752  -1.238  8.878   1.00 0.00 ? 50 PRO A CA   4  
ATOM 5639  C C    . PRO A 1 50 ? 15.099  -0.795  8.256   1.00 0.00 ? 50 PRO A C    4  
ATOM 5640  O O    . PRO A 1 50 ? 15.659  -1.509  7.420   1.00 0.00 ? 50 PRO A O    4  
ATOM 5641  C CB   . PRO A 1 50 ? 13.907  -2.576  9.647   1.00 0.00 ? 50 PRO A CB   4  
ATOM 5642  C CG   . PRO A 1 50 ? 12.565  -3.241  9.521   1.00 0.00 ? 50 PRO A CG   4  
ATOM 5643  C CD   . PRO A 1 50 ? 12.031  -2.847  8.156   1.00 0.00 ? 50 PRO A CD   4  
ATOM 5644  H HA   . PRO A 1 50 ? 13.401  -0.466  9.560   1.00 0.00 ? 50 PRO A HA   4  
ATOM 5645  H HB2  . PRO A 1 50 ? 14.692  -3.190  9.199   1.00 0.00 ? 50 PRO A HB2  4  
ATOM 5646  H HB3  . PRO A 1 50 ? 14.143  -2.394  10.691  1.00 0.00 ? 50 PRO A HB3  4  
ATOM 5647  H HG2  . PRO A 1 50 ? 12.671  -4.324  9.604   1.00 0.00 ? 50 PRO A HG2  4  
ATOM 5648  H HG3  . PRO A 1 50 ? 11.895  -2.883  10.302  1.00 0.00 ? 50 PRO A HG3  4  
ATOM 5649  H HD2  . PRO A 1 50 ? 12.297  -3.586  7.407   1.00 0.00 ? 50 PRO A HD2  4  
ATOM 5650  H HD3  . PRO A 1 50 ? 10.955  -2.719  8.189   1.00 0.00 ? 50 PRO A HD3  4  
ATOM 5651  N N    . GLY A 1 51 ? 15.578  0.398   8.647   1.00 0.00 ? 51 GLY A N    4  
ATOM 5652  C CA   . GLY A 1 51 ? 16.821  0.973   8.103   1.00 0.00 ? 51 GLY A CA   4  
ATOM 5653  C C    . GLY A 1 51 ? 16.565  2.054   7.053   1.00 0.00 ? 51 GLY A C    4  
ATOM 5654  O O    . GLY A 1 51 ? 17.443  2.875   6.771   1.00 0.00 ? 51 GLY A O    4  
ATOM 5655  H H    . GLY A 1 51 ? 15.073  0.902   9.323   1.00 0.00 ? 51 GLY A H    4  
ATOM 5656  H HA2  . GLY A 1 51 ? 17.374  1.410   8.923   1.00 0.00 ? 51 GLY A HA2  4  
ATOM 5657  H HA3  . GLY A 1 51 ? 17.428  0.191   7.659   1.00 0.00 ? 51 GLY A HA3  4  
ATOM 5658  N N    . LYS A 1 52 ? 15.361  2.031   6.458   1.00 0.00 ? 52 LYS A N    4  
ATOM 5659  C CA   . LYS A 1 52 ? 14.904  3.039   5.469   1.00 0.00 ? 52 LYS A CA   4  
ATOM 5660  C C    . LYS A 1 52 ? 13.836  3.965   6.092   1.00 0.00 ? 52 LYS A C    4  
ATOM 5661  O O    . LYS A 1 52 ? 13.356  4.896   5.432   1.00 0.00 ? 52 LYS A O    4  
ATOM 5662  C CB   . LYS A 1 52 ? 14.336  2.311   4.216   1.00 0.00 ? 52 LYS A CB   4  
ATOM 5663  C CG   . LYS A 1 52 ? 15.357  1.407   3.498   1.00 0.00 ? 52 LYS A CG   4  
ATOM 5664  C CD   . LYS A 1 52 ? 14.775  0.703   2.254   1.00 0.00 ? 52 LYS A CD   4  
ATOM 5665  C CE   . LYS A 1 52 ? 15.770  -0.291  1.627   1.00 0.00 ? 52 LYS A CE   4  
ATOM 5666  N NZ   . LYS A 1 52 ? 17.044  0.354   1.217   1.00 0.00 ? 52 LYS A NZ   4  
ATOM 5667  H H    . LYS A 1 52 ? 14.744  1.307   6.685   1.00 0.00 ? 52 LYS A H    4  
ATOM 5668  H HA   . LYS A 1 52 ? 15.754  3.650   5.174   1.00 0.00 ? 52 LYS A HA   4  
ATOM 5669  H HB2  . LYS A 1 52 ? 13.493  1.695   4.516   1.00 0.00 ? 52 LYS A HB2  4  
ATOM 5670  H HB3  . LYS A 1 52 ? 13.986  3.055   3.507   1.00 0.00 ? 52 LYS A HB3  4  
ATOM 5671  H HG2  . LYS A 1 52 ? 16.209  2.007   3.191   1.00 0.00 ? 52 LYS A HG2  4  
ATOM 5672  H HG3  . LYS A 1 52 ? 15.696  0.652   4.201   1.00 0.00 ? 52 LYS A HG3  4  
ATOM 5673  H HD2  . LYS A 1 52 ? 13.878  0.163   2.540   1.00 0.00 ? 52 LYS A HD2  4  
ATOM 5674  H HD3  . LYS A 1 52 ? 14.516  1.453   1.515   1.00 0.00 ? 52 LYS A HD3  4  
ATOM 5675  H HE2  . LYS A 1 52 ? 15.997  -1.064  2.345   1.00 0.00 ? 52 LYS A HE2  4  
ATOM 5676  H HE3  . LYS A 1 52 ? 15.310  -0.739  0.755   1.00 0.00 ? 52 LYS A HE3  4  
ATOM 5677  H HZ1  . LYS A 1 52 ? 16.862  1.121   0.537   1.00 0.00 ? 52 LYS A HZ1  4  
ATOM 5678  H HZ2  . LYS A 1 52 ? 17.671  -0.343  0.771   1.00 0.00 ? 52 LYS A HZ2  4  
ATOM 5679  H HZ3  . LYS A 1 52 ? 17.521  0.751   2.043   1.00 0.00 ? 52 LYS A HZ3  4  
ATOM 5680  N N    . THR A 1 53 ? 13.466  3.676   7.348   1.00 0.00 ? 53 THR A N    4  
ATOM 5681  C CA   . THR A 1 53 ? 12.533  4.493   8.137   1.00 0.00 ? 53 THR A CA   4  
ATOM 5682  C C    . THR A 1 53 ? 13.212  5.839   8.543   1.00 0.00 ? 53 THR A C    4  
ATOM 5683  O O    . THR A 1 53 ? 14.355  5.812   9.005   1.00 0.00 ? 53 THR A O    4  
ATOM 5684  C CB   . THR A 1 53 ? 12.079  3.699   9.411   1.00 0.00 ? 53 THR A CB   4  
ATOM 5685  O OG1  . THR A 1 53 ? 11.591  2.402   9.026   1.00 0.00 ? 53 THR A OG1  4  
ATOM 5686  C CG2  . THR A 1 53 ? 10.997  4.442   10.226  1.00 0.00 ? 53 THR A CG2  4  
ATOM 5687  H H    . THR A 1 53 ? 13.827  2.872   7.763   1.00 0.00 ? 53 THR A H    4  
ATOM 5688  H HA   . THR A 1 53 ? 11.657  4.695   7.523   1.00 0.00 ? 53 THR A HA   4  
ATOM 5689  H HB   . THR A 1 53 ? 12.947  3.552   10.051  1.00 0.00 ? 53 THR A HB   4  
ATOM 5690  H HG1  . THR A 1 53 ? 10.765  2.496   8.542   1.00 0.00 ? 53 THR A HG1  4  
ATOM 5691  H HG21 . THR A 1 53 ? 11.374  5.404   10.545  1.00 0.00 ? 53 THR A HG21 4  
ATOM 5692  H HG22 . THR A 1 53 ? 10.736  3.855   11.098  1.00 0.00 ? 53 THR A HG22 4  
ATOM 5693  H HG23 . THR A 1 53 ? 10.114  4.585   9.617   1.00 0.00 ? 53 THR A HG23 4  
ATOM 5694  N N    . PRO A 1 54 ? 12.538  7.027   8.340   1.00 0.00 ? 54 PRO A N    4  
ATOM 5695  C CA   . PRO A 1 54 ? 13.085  8.367   8.720   1.00 0.00 ? 54 PRO A CA   4  
ATOM 5696  C C    . PRO A 1 54 ? 13.493  8.451   10.212  1.00 0.00 ? 54 PRO A C    4  
ATOM 5697  O O    . PRO A 1 54 ? 12.826  7.865   11.073  1.00 0.00 ? 54 PRO A O    4  
ATOM 5698  C CB   . PRO A 1 54 ? 11.914  9.345   8.395   1.00 0.00 ? 54 PRO A CB   4  
ATOM 5699  C CG   . PRO A 1 54 ? 10.697  8.474   8.249   1.00 0.00 ? 54 PRO A CG   4  
ATOM 5700  C CD   . PRO A 1 54 ? 11.208  7.171   7.691   1.00 0.00 ? 54 PRO A CD   4  
ATOM 5701  H HA   . PRO A 1 54 ? 13.947  8.614   8.104   1.00 0.00 ? 54 PRO A HA   4  
ATOM 5702  H HB2  . PRO A 1 54 ? 11.781  10.074  9.195   1.00 0.00 ? 54 PRO A HB2  4  
ATOM 5703  H HB3  . PRO A 1 54 ? 12.107  9.869   7.465   1.00 0.00 ? 54 PRO A HB3  4  
ATOM 5704  H HG2  . PRO A 1 54 ? 10.229  8.325   9.222   1.00 0.00 ? 54 PRO A HG2  4  
ATOM 5705  H HG3  . PRO A 1 54 ? 9.985   8.923   7.563   1.00 0.00 ? 54 PRO A HG3  4  
ATOM 5706  H HD2  . PRO A 1 54 ? 10.548  6.352   7.958   1.00 0.00 ? 54 PRO A HD2  4  
ATOM 5707  H HD3  . PRO A 1 54 ? 11.315  7.229   6.612   1.00 0.00 ? 54 PRO A HD3  4  
ATOM 5708  N N    . VAL A 1 55 ? 14.586  9.193   10.490  1.00 0.00 ? 55 VAL A N    4  
ATOM 5709  C CA   . VAL A 1 55 ? 15.179  9.302   11.843  1.00 0.00 ? 55 VAL A CA   4  
ATOM 5710  C C    . VAL A 1 55 ? 14.230  10.045  12.820  1.00 0.00 ? 55 VAL A C    4  
ATOM 5711  O O    . VAL A 1 55 ? 14.043  9.626   13.966  1.00 0.00 ? 55 VAL A O    4  
ATOM 5712  C CB   . VAL A 1 55 ? 16.600  10.006  11.797  1.00 0.00 ? 55 VAL A CB   4  
ATOM 5713  C CG1  . VAL A 1 55 ? 16.528  11.443  11.212  1.00 0.00 ? 55 VAL A CG1  4  
ATOM 5714  C CG2  . VAL A 1 55 ? 17.287  9.991   13.192  1.00 0.00 ? 55 VAL A CG2  4  
ATOM 5715  H H    . VAL A 1 55 ? 15.009  9.689   9.755   1.00 0.00 ? 55 VAL A H    4  
ATOM 5716  H HA   . VAL A 1 55 ? 15.328  8.288   12.206  1.00 0.00 ? 55 VAL A HA   4  
ATOM 5717  H HB   . VAL A 1 55 ? 17.227  9.421   11.124  1.00 0.00 ? 55 VAL A HB   4  
ATOM 5718  H HG11 . VAL A 1 55 ? 17.516  11.880  11.174  1.00 0.00 ? 55 VAL A HG11 4  
ATOM 5719  H HG12 . VAL A 1 55 ? 15.887  12.059  11.829  1.00 0.00 ? 55 VAL A HG12 4  
ATOM 5720  H HG13 . VAL A 1 55 ? 16.114  11.403  10.209  1.00 0.00 ? 55 VAL A HG13 4  
ATOM 5721  H HG21 . VAL A 1 55 ? 17.386  8.970   13.539  1.00 0.00 ? 55 VAL A HG21 4  
ATOM 5722  H HG22 . VAL A 1 55 ? 16.685  10.547  13.902  1.00 0.00 ? 55 VAL A HG22 4  
ATOM 5723  H HG23 . VAL A 1 55 ? 18.267  10.441  13.125  1.00 0.00 ? 55 VAL A HG23 4  
ATOM 5724  N N    . ASP A 1 56 ? 13.609  11.123  12.329  1.00 0.00 ? 56 ASP A N    4  
ATOM 5725  C CA   . ASP A 1 56 ? 12.699  11.977  13.112  1.00 0.00 ? 56 ASP A CA   4  
ATOM 5726  C C    . ASP A 1 56 ? 11.309  11.340  13.214  1.00 0.00 ? 56 ASP A C    4  
ATOM 5727  O O    . ASP A 1 56 ? 10.681  11.356  14.280  1.00 0.00 ? 56 ASP A O    4  
ATOM 5728  C CB   . ASP A 1 56 ? 12.611  13.403  12.479  1.00 0.00 ? 56 ASP A CB   4  
ATOM 5729  C CG   . ASP A 1 56 ? 12.092  13.421  11.022  1.00 0.00 ? 56 ASP A CG   4  
ATOM 5730  O OD1  . ASP A 1 56 ? 12.821  12.949  10.116  1.00 0.00 ? 56 ASP A OD1  4  
ATOM 5731  O OD2  . ASP A 1 56 ? 10.949  13.871  10.777  1.00 0.00 ? 56 ASP A OD2  4  
ATOM 5732  H H    . ASP A 1 56 ? 13.764  11.356  11.388  1.00 0.00 ? 56 ASP A H    4  
ATOM 5733  H HA   . ASP A 1 56 ? 13.110  12.069  14.119  1.00 0.00 ? 56 ASP A HA   4  
ATOM 5734  H HB2  . ASP A 1 56 ? 11.963  14.014  13.095  1.00 0.00 ? 56 ASP A HB2  4  
ATOM 5735  H HB3  . ASP A 1 56 ? 13.599  13.842  12.483  1.00 0.00 ? 56 ASP A HB3  4  
ATOM 5736  N N    . GLY A 1 57 ? 10.849  10.773  12.100  1.00 0.00 ? 57 GLY A N    4  
ATOM 5737  C CA   . GLY A 1 57 ? 9.507   10.225  11.985  1.00 0.00 ? 57 GLY A CA   4  
ATOM 5738  C C    . GLY A 1 57 ? 8.813   10.803  10.770  1.00 0.00 ? 57 GLY A C    4  
ATOM 5739  O O    . GLY A 1 57 ? 9.466   11.007  9.748   1.00 0.00 ? 57 GLY A O    4  
ATOM 5740  H H    . GLY A 1 57 ? 11.432  10.750  11.310  1.00 0.00 ? 57 GLY A H    4  
ATOM 5741  H HA2  . GLY A 1 57 ? 9.573   9.150   11.871  1.00 0.00 ? 57 GLY A HA2  4  
ATOM 5742  H HA3  . GLY A 1 57 ? 8.927   10.450  12.875  1.00 0.00 ? 57 GLY A HA3  4  
ATOM 5743  N N    . GLN A 1 58 ? 7.508   11.113  10.904  1.00 0.00 ? 58 GLN A N    4  
ATOM 5744  C CA   . GLN A 1 58 ? 6.634   11.535  9.793   1.00 0.00 ? 58 GLN A CA   4  
ATOM 5745  C C    . GLN A 1 58 ? 6.631   10.474  8.670   1.00 0.00 ? 58 GLN A C    4  
ATOM 5746  O O    . GLN A 1 58 ? 7.437   10.542  7.731   1.00 0.00 ? 58 GLN A O    4  
ATOM 5747  C CB   . GLN A 1 58 ? 7.004   12.946  9.231   1.00 0.00 ? 58 GLN A CB   4  
ATOM 5748  C CG   . GLN A 1 58 ? 6.932   14.095  10.252  1.00 0.00 ? 58 GLN A CG   4  
ATOM 5749  C CD   . GLN A 1 58 ? 7.190   15.484  9.655   1.00 0.00 ? 58 GLN A CD   4  
ATOM 5750  O OE1  . GLN A 1 58 ? 6.657   16.485  10.137  1.00 0.00 ? 58 GLN A OE1  4  
ATOM 5751  N NE2  . GLN A 1 58 ? 8.013   15.575  8.617   1.00 0.00 ? 58 GLN A NE2  4  
ATOM 5752  H H    . GLN A 1 58 ? 7.113   11.049  11.795  1.00 0.00 ? 58 GLN A H    4  
ATOM 5753  H HA   . GLN A 1 58 ? 5.628   11.588  10.197  1.00 0.00 ? 58 GLN A HA   4  
ATOM 5754  H HB2  . GLN A 1 58 ? 8.017   12.908  8.841   1.00 0.00 ? 58 GLN A HB2  4  
ATOM 5755  H HB3  . GLN A 1 58 ? 6.331   13.177  8.412   1.00 0.00 ? 58 GLN A HB3  4  
ATOM 5756  H HG2  . GLN A 1 58 ? 5.946   14.095  10.708  1.00 0.00 ? 58 GLN A HG2  4  
ATOM 5757  H HG3  . GLN A 1 58 ? 7.668   13.915  11.026  1.00 0.00 ? 58 GLN A HG3  4  
ATOM 5758  H HE21 . GLN A 1 58 ? 8.434   14.758  8.273   1.00 0.00 ? 58 GLN A HE21 4  
ATOM 5759  H HE22 . GLN A 1 58 ? 8.167   16.463  8.232   1.00 0.00 ? 58 GLN A HE22 4  
ATOM 5760  N N    . TYR A 1 59 ? 5.761   9.464   8.818   1.00 0.00 ? 59 TYR A N    4  
ATOM 5761  C CA   . TYR A 1 59 ? 5.511   8.461   7.767   1.00 0.00 ? 59 TYR A CA   4  
ATOM 5762  C C    . TYR A 1 59 ? 4.800   9.105   6.568   1.00 0.00 ? 59 TYR A C    4  
ATOM 5763  O O    . TYR A 1 59 ? 4.451   10.278  6.607   1.00 0.00 ? 59 TYR A O    4  
ATOM 5764  C CB   . TYR A 1 59 ? 4.681   7.273   8.338   1.00 0.00 ? 59 TYR A CB   4  
ATOM 5765  C CG   . TYR A 1 59 ? 3.352   7.687   8.996   1.00 0.00 ? 59 TYR A CG   4  
ATOM 5766  C CD1  . TYR A 1 59 ? 2.194   7.930   8.238   1.00 0.00 ? 59 TYR A CD1  4  
ATOM 5767  C CD2  . TYR A 1 59 ? 3.247   7.846   10.383  1.00 0.00 ? 59 TYR A CD2  4  
ATOM 5768  C CE1  . TYR A 1 59 ? 1.012   8.315   8.835   1.00 0.00 ? 59 TYR A CE1  4  
ATOM 5769  C CE2  . TYR A 1 59 ? 2.056   8.228   10.976  1.00 0.00 ? 59 TYR A CE2  4  
ATOM 5770  C CZ   . TYR A 1 59 ? 0.949   8.458   10.194  1.00 0.00 ? 59 TYR A CZ   4  
ATOM 5771  O OH   . TYR A 1 59 ? -0.234  8.851   10.782  1.00 0.00 ? 59 TYR A OH   4  
ATOM 5772  H H    . TYR A 1 59 ? 5.266   9.390   9.658   1.00 0.00 ? 59 TYR A H    4  
ATOM 5773  H HA   . TYR A 1 59 ? 6.469   8.088   7.431   1.00 0.00 ? 59 TYR A HA   4  
ATOM 5774  H HB2  . TYR A 1 59 ? 4.453   6.571   7.538   1.00 0.00 ? 59 TYR A HB2  4  
ATOM 5775  H HB3  . TYR A 1 59 ? 5.277   6.754   9.082   1.00 0.00 ? 59 TYR A HB3  4  
ATOM 5776  H HD1  . TYR A 1 59 ? 2.232   7.815   7.165   1.00 0.00 ? 59 TYR A HD1  4  
ATOM 5777  H HD2  . TYR A 1 59 ? 4.117   7.664   11.005  1.00 0.00 ? 59 TYR A HD2  4  
ATOM 5778  H HE1  . TYR A 1 59 ? 0.134   8.503   8.229   1.00 0.00 ? 59 TYR A HE1  4  
ATOM 5779  H HE2  . TYR A 1 59 ? 1.997   8.351   12.057  1.00 0.00 ? 59 TYR A HE2  4  
ATOM 5780  H HH   . TYR A 1 59 ? -0.047  9.514   11.458  1.00 0.00 ? 59 TYR A HH   4  
ATOM 5781  N N    . VAL A 1 60 ? 4.596   8.342   5.498   1.00 0.00 ? 60 VAL A N    4  
ATOM 5782  C CA   . VAL A 1 60 ? 3.726   8.763   4.383   1.00 0.00 ? 60 VAL A CA   4  
ATOM 5783  C C    . VAL A 1 60 ? 2.464   7.888   4.390   1.00 0.00 ? 60 VAL A C    4  
ATOM 5784  O O    . VAL A 1 60 ? 2.486   6.767   4.914   1.00 0.00 ? 60 VAL A O    4  
ATOM 5785  C CB   . VAL A 1 60 ? 4.471   8.717   2.998   1.00 0.00 ? 60 VAL A CB   4  
ATOM 5786  C CG1  . VAL A 1 60 ? 5.641   9.736   2.965   1.00 0.00 ? 60 VAL A CG1  4  
ATOM 5787  C CG2  . VAL A 1 60 ? 4.960   7.292   2.652   1.00 0.00 ? 60 VAL A CG2  4  
ATOM 5788  H H    . VAL A 1 60 ? 5.026   7.463   5.452   1.00 0.00 ? 60 VAL A H    4  
ATOM 5789  H HA   . VAL A 1 60 ? 3.411   9.795   4.560   1.00 0.00 ? 60 VAL A HA   4  
ATOM 5790  H HB   . VAL A 1 60 ? 3.758   9.016   2.232   1.00 0.00 ? 60 VAL A HB   4  
ATOM 5791  H HG11 . VAL A 1 60 ? 5.263   10.733  3.160   1.00 0.00 ? 60 VAL A HG11 4  
ATOM 5792  H HG12 . VAL A 1 60 ? 6.111   9.722   1.990   1.00 0.00 ? 60 VAL A HG12 4  
ATOM 5793  H HG13 . VAL A 1 60 ? 6.378   9.480   3.719   1.00 0.00 ? 60 VAL A HG13 4  
ATOM 5794  H HG21 . VAL A 1 60 ? 5.464   7.295   1.693   1.00 0.00 ? 60 VAL A HG21 4  
ATOM 5795  H HG22 . VAL A 1 60 ? 4.111   6.625   2.603   1.00 0.00 ? 60 VAL A HG22 4  
ATOM 5796  H HG23 . VAL A 1 60 ? 5.642   6.942   3.415   1.00 0.00 ? 60 VAL A HG23 4  
ATOM 5797  N N    . TRP A 1 61 ? 1.360   8.428   3.861   1.00 0.00 ? 61 TRP A N    4  
ATOM 5798  C CA   . TRP A 1 61 ? 0.032   7.785   3.909   1.00 0.00 ? 61 TRP A CA   4  
ATOM 5799  C C    . TRP A 1 61 ? -0.875  8.387   2.830   1.00 0.00 ? 61 TRP A C    4  
ATOM 5800  O O    . TRP A 1 61 ? -0.583  9.455   2.304   1.00 0.00 ? 61 TRP A O    4  
ATOM 5801  C CB   . TRP A 1 61 ? -0.617  7.980   5.317   1.00 0.00 ? 61 TRP A CB   4  
ATOM 5802  C CG   . TRP A 1 61 ? -0.964  9.423   5.640   1.00 0.00 ? 61 TRP A CG   4  
ATOM 5803  C CD1  . TRP A 1 61 ? -0.121  10.386  6.117   1.00 0.00 ? 61 TRP A CD1  4  
ATOM 5804  C CD2  . TRP A 1 61 ? -2.249  10.059  5.498   1.00 0.00 ? 61 TRP A CD2  4  
ATOM 5805  N NE1  . TRP A 1 61 ? -0.794  11.569  6.274   1.00 0.00 ? 61 TRP A NE1  4  
ATOM 5806  C CE2  . TRP A 1 61 ? -2.103  11.389  5.907   1.00 0.00 ? 61 TRP A CE2  4  
ATOM 5807  C CE3  . TRP A 1 61 ? -3.505  9.627   5.065   1.00 0.00 ? 61 TRP A CE3  4  
ATOM 5808  C CZ2  . TRP A 1 61 ? -3.162  12.291  5.898   1.00 0.00 ? 61 TRP A CZ2  4  
ATOM 5809  C CZ3  . TRP A 1 61 ? -4.557  10.520  5.056   1.00 0.00 ? 61 TRP A CZ3  4  
ATOM 5810  C CH2  . TRP A 1 61 ? -4.381  11.839  5.473   1.00 0.00 ? 61 TRP A CH2  4  
ATOM 5811  H H    . TRP A 1 61 ? 1.437   9.297   3.418   1.00 0.00 ? 61 TRP A H    4  
ATOM 5812  H HA   . TRP A 1 61 ? 0.158   6.722   3.712   1.00 0.00 ? 61 TRP A HA   4  
ATOM 5813  H HB2  . TRP A 1 61 ? -1.530  7.395   5.375   1.00 0.00 ? 61 TRP A HB2  4  
ATOM 5814  H HB3  . TRP A 1 61 ? 0.069   7.620   6.079   1.00 0.00 ? 61 TRP A HB3  4  
ATOM 5815  H HD1  . TRP A 1 61 ? 0.932   10.229  6.329   1.00 0.00 ? 61 TRP A HD1  4  
ATOM 5816  H HE1  . TRP A 1 61 ? -0.404  12.408  6.604   1.00 0.00 ? 61 TRP A HE1  4  
ATOM 5817  H HE3  . TRP A 1 61 ? -3.663  8.606   4.737   1.00 0.00 ? 61 TRP A HE3  4  
ATOM 5818  H HZ2  . TRP A 1 61 ? -3.039  13.313  6.216   1.00 0.00 ? 61 TRP A HZ2  4  
ATOM 5819  H HZ3  . TRP A 1 61 ? -5.541  10.194  4.723   1.00 0.00 ? 61 TRP A HZ3  4  
ATOM 5820  H HH2  . TRP A 1 61 ? -5.235  12.507  5.449   1.00 0.00 ? 61 TRP A HH2  4  
ATOM 5821  N N    . PHE A 1 62 ? -2.007  7.722   2.557   1.00 0.00 ? 62 PHE A N    4  
ATOM 5822  C CA   . PHE A 1 62 ? -3.011  8.194   1.582   1.00 0.00 ? 62 PHE A CA   4  
ATOM 5823  C C    . PHE A 1 62 ? -4.418  7.765   2.029   1.00 0.00 ? 62 PHE A C    4  
ATOM 5824  O O    . PHE A 1 62 ? -4.602  6.642   2.521   1.00 0.00 ? 62 PHE A O    4  
ATOM 5825  C CB   . PHE A 1 62 ? -2.679  7.679   0.145   1.00 0.00 ? 62 PHE A CB   4  
ATOM 5826  C CG   . PHE A 1 62 ? -2.465  6.171   0.031   1.00 0.00 ? 62 PHE A CG   4  
ATOM 5827  C CD1  . PHE A 1 62 ? -1.219  5.603   0.310   1.00 0.00 ? 62 PHE A CD1  4  
ATOM 5828  C CD2  . PHE A 1 62 ? -3.505  5.316   -0.344  1.00 0.00 ? 62 PHE A CD2  4  
ATOM 5829  C CE1  . PHE A 1 62 ? -1.025  4.239   0.219   1.00 0.00 ? 62 PHE A CE1  4  
ATOM 5830  C CE2  . PHE A 1 62 ? -3.305  3.955   -0.429  1.00 0.00 ? 62 PHE A CE2  4  
ATOM 5831  C CZ   . PHE A 1 62 ? -2.064  3.416   -0.150  1.00 0.00 ? 62 PHE A CZ   4  
ATOM 5832  H H    . PHE A 1 62 ? -2.171  6.873   3.024   1.00 0.00 ? 62 PHE A H    4  
ATOM 5833  H HA   . PHE A 1 62 ? -2.977  9.283   1.578   1.00 0.00 ? 62 PHE A HA   4  
ATOM 5834  H HB2  . PHE A 1 62 ? -3.483  7.956   -0.526  1.00 0.00 ? 62 PHE A HB2  4  
ATOM 5835  H HB3  . PHE A 1 62 ? -1.772  8.168   -0.199  1.00 0.00 ? 62 PHE A HB3  4  
ATOM 5836  H HD1  . PHE A 1 62 ? -0.396  6.243   0.602   1.00 0.00 ? 62 PHE A HD1  4  
ATOM 5837  H HD2  . PHE A 1 62 ? -4.479  5.728   -0.566  1.00 0.00 ? 62 PHE A HD2  4  
ATOM 5838  H HE1  . PHE A 1 62 ? -0.051  3.811   0.436   1.00 0.00 ? 62 PHE A HE1  4  
ATOM 5839  H HE2  . PHE A 1 62 ? -4.120  3.304   -0.722  1.00 0.00 ? 62 PHE A HE2  4  
ATOM 5840  H HZ   . PHE A 1 62 ? -1.911  2.343   -0.221  1.00 0.00 ? 62 PHE A HZ   4  
ATOM 5841  N N    . ASN A 1 63 ? -5.404  8.666   1.846   1.00 0.00 ? 63 ASN A N    4  
ATOM 5842  C CA   . ASN A 1 63 ? -6.799  8.435   2.261   1.00 0.00 ? 63 ASN A CA   4  
ATOM 5843  C C    . ASN A 1 63 ? -7.540  7.655   1.167   1.00 0.00 ? 63 ASN A C    4  
ATOM 5844  O O    . ASN A 1 63 ? -7.520  8.044   -0.004  1.00 0.00 ? 63 ASN A O    4  
ATOM 5845  C CB   . ASN A 1 63 ? -7.510  9.776   2.615   1.00 0.00 ? 63 ASN A CB   4  
ATOM 5846  C CG   . ASN A 1 63 ? -7.512  10.804  1.479   1.00 0.00 ? 63 ASN A CG   4  
ATOM 5847  O OD1  . ASN A 1 63 ? -8.413  10.820  0.641   1.00 0.00 ? 63 ASN A OD1  4  
ATOM 5848  N ND2  . ASN A 1 63 ? -6.508  11.665  1.444   1.00 0.00 ? 63 ASN A ND2  4  
ATOM 5849  H H    . ASN A 1 63 ? -5.186  9.495   1.380   1.00 0.00 ? 63 ASN A H    4  
ATOM 5850  H HA   . ASN A 1 63 ? -6.770  7.815   3.157   1.00 0.00 ? 63 ASN A HA   4  
ATOM 5851  H HB2  . ASN A 1 63 ? -8.537  9.573   2.888   1.00 0.00 ? 63 ASN A HB2  4  
ATOM 5852  H HB3  . ASN A 1 63 ? -7.012  10.219  3.476   1.00 0.00 ? 63 ASN A HB3  4  
ATOM 5853  H HD21 . ASN A 1 63 ? -5.819  11.610  2.144   1.00 0.00 ? 63 ASN A HD21 4  
ATOM 5854  H HD22 . ASN A 1 63 ? -6.499  12.336  0.731   1.00 0.00 ? 63 ASN A HD22 4  
ATOM 5855  N N    . ILE A 1 64 ? -8.174  6.531   1.546   1.00 0.00 ? 64 ILE A N    4  
ATOM 5856  C CA   . ILE A 1 64 ? -8.815  5.614   0.577   1.00 0.00 ? 64 ILE A CA   4  
ATOM 5857  C C    . ILE A 1 64 ? -10.347 5.752   0.589   1.00 0.00 ? 64 ILE A C    4  
ATOM 5858  O O    . ILE A 1 64 ? -10.973 5.767   -0.475  1.00 0.00 ? 64 ILE A O    4  
ATOM 5859  C CB   . ILE A 1 64 ? -8.407  4.113   0.824   1.00 0.00 ? 64 ILE A CB   4  
ATOM 5860  C CG1  . ILE A 1 64 ? -8.768  3.651   2.274   1.00 0.00 ? 64 ILE A CG1  4  
ATOM 5861  C CG2  . ILE A 1 64 ? -6.902  3.917   0.536   1.00 0.00 ? 64 ILE A CG2  4  
ATOM 5862  C CD1  . ILE A 1 64 ? -8.532  2.186   2.557   1.00 0.00 ? 64 ILE A CD1  4  
ATOM 5863  H H    . ILE A 1 64 ? -8.225  6.320   2.503   1.00 0.00 ? 64 ILE A H    4  
ATOM 5864  H HA   . ILE A 1 64 ? -8.463  5.886   -0.426  1.00 0.00 ? 64 ILE A HA   4  
ATOM 5865  H HB   . ILE A 1 64 ? -8.956  3.496   0.109   1.00 0.00 ? 64 ILE A HB   4  
ATOM 5866  H HG12 . ILE A 1 64 ? -8.181  4.216   2.983   1.00 0.00 ? 64 ILE A HG12 4  
ATOM 5867  H HG13 . ILE A 1 64 ? -9.816  3.853   2.453   1.00 0.00 ? 64 ILE A HG13 4  
ATOM 5868  H HG21 . ILE A 1 64 ? -6.321  4.522   1.219   1.00 0.00 ? 64 ILE A HG21 4  
ATOM 5869  H HG22 . ILE A 1 64 ? -6.676  4.212   -0.481  1.00 0.00 ? 64 ILE A HG22 4  
ATOM 5870  H HG23 . ILE A 1 64 ? -6.632  2.873   0.667   1.00 0.00 ? 64 ILE A HG23 4  
ATOM 5871  H HD11 . ILE A 1 64 ? -7.483  1.956   2.453   1.00 0.00 ? 64 ILE A HD11 4  
ATOM 5872  H HD12 . ILE A 1 64 ? -9.104  1.590   1.861   1.00 0.00 ? 64 ILE A HD12 4  
ATOM 5873  H HD13 . ILE A 1 64 ? -8.851  1.963   3.564   1.00 0.00 ? 64 ILE A HD13 4  
ATOM 5874  N N    . GLY A 1 65 ? -10.938 5.885   1.791   1.00 0.00 ? 65 GLY A N    4  
ATOM 5875  C CA   . GLY A 1 65 ? -12.393 5.835   1.950   1.00 0.00 ? 65 GLY A CA   4  
ATOM 5876  C C    . GLY A 1 65 ? -12.955 4.451   1.636   1.00 0.00 ? 65 GLY A C    4  
ATOM 5877  O O    . GLY A 1 65 ? -13.215 3.655   2.544   1.00 0.00 ? 65 GLY A O    4  
ATOM 5878  H H    . GLY A 1 65 ? -10.376 6.021   2.581   1.00 0.00 ? 65 GLY A H    4  
ATOM 5879  H HA2  . GLY A 1 65 ? -12.633 6.089   2.970   1.00 0.00 ? 65 GLY A HA2  4  
ATOM 5880  H HA3  . GLY A 1 65 ? -12.849 6.567   1.294   1.00 0.00 ? 65 GLY A HA3  4  
ATOM 5881  N N    . SER A 1 66 ? -13.120 4.170   0.331   1.00 0.00 ? 66 SER A N    4  
ATOM 5882  C CA   . SER A 1 66 ? -13.529 2.858   -0.174  1.00 0.00 ? 66 SER A CA   4  
ATOM 5883  C C    . SER A 1 66 ? -12.375 1.848   -0.007  1.00 0.00 ? 66 SER A C    4  
ATOM 5884  O O    . SER A 1 66 ? -11.452 1.800   -0.838  1.00 0.00 ? 66 SER A O    4  
ATOM 5885  C CB   . SER A 1 66 ? -13.927 2.990   -1.658  1.00 0.00 ? 66 SER A CB   4  
ATOM 5886  O OG   . SER A 1 66 ? -14.954 3.957   -1.844  1.00 0.00 ? 66 SER A OG   4  
ATOM 5887  H H    . SER A 1 66 ? -12.944 4.881   -0.322  1.00 0.00 ? 66 SER A H    4  
ATOM 5888  H HA   . SER A 1 66 ? -14.387 2.519   0.398   1.00 0.00 ? 66 SER A HA   4  
ATOM 5889  H HB2  . SER A 1 66 ? -13.063 3.297   -2.230  1.00 0.00 ? 66 SER A HB2  4  
ATOM 5890  H HB3  . SER A 1 66 ? -14.276 2.031   -2.025  1.00 0.00 ? 66 SER A HB3  4  
ATOM 5891  H HG   . SER A 1 66 ? -15.082 4.445   -1.018  1.00 0.00 ? 66 SER A HG   4  
ATOM 5892  N N    . VAL A 1 67 ? -12.424 1.091   1.111   1.00 0.00 ? 67 VAL A N    4  
ATOM 5893  C CA   . VAL A 1 67 ? -11.439 0.034   1.429   1.00 0.00 ? 67 VAL A CA   4  
ATOM 5894  C C    . VAL A 1 67 ? -11.461 -1.053  0.365   1.00 0.00 ? 67 VAL A C    4  
ATOM 5895  O O    . VAL A 1 67 ? -10.411 -1.534  -0.053  1.00 0.00 ? 67 VAL A O    4  
ATOM 5896  C CB   . VAL A 1 67 ? -11.683 -0.622  2.835   1.00 0.00 ? 67 VAL A CB   4  
ATOM 5897  C CG1  . VAL A 1 67 ? -10.619 -1.714  3.143   1.00 0.00 ? 67 VAL A CG1  4  
ATOM 5898  C CG2  . VAL A 1 67 ? -11.704 0.459   3.924   1.00 0.00 ? 67 VAL A CG2  4  
ATOM 5899  H H    . VAL A 1 67 ? -13.153 1.264   1.742   1.00 0.00 ? 67 VAL A H    4  
ATOM 5900  H HA   . VAL A 1 67 ? -10.452 0.499   1.440   1.00 0.00 ? 67 VAL A HA   4  
ATOM 5901  H HB   . VAL A 1 67 ? -12.663 -1.104  2.821   1.00 0.00 ? 67 VAL A HB   4  
ATOM 5902  H HG11 . VAL A 1 67 ? -10.661 -2.490  2.389   1.00 0.00 ? 67 VAL A HG11 4  
ATOM 5903  H HG12 . VAL A 1 67 ? -10.811 -2.158  4.116   1.00 0.00 ? 67 VAL A HG12 4  
ATOM 5904  H HG13 . VAL A 1 67 ? -9.632  -1.273  3.145   1.00 0.00 ? 67 VAL A HG13 4  
ATOM 5905  H HG21 . VAL A 1 67 ? -10.743 0.957   3.960   1.00 0.00 ? 67 VAL A HG21 4  
ATOM 5906  H HG22 . VAL A 1 67 ? -11.910 0.009   4.890   1.00 0.00 ? 67 VAL A HG22 4  
ATOM 5907  H HG23 . VAL A 1 67 ? -12.472 1.188   3.703   1.00 0.00 ? 67 VAL A HG23 4  
ATOM 5908  N N    . ASP A 1 68 ? -12.677 -1.397  -0.087  1.00 0.00 ? 68 ASP A N    4  
ATOM 5909  C CA   . ASP A 1 68 ? -12.912 -2.452  -1.081  1.00 0.00 ? 68 ASP A CA   4  
ATOM 5910  C C    . ASP A 1 68 ? -12.161 -2.142  -2.379  1.00 0.00 ? 68 ASP A C    4  
ATOM 5911  O O    . ASP A 1 68 ? -11.503 -3.011  -2.948  1.00 0.00 ? 68 ASP A O    4  
ATOM 5912  C CB   . ASP A 1 68 ? -14.433 -2.587  -1.363  1.00 0.00 ? 68 ASP A CB   4  
ATOM 5913  C CG   . ASP A 1 68 ? -15.263 -2.812  -0.085  1.00 0.00 ? 68 ASP A CG   4  
ATOM 5914  O OD1  . ASP A 1 68 ? -15.612 -1.819  0.591   1.00 0.00 ? 68 ASP A OD1  4  
ATOM 5915  O OD2  . ASP A 1 68 ? -15.546 -3.975  0.262   1.00 0.00 ? 68 ASP A OD2  4  
ATOM 5916  H H    . ASP A 1 68 ? -13.474 -0.933  0.240   1.00 0.00 ? 68 ASP A H    4  
ATOM 5917  H HA   . ASP A 1 68 ? -12.544 -3.387  -0.669  1.00 0.00 ? 68 ASP A HA   4  
ATOM 5918  H HB2  . ASP A 1 68 ? -14.790 -1.682  -1.853  1.00 0.00 ? 68 ASP A HB2  4  
ATOM 5919  H HB3  . ASP A 1 68 ? -14.600 -3.422  -2.038  1.00 0.00 ? 68 ASP A HB3  4  
ATOM 5920  N N    . THR A 1 69 ? -12.254 -0.866  -2.803  1.00 0.00 ? 69 THR A N    4  
ATOM 5921  C CA   . THR A 1 69 ? -11.598 -0.363  -4.008  1.00 0.00 ? 69 THR A CA   4  
ATOM 5922  C C    . THR A 1 69 ? -10.063 -0.379  -3.841  1.00 0.00 ? 69 THR A C    4  
ATOM 5923  O O    . THR A 1 69 ? -9.349  -0.747  -4.777  1.00 0.00 ? 69 THR A O    4  
ATOM 5924  C CB   . THR A 1 69 ? -12.106 1.073   -4.348  1.00 0.00 ? 69 THR A CB   4  
ATOM 5925  O OG1  . THR A 1 69 ? -13.553 1.091   -4.313  1.00 0.00 ? 69 THR A OG1  4  
ATOM 5926  C CG2  . THR A 1 69 ? -11.627 1.535   -5.733  1.00 0.00 ? 69 THR A CG2  4  
ATOM 5927  H H    . THR A 1 69 ? -12.788 -0.241  -2.270  1.00 0.00 ? 69 THR A H    4  
ATOM 5928  H HA   . THR A 1 69 ? -11.877 -1.027  -4.825  1.00 0.00 ? 69 THR A HA   4  
ATOM 5929  H HB   . THR A 1 69 ? -11.731 1.764   -3.596  1.00 0.00 ? 69 THR A HB   4  
ATOM 5930  H HG1  . THR A 1 69 ? -13.873 0.186   -4.333  1.00 0.00 ? 69 THR A HG1  4  
ATOM 5931  H HG21 . THR A 1 69 ? -10.541 1.558   -5.760  1.00 0.00 ? 69 THR A HG21 4  
ATOM 5932  H HG22 . THR A 1 69 ? -12.010 2.525   -5.936  1.00 0.00 ? 69 THR A HG22 4  
ATOM 5933  H HG23 . THR A 1 69 ? -11.982 0.852   -6.492  1.00 0.00 ? 69 THR A HG23 4  
ATOM 5934  N N    . PHE A 1 70 ? -9.578  0.000   -2.628  1.00 0.00 ? 70 PHE A N    4  
ATOM 5935  C CA   . PHE A 1 70 ? -8.148  -0.093  -2.261  1.00 0.00 ? 70 PHE A CA   4  
ATOM 5936  C C    . PHE A 1 70 ? -7.635  -1.530  -2.443  1.00 0.00 ? 70 PHE A C    4  
ATOM 5937  O O    . PHE A 1 70 ? -6.576  -1.729  -3.028  1.00 0.00 ? 70 PHE A O    4  
ATOM 5938  C CB   . PHE A 1 70 ? -7.889  0.384   -0.797  1.00 0.00 ? 70 PHE A CB   4  
ATOM 5939  C CG   . PHE A 1 70 ? -6.517  -0.019  -0.232  1.00 0.00 ? 70 PHE A CG   4  
ATOM 5940  C CD1  . PHE A 1 70 ? -5.336  0.525   -0.749  1.00 0.00 ? 70 PHE A CD1  4  
ATOM 5941  C CD2  . PHE A 1 70 ? -6.402  -0.979  0.786   1.00 0.00 ? 70 PHE A CD2  4  
ATOM 5942  C CE1  . PHE A 1 70 ? -4.098  0.126   -0.268  1.00 0.00 ? 70 PHE A CE1  4  
ATOM 5943  C CE2  . PHE A 1 70 ? -5.162  -1.367  1.267   1.00 0.00 ? 70 PHE A CE2  4  
ATOM 5944  C CZ   . PHE A 1 70 ? -4.015  -0.820  0.736   1.00 0.00 ? 70 PHE A CZ   4  
ATOM 5945  H H    . PHE A 1 70 ? -10.206 0.359   -1.967  1.00 0.00 ? 70 PHE A H    4  
ATOM 5946  H HA   . PHE A 1 70 ? -7.605  0.564   -2.937  1.00 0.00 ? 70 PHE A HA   4  
ATOM 5947  H HB2  . PHE A 1 70 ? -7.950  1.464   -0.757  1.00 0.00 ? 70 PHE A HB2  4  
ATOM 5948  H HB3  . PHE A 1 70 ? -8.654  -0.030  -0.148  1.00 0.00 ? 70 PHE A HB3  4  
ATOM 5949  H HD1  . PHE A 1 70 ? -5.387  1.266   -1.534  1.00 0.00 ? 70 PHE A HD1  4  
ATOM 5950  H HD2  . PHE A 1 70 ? -7.295  -1.418  1.209   1.00 0.00 ? 70 PHE A HD2  4  
ATOM 5951  H HE1  . PHE A 1 70 ? -3.188  0.559   -0.680  1.00 0.00 ? 70 PHE A HE1  4  
ATOM 5952  H HE2  . PHE A 1 70 ? -5.089  -2.108  2.057   1.00 0.00 ? 70 PHE A HE2  4  
ATOM 5953  H HZ   . PHE A 1 70 ? -3.042  -1.123  1.113   1.00 0.00 ? 70 PHE A HZ   4  
ATOM 5954  N N    . GLU A 1 71 ? -8.426  -2.508  -1.948  1.00 0.00 ? 71 GLU A N    4  
ATOM 5955  C CA   . GLU A 1 71 ? -8.067  -3.936  -1.966  1.00 0.00 ? 71 GLU A CA   4  
ATOM 5956  C C    . GLU A 1 71 ? -7.961  -4.430  -3.410  1.00 0.00 ? 71 GLU A C    4  
ATOM 5957  O O    . GLU A 1 71 ? -6.987  -5.092  -3.751  1.00 0.00 ? 71 GLU A O    4  
ATOM 5958  C CB   . GLU A 1 71 ? -9.103  -4.776  -1.172  1.00 0.00 ? 71 GLU A CB   4  
ATOM 5959  C CG   . GLU A 1 71 ? -9.206  -4.390  0.310   1.00 0.00 ? 71 GLU A CG   4  
ATOM 5960  C CD   . GLU A 1 71 ? -10.294 -5.158  1.060   1.00 0.00 ? 71 GLU A CD   4  
ATOM 5961  O OE1  . GLU A 1 71 ? -11.479 -4.815  0.910   1.00 0.00 ? 71 GLU A OE1  4  
ATOM 5962  O OE2  . GLU A 1 71 ? -9.981  -6.116  1.790   1.00 0.00 ? 71 GLU A OE2  4  
ATOM 5963  H H    . GLU A 1 71 ? -9.290  -2.252  -1.561  1.00 0.00 ? 71 GLU A H    4  
ATOM 5964  H HA   . GLU A 1 71 ? -7.090  -4.033  -1.481  1.00 0.00 ? 71 GLU A HA   4  
ATOM 5965  H HB2  . GLU A 1 71 ? -10.087 -4.650  -1.628  1.00 0.00 ? 71 GLU A HB2  4  
ATOM 5966  H HB3  . GLU A 1 71 ? -8.830  -5.825  -1.232  1.00 0.00 ? 71 GLU A HB3  4  
ATOM 5967  H HG2  . GLU A 1 71 ? -8.248  -4.571  0.785   1.00 0.00 ? 71 GLU A HG2  4  
ATOM 5968  H HG3  . GLU A 1 71 ? -9.421  -3.330  0.374   1.00 0.00 ? 71 GLU A HG3  4  
ATOM 5969  N N    . ARG A 1 72 ? -8.958  -4.045  -4.254  1.00 0.00 ? 72 ARG A N    4  
ATOM 5970  C CA   . ARG A 1 72 ? -8.995  -4.416  -5.688  1.00 0.00 ? 72 ARG A CA   4  
ATOM 5971  C C    . ARG A 1 72 ? -7.752  -3.907  -6.426  1.00 0.00 ? 72 ARG A C    4  
ATOM 5972  O O    . ARG A 1 72 ? -7.061  -4.671  -7.106  1.00 0.00 ? 72 ARG A O    4  
ATOM 5973  C CB   . ARG A 1 72 ? -10.275 -3.875  -6.395  1.00 0.00 ? 72 ARG A CB   4  
ATOM 5974  C CG   . ARG A 1 72 ? -11.628 -4.350  -5.821  1.00 0.00 ? 72 ARG A CG   4  
ATOM 5975  C CD   . ARG A 1 72 ? -11.796 -5.884  -5.739  1.00 0.00 ? 72 ARG A CD   4  
ATOM 5976  N NE   . ARG A 1 72 ? -11.125 -6.469  -4.560  1.00 0.00 ? 72 ARG A NE   4  
ATOM 5977  C CZ   . ARG A 1 72 ? -10.331 -7.546  -4.575  1.00 0.00 ? 72 ARG A CZ   4  
ATOM 5978  N NH1  . ARG A 1 72 ? -10.067 -8.199  -5.697  1.00 0.00 ? 72 ARG A NH1  4  
ATOM 5979  N NH2  . ARG A 1 72 ? -9.794  -7.974  -3.446  1.00 0.00 ? 72 ARG A NH2  4  
ATOM 5980  H H    . ARG A 1 72 ? -9.700  -3.511  -3.896  1.00 0.00 ? 72 ARG A H    4  
ATOM 5981  H HA   . ARG A 1 72 ? -9.014  -5.503  -5.731  1.00 0.00 ? 72 ARG A HA   4  
ATOM 5982  H HB2  . ARG A 1 72 ? -10.263 -2.789  -6.352  1.00 0.00 ? 72 ARG A HB2  4  
ATOM 5983  H HB3  . ARG A 1 72 ? -10.241 -4.168  -7.443  1.00 0.00 ? 72 ARG A HB3  4  
ATOM 5984  H HG2  . ARG A 1 72 ? -11.733 -3.945  -4.824  1.00 0.00 ? 72 ARG A HG2  4  
ATOM 5985  H HG3  . ARG A 1 72 ? -12.426 -3.944  -6.442  1.00 0.00 ? 72 ARG A HG3  4  
ATOM 5986  H HD2  . ARG A 1 72 ? -12.852 -6.117  -5.676  1.00 0.00 ? 72 ARG A HD2  4  
ATOM 5987  H HD3  . ARG A 1 72 ? -11.393 -6.334  -6.646  1.00 0.00 ? 72 ARG A HD3  4  
ATOM 5988  H HE   . ARG A 1 72 ? -11.289 -6.026  -3.698  1.00 0.00 ? 72 ARG A HE   4  
ATOM 5989  H HH11 . ARG A 1 72 ? -10.472 -7.894  -6.565  1.00 0.00 ? 72 ARG A HH11 4  
ATOM 5990  H HH12 . ARG A 1 72 ? -9.468  -9.007  -5.685  1.00 0.00 ? 72 ARG A HH12 4  
ATOM 5991  H HH21 . ARG A 1 72 ? -9.975  -7.493  -2.580  1.00 0.00 ? 72 ARG A HH21 4  
ATOM 5992  H HH22 . ARG A 1 72 ? -9.193  -8.777  -3.444  1.00 0.00 ? 72 ARG A HH22 4  
ATOM 5993  N N    . ASN A 1 73 ? -7.475  -2.604  -6.253  1.00 0.00 ? 73 ASN A N    4  
ATOM 5994  C CA   . ASN A 1 73 ? -6.372  -1.907  -6.934  1.00 0.00 ? 73 ASN A CA   4  
ATOM 5995  C C    . ASN A 1 73 ? -5.021  -2.460  -6.467  1.00 0.00 ? 73 ASN A C    4  
ATOM 5996  O O    . ASN A 1 73 ? -4.117  -2.648  -7.271  1.00 0.00 ? 73 ASN A O    4  
ATOM 5997  C CB   . ASN A 1 73 ? -6.464  -0.375  -6.673  1.00 0.00 ? 73 ASN A CB   4  
ATOM 5998  C CG   . ASN A 1 73 ? -7.752  0.253   -7.220  1.00 0.00 ? 73 ASN A CG   4  
ATOM 5999  O OD1  . ASN A 1 73 ? -8.311  -0.193  -8.222  1.00 0.00 ? 73 ASN A OD1  4  
ATOM 6000  N ND2  . ASN A 1 73 ? -8.245  1.275   -6.538  1.00 0.00 ? 73 ASN A ND2  4  
ATOM 6001  H H    . ASN A 1 73 ? -8.029  -2.083  -5.635  1.00 0.00 ? 73 ASN A H    4  
ATOM 6002  H HA   . ASN A 1 73 ? -6.480  -2.087  -8.004  1.00 0.00 ? 73 ASN A HA   4  
ATOM 6003  H HB2  . ASN A 1 73 ? -6.423  -0.194  -5.601  1.00 0.00 ? 73 ASN A HB2  4  
ATOM 6004  H HB3  . ASN A 1 73 ? -5.626  0.125   -7.145  1.00 0.00 ? 73 ASN A HB3  4  
ATOM 6005  H HD21 . ASN A 1 73 ? -7.772  1.561   -5.729  1.00 0.00 ? 73 ASN A HD21 4  
ATOM 6006  H HD22 . ASN A 1 73 ? -9.069  1.692   -6.864  1.00 0.00 ? 73 ASN A HD22 4  
ATOM 6007  N N    . LEU A 1 74 ? -4.920  -2.726  -5.159  1.00 0.00 ? 74 LEU A N    4  
ATOM 6008  C CA   . LEU A 1 74 ? -3.710  -3.269  -4.530  1.00 0.00 ? 74 LEU A CA   4  
ATOM 6009  C C    . LEU A 1 74 ? -3.340  -4.658  -5.083  1.00 0.00 ? 74 LEU A C    4  
ATOM 6010  O O    . LEU A 1 74 ? -2.197  -4.873  -5.477  1.00 0.00 ? 74 LEU A O    4  
ATOM 6011  C CB   . LEU A 1 74 ? -3.904  -3.343  -2.999  1.00 0.00 ? 74 LEU A CB   4  
ATOM 6012  C CG   . LEU A 1 74 ? -2.699  -3.910  -2.179  1.00 0.00 ? 74 LEU A CG   4  
ATOM 6013  C CD1  . LEU A 1 74 ? -1.455  -2.997  -2.260  1.00 0.00 ? 74 LEU A CD1  4  
ATOM 6014  C CD2  . LEU A 1 74 ? -3.108  -4.174  -0.729  1.00 0.00 ? 74 LEU A CD2  4  
ATOM 6015  H H    . LEU A 1 74 ? -5.681  -2.511  -4.584  1.00 0.00 ? 74 LEU A H    4  
ATOM 6016  H HA   . LEU A 1 74 ? -2.898  -2.577  -4.741  1.00 0.00 ? 74 LEU A HA   4  
ATOM 6017  H HB2  . LEU A 1 74 ? -4.126  -2.338  -2.638  1.00 0.00 ? 74 LEU A HB2  4  
ATOM 6018  H HB3  . LEU A 1 74 ? -4.778  -3.963  -2.802  1.00 0.00 ? 74 LEU A HB3  4  
ATOM 6019  H HG   . LEU A 1 74 ? -2.413  -4.866  -2.607  1.00 0.00 ? 74 LEU A HG   4  
ATOM 6020  H HD11 . LEU A 1 74 ? -1.691  -2.016  -1.866  1.00 0.00 ? 74 LEU A HD11 4  
ATOM 6021  H HD12 . LEU A 1 74 ? -1.136  -2.903  -3.288  1.00 0.00 ? 74 LEU A HD12 4  
ATOM 6022  H HD13 . LEU A 1 74 ? -0.650  -3.432  -1.682  1.00 0.00 ? 74 LEU A HD13 4  
ATOM 6023  H HD21 . LEU A 1 74 ? -2.275  -4.608  -0.191  1.00 0.00 ? 74 LEU A HD21 4  
ATOM 6024  H HD22 . LEU A 1 74 ? -3.943  -4.863  -0.706  1.00 0.00 ? 74 LEU A HD22 4  
ATOM 6025  H HD23 . LEU A 1 74 ? -3.398  -3.247  -0.251  1.00 0.00 ? 74 LEU A HD23 4  
ATOM 6026  N N    . GLU A 1 75 ? -4.319  -5.593  -5.121  1.00 0.00 ? 75 GLU A N    4  
ATOM 6027  C CA   . GLU A 1 75 ? -4.059  -6.990  -5.532  1.00 0.00 ? 75 GLU A CA   4  
ATOM 6028  C C    . GLU A 1 75 ? -3.767  -7.095  -7.047  1.00 0.00 ? 75 GLU A C    4  
ATOM 6029  O O    . GLU A 1 75 ? -2.956  -7.930  -7.475  1.00 0.00 ? 75 GLU A O    4  
ATOM 6030  C CB   . GLU A 1 75 ? -5.206  -7.935  -5.050  1.00 0.00 ? 75 GLU A CB   4  
ATOM 6031  C CG   . GLU A 1 75 ? -6.646  -7.607  -5.523  1.00 0.00 ? 75 GLU A CG   4  
ATOM 6032  C CD   . GLU A 1 75 ? -7.064  -8.269  -6.848  1.00 0.00 ? 75 GLU A CD   4  
ATOM 6033  O OE1  . GLU A 1 75 ? -7.471  -9.449  -6.831  1.00 0.00 ? 75 GLU A OE1  4  
ATOM 6034  O OE2  . GLU A 1 75 ? -7.020  -7.615  -7.901  1.00 0.00 ? 75 GLU A OE2  4  
ATOM 6035  H H    . GLU A 1 75 ? -5.225  -5.338  -4.838  1.00 0.00 ? 75 GLU A H    4  
ATOM 6036  H HA   . GLU A 1 75 ? -3.149  -7.291  -5.006  1.00 0.00 ? 75 GLU A HA   4  
ATOM 6037  H HB2  . GLU A 1 75 ? -4.974  -8.943  -5.372  1.00 0.00 ? 75 GLU A HB2  4  
ATOM 6038  H HB3  . GLU A 1 75 ? -5.204  -7.932  -3.961  1.00 0.00 ? 75 GLU A HB3  4  
ATOM 6039  H HG2  . GLU A 1 75 ? -7.347  -7.922  -4.751  1.00 0.00 ? 75 GLU A HG2  4  
ATOM 6040  H HG3  . GLU A 1 75 ? -6.733  -6.526  -5.627  1.00 0.00 ? 75 GLU A HG3  4  
ATOM 6041  N N    . THR A 1 76 ? -4.412  -6.217  -7.841  1.00 0.00 ? 76 THR A N    4  
ATOM 6042  C CA   . THR A 1 76 ? -4.108  -6.051  -9.280  1.00 0.00 ? 76 THR A CA   4  
ATOM 6043  C C    . THR A 1 76 ? -2.667  -5.524  -9.454  1.00 0.00 ? 76 THR A C    4  
ATOM 6044  O O    . THR A 1 76 ? -1.901  -6.027  -10.277 1.00 0.00 ? 76 THR A O    4  
ATOM 6045  C CB   . THR A 1 76 ? -5.119  -5.065  -9.971  1.00 0.00 ? 76 THR A CB   4  
ATOM 6046  O OG1  . THR A 1 76 ? -6.462  -5.506  -9.732  1.00 0.00 ? 76 THR A OG1  4  
ATOM 6047  C CG2  . THR A 1 76 ? -4.892  -4.964  -11.489 1.00 0.00 ? 76 THR A CG2  4  
ATOM 6048  H H    . THR A 1 76 ? -5.132  -5.681  -7.448  1.00 0.00 ? 76 THR A H    4  
ATOM 6049  H HA   . THR A 1 76 ? -4.198  -7.024  -9.753  1.00 0.00 ? 76 THR A HA   4  
ATOM 6050  H HB   . THR A 1 76 ? -4.999  -4.077  -9.529  1.00 0.00 ? 76 THR A HB   4  
ATOM 6051  H HG1  . THR A 1 76 ? -6.533  -5.808  -8.823  1.00 0.00 ? 76 THR A HG1  4  
ATOM 6052  H HG21 . THR A 1 76 ? -3.895  -4.590  -11.686 1.00 0.00 ? 76 THR A HG21 4  
ATOM 6053  H HG22 . THR A 1 76 ? -5.620  -4.290  -11.924 1.00 0.00 ? 76 THR A HG22 4  
ATOM 6054  H HG23 . THR A 1 76 ? -5.000  -5.942  -11.938 1.00 0.00 ? 76 THR A HG23 4  
ATOM 6055  N N    . LEU A 1 77 ? -2.335  -4.521  -8.628  1.00 0.00 ? 77 LEU A N    4  
ATOM 6056  C CA   . LEU A 1 77 ? -1.021  -3.854  -8.616  1.00 0.00 ? 77 LEU A CA   4  
ATOM 6057  C C    . LEU A 1 77 ? 0.107   -4.827  -8.235  1.00 0.00 ? 77 LEU A C    4  
ATOM 6058  O O    . LEU A 1 77 ? 1.203   -4.739  -8.780  1.00 0.00 ? 77 LEU A O    4  
ATOM 6059  C CB   . LEU A 1 77 ? -1.045  -2.658  -7.639  1.00 0.00 ? 77 LEU A CB   4  
ATOM 6060  C CG   . LEU A 1 77 ? 0.204   -1.735  -7.660  1.00 0.00 ? 77 LEU A CG   4  
ATOM 6061  C CD1  . LEU A 1 77 ? 0.398   -1.081  -9.050  1.00 0.00 ? 77 LEU A CD1  4  
ATOM 6062  C CD2  . LEU A 1 77 ? 0.114   -0.680  -6.548  1.00 0.00 ? 77 LEU A CD2  4  
ATOM 6063  H H    . LEU A 1 77 ? -3.039  -4.202  -8.027  1.00 0.00 ? 77 LEU A H    4  
ATOM 6064  H HA   . LEU A 1 77 ? -0.839  -3.478  -9.620  1.00 0.00 ? 77 LEU A HA   4  
ATOM 6065  H HB2  . LEU A 1 77 ? -1.920  -2.051  -7.873  1.00 0.00 ? 77 LEU A HB2  4  
ATOM 6066  H HB3  . LEU A 1 77 ? -1.173  -3.042  -6.629  1.00 0.00 ? 77 LEU A HB3  4  
ATOM 6067  H HG   . LEU A 1 77 ? 1.087   -2.336  -7.465  1.00 0.00 ? 77 LEU A HG   4  
ATOM 6068  H HD11 . LEU A 1 77 ? 0.528   -1.852  -9.800  1.00 0.00 ? 77 LEU A HD11 4  
ATOM 6069  H HD12 . LEU A 1 77 ? 1.279   -0.455  -9.036  1.00 0.00 ? 77 LEU A HD12 4  
ATOM 6070  H HD13 . LEU A 1 77 ? -0.465  -0.479  -9.302  1.00 0.00 ? 77 LEU A HD13 4  
ATOM 6071  H HD21 . LEU A 1 77 ? 1.021   -0.091  -6.532  1.00 0.00 ? 77 LEU A HD21 4  
ATOM 6072  H HD22 . LEU A 1 77 ? -0.007  -1.170  -5.588  1.00 0.00 ? 77 LEU A HD22 4  
ATOM 6073  H HD23 . LEU A 1 77 ? -0.732  -0.027  -6.724  1.00 0.00 ? 77 LEU A HD23 4  
ATOM 6074  N N    . GLN A 1 78 ? -0.184  -5.743  -7.296  1.00 0.00 ? 78 GLN A N    4  
ATOM 6075  C CA   . GLN A 1 78 ? 0.743   -6.807  -6.892  1.00 0.00 ? 78 GLN A CA   4  
ATOM 6076  C C    . GLN A 1 78 ? 1.008   -7.752  -8.077  1.00 0.00 ? 78 GLN A C    4  
ATOM 6077  O O    . GLN A 1 78 ? 2.139   -8.183  -8.281  1.00 0.00 ? 78 GLN A O    4  
ATOM 6078  C CB   . GLN A 1 78 ? 0.177   -7.574  -5.663  1.00 0.00 ? 78 GLN A CB   4  
ATOM 6079  C CG   . GLN A 1 78 ? 0.191   -6.771  -4.340  1.00 0.00 ? 78 GLN A CG   4  
ATOM 6080  C CD   . GLN A 1 78 ? -0.472  -7.490  -3.146  1.00 0.00 ? 78 GLN A CD   4  
ATOM 6081  O OE1  . GLN A 1 78 ? -0.048  -7.342  -2.001  1.00 0.00 ? 78 GLN A OE1  4  
ATOM 6082  N NE2  . GLN A 1 78 ? -1.534  -8.243  -3.391  1.00 0.00 ? 78 GLN A NE2  4  
ATOM 6083  H H    . GLN A 1 78 ? -1.060  -5.704  -6.862  1.00 0.00 ? 78 GLN A H    4  
ATOM 6084  H HA   . GLN A 1 78 ? 1.681   -6.331  -6.609  1.00 0.00 ? 78 GLN A HA   4  
ATOM 6085  H HB2  . GLN A 1 78 ? -0.850  -7.861  -5.881  1.00 0.00 ? 78 GLN A HB2  4  
ATOM 6086  H HB3  . GLN A 1 78 ? 0.760   -8.477  -5.516  1.00 0.00 ? 78 GLN A HB3  4  
ATOM 6087  H HG2  . GLN A 1 78 ? 1.218   -6.554  -4.079  1.00 0.00 ? 78 GLN A HG2  4  
ATOM 6088  H HG3  . GLN A 1 78 ? -0.333  -5.832  -4.498  1.00 0.00 ? 78 GLN A HG3  4  
ATOM 6089  H HE21 . GLN A 1 78 ? -1.857  -8.314  -4.313  1.00 0.00 ? 78 GLN A HE21 4  
ATOM 6090  H HE22 . GLN A 1 78 ? -1.961  -8.692  -2.636  1.00 0.00 ? 78 GLN A HE22 4  
ATOM 6091  N N    . GLN A 1 79 ? -0.039  -8.037  -8.880  1.00 0.00 ? 79 GLN A N    4  
ATOM 6092  C CA   . GLN A 1 79 ? 0.114   -8.848  -10.105 1.00 0.00 ? 79 GLN A CA   4  
ATOM 6093  C C    . GLN A 1 79 ? 0.939   -8.098  -11.183 1.00 0.00 ? 79 GLN A C    4  
ATOM 6094  O O    . GLN A 1 79 ? 1.744   -8.711  -11.887 1.00 0.00 ? 79 GLN A O    4  
ATOM 6095  C CB   . GLN A 1 79 ? -1.265  -9.289  -10.664 1.00 0.00 ? 79 GLN A CB   4  
ATOM 6096  C CG   . GLN A 1 79 ? -2.055  -10.259 -9.749  1.00 0.00 ? 79 GLN A CG   4  
ATOM 6097  C CD   . GLN A 1 79 ? -3.349  -10.808 -10.369 1.00 0.00 ? 79 GLN A CD   4  
ATOM 6098  O OE1  . GLN A 1 79 ? -4.304  -11.107 -9.664  1.00 0.00 ? 79 GLN A OE1  4  
ATOM 6099  N NE2  . GLN A 1 79 ? -3.391  -10.968 -11.684 1.00 0.00 ? 79 GLN A NE2  4  
ATOM 6100  H H    . GLN A 1 79 ? -0.933  -7.699  -8.636  1.00 0.00 ? 79 GLN A H    4  
ATOM 6101  H HA   . GLN A 1 79 ? 0.663   -9.742  -9.824  1.00 0.00 ? 79 GLN A HA   4  
ATOM 6102  H HB2  . GLN A 1 79 ? -1.875  -8.404  -10.830 1.00 0.00 ? 79 GLN A HB2  4  
ATOM 6103  H HB3  . GLN A 1 79 ? -1.110  -9.780  -11.619 1.00 0.00 ? 79 GLN A HB3  4  
ATOM 6104  H HG2  . GLN A 1 79 ? -1.420  -11.100 -9.508  1.00 0.00 ? 79 GLN A HG2  4  
ATOM 6105  H HG3  . GLN A 1 79 ? -2.309  -9.740  -8.832  1.00 0.00 ? 79 GLN A HG3  4  
ATOM 6106  H HE21 . GLN A 1 79 ? -2.599  -10.734 -12.216 1.00 0.00 ? 79 GLN A HE21 4  
ATOM 6107  H HE22 . GLN A 1 79 ? -4.216  -11.320 -12.073 1.00 0.00 ? 79 GLN A HE22 4  
ATOM 6108  N N    . GLU A 1 80 ? 0.758   -6.764  -11.282 1.00 0.00 ? 80 GLU A N    4  
ATOM 6109  C CA   . GLU A 1 80 ? 1.484   -5.920  -12.262 1.00 0.00 ? 80 GLU A CA   4  
ATOM 6110  C C    . GLU A 1 80 ? 2.988   -5.836  -11.927 1.00 0.00 ? 80 GLU A C    4  
ATOM 6111  O O    . GLU A 1 80 ? 3.837   -5.992  -12.808 1.00 0.00 ? 80 GLU A O    4  
ATOM 6112  C CB   . GLU A 1 80 ? 0.865   -4.498  -12.302 1.00 0.00 ? 80 GLU A CB   4  
ATOM 6113  C CG   . GLU A 1 80 ? -0.583  -4.452  -12.822 1.00 0.00 ? 80 GLU A CG   4  
ATOM 6114  C CD   . GLU A 1 80 ? -1.190  -3.051  -12.748 1.00 0.00 ? 80 GLU A CD   4  
ATOM 6115  O OE1  . GLU A 1 80 ? -0.864  -2.207  -13.614 1.00 0.00 ? 80 GLU A OE1  4  
ATOM 6116  O OE2  . GLU A 1 80 ? -1.961  -2.770  -11.810 1.00 0.00 ? 80 GLU A OE2  4  
ATOM 6117  H H    . GLU A 1 80 ? 0.113   -6.321  -10.688 1.00 0.00 ? 80 GLU A H    4  
ATOM 6118  H HA   . GLU A 1 80 ? 1.365   -6.378  -13.240 1.00 0.00 ? 80 GLU A HA   4  
ATOM 6119  H HB2  . GLU A 1 80 ? 0.882   -4.085  -11.294 1.00 0.00 ? 80 GLU A HB2  4  
ATOM 6120  H HB3  . GLU A 1 80 ? 1.475   -3.865  -12.942 1.00 0.00 ? 80 GLU A HB3  4  
ATOM 6121  H HG2  . GLU A 1 80 ? -0.599  -4.790  -13.854 1.00 0.00 ? 80 GLU A HG2  4  
ATOM 6122  H HG3  . GLU A 1 80 ? -1.190  -5.133  -12.227 1.00 0.00 ? 80 GLU A HG3  4  
ATOM 6123  N N    . LEU A 1 81 ? 3.295   -5.598  -10.636 1.00 0.00 ? 81 LEU A N    4  
ATOM 6124  C CA   . LEU A 1 81 ? 4.677   -5.431  -10.141 1.00 0.00 ? 81 LEU A CA   4  
ATOM 6125  C C    . LEU A 1 81 ? 5.375   -6.788  -9.882  1.00 0.00 ? 81 LEU A C    4  
ATOM 6126  O O    . LEU A 1 81 ? 6.523   -6.806  -9.419  1.00 0.00 ? 81 LEU A O    4  
ATOM 6127  C CB   . LEU A 1 81 ? 4.669   -4.567  -8.847  1.00 0.00 ? 81 LEU A CB   4  
ATOM 6128  C CG   . LEU A 1 81 ? 4.012   -3.147  -8.946  1.00 0.00 ? 81 LEU A CG   4  
ATOM 6129  C CD1  . LEU A 1 81 ? 4.057   -2.418  -7.580  1.00 0.00 ? 81 LEU A CD1  4  
ATOM 6130  C CD2  . LEU A 1 81 ? 4.656   -2.298  -10.069 1.00 0.00 ? 81 LEU A CD2  4  
ATOM 6131  H H    . LEU A 1 81 ? 2.568   -5.499  -9.994  1.00 0.00 ? 81 LEU A H    4  
ATOM 6132  H HA   . LEU A 1 81 ? 5.243   -4.903  -10.903 1.00 0.00 ? 81 LEU A HA   4  
ATOM 6133  H HB2  . LEU A 1 81 ? 4.144   -5.124  -8.073  1.00 0.00 ? 81 LEU A HB2  4  
ATOM 6134  H HB3  . LEU A 1 81 ? 5.696   -4.436  -8.521  1.00 0.00 ? 81 LEU A HB3  4  
ATOM 6135  H HG   . LEU A 1 81 ? 2.965   -3.272  -9.199  1.00 0.00 ? 81 LEU A HG   4  
ATOM 6136  H HD11 . LEU A 1 81 ? 3.541   -3.010  -6.835  1.00 0.00 ? 81 LEU A HD11 4  
ATOM 6137  H HD12 . LEU A 1 81 ? 3.567   -1.456  -7.662  1.00 0.00 ? 81 LEU A HD12 4  
ATOM 6138  H HD13 . LEU A 1 81 ? 5.086   -2.269  -7.269  1.00 0.00 ? 81 LEU A HD13 4  
ATOM 6139  H HD21 . LEU A 1 81 ? 5.716   -2.179  -9.882  1.00 0.00 ? 81 LEU A HD21 4  
ATOM 6140  H HD22 . LEU A 1 81 ? 4.188   -1.323  -10.109 1.00 0.00 ? 81 LEU A HD22 4  
ATOM 6141  H HD23 . LEU A 1 81 ? 4.515   -2.795  -11.021 1.00 0.00 ? 81 LEU A HD23 4  
ATOM 6142  N N    . GLY A 1 82 ? 4.672   -7.912  -10.177 1.00 0.00 ? 82 GLY A N    4  
ATOM 6143  C CA   . GLY A 1 82 ? 5.233   -9.264  -10.028 1.00 0.00 ? 82 GLY A CA   4  
ATOM 6144  C C    . GLY A 1 82 ? 5.358   -9.721  -8.572  1.00 0.00 ? 82 GLY A C    4  
ATOM 6145  O O    . GLY A 1 82 ? 6.039   -10.704 -8.293  1.00 0.00 ? 82 GLY A O    4  
ATOM 6146  H H    . GLY A 1 82 ? 3.753   -7.823  -10.505 1.00 0.00 ? 82 GLY A H    4  
ATOM 6147  H HA2  . GLY A 1 82 ? 4.588   -9.960  -10.551 1.00 0.00 ? 82 GLY A HA2  4  
ATOM 6148  H HA3  . GLY A 1 82 ? 6.212   -9.290  -10.495 1.00 0.00 ? 82 GLY A HA3  4  
ATOM 6149  N N    . ILE A 1 83 ? 4.679   -8.992  -7.668  1.00 0.00 ? 83 ILE A N    4  
ATOM 6150  C CA   . ILE A 1 83 ? 4.681   -9.224  -6.213  1.00 0.00 ? 83 ILE A CA   4  
ATOM 6151  C C    . ILE A 1 83 ? 3.663   -10.337 -5.863  1.00 0.00 ? 83 ILE A C    4  
ATOM 6152  O O    . ILE A 1 83 ? 2.451   -10.127 -5.996  1.00 0.00 ? 83 ILE A O    4  
ATOM 6153  C CB   . ILE A 1 83 ? 4.313   -7.878  -5.467  1.00 0.00 ? 83 ILE A CB   4  
ATOM 6154  C CG1  . ILE A 1 83 ? 5.386   -6.779  -5.749  1.00 0.00 ? 83 ILE A CG1  4  
ATOM 6155  C CG2  . ILE A 1 83 ? 4.113   -8.086  -3.946  1.00 0.00 ? 83 ILE A CG2  4  
ATOM 6156  C CD1  . ILE A 1 83 ? 5.066   -5.411  -5.165  1.00 0.00 ? 83 ILE A CD1  4  
ATOM 6157  H H    . ILE A 1 83 ? 4.115   -8.273  -8.009  1.00 0.00 ? 83 ILE A H    4  
ATOM 6158  H HA   . ILE A 1 83 ? 5.684   -9.526  -5.906  1.00 0.00 ? 83 ILE A HA   4  
ATOM 6159  H HB   . ILE A 1 83 ? 3.361   -7.533  -5.874  1.00 0.00 ? 83 ILE A HB   4  
ATOM 6160  H HG12 . ILE A 1 83 ? 6.333   -7.094  -5.336  1.00 0.00 ? 83 ILE A HG12 4  
ATOM 6161  H HG13 . ILE A 1 83 ? 5.497   -6.656  -6.822  1.00 0.00 ? 83 ILE A HG13 4  
ATOM 6162  H HG21 . ILE A 1 83 ? 3.318   -8.802  -3.772  1.00 0.00 ? 83 ILE A HG21 4  
ATOM 6163  H HG22 . ILE A 1 83 ? 3.849   -7.146  -3.480  1.00 0.00 ? 83 ILE A HG22 4  
ATOM 6164  H HG23 . ILE A 1 83 ? 5.029   -8.459  -3.506  1.00 0.00 ? 83 ILE A HG23 4  
ATOM 6165  H HD11 . ILE A 1 83 ? 4.113   -5.065  -5.546  1.00 0.00 ? 83 ILE A HD11 4  
ATOM 6166  H HD12 . ILE A 1 83 ? 5.838   -4.717  -5.453  1.00 0.00 ? 83 ILE A HD12 4  
ATOM 6167  H HD13 . ILE A 1 83 ? 5.022   -5.474  -4.087  1.00 0.00 ? 83 ILE A HD13 4  
ATOM 6168  N N    . GLU A 1 84 ? 4.151   -11.510 -5.419  1.00 0.00 ? 84 GLU A N    4  
ATOM 6169  C CA   . GLU A 1 84 ? 3.297   -12.688 -5.138  1.00 0.00 ? 84 GLU A CA   4  
ATOM 6170  C C    . GLU A 1 84 ? 3.967   -13.649 -4.132  1.00 0.00 ? 84 GLU A C    4  
ATOM 6171  O O    . GLU A 1 84 ? 5.168   -13.540 -3.857  1.00 0.00 ? 84 GLU A O    4  
ATOM 6172  C CB   . GLU A 1 84 ? 2.899   -13.406 -6.473  1.00 0.00 ? 84 GLU A CB   4  
ATOM 6173  C CG   . GLU A 1 84 ? 4.065   -13.881 -7.376  1.00 0.00 ? 84 GLU A CG   4  
ATOM 6174  C CD   . GLU A 1 84 ? 4.810   -15.127 -6.863  1.00 0.00 ? 84 GLU A CD   4  
ATOM 6175  O OE1  . GLU A 1 84 ? 4.178   -16.204 -6.760  1.00 0.00 ? 84 GLU A OE1  4  
ATOM 6176  O OE2  . GLU A 1 84 ? 6.019   -15.036 -6.566  1.00 0.00 ? 84 GLU A OE2  4  
ATOM 6177  H H    . GLU A 1 84 ? 5.114   -11.585 -5.253  1.00 0.00 ? 84 GLU A H    4  
ATOM 6178  H HA   . GLU A 1 84 ? 2.391   -12.322 -4.670  1.00 0.00 ? 84 GLU A HA   4  
ATOM 6179  H HB2  . GLU A 1 84 ? 2.293   -14.269 -6.234  1.00 0.00 ? 84 GLU A HB2  4  
ATOM 6180  H HB3  . GLU A 1 84 ? 2.284   -12.718 -7.057  1.00 0.00 ? 84 GLU A HB3  4  
ATOM 6181  H HG2  . GLU A 1 84 ? 3.670   -14.106 -8.361  1.00 0.00 ? 84 GLU A HG2  4  
ATOM 6182  H HG3  . GLU A 1 84 ? 4.768   -13.058 -7.473  1.00 0.00 ? 84 GLU A HG3  4  
ATOM 6183  N N    . GLY A 1 85 ? 3.175   -14.611 -3.624  1.00 0.00 ? 85 GLY A N    4  
ATOM 6184  C CA   . GLY A 1 85 ? 3.644   -15.600 -2.651  1.00 0.00 ? 85 GLY A CA   4  
ATOM 6185  C C    . GLY A 1 85 ? 3.967   -14.976 -1.291  1.00 0.00 ? 85 GLY A C    4  
ATOM 6186  O O    . GLY A 1 85 ? 3.128   -14.271 -0.723  1.00 0.00 ? 85 GLY A O    4  
ATOM 6187  H H    . GLY A 1 85 ? 2.242   -14.643 -3.908  1.00 0.00 ? 85 GLY A H    4  
ATOM 6188  H HA2  . GLY A 1 85 ? 2.861   -16.335 -2.515  1.00 0.00 ? 85 GLY A HA2  4  
ATOM 6189  H HA3  . GLY A 1 85 ? 4.526   -16.098 -3.042  1.00 0.00 ? 85 GLY A HA3  4  
ATOM 6190  N N    . GLU A 1 86 ? 5.189   -15.217 -0.785  1.00 0.00 ? 86 GLU A N    4  
ATOM 6191  C CA   . GLU A 1 86 ? 5.664   -14.635 0.495   1.00 0.00 ? 86 GLU A CA   4  
ATOM 6192  C C    . GLU A 1 86 ? 6.009   -13.137 0.314   1.00 0.00 ? 86 GLU A C    4  
ATOM 6193  O O    . GLU A 1 86 ? 6.169   -12.410 1.292   1.00 0.00 ? 86 GLU A O    4  
ATOM 6194  C CB   . GLU A 1 86 ? 6.891   -15.431 1.055   1.00 0.00 ? 86 GLU A CB   4  
ATOM 6195  C CG   . GLU A 1 86 ? 8.257   -15.209 0.343   1.00 0.00 ? 86 GLU A CG   4  
ATOM 6196  C CD   . GLU A 1 86 ? 8.289   -15.650 -1.132  1.00 0.00 ? 86 GLU A CD   4  
ATOM 6197  O OE1  . GLU A 1 86 ? 8.553   -16.843 -1.396  1.00 0.00 ? 86 GLU A OE1  4  
ATOM 6198  O OE2  . GLU A 1 86 ? 8.027   -14.813 -2.024  1.00 0.00 ? 86 GLU A OE2  4  
ATOM 6199  H H    . GLU A 1 86 ? 5.795   -15.800 -1.291  1.00 0.00 ? 86 GLU A H    4  
ATOM 6200  H HA   . GLU A 1 86 ? 4.849   -14.709 1.205   1.00 0.00 ? 86 GLU A HA   4  
ATOM 6201  H HB2  . GLU A 1 86 ? 7.018   -15.171 2.099   1.00 0.00 ? 86 GLU A HB2  4  
ATOM 6202  H HB3  . GLU A 1 86 ? 6.659   -16.489 1.000   1.00 0.00 ? 86 GLU A HB3  4  
ATOM 6203  H HG2  . GLU A 1 86 ? 8.509   -14.156 0.398   1.00 0.00 ? 86 GLU A HG2  4  
ATOM 6204  H HG3  . GLU A 1 86 ? 9.017   -15.766 0.882   1.00 0.00 ? 86 GLU A HG3  4  
ATOM 6205  N N    . ASN A 1 87 ? 6.119   -12.698 -0.963  1.00 0.00 ? 87 ASN A N    4  
ATOM 6206  C CA   . ASN A 1 87 ? 6.439   -11.307 -1.328  1.00 0.00 ? 87 ASN A CA   4  
ATOM 6207  C C    . ASN A 1 87 ? 5.196   -10.389 -1.230  1.00 0.00 ? 87 ASN A C    4  
ATOM 6208  O O    . ASN A 1 87 ? 5.352   -9.163  -1.187  1.00 0.00 ? 87 ASN A O    4  
ATOM 6209  C CB   . ASN A 1 87 ? 7.032   -11.270 -2.761  1.00 0.00 ? 87 ASN A CB   4  
ATOM 6210  C CG   . ASN A 1 87 ? 7.573   -9.906  -3.218  1.00 0.00 ? 87 ASN A CG   4  
ATOM 6211  O OD1  . ASN A 1 87 ? 7.458   -9.547  -4.393  1.00 0.00 ? 87 ASN A OD1  4  
ATOM 6212  N ND2  . ASN A 1 87 ? 8.205   -9.154  -2.322  1.00 0.00 ? 87 ASN A ND2  4  
ATOM 6213  H H    . ASN A 1 87 ? 6.001   -13.352 -1.693  1.00 0.00 ? 87 ASN A H    4  
ATOM 6214  H HA   . ASN A 1 87 ? 7.191   -10.944 -0.631  1.00 0.00 ? 87 ASN A HA   4  
ATOM 6215  H HB2  . ASN A 1 87 ? 7.854   -11.972 -2.812  1.00 0.00 ? 87 ASN A HB2  4  
ATOM 6216  H HB3  . ASN A 1 87 ? 6.268   -11.588 -3.466  1.00 0.00 ? 87 ASN A HB3  4  
ATOM 6217  H HD21 . ASN A 1 87 ? 8.304   -9.494  -1.411  1.00 0.00 ? 87 ASN A HD21 4  
ATOM 6218  H HD22 . ASN A 1 87 ? 8.548   -8.281  -2.615  1.00 0.00 ? 87 ASN A HD22 4  
ATOM 6219  N N    . ARG A 1 88 ? 3.981   -10.995 -1.173  1.00 0.00 ? 88 ARG A N    4  
ATOM 6220  C CA   . ARG A 1 88 ? 2.687   -10.263 -1.080  1.00 0.00 ? 88 ARG A CA   4  
ATOM 6221  C C    . ARG A 1 88 ? 2.717   -9.235  0.060   1.00 0.00 ? 88 ARG A C    4  
ATOM 6222  O O    . ARG A 1 88 ? 3.074   -9.584  1.190   1.00 0.00 ? 88 ARG A O    4  
ATOM 6223  C CB   . ARG A 1 88 ? 1.515   -11.252 -0.845  1.00 0.00 ? 88 ARG A CB   4  
ATOM 6224  C CG   . ARG A 1 88 ? 1.115   -12.098 -2.067  1.00 0.00 ? 88 ARG A CG   4  
ATOM 6225  C CD   . ARG A 1 88 ? 0.481   -11.272 -3.206  1.00 0.00 ? 88 ARG A CD   4  
ATOM 6226  N NE   . ARG A 1 88 ? -0.128  -12.131 -4.246  1.00 0.00 ? 88 ARG A NE   4  
ATOM 6227  C CZ   . ARG A 1 88 ? -1.283  -12.797 -4.107  1.00 0.00 ? 88 ARG A CZ   4  
ATOM 6228  N NH1  . ARG A 1 88 ? -1.991  -12.729 -2.992  1.00 0.00 ? 88 ARG A NH1  4  
ATOM 6229  N NH2  . ARG A 1 88 ? -1.738  -13.535 -5.103  1.00 0.00 ? 88 ARG A NH2  4  
ATOM 6230  H H    . ARG A 1 88 ? 3.954   -11.977 -1.174  1.00 0.00 ? 88 ARG A H    4  
ATOM 6231  H HA   . ARG A 1 88 ? 2.534   -9.748  -2.020  1.00 0.00 ? 88 ARG A HA   4  
ATOM 6232  H HB2  . ARG A 1 88 ? 1.798   -11.932 -0.045  1.00 0.00 ? 88 ARG A HB2  4  
ATOM 6233  H HB3  . ARG A 1 88 ? 0.635   -10.697 -0.519  1.00 0.00 ? 88 ARG A HB3  4  
ATOM 6234  H HG2  . ARG A 1 88 ? 1.997   -12.602 -2.449  1.00 0.00 ? 88 ARG A HG2  4  
ATOM 6235  H HG3  . ARG A 1 88 ? 0.401   -12.851 -1.745  1.00 0.00 ? 88 ARG A HG3  4  
ATOM 6236  H HD2  . ARG A 1 88 ? -0.284  -10.616 -2.801  1.00 0.00 ? 88 ARG A HD2  4  
ATOM 6237  H HD3  . ARG A 1 88 ? 1.251   -10.670 -3.673  1.00 0.00 ? 88 ARG A HD3  4  
ATOM 6238  H HE   . ARG A 1 88 ? 0.347   -12.195 -5.106  1.00 0.00 ? 88 ARG A HE   4  
ATOM 6239  H HH11 . ARG A 1 88 ? -1.670  -12.176 -2.219  1.00 0.00 ? 88 ARG A HH11 4  
ATOM 6240  H HH12 . ARG A 1 88 ? -2.848  -13.244 -2.910  1.00 0.00 ? 88 ARG A HH12 4  
ATOM 6241  H HH21 . ARG A 1 88 ? -1.233  -13.589 -5.966  1.00 0.00 ? 88 ARG A HH21 4  
ATOM 6242  H HH22 . ARG A 1 88 ? -2.608  -14.029 -5.003  1.00 0.00 ? 88 ARG A HH22 4  
ATOM 6243  N N    . VAL A 1 89 ? 2.322   -7.992  -0.263  1.00 0.00 ? 89 VAL A N    4  
ATOM 6244  C CA   . VAL A 1 89 ? 2.411   -6.842  0.654   1.00 0.00 ? 89 VAL A CA   4  
ATOM 6245  C C    . VAL A 1 89 ? 1.516   -7.083  1.887   1.00 0.00 ? 89 VAL A C    4  
ATOM 6246  O O    . VAL A 1 89 ? 0.292   -7.158  1.736   1.00 0.00 ? 89 VAL A O    4  
ATOM 6247  C CB   . VAL A 1 89 ? 1.993   -5.502  -0.063  1.00 0.00 ? 89 VAL A CB   4  
ATOM 6248  C CG1  . VAL A 1 89 ? 2.142   -4.272  0.878   1.00 0.00 ? 89 VAL A CG1  4  
ATOM 6249  C CG2  . VAL A 1 89 ? 2.805   -5.318  -1.361  1.00 0.00 ? 89 VAL A CG2  4  
ATOM 6250  H H    . VAL A 1 89 ? 1.925   -7.845  -1.151  1.00 0.00 ? 89 VAL A H    4  
ATOM 6251  H HA   . VAL A 1 89 ? 3.449   -6.745  0.966   1.00 0.00 ? 89 VAL A HA   4  
ATOM 6252  H HB   . VAL A 1 89 ? 0.943   -5.579  -0.342  1.00 0.00 ? 89 VAL A HB   4  
ATOM 6253  H HG11 . VAL A 1 89 ? 1.519   -4.406  1.755   1.00 0.00 ? 89 VAL A HG11 4  
ATOM 6254  H HG12 . VAL A 1 89 ? 1.836   -3.370  0.363   1.00 0.00 ? 89 VAL A HG12 4  
ATOM 6255  H HG13 . VAL A 1 89 ? 3.175   -4.170  1.190   1.00 0.00 ? 89 VAL A HG13 4  
ATOM 6256  H HG21 . VAL A 1 89 ? 3.858   -5.223  -1.120  1.00 0.00 ? 89 VAL A HG21 4  
ATOM 6257  H HG22 . VAL A 1 89 ? 2.478   -4.421  -1.878  1.00 0.00 ? 89 VAL A HG22 4  
ATOM 6258  H HG23 . VAL A 1 89 ? 2.663   -6.172  -2.010  1.00 0.00 ? 89 VAL A HG23 4  
ATOM 6259  N N    . PRO A 1 90 ? 2.109   -7.250  3.115   1.00 0.00 ? 90 PRO A N    4  
ATOM 6260  C CA   . PRO A 1 90 ? 1.329   -7.549  4.337   1.00 0.00 ? 90 PRO A CA   4  
ATOM 6261  C C    . PRO A 1 90 ? 0.465   -6.335  4.759   1.00 0.00 ? 90 PRO A C    4  
ATOM 6262  O O    . PRO A 1 90 ? 0.981   -5.264  5.074   1.00 0.00 ? 90 PRO A O    4  
ATOM 6263  C CB   . PRO A 1 90 ? 2.419   -7.906  5.386   1.00 0.00 ? 90 PRO A CB   4  
ATOM 6264  C CG   . PRO A 1 90 ? 3.655   -7.198  4.918   1.00 0.00 ? 90 PRO A CG   4  
ATOM 6265  C CD   . PRO A 1 90 ? 3.573   -7.152  3.408   1.00 0.00 ? 90 PRO A CD   4  
ATOM 6266  H HA   . PRO A 1 90 ? 0.679   -8.411  4.182   1.00 0.00 ? 90 PRO A HA   4  
ATOM 6267  H HB2  . PRO A 1 90 ? 2.123   -7.569  6.380   1.00 0.00 ? 90 PRO A HB2  4  
ATOM 6268  H HB3  . PRO A 1 90 ? 2.590   -8.979  5.406   1.00 0.00 ? 90 PRO A HB3  4  
ATOM 6269  H HG2  . PRO A 1 90 ? 3.681   -6.193  5.331   1.00 0.00 ? 90 PRO A HG2  4  
ATOM 6270  H HG3  . PRO A 1 90 ? 4.546   -7.738  5.229   1.00 0.00 ? 90 PRO A HG3  4  
ATOM 6271  H HD2  . PRO A 1 90 ? 3.979   -6.219  3.029   1.00 0.00 ? 90 PRO A HD2  4  
ATOM 6272  H HD3  . PRO A 1 90 ? 4.104   -7.992  2.969   1.00 0.00 ? 90 PRO A HD3  4  
ATOM 6273  N N    . VAL A 1 91 ? -0.859  -6.515  4.712   1.00 0.00 ? 91 VAL A N    4  
ATOM 6274  C CA   . VAL A 1 91 ? -1.831  -5.462  5.032   1.00 0.00 ? 91 VAL A CA   4  
ATOM 6275  C C    . VAL A 1 91 ? -2.497  -5.786  6.367   1.00 0.00 ? 91 VAL A C    4  
ATOM 6276  O O    . VAL A 1 91 ? -3.122  -6.843  6.520   1.00 0.00 ? 91 VAL A O    4  
ATOM 6277  C CB   . VAL A 1 91 ? -2.901  -5.297  3.901   1.00 0.00 ? 91 VAL A CB   4  
ATOM 6278  C CG1  . VAL A 1 91 ? -3.941  -4.203  4.254   1.00 0.00 ? 91 VAL A CG1  4  
ATOM 6279  C CG2  . VAL A 1 91 ? -2.212  -4.992  2.557   1.00 0.00 ? 91 VAL A CG2  4  
ATOM 6280  H H    . VAL A 1 91 ? -1.186  -7.409  4.481   1.00 0.00 ? 91 VAL A H    4  
ATOM 6281  H HA   . VAL A 1 91 ? -1.292  -4.515  5.125   1.00 0.00 ? 91 VAL A HA   4  
ATOM 6282  H HB   . VAL A 1 91 ? -3.433  -6.241  3.796   1.00 0.00 ? 91 VAL A HB   4  
ATOM 6283  H HG11 . VAL A 1 91 ? -3.443  -3.249  4.382   1.00 0.00 ? 91 VAL A HG11 4  
ATOM 6284  H HG12 . VAL A 1 91 ? -4.449  -4.463  5.177   1.00 0.00 ? 91 VAL A HG12 4  
ATOM 6285  H HG13 . VAL A 1 91 ? -4.672  -4.123  3.462   1.00 0.00 ? 91 VAL A HG13 4  
ATOM 6286  H HG21 . VAL A 1 91 ? -1.673  -4.054  2.622   1.00 0.00 ? 91 VAL A HG21 4  
ATOM 6287  H HG22 . VAL A 1 91 ? -2.956  -4.923  1.775   1.00 0.00 ? 91 VAL A HG22 4  
ATOM 6288  H HG23 . VAL A 1 91 ? -1.516  -5.786  2.315   1.00 0.00 ? 91 VAL A HG23 4  
ATOM 6289  N N    . VAL A 1 92 ? -2.357  -4.865  7.325   1.00 0.00 ? 92 VAL A N    4  
ATOM 6290  C CA   . VAL A 1 92 ? -2.820  -5.033  8.702   1.00 0.00 ? 92 VAL A CA   4  
ATOM 6291  C C    . VAL A 1 92 ? -3.897  -3.977  8.959   1.00 0.00 ? 92 VAL A C    4  
ATOM 6292  O O    . VAL A 1 92 ? -3.627  -2.785  8.817   1.00 0.00 ? 92 VAL A O    4  
ATOM 6293  C CB   . VAL A 1 92 ? -1.634  -4.848  9.736   1.00 0.00 ? 92 VAL A CB   4  
ATOM 6294  C CG1  . VAL A 1 92 ? -2.026  -5.369  11.140  1.00 0.00 ? 92 VAL A CG1  4  
ATOM 6295  C CG2  . VAL A 1 92 ? -0.334  -5.514  9.227   1.00 0.00 ? 92 VAL A CG2  4  
ATOM 6296  H H    . VAL A 1 92 ? -1.956  -4.005  7.088   1.00 0.00 ? 92 VAL A H    4  
ATOM 6297  H HA   . VAL A 1 92 ? -3.245  -6.033  8.821   1.00 0.00 ? 92 VAL A HA   4  
ATOM 6298  H HB   . VAL A 1 92 ? -1.431  -3.780  9.832   1.00 0.00 ? 92 VAL A HB   4  
ATOM 6299  H HG11 . VAL A 1 92 ? -1.203  -5.223  11.828  1.00 0.00 ? 92 VAL A HG11 4  
ATOM 6300  H HG12 . VAL A 1 92 ? -2.263  -6.425  11.086  1.00 0.00 ? 92 VAL A HG12 4  
ATOM 6301  H HG13 . VAL A 1 92 ? -2.893  -4.828  11.503  1.00 0.00 ? 92 VAL A HG13 4  
ATOM 6302  H HG21 . VAL A 1 92 ? -0.056  -5.079  8.272   1.00 0.00 ? 92 VAL A HG21 4  
ATOM 6303  H HG22 . VAL A 1 92 ? -0.491  -6.577  9.104   1.00 0.00 ? 92 VAL A HG22 4  
ATOM 6304  H HG23 . VAL A 1 92 ? 0.469   -5.351  9.936   1.00 0.00 ? 92 VAL A HG23 4  
ATOM 6305  N N    . TYR A 1 93 ? -5.116  -4.404  9.287   1.00 0.00 ? 93 TYR A N    4  
ATOM 6306  C CA   . TYR A 1 93 ? -6.223  -3.494  9.615   1.00 0.00 ? 93 TYR A CA   4  
ATOM 6307  C C    . TYR A 1 93 ? -6.220  -3.214  11.120  1.00 0.00 ? 93 TYR A C    4  
ATOM 6308  O O    . TYR A 1 93 ? -6.446  -4.127  11.922  1.00 0.00 ? 93 TYR A O    4  
ATOM 6309  C CB   . TYR A 1 93 ? -7.564  -4.118  9.170   1.00 0.00 ? 93 TYR A CB   4  
ATOM 6310  C CG   . TYR A 1 93 ? -7.733  -4.178  7.649   1.00 0.00 ? 93 TYR A CG   4  
ATOM 6311  C CD1  . TYR A 1 93 ? -7.240  -5.250  6.894   1.00 0.00 ? 93 TYR A CD1  4  
ATOM 6312  C CD2  . TYR A 1 93 ? -8.372  -3.144  6.966   1.00 0.00 ? 93 TYR A CD2  4  
ATOM 6313  C CE1  . TYR A 1 93 ? -7.382  -5.280  5.517   1.00 0.00 ? 93 TYR A CE1  4  
ATOM 6314  C CE2  . TYR A 1 93 ? -8.516  -3.178  5.598   1.00 0.00 ? 93 TYR A CE2  4  
ATOM 6315  C CZ   . TYR A 1 93 ? -8.021  -4.244  4.877   1.00 0.00 ? 93 TYR A CZ   4  
ATOM 6316  O OH   . TYR A 1 93 ? -8.158  -4.263  3.504   1.00 0.00 ? 93 TYR A OH   4  
ATOM 6317  H H    . TYR A 1 93 ? -5.286  -5.367  9.317   1.00 0.00 ? 93 TYR A H    4  
ATOM 6318  H HA   . TYR A 1 93 ? -6.072  -2.557  9.076   1.00 0.00 ? 93 TYR A HA   4  
ATOM 6319  H HB2  . TYR A 1 93 ? -7.637  -5.130  9.557   1.00 0.00 ? 93 TYR A HB2  4  
ATOM 6320  H HB3  . TYR A 1 93 ? -8.385  -3.535  9.577   1.00 0.00 ? 93 TYR A HB3  4  
ATOM 6321  H HD1  . TYR A 1 93 ? -6.741  -6.067  7.403   1.00 0.00 ? 93 TYR A HD1  4  
ATOM 6322  H HD2  . TYR A 1 93 ? -8.768  -2.303  7.526   1.00 0.00 ? 93 TYR A HD2  4  
ATOM 6323  H HE1  . TYR A 1 93 ? -6.992  -6.116  4.949   1.00 0.00 ? 93 TYR A HE1  4  
ATOM 6324  H HE2  . TYR A 1 93 ? -9.016  -2.361  5.095   1.00 0.00 ? 93 TYR A HE2  4  
ATOM 6325  H HH   . TYR A 1 93 ? -8.595  -5.079  3.236   1.00 0.00 ? 93 TYR A HH   4  
ATOM 6326  N N    . ILE A 1 94 ? -5.943  -1.960  11.497  1.00 0.00 ? 94 ILE A N    4  
ATOM 6327  C CA   . ILE A 1 94 ? -5.969  -1.502  12.897  1.00 0.00 ? 94 ILE A CA   4  
ATOM 6328  C C    . ILE A 1 94 ? -7.070  -0.446  12.992  1.00 0.00 ? 94 ILE A C    4  
ATOM 6329  O O    . ILE A 1 94 ? -7.084  0.475   12.190  1.00 0.00 ? 94 ILE A O    4  
ATOM 6330  C CB   . ILE A 1 94 ? -4.597  -0.869  13.389  1.00 0.00 ? 94 ILE A CB   4  
ATOM 6331  C CG1  . ILE A 1 94 ? -3.377  -1.827  13.154  1.00 0.00 ? 94 ILE A CG1  4  
ATOM 6332  C CG2  . ILE A 1 94 ? -4.687  -0.467  14.883  1.00 0.00 ? 94 ILE A CG2  4  
ATOM 6333  C CD1  . ILE A 1 94 ? -2.797  -1.782  11.756  1.00 0.00 ? 94 ILE A CD1  4  
ATOM 6334  H H    . ILE A 1 94 ? -5.760  -1.287  10.806  1.00 0.00 ? 94 ILE A H    4  
ATOM 6335  H HA   . ILE A 1 94 ? -6.220  -2.346  13.550  1.00 0.00 ? 94 ILE A HA   4  
ATOM 6336  H HB   . ILE A 1 94 ? -4.431  0.046   12.819  1.00 0.00 ? 94 ILE A HB   4  
ATOM 6337  H HG12 . ILE A 1 94 ? -2.575  -1.569  13.829  1.00 0.00 ? 94 ILE A HG12 4  
ATOM 6338  H HG13 . ILE A 1 94 ? -3.680  -2.847  13.347  1.00 0.00 ? 94 ILE A HG13 4  
ATOM 6339  H HG21 . ILE A 1 94 ? -4.885  -1.344  15.488  1.00 0.00 ? 94 ILE A HG21 4  
ATOM 6340  H HG22 . ILE A 1 94 ? -5.491  0.248   15.023  1.00 0.00 ? 94 ILE A HG22 4  
ATOM 6341  H HG23 . ILE A 1 94 ? -3.757  -0.020  15.200  1.00 0.00 ? 94 ILE A HG23 4  
ATOM 6342  H HD11 . ILE A 1 94 ? -1.964  -2.466  11.684  1.00 0.00 ? 94 ILE A HD11 4  
ATOM 6343  H HD12 . ILE A 1 94 ? -2.459  -0.779  11.531  1.00 0.00 ? 94 ILE A HD12 4  
ATOM 6344  H HD13 . ILE A 1 94 ? -3.557  -2.073  11.042  1.00 0.00 ? 94 ILE A HD13 4  
ATOM 6345  N N    . ALA A 1 95 ? -8.004  -0.586  13.948  1.00 0.00 ? 95 ALA A N    4  
ATOM 6346  C CA   . ALA A 1 95 ? -9.121  0.355   14.114  1.00 0.00 ? 95 ALA A CA   4  
ATOM 6347  C C    . ALA A 1 95 ? -9.357  0.615   15.605  1.00 0.00 ? 95 ALA A C    4  
ATOM 6348  O O    . ALA A 1 95 ? -9.845  -0.264  16.323  1.00 0.00 ? 95 ALA A O    4  
ATOM 6349  C CB   . ALA A 1 95 ? -10.384 -0.186  13.424  1.00 0.00 ? 95 ALA A CB   4  
ATOM 6350  H H    . ALA A 1 95 ? -7.935  -1.340  14.569  1.00 0.00 ? 95 ALA A H    4  
ATOM 6351  H HA   . ALA A 1 95 ? -8.857  1.301   13.633  1.00 0.00 ? 95 ALA A HA   4  
ATOM 6352  H HB1  . ALA A 1 95 ? -11.190 0.532   13.520  1.00 0.00 ? 95 ALA A HB1  4  
ATOM 6353  H HB2  . ALA A 1 95 ? -10.679 -1.123  13.880  1.00 0.00 ? 95 ALA A HB2  4  
ATOM 6354  H HB3  . ALA A 1 95 ? -10.184 -0.351  12.372  1.00 0.00 ? 95 ALA A HB3  4  
ATOM 6355  N N    . GLU A 1 96 ? -8.970  1.816   16.046  1.00 0.00 ? 96 GLU A N    4  
ATOM 6356  C CA   . GLU A 1 96 ? -9.192  2.301   17.424  1.00 0.00 ? 96 GLU A CA   4  
ATOM 6357  C C    . GLU A 1 96 ? -10.701 2.430   17.685  1.00 0.00 ? 96 GLU A C    4  
ATOM 6358  O O    . GLU A 1 96 ? -11.193 2.092   18.768  1.00 0.00 ? 96 GLU A O    4  
ATOM 6359  C CB   . GLU A 1 96 ? -8.505  3.682   17.644  1.00 0.00 ? 96 GLU A CB   4  
ATOM 6360  C CG   . GLU A 1 96 ? -6.960  3.684   17.538  1.00 0.00 ? 96 GLU A CG   4  
ATOM 6361  C CD   . GLU A 1 96 ? -6.407  3.385   16.128  1.00 0.00 ? 96 GLU A CD   4  
ATOM 6362  O OE1  . GLU A 1 96 ? -6.818  4.061   15.159  1.00 0.00 ? 96 GLU A OE1  4  
ATOM 6363  O OE2  . GLU A 1 96 ? -5.556  2.489   15.980  1.00 0.00 ? 96 GLU A OE2  4  
ATOM 6364  H H    . GLU A 1 96 ? -8.514  2.412   15.411  1.00 0.00 ? 96 GLU A H    4  
ATOM 6365  H HA   . GLU A 1 96 ? -8.771  1.575   18.110  1.00 0.00 ? 96 GLU A HA   4  
ATOM 6366  H HB2  . GLU A 1 96 ? -8.894  4.387   16.912  1.00 0.00 ? 96 GLU A HB2  4  
ATOM 6367  H HB3  . GLU A 1 96 ? -8.770  4.044   18.634  1.00 0.00 ? 96 GLU A HB3  4  
ATOM 6368  H HG2  . GLU A 1 96 ? -6.589  4.658   17.843  1.00 0.00 ? 96 GLU A HG2  4  
ATOM 6369  H HG3  . GLU A 1 96 ? -6.581  2.939   18.228  1.00 0.00 ? 96 GLU A HG3  4  
ATOM 6370  N N    . SER A 1 97 ? -11.397 2.924   16.650  1.00 0.00 ? 97 SER A N    4  
ATOM 6371  C CA   . SER A 1 97 ? -12.855 3.072   16.613  1.00 0.00 ? 97 SER A CA   4  
ATOM 6372  C C    . SER A 1 97 ? -13.295 3.417   15.178  1.00 0.00 ? 97 SER A C    4  
ATOM 6373  O O    . SER A 1 97 ? -12.481 3.838   14.351  1.00 0.00 ? 97 SER A O    4  
ATOM 6374  C CB   . SER A 1 97 ? -13.323 4.171   17.602  1.00 0.00 ? 97 SER A CB   4  
ATOM 6375  O OG   . SER A 1 97 ? -14.738 4.307   17.613  1.00 0.00 ? 97 SER A OG   4  
ATOM 6376  H H    . SER A 1 97 ? -10.890 3.198   15.850  1.00 0.00 ? 97 SER A H    4  
ATOM 6377  H HA   . SER A 1 97 ? -13.293 2.121   16.896  1.00 0.00 ? 97 SER A HA   4  
ATOM 6378  H HB2  . SER A 1 97 ? -13.002 3.912   18.604  1.00 0.00 ? 97 SER A HB2  4  
ATOM 6379  H HB3  . SER A 1 97 ? -12.884 5.122   17.330  1.00 0.00 ? 97 SER A HB3  4  
ATOM 6380  H HG   . SER A 1 97 ? -14.993 4.895   18.337  1.00 0.00 ? 97 SER A HG   4  
ATOM 6381  N N    . ASP A 1 98 ? -14.589 3.234   14.896  1.00 0.00 ? 98 ASP A N    4  
ATOM 6382  C CA   . ASP A 1 98 ? -15.219 3.665   13.631  1.00 0.00 ? 98 ASP A CA   4  
ATOM 6383  C C    . ASP A 1 98 ? -15.635 5.151   13.744  1.00 0.00 ? 98 ASP A C    4  
ATOM 6384  O O    . ASP A 1 98 ? -15.863 5.826   12.736  1.00 0.00 ? 98 ASP A O    4  
ATOM 6385  C CB   . ASP A 1 98 ? -16.441 2.763   13.294  1.00 0.00 ? 98 ASP A CB   4  
ATOM 6386  C CG   . ASP A 1 98 ? -17.583 2.896   14.316  1.00 0.00 ? 98 ASP A CG   4  
ATOM 6387  O OD1  . ASP A 1 98 ? -17.440 2.390   15.450  1.00 0.00 ? 98 ASP A OD1  4  
ATOM 6388  O OD2  . ASP A 1 98 ? -18.615 3.533   14.007  1.00 0.00 ? 98 ASP A OD2  4  
ATOM 6389  H H    . ASP A 1 98 ? -15.150 2.802   15.573  1.00 0.00 ? 98 ASP A H    4  
ATOM 6390  H HA   . ASP A 1 98 ? -14.479 3.577   12.834  1.00 0.00 ? 98 ASP A HA   4  
ATOM 6391  H HB2  . ASP A 1 98 ? -16.813 3.028   12.307  1.00 0.00 ? 98 ASP A HB2  4  
ATOM 6392  H HB3  . ASP A 1 98 ? -16.120 1.723   13.266  1.00 0.00 ? 98 ASP A HB3  4  
ATOM 6393  N N    . GLY A 1 99 ? -15.723 5.646   14.989  1.00 0.00 ? 99 GLY A N    4  
ATOM 6394  C CA   . GLY A 1 99 ? -16.048 7.038   15.261  1.00 0.00 ? 99 GLY A CA   4  
ATOM 6395  C C    . GLY A 1 99 ? -16.124 7.266   16.766  1.00 0.00 ? 99 GLY A C    4  
ATOM 6396  O O    . GLY A 1 99 ? -15.085 7.563   17.388  1.00 0.00 ? 99 GLY A O    4  
ATOM 6397  O OXT  . GLY A 1 99 ? -17.216 7.116   17.343  1.00 0.00 ? 99 GLY A OXT  4  
ATOM 6398  H H    . GLY A 1 99 ? -15.567 5.044   15.750  1.00 0.00 ? 99 GLY A H    4  
ATOM 6399  H HA2  . GLY A 1 99 ? -15.281 7.672   14.827  1.00 0.00 ? 99 GLY A HA2  4  
ATOM 6400  H HA3  . GLY A 1 99 ? -17.003 7.282   14.806  1.00 0.00 ? 99 GLY A HA3  4  
ATOM 6401  N N    . MET A 1 1  ? 21.364  -1.047  18.260  1.00 0.00 ? 1  MET A N    5  
ATOM 6402  C CA   . MET A 1 1  ? 20.513  0.050   18.768  1.00 0.00 ? 1  MET A CA   5  
ATOM 6403  C C    . MET A 1 1  ? 19.078  -0.463  19.003  1.00 0.00 ? 1  MET A C    5  
ATOM 6404  O O    . MET A 1 1  ? 18.468  -1.060  18.108  1.00 0.00 ? 1  MET A O    5  
ATOM 6405  C CB   . MET A 1 1  ? 20.556  1.282   17.801  1.00 0.00 ? 1  MET A CB   5  
ATOM 6406  C CG   . MET A 1 1  ? 20.336  0.984   16.298  1.00 0.00 ? 1  MET A CG   5  
ATOM 6407  S SD   . MET A 1 1  ? 18.616  0.627   15.858  1.00 0.00 ? 1  MET A SD   5  
ATOM 6408  C CE   . MET A 1 1  ? 18.765  0.233   14.111  1.00 0.00 ? 1  MET A CE   5  
ATOM 6409  H H1   . MET A 1 1  ? 22.338  -0.711  18.100  1.00 0.00 ? 1  MET A H1   5  
ATOM 6410  H H2   . MET A 1 1  ? 20.980  -1.401  17.362  1.00 0.00 ? 1  MET A H2   5  
ATOM 6411  H H3   . MET A 1 1  ? 21.381  -1.830  18.945  1.00 0.00 ? 1  MET A H3   5  
ATOM 6412  H HA   . MET A 1 1  ? 20.930  0.347   19.727  1.00 0.00 ? 1  MET A HA   5  
ATOM 6413  H HB2  . MET A 1 1  ? 19.794  1.989   18.109  1.00 0.00 ? 1  MET A HB2  5  
ATOM 6414  H HB3  . MET A 1 1  ? 21.523  1.767   17.909  1.00 0.00 ? 1  MET A HB3  5  
ATOM 6415  H HG2  . MET A 1 1  ? 20.655  1.844   15.721  1.00 0.00 ? 1  MET A HG2  5  
ATOM 6416  H HG3  . MET A 1 1  ? 20.946  0.132   16.018  1.00 0.00 ? 1  MET A HG3  5  
ATOM 6417  H HE1  . MET A 1 1  ? 17.785  0.025   13.707  1.00 0.00 ? 1  MET A HE1  5  
ATOM 6418  H HE2  . MET A 1 1  ? 19.395  -0.638  13.986  1.00 0.00 ? 1  MET A HE2  5  
ATOM 6419  H HE3  . MET A 1 1  ? 19.198  1.070   13.584  1.00 0.00 ? 1  MET A HE3  5  
ATOM 6420  N N    . GLY A 1 2  ? 18.571  -0.269  20.236  1.00 0.00 ? 2  GLY A N    5  
ATOM 6421  C CA   . GLY A 1 2  ? 17.192  -0.603  20.599  1.00 0.00 ? 2  GLY A CA   5  
ATOM 6422  C C    . GLY A 1 2  ? 16.315  0.623   20.495  1.00 0.00 ? 2  GLY A C    5  
ATOM 6423  O O    . GLY A 1 2  ? 16.533  1.581   21.248  1.00 0.00 ? 2  GLY A O    5  
ATOM 6424  H H    . GLY A 1 2  ? 19.151  0.125   20.919  1.00 0.00 ? 2  GLY A H    5  
ATOM 6425  H HA2  . GLY A 1 2  ? 16.809  -1.393  19.961  1.00 0.00 ? 2  GLY A HA2  5  
ATOM 6426  H HA3  . GLY A 1 2  ? 17.181  -0.951  21.626  1.00 0.00 ? 2  GLY A HA3  5  
ATOM 6427  N N    . HIS A 1 3  ? 15.342  0.598   19.552  1.00 0.00 ? 3  HIS A N    5  
ATOM 6428  C CA   . HIS A 1 3  ? 14.472  1.750   19.225  1.00 0.00 ? 3  HIS A CA   5  
ATOM 6429  C C    . HIS A 1 3  ? 13.616  2.175   20.435  1.00 0.00 ? 3  HIS A C    5  
ATOM 6430  O O    . HIS A 1 3  ? 12.512  1.675   20.658  1.00 0.00 ? 3  HIS A O    5  
ATOM 6431  C CB   . HIS A 1 3  ? 13.577  1.446   17.995  1.00 0.00 ? 3  HIS A CB   5  
ATOM 6432  C CG   . HIS A 1 3  ? 14.350  1.149   16.739  1.00 0.00 ? 3  HIS A CG   5  
ATOM 6433  N ND1  . HIS A 1 3  ? 14.464  -0.117  16.208  1.00 0.00 ? 3  HIS A ND1  5  
ATOM 6434  C CD2  . HIS A 1 3  ? 15.039  1.962   15.906  1.00 0.00 ? 3  HIS A CD2  5  
ATOM 6435  C CE1  . HIS A 1 3  ? 15.182  -0.068  15.111  1.00 0.00 ? 3  HIS A CE1  5  
ATOM 6436  N NE2  . HIS A 1 3  ? 15.544  1.180   14.906  1.00 0.00 ? 3  HIS A NE2  5  
ATOM 6437  H H    . HIS A 1 3  ? 15.203  -0.236  19.060  1.00 0.00 ? 3  HIS A H    5  
ATOM 6438  H HA   . HIS A 1 3  ? 15.129  2.577   18.964  1.00 0.00 ? 3  HIS A HA   5  
ATOM 6439  H HB2  . HIS A 1 3  ? 12.950  0.586   18.205  1.00 0.00 ? 3  HIS A HB2  5  
ATOM 6440  H HB3  . HIS A 1 3  ? 12.940  2.299   17.790  1.00 0.00 ? 3  HIS A HB3  5  
ATOM 6441  H HD1  . HIS A 1 3  ? 14.073  -0.934  16.580  1.00 0.00 ? 3  HIS A HD1  5  
ATOM 6442  H HD2  . HIS A 1 3  ? 15.165  3.030   16.007  1.00 0.00 ? 3  HIS A HD2  5  
ATOM 6443  H HE1  . HIS A 1 3  ? 15.431  -0.910  14.482  1.00 0.00 ? 3  HIS A HE1  5  
ATOM 6444  H HE2  . HIS A 1 3  ? 15.946  1.512   14.079  1.00 0.00 ? 3  HIS A HE2  5  
ATOM 6445  N N    . HIS A 1 4  ? 14.206  3.050   21.250  1.00 0.00 ? 4  HIS A N    5  
ATOM 6446  C CA   . HIS A 1 4  ? 13.559  3.679   22.423  1.00 0.00 ? 4  HIS A CA   5  
ATOM 6447  C C    . HIS A 1 4  ? 13.791  5.198   22.387  1.00 0.00 ? 4  HIS A C    5  
ATOM 6448  O O    . HIS A 1 4  ? 13.386  5.921   23.303  1.00 0.00 ? 4  HIS A O    5  
ATOM 6449  C CB   . HIS A 1 4  ? 14.112  3.069   23.736  1.00 0.00 ? 4  HIS A CB   5  
ATOM 6450  C CG   . HIS A 1 4  ? 13.844  1.590   23.887  1.00 0.00 ? 4  HIS A CG   5  
ATOM 6451  N ND1  . HIS A 1 4  ? 14.845  0.642   23.879  1.00 0.00 ? 4  HIS A ND1  5  
ATOM 6452  C CD2  . HIS A 1 4  ? 12.686  0.898   24.053  1.00 0.00 ? 4  HIS A CD2  5  
ATOM 6453  C CE1  . HIS A 1 4  ? 14.319  -0.552  24.025  1.00 0.00 ? 4  HIS A CE1  5  
ATOM 6454  N NE2  . HIS A 1 4  ? 13.018  -0.425  24.132  1.00 0.00 ? 4  HIS A NE2  5  
ATOM 6455  H H    . HIS A 1 4  ? 15.137  3.290   21.055  1.00 0.00 ? 4  HIS A H    5  
ATOM 6456  H HA   . HIS A 1 4  ? 12.483  3.501   22.371  1.00 0.00 ? 4  HIS A HA   5  
ATOM 6457  H HB2  . HIS A 1 4  ? 15.184  3.214   23.773  1.00 0.00 ? 4  HIS A HB2  5  
ATOM 6458  H HB3  . HIS A 1 4  ? 13.664  3.573   24.587  1.00 0.00 ? 4  HIS A HB3  5  
ATOM 6459  H HD1  . HIS A 1 4  ? 15.805  0.825   23.787  1.00 0.00 ? 4  HIS A HD1  5  
ATOM 6460  H HD2  . HIS A 1 4  ? 11.685  1.312   24.114  1.00 0.00 ? 4  HIS A HD2  5  
ATOM 6461  H HE1  . HIS A 1 4  ? 14.863  -1.486  24.055  1.00 0.00 ? 4  HIS A HE1  5  
ATOM 6462  H HE2  . HIS A 1 4  ? 12.394  -1.163  24.285  1.00 0.00 ? 4  HIS A HE2  5  
ATOM 6463  N N    . HIS A 1 5  ? 14.438  5.679   21.304  1.00 0.00 ? 5  HIS A N    5  
ATOM 6464  C CA   . HIS A 1 5  ? 14.697  7.109   21.069  1.00 0.00 ? 5  HIS A CA   5  
ATOM 6465  C C    . HIS A 1 5  ? 14.060  7.493   19.741  1.00 0.00 ? 5  HIS A C    5  
ATOM 6466  O O    . HIS A 1 5  ? 14.354  6.862   18.713  1.00 0.00 ? 5  HIS A O    5  
ATOM 6467  C CB   . HIS A 1 5  ? 16.216  7.400   21.044  1.00 0.00 ? 5  HIS A CB   5  
ATOM 6468  C CG   . HIS A 1 5  ? 16.926  6.913   22.273  1.00 0.00 ? 5  HIS A CG   5  
ATOM 6469  N ND1  . HIS A 1 5  ? 17.839  5.884   22.254  1.00 0.00 ? 5  HIS A ND1  5  
ATOM 6470  C CD2  . HIS A 1 5  ? 16.818  7.290   23.571  1.00 0.00 ? 5  HIS A CD2  5  
ATOM 6471  C CE1  . HIS A 1 5  ? 18.253  5.646   23.479  1.00 0.00 ? 5  HIS A CE1  5  
ATOM 6472  N NE2  . HIS A 1 5  ? 17.653  6.483   24.293  1.00 0.00 ? 5  HIS A NE2  5  
ATOM 6473  H H    . HIS A 1 5  ? 14.737  5.045   20.618  1.00 0.00 ? 5  HIS A H    5  
ATOM 6474  H HA   . HIS A 1 5  ? 14.235  7.688   21.873  1.00 0.00 ? 5  HIS A HA   5  
ATOM 6475  H HB2  . HIS A 1 5  ? 16.666  6.921   20.179  1.00 0.00 ? 5  HIS A HB2  5  
ATOM 6476  H HB3  . HIS A 1 5  ? 16.374  8.469   20.974  1.00 0.00 ? 5  HIS A HB3  5  
ATOM 6477  H HD1  . HIS A 1 5  ? 18.146  5.404   21.457  1.00 0.00 ? 5  HIS A HD1  5  
ATOM 6478  H HD2  . HIS A 1 5  ? 16.183  8.070   23.966  1.00 0.00 ? 5  HIS A HD2  5  
ATOM 6479  H HE1  . HIS A 1 5  ? 18.976  4.894   23.766  1.00 0.00 ? 5  HIS A HE1  5  
ATOM 6480  H HE2  . HIS A 1 5  ? 17.921  6.641   25.221  1.00 0.00 ? 5  HIS A HE2  5  
ATOM 6481  N N    . HIS A 1 6  ? 13.187  8.524   19.786  1.00 0.00 ? 6  HIS A N    5  
ATOM 6482  C CA   . HIS A 1 6  ? 12.363  8.973   18.647  1.00 0.00 ? 6  HIS A CA   5  
ATOM 6483  C C    . HIS A 1 6  ? 11.343  7.870   18.251  1.00 0.00 ? 6  HIS A C    5  
ATOM 6484  O O    . HIS A 1 6  ? 11.227  6.847   18.942  1.00 0.00 ? 6  HIS A O    5  
ATOM 6485  C CB   . HIS A 1 6  ? 13.245  9.445   17.444  1.00 0.00 ? 6  HIS A CB   5  
ATOM 6486  C CG   . HIS A 1 6  ? 14.223  10.546  17.794  1.00 0.00 ? 6  HIS A CG   5  
ATOM 6487  N ND1  . HIS A 1 6  ? 13.972  11.883  17.567  1.00 0.00 ? 6  HIS A ND1  5  
ATOM 6488  C CD2  . HIS A 1 6  ? 15.445  10.501  18.380  1.00 0.00 ? 6  HIS A CD2  5  
ATOM 6489  C CE1  . HIS A 1 6  ? 14.991  12.602  17.996  1.00 0.00 ? 6  HIS A CE1  5  
ATOM 6490  N NE2  . HIS A 1 6  ? 15.895  11.789  18.490  1.00 0.00 ? 6  HIS A NE2  5  
ATOM 6491  H H    . HIS A 1 6  ? 13.085  8.998   20.639  1.00 0.00 ? 6  HIS A H    5  
ATOM 6492  H HA   . HIS A 1 6  ? 11.789  9.824   19.004  1.00 0.00 ? 6  HIS A HA   5  
ATOM 6493  H HB2  . HIS A 1 6  ? 13.814  8.604   17.061  1.00 0.00 ? 6  HIS A HB2  5  
ATOM 6494  H HB3  . HIS A 1 6  ? 12.602  9.815   16.654  1.00 0.00 ? 6  HIS A HB3  5  
ATOM 6495  H HD1  . HIS A 1 6  ? 13.168  12.251  17.148  1.00 0.00 ? 6  HIS A HD1  5  
ATOM 6496  H HD2  . HIS A 1 6  ? 15.960  9.614   18.724  1.00 0.00 ? 6  HIS A HD2  5  
ATOM 6497  H HE1  . HIS A 1 6  ? 15.069  13.678  17.944  1.00 0.00 ? 6  HIS A HE1  5  
ATOM 6498  H HE2  . HIS A 1 6  ? 16.804  12.051  18.746  1.00 0.00 ? 6  HIS A HE2  5  
ATOM 6499  N N    . HIS A 1 7  ? 10.547  8.137   17.193  1.00 0.00 ? 7  HIS A N    5  
ATOM 6500  C CA   . HIS A 1 7  ? 9.464   7.239   16.694  1.00 0.00 ? 7  HIS A CA   5  
ATOM 6501  C C    . HIS A 1 7  ? 8.241   7.208   17.677  1.00 0.00 ? 7  HIS A C    5  
ATOM 6502  O O    . HIS A 1 7  ? 7.220   6.557   17.409  1.00 0.00 ? 7  HIS A O    5  
ATOM 6503  C CB   . HIS A 1 7  ? 10.020  5.811   16.367  1.00 0.00 ? 7  HIS A CB   5  
ATOM 6504  C CG   . HIS A 1 7  ? 9.029   4.878   15.730  1.00 0.00 ? 7  HIS A CG   5  
ATOM 6505  N ND1  . HIS A 1 7  ? 8.151   4.109   16.461  1.00 0.00 ? 7  HIS A ND1  5  
ATOM 6506  C CD2  . HIS A 1 7  ? 8.747   4.624   14.435  1.00 0.00 ? 7  HIS A CD2  5  
ATOM 6507  C CE1  . HIS A 1 7  ? 7.379   3.432   15.650  1.00 0.00 ? 7  HIS A CE1  5  
ATOM 6508  N NE2  . HIS A 1 7  ? 7.713   3.729   14.423  1.00 0.00 ? 7  HIS A NE2  5  
ATOM 6509  H H    . HIS A 1 7  ? 10.680  8.987   16.733  1.00 0.00 ? 7  HIS A H    5  
ATOM 6510  H HA   . HIS A 1 7  ? 9.115   7.685   15.766  1.00 0.00 ? 7  HIS A HA   5  
ATOM 6511  H HB2  . HIS A 1 7  ? 10.860  5.903   15.690  1.00 0.00 ? 7  HIS A HB2  5  
ATOM 6512  H HB3  . HIS A 1 7  ? 10.367  5.351   17.286  1.00 0.00 ? 7  HIS A HB3  5  
ATOM 6513  H HD1  . HIS A 1 7  ? 8.099   4.074   17.436  1.00 0.00 ? 7  HIS A HD1  5  
ATOM 6514  H HD2  . HIS A 1 7  ? 9.235   5.052   13.570  1.00 0.00 ? 7  HIS A HD2  5  
ATOM 6515  H HE1  . HIS A 1 7  ? 6.586   2.758   15.944  1.00 0.00 ? 7  HIS A HE1  5  
ATOM 6516  H HE2  . HIS A 1 7  ? 7.311   3.336   13.624  1.00 0.00 ? 7  HIS A HE2  5  
ATOM 6517  N N    . HIS A 1 8  ? 8.338   7.957   18.804  1.00 0.00 ? 8  HIS A N    5  
ATOM 6518  C CA   . HIS A 1 8  ? 7.233   8.150   19.763  1.00 0.00 ? 8  HIS A CA   5  
ATOM 6519  C C    . HIS A 1 8  ? 6.074   8.892   19.067  1.00 0.00 ? 8  HIS A C    5  
ATOM 6520  O O    . HIS A 1 8  ? 4.892   8.643   19.347  1.00 0.00 ? 8  HIS A O    5  
ATOM 6521  C CB   . HIS A 1 8  ? 7.759   8.946   20.999  1.00 0.00 ? 8  HIS A CB   5  
ATOM 6522  C CG   . HIS A 1 8  ? 6.713   9.288   22.050  1.00 0.00 ? 8  HIS A CG   5  
ATOM 6523  N ND1  . HIS A 1 8  ? 6.494   8.538   23.187  1.00 0.00 ? 8  HIS A ND1  5  
ATOM 6524  C CD2  . HIS A 1 8  ? 5.849   10.335  22.136  1.00 0.00 ? 8  HIS A CD2  5  
ATOM 6525  C CE1  . HIS A 1 8  ? 5.541   9.107   23.911  1.00 0.00 ? 8  HIS A CE1  5  
ATOM 6526  N NE2  . HIS A 1 8  ? 5.136   10.194  23.295  1.00 0.00 ? 8  HIS A NE2  5  
ATOM 6527  H H    . HIS A 1 8  ? 9.178   8.420   18.981  1.00 0.00 ? 8  HIS A H    5  
ATOM 6528  H HA   . HIS A 1 8  ? 6.891   7.168   20.085  1.00 0.00 ? 8  HIS A HA   5  
ATOM 6529  H HB2  . HIS A 1 8  ? 8.530   8.364   21.486  1.00 0.00 ? 8  HIS A HB2  5  
ATOM 6530  H HB3  . HIS A 1 8  ? 8.201   9.879   20.657  1.00 0.00 ? 8  HIS A HB3  5  
ATOM 6531  H HD1  . HIS A 1 8  ? 6.962   7.709   23.431  1.00 0.00 ? 8  HIS A HD1  5  
ATOM 6532  H HD2  . HIS A 1 8  ? 5.750   11.140  21.423  1.00 0.00 ? 8  HIS A HD2  5  
ATOM 6533  H HE1  . HIS A 1 8  ? 5.165   8.745   24.855  1.00 0.00 ? 8  HIS A HE1  5  
ATOM 6534  H HE2  . HIS A 1 8  ? 4.296   10.666  23.496  1.00 0.00 ? 8  HIS A HE2  5  
ATOM 6535  N N    . SER A 1 9  ? 6.456   9.798   18.147  1.00 0.00 ? 9  SER A N    5  
ATOM 6536  C CA   . SER A 1 9  ? 5.532   10.546  17.310  1.00 0.00 ? 9  SER A CA   5  
ATOM 6537  C C    . SER A 1 9  ? 4.934   9.622   16.235  1.00 0.00 ? 9  SER A C    5  
ATOM 6538  O O    . SER A 1 9  ? 5.495   9.458   15.151  1.00 0.00 ? 9  SER A O    5  
ATOM 6539  C CB   . SER A 1 9  ? 6.246   11.752  16.669  1.00 0.00 ? 9  SER A CB   5  
ATOM 6540  O OG   . SER A 1 9  ? 6.815   12.581  17.662  1.00 0.00 ? 9  SER A OG   5  
ATOM 6541  H H    . SER A 1 9  ? 7.415   9.950   18.018  1.00 0.00 ? 9  SER A H    5  
ATOM 6542  H HA   . SER A 1 9  ? 4.730   10.918  17.950  1.00 0.00 ? 9  SER A HA   5  
ATOM 6543  H HB2  . SER A 1 9  ? 7.037   11.409  16.013  1.00 0.00 ? 9  SER A HB2  5  
ATOM 6544  H HB3  . SER A 1 9  ? 5.535   12.338  16.101  1.00 0.00 ? 9  SER A HB3  5  
ATOM 6545  H HG   . SER A 1 9  ? 6.323   12.472  18.482  1.00 0.00 ? 9  SER A HG   5  
ATOM 6546  N N    . HIS A 1 10 ? 3.815   8.981   16.586  1.00 0.00 ? 10 HIS A N    5  
ATOM 6547  C CA   . HIS A 1 10 ? 3.007   8.140   15.671  1.00 0.00 ? 10 HIS A CA   5  
ATOM 6548  C C    . HIS A 1 10 ? 1.970   9.003   14.915  1.00 0.00 ? 10 HIS A C    5  
ATOM 6549  O O    . HIS A 1 10 ? 0.959   8.489   14.420  1.00 0.00 ? 10 HIS A O    5  
ATOM 6550  C CB   . HIS A 1 10 ? 2.316   7.014   16.500  1.00 0.00 ? 10 HIS A CB   5  
ATOM 6551  C CG   . HIS A 1 10 ? 1.495   7.512   17.674  1.00 0.00 ? 10 HIS A CG   5  
ATOM 6552  N ND1  . HIS A 1 10 ? 1.927   7.457   18.984  1.00 0.00 ? 10 HIS A ND1  5  
ATOM 6553  C CD2  . HIS A 1 10 ? 0.254   8.056   17.729  1.00 0.00 ? 10 HIS A CD2  5  
ATOM 6554  C CE1  . HIS A 1 10 ? 0.990   7.935   19.779  1.00 0.00 ? 10 HIS A CE1  5  
ATOM 6555  N NE2  . HIS A 1 10 ? -0.033  8.307   19.046  1.00 0.00 ? 10 HIS A NE2  5  
ATOM 6556  H H    . HIS A 1 10 ? 3.512   9.073   17.516  1.00 0.00 ? 10 HIS A H    5  
ATOM 6557  H HA   . HIS A 1 10 ? 3.673   7.684   14.940  1.00 0.00 ? 10 HIS A HA   5  
ATOM 6558  H HB2  . HIS A 1 10 ? 1.659   6.440   15.856  1.00 0.00 ? 10 HIS A HB2  5  
ATOM 6559  H HB3  . HIS A 1 10 ? 3.077   6.347   16.892  1.00 0.00 ? 10 HIS A HB3  5  
ATOM 6560  H HD1  . HIS A 1 10 ? 2.800   7.127   19.286  1.00 0.00 ? 10 HIS A HD1  5  
ATOM 6561  H HD2  . HIS A 1 10 ? -0.390  8.267   16.885  1.00 0.00 ? 10 HIS A HD2  5  
ATOM 6562  H HE1  . HIS A 1 10 ? 1.048   8.000   20.857  1.00 0.00 ? 10 HIS A HE1  5  
ATOM 6563  H HE2  . HIS A 1 10 ? -0.936  8.470   19.402  1.00 0.00 ? 10 HIS A HE2  5  
ATOM 6564  N N    . MET A 1 11 ? 2.269   10.312  14.802  1.00 0.00 ? 11 MET A N    5  
ATOM 6565  C CA   . MET A 1 11 ? 1.354   11.321  14.278  1.00 0.00 ? 11 MET A CA   5  
ATOM 6566  C C    . MET A 1 11 ? 1.153   11.151  12.764  1.00 0.00 ? 11 MET A C    5  
ATOM 6567  O O    . MET A 1 11 ? 2.098   10.834  12.029  1.00 0.00 ? 11 MET A O    5  
ATOM 6568  C CB   . MET A 1 11 ? 1.896   12.745  14.585  1.00 0.00 ? 11 MET A CB   5  
ATOM 6569  C CG   . MET A 1 11 ? 2.181   13.023  16.071  1.00 0.00 ? 11 MET A CG   5  
ATOM 6570  S SD   . MET A 1 11 ? 2.803   14.696  16.372  1.00 0.00 ? 11 MET A SD   5  
ATOM 6571  C CE   . MET A 1 11 ? 4.238   14.772  15.289  1.00 0.00 ? 11 MET A CE   5  
ATOM 6572  H H    . MET A 1 11 ? 3.160   10.604  15.061  1.00 0.00 ? 11 MET A H    5  
ATOM 6573  H HA   . MET A 1 11 ? 0.397   11.198  14.779  1.00 0.00 ? 11 MET A HA   5  
ATOM 6574  H HB2  . MET A 1 11 ? 2.819   12.895  14.039  1.00 0.00 ? 11 MET A HB2  5  
ATOM 6575  H HB3  . MET A 1 11 ? 1.175   13.480  14.244  1.00 0.00 ? 11 MET A HB3  5  
ATOM 6576  H HG2  . MET A 1 11 ? 1.267   12.899  16.635  1.00 0.00 ? 11 MET A HG2  5  
ATOM 6577  H HG3  . MET A 1 11 ? 2.917   12.314  16.426  1.00 0.00 ? 11 MET A HG3  5  
ATOM 6578  H HE1  . MET A 1 11 ? 4.725   15.728  15.407  1.00 0.00 ? 11 MET A HE1  5  
ATOM 6579  H HE2  . MET A 1 11 ? 3.924   14.656  14.260  1.00 0.00 ? 11 MET A HE2  5  
ATOM 6580  H HE3  . MET A 1 11 ? 4.930   13.983  15.545  1.00 0.00 ? 11 MET A HE3  5  
ATOM 6581  N N    . LYS A 1 12 ? -0.094  11.348  12.330  1.00 0.00 ? 12 LYS A N    5  
ATOM 6582  C CA   . LYS A 1 12 ? -0.470  11.403  10.905  1.00 0.00 ? 12 LYS A CA   5  
ATOM 6583  C C    . LYS A 1 12 ? 0.133   12.674  10.282  1.00 0.00 ? 12 LYS A C    5  
ATOM 6584  O O    . LYS A 1 12 ? 0.549   12.687  9.123   1.00 0.00 ? 12 LYS A O    5  
ATOM 6585  C CB   . LYS A 1 12 ? -2.016  11.395  10.779  1.00 0.00 ? 12 LYS A CB   5  
ATOM 6586  C CG   . LYS A 1 12 ? -2.684  10.228  11.541  1.00 0.00 ? 12 LYS A CG   5  
ATOM 6587  C CD   . LYS A 1 12 ? -4.217  10.371  11.658  1.00 0.00 ? 12 LYS A CD   5  
ATOM 6588  C CE   . LYS A 1 12 ? -4.828  9.254   12.524  1.00 0.00 ? 12 LYS A CE   5  
ATOM 6589  N NZ   . LYS A 1 12 ? -4.321  9.288   13.919  1.00 0.00 ? 12 LYS A NZ   5  
ATOM 6590  H H    . LYS A 1 12 ? -0.798  11.472  13.003  1.00 0.00 ? 12 LYS A H    5  
ATOM 6591  H HA   . LYS A 1 12 ? -0.060  10.530  10.401  1.00 0.00 ? 12 LYS A HA   5  
ATOM 6592  H HB2  . LYS A 1 12 ? -2.409  12.333  11.170  1.00 0.00 ? 12 LYS A HB2  5  
ATOM 6593  H HB3  . LYS A 1 12 ? -2.285  11.318  9.731   1.00 0.00 ? 12 LYS A HB3  5  
ATOM 6594  H HG2  . LYS A 1 12 ? -2.459  9.298   11.022  1.00 0.00 ? 12 LYS A HG2  5  
ATOM 6595  H HG3  . LYS A 1 12 ? -2.260  10.180  12.539  1.00 0.00 ? 12 LYS A HG3  5  
ATOM 6596  H HD2  . LYS A 1 12 ? -4.456  11.329  12.107  1.00 0.00 ? 12 LYS A HD2  5  
ATOM 6597  H HD3  . LYS A 1 12 ? -4.653  10.322  10.665  1.00 0.00 ? 12 LYS A HD3  5  
ATOM 6598  H HE2  . LYS A 1 12 ? -5.902  9.373   12.548  1.00 0.00 ? 12 LYS A HE2  5  
ATOM 6599  H HE3  . LYS A 1 12 ? -4.588  8.287   12.090  1.00 0.00 ? 12 LYS A HE3  5  
ATOM 6600  H HZ1  . LYS A 1 12 ? -4.569  10.195  14.371  1.00 0.00 ? 12 LYS A HZ1  5  
ATOM 6601  H HZ2  . LYS A 1 12 ? -3.289  9.179   13.932  1.00 0.00 ? 12 LYS A HZ2  5  
ATOM 6602  H HZ3  . LYS A 1 12 ? -4.743  8.516   14.469  1.00 0.00 ? 12 LYS A HZ3  5  
ATOM 6603  N N    . ARG A 1 13 ? 0.179   13.741  11.102  1.00 0.00 ? 13 ARG A N    5  
ATOM 6604  C CA   . ARG A 1 13 ? 0.851   15.005  10.767  1.00 0.00 ? 13 ARG A CA   5  
ATOM 6605  C C    . ARG A 1 13 ? 2.383   14.809  10.840  1.00 0.00 ? 13 ARG A C    5  
ATOM 6606  O O    . ARG A 1 13 ? 2.865   13.902  11.543  1.00 0.00 ? 13 ARG A O    5  
ATOM 6607  C CB   . ARG A 1 13 ? 0.391   16.126  11.735  1.00 0.00 ? 13 ARG A CB   5  
ATOM 6608  C CG   . ARG A 1 13 ? 0.915   17.542  11.382  1.00 0.00 ? 13 ARG A CG   5  
ATOM 6609  C CD   . ARG A 1 13 ? 0.417   18.627  12.344  1.00 0.00 ? 13 ARG A CD   5  
ATOM 6610  N NE   . ARG A 1 13 ? -1.053  18.788  12.323  1.00 0.00 ? 13 ARG A NE   5  
ATOM 6611  C CZ   . ARG A 1 13 ? -1.729  19.814  12.869  1.00 0.00 ? 13 ARG A CZ   5  
ATOM 6612  N NH1  . ARG A 1 13 ? -1.086  20.797  13.496  1.00 0.00 ? 13 ARG A NH1  5  
ATOM 6613  N NH2  . ARG A 1 13 ? -3.049  19.852  12.768  1.00 0.00 ? 13 ARG A NH2  5  
ATOM 6614  H H    . ARG A 1 13 ? -0.243  13.663  11.981  1.00 0.00 ? 13 ARG A H    5  
ATOM 6615  H HA   . ARG A 1 13 ? 0.573   15.285  9.745   1.00 0.00 ? 13 ARG A HA   5  
ATOM 6616  H HB2  . ARG A 1 13 ? -0.692  16.161  11.730  1.00 0.00 ? 13 ARG A HB2  5  
ATOM 6617  H HB3  . ARG A 1 13 ? 0.723   15.880  12.741  1.00 0.00 ? 13 ARG A HB3  5  
ATOM 6618  H HG2  . ARG A 1 13 ? 1.999   17.528  11.401  1.00 0.00 ? 13 ARG A HG2  5  
ATOM 6619  H HG3  . ARG A 1 13 ? 0.586   17.792  10.378  1.00 0.00 ? 13 ARG A HG3  5  
ATOM 6620  H HD2  . ARG A 1 13 ? 0.715   18.365  13.354  1.00 0.00 ? 13 ARG A HD2  5  
ATOM 6621  H HD3  . ARG A 1 13 ? 0.878   19.566  12.071  1.00 0.00 ? 13 ARG A HD3  5  
ATOM 6622  H HE   . ARG A 1 13 ? -1.567  18.084  11.874  1.00 0.00 ? 13 ARG A HE   5  
ATOM 6623  H HH11 . ARG A 1 13 ? -0.084  20.780  13.572  1.00 0.00 ? 13 ARG A HH11 5  
ATOM 6624  H HH12 . ARG A 1 13 ? -1.600  21.558  13.911  1.00 0.00 ? 13 ARG A HH12 5  
ATOM 6625  H HH21 . ARG A 1 13 ? -3.541  19.121  12.275  1.00 0.00 ? 13 ARG A HH21 5  
ATOM 6626  H HH22 . ARG A 1 13 ? -3.566  20.613  13.173  1.00 0.00 ? 13 ARG A HH22 5  
ATOM 6627  N N    . SER A 1 14 ? 3.116   15.630  10.062  1.00 0.00 ? 14 SER A N    5  
ATOM 6628  C CA   . SER A 1 14 ? 4.597   15.653  9.977   1.00 0.00 ? 14 SER A CA   5  
ATOM 6629  C C    . SER A 1 14 ? 5.147   14.526  9.065   1.00 0.00 ? 14 SER A C    5  
ATOM 6630  O O    . SER A 1 14 ? 6.275   14.628  8.557   1.00 0.00 ? 14 SER A O    5  
ATOM 6631  C CB   . SER A 1 14 ? 5.260   15.662  11.382  1.00 0.00 ? 14 SER A CB   5  
ATOM 6632  O OG   . SER A 1 14 ? 4.776   16.743  12.179  1.00 0.00 ? 14 SER A OG   5  
ATOM 6633  H H    . SER A 1 14 ? 2.625   16.262  9.502   1.00 0.00 ? 14 SER A H    5  
ATOM 6634  H HA   . SER A 1 14 ? 4.841   16.590  9.489   1.00 0.00 ? 14 SER A HA   5  
ATOM 6635  H HB2  . SER A 1 14 ? 5.043   14.733  11.892  1.00 0.00 ? 14 SER A HB2  5  
ATOM 6636  H HB3  . SER A 1 14 ? 6.337   15.762  11.278  1.00 0.00 ? 14 SER A HB3  5  
ATOM 6637  H HG   . SER A 1 14 ? 4.429   17.433  11.607  1.00 0.00 ? 14 SER A HG   5  
ATOM 6638  N N    . GLY A 1 15 ? 4.351   13.460  8.865   1.00 0.00 ? 15 GLY A N    5  
ATOM 6639  C CA   . GLY A 1 15 ? 4.573   12.512  7.774   1.00 0.00 ? 15 GLY A CA   5  
ATOM 6640  C C    . GLY A 1 15 ? 3.971   13.041  6.475   1.00 0.00 ? 15 GLY A C    5  
ATOM 6641  O O    . GLY A 1 15 ? 3.148   13.966  6.509   1.00 0.00 ? 15 GLY A O    5  
ATOM 6642  H H    . GLY A 1 15 ? 3.596   13.317  9.466   1.00 0.00 ? 15 GLY A H    5  
ATOM 6643  H HA2  . GLY A 1 15 ? 5.640   12.343  7.640   1.00 0.00 ? 15 GLY A HA2  5  
ATOM 6644  H HA3  . GLY A 1 15 ? 4.098   11.575  8.019   1.00 0.00 ? 15 GLY A HA3  5  
ATOM 6645  N N    . ARG A 1 16 ? 4.355   12.466  5.328   1.00 0.00 ? 16 ARG A N    5  
ATOM 6646  C CA   . ARG A 1 16 ? 3.928   12.984  4.010   1.00 0.00 ? 16 ARG A CA   5  
ATOM 6647  C C    . ARG A 1 16 ? 2.620   12.308  3.552   1.00 0.00 ? 16 ARG A C    5  
ATOM 6648  O O    . ARG A 1 16 ? 2.570   11.087  3.397   1.00 0.00 ? 16 ARG A O    5  
ATOM 6649  C CB   . ARG A 1 16 ? 5.052   12.787  2.949   1.00 0.00 ? 16 ARG A CB   5  
ATOM 6650  C CG   . ARG A 1 16 ? 4.715   13.314  1.527   1.00 0.00 ? 16 ARG A CG   5  
ATOM 6651  C CD   . ARG A 1 16 ? 4.535   14.840  1.477   1.00 0.00 ? 16 ARG A CD   5  
ATOM 6652  N NE   . ARG A 1 16 ? 5.770   15.551  1.861   1.00 0.00 ? 16 ARG A NE   5  
ATOM 6653  C CZ   . ARG A 1 16 ? 5.829   16.792  2.374   1.00 0.00 ? 16 ARG A CZ   5  
ATOM 6654  N NH1  . ARG A 1 16 ? 4.724   17.497  2.595   1.00 0.00 ? 16 ARG A NH1  5  
ATOM 6655  N NH2  . ARG A 1 16 ? 7.015   17.321  2.657   1.00 0.00 ? 16 ARG A NH2  5  
ATOM 6656  H H    . ARG A 1 16 ? 4.908   11.659  5.361   1.00 0.00 ? 16 ARG A H    5  
ATOM 6657  H HA   . ARG A 1 16 ? 3.748   14.053  4.111   1.00 0.00 ? 16 ARG A HA   5  
ATOM 6658  H HB2  . ARG A 1 16 ? 5.949   13.292  3.290   1.00 0.00 ? 16 ARG A HB2  5  
ATOM 6659  H HB3  . ARG A 1 16 ? 5.272   11.726  2.870   1.00 0.00 ? 16 ARG A HB3  5  
ATOM 6660  H HG2  . ARG A 1 16 ? 5.522   13.044  0.854   1.00 0.00 ? 16 ARG A HG2  5  
ATOM 6661  H HG3  . ARG A 1 16 ? 3.800   12.839  1.186   1.00 0.00 ? 16 ARG A HG3  5  
ATOM 6662  H HD2  . ARG A 1 16 ? 4.272   15.125  0.467   1.00 0.00 ? 16 ARG A HD2  5  
ATOM 6663  H HD3  . ARG A 1 16 ? 3.731   15.121  2.148   1.00 0.00 ? 16 ARG A HD3  5  
ATOM 6664  H HE   . ARG A 1 16 ? 6.611   15.071  1.715   1.00 0.00 ? 16 ARG A HE   5  
ATOM 6665  H HH11 . ARG A 1 16 ? 3.822   17.105  2.376   1.00 0.00 ? 16 ARG A HH11 5  
ATOM 6666  H HH12 . ARG A 1 16 ? 4.782   18.422  2.979   1.00 0.00 ? 16 ARG A HH12 5  
ATOM 6667  H HH21 . ARG A 1 16 ? 7.859   16.799  2.487   1.00 0.00 ? 16 ARG A HH21 5  
ATOM 6668  H HH22 . ARG A 1 16 ? 7.073   18.248  3.044   1.00 0.00 ? 16 ARG A HH22 5  
ATOM 6669  N N    . GLU A 1 17 ? 1.564   13.113  3.353   1.00 0.00 ? 17 GLU A N    5  
ATOM 6670  C CA   . GLU A 1 17 ? 0.328   12.649  2.723   1.00 0.00 ? 17 GLU A CA   5  
ATOM 6671  C C    . GLU A 1 17 ? 0.567   12.600  1.196   1.00 0.00 ? 17 GLU A C    5  
ATOM 6672  O O    . GLU A 1 17 ? 0.737   13.645  0.558   1.00 0.00 ? 17 GLU A O    5  
ATOM 6673  C CB   . GLU A 1 17 ? -0.831  13.612  3.073   1.00 0.00 ? 17 GLU A CB   5  
ATOM 6674  C CG   . GLU A 1 17 ? -2.193  13.244  2.456   1.00 0.00 ? 17 GLU A CG   5  
ATOM 6675  C CD   . GLU A 1 17 ? -3.240  14.344  2.668   1.00 0.00 ? 17 GLU A CD   5  
ATOM 6676  O OE1  . GLU A 1 17 ? -3.118  15.410  2.027   1.00 0.00 ? 17 GLU A OE1  5  
ATOM 6677  O OE2  . GLU A 1 17 ? -4.168  14.171  3.487   1.00 0.00 ? 17 GLU A OE2  5  
ATOM 6678  H H    . GLU A 1 17 ? 1.618   14.051  3.634   1.00 0.00 ? 17 GLU A H    5  
ATOM 6679  H HA   . GLU A 1 17 ? 0.094   11.647  3.100   1.00 0.00 ? 17 GLU A HA   5  
ATOM 6680  H HB2  . GLU A 1 17 ? -0.949  13.639  4.155   1.00 0.00 ? 17 GLU A HB2  5  
ATOM 6681  H HB3  . GLU A 1 17 ? -0.565  14.612  2.737   1.00 0.00 ? 17 GLU A HB3  5  
ATOM 6682  H HG2  . GLU A 1 17 ? -2.063  13.089  1.387   1.00 0.00 ? 17 GLU A HG2  5  
ATOM 6683  H HG3  . GLU A 1 17 ? -2.548  12.318  2.900   1.00 0.00 ? 17 GLU A HG3  5  
ATOM 6684  N N    . ILE A 1 18 ? 0.625   11.380  0.649   1.00 0.00 ? 18 ILE A N    5  
ATOM 6685  C CA   . ILE A 1 18 ? 0.876   11.093  -0.780  1.00 0.00 ? 18 ILE A CA   5  
ATOM 6686  C C    . ILE A 1 18 ? -0.434  10.678  -1.470  1.00 0.00 ? 18 ILE A C    5  
ATOM 6687  O O    . ILE A 1 18 ? -1.466  10.515  -0.815  1.00 0.00 ? 18 ILE A O    5  
ATOM 6688  C CB   . ILE A 1 18 ? 1.937   9.923   -0.918  1.00 0.00 ? 18 ILE A CB   5  
ATOM 6689  C CG1  . ILE A 1 18 ? 1.420   8.608   -0.219  1.00 0.00 ? 18 ILE A CG1  5  
ATOM 6690  C CG2  . ILE A 1 18 ? 3.320   10.354  -0.363  1.00 0.00 ? 18 ILE A CG2  5  
ATOM 6691  C CD1  . ILE A 1 18 ? 2.369   7.425   -0.286  1.00 0.00 ? 18 ILE A CD1  5  
ATOM 6692  H H    . ILE A 1 18 ? 0.487   10.618  1.239   1.00 0.00 ? 18 ILE A H    5  
ATOM 6693  H HA   . ILE A 1 18 ? 1.269   11.987  -1.273  1.00 0.00 ? 18 ILE A HA   5  
ATOM 6694  H HB   . ILE A 1 18 ? 2.067   9.720   -1.980  1.00 0.00 ? 18 ILE A HB   5  
ATOM 6695  H HG12 . ILE A 1 18 ? 1.231   8.805   0.828   1.00 0.00 ? 18 ILE A HG12 5  
ATOM 6696  H HG13 . ILE A 1 18 ? 0.488   8.298   -0.683  1.00 0.00 ? 18 ILE A HG13 5  
ATOM 6697  H HG21 . ILE A 1 18 ? 3.661   11.247  -0.874  1.00 0.00 ? 18 ILE A HG21 5  
ATOM 6698  H HG22 . ILE A 1 18 ? 4.045   9.564   -0.517  1.00 0.00 ? 18 ILE A HG22 5  
ATOM 6699  H HG23 . ILE A 1 18 ? 3.243   10.561  0.699   1.00 0.00 ? 18 ILE A HG23 5  
ATOM 6700  H HD11 . ILE A 1 18 ? 3.283   7.661   0.238   1.00 0.00 ? 18 ILE A HD11 5  
ATOM 6701  H HD12 . ILE A 1 18 ? 2.595   7.201   -1.321  1.00 0.00 ? 18 ILE A HD12 5  
ATOM 6702  H HD13 . ILE A 1 18 ? 1.907   6.561   0.171   1.00 0.00 ? 18 ILE A HD13 5  
ATOM 6703  N N    . THR A 1 19 ? -0.376  10.507  -2.801  1.00 0.00 ? 19 THR A N    5  
ATOM 6704  C CA   . THR A 1 19 ? -1.466  9.890   -3.577  1.00 0.00 ? 19 THR A CA   5  
ATOM 6705  C C    . THR A 1 19 ? -1.213  8.375   -3.672  1.00 0.00 ? 19 THR A C    5  
ATOM 6706  O O    . THR A 1 19 ? -0.119  7.900   -3.313  1.00 0.00 ? 19 THR A O    5  
ATOM 6707  C CB   . THR A 1 19 ? -1.564  10.499  -5.024  1.00 0.00 ? 19 THR A CB   5  
ATOM 6708  O OG1  . THR A 1 19 ? -0.395  10.170  -5.790  1.00 0.00 ? 19 THR A OG1  5  
ATOM 6709  C CG2  . THR A 1 19 ? -1.725  12.028  -4.995  1.00 0.00 ? 19 THR A CG2  5  
ATOM 6710  H H    . THR A 1 19 ? 0.435   10.794  -3.276  1.00 0.00 ? 19 THR A H    5  
ATOM 6711  H HA   . THR A 1 19 ? -2.415  10.061  -3.065  1.00 0.00 ? 19 THR A HA   5  
ATOM 6712  H HB   . THR A 1 19 ? -2.429  10.070  -5.527  1.00 0.00 ? 19 THR A HB   5  
ATOM 6713  H HG1  . THR A 1 19 ? 0.178   10.939  -5.853  1.00 0.00 ? 19 THR A HG1  5  
ATOM 6714  H HG21 . THR A 1 19 ? -2.610  12.292  -4.431  1.00 0.00 ? 19 THR A HG21 5  
ATOM 6715  H HG22 . THR A 1 19 ? -1.820  12.400  -6.004  1.00 0.00 ? 19 THR A HG22 5  
ATOM 6716  H HG23 . THR A 1 19 ? -0.857  12.478  -4.530  1.00 0.00 ? 19 THR A HG23 5  
ATOM 6717  N N    . TRP A 1 20 ? -2.235  7.630   -4.146  1.00 0.00 ? 20 TRP A N    5  
ATOM 6718  C CA   . TRP A 1 20 ? -2.089  6.214   -4.536  1.00 0.00 ? 20 TRP A CA   5  
ATOM 6719  C C    . TRP A 1 20 ? -0.993  6.088   -5.616  1.00 0.00 ? 20 TRP A C    5  
ATOM 6720  O O    . TRP A 1 20 ? -0.172  5.189   -5.543  1.00 0.00 ? 20 TRP A O    5  
ATOM 6721  C CB   . TRP A 1 20 ? -3.446  5.627   -5.037  1.00 0.00 ? 20 TRP A CB   5  
ATOM 6722  C CG   . TRP A 1 20 ? -3.380  4.195   -5.554  1.00 0.00 ? 20 TRP A CG   5  
ATOM 6723  C CD1  . TRP A 1 20 ? -3.464  3.788   -6.855  1.00 0.00 ? 20 TRP A CD1  5  
ATOM 6724  C CD2  . TRP A 1 20 ? -3.219  2.991   -4.781  1.00 0.00 ? 20 TRP A CD2  5  
ATOM 6725  N NE1  . TRP A 1 20 ? -3.385  2.423   -6.933  1.00 0.00 ? 20 TRP A NE1  5  
ATOM 6726  C CE2  . TRP A 1 20 ? -3.233  1.912   -5.680  1.00 0.00 ? 20 TRP A CE2  5  
ATOM 6727  C CE3  . TRP A 1 20 ? -3.074  2.721   -3.427  1.00 0.00 ? 20 TRP A CE3  5  
ATOM 6728  C CZ2  . TRP A 1 20 ? -3.108  0.590   -5.268  1.00 0.00 ? 20 TRP A CZ2  5  
ATOM 6729  C CZ3  . TRP A 1 20 ? -2.941  1.411   -3.017  1.00 0.00 ? 20 TRP A CZ3  5  
ATOM 6730  C CH2  . TRP A 1 20 ? -2.963  0.358   -3.932  1.00 0.00 ? 20 TRP A CH2  5  
ATOM 6731  H H    . TRP A 1 20 ? -3.113  8.048   -4.201  1.00 0.00 ? 20 TRP A H    5  
ATOM 6732  H HA   . TRP A 1 20 ? -1.774  5.665   -3.648  1.00 0.00 ? 20 TRP A HA   5  
ATOM 6733  H HB2  . TRP A 1 20 ? -4.159  5.637   -4.222  1.00 0.00 ? 20 TRP A HB2  5  
ATOM 6734  H HB3  . TRP A 1 20 ? -3.835  6.253   -5.838  1.00 0.00 ? 20 TRP A HB3  5  
ATOM 6735  H HD1  . TRP A 1 20 ? -3.587  4.457   -7.693  1.00 0.00 ? 20 TRP A HD1  5  
ATOM 6736  H HE1  . TRP A 1 20 ? -3.424  1.897   -7.758  1.00 0.00 ? 20 TRP A HE1  5  
ATOM 6737  H HE3  . TRP A 1 20 ? -3.052  3.519   -2.700  1.00 0.00 ? 20 TRP A HE3  5  
ATOM 6738  H HZ2  . TRP A 1 20 ? -3.125  -0.234  -5.973  1.00 0.00 ? 20 TRP A HZ2  5  
ATOM 6739  H HZ3  . TRP A 1 20 ? -2.816  1.190   -1.967  1.00 0.00 ? 20 TRP A HZ3  5  
ATOM 6740  H HH2  . TRP A 1 20 ? -2.857  -0.654  -3.563  1.00 0.00 ? 20 TRP A HH2  5  
ATOM 6741  N N    . LYS A 1 21 ? -0.990  7.035   -6.581  1.00 0.00 ? 21 LYS A N    5  
ATOM 6742  C CA   . LYS A 1 21 ? 0.020   7.125   -7.657  1.00 0.00 ? 21 LYS A CA   5  
ATOM 6743  C C    . LYS A 1 21 ? 1.463   7.205   -7.106  1.00 0.00 ? 21 LYS A C    5  
ATOM 6744  O O    . LYS A 1 21 ? 2.328   6.412   -7.519  1.00 0.00 ? 21 LYS A O    5  
ATOM 6745  C CB   . LYS A 1 21 ? -0.307  8.342   -8.568  1.00 0.00 ? 21 LYS A CB   5  
ATOM 6746  C CG   . LYS A 1 21 ? 0.695   8.591   -9.712  1.00 0.00 ? 21 LYS A CG   5  
ATOM 6747  C CD   . LYS A 1 21 ? 0.214   9.706   -10.673 1.00 0.00 ? 21 LYS A CD   5  
ATOM 6748  C CE   . LYS A 1 21 ? 1.231   10.035  -11.771 1.00 0.00 ? 21 LYS A CE   5  
ATOM 6749  N NZ   . LYS A 1 21 ? 2.485   10.591  -11.217 1.00 0.00 ? 21 LYS A NZ   5  
ATOM 6750  H H    . LYS A 1 21 ? -1.721  7.690   -6.590  1.00 0.00 ? 21 LYS A H    5  
ATOM 6751  H HA   . LYS A 1 21 ? -0.071  6.219   -8.251  1.00 0.00 ? 21 LYS A HA   5  
ATOM 6752  H HB2  . LYS A 1 21 ? -1.285  8.179   -9.011  1.00 0.00 ? 21 LYS A HB2  5  
ATOM 6753  H HB3  . LYS A 1 21 ? -0.359  9.241   -7.955  1.00 0.00 ? 21 LYS A HB3  5  
ATOM 6754  H HG2  . LYS A 1 21 ? 1.651   8.875   -9.278  1.00 0.00 ? 21 LYS A HG2  5  
ATOM 6755  H HG3  . LYS A 1 21 ? 0.820   7.670   -10.269 1.00 0.00 ? 21 LYS A HG3  5  
ATOM 6756  H HD2  . LYS A 1 21 ? -0.709  9.388   -11.144 1.00 0.00 ? 21 LYS A HD2  5  
ATOM 6757  H HD3  . LYS A 1 21 ? 0.021   10.608  -10.097 1.00 0.00 ? 21 LYS A HD3  5  
ATOM 6758  H HE2  . LYS A 1 21 ? 1.466   9.137   -12.327 1.00 0.00 ? 21 LYS A HE2  5  
ATOM 6759  H HE3  . LYS A 1 21 ? 0.793   10.764  -12.440 1.00 0.00 ? 21 LYS A HE3  5  
ATOM 6760  H HZ1  . LYS A 1 21 ? 2.948   9.890   -10.609 1.00 0.00 ? 21 LYS A HZ1  5  
ATOM 6761  H HZ2  . LYS A 1 21 ? 2.277   11.442  -10.652 1.00 0.00 ? 21 LYS A HZ2  5  
ATOM 6762  H HZ3  . LYS A 1 21 ? 3.132   10.849  -11.988 1.00 0.00 ? 21 LYS A HZ3  5  
ATOM 6763  N N    . ASP A 1 22 ? 1.707   8.135   -6.148  1.00 0.00 ? 22 ASP A N    5  
ATOM 6764  C CA   . ASP A 1 22 ? 3.039   8.307   -5.512  1.00 0.00 ? 22 ASP A CA   5  
ATOM 6765  C C    . ASP A 1 22 ? 3.428   7.039   -4.751  1.00 0.00 ? 22 ASP A C    5  
ATOM 6766  O O    . ASP A 1 22 ? 4.602   6.638   -4.757  1.00 0.00 ? 22 ASP A O    5  
ATOM 6767  C CB   . ASP A 1 22 ? 3.070   9.503   -4.523  1.00 0.00 ? 22 ASP A CB   5  
ATOM 6768  C CG   . ASP A 1 22 ? 2.865   10.866  -5.193  1.00 0.00 ? 22 ASP A CG   5  
ATOM 6769  O OD1  . ASP A 1 22 ? 3.623   11.191  -6.127  1.00 0.00 ? 22 ASP A OD1  5  
ATOM 6770  O OD2  . ASP A 1 22 ? 1.935   11.612  -4.800  1.00 0.00 ? 22 ASP A OD2  5  
ATOM 6771  H H    . ASP A 1 22 ? 0.982   8.717   -5.849  1.00 0.00 ? 22 ASP A H    5  
ATOM 6772  H HA   . ASP A 1 22 ? 3.762   8.486   -6.305  1.00 0.00 ? 22 ASP A HA   5  
ATOM 6773  H HB2  . ASP A 1 22 ? 2.293   9.350   -3.771  1.00 0.00 ? 22 ASP A HB2  5  
ATOM 6774  H HB3  . ASP A 1 22 ? 4.034   9.517   -4.011  1.00 0.00 ? 22 ASP A HB3  5  
ATOM 6775  N N    . PHE A 1 23 ? 2.412   6.435   -4.093  1.00 0.00 ? 23 PHE A N    5  
ATOM 6776  C CA   . PHE A 1 23 ? 2.564   5.173   -3.368  1.00 0.00 ? 23 PHE A CA   5  
ATOM 6777  C C    . PHE A 1 23 ? 3.137   4.080   -4.285  1.00 0.00 ? 23 PHE A C    5  
ATOM 6778  O O    . PHE A 1 23 ? 4.125   3.447   -3.926  1.00 0.00 ? 23 PHE A O    5  
ATOM 6779  C CB   . PHE A 1 23 ? 1.233   4.699   -2.712  1.00 0.00 ? 23 PHE A CB   5  
ATOM 6780  C CG   . PHE A 1 23 ? 1.331   3.299   -2.122  1.00 0.00 ? 23 PHE A CG   5  
ATOM 6781  C CD1  . PHE A 1 23 ? 2.272   3.013   -1.132  1.00 0.00 ? 23 PHE A CD1  5  
ATOM 6782  C CD2  . PHE A 1 23 ? 0.530   2.262   -2.594  1.00 0.00 ? 23 PHE A CD2  5  
ATOM 6783  C CE1  . PHE A 1 23 ? 2.400   1.738   -0.634  1.00 0.00 ? 23 PHE A CE1  5  
ATOM 6784  C CE2  . PHE A 1 23 ? 0.663   0.988   -2.098  1.00 0.00 ? 23 PHE A CE2  5  
ATOM 6785  C CZ   . PHE A 1 23 ? 1.597   0.729   -1.119  1.00 0.00 ? 23 PHE A CZ   5  
ATOM 6786  H H    . PHE A 1 23 ? 1.533   6.869   -4.094  1.00 0.00 ? 23 PHE A H    5  
ATOM 6787  H HA   . PHE A 1 23 ? 3.277   5.362   -2.572  1.00 0.00 ? 23 PHE A HA   5  
ATOM 6788  H HB2  . PHE A 1 23 ? 0.963   5.376   -1.908  1.00 0.00 ? 23 PHE A HB2  5  
ATOM 6789  H HB3  . PHE A 1 23 ? 0.439   4.709   -3.456  1.00 0.00 ? 23 PHE A HB3  5  
ATOM 6790  H HD1  . PHE A 1 23 ? 2.903   3.803   -0.746  1.00 0.00 ? 23 PHE A HD1  5  
ATOM 6791  H HD2  . PHE A 1 23 ? -0.207  2.462   -3.361  1.00 0.00 ? 23 PHE A HD2  5  
ATOM 6792  H HE1  . PHE A 1 23 ? 3.131   1.527   0.137   1.00 0.00 ? 23 PHE A HE1  5  
ATOM 6793  H HE2  . PHE A 1 23 ? 0.034   0.189   -2.471  1.00 0.00 ? 23 PHE A HE2  5  
ATOM 6794  H HZ   . PHE A 1 23 ? 1.702   -0.275  -0.725  1.00 0.00 ? 23 PHE A HZ   5  
ATOM 6795  N N    . VAL A 1 24 ? 2.529   3.901   -5.470  1.00 0.00 ? 24 VAL A N    5  
ATOM 6796  C CA   . VAL A 1 24 ? 2.936   2.857   -6.425  1.00 0.00 ? 24 VAL A CA   5  
ATOM 6797  C C    . VAL A 1 24 ? 4.410   3.021   -6.820  1.00 0.00 ? 24 VAL A C    5  
ATOM 6798  O O    . VAL A 1 24 ? 5.239   2.184   -6.486  1.00 0.00 ? 24 VAL A O    5  
ATOM 6799  C CB   . VAL A 1 24 ? 2.048   2.866   -7.725  1.00 0.00 ? 24 VAL A CB   5  
ATOM 6800  C CG1  . VAL A 1 24 ? 2.446   1.710   -8.674  1.00 0.00 ? 24 VAL A CG1  5  
ATOM 6801  C CG2  . VAL A 1 24 ? 0.551   2.817   -7.359  1.00 0.00 ? 24 VAL A CG2  5  
ATOM 6802  H H    . VAL A 1 24 ? 1.774   4.486   -5.715  1.00 0.00 ? 24 VAL A H    5  
ATOM 6803  H HA   . VAL A 1 24 ? 2.805   1.895   -5.929  1.00 0.00 ? 24 VAL A HA   5  
ATOM 6804  H HB   . VAL A 1 24 ? 2.230   3.805   -8.251  1.00 0.00 ? 24 VAL A HB   5  
ATOM 6805  H HG11 . VAL A 1 24 ? 3.488   1.807   -8.958  1.00 0.00 ? 24 VAL A HG11 5  
ATOM 6806  H HG12 . VAL A 1 24 ? 1.834   1.740   -9.563  1.00 0.00 ? 24 VAL A HG12 5  
ATOM 6807  H HG13 . VAL A 1 24 ? 2.300   0.759   -8.173  1.00 0.00 ? 24 VAL A HG13 5  
ATOM 6808  H HG21 . VAL A 1 24 ? 0.362   1.977   -6.700  1.00 0.00 ? 24 VAL A HG21 5  
ATOM 6809  H HG22 . VAL A 1 24 ? -0.052  2.711   -8.252  1.00 0.00 ? 24 VAL A HG22 5  
ATOM 6810  H HG23 . VAL A 1 24 ? 0.272   3.727   -6.851  1.00 0.00 ? 24 VAL A HG23 5  
ATOM 6811  N N    . ASN A 1 25 ? 4.718   4.160   -7.449  1.00 0.00 ? 25 ASN A N    5  
ATOM 6812  C CA   . ASN A 1 25 ? 6.014   4.378   -8.113  1.00 0.00 ? 25 ASN A CA   5  
ATOM 6813  C C    . ASN A 1 25 ? 7.171   4.408   -7.113  1.00 0.00 ? 25 ASN A C    5  
ATOM 6814  O O    . ASN A 1 25 ? 8.126   3.637   -7.241  1.00 0.00 ? 25 ASN A O    5  
ATOM 6815  C CB   . ASN A 1 25 ? 6.002   5.683   -8.945  1.00 0.00 ? 25 ASN A CB   5  
ATOM 6816  C CG   . ASN A 1 25 ? 5.011   5.632   -10.100 1.00 0.00 ? 25 ASN A CG   5  
ATOM 6817  O OD1  . ASN A 1 25 ? 5.319   5.110   -11.172 1.00 0.00 ? 25 ASN A OD1  5  
ATOM 6818  N ND2  . ASN A 1 25 ? 3.833   6.201   -9.914  1.00 0.00 ? 25 ASN A ND2  5  
ATOM 6819  H H    . ASN A 1 25 ? 4.054   4.885   -7.447  1.00 0.00 ? 25 ASN A H    5  
ATOM 6820  H HA   . ASN A 1 25 ? 6.169   3.540   -8.792  1.00 0.00 ? 25 ASN A HA   5  
ATOM 6821  H HB2  . ASN A 1 25 ? 5.753   6.521   -8.297  1.00 0.00 ? 25 ASN A HB2  5  
ATOM 6822  H HB3  . ASN A 1 25 ? 6.990   5.859   -9.359  1.00 0.00 ? 25 ASN A HB3  5  
ATOM 6823  H HD21 . ASN A 1 25 ? 3.655   6.630   -9.051  1.00 0.00 ? 25 ASN A HD21 5  
ATOM 6824  H HD22 . ASN A 1 25 ? 3.188   6.175   -10.651 1.00 0.00 ? 25 ASN A HD22 5  
ATOM 6825  N N    . ASN A 1 26 ? 7.049   5.268   -6.098  1.00 0.00 ? 26 ASN A N    5  
ATOM 6826  C CA   . ASN A 1 26 ? 8.165   5.622   -5.203  1.00 0.00 ? 26 ASN A CA   5  
ATOM 6827  C C    . ASN A 1 26 ? 8.324   4.608   -4.057  1.00 0.00 ? 26 ASN A C    5  
ATOM 6828  O O    . ASN A 1 26 ? 9.402   4.519   -3.460  1.00 0.00 ? 26 ASN A O    5  
ATOM 6829  C CB   . ASN A 1 26 ? 7.937   7.042   -4.619  1.00 0.00 ? 26 ASN A CB   5  
ATOM 6830  C CG   . ASN A 1 26 ? 7.716   8.099   -5.708  1.00 0.00 ? 26 ASN A CG   5  
ATOM 6831  O OD1  . ASN A 1 26 ? 6.590   8.308   -6.161  1.00 0.00 ? 26 ASN A OD1  5  
ATOM 6832  N ND2  . ASN A 1 26 ? 8.779   8.761   -6.139  1.00 0.00 ? 26 ASN A ND2  5  
ATOM 6833  H H    . ASN A 1 26 ? 6.179   5.683   -5.917  1.00 0.00 ? 26 ASN A H    5  
ATOM 6834  H HA   . ASN A 1 26 ? 9.083   5.632   -5.791  1.00 0.00 ? 26 ASN A HA   5  
ATOM 6835  H HB2  . ASN A 1 26 ? 7.062   7.032   -3.976  1.00 0.00 ? 26 ASN A HB2  5  
ATOM 6836  H HB3  . ASN A 1 26 ? 8.800   7.331   -4.023  1.00 0.00 ? 26 ASN A HB3  5  
ATOM 6837  H HD21 . ASN A 1 26 ? 9.653   8.545   -5.746  1.00 0.00 ? 26 ASN A HD21 5  
ATOM 6838  H HD22 . ASN A 1 26 ? 8.651   9.446   -6.825  1.00 0.00 ? 26 ASN A HD22 5  
ATOM 6839  N N    . TYR A 1 27 ? 7.255   3.842   -3.730  1.00 0.00 ? 27 TYR A N    5  
ATOM 6840  C CA   . TYR A 1 27 ? 7.234   2.998   -2.508  1.00 0.00 ? 27 TYR A CA   5  
ATOM 6841  C C    . TYR A 1 27 ? 6.978   1.502   -2.817  1.00 0.00 ? 27 TYR A C    5  
ATOM 6842  O O    . TYR A 1 27 ? 7.888   0.659   -2.642  1.00 0.00 ? 27 TYR A O    5  
ATOM 6843  C CB   . TYR A 1 27 ? 6.191   3.558   -1.488  1.00 0.00 ? 27 TYR A CB   5  
ATOM 6844  C CG   . TYR A 1 27 ? 6.414   5.041   -1.134  1.00 0.00 ? 27 TYR A CG   5  
ATOM 6845  C CD1  . TYR A 1 27 ? 7.370   5.431   -0.195  1.00 0.00 ? 27 TYR A CD1  5  
ATOM 6846  C CD2  . TYR A 1 27 ? 5.686   6.055   -1.763  1.00 0.00 ? 27 TYR A CD2  5  
ATOM 6847  C CE1  . TYR A 1 27 ? 7.576   6.768   0.096   1.00 0.00 ? 27 TYR A CE1  5  
ATOM 6848  C CE2  . TYR A 1 27 ? 5.893   7.384   -1.470  1.00 0.00 ? 27 TYR A CE2  5  
ATOM 6849  C CZ   . TYR A 1 27 ? 6.834   7.732   -0.543  1.00 0.00 ? 27 TYR A CZ   5  
ATOM 6850  O OH   . TYR A 1 27 ? 7.039   9.056   -0.252  1.00 0.00 ? 27 TYR A OH   5  
ATOM 6851  H H    . TYR A 1 27 ? 6.468   3.852   -4.311  1.00 0.00 ? 27 TYR A H    5  
ATOM 6852  H HA   . TYR A 1 27 ? 8.219   3.071   -2.041  1.00 0.00 ? 27 TYR A HA   5  
ATOM 6853  H HB2  . TYR A 1 27 ? 5.190   3.451   -1.901  1.00 0.00 ? 27 TYR A HB2  5  
ATOM 6854  H HB3  . TYR A 1 27 ? 6.245   2.985   -0.569  1.00 0.00 ? 27 TYR A HB3  5  
ATOM 6855  H HD1  . TYR A 1 27 ? 7.957   4.672   0.317   1.00 0.00 ? 27 TYR A HD1  5  
ATOM 6856  H HD2  . TYR A 1 27 ? 4.947   5.786   -2.501  1.00 0.00 ? 27 TYR A HD2  5  
ATOM 6857  H HE1  . TYR A 1 27 ? 8.324   7.053   0.825   1.00 0.00 ? 27 TYR A HE1  5  
ATOM 6858  H HE2  . TYR A 1 27 ? 5.313   8.149   -1.971  1.00 0.00 ? 27 TYR A HE2  5  
ATOM 6859  H HH   . TYR A 1 27 ? 7.976   9.256   -0.351  1.00 0.00 ? 27 TYR A HH   5  
ATOM 6860  N N    . LEU A 1 28 ? 5.737   1.182   -3.256  1.00 0.00 ? 28 LEU A N    5  
ATOM 6861  C CA   . LEU A 1 28 ? 5.268   -0.206  -3.460  1.00 0.00 ? 28 LEU A CA   5  
ATOM 6862  C C    . LEU A 1 28 ? 6.155   -0.958  -4.470  1.00 0.00 ? 28 LEU A C    5  
ATOM 6863  O O    . LEU A 1 28 ? 6.742   -1.992  -4.129  1.00 0.00 ? 28 LEU A O    5  
ATOM 6864  C CB   . LEU A 1 28 ? 3.787   -0.224  -3.926  1.00 0.00 ? 28 LEU A CB   5  
ATOM 6865  C CG   . LEU A 1 28 ? 3.135   -1.642  -4.068  1.00 0.00 ? 28 LEU A CG   5  
ATOM 6866  C CD1  . LEU A 1 28 ? 3.105   -2.404  -2.721  1.00 0.00 ? 28 LEU A CD1  5  
ATOM 6867  C CD2  . LEU A 1 28 ? 1.727   -1.544  -4.676  1.00 0.00 ? 28 LEU A CD2  5  
ATOM 6868  H H    . LEU A 1 28 ? 5.109   1.908   -3.428  1.00 0.00 ? 28 LEU A H    5  
ATOM 6869  H HA   . LEU A 1 28 ? 5.330   -0.712  -2.497  1.00 0.00 ? 28 LEU A HA   5  
ATOM 6870  H HB2  . LEU A 1 28 ? 3.199   0.356   -3.216  1.00 0.00 ? 28 LEU A HB2  5  
ATOM 6871  H HB3  . LEU A 1 28 ? 3.732   0.278   -4.889  1.00 0.00 ? 28 LEU A HB3  5  
ATOM 6872  H HG   . LEU A 1 28 ? 3.740   -2.229  -4.750  1.00 0.00 ? 28 LEU A HG   5  
ATOM 6873  H HD11 . LEU A 1 28 ? 2.543   -1.840  -1.985  1.00 0.00 ? 28 LEU A HD11 5  
ATOM 6874  H HD12 . LEU A 1 28 ? 4.115   -2.550  -2.359  1.00 0.00 ? 28 LEU A HD12 5  
ATOM 6875  H HD13 . LEU A 1 28 ? 2.640   -3.373  -2.859  1.00 0.00 ? 28 LEU A HD13 5  
ATOM 6876  H HD21 . LEU A 1 28 ? 1.784   -1.078  -5.649  1.00 0.00 ? 28 LEU A HD21 5  
ATOM 6877  H HD22 . LEU A 1 28 ? 1.087   -0.952  -4.031  1.00 0.00 ? 28 LEU A HD22 5  
ATOM 6878  H HD23 . LEU A 1 28 ? 1.308   -2.535  -4.783  1.00 0.00 ? 28 LEU A HD23 5  
ATOM 6879  N N    . SER A 1 29 ? 6.277   -0.386  -5.686  1.00 0.00 ? 29 SER A N    5  
ATOM 6880  C CA   . SER A 1 29 ? 7.082   -0.949  -6.794  1.00 0.00 ? 29 SER A CA   5  
ATOM 6881  C C    . SER A 1 29 ? 8.578   -1.088  -6.439  1.00 0.00 ? 29 SER A C    5  
ATOM 6882  O O    . SER A 1 29 ? 9.295   -1.855  -7.085  1.00 0.00 ? 29 SER A O    5  
ATOM 6883  C CB   . SER A 1 29 ? 6.935   -0.051  -8.044  1.00 0.00 ? 29 SER A CB   5  
ATOM 6884  O OG   . SER A 1 29 ? 5.573   0.124   -8.379  1.00 0.00 ? 29 SER A OG   5  
ATOM 6885  H H    . SER A 1 29 ? 5.778   0.437   -5.860  1.00 0.00 ? 29 SER A H    5  
ATOM 6886  H HA   . SER A 1 29 ? 6.681   -1.930  -7.025  1.00 0.00 ? 29 SER A HA   5  
ATOM 6887  H HB2  . SER A 1 29 ? 7.370   0.926   -7.851  1.00 0.00 ? 29 SER A HB2  5  
ATOM 6888  H HB3  . SER A 1 29 ? 7.442   -0.505  -8.885  1.00 0.00 ? 29 SER A HB3  5  
ATOM 6889  H HG   . SER A 1 29 ? 5.396   1.060   -8.519  1.00 0.00 ? 29 SER A HG   5  
ATOM 6890  N N    . LYS A 1 30 ? 9.034   -0.336  -5.420  1.00 0.00 ? 30 LYS A N    5  
ATOM 6891  C CA   . LYS A 1 30 ? 10.445  -0.319  -4.982  1.00 0.00 ? 30 LYS A CA   5  
ATOM 6892  C C    . LYS A 1 30 ? 10.694  -1.312  -3.835  1.00 0.00 ? 30 LYS A C    5  
ATOM 6893  O O    . LYS A 1 30 ? 11.846  -1.545  -3.467  1.00 0.00 ? 30 LYS A O    5  
ATOM 6894  C CB   . LYS A 1 30 ? 10.838  1.119   -4.549  1.00 0.00 ? 30 LYS A CB   5  
ATOM 6895  C CG   . LYS A 1 30 ? 10.663  2.182   -5.651  1.00 0.00 ? 30 LYS A CG   5  
ATOM 6896  C CD   . LYS A 1 30 ? 11.407  1.829   -6.961  1.00 0.00 ? 30 LYS A CD   5  
ATOM 6897  C CE   . LYS A 1 30 ? 11.164  2.857   -8.075  1.00 0.00 ? 30 LYS A CE   5  
ATOM 6898  N NZ   . LYS A 1 30 ? 11.736  2.404   -9.371  1.00 0.00 ? 30 LYS A NZ   5  
ATOM 6899  H H    . LYS A 1 30 ? 8.399   0.225   -4.932  1.00 0.00 ? 30 LYS A H    5  
ATOM 6900  H HA   . LYS A 1 30 ? 11.068  -0.607  -5.827  1.00 0.00 ? 30 LYS A HA   5  
ATOM 6901  H HB2  . LYS A 1 30 ? 10.227  1.413   -3.696  1.00 0.00 ? 30 LYS A HB2  5  
ATOM 6902  H HB3  . LYS A 1 30 ? 11.876  1.122   -4.238  1.00 0.00 ? 30 LYS A HB3  5  
ATOM 6903  H HG2  . LYS A 1 30 ? 9.608   2.275   -5.866  1.00 0.00 ? 30 LYS A HG2  5  
ATOM 6904  H HG3  . LYS A 1 30 ? 11.032  3.136   -5.282  1.00 0.00 ? 30 LYS A HG3  5  
ATOM 6905  H HD2  . LYS A 1 30 ? 12.471  1.778   -6.764  1.00 0.00 ? 30 LYS A HD2  5  
ATOM 6906  H HD3  . LYS A 1 30 ? 11.066  0.858   -7.306  1.00 0.00 ? 30 LYS A HD3  5  
ATOM 6907  H HE2  . LYS A 1 30 ? 10.097  3.001   -8.203  1.00 0.00 ? 30 LYS A HE2  5  
ATOM 6908  H HE3  . LYS A 1 30 ? 11.620  3.801   -7.799  1.00 0.00 ? 30 LYS A HE3  5  
ATOM 6909  H HZ1  . LYS A 1 30 ? 12.767  2.275   -9.290  1.00 0.00 ? 30 LYS A HZ1  5  
ATOM 6910  H HZ2  . LYS A 1 30 ? 11.541  3.105   -10.107 1.00 0.00 ? 30 LYS A HZ2  5  
ATOM 6911  H HZ3  . LYS A 1 30 ? 11.307  1.499   -9.652  1.00 0.00 ? 30 LYS A HZ3  5  
ATOM 6912  N N    . GLY A 1 31 ? 9.600   -1.885  -3.285  1.00 0.00 ? 31 GLY A N    5  
ATOM 6913  C CA   . GLY A 1 31 ? 9.664   -2.828  -2.167  1.00 0.00 ? 31 GLY A CA   5  
ATOM 6914  C C    . GLY A 1 31 ? 10.177  -2.226  -0.865  1.00 0.00 ? 31 GLY A C    5  
ATOM 6915  O O    . GLY A 1 31 ? 10.633  -2.960  0.019   1.00 0.00 ? 31 GLY A O    5  
ATOM 6916  H H    . GLY A 1 31 ? 8.728   -1.708  -3.692  1.00 0.00 ? 31 GLY A H    5  
ATOM 6917  H HA2  . GLY A 1 31 ? 8.667   -3.208  -1.992  1.00 0.00 ? 31 GLY A HA2  5  
ATOM 6918  H HA3  . GLY A 1 31 ? 10.300  -3.659  -2.450  1.00 0.00 ? 31 GLY A HA3  5  
ATOM 6919  N N    . VAL A 1 32 ? 10.089  -0.880  -0.729  1.00 0.00 ? 32 VAL A N    5  
ATOM 6920  C CA   . VAL A 1 32 ? 10.528  -0.172  0.497   1.00 0.00 ? 32 VAL A CA   5  
ATOM 6921  C C    . VAL A 1 32 ? 9.450   -0.251  1.596   1.00 0.00 ? 32 VAL A C    5  
ATOM 6922  O O    . VAL A 1 32 ? 9.681   0.182   2.727   1.00 0.00 ? 32 VAL A O    5  
ATOM 6923  C CB   . VAL A 1 32 ? 10.898  1.338   0.228   1.00 0.00 ? 32 VAL A CB   5  
ATOM 6924  C CG1  . VAL A 1 32 ? 11.899  1.478   -0.938  1.00 0.00 ? 32 VAL A CG1  5  
ATOM 6925  C CG2  . VAL A 1 32 ? 9.649   2.222   0.006   1.00 0.00 ? 32 VAL A CG2  5  
ATOM 6926  H H    . VAL A 1 32 ? 9.707   -0.351  -1.467  1.00 0.00 ? 32 VAL A H    5  
ATOM 6927  H HA   . VAL A 1 32 ? 11.418  -0.675  0.864   1.00 0.00 ? 32 VAL A HA   5  
ATOM 6928  H HB   . VAL A 1 32 ? 11.399  1.707   1.124   1.00 0.00 ? 32 VAL A HB   5  
ATOM 6929  H HG11 . VAL A 1 32 ? 11.460  1.088   -1.847  1.00 0.00 ? 32 VAL A HG11 5  
ATOM 6930  H HG12 . VAL A 1 32 ? 12.802  0.927   -0.714  1.00 0.00 ? 32 VAL A HG12 5  
ATOM 6931  H HG13 . VAL A 1 32 ? 12.149  2.523   -1.082  1.00 0.00 ? 32 VAL A HG13 5  
ATOM 6932  H HG21 . VAL A 1 32 ? 9.011   2.178   0.880   1.00 0.00 ? 32 VAL A HG21 5  
ATOM 6933  H HG22 . VAL A 1 32 ? 9.098   1.865   -0.853  1.00 0.00 ? 32 VAL A HG22 5  
ATOM 6934  H HG23 . VAL A 1 32 ? 9.946   3.251   -0.161  1.00 0.00 ? 32 VAL A HG23 5  
ATOM 6935  N N    . VAL A 1 33 ? 8.283   -0.823  1.250   1.00 0.00 ? 33 VAL A N    5  
ATOM 6936  C CA   . VAL A 1 33 ? 7.126   -0.894  2.144   1.00 0.00 ? 33 VAL A CA   5  
ATOM 6937  C C    . VAL A 1 33 ? 7.146   -2.231  2.895   1.00 0.00 ? 33 VAL A C    5  
ATOM 6938  O O    . VAL A 1 33 ? 7.301   -3.295  2.277   1.00 0.00 ? 33 VAL A O    5  
ATOM 6939  C CB   . VAL A 1 33 ? 5.762   -0.749  1.367   1.00 0.00 ? 33 VAL A CB   5  
ATOM 6940  C CG1  . VAL A 1 33 ? 4.570   -0.612  2.344   1.00 0.00 ? 33 VAL A CG1  5  
ATOM 6941  C CG2  . VAL A 1 33 ? 5.806   0.435   0.386   1.00 0.00 ? 33 VAL A CG2  5  
ATOM 6942  H H    . VAL A 1 33 ? 8.220   -1.259  0.381   1.00 0.00 ? 33 VAL A H    5  
ATOM 6943  H HA   . VAL A 1 33 ? 7.200   -0.078  2.870   1.00 0.00 ? 33 VAL A HA   5  
ATOM 6944  H HB   . VAL A 1 33 ? 5.607   -1.657  0.780   1.00 0.00 ? 33 VAL A HB   5  
ATOM 6945  H HG11 . VAL A 1 33 ? 3.648   -0.531  1.785   1.00 0.00 ? 33 VAL A HG11 5  
ATOM 6946  H HG12 . VAL A 1 33 ? 4.695   0.275   2.956   1.00 0.00 ? 33 VAL A HG12 5  
ATOM 6947  H HG13 . VAL A 1 33 ? 4.523   -1.481  2.986   1.00 0.00 ? 33 VAL A HG13 5  
ATOM 6948  H HG21 . VAL A 1 33 ? 6.617   0.294   -0.321  1.00 0.00 ? 33 VAL A HG21 5  
ATOM 6949  H HG22 . VAL A 1 33 ? 5.966   1.359   0.927   1.00 0.00 ? 33 VAL A HG22 5  
ATOM 6950  H HG23 . VAL A 1 33 ? 4.873   0.499   -0.160  1.00 0.00 ? 33 VAL A HG23 5  
ATOM 6951  N N    . ASP A 1 34 ? 6.998   -2.155  4.217   1.00 0.00 ? 34 ASP A N    5  
ATOM 6952  C CA   . ASP A 1 34 ? 6.946   -3.311  5.113   1.00 0.00 ? 34 ASP A CA   5  
ATOM 6953  C C    . ASP A 1 34 ? 5.516   -3.871  5.155   1.00 0.00 ? 34 ASP A C    5  
ATOM 6954  O O    . ASP A 1 34 ? 5.298   -5.060  4.938   1.00 0.00 ? 34 ASP A O    5  
ATOM 6955  C CB   . ASP A 1 34 ? 7.397   -2.876  6.532   1.00 0.00 ? 34 ASP A CB   5  
ATOM 6956  C CG   . ASP A 1 34 ? 7.345   -4.015  7.551   1.00 0.00 ? 34 ASP A CG   5  
ATOM 6957  O OD1  . ASP A 1 34 ? 8.236   -4.879  7.516   1.00 0.00 ? 34 ASP A OD1  5  
ATOM 6958  O OD2  . ASP A 1 34 ? 6.406   -4.065  8.379   1.00 0.00 ? 34 ASP A OD2  5  
ATOM 6959  H H    . ASP A 1 34 ? 6.893   -1.276  4.616   1.00 0.00 ? 34 ASP A H    5  
ATOM 6960  H HA   . ASP A 1 34 ? 7.629   -4.079  4.742   1.00 0.00 ? 34 ASP A HA   5  
ATOM 6961  H HB2  . ASP A 1 34 ? 8.417   -2.509  6.483   1.00 0.00 ? 34 ASP A HB2  5  
ATOM 6962  H HB3  . ASP A 1 34 ? 6.763   -2.061  6.880   1.00 0.00 ? 34 ASP A HB3  5  
ATOM 6963  N N    . ARG A 1 35 ? 4.566   -2.973  5.424   1.00 0.00 ? 35 ARG A N    5  
ATOM 6964  C CA   . ARG A 1 35 ? 3.147   -3.310  5.621   1.00 0.00 ? 35 ARG A CA   5  
ATOM 6965  C C    . ARG A 1 35 ? 2.287   -2.059  5.366   1.00 0.00 ? 35 ARG A C    5  
ATOM 6966  O O    . ARG A 1 35 ? 2.787   -0.919  5.390   1.00 0.00 ? 35 ARG A O    5  
ATOM 6967  C CB   . ARG A 1 35 ? 2.911   -3.866  7.061   1.00 0.00 ? 35 ARG A CB   5  
ATOM 6968  C CG   . ARG A 1 35 ? 3.140   -2.826  8.177   1.00 0.00 ? 35 ARG A CG   5  
ATOM 6969  C CD   . ARG A 1 35 ? 3.070   -3.384  9.601   1.00 0.00 ? 35 ARG A CD   5  
ATOM 6970  N NE   . ARG A 1 35 ? 3.202   -2.304  10.596  1.00 0.00 ? 35 ARG A NE   5  
ATOM 6971  C CZ   . ARG A 1 35 ? 3.745   -2.422  11.812  1.00 0.00 ? 35 ARG A CZ   5  
ATOM 6972  N NH1  . ARG A 1 35 ? 4.227   -3.581  12.243  1.00 0.00 ? 35 ARG A NH1  5  
ATOM 6973  N NH2  . ARG A 1 35 ? 3.764   -1.370  12.606  1.00 0.00 ? 35 ARG A NH2  5  
ATOM 6974  H H    . ARG A 1 35 ? 4.834   -2.032  5.464   1.00 0.00 ? 35 ARG A H    5  
ATOM 6975  H HA   . ARG A 1 35 ? 2.872   -4.068  4.890   1.00 0.00 ? 35 ARG A HA   5  
ATOM 6976  H HB2  . ARG A 1 35 ? 1.894   -4.241  7.136   1.00 0.00 ? 35 ARG A HB2  5  
ATOM 6977  H HB3  . ARG A 1 35 ? 3.594   -4.695  7.220   1.00 0.00 ? 35 ARG A HB3  5  
ATOM 6978  H HG2  . ARG A 1 35 ? 4.124   -2.387  8.037   1.00 0.00 ? 35 ARG A HG2  5  
ATOM 6979  H HG3  . ARG A 1 35 ? 2.399   -2.042  8.074   1.00 0.00 ? 35 ARG A HG3  5  
ATOM 6980  H HD2  . ARG A 1 35 ? 2.111   -3.874  9.749   1.00 0.00 ? 35 ARG A HD2  5  
ATOM 6981  H HD3  . ARG A 1 35 ? 3.868   -4.107  9.744   1.00 0.00 ? 35 ARG A HD3  5  
ATOM 6982  H HE   . ARG A 1 35 ? 2.872   -1.420  10.327  1.00 0.00 ? 35 ARG A HE   5  
ATOM 6983  H HH11 . ARG A 1 35 ? 4.188   -4.395  11.648  1.00 0.00 ? 35 ARG A HH11 5  
ATOM 6984  H HH12 . ARG A 1 35 ? 4.620   -3.663  13.161  1.00 0.00 ? 35 ARG A HH12 5  
ATOM 6985  H HH21 . ARG A 1 35 ? 3.383   -0.492  12.292  1.00 0.00 ? 35 ARG A HH21 5  
ATOM 6986  H HH22 . ARG A 1 35 ? 4.160   -1.443  13.523  1.00 0.00 ? 35 ARG A HH22 5  
ATOM 6987  N N    . LEU A 1 36 ? 1.000   -2.286  5.109   1.00 0.00 ? 36 LEU A N    5  
ATOM 6988  C CA   . LEU A 1 36 ? 0.020   -1.234  4.858   1.00 0.00 ? 36 LEU A CA   5  
ATOM 6989  C C    . LEU A 1 36 ? -1.053  -1.288  5.936   1.00 0.00 ? 36 LEU A C    5  
ATOM 6990  O O    . LEU A 1 36 ? -1.943  -2.145  5.896   1.00 0.00 ? 36 LEU A O    5  
ATOM 6991  C CB   . LEU A 1 36 ? -0.585  -1.414  3.443   1.00 0.00 ? 36 LEU A CB   5  
ATOM 6992  C CG   . LEU A 1 36 ? 0.383   -1.094  2.271   1.00 0.00 ? 36 LEU A CG   5  
ATOM 6993  C CD1  . LEU A 1 36 ? -0.275  -1.393  0.914   1.00 0.00 ? 36 LEU A CD1  5  
ATOM 6994  C CD2  . LEU A 1 36 ? 0.895   0.369   2.361   1.00 0.00 ? 36 LEU A CD2  5  
ATOM 6995  H H    . LEU A 1 36 ? 0.690   -3.207  5.085   1.00 0.00 ? 36 LEU A H    5  
ATOM 6996  H HA   . LEU A 1 36 ? 0.519   -0.260  4.905   1.00 0.00 ? 36 LEU A HA   5  
ATOM 6997  H HB2  . LEU A 1 36 ? -0.924  -2.442  3.345   1.00 0.00 ? 36 LEU A HB2  5  
ATOM 6998  H HB3  . LEU A 1 36 ? -1.454  -0.766  3.347   1.00 0.00 ? 36 LEU A HB3  5  
ATOM 6999  H HG   . LEU A 1 36 ? 1.251   -1.742  2.352   1.00 0.00 ? 36 LEU A HG   5  
ATOM 7000  H HD11 . LEU A 1 36 ? -0.607  -2.423  0.891   1.00 0.00 ? 36 LEU A HD11 5  
ATOM 7001  H HD12 . LEU A 1 36 ? 0.440   -1.239  0.121   1.00 0.00 ? 36 LEU A HD12 5  
ATOM 7002  H HD13 . LEU A 1 36 ? -1.127  -0.740  0.762   1.00 0.00 ? 36 LEU A HD13 5  
ATOM 7003  H HD21 . LEU A 1 36 ? 0.062   1.058   2.294   1.00 0.00 ? 36 LEU A HD21 5  
ATOM 7004  H HD22 . LEU A 1 36 ? 1.585   0.567   1.553   1.00 0.00 ? 36 LEU A HD22 5  
ATOM 7005  H HD23 . LEU A 1 36 ? 1.407   0.520   3.302   1.00 0.00 ? 36 LEU A HD23 5  
ATOM 7006  N N    . GLU A 1 37 ? -0.960  -0.359  6.888   1.00 0.00 ? 37 GLU A N    5  
ATOM 7007  C CA   . GLU A 1 37 ? -1.852  -0.301  8.043   1.00 0.00 ? 37 GLU A CA   5  
ATOM 7008  C C    . GLU A 1 37 ? -3.096  0.518   7.685   1.00 0.00 ? 37 GLU A C    5  
ATOM 7009  O O    . GLU A 1 37 ? -3.016  1.736   7.546   1.00 0.00 ? 37 GLU A O    5  
ATOM 7010  C CB   . GLU A 1 37 ? -1.107  0.315   9.245   1.00 0.00 ? 37 GLU A CB   5  
ATOM 7011  C CG   . GLU A 1 37 ? 0.161   -0.470  9.643   1.00 0.00 ? 37 GLU A CG   5  
ATOM 7012  C CD   . GLU A 1 37 ? 0.987   0.260   10.694  1.00 0.00 ? 37 GLU A CD   5  
ATOM 7013  O OE1  . GLU A 1 37 ? 1.579   1.290   10.350  1.00 0.00 ? 37 GLU A OE1  5  
ATOM 7014  O OE2  . GLU A 1 37 ? 1.036   -0.170  11.865  1.00 0.00 ? 37 GLU A OE2  5  
ATOM 7015  H H    . GLU A 1 37 ? -0.260  0.324   6.804   1.00 0.00 ? 37 GLU A H    5  
ATOM 7016  H HA   . GLU A 1 37 ? -2.150  -1.320  8.300   1.00 0.00 ? 37 GLU A HA   5  
ATOM 7017  H HB2  . GLU A 1 37 ? -0.822  1.338   8.995   1.00 0.00 ? 37 GLU A HB2  5  
ATOM 7018  H HB3  . GLU A 1 37 ? -1.773  0.344   10.100  1.00 0.00 ? 37 GLU A HB3  5  
ATOM 7019  H HG2  . GLU A 1 37 ? -0.126  -1.448  10.021  1.00 0.00 ? 37 GLU A HG2  5  
ATOM 7020  H HG3  . GLU A 1 37 ? 0.781   -0.610  8.760   1.00 0.00 ? 37 GLU A HG3  5  
ATOM 7021  N N    . VAL A 1 38 ? -4.241  -0.151  7.542   1.00 0.00 ? 38 VAL A N    5  
ATOM 7022  C CA   . VAL A 1 38 ? -5.491  0.499   7.147   1.00 0.00 ? 38 VAL A CA   5  
ATOM 7023  C C    . VAL A 1 38 ? -6.131  1.058   8.421   1.00 0.00 ? 38 VAL A C    5  
ATOM 7024  O O    . VAL A 1 38 ? -6.837  0.343   9.151   1.00 0.00 ? 38 VAL A O    5  
ATOM 7025  C CB   . VAL A 1 38 ? -6.441  -0.504  6.408   1.00 0.00 ? 38 VAL A CB   5  
ATOM 7026  C CG1  . VAL A 1 38 ? -7.716  0.197   5.897   1.00 0.00 ? 38 VAL A CG1  5  
ATOM 7027  C CG2  . VAL A 1 38 ? -5.696  -1.210  5.258   1.00 0.00 ? 38 VAL A CG2  5  
ATOM 7028  H H    . VAL A 1 38 ? -4.267  -1.097  7.794   1.00 0.00 ? 38 VAL A H    5  
ATOM 7029  H HA   . VAL A 1 38 ? -5.264  1.325   6.465   1.00 0.00 ? 38 VAL A HA   5  
ATOM 7030  H HB   . VAL A 1 38 ? -6.747  -1.266  7.121   1.00 0.00 ? 38 VAL A HB   5  
ATOM 7031  H HG11 . VAL A 1 38 ? -8.354  -0.519  5.397   1.00 0.00 ? 38 VAL A HG11 5  
ATOM 7032  H HG12 . VAL A 1 38 ? -7.448  0.983   5.205   1.00 0.00 ? 38 VAL A HG12 5  
ATOM 7033  H HG13 . VAL A 1 38 ? -8.254  0.628   6.733   1.00 0.00 ? 38 VAL A HG13 5  
ATOM 7034  H HG21 . VAL A 1 38 ? -6.351  -1.931  4.781   1.00 0.00 ? 38 VAL A HG21 5  
ATOM 7035  H HG22 . VAL A 1 38 ? -4.829  -1.728  5.650   1.00 0.00 ? 38 VAL A HG22 5  
ATOM 7036  H HG23 . VAL A 1 38 ? -5.374  -0.484  4.523   1.00 0.00 ? 38 VAL A HG23 5  
ATOM 7037  N N    . VAL A 1 39 ? -5.825  2.327   8.706   1.00 0.00 ? 39 VAL A N    5  
ATOM 7038  C CA   . VAL A 1 39 ? -6.116  2.961   9.989   1.00 0.00 ? 39 VAL A CA   5  
ATOM 7039  C C    . VAL A 1 39 ? -7.580  3.432   10.026  1.00 0.00 ? 39 VAL A C    5  
ATOM 7040  O O    . VAL A 1 39 ? -7.963  4.370   9.301   1.00 0.00 ? 39 VAL A O    5  
ATOM 7041  C CB   . VAL A 1 39 ? -5.113  4.145   10.257  1.00 0.00 ? 39 VAL A CB   5  
ATOM 7042  C CG1  . VAL A 1 39 ? -5.412  4.862   11.591  1.00 0.00 ? 39 VAL A CG1  5  
ATOM 7043  C CG2  . VAL A 1 39 ? -3.640  3.650   10.210  1.00 0.00 ? 39 VAL A CG2  5  
ATOM 7044  H H    . VAL A 1 39 ? -5.409  2.892   8.015   1.00 0.00 ? 39 VAL A H    5  
ATOM 7045  H HA   . VAL A 1 39 ? -5.959  2.214   10.768  1.00 0.00 ? 39 VAL A HA   5  
ATOM 7046  H HB   . VAL A 1 39 ? -5.240  4.877   9.458   1.00 0.00 ? 39 VAL A HB   5  
ATOM 7047  H HG11 . VAL A 1 39 ? -6.419  5.261   11.578  1.00 0.00 ? 39 VAL A HG11 5  
ATOM 7048  H HG12 . VAL A 1 39 ? -4.715  5.678   11.738  1.00 0.00 ? 39 VAL A HG12 5  
ATOM 7049  H HG13 . VAL A 1 39 ? -5.317  4.165   12.415  1.00 0.00 ? 39 VAL A HG13 5  
ATOM 7050  H HG21 . VAL A 1 39 ? -2.968  4.486   10.355  1.00 0.00 ? 39 VAL A HG21 5  
ATOM 7051  H HG22 . VAL A 1 39 ? -3.436  3.196   9.247   1.00 0.00 ? 39 VAL A HG22 5  
ATOM 7052  H HG23 . VAL A 1 39 ? -3.470  2.918   10.990  1.00 0.00 ? 39 VAL A HG23 5  
ATOM 7053  N N    . ASN A 1 40 ? -8.383  2.723   10.864  1.00 0.00 ? 40 ASN A N    5  
ATOM 7054  C CA   . ASN A 1 40 ? -9.839  2.923   11.034  1.00 0.00 ? 40 ASN A CA   5  
ATOM 7055  C C    . ASN A 1 40 ? -10.611 2.902   9.694   1.00 0.00 ? 40 ASN A C    5  
ATOM 7056  O O    . ASN A 1 40 ? -11.695 3.489   9.585   1.00 0.00 ? 40 ASN A O    5  
ATOM 7057  C CB   . ASN A 1 40 ? -10.116 4.220   11.853  1.00 0.00 ? 40 ASN A CB   5  
ATOM 7058  C CG   . ASN A 1 40 ? -9.680  4.088   13.317  1.00 0.00 ? 40 ASN A CG   5  
ATOM 7059  O OD1  . ASN A 1 40 ? -10.470 3.710   14.178  1.00 0.00 ? 40 ASN A OD1  5  
ATOM 7060  N ND2  . ASN A 1 40 ? -8.420  4.364   13.602  1.00 0.00 ? 40 ASN A ND2  5  
ATOM 7061  H H    . ASN A 1 40 ? -7.960  2.060   11.437  1.00 0.00 ? 40 ASN A H    5  
ATOM 7062  H HA   . ASN A 1 40 ? -10.198 2.077   11.610  1.00 0.00 ? 40 ASN A HA   5  
ATOM 7063  H HB2  . ASN A 1 40 ? -9.587  5.056   11.399  1.00 0.00 ? 40 ASN A HB2  5  
ATOM 7064  H HB3  . ASN A 1 40 ? -11.176 4.436   11.835  1.00 0.00 ? 40 ASN A HB3  5  
ATOM 7065  H HD21 . ASN A 1 40 ? -7.831  4.642   12.872  1.00 0.00 ? 40 ASN A HD21 5  
ATOM 7066  H HD22 . ASN A 1 40 ? -8.126  4.269   14.531  1.00 0.00 ? 40 ASN A HD22 5  
ATOM 7067  N N    . LYS A 1 41 ? -10.040 2.172   8.696   1.00 0.00 ? 41 LYS A N    5  
ATOM 7068  C CA   . LYS A 1 41 ? -10.551 2.083   7.303   1.00 0.00 ? 41 LYS A CA   5  
ATOM 7069  C C    . LYS A 1 41 ? -10.537 3.434   6.542   1.00 0.00 ? 41 LYS A C    5  
ATOM 7070  O O    . LYS A 1 41 ? -10.808 3.465   5.342   1.00 0.00 ? 41 LYS A O    5  
ATOM 7071  C CB   . LYS A 1 41 ? -11.966 1.441   7.258   1.00 0.00 ? 41 LYS A CB   5  
ATOM 7072  C CG   . LYS A 1 41 ? -12.036 -0.022  7.763   1.00 0.00 ? 41 LYS A CG   5  
ATOM 7073  C CD   . LYS A 1 41 ? -13.423 -0.677  7.509   1.00 0.00 ? 41 LYS A CD   5  
ATOM 7074  C CE   . LYS A 1 41 ? -14.599 0.130   8.098   1.00 0.00 ? 41 LYS A CE   5  
ATOM 7075  N NZ   . LYS A 1 41 ? -14.473 0.329   9.564   1.00 0.00 ? 41 LYS A NZ   5  
ATOM 7076  H H    . LYS A 1 41 ? -9.248  1.637   8.923   1.00 0.00 ? 41 LYS A H    5  
ATOM 7077  H HA   . LYS A 1 41 ? -9.875  1.425   6.777   1.00 0.00 ? 41 LYS A HA   5  
ATOM 7078  H HB2  . LYS A 1 41 ? -12.634 2.044   7.862   1.00 0.00 ? 41 LYS A HB2  5  
ATOM 7079  H HB3  . LYS A 1 41 ? -12.323 1.460   6.234   1.00 0.00 ? 41 LYS A HB3  5  
ATOM 7080  H HG2  . LYS A 1 41 ? -11.278 -0.606  7.251   1.00 0.00 ? 41 LYS A HG2  5  
ATOM 7081  H HG3  . LYS A 1 41 ? -11.830 -0.038  8.829   1.00 0.00 ? 41 LYS A HG3  5  
ATOM 7082  H HD2  . LYS A 1 41 ? -13.574 -0.773  6.440   1.00 0.00 ? 41 LYS A HD2  5  
ATOM 7083  H HD3  . LYS A 1 41 ? -13.426 -1.668  7.951   1.00 0.00 ? 41 LYS A HD3  5  
ATOM 7084  H HE2  . LYS A 1 41 ? -14.643 1.098   7.622   1.00 0.00 ? 41 LYS A HE2  5  
ATOM 7085  H HE3  . LYS A 1 41 ? -15.522 -0.401  7.903   1.00 0.00 ? 41 LYS A HE3  5  
ATOM 7086  H HZ1  . LYS A 1 41 ? -15.288 0.868   9.919   1.00 0.00 ? 41 LYS A HZ1  5  
ATOM 7087  H HZ2  . LYS A 1 41 ? -13.602 0.853   9.785   1.00 0.00 ? 41 LYS A HZ2  5  
ATOM 7088  H HZ3  . LYS A 1 41 ? -14.442 -0.587  10.046  1.00 0.00 ? 41 LYS A HZ3  5  
ATOM 7089  N N    . ARG A 1 42 ? -10.166 4.518   7.231   1.00 0.00 ? 42 ARG A N    5  
ATOM 7090  C CA   . ARG A 1 42 ? -10.272 5.898   6.730   1.00 0.00 ? 42 ARG A CA   5  
ATOM 7091  C C    . ARG A 1 42 ? -9.164  6.189   5.714   1.00 0.00 ? 42 ARG A C    5  
ATOM 7092  O O    . ARG A 1 42 ? -9.389  6.832   4.676   1.00 0.00 ? 42 ARG A O    5  
ATOM 7093  C CB   . ARG A 1 42 ? -10.192 6.855   7.946   1.00 0.00 ? 42 ARG A CB   5  
ATOM 7094  C CG   . ARG A 1 42 ? -10.289 8.363   7.626   1.00 0.00 ? 42 ARG A CG   5  
ATOM 7095  C CD   . ARG A 1 42 ? -10.371 9.218   8.903   1.00 0.00 ? 42 ARG A CD   5  
ATOM 7096  N NE   . ARG A 1 42 ? -11.556 8.870   9.724   1.00 0.00 ? 42 ARG A NE   5  
ATOM 7097  C CZ   . ARG A 1 42 ? -11.639 8.990   11.058  1.00 0.00 ? 42 ARG A CZ   5  
ATOM 7098  N NH1  . ARG A 1 42 ? -10.624 9.464   11.763  1.00 0.00 ? 42 ARG A NH1  5  
ATOM 7099  N NH2  . ARG A 1 42 ? -12.757 8.642   11.682  1.00 0.00 ? 42 ARG A NH2  5  
ATOM 7100  H H    . ARG A 1 42 ? -9.772  4.393   8.117   1.00 0.00 ? 42 ARG A H    5  
ATOM 7101  H HA   . ARG A 1 42 ? -11.242 6.019   6.245   1.00 0.00 ? 42 ARG A HA   5  
ATOM 7102  H HB2  . ARG A 1 42 ? -10.999 6.603   8.625   1.00 0.00 ? 42 ARG A HB2  5  
ATOM 7103  H HB3  . ARG A 1 42 ? -9.248  6.677   8.462   1.00 0.00 ? 42 ARG A HB3  5  
ATOM 7104  H HG2  . ARG A 1 42 ? -9.409  8.660   7.061   1.00 0.00 ? 42 ARG A HG2  5  
ATOM 7105  H HG3  . ARG A 1 42 ? -11.172 8.543   7.025   1.00 0.00 ? 42 ARG A HG3  5  
ATOM 7106  H HD2  . ARG A 1 42 ? -9.471  9.056   9.488   1.00 0.00 ? 42 ARG A HD2  5  
ATOM 7107  H HD3  . ARG A 1 42 ? -10.429 10.264  8.624   1.00 0.00 ? 42 ARG A HD3  5  
ATOM 7108  H HE   . ARG A 1 42 ? -12.333 8.520   9.244   1.00 0.00 ? 42 ARG A HE   5  
ATOM 7109  H HH11 . ARG A 1 42 ? -9.774  9.732   11.307  1.00 0.00 ? 42 ARG A HH11 5  
ATOM 7110  H HH12 . ARG A 1 42 ? -10.696 9.542   12.763  1.00 0.00 ? 42 ARG A HH12 5  
ATOM 7111  H HH21 . ARG A 1 42 ? -13.540 8.281   11.158  1.00 0.00 ? 42 ARG A HH21 5  
ATOM 7112  H HH22 . ARG A 1 42 ? -12.822 8.724   12.680  1.00 0.00 ? 42 ARG A HH22 5  
ATOM 7113  N N    . PHE A 1 43 ? -7.974  5.657   6.011   1.00 0.00 ? 43 PHE A N    5  
ATOM 7114  C CA   . PHE A 1 43 ? -6.787  5.813   5.175   1.00 0.00 ? 43 PHE A CA   5  
ATOM 7115  C C    . PHE A 1 43 ? -5.865  4.616   5.410   1.00 0.00 ? 43 PHE A C    5  
ATOM 7116  O O    . PHE A 1 43 ? -6.179  3.726   6.211   1.00 0.00 ? 43 PHE A O    5  
ATOM 7117  C CB   . PHE A 1 43 ? -6.056  7.160   5.465   1.00 0.00 ? 43 PHE A CB   5  
ATOM 7118  C CG   . PHE A 1 43 ? -5.384  7.271   6.835   1.00 0.00 ? 43 PHE A CG   5  
ATOM 7119  C CD1  . PHE A 1 43 ? -6.113  7.649   7.960   1.00 0.00 ? 43 PHE A CD1  5  
ATOM 7120  C CD2  . PHE A 1 43 ? -4.011  7.020   6.993   1.00 0.00 ? 43 PHE A CD2  5  
ATOM 7121  C CE1  . PHE A 1 43 ? -5.497  7.772   9.186   1.00 0.00 ? 43 PHE A CE1  5  
ATOM 7122  C CE2  . PHE A 1 43 ? -3.400  7.142   8.222   1.00 0.00 ? 43 PHE A CE2  5  
ATOM 7123  C CZ   . PHE A 1 43 ? -4.142  7.519   9.316   1.00 0.00 ? 43 PHE A CZ   5  
ATOM 7124  H H    . PHE A 1 43 ? -7.900  5.087   6.810   1.00 0.00 ? 43 PHE A H    5  
ATOM 7125  H HA   . PHE A 1 43 ? -7.103  5.797   4.133   1.00 0.00 ? 43 PHE A HA   5  
ATOM 7126  H HB2  . PHE A 1 43 ? -5.293  7.314   4.708   1.00 0.00 ? 43 PHE A HB2  5  
ATOM 7127  H HB3  . PHE A 1 43 ? -6.774  7.971   5.381   1.00 0.00 ? 43 PHE A HB3  5  
ATOM 7128  H HD1  . PHE A 1 43 ? -7.173  7.848   7.868   1.00 0.00 ? 43 PHE A HD1  5  
ATOM 7129  H HD2  . PHE A 1 43 ? -3.425  6.722   6.131   1.00 0.00 ? 43 PHE A HD2  5  
ATOM 7130  H HE1  . PHE A 1 43 ? -6.075  8.066   10.057  1.00 0.00 ? 43 PHE A HE1  5  
ATOM 7131  H HE2  . PHE A 1 43 ? -2.339  6.944   8.328   1.00 0.00 ? 43 PHE A HE2  5  
ATOM 7132  H HZ   . PHE A 1 43 ? -3.665  7.619   10.285  1.00 0.00 ? 43 PHE A HZ   5  
ATOM 7133  N N    . VAL A 1 44 ? -4.728  4.607   4.715   1.00 0.00 ? 44 VAL A N    5  
ATOM 7134  C CA   . VAL A 1 44 ? -3.694  3.582   4.853   1.00 0.00 ? 44 VAL A CA   5  
ATOM 7135  C C    . VAL A 1 44 ? -2.353  4.270   5.107   1.00 0.00 ? 44 VAL A C    5  
ATOM 7136  O O    . VAL A 1 44 ? -1.990  5.200   4.380   1.00 0.00 ? 44 VAL A O    5  
ATOM 7137  C CB   . VAL A 1 44 ? -3.596  2.683   3.571   1.00 0.00 ? 44 VAL A CB   5  
ATOM 7138  C CG1  . VAL A 1 44 ? -2.446  1.661   3.679   1.00 0.00 ? 44 VAL A CG1  5  
ATOM 7139  C CG2  . VAL A 1 44 ? -4.937  1.973   3.309   1.00 0.00 ? 44 VAL A CG2  5  
ATOM 7140  H H    . VAL A 1 44 ? -4.567  5.335   4.083   1.00 0.00 ? 44 VAL A H    5  
ATOM 7141  H HA   . VAL A 1 44 ? -3.935  2.943   5.707   1.00 0.00 ? 44 VAL A HA   5  
ATOM 7142  H HB   . VAL A 1 44 ? -3.391  3.328   2.715   1.00 0.00 ? 44 VAL A HB   5  
ATOM 7143  H HG11 . VAL A 1 44 ? -1.502  2.179   3.807   1.00 0.00 ? 44 VAL A HG11 5  
ATOM 7144  H HG12 . VAL A 1 44 ? -2.397  1.063   2.778   1.00 0.00 ? 44 VAL A HG12 5  
ATOM 7145  H HG13 . VAL A 1 44 ? -2.611  1.008   4.529   1.00 0.00 ? 44 VAL A HG13 5  
ATOM 7146  H HG21 . VAL A 1 44 ? -4.871  1.375   2.408   1.00 0.00 ? 44 VAL A HG21 5  
ATOM 7147  H HG22 . VAL A 1 44 ? -5.723  2.708   3.190   1.00 0.00 ? 44 VAL A HG22 5  
ATOM 7148  H HG23 . VAL A 1 44 ? -5.181  1.327   4.143   1.00 0.00 ? 44 VAL A HG23 5  
ATOM 7149  N N    . ARG A 1 45 ? -1.626  3.796   6.126   1.00 0.00 ? 45 ARG A N    5  
ATOM 7150  C CA   . ARG A 1 45 ? -0.316  4.307   6.486   1.00 0.00 ? 45 ARG A CA   5  
ATOM 7151  C C    . ARG A 1 45 ? 0.736   3.350   5.922   1.00 0.00 ? 45 ARG A C    5  
ATOM 7152  O O    . ARG A 1 45 ? 0.726   2.143   6.211   1.00 0.00 ? 45 ARG A O    5  
ATOM 7153  C CB   . ARG A 1 45 ? -0.171  4.450   8.022   1.00 0.00 ? 45 ARG A CB   5  
ATOM 7154  C CG   . ARG A 1 45 ? 1.168   5.086   8.467   1.00 0.00 ? 45 ARG A CG   5  
ATOM 7155  C CD   . ARG A 1 45 ? 1.232   5.348   9.983   1.00 0.00 ? 45 ARG A CD   5  
ATOM 7156  N NE   . ARG A 1 45 ? 1.042   4.126   10.780  1.00 0.00 ? 45 ARG A NE   5  
ATOM 7157  C CZ   . ARG A 1 45 ? 0.725   4.086   12.086  1.00 0.00 ? 45 ARG A CZ   5  
ATOM 7158  N NH1  . ARG A 1 45 ? 0.530   5.206   12.778  1.00 0.00 ? 45 ARG A NH1  5  
ATOM 7159  N NH2  . ARG A 1 45 ? 0.591   2.911   12.684  1.00 0.00 ? 45 ARG A NH2  5  
ATOM 7160  H H    . ARG A 1 45 ? -1.958  3.027   6.615   1.00 0.00 ? 45 ARG A H    5  
ATOM 7161  H HA   . ARG A 1 45 ? -0.190  5.295   6.030   1.00 0.00 ? 45 ARG A HA   5  
ATOM 7162  H HB2  . ARG A 1 45 ? -0.985  5.069   8.387   1.00 0.00 ? 45 ARG A HB2  5  
ATOM 7163  H HB3  . ARG A 1 45 ? -0.252  3.467   8.478   1.00 0.00 ? 45 ARG A HB3  5  
ATOM 7164  H HG2  . ARG A 1 45 ? 1.977   4.419   8.196   1.00 0.00 ? 45 ARG A HG2  5  
ATOM 7165  H HG3  . ARG A 1 45 ? 1.301   6.030   7.943   1.00 0.00 ? 45 ARG A HG3  5  
ATOM 7166  H HD2  . ARG A 1 45 ? 2.200   5.768   10.221  1.00 0.00 ? 45 ARG A HD2  5  
ATOM 7167  H HD3  . ARG A 1 45 ? 0.461   6.064   10.245  1.00 0.00 ? 45 ARG A HD3  5  
ATOM 7168  H HE   . ARG A 1 45 ? 1.174   3.275   10.315  1.00 0.00 ? 45 ARG A HE   5  
ATOM 7169  H HH11 . ARG A 1 45 ? 0.635   6.102   12.335  1.00 0.00 ? 45 ARG A HH11 5  
ATOM 7170  H HH12 . ARG A 1 45 ? 0.295   5.163   13.752  1.00 0.00 ? 45 ARG A HH12 5  
ATOM 7171  H HH21 . ARG A 1 45 ? 0.734   2.059   12.162  1.00 0.00 ? 45 ARG A HH21 5  
ATOM 7172  H HH22 . ARG A 1 45 ? 0.347   2.861   13.656  1.00 0.00 ? 45 ARG A HH22 5  
ATOM 7173  N N    . VAL A 1 46 ? 1.625   3.921   5.122   1.00 0.00 ? 46 VAL A N    5  
ATOM 7174  C CA   . VAL A 1 46 ? 2.716   3.215   4.464   1.00 0.00 ? 46 VAL A CA   5  
ATOM 7175  C C    . VAL A 1 46 ? 3.857   3.072   5.471   1.00 0.00 ? 46 VAL A C    5  
ATOM 7176  O O    . VAL A 1 46 ? 4.509   4.065   5.840   1.00 0.00 ? 46 VAL A O    5  
ATOM 7177  C CB   . VAL A 1 46 ? 3.218   3.991   3.189   1.00 0.00 ? 46 VAL A CB   5  
ATOM 7178  C CG1  . VAL A 1 46 ? 4.335   3.215   2.444   1.00 0.00 ? 46 VAL A CG1  5  
ATOM 7179  C CG2  . VAL A 1 46 ? 2.042   4.326   2.249   1.00 0.00 ? 46 VAL A CG2  5  
ATOM 7180  H H    . VAL A 1 46 ? 1.549   4.884   5.008   1.00 0.00 ? 46 VAL A H    5  
ATOM 7181  H HA   . VAL A 1 46 ? 2.364   2.230   4.158   1.00 0.00 ? 46 VAL A HA   5  
ATOM 7182  H HB   . VAL A 1 46 ? 3.647   4.934   3.522   1.00 0.00 ? 46 VAL A HB   5  
ATOM 7183  H HG11 . VAL A 1 46 ? 4.674   3.786   1.585   1.00 0.00 ? 46 VAL A HG11 5  
ATOM 7184  H HG12 . VAL A 1 46 ? 3.954   2.261   2.105   1.00 0.00 ? 46 VAL A HG12 5  
ATOM 7185  H HG13 . VAL A 1 46 ? 5.171   3.046   3.111   1.00 0.00 ? 46 VAL A HG13 5  
ATOM 7186  H HG21 . VAL A 1 46 ? 1.578   3.412   1.900   1.00 0.00 ? 46 VAL A HG21 5  
ATOM 7187  H HG22 . VAL A 1 46 ? 2.399   4.892   1.394   1.00 0.00 ? 46 VAL A HG22 5  
ATOM 7188  H HG23 . VAL A 1 46 ? 1.305   4.917   2.778   1.00 0.00 ? 46 VAL A HG23 5  
ATOM 7189  N N    . THR A 1 47 ? 4.063   1.840   5.931   1.00 0.00 ? 47 THR A N    5  
ATOM 7190  C CA   . THR A 1 47 ? 5.151   1.506   6.838   1.00 0.00 ? 47 THR A CA   5  
ATOM 7191  C C    . THR A 1 47 ? 6.391   1.212   5.991   1.00 0.00 ? 47 THR A C    5  
ATOM 7192  O O    . THR A 1 47 ? 6.287   0.493   5.002   1.00 0.00 ? 47 THR A O    5  
ATOM 7193  C CB   . THR A 1 47 ? 4.783   0.259   7.702   1.00 0.00 ? 47 THR A CB   5  
ATOM 7194  O OG1  . THR A 1 47 ? 3.578   0.514   8.443   1.00 0.00 ? 47 THR A OG1  5  
ATOM 7195  C CG2  . THR A 1 47 ? 5.900   -0.144  8.681   1.00 0.00 ? 47 THR A CG2  5  
ATOM 7196  H H    . THR A 1 47 ? 3.502   1.106   5.599   1.00 0.00 ? 47 THR A H    5  
ATOM 7197  H HA   . THR A 1 47 ? 5.335   2.351   7.501   1.00 0.00 ? 47 THR A HA   5  
ATOM 7198  H HB   . THR A 1 47 ? 4.599   -0.575  7.033   1.00 0.00 ? 47 THR A HB   5  
ATOM 7199  H HG1  . THR A 1 47 ? 2.912   0.893   7.858   1.00 0.00 ? 47 THR A HG1  5  
ATOM 7200  H HG21 . THR A 1 47 ? 6.803   -0.376  8.132   1.00 0.00 ? 47 THR A HG21 5  
ATOM 7201  H HG22 . THR A 1 47 ? 5.596   -1.014  9.253   1.00 0.00 ? 47 THR A HG22 5  
ATOM 7202  H HG23 . THR A 1 47 ? 6.103   0.674   9.364   1.00 0.00 ? 47 THR A HG23 5  
ATOM 7203  N N    . PHE A 1 48 ? 7.527   1.809   6.341   1.00 0.00 ? 48 PHE A N    5  
ATOM 7204  C CA   . PHE A 1 48 ? 8.813   1.518   5.683   1.00 0.00 ? 48 PHE A CA   5  
ATOM 7205  C C    . PHE A 1 48 ? 9.455   0.293   6.337   1.00 0.00 ? 48 PHE A C    5  
ATOM 7206  O O    . PHE A 1 48 ? 9.220   0.028   7.524   1.00 0.00 ? 48 PHE A O    5  
ATOM 7207  C CB   . PHE A 1 48 ? 9.748   2.744   5.776   1.00 0.00 ? 48 PHE A CB   5  
ATOM 7208  C CG   . PHE A 1 48 ? 9.190   3.974   5.069   1.00 0.00 ? 48 PHE A CG   5  
ATOM 7209  C CD1  . PHE A 1 48 ? 8.359   4.880   5.738   1.00 0.00 ? 48 PHE A CD1  5  
ATOM 7210  C CD2  . PHE A 1 48 ? 9.488   4.223   3.728   1.00 0.00 ? 48 PHE A CD2  5  
ATOM 7211  C CE1  . PHE A 1 48 ? 7.850   5.987   5.088   1.00 0.00 ? 48 PHE A CE1  5  
ATOM 7212  C CE2  . PHE A 1 48 ? 8.979   5.332   3.086   1.00 0.00 ? 48 PHE A CE2  5  
ATOM 7213  C CZ   . PHE A 1 48 ? 8.166   6.216   3.764   1.00 0.00 ? 48 PHE A CZ   5  
ATOM 7214  H H    . PHE A 1 48 ? 7.502   2.472   7.060   1.00 0.00 ? 48 PHE A H    5  
ATOM 7215  H HA   . PHE A 1 48 ? 8.622   1.294   4.633   1.00 0.00 ? 48 PHE A HA   5  
ATOM 7216  H HB2  . PHE A 1 48 ? 9.909   2.997   6.821   1.00 0.00 ? 48 PHE A HB2  5  
ATOM 7217  H HB3  . PHE A 1 48 ? 10.708  2.501   5.330   1.00 0.00 ? 48 PHE A HB3  5  
ATOM 7218  H HD1  . PHE A 1 48 ? 8.112   4.710   6.778   1.00 0.00 ? 48 PHE A HD1  5  
ATOM 7219  H HD2  . PHE A 1 48 ? 10.128  3.535   3.186   1.00 0.00 ? 48 PHE A HD2  5  
ATOM 7220  H HE1  . PHE A 1 48 ? 7.207   6.679   5.618   1.00 0.00 ? 48 PHE A HE1  5  
ATOM 7221  H HE2  . PHE A 1 48 ? 9.223   5.514   2.047   1.00 0.00 ? 48 PHE A HE2  5  
ATOM 7222  H HZ   . PHE A 1 48 ? 7.764   7.084   3.253   1.00 0.00 ? 48 PHE A HZ   5  
ATOM 7223  N N    . THR A 1 49 ? 10.230  -0.465  5.552   1.00 0.00 ? 49 THR A N    5  
ATOM 7224  C CA   . THR A 1 49 ? 10.985  -1.617  6.057   1.00 0.00 ? 49 THR A CA   5  
ATOM 7225  C C    . THR A 1 49 ? 12.067  -1.154  7.062   1.00 0.00 ? 49 THR A C    5  
ATOM 7226  O O    . THR A 1 49 ? 12.620  -0.056  6.899   1.00 0.00 ? 49 THR A O    5  
ATOM 7227  C CB   . THR A 1 49 ? 11.657  -2.415  4.894   1.00 0.00 ? 49 THR A CB   5  
ATOM 7228  O OG1  . THR A 1 49 ? 12.462  -1.532  4.105   1.00 0.00 ? 49 THR A OG1  5  
ATOM 7229  C CG2  . THR A 1 49 ? 10.625  -3.113  3.992   1.00 0.00 ? 49 THR A CG2  5  
ATOM 7230  H H    . THR A 1 49 ? 10.297  -0.248  4.600   1.00 0.00 ? 49 THR A H    5  
ATOM 7231  H HA   . THR A 1 49 ? 10.286  -2.278  6.564   1.00 0.00 ? 49 THR A HA   5  
ATOM 7232  H HB   . THR A 1 49 ? 12.307  -3.173  5.319   1.00 0.00 ? 49 THR A HB   5  
ATOM 7233  H HG1  . THR A 1 49 ? 12.857  -2.024  3.383   1.00 0.00 ? 49 THR A HG1  5  
ATOM 7234  H HG21 . THR A 1 49 ? 11.138  -3.655  3.207   1.00 0.00 ? 49 THR A HG21 5  
ATOM 7235  H HG22 . THR A 1 49 ? 9.967   -2.377  3.546   1.00 0.00 ? 49 THR A HG22 5  
ATOM 7236  H HG23 . THR A 1 49 ? 10.039  -3.808  4.577   1.00 0.00 ? 49 THR A HG23 5  
ATOM 7237  N N    . PRO A 1 50 ? 12.351  -1.966  8.136   1.00 0.00 ? 50 PRO A N    5  
ATOM 7238  C CA   . PRO A 1 50 ? 13.495  -1.715  9.044   1.00 0.00 ? 50 PRO A CA   5  
ATOM 7239  C C    . PRO A 1 50 ? 14.824  -1.618  8.262   1.00 0.00 ? 50 PRO A C    5  
ATOM 7240  O O    . PRO A 1 50 ? 15.350  -2.624  7.775   1.00 0.00 ? 50 PRO A O    5  
ATOM 7241  C CB   . PRO A 1 50 ? 13.469  -2.934  10.007  1.00 0.00 ? 50 PRO A CB   5  
ATOM 7242  C CG   . PRO A 1 50 ? 12.044  -3.404  9.978   1.00 0.00 ? 50 PRO A CG   5  
ATOM 7243  C CD   . PRO A 1 50 ? 11.561  -3.155  8.569   1.00 0.00 ? 50 PRO A CD   5  
ATOM 7244  H HA   . PRO A 1 50 ? 13.343  -0.796  9.612   1.00 0.00 ? 50 PRO A HA   5  
ATOM 7245  H HB2  . PRO A 1 50 ? 14.145  -3.718  9.655   1.00 0.00 ? 50 PRO A HB2  5  
ATOM 7246  H HB3  . PRO A 1 50 ? 13.748  -2.633  11.009  1.00 0.00 ? 50 PRO A HB3  5  
ATOM 7247  H HG2  . PRO A 1 50 ? 11.997  -4.463  10.228  1.00 0.00 ? 50 PRO A HG2  5  
ATOM 7248  H HG3  . PRO A 1 50 ? 11.443  -2.834  10.688  1.00 0.00 ? 50 PRO A HG3  5  
ATOM 7249  H HD2  . PRO A 1 50 ? 11.771  -4.010  7.933   1.00 0.00 ? 50 PRO A HD2  5  
ATOM 7250  H HD3  . PRO A 1 50 ? 10.499  -2.936  8.561   1.00 0.00 ? 50 PRO A HD3  5  
ATOM 7251  N N    . GLY A 1 51 ? 15.318  -0.390  8.103   1.00 0.00 ? 51 GLY A N    5  
ATOM 7252  C CA   . GLY A 1 51 ? 16.488  -0.103  7.265   1.00 0.00 ? 51 GLY A CA   5  
ATOM 7253  C C    . GLY A 1 51 ? 16.246  1.120   6.404   1.00 0.00 ? 51 GLY A C    5  
ATOM 7254  O O    . GLY A 1 51 ? 17.119  1.984   6.277   1.00 0.00 ? 51 GLY A O    5  
ATOM 7255  H H    . GLY A 1 51 ? 14.870  0.356   8.564   1.00 0.00 ? 51 GLY A H    5  
ATOM 7256  H HA2  . GLY A 1 51 ? 17.343  0.065   7.908   1.00 0.00 ? 51 GLY A HA2  5  
ATOM 7257  H HA3  . GLY A 1 51 ? 16.701  -0.945  6.612   1.00 0.00 ? 51 GLY A HA3  5  
ATOM 7258  N N    . LYS A 1 52 ? 15.049  1.175   5.779   1.00 0.00 ? 52 LYS A N    5  
ATOM 7259  C CA   . LYS A 1 52 ? 14.557  2.387   5.096   1.00 0.00 ? 52 LYS A CA   5  
ATOM 7260  C C    . LYS A 1 52 ? 14.143  3.420   6.147   1.00 0.00 ? 52 LYS A C    5  
ATOM 7261  O O    . LYS A 1 52 ? 14.268  4.622   5.925   1.00 0.00 ? 52 LYS A O    5  
ATOM 7262  C CB   . LYS A 1 52 ? 13.367  2.074   4.145   1.00 0.00 ? 52 LYS A CB   5  
ATOM 7263  C CG   . LYS A 1 52 ? 13.723  1.146   2.965   1.00 0.00 ? 52 LYS A CG   5  
ATOM 7264  C CD   . LYS A 1 52 ? 14.929  1.652   2.136   1.00 0.00 ? 52 LYS A CD   5  
ATOM 7265  C CE   . LYS A 1 52 ? 15.272  0.723   0.963   1.00 0.00 ? 52 LYS A CE   5  
ATOM 7266  N NZ   . LYS A 1 52 ? 15.541  -0.668  1.400   1.00 0.00 ? 52 LYS A NZ   5  
ATOM 7267  H H    . LYS A 1 52 ? 14.479  0.377   5.788   1.00 0.00 ? 52 LYS A H    5  
ATOM 7268  H HA   . LYS A 1 52 ? 15.379  2.796   4.510   1.00 0.00 ? 52 LYS A HA   5  
ATOM 7269  H HB2  . LYS A 1 52 ? 12.568  1.605   4.717   1.00 0.00 ? 52 LYS A HB2  5  
ATOM 7270  H HB3  . LYS A 1 52 ? 12.989  3.003   3.735   1.00 0.00 ? 52 LYS A HB3  5  
ATOM 7271  H HG2  . LYS A 1 52 ? 13.955  0.164   3.359   1.00 0.00 ? 52 LYS A HG2  5  
ATOM 7272  H HG3  . LYS A 1 52 ? 12.858  1.065   2.312   1.00 0.00 ? 52 LYS A HG3  5  
ATOM 7273  H HD2  . LYS A 1 52 ? 14.695  2.634   1.740   1.00 0.00 ? 52 LYS A HD2  5  
ATOM 7274  H HD3  . LYS A 1 52 ? 15.798  1.732   2.783   1.00 0.00 ? 52 LYS A HD3  5  
ATOM 7275  H HE2  . LYS A 1 52 ? 14.443  0.712   0.268   1.00 0.00 ? 52 LYS A HE2  5  
ATOM 7276  H HE3  . LYS A 1 52 ? 16.151  1.104   0.457   1.00 0.00 ? 52 LYS A HE3  5  
ATOM 7277  H HZ1  . LYS A 1 52 ? 15.778  -1.262  0.581   1.00 0.00 ? 52 LYS A HZ1  5  
ATOM 7278  H HZ2  . LYS A 1 52 ? 14.702  -1.063  1.867   1.00 0.00 ? 52 LYS A HZ2  5  
ATOM 7279  H HZ3  . LYS A 1 52 ? 16.335  -0.689  2.069   1.00 0.00 ? 52 LYS A HZ3  5  
ATOM 7280  N N    . THR A 1 53 ? 13.642  2.914   7.286   1.00 0.00 ? 53 THR A N    5  
ATOM 7281  C CA   . THR A 1 53 ? 13.364  3.712   8.481   1.00 0.00 ? 53 THR A CA   5  
ATOM 7282  C C    . THR A 1 53 ? 14.693  4.255   9.078   1.00 0.00 ? 53 THR A C    5  
ATOM 7283  O O    . THR A 1 53 ? 15.554  3.453   9.469   1.00 0.00 ? 53 THR A O    5  
ATOM 7284  C CB   . THR A 1 53 ? 12.630  2.839   9.554   1.00 0.00 ? 53 THR A CB   5  
ATOM 7285  O OG1  . THR A 1 53 ? 13.359  1.608   9.755   1.00 0.00 ? 53 THR A OG1  5  
ATOM 7286  C CG2  . THR A 1 53 ? 11.182  2.514   9.150   1.00 0.00 ? 53 THR A CG2  5  
ATOM 7287  H H    . THR A 1 53 ? 13.465  1.949   7.322   1.00 0.00 ? 53 THR A H    5  
ATOM 7288  H HA   . THR A 1 53 ? 12.715  4.542   8.204   1.00 0.00 ? 53 THR A HA   5  
ATOM 7289  H HB   . THR A 1 53 ? 12.609  3.379   10.498  1.00 0.00 ? 53 THR A HB   5  
ATOM 7290  H HG1  . THR A 1 53 ? 12.775  0.944   10.131  1.00 0.00 ? 53 THR A HG1  5  
ATOM 7291  H HG21 . THR A 1 53 ? 10.627  3.433   9.007   1.00 0.00 ? 53 THR A HG21 5  
ATOM 7292  H HG22 . THR A 1 53 ? 10.710  1.927   9.924   1.00 0.00 ? 53 THR A HG22 5  
ATOM 7293  H HG23 . THR A 1 53 ? 11.180  1.951   8.225   1.00 0.00 ? 53 THR A HG23 5  
ATOM 7294  N N    . PRO A 1 54 ? 14.911  5.611   9.099   1.00 0.00 ? 54 PRO A N    5  
ATOM 7295  C CA   . PRO A 1 54 ? 16.050  6.230   9.814   1.00 0.00 ? 54 PRO A CA   5  
ATOM 7296  C C    . PRO A 1 54 ? 15.688  6.540   11.285  1.00 0.00 ? 54 PRO A C    5  
ATOM 7297  O O    . PRO A 1 54 ? 14.701  6.010   11.813  1.00 0.00 ? 54 PRO A O    5  
ATOM 7298  C CB   . PRO A 1 54 ? 16.291  7.513   8.978   1.00 0.00 ? 54 PRO A CB   5  
ATOM 7299  C CG   . PRO A 1 54 ? 14.936  7.917   8.468   1.00 0.00 ? 54 PRO A CG   5  
ATOM 7300  C CD   . PRO A 1 54 ? 14.087  6.649   8.408   1.00 0.00 ? 54 PRO A CD   5  
ATOM 7301  H HA   . PRO A 1 54 ? 16.937  5.599   9.791   1.00 0.00 ? 54 PRO A HA   5  
ATOM 7302  H HB2  . PRO A 1 54 ? 16.726  8.294   9.602   1.00 0.00 ? 54 PRO A HB2  5  
ATOM 7303  H HB3  . PRO A 1 54 ? 16.955  7.303   8.146   1.00 0.00 ? 54 PRO A HB3  5  
ATOM 7304  H HG2  . PRO A 1 54 ? 14.490  8.644   9.147   1.00 0.00 ? 54 PRO A HG2  5  
ATOM 7305  H HG3  . PRO A 1 54 ? 15.021  8.356   7.477   1.00 0.00 ? 54 PRO A HG3  5  
ATOM 7306  H HD2  . PRO A 1 54 ? 13.142  6.791   8.922   1.00 0.00 ? 54 PRO A HD2  5  
ATOM 7307  H HD3  . PRO A 1 54 ? 13.906  6.367   7.376   1.00 0.00 ? 54 PRO A HD3  5  
ATOM 7308  N N    . VAL A 1 55 ? 16.505  7.385   11.947  1.00 0.00 ? 55 VAL A N    5  
ATOM 7309  C CA   . VAL A 1 55 ? 16.208  7.885   13.308  1.00 0.00 ? 55 VAL A CA   5  
ATOM 7310  C C    . VAL A 1 55 ? 14.967  8.806   13.256  1.00 0.00 ? 55 VAL A C    5  
ATOM 7311  O O    . VAL A 1 55 ? 14.156  8.840   14.194  1.00 0.00 ? 55 VAL A O    5  
ATOM 7312  C CB   . VAL A 1 55 ? 17.448  8.626   13.938  1.00 0.00 ? 55 VAL A CB   5  
ATOM 7313  C CG1  . VAL A 1 55 ? 17.137  9.159   15.364  1.00 0.00 ? 55 VAL A CG1  5  
ATOM 7314  C CG2  . VAL A 1 55 ? 18.686  7.695   13.945  1.00 0.00 ? 55 VAL A CG2  5  
ATOM 7315  H H    . VAL A 1 55 ? 17.327  7.689   11.502  1.00 0.00 ? 55 VAL A H    5  
ATOM 7316  H HA   . VAL A 1 55 ? 15.975  7.024   13.933  1.00 0.00 ? 55 VAL A HA   5  
ATOM 7317  H HB   . VAL A 1 55 ? 17.683  9.482   13.309  1.00 0.00 ? 55 VAL A HB   5  
ATOM 7318  H HG11 . VAL A 1 55 ? 16.870  8.337   16.017  1.00 0.00 ? 55 VAL A HG11 5  
ATOM 7319  H HG12 . VAL A 1 55 ? 16.312  9.860   15.320  1.00 0.00 ? 55 VAL A HG12 5  
ATOM 7320  H HG13 . VAL A 1 55 ? 18.006  9.665   15.766  1.00 0.00 ? 55 VAL A HG13 5  
ATOM 7321  H HG21 . VAL A 1 55 ? 18.486  6.820   14.551  1.00 0.00 ? 55 VAL A HG21 5  
ATOM 7322  H HG22 . VAL A 1 55 ? 19.543  8.221   14.351  1.00 0.00 ? 55 VAL A HG22 5  
ATOM 7323  H HG23 . VAL A 1 55 ? 18.914  7.382   12.934  1.00 0.00 ? 55 VAL A HG23 5  
ATOM 7324  N N    . ASP A 1 56 ? 14.811  9.520   12.115  1.00 0.00 ? 56 ASP A N    5  
ATOM 7325  C CA   . ASP A 1 56 ? 13.571  10.230  11.769  1.00 0.00 ? 56 ASP A CA   5  
ATOM 7326  C C    . ASP A 1 56 ? 12.607  9.218   11.124  1.00 0.00 ? 56 ASP A C    5  
ATOM 7327  O O    . ASP A 1 56 ? 12.320  9.295   9.923   1.00 0.00 ? 56 ASP A O    5  
ATOM 7328  C CB   . ASP A 1 56 ? 13.839  11.426  10.801  1.00 0.00 ? 56 ASP A CB   5  
ATOM 7329  C CG   . ASP A 1 56 ? 14.710  12.532  11.409  1.00 0.00 ? 56 ASP A CG   5  
ATOM 7330  O OD1  . ASP A 1 56 ? 14.189  13.329  12.216  1.00 0.00 ? 56 ASP A OD1  5  
ATOM 7331  O OD2  . ASP A 1 56 ? 15.912  12.620  11.077  1.00 0.00 ? 56 ASP A OD2  5  
ATOM 7332  H H    . ASP A 1 56 ? 15.554  9.544   11.479  1.00 0.00 ? 56 ASP A H    5  
ATOM 7333  H HA   . ASP A 1 56 ? 13.121  10.609  12.691  1.00 0.00 ? 56 ASP A HA   5  
ATOM 7334  H HB2  . ASP A 1 56 ? 14.327  11.050  9.904   1.00 0.00 ? 56 ASP A HB2  5  
ATOM 7335  H HB3  . ASP A 1 56 ? 12.889  11.863  10.509  1.00 0.00 ? 56 ASP A HB3  5  
ATOM 7336  N N    . GLY A 1 57 ? 12.170  8.228   11.928  1.00 0.00 ? 57 GLY A N    5  
ATOM 7337  C CA   . GLY A 1 57 ? 11.243  7.179   11.495  1.00 0.00 ? 57 GLY A CA   5  
ATOM 7338  C C    . GLY A 1 57 ? 9.797   7.658   11.392  1.00 0.00 ? 57 GLY A C    5  
ATOM 7339  O O    . GLY A 1 57 ? 8.902   7.137   12.069  1.00 0.00 ? 57 GLY A O    5  
ATOM 7340  H H    . GLY A 1 57 ? 12.499  8.205   12.848  1.00 0.00 ? 57 GLY A H    5  
ATOM 7341  H HA2  . GLY A 1 57 ? 11.554  6.795   10.527  1.00 0.00 ? 57 GLY A HA2  5  
ATOM 7342  H HA3  . GLY A 1 57 ? 11.290  6.370   12.212  1.00 0.00 ? 57 GLY A HA3  5  
ATOM 7343  N N    . GLN A 1 58 ? 9.583   8.672   10.541  1.00 0.00 ? 58 GLN A N    5  
ATOM 7344  C CA   . GLN A 1 58 ? 8.258   9.207   10.218  1.00 0.00 ? 58 GLN A CA   5  
ATOM 7345  C C    . GLN A 1 58 ? 7.711   8.447   9.011   1.00 0.00 ? 58 GLN A C    5  
ATOM 7346  O O    . GLN A 1 58 ? 8.465   8.093   8.099   1.00 0.00 ? 58 GLN A O    5  
ATOM 7347  C CB   . GLN A 1 58 ? 8.347   10.724  9.909   1.00 0.00 ? 58 GLN A CB   5  
ATOM 7348  C CG   . GLN A 1 58 ? 8.881   11.573  11.076  1.00 0.00 ? 58 GLN A CG   5  
ATOM 7349  C CD   . GLN A 1 58 ? 8.931   13.068  10.754  1.00 0.00 ? 58 GLN A CD   5  
ATOM 7350  O OE1  . GLN A 1 58 ? 9.934   13.583  10.267  1.00 0.00 ? 58 GLN A OE1  5  
ATOM 7351  N NE2  . GLN A 1 58 ? 7.858   13.774  11.029  1.00 0.00 ? 58 GLN A NE2  5  
ATOM 7352  H H    . GLN A 1 58 ? 10.353  9.063   10.090  1.00 0.00 ? 58 GLN A H    5  
ATOM 7353  H HA   . GLN A 1 58 ? 7.597   9.054   11.072  1.00 0.00 ? 58 GLN A HA   5  
ATOM 7354  H HB2  . GLN A 1 58 ? 9.000   10.871  9.054   1.00 0.00 ? 58 GLN A HB2  5  
ATOM 7355  H HB3  . GLN A 1 58 ? 7.357   11.088  9.652   1.00 0.00 ? 58 GLN A HB3  5  
ATOM 7356  H HG2  . GLN A 1 58 ? 8.244   11.419  11.940  1.00 0.00 ? 58 GLN A HG2  5  
ATOM 7357  H HG3  . GLN A 1 58 ? 9.885   11.241  11.323  1.00 0.00 ? 58 GLN A HG3  5  
ATOM 7358  H HE21 . GLN A 1 58 ? 7.084   13.314  11.428  1.00 0.00 ? 58 GLN A HE21 5  
ATOM 7359  H HE22 . GLN A 1 58 ? 7.872   14.728  10.815  1.00 0.00 ? 58 GLN A HE22 5  
ATOM 7360  N N    . TYR A 1 59 ? 6.408   8.195   9.009   1.00 0.00 ? 59 TYR A N    5  
ATOM 7361  C CA   . TYR A 1 59 ? 5.749   7.400   7.962   1.00 0.00 ? 59 TYR A CA   5  
ATOM 7362  C C    . TYR A 1 59 ? 4.932   8.295   7.045   1.00 0.00 ? 59 TYR A C    5  
ATOM 7363  O O    . TYR A 1 59 ? 4.501   9.381   7.435   1.00 0.00 ? 59 TYR A O    5  
ATOM 7364  C CB   . TYR A 1 59 ? 4.863   6.309   8.607   1.00 0.00 ? 59 TYR A CB   5  
ATOM 7365  C CG   . TYR A 1 59 ? 5.676   5.328   9.459   1.00 0.00 ? 59 TYR A CG   5  
ATOM 7366  C CD1  . TYR A 1 59 ? 6.366   4.268   8.866   1.00 0.00 ? 59 TYR A CD1  5  
ATOM 7367  C CD2  . TYR A 1 59 ? 5.790   5.485   10.841  1.00 0.00 ? 59 TYR A CD2  5  
ATOM 7368  C CE1  . TYR A 1 59 ? 7.128   3.398   9.620   1.00 0.00 ? 59 TYR A CE1  5  
ATOM 7369  C CE2  . TYR A 1 59 ? 6.555   4.620   11.592  1.00 0.00 ? 59 TYR A CE2  5  
ATOM 7370  C CZ   . TYR A 1 59 ? 7.220   3.577   10.981  1.00 0.00 ? 59 TYR A CZ   5  
ATOM 7371  O OH   . TYR A 1 59 ? 7.981   2.711   11.739  1.00 0.00 ? 59 TYR A OH   5  
ATOM 7372  H H    . TYR A 1 59 ? 5.859   8.561   9.732   1.00 0.00 ? 59 TYR A H    5  
ATOM 7373  H HA   . TYR A 1 59 ? 6.519   6.910   7.362   1.00 0.00 ? 59 TYR A HA   5  
ATOM 7374  H HB2  . TYR A 1 59 ? 4.110   6.777   9.240   1.00 0.00 ? 59 TYR A HB2  5  
ATOM 7375  H HB3  . TYR A 1 59 ? 4.360   5.746   7.830   1.00 0.00 ? 59 TYR A HB3  5  
ATOM 7376  H HD1  . TYR A 1 59 ? 6.295   4.126   7.791   1.00 0.00 ? 59 TYR A HD1  5  
ATOM 7377  H HD2  . TYR A 1 59 ? 5.268   6.299   11.326  1.00 0.00 ? 59 TYR A HD2  5  
ATOM 7378  H HE1  . TYR A 1 59 ? 7.651   2.580   9.138   1.00 0.00 ? 59 TYR A HE1  5  
ATOM 7379  H HE2  . TYR A 1 59 ? 6.633   4.759   12.663  1.00 0.00 ? 59 TYR A HE2  5  
ATOM 7380  H HH   . TYR A 1 59 ? 8.733   2.406   11.218  1.00 0.00 ? 59 TYR A HH   5  
ATOM 7381  N N    . VAL A 1 60 ? 4.697   7.801   5.831   1.00 0.00 ? 60 VAL A N    5  
ATOM 7382  C CA   . VAL A 1 60 ? 3.863   8.478   4.830   1.00 0.00 ? 60 VAL A CA   5  
ATOM 7383  C C    . VAL A 1 60 ? 2.548   7.707   4.723   1.00 0.00 ? 60 VAL A C    5  
ATOM 7384  O O    . VAL A 1 60 ? 2.459   6.582   5.221   1.00 0.00 ? 60 VAL A O    5  
ATOM 7385  C CB   . VAL A 1 60 ? 4.589   8.579   3.432   1.00 0.00 ? 60 VAL A CB   5  
ATOM 7386  C CG1  . VAL A 1 60 ? 5.950   9.296   3.579   1.00 0.00 ? 60 VAL A CG1  5  
ATOM 7387  C CG2  . VAL A 1 60 ? 4.760   7.200   2.753   1.00 0.00 ? 60 VAL A CG2  5  
ATOM 7388  H H    . VAL A 1 60 ? 5.080   6.927   5.601   1.00 0.00 ? 60 VAL A H    5  
ATOM 7389  H HA   . VAL A 1 60 ? 3.642   9.491   5.178   1.00 0.00 ? 60 VAL A HA   5  
ATOM 7390  H HB   . VAL A 1 60 ? 3.965   9.195   2.784   1.00 0.00 ? 60 VAL A HB   5  
ATOM 7391  H HG11 . VAL A 1 60 ? 6.600   8.723   4.233   1.00 0.00 ? 60 VAL A HG11 5  
ATOM 7392  H HG12 . VAL A 1 60 ? 5.801   10.280  4.004   1.00 0.00 ? 60 VAL A HG12 5  
ATOM 7393  H HG13 . VAL A 1 60 ? 6.419   9.399   2.609   1.00 0.00 ? 60 VAL A HG13 5  
ATOM 7394  H HG21 . VAL A 1 60 ? 5.340   6.545   3.392   1.00 0.00 ? 60 VAL A HG21 5  
ATOM 7395  H HG22 . VAL A 1 60 ? 5.268   7.312   1.801   1.00 0.00 ? 60 VAL A HG22 5  
ATOM 7396  H HG23 . VAL A 1 60 ? 3.789   6.757   2.582   1.00 0.00 ? 60 VAL A HG23 5  
ATOM 7397  N N    . TRP A 1 61 ? 1.524   8.312   4.118   1.00 0.00 ? 61 TRP A N    5  
ATOM 7398  C CA   . TRP A 1 61 ? 0.165   7.740   4.104   1.00 0.00 ? 61 TRP A CA   5  
ATOM 7399  C C    . TRP A 1 61 ? -0.696  8.388   3.013   1.00 0.00 ? 61 TRP A C    5  
ATOM 7400  O O    . TRP A 1 61 ? -0.387  9.474   2.531   1.00 0.00 ? 61 TRP A O    5  
ATOM 7401  C CB   . TRP A 1 61 ? -0.507  7.918   5.499   1.00 0.00 ? 61 TRP A CB   5  
ATOM 7402  C CG   . TRP A 1 61 ? -0.684  9.354   5.938   1.00 0.00 ? 61 TRP A CG   5  
ATOM 7403  C CD1  . TRP A 1 61 ? 0.253   10.167  6.515   1.00 0.00 ? 61 TRP A CD1  5  
ATOM 7404  C CD2  . TRP A 1 61 ? -1.877  10.140  5.831   1.00 0.00 ? 61 TRP A CD2  5  
ATOM 7405  N NE1  . TRP A 1 61 ? -0.291  11.397  6.770   1.00 0.00 ? 61 TRP A NE1  5  
ATOM 7406  C CE2  . TRP A 1 61 ? -1.597  11.398  6.370   1.00 0.00 ? 61 TRP A CE2  5  
ATOM 7407  C CE3  . TRP A 1 61 ? -3.160  9.890   5.338   1.00 0.00 ? 61 TRP A CE3  5  
ATOM 7408  C CZ2  . TRP A 1 61 ? -2.546  12.407  6.426   1.00 0.00 ? 61 TRP A CZ2  5  
ATOM 7409  C CZ3  . TRP A 1 61 ? -4.103  10.890  5.395   1.00 0.00 ? 61 TRP A CZ3  5  
ATOM 7410  C CH2  . TRP A 1 61 ? -3.793  12.135  5.942   1.00 0.00 ? 61 TRP A CH2  5  
ATOM 7411  H H    . TRP A 1 61 ? 1.677   9.170   3.672   1.00 0.00 ? 61 TRP A H    5  
ATOM 7412  H HA   . TRP A 1 61 ? 0.252   6.677   3.887   1.00 0.00 ? 61 TRP A HA   5  
ATOM 7413  H HB2  . TRP A 1 61 ? -1.489  7.451   5.485   1.00 0.00 ? 61 TRP A HB2  5  
ATOM 7414  H HB3  . TRP A 1 61 ? 0.098   7.414   6.248   1.00 0.00 ? 61 TRP A HB3  5  
ATOM 7415  H HD1  . TRP A 1 61 ? 1.269   9.870   6.730   1.00 0.00 ? 61 TRP A HD1  5  
ATOM 7416  H HE1  . TRP A 1 61 ? 0.180   12.151  7.182   1.00 0.00 ? 61 TRP A HE1  5  
ATOM 7417  H HE3  . TRP A 1 61 ? -3.416  8.929   4.909   1.00 0.00 ? 61 TRP A HE3  5  
ATOM 7418  H HZ2  . TRP A 1 61 ? -2.321  13.376  6.846   1.00 0.00 ? 61 TRP A HZ2  5  
ATOM 7419  H HZ3  . TRP A 1 61 ? -5.106  10.709  5.019   1.00 0.00 ? 61 TRP A HZ3  5  
ATOM 7420  H HH2  . TRP A 1 61 ? -4.564  12.895  5.970   1.00 0.00 ? 61 TRP A HH2  5  
ATOM 7421  N N    . PHE A 1 62 ? -1.806  7.719   2.670   1.00 0.00 ? 62 PHE A N    5  
ATOM 7422  C CA   . PHE A 1 62 ? -2.749  8.176   1.637   1.00 0.00 ? 62 PHE A CA   5  
ATOM 7423  C C    . PHE A 1 62 ? -4.178  7.792   2.046   1.00 0.00 ? 62 PHE A C    5  
ATOM 7424  O O    . PHE A 1 62 ? -4.384  6.745   2.673   1.00 0.00 ? 62 PHE A O    5  
ATOM 7425  C CB   . PHE A 1 62 ? -2.379  7.574   0.246   1.00 0.00 ? 62 PHE A CB   5  
ATOM 7426  C CG   . PHE A 1 62 ? -2.293  6.044   0.207   1.00 0.00 ? 62 PHE A CG   5  
ATOM 7427  C CD1  . PHE A 1 62 ? -1.117  5.380   0.565   1.00 0.00 ? 62 PHE A CD1  5  
ATOM 7428  C CD2  . PHE A 1 62 ? -3.389  5.269   -0.168  1.00 0.00 ? 62 PHE A CD2  5  
ATOM 7429  C CE1  . PHE A 1 62 ? -1.047  3.998   0.544   1.00 0.00 ? 62 PHE A CE1  5  
ATOM 7430  C CE2  . PHE A 1 62 ? -3.314  3.893   -0.183  1.00 0.00 ? 62 PHE A CE2  5  
ATOM 7431  C CZ   . PHE A 1 62 ? -2.144  3.258   0.171   1.00 0.00 ? 62 PHE A CZ   5  
ATOM 7432  H H    . PHE A 1 62 ? -2.004  6.877   3.136   1.00 0.00 ? 62 PHE A H    5  
ATOM 7433  H HA   . PHE A 1 62 ? -2.687  9.260   1.581   1.00 0.00 ? 62 PHE A HA   5  
ATOM 7434  H HB2  . PHE A 1 62 ? -3.114  7.889   -0.487  1.00 0.00 ? 62 PHE A HB2  5  
ATOM 7435  H HB3  . PHE A 1 62 ? -1.413  7.968   -0.059  1.00 0.00 ? 62 PHE A HB3  5  
ATOM 7436  H HD1  . PHE A 1 62 ? -0.249  5.956   0.860   1.00 0.00 ? 62 PHE A HD1  5  
ATOM 7437  H HD2  . PHE A 1 62 ? -4.312  5.757   -0.451  1.00 0.00 ? 62 PHE A HD2  5  
ATOM 7438  H HE1  . PHE A 1 62 ? -0.128  3.496   0.821   1.00 0.00 ? 62 PHE A HE1  5  
ATOM 7439  H HE2  . PHE A 1 62 ? -4.175  3.307   -0.479  1.00 0.00 ? 62 PHE A HE2  5  
ATOM 7440  H HZ   . PHE A 1 62 ? -2.089  2.176   0.159   1.00 0.00 ? 62 PHE A HZ   5  
ATOM 7441  N N    . ASN A 1 63 ? -5.154  8.637   1.679   1.00 0.00 ? 63 ASN A N    5  
ATOM 7442  C CA   . ASN A 1 63 ? -6.579  8.414   1.998   1.00 0.00 ? 63 ASN A CA   5  
ATOM 7443  C C    . ASN A 1 63 ? -7.190  7.434   0.977   1.00 0.00 ? 63 ASN A C    5  
ATOM 7444  O O    . ASN A 1 63 ? -6.868  7.513   -0.221  1.00 0.00 ? 63 ASN A O    5  
ATOM 7445  C CB   . ASN A 1 63 ? -7.355  9.767   2.024   1.00 0.00 ? 63 ASN A CB   5  
ATOM 7446  C CG   . ASN A 1 63 ? -7.398  10.466  0.659   1.00 0.00 ? 63 ASN A CG   5  
ATOM 7447  O OD1  . ASN A 1 63 ? -6.470  11.180  0.295   1.00 0.00 ? 63 ASN A OD1  5  
ATOM 7448  N ND2  . ASN A 1 63 ? -8.466  10.266  -0.106  1.00 0.00 ? 63 ASN A ND2  5  
ATOM 7449  H H    . ASN A 1 63 ? -4.912  9.428   1.153   1.00 0.00 ? 63 ASN A H    5  
ATOM 7450  H HA   . ASN A 1 63 ? -6.631  7.962   2.988   1.00 0.00 ? 63 ASN A HA   5  
ATOM 7451  H HB2  . ASN A 1 63 ? -8.373  9.587   2.357   1.00 0.00 ? 63 ASN A HB2  5  
ATOM 7452  H HB3  . ASN A 1 63 ? -6.882  10.439  2.736   1.00 0.00 ? 63 ASN A HB3  5  
ATOM 7453  H HD21 . ASN A 1 63 ? -9.179  9.685   0.231   1.00 0.00 ? 63 ASN A HD21 5  
ATOM 7454  H HD22 . ASN A 1 63 ? -8.496  10.707  -0.978  1.00 0.00 ? 63 ASN A HD22 5  
ATOM 7455  N N    . ILE A 1 64 ? -8.055  6.506   1.441   1.00 0.00 ? 64 ILE A N    5  
ATOM 7456  C CA   . ILE A 1 64 ? -8.672  5.478   0.564   1.00 0.00 ? 64 ILE A CA   5  
ATOM 7457  C C    . ILE A 1 64 ? -10.200 5.633   0.506   1.00 0.00 ? 64 ILE A C    5  
ATOM 7458  O O    . ILE A 1 64 ? -10.774 5.688   -0.589  1.00 0.00 ? 64 ILE A O    5  
ATOM 7459  C CB   . ILE A 1 64 ? -8.293  4.002   0.987   1.00 0.00 ? 64 ILE A CB   5  
ATOM 7460  C CG1  . ILE A 1 64 ? -8.699  3.684   2.466   1.00 0.00 ? 64 ILE A CG1  5  
ATOM 7461  C CG2  . ILE A 1 64 ? -6.787  3.756   0.762   1.00 0.00 ? 64 ILE A CG2  5  
ATOM 7462  C CD1  . ILE A 1 64 ? -8.583  2.225   2.847   1.00 0.00 ? 64 ILE A CD1  5  
ATOM 7463  H H    . ILE A 1 64 ? -8.299  6.523   2.393   1.00 0.00 ? 64 ILE A H    5  
ATOM 7464  H HA   . ILE A 1 64 ? -8.285  5.631   -0.449  1.00 0.00 ? 64 ILE A HA   5  
ATOM 7465  H HB   . ILE A 1 64 ? -8.833  3.320   0.323   1.00 0.00 ? 64 ILE A HB   5  
ATOM 7466  H HG12 . ILE A 1 64 ? -8.071  4.247   3.143   1.00 0.00 ? 64 ILE A HG12 5  
ATOM 7467  H HG13 . ILE A 1 64 ? -9.729  3.977   2.623   1.00 0.00 ? 64 ILE A HG13 5  
ATOM 7468  H HG21 . ILE A 1 64 ? -6.535  3.943   -0.277  1.00 0.00 ? 64 ILE A HG21 5  
ATOM 7469  H HG22 . ILE A 1 64 ? -6.533  2.730   1.003   1.00 0.00 ? 64 ILE A HG22 5  
ATOM 7470  H HG23 . ILE A 1 64 ? -6.210  4.421   1.391   1.00 0.00 ? 64 ILE A HG23 5  
ATOM 7471  H HD11 . ILE A 1 64 ? -7.559  1.900   2.737   1.00 0.00 ? 64 ILE A HD11 5  
ATOM 7472  H HD12 . ILE A 1 64 ? -9.218  1.634   2.204   1.00 0.00 ? 64 ILE A HD12 5  
ATOM 7473  H HD13 . ILE A 1 64 ? -8.893  2.097   3.874   1.00 0.00 ? 64 ILE A HD13 5  
ATOM 7474  N N    . GLY A 1 65 ? -10.851 5.756   1.685   1.00 0.00 ? 65 GLY A N    5  
ATOM 7475  C CA   . GLY A 1 65 ? -12.307 5.720   1.780   1.00 0.00 ? 65 GLY A CA   5  
ATOM 7476  C C    . GLY A 1 65 ? -12.869 4.335   1.442   1.00 0.00 ? 65 GLY A C    5  
ATOM 7477  O O    . GLY A 1 65 ? -13.222 3.563   2.341   1.00 0.00 ? 65 GLY A O    5  
ATOM 7478  H H    . GLY A 1 65 ? -10.324 5.882   2.503   1.00 0.00 ? 65 GLY A H    5  
ATOM 7479  H HA2  . GLY A 1 65 ? -12.590 5.984   2.790   1.00 0.00 ? 65 GLY A HA2  5  
ATOM 7480  H HA3  . GLY A 1 65 ? -12.729 6.451   1.101   1.00 0.00 ? 65 GLY A HA3  5  
ATOM 7481  N N    . SER A 1 66 ? -12.939 4.027   0.135   1.00 0.00 ? 66 SER A N    5  
ATOM 7482  C CA   . SER A 1 66 ? -13.360 2.713   -0.369  1.00 0.00 ? 66 SER A CA   5  
ATOM 7483  C C    . SER A 1 66 ? -12.230 1.684   -0.145  1.00 0.00 ? 66 SER A C    5  
ATOM 7484  O O    . SER A 1 66 ? -11.287 1.591   -0.941  1.00 0.00 ? 66 SER A O    5  
ATOM 7485  C CB   . SER A 1 66 ? -13.721 2.820   -1.861  1.00 0.00 ? 66 SER A CB   5  
ATOM 7486  O OG   . SER A 1 66 ? -14.677 3.841   -2.087  1.00 0.00 ? 66 SER A OG   5  
ATOM 7487  H H    . SER A 1 66 ? -12.693 4.714   -0.518  1.00 0.00 ? 66 SER A H    5  
ATOM 7488  H HA   . SER A 1 66 ? -14.245 2.400   0.187   1.00 0.00 ? 66 SER A HA   5  
ATOM 7489  H HB2  . SER A 1 66 ? -12.827 3.055   -2.431  1.00 0.00 ? 66 SER A HB2  5  
ATOM 7490  H HB3  . SER A 1 66 ? -14.124 1.877   -2.208  1.00 0.00 ? 66 SER A HB3  5  
ATOM 7491  H HG   . SER A 1 66 ? -14.220 4.631   -2.406  1.00 0.00 ? 66 SER A HG   5  
ATOM 7492  N N    . VAL A 1 67 ? -12.327 0.975   0.991   1.00 0.00 ? 67 VAL A N    5  
ATOM 7493  C CA   . VAL A 1 67 ? -11.388 -0.096  1.403   1.00 0.00 ? 67 VAL A CA   5  
ATOM 7494  C C    . VAL A 1 67 ? -11.371 -1.241  0.382   1.00 0.00 ? 67 VAL A C    5  
ATOM 7495  O O    . VAL A 1 67 ? -10.316 -1.822  0.115   1.00 0.00 ? 67 VAL A O    5  
ATOM 7496  C CB   . VAL A 1 67 ? -11.763 -0.665  2.824   1.00 0.00 ? 67 VAL A CB   5  
ATOM 7497  C CG1  . VAL A 1 67 ? -10.723 -1.707  3.335   1.00 0.00 ? 67 VAL A CG1  5  
ATOM 7498  C CG2  . VAL A 1 67 ? -11.945 0.493   3.827   1.00 0.00 ? 67 VAL A CG2  5  
ATOM 7499  H H    . VAL A 1 67 ? -13.063 1.206   1.592   1.00 0.00 ? 67 VAL A H    5  
ATOM 7500  H HA   . VAL A 1 67 ? -10.392 0.340   1.464   1.00 0.00 ? 67 VAL A HA   5  
ATOM 7501  H HB   . VAL A 1 67 ? -12.722 -1.178  2.738   1.00 0.00 ? 67 VAL A HB   5  
ATOM 7502  H HG11 . VAL A 1 67 ? -10.668 -2.540  2.645   1.00 0.00 ? 67 VAL A HG11 5  
ATOM 7503  H HG12 . VAL A 1 67 ? -11.017 -2.078  4.310   1.00 0.00 ? 67 VAL A HG12 5  
ATOM 7504  H HG13 . VAL A 1 67 ? -9.747  -1.245  3.414   1.00 0.00 ? 67 VAL A HG13 5  
ATOM 7505  H HG21 . VAL A 1 67 ? -12.262 0.106   4.788   1.00 0.00 ? 67 VAL A HG21 5  
ATOM 7506  H HG22 . VAL A 1 67 ? -12.696 1.182   3.457   1.00 0.00 ? 67 VAL A HG22 5  
ATOM 7507  H HG23 . VAL A 1 67 ? -11.008 1.024   3.951   1.00 0.00 ? 67 VAL A HG23 5  
ATOM 7508  N N    . ASP A 1 68 ? -12.553 -1.542  -0.193  1.00 0.00 ? 68 ASP A N    5  
ATOM 7509  C CA   . ASP A 1 68 ? -12.718 -2.592  -1.219  1.00 0.00 ? 68 ASP A CA   5  
ATOM 7510  C C    . ASP A 1 68 ? -11.905 -2.245  -2.472  1.00 0.00 ? 68 ASP A C    5  
ATOM 7511  O O    . ASP A 1 68 ? -11.297 -3.123  -3.081  1.00 0.00 ? 68 ASP A O    5  
ATOM 7512  C CB   . ASP A 1 68 ? -14.223 -2.776  -1.586  1.00 0.00 ? 68 ASP A CB   5  
ATOM 7513  C CG   . ASP A 1 68 ? -15.100 -3.093  -0.361  1.00 0.00 ? 68 ASP A CG   5  
ATOM 7514  O OD1  . ASP A 1 68 ? -15.460 -2.143  0.373   1.00 0.00 ? 68 ASP A OD1  5  
ATOM 7515  O OD2  . ASP A 1 68 ? -15.411 -4.281  -0.107  1.00 0.00 ? 68 ASP A OD2  5  
ATOM 7516  H H    . ASP A 1 68 ? -13.360 -1.057  0.078   1.00 0.00 ? 68 ASP A H    5  
ATOM 7517  H HA   . ASP A 1 68 ? -12.342 -3.520  -0.800  1.00 0.00 ? 68 ASP A HA   5  
ATOM 7518  H HB2  . ASP A 1 68 ? -14.594 -1.864  -2.051  1.00 0.00 ? 68 ASP A HB2  5  
ATOM 7519  H HB3  . ASP A 1 68 ? -14.319 -3.587  -2.305  1.00 0.00 ? 68 ASP A HB3  5  
ATOM 7520  N N    . THR A 1 69 ? -11.895 -0.948  -2.832  1.00 0.00 ? 69 THR A N    5  
ATOM 7521  C CA   . THR A 1 69 ? -11.125 -0.454  -3.976  1.00 0.00 ? 69 THR A CA   5  
ATOM 7522  C C    . THR A 1 69 ? -9.613  -0.507  -3.678  1.00 0.00 ? 69 THR A C    5  
ATOM 7523  O O    . THR A 1 69 ? -8.839  -0.900  -4.549  1.00 0.00 ? 69 THR A O    5  
ATOM 7524  C CB   . THR A 1 69 ? -11.550 0.996   -4.374  1.00 0.00 ? 69 THR A CB   5  
ATOM 7525  O OG1  . THR A 1 69 ? -12.970 1.029   -4.619  1.00 0.00 ? 69 THR A OG1  5  
ATOM 7526  C CG2  . THR A 1 69 ? -10.806 1.504   -5.627  1.00 0.00 ? 69 THR A CG2  5  
ATOM 7527  H H    . THR A 1 69 ? -12.427 -0.309  -2.314  1.00 0.00 ? 69 THR A H    5  
ATOM 7528  H HA   . THR A 1 69 ? -11.342 -1.114  -4.821  1.00 0.00 ? 69 THR A HA   5  
ATOM 7529  H HB   . THR A 1 69 ? -11.329 1.665   -3.544  1.00 0.00 ? 69 THR A HB   5  
ATOM 7530  H HG1  . THR A 1 69 ? -13.244 0.195   -5.020  1.00 0.00 ? 69 THR A HG1  5  
ATOM 7531  H HG21 . THR A 1 69 ? -11.025 0.861   -6.471  1.00 0.00 ? 69 THR A HG21 5  
ATOM 7532  H HG22 . THR A 1 69 ? -9.739  1.505   -5.446  1.00 0.00 ? 69 THR A HG22 5  
ATOM 7533  H HG23 . THR A 1 69 ? -11.129 2.511   -5.854  1.00 0.00 ? 69 THR A HG23 5  
ATOM 7534  N N    . PHE A 1 70 ? -9.213  -0.125  -2.438  1.00 0.00 ? 70 PHE A N    5  
ATOM 7535  C CA   . PHE A 1 70 ? -7.814  -0.229  -1.971  1.00 0.00 ? 70 PHE A CA   5  
ATOM 7536  C C    . PHE A 1 70 ? -7.278  -1.652  -2.174  1.00 0.00 ? 70 PHE A C    5  
ATOM 7537  O O    . PHE A 1 70 ? -6.243  -1.841  -2.816  1.00 0.00 ? 70 PHE A O    5  
ATOM 7538  C CB   . PHE A 1 70 ? -7.683  0.195   -0.475  1.00 0.00 ? 70 PHE A CB   5  
ATOM 7539  C CG   . PHE A 1 70 ? -6.336  -0.170  0.164   1.00 0.00 ? 70 PHE A CG   5  
ATOM 7540  C CD1  . PHE A 1 70 ? -5.147  0.413   -0.282  1.00 0.00 ? 70 PHE A CD1  5  
ATOM 7541  C CD2  . PHE A 1 70 ? -6.255  -1.138  1.169   1.00 0.00 ? 70 PHE A CD2  5  
ATOM 7542  C CE1  . PHE A 1 70 ? -3.931  0.044   0.265   1.00 0.00 ? 70 PHE A CE1  5  
ATOM 7543  C CE2  . PHE A 1 70 ? -5.037  -1.507  1.705   1.00 0.00 ? 70 PHE A CE2  5  
ATOM 7544  C CZ   . PHE A 1 70 ? -3.880  -0.916  1.256   1.00 0.00 ? 70 PHE A CZ   5  
ATOM 7545  H H    . PHE A 1 70 ? -9.872  0.259   -1.823  1.00 0.00 ? 70 PHE A H    5  
ATOM 7546  H HA   . PHE A 1 70 ? -7.224  0.453   -2.576  1.00 0.00 ? 70 PHE A HA   5  
ATOM 7547  H HB2  . PHE A 1 70 ? -7.804  1.265   -0.399  1.00 0.00 ? 70 PHE A HB2  5  
ATOM 7548  H HB3  . PHE A 1 70 ? -8.475  -0.284  0.099   1.00 0.00 ? 70 PHE A HB3  5  
ATOM 7549  H HD1  . PHE A 1 70 ? -5.180  1.169   -1.056  1.00 0.00 ? 70 PHE A HD1  5  
ATOM 7550  H HD2  . PHE A 1 70 ? -7.163  -1.605  1.534   1.00 0.00 ? 70 PHE A HD2  5  
ATOM 7551  H HE1  . PHE A 1 70 ? -3.016  0.506   -0.086  1.00 0.00 ? 70 PHE A HE1  5  
ATOM 7552  H HE2  . PHE A 1 70 ? -4.992  -2.261  2.485   1.00 0.00 ? 70 PHE A HE2  5  
ATOM 7553  H HZ   . PHE A 1 70 ? -2.926  -1.205  1.680   1.00 0.00 ? 70 PHE A HZ   5  
ATOM 7554  N N    . GLU A 1 71 ? -8.031  -2.627  -1.641  1.00 0.00 ? 71 GLU A N    5  
ATOM 7555  C CA   . GLU A 1 71 ? -7.684  -4.047  -1.697  1.00 0.00 ? 71 GLU A CA   5  
ATOM 7556  C C    . GLU A 1 71 ? -7.583  -4.542  -3.144  1.00 0.00 ? 71 GLU A C    5  
ATOM 7557  O O    . GLU A 1 71 ? -6.560  -5.097  -3.535  1.00 0.00 ? 71 GLU A O    5  
ATOM 7558  C CB   . GLU A 1 71 ? -8.736  -4.873  -0.924  1.00 0.00 ? 71 GLU A CB   5  
ATOM 7559  C CG   . GLU A 1 71 ? -8.715  -4.667  0.598   1.00 0.00 ? 71 GLU A CG   5  
ATOM 7560  C CD   . GLU A 1 71 ? -7.411  -5.142  1.259   1.00 0.00 ? 71 GLU A CD   5  
ATOM 7561  O OE1  . GLU A 1 71 ? -7.068  -6.335  1.103   1.00 0.00 ? 71 GLU A OE1  5  
ATOM 7562  O OE2  . GLU A 1 71 ? -6.744  -4.347  1.945   1.00 0.00 ? 71 GLU A OE2  5  
ATOM 7563  H H    . GLU A 1 71 ? -8.864  -2.374  -1.188  1.00 0.00 ? 71 GLU A H    5  
ATOM 7564  H HA   . GLU A 1 71 ? -6.715  -4.165  -1.215  1.00 0.00 ? 71 GLU A HA   5  
ATOM 7565  H HB2  . GLU A 1 71 ? -9.727  -4.609  -1.286  1.00 0.00 ? 71 GLU A HB2  5  
ATOM 7566  H HB3  . GLU A 1 71 ? -8.571  -5.925  -1.121  1.00 0.00 ? 71 GLU A HB3  5  
ATOM 7567  H HG2  . GLU A 1 71 ? -8.862  -3.610  0.804   1.00 0.00 ? 71 GLU A HG2  5  
ATOM 7568  H HG3  . GLU A 1 71 ? -9.540  -5.222  1.031   1.00 0.00 ? 71 GLU A HG3  5  
ATOM 7569  N N    . ARG A 1 72 ? -8.644  -4.283  -3.926  1.00 0.00 ? 72 ARG A N    5  
ATOM 7570  C CA   . ARG A 1 72 ? -8.795  -4.756  -5.294  1.00 0.00 ? 72 ARG A CA   5  
ATOM 7571  C C    . ARG A 1 72 ? -7.655  -4.260  -6.203  1.00 0.00 ? 72 ARG A C    5  
ATOM 7572  O O    . ARG A 1 72 ? -7.060  -5.036  -6.971  1.00 0.00 ? 72 ARG A O    5  
ATOM 7573  C CB   . ARG A 1 72 ? -10.157 -4.250  -5.814  1.00 0.00 ? 72 ARG A CB   5  
ATOM 7574  C CG   . ARG A 1 72 ? -10.585 -4.827  -7.162  1.00 0.00 ? 72 ARG A CG   5  
ATOM 7575  C CD   . ARG A 1 72 ? -11.155 -6.255  -7.070  1.00 0.00 ? 72 ARG A CD   5  
ATOM 7576  N NE   . ARG A 1 72 ? -10.186 -7.286  -6.621  1.00 0.00 ? 72 ARG A NE   5  
ATOM 7577  C CZ   . ARG A 1 72 ? -9.875  -8.402  -7.291  1.00 0.00 ? 72 ARG A CZ   5  
ATOM 7578  N NH1  . ARG A 1 72 ? -10.432 -8.685  -8.467  1.00 0.00 ? 72 ARG A NH1  5  
ATOM 7579  N NH2  . ARG A 1 72 ? -9.052  -9.268  -6.743  1.00 0.00 ? 72 ARG A NH2  5  
ATOM 7580  H H    . ARG A 1 72 ? -9.376  -3.746  -3.576  1.00 0.00 ? 72 ARG A H    5  
ATOM 7581  H HA   . ARG A 1 72 ? -8.803  -5.842  -5.278  1.00 0.00 ? 72 ARG A HA   5  
ATOM 7582  H HB2  . ARG A 1 72 ? -10.926 -4.496  -5.083  1.00 0.00 ? 72 ARG A HB2  5  
ATOM 7583  H HB3  . ARG A 1 72 ? -10.113 -3.166  -5.902  1.00 0.00 ? 72 ARG A HB3  5  
ATOM 7584  H HG2  . ARG A 1 72 ? -11.341 -4.182  -7.582  1.00 0.00 ? 72 ARG A HG2  5  
ATOM 7585  H HG3  . ARG A 1 72 ? -9.727  -4.836  -7.821  1.00 0.00 ? 72 ARG A HG3  5  
ATOM 7586  H HD2  . ARG A 1 72 ? -11.979 -6.245  -6.366  1.00 0.00 ? 72 ARG A HD2  5  
ATOM 7587  H HD3  . ARG A 1 72 ? -11.537 -6.527  -8.044  1.00 0.00 ? 72 ARG A HD3  5  
ATOM 7588  H HE   . ARG A 1 72 ? -9.757  -7.141  -5.748  1.00 0.00 ? 72 ARG A HE   5  
ATOM 7589  H HH11 . ARG A 1 72 ? -11.099 -8.053  -8.878  1.00 0.00 ? 72 ARG A HH11 5  
ATOM 7590  H HH12 . ARG A 1 72 ? -10.189 -9.527  -8.954  1.00 0.00 ? 72 ARG A HH12 5  
ATOM 7591  H HH21 . ARG A 1 72 ? -8.657  -9.088  -5.833  1.00 0.00 ? 72 ARG A HH21 5  
ATOM 7592  H HH22 . ARG A 1 72 ? -8.806  -10.112 -7.230  1.00 0.00 ? 72 ARG A HH22 5  
ATOM 7593  N N    . ASN A 1 73 ? -7.366  -2.953  -6.078  1.00 0.00 ? 73 ASN A N    5  
ATOM 7594  C CA   . ASN A 1 73 ? -6.313  -2.278  -6.844  1.00 0.00 ? 73 ASN A CA   5  
ATOM 7595  C C    . ASN A 1 73 ? -4.939  -2.789  -6.423  1.00 0.00 ? 73 ASN A C    5  
ATOM 7596  O O    . ASN A 1 73 ? -4.101  -3.047  -7.271  1.00 0.00 ? 73 ASN A O    5  
ATOM 7597  C CB   . ASN A 1 73 ? -6.411  -0.738  -6.671  1.00 0.00 ? 73 ASN A CB   5  
ATOM 7598  C CG   . ASN A 1 73 ? -7.646  -0.101  -7.353  1.00 0.00 ? 73 ASN A CG   5  
ATOM 7599  O OD1  . ASN A 1 73 ? -7.592  1.049   -7.782  1.00 0.00 ? 73 ASN A OD1  5  
ATOM 7600  N ND2  . ASN A 1 73 ? -8.768  -0.823  -7.469  1.00 0.00 ? 73 ASN A ND2  5  
ATOM 7601  H H    . ASN A 1 73 ? -7.880  -2.421  -5.439  1.00 0.00 ? 73 ASN A H    5  
ATOM 7602  H HA   . ASN A 1 73 ? -6.467  -2.520  -7.895  1.00 0.00 ? 73 ASN A HA   5  
ATOM 7603  H HB2  . ASN A 1 73 ? -6.450  -0.497  -5.613  1.00 0.00 ? 73 ASN A HB2  5  
ATOM 7604  H HB3  . ASN A 1 73 ? -5.521  -0.280  -7.093  1.00 0.00 ? 73 ASN A HB3  5  
ATOM 7605  H HD21 . ASN A 1 73 ? -8.783  -1.740  -7.123  1.00 0.00 ? 73 ASN A HD21 5  
ATOM 7606  H HD22 . ASN A 1 73 ? -9.541  -0.396  -7.895  1.00 0.00 ? 73 ASN A HD22 5  
ATOM 7607  N N    . LEU A 1 74 ? -4.754  -2.965  -5.099  1.00 0.00 ? 74 LEU A N    5  
ATOM 7608  C CA   . LEU A 1 74 ? -3.501  -3.472  -4.504  1.00 0.00 ? 74 LEU A CA   5  
ATOM 7609  C C    . LEU A 1 74 ? -3.151  -4.883  -5.037  1.00 0.00 ? 74 LEU A C    5  
ATOM 7610  O O    . LEU A 1 74 ? -1.998  -5.149  -5.371  1.00 0.00 ? 74 LEU A O    5  
ATOM 7611  C CB   . LEU A 1 74 ? -3.626  -3.499  -2.953  1.00 0.00 ? 74 LEU A CB   5  
ATOM 7612  C CG   . LEU A 1 74 ? -2.326  -3.814  -2.156  1.00 0.00 ? 74 LEU A CG   5  
ATOM 7613  C CD1  . LEU A 1 74 ? -1.232  -2.754  -2.420  1.00 0.00 ? 74 LEU A CD1  5  
ATOM 7614  C CD2  . LEU A 1 74 ? -2.624  -3.955  -0.649  1.00 0.00 ? 74 LEU A CD2  5  
ATOM 7615  H H    . LEU A 1 74 ? -5.485  -2.719  -4.492  1.00 0.00 ? 74 LEU A H    5  
ATOM 7616  H HA   . LEU A 1 74 ? -2.712  -2.779  -4.782  1.00 0.00 ? 74 LEU A HA   5  
ATOM 7617  H HB2  . LEU A 1 74 ? -3.989  -2.527  -2.630  1.00 0.00 ? 74 LEU A HB2  5  
ATOM 7618  H HB3  . LEU A 1 74 ? -4.382  -4.238  -2.687  1.00 0.00 ? 74 LEU A HB3  5  
ATOM 7619  H HG   . LEU A 1 74 ? -1.932  -4.767  -2.496  1.00 0.00 ? 74 LEU A HG   5  
ATOM 7620  H HD11 . LEU A 1 74 ? -1.589  -1.774  -2.119  1.00 0.00 ? 74 LEU A HD11 5  
ATOM 7621  H HD12 . LEU A 1 74 ? -0.986  -2.737  -3.472  1.00 0.00 ? 74 LEU A HD12 5  
ATOM 7622  H HD13 . LEU A 1 74 ? -0.344  -2.999  -1.854  1.00 0.00 ? 74 LEU A HD13 5  
ATOM 7623  H HD21 . LEU A 1 74 ? -3.031  -3.027  -0.264  1.00 0.00 ? 74 LEU A HD21 5  
ATOM 7624  H HD22 . LEU A 1 74 ? -1.713  -4.192  -0.117  1.00 0.00 ? 74 LEU A HD22 5  
ATOM 7625  H HD23 . LEU A 1 74 ? -3.340  -4.751  -0.491  1.00 0.00 ? 74 LEU A HD23 5  
ATOM 7626  N N    . GLU A 1 75 ? -4.177  -5.758  -5.119  1.00 0.00 ? 75 GLU A N    5  
ATOM 7627  C CA   . GLU A 1 75 ? -4.042  -7.143  -5.630  1.00 0.00 ? 75 GLU A CA   5  
ATOM 7628  C C    . GLU A 1 75 ? -3.548  -7.149  -7.084  1.00 0.00 ? 75 GLU A C    5  
ATOM 7629  O O    . GLU A 1 75 ? -2.481  -7.693  -7.371  1.00 0.00 ? 75 GLU A O    5  
ATOM 7630  C CB   . GLU A 1 75 ? -5.406  -7.890  -5.536  1.00 0.00 ? 75 GLU A CB   5  
ATOM 7631  C CG   . GLU A 1 75 ? -5.908  -8.116  -4.095  1.00 0.00 ? 75 GLU A CG   5  
ATOM 7632  C CD   . GLU A 1 75 ? -7.350  -8.635  -4.049  1.00 0.00 ? 75 GLU A CD   5  
ATOM 7633  O OE1  . GLU A 1 75 ? -7.558  -9.866  -4.073  1.00 0.00 ? 75 GLU A OE1  5  
ATOM 7634  O OE2  . GLU A 1 75 ? -8.288  -7.815  -4.032  1.00 0.00 ? 75 GLU A OE2  5  
ATOM 7635  H H    . GLU A 1 75 ? -5.061  -5.458  -4.819  1.00 0.00 ? 75 GLU A H    5  
ATOM 7636  H HA   . GLU A 1 75 ? -3.316  -7.658  -5.005  1.00 0.00 ? 75 GLU A HA   5  
ATOM 7637  H HB2  . GLU A 1 75 ? -6.156  -7.311  -6.075  1.00 0.00 ? 75 GLU A HB2  5  
ATOM 7638  H HB3  . GLU A 1 75 ? -5.316  -8.858  -6.020  1.00 0.00 ? 75 GLU A HB3  5  
ATOM 7639  H HG2  . GLU A 1 75 ? -5.254  -8.832  -3.601  1.00 0.00 ? 75 GLU A HG2  5  
ATOM 7640  H HG3  . GLU A 1 75 ? -5.855  -7.172  -3.557  1.00 0.00 ? 75 GLU A HG3  5  
ATOM 7641  N N    . THR A 1 76 ? -4.308  -6.449  -7.956  1.00 0.00 ? 76 THR A N    5  
ATOM 7642  C CA   . THR A 1 76 ? -4.079  -6.426  -9.413  1.00 0.00 ? 76 THR A CA   5  
ATOM 7643  C C    . THR A 1 76 ? -2.707  -5.798  -9.729  1.00 0.00 ? 76 THR A C    5  
ATOM 7644  O O    . THR A 1 76 ? -1.912  -6.353  -10.495 1.00 0.00 ? 76 THR A O    5  
ATOM 7645  C CB   . THR A 1 76 ? -5.210  -5.611  -10.131 1.00 0.00 ? 76 THR A CB   5  
ATOM 7646  O OG1  . THR A 1 76 ? -6.494  -6.072  -9.682  1.00 0.00 ? 76 THR A OG1  5  
ATOM 7647  C CG2  . THR A 1 76 ? -5.142  -5.729  -11.667 1.00 0.00 ? 76 THR A CG2  5  
ATOM 7648  H H    . THR A 1 76 ? -5.038  -5.906  -7.591  1.00 0.00 ? 76 THR A H    5  
ATOM 7649  H HA   . THR A 1 76 ? -4.106  -7.451  -9.769  1.00 0.00 ? 76 THR A HA   5  
ATOM 7650  H HB   . THR A 1 76 ? -5.113  -4.556  -9.857  1.00 0.00 ? 76 THR A HB   5  
ATOM 7651  H HG1  . THR A 1 76 ? -6.951  -5.365  -9.220  1.00 0.00 ? 76 THR A HG1  5  
ATOM 7652  H HG21 . THR A 1 76 ? -4.194  -5.349  -12.025 1.00 0.00 ? 76 THR A HG21 5  
ATOM 7653  H HG22 . THR A 1 76 ? -5.948  -5.153  -12.111 1.00 0.00 ? 76 THR A HG22 5  
ATOM 7654  H HG23 . THR A 1 76 ? -5.245  -6.764  -11.958 1.00 0.00 ? 76 THR A HG23 5  
ATOM 7655  N N    . LEU A 1 77 ? -2.481  -4.637  -9.096  1.00 0.00 ? 77 LEU A N    5  
ATOM 7656  C CA   . LEU A 1 77 ? -1.252  -3.840  -9.203  1.00 0.00 ? 77 LEU A CA   5  
ATOM 7657  C C    . LEU A 1 77 ? 0.012   -4.651  -8.883  1.00 0.00 ? 77 LEU A C    5  
ATOM 7658  O O    . LEU A 1 77 ? 0.929   -4.686  -9.696  1.00 0.00 ? 77 LEU A O    5  
ATOM 7659  C CB   . LEU A 1 77 ? -1.336  -2.623  -8.261  1.00 0.00 ? 77 LEU A CB   5  
ATOM 7660  C CG   . LEU A 1 77 ? -0.160  -1.615  -8.320  1.00 0.00 ? 77 LEU A CG   5  
ATOM 7661  C CD1  . LEU A 1 77 ? 0.045   -1.042  -9.747  1.00 0.00 ? 77 LEU A CD1  5  
ATOM 7662  C CD2  . LEU A 1 77 ? -0.385  -0.501  -7.295  1.00 0.00 ? 77 LEU A CD2  5  
ATOM 7663  H H    . LEU A 1 77 ? -3.221  -4.271  -8.571  1.00 0.00 ? 77 LEU A H    5  
ATOM 7664  H HA   . LEU A 1 77 ? -1.194  -3.480  -10.225 1.00 0.00 ? 77 LEU A HA   5  
ATOM 7665  H HB2  . LEU A 1 77 ? -2.254  -2.085  -8.490  1.00 0.00 ? 77 LEU A HB2  5  
ATOM 7666  H HB3  . LEU A 1 77 ? -1.421  -2.994  -7.239  1.00 0.00 ? 77 LEU A HB3  5  
ATOM 7667  H HG   . LEU A 1 77 ? 0.757   -2.128  -8.046  1.00 0.00 ? 77 LEU A HG   5  
ATOM 7668  H HD11 . LEU A 1 77 ? 0.262   -1.848  -10.437 1.00 0.00 ? 77 LEU A HD11 5  
ATOM 7669  H HD12 . LEU A 1 77 ? 0.875   -0.351  -9.746  1.00 0.00 ? 77 LEU A HD12 5  
ATOM 7670  H HD13 . LEU A 1 77 ? -0.851  -0.524  -10.073 1.00 0.00 ? 77 LEU A HD13 5  
ATOM 7671  H HD21 . LEU A 1 77 ? -1.268  0.071   -7.554  1.00 0.00 ? 77 LEU A HD21 5  
ATOM 7672  H HD22 . LEU A 1 77 ? 0.472   0.155   -7.282  1.00 0.00 ? 77 LEU A HD22 5  
ATOM 7673  H HD23 . LEU A 1 77 ? -0.513  -0.931  -6.310  1.00 0.00 ? 77 LEU A HD23 5  
ATOM 7674  N N    . GLN A 1 78 ? 0.037   -5.318  -7.709  1.00 0.00 ? 78 GLN A N    5  
ATOM 7675  C CA   . GLN A 1 78 ? 1.211   -6.099  -7.267  1.00 0.00 ? 78 GLN A CA   5  
ATOM 7676  C C    . GLN A 1 78 ? 1.441   -7.327  -8.175  1.00 0.00 ? 78 GLN A C    5  
ATOM 7677  O O    . GLN A 1 78 ? 2.580   -7.740  -8.374  1.00 0.00 ? 78 GLN A O    5  
ATOM 7678  C CB   . GLN A 1 78 ? 1.071   -6.531  -5.792  1.00 0.00 ? 78 GLN A CB   5  
ATOM 7679  C CG   . GLN A 1 78 ? 1.052   -5.376  -4.782  1.00 0.00 ? 78 GLN A CG   5  
ATOM 7680  C CD   . GLN A 1 78 ? 0.964   -5.869  -3.338  1.00 0.00 ? 78 GLN A CD   5  
ATOM 7681  O OE1  . GLN A 1 78 ? 1.973   -6.021  -2.651  1.00 0.00 ? 78 GLN A OE1  5  
ATOM 7682  N NE2  . GLN A 1 78 ? -0.237  -6.192  -2.896  1.00 0.00 ? 78 GLN A NE2  5  
ATOM 7683  H H    . GLN A 1 78 ? -0.762  -5.295  -7.132  1.00 0.00 ? 78 GLN A H    5  
ATOM 7684  H HA   . GLN A 1 78 ? 2.081   -5.446  -7.355  1.00 0.00 ? 78 GLN A HA   5  
ATOM 7685  H HB2  . GLN A 1 78 ? 0.150   -7.099  -5.678  1.00 0.00 ? 78 GLN A HB2  5  
ATOM 7686  H HB3  . GLN A 1 78 ? 1.904   -7.181  -5.542  1.00 0.00 ? 78 GLN A HB3  5  
ATOM 7687  H HG2  . GLN A 1 78 ? 1.961   -4.791  -4.899  1.00 0.00 ? 78 GLN A HG2  5  
ATOM 7688  H HG3  . GLN A 1 78 ? 0.198   -4.741  -4.991  1.00 0.00 ? 78 GLN A HG3  5  
ATOM 7689  H HE21 . GLN A 1 78 ? -1.001  -6.101  -3.510  1.00 0.00 ? 78 GLN A HE21 5  
ATOM 7690  H HE22 . GLN A 1 78 ? -0.316  -6.501  -1.974  1.00 0.00 ? 78 GLN A HE22 5  
ATOM 7691  N N    . GLN A 1 79 ? 0.343   -7.874  -8.746  1.00 0.00 ? 79 GLN A N    5  
ATOM 7692  C CA   . GLN A 1 79 ? 0.423   -8.953  -9.761  1.00 0.00 ? 79 GLN A CA   5  
ATOM 7693  C C    . GLN A 1 79 ? 1.136   -8.436  -11.029 1.00 0.00 ? 79 GLN A C    5  
ATOM 7694  O O    . GLN A 1 79 ? 1.938   -9.153  -11.628 1.00 0.00 ? 79 GLN A O    5  
ATOM 7695  C CB   . GLN A 1 79 ? -0.989  -9.500  -10.117 1.00 0.00 ? 79 GLN A CB   5  
ATOM 7696  C CG   . GLN A 1 79 ? -1.675  -10.291 -8.999  1.00 0.00 ? 79 GLN A CG   5  
ATOM 7697  C CD   . GLN A 1 79 ? -3.106  -10.720 -9.349  1.00 0.00 ? 79 GLN A CD   5  
ATOM 7698  O OE1  . GLN A 1 79 ? -4.068  -10.002 -9.071  1.00 0.00 ? 79 GLN A OE1  5  
ATOM 7699  N NE2  . GLN A 1 79 ? -3.252  -11.875 -9.980  1.00 0.00 ? 79 GLN A NE2  5  
ATOM 7700  H H    . GLN A 1 79 ? -0.536  -7.526  -8.481  1.00 0.00 ? 79 GLN A H    5  
ATOM 7701  H HA   . GLN A 1 79 ? 1.017   -9.761  -9.339  1.00 0.00 ? 79 GLN A HA   5  
ATOM 7702  H HB2  . GLN A 1 79 ? -1.633  -8.666  -10.385 1.00 0.00 ? 79 GLN A HB2  5  
ATOM 7703  H HB3  . GLN A 1 79 ? -0.904  -10.154 -10.984 1.00 0.00 ? 79 GLN A HB3  5  
ATOM 7704  H HG2  . GLN A 1 79 ? -1.084  -11.177 -8.789  1.00 0.00 ? 79 GLN A HG2  5  
ATOM 7705  H HG3  . GLN A 1 79 ? -1.708  -9.681  -8.102  1.00 0.00 ? 79 GLN A HG3  5  
ATOM 7706  H HE21 . GLN A 1 79 ? -2.448  -12.396 -10.190 1.00 0.00 ? 79 GLN A HE21 5  
ATOM 7707  H HE22 . GLN A 1 79 ? -4.160  -12.165 -10.204 1.00 0.00 ? 79 GLN A HE22 5  
ATOM 7708  N N    . GLU A 1 80 ? 0.851   -7.169  -11.400 1.00 0.00 ? 80 GLU A N    5  
ATOM 7709  C CA   . GLU A 1 80 ? 1.483   -6.503  -12.557 1.00 0.00 ? 80 GLU A CA   5  
ATOM 7710  C C    . GLU A 1 80 ? 2.965   -6.201  -12.277 1.00 0.00 ? 80 GLU A C    5  
ATOM 7711  O O    . GLU A 1 80 ? 3.820   -6.404  -13.140 1.00 0.00 ? 80 GLU A O    5  
ATOM 7712  C CB   . GLU A 1 80 ? 0.731   -5.187  -12.913 1.00 0.00 ? 80 GLU A CB   5  
ATOM 7713  C CG   . GLU A 1 80 ? -0.724  -5.385  -13.368 1.00 0.00 ? 80 GLU A CG   5  
ATOM 7714  C CD   . GLU A 1 80 ? -0.848  -6.309  -14.586 1.00 0.00 ? 80 GLU A CD   5  
ATOM 7715  O OE1  . GLU A 1 80 ? -0.571  -5.853  -15.718 1.00 0.00 ? 80 GLU A OE1  5  
ATOM 7716  O OE2  . GLU A 1 80 ? -1.208  -7.499  -14.425 1.00 0.00 ? 80 GLU A OE2  5  
ATOM 7717  H H    . GLU A 1 80 ? 0.190   -6.660  -10.877 1.00 0.00 ? 80 GLU A H    5  
ATOM 7718  H HA   . GLU A 1 80 ? 1.419   -7.185  -13.403 1.00 0.00 ? 80 GLU A HA   5  
ATOM 7719  H HB2  . GLU A 1 80 ? 0.732   -4.535  -12.041 1.00 0.00 ? 80 GLU A HB2  5  
ATOM 7720  H HB3  . GLU A 1 80 ? 1.264   -4.678  -13.713 1.00 0.00 ? 80 GLU A HB3  5  
ATOM 7721  H HG2  . GLU A 1 80 ? -1.292  -5.804  -12.542 1.00 0.00 ? 80 GLU A HG2  5  
ATOM 7722  H HG3  . GLU A 1 80 ? -1.148  -4.415  -13.620 1.00 0.00 ? 80 GLU A HG3  5  
ATOM 7723  N N    . LEU A 1 81 ? 3.249   -5.693  -11.067 1.00 0.00 ? 81 LEU A N    5  
ATOM 7724  C CA   . LEU A 1 81 ? 4.613   -5.333  -10.631 1.00 0.00 ? 81 LEU A CA   5  
ATOM 7725  C C    . LEU A 1 81 ? 5.482   -6.589  -10.386 1.00 0.00 ? 81 LEU A C    5  
ATOM 7726  O O    . LEU A 1 81 ? 6.711   -6.493  -10.357 1.00 0.00 ? 81 LEU A O    5  
ATOM 7727  C CB   . LEU A 1 81 ? 4.528   -4.470  -9.336  1.00 0.00 ? 81 LEU A CB   5  
ATOM 7728  C CG   . LEU A 1 81 ? 3.711   -3.135  -9.427  1.00 0.00 ? 81 LEU A CG   5  
ATOM 7729  C CD1  . LEU A 1 81 ? 3.565   -2.467  -8.038  1.00 0.00 ? 81 LEU A CD1  5  
ATOM 7730  C CD2  . LEU A 1 81 ? 4.320   -2.160  -10.463 1.00 0.00 ? 81 LEU A CD2  5  
ATOM 7731  H H    . LEU A 1 81 ? 2.512   -5.528  -10.444 1.00 0.00 ? 81 LEU A H    5  
ATOM 7732  H HA   . LEU A 1 81 ? 5.072   -4.740  -11.419 1.00 0.00 ? 81 LEU A HA   5  
ATOM 7733  H HB2  . LEU A 1 81 ? 4.083   -5.087  -8.555  1.00 0.00 ? 81 LEU A HB2  5  
ATOM 7734  H HB3  . LEU A 1 81 ? 5.537   -4.225  -9.026  1.00 0.00 ? 81 LEU A HB3  5  
ATOM 7735  H HG   . LEU A 1 81 ? 2.706   -3.371  -9.766  1.00 0.00 ? 81 LEU A HG   5  
ATOM 7736  H HD11 . LEU A 1 81 ? 2.986   -1.557  -8.125  1.00 0.00 ? 81 LEU A HD11 5  
ATOM 7737  H HD12 . LEU A 1 81 ? 4.544   -2.227  -7.635  1.00 0.00 ? 81 LEU A HD12 5  
ATOM 7738  H HD13 . LEU A 1 81 ? 3.060   -3.144  -7.360  1.00 0.00 ? 81 LEU A HD13 5  
ATOM 7739  H HD21 . LEU A 1 81 ? 5.336   -1.910  -10.182 1.00 0.00 ? 81 LEU A HD21 5  
ATOM 7740  H HD22 . LEU A 1 81 ? 3.729   -1.251  -10.506 1.00 0.00 ? 81 LEU A HD22 5  
ATOM 7741  H HD23 . LEU A 1 81 ? 4.323   -2.622  -11.440 1.00 0.00 ? 81 LEU A HD23 5  
ATOM 7742  N N    . GLY A 1 82 ? 4.825   -7.757  -10.211 1.00 0.00 ? 82 GLY A N    5  
ATOM 7743  C CA   . GLY A 1 82 ? 5.513   -9.018  -9.903  1.00 0.00 ? 82 GLY A CA   5  
ATOM 7744  C C    . GLY A 1 82 ? 5.740   -9.224  -8.404  1.00 0.00 ? 82 GLY A C    5  
ATOM 7745  O O    . GLY A 1 82 ? 6.425   -10.164 -8.001  1.00 0.00 ? 82 GLY A O    5  
ATOM 7746  H H    . GLY A 1 82 ? 3.847   -7.762  -10.293 1.00 0.00 ? 82 GLY A H    5  
ATOM 7747  H HA2  . GLY A 1 82 ? 4.907   -9.833  -10.271 1.00 0.00 ? 82 GLY A HA2  5  
ATOM 7748  H HA3  . GLY A 1 82 ? 6.469   -9.040  -10.412 1.00 0.00 ? 82 GLY A HA3  5  
ATOM 7749  N N    . ILE A 1 83 ? 5.145   -8.337  -7.589  1.00 0.00 ? 83 ILE A N    5  
ATOM 7750  C CA   . ILE A 1 83 ? 5.208   -8.356  -6.122  1.00 0.00 ? 83 ILE A CA   5  
ATOM 7751  C C    . ILE A 1 83 ? 4.150   -9.353  -5.591  1.00 0.00 ? 83 ILE A C    5  
ATOM 7752  O O    . ILE A 1 83 ? 2.967   -9.023  -5.513  1.00 0.00 ? 83 ILE A O    5  
ATOM 7753  C CB   . ILE A 1 83 ? 4.926   -6.899  -5.577  1.00 0.00 ? 83 ILE A CB   5  
ATOM 7754  C CG1  . ILE A 1 83 ? 5.996   -5.904  -6.118  1.00 0.00 ? 83 ILE A CG1  5  
ATOM 7755  C CG2  . ILE A 1 83 ? 4.845   -6.852  -4.038  1.00 0.00 ? 83 ILE A CG2  5  
ATOM 7756  C CD1  . ILE A 1 83 ? 5.763   -4.458  -5.747  1.00 0.00 ? 83 ILE A CD1  5  
ATOM 7757  H H    . ILE A 1 83 ? 4.604   -7.631  -7.994  1.00 0.00 ? 83 ILE A H    5  
ATOM 7758  H HA   . ILE A 1 83 ? 6.208   -8.661  -5.808  1.00 0.00 ? 83 ILE A HA   5  
ATOM 7759  H HB   . ILE A 1 83 ? 3.952   -6.589  -5.961  1.00 0.00 ? 83 ILE A HB   5  
ATOM 7760  H HG12 . ILE A 1 83 ? 6.965   -6.179  -5.735  1.00 0.00 ? 83 ILE A HG12 5  
ATOM 7761  H HG13 . ILE A 1 83 ? 6.019   -5.958  -7.200  1.00 0.00 ? 83 ILE A HG13 5  
ATOM 7762  H HG21 . ILE A 1 83 ? 4.049   -7.511  -3.695  1.00 0.00 ? 83 ILE A HG21 5  
ATOM 7763  H HG22 . ILE A 1 83 ? 4.630   -5.845  -3.704  1.00 0.00 ? 83 ILE A HG22 5  
ATOM 7764  H HG23 . ILE A 1 83 ? 5.783   -7.178  -3.610  1.00 0.00 ? 83 ILE A HG23 5  
ATOM 7765  H HD11 . ILE A 1 83 ? 5.822   -4.341  -4.673  1.00 0.00 ? 83 ILE A HD11 5  
ATOM 7766  H HD12 . ILE A 1 83 ? 4.786   -4.141  -6.093  1.00 0.00 ? 83 ILE A HD12 5  
ATOM 7767  H HD13 . ILE A 1 83 ? 6.520   -3.849  -6.215  1.00 0.00 ? 83 ILE A HD13 5  
ATOM 7768  N N    . GLU A 1 84 ? 4.562   -10.598 -5.284  1.00 0.00 ? 84 GLU A N    5  
ATOM 7769  C CA   . GLU A 1 84 ? 3.627   -11.689 -4.903  1.00 0.00 ? 84 GLU A CA   5  
ATOM 7770  C C    . GLU A 1 84 ? 4.184   -12.529 -3.742  1.00 0.00 ? 84 GLU A C    5  
ATOM 7771  O O    . GLU A 1 84 ? 5.396   -12.575 -3.525  1.00 0.00 ? 84 GLU A O    5  
ATOM 7772  C CB   . GLU A 1 84 ? 3.324   -12.599 -6.127  1.00 0.00 ? 84 GLU A CB   5  
ATOM 7773  C CG   . GLU A 1 84 ? 2.627   -11.888 -7.302  1.00 0.00 ? 84 GLU A CG   5  
ATOM 7774  C CD   . GLU A 1 84 ? 2.183   -12.852 -8.404  1.00 0.00 ? 84 GLU A CD   5  
ATOM 7775  O OE1  . GLU A 1 84 ? 1.103   -13.457 -8.267  1.00 0.00 ? 84 GLU A OE1  5  
ATOM 7776  O OE2  . GLU A 1 84 ? 2.918   -13.030 -9.399  1.00 0.00 ? 84 GLU A OE2  5  
ATOM 7777  H H    . GLU A 1 84 ? 5.519   -10.794 -5.322  1.00 0.00 ? 84 GLU A H    5  
ATOM 7778  H HA   . GLU A 1 84 ? 2.691   -11.236 -4.566  1.00 0.00 ? 84 GLU A HA   5  
ATOM 7779  H HB2  . GLU A 1 84 ? 4.263   -13.013 -6.491  1.00 0.00 ? 84 GLU A HB2  5  
ATOM 7780  H HB3  . GLU A 1 84 ? 2.693   -13.419 -5.805  1.00 0.00 ? 84 GLU A HB3  5  
ATOM 7781  H HG2  . GLU A 1 84 ? 1.756   -11.355 -6.928  1.00 0.00 ? 84 GLU A HG2  5  
ATOM 7782  H HG3  . GLU A 1 84 ? 3.321   -11.164 -7.719  1.00 0.00 ? 84 GLU A HG3  5  
ATOM 7783  N N    . GLY A 1 85 ? 3.244   -13.168 -3.007  1.00 0.00 ? 85 GLY A N    5  
ATOM 7784  C CA   . GLY A 1 85 ? 3.532   -14.088 -1.904  1.00 0.00 ? 85 GLY A CA   5  
ATOM 7785  C C    . GLY A 1 85 ? 4.369   -13.471 -0.787  1.00 0.00 ? 85 GLY A C    5  
ATOM 7786  O O    . GLY A 1 85 ? 3.853   -12.718 0.047   1.00 0.00 ? 85 GLY A O    5  
ATOM 7787  H H    . GLY A 1 85 ? 2.312   -13.000 -3.228  1.00 0.00 ? 85 GLY A H    5  
ATOM 7788  H HA2  . GLY A 1 85 ? 2.590   -14.411 -1.486  1.00 0.00 ? 85 GLY A HA2  5  
ATOM 7789  H HA3  . GLY A 1 85 ? 4.043   -14.959 -2.297  1.00 0.00 ? 85 GLY A HA3  5  
ATOM 7790  N N    . GLU A 1 86 ? 5.677   -13.773 -0.821  1.00 0.00 ? 86 GLU A N    5  
ATOM 7791  C CA   . GLU A 1 86 ? 6.662   -13.326 0.185   1.00 0.00 ? 86 GLU A CA   5  
ATOM 7792  C C    . GLU A 1 86 ? 7.022   -11.847 -0.002  1.00 0.00 ? 86 GLU A C    5  
ATOM 7793  O O    . GLU A 1 86 ? 7.386   -11.163 0.954   1.00 0.00 ? 86 GLU A O    5  
ATOM 7794  C CB   . GLU A 1 86 ? 7.939   -14.197 0.097   1.00 0.00 ? 86 GLU A CB   5  
ATOM 7795  C CG   . GLU A 1 86 ? 7.691   -15.686 0.387   1.00 0.00 ? 86 GLU A CG   5  
ATOM 7796  C CD   . GLU A 1 86 ? 8.924   -16.542 0.096   1.00 0.00 ? 86 GLU A CD   5  
ATOM 7797  O OE1  . GLU A 1 86 ? 9.787   -16.684 0.994   1.00 0.00 ? 86 GLU A OE1  5  
ATOM 7798  O OE2  . GLU A 1 86 ? 9.048   -17.057 -1.037  1.00 0.00 ? 86 GLU A OE2  5  
ATOM 7799  H H    . GLU A 1 86 ? 5.995   -14.325 -1.568  1.00 0.00 ? 86 GLU A H    5  
ATOM 7800  H HA   . GLU A 1 86 ? 6.218   -13.459 1.169   1.00 0.00 ? 86 GLU A HA   5  
ATOM 7801  H HB2  . GLU A 1 86 ? 8.360   -14.109 -0.901  1.00 0.00 ? 86 GLU A HB2  5  
ATOM 7802  H HB3  . GLU A 1 86 ? 8.667   -13.833 0.815   1.00 0.00 ? 86 GLU A HB3  5  
ATOM 7803  H HG2  . GLU A 1 86 ? 7.415   -15.800 1.434   1.00 0.00 ? 86 GLU A HG2  5  
ATOM 7804  H HG3  . GLU A 1 86 ? 6.866   -16.033 -0.230  1.00 0.00 ? 86 GLU A HG3  5  
ATOM 7805  N N    . ASN A 1 87 ? 6.940   -11.372 -1.249  1.00 0.00 ? 87 ASN A N    5  
ATOM 7806  C CA   . ASN A 1 87 ? 7.219   -9.969  -1.602  1.00 0.00 ? 87 ASN A CA   5  
ATOM 7807  C C    . ASN A 1 87 ? 5.959   -9.099  -1.468  1.00 0.00 ? 87 ASN A C    5  
ATOM 7808  O O    . ASN A 1 87 ? 6.070   -7.886  -1.269  1.00 0.00 ? 87 ASN A O    5  
ATOM 7809  C CB   . ASN A 1 87 ? 7.823   -9.890  -3.036  1.00 0.00 ? 87 ASN A CB   5  
ATOM 7810  C CG   . ASN A 1 87 ? 9.249   -10.460 -3.113  1.00 0.00 ? 87 ASN A CG   5  
ATOM 7811  O OD1  . ASN A 1 87 ? 9.651   -11.302 -2.308  1.00 0.00 ? 87 ASN A OD1  5  
ATOM 7812  N ND2  . ASN A 1 87 ? 10.015  -10.021 -4.100  1.00 0.00 ? 87 ASN A ND2  5  
ATOM 7813  H H    . ASN A 1 87 ? 6.695   -11.991 -1.966  1.00 0.00 ? 87 ASN A H    5  
ATOM 7814  H HA   . ASN A 1 87 ? 7.961   -9.588  -0.896  1.00 0.00 ? 87 ASN A HA   5  
ATOM 7815  H HB2  . ASN A 1 87 ? 7.201   -10.451 -3.725  1.00 0.00 ? 87 ASN A HB2  5  
ATOM 7816  H HB3  . ASN A 1 87 ? 7.852   -8.852  -3.352  1.00 0.00 ? 87 ASN A HB3  5  
ATOM 7817  H HD21 . ASN A 1 87 ? 9.635   -9.367  -4.720  1.00 0.00 ? 87 ASN A HD21 5  
ATOM 7818  H HD22 . ASN A 1 87 ? 10.931  -10.366 -4.168  1.00 0.00 ? 87 ASN A HD22 5  
ATOM 7819  N N    . ARG A 1 88 ? 4.769   -9.739  -1.551  1.00 0.00 ? 88 ARG A N    5  
ATOM 7820  C CA   . ARG A 1 88 ? 3.466   -9.051  -1.441  1.00 0.00 ? 88 ARG A CA   5  
ATOM 7821  C C    . ARG A 1 88 ? 3.324   -8.380  -0.064  1.00 0.00 ? 88 ARG A C    5  
ATOM 7822  O O    . ARG A 1 88 ? 3.347   -9.068  0.955   1.00 0.00 ? 88 ARG A O    5  
ATOM 7823  C CB   . ARG A 1 88 ? 2.313   -10.053 -1.662  1.00 0.00 ? 88 ARG A CB   5  
ATOM 7824  C CG   . ARG A 1 88 ? 0.903   -9.427  -1.616  1.00 0.00 ? 88 ARG A CG   5  
ATOM 7825  C CD   . ARG A 1 88 ? -0.210  -10.475 -1.654  1.00 0.00 ? 88 ARG A CD   5  
ATOM 7826  N NE   . ARG A 1 88 ? -0.127  -11.332 -2.861  1.00 0.00 ? 88 ARG A NE   5  
ATOM 7827  C CZ   . ARG A 1 88 ? -0.053  -12.673 -2.860  1.00 0.00 ? 88 ARG A CZ   5  
ATOM 7828  N NH1  . ARG A 1 88 ? -0.031  -13.357 -1.726  1.00 0.00 ? 88 ARG A NH1  5  
ATOM 7829  N NH2  . ARG A 1 88 ? 0.076   -13.321 -4.003  1.00 0.00 ? 88 ARG A NH2  5  
ATOM 7830  H H    . ARG A 1 88 ? 4.771   -10.710 -1.677  1.00 0.00 ? 88 ARG A H    5  
ATOM 7831  H HA   . ARG A 1 88 ? 3.423   -8.290  -2.217  1.00 0.00 ? 88 ARG A HA   5  
ATOM 7832  H HB2  . ARG A 1 88 ? 2.444   -10.518 -2.633  1.00 0.00 ? 88 ARG A HB2  5  
ATOM 7833  H HB3  . ARG A 1 88 ? 2.371   -10.826 -0.904  1.00 0.00 ? 88 ARG A HB3  5  
ATOM 7834  H HG2  . ARG A 1 88 ? 0.805   -8.855  -0.701  1.00 0.00 ? 88 ARG A HG2  5  
ATOM 7835  H HG3  . ARG A 1 88 ? 0.789   -8.760  -2.464  1.00 0.00 ? 88 ARG A HG3  5  
ATOM 7836  H HD2  . ARG A 1 88 ? -0.137  -11.093 -0.765  1.00 0.00 ? 88 ARG A HD2  5  
ATOM 7837  H HD3  . ARG A 1 88 ? -1.166  -9.966  -1.652  1.00 0.00 ? 88 ARG A HD3  5  
ATOM 7838  H HE   . ARG A 1 88 ? -0.149  -10.867 -3.729  1.00 0.00 ? 88 ARG A HE   5  
ATOM 7839  H HH11 . ARG A 1 88 ? -0.082  -12.881 -0.844  1.00 0.00 ? 88 ARG A HH11 5  
ATOM 7840  H HH12 . ARG A 1 88 ? 0.028   -14.360 -1.741  1.00 0.00 ? 88 ARG A HH12 5  
ATOM 7841  H HH21 . ARG A 1 88 ? 0.107   -12.815 -4.871  1.00 0.00 ? 88 ARG A HH21 5  
ATOM 7842  H HH22 . ARG A 1 88 ? 0.137   -14.324 -4.010  1.00 0.00 ? 88 ARG A HH22 5  
ATOM 7843  N N    . VAL A 1 89 ? 3.161   -7.051  -0.067  1.00 0.00 ? 89 VAL A N    5  
ATOM 7844  C CA   . VAL A 1 89 ? 3.111   -6.228  1.154   1.00 0.00 ? 89 VAL A CA   5  
ATOM 7845  C C    . VAL A 1 89 ? 1.842   -6.547  1.997   1.00 0.00 ? 89 VAL A C    5  
ATOM 7846  O O    . VAL A 1 89 ? 0.731   -6.367  1.503   1.00 0.00 ? 89 VAL A O    5  
ATOM 7847  C CB   . VAL A 1 89 ? 3.159   -4.700  0.783   1.00 0.00 ? 89 VAL A CB   5  
ATOM 7848  C CG1  . VAL A 1 89 ? 2.972   -3.805  2.029   1.00 0.00 ? 89 VAL A CG1  5  
ATOM 7849  C CG2  . VAL A 1 89 ? 4.483   -4.360  0.043   1.00 0.00 ? 89 VAL A CG2  5  
ATOM 7850  H H    . VAL A 1 89 ? 3.048   -6.602  -0.931  1.00 0.00 ? 89 VAL A H    5  
ATOM 7851  H HA   . VAL A 1 89 ? 4.000   -6.457  1.739   1.00 0.00 ? 89 VAL A HA   5  
ATOM 7852  H HB   . VAL A 1 89 ? 2.333   -4.492  0.101   1.00 0.00 ? 89 VAL A HB   5  
ATOM 7853  H HG11 . VAL A 1 89 ? 2.978   -2.759  1.742   1.00 0.00 ? 89 VAL A HG11 5  
ATOM 7854  H HG12 . VAL A 1 89 ? 3.774   -3.982  2.735   1.00 0.00 ? 89 VAL A HG12 5  
ATOM 7855  H HG13 . VAL A 1 89 ? 2.026   -4.033  2.505   1.00 0.00 ? 89 VAL A HG13 5  
ATOM 7856  H HG21 . VAL A 1 89 ? 5.328   -4.566  0.690   1.00 0.00 ? 89 VAL A HG21 5  
ATOM 7857  H HG22 . VAL A 1 89 ? 4.494   -3.314  -0.237  1.00 0.00 ? 89 VAL A HG22 5  
ATOM 7858  H HG23 . VAL A 1 89 ? 4.564   -4.965  -0.850  1.00 0.00 ? 89 VAL A HG23 5  
ATOM 7859  N N    . PRO A 1 90 ? 2.000   -7.033  3.281   1.00 0.00 ? 90 PRO A N    5  
ATOM 7860  C CA   . PRO A 1 90 ? 0.853   -7.371  4.177   1.00 0.00 ? 90 PRO A CA   5  
ATOM 7861  C C    . PRO A 1 90 ? -0.059  -6.165  4.479   1.00 0.00 ? 90 PRO A C    5  
ATOM 7862  O O    . PRO A 1 90 ? 0.412   -5.036  4.566   1.00 0.00 ? 90 PRO A O    5  
ATOM 7863  C CB   . PRO A 1 90 ? 1.544   -7.873  5.483   1.00 0.00 ? 90 PRO A CB   5  
ATOM 7864  C CG   . PRO A 1 90 ? 2.934   -8.261  5.062   1.00 0.00 ? 90 PRO A CG   5  
ATOM 7865  C CD   . PRO A 1 90 ? 3.301   -7.305  3.954   1.00 0.00 ? 90 PRO A CD   5  
ATOM 7866  H HA   . PRO A 1 90 ? 0.257   -8.173  3.748   1.00 0.00 ? 90 PRO A HA   5  
ATOM 7867  H HB2  . PRO A 1 90 ? 1.576   -7.083  6.240   1.00 0.00 ? 90 PRO A HB2  5  
ATOM 7868  H HB3  . PRO A 1 90 ? 1.016   -8.734  5.881   1.00 0.00 ? 90 PRO A HB3  5  
ATOM 7869  H HG2  . PRO A 1 90 ? 3.622   -8.165  5.898   1.00 0.00 ? 90 PRO A HG2  5  
ATOM 7870  H HG3  . PRO A 1 90 ? 2.946   -9.287  4.691   1.00 0.00 ? 90 PRO A HG3  5  
ATOM 7871  H HD2  . PRO A 1 90 ? 3.721   -6.391  4.357   1.00 0.00 ? 90 PRO A HD2  5  
ATOM 7872  H HD3  . PRO A 1 90 ? 4.002   -7.769  3.268   1.00 0.00 ? 90 PRO A HD3  5  
ATOM 7873  N N    . VAL A 1 91 ? -1.356  -6.429  4.642   1.00 0.00 ? 91 VAL A N    5  
ATOM 7874  C CA   . VAL A 1 91 ? -2.358  -5.424  5.029   1.00 0.00 ? 91 VAL A CA   5  
ATOM 7875  C C    . VAL A 1 91 ? -2.719  -5.656  6.503   1.00 0.00 ? 91 VAL A C    5  
ATOM 7876  O O    . VAL A 1 91 ? -3.007  -6.790  6.898   1.00 0.00 ? 91 VAL A O    5  
ATOM 7877  C CB   . VAL A 1 91 ? -3.643  -5.528  4.135   1.00 0.00 ? 91 VAL A CB   5  
ATOM 7878  C CG1  . VAL A 1 91 ? -4.732  -4.538  4.595   1.00 0.00 ? 91 VAL A CG1  5  
ATOM 7879  C CG2  . VAL A 1 91 ? -3.297  -5.320  2.642   1.00 0.00 ? 91 VAL A CG2  5  
ATOM 7880  H H    . VAL A 1 91 ? -1.655  -7.356  4.522   1.00 0.00 ? 91 VAL A H    5  
ATOM 7881  H HA   . VAL A 1 91 ? -1.927  -4.422  4.911   1.00 0.00 ? 91 VAL A HA   5  
ATOM 7882  H HB   . VAL A 1 91 ? -4.048  -6.535  4.242   1.00 0.00 ? 91 VAL A HB   5  
ATOM 7883  H HG11 . VAL A 1 91 ? -4.361  -3.523  4.518   1.00 0.00 ? 91 VAL A HG11 5  
ATOM 7884  H HG12 . VAL A 1 91 ? -4.999  -4.740  5.626   1.00 0.00 ? 91 VAL A HG12 5  
ATOM 7885  H HG13 . VAL A 1 91 ? -5.609  -4.645  3.975   1.00 0.00 ? 91 VAL A HG13 5  
ATOM 7886  H HG21 . VAL A 1 91 ? -2.873  -4.334  2.494   1.00 0.00 ? 91 VAL A HG21 5  
ATOM 7887  H HG22 . VAL A 1 91 ? -4.194  -5.415  2.041   1.00 0.00 ? 91 VAL A HG22 5  
ATOM 7888  H HG23 . VAL A 1 91 ? -2.581  -6.067  2.323   1.00 0.00 ? 91 VAL A HG23 5  
ATOM 7889  N N    . VAL A 1 92 ? -2.680  -4.585  7.315   1.00 0.00 ? 92 VAL A N    5  
ATOM 7890  C CA   . VAL A 1 92 ? -2.907  -4.658  8.769   1.00 0.00 ? 92 VAL A CA   5  
ATOM 7891  C C    . VAL A 1 92 ? -3.988  -3.636  9.170   1.00 0.00 ? 92 VAL A C    5  
ATOM 7892  O O    . VAL A 1 92 ? -3.701  -2.449  9.292   1.00 0.00 ? 92 VAL A O    5  
ATOM 7893  C CB   . VAL A 1 92 ? -1.576  -4.365  9.584   1.00 0.00 ? 92 VAL A CB   5  
ATOM 7894  C CG1  . VAL A 1 92 ? -1.724  -4.810  11.056  1.00 0.00 ? 92 VAL A CG1  5  
ATOM 7895  C CG2  . VAL A 1 92 ? -0.342  -5.018  8.925   1.00 0.00 ? 92 VAL A CG2  5  
ATOM 7896  H H    . VAL A 1 92 ? -2.487  -3.714  6.920   1.00 0.00 ? 92 VAL A H    5  
ATOM 7897  H HA   . VAL A 1 92 ? -3.253  -5.665  9.022   1.00 0.00 ? 92 VAL A HA   5  
ATOM 7898  H HB   . VAL A 1 92 ? -1.402  -3.282  9.584   1.00 0.00 ? 92 VAL A HB   5  
ATOM 7899  H HG11 . VAL A 1 92 ? -1.922  -5.874  11.102  1.00 0.00 ? 92 VAL A HG11 5  
ATOM 7900  H HG12 . VAL A 1 92 ? -2.542  -4.275  11.520  1.00 0.00 ? 92 VAL A HG12 5  
ATOM 7901  H HG13 . VAL A 1 92 ? -0.811  -4.596  11.597  1.00 0.00 ? 92 VAL A HG13 5  
ATOM 7902  H HG21 . VAL A 1 92 ? -0.217  -4.628  7.920   1.00 0.00 ? 92 VAL A HG21 5  
ATOM 7903  H HG22 . VAL A 1 92 ? -0.476  -6.090  8.876   1.00 0.00 ? 92 VAL A HG22 5  
ATOM 7904  H HG23 . VAL A 1 92 ? 0.549   -4.795  9.501   1.00 0.00 ? 92 VAL A HG23 5  
ATOM 7905  N N    . TYR A 1 93 ? -5.239  -4.097  9.337   1.00 0.00 ? 93 TYR A N    5  
ATOM 7906  C CA   . TYR A 1 93 ? -6.363  -3.238  9.758   1.00 0.00 ? 93 TYR A CA   5  
ATOM 7907  C C    . TYR A 1 93 ? -6.168  -2.818  11.220  1.00 0.00 ? 93 TYR A C    5  
ATOM 7908  O O    . TYR A 1 93 ? -6.322  -3.625  12.139  1.00 0.00 ? 93 TYR A O    5  
ATOM 7909  C CB   . TYR A 1 93 ? -7.716  -3.967  9.556   1.00 0.00 ? 93 TYR A CB   5  
ATOM 7910  C CG   . TYR A 1 93 ? -7.997  -4.313  8.087   1.00 0.00 ? 93 TYR A CG   5  
ATOM 7911  C CD1  . TYR A 1 93 ? -8.608  -3.387  7.233   1.00 0.00 ? 93 TYR A CD1  5  
ATOM 7912  C CD2  . TYR A 1 93 ? -7.633  -5.551  7.541   1.00 0.00 ? 93 TYR A CD2  5  
ATOM 7913  C CE1  . TYR A 1 93 ? -8.843  -3.684  5.907   1.00 0.00 ? 93 TYR A CE1  5  
ATOM 7914  C CE2  . TYR A 1 93 ? -7.874  -5.844  6.213   1.00 0.00 ? 93 TYR A CE2  5  
ATOM 7915  C CZ   . TYR A 1 93 ? -8.476  -4.909  5.406   1.00 0.00 ? 93 TYR A CZ   5  
ATOM 7916  O OH   . TYR A 1 93 ? -8.716  -5.205  4.092   1.00 0.00 ? 93 TYR A OH   5  
ATOM 7917  H H    . TYR A 1 93 ? -5.414  -5.044  9.171   1.00 0.00 ? 93 TYR A H    5  
ATOM 7918  H HA   . TYR A 1 93 ? -6.354  -2.342  9.130   1.00 0.00 ? 93 TYR A HA   5  
ATOM 7919  H HB2  . TYR A 1 93 ? -7.715  -4.888  10.132  1.00 0.00 ? 93 TYR A HB2  5  
ATOM 7920  H HB3  . TYR A 1 93 ? -8.520  -3.337  9.916   1.00 0.00 ? 93 TYR A HB3  5  
ATOM 7921  H HD1  . TYR A 1 93 ? -8.902  -2.416  7.624   1.00 0.00 ? 93 TYR A HD1  5  
ATOM 7922  H HD2  . TYR A 1 93 ? -7.158  -6.291  8.173   1.00 0.00 ? 93 TYR A HD2  5  
ATOM 7923  H HE1  . TYR A 1 93 ? -9.311  -2.950  5.265   1.00 0.00 ? 93 TYR A HE1  5  
ATOM 7924  H HE2  . TYR A 1 93 ? -7.583  -6.805  5.810   1.00 0.00 ? 93 TYR A HE2  5  
ATOM 7925  H HH   . TYR A 1 93 ? -8.323  -4.514  3.540   1.00 0.00 ? 93 TYR A HH   5  
ATOM 7926  N N    . ILE A 1 94 ? -5.800  -1.553  11.414  1.00 0.00 ? 94 ILE A N    5  
ATOM 7927  C CA   . ILE A 1 94 ? -5.480  -0.990  12.729  1.00 0.00 ? 94 ILE A CA   5  
ATOM 7928  C C    . ILE A 1 94 ? -6.540  0.056   13.074  1.00 0.00 ? 94 ILE A C    5  
ATOM 7929  O O    . ILE A 1 94 ? -6.637  1.070   12.402  1.00 0.00 ? 94 ILE A O    5  
ATOM 7930  C CB   . ILE A 1 94 ? -4.032  -0.348  12.709  1.00 0.00 ? 94 ILE A CB   5  
ATOM 7931  C CG1  . ILE A 1 94 ? -2.941  -1.456  12.550  1.00 0.00 ? 94 ILE A CG1  5  
ATOM 7932  C CG2  . ILE A 1 94 ? -3.746  0.525   13.962  1.00 0.00 ? 94 ILE A CG2  5  
ATOM 7933  C CD1  . ILE A 1 94 ? -2.934  -2.502  13.665  1.00 0.00 ? 94 ILE A CD1  5  
ATOM 7934  H H    . ILE A 1 94 ? -5.777  -0.945  10.648  1.00 0.00 ? 94 ILE A H    5  
ATOM 7935  H HA   . ILE A 1 94 ? -5.499  -1.792  13.485  1.00 0.00 ? 94 ILE A HA   5  
ATOM 7936  H HB   . ILE A 1 94 ? -3.981  0.308   11.836  1.00 0.00 ? 94 ILE A HB   5  
ATOM 7937  H HG12 . ILE A 1 94 ? -3.093  -1.979  11.614  1.00 0.00 ? 94 ILE A HG12 5  
ATOM 7938  H HG13 . ILE A 1 94 ? -1.963  -0.987  12.530  1.00 0.00 ? 94 ILE A HG13 5  
ATOM 7939  H HG21 . ILE A 1 94 ? -3.826  -0.078  14.862  1.00 0.00 ? 94 ILE A HG21 5  
ATOM 7940  H HG22 . ILE A 1 94 ? -4.463  1.335   14.015  1.00 0.00 ? 94 ILE A HG22 5  
ATOM 7941  H HG23 . ILE A 1 94 ? -2.750  0.938   13.898  1.00 0.00 ? 94 ILE A HG23 5  
ATOM 7942  H HD11 . ILE A 1 94 ? -2.128  -3.200  13.498  1.00 0.00 ? 94 ILE A HD11 5  
ATOM 7943  H HD12 . ILE A 1 94 ? -3.875  -3.034  13.663  1.00 0.00 ? 94 ILE A HD12 5  
ATOM 7944  H HD13 . ILE A 1 94 ? -2.797  -2.019  14.622  1.00 0.00 ? 94 ILE A HD13 5  
ATOM 7945  N N    . ALA A 1 95 ? -7.322  -0.180  14.143  1.00 0.00 ? 95 ALA A N    5  
ATOM 7946  C CA   . ALA A 1 95 ? -8.373  0.760   14.593  1.00 0.00 ? 95 ALA A CA   5  
ATOM 7947  C C    . ALA A 1 95 ? -7.804  1.734   15.645  1.00 0.00 ? 95 ALA A C    5  
ATOM 7948  O O    . ALA A 1 95 ? -8.559  2.452   16.306  1.00 0.00 ? 95 ALA A O    5  
ATOM 7949  C CB   . ALA A 1 95 ? -9.572  -0.028  15.151  1.00 0.00 ? 95 ALA A CB   5  
ATOM 7950  H H    . ALA A 1 95 ? -7.155  -0.972  14.704  1.00 0.00 ? 95 ALA A H    5  
ATOM 7951  H HA   . ALA A 1 95 ? -8.716  1.342   13.732  1.00 0.00 ? 95 ALA A HA   5  
ATOM 7952  H HB1  . ALA A 1 95 ? -9.264  -0.607  16.013  1.00 0.00 ? 95 ALA A HB1  5  
ATOM 7953  H HB2  . ALA A 1 95 ? -9.950  -0.695  14.388  1.00 0.00 ? 95 ALA A HB2  5  
ATOM 7954  H HB3  . ALA A 1 95 ? -10.356 0.659   15.437  1.00 0.00 ? 95 ALA A HB3  5  
ATOM 7955  N N    . GLU A 1 96 ? -6.456  1.755   15.732  1.00 0.00 ? 96 GLU A N    5  
ATOM 7956  C CA   . GLU A 1 96 ? -5.650  2.529   16.694  1.00 0.00 ? 96 GLU A CA   5  
ATOM 7957  C C    . GLU A 1 96 ? -5.890  2.076   18.139  1.00 0.00 ? 96 GLU A C    5  
ATOM 7958  O O    . GLU A 1 96 ? -5.080  1.321   18.697  1.00 0.00 ? 96 GLU A O    5  
ATOM 7959  C CB   . GLU A 1 96 ? -5.823  4.066   16.521  1.00 0.00 ? 96 GLU A CB   5  
ATOM 7960  C CG   . GLU A 1 96 ? -5.355  4.595   15.153  1.00 0.00 ? 96 GLU A CG   5  
ATOM 7961  C CD   . GLU A 1 96 ? -5.432  6.126   15.035  1.00 0.00 ? 96 GLU A CD   5  
ATOM 7962  O OE1  . GLU A 1 96 ? -4.468  6.810   15.430  1.00 0.00 ? 96 GLU A OE1  5  
ATOM 7963  O OE2  . GLU A 1 96 ? -6.457  6.650   14.544  1.00 0.00 ? 96 GLU A OE2  5  
ATOM 7964  H H    . GLU A 1 96 ? -5.969  1.205   15.096  1.00 0.00 ? 96 GLU A H    5  
ATOM 7965  H HA   . GLU A 1 96 ? -4.621  2.288   16.459  1.00 0.00 ? 96 GLU A HA   5  
ATOM 7966  H HB2  . GLU A 1 96 ? -6.873  4.323   16.646  1.00 0.00 ? 96 GLU A HB2  5  
ATOM 7967  H HB3  . GLU A 1 96 ? -5.254  4.568   17.289  1.00 0.00 ? 96 GLU A HB3  5  
ATOM 7968  H HG2  . GLU A 1 96 ? -4.327  4.279   14.981  1.00 0.00 ? 96 GLU A HG2  5  
ATOM 7969  H HG3  . GLU A 1 96 ? -5.981  4.151   14.382  1.00 0.00 ? 96 GLU A HG3  5  
ATOM 7970  N N    . SER A 1 97 ? -7.017  2.533   18.723  1.00 0.00 ? 97 SER A N    5  
ATOM 7971  C CA   . SER A 1 97 ? -7.327  2.367   20.159  1.00 0.00 ? 97 SER A CA   5  
ATOM 7972  C C    . SER A 1 97 ? -6.255  3.067   21.027  1.00 0.00 ? 97 SER A C    5  
ATOM 7973  O O    . SER A 1 97 ? -6.077  2.746   22.208  1.00 0.00 ? 97 SER A O    5  
ATOM 7974  C CB   . SER A 1 97 ? -7.475  0.865   20.527  1.00 0.00 ? 97 SER A CB   5  
ATOM 7975  O OG   . SER A 1 97 ? -8.379  0.208   19.640  1.00 0.00 ? 97 SER A OG   5  
ATOM 7976  H H    . SER A 1 97 ? -7.667  3.005   18.164  1.00 0.00 ? 97 SER A H    5  
ATOM 7977  H HA   . SER A 1 97 ? -8.277  2.866   20.334  1.00 0.00 ? 97 SER A HA   5  
ATOM 7978  H HB2  . SER A 1 97 ? -6.512  0.379   20.458  1.00 0.00 ? 97 SER A HB2  5  
ATOM 7979  H HB3  . SER A 1 97 ? -7.850  0.775   21.538  1.00 0.00 ? 97 SER A HB3  5  
ATOM 7980  H HG   . SER A 1 97 ? -8.703  0.842   18.982  1.00 0.00 ? 97 SER A HG   5  
ATOM 7981  N N    . ASP A 1 98 ? -5.577  4.069   20.406  1.00 0.00 ? 98 ASP A N    5  
ATOM 7982  C CA   . ASP A 1 98 ? -4.481  4.843   21.003  1.00 0.00 ? 98 ASP A CA   5  
ATOM 7983  C C    . ASP A 1 98 ? -5.011  5.741   22.131  1.00 0.00 ? 98 ASP A C    5  
ATOM 7984  O O    . ASP A 1 98 ? -4.393  5.860   23.196  1.00 0.00 ? 98 ASP A O    5  
ATOM 7985  C CB   . ASP A 1 98 ? -3.799  5.705   19.905  1.00 0.00 ? 98 ASP A CB   5  
ATOM 7986  C CG   . ASP A 1 98 ? -2.663  6.593   20.443  1.00 0.00 ? 98 ASP A CG   5  
ATOM 7987  O OD1  . ASP A 1 98 ? -1.616  6.053   20.835  1.00 0.00 ? 98 ASP A OD1  5  
ATOM 7988  O OD2  . ASP A 1 98 ? -2.807  7.835   20.481  1.00 0.00 ? 98 ASP A OD2  5  
ATOM 7989  H H    . ASP A 1 98 ? -5.845  4.299   19.495  1.00 0.00 ? 98 ASP A H    5  
ATOM 7990  H HA   . ASP A 1 98 ? -3.751  4.142   21.408  1.00 0.00 ? 98 ASP A HA   5  
ATOM 7991  H HB2  . ASP A 1 98 ? -3.389  5.047   19.145  1.00 0.00 ? 98 ASP A HB2  5  
ATOM 7992  H HB3  . ASP A 1 98 ? -4.551  6.335   19.436  1.00 0.00 ? 98 ASP A HB3  5  
ATOM 7993  N N    . GLY A 1 99 ? -6.169  6.360   21.868  1.00 0.00 ? 99 GLY A N    5  
ATOM 7994  C CA   . GLY A 1 99 ? -6.841  7.238   22.816  1.00 0.00 ? 99 GLY A CA   5  
ATOM 7995  C C    . GLY A 1 99 ? -8.230  6.693   23.161  1.00 0.00 ? 99 GLY A C    5  
ATOM 7996  O O    . GLY A 1 99 ? -8.332  5.850   24.077  1.00 0.00 ? 99 GLY A O    5  
ATOM 7997  O OXT  . GLY A 1 99 ? -9.218  7.076   22.502  1.00 0.00 ? 99 GLY A OXT  5  
ATOM 7998  H H    . GLY A 1 99 ? -6.595  6.191   20.999  1.00 0.00 ? 99 GLY A H    5  
ATOM 7999  H HA2  . GLY A 1 99 ? -6.248  7.340   23.729  1.00 0.00 ? 99 GLY A HA2  5  
ATOM 8000  H HA3  . GLY A 1 99 ? -6.944  8.220   22.365  1.00 0.00 ? 99 GLY A HA3  5  
ATOM 8001  N N    . MET A 1 1  ? -26.912 23.746  7.836   1.00 0.00 ? 1  MET A N    6  
ATOM 8002  C CA   . MET A 1 1  ? -26.259 22.532  8.378   1.00 0.00 ? 1  MET A CA   6  
ATOM 8003  C C    . MET A 1 1  ? -24.775 22.568  7.997   1.00 0.00 ? 1  MET A C    6  
ATOM 8004  O O    . MET A 1 1  ? -24.414 22.211  6.877   1.00 0.00 ? 1  MET A O    6  
ATOM 8005  C CB   . MET A 1 1  ? -26.942 21.241  7.836   1.00 0.00 ? 1  MET A CB   6  
ATOM 8006  C CG   . MET A 1 1  ? -28.438 21.129  8.154   1.00 0.00 ? 1  MET A CG   6  
ATOM 8007  S SD   . MET A 1 1  ? -29.209 19.647  7.452   1.00 0.00 ? 1  MET A SD   6  
ATOM 8008  C CE   . MET A 1 1  ? -28.311 18.327  8.275   1.00 0.00 ? 1  MET A CE   6  
ATOM 8009  H H1   . MET A 1 1  ? -27.921 23.769  8.095   1.00 0.00 ? 1  MET A H1   6  
ATOM 8010  H H2   . MET A 1 1  ? -26.832 23.763  6.799   1.00 0.00 ? 1  MET A H2   6  
ATOM 8011  H H3   . MET A 1 1  ? -26.454 24.593  8.216   1.00 0.00 ? 1  MET A H3   6  
ATOM 8012  H HA   . MET A 1 1  ? -26.343 22.557  9.461   1.00 0.00 ? 1  MET A HA   6  
ATOM 8013  H HB2  . MET A 1 1  ? -26.826 21.203  6.756   1.00 0.00 ? 1  MET A HB2  6  
ATOM 8014  H HB3  . MET A 1 1  ? -26.442 20.379  8.263   1.00 0.00 ? 1  MET A HB3  6  
ATOM 8015  H HG2  . MET A 1 1  ? -28.571 21.106  9.226   1.00 0.00 ? 1  MET A HG2  6  
ATOM 8016  H HG3  . MET A 1 1  ? -28.947 22.000  7.754   1.00 0.00 ? 1  MET A HG3  6  
ATOM 8017  H HE1  . MET A 1 1  ? -28.706 17.372  7.957   1.00 0.00 ? 1  MET A HE1  6  
ATOM 8018  H HE2  . MET A 1 1  ? -28.425 18.421  9.346   1.00 0.00 ? 1  MET A HE2  6  
ATOM 8019  H HE3  . MET A 1 1  ? -27.265 18.385  8.015   1.00 0.00 ? 1  MET A HE3  6  
ATOM 8020  N N    . GLY A 1 2  ? -23.938 23.060  8.920   1.00 0.00 ? 2  GLY A N    6  
ATOM 8021  C CA   . GLY A 1 2  ? -22.495 23.145  8.712   1.00 0.00 ? 2  GLY A CA   6  
ATOM 8022  C C    . GLY A 1 2  ? -21.832 21.777  8.598   1.00 0.00 ? 2  GLY A C    6  
ATOM 8023  O O    . GLY A 1 2  ? -22.263 20.826  9.246   1.00 0.00 ? 2  GLY A O    6  
ATOM 8024  H H    . GLY A 1 2  ? -24.313 23.377  9.765   1.00 0.00 ? 2  GLY A H    6  
ATOM 8025  H HA2  . GLY A 1 2  ? -22.301 23.717  7.815   1.00 0.00 ? 2  GLY A HA2  6  
ATOM 8026  H HA3  . GLY A 1 2  ? -22.058 23.669  9.554   1.00 0.00 ? 2  GLY A HA3  6  
ATOM 8027  N N    . HIS A 1 3  ? -20.812 21.686  7.742   1.00 0.00 ? 3  HIS A N    6  
ATOM 8028  C CA   . HIS A 1 3  ? -19.981 20.479  7.567   1.00 0.00 ? 3  HIS A CA   6  
ATOM 8029  C C    . HIS A 1 3  ? -18.533 20.880  7.222   1.00 0.00 ? 3  HIS A C    6  
ATOM 8030  O O    . HIS A 1 3  ? -17.715 20.050  6.808   1.00 0.00 ? 3  HIS A O    6  
ATOM 8031  C CB   . HIS A 1 3  ? -20.585 19.539  6.484   1.00 0.00 ? 3  HIS A CB   6  
ATOM 8032  C CG   . HIS A 1 3  ? -20.605 20.091  5.078   1.00 0.00 ? 3  HIS A CG   6  
ATOM 8033  N ND1  . HIS A 1 3  ? -19.815 19.594  4.064   1.00 0.00 ? 3  HIS A ND1  6  
ATOM 8034  C CD2  . HIS A 1 3  ? -21.351 21.071  4.519   1.00 0.00 ? 3  HIS A CD2  6  
ATOM 8035  C CE1  . HIS A 1 3  ? -20.073 20.244  2.945   1.00 0.00 ? 3  HIS A CE1  6  
ATOM 8036  N NE2  . HIS A 1 3  ? -20.999 21.143  3.194   1.00 0.00 ? 3  HIS A NE2  6  
ATOM 8037  H H    . HIS A 1 3  ? -20.604 22.463  7.200   1.00 0.00 ? 3  HIS A H    6  
ATOM 8038  H HA   . HIS A 1 3  ? -19.958 19.952  8.515   1.00 0.00 ? 3  HIS A HA   6  
ATOM 8039  H HB2  . HIS A 1 3  ? -20.021 18.616  6.465   1.00 0.00 ? 3  HIS A HB2  6  
ATOM 8040  H HB3  . HIS A 1 3  ? -21.608 19.306  6.756   1.00 0.00 ? 3  HIS A HB3  6  
ATOM 8041  H HD1  . HIS A 1 3  ? -19.166 18.865  4.154   1.00 0.00 ? 3  HIS A HD1  6  
ATOM 8042  H HD2  . HIS A 1 3  ? -22.094 21.680  5.022   1.00 0.00 ? 3  HIS A HD2  6  
ATOM 8043  H HE1  . HIS A 1 3  ? -19.600 20.067  1.989   1.00 0.00 ? 3  HIS A HE1  6  
ATOM 8044  H HE2  . HIS A 1 3  ? -21.468 21.664  2.509   1.00 0.00 ? 3  HIS A HE2  6  
ATOM 8045  N N    . HIS A 1 4  ? -18.220 22.166  7.461   1.00 0.00 ? 4  HIS A N    6  
ATOM 8046  C CA   . HIS A 1 4  ? -16.923 22.780  7.118   1.00 0.00 ? 4  HIS A CA   6  
ATOM 8047  C C    . HIS A 1 4  ? -16.001 22.852  8.367   1.00 0.00 ? 4  HIS A C    6  
ATOM 8048  O O    . HIS A 1 4  ? -14.884 23.368  8.289   1.00 0.00 ? 4  HIS A O    6  
ATOM 8049  C CB   . HIS A 1 4  ? -17.196 24.187  6.510   1.00 0.00 ? 4  HIS A CB   6  
ATOM 8050  C CG   . HIS A 1 4  ? -16.017 24.859  5.847   1.00 0.00 ? 4  HIS A CG   6  
ATOM 8051  N ND1  . HIS A 1 4  ? -15.533 24.486  4.613   1.00 0.00 ? 4  HIS A ND1  6  
ATOM 8052  C CD2  . HIS A 1 4  ? -15.232 25.885  6.256   1.00 0.00 ? 4  HIS A CD2  6  
ATOM 8053  C CE1  . HIS A 1 4  ? -14.504 25.246  4.296   1.00 0.00 ? 4  HIS A CE1  6  
ATOM 8054  N NE2  . HIS A 1 4  ? -14.298 26.101  5.271   1.00 0.00 ? 4  HIS A NE2  6  
ATOM 8055  H H    . HIS A 1 4  ? -18.891 22.730  7.893   1.00 0.00 ? 4  HIS A H    6  
ATOM 8056  H HA   . HIS A 1 4  ? -16.438 22.163  6.363   1.00 0.00 ? 4  HIS A HA   6  
ATOM 8057  H HB2  . HIS A 1 4  ? -17.968 24.092  5.758   1.00 0.00 ? 4  HIS A HB2  6  
ATOM 8058  H HB3  . HIS A 1 4  ? -17.559 24.842  7.290   1.00 0.00 ? 4  HIS A HB3  6  
ATOM 8059  H HD1  . HIS A 1 4  ? -15.902 23.772  4.047   1.00 0.00 ? 4  HIS A HD1  6  
ATOM 8060  H HD2  . HIS A 1 4  ? -15.330 26.439  7.182   1.00 0.00 ? 4  HIS A HD2  6  
ATOM 8061  H HE1  . HIS A 1 4  ? -13.942 25.192  3.378   1.00 0.00 ? 4  HIS A HE1  6  
ATOM 8062  H HE2  . HIS A 1 4  ? -13.474 26.624  5.385   1.00 0.00 ? 4  HIS A HE2  6  
ATOM 8063  N N    . HIS A 1 5  ? -16.464 22.279  9.504   1.00 0.00 ? 5  HIS A N    6  
ATOM 8064  C CA   . HIS A 1 5  ? -15.715 22.263  10.791  1.00 0.00 ? 5  HIS A CA   6  
ATOM 8065  C C    . HIS A 1 5  ? -14.712 21.084  10.866  1.00 0.00 ? 5  HIS A C    6  
ATOM 8066  O O    . HIS A 1 5  ? -14.234 20.752  11.958  1.00 0.00 ? 5  HIS A O    6  
ATOM 8067  C CB   . HIS A 1 5  ? -16.709 22.187  11.987  1.00 0.00 ? 5  HIS A CB   6  
ATOM 8068  C CG   . HIS A 1 5  ? -17.398 23.486  12.334  1.00 0.00 ? 5  HIS A CG   6  
ATOM 8069  N ND1  . HIS A 1 5  ? -16.872 24.390  13.231  1.00 0.00 ? 5  HIS A ND1  6  
ATOM 8070  C CD2  . HIS A 1 5  ? -18.582 24.017  11.928  1.00 0.00 ? 5  HIS A CD2  6  
ATOM 8071  C CE1  . HIS A 1 5  ? -17.692 25.411  13.366  1.00 0.00 ? 5  HIS A CE1  6  
ATOM 8072  N NE2  . HIS A 1 5  ? -18.735 25.211  12.590  1.00 0.00 ? 5  HIS A NE2  6  
ATOM 8073  H H    . HIS A 1 5  ? -17.335 21.834  9.476   1.00 0.00 ? 5  HIS A H    6  
ATOM 8074  H HA   . HIS A 1 5  ? -15.149 23.187  10.869  1.00 0.00 ? 5  HIS A HA   6  
ATOM 8075  H HB2  . HIS A 1 5  ? -17.479 21.465  11.753  1.00 0.00 ? 5  HIS A HB2  6  
ATOM 8076  H HB3  . HIS A 1 5  ? -16.180 21.847  12.875  1.00 0.00 ? 5  HIS A HB3  6  
ATOM 8077  H HD1  . HIS A 1 5  ? -16.013 24.293  13.705  1.00 0.00 ? 5  HIS A HD1  6  
ATOM 8078  H HD2  . HIS A 1 5  ? -19.269 23.585  11.212  1.00 0.00 ? 5  HIS A HD2  6  
ATOM 8079  H HE1  . HIS A 1 5  ? -17.534 26.266  14.006  1.00 0.00 ? 5  HIS A HE1  6  
ATOM 8080  H HE2  . HIS A 1 5  ? -19.499 25.819  12.504  1.00 0.00 ? 5  HIS A HE2  6  
ATOM 8081  N N    . HIS A 1 6  ? -14.385 20.465  9.711   1.00 0.00 ? 6  HIS A N    6  
ATOM 8082  C CA   . HIS A 1 6  ? -13.420 19.350  9.652   1.00 0.00 ? 6  HIS A CA   6  
ATOM 8083  C C    . HIS A 1 6  ? -12.005 19.881  9.969   1.00 0.00 ? 6  HIS A C    6  
ATOM 8084  O O    . HIS A 1 6  ? -11.295 20.352  9.073   1.00 0.00 ? 6  HIS A O    6  
ATOM 8085  C CB   . HIS A 1 6  ? -13.464 18.651  8.270   1.00 0.00 ? 6  HIS A CB   6  
ATOM 8086  C CG   . HIS A 1 6  ? -12.696 17.351  8.216   1.00 0.00 ? 6  HIS A CG   6  
ATOM 8087  N ND1  . HIS A 1 6  ? -11.401 17.255  7.760   1.00 0.00 ? 6  HIS A ND1  6  
ATOM 8088  C CD2  . HIS A 1 6  ? -13.056 16.095  8.569   1.00 0.00 ? 6  HIS A CD2  6  
ATOM 8089  C CE1  . HIS A 1 6  ? -11.000 16.000  7.832   1.00 0.00 ? 6  HIS A CE1  6  
ATOM 8090  N NE2  . HIS A 1 6  ? -11.984 15.275  8.320   1.00 0.00 ? 6  HIS A NE2  6  
ATOM 8091  H H    . HIS A 1 6  ? -14.806 20.761  8.885   1.00 0.00 ? 6  HIS A H    6  
ATOM 8092  H HA   . HIS A 1 6  ? -13.706 18.631  10.418  1.00 0.00 ? 6  HIS A HA   6  
ATOM 8093  H HB2  . HIS A 1 6  ? -14.497 18.435  8.015   1.00 0.00 ? 6  HIS A HB2  6  
ATOM 8094  H HB3  . HIS A 1 6  ? -13.059 19.319  7.520   1.00 0.00 ? 6  HIS A HB3  6  
ATOM 8095  H HD1  . HIS A 1 6  ? -10.848 18.006  7.436   1.00 0.00 ? 6  HIS A HD1  6  
ATOM 8096  H HD2  . HIS A 1 6  ? -14.016 15.794  8.970   1.00 0.00 ? 6  HIS A HD2  6  
ATOM 8097  H HE1  . HIS A 1 6  ? -10.027 15.631  7.537   1.00 0.00 ? 6  HIS A HE1  6  
ATOM 8098  H HE2  . HIS A 1 6  ? -11.994 14.295  8.357   1.00 0.00 ? 6  HIS A HE2  6  
ATOM 8099  N N    . HIS A 1 7  ? -11.637 19.826  11.260  1.00 0.00 ? 7  HIS A N    6  
ATOM 8100  C CA   . HIS A 1 7  ? -10.435 20.498  11.786  1.00 0.00 ? 7  HIS A CA   6  
ATOM 8101  C C    . HIS A 1 7  ? -9.142  19.845  11.261  1.00 0.00 ? 7  HIS A C    6  
ATOM 8102  O O    . HIS A 1 7  ? -8.972  18.628  11.348  1.00 0.00 ? 7  HIS A O    6  
ATOM 8103  C CB   . HIS A 1 7  ? -10.449 20.519  13.346  1.00 0.00 ? 7  HIS A CB   6  
ATOM 8104  C CG   . HIS A 1 7  ? -10.272 19.178  14.021  1.00 0.00 ? 7  HIS A CG   6  
ATOM 8105  N ND1  . HIS A 1 7  ? -11.293 18.272  14.177  1.00 0.00 ? 7  HIS A ND1  6  
ATOM 8106  C CD2  . HIS A 1 7  ? -9.175  18.601  14.574  1.00 0.00 ? 7  HIS A CD2  6  
ATOM 8107  C CE1  . HIS A 1 7  ? -10.840 17.197  14.788  1.00 0.00 ? 7  HIS A CE1  6  
ATOM 8108  N NE2  . HIS A 1 7  ? -9.560  17.370  15.037  1.00 0.00 ? 7  HIS A NE2  6  
ATOM 8109  H H    . HIS A 1 7  ? -12.204 19.321  11.883  1.00 0.00 ? 7  HIS A H    6  
ATOM 8110  H HA   . HIS A 1 7  ? -10.468 21.531  11.437  1.00 0.00 ? 7  HIS A HA   6  
ATOM 8111  H HB2  . HIS A 1 7  ? -9.654  21.161  13.696  1.00 0.00 ? 7  HIS A HB2  6  
ATOM 8112  H HB3  . HIS A 1 7  ? -11.394 20.932  13.681  1.00 0.00 ? 7  HIS A HB3  6  
ATOM 8113  H HD1  . HIS A 1 7  ? -12.219 18.399  13.890  1.00 0.00 ? 7  HIS A HD1  6  
ATOM 8114  H HD2  . HIS A 1 7  ? -8.183  19.036  14.641  1.00 0.00 ? 7  HIS A HD2  6  
ATOM 8115  H HE1  . HIS A 1 7  ? -11.427 16.327  15.059  1.00 0.00 ? 7  HIS A HE1  6  
ATOM 8116  H HE2  . HIS A 1 7  ? -8.953  16.669  15.342  1.00 0.00 ? 7  HIS A HE2  6  
ATOM 8117  N N    . HIS A 1 8  ? -8.265  20.666  10.673  1.00 0.00 ? 8  HIS A N    6  
ATOM 8118  C CA   . HIS A 1 8  ? -6.889  20.267  10.352  1.00 0.00 ? 8  HIS A CA   6  
ATOM 8119  C C    . HIS A 1 8  ? -6.038  20.496  11.611  1.00 0.00 ? 8  HIS A C    6  
ATOM 8120  O O    . HIS A 1 8  ? -5.631  19.538  12.274  1.00 0.00 ? 8  HIS A O    6  
ATOM 8121  C CB   . HIS A 1 8  ? -6.337  21.091  9.157   1.00 0.00 ? 8  HIS A CB   6  
ATOM 8122  C CG   . HIS A 1 8  ? -7.088  20.926  7.860   1.00 0.00 ? 8  HIS A CG   6  
ATOM 8123  N ND1  . HIS A 1 8  ? -6.601  20.195  6.798   1.00 0.00 ? 8  HIS A ND1  6  
ATOM 8124  C CD2  . HIS A 1 8  ? -8.282  21.424  7.446   1.00 0.00 ? 8  HIS A CD2  6  
ATOM 8125  C CE1  . HIS A 1 8  ? -7.455  20.250  5.795   1.00 0.00 ? 8  HIS A CE1  6  
ATOM 8126  N NE2  . HIS A 1 8  ? -8.482  20.984  6.162   1.00 0.00 ? 8  HIS A NE2  6  
ATOM 8127  H H    . HIS A 1 8  ? -8.552  21.579  10.456  1.00 0.00 ? 8  HIS A H    6  
ATOM 8128  H HA   . HIS A 1 8  ? -6.881  19.209  10.094  1.00 0.00 ? 8  HIS A HA   6  
ATOM 8129  H HB2  . HIS A 1 8  ? -6.366  22.145  9.412   1.00 0.00 ? 8  HIS A HB2  6  
ATOM 8130  H HB3  . HIS A 1 8  ? -5.304  20.808  8.986   1.00 0.00 ? 8  HIS A HB3  6  
ATOM 8131  H HD1  . HIS A 1 8  ? -5.754  19.704  6.783   1.00 0.00 ? 8  HIS A HD1  6  
ATOM 8132  H HD2  . HIS A 1 8  ? -8.954  22.051  8.023   1.00 0.00 ? 8  HIS A HD2  6  
ATOM 8133  H HE1  . HIS A 1 8  ? -7.329  19.779  4.829   1.00 0.00 ? 8  HIS A HE1  6  
ATOM 8134  H HE2  . HIS A 1 8  ? -9.333  21.041  5.673   1.00 0.00 ? 8  HIS A HE2  6  
ATOM 8135  N N    . SER A 1 9  ? -5.859  21.802  11.923  1.00 0.00 ? 9  SER A N    6  
ATOM 8136  C CA   . SER A 1 9  ? -5.167  22.347  13.110  1.00 0.00 ? 9  SER A CA   6  
ATOM 8137  C C    . SER A 1 9  ? -3.875  21.579  13.469  1.00 0.00 ? 9  SER A C    6  
ATOM 8138  O O    . SER A 1 9  ? -2.795  21.919  12.987  1.00 0.00 ? 9  SER A O    6  
ATOM 8139  C CB   . SER A 1 9  ? -6.152  22.470  14.310  1.00 0.00 ? 9  SER A CB   6  
ATOM 8140  O OG   . SER A 1 9  ? -6.761  21.228  14.622  1.00 0.00 ? 9  SER A OG   6  
ATOM 8141  H H    . SER A 1 9  ? -6.233  22.454  11.305  1.00 0.00 ? 9  SER A H    6  
ATOM 8142  H HA   . SER A 1 9  ? -4.871  23.355  12.829  1.00 0.00 ? 9  SER A HA   6  
ATOM 8143  H HB2  . SER A 1 9  ? -5.626  22.818  15.185  1.00 0.00 ? 9  SER A HB2  6  
ATOM 8144  H HB3  . SER A 1 9  ? -6.937  23.178  14.064  1.00 0.00 ? 9  SER A HB3  6  
ATOM 8145  H HG   . SER A 1 9  ? -7.620  21.388  15.023  1.00 0.00 ? 9  SER A HG   6  
ATOM 8146  N N    . HIS A 1 10 ? -4.012  20.507  14.264  1.00 0.00 ? 10 HIS A N    6  
ATOM 8147  C CA   . HIS A 1 10 ? -2.891  19.697  14.736  1.00 0.00 ? 10 HIS A CA   6  
ATOM 8148  C C    . HIS A 1 10 ? -3.121  18.231  14.340  1.00 0.00 ? 10 HIS A C    6  
ATOM 8149  O O    . HIS A 1 10 ? -4.057  17.587  14.815  1.00 0.00 ? 10 HIS A O    6  
ATOM 8150  C CB   . HIS A 1 10 ? -2.699  19.872  16.272  1.00 0.00 ? 10 HIS A CB   6  
ATOM 8151  C CG   . HIS A 1 10 ? -3.939  19.668  17.110  1.00 0.00 ? 10 HIS A CG   6  
ATOM 8152  N ND1  . HIS A 1 10 ? -4.911  20.629  17.244  1.00 0.00 ? 10 HIS A ND1  6  
ATOM 8153  C CD2  . HIS A 1 10 ? -4.348  18.614  17.858  1.00 0.00 ? 10 HIS A CD2  6  
ATOM 8154  C CE1  . HIS A 1 10 ? -5.867  20.184  18.032  1.00 0.00 ? 10 HIS A CE1  6  
ATOM 8155  N NE2  . HIS A 1 10 ? -5.553  18.965  18.418  1.00 0.00 ? 10 HIS A NE2  6  
ATOM 8156  H H    . HIS A 1 10 ? -4.914  20.228  14.512  1.00 0.00 ? 10 HIS A H    6  
ATOM 8157  H HA   . HIS A 1 10 ? -1.982  20.047  14.239  1.00 0.00 ? 10 HIS A HA   6  
ATOM 8158  H HB2  . HIS A 1 10 ? -1.950  19.172  16.621  1.00 0.00 ? 10 HIS A HB2  6  
ATOM 8159  H HB3  . HIS A 1 10 ? -2.341  20.874  16.465  1.00 0.00 ? 10 HIS A HB3  6  
ATOM 8160  H HD1  . HIS A 1 10 ? -4.888  21.520  16.836  1.00 0.00 ? 10 HIS A HD1  6  
ATOM 8161  H HD2  . HIS A 1 10 ? -3.817  17.677  17.998  1.00 0.00 ? 10 HIS A HD2  6  
ATOM 8162  H HE1  . HIS A 1 10 ? -6.752  20.730  18.321  1.00 0.00 ? 10 HIS A HE1  6  
ATOM 8163  H HE2  . HIS A 1 10 ? -6.172  18.343  18.857  1.00 0.00 ? 10 HIS A HE2  6  
ATOM 8164  N N    . MET A 1 11 ? -2.306  17.745  13.394  1.00 0.00 ? 11 MET A N    6  
ATOM 8165  C CA   . MET A 1 11 ? -2.247  16.316  13.002  1.00 0.00 ? 11 MET A CA   6  
ATOM 8166  C C    . MET A 1 11 ? -1.024  15.638  13.649  1.00 0.00 ? 11 MET A C    6  
ATOM 8167  O O    . MET A 1 11 ? -0.835  14.431  13.496  1.00 0.00 ? 11 MET A O    6  
ATOM 8168  C CB   . MET A 1 11 ? -2.179  16.195  11.457  1.00 0.00 ? 11 MET A CB   6  
ATOM 8169  C CG   . MET A 1 11 ? -3.447  16.682  10.744  1.00 0.00 ? 11 MET A CG   6  
ATOM 8170  S SD   . MET A 1 11 ? -3.342  16.554  8.948   1.00 0.00 ? 11 MET A SD   6  
ATOM 8171  C CE   . MET A 1 11 ? -5.001  17.035  8.469   1.00 0.00 ? 11 MET A CE   6  
ATOM 8172  H H    . MET A 1 11 ? -1.722  18.374  12.924  1.00 0.00 ? 11 MET A H    6  
ATOM 8173  H HA   . MET A 1 11 ? -3.146  15.816  13.361  1.00 0.00 ? 11 MET A HA   6  
ATOM 8174  H HB2  . MET A 1 11 ? -1.337  16.778  11.094  1.00 0.00 ? 11 MET A HB2  6  
ATOM 8175  H HB3  . MET A 1 11 ? -2.020  15.155  11.194  1.00 0.00 ? 11 MET A HB3  6  
ATOM 8176  H HG2  . MET A 1 11 ? -4.286  16.087  11.080  1.00 0.00 ? 11 MET A HG2  6  
ATOM 8177  H HG3  . MET A 1 11 ? -3.619  17.720  11.001  1.00 0.00 ? 11 MET A HG3  6  
ATOM 8178  H HE1  . MET A 1 11 ? -5.103  16.971  7.395   1.00 0.00 ? 11 MET A HE1  6  
ATOM 8179  H HE2  . MET A 1 11 ? -5.188  18.048  8.790   1.00 0.00 ? 11 MET A HE2  6  
ATOM 8180  H HE3  . MET A 1 11 ? -5.717  16.372  8.933   1.00 0.00 ? 11 MET A HE3  6  
ATOM 8181  N N    . LYS A 1 12 ? -0.199  16.465  14.336  1.00 0.00 ? 12 LYS A N    6  
ATOM 8182  C CA   . LYS A 1 12 ? 0.962   16.053  15.158  1.00 0.00 ? 12 LYS A CA   6  
ATOM 8183  C C    . LYS A 1 12 ? 2.146   15.587  14.288  1.00 0.00 ? 12 LYS A C    6  
ATOM 8184  O O    . LYS A 1 12 ? 3.167   16.274  14.201  1.00 0.00 ? 12 LYS A O    6  
ATOM 8185  C CB   . LYS A 1 12 ? 0.572   14.975  16.220  1.00 0.00 ? 12 LYS A CB   6  
ATOM 8186  C CG   . LYS A 1 12 ? 1.672   14.661  17.263  1.00 0.00 ? 12 LYS A CG   6  
ATOM 8187  C CD   . LYS A 1 12 ? 1.220   13.617  18.313  1.00 0.00 ? 12 LYS A CD   6  
ATOM 8188  C CE   . LYS A 1 12 ? 2.258   13.408  19.437  1.00 0.00 ? 12 LYS A CE   6  
ATOM 8189  N NZ   . LYS A 1 12 ? 3.561   12.900  18.929  1.00 0.00 ? 12 LYS A NZ   6  
ATOM 8190  H H    . LYS A 1 12 ? -0.378  17.421  14.278  1.00 0.00 ? 12 LYS A H    6  
ATOM 8191  H HA   . LYS A 1 12 ? 1.279   16.956  15.690  1.00 0.00 ? 12 LYS A HA   6  
ATOM 8192  H HB2  . LYS A 1 12 ? -0.307  15.323  16.751  1.00 0.00 ? 12 LYS A HB2  6  
ATOM 8193  H HB3  . LYS A 1 12 ? 0.316   14.053  15.703  1.00 0.00 ? 12 LYS A HB3  6  
ATOM 8194  H HG2  . LYS A 1 12 ? 2.549   14.281  16.745  1.00 0.00 ? 12 LYS A HG2  6  
ATOM 8195  H HG3  . LYS A 1 12 ? 1.935   15.582  17.773  1.00 0.00 ? 12 LYS A HG3  6  
ATOM 8196  H HD2  . LYS A 1 12 ? 0.292   13.954  18.761  1.00 0.00 ? 12 LYS A HD2  6  
ATOM 8197  H HD3  . LYS A 1 12 ? 1.046   12.665  17.816  1.00 0.00 ? 12 LYS A HD3  6  
ATOM 8198  H HE2  . LYS A 1 12 ? 2.431   14.352  19.938  1.00 0.00 ? 12 LYS A HE2  6  
ATOM 8199  H HE3  . LYS A 1 12 ? 1.865   12.696  20.153  1.00 0.00 ? 12 LYS A HE3  6  
ATOM 8200  H HZ1  . LYS A 1 12 ? 3.427   11.988  18.458  1.00 0.00 ? 12 LYS A HZ1  6  
ATOM 8201  H HZ2  . LYS A 1 12 ? 4.232   12.780  19.713  1.00 0.00 ? 12 LYS A HZ2  6  
ATOM 8202  H HZ3  . LYS A 1 12 ? 3.966   13.569  18.244  1.00 0.00 ? 12 LYS A HZ3  6  
ATOM 8203  N N    . ARG A 1 13 ? 1.994   14.423  13.646  1.00 0.00 ? 13 ARG A N    6  
ATOM 8204  C CA   . ARG A 1 13 ? 3.053   13.800  12.836  1.00 0.00 ? 13 ARG A CA   6  
ATOM 8205  C C    . ARG A 1 13 ? 3.376   14.625  11.572  1.00 0.00 ? 13 ARG A C    6  
ATOM 8206  O O    . ARG A 1 13 ? 2.474   15.076  10.860  1.00 0.00 ? 13 ARG A O    6  
ATOM 8207  C CB   . ARG A 1 13 ? 2.646   12.357  12.445  1.00 0.00 ? 13 ARG A CB   6  
ATOM 8208  C CG   . ARG A 1 13 ? 2.452   11.420  13.654  1.00 0.00 ? 13 ARG A CG   6  
ATOM 8209  C CD   . ARG A 1 13 ? 2.012   10.002  13.262  1.00 0.00 ? 13 ARG A CD   6  
ATOM 8210  N NE   . ARG A 1 13 ? 1.885   9.125   14.438  1.00 0.00 ? 13 ARG A NE   6  
ATOM 8211  C CZ   . ARG A 1 13 ? 2.895   8.463   15.019  1.00 0.00 ? 13 ARG A CZ   6  
ATOM 8212  N NH1  . ARG A 1 13 ? 4.140   8.561   14.546  1.00 0.00 ? 13 ARG A NH1  6  
ATOM 8213  N NH2  . ARG A 1 13 ? 2.646   7.682   16.062  1.00 0.00 ? 13 ARG A NH2  6  
ATOM 8214  H H    . ARG A 1 13 ? 1.139   13.966  13.722  1.00 0.00 ? 13 ARG A H    6  
ATOM 8215  H HA   . ARG A 1 13 ? 3.948   13.746  13.457  1.00 0.00 ? 13 ARG A HA   6  
ATOM 8216  H HB2  . ARG A 1 13 ? 1.714   12.393  11.888  1.00 0.00 ? 13 ARG A HB2  6  
ATOM 8217  H HB3  . ARG A 1 13 ? 3.415   11.933  11.808  1.00 0.00 ? 13 ARG A HB3  6  
ATOM 8218  H HG2  . ARG A 1 13 ? 3.390   11.351  14.193  1.00 0.00 ? 13 ARG A HG2  6  
ATOM 8219  H HG3  . ARG A 1 13 ? 1.702   11.850  14.309  1.00 0.00 ? 13 ARG A HG3  6  
ATOM 8220  H HD2  . ARG A 1 13 ? 1.045   10.059  12.775  1.00 0.00 ? 13 ARG A HD2  6  
ATOM 8221  H HD3  . ARG A 1 13 ? 2.731   9.575   12.572  1.00 0.00 ? 13 ARG A HD3  6  
ATOM 8222  H HE   . ARG A 1 13 ? 0.986   9.037   14.824  1.00 0.00 ? 13 ARG A HE   6  
ATOM 8223  H HH11 . ARG A 1 13 ? 4.337   9.143   13.755  1.00 0.00 ? 13 ARG A HH11 6  
ATOM 8224  H HH12 . ARG A 1 13 ? 4.887   8.062   14.989  1.00 0.00 ? 13 ARG A HH12 6  
ATOM 8225  H HH21 . ARG A 1 13 ? 1.710   7.604   16.422  1.00 0.00 ? 13 ARG A HH21 6  
ATOM 8226  H HH22 . ARG A 1 13 ? 3.394   7.186   16.504  1.00 0.00 ? 13 ARG A HH22 6  
ATOM 8227  N N    . SER A 1 14 ? 4.685   14.789  11.315  1.00 0.00 ? 14 SER A N    6  
ATOM 8228  C CA   . SER A 1 14 ? 5.219   15.530  10.158  1.00 0.00 ? 14 SER A CA   6  
ATOM 8229  C C    . SER A 1 14 ? 5.185   14.676  8.864   1.00 0.00 ? 14 SER A C    6  
ATOM 8230  O O    . SER A 1 14 ? 5.606   15.147  7.797   1.00 0.00 ? 14 SER A O    6  
ATOM 8231  C CB   . SER A 1 14 ? 6.668   15.976  10.475  1.00 0.00 ? 14 SER A CB   6  
ATOM 8232  O OG   . SER A 1 14 ? 6.744   16.609  11.750  1.00 0.00 ? 14 SER A OG   6  
ATOM 8233  H H    . SER A 1 14 ? 5.331   14.396  11.943  1.00 0.00 ? 14 SER A H    6  
ATOM 8234  H HA   . SER A 1 14 ? 4.603   16.413  10.007  1.00 0.00 ? 14 SER A HA   6  
ATOM 8235  H HB2  . SER A 1 14 ? 7.326   15.115  10.481  1.00 0.00 ? 14 SER A HB2  6  
ATOM 8236  H HB3  . SER A 1 14 ? 7.006   16.678  9.723   1.00 0.00 ? 14 SER A HB3  6  
ATOM 8237  H HG   . SER A 1 14 ? 7.624   16.479  12.119  1.00 0.00 ? 14 SER A HG   6  
ATOM 8238  N N    . GLY A 1 15 ? 4.703   13.414  8.982   1.00 0.00 ? 15 GLY A N    6  
ATOM 8239  C CA   . GLY A 1 15 ? 4.588   12.495  7.845   1.00 0.00 ? 15 GLY A CA   6  
ATOM 8240  C C    . GLY A 1 15 ? 3.696   13.025  6.720   1.00 0.00 ? 15 GLY A C    6  
ATOM 8241  O O    . GLY A 1 15 ? 2.667   13.665  6.984   1.00 0.00 ? 15 GLY A O    6  
ATOM 8242  H H    . GLY A 1 15 ? 4.434   13.101  9.867   1.00 0.00 ? 15 GLY A H    6  
ATOM 8243  H HA2  . GLY A 1 15 ? 5.580   12.310  7.454   1.00 0.00 ? 15 GLY A HA2  6  
ATOM 8244  H HA3  . GLY A 1 15 ? 4.180   11.560  8.201   1.00 0.00 ? 15 GLY A HA3  6  
ATOM 8245  N N    . ARG A 1 16 ? 4.093   12.748  5.467   1.00 0.00 ? 16 ARG A N    6  
ATOM 8246  C CA   . ARG A 1 16 ? 3.443   13.323  4.272   1.00 0.00 ? 16 ARG A CA   6  
ATOM 8247  C C    . ARG A 1 16 ? 2.207   12.510  3.876   1.00 0.00 ? 16 ARG A C    6  
ATOM 8248  O O    . ARG A 1 16 ? 2.266   11.285  3.807   1.00 0.00 ? 16 ARG A O    6  
ATOM 8249  C CB   . ARG A 1 16 ? 4.421   13.381  3.064   1.00 0.00 ? 16 ARG A CB   6  
ATOM 8250  C CG   . ARG A 1 16 ? 5.555   14.418  3.179   1.00 0.00 ? 16 ARG A CG   6  
ATOM 8251  C CD   . ARG A 1 16 ? 6.436   14.432  1.912   1.00 0.00 ? 16 ARG A CD   6  
ATOM 8252  N NE   . ARG A 1 16 ? 5.630   14.611  0.683   1.00 0.00 ? 16 ARG A NE   6  
ATOM 8253  C CZ   . ARG A 1 16 ? 5.776   13.929  -0.475  1.00 0.00 ? 16 ARG A CZ   6  
ATOM 8254  N NH1  . ARG A 1 16 ? 6.720   12.994  -0.616  1.00 0.00 ? 16 ARG A NH1  6  
ATOM 8255  N NH2  . ARG A 1 16 ? 4.944   14.176  -1.483  1.00 0.00 ? 16 ARG A NH2  6  
ATOM 8256  H H    . ARG A 1 16 ? 4.807   12.089  5.352   1.00 0.00 ? 16 ARG A H    6  
ATOM 8257  H HA   . ARG A 1 16 ? 3.134   14.336  4.514   1.00 0.00 ? 16 ARG A HA   6  
ATOM 8258  H HB2  . ARG A 1 16 ? 4.879   12.402  2.933   1.00 0.00 ? 16 ARG A HB2  6  
ATOM 8259  H HB3  . ARG A 1 16 ? 3.853   13.612  2.166   1.00 0.00 ? 16 ARG A HB3  6  
ATOM 8260  H HG2  . ARG A 1 16 ? 5.119   15.403  3.320   1.00 0.00 ? 16 ARG A HG2  6  
ATOM 8261  H HG3  . ARG A 1 16 ? 6.172   14.177  4.039   1.00 0.00 ? 16 ARG A HG3  6  
ATOM 8262  H HD2  . ARG A 1 16 ? 7.140   15.254  1.988   1.00 0.00 ? 16 ARG A HD2  6  
ATOM 8263  H HD3  . ARG A 1 16 ? 6.988   13.498  1.855   1.00 0.00 ? 16 ARG A HD3  6  
ATOM 8264  H HE   . ARG A 1 16 ? 4.921   15.289  0.726   1.00 0.00 ? 16 ARG A HE   6  
ATOM 8265  H HH11 . ARG A 1 16 ? 7.340   12.785  0.141   1.00 0.00 ? 16 ARG A HH11 6  
ATOM 8266  H HH12 . ARG A 1 16 ? 6.814   12.504  -1.485  1.00 0.00 ? 16 ARG A HH12 6  
ATOM 8267  H HH21 . ARG A 1 16 ? 4.219   14.864  -1.379  1.00 0.00 ? 16 ARG A HH21 6  
ATOM 8268  H HH22 . ARG A 1 16 ? 5.040   13.687  -2.352  1.00 0.00 ? 16 ARG A HH22 6  
ATOM 8269  N N    . GLU A 1 17 ? 1.092   13.194  3.612   1.00 0.00 ? 17 GLU A N    6  
ATOM 8270  C CA   . GLU A 1 17 ? -0.048  12.578  2.937   1.00 0.00 ? 17 GLU A CA   6  
ATOM 8271  C C    . GLU A 1 17 ? 0.250   12.548  1.428   1.00 0.00 ? 17 GLU A C    6  
ATOM 8272  O O    . GLU A 1 17 ? 0.304   13.591  0.777   1.00 0.00 ? 17 GLU A O    6  
ATOM 8273  C CB   . GLU A 1 17 ? -1.367  13.346  3.194   1.00 0.00 ? 17 GLU A CB   6  
ATOM 8274  C CG   . GLU A 1 17 ? -2.605  12.642  2.591   1.00 0.00 ? 17 GLU A CG   6  
ATOM 8275  C CD   . GLU A 1 17 ? -3.775  13.592  2.316   1.00 0.00 ? 17 GLU A CD   6  
ATOM 8276  O OE1  . GLU A 1 17 ? -4.460  13.994  3.268   1.00 0.00 ? 17 GLU A OE1  6  
ATOM 8277  O OE2  . GLU A 1 17 ? -4.025  13.935  1.137   1.00 0.00 ? 17 GLU A OE2  6  
ATOM 8278  H H    . GLU A 1 17 ? 1.030   14.127  3.889   1.00 0.00 ? 17 GLU A H    6  
ATOM 8279  H HA   . GLU A 1 17 ? -0.152  11.558  3.308   1.00 0.00 ? 17 GLU A HA   6  
ATOM 8280  H HB2  . GLU A 1 17 ? -1.511  13.446  4.266   1.00 0.00 ? 17 GLU A HB2  6  
ATOM 8281  H HB3  . GLU A 1 17 ? -1.285  14.340  2.763   1.00 0.00 ? 17 GLU A HB3  6  
ATOM 8282  H HG2  . GLU A 1 17 ? -2.316  12.167  1.657   1.00 0.00 ? 17 GLU A HG2  6  
ATOM 8283  H HG3  . GLU A 1 17 ? -2.936  11.866  3.278   1.00 0.00 ? 17 GLU A HG3  6  
ATOM 8284  N N    . ILE A 1 18 ? 0.461   11.356  0.893   1.00 0.00 ? 18 ILE A N    6  
ATOM 8285  C CA   . ILE A 1 18 ? 0.724   11.132  -0.532  1.00 0.00 ? 18 ILE A CA   6  
ATOM 8286  C C    . ILE A 1 18 ? -0.572  10.756  -1.269  1.00 0.00 ? 18 ILE A C    6  
ATOM 8287  O O    . ILE A 1 18 ? -1.626  10.590  -0.643  1.00 0.00 ? 18 ILE A O    6  
ATOM 8288  C CB   . ILE A 1 18 ? 1.781   9.988   -0.712  1.00 0.00 ? 18 ILE A CB   6  
ATOM 8289  C CG1  . ILE A 1 18 ? 1.263   8.653   -0.066  1.00 0.00 ? 18 ILE A CG1  6  
ATOM 8290  C CG2  . ILE A 1 18 ? 3.157   10.416  -0.132  1.00 0.00 ? 18 ILE A CG2  6  
ATOM 8291  C CD1  . ILE A 1 18 ? 2.178   7.463   -0.228  1.00 0.00 ? 18 ILE A CD1  6  
ATOM 8292  H H    . ILE A 1 18 ? 0.433   10.582  1.482   1.00 0.00 ? 18 ILE A H    6  
ATOM 8293  H HA   . ILE A 1 18 ? 1.125   12.043  -0.969  1.00 0.00 ? 18 ILE A HA   6  
ATOM 8294  H HB   . ILE A 1 18 ? 1.914   9.829   -1.779  1.00 0.00 ? 18 ILE A HB   6  
ATOM 8295  H HG12 . ILE A 1 18 ? 1.122   8.807   0.997   1.00 0.00 ? 18 ILE A HG12 6  
ATOM 8296  H HG13 . ILE A 1 18 ? 0.307   8.392   -0.506  1.00 0.00 ? 18 ILE A HG13 6  
ATOM 8297  H HG21 . ILE A 1 18 ? 3.882   9.630   -0.297  1.00 0.00 ? 18 ILE A HG21 6  
ATOM 8298  H HG22 . ILE A 1 18 ? 3.067   10.602  0.929   1.00 0.00 ? 18 ILE A HG22 6  
ATOM 8299  H HG23 . ILE A 1 18 ? 3.499   11.321  -0.625  1.00 0.00 ? 18 ILE A HG23 6  
ATOM 8300  H HD11 . ILE A 1 18 ? 3.110   7.649   0.286   1.00 0.00 ? 18 ILE A HD11 6  
ATOM 8301  H HD12 . ILE A 1 18 ? 2.372   7.291   -1.278  1.00 0.00 ? 18 ILE A HD12 6  
ATOM 8302  H HD13 . ILE A 1 18 ? 1.705   6.588   0.195   1.00 0.00 ? 18 ILE A HD13 6  
ATOM 8303  N N    . THR A 1 19 ? -0.482  10.640  -2.601  1.00 0.00 ? 19 THR A N    6  
ATOM 8304  C CA   . THR A 1 19 ? -1.527  10.022  -3.430  1.00 0.00 ? 19 THR A CA   6  
ATOM 8305  C C    . THR A 1 19 ? -1.129  8.557   -3.728  1.00 0.00 ? 19 THR A C    6  
ATOM 8306  O O    . THR A 1 19 ? 0.014   8.151   -3.452  1.00 0.00 ? 19 THR A O    6  
ATOM 8307  C CB   . THR A 1 19 ? -1.732  10.807  -4.774  1.00 0.00 ? 19 THR A CB   6  
ATOM 8308  O OG1  . THR A 1 19 ? -0.534  10.788  -5.578  1.00 0.00 ? 19 THR A OG1  6  
ATOM 8309  C CG2  . THR A 1 19 ? -2.157  12.263  -4.533  1.00 0.00 ? 19 THR A CG2  6  
ATOM 8310  H H    . THR A 1 19 ? 0.318   10.981  -3.044  1.00 0.00 ? 19 THR A H    6  
ATOM 8311  H HA   . THR A 1 19 ? -2.472  10.024  -2.879  1.00 0.00 ? 19 THR A HA   6  
ATOM 8312  H HB   . THR A 1 19 ? -2.522  10.316  -5.333  1.00 0.00 ? 19 THR A HB   6  
ATOM 8313  H HG1  . THR A 1 19 ? 0.091   11.440  -5.235  1.00 0.00 ? 19 THR A HG1  6  
ATOM 8314  H HG21 . THR A 1 19 ? -3.082  12.283  -3.973  1.00 0.00 ? 19 THR A HG21 6  
ATOM 8315  H HG22 . THR A 1 19 ? -2.304  12.760  -5.483  1.00 0.00 ? 19 THR A HG22 6  
ATOM 8316  H HG23 . THR A 1 19 ? -1.389  12.785  -3.973  1.00 0.00 ? 19 THR A HG23 6  
ATOM 8317  N N    . TRP A 1 20 ? -2.085  7.774   -4.276  1.00 0.00 ? 20 TRP A N    6  
ATOM 8318  C CA   . TRP A 1 20 ? -1.849  6.377   -4.725  1.00 0.00 ? 20 TRP A CA   6  
ATOM 8319  C C    . TRP A 1 20 ? -0.681  6.316   -5.740  1.00 0.00 ? 20 TRP A C    6  
ATOM 8320  O O    . TRP A 1 20 ? 0.114   5.372   -5.722  1.00 0.00 ? 20 TRP A O    6  
ATOM 8321  C CB   . TRP A 1 20 ? -3.151  5.780   -5.340  1.00 0.00 ? 20 TRP A CB   6  
ATOM 8322  C CG   . TRP A 1 20 ? -3.043  4.355   -5.845  1.00 0.00 ? 20 TRP A CG   6  
ATOM 8323  C CD1  . TRP A 1 20 ? -2.742  3.952   -7.115  1.00 0.00 ? 20 TRP A CD1  6  
ATOM 8324  C CD2  . TRP A 1 20 ? -3.259  3.157   -5.094  1.00 0.00 ? 20 TRP A CD2  6  
ATOM 8325  N NE1  . TRP A 1 20 ? -2.754  2.586   -7.191  1.00 0.00 ? 20 TRP A NE1  6  
ATOM 8326  C CE2  . TRP A 1 20 ? -3.078  2.074   -5.968  1.00 0.00 ? 20 TRP A CE2  6  
ATOM 8327  C CE3  . TRP A 1 20 ? -3.590  2.899   -3.771  1.00 0.00 ? 20 TRP A CE3  6  
ATOM 8328  C CZ2  . TRP A 1 20 ? -3.217  0.756   -5.560  1.00 0.00 ? 20 TRP A CZ2  6  
ATOM 8329  C CZ3  . TRP A 1 20 ? -3.721  1.592   -3.368  1.00 0.00 ? 20 TRP A CZ3  6  
ATOM 8330  C CH2  . TRP A 1 20 ? -3.539  0.532   -4.255  1.00 0.00 ? 20 TRP A CH2  6  
ATOM 8331  H H    . TRP A 1 20 ? -2.984  8.153   -4.351  1.00 0.00 ? 20 TRP A H    6  
ATOM 8332  H HA   . TRP A 1 20 ? -1.576  5.796   -3.847  1.00 0.00 ? 20 TRP A HA   6  
ATOM 8333  H HB2  . TRP A 1 20 ? -3.931  5.795   -4.590  1.00 0.00 ? 20 TRP A HB2  6  
ATOM 8334  H HB3  . TRP A 1 20 ? -3.471  6.401   -6.171  1.00 0.00 ? 20 TRP A HB3  6  
ATOM 8335  H HD1  . TRP A 1 20 ? -2.522  4.628   -7.929  1.00 0.00 ? 20 TRP A HD1  6  
ATOM 8336  H HE1  . TRP A 1 20 ? -2.564  2.062   -7.996  1.00 0.00 ? 20 TRP A HE1  6  
ATOM 8337  H HE3  . TRP A 1 20 ? -3.734  3.704   -3.063  1.00 0.00 ? 20 TRP A HE3  6  
ATOM 8338  H HZ2  . TRP A 1 20 ? -3.074  -0.072  -6.242  1.00 0.00 ? 20 TRP A HZ2  6  
ATOM 8339  H HZ3  . TRP A 1 20 ? -3.956  1.377   -2.350  1.00 0.00 ? 20 TRP A HZ3  6  
ATOM 8340  H HH2  . TRP A 1 20 ? -3.655  -0.481  -3.889  1.00 0.00 ? 20 TRP A HH2  6  
ATOM 8341  N N    . LYS A 1 21 ? -0.595  7.343   -6.606  1.00 0.00 ? 21 LYS A N    6  
ATOM 8342  C CA   . LYS A 1 21 ? 0.491   7.484   -7.601  1.00 0.00 ? 21 LYS A CA   6  
ATOM 8343  C C    . LYS A 1 21 ? 1.885   7.469   -6.931  1.00 0.00 ? 21 LYS A C    6  
ATOM 8344  O O    . LYS A 1 21 ? 2.765   6.711   -7.349  1.00 0.00 ? 21 LYS A O    6  
ATOM 8345  C CB   . LYS A 1 21 ? 0.280   8.778   -8.437  1.00 0.00 ? 21 LYS A CB   6  
ATOM 8346  C CG   . LYS A 1 21 ? 1.293   8.985   -9.587  1.00 0.00 ? 21 LYS A CG   6  
ATOM 8347  C CD   . LYS A 1 21 ? 1.020   10.288  -10.381 1.00 0.00 ? 21 LYS A CD   6  
ATOM 8348  C CE   . LYS A 1 21 ? 2.061   10.555  -11.477 1.00 0.00 ? 21 LYS A CE   6  
ATOM 8349  N NZ   . LYS A 1 21 ? 3.435   10.670  -10.923 1.00 0.00 ? 21 LYS A NZ   6  
ATOM 8350  H H    . LYS A 1 21 ? -1.316  8.005   -6.613  1.00 0.00 ? 21 LYS A H    6  
ATOM 8351  H HA   . LYS A 1 21 ? 0.423   6.627   -8.270  1.00 0.00 ? 21 LYS A HA   6  
ATOM 8352  H HB2  . LYS A 1 21 ? -0.716  8.752   -8.869  1.00 0.00 ? 21 LYS A HB2  6  
ATOM 8353  H HB3  . LYS A 1 21 ? 0.338   9.639   -7.773  1.00 0.00 ? 21 LYS A HB3  6  
ATOM 8354  H HG2  . LYS A 1 21 ? 2.293   9.031   -9.168  1.00 0.00 ? 21 LYS A HG2  6  
ATOM 8355  H HG3  . LYS A 1 21 ? 1.231   8.139   -10.264 1.00 0.00 ? 21 LYS A HG3  6  
ATOM 8356  H HD2  . LYS A 1 21 ? 0.045   10.218  -10.846 1.00 0.00 ? 21 LYS A HD2  6  
ATOM 8357  H HD3  . LYS A 1 21 ? 1.023   11.127  -9.691  1.00 0.00 ? 21 LYS A HD3  6  
ATOM 8358  H HE2  . LYS A 1 21 ? 2.043   9.748   -12.197 1.00 0.00 ? 21 LYS A HE2  6  
ATOM 8359  H HE3  . LYS A 1 21 ? 1.810   11.483  -11.975 1.00 0.00 ? 21 LYS A HE3  6  
ATOM 8360  H HZ1  . LYS A 1 21 ? 4.109   10.898  -11.683 1.00 0.00 ? 21 LYS A HZ1  6  
ATOM 8361  H HZ2  . LYS A 1 21 ? 3.719   9.774   -10.480 1.00 0.00 ? 21 LYS A HZ2  6  
ATOM 8362  H HZ3  . LYS A 1 21 ? 3.468   11.424  -10.207 1.00 0.00 ? 21 LYS A HZ3  6  
ATOM 8363  N N    . ASP A 1 22 ? 2.065   8.275   -5.863  1.00 0.00 ? 22 ASP A N    6  
ATOM 8364  C CA   . ASP A 1 22 ? 3.339   8.315   -5.102  1.00 0.00 ? 22 ASP A CA   6  
ATOM 8365  C C    . ASP A 1 22 ? 3.594   6.986   -4.405  1.00 0.00 ? 22 ASP A C    6  
ATOM 8366  O O    . ASP A 1 22 ? 4.720   6.484   -4.403  1.00 0.00 ? 22 ASP A O    6  
ATOM 8367  C CB   . ASP A 1 22 ? 3.336   9.426   -4.034  1.00 0.00 ? 22 ASP A CB   6  
ATOM 8368  C CG   . ASP A 1 22 ? 3.018   10.803  -4.607  1.00 0.00 ? 22 ASP A CG   6  
ATOM 8369  O OD1  . ASP A 1 22 ? 3.817   11.322  -5.407  1.00 0.00 ? 22 ASP A OD1  6  
ATOM 8370  O OD2  . ASP A 1 22 ? 1.957   11.366  -4.287  1.00 0.00 ? 22 ASP A OD2  6  
ATOM 8371  H H    . ASP A 1 22 ? 1.332   8.859   -5.569  1.00 0.00 ? 22 ASP A H    6  
ATOM 8372  H HA   . ASP A 1 22 ? 4.144   8.504   -5.810  1.00 0.00 ? 22 ASP A HA   6  
ATOM 8373  H HB2  . ASP A 1 22 ? 2.603   9.181   -3.269  1.00 0.00 ? 22 ASP A HB2  6  
ATOM 8374  H HB3  . ASP A 1 22 ? 4.315   9.471   -3.567  1.00 0.00 ? 22 ASP A HB3  6  
ATOM 8375  N N    . PHE A 1 23 ? 2.513   6.436   -3.822  1.00 0.00 ? 23 PHE A N    6  
ATOM 8376  C CA   . PHE A 1 23 ? 2.521   5.147   -3.118  1.00 0.00 ? 23 PHE A CA   6  
ATOM 8377  C C    . PHE A 1 23 ? 3.168   4.054   -3.975  1.00 0.00 ? 23 PHE A C    6  
ATOM 8378  O O    . PHE A 1 23 ? 4.025   3.323   -3.497  1.00 0.00 ? 23 PHE A O    6  
ATOM 8379  C CB   . PHE A 1 23 ? 1.071   4.741   -2.703  1.00 0.00 ? 23 PHE A CB   6  
ATOM 8380  C CG   . PHE A 1 23 ? 0.913   3.269   -2.300  1.00 0.00 ? 23 PHE A CG   6  
ATOM 8381  C CD1  . PHE A 1 23 ? 1.692   2.727   -1.282  1.00 0.00 ? 23 PHE A CD1  6  
ATOM 8382  C CD2  . PHE A 1 23 ? 0.017   2.432   -2.961  1.00 0.00 ? 23 PHE A CD2  6  
ATOM 8383  C CE1  . PHE A 1 23 ? 1.581   1.406   -0.941  1.00 0.00 ? 23 PHE A CE1  6  
ATOM 8384  C CE2  . PHE A 1 23 ? -0.100  1.104   -2.608  1.00 0.00 ? 23 PHE A CE2  6  
ATOM 8385  C CZ   . PHE A 1 23 ? 0.685   0.592   -1.600  1.00 0.00 ? 23 PHE A CZ   6  
ATOM 8386  H H    . PHE A 1 23 ? 1.664   6.923   -3.880  1.00 0.00 ? 23 PHE A H    6  
ATOM 8387  H HA   . PHE A 1 23 ? 3.114   5.283   -2.218  1.00 0.00 ? 23 PHE A HA   6  
ATOM 8388  H HB2  . PHE A 1 23 ? 0.758   5.350   -1.861  1.00 0.00 ? 23 PHE A HB2  6  
ATOM 8389  H HB3  . PHE A 1 23 ? 0.404   4.941   -3.534  1.00 0.00 ? 23 PHE A HB3  6  
ATOM 8390  H HD1  . PHE A 1 23 ? 2.395   3.366   -0.752  1.00 0.00 ? 23 PHE A HD1  6  
ATOM 8391  H HD2  . PHE A 1 23 ? -0.603  2.838   -3.754  1.00 0.00 ? 23 PHE A HD2  6  
ATOM 8392  H HE1  . PHE A 1 23 ? 2.196   1.005   -0.154  1.00 0.00 ? 23 PHE A HE1  6  
ATOM 8393  H HE2  . PHE A 1 23 ? -0.804  0.468   -3.129  1.00 0.00 ? 23 PHE A HE2  6  
ATOM 8394  H HZ   . PHE A 1 23 ? 0.604   -0.449  -1.333  1.00 0.00 ? 23 PHE A HZ   6  
ATOM 8395  N N    . VAL A 1 24 ? 2.749   3.966   -5.236  1.00 0.00 ? 24 VAL A N    6  
ATOM 8396  C CA   . VAL A 1 24 ? 3.245   2.955   -6.161  1.00 0.00 ? 24 VAL A CA   6  
ATOM 8397  C C    . VAL A 1 24 ? 4.691   3.260   -6.579  1.00 0.00 ? 24 VAL A C    6  
ATOM 8398  O O    . VAL A 1 24 ? 5.603   2.499   -6.259  1.00 0.00 ? 24 VAL A O    6  
ATOM 8399  C CB   . VAL A 1 24 ? 2.322   2.862   -7.426  1.00 0.00 ? 24 VAL A CB   6  
ATOM 8400  C CG1  . VAL A 1 24 ? 2.851   1.811   -8.438  1.00 0.00 ? 24 VAL A CG1  6  
ATOM 8401  C CG2  . VAL A 1 24 ? 0.855   2.577   -7.001  1.00 0.00 ? 24 VAL A CG2  6  
ATOM 8402  H H    . VAL A 1 24 ? 2.067   4.593   -5.553  1.00 0.00 ? 24 VAL A H    6  
ATOM 8403  H HA   . VAL A 1 24 ? 3.220   1.990   -5.651  1.00 0.00 ? 24 VAL A HA   6  
ATOM 8404  H HB   . VAL A 1 24 ? 2.338   3.833   -7.926  1.00 0.00 ? 24 VAL A HB   6  
ATOM 8405  H HG11 . VAL A 1 24 ? 3.848   2.083   -8.764  1.00 0.00 ? 24 VAL A HG11 6  
ATOM 8406  H HG12 . VAL A 1 24 ? 2.199   1.776   -9.300  1.00 0.00 ? 24 VAL A HG12 6  
ATOM 8407  H HG13 . VAL A 1 24 ? 2.882   0.831   -7.975  1.00 0.00 ? 24 VAL A HG13 6  
ATOM 8408  H HG21 . VAL A 1 24 ? 0.803   1.651   -6.437  1.00 0.00 ? 24 VAL A HG21 6  
ATOM 8409  H HG22 . VAL A 1 24 ? 0.225   2.500   -7.875  1.00 0.00 ? 24 VAL A HG22 6  
ATOM 8410  H HG23 . VAL A 1 24 ? 0.490   3.379   -6.373  1.00 0.00 ? 24 VAL A HG23 6  
ATOM 8411  N N    . ASN A 1 25 ? 4.893   4.410   -7.235  1.00 0.00 ? 25 ASN A N    6  
ATOM 8412  C CA   . ASN A 1 25 ? 6.151   4.724   -7.939  1.00 0.00 ? 25 ASN A CA   6  
ATOM 8413  C C    . ASN A 1 25 ? 7.306   4.962   -6.959  1.00 0.00 ? 25 ASN A C    6  
ATOM 8414  O O    . ASN A 1 25 ? 8.364   4.335   -7.073  1.00 0.00 ? 25 ASN A O    6  
ATOM 8415  C CB   . ASN A 1 25 ? 5.979   5.963   -8.858  1.00 0.00 ? 25 ASN A CB   6  
ATOM 8416  C CG   . ASN A 1 25 ? 5.096   5.685   -10.078 1.00 0.00 ? 25 ASN A CG   6  
ATOM 8417  O OD1  . ASN A 1 25 ? 5.586   5.279   -11.134 1.00 0.00 ? 25 ASN A OD1  6  
ATOM 8418  N ND2  . ASN A 1 25 ? 3.803   5.912   -9.954  1.00 0.00 ? 25 ASN A ND2  6  
ATOM 8419  H H    . ASN A 1 25 ? 4.192   5.090   -7.202  1.00 0.00 ? 25 ASN A H    6  
ATOM 8420  H HA   . ASN A 1 25 ? 6.403   3.865   -8.559  1.00 0.00 ? 25 ASN A HA   6  
ATOM 8421  H HB2  . ASN A 1 25 ? 5.536   6.772   -8.287  1.00 0.00 ? 25 ASN A HB2  6  
ATOM 8422  H HB3  . ASN A 1 25 ? 6.953   6.289   -9.215  1.00 0.00 ? 25 ASN A HB3  6  
ATOM 8423  H HD21 . ASN A 1 25 ? 3.475   6.252   -9.106  1.00 0.00 ? 25 ASN A HD21 6  
ATOM 8424  H HD22 . ASN A 1 25 ? 3.221   5.725   -10.720 1.00 0.00 ? 25 ASN A HD22 6  
ATOM 8425  N N    . ASN A 1 26 ? 7.094   5.860   -5.989  1.00 0.00 ? 26 ASN A N    6  
ATOM 8426  C CA   . ASN A 1 26 ? 8.161   6.337   -5.093  1.00 0.00 ? 26 ASN A CA   6  
ATOM 8427  C C    . ASN A 1 26 ? 8.452   5.339   -3.959  1.00 0.00 ? 26 ASN A C    6  
ATOM 8428  O O    . ASN A 1 26 ? 9.508   5.416   -3.340  1.00 0.00 ? 26 ASN A O    6  
ATOM 8429  C CB   . ASN A 1 26 ? 7.762   7.722   -4.497  1.00 0.00 ? 26 ASN A CB   6  
ATOM 8430  C CG   . ASN A 1 26 ? 7.453   8.790   -5.566  1.00 0.00 ? 26 ASN A CG   6  
ATOM 8431  O OD1  . ASN A 1 26 ? 6.550   9.608   -5.393  1.00 0.00 ? 26 ASN A OD1  6  
ATOM 8432  N ND2  . ASN A 1 26 ? 8.210   8.815   -6.662  1.00 0.00 ? 26 ASN A ND2  6  
ATOM 8433  H H    . ASN A 1 26 ? 6.200   6.226   -5.835  1.00 0.00 ? 26 ASN A H    6  
ATOM 8434  H HA   . ASN A 1 26 ? 9.062   6.466   -5.679  1.00 0.00 ? 26 ASN A HA   6  
ATOM 8435  H HB2  . ASN A 1 26 ? 6.881   7.600   -3.870  1.00 0.00 ? 26 ASN A HB2  6  
ATOM 8436  H HB3  . ASN A 1 26 ? 8.575   8.090   -3.879  1.00 0.00 ? 26 ASN A HB3  6  
ATOM 8437  H HD21 . ASN A 1 26 ? 8.935   8.163   -6.742  1.00 0.00 ? 26 ASN A HD21 6  
ATOM 8438  H HD22 . ASN A 1 26 ? 8.018   9.493   -7.348  1.00 0.00 ? 26 ASN A HD22 6  
ATOM 8439  N N    . TYR A 1 27 ? 7.506   4.414   -3.662  1.00 0.00 ? 27 TYR A N    6  
ATOM 8440  C CA   . TYR A 1 27 ? 7.620   3.532   -2.477  1.00 0.00 ? 27 TYR A CA   6  
ATOM 8441  C C    . TYR A 1 27 ? 7.499   2.025   -2.827  1.00 0.00 ? 27 TYR A C    6  
ATOM 8442  O O    . TYR A 1 27 ? 8.487   1.281   -2.734  1.00 0.00 ? 27 TYR A O    6  
ATOM 8443  C CB   . TYR A 1 27 ? 6.570   3.947   -1.397  1.00 0.00 ? 27 TYR A CB   6  
ATOM 8444  C CG   . TYR A 1 27 ? 6.623   5.443   -1.013  1.00 0.00 ? 27 TYR A CG   6  
ATOM 8445  C CD1  . TYR A 1 27 ? 7.684   5.967   -0.269  1.00 0.00 ? 27 TYR A CD1  6  
ATOM 8446  C CD2  . TYR A 1 27 ? 5.623   6.329   -1.412  1.00 0.00 ? 27 TYR A CD2  6  
ATOM 8447  C CE1  . TYR A 1 27 ? 7.733   7.313   0.064   1.00 0.00 ? 27 TYR A CE1  6  
ATOM 8448  C CE2  . TYR A 1 27 ? 5.670   7.669   -1.085  1.00 0.00 ? 27 TYR A CE2  6  
ATOM 8449  C CZ   . TYR A 1 27 ? 6.724   8.158   -0.348  1.00 0.00 ? 27 TYR A CZ   6  
ATOM 8450  O OH   . TYR A 1 27 ? 6.763   9.498   -0.014  1.00 0.00 ? 27 TYR A OH   6  
ATOM 8451  H H    . TYR A 1 27 ? 6.715   4.341   -4.236  1.00 0.00 ? 27 TYR A H    6  
ATOM 8452  H HA   . TYR A 1 27 ? 8.610   3.685   -2.045  1.00 0.00 ? 27 TYR A HA   6  
ATOM 8453  H HB2  . TYR A 1 27 ? 5.571   3.722   -1.761  1.00 0.00 ? 27 TYR A HB2  6  
ATOM 8454  H HB3  . TYR A 1 27 ? 6.743   3.366   -0.493  1.00 0.00 ? 27 TYR A HB3  6  
ATOM 8455  H HD1  . TYR A 1 27 ? 8.479   5.305   0.055   1.00 0.00 ? 27 TYR A HD1  6  
ATOM 8456  H HD2  . TYR A 1 27 ? 4.793   5.951   -1.995  1.00 0.00 ? 27 TYR A HD2  6  
ATOM 8457  H HE1  . TYR A 1 27 ? 8.565   7.692   0.644   1.00 0.00 ? 27 TYR A HE1  6  
ATOM 8458  H HE2  . TYR A 1 27 ? 4.877   8.331   -1.407  1.00 0.00 ? 27 TYR A HE2  6  
ATOM 8459  H HH   . TYR A 1 27 ? 5.905   9.768   0.330   1.00 0.00 ? 27 TYR A HH   6  
ATOM 8460  N N    . LEU A 1 28 ? 6.286   1.587   -3.213  1.00 0.00 ? 28 LEU A N    6  
ATOM 8461  C CA   . LEU A 1 28 ? 5.927   0.149   -3.304  1.00 0.00 ? 28 LEU A CA   6  
ATOM 8462  C C    . LEU A 1 28 ? 6.752   -0.613  -4.363  1.00 0.00 ? 28 LEU A C    6  
ATOM 8463  O O    . LEU A 1 28 ? 7.219   -1.729  -4.108  1.00 0.00 ? 28 LEU A O    6  
ATOM 8464  C CB   . LEU A 1 28 ? 4.409   -0.041  -3.576  1.00 0.00 ? 28 LEU A CB   6  
ATOM 8465  C CG   . LEU A 1 28 ? 3.887   -1.505  -3.377  1.00 0.00 ? 28 LEU A CG   6  
ATOM 8466  C CD1  . LEU A 1 28 ? 4.001   -1.947  -1.899  1.00 0.00 ? 28 LEU A CD1  6  
ATOM 8467  C CD2  . LEU A 1 28 ? 2.447   -1.679  -3.895  1.00 0.00 ? 28 LEU A CD2  6  
ATOM 8468  H H    . LEU A 1 28 ? 5.602   2.257   -3.382  1.00 0.00 ? 28 LEU A H    6  
ATOM 8469  H HA   . LEU A 1 28 ? 6.152   -0.282  -2.333  1.00 0.00 ? 28 LEU A HA   6  
ATOM 8470  H HB2  . LEU A 1 28 ? 3.853   0.621   -2.917  1.00 0.00 ? 28 LEU A HB2  6  
ATOM 8471  H HB3  . LEU A 1 28 ? 4.208   0.259   -4.600  1.00 0.00 ? 28 LEU A HB3  6  
ATOM 8472  H HG   . LEU A 1 28 ? 4.520   -2.172  -3.955  1.00 0.00 ? 28 LEU A HG   6  
ATOM 8473  H HD11 . LEU A 1 28 ? 5.034   -1.912  -1.586  1.00 0.00 ? 28 LEU A HD11 6  
ATOM 8474  H HD12 . LEU A 1 28 ? 3.637   -2.962  -1.794  1.00 0.00 ? 28 LEU A HD12 6  
ATOM 8475  H HD13 . LEU A 1 28 ? 3.411   -1.291  -1.266  1.00 0.00 ? 28 LEU A HD13 6  
ATOM 8476  H HD21 . LEU A 1 28 ? 2.401   -1.396  -4.939  1.00 0.00 ? 28 LEU A HD21 6  
ATOM 8477  H HD22 . LEU A 1 28 ? 1.769   -1.055  -3.326  1.00 0.00 ? 28 LEU A HD22 6  
ATOM 8478  H HD23 . LEU A 1 28 ? 2.148   -2.713  -3.800  1.00 0.00 ? 28 LEU A HD23 6  
ATOM 8479  N N    . SER A 1 29 ? 6.931   -0.003  -5.545  1.00 0.00 ? 29 SER A N    6  
ATOM 8480  C CA   . SER A 1 29 ? 7.695   -0.609  -6.652  1.00 0.00 ? 29 SER A CA   6  
ATOM 8481  C C    . SER A 1 29 ? 9.216   -0.598  -6.378  1.00 0.00 ? 29 SER A C    6  
ATOM 8482  O O    . SER A 1 29 ? 9.982   -1.240  -7.095  1.00 0.00 ? 29 SER A O    6  
ATOM 8483  C CB   . SER A 1 29 ? 7.367   0.115   -7.977  1.00 0.00 ? 29 SER A CB   6  
ATOM 8484  O OG   . SER A 1 29 ? 7.736   1.484   -7.924  1.00 0.00 ? 29 SER A OG   6  
ATOM 8485  H H    . SER A 1 29 ? 6.522   0.874   -5.694  1.00 0.00 ? 29 SER A H    6  
ATOM 8486  H HA   . SER A 1 29 ? 7.376   -1.646  -6.741  1.00 0.00 ? 29 SER A HA   6  
ATOM 8487  H HB2  . SER A 1 29 ? 7.903   -0.355  -8.793  1.00 0.00 ? 29 SER A HB2  6  
ATOM 8488  H HB3  . SER A 1 29 ? 6.303   0.048   -8.167  1.00 0.00 ? 29 SER A HB3  6  
ATOM 8489  H HG   . SER A 1 29 ? 6.952   2.023   -7.780  1.00 0.00 ? 29 SER A HG   6  
ATOM 8490  N N    . LYS A 1 30 ? 9.648   0.140   -5.341  1.00 0.00 ? 30 LYS A N    6  
ATOM 8491  C CA   . LYS A 1 30 ? 11.046  0.132   -4.869  1.00 0.00 ? 30 LYS A CA   6  
ATOM 8492  C C    . LYS A 1 30 ? 11.235  -0.908  -3.751  1.00 0.00 ? 30 LYS A C    6  
ATOM 8493  O O    . LYS A 1 30 ? 12.370  -1.189  -3.357  1.00 0.00 ? 30 LYS A O    6  
ATOM 8494  C CB   . LYS A 1 30 ? 11.458  1.538   -4.359  1.00 0.00 ? 30 LYS A CB   6  
ATOM 8495  C CG   . LYS A 1 30 ? 11.556  2.608   -5.462  1.00 0.00 ? 30 LYS A CG   6  
ATOM 8496  C CD   . LYS A 1 30 ? 11.987  3.985   -4.915  1.00 0.00 ? 30 LYS A CD   6  
ATOM 8497  C CE   . LYS A 1 30 ? 12.181  5.016   -6.030  1.00 0.00 ? 30 LYS A CE   6  
ATOM 8498  N NZ   . LYS A 1 30 ? 13.285  4.645   -6.958  1.00 0.00 ? 30 LYS A NZ   6  
ATOM 8499  H H    . LYS A 1 30 ? 9.007   0.697   -4.858  1.00 0.00 ? 30 LYS A H    6  
ATOM 8500  H HA   . LYS A 1 30 ? 11.687  -0.141  -5.703  1.00 0.00 ? 30 LYS A HA   6  
ATOM 8501  H HB2  . LYS A 1 30 ? 10.720  1.869   -3.632  1.00 0.00 ? 30 LYS A HB2  6  
ATOM 8502  H HB3  . LYS A 1 30 ? 12.422  1.469   -3.864  1.00 0.00 ? 30 LYS A HB3  6  
ATOM 8503  H HG2  . LYS A 1 30 ? 12.283  2.281   -6.204  1.00 0.00 ? 30 LYS A HG2  6  
ATOM 8504  H HG3  . LYS A 1 30 ? 10.587  2.709   -5.940  1.00 0.00 ? 30 LYS A HG3  6  
ATOM 8505  H HD2  . LYS A 1 30 ? 11.223  4.347   -4.235  1.00 0.00 ? 30 LYS A HD2  6  
ATOM 8506  H HD3  . LYS A 1 30 ? 12.922  3.878   -4.369  1.00 0.00 ? 30 LYS A HD3  6  
ATOM 8507  H HE2  . LYS A 1 30 ? 11.265  5.099   -6.602  1.00 0.00 ? 30 LYS A HE2  6  
ATOM 8508  H HE3  . LYS A 1 30 ? 12.409  5.975   -5.586  1.00 0.00 ? 30 LYS A HE3  6  
ATOM 8509  H HZ1  . LYS A 1 30 ? 13.376  5.355   -7.713  1.00 0.00 ? 30 LYS A HZ1  6  
ATOM 8510  H HZ2  . LYS A 1 30 ? 13.098  3.719   -7.392  1.00 0.00 ? 30 LYS A HZ2  6  
ATOM 8511  H HZ3  . LYS A 1 30 ? 14.185  4.594   -6.440  1.00 0.00 ? 30 LYS A HZ3  6  
ATOM 8512  N N    . GLY A 1 31 ? 10.119  -1.481  -3.258  1.00 0.00 ? 31 GLY A N    6  
ATOM 8513  C CA   . GLY A 1 31 ? 10.137  -2.409  -2.123  1.00 0.00 ? 31 GLY A CA   6  
ATOM 8514  C C    . GLY A 1 31 ? 10.679  -1.802  -0.832  1.00 0.00 ? 31 GLY A C    6  
ATOM 8515  O O    . GLY A 1 31 ? 11.200  -2.521  0.018   1.00 0.00 ? 31 GLY A O    6  
ATOM 8516  H H    . GLY A 1 31 ? 9.276   -1.321  -3.714  1.00 0.00 ? 31 GLY A H    6  
ATOM 8517  H HA2  . GLY A 1 31 ? 9.123   -2.745  -1.940  1.00 0.00 ? 31 GLY A HA2  6  
ATOM 8518  H HA3  . GLY A 1 31 ? 10.738  -3.273  -2.393  1.00 0.00 ? 31 GLY A HA3  6  
ATOM 8519  N N    . VAL A 1 32 ? 10.532  -0.469  -0.673  1.00 0.00 ? 32 VAL A N    6  
ATOM 8520  C CA   . VAL A 1 32 ? 10.947  0.236   0.568   1.00 0.00 ? 32 VAL A CA   6  
ATOM 8521  C C    . VAL A 1 32 ? 9.814   0.213   1.606   1.00 0.00 ? 32 VAL A C    6  
ATOM 8522  O O    . VAL A 1 32 ? 9.912   0.841   2.661   1.00 0.00 ? 32 VAL A O    6  
ATOM 8523  C CB   . VAL A 1 32 ? 11.400  1.714   0.291   1.00 0.00 ? 32 VAL A CB   6  
ATOM 8524  C CG1  . VAL A 1 32 ? 12.521  1.749   -0.768  1.00 0.00 ? 32 VAL A CG1  6  
ATOM 8525  C CG2  . VAL A 1 32 ? 10.209  2.620   -0.103  1.00 0.00 ? 32 VAL A CG2  6  
ATOM 8526  H H    . VAL A 1 32 ? 10.132  0.050   -1.401  1.00 0.00 ? 32 VAL A H    6  
ATOM 8527  H HA   . VAL A 1 32 ? 11.795  -0.301  0.988   1.00 0.00 ? 32 VAL A HA   6  
ATOM 8528  H HB   . VAL A 1 32 ? 11.821  2.108   1.217   1.00 0.00 ? 32 VAL A HB   6  
ATOM 8529  H HG11 . VAL A 1 32 ? 12.832  2.769   -0.946  1.00 0.00 ? 32 VAL A HG11 6  
ATOM 8530  H HG12 . VAL A 1 32 ? 12.163  1.316   -1.695  1.00 0.00 ? 32 VAL A HG12 6  
ATOM 8531  H HG13 . VAL A 1 32 ? 13.369  1.175   -0.415  1.00 0.00 ? 32 VAL A HG13 6  
ATOM 8532  H HG21 . VAL A 1 32 ? 9.474   2.624   0.694   1.00 0.00 ? 32 VAL A HG21 6  
ATOM 8533  H HG22 . VAL A 1 32 ? 9.749   2.250   -1.011  1.00 0.00 ? 32 VAL A HG22 6  
ATOM 8534  H HG23 . VAL A 1 32 ? 10.555  3.630   -0.264  1.00 0.00 ? 32 VAL A HG23 6  
ATOM 8535  N N    . VAL A 1 33 ? 8.742   -0.527  1.291   1.00 0.00 ? 33 VAL A N    6  
ATOM 8536  C CA   . VAL A 1 33 ? 7.582   -0.695  2.160   1.00 0.00 ? 33 VAL A CA   6  
ATOM 8537  C C    . VAL A 1 33 ? 7.713   -2.024  2.915   1.00 0.00 ? 33 VAL A C    6  
ATOM 8538  O O    . VAL A 1 33 ? 7.900   -3.080  2.299   1.00 0.00 ? 33 VAL A O    6  
ATOM 8539  C CB   . VAL A 1 33 ? 6.236   -0.675  1.335   1.00 0.00 ? 33 VAL A CB   6  
ATOM 8540  C CG1  . VAL A 1 33 ? 4.994   -0.723  2.258   1.00 0.00 ? 33 VAL A CG1  6  
ATOM 8541  C CG2  . VAL A 1 33 ? 6.183   0.552   0.400   1.00 0.00 ? 33 VAL A CG2  6  
ATOM 8542  H H    . VAL A 1 33 ? 8.734   -0.989  0.435   1.00 0.00 ? 33 VAL A H    6  
ATOM 8543  H HA   . VAL A 1 33 ? 7.559   0.133   2.876   1.00 0.00 ? 33 VAL A HA   6  
ATOM 8544  H HB   . VAL A 1 33 ? 6.210   -1.568  0.704   1.00 0.00 ? 33 VAL A HB   6  
ATOM 8545  H HG11 . VAL A 1 33 ? 5.024   -1.622  2.860   1.00 0.00 ? 33 VAL A HG11 6  
ATOM 8546  H HG12 . VAL A 1 33 ? 4.091   -0.736  1.658   1.00 0.00 ? 33 VAL A HG12 6  
ATOM 8547  H HG13 . VAL A 1 33 ? 4.976   0.145   2.910   1.00 0.00 ? 33 VAL A HG13 6  
ATOM 8548  H HG21 . VAL A 1 33 ? 6.226   1.465   0.985   1.00 0.00 ? 33 VAL A HG21 6  
ATOM 8549  H HG22 . VAL A 1 33 ? 5.265   0.539   -0.175  1.00 0.00 ? 33 VAL A HG22 6  
ATOM 8550  H HG23 . VAL A 1 33 ? 7.024   0.525   -0.277  1.00 0.00 ? 33 VAL A HG23 6  
ATOM 8551  N N    . ASP A 1 34 ? 7.626   -1.946  4.243   1.00 0.00 ? 34 ASP A N    6  
ATOM 8552  C CA   . ASP A 1 34 ? 7.557   -3.106  5.136   1.00 0.00 ? 34 ASP A CA   6  
ATOM 8553  C C    . ASP A 1 34 ? 6.136   -3.666  5.082   1.00 0.00 ? 34 ASP A C    6  
ATOM 8554  O O    . ASP A 1 34 ? 5.915   -4.835  4.762   1.00 0.00 ? 34 ASP A O    6  
ATOM 8555  C CB   . ASP A 1 34 ? 7.887   -2.652  6.596   1.00 0.00 ? 34 ASP A CB   6  
ATOM 8556  C CG   . ASP A 1 34 ? 7.802   -3.751  7.666   1.00 0.00 ? 34 ASP A CG   6  
ATOM 8557  O OD1  . ASP A 1 34 ? 8.737   -4.575  7.758   1.00 0.00 ? 34 ASP A OD1  6  
ATOM 8558  O OD2  . ASP A 1 34 ? 6.809   -3.793  8.419   1.00 0.00 ? 34 ASP A OD2  6  
ATOM 8559  H H    . ASP A 1 34 ? 7.535   -1.070  4.653   1.00 0.00 ? 34 ASP A H    6  
ATOM 8560  H HA   . ASP A 1 34 ? 8.273   -3.854  4.808   1.00 0.00 ? 34 ASP A HA   6  
ATOM 8561  H HB2  . ASP A 1 34 ? 8.893   -2.259  6.609   1.00 0.00 ? 34 ASP A HB2  6  
ATOM 8562  H HB3  . ASP A 1 34 ? 7.208   -1.847  6.871   1.00 0.00 ? 34 ASP A HB3  6  
ATOM 8563  N N    . ARG A 1 35 ? 5.174   -2.766  5.343   1.00 0.00 ? 35 ARG A N    6  
ATOM 8564  C CA   . ARG A 1 35 ? 3.794   -3.132  5.661   1.00 0.00 ? 35 ARG A CA   6  
ATOM 8565  C C    . ARG A 1 35 ? 2.824   -1.991  5.305   1.00 0.00 ? 35 ARG A C    6  
ATOM 8566  O O    . ARG A 1 35 ? 3.209   -0.818  5.269   1.00 0.00 ? 35 ARG A O    6  
ATOM 8567  C CB   . ARG A 1 35 ? 3.750   -3.460  7.174   1.00 0.00 ? 35 ARG A CB   6  
ATOM 8568  C CG   . ARG A 1 35 ? 2.403   -3.927  7.747   1.00 0.00 ? 35 ARG A CG   6  
ATOM 8569  C CD   . ARG A 1 35 ? 2.532   -4.282  9.237   1.00 0.00 ? 35 ARG A CD   6  
ATOM 8570  N NE   . ARG A 1 35 ? 3.006   -3.134  10.035  1.00 0.00 ? 35 ARG A NE   6  
ATOM 8571  C CZ   . ARG A 1 35 ? 4.005   -3.156  10.933  1.00 0.00 ? 35 ARG A CZ   6  
ATOM 8572  N NH1  . ARG A 1 35 ? 4.677   -4.273  11.178  1.00 0.00 ? 35 ARG A NH1  6  
ATOM 8573  N NH2  . ARG A 1 35 ? 4.318   -2.045  11.573  1.00 0.00 ? 35 ARG A NH2  6  
ATOM 8574  H H    . ARG A 1 35 ? 5.407   -1.818  5.350   1.00 0.00 ? 35 ARG A H    6  
ATOM 8575  H HA   . ARG A 1 35 ? 3.524   -4.020  5.093   1.00 0.00 ? 35 ARG A HA   6  
ATOM 8576  H HB2  . ARG A 1 35 ? 4.478   -4.244  7.369   1.00 0.00 ? 35 ARG A HB2  6  
ATOM 8577  H HB3  . ARG A 1 35 ? 4.059   -2.574  7.729   1.00 0.00 ? 35 ARG A HB3  6  
ATOM 8578  H HG2  . ARG A 1 35 ? 1.674   -3.131  7.630   1.00 0.00 ? 35 ARG A HG2  6  
ATOM 8579  H HG3  . ARG A 1 35 ? 2.066   -4.805  7.200   1.00 0.00 ? 35 ARG A HG3  6  
ATOM 8580  H HD2  . ARG A 1 35 ? 1.561   -4.581  9.603   1.00 0.00 ? 35 ARG A HD2  6  
ATOM 8581  H HD3  . ARG A 1 35 ? 3.223   -5.113  9.347   1.00 0.00 ? 35 ARG A HD3  6  
ATOM 8582  H HE   . ARG A 1 35 ? 2.545   -2.287  9.883   1.00 0.00 ? 35 ARG A HE   6  
ATOM 8583  H HH11 . ARG A 1 35 ? 4.446   -5.122  10.695  1.00 0.00 ? 35 ARG A HH11 6  
ATOM 8584  H HH12 . ARG A 1 35 ? 5.419   -4.277  11.848  1.00 0.00 ? 35 ARG A HH12 6  
ATOM 8585  H HH21 . ARG A 1 35 ? 3.812   -1.196  11.384  1.00 0.00 ? 35 ARG A HH21 6  
ATOM 8586  H HH22 . ARG A 1 35 ? 5.062   -2.040  12.243  1.00 0.00 ? 35 ARG A HH22 6  
ATOM 8587  N N    . LEU A 1 36 ? 1.572   -2.362  5.018   1.00 0.00 ? 36 LEU A N    6  
ATOM 8588  C CA   . LEU A 1 36 ? 0.464   -1.438  4.746   1.00 0.00 ? 36 LEU A CA   6  
ATOM 8589  C C    . LEU A 1 36 ? -0.555  -1.559  5.872   1.00 0.00 ? 36 LEU A C    6  
ATOM 8590  O O    . LEU A 1 36 ? -1.084  -2.645  6.119   1.00 0.00 ? 36 LEU A O    6  
ATOM 8591  C CB   . LEU A 1 36 ? -0.187  -1.770  3.380   1.00 0.00 ? 36 LEU A CB   6  
ATOM 8592  C CG   . LEU A 1 36 ? 0.753   -1.606  2.157   1.00 0.00 ? 36 LEU A CG   6  
ATOM 8593  C CD1  . LEU A 1 36 ? 0.047   -2.006  0.848   1.00 0.00 ? 36 LEU A CD1  6  
ATOM 8594  C CD2  . LEU A 1 36 ? 1.322   -0.168  2.096   1.00 0.00 ? 36 LEU A CD2  6  
ATOM 8595  H H    . LEU A 1 36 ? 1.369   -3.313  5.003   1.00 0.00 ? 36 LEU A H    6  
ATOM 8596  H HA   . LEU A 1 36 ? 0.849   -0.419  4.722   1.00 0.00 ? 36 LEU A HA   6  
ATOM 8597  H HB2  . LEU A 1 36 ? -0.538  -2.801  3.405   1.00 0.00 ? 36 LEU A HB2  6  
ATOM 8598  H HB3  . LEU A 1 36 ? -1.048  -1.123  3.238   1.00 0.00 ? 36 LEU A HB3  6  
ATOM 8599  H HG   . LEU A 1 36 ? 1.593   -2.276  2.280   1.00 0.00 ? 36 LEU A HG   6  
ATOM 8600  H HD11 . LEU A 1 36 ? -0.284  -3.037  0.916   1.00 0.00 ? 36 LEU A HD11 6  
ATOM 8601  H HD12 . LEU A 1 36 ? 0.730   -1.913  0.018   1.00 0.00 ? 36 LEU A HD12 6  
ATOM 8602  H HD13 . LEU A 1 36 ? -0.814  -1.368  0.676   1.00 0.00 ? 36 LEU A HD13 6  
ATOM 8603  H HD21 . LEU A 1 36 ? 1.997   -0.084  1.253   1.00 0.00 ? 36 LEU A HD21 6  
ATOM 8604  H HD22 . LEU A 1 36 ? 1.873   0.046   3.004   1.00 0.00 ? 36 LEU A HD22 6  
ATOM 8605  H HD23 . LEU A 1 36 ? 0.520   0.549   1.985   1.00 0.00 ? 36 LEU A HD23 6  
ATOM 8606  N N    . GLU A 1 37 ? -0.802  -0.454  6.575   1.00 0.00 ? 37 GLU A N    6  
ATOM 8607  C CA   . GLU A 1 37 ? -1.707  -0.417  7.730   1.00 0.00 ? 37 GLU A CA   6  
ATOM 8608  C C    . GLU A 1 37 ? -2.951  0.403   7.402   1.00 0.00 ? 37 GLU A C    6  
ATOM 8609  O O    . GLU A 1 37 ? -2.893  1.626   7.356   1.00 0.00 ? 37 GLU A O    6  
ATOM 8610  C CB   . GLU A 1 37 ? -0.957  0.150   8.966   1.00 0.00 ? 37 GLU A CB   6  
ATOM 8611  C CG   . GLU A 1 37 ? 0.111   -0.812  9.523   1.00 0.00 ? 37 GLU A CG   6  
ATOM 8612  C CD   . GLU A 1 37 ? 0.972   -0.217  10.642  1.00 0.00 ? 37 GLU A CD   6  
ATOM 8613  O OE1  . GLU A 1 37 ? 0.422   0.343   11.613  1.00 0.00 ? 37 GLU A OE1  6  
ATOM 8614  O OE2  . GLU A 1 37 ? 2.205   -0.346  10.576  1.00 0.00 ? 37 GLU A OE2  6  
ATOM 8615  H H    . GLU A 1 37 ? -0.356  0.380   6.303   1.00 0.00 ? 37 GLU A H    6  
ATOM 8616  H HA   . GLU A 1 37 ? -2.022  -1.439  7.955   1.00 0.00 ? 37 GLU A HA   6  
ATOM 8617  H HB2  . GLU A 1 37 ? -0.470  1.082   8.689   1.00 0.00 ? 37 GLU A HB2  6  
ATOM 8618  H HB3  . GLU A 1 37 ? -1.672  0.355   9.755   1.00 0.00 ? 37 GLU A HB3  6  
ATOM 8619  H HG2  . GLU A 1 37 ? -0.383  -1.696  9.914   1.00 0.00 ? 37 GLU A HG2  6  
ATOM 8620  H HG3  . GLU A 1 37 ? 0.756   -1.111  8.699   1.00 0.00 ? 37 GLU A HG3  6  
ATOM 8621  N N    . VAL A 1 38 ? -4.087  -0.279  7.204   1.00 0.00 ? 38 VAL A N    6  
ATOM 8622  C CA   . VAL A 1 38 ? -5.347  0.380   6.847   1.00 0.00 ? 38 VAL A CA   6  
ATOM 8623  C C    . VAL A 1 38 ? -5.966  0.910   8.143   1.00 0.00 ? 38 VAL A C    6  
ATOM 8624  O O    . VAL A 1 38 ? -6.543  0.141   8.915   1.00 0.00 ? 38 VAL A O    6  
ATOM 8625  C CB   . VAL A 1 38 ? -6.339  -0.600  6.118   1.00 0.00 ? 38 VAL A CB   6  
ATOM 8626  C CG1  . VAL A 1 38 ? -7.621  0.134   5.667   1.00 0.00 ? 38 VAL A CG1  6  
ATOM 8627  C CG2  . VAL A 1 38 ? -5.652  -1.322  4.936   1.00 0.00 ? 38 VAL A CG2  6  
ATOM 8628  H H    . VAL A 1 38 ? -4.097  -1.243  7.412   1.00 0.00 ? 38 VAL A H    6  
ATOM 8629  H HA   . VAL A 1 38 ? -5.125  1.217   6.179   1.00 0.00 ? 38 VAL A HA   6  
ATOM 8630  H HB   . VAL A 1 38 ? -6.636  -1.366  6.834   1.00 0.00 ? 38 VAL A HB   6  
ATOM 8631  H HG11 . VAL A 1 38 ? -8.116  0.560   6.528   1.00 0.00 ? 38 VAL A HG11 6  
ATOM 8632  H HG12 . VAL A 1 38 ? -8.290  -0.564  5.182   1.00 0.00 ? 38 VAL A HG12 6  
ATOM 8633  H HG13 . VAL A 1 38 ? -7.369  0.928   4.971   1.00 0.00 ? 38 VAL A HG13 6  
ATOM 8634  H HG21 . VAL A 1 38 ? -6.347  -2.014  4.474   1.00 0.00 ? 38 VAL A HG21 6  
ATOM 8635  H HG22 . VAL A 1 38 ? -4.792  -1.873  5.294   1.00 0.00 ? 38 VAL A HG22 6  
ATOM 8636  H HG23 . VAL A 1 38 ? -5.325  -0.600  4.195   1.00 0.00 ? 38 VAL A HG23 6  
ATOM 8637  N N    . VAL A 1 39 ? -5.769  2.206   8.416   1.00 0.00 ? 39 VAL A N    6  
ATOM 8638  C CA   . VAL A 1 39 ? -6.145  2.813   9.688   1.00 0.00 ? 39 VAL A CA   6  
ATOM 8639  C C    . VAL A 1 39 ? -7.544  3.459   9.587   1.00 0.00 ? 39 VAL A C    6  
ATOM 8640  O O    . VAL A 1 39 ? -7.784  4.316   8.726   1.00 0.00 ? 39 VAL A O    6  
ATOM 8641  C CB   . VAL A 1 39 ? -5.070  3.863   10.156  1.00 0.00 ? 39 VAL A CB   6  
ATOM 8642  C CG1  . VAL A 1 39 ? -5.433  4.474   11.527  1.00 0.00 ? 39 VAL A CG1  6  
ATOM 8643  C CG2  . VAL A 1 39 ? -3.646  3.241   10.186  1.00 0.00 ? 39 VAL A CG2  6  
ATOM 8644  H H    . VAL A 1 39 ? -5.373  2.789   7.738   1.00 0.00 ? 39 VAL A H    6  
ATOM 8645  H HA   . VAL A 1 39 ? -6.179  2.021   10.436  1.00 0.00 ? 39 VAL A HA   6  
ATOM 8646  H HB   . VAL A 1 39 ? -5.059  4.678   9.428   1.00 0.00 ? 39 VAL A HB   6  
ATOM 8647  H HG11 . VAL A 1 39 ? -6.392  4.971   11.459  1.00 0.00 ? 39 VAL A HG11 6  
ATOM 8648  H HG12 . VAL A 1 39 ? -4.682  5.198   11.818  1.00 0.00 ? 39 VAL A HG12 6  
ATOM 8649  H HG13 . VAL A 1 39 ? -5.490  3.694   12.279  1.00 0.00 ? 39 VAL A HG13 6  
ATOM 8650  H HG21 . VAL A 1 39 ? -2.924  3.989   10.490  1.00 0.00 ? 39 VAL A HG21 6  
ATOM 8651  H HG22 . VAL A 1 39 ? -3.387  2.880   9.200   1.00 0.00 ? 39 VAL A HG22 6  
ATOM 8652  H HG23 . VAL A 1 39 ? -3.614  2.413   10.886  1.00 0.00 ? 39 VAL A HG23 6  
ATOM 8653  N N    . ASN A 1 40 ? -8.455  3.000   10.471  1.00 0.00 ? 40 ASN A N    6  
ATOM 8654  C CA   . ASN A 1 40 ? -9.835  3.525   10.630  1.00 0.00 ? 40 ASN A CA   6  
ATOM 8655  C C    . ASN A 1 40 ? -10.688 3.406   9.350   1.00 0.00 ? 40 ASN A C    6  
ATOM 8656  O O    . ASN A 1 40 ? -11.747 4.029   9.265   1.00 0.00 ? 40 ASN A O    6  
ATOM 8657  C CB   . ASN A 1 40 ? -9.823  4.999   11.153  1.00 0.00 ? 40 ASN A CB   6  
ATOM 8658  C CG   . ASN A 1 40 ? -9.240  5.151   12.564  1.00 0.00 ? 40 ASN A CG   6  
ATOM 8659  O OD1  . ASN A 1 40 ? -8.399  4.370   12.988  1.00 0.00 ? 40 ASN A OD1  6  
ATOM 8660  N ND2  . ASN A 1 40 ? -9.687  6.156   13.305  1.00 0.00 ? 40 ASN A ND2  6  
ATOM 8661  H H    . ASN A 1 40 ? -8.173  2.282   11.079  1.00 0.00 ? 40 ASN A H    6  
ATOM 8662  H HA   . ASN A 1 40 ? -10.310 2.907   11.379  1.00 0.00 ? 40 ASN A HA   6  
ATOM 8663  H HB2  . ASN A 1 40 ? -9.234  5.618   10.482  1.00 0.00 ? 40 ASN A HB2  6  
ATOM 8664  H HB3  . ASN A 1 40 ? -10.842 5.368   11.162  1.00 0.00 ? 40 ASN A HB3  6  
ATOM 8665  H HD21 . ASN A 1 40 ? -10.366 6.743   12.923  1.00 0.00 ? 40 ASN A HD21 6  
ATOM 8666  H HD22 . ASN A 1 40 ? -9.311  6.271   14.203  1.00 0.00 ? 40 ASN A HD22 6  
ATOM 8667  N N    . LYS A 1 41 ? -10.226 2.585   8.380   1.00 0.00 ? 41 LYS A N    6  
ATOM 8668  C CA   . LYS A 1 41 ? -10.843 2.399   7.036   1.00 0.00 ? 41 LYS A CA   6  
ATOM 8669  C C    . LYS A 1 41 ? -10.780 3.689   6.158   1.00 0.00 ? 41 LYS A C    6  
ATOM 8670  O O    . LYS A 1 41 ? -11.176 3.658   4.984   1.00 0.00 ? 41 LYS A O    6  
ATOM 8671  C CB   . LYS A 1 41 ? -12.317 1.885   7.154   1.00 0.00 ? 41 LYS A CB   6  
ATOM 8672  C CG   . LYS A 1 41 ? -12.507 0.618   8.026   1.00 0.00 ? 41 LYS A CG   6  
ATOM 8673  C CD   . LYS A 1 41 ? -14.004 0.273   8.240   1.00 0.00 ? 41 LYS A CD   6  
ATOM 8674  C CE   . LYS A 1 41 ? -14.224 -0.880  9.230   1.00 0.00 ? 41 LYS A CE   6  
ATOM 8675  N NZ   . LYS A 1 41 ? -13.590 -2.147  8.786   1.00 0.00 ? 41 LYS A NZ   6  
ATOM 8676  H H    . LYS A 1 41 ? -9.447  2.042   8.594   1.00 0.00 ? 41 LYS A H    6  
ATOM 8677  H HA   . LYS A 1 41 ? -10.256 1.637   6.534   1.00 0.00 ? 41 LYS A HA   6  
ATOM 8678  H HB2  . LYS A 1 41 ? -12.927 2.674   7.580   1.00 0.00 ? 41 LYS A HB2  6  
ATOM 8679  H HB3  . LYS A 1 41 ? -12.690 1.667   6.155   1.00 0.00 ? 41 LYS A HB3  6  
ATOM 8680  H HG2  . LYS A 1 41 ? -12.012 -0.220  7.544   1.00 0.00 ? 41 LYS A HG2  6  
ATOM 8681  H HG3  . LYS A 1 41 ? -12.045 0.794   8.990   1.00 0.00 ? 41 LYS A HG3  6  
ATOM 8682  H HD2  . LYS A 1 41 ? -14.514 1.150   8.622   1.00 0.00 ? 41 LYS A HD2  6  
ATOM 8683  H HD3  . LYS A 1 41 ? -14.444 0.002   7.283   1.00 0.00 ? 41 LYS A HD3  6  
ATOM 8684  H HE2  . LYS A 1 41 ? -13.809 -0.607  10.192  1.00 0.00 ? 41 LYS A HE2  6  
ATOM 8685  H HE3  . LYS A 1 41 ? -15.289 -1.045  9.339   1.00 0.00 ? 41 LYS A HE3  6  
ATOM 8686  H HZ1  . LYS A 1 41 ? -13.770 -2.895  9.481   1.00 0.00 ? 41 LYS A HZ1  6  
ATOM 8687  H HZ2  . LYS A 1 41 ? -12.565 -2.016  8.694   1.00 0.00 ? 41 LYS A HZ2  6  
ATOM 8688  H HZ3  . LYS A 1 41 ? -13.975 -2.438  7.867   1.00 0.00 ? 41 LYS A HZ3  6  
ATOM 8689  N N    . ARG A 1 42 ? -10.254 4.793   6.721   1.00 0.00 ? 42 ARG A N    6  
ATOM 8690  C CA   . ARG A 1 42 ? -10.262 6.129   6.090   1.00 0.00 ? 42 ARG A CA   6  
ATOM 8691  C C    . ARG A 1 42 ? -9.034  6.293   5.202   1.00 0.00 ? 42 ARG A C    6  
ATOM 8692  O O    . ARG A 1 42 ? -9.086  6.958   4.161   1.00 0.00 ? 42 ARG A O    6  
ATOM 8693  C CB   . ARG A 1 42 ? -10.275 7.226   7.184   1.00 0.00 ? 42 ARG A CB   6  
ATOM 8694  C CG   . ARG A 1 42 ? -11.446 7.115   8.179   1.00 0.00 ? 42 ARG A CG   6  
ATOM 8695  C CD   . ARG A 1 42 ? -11.357 8.123   9.333   1.00 0.00 ? 42 ARG A CD   6  
ATOM 8696  N NE   . ARG A 1 42 ? -12.365 7.848   10.373  1.00 0.00 ? 42 ARG A NE   6  
ATOM 8697  C CZ   . ARG A 1 42 ? -12.240 8.168   11.669  1.00 0.00 ? 42 ARG A CZ   6  
ATOM 8698  N NH1  . ARG A 1 42 ? -11.138 8.762   12.117  1.00 0.00 ? 42 ARG A NH1  6  
ATOM 8699  N NH2  . ARG A 1 42 ? -13.189 7.833   12.529  1.00 0.00 ? 42 ARG A NH2  6  
ATOM 8700  H H    . ARG A 1 42 ? -9.821  4.705   7.588   1.00 0.00 ? 42 ARG A H    6  
ATOM 8701  H HA   . ARG A 1 42 ? -11.154 6.220   5.478   1.00 0.00 ? 42 ARG A HA   6  
ATOM 8702  H HB2  . ARG A 1 42 ? -9.346  7.174   7.750   1.00 0.00 ? 42 ARG A HB2  6  
ATOM 8703  H HB3  . ARG A 1 42 ? -10.331 8.199   6.705   1.00 0.00 ? 42 ARG A HB3  6  
ATOM 8704  H HG2  . ARG A 1 42 ? -12.375 7.280   7.647   1.00 0.00 ? 42 ARG A HG2  6  
ATOM 8705  H HG3  . ARG A 1 42 ? -11.453 6.110   8.593   1.00 0.00 ? 42 ARG A HG3  6  
ATOM 8706  H HD2  . ARG A 1 42 ? -10.367 8.062   9.782   1.00 0.00 ? 42 ARG A HD2  6  
ATOM 8707  H HD3  . ARG A 1 42 ? -11.512 9.121   8.949   1.00 0.00 ? 42 ARG A HD3  6  
ATOM 8708  H HE   . ARG A 1 42 ? -13.199 7.419   10.077  1.00 0.00 ? 42 ARG A HE   6  
ATOM 8709  H HH11 . ARG A 1 42 ? -10.393 8.998   11.487  1.00 0.00 ? 42 ARG A HH11 6  
ATOM 8710  H HH12 . ARG A 1 42 ? -11.046 8.993   13.090  1.00 0.00 ? 42 ARG A HH12 6  
ATOM 8711  H HH21 . ARG A 1 42 ? -14.010 7.355   12.218  1.00 0.00 ? 42 ARG A HH21 6  
ATOM 8712  H HH22 . ARG A 1 42 ? -13.090 8.066   13.506  1.00 0.00 ? 42 ARG A HH22 6  
ATOM 8713  N N    . PHE A 1 43 ? -7.935  5.654   5.619   1.00 0.00 ? 43 PHE A N    6  
ATOM 8714  C CA   . PHE A 1 43 ? -6.642  5.769   4.952   1.00 0.00 ? 43 PHE A CA   6  
ATOM 8715  C C    . PHE A 1 43 ? -5.794  4.523   5.210   1.00 0.00 ? 43 PHE A C    6  
ATOM 8716  O O    . PHE A 1 43 ? -6.158  3.658   6.012   1.00 0.00 ? 43 PHE A O    6  
ATOM 8717  C CB   . PHE A 1 43 ? -5.885  7.062   5.392   1.00 0.00 ? 43 PHE A CB   6  
ATOM 8718  C CG   . PHE A 1 43 ? -5.500  7.166   6.877   1.00 0.00 ? 43 PHE A CG   6  
ATOM 8719  C CD1  . PHE A 1 43 ? -6.444  7.539   7.829   1.00 0.00 ? 43 PHE A CD1  6  
ATOM 8720  C CD2  . PHE A 1 43 ? -4.190  6.931   7.309   1.00 0.00 ? 43 PHE A CD2  6  
ATOM 8721  C CE1  . PHE A 1 43 ? -6.099  7.670   9.160   1.00 0.00 ? 43 PHE A CE1  6  
ATOM 8722  C CE2  . PHE A 1 43 ? -3.844  7.072   8.640   1.00 0.00 ? 43 PHE A CE2  6  
ATOM 8723  C CZ   . PHE A 1 43 ? -4.801  7.443   9.566   1.00 0.00 ? 43 PHE A CZ   6  
ATOM 8724  H H    . PHE A 1 43 ? -8.007  5.041   6.384   1.00 0.00 ? 43 PHE A H    6  
ATOM 8725  H HA   . PHE A 1 43 ? -6.830  5.821   3.881   1.00 0.00 ? 43 PHE A HA   6  
ATOM 8726  H HB2  . PHE A 1 43 ? -4.975  7.144   4.806   1.00 0.00 ? 43 PHE A HB2  6  
ATOM 8727  H HB3  . PHE A 1 43 ? -6.508  7.919   5.152   1.00 0.00 ? 43 PHE A HB3  6  
ATOM 8728  H HD1  . PHE A 1 43 ? -7.470  7.721   7.517   1.00 0.00 ? 43 PHE A HD1  6  
ATOM 8729  H HD2  . PHE A 1 43 ? -3.436  6.641   6.584   1.00 0.00 ? 43 PHE A HD2  6  
ATOM 8730  H HE1  . PHE A 1 43 ? -6.850  7.960   9.880   1.00 0.00 ? 43 PHE A HE1  6  
ATOM 8731  H HE2  . PHE A 1 43 ? -2.827  6.888   8.956   1.00 0.00 ? 43 PHE A HE2  6  
ATOM 8732  H HZ   . PHE A 1 43 ? -4.534  7.555   10.605  1.00 0.00 ? 43 PHE A HZ   6  
ATOM 8733  N N    . VAL A 1 44 ? -4.666  4.446   4.497   1.00 0.00 ? 44 VAL A N    6  
ATOM 8734  C CA   . VAL A 1 44 ? -3.671  3.380   4.638   1.00 0.00 ? 44 VAL A CA   6  
ATOM 8735  C C    . VAL A 1 44 ? -2.311  4.047   4.821   1.00 0.00 ? 44 VAL A C    6  
ATOM 8736  O O    . VAL A 1 44 ? -1.975  4.977   4.076   1.00 0.00 ? 44 VAL A O    6  
ATOM 8737  C CB   . VAL A 1 44 ? -3.623  2.425   3.384   1.00 0.00 ? 44 VAL A CB   6  
ATOM 8738  C CG1  . VAL A 1 44 ? -2.599  1.281   3.589   1.00 0.00 ? 44 VAL A CG1  6  
ATOM 8739  C CG2  . VAL A 1 44 ? -5.026  1.876   3.050   1.00 0.00 ? 44 VAL A CG2  6  
ATOM 8740  H H    . VAL A 1 44 ? -4.476  5.166   3.865   1.00 0.00 ? 44 VAL A H    6  
ATOM 8741  H HA   . VAL A 1 44 ? -3.907  2.787   5.526   1.00 0.00 ? 44 VAL A HA   6  
ATOM 8742  H HB   . VAL A 1 44 ? -3.287  3.015   2.524   1.00 0.00 ? 44 VAL A HB   6  
ATOM 8743  H HG11 . VAL A 1 44 ? -1.617  1.697   3.769   1.00 0.00 ? 44 VAL A HG11 6  
ATOM 8744  H HG12 . VAL A 1 44 ? -2.560  0.659   2.704   1.00 0.00 ? 44 VAL A HG12 6  
ATOM 8745  H HG13 . VAL A 1 44 ? -2.891  0.673   4.439   1.00 0.00 ? 44 VAL A HG13 6  
ATOM 8746  H HG21 . VAL A 1 44 ? -4.974  1.244   2.172   1.00 0.00 ? 44 VAL A HG21 6  
ATOM 8747  H HG22 . VAL A 1 44 ? -5.702  2.700   2.852   1.00 0.00 ? 44 VAL A HG22 6  
ATOM 8748  H HG23 . VAL A 1 44 ? -5.406  1.299   3.884   1.00 0.00 ? 44 VAL A HG23 6  
ATOM 8749  N N    . ARG A 1 45 ? -1.535  3.572   5.795   1.00 0.00 ? 45 ARG A N    6  
ATOM 8750  C CA   . ARG A 1 45 ? -0.219  4.115   6.089   1.00 0.00 ? 45 ARG A CA   6  
ATOM 8751  C C    . ARG A 1 45 ? 0.830   3.212   5.446   1.00 0.00 ? 45 ARG A C    6  
ATOM 8752  O O    . ARG A 1 45 ? 0.799   1.985   5.606   1.00 0.00 ? 45 ARG A O    6  
ATOM 8753  C CB   . ARG A 1 45 ? 0.030   4.223   7.618   1.00 0.00 ? 45 ARG A CB   6  
ATOM 8754  C CG   . ARG A 1 45 ? 1.305   5.028   7.976   1.00 0.00 ? 45 ARG A CG   6  
ATOM 8755  C CD   . ARG A 1 45 ? 1.676   4.964   9.466   1.00 0.00 ? 45 ARG A CD   6  
ATOM 8756  N NE   . ARG A 1 45 ? 2.187   3.635   9.861   1.00 0.00 ? 45 ARG A NE   6  
ATOM 8757  C CZ   . ARG A 1 45 ? 2.743   3.347   11.051  1.00 0.00 ? 45 ARG A CZ   6  
ATOM 8758  N NH1  . ARG A 1 45 ? 2.853   4.281   11.987  1.00 0.00 ? 45 ARG A NH1  6  
ATOM 8759  N NH2  . ARG A 1 45 ? 3.193   2.127   11.287  1.00 0.00 ? 45 ARG A NH2  6  
ATOM 8760  H H    . ARG A 1 45 ? -1.825  2.786   6.288   1.00 0.00 ? 45 ARG A H    6  
ATOM 8761  H HA   . ARG A 1 45 ? -0.151  5.118   5.649   1.00 0.00 ? 45 ARG A HA   6  
ATOM 8762  H HB2  . ARG A 1 45 ? -0.826  4.715   8.073   1.00 0.00 ? 45 ARG A HB2  6  
ATOM 8763  H HB3  . ARG A 1 45 ? 0.119   3.225   8.041   1.00 0.00 ? 45 ARG A HB3  6  
ATOM 8764  H HG2  . ARG A 1 45 ? 2.140   4.633   7.401   1.00 0.00 ? 45 ARG A HG2  6  
ATOM 8765  H HG3  . ARG A 1 45 ? 1.153   6.068   7.693   1.00 0.00 ? 45 ARG A HG3  6  
ATOM 8766  H HD2  . ARG A 1 45 ? 2.448   5.700   9.657   1.00 0.00 ? 45 ARG A HD2  6  
ATOM 8767  H HD3  . ARG A 1 45 ? 0.803   5.204   10.068  1.00 0.00 ? 45 ARG A HD3  6  
ATOM 8768  H HE   . ARG A 1 45 ? 2.123   2.920   9.194   1.00 0.00 ? 45 ARG A HE   6  
ATOM 8769  H HH11 . ARG A 1 45 ? 2.525   5.213   11.813  1.00 0.00 ? 45 ARG A HH11 6  
ATOM 8770  H HH12 . ARG A 1 45 ? 3.265   4.060   12.873  1.00 0.00 ? 45 ARG A HH12 6  
ATOM 8771  H HH21 . ARG A 1 45 ? 3.120   1.421   10.580  1.00 0.00 ? 45 ARG A HH21 6  
ATOM 8772  H HH22 . ARG A 1 45 ? 3.609   1.899   12.172  1.00 0.00 ? 45 ARG A HH22 6  
ATOM 8773  N N    . VAL A 1 46 ? 1.737   3.849   4.724   1.00 0.00 ? 46 VAL A N    6  
ATOM 8774  C CA   . VAL A 1 46 ? 2.906   3.206   4.153   1.00 0.00 ? 46 VAL A CA   6  
ATOM 8775  C C    . VAL A 1 46 ? 3.966   3.148   5.264   1.00 0.00 ? 46 VAL A C    6  
ATOM 8776  O O    . VAL A 1 46 ? 4.535   4.182   5.656   1.00 0.00 ? 46 VAL A O    6  
ATOM 8777  C CB   . VAL A 1 46 ? 3.442   4.018   2.915   1.00 0.00 ? 46 VAL A CB   6  
ATOM 8778  C CG1  . VAL A 1 46 ? 4.640   3.318   2.239   1.00 0.00 ? 46 VAL A CG1  6  
ATOM 8779  C CG2  . VAL A 1 46 ? 2.303   4.298   1.902   1.00 0.00 ? 46 VAL A CG2  6  
ATOM 8780  H H    . VAL A 1 46 ? 1.624   4.805   4.625   1.00 0.00 ? 46 VAL A H    6  
ATOM 8781  H HA   . VAL A 1 46 ? 2.637   2.196   3.826   1.00 0.00 ? 46 VAL A HA   6  
ATOM 8782  H HB   . VAL A 1 46 ? 3.794   4.983   3.280   1.00 0.00 ? 46 VAL A HB   6  
ATOM 8783  H HG11 . VAL A 1 46 ? 5.001   3.918   1.412   1.00 0.00 ? 46 VAL A HG11 6  
ATOM 8784  H HG12 . VAL A 1 46 ? 4.335   2.348   1.868   1.00 0.00 ? 46 VAL A HG12 6  
ATOM 8785  H HG13 . VAL A 1 46 ? 5.438   3.188   2.958   1.00 0.00 ? 46 VAL A HG13 6  
ATOM 8786  H HG21 . VAL A 1 46 ? 1.902   3.361   1.532   1.00 0.00 ? 46 VAL A HG21 6  
ATOM 8787  H HG22 . VAL A 1 46 ? 2.681   4.879   1.071   1.00 0.00 ? 46 VAL A HG22 6  
ATOM 8788  H HG23 . VAL A 1 46 ? 1.511   4.854   2.390   1.00 0.00 ? 46 VAL A HG23 6  
ATOM 8789  N N    . THR A 1 47 ? 4.176   1.946   5.794   1.00 0.00 ? 47 THR A N    6  
ATOM 8790  C CA   . THR A 1 47 ? 5.197   1.686   6.806   1.00 0.00 ? 47 THR A CA   6  
ATOM 8791  C C    . THR A 1 47 ? 6.447   1.211   6.062   1.00 0.00 ? 47 THR A C    6  
ATOM 8792  O O    . THR A 1 47 ? 6.351   0.291   5.258   1.00 0.00 ? 47 THR A O    6  
ATOM 8793  C CB   . THR A 1 47 ? 4.695   0.604   7.820   1.00 0.00 ? 47 THR A CB   6  
ATOM 8794  O OG1  . THR A 1 47 ? 3.472   1.058   8.437   1.00 0.00 ? 47 THR A OG1  6  
ATOM 8795  C CG2  . THR A 1 47 ? 5.741   0.276   8.904   1.00 0.00 ? 47 THR A CG2  6  
ATOM 8796  H H    . THR A 1 47 ? 3.650   1.180   5.467   1.00 0.00 ? 47 THR A H    6  
ATOM 8797  H HA   . THR A 1 47 ? 5.411   2.612   7.350   1.00 0.00 ? 47 THR A HA   6  
ATOM 8798  H HB   . THR A 1 47 ? 4.473   -0.310  7.267   1.00 0.00 ? 47 THR A HB   6  
ATOM 8799  H HG1  . THR A 1 47 ? 2.898   0.301   8.603   1.00 0.00 ? 47 THR A HG1  6  
ATOM 8800  H HG21 . THR A 1 47 ? 5.971   1.166   9.476   1.00 0.00 ? 47 THR A HG21 6  
ATOM 8801  H HG22 . THR A 1 47 ? 6.646   -0.094  8.438   1.00 0.00 ? 47 THR A HG22 6  
ATOM 8802  H HG23 . THR A 1 47 ? 5.353   -0.483  9.572   1.00 0.00 ? 47 THR A HG23 6  
ATOM 8803  N N    . PHE A 1 48 ? 7.581   1.870   6.306   1.00 0.00 ? 48 PHE A N    6  
ATOM 8804  C CA   . PHE A 1 48 ? 8.849   1.599   5.597   1.00 0.00 ? 48 PHE A CA   6  
ATOM 8805  C C    . PHE A 1 48 ? 9.577   0.398   6.203   1.00 0.00 ? 48 PHE A C    6  
ATOM 8806  O O    . PHE A 1 48 ? 9.392   0.097   7.379   1.00 0.00 ? 48 PHE A O    6  
ATOM 8807  C CB   . PHE A 1 48 ? 9.758   2.846   5.649   1.00 0.00 ? 48 PHE A CB   6  
ATOM 8808  C CG   . PHE A 1 48 ? 9.188   4.064   4.922   1.00 0.00 ? 48 PHE A CG   6  
ATOM 8809  C CD1  . PHE A 1 48 ? 8.279   4.918   5.552   1.00 0.00 ? 48 PHE A CD1  6  
ATOM 8810  C CD2  . PHE A 1 48 ? 9.565   4.358   3.615   1.00 0.00 ? 48 PHE A CD2  6  
ATOM 8811  C CE1  . PHE A 1 48 ? 7.769   6.020   4.893   1.00 0.00 ? 48 PHE A CE1  6  
ATOM 8812  C CE2  . PHE A 1 48 ? 9.052   5.462   2.960   1.00 0.00 ? 48 PHE A CE2  6  
ATOM 8813  C CZ   . PHE A 1 48 ? 8.156   6.294   3.598   1.00 0.00 ? 48 PHE A CZ   6  
ATOM 8814  H H    . PHE A 1 48 ? 7.557   2.563   6.994   1.00 0.00 ? 48 PHE A H    6  
ATOM 8815  H HA   . PHE A 1 48 ? 8.616   1.373   4.553   1.00 0.00 ? 48 PHE A HA   6  
ATOM 8816  H HB2  . PHE A 1 48 ? 9.927   3.120   6.689   1.00 0.00 ? 48 PHE A HB2  6  
ATOM 8817  H HB3  . PHE A 1 48 ? 10.720  2.603   5.203   1.00 0.00 ? 48 PHE A HB3  6  
ATOM 8818  H HD1  . PHE A 1 48 ? 7.967   4.706   6.570   1.00 0.00 ? 48 PHE A HD1  6  
ATOM 8819  H HD2  . PHE A 1 48 ? 10.271  3.712   3.104   1.00 0.00 ? 48 PHE A HD2  6  
ATOM 8820  H HE1  . PHE A 1 48 ? 7.068   6.669   5.397   1.00 0.00 ? 48 PHE A HE1  6  
ATOM 8821  H HE2  . PHE A 1 48 ? 9.359   5.673   1.943   1.00 0.00 ? 48 PHE A HE2  6  
ATOM 8822  H HZ   . PHE A 1 48 ? 7.758   7.158   3.083   1.00 0.00 ? 48 PHE A HZ   6  
ATOM 8823  N N    . THR A 1 49 ? 10.376  -0.296  5.379   1.00 0.00 ? 49 THR A N    6  
ATOM 8824  C CA   . THR A 1 49 ? 11.255  -1.394  5.819   1.00 0.00 ? 49 THR A CA   6  
ATOM 8825  C C    . THR A 1 49 ? 12.340  -0.823  6.781   1.00 0.00 ? 49 THR A C    6  
ATOM 8826  O O    . THR A 1 49 ? 12.817  0.268   6.517   1.00 0.00 ? 49 THR A O    6  
ATOM 8827  C CB   . THR A 1 49 ? 11.903  -2.083  4.551   1.00 0.00 ? 49 THR A CB   6  
ATOM 8828  O OG1  . THR A 1 49 ? 11.039  -1.952  3.405   1.00 0.00 ? 49 THR A OG1  6  
ATOM 8829  C CG2  . THR A 1 49 ? 12.164  -3.576  4.740   1.00 0.00 ? 49 THR A CG2  6  
ATOM 8830  H H    . THR A 1 49 ? 10.373  -0.082  4.423   1.00 0.00 ? 49 THR A H    6  
ATOM 8831  H HA   . THR A 1 49 ? 10.648  -2.114  6.348   1.00 0.00 ? 49 THR A HA   6  
ATOM 8832  H HB   . THR A 1 49 ? 12.842  -1.589  4.327   1.00 0.00 ? 49 THR A HB   6  
ATOM 8833  H HG1  . THR A 1 49 ? 10.470  -2.730  3.337   1.00 0.00 ? 49 THR A HG1  6  
ATOM 8834  H HG21 . THR A 1 49 ? 12.612  -3.977  3.839   1.00 0.00 ? 49 THR A HG21 6  
ATOM 8835  H HG22 . THR A 1 49 ? 11.227  -4.089  4.933   1.00 0.00 ? 49 THR A HG22 6  
ATOM 8836  H HG23 . THR A 1 49 ? 12.834  -3.726  5.569   1.00 0.00 ? 49 THR A HG23 6  
ATOM 8837  N N    . PRO A 1 50 ? 12.697  -1.522  7.919   1.00 0.00 ? 50 PRO A N    6  
ATOM 8838  C CA   . PRO A 1 50 ? 13.629  -1.014  8.982   1.00 0.00 ? 50 PRO A CA   6  
ATOM 8839  C C    . PRO A 1 50 ? 14.830  -0.169  8.485   1.00 0.00 ? 50 PRO A C    6  
ATOM 8840  O O    . PRO A 1 50 ? 15.043  0.957   8.956   1.00 0.00 ? 50 PRO A O    6  
ATOM 8841  C CB   . PRO A 1 50 ? 14.112  -2.324  9.630   1.00 0.00 ? 50 PRO A CB   6  
ATOM 8842  C CG   . PRO A 1 50 ? 12.926  -3.230  9.566   1.00 0.00 ? 50 PRO A CG   6  
ATOM 8843  C CD   . PRO A 1 50 ? 12.191  -2.881  8.279   1.00 0.00 ? 50 PRO A CD   6  
ATOM 8844  H HA   . PRO A 1 50 ? 13.081  -0.429  9.716   1.00 0.00 ? 50 PRO A HA   6  
ATOM 8845  H HB2  . PRO A 1 50 ? 14.950  -2.738  9.067   1.00 0.00 ? 50 PRO A HB2  6  
ATOM 8846  H HB3  . PRO A 1 50 ? 14.404  -2.152  10.658  1.00 0.00 ? 50 PRO A HB3  6  
ATOM 8847  H HG2  . PRO A 1 50 ? 13.253  -4.269  9.549   1.00 0.00 ? 50 PRO A HG2  6  
ATOM 8848  H HG3  . PRO A 1 50 ? 12.279  -3.062  10.419  1.00 0.00 ? 50 PRO A HG3  6  
ATOM 8849  H HD2  . PRO A 1 50 ? 12.435  -3.593  7.496   1.00 0.00 ? 50 PRO A HD2  6  
ATOM 8850  H HD3  . PRO A 1 50 ? 11.122  -2.861  8.437   1.00 0.00 ? 50 PRO A HD3  6  
ATOM 8851  N N    . GLY A 1 51 ? 15.591  -0.711  7.517   1.00 0.00 ? 51 GLY A N    6  
ATOM 8852  C CA   . GLY A 1 51 ? 16.760  -0.017  6.952   1.00 0.00 ? 51 GLY A CA   6  
ATOM 8853  C C    . GLY A 1 51 ? 16.387  1.003   5.869   1.00 0.00 ? 51 GLY A C    6  
ATOM 8854  O O    . GLY A 1 51 ? 17.125  1.961   5.638   1.00 0.00 ? 51 GLY A O    6  
ATOM 8855  H H    . GLY A 1 51 ? 15.350  -1.591  7.170   1.00 0.00 ? 51 GLY A H    6  
ATOM 8856  H HA2  . GLY A 1 51 ? 17.298  0.492   7.752   1.00 0.00 ? 51 GLY A HA2  6  
ATOM 8857  H HA3  . GLY A 1 51 ? 17.419  -0.754  6.511   1.00 0.00 ? 51 GLY A HA3  6  
ATOM 8858  N N    . LYS A 1 52 ? 15.238  0.777   5.211   1.00 0.00 ? 52 LYS A N    6  
ATOM 8859  C CA   . LYS A 1 52 ? 14.687  1.685   4.176   1.00 0.00 ? 52 LYS A CA   6  
ATOM 8860  C C    . LYS A 1 52 ? 13.926  2.879   4.798   1.00 0.00 ? 52 LYS A C    6  
ATOM 8861  O O    . LYS A 1 52 ? 13.498  3.775   4.066   1.00 0.00 ? 52 LYS A O    6  
ATOM 8862  C CB   . LYS A 1 52 ? 13.729  0.914   3.230   1.00 0.00 ? 52 LYS A CB   6  
ATOM 8863  C CG   . LYS A 1 52 ? 14.371  -0.216  2.406   1.00 0.00 ? 52 LYS A CG   6  
ATOM 8864  C CD   . LYS A 1 52 ? 15.437  0.292   1.415   1.00 0.00 ? 52 LYS A CD   6  
ATOM 8865  C CE   . LYS A 1 52 ? 15.952  -0.835  0.495   1.00 0.00 ? 52 LYS A CE   6  
ATOM 8866  N NZ   . LYS A 1 52 ? 17.116  -0.409  -0.331  1.00 0.00 ? 52 LYS A NZ   6  
ATOM 8867  H H    . LYS A 1 52 ? 14.738  -0.032  5.432   1.00 0.00 ? 52 LYS A H    6  
ATOM 8868  H HA   . LYS A 1 52 ? 15.516  2.072   3.595   1.00 0.00 ? 52 LYS A HA   6  
ATOM 8869  H HB2  . LYS A 1 52 ? 12.933  0.480   3.823   1.00 0.00 ? 52 LYS A HB2  6  
ATOM 8870  H HB3  . LYS A 1 52 ? 13.285  1.623   2.533   1.00 0.00 ? 52 LYS A HB3  6  
ATOM 8871  H HG2  . LYS A 1 52 ? 14.830  -0.928  3.083   1.00 0.00 ? 52 LYS A HG2  6  
ATOM 8872  H HG3  . LYS A 1 52 ? 13.584  -0.722  1.847   1.00 0.00 ? 52 LYS A HG3  6  
ATOM 8873  H HD2  . LYS A 1 52 ? 15.003  1.073   0.802   1.00 0.00 ? 52 LYS A HD2  6  
ATOM 8874  H HD3  . LYS A 1 52 ? 16.272  0.699   1.975   1.00 0.00 ? 52 LYS A HD3  6  
ATOM 8875  H HE2  . LYS A 1 52 ? 16.254  -1.678  1.102   1.00 0.00 ? 52 LYS A HE2  6  
ATOM 8876  H HE3  . LYS A 1 52 ? 15.149  -1.142  -0.165  1.00 0.00 ? 52 LYS A HE3  6  
ATOM 8877  H HZ1  . LYS A 1 52 ? 16.844  0.369   -0.964  1.00 0.00 ? 52 LYS A HZ1  6  
ATOM 8878  H HZ2  . LYS A 1 52 ? 17.459  -1.206  -0.904  1.00 0.00 ? 52 LYS A HZ2  6  
ATOM 8879  H HZ3  . LYS A 1 52 ? 17.890  -0.082  0.281   1.00 0.00 ? 52 LYS A HZ3  6  
ATOM 8880  N N    . THR A 1 53 ? 13.751  2.872   6.138   1.00 0.00 ? 53 THR A N    6  
ATOM 8881  C CA   . THR A 1 53 ? 13.082  3.962   6.860   1.00 0.00 ? 53 THR A CA   6  
ATOM 8882  C C    . THR A 1 53 ? 13.918  5.251   6.733   1.00 0.00 ? 53 THR A C    6  
ATOM 8883  O O    . THR A 1 53 ? 15.110  5.217   7.068   1.00 0.00 ? 53 THR A O    6  
ATOM 8884  C CB   . THR A 1 53 ? 12.872  3.590   8.367   1.00 0.00 ? 53 THR A CB   6  
ATOM 8885  O OG1  . THR A 1 53 ? 12.186  2.331   8.453   1.00 0.00 ? 53 THR A OG1  6  
ATOM 8886  C CG2  . THR A 1 53 ? 12.057  4.657   9.130   1.00 0.00 ? 53 THR A CG2  6  
ATOM 8887  H H    . THR A 1 53 ? 14.087  2.111   6.650   1.00 0.00 ? 53 THR A H    6  
ATOM 8888  H HA   . THR A 1 53 ? 12.107  4.110   6.408   1.00 0.00 ? 53 THR A HA   6  
ATOM 8889  H HB   . THR A 1 53 ? 13.843  3.478   8.844   1.00 0.00 ? 53 THR A HB   6  
ATOM 8890  H HG1  . THR A 1 53 ? 12.151  1.923   7.580   1.00 0.00 ? 53 THR A HG1  6  
ATOM 8891  H HG21 . THR A 1 53 ? 12.574  5.606   9.090   1.00 0.00 ? 53 THR A HG21 6  
ATOM 8892  H HG22 . THR A 1 53 ? 11.933  4.361   10.165  1.00 0.00 ? 53 THR A HG22 6  
ATOM 8893  H HG23 . THR A 1 53 ? 11.080  4.766   8.675   1.00 0.00 ? 53 THR A HG23 6  
ATOM 8894  N N    . PRO A 1 54 ? 13.339  6.380   6.194   1.00 0.00 ? 54 PRO A N    6  
ATOM 8895  C CA   . PRO A 1 54 ? 14.037  7.690   6.115   1.00 0.00 ? 54 PRO A CA   6  
ATOM 8896  C C    . PRO A 1 54 ? 14.659  8.105   7.460   1.00 0.00 ? 54 PRO A C    6  
ATOM 8897  O O    . PRO A 1 54 ? 14.169  7.693   8.515   1.00 0.00 ? 54 PRO A O    6  
ATOM 8898  C CB   . PRO A 1 54 ? 12.909  8.665   5.687   1.00 0.00 ? 54 PRO A CB   6  
ATOM 8899  C CG   . PRO A 1 54 ? 11.965  7.811   4.904   1.00 0.00 ? 54 PRO A CG   6  
ATOM 8900  C CD   . PRO A 1 54 ? 11.983  6.457   5.584   1.00 0.00 ? 54 PRO A CD   6  
ATOM 8901  H HA   . PRO A 1 54 ? 14.812  7.666   5.350   1.00 0.00 ? 54 PRO A HA   6  
ATOM 8902  H HB2  . PRO A 1 54 ? 12.414  9.094   6.565   1.00 0.00 ? 54 PRO A HB2  6  
ATOM 8903  H HB3  . PRO A 1 54 ? 13.305  9.455   5.065   1.00 0.00 ? 54 PRO A HB3  6  
ATOM 8904  H HG2  . PRO A 1 54 ? 10.969  8.240   4.925   1.00 0.00 ? 54 PRO A HG2  6  
ATOM 8905  H HG3  . PRO A 1 54 ? 12.308  7.714   3.878   1.00 0.00 ? 54 PRO A HG3  6  
ATOM 8906  H HD2  . PRO A 1 54 ? 11.215  6.397   6.348   1.00 0.00 ? 54 PRO A HD2  6  
ATOM 8907  H HD3  . PRO A 1 54 ? 11.845  5.668   4.855   1.00 0.00 ? 54 PRO A HD3  6  
ATOM 8908  N N    . VAL A 1 55 ? 15.726  8.914   7.408   1.00 0.00 ? 55 VAL A N    6  
ATOM 8909  C CA   . VAL A 1 55 ? 16.459  9.384   8.608   1.00 0.00 ? 55 VAL A CA   6  
ATOM 8910  C C    . VAL A 1 55 ? 15.521  10.192  9.551   1.00 0.00 ? 55 VAL A C    6  
ATOM 8911  O O    . VAL A 1 55 ? 15.652  10.133  10.777  1.00 0.00 ? 55 VAL A O    6  
ATOM 8912  C CB   . VAL A 1 55 ? 17.719  10.238  8.194   1.00 0.00 ? 55 VAL A CB   6  
ATOM 8913  C CG1  . VAL A 1 55 ? 18.496  10.801  9.412   1.00 0.00 ? 55 VAL A CG1  6  
ATOM 8914  C CG2  . VAL A 1 55 ? 18.660  9.413   7.276   1.00 0.00 ? 55 VAL A CG2  6  
ATOM 8915  H H    . VAL A 1 55 ? 16.029  9.220   6.527   1.00 0.00 ? 55 VAL A H    6  
ATOM 8916  H HA   . VAL A 1 55 ? 16.805  8.500   9.143   1.00 0.00 ? 55 VAL A HA   6  
ATOM 8917  H HB   . VAL A 1 55 ? 17.363  11.088  7.616   1.00 0.00 ? 55 VAL A HB   6  
ATOM 8918  H HG11 . VAL A 1 55 ? 17.843  11.435  9.998   1.00 0.00 ? 55 VAL A HG11 6  
ATOM 8919  H HG12 . VAL A 1 55 ? 19.341  11.387  9.073   1.00 0.00 ? 55 VAL A HG12 6  
ATOM 8920  H HG13 . VAL A 1 55 ? 18.854  9.988   10.035  1.00 0.00 ? 55 VAL A HG13 6  
ATOM 8921  H HG21 . VAL A 1 55 ? 19.498  10.022  6.967   1.00 0.00 ? 55 VAL A HG21 6  
ATOM 8922  H HG22 . VAL A 1 55 ? 18.115  9.089   6.395   1.00 0.00 ? 55 VAL A HG22 6  
ATOM 8923  H HG23 . VAL A 1 55 ? 19.027  8.541   7.805   1.00 0.00 ? 55 VAL A HG23 6  
ATOM 8924  N N    . ASP A 1 56 ? 14.546  10.906  8.952   1.00 0.00 ? 56 ASP A N    6  
ATOM 8925  C CA   . ASP A 1 56 ? 13.512  11.686  9.687   1.00 0.00 ? 56 ASP A CA   6  
ATOM 8926  C C    . ASP A 1 56 ? 12.276  10.816  10.036  1.00 0.00 ? 56 ASP A C    6  
ATOM 8927  O O    . ASP A 1 56 ? 11.332  11.299  10.661  1.00 0.00 ? 56 ASP A O    6  
ATOM 8928  C CB   . ASP A 1 56 ? 13.060  12.908  8.841   1.00 0.00 ? 56 ASP A CB   6  
ATOM 8929  C CG   . ASP A 1 56 ? 14.207  13.881  8.531   1.00 0.00 ? 56 ASP A CG   6  
ATOM 8930  O OD1  . ASP A 1 56 ? 14.981  13.625  7.585   1.00 0.00 ? 56 ASP A OD1  6  
ATOM 8931  O OD2  . ASP A 1 56 ? 14.335  14.912  9.223   1.00 0.00 ? 56 ASP A OD2  6  
ATOM 8932  H H    . ASP A 1 56 ? 14.519  10.909  7.975   1.00 0.00 ? 56 ASP A H    6  
ATOM 8933  H HA   . ASP A 1 56 ? 13.951  12.049  10.617  1.00 0.00 ? 56 ASP A HA   6  
ATOM 8934  H HB2  . ASP A 1 56 ? 12.639  12.553  7.898   1.00 0.00 ? 56 ASP A HB2  6  
ATOM 8935  H HB3  . ASP A 1 56 ? 12.277  13.443  9.377   1.00 0.00 ? 56 ASP A HB3  6  
ATOM 8936  N N    . GLY A 1 57 ? 12.299  9.539   9.631   1.00 0.00 ? 57 GLY A N    6  
ATOM 8937  C CA   . GLY A 1 57 ? 11.166  8.617   9.803   1.00 0.00 ? 57 GLY A CA   6  
ATOM 8938  C C    . GLY A 1 57 ? 10.146  8.794   8.694   1.00 0.00 ? 57 GLY A C    6  
ATOM 8939  O O    . GLY A 1 57 ? 10.061  7.951   7.796   1.00 0.00 ? 57 GLY A O    6  
ATOM 8940  H H    . GLY A 1 57 ? 13.102  9.217   9.209   1.00 0.00 ? 57 GLY A H    6  
ATOM 8941  H HA2  . GLY A 1 57 ? 11.542  7.595   9.793   1.00 0.00 ? 57 GLY A HA2  6  
ATOM 8942  H HA3  . GLY A 1 57 ? 10.688  8.794   10.756  1.00 0.00 ? 57 GLY A HA3  6  
ATOM 8943  N N    . GLN A 1 58 ? 9.389   9.916   8.782   1.00 0.00 ? 58 GLN A N    6  
ATOM 8944  C CA   . GLN A 1 58 ? 8.477   10.408  7.726   1.00 0.00 ? 58 GLN A CA   6  
ATOM 8945  C C    . GLN A 1 58 ? 7.571   9.308   7.136   1.00 0.00 ? 58 GLN A C    6  
ATOM 8946  O O    . GLN A 1 58 ? 7.593   9.046   5.921   1.00 0.00 ? 58 GLN A O    6  
ATOM 8947  C CB   . GLN A 1 58 ? 9.297   11.147  6.619   1.00 0.00 ? 58 GLN A CB   6  
ATOM 8948  C CG   . GLN A 1 58 ? 9.774   12.559  7.003   1.00 0.00 ? 58 GLN A CG   6  
ATOM 8949  C CD   . GLN A 1 58 ? 8.612   13.531  7.239   1.00 0.00 ? 58 GLN A CD   6  
ATOM 8950  O OE1  . GLN A 1 58 ? 8.118   13.658  8.352   1.00 0.00 ? 58 GLN A OE1  6  
ATOM 8951  N NE2  . GLN A 1 58 ? 8.161   14.221  6.201   1.00 0.00 ? 58 GLN A NE2  6  
ATOM 8952  H H    . GLN A 1 58 ? 9.466   10.449  9.604   1.00 0.00 ? 58 GLN A H    6  
ATOM 8953  H HA   . GLN A 1 58 ? 7.826   11.130  8.202   1.00 0.00 ? 58 GLN A HA   6  
ATOM 8954  H HB2  . GLN A 1 58 ? 10.174  10.548  6.391   1.00 0.00 ? 58 GLN A HB2  6  
ATOM 8955  H HB3  . GLN A 1 58 ? 8.698   11.226  5.720   1.00 0.00 ? 58 GLN A HB3  6  
ATOM 8956  H HG2  . GLN A 1 58 ? 10.367  12.498  7.913   1.00 0.00 ? 58 GLN A HG2  6  
ATOM 8957  H HG3  . GLN A 1 58 ? 10.399  12.949  6.208   1.00 0.00 ? 58 GLN A HG3  6  
ATOM 8958  H HE21 . GLN A 1 58 ? 8.592   14.090  5.333   1.00 0.00 ? 58 GLN A HE21 6  
ATOM 8959  H HE22 . GLN A 1 58 ? 7.407   14.835  6.348   1.00 0.00 ? 58 GLN A HE22 6  
ATOM 8960  N N    . TYR A 1 59 ? 6.807   8.645   8.025   1.00 0.00 ? 59 TYR A N    6  
ATOM 8961  C CA   . TYR A 1 59 ? 5.793   7.667   7.618   1.00 0.00 ? 59 TYR A CA   6  
ATOM 8962  C C    . TYR A 1 59 ? 4.683   8.377   6.850   1.00 0.00 ? 59 TYR A C    6  
ATOM 8963  O O    . TYR A 1 59 ? 4.041   9.301   7.367   1.00 0.00 ? 59 TYR A O    6  
ATOM 8964  C CB   . TYR A 1 59 ? 5.227   6.905   8.834   1.00 0.00 ? 59 TYR A CB   6  
ATOM 8965  C CG   . TYR A 1 59 ? 6.260   5.967   9.478   1.00 0.00 ? 59 TYR A CG   6  
ATOM 8966  C CD1  . TYR A 1 59 ? 6.463   4.678   8.978   1.00 0.00 ? 59 TYR A CD1  6  
ATOM 8967  C CD2  . TYR A 1 59 ? 7.050   6.382   10.550  1.00 0.00 ? 59 TYR A CD2  6  
ATOM 8968  C CE1  . TYR A 1 59 ? 7.416   3.842   9.525   1.00 0.00 ? 59 TYR A CE1  6  
ATOM 8969  C CE2  . TYR A 1 59 ? 7.995   5.547   11.104  1.00 0.00 ? 59 TYR A CE2  6  
ATOM 8970  C CZ   . TYR A 1 59 ? 8.177   4.281   10.588  1.00 0.00 ? 59 TYR A CZ   6  
ATOM 8971  O OH   . TYR A 1 59 ? 9.133   3.460   11.134  1.00 0.00 ? 59 TYR A OH   6  
ATOM 8972  H H    . TYR A 1 59 ? 6.933   8.824   8.976   1.00 0.00 ? 59 TYR A H    6  
ATOM 8973  H HA   . TYR A 1 59 ? 6.280   6.950   6.953   1.00 0.00 ? 59 TYR A HA   6  
ATOM 8974  H HB2  . TYR A 1 59 ? 4.892   7.623   9.578   1.00 0.00 ? 59 TYR A HB2  6  
ATOM 8975  H HB3  . TYR A 1 59 ? 4.375   6.309   8.522   1.00 0.00 ? 59 TYR A HB3  6  
ATOM 8976  H HD1  . TYR A 1 59 ? 5.858   4.339   8.140   1.00 0.00 ? 59 TYR A HD1  6  
ATOM 8977  H HD2  . TYR A 1 59 ? 6.909   7.381   10.954  1.00 0.00 ? 59 TYR A HD2  6  
ATOM 8978  H HE1  . TYR A 1 59 ? 7.556   2.850   9.127   1.00 0.00 ? 59 TYR A HE1  6  
ATOM 8979  H HE2  . TYR A 1 59 ? 8.592   5.887   11.940  1.00 0.00 ? 59 TYR A HE2  6  
ATOM 8980  H HH   . TYR A 1 59 ? 9.645   3.052   10.432  1.00 0.00 ? 59 TYR A HH   6  
ATOM 8981  N N    . VAL A 1 60 ? 4.466   7.926   5.618   1.00 0.00 ? 60 VAL A N    6  
ATOM 8982  C CA   . VAL A 1 60 ? 3.563   8.586   4.677   1.00 0.00 ? 60 VAL A CA   6  
ATOM 8983  C C    . VAL A 1 60 ? 2.275   7.767   4.551   1.00 0.00 ? 60 VAL A C    6  
ATOM 8984  O O    . VAL A 1 60 ? 2.276   6.580   4.850   1.00 0.00 ? 60 VAL A O    6  
ATOM 8985  C CB   . VAL A 1 60 ? 4.257   8.776   3.272   1.00 0.00 ? 60 VAL A CB   6  
ATOM 8986  C CG1  . VAL A 1 60 ? 5.481   9.720   3.369   1.00 0.00 ? 60 VAL A CG1  6  
ATOM 8987  C CG2  . VAL A 1 60 ? 4.654   7.418   2.653   1.00 0.00 ? 60 VAL A CG2  6  
ATOM 8988  H H    . VAL A 1 60 ? 4.920   7.099   5.330   1.00 0.00 ? 60 VAL A H    6  
ATOM 8989  H HA   . VAL A 1 60 ? 3.310   9.570   5.068   1.00 0.00 ? 60 VAL A HA   6  
ATOM 8990  H HB   . VAL A 1 60 ? 3.534   9.248   2.608   1.00 0.00 ? 60 VAL A HB   6  
ATOM 8991  H HG11 . VAL A 1 60 ? 5.918   9.862   2.386   1.00 0.00 ? 60 VAL A HG11 6  
ATOM 8992  H HG12 . VAL A 1 60 ? 6.226   9.294   4.029   1.00 0.00 ? 60 VAL A HG12 6  
ATOM 8993  H HG13 . VAL A 1 60 ? 5.172   10.683  3.760   1.00 0.00 ? 60 VAL A HG13 6  
ATOM 8994  H HG21 . VAL A 1 60 ? 5.114   7.571   1.685   1.00 0.00 ? 60 VAL A HG21 6  
ATOM 8995  H HG22 . VAL A 1 60 ? 3.771   6.803   2.529   1.00 0.00 ? 60 VAL A HG22 6  
ATOM 8996  H HG23 . VAL A 1 60 ? 5.351   6.905   3.303   1.00 0.00 ? 60 VAL A HG23 6  
ATOM 8997  N N    . TRP A 1 61 ? 1.174   8.412   4.144   1.00 0.00 ? 61 TRP A N    6  
ATOM 8998  C CA   . TRP A 1 61 ? -0.160  7.776   4.106   1.00 0.00 ? 61 TRP A CA   6  
ATOM 8999  C C    . TRP A 1 61 ? -1.038  8.387   3.012   1.00 0.00 ? 61 TRP A C    6  
ATOM 9000  O O    . TRP A 1 61 ? -0.817  9.516   2.596   1.00 0.00 ? 61 TRP A O    6  
ATOM 9001  C CB   . TRP A 1 61 ? -0.858  7.882   5.495   1.00 0.00 ? 61 TRP A CB   6  
ATOM 9002  C CG   . TRP A 1 61 ? -1.020  9.293   6.036   1.00 0.00 ? 61 TRP A CG   6  
ATOM 9003  C CD1  . TRP A 1 61 ? -0.068  10.041  6.679   1.00 0.00 ? 61 TRP A CD1  6  
ATOM 9004  C CD2  . TRP A 1 61 ? -2.209  10.109  6.004   1.00 0.00 ? 61 TRP A CD2  6  
ATOM 9005  N NE1  . TRP A 1 61 ? -0.588  11.255  7.039   1.00 0.00 ? 61 TRP A NE1  6  
ATOM 9006  C CE2  . TRP A 1 61 ? -1.896  11.323  6.636   1.00 0.00 ? 61 TRP A CE2  6  
ATOM 9007  C CE3  . TRP A 1 61 ? -3.500  9.926   5.498   1.00 0.00 ? 61 TRP A CE3  6  
ATOM 9008  C CZ2  . TRP A 1 61 ? -2.826  12.348  6.780   1.00 0.00 ? 61 TRP A CZ2  6  
ATOM 9009  C CZ3  . TRP A 1 61 ? -4.425  10.943  5.641   1.00 0.00 ? 61 TRP A CZ3  6  
ATOM 9010  C CH2  . TRP A 1 61 ? -4.085  12.143  6.278   1.00 0.00 ? 61 TRP A CH2  6  
ATOM 9011  H H    . TRP A 1 61 ? 1.253   9.349   3.868   1.00 0.00 ? 61 TRP A H    6  
ATOM 9012  H HA   . TRP A 1 61 ? -0.023  6.722   3.870   1.00 0.00 ? 61 TRP A HA   6  
ATOM 9013  H HB2  . TRP A 1 61 ? -1.846  7.437   5.432   1.00 0.00 ? 61 TRP A HB2  6  
ATOM 9014  H HB3  . TRP A 1 61 ? -0.278  7.320   6.214   1.00 0.00 ? 61 TRP A HB3  6  
ATOM 9015  H HD1  . TRP A 1 61 ? 0.943   9.709   6.870   1.00 0.00 ? 61 TRP A HD1  6  
ATOM 9016  H HE1  . TRP A 1 61 ? -0.103  11.964  7.508   1.00 0.00 ? 61 TRP A HE1  6  
ATOM 9017  H HE3  . TRP A 1 61 ? -3.780  9.004   5.006   1.00 0.00 ? 61 TRP A HE3  6  
ATOM 9018  H HZ2  . TRP A 1 61 ? -2.577  13.280  7.268   1.00 0.00 ? 61 TRP A HZ2  6  
ATOM 9019  H HZ3  . TRP A 1 61 ? -5.427  10.818  5.262   1.00 0.00 ? 61 TRP A HZ3  6  
ATOM 9020  H HH2  . TRP A 1 61 ? -4.838  12.915  6.370   1.00 0.00 ? 61 TRP A HH2  6  
ATOM 9021  N N    . PHE A 1 62 ? -2.059  7.638   2.579   1.00 0.00 ? 62 PHE A N    6  
ATOM 9022  C CA   . PHE A 1 62 ? -2.972  8.057   1.504   1.00 0.00 ? 62 PHE A CA   6  
ATOM 9023  C C    . PHE A 1 62 ? -4.401  7.641   1.863   1.00 0.00 ? 62 PHE A C    6  
ATOM 9024  O O    . PHE A 1 62 ? -4.620  6.540   2.376   1.00 0.00 ? 62 PHE A O    6  
ATOM 9025  C CB   . PHE A 1 62 ? -2.531  7.463   0.129   1.00 0.00 ? 62 PHE A CB   6  
ATOM 9026  C CG   . PHE A 1 62 ? -2.409  5.933   0.098   1.00 0.00 ? 62 PHE A CG   6  
ATOM 9027  C CD1  . PHE A 1 62 ? -1.279  5.292   0.610   1.00 0.00 ? 62 PHE A CD1  6  
ATOM 9028  C CD2  . PHE A 1 62 ? -3.432  5.139   -0.419  1.00 0.00 ? 62 PHE A CD2  6  
ATOM 9029  C CE1  . PHE A 1 62 ? -1.177  3.918   0.598   1.00 0.00 ? 62 PHE A CE1  6  
ATOM 9030  C CE2  . PHE A 1 62 ? -3.327  3.763   -0.424  1.00 0.00 ? 62 PHE A CE2  6  
ATOM 9031  C CZ   . PHE A 1 62 ? -2.199  3.153   0.083   1.00 0.00 ? 62 PHE A CZ   6  
ATOM 9032  H H    . PHE A 1 62 ? -2.223  6.778   3.019   1.00 0.00 ? 62 PHE A H    6  
ATOM 9033  H HA   . PHE A 1 62 ? -2.942  9.145   1.442   1.00 0.00 ? 62 PHE A HA   6  
ATOM 9034  H HB2  . PHE A 1 62 ? -3.244  7.766   -0.631  1.00 0.00 ? 62 PHE A HB2  6  
ATOM 9035  H HB3  . PHE A 1 62 ? -1.563  7.881   -0.134  1.00 0.00 ? 62 PHE A HB3  6  
ATOM 9036  H HD1  . PHE A 1 62 ? -0.469  5.892   1.016   1.00 0.00 ? 62 PHE A HD1  6  
ATOM 9037  H HD2  . PHE A 1 62 ? -4.319  5.615   -0.825  1.00 0.00 ? 62 PHE A HD2  6  
ATOM 9038  H HE1  . PHE A 1 62 ? -0.292  3.441   0.996   1.00 0.00 ? 62 PHE A HE1  6  
ATOM 9039  H HE2  . PHE A 1 62 ? -4.132  3.165   -0.829  1.00 0.00 ? 62 PHE A HE2  6  
ATOM 9040  H HZ   . PHE A 1 62 ? -2.121  2.076   0.080   1.00 0.00 ? 62 PHE A HZ   6  
ATOM 9041  N N    . ASN A 1 63 ? -5.367  8.529   1.584   1.00 0.00 ? 63 ASN A N    6  
ATOM 9042  C CA   . ASN A 1 63 ? -6.786  8.324   1.934   1.00 0.00 ? 63 ASN A CA   6  
ATOM 9043  C C    . ASN A 1 63 ? -7.457  7.383   0.917   1.00 0.00 ? 63 ASN A C    6  
ATOM 9044  O O    . ASN A 1 63 ? -7.302  7.569   -0.295  1.00 0.00 ? 63 ASN A O    6  
ATOM 9045  C CB   . ASN A 1 63 ? -7.555  9.672   1.992   1.00 0.00 ? 63 ASN A CB   6  
ATOM 9046  C CG   . ASN A 1 63 ? -7.020  10.636  3.054   1.00 0.00 ? 63 ASN A CG   6  
ATOM 9047  O OD1  . ASN A 1 63 ? -7.414  10.584  4.218   1.00 0.00 ? 63 ASN A OD1  6  
ATOM 9048  N ND2  . ASN A 1 63 ? -6.135  11.531  2.661   1.00 0.00 ? 63 ASN A ND2  6  
ATOM 9049  H H    . ASN A 1 63 ? -5.118  9.341   1.097   1.00 0.00 ? 63 ASN A H    6  
ATOM 9050  H HA   . ASN A 1 63 ? -6.822  7.860   2.917   1.00 0.00 ? 63 ASN A HA   6  
ATOM 9051  H HB2  . ASN A 1 63 ? -7.498  10.163  1.026   1.00 0.00 ? 63 ASN A HB2  6  
ATOM 9052  H HB3  . ASN A 1 63 ? -8.603  9.476   2.215   1.00 0.00 ? 63 ASN A HB3  6  
ATOM 9053  H HD21 . ASN A 1 63 ? -5.880  11.543  1.715   1.00 0.00 ? 63 ASN A HD21 6  
ATOM 9054  H HD22 . ASN A 1 63 ? -5.771  12.149  3.328   1.00 0.00 ? 63 ASN A HD22 6  
ATOM 9055  N N    . ILE A 1 64 ? -8.184  6.366   1.425   1.00 0.00 ? 64 ILE A N    6  
ATOM 9056  C CA   . ILE A 1 64 ? -8.999  5.447   0.607   1.00 0.00 ? 64 ILE A CA   6  
ATOM 9057  C C    . ILE A 1 64 ? -10.499 5.721   0.871   1.00 0.00 ? 64 ILE A C    6  
ATOM 9058  O O    . ILE A 1 64 ? -10.890 6.058   2.001   1.00 0.00 ? 64 ILE A O    6  
ATOM 9059  C CB   . ILE A 1 64 ? -8.652  3.930   0.896   1.00 0.00 ? 64 ILE A CB   6  
ATOM 9060  C CG1  . ILE A 1 64 ? -8.950  3.549   2.388   1.00 0.00 ? 64 ILE A CG1  6  
ATOM 9061  C CG2  . ILE A 1 64 ? -7.171  3.636   0.523   1.00 0.00 ? 64 ILE A CG2  6  
ATOM 9062  C CD1  . ILE A 1 64 ? -8.816  2.072   2.708   1.00 0.00 ? 64 ILE A CD1  6  
ATOM 9063  H H    . ILE A 1 64 ? -8.181  6.232   2.392   1.00 0.00 ? 64 ILE A H    6  
ATOM 9064  H HA   . ILE A 1 64 ? -8.795  5.644   -0.448  1.00 0.00 ? 64 ILE A HA   6  
ATOM 9065  H HB   . ILE A 1 64 ? -9.279  3.316   0.246   1.00 0.00 ? 64 ILE A HB   6  
ATOM 9066  H HG12 . ILE A 1 64 ? -8.267  4.083   3.040   1.00 0.00 ? 64 ILE A HG12 6  
ATOM 9067  H HG13 . ILE A 1 64 ? -9.963  3.844   2.637   1.00 0.00 ? 64 ILE A HG13 6  
ATOM 9068  H HG21 . ILE A 1 64 ? -7.007  3.855   -0.525  1.00 0.00 ? 64 ILE A HG21 6  
ATOM 9069  H HG22 . ILE A 1 64 ? -6.941  2.590   0.701   1.00 0.00 ? 64 ILE A HG22 6  
ATOM 9070  H HG23 . ILE A 1 64 ? -6.510  4.250   1.124   1.00 0.00 ? 64 ILE A HG23 6  
ATOM 9071  H HD11 . ILE A 1 64 ? -9.492  1.501   2.089   1.00 0.00 ? 64 ILE A HD11 6  
ATOM 9072  H HD12 . ILE A 1 64 ? -9.059  1.909   3.749   1.00 0.00 ? 64 ILE A HD12 6  
ATOM 9073  H HD13 . ILE A 1 64 ? -7.800  1.753   2.526   1.00 0.00 ? 64 ILE A HD13 6  
ATOM 9074  N N    . GLY A 1 65 ? -11.317 5.616   -0.184  1.00 0.00 ? 65 GLY A N    6  
ATOM 9075  C CA   . GLY A 1 65 ? -12.762 5.851   -0.096  1.00 0.00 ? 65 GLY A CA   6  
ATOM 9076  C C    . GLY A 1 65 ? -13.496 4.604   0.373   1.00 0.00 ? 65 GLY A C    6  
ATOM 9077  O O    . GLY A 1 65 ? -14.384 4.677   1.231   1.00 0.00 ? 65 GLY A O    6  
ATOM 9078  H H    . GLY A 1 65 ? -10.932 5.369   -1.049  1.00 0.00 ? 65 GLY A H    6  
ATOM 9079  H HA2  . GLY A 1 65 ? -12.960 6.671   0.589   1.00 0.00 ? 65 GLY A HA2  6  
ATOM 9080  H HA3  . GLY A 1 65 ? -13.127 6.127   -1.077  1.00 0.00 ? 65 GLY A HA3  6  
ATOM 9081  N N    . SER A 1 66 ? -13.100 3.451   -0.185  1.00 0.00 ? 66 SER A N    6  
ATOM 9082  C CA   . SER A 1 66 ? -13.629 2.137   0.190   1.00 0.00 ? 66 SER A CA   6  
ATOM 9083  C C    . SER A 1 66 ? -12.463 1.172   0.431   1.00 0.00 ? 66 SER A C    6  
ATOM 9084  O O    . SER A 1 66 ? -11.455 1.210   -0.298  1.00 0.00 ? 66 SER A O    6  
ATOM 9085  C CB   . SER A 1 66 ? -14.548 1.598   -0.932  1.00 0.00 ? 66 SER A CB   6  
ATOM 9086  O OG   . SER A 1 66 ? -14.991 0.273   -0.671  1.00 0.00 ? 66 SER A OG   6  
ATOM 9087  H H    . SER A 1 66 ? -12.403 3.481   -0.880  1.00 0.00 ? 66 SER A H    6  
ATOM 9088  H HA   . SER A 1 66 ? -14.209 2.236   1.107   1.00 0.00 ? 66 SER A HA   6  
ATOM 9089  H HB2  . SER A 1 66 ? -15.418 2.236   -1.022  1.00 0.00 ? 66 SER A HB2  6  
ATOM 9090  H HB3  . SER A 1 66 ? -14.012 1.603   -1.873  1.00 0.00 ? 66 SER A HB3  6  
ATOM 9091  H HG   . SER A 1 66 ? -15.561 0.274   0.105   1.00 0.00 ? 66 SER A HG   6  
ATOM 9092  N N    . VAL A 1 67 ? -12.602 0.326   1.470   1.00 0.00 ? 67 VAL A N    6  
ATOM 9093  C CA   . VAL A 1 67 ? -11.654 -0.773  1.740   1.00 0.00 ? 67 VAL A CA   6  
ATOM 9094  C C    . VAL A 1 67 ? -11.610 -1.744  0.545   1.00 0.00 ? 67 VAL A C    6  
ATOM 9095  O O    . VAL A 1 67 ? -10.527 -2.152  0.132   1.00 0.00 ? 67 VAL A O    6  
ATOM 9096  C CB   . VAL A 1 67 ? -12.002 -1.550  3.068   1.00 0.00 ? 67 VAL A CB   6  
ATOM 9097  C CG1  . VAL A 1 67 ? -10.975 -2.677  3.355   1.00 0.00 ? 67 VAL A CG1  6  
ATOM 9098  C CG2  . VAL A 1 67 ? -12.105 -0.574  4.269   1.00 0.00 ? 67 VAL A CG2  6  
ATOM 9099  H H    . VAL A 1 67 ? -13.344 0.485   2.092   1.00 0.00 ? 67 VAL A H    6  
ATOM 9100  H HA   . VAL A 1 67 ? -10.665 -0.326  1.861   1.00 0.00 ? 67 VAL A HA   6  
ATOM 9101  H HB   . VAL A 1 67 ? -12.979 -2.017  2.937   1.00 0.00 ? 67 VAL A HB   6  
ATOM 9102  H HG11 . VAL A 1 67 ? -10.959 -3.374  2.526   1.00 0.00 ? 67 VAL A HG11 6  
ATOM 9103  H HG12 . VAL A 1 67 ? -11.251 -3.212  4.254   1.00 0.00 ? 67 VAL A HG12 6  
ATOM 9104  H HG13 . VAL A 1 67 ? -9.984  -2.255  3.483   1.00 0.00 ? 67 VAL A HG13 6  
ATOM 9105  H HG21 . VAL A 1 67 ? -11.148 -0.094  4.441   1.00 0.00 ? 67 VAL A HG21 6  
ATOM 9106  H HG22 . VAL A 1 67 ? -12.395 -1.117  5.161   1.00 0.00 ? 67 VAL A HG22 6  
ATOM 9107  H HG23 . VAL A 1 67 ? -12.850 0.183   4.061   1.00 0.00 ? 67 VAL A HG23 6  
ATOM 9108  N N    . ASP A 1 68 ? -12.796 -2.054  -0.033  1.00 0.00 ? 68 ASP A N    6  
ATOM 9109  C CA   . ASP A 1 68 ? -12.922 -2.966  -1.198  1.00 0.00 ? 68 ASP A CA   6  
ATOM 9110  C C    . ASP A 1 68 ? -12.087 -2.481  -2.388  1.00 0.00 ? 68 ASP A C    6  
ATOM 9111  O O    . ASP A 1 68 ? -11.413 -3.280  -3.047  1.00 0.00 ? 68 ASP A O    6  
ATOM 9112  C CB   . ASP A 1 68 ? -14.410 -3.111  -1.634  1.00 0.00 ? 68 ASP A CB   6  
ATOM 9113  C CG   . ASP A 1 68 ? -15.290 -3.853  -0.615  1.00 0.00 ? 68 ASP A CG   6  
ATOM 9114  O OD1  . ASP A 1 68 ? -15.638 -3.263  0.426   1.00 0.00 ? 68 ASP A OD1  6  
ATOM 9115  O OD2  . ASP A 1 68 ? -15.657 -5.026  -0.857  1.00 0.00 ? 68 ASP A OD2  6  
ATOM 9116  H H    . ASP A 1 68 ? -13.623 -1.655  0.316   1.00 0.00 ? 68 ASP A H    6  
ATOM 9117  H HA   . ASP A 1 68 ? -12.546 -3.936  -0.891  1.00 0.00 ? 68 ASP A HA   6  
ATOM 9118  H HB2  . ASP A 1 68 ? -14.831 -2.121  -1.785  1.00 0.00 ? 68 ASP A HB2  6  
ATOM 9119  H HB3  . ASP A 1 68 ? -14.451 -3.643  -2.579  1.00 0.00 ? 68 ASP A HB3  6  
ATOM 9120  N N    . THR A 1 69 ? -12.120 -1.163  -2.637  1.00 0.00 ? 69 THR A N    6  
ATOM 9121  C CA   . THR A 1 69 ? -11.378 -0.561  -3.750  1.00 0.00 ? 69 THR A CA   6  
ATOM 9122  C C    . THR A 1 69 ? -9.864  -0.695  -3.513  1.00 0.00 ? 69 THR A C    6  
ATOM 9123  O O    . THR A 1 69 ? -9.144  -1.116  -4.409  1.00 0.00 ? 69 THR A O    6  
ATOM 9124  C CB   . THR A 1 69 ? -11.772 0.936   -3.959  1.00 0.00 ? 69 THR A CB   6  
ATOM 9125  O OG1  . THR A 1 69 ? -13.198 1.084   -3.902  1.00 0.00 ? 69 THR A OG1  6  
ATOM 9126  C CG2  . THR A 1 69 ? -11.273 1.477   -5.311  1.00 0.00 ? 69 THR A CG2  6  
ATOM 9127  H H    . THR A 1 69 ? -12.650 -0.582  -2.051  1.00 0.00 ? 69 THR A H    6  
ATOM 9128  H HA   . THR A 1 69 ? -11.642 -1.111  -4.655  1.00 0.00 ? 69 THR A HA   6  
ATOM 9129  H HB   . THR A 1 69 ? -11.343 1.537   -3.163  1.00 0.00 ? 69 THR A HB   6  
ATOM 9130  H HG1  . THR A 1 69 ? -13.620 0.215   -3.877  1.00 0.00 ? 69 THR A HG1  6  
ATOM 9131  H HG21 . THR A 1 69 ? -10.193 1.393   -5.364  1.00 0.00 ? 69 THR A HG21 6  
ATOM 9132  H HG22 . THR A 1 69 ? -11.551 2.518   -5.410  1.00 0.00 ? 69 THR A HG22 6  
ATOM 9133  H HG23 . THR A 1 69 ? -11.719 0.912   -6.117  1.00 0.00 ? 69 THR A HG23 6  
ATOM 9134  N N    . PHE A 1 70 ? -9.406  -0.383  -2.275  1.00 0.00 ? 70 PHE A N    6  
ATOM 9135  C CA   . PHE A 1 70 ? -7.985  -0.521  -1.887  1.00 0.00 ? 70 PHE A CA   6  
ATOM 9136  C C    . PHE A 1 70 ? -7.477  -1.955  -2.127  1.00 0.00 ? 70 PHE A C    6  
ATOM 9137  O O    . PHE A 1 70 ? -6.420  -2.140  -2.726  1.00 0.00 ? 70 PHE A O    6  
ATOM 9138  C CB   . PHE A 1 70 ? -7.749  -0.116  -0.398  1.00 0.00 ? 70 PHE A CB   6  
ATOM 9139  C CG   . PHE A 1 70 ? -6.316  -0.405  0.093   1.00 0.00 ? 70 PHE A CG   6  
ATOM 9140  C CD1  . PHE A 1 70 ? -5.229  0.285   -0.442  1.00 0.00 ? 70 PHE A CD1  6  
ATOM 9141  C CD2  . PHE A 1 70 ? -6.059  -1.395  1.039   1.00 0.00 ? 70 PHE A CD2  6  
ATOM 9142  C CE1  . PHE A 1 70 ? -3.938  -0.001  -0.044  1.00 0.00 ? 70 PHE A CE1  6  
ATOM 9143  C CE2  . PHE A 1 70 ? -4.765  -1.686  1.430   1.00 0.00 ? 70 PHE A CE2  6  
ATOM 9144  C CZ   . PHE A 1 70 ? -3.705  -0.987  0.890   1.00 0.00 ? 70 PHE A CZ   6  
ATOM 9145  H H    . PHE A 1 70 ? -10.040 -0.045  -1.611  1.00 0.00 ? 70 PHE A H    6  
ATOM 9146  H HA   . PHE A 1 70 ? -7.416  0.153   -2.521  1.00 0.00 ? 70 PHE A HA   6  
ATOM 9147  H HB2  . PHE A 1 70 ? -7.939  0.947   -0.284  1.00 0.00 ? 70 PHE A HB2  6  
ATOM 9148  H HB3  . PHE A 1 70 ? -8.449  -0.659  0.234   1.00 0.00 ? 70 PHE A HB3  6  
ATOM 9149  H HD1  . PHE A 1 70 ? -5.407  1.065   -1.177  1.00 0.00 ? 70 PHE A HD1  6  
ATOM 9150  H HD2  . PHE A 1 70 ? -6.889  -1.944  1.469   1.00 0.00 ? 70 PHE A HD2  6  
ATOM 9151  H HE1  . PHE A 1 70 ? -3.113  0.547   -0.469  1.00 0.00 ? 70 PHE A HE1  6  
ATOM 9152  H HE2  . PHE A 1 70 ? -4.585  -2.463  2.163   1.00 0.00 ? 70 PHE A HE2  6  
ATOM 9153  H HZ   . PHE A 1 70 ? -2.694  -1.214  1.196   1.00 0.00 ? 70 PHE A HZ   6  
ATOM 9154  N N    . GLU A 1 71 ? -8.251  -2.946  -1.659  1.00 0.00 ? 71 GLU A N    6  
ATOM 9155  C CA   . GLU A 1 71 ? -7.871  -4.371  -1.722  1.00 0.00 ? 71 GLU A CA   6  
ATOM 9156  C C    . GLU A 1 71 ? -7.717  -4.844  -3.177  1.00 0.00 ? 71 GLU A C    6  
ATOM 9157  O O    . GLU A 1 71 ? -6.674  -5.376  -3.549  1.00 0.00 ? 71 GLU A O    6  
ATOM 9158  C CB   . GLU A 1 71 ? -8.926  -5.251  -0.999  1.00 0.00 ? 71 GLU A CB   6  
ATOM 9159  C CG   . GLU A 1 71 ? -9.121  -4.938  0.494   1.00 0.00 ? 71 GLU A CG   6  
ATOM 9160  C CD   . GLU A 1 71 ? -7.894  -5.238  1.362   1.00 0.00 ? 71 GLU A CD   6  
ATOM 9161  O OE1  . GLU A 1 71 ? -7.598  -6.426  1.569   1.00 0.00 ? 71 GLU A OE1  6  
ATOM 9162  O OE2  . GLU A 1 71 ? -7.235  -4.303  1.869   1.00 0.00 ? 71 GLU A OE2  6  
ATOM 9163  H H    . GLU A 1 71 ? -9.111  -2.711  -1.260  1.00 0.00 ? 71 GLU A H    6  
ATOM 9164  H HA   . GLU A 1 71 ? -6.914  -4.479  -1.215  1.00 0.00 ? 71 GLU A HA   6  
ATOM 9165  H HB2  . GLU A 1 71 ? -9.884  -5.116  -1.489  1.00 0.00 ? 71 GLU A HB2  6  
ATOM 9166  H HB3  . GLU A 1 71 ? -8.634  -6.294  -1.095  1.00 0.00 ? 71 GLU A HB3  6  
ATOM 9167  H HG2  . GLU A 1 71 ? -9.367  -3.890  0.589   1.00 0.00 ? 71 GLU A HG2  6  
ATOM 9168  H HG3  . GLU A 1 71 ? -9.961  -5.526  0.861   1.00 0.00 ? 71 GLU A HG3  6  
ATOM 9169  N N    . ARG A 1 72 ? -8.762  -4.606  -3.991  1.00 0.00 ? 72 ARG A N    6  
ATOM 9170  C CA   . ARG A 1 72 ? -8.834  -5.076  -5.390  1.00 0.00 ? 72 ARG A CA   6  
ATOM 9171  C C    . ARG A 1 72 ? -7.796  -4.368  -6.273  1.00 0.00 ? 72 ARG A C    6  
ATOM 9172  O O    . ARG A 1 72 ? -7.205  -4.989  -7.161  1.00 0.00 ? 72 ARG A O    6  
ATOM 9173  C CB   . ARG A 1 72 ? -10.257 -4.848  -5.950  1.00 0.00 ? 72 ARG A CB   6  
ATOM 9174  C CG   . ARG A 1 72 ? -11.367 -5.622  -5.206  1.00 0.00 ? 72 ARG A CG   6  
ATOM 9175  C CD   . ARG A 1 72 ? -12.777 -5.305  -5.735  1.00 0.00 ? 72 ARG A CD   6  
ATOM 9176  N NE   . ARG A 1 72 ? -13.823 -6.038  -4.994  1.00 0.00 ? 72 ARG A NE   6  
ATOM 9177  C CZ   . ARG A 1 72 ? -15.020 -5.544  -4.626  1.00 0.00 ? 72 ARG A CZ   6  
ATOM 9178  N NH1  . ARG A 1 72 ? -15.363 -4.292  -4.927  1.00 0.00 ? 72 ARG A NH1  6  
ATOM 9179  N NH2  . ARG A 1 72 ? -15.864 -6.313  -3.952  1.00 0.00 ? 72 ARG A NH2  6  
ATOM 9180  H H    . ARG A 1 72 ? -9.512  -4.081  -3.644  1.00 0.00 ? 72 ARG A H    6  
ATOM 9181  H HA   . ARG A 1 72 ? -8.621  -6.143  -5.392  1.00 0.00 ? 72 ARG A HA   6  
ATOM 9182  H HB2  . ARG A 1 72 ? -10.482 -3.789  -5.897  1.00 0.00 ? 72 ARG A HB2  6  
ATOM 9183  H HB3  . ARG A 1 72 ? -10.273 -5.154  -6.993  1.00 0.00 ? 72 ARG A HB3  6  
ATOM 9184  H HG2  . ARG A 1 72 ? -11.187 -6.686  -5.315  1.00 0.00 ? 72 ARG A HG2  6  
ATOM 9185  H HG3  . ARG A 1 72 ? -11.326 -5.367  -4.148  1.00 0.00 ? 72 ARG A HG3  6  
ATOM 9186  H HD2  . ARG A 1 72 ? -12.955 -4.236  -5.659  1.00 0.00 ? 72 ARG A HD2  6  
ATOM 9187  H HD3  . ARG A 1 72 ? -12.829 -5.596  -6.780  1.00 0.00 ? 72 ARG A HD3  6  
ATOM 9188  H HE   . ARG A 1 72 ? -13.613 -6.967  -4.753  1.00 0.00 ? 72 ARG A HE   6  
ATOM 9189  H HH11 . ARG A 1 72 ? -14.725 -3.705  -5.435  1.00 0.00 ? 72 ARG A HH11 6  
ATOM 9190  H HH12 . ARG A 1 72 ? -16.256 -3.937  -4.658  1.00 0.00 ? 72 ARG A HH12 6  
ATOM 9191  H HH21 . ARG A 1 72 ? -15.610 -7.258  -3.722  1.00 0.00 ? 72 ARG A HH21 6  
ATOM 9192  H HH22 . ARG A 1 72 ? -16.761 -5.958  -3.682  1.00 0.00 ? 72 ARG A HH22 6  
ATOM 9193  N N    . ASN A 1 73 ? -7.586  -3.066  -6.027  1.00 0.00 ? 73 ASN A N    6  
ATOM 9194  C CA   . ASN A 1 73 ? -6.548  -2.284  -6.719  1.00 0.00 ? 73 ASN A CA   6  
ATOM 9195  C C    . ASN A 1 73 ? -5.159  -2.773  -6.316  1.00 0.00 ? 73 ASN A C    6  
ATOM 9196  O O    . ASN A 1 73 ? -4.260  -2.770  -7.135  1.00 0.00 ? 73 ASN A O    6  
ATOM 9197  C CB   . ASN A 1 73 ? -6.698  -0.766  -6.420  1.00 0.00 ? 73 ASN A CB   6  
ATOM 9198  C CG   . ASN A 1 73 ? -7.944  -0.136  -7.059  1.00 0.00 ? 73 ASN A CG   6  
ATOM 9199  O OD1  . ASN A 1 73 ? -8.939  -0.807  -7.323  1.00 0.00 ? 73 ASN A OD1  6  
ATOM 9200  N ND2  . ASN A 1 73 ? -7.909  1.161   -7.285  1.00 0.00 ? 73 ASN A ND2  6  
ATOM 9201  H H    . ASN A 1 73 ? -8.142  -2.603  -5.375  1.00 0.00 ? 73 ASN A H    6  
ATOM 9202  H HA   . ASN A 1 73 ? -6.671  -2.443  -7.789  1.00 0.00 ? 73 ASN A HA   6  
ATOM 9203  H HB2  . ASN A 1 73 ? -6.760  -0.619  -5.349  1.00 0.00 ? 73 ASN A HB2  6  
ATOM 9204  H HB3  . ASN A 1 73 ? -5.821  -0.243  -6.792  1.00 0.00 ? 73 ASN A HB3  6  
ATOM 9205  H HD21 . ASN A 1 73 ? -7.097  1.648   -7.038  1.00 0.00 ? 73 ASN A HD21 6  
ATOM 9206  H HD22 . ASN A 1 73 ? -8.692  1.585   -7.696  1.00 0.00 ? 73 ASN A HD22 6  
ATOM 9207  N N    . LEU A 1 74 ? -4.998  -3.173  -5.048  1.00 0.00 ? 74 LEU A N    6  
ATOM 9208  C CA   . LEU A 1 74 ? -3.738  -3.749  -4.539  1.00 0.00 ? 74 LEU A CA   6  
ATOM 9209  C C    . LEU A 1 74 ? -3.468  -5.149  -5.145  1.00 0.00 ? 74 LEU A C    6  
ATOM 9210  O O    . LEU A 1 74 ? -2.311  -5.516  -5.346  1.00 0.00 ? 74 LEU A O    6  
ATOM 9211  C CB   . LEU A 1 74 ? -3.759  -3.806  -2.983  1.00 0.00 ? 74 LEU A CB   6  
ATOM 9212  C CG   . LEU A 1 74 ? -2.372  -3.939  -2.285  1.00 0.00 ? 74 LEU A CG   6  
ATOM 9213  C CD1  . LEU A 1 74 ? -1.481  -2.704  -2.562  1.00 0.00 ? 74 LEU A CD1  6  
ATOM 9214  C CD2  . LEU A 1 74 ? -2.531  -4.193  -0.769  1.00 0.00 ? 74 LEU A CD2  6  
ATOM 9215  H H    . LEU A 1 74 ? -5.720  -2.998  -4.416  1.00 0.00 ? 74 LEU A H    6  
ATOM 9216  H HA   . LEU A 1 74 ? -2.932  -3.085  -4.846  1.00 0.00 ? 74 LEU A HA   6  
ATOM 9217  H HB2  . LEU A 1 74 ? -4.235  -2.898  -2.614  1.00 0.00 ? 74 LEU A HB2  6  
ATOM 9218  H HB3  . LEU A 1 74 ? -4.377  -4.647  -2.677  1.00 0.00 ? 74 LEU A HB3  6  
ATOM 9219  H HG   . LEU A 1 74 ? -1.859  -4.798  -2.706  1.00 0.00 ? 74 LEU A HG   6  
ATOM 9220  H HD11 . LEU A 1 74 ? -1.319  -2.603  -3.627  1.00 0.00 ? 74 LEU A HD11 6  
ATOM 9221  H HD12 . LEU A 1 74 ? -0.524  -2.826  -2.074  1.00 0.00 ? 74 LEU A HD12 6  
ATOM 9222  H HD13 . LEU A 1 74 ? -1.964  -1.808  -2.186  1.00 0.00 ? 74 LEU A HD13 6  
ATOM 9223  H HD21 . LEU A 1 74 ? -3.054  -3.364  -0.302  1.00 0.00 ? 74 LEU A HD21 6  
ATOM 9224  H HD22 . LEU A 1 74 ? -1.558  -4.304  -0.311  1.00 0.00 ? 74 LEU A HD22 6  
ATOM 9225  H HD23 . LEU A 1 74 ? -3.096  -5.101  -0.611  1.00 0.00 ? 74 LEU A HD23 6  
ATOM 9226  N N    . GLU A 1 75 ? -4.541  -5.914  -5.435  1.00 0.00 ? 75 GLU A N    6  
ATOM 9227  C CA   . GLU A 1 75 ? -4.431  -7.215  -6.144  1.00 0.00 ? 75 GLU A CA   6  
ATOM 9228  C C    . GLU A 1 75 ? -3.847  -7.005  -7.548  1.00 0.00 ? 75 GLU A C    6  
ATOM 9229  O O    . GLU A 1 75 ? -2.860  -7.650  -7.936  1.00 0.00 ? 75 GLU A O    6  
ATOM 9230  C CB   . GLU A 1 75 ? -5.817  -7.899  -6.286  1.00 0.00 ? 75 GLU A CB   6  
ATOM 9231  C CG   . GLU A 1 75 ? -6.528  -8.245  -4.968  1.00 0.00 ? 75 GLU A CG   6  
ATOM 9232  C CD   . GLU A 1 75 ? -5.734  -9.209  -4.084  1.00 0.00 ? 75 GLU A CD   6  
ATOM 9233  O OE1  . GLU A 1 75 ? -5.585  -10.395 -4.460  1.00 0.00 ? 75 GLU A OE1  6  
ATOM 9234  O OE2  . GLU A 1 75 ? -5.262  -8.807  -3.007  1.00 0.00 ? 75 GLU A OE2  6  
ATOM 9235  H H    . GLU A 1 75 ? -5.428  -5.606  -5.154  1.00 0.00 ? 75 GLU A H    6  
ATOM 9236  H HA   . GLU A 1 75 ? -3.771  -7.857  -5.570  1.00 0.00 ? 75 GLU A HA   6  
ATOM 9237  H HB2  . GLU A 1 75 ? -6.470  -7.236  -6.849  1.00 0.00 ? 75 GLU A HB2  6  
ATOM 9238  H HB3  . GLU A 1 75 ? -5.695  -8.818  -6.855  1.00 0.00 ? 75 GLU A HB3  6  
ATOM 9239  H HG2  . GLU A 1 75 ? -6.714  -7.328  -4.419  1.00 0.00 ? 75 GLU A HG2  6  
ATOM 9240  H HG3  . GLU A 1 75 ? -7.481  -8.700  -5.204  1.00 0.00 ? 75 GLU A HG3  6  
ATOM 9241  N N    . THR A 1 76 ? -4.481  -6.065  -8.276  1.00 0.00 ? 76 THR A N    6  
ATOM 9242  C CA   . THR A 1 76 ? -4.120  -5.706  -9.649  1.00 0.00 ? 76 THR A CA   6  
ATOM 9243  C C    . THR A 1 76 ? -2.695  -5.128  -9.695  1.00 0.00 ? 76 THR A C    6  
ATOM 9244  O O    . THR A 1 76 ? -1.879  -5.520  -10.517 1.00 0.00 ? 76 THR A O    6  
ATOM 9245  C CB   . THR A 1 76 ? -5.138  -4.646  -10.198 1.00 0.00 ? 76 THR A CB   6  
ATOM 9246  O OG1  . THR A 1 76 ? -6.490  -5.108  -10.003 1.00 0.00 ? 76 THR A OG1  6  
ATOM 9247  C CG2  . THR A 1 76 ? -4.924  -4.328  -11.685 1.00 0.00 ? 76 THR A CG2  6  
ATOM 9248  H H    . THR A 1 76 ? -5.220  -5.570  -7.854  1.00 0.00 ? 76 THR A H    6  
ATOM 9249  H HA   . THR A 1 76 ? -4.178  -6.600  -10.265 1.00 0.00 ? 76 THR A HA   6  
ATOM 9250  H HB   . THR A 1 76 ? -5.020  -3.724  -9.629  1.00 0.00 ? 76 THR A HB   6  
ATOM 9251  H HG1  . THR A 1 76 ? -6.500  -6.072  -9.902  1.00 0.00 ? 76 THR A HG1  6  
ATOM 9252  H HG21 . THR A 1 76 ? -5.647  -3.583  -12.008 1.00 0.00 ? 76 THR A HG21 6  
ATOM 9253  H HG22 . THR A 1 76 ? -5.047  -5.229  -12.273 1.00 0.00 ? 76 THR A HG22 6  
ATOM 9254  H HG23 . THR A 1 76 ? -3.930  -3.937  -11.836 1.00 0.00 ? 76 THR A HG23 6  
ATOM 9255  N N    . LEU A 1 77 ? -2.436  -4.193  -8.786  1.00 0.00 ? 77 LEU A N    6  
ATOM 9256  C CA   . LEU A 1 77 ? -1.163  -3.481  -8.672  1.00 0.00 ? 77 LEU A CA   6  
ATOM 9257  C C    . LEU A 1 77 ? 0.018   -4.436  -8.457  1.00 0.00 ? 77 LEU A C    6  
ATOM 9258  O O    . LEU A 1 77 ? 0.946   -4.459  -9.264  1.00 0.00 ? 77 LEU A O    6  
ATOM 9259  C CB   . LEU A 1 77 ? -1.235  -2.465  -7.509  1.00 0.00 ? 77 LEU A CB   6  
ATOM 9260  C CG   . LEU A 1 77 ? 0.007   -1.563  -7.343  1.00 0.00 ? 77 LEU A CG   6  
ATOM 9261  C CD1  . LEU A 1 77 ? 0.226   -0.686  -8.596  1.00 0.00 ? 77 LEU A CD1  6  
ATOM 9262  C CD2  . LEU A 1 77 ? -0.107  -0.718  -6.064  1.00 0.00 ? 77 LEU A CD2  6  
ATOM 9263  H H    . LEU A 1 77 ? -3.155  -3.938  -8.193  1.00 0.00 ? 77 LEU A H    6  
ATOM 9264  H HA   . LEU A 1 77 ? -1.012  -2.937  -9.596  1.00 0.00 ? 77 LEU A HA   6  
ATOM 9265  H HB2  . LEU A 1 77 ? -2.103  -1.831  -7.665  1.00 0.00 ? 77 LEU A HB2  6  
ATOM 9266  H HB3  . LEU A 1 77 ? -1.385  -3.016  -6.580  1.00 0.00 ? 77 LEU A HB3  6  
ATOM 9267  H HG   . LEU A 1 77 ? 0.881   -2.196  -7.237  1.00 0.00 ? 77 LEU A HG   6  
ATOM 9268  H HD11 . LEU A 1 77 ? 0.363   -1.317  -9.468  1.00 0.00 ? 77 LEU A HD11 6  
ATOM 9269  H HD12 . LEU A 1 77 ? 1.110   -0.083  -8.464  1.00 0.00 ? 77 LEU A HD12 6  
ATOM 9270  H HD13 . LEU A 1 77 ? -0.629  -0.037  -8.755  1.00 0.00 ? 77 LEU A HD13 6  
ATOM 9271  H HD21 . LEU A 1 77 ? -0.267  -1.366  -5.212  1.00 0.00 ? 77 LEU A HD21 6  
ATOM 9272  H HD22 . LEU A 1 77 ? -0.934  -0.028  -6.150  1.00 0.00 ? 77 LEU A HD22 6  
ATOM 9273  H HD23 . LEU A 1 77 ? 0.808   -0.163  -5.917  1.00 0.00 ? 77 LEU A HD23 6  
ATOM 9274  N N    . GLN A 1 78 ? -0.054  -5.236  -7.381  1.00 0.00 ? 78 GLN A N    6  
ATOM 9275  C CA   . GLN A 1 78 ? 1.042   -6.125  -6.978  1.00 0.00 ? 78 GLN A CA   6  
ATOM 9276  C C    . GLN A 1 78 ? 1.344   -7.178  -8.063  1.00 0.00 ? 78 GLN A C    6  
ATOM 9277  O O    . GLN A 1 78 ? 2.508   -7.436  -8.347  1.00 0.00 ? 78 GLN A O    6  
ATOM 9278  C CB   . GLN A 1 78 ? 0.742   -6.802  -5.612  1.00 0.00 ? 78 GLN A CB   6  
ATOM 9279  C CG   . GLN A 1 78 ? 0.741   -5.849  -4.400  1.00 0.00 ? 78 GLN A CG   6  
ATOM 9280  C CD   . GLN A 1 78 ? 0.566   -6.581  -3.065  1.00 0.00 ? 78 GLN A CD   6  
ATOM 9281  O OE1  . GLN A 1 78 ? 1.535   -6.945  -2.394  1.00 0.00 ? 78 GLN A OE1  6  
ATOM 9282  N NE2  . GLN A 1 78 ? -0.671  -6.843  -2.699  1.00 0.00 ? 78 GLN A NE2  6  
ATOM 9283  H H    . GLN A 1 78 ? -0.877  -5.235  -6.852  1.00 0.00 ? 78 GLN A H    6  
ATOM 9284  H HA   . GLN A 1 78 ? 1.929   -5.503  -6.856  1.00 0.00 ? 78 GLN A HA   6  
ATOM 9285  H HB2  . GLN A 1 78 ? -0.234  -7.276  -5.668  1.00 0.00 ? 78 GLN A HB2  6  
ATOM 9286  H HB3  . GLN A 1 78 ? 1.484   -7.573  -5.432  1.00 0.00 ? 78 GLN A HB3  6  
ATOM 9287  H HG2  . GLN A 1 78 ? 1.684   -5.307  -4.372  1.00 0.00 ? 78 GLN A HG2  6  
ATOM 9288  H HG3  . GLN A 1 78 ? -0.067  -5.134  -4.511  1.00 0.00 ? 78 GLN A HG3  6  
ATOM 9289  H HE21 . GLN A 1 78 ? -1.401  -6.555  -3.290  1.00 0.00 ? 78 GLN A HE21 6  
ATOM 9290  H HE22 . GLN A 1 78 ? -0.817  -7.313  -1.852  1.00 0.00 ? 78 GLN A HE22 6  
ATOM 9291  N N    . GLN A 1 79 ? 0.291   -7.736  -8.709  1.00 0.00 ? 79 GLN A N    6  
ATOM 9292  C CA   . GLN A 1 79 ? 0.477   -8.769  -9.761  1.00 0.00 ? 79 GLN A CA   6  
ATOM 9293  C C    . GLN A 1 79 ? 1.181   -8.156  -10.995 1.00 0.00 ? 79 GLN A C    6  
ATOM 9294  O O    . GLN A 1 79 ? 1.999   -8.824  -11.636 1.00 0.00 ? 79 GLN A O    6  
ATOM 9295  C CB   . GLN A 1 79 ? -0.864  -9.453  -10.165 1.00 0.00 ? 79 GLN A CB   6  
ATOM 9296  C CG   . GLN A 1 79 ? -1.819  -8.568  -10.980 1.00 0.00 ? 79 GLN A CG   6  
ATOM 9297  C CD   . GLN A 1 79 ? -3.108  -9.263  -11.416 1.00 0.00 ? 79 GLN A CD   6  
ATOM 9298  O OE1  . GLN A 1 79 ? -3.616  -10.147 -10.737 1.00 0.00 ? 79 GLN A OE1  6  
ATOM 9299  N NE2  . GLN A 1 79 ? -3.643  -8.869  -12.563 1.00 0.00 ? 79 GLN A NE2  6  
ATOM 9300  H H    . GLN A 1 79 ? -0.608  -7.426  -8.473  1.00 0.00 ? 79 GLN A H    6  
ATOM 9301  H HA   . GLN A 1 79 ? 1.137   -9.529  -9.346  1.00 0.00 ? 79 GLN A HA   6  
ATOM 9302  H HB2  . GLN A 1 79 ? -0.640  -10.338 -10.757 1.00 0.00 ? 79 GLN A HB2  6  
ATOM 9303  H HB3  . GLN A 1 79 ? -1.375  -9.766  -9.262  1.00 0.00 ? 79 GLN A HB3  6  
ATOM 9304  H HG2  . GLN A 1 79 ? -2.090  -7.716  -10.379 1.00 0.00 ? 79 GLN A HG2  6  
ATOM 9305  H HG3  . GLN A 1 79 ? -1.296  -8.225  -11.865 1.00 0.00 ? 79 GLN A HG3  6  
ATOM 9306  H HE21 . GLN A 1 79 ? -3.183  -8.169  -13.066 1.00 0.00 ? 79 GLN A HE21 6  
ATOM 9307  H HE22 . GLN A 1 79 ? -4.475  -9.296  -12.859 1.00 0.00 ? 79 GLN A HE22 6  
ATOM 9308  N N    . GLU A 1 80 ? 0.897   -6.863  -11.289 1.00 0.00 ? 80 GLU A N    6  
ATOM 9309  C CA   . GLU A 1 80 ? 1.556   -6.128  -12.393 1.00 0.00 ? 80 GLU A CA   6  
ATOM 9310  C C    . GLU A 1 80 ? 3.027   -5.851  -12.054 1.00 0.00 ? 80 GLU A C    6  
ATOM 9311  O O    . GLU A 1 80 ? 3.901   -5.963  -12.921 1.00 0.00 ? 80 GLU A O    6  
ATOM 9312  C CB   . GLU A 1 80 ? 0.820   -4.794  -12.701 1.00 0.00 ? 80 GLU A CB   6  
ATOM 9313  C CG   . GLU A 1 80 ? -0.605  -4.950  -13.276 1.00 0.00 ? 80 GLU A CG   6  
ATOM 9314  C CD   . GLU A 1 80 ? -0.674  -5.809  -14.552 1.00 0.00 ? 80 GLU A CD   6  
ATOM 9315  O OE1  . GLU A 1 80 ? -0.240  -5.335  -15.628 1.00 0.00 ? 80 GLU A OE1  6  
ATOM 9316  O OE2  . GLU A 1 80 ? -1.173  -6.958  -14.496 1.00 0.00 ? 80 GLU A OE2  6  
ATOM 9317  H H    . GLU A 1 80 ? 0.234   -6.386  -10.747 1.00 0.00 ? 80 GLU A H    6  
ATOM 9318  H HA   . GLU A 1 80 ? 1.516   -6.759  -13.276 1.00 0.00 ? 80 GLU A HA   6  
ATOM 9319  H HB2  . GLU A 1 80 ? 0.745   -4.220  -11.780 1.00 0.00 ? 80 GLU A HB2  6  
ATOM 9320  H HB3  . GLU A 1 80 ? 1.412   -4.224  -13.410 1.00 0.00 ? 80 GLU A HB3  6  
ATOM 9321  H HG2  . GLU A 1 80 ? -1.232  -5.399  -12.517 1.00 0.00 ? 80 GLU A HG2  6  
ATOM 9322  H HG3  . GLU A 1 80 ? -0.995  -3.962  -13.500 1.00 0.00 ? 80 GLU A HG3  6  
ATOM 9323  N N    . LEU A 1 81 ? 3.282   -5.499  -10.783 1.00 0.00 ? 81 LEU A N    6  
ATOM 9324  C CA   . LEU A 1 81 ? 4.636   -5.271  -10.258 1.00 0.00 ? 81 LEU A CA   6  
ATOM 9325  C C    . LEU A 1 81 ? 5.401   -6.610  -10.080 1.00 0.00 ? 81 LEU A C    6  
ATOM 9326  O O    . LEU A 1 81 ? 6.614   -6.606  -9.855  1.00 0.00 ? 81 LEU A O    6  
ATOM 9327  C CB   . LEU A 1 81 ? 4.561   -4.503  -8.901  1.00 0.00 ? 81 LEU A CB   6  
ATOM 9328  C CG   . LEU A 1 81 ? 3.869   -3.092  -8.914  1.00 0.00 ? 81 LEU A CG   6  
ATOM 9329  C CD1  . LEU A 1 81 ? 3.853   -2.460  -7.497  1.00 0.00 ? 81 LEU A CD1  6  
ATOM 9330  C CD2  . LEU A 1 81 ? 4.531   -2.143  -9.942  1.00 0.00 ? 81 LEU A CD2  6  
ATOM 9331  H H    . LEU A 1 81 ? 2.532   -5.367  -10.175 1.00 0.00 ? 81 LEU A H    6  
ATOM 9332  H HA   . LEU A 1 81 ? 5.174   -4.661  -10.975 1.00 0.00 ? 81 LEU A HA   6  
ATOM 9333  H HB2  . LEU A 1 81 ? 4.025   -5.130  -8.194  1.00 0.00 ? 81 LEU A HB2  6  
ATOM 9334  H HB3  . LEU A 1 81 ? 5.575   -4.375  -8.531  1.00 0.00 ? 81 LEU A HB3  6  
ATOM 9335  H HG   . LEU A 1 81 ? 2.835   -3.220  -9.212  1.00 0.00 ? 81 LEU A HG   6  
ATOM 9336  H HD11 . LEU A 1 81 ? 3.339   -1.505  -7.525  1.00 0.00 ? 81 LEU A HD11 6  
ATOM 9337  H HD12 . LEU A 1 81 ? 4.865   -2.306  -7.145  1.00 0.00 ? 81 LEU A HD12 6  
ATOM 9338  H HD13 . LEU A 1 81 ? 3.334   -3.117  -6.809  1.00 0.00 ? 81 LEU A HD13 6  
ATOM 9339  H HD21 . LEU A 1 81 ? 5.573   -1.998  -9.690  1.00 0.00 ? 81 LEU A HD21 6  
ATOM 9340  H HD22 . LEU A 1 81 ? 4.022   -1.186  -9.939  1.00 0.00 ? 81 LEU A HD22 6  
ATOM 9341  H HD23 . LEU A 1 81 ? 4.459   -2.573  -10.931 1.00 0.00 ? 81 LEU A HD23 6  
ATOM 9342  N N    . GLY A 1 82 ? 4.674   -7.746  -10.166 1.00 0.00 ? 82 GLY A N    6  
ATOM 9343  C CA   . GLY A 1 82 ? 5.261   -9.080  -9.979  1.00 0.00 ? 82 GLY A CA   6  
ATOM 9344  C C    . GLY A 1 82 ? 5.259   -9.529  -8.519  1.00 0.00 ? 82 GLY A C    6  
ATOM 9345  O O    . GLY A 1 82 ? 5.594   -10.672 -8.230  1.00 0.00 ? 82 GLY A O    6  
ATOM 9346  H H    . GLY A 1 82 ? 3.716   -7.678  -10.355 1.00 0.00 ? 82 GLY A H    6  
ATOM 9347  H HA2  . GLY A 1 82 ? 4.680   -9.791  -10.557 1.00 0.00 ? 82 GLY A HA2  6  
ATOM 9348  H HA3  . GLY A 1 82 ? 6.278   -9.085  -10.350 1.00 0.00 ? 82 GLY A HA3  6  
ATOM 9349  N N    . ILE A 1 83 ? 4.893   -8.605  -7.614  1.00 0.00 ? 83 ILE A N    6  
ATOM 9350  C CA   . ILE A 1 83 ? 4.782   -8.833  -6.165  1.00 0.00 ? 83 ILE A CA   6  
ATOM 9351  C C    . ILE A 1 83 ? 3.603   -9.799  -5.891  1.00 0.00 ? 83 ILE A C    6  
ATOM 9352  O O    . ILE A 1 83 ? 2.439   -9.414  -6.015  1.00 0.00 ? 83 ILE A O    6  
ATOM 9353  C CB   . ILE A 1 83 ? 4.560   -7.451  -5.421  1.00 0.00 ? 83 ILE A CB   6  
ATOM 9354  C CG1  . ILE A 1 83 ? 5.717   -6.446  -5.738  1.00 0.00 ? 83 ILE A CG1  6  
ATOM 9355  C CG2  . ILE A 1 83 ? 4.394   -7.634  -3.895  1.00 0.00 ? 83 ILE A CG2  6  
ATOM 9356  C CD1  . ILE A 1 83 ? 5.525   -5.046  -5.166  1.00 0.00 ? 83 ILE A CD1  6  
ATOM 9357  H H    . ILE A 1 83 ? 4.666   -7.726  -7.953  1.00 0.00 ? 83 ILE A H    6  
ATOM 9358  H HA   . ILE A 1 83 ? 5.713   -9.275  -5.812  1.00 0.00 ? 83 ILE A HA   6  
ATOM 9359  H HB   . ILE A 1 83 ? 3.627   -7.028  -5.798  1.00 0.00 ? 83 ILE A HB   6  
ATOM 9360  H HG12 . ILE A 1 83 ? 6.649   -6.829  -5.338  1.00 0.00 ? 83 ILE A HG12 6  
ATOM 9361  H HG13 . ILE A 1 83 ? 5.816   -6.348  -6.814  1.00 0.00 ? 83 ILE A HG13 6  
ATOM 9362  H HG21 . ILE A 1 83 ? 4.215   -6.673  -3.423  1.00 0.00 ? 83 ILE A HG21 6  
ATOM 9363  H HG22 . ILE A 1 83 ? 5.289   -8.074  -3.474  1.00 0.00 ? 83 ILE A HG22 6  
ATOM 9364  H HG23 . ILE A 1 83 ? 3.552   -8.285  -3.694  1.00 0.00 ? 83 ILE A HG23 6  
ATOM 9365  H HD11 . ILE A 1 83 ? 5.498   -5.094  -4.087  1.00 0.00 ? 83 ILE A HD11 6  
ATOM 9366  H HD12 . ILE A 1 83 ? 4.600   -4.622  -5.534  1.00 0.00 ? 83 ILE A HD12 6  
ATOM 9367  H HD13 . ILE A 1 83 ? 6.350   -4.420  -5.473  1.00 0.00 ? 83 ILE A HD13 6  
ATOM 9368  N N    . GLU A 1 84 ? 3.911   -11.066 -5.554  1.00 0.00 ? 84 GLU A N    6  
ATOM 9369  C CA   . GLU A 1 84 ? 2.886   -12.116 -5.389  1.00 0.00 ? 84 GLU A CA   6  
ATOM 9370  C C    . GLU A 1 84 ? 3.334   -13.183 -4.384  1.00 0.00 ? 84 GLU A C    6  
ATOM 9371  O O    . GLU A 1 84 ? 4.529   -13.331 -4.111  1.00 0.00 ? 84 GLU A O    6  
ATOM 9372  C CB   . GLU A 1 84 ? 2.550   -12.776 -6.758  1.00 0.00 ? 84 GLU A CB   6  
ATOM 9373  C CG   . GLU A 1 84 ? 3.750   -13.440 -7.469  1.00 0.00 ? 84 GLU A CG   6  
ATOM 9374  C CD   . GLU A 1 84 ? 3.359   -14.221 -8.734  1.00 0.00 ? 84 GLU A CD   6  
ATOM 9375  O OE1  . GLU A 1 84 ? 3.137   -13.596 -9.789  1.00 0.00 ? 84 GLU A OE1  6  
ATOM 9376  O OE2  . GLU A 1 84 ? 3.284   -15.466 -8.682  1.00 0.00 ? 84 GLU A OE2  6  
ATOM 9377  H H    . GLU A 1 84 ? 4.851   -11.306 -5.419  1.00 0.00 ? 84 GLU A H    6  
ATOM 9378  H HA   . GLU A 1 84 ? 1.987   -11.648 -4.998  1.00 0.00 ? 84 GLU A HA   6  
ATOM 9379  H HB2  . GLU A 1 84 ? 1.786   -13.531 -6.598  1.00 0.00 ? 84 GLU A HB2  6  
ATOM 9380  H HB3  . GLU A 1 84 ? 2.146   -12.015 -7.416  1.00 0.00 ? 84 GLU A HB3  6  
ATOM 9381  H HG2  . GLU A 1 84 ? 4.452   -12.665 -7.747  1.00 0.00 ? 84 GLU A HG2  6  
ATOM 9382  H HG3  . GLU A 1 84 ? 4.245   -14.115 -6.774  1.00 0.00 ? 84 GLU A HG3  6  
ATOM 9383  N N    . GLY A 1 85 ? 2.343   -13.920 -3.849  1.00 0.00 ? 85 GLY A N    6  
ATOM 9384  C CA   . GLY A 1 85 ? 2.572   -15.002 -2.894  1.00 0.00 ? 85 GLY A CA   6  
ATOM 9385  C C    . GLY A 1 85 ? 3.212   -14.524 -1.599  1.00 0.00 ? 85 GLY A C    6  
ATOM 9386  O O    . GLY A 1 85 ? 2.692   -13.611 -0.951  1.00 0.00 ? 85 GLY A O    6  
ATOM 9387  H H    . GLY A 1 85 ? 1.423   -13.727 -4.121  1.00 0.00 ? 85 GLY A H    6  
ATOM 9388  H HA2  . GLY A 1 85 ? 1.621   -15.457 -2.659  1.00 0.00 ? 85 GLY A HA2  6  
ATOM 9389  H HA3  . GLY A 1 85 ? 3.203   -15.747 -3.358  1.00 0.00 ? 85 GLY A HA3  6  
ATOM 9390  N N    . GLU A 1 86 ? 4.355   -15.125 -1.247  1.00 0.00 ? 86 GLU A N    6  
ATOM 9391  C CA   . GLU A 1 86 ? 5.129   -14.792 -0.044  1.00 0.00 ? 86 GLU A CA   6  
ATOM 9392  C C    . GLU A 1 86 ? 5.724   -13.362 -0.121  1.00 0.00 ? 86 GLU A C    6  
ATOM 9393  O O    . GLU A 1 86 ? 6.010   -12.747 0.909   1.00 0.00 ? 86 GLU A O    6  
ATOM 9394  C CB   . GLU A 1 86 ? 6.245   -15.856 0.142   1.00 0.00 ? 86 GLU A CB   6  
ATOM 9395  C CG   . GLU A 1 86 ? 7.118   -15.718 1.406   1.00 0.00 ? 86 GLU A CG   6  
ATOM 9396  C CD   . GLU A 1 86 ? 6.327   -15.813 2.717   1.00 0.00 ? 86 GLU A CD   6  
ATOM 9397  O OE1  . GLU A 1 86 ? 5.864   -16.920 3.070   1.00 0.00 ? 86 GLU A OE1  6  
ATOM 9398  O OE2  . GLU A 1 86 ? 6.143   -14.784 3.402   1.00 0.00 ? 86 GLU A OE2  6  
ATOM 9399  H H    . GLU A 1 86 ? 4.695   -15.840 -1.821  1.00 0.00 ? 86 GLU A H    6  
ATOM 9400  H HA   . GLU A 1 86 ? 4.456   -14.842 0.807   1.00 0.00 ? 86 GLU A HA   6  
ATOM 9401  H HB2  . GLU A 1 86 ? 5.782   -16.838 0.164   1.00 0.00 ? 86 GLU A HB2  6  
ATOM 9402  H HB3  . GLU A 1 86 ? 6.905   -15.821 -0.722  1.00 0.00 ? 86 GLU A HB3  6  
ATOM 9403  H HG2  . GLU A 1 86 ? 7.862   -16.505 1.395   1.00 0.00 ? 86 GLU A HG2  6  
ATOM 9404  H HG3  . GLU A 1 86 ? 7.627   -14.760 1.365   1.00 0.00 ? 86 GLU A HG3  6  
ATOM 9405  N N    . ASN A 1 87 ? 5.877   -12.834 -1.345  1.00 0.00 ? 87 ASN A N    6  
ATOM 9406  C CA   . ASN A 1 87 ? 6.467   -11.498 -1.584  1.00 0.00 ? 87 ASN A CA   6  
ATOM 9407  C C    . ASN A 1 87 ? 5.438   -10.369 -1.430  1.00 0.00 ? 87 ASN A C    6  
ATOM 9408  O O    . ASN A 1 87 ? 5.816   -9.197  -1.495  1.00 0.00 ? 87 ASN A O    6  
ATOM 9409  C CB   . ASN A 1 87 ? 7.137   -11.444 -2.980  1.00 0.00 ? 87 ASN A CB   6  
ATOM 9410  C CG   . ASN A 1 87 ? 8.395   -12.319 -3.093  1.00 0.00 ? 87 ASN A CG   6  
ATOM 9411  O OD1  . ASN A 1 87 ? 8.543   -13.312 -2.390  1.00 0.00 ? 87 ASN A OD1  6  
ATOM 9412  N ND2  . ASN A 1 87 ? 9.299   -11.966 -3.999  1.00 0.00 ? 87 ASN A ND2  6  
ATOM 9413  H H    . ASN A 1 87 ? 5.585   -13.362 -2.118  1.00 0.00 ? 87 ASN A H    6  
ATOM 9414  H HA   . ASN A 1 87 ? 7.235   -11.340 -0.833  1.00 0.00 ? 87 ASN A HA   6  
ATOM 9415  H HB2  . ASN A 1 87 ? 6.422   -11.781 -3.725  1.00 0.00 ? 87 ASN A HB2  6  
ATOM 9416  H HB3  . ASN A 1 87 ? 7.410   -10.419 -3.202  1.00 0.00 ? 87 ASN A HB3  6  
ATOM 9417  H HD21 . ASN A 1 87 ? 9.115   -11.177 -4.550  1.00 0.00 ? 87 ASN A HD21 6  
ATOM 9418  H HD22 . ASN A 1 87 ? 10.114  -12.505 -4.078  1.00 0.00 ? 87 ASN A HD22 6  
ATOM 9419  N N    . ARG A 1 88 ? 4.152   -10.713 -1.215  1.00 0.00 ? 88 ARG A N    6  
ATOM 9420  C CA   . ARG A 1 88 ? 3.085   -9.709  -0.995  1.00 0.00 ? 88 ARG A CA   6  
ATOM 9421  C C    . ARG A 1 88 ? 3.307   -8.933  0.321   1.00 0.00 ? 88 ARG A C    6  
ATOM 9422  O O    . ARG A 1 88 ? 3.725   -9.508  1.332   1.00 0.00 ? 88 ARG A O    6  
ATOM 9423  C CB   . ARG A 1 88 ? 1.684   -10.363 -0.997  1.00 0.00 ? 88 ARG A CB   6  
ATOM 9424  C CG   . ARG A 1 88 ? 1.135   -10.723 -2.394  1.00 0.00 ? 88 ARG A CG   6  
ATOM 9425  C CD   . ARG A 1 88 ? -0.285  -11.305 -2.325  1.00 0.00 ? 88 ARG A CD   6  
ATOM 9426  N NE   . ARG A 1 88 ? -0.924  -11.416 -3.655  1.00 0.00 ? 88 ARG A NE   6  
ATOM 9427  C CZ   . ARG A 1 88 ? -2.209  -11.103 -3.916  1.00 0.00 ? 88 ARG A CZ   6  
ATOM 9428  N NH1  . ARG A 1 88 ? -3.004  -10.654 -2.944  1.00 0.00 ? 88 ARG A NH1  6  
ATOM 9429  N NH2  . ARG A 1 88 ? -2.691  -11.250 -5.147  1.00 0.00 ? 88 ARG A NH2  6  
ATOM 9430  H H    . ARG A 1 88 ? 3.912   -11.666 -1.194  1.00 0.00 ? 88 ARG A H    6  
ATOM 9431  H HA   . ARG A 1 88 ? 3.140   -9.002  -1.819  1.00 0.00 ? 88 ARG A HA   6  
ATOM 9432  H HB2  . ARG A 1 88 ? 1.723   -11.274 -0.407  1.00 0.00 ? 88 ARG A HB2  6  
ATOM 9433  H HB3  . ARG A 1 88 ? 0.976   -9.685  -0.529  1.00 0.00 ? 88 ARG A HB3  6  
ATOM 9434  H HG2  . ARG A 1 88 ? 1.122   -9.830  -3.009  1.00 0.00 ? 88 ARG A HG2  6  
ATOM 9435  H HG3  . ARG A 1 88 ? 1.792   -11.457 -2.847  1.00 0.00 ? 88 ARG A HG3  6  
ATOM 9436  H HD2  . ARG A 1 88 ? -0.230  -12.298 -1.891  1.00 0.00 ? 88 ARG A HD2  6  
ATOM 9437  H HD3  . ARG A 1 88 ? -0.896  -10.672 -1.682  1.00 0.00 ? 88 ARG A HD3  6  
ATOM 9438  H HE   . ARG A 1 88 ? -0.363  -11.759 -4.389  1.00 0.00 ? 88 ARG A HE   6  
ATOM 9439  H HH11 . ARG A 1 88 ? -2.650  -10.542 -2.008  1.00 0.00 ? 88 ARG A HH11 6  
ATOM 9440  H HH12 . ARG A 1 88 ? -3.956  -10.423 -3.138  1.00 0.00 ? 88 ARG A HH12 6  
ATOM 9441  H HH21 . ARG A 1 88 ? -2.097  -11.595 -5.882  1.00 0.00 ? 88 ARG A HH21 6  
ATOM 9442  H HH22 . ARG A 1 88 ? -3.647  -11.017 -5.344  1.00 0.00 ? 88 ARG A HH22 6  
ATOM 9443  N N    . VAL A 1 89 ? 2.998   -7.630  0.282   1.00 0.00 ? 89 VAL A N    6  
ATOM 9444  C CA   . VAL A 1 89 ? 3.222   -6.698  1.401   1.00 0.00 ? 89 VAL A CA   6  
ATOM 9445  C C    . VAL A 1 89 ? 2.045   -6.805  2.409   1.00 0.00 ? 89 VAL A C    6  
ATOM 9446  O O    . VAL A 1 89 ? 0.891   -6.614  2.004   1.00 0.00 ? 89 VAL A O    6  
ATOM 9447  C CB   . VAL A 1 89 ? 3.371   -5.227  0.856   1.00 0.00 ? 89 VAL A CB   6  
ATOM 9448  C CG1  . VAL A 1 89 ? 3.615   -4.204  1.988   1.00 0.00 ? 89 VAL A CG1  6  
ATOM 9449  C CG2  . VAL A 1 89 ? 4.491   -5.159  -0.216  1.00 0.00 ? 89 VAL A CG2  6  
ATOM 9450  H H    . VAL A 1 89 ? 2.584   -7.278  -0.533  1.00 0.00 ? 89 VAL A H    6  
ATOM 9451  H HA   . VAL A 1 89 ? 4.153   -6.978  1.892   1.00 0.00 ? 89 VAL A HA   6  
ATOM 9452  H HB   . VAL A 1 89 ? 2.434   -4.957  0.370   1.00 0.00 ? 89 VAL A HB   6  
ATOM 9453  H HG11 . VAL A 1 89 ? 3.668   -3.203  1.573   1.00 0.00 ? 89 VAL A HG11 6  
ATOM 9454  H HG12 . VAL A 1 89 ? 4.543   -4.425  2.504   1.00 0.00 ? 89 VAL A HG12 6  
ATOM 9455  H HG13 . VAL A 1 89 ? 2.797   -4.246  2.696   1.00 0.00 ? 89 VAL A HG13 6  
ATOM 9456  H HG21 . VAL A 1 89 ? 4.238   -5.811  -1.042  1.00 0.00 ? 89 VAL A HG21 6  
ATOM 9457  H HG22 . VAL A 1 89 ? 5.439   -5.478  0.210   1.00 0.00 ? 89 VAL A HG22 6  
ATOM 9458  H HG23 . VAL A 1 89 ? 4.588   -4.149  -0.583  1.00 0.00 ? 89 VAL A HG23 6  
ATOM 9459  N N    . PRO A 1 90 ? 2.326   -7.119  3.726   1.00 0.00 ? 90 PRO A N    6  
ATOM 9460  C CA   . PRO A 1 90 ? 1.274   -7.420  4.742   1.00 0.00 ? 90 PRO A CA   6  
ATOM 9461  C C    . PRO A 1 90 ? 0.295   -6.249  4.992   1.00 0.00 ? 90 PRO A C    6  
ATOM 9462  O O    . PRO A 1 90 ? 0.715   -5.114  5.172   1.00 0.00 ? 90 PRO A O    6  
ATOM 9463  C CB   . PRO A 1 90 ? 2.093   -7.776  6.017   1.00 0.00 ? 90 PRO A CB   6  
ATOM 9464  C CG   . PRO A 1 90 ? 3.446   -7.172  5.806   1.00 0.00 ? 90 PRO A CG   6  
ATOM 9465  C CD   . PRO A 1 90 ? 3.693   -7.223  4.319   1.00 0.00 ? 90 PRO A CD   6  
ATOM 9466  H HA   . PRO A 1 90 ? 0.704   -8.293  4.434   1.00 0.00 ? 90 PRO A HA   6  
ATOM 9467  H HB2  . PRO A 1 90 ? 1.622   -7.369  6.909   1.00 0.00 ? 90 PRO A HB2  6  
ATOM 9468  H HB3  . PRO A 1 90 ? 2.181   -8.854  6.114   1.00 0.00 ? 90 PRO A HB3  6  
ATOM 9469  H HG2  . PRO A 1 90 ? 3.456   -6.141  6.162   1.00 0.00 ? 90 PRO A HG2  6  
ATOM 9470  H HG3  . PRO A 1 90 ? 4.201   -7.749  6.328   1.00 0.00 ? 90 PRO A HG3  6  
ATOM 9471  H HD2  . PRO A 1 90 ? 4.315   -6.390  4.005   1.00 0.00 ? 90 PRO A HD2  6  
ATOM 9472  H HD3  . PRO A 1 90 ? 4.158   -8.160  4.038   1.00 0.00 ? 90 PRO A HD3  6  
ATOM 9473  N N    . VAL A 1 91 ? -1.013  -6.559  4.999   1.00 0.00 ? 91 VAL A N    6  
ATOM 9474  C CA   . VAL A 1 91 ? -2.093  -5.575  5.204   1.00 0.00 ? 91 VAL A CA   6  
ATOM 9475  C C    . VAL A 1 91 ? -2.710  -5.795  6.600   1.00 0.00 ? 91 VAL A C    6  
ATOM 9476  O O    . VAL A 1 91 ? -3.203  -6.892  6.891   1.00 0.00 ? 91 VAL A O    6  
ATOM 9477  C CB   . VAL A 1 91 ? -3.190  -5.699  4.080   1.00 0.00 ? 91 VAL A CB   6  
ATOM 9478  C CG1  . VAL A 1 91 ? -4.309  -4.644  4.247   1.00 0.00 ? 91 VAL A CG1  6  
ATOM 9479  C CG2  . VAL A 1 91 ? -2.552  -5.620  2.667   1.00 0.00 ? 91 VAL A CG2  6  
ATOM 9480  H H    . VAL A 1 91 ? -1.259  -7.495  4.875   1.00 0.00 ? 91 VAL A H    6  
ATOM 9481  H HA   . VAL A 1 91 ? -1.664  -4.571  5.157   1.00 0.00 ? 91 VAL A HA   6  
ATOM 9482  H HB   . VAL A 1 91 ? -3.656  -6.683  4.175   1.00 0.00 ? 91 VAL A HB   6  
ATOM 9483  H HG11 . VAL A 1 91 ? -3.891  -3.644  4.171   1.00 0.00 ? 91 VAL A HG11 6  
ATOM 9484  H HG12 . VAL A 1 91 ? -4.775  -4.760  5.214   1.00 0.00 ? 91 VAL A HG12 6  
ATOM 9485  H HG13 . VAL A 1 91 ? -5.058  -4.777  3.475   1.00 0.00 ? 91 VAL A HG13 6  
ATOM 9486  H HG21 . VAL A 1 91 ? -2.072  -4.655  2.529   1.00 0.00 ? 91 VAL A HG21 6  
ATOM 9487  H HG22 . VAL A 1 91 ? -3.315  -5.750  1.911   1.00 0.00 ? 91 VAL A HG22 6  
ATOM 9488  H HG23 . VAL A 1 91 ? -1.813  -6.402  2.560   1.00 0.00 ? 91 VAL A HG23 6  
ATOM 9489  N N    . VAL A 1 92 ? -2.647  -4.757  7.467   1.00 0.00 ? 92 VAL A N    6  
ATOM 9490  C CA   . VAL A 1 92 ? -3.065  -4.836  8.887   1.00 0.00 ? 92 VAL A CA   6  
ATOM 9491  C C    . VAL A 1 92 ? -4.019  -3.675  9.195   1.00 0.00 ? 92 VAL A C    6  
ATOM 9492  O O    . VAL A 1 92 ? -3.654  -2.518  9.017   1.00 0.00 ? 92 VAL A O    6  
ATOM 9493  C CB   . VAL A 1 92 ? -1.817  -4.763  9.859   1.00 0.00 ? 92 VAL A CB   6  
ATOM 9494  C CG1  . VAL A 1 92 ? -2.224  -4.955  11.342  1.00 0.00 ? 92 VAL A CG1  6  
ATOM 9495  C CG2  . VAL A 1 92 ? -0.740  -5.784  9.444   1.00 0.00 ? 92 VAL A CG2  6  
ATOM 9496  H H    . VAL A 1 92 ? -2.327  -3.894  7.137   1.00 0.00 ? 92 VAL A H    6  
ATOM 9497  H HA   . VAL A 1 92 ? -3.583  -5.782  9.051   1.00 0.00 ? 92 VAL A HA   6  
ATOM 9498  H HB   . VAL A 1 92 ? -1.375  -3.764  9.767   1.00 0.00 ? 92 VAL A HB   6  
ATOM 9499  H HG11 . VAL A 1 92 ? -1.349  -4.878  11.974  1.00 0.00 ? 92 VAL A HG11 6  
ATOM 9500  H HG12 . VAL A 1 92 ? -2.682  -5.928  11.481  1.00 0.00 ? 92 VAL A HG12 6  
ATOM 9501  H HG13 . VAL A 1 92 ? -2.932  -4.186  11.627  1.00 0.00 ? 92 VAL A HG13 6  
ATOM 9502  H HG21 . VAL A 1 92 ? -0.436  -5.580  8.426   1.00 0.00 ? 92 VAL A HG21 6  
ATOM 9503  H HG22 . VAL A 1 92 ? -1.140  -6.789  9.503   1.00 0.00 ? 92 VAL A HG22 6  
ATOM 9504  H HG23 . VAL A 1 92 ? 0.118   -5.698  10.095  1.00 0.00 ? 92 VAL A HG23 6  
ATOM 9505  N N    . TYR A 1 93 ? -5.236  -3.988  9.648   1.00 0.00 ? 93 TYR A N    6  
ATOM 9506  C CA   . TYR A 1 93 ? -6.253  -2.977  9.981   1.00 0.00 ? 93 TYR A CA   6  
ATOM 9507  C C    . TYR A 1 93 ? -6.050  -2.472  11.418  1.00 0.00 ? 93 TYR A C    6  
ATOM 9508  O O    . TYR A 1 93 ? -6.147  -3.248  12.375  1.00 0.00 ? 93 TYR A O    6  
ATOM 9509  C CB   . TYR A 1 93 ? -7.668  -3.574  9.782   1.00 0.00 ? 93 TYR A CB   6  
ATOM 9510  C CG   . TYR A 1 93 ? -7.924  -4.063  8.341   1.00 0.00 ? 93 TYR A CG   6  
ATOM 9511  C CD1  . TYR A 1 93 ? -8.419  -3.202  7.363   1.00 0.00 ? 93 TYR A CD1  6  
ATOM 9512  C CD2  . TYR A 1 93 ? -7.622  -5.373  7.952   1.00 0.00 ? 93 TYR A CD2  6  
ATOM 9513  C CE1  . TYR A 1 93 ? -8.609  -3.628  6.066   1.00 0.00 ? 93 TYR A CE1  6  
ATOM 9514  C CE2  . TYR A 1 93 ? -7.819  -5.799  6.659   1.00 0.00 ? 93 TYR A CE2  6  
ATOM 9515  C CZ   . TYR A 1 93 ? -8.304  -4.920  5.721   1.00 0.00 ? 93 TYR A CZ   6  
ATOM 9516  O OH   . TYR A 1 93 ? -8.494  -5.339  4.432   1.00 0.00 ? 93 TYR A OH   6  
ATOM 9517  H H    . TYR A 1 93 ? -5.463  -4.932  9.764   1.00 0.00 ? 93 TYR A H    6  
ATOM 9518  H HA   . TYR A 1 93 ? -6.132  -2.135  9.296   1.00 0.00 ? 93 TYR A HA   6  
ATOM 9519  H HB2  . TYR A 1 93 ? -7.803  -4.417  10.455  1.00 0.00 ? 93 TYR A HB2  6  
ATOM 9520  H HB3  . TYR A 1 93 ? -8.411  -2.818  10.021  1.00 0.00 ? 93 TYR A HB3  6  
ATOM 9521  H HD1  . TYR A 1 93 ? -8.663  -2.179  7.633   1.00 0.00 ? 93 TYR A HD1  6  
ATOM 9522  H HD2  . TYR A 1 93 ? -7.235  -6.066  8.691   1.00 0.00 ? 93 TYR A HD2  6  
ATOM 9523  H HE1  . TYR A 1 93 ? -8.992  -2.943  5.326   1.00 0.00 ? 93 TYR A HE1  6  
ATOM 9524  H HE2  . TYR A 1 93 ? -7.584  -6.819  6.381   1.00 0.00 ? 93 TYR A HE2  6  
ATOM 9525  H HH   . TYR A 1 93 ? -8.074  -4.713  3.829   1.00 0.00 ? 93 TYR A HH   6  
ATOM 9526  N N    . ILE A 1 94 ? -5.745  -1.174  11.558  1.00 0.00 ? 94 ILE A N    6  
ATOM 9527  C CA   . ILE A 1 94 ? -5.445  -0.531  12.848  1.00 0.00 ? 94 ILE A CA   6  
ATOM 9528  C C    . ILE A 1 94 ? -6.546  0.493   13.157  1.00 0.00 ? 94 ILE A C    6  
ATOM 9529  O O    . ILE A 1 94 ? -6.847  1.329   12.316  1.00 0.00 ? 94 ILE A O    6  
ATOM 9530  C CB   . ILE A 1 94 ? -4.040  0.198   12.801  1.00 0.00 ? 94 ILE A CB   6  
ATOM 9531  C CG1  . ILE A 1 94 ? -2.901  -0.809  12.452  1.00 0.00 ? 94 ILE A CG1  6  
ATOM 9532  C CG2  . ILE A 1 94 ? -3.731  0.948   14.125  1.00 0.00 ? 94 ILE A CG2  6  
ATOM 9533  C CD1  . ILE A 1 94 ? -2.712  -1.942  13.462  1.00 0.00 ? 94 ILE A CD1  6  
ATOM 9534  H H    . ILE A 1 94 ? -5.763  -0.596  10.768  1.00 0.00 ? 94 ILE A H    6  
ATOM 9535  H HA   . ILE A 1 94 ? -5.423  -1.285  13.629  1.00 0.00 ? 94 ILE A HA   6  
ATOM 9536  H HB   . ILE A 1 94 ? -4.083  0.950   12.007  1.00 0.00 ? 94 ILE A HB   6  
ATOM 9537  H HG12 . ILE A 1 94 ? -3.113  -1.264  11.492  1.00 0.00 ? 94 ILE A HG12 6  
ATOM 9538  H HG13 . ILE A 1 94 ? -1.961  -0.274  12.378  1.00 0.00 ? 94 ILE A HG13 6  
ATOM 9539  H HG21 . ILE A 1 94 ? -4.489  1.701   14.307  1.00 0.00 ? 94 ILE A HG21 6  
ATOM 9540  H HG22 . ILE A 1 94 ? -2.767  1.431   14.057  1.00 0.00 ? 94 ILE A HG22 6  
ATOM 9541  H HG23 . ILE A 1 94 ? -3.720  0.247   14.954  1.00 0.00 ? 94 ILE A HG23 6  
ATOM 9542  H HD11 . ILE A 1 94 ? -2.509  -1.529  14.439  1.00 0.00 ? 94 ILE A HD11 6  
ATOM 9543  H HD12 . ILE A 1 94 ? -1.880  -2.563  13.159  1.00 0.00 ? 94 ILE A HD12 6  
ATOM 9544  H HD13 . ILE A 1 94 ? -3.608  -2.547  13.505  1.00 0.00 ? 94 ILE A HD13 6  
ATOM 9545  N N    . ALA A 1 95 ? -7.149  0.435   14.346  1.00 0.00 ? 95 ALA A N    6  
ATOM 9546  C CA   . ALA A 1 95 ? -8.152  1.424   14.768  1.00 0.00 ? 95 ALA A CA   6  
ATOM 9547  C C    . ALA A 1 95 ? -7.489  2.436   15.713  1.00 0.00 ? 95 ALA A C    6  
ATOM 9548  O O    . ALA A 1 95 ? -7.465  2.229   16.934  1.00 0.00 ? 95 ALA A O    6  
ATOM 9549  C CB   . ALA A 1 95 ? -9.360  0.731   15.426  1.00 0.00 ? 95 ALA A CB   6  
ATOM 9550  H H    . ALA A 1 95 ? -6.905  -0.280  14.971  1.00 0.00 ? 95 ALA A H    6  
ATOM 9551  H HA   . ALA A 1 95 ? -8.518  1.956   13.883  1.00 0.00 ? 95 ALA A HA   6  
ATOM 9552  H HB1  . ALA A 1 95 ? -9.042  0.202   16.317  1.00 0.00 ? 95 ALA A HB1  6  
ATOM 9553  H HB2  . ALA A 1 95 ? -9.797  0.025   14.734  1.00 0.00 ? 95 ALA A HB2  6  
ATOM 9554  H HB3  . ALA A 1 95 ? -10.107 1.469   15.698  1.00 0.00 ? 95 ALA A HB3  6  
ATOM 9555  N N    . GLU A 1 96 ? -6.883  3.499   15.138  1.00 0.00 ? 96 GLU A N    6  
ATOM 9556  C CA   . GLU A 1 96 ? -6.266  4.587   15.914  1.00 0.00 ? 96 GLU A CA   6  
ATOM 9557  C C    . GLU A 1 96 ? -7.401  5.342   16.621  1.00 0.00 ? 96 GLU A C    6  
ATOM 9558  O O    . GLU A 1 96 ? -8.119  6.135   16.004  1.00 0.00 ? 96 GLU A O    6  
ATOM 9559  C CB   . GLU A 1 96 ? -5.425  5.524   14.986  1.00 0.00 ? 96 GLU A CB   6  
ATOM 9560  C CG   . GLU A 1 96 ? -4.393  6.453   15.685  1.00 0.00 ? 96 GLU A CG   6  
ATOM 9561  C CD   . GLU A 1 96 ? -5.009  7.532   16.601  1.00 0.00 ? 96 GLU A CD   6  
ATOM 9562  O OE1  . GLU A 1 96 ? -5.575  8.513   16.074  1.00 0.00 ? 96 GLU A OE1  6  
ATOM 9563  O OE2  . GLU A 1 96 ? -4.951  7.398   17.846  1.00 0.00 ? 96 GLU A OE2  6  
ATOM 9564  H H    . GLU A 1 96 ? -6.872  3.563   14.158  1.00 0.00 ? 96 GLU A H    6  
ATOM 9565  H HA   . GLU A 1 96 ? -5.610  4.140   16.659  1.00 0.00 ? 96 GLU A HA   6  
ATOM 9566  H HB2  . GLU A 1 96 ? -4.874  4.902   14.291  1.00 0.00 ? 96 GLU A HB2  6  
ATOM 9567  H HB3  . GLU A 1 96 ? -6.105  6.147   14.412  1.00 0.00 ? 96 GLU A HB3  6  
ATOM 9568  H HG2  . GLU A 1 96 ? -3.716  5.840   16.277  1.00 0.00 ? 96 GLU A HG2  6  
ATOM 9569  H HG3  . GLU A 1 96 ? -3.807  6.948   14.914  1.00 0.00 ? 96 GLU A HG3  6  
ATOM 9570  N N    . SER A 1 97 ? -7.590  5.015   17.898  1.00 0.00 ? 97 SER A N    6  
ATOM 9571  C CA   . SER A 1 97 ? -8.654  5.556   18.745  1.00 0.00 ? 97 SER A CA   6  
ATOM 9572  C C    . SER A 1 97 ? -8.118  5.671   20.180  1.00 0.00 ? 97 SER A C    6  
ATOM 9573  O O    . SER A 1 97 ? -8.788  5.280   21.141  1.00 0.00 ? 97 SER A O    6  
ATOM 9574  C CB   . SER A 1 97 ? -9.901  4.634   18.670  1.00 0.00 ? 97 SER A CB   6  
ATOM 9575  O OG   . SER A 1 97 ? -10.397 4.516   17.340  1.00 0.00 ? 97 SER A OG   6  
ATOM 9576  H H    . SER A 1 97 ? -6.975  4.369   18.301  1.00 0.00 ? 97 SER A H    6  
ATOM 9577  H HA   . SER A 1 97 ? -8.922  6.550   18.388  1.00 0.00 ? 97 SER A HA   6  
ATOM 9578  H HB2  . SER A 1 97 ? -9.644  3.645   19.024  1.00 0.00 ? 97 SER A HB2  6  
ATOM 9579  H HB3  . SER A 1 97 ? -10.690 5.039   19.293  1.00 0.00 ? 97 SER A HB3  6  
ATOM 9580  H HG   . SER A 1 97 ? -9.779  4.921   16.729  1.00 0.00 ? 97 SER A HG   6  
ATOM 9581  N N    . ASP A 1 98 ? -6.892  6.222   20.302  1.00 0.00 ? 98 ASP A N    6  
ATOM 9582  C CA   . ASP A 1 98 ? -6.201  6.401   21.598  1.00 0.00 ? 98 ASP A CA   6  
ATOM 9583  C C    . ASP A 1 98 ? -7.028  7.305   22.528  1.00 0.00 ? 98 ASP A C    6  
ATOM 9584  O O    . ASP A 1 98 ? -7.156  7.025   23.721  1.00 0.00 ? 98 ASP A O    6  
ATOM 9585  C CB   . ASP A 1 98 ? -4.788  7.002   21.374  1.00 0.00 ? 98 ASP A CB   6  
ATOM 9586  C CG   . ASP A 1 98 ? -4.007  7.265   22.682  1.00 0.00 ? 98 ASP A CG   6  
ATOM 9587  O OD1  . ASP A 1 98 ? -3.493  6.299   23.284  1.00 0.00 ? 98 ASP A OD1  6  
ATOM 9588  O OD2  . ASP A 1 98 ? -3.922  8.431   23.127  1.00 0.00 ? 98 ASP A OD2  6  
ATOM 9589  H H    . ASP A 1 98 ? -6.439  6.535   19.488  1.00 0.00 ? 98 ASP A H    6  
ATOM 9590  H HA   . ASP A 1 98 ? -6.100  5.417   22.050  1.00 0.00 ? 98 ASP A HA   6  
ATOM 9591  H HB2  . ASP A 1 98 ? -4.216  6.313   20.768  1.00 0.00 ? 98 ASP A HB2  6  
ATOM 9592  H HB3  . ASP A 1 98 ? -4.886  7.936   20.829  1.00 0.00 ? 98 ASP A HB3  6  
ATOM 9593  N N    . GLY A 1 99 ? -7.587  8.377   21.948  1.00 0.00 ? 99 GLY A N    6  
ATOM 9594  C CA   . GLY A 1 99 ? -8.417  9.335   22.680  1.00 0.00 ? 99 GLY A CA   6  
ATOM 9595  C C    . GLY A 1 99 ? -8.389  10.716  22.034  1.00 0.00 ? 99 GLY A C    6  
ATOM 9596  O O    . GLY A 1 99 ? -7.365  11.070  21.412  1.00 0.00 ? 99 GLY A O    6  
ATOM 9597  O OXT  . GLY A 1 99 ? -9.387  11.461  22.122  1.00 0.00 ? 99 GLY A OXT  6  
ATOM 9598  H H    . GLY A 1 99 ? -7.431  8.530   20.993  1.00 0.00 ? 99 GLY A H    6  
ATOM 9599  H HA2  . GLY A 1 99 ? -9.434  8.962   22.697  1.00 0.00 ? 99 GLY A HA2  6  
ATOM 9600  H HA3  . GLY A 1 99 ? -8.059  9.422   23.699  1.00 0.00 ? 99 GLY A HA3  6  
ATOM 9601  N N    . MET A 1 1  ? -8.384  -8.649  16.137  1.00 0.00 ? 1  MET A N    7  
ATOM 9602  C CA   . MET A 1 1  ? -7.654  -9.561  17.035  1.00 0.00 ? 1  MET A CA   7  
ATOM 9603  C C    . MET A 1 1  ? -7.400  -8.853  18.384  1.00 0.00 ? 1  MET A C    7  
ATOM 9604  O O    . MET A 1 1  ? -7.024  -7.672  18.415  1.00 0.00 ? 1  MET A O    7  
ATOM 9605  C CB   . MET A 1 1  ? -6.346  -10.054 16.338  1.00 0.00 ? 1  MET A CB   7  
ATOM 9606  C CG   . MET A 1 1  ? -5.229  -9.001  16.150  1.00 0.00 ? 1  MET A CG   7  
ATOM 9607  S SD   . MET A 1 1  ? -4.189  -8.821  17.615  1.00 0.00 ? 1  MET A SD   7  
ATOM 9608  C CE   . MET A 1 1  ? -3.467  -10.459 17.724  1.00 0.00 ? 1  MET A CE   7  
ATOM 9609  H H1   . MET A 1 1  ? -9.303  -8.399  16.551  1.00 0.00 ? 1  MET A H1   7  
ATOM 9610  H H2   . MET A 1 1  ? -8.546  -9.104  15.218  1.00 0.00 ? 1  MET A H2   7  
ATOM 9611  H H3   . MET A 1 1  ? -7.838  -7.782  15.992  1.00 0.00 ? 1  MET A H3   7  
ATOM 9612  H HA   . MET A 1 1  ? -8.303  -10.415 17.214  1.00 0.00 ? 1  MET A HA   7  
ATOM 9613  H HB2  . MET A 1 1  ? -5.937  -10.870 16.919  1.00 0.00 ? 1  MET A HB2  7  
ATOM 9614  H HB3  . MET A 1 1  ? -6.613  -10.444 15.360  1.00 0.00 ? 1  MET A HB3  7  
ATOM 9615  H HG2  . MET A 1 1  ? -4.597  -9.292  15.316  1.00 0.00 ? 1  MET A HG2  7  
ATOM 9616  H HG3  . MET A 1 1  ? -5.679  -8.041  15.929  1.00 0.00 ? 1  MET A HG3  7  
ATOM 9617  H HE1  . MET A 1 1  ? -4.248  -11.195 17.855  1.00 0.00 ? 1  MET A HE1  7  
ATOM 9618  H HE2  . MET A 1 1  ? -2.800  -10.495 18.570  1.00 0.00 ? 1  MET A HE2  7  
ATOM 9619  H HE3  . MET A 1 1  ? -2.916  -10.677 16.818  1.00 0.00 ? 1  MET A HE3  7  
ATOM 9620  N N    . GLY A 1 2  ? -7.648  -9.572  19.491  1.00 0.00 ? 2  GLY A N    7  
ATOM 9621  C CA   . GLY A 1 2  ? -7.667  -8.976  20.832  1.00 0.00 ? 2  GLY A CA   7  
ATOM 9622  C C    . GLY A 1 2  ? -6.355  -9.100  21.594  1.00 0.00 ? 2  GLY A C    7  
ATOM 9623  O O    . GLY A 1 2  ? -6.145  -8.374  22.573  1.00 0.00 ? 2  GLY A O    7  
ATOM 9624  H H    . GLY A 1 2  ? -7.815  -10.532 19.398  1.00 0.00 ? 2  GLY A H    7  
ATOM 9625  H HA2  . GLY A 1 2  ? -7.928  -7.925  20.759  1.00 0.00 ? 2  GLY A HA2  7  
ATOM 9626  H HA3  . GLY A 1 2  ? -8.436  -9.473  21.407  1.00 0.00 ? 2  GLY A HA3  7  
ATOM 9627  N N    . HIS A 1 3  ? -5.467  -10.008 21.142  1.00 0.00 ? 3  HIS A N    7  
ATOM 9628  C CA   . HIS A 1 3  ? -4.202  -10.320 21.848  1.00 0.00 ? 3  HIS A CA   7  
ATOM 9629  C C    . HIS A 1 3  ? -3.216  -9.124  21.799  1.00 0.00 ? 3  HIS A C    7  
ATOM 9630  O O    . HIS A 1 3  ? -2.541  -8.831  22.786  1.00 0.00 ? 3  HIS A O    7  
ATOM 9631  C CB   . HIS A 1 3  ? -3.565  -11.605 21.244  1.00 0.00 ? 3  HIS A CB   7  
ATOM 9632  C CG   . HIS A 1 3  ? -2.370  -12.160 21.989  1.00 0.00 ? 3  HIS A CG   7  
ATOM 9633  N ND1  . HIS A 1 3  ? -2.449  -13.253 22.826  1.00 0.00 ? 3  HIS A ND1  7  
ATOM 9634  C CD2  . HIS A 1 3  ? -1.064  -11.793 21.994  1.00 0.00 ? 3  HIS A CD2  7  
ATOM 9635  C CE1  . HIS A 1 3  ? -1.254  -13.529 23.304  1.00 0.00 ? 3  HIS A CE1  7  
ATOM 9636  N NE2  . HIS A 1 3  ? -0.401  -12.659 22.814  1.00 0.00 ? 3  HIS A NE2  7  
ATOM 9637  H H    . HIS A 1 3  ? -5.677  -10.499 20.320  1.00 0.00 ? 3  HIS A H    7  
ATOM 9638  H HA   . HIS A 1 3  ? -4.457  -10.519 22.888  1.00 0.00 ? 3  HIS A HA   7  
ATOM 9639  H HB2  . HIS A 1 3  ? -4.316  -12.390 21.216  1.00 0.00 ? 3  HIS A HB2  7  
ATOM 9640  H HB3  . HIS A 1 3  ? -3.254  -11.403 20.225  1.00 0.00 ? 3  HIS A HB3  7  
ATOM 9641  H HD1  . HIS A 1 3  ? -3.260  -13.761 23.033  1.00 0.00 ? 3  HIS A HD1  7  
ATOM 9642  H HD2  . HIS A 1 3  ? -0.629  -10.967 21.452  1.00 0.00 ? 3  HIS A HD2  7  
ATOM 9643  H HE1  . HIS A 1 3  ? -1.014  -14.339 23.973  1.00 0.00 ? 3  HIS A HE1  7  
ATOM 9644  H HE2  . HIS A 1 3  ? 0.547   -12.594 23.060  1.00 0.00 ? 3  HIS A HE2  7  
ATOM 9645  N N    . HIS A 1 4  ? -3.153  -8.431  20.646  1.00 0.00 ? 4  HIS A N    7  
ATOM 9646  C CA   . HIS A 1 4  ? -2.277  -7.244  20.459  1.00 0.00 ? 4  HIS A CA   7  
ATOM 9647  C C    . HIS A 1 4  ? -3.090  -5.942  20.565  1.00 0.00 ? 4  HIS A C    7  
ATOM 9648  O O    . HIS A 1 4  ? -2.606  -4.877  20.164  1.00 0.00 ? 4  HIS A O    7  
ATOM 9649  C CB   . HIS A 1 4  ? -1.539  -7.300  19.088  1.00 0.00 ? 4  HIS A CB   7  
ATOM 9650  C CG   . HIS A 1 4  ? -0.572  -8.443  18.939  1.00 0.00 ? 4  HIS A CG   7  
ATOM 9651  N ND1  . HIS A 1 4  ? -0.397  -9.128  17.758  1.00 0.00 ? 4  HIS A ND1  7  
ATOM 9652  C CD2  . HIS A 1 4  ? 0.282   -9.011  19.824  1.00 0.00 ? 4  HIS A CD2  7  
ATOM 9653  C CE1  . HIS A 1 4  ? 0.511   -10.065 17.926  1.00 0.00 ? 4  HIS A CE1  7  
ATOM 9654  N NE2  . HIS A 1 4  ? 0.936   -10.014 19.168  1.00 0.00 ? 4  HIS A NE2  7  
ATOM 9655  H H    . HIS A 1 4  ? -3.724  -8.708  19.901  1.00 0.00 ? 4  HIS A H    7  
ATOM 9656  H HA   . HIS A 1 4  ? -1.535  -7.237  21.253  1.00 0.00 ? 4  HIS A HA   7  
ATOM 9657  H HB2  . HIS A 1 4  ? -2.271  -7.386  18.294  1.00 0.00 ? 4  HIS A HB2  7  
ATOM 9658  H HB3  . HIS A 1 4  ? -0.980  -6.382  18.943  1.00 0.00 ? 4  HIS A HB3  7  
ATOM 9659  H HD1  . HIS A 1 4  ? -0.863  -8.948  16.914  1.00 0.00 ? 4  HIS A HD1  7  
ATOM 9660  H HD2  . HIS A 1 4  ? 0.423   -8.723  20.855  1.00 0.00 ? 4  HIS A HD2  7  
ATOM 9661  H HE1  . HIS A 1 4  ? 0.847   -10.763 17.172  1.00 0.00 ? 4  HIS A HE1  7  
ATOM 9662  H HE2  . HIS A 1 4  ? 1.694   -10.519 19.523  1.00 0.00 ? 4  HIS A HE2  7  
ATOM 9663  N N    . HIS A 1 5  ? -4.317  -6.022  21.119  1.00 0.00 ? 5  HIS A N    7  
ATOM 9664  C CA   . HIS A 1 5  ? -5.170  -4.840  21.321  1.00 0.00 ? 5  HIS A CA   7  
ATOM 9665  C C    . HIS A 1 5  ? -4.798  -4.165  22.658  1.00 0.00 ? 5  HIS A C    7  
ATOM 9666  O O    . HIS A 1 5  ? -5.525  -4.256  23.653  1.00 0.00 ? 5  HIS A O    7  
ATOM 9667  C CB   . HIS A 1 5  ? -6.676  -5.227  21.249  1.00 0.00 ? 5  HIS A CB   7  
ATOM 9668  C CG   . HIS A 1 5  ? -7.624  -4.053  21.305  1.00 0.00 ? 5  HIS A CG   7  
ATOM 9669  N ND1  . HIS A 1 5  ? -8.217  -3.618  22.470  1.00 0.00 ? 5  HIS A ND1  7  
ATOM 9670  C CD2  . HIS A 1 5  ? -8.076  -3.225  20.332  1.00 0.00 ? 5  HIS A CD2  7  
ATOM 9671  C CE1  . HIS A 1 5  ? -8.986  -2.580  22.209  1.00 0.00 ? 5  HIS A CE1  7  
ATOM 9672  N NE2  . HIS A 1 5  ? -8.914  -2.321  20.924  1.00 0.00 ? 5  HIS A NE2  7  
ATOM 9673  H H    . HIS A 1 5  ? -4.651  -6.894  21.404  1.00 0.00 ? 5  HIS A H    7  
ATOM 9674  H HA   . HIS A 1 5  ? -4.954  -4.133  20.516  1.00 0.00 ? 5  HIS A HA   7  
ATOM 9675  H HB2  . HIS A 1 5  ? -6.864  -5.755  20.322  1.00 0.00 ? 5  HIS A HB2  7  
ATOM 9676  H HB3  . HIS A 1 5  ? -6.915  -5.887  22.076  1.00 0.00 ? 5  HIS A HB3  7  
ATOM 9677  H HD1  . HIS A 1 5  ? -8.094  -4.017  23.361  1.00 0.00 ? 5  HIS A HD1  7  
ATOM 9678  H HD2  . HIS A 1 5  ? -7.823  -3.269  19.282  1.00 0.00 ? 5  HIS A HD2  7  
ATOM 9679  H HE1  . HIS A 1 5  ? -9.572  -2.033  22.932  1.00 0.00 ? 5  HIS A HE1  7  
ATOM 9680  H HE2  . HIS A 1 5  ? -9.440  -1.639  20.455  1.00 0.00 ? 5  HIS A HE2  7  
ATOM 9681  N N    . HIS A 1 6  ? -3.614  -3.528  22.672  1.00 0.00 ? 6  HIS A N    7  
ATOM 9682  C CA   . HIS A 1 6  ? -3.122  -2.759  23.833  1.00 0.00 ? 6  HIS A CA   7  
ATOM 9683  C C    . HIS A 1 6  ? -3.730  -1.342  23.793  1.00 0.00 ? 6  HIS A C    7  
ATOM 9684  O O    . HIS A 1 6  ? -3.180  -0.414  23.182  1.00 0.00 ? 6  HIS A O    7  
ATOM 9685  C CB   . HIS A 1 6  ? -1.552  -2.750  23.884  1.00 0.00 ? 6  HIS A CB   7  
ATOM 9686  C CG   . HIS A 1 6  ? -0.839  -2.148  22.682  1.00 0.00 ? 6  HIS A CG   7  
ATOM 9687  N ND1  . HIS A 1 6  ? -0.097  -0.984  22.748  1.00 0.00 ? 6  HIS A ND1  7  
ATOM 9688  C CD2  . HIS A 1 6  ? -0.743  -2.564  21.395  1.00 0.00 ? 6  HIS A CD2  7  
ATOM 9689  C CE1  . HIS A 1 6  ? 0.411   -0.719  21.561  1.00 0.00 ? 6  HIS A CE1  7  
ATOM 9690  N NE2  . HIS A 1 6  ? 0.033   -1.662  20.725  1.00 0.00 ? 6  HIS A NE2  7  
ATOM 9691  H H    . HIS A 1 6  ? -3.056  -3.573  21.867  1.00 0.00 ? 6  HIS A H    7  
ATOM 9692  H HA   . HIS A 1 6  ? -3.487  -3.258  24.734  1.00 0.00 ? 6  HIS A HA   7  
ATOM 9693  H HB2  . HIS A 1 6  ? -1.233  -2.198  24.759  1.00 0.00 ? 6  HIS A HB2  7  
ATOM 9694  H HB3  . HIS A 1 6  ? -1.203  -3.769  23.987  1.00 0.00 ? 6  HIS A HB3  7  
ATOM 9695  H HD1  . HIS A 1 6  ? 0.048   -0.441  23.552  1.00 0.00 ? 6  HIS A HD1  7  
ATOM 9696  H HD2  . HIS A 1 6  ? -1.197  -3.449  20.971  1.00 0.00 ? 6  HIS A HD2  7  
ATOM 9697  H HE1  . HIS A 1 6  ? 1.034   0.128   21.318  1.00 0.00 ? 6  HIS A HE1  7  
ATOM 9698  H HE2  . HIS A 1 6  ? 0.133   -1.622  19.752  1.00 0.00 ? 6  HIS A HE2  7  
ATOM 9699  N N    . HIS A 1 7  ? -4.929  -1.201  24.383  1.00 0.00 ? 7  HIS A N    7  
ATOM 9700  C CA   . HIS A 1 7  ? -5.696  0.054   24.341  1.00 0.00 ? 7  HIS A CA   7  
ATOM 9701  C C    . HIS A 1 7  ? -5.405  0.906   25.586  1.00 0.00 ? 7  HIS A C    7  
ATOM 9702  O O    . HIS A 1 7  ? -5.967  0.674   26.666  1.00 0.00 ? 7  HIS A O    7  
ATOM 9703  C CB   . HIS A 1 7  ? -7.207  -0.218  24.204  1.00 0.00 ? 7  HIS A CB   7  
ATOM 9704  C CG   . HIS A 1 7  ? -8.012  1.042   23.991  1.00 0.00 ? 7  HIS A CG   7  
ATOM 9705  N ND1  . HIS A 1 7  ? -8.746  1.648   24.984  1.00 0.00 ? 7  HIS A ND1  7  
ATOM 9706  C CD2  . HIS A 1 7  ? -8.158  1.824   22.895  1.00 0.00 ? 7  HIS A CD2  7  
ATOM 9707  C CE1  . HIS A 1 7  ? -9.305  2.739   24.510  1.00 0.00 ? 7  HIS A CE1  7  
ATOM 9708  N NE2  . HIS A 1 7  ? -8.963  2.872   23.247  1.00 0.00 ? 7  HIS A NE2  7  
ATOM 9709  H H    . HIS A 1 7  ? -5.303  -1.965  24.871  1.00 0.00 ? 7  HIS A H    7  
ATOM 9710  H HA   . HIS A 1 7  ? -5.375  0.610   23.458  1.00 0.00 ? 7  HIS A HA   7  
ATOM 9711  H HB2  . HIS A 1 7  ? -7.377  -0.872  23.355  1.00 0.00 ? 7  HIS A HB2  7  
ATOM 9712  H HB3  . HIS A 1 7  ? -7.574  -0.708  25.099  1.00 0.00 ? 7  HIS A HB3  7  
ATOM 9713  H HD1  . HIS A 1 7  ? -8.841  1.326   25.906  1.00 0.00 ? 7  HIS A HD1  7  
ATOM 9714  H HD2  . HIS A 1 7  ? -7.720  1.656   21.919  1.00 0.00 ? 7  HIS A HD2  7  
ATOM 9715  H HE1  . HIS A 1 7  ? -9.937  3.414   25.065  1.00 0.00 ? 7  HIS A HE1  7  
ATOM 9716  H HE2  . HIS A 1 7  ? -9.409  3.476   22.612  1.00 0.00 ? 7  HIS A HE2  7  
ATOM 9717  N N    . HIS A 1 8  ? -4.501  1.868   25.401  1.00 0.00 ? 8  HIS A N    7  
ATOM 9718  C CA   . HIS A 1 8  ? -4.083  2.848   26.424  1.00 0.00 ? 8  HIS A CA   7  
ATOM 9719  C C    . HIS A 1 8  ? -3.333  3.993   25.716  1.00 0.00 ? 8  HIS A C    7  
ATOM 9720  O O    . HIS A 1 8  ? -3.351  5.150   26.153  1.00 0.00 ? 8  HIS A O    7  
ATOM 9721  C CB   . HIS A 1 8  ? -3.172  2.182   27.496  1.00 0.00 ? 8  HIS A CB   7  
ATOM 9722  C CG   . HIS A 1 8  ? -2.791  3.097   28.637  1.00 0.00 ? 8  HIS A CG   7  
ATOM 9723  N ND1  . HIS A 1 8  ? -1.631  3.848   28.652  1.00 0.00 ? 8  HIS A ND1  7  
ATOM 9724  C CD2  . HIS A 1 8  ? -3.429  3.388   29.800  1.00 0.00 ? 8  HIS A CD2  7  
ATOM 9725  C CE1  . HIS A 1 8  ? -1.581  4.555   29.762  1.00 0.00 ? 8  HIS A CE1  7  
ATOM 9726  N NE2  . HIS A 1 8  ? -2.656  4.298   30.468  1.00 0.00 ? 8  HIS A NE2  7  
ATOM 9727  H H    . HIS A 1 8  ? -4.088  1.929   24.518  1.00 0.00 ? 8  HIS A H    7  
ATOM 9728  H HA   . HIS A 1 8  ? -4.978  3.247   26.895  1.00 0.00 ? 8  HIS A HA   7  
ATOM 9729  H HB2  . HIS A 1 8  ? -3.690  1.325   27.915  1.00 0.00 ? 8  HIS A HB2  7  
ATOM 9730  H HB3  . HIS A 1 8  ? -2.261  1.835   27.025  1.00 0.00 ? 8  HIS A HB3  7  
ATOM 9731  H HD1  . HIS A 1 8  ? -0.940  3.858   27.954  1.00 0.00 ? 8  HIS A HD1  7  
ATOM 9732  H HD2  . HIS A 1 8  ? -4.374  2.984   30.133  1.00 0.00 ? 8  HIS A HD2  7  
ATOM 9733  H HE1  . HIS A 1 8  ? -0.793  5.242   30.038  1.00 0.00 ? 8  HIS A HE1  7  
ATOM 9734  H HE2  . HIS A 1 8  ? -2.886  4.720   31.321  1.00 0.00 ? 8  HIS A HE2  7  
ATOM 9735  N N    . SER A 1 9  ? -2.679  3.624   24.607  1.00 0.00 ? 9  SER A N    7  
ATOM 9736  C CA   . SER A 1 9  ? -1.945  4.530   23.736  1.00 0.00 ? 9  SER A CA   7  
ATOM 9737  C C    . SER A 1 9  ? -1.858  3.893   22.333  1.00 0.00 ? 9  SER A C    7  
ATOM 9738  O O    . SER A 1 9  ? -1.829  2.660   22.198  1.00 0.00 ? 9  SER A O    7  
ATOM 9739  C CB   . SER A 1 9  ? -0.539  4.806   24.315  1.00 0.00 ? 9  SER A CB   7  
ATOM 9740  O OG   . SER A 1 9  ? 0.139   5.808   23.576  1.00 0.00 ? 9  SER A OG   7  
ATOM 9741  H H    . SER A 1 9  ? -2.684  2.676   24.366  1.00 0.00 ? 9  SER A H    7  
ATOM 9742  H HA   . SER A 1 9  ? -2.499  5.465   23.668  1.00 0.00 ? 9  SER A HA   7  
ATOM 9743  H HB2  . SER A 1 9  ? -0.632  5.146   25.337  1.00 0.00 ? 9  SER A HB2  7  
ATOM 9744  H HB3  . SER A 1 9  ? 0.057   3.897   24.299  1.00 0.00 ? 9  SER A HB3  7  
ATOM 9745  H HG   . SER A 1 9  ? 1.055   5.852   23.874  1.00 0.00 ? 9  SER A HG   7  
ATOM 9746  N N    . HIS A 1 10 ? -1.809  4.743   21.306  1.00 0.00 ? 10 HIS A N    7  
ATOM 9747  C CA   . HIS A 1 10 ? -1.779  4.337   19.888  1.00 0.00 ? 10 HIS A CA   7  
ATOM 9748  C C    . HIS A 1 10 ? -0.854  5.302   19.118  1.00 0.00 ? 10 HIS A C    7  
ATOM 9749  O O    . HIS A 1 10 ? -1.200  5.788   18.030  1.00 0.00 ? 10 HIS A O    7  
ATOM 9750  C CB   . HIS A 1 10 ? -3.225  4.330   19.306  1.00 0.00 ? 10 HIS A CB   7  
ATOM 9751  C CG   . HIS A 1 10 ? -3.935  5.659   19.429  1.00 0.00 ? 10 HIS A CG   7  
ATOM 9752  N ND1  . HIS A 1 10 ? -3.853  6.644   18.467  1.00 0.00 ? 10 HIS A ND1  7  
ATOM 9753  C CD2  . HIS A 1 10 ? -4.693  6.180   20.423  1.00 0.00 ? 10 HIS A CD2  7  
ATOM 9754  C CE1  . HIS A 1 10 ? -4.520  7.703   18.865  1.00 0.00 ? 10 HIS A CE1  7  
ATOM 9755  N NE2  . HIS A 1 10 ? -5.034  7.446   20.049  1.00 0.00 ? 10 HIS A NE2  7  
ATOM 9756  H H    . HIS A 1 10 ? -1.784  5.700   21.507  1.00 0.00 ? 10 HIS A H    7  
ATOM 9757  H HA   . HIS A 1 10 ? -1.358  3.334   19.819  1.00 0.00 ? 10 HIS A HA   7  
ATOM 9758  H HB2  . HIS A 1 10 ? -3.190  4.069   18.254  1.00 0.00 ? 10 HIS A HB2  7  
ATOM 9759  H HB3  . HIS A 1 10 ? -3.813  3.583   19.829  1.00 0.00 ? 10 HIS A HB3  7  
ATOM 9760  H HD1  . HIS A 1 10 ? -3.374  6.572   17.612  1.00 0.00 ? 10 HIS A HD1  7  
ATOM 9761  H HD2  . HIS A 1 10 ? -4.977  5.686   21.341  1.00 0.00 ? 10 HIS A HD2  7  
ATOM 9762  H HE1  . HIS A 1 10 ? -4.625  8.628   18.318  1.00 0.00 ? 10 HIS A HE1  7  
ATOM 9763  H HE2  . HIS A 1 10 ? -5.591  8.059   20.566  1.00 0.00 ? 10 HIS A HE2  7  
ATOM 9764  N N    . MET A 1 11 ? 0.337   5.556   19.704  1.00 0.00 ? 11 MET A N    7  
ATOM 9765  C CA   . MET A 1 11 ? 1.324   6.519   19.165  1.00 0.00 ? 11 MET A CA   7  
ATOM 9766  C C    . MET A 1 11 ? 1.844   6.074   17.785  1.00 0.00 ? 11 MET A C    7  
ATOM 9767  O O    . MET A 1 11 ? 2.836   5.351   17.672  1.00 0.00 ? 11 MET A O    7  
ATOM 9768  C CB   . MET A 1 11 ? 2.506   6.731   20.152  1.00 0.00 ? 11 MET A CB   7  
ATOM 9769  C CG   . MET A 1 11 ? 2.119   7.399   21.472  1.00 0.00 ? 11 MET A CG   7  
ATOM 9770  S SD   . MET A 1 11 ? 3.547   7.750   22.521  1.00 0.00 ? 11 MET A SD   7  
ATOM 9771  C CE   . MET A 1 11 ? 2.774   8.595   23.903  1.00 0.00 ? 11 MET A CE   7  
ATOM 9772  H H    . MET A 1 11 ? 0.556   5.072   20.526  1.00 0.00 ? 11 MET A H    7  
ATOM 9773  H HA   . MET A 1 11 ? 0.808   7.473   19.046  1.00 0.00 ? 11 MET A HA   7  
ATOM 9774  H HB2  . MET A 1 11 ? 2.952   5.769   20.379  1.00 0.00 ? 11 MET A HB2  7  
ATOM 9775  H HB3  . MET A 1 11 ? 3.260   7.353   19.675  1.00 0.00 ? 11 MET A HB3  7  
ATOM 9776  H HG2  . MET A 1 11 ? 1.612   8.330   21.257  1.00 0.00 ? 11 MET A HG2  7  
ATOM 9777  H HG3  . MET A 1 11 ? 1.445   6.742   22.012  1.00 0.00 ? 11 MET A HG3  7  
ATOM 9778  H HE1  . MET A 1 11 ? 2.064   7.933   24.381  1.00 0.00 ? 11 MET A HE1  7  
ATOM 9779  H HE2  . MET A 1 11 ? 2.261   9.479   23.549  1.00 0.00 ? 11 MET A HE2  7  
ATOM 9780  H HE3  . MET A 1 11 ? 3.531   8.882   24.616  1.00 0.00 ? 11 MET A HE3  7  
ATOM 9781  N N    . LYS A 1 12 ? 1.113   6.500   16.746  1.00 0.00 ? 12 LYS A N    7  
ATOM 9782  C CA   . LYS A 1 12 ? 1.411   6.223   15.338  1.00 0.00 ? 12 LYS A CA   7  
ATOM 9783  C C    . LYS A 1 12 ? 1.523   7.562   14.620  1.00 0.00 ? 12 LYS A C    7  
ATOM 9784  O O    . LYS A 1 12 ? 0.526   8.269   14.470  1.00 0.00 ? 12 LYS A O    7  
ATOM 9785  C CB   . LYS A 1 12 ? 0.280   5.359   14.711  1.00 0.00 ? 12 LYS A CB   7  
ATOM 9786  C CG   . LYS A 1 12 ? 0.161   3.959   15.326  1.00 0.00 ? 12 LYS A CG   7  
ATOM 9787  C CD   . LYS A 1 12 ? -0.958  3.108   14.695  1.00 0.00 ? 12 LYS A CD   7  
ATOM 9788  C CE   . LYS A 1 12 ? -0.887  1.647   15.150  1.00 0.00 ? 12 LYS A CE   7  
ATOM 9789  N NZ   . LYS A 1 12 ? 0.411   1.034   14.776  1.00 0.00 ? 12 LYS A NZ   7  
ATOM 9790  H H    . LYS A 1 12 ? 0.316   7.040   16.943  1.00 0.00 ? 12 LYS A H    7  
ATOM 9791  H HA   . LYS A 1 12 ? 2.358   5.689   15.265  1.00 0.00 ? 12 LYS A HA   7  
ATOM 9792  H HB2  . LYS A 1 12 ? -0.671  5.871   14.845  1.00 0.00 ? 12 LYS A HB2  7  
ATOM 9793  H HB3  . LYS A 1 12 ? 0.464   5.248   13.646  1.00 0.00 ? 12 LYS A HB3  7  
ATOM 9794  H HG2  . LYS A 1 12 ? 1.109   3.446   15.188  1.00 0.00 ? 12 LYS A HG2  7  
ATOM 9795  H HG3  . LYS A 1 12 ? -0.029  4.063   16.392  1.00 0.00 ? 12 LYS A HG3  7  
ATOM 9796  H HD2  . LYS A 1 12 ? -1.921  3.519   14.982  1.00 0.00 ? 12 LYS A HD2  7  
ATOM 9797  H HD3  . LYS A 1 12 ? -0.867  3.144   13.614  1.00 0.00 ? 12 LYS A HD3  7  
ATOM 9798  H HE2  . LYS A 1 12 ? -1.003  1.597   16.225  1.00 0.00 ? 12 LYS A HE2  7  
ATOM 9799  H HE3  . LYS A 1 12 ? -1.686  1.089   14.677  1.00 0.00 ? 12 LYS A HE3  7  
ATOM 9800  H HZ1  . LYS A 1 12 ? 0.470   0.063   15.143  1.00 0.00 ? 12 LYS A HZ1  7  
ATOM 9801  H HZ2  . LYS A 1 12 ? 1.200   1.590   15.165  1.00 0.00 ? 12 LYS A HZ2  7  
ATOM 9802  H HZ3  . LYS A 1 12 ? 0.509   1.001   13.741  1.00 0.00 ? 12 LYS A HZ3  7  
ATOM 9803  N N    . ARG A 1 13 ? 2.744   7.939   14.238  1.00 0.00 ? 13 ARG A N    7  
ATOM 9804  C CA   . ARG A 1 13 ? 3.011   9.226   13.587  1.00 0.00 ? 13 ARG A CA   7  
ATOM 9805  C C    . ARG A 1 13 ? 2.782   9.101   12.067  1.00 0.00 ? 13 ARG A C    7  
ATOM 9806  O O    . ARG A 1 13 ? 3.708   8.789   11.304  1.00 0.00 ? 13 ARG A O    7  
ATOM 9807  C CB   . ARG A 1 13 ? 4.459   9.700   13.917  1.00 0.00 ? 13 ARG A CB   7  
ATOM 9808  C CG   . ARG A 1 13 ? 4.768   11.168  13.533  1.00 0.00 ? 13 ARG A CG   7  
ATOM 9809  C CD   . ARG A 1 13 ? 6.236   11.558  13.789  1.00 0.00 ? 13 ARG A CD   7  
ATOM 9810  N NE   . ARG A 1 13 ? 7.176   10.738  12.995  1.00 0.00 ? 13 ARG A NE   7  
ATOM 9811  C CZ   . ARG A 1 13 ? 8.280   11.183  12.370  1.00 0.00 ? 13 ARG A CZ   7  
ATOM 9812  N NH1  . ARG A 1 13 ? 8.633   12.463  12.415  1.00 0.00 ? 13 ARG A NH1  7  
ATOM 9813  N NH2  . ARG A 1 13 ? 9.021   10.327  11.687  1.00 0.00 ? 13 ARG A NH2  7  
ATOM 9814  H H    . ARG A 1 13 ? 3.493   7.330   14.397  1.00 0.00 ? 13 ARG A H    7  
ATOM 9815  H HA   . ARG A 1 13 ? 2.308   9.957   13.985  1.00 0.00 ? 13 ARG A HA   7  
ATOM 9816  H HB2  . ARG A 1 13 ? 4.623   9.591   14.983  1.00 0.00 ? 13 ARG A HB2  7  
ATOM 9817  H HB3  . ARG A 1 13 ? 5.159   9.056   13.395  1.00 0.00 ? 13 ARG A HB3  7  
ATOM 9818  H HG2  . ARG A 1 13 ? 4.554   11.307  12.481  1.00 0.00 ? 13 ARG A HG2  7  
ATOM 9819  H HG3  . ARG A 1 13 ? 4.128   11.824  14.114  1.00 0.00 ? 13 ARG A HG3  7  
ATOM 9820  H HD2  . ARG A 1 13 ? 6.368   12.604  13.530  1.00 0.00 ? 13 ARG A HD2  7  
ATOM 9821  H HD3  . ARG A 1 13 ? 6.459   11.424  14.840  1.00 0.00 ? 13 ARG A HD3  7  
ATOM 9822  H HE   . ARG A 1 13 ? 6.972   9.782   12.933  1.00 0.00 ? 13 ARG A HE   7  
ATOM 9823  H HH11 . ARG A 1 13 ? 8.073   13.125  12.916  1.00 0.00 ? 13 ARG A HH11 7  
ATOM 9824  H HH12 . ARG A 1 13 ? 9.460   12.777  11.941  1.00 0.00 ? 13 ARG A HH12 7  
ATOM 9825  H HH21 . ARG A 1 13 ? 8.756   9.358   11.641  1.00 0.00 ? 13 ARG A HH21 7  
ATOM 9826  H HH22 . ARG A 1 13 ? 9.848   10.641  11.214  1.00 0.00 ? 13 ARG A HH22 7  
ATOM 9827  N N    . SER A 1 14 ? 1.514   9.265   11.654  1.00 0.00 ? 14 SER A N    7  
ATOM 9828  C CA   . SER A 1 14 ? 1.135   9.394   10.237  1.00 0.00 ? 14 SER A CA   7  
ATOM 9829  C C    . SER A 1 14 ? 1.452   10.835  9.801   1.00 0.00 ? 14 SER A C    7  
ATOM 9830  O O    . SER A 1 14 ? 0.603   11.732  9.912   1.00 0.00 ? 14 SER A O    7  
ATOM 9831  C CB   . SER A 1 14 ? -0.370  9.054   10.035  1.00 0.00 ? 14 SER A CB   7  
ATOM 9832  O OG   . SER A 1 14 ? -0.669  7.732   10.461  1.00 0.00 ? 14 SER A OG   7  
ATOM 9833  H H    . SER A 1 14 ? 0.809   9.302   12.331  1.00 0.00 ? 14 SER A H    7  
ATOM 9834  H HA   . SER A 1 14 ? 1.737   8.700   9.647   1.00 0.00 ? 14 SER A HA   7  
ATOM 9835  H HB2  . SER A 1 14 ? -0.978  9.740   10.612  1.00 0.00 ? 14 SER A HB2  7  
ATOM 9836  H HB3  . SER A 1 14 ? -0.630  9.142   8.987   1.00 0.00 ? 14 SER A HB3  7  
ATOM 9837  H HG   . SER A 1 14 ? -1.412  7.751   11.080  1.00 0.00 ? 14 SER A HG   7  
ATOM 9838  N N    . GLY A 1 15 ? 2.704   11.045  9.352   1.00 0.00 ? 15 GLY A N    7  
ATOM 9839  C CA   . GLY A 1 15 ? 3.231   12.379  9.081   1.00 0.00 ? 15 GLY A CA   7  
ATOM 9840  C C    . GLY A 1 15 ? 2.587   13.052  7.881   1.00 0.00 ? 15 GLY A C    7  
ATOM 9841  O O    . GLY A 1 15 ? 1.663   13.857  8.031   1.00 0.00 ? 15 GLY A O    7  
ATOM 9842  H H    . GLY A 1 15 ? 3.283   10.266  9.196   1.00 0.00 ? 15 GLY A H    7  
ATOM 9843  H HA2  . GLY A 1 15 ? 3.091   13.003  9.959   1.00 0.00 ? 15 GLY A HA2  7  
ATOM 9844  H HA3  . GLY A 1 15 ? 4.298   12.290  8.902   1.00 0.00 ? 15 GLY A HA3  7  
ATOM 9845  N N    . ARG A 1 16 ? 3.033   12.660  6.688   1.00 0.00 ? 16 ARG A N    7  
ATOM 9846  C CA   . ARG A 1 16 ? 2.726   13.366  5.430   1.00 0.00 ? 16 ARG A CA   7  
ATOM 9847  C C    . ARG A 1 16 ? 1.888   12.477  4.484   1.00 0.00 ? 16 ARG A C    7  
ATOM 9848  O O    . ARG A 1 16 ? 2.263   11.343  4.183   1.00 0.00 ? 16 ARG A O    7  
ATOM 9849  C CB   . ARG A 1 16 ? 4.060   13.830  4.767   1.00 0.00 ? 16 ARG A CB   7  
ATOM 9850  C CG   . ARG A 1 16 ? 5.199   12.779  4.784   1.00 0.00 ? 16 ARG A CG   7  
ATOM 9851  C CD   . ARG A 1 16 ? 6.443   13.234  4.003   1.00 0.00 ? 16 ARG A CD   7  
ATOM 9852  N NE   . ARG A 1 16 ? 6.138   13.440  2.579   1.00 0.00 ? 16 ARG A NE   7  
ATOM 9853  C CZ   . ARG A 1 16 ? 6.989   13.265  1.562   1.00 0.00 ? 16 ARG A CZ   7  
ATOM 9854  N NH1  . ARG A 1 16 ? 8.247   12.880  1.765   1.00 0.00 ? 16 ARG A NH1  7  
ATOM 9855  N NH2  . ARG A 1 16 ? 6.560   13.477  0.332   1.00 0.00 ? 16 ARG A NH2  7  
ATOM 9856  H H    . ARG A 1 16 ? 3.585   11.847  6.651   1.00 0.00 ? 16 ARG A H    7  
ATOM 9857  H HA   . ARG A 1 16 ? 2.139   14.253  5.673   1.00 0.00 ? 16 ARG A HA   7  
ATOM 9858  H HB2  . ARG A 1 16 ? 3.866   14.105  3.735   1.00 0.00 ? 16 ARG A HB2  7  
ATOM 9859  H HB3  . ARG A 1 16 ? 4.415   14.714  5.291   1.00 0.00 ? 16 ARG A HB3  7  
ATOM 9860  H HG2  . ARG A 1 16 ? 5.485   12.594  5.814   1.00 0.00 ? 16 ARG A HG2  7  
ATOM 9861  H HG3  . ARG A 1 16 ? 4.832   11.854  4.351   1.00 0.00 ? 16 ARG A HG3  7  
ATOM 9862  H HD2  . ARG A 1 16 ? 6.808   14.165  4.424   1.00 0.00 ? 16 ARG A HD2  7  
ATOM 9863  H HD3  . ARG A 1 16 ? 7.214   12.474  4.100   1.00 0.00 ? 16 ARG A HD3  7  
ATOM 9864  H HE   . ARG A 1 16 ? 5.226   13.743  2.366   1.00 0.00 ? 16 ARG A HE   7  
ATOM 9865  H HH11 . ARG A 1 16 ? 8.583   12.712  2.694   1.00 0.00 ? 16 ARG A HH11 7  
ATOM 9866  H HH12 . ARG A 1 16 ? 8.870   12.754  0.985   1.00 0.00 ? 16 ARG A HH12 7  
ATOM 9867  H HH21 . ARG A 1 16 ? 5.613   13.765  0.175   1.00 0.00 ? 16 ARG A HH21 7  
ATOM 9868  H HH22 . ARG A 1 16 ? 7.180   13.352  -0.450  1.00 0.00 ? 16 ARG A HH22 7  
ATOM 9869  N N    . GLU A 1 17 ? 0.737   13.005  4.026   1.00 0.00 ? 17 GLU A N    7  
ATOM 9870  C CA   . GLU A 1 17 ? -0.158  12.296  3.102   1.00 0.00 ? 17 GLU A CA   7  
ATOM 9871  C C    . GLU A 1 17 ? 0.315   12.529  1.654   1.00 0.00 ? 17 GLU A C    7  
ATOM 9872  O O    . GLU A 1 17 ? 0.524   13.673  1.247   1.00 0.00 ? 17 GLU A O    7  
ATOM 9873  C CB   . GLU A 1 17 ? -1.630  12.767  3.257   1.00 0.00 ? 17 GLU A CB   7  
ATOM 9874  C CG   . GLU A 1 17 ? -2.634  11.980  2.379   1.00 0.00 ? 17 GLU A CG   7  
ATOM 9875  C CD   . GLU A 1 17 ? -4.059  12.543  2.421   1.00 0.00 ? 17 GLU A CD   7  
ATOM 9876  O OE1  . GLU A 1 17 ? -4.781  12.300  3.410   1.00 0.00 ? 17 GLU A OE1  7  
ATOM 9877  O OE2  . GLU A 1 17 ? -4.467  13.248  1.469   1.00 0.00 ? 17 GLU A OE2  7  
ATOM 9878  H H    . GLU A 1 17 ? 0.500   13.913  4.290   1.00 0.00 ? 17 GLU A H    7  
ATOM 9879  H HA   . GLU A 1 17 ? -0.109  11.228  3.336   1.00 0.00 ? 17 GLU A HA   7  
ATOM 9880  H HB2  . GLU A 1 17 ? -1.928  12.658  4.299   1.00 0.00 ? 17 GLU A HB2  7  
ATOM 9881  H HB3  . GLU A 1 17 ? -1.691  13.817  2.993   1.00 0.00 ? 17 GLU A HB3  7  
ATOM 9882  H HG2  . GLU A 1 17 ? -2.281  11.991  1.353   1.00 0.00 ? 17 GLU A HG2  7  
ATOM 9883  H HG3  . GLU A 1 17 ? -2.660  10.948  2.720   1.00 0.00 ? 17 GLU A HG3  7  
ATOM 9884  N N    . ILE A 1 18 ? 0.486   11.436  0.911   1.00 0.00 ? 18 ILE A N    7  
ATOM 9885  C CA   . ILE A 1 18 ? 0.893   11.414  -0.502  1.00 0.00 ? 18 ILE A CA   7  
ATOM 9886  C C    . ILE A 1 18 ? -0.295  10.965  -1.376  1.00 0.00 ? 18 ILE A C    7  
ATOM 9887  O O    . ILE A 1 18 ? -1.387  10.657  -0.869  1.00 0.00 ? 18 ILE A O    7  
ATOM 9888  C CB   . ILE A 1 18 ? 2.097   10.407  -0.713  1.00 0.00 ? 18 ILE A CB   7  
ATOM 9889  C CG1  . ILE A 1 18 ? 1.677   8.951   -0.292  1.00 0.00 ? 18 ILE A CG1  7  
ATOM 9890  C CG2  . ILE A 1 18 ? 3.358   10.881  0.050   1.00 0.00 ? 18 ILE A CG2  7  
ATOM 9891  C CD1  . ILE A 1 18 ? 2.714   7.883   -0.567  1.00 0.00 ? 18 ILE A CD1  7  
ATOM 9892  H H    . ILE A 1 18 ? 0.319   10.583  1.330   1.00 0.00 ? 18 ILE A H    7  
ATOM 9893  H HA   . ILE A 1 18 ? 1.208   12.409  -0.812  1.00 0.00 ? 18 ILE A HA   7  
ATOM 9894  H HB   . ILE A 1 18 ? 2.348   10.400  -1.776  1.00 0.00 ? 18 ILE A HB   7  
ATOM 9895  H HG12 . ILE A 1 18 ? 1.465   8.928   0.771   1.00 0.00 ? 18 ILE A HG12 7  
ATOM 9896  H HG13 . ILE A 1 18 ? 0.777   8.668   -0.828  1.00 0.00 ? 18 ILE A HG13 7  
ATOM 9897  H HG21 . ILE A 1 18 ? 3.637   11.874  -0.281  1.00 0.00 ? 18 ILE A HG21 7  
ATOM 9898  H HG22 . ILE A 1 18 ? 4.184   10.202  -0.142  1.00 0.00 ? 18 ILE A HG22 7  
ATOM 9899  H HG23 . ILE A 1 18 ? 3.155   10.902  1.112   1.00 0.00 ? 18 ILE A HG23 7  
ATOM 9900  H HD11 . ILE A 1 18 ? 3.617   8.101   -0.014  1.00 0.00 ? 18 ILE A HD11 7  
ATOM 9901  H HD12 . ILE A 1 18 ? 2.935   7.859   -1.623  1.00 0.00 ? 18 ILE A HD12 7  
ATOM 9902  H HD13 . ILE A 1 18 ? 2.330   6.921   -0.259  1.00 0.00 ? 18 ILE A HD13 7  
ATOM 9903  N N    . THR A 1 19 ? -0.052  10.912  -2.692  1.00 0.00 ? 19 THR A N    7  
ATOM 9904  C CA   . THR A 1 19 ? -1.004  10.402  -3.683  1.00 0.00 ? 19 THR A CA   7  
ATOM 9905  C C    . THR A 1 19 ? -0.785  8.885   -3.873  1.00 0.00 ? 19 THR A C    7  
ATOM 9906  O O    . THR A 1 19 ? 0.314   8.384   -3.608  1.00 0.00 ? 19 THR A O    7  
ATOM 9907  C CB   . THR A 1 19 ? -0.818  11.155  -5.044  1.00 0.00 ? 19 THR A CB   7  
ATOM 9908  O OG1  . THR A 1 19 ? 0.502   10.921  -5.565  1.00 0.00 ? 19 THR A OG1  7  
ATOM 9909  C CG2  . THR A 1 19 ? -1.046  12.673  -4.885  1.00 0.00 ? 19 THR A CG2  7  
ATOM 9910  H H    . THR A 1 19 ? 0.818   11.208  -3.010  1.00 0.00 ? 19 THR A H    7  
ATOM 9911  H HA   . THR A 1 19 ? -2.022  10.574  -3.326  1.00 0.00 ? 19 THR A HA   7  
ATOM 9912  H HB   . THR A 1 19 ? -1.537  10.771  -5.763  1.00 0.00 ? 19 THR A HB   7  
ATOM 9913  H HG1  . THR A 1 19 ? 1.156   11.309  -4.972  1.00 0.00 ? 19 THR A HG1  7  
ATOM 9914  H HG21 . THR A 1 19 ? -2.050  12.856  -4.518  1.00 0.00 ? 19 THR A HG21 7  
ATOM 9915  H HG22 . THR A 1 19 ? -0.920  13.169  -5.840  1.00 0.00 ? 19 THR A HG22 7  
ATOM 9916  H HG23 . THR A 1 19 ? -0.331  13.078  -4.180  1.00 0.00 ? 19 THR A HG23 7  
ATOM 9917  N N    . TRP A 1 20 ? -1.848  8.165   -4.296  1.00 0.00 ? 20 TRP A N    7  
ATOM 9918  C CA   . TRP A 1 20 ? -1.787  6.716   -4.596  1.00 0.00 ? 20 TRP A CA   7  
ATOM 9919  C C    . TRP A 1 20 ? -0.768  6.446   -5.713  1.00 0.00 ? 20 TRP A C    7  
ATOM 9920  O O    . TRP A 1 20 ? -0.003  5.491   -5.631  1.00 0.00 ? 20 TRP A O    7  
ATOM 9921  C CB   . TRP A 1 20 ? -3.197  6.160   -4.986  1.00 0.00 ? 20 TRP A CB   7  
ATOM 9922  C CG   . TRP A 1 20 ? -3.183  4.731   -5.529  1.00 0.00 ? 20 TRP A CG   7  
ATOM 9923  C CD1  . TRP A 1 20 ? -3.216  4.352   -6.844  1.00 0.00 ? 20 TRP A CD1  7  
ATOM 9924  C CD2  . TRP A 1 20 ? -3.111  3.506   -4.777  1.00 0.00 ? 20 TRP A CD2  7  
ATOM 9925  N NE1  . TRP A 1 20 ? -3.168  2.986   -6.948  1.00 0.00 ? 20 TRP A NE1  7  
ATOM 9926  C CE2  . TRP A 1 20 ? -3.108  2.443   -5.699  1.00 0.00 ? 20 TRP A CE2  7  
ATOM 9927  C CE3  . TRP A 1 20 ? -3.054  3.206   -3.421  1.00 0.00 ? 20 TRP A CE3  7  
ATOM 9928  C CZ2  . TRP A 1 20 ? -3.042  1.108   -5.307  1.00 0.00 ? 20 TRP A CZ2  7  
ATOM 9929  C CZ3  . TRP A 1 20 ? -2.993  1.880   -3.031  1.00 0.00 ? 20 TRP A CZ3  7  
ATOM 9930  C CH2  . TRP A 1 20 ? -2.990  0.843   -3.971  1.00 0.00 ? 20 TRP A CH2  7  
ATOM 9931  H H    . TRP A 1 20 ? -2.707  8.624   -4.388  1.00 0.00 ? 20 TRP A H    7  
ATOM 9932  H HA   . TRP A 1 20 ? -1.456  6.214   -3.694  1.00 0.00 ? 20 TRP A HA   7  
ATOM 9933  H HB2  . TRP A 1 20 ? -3.841  6.175   -4.113  1.00 0.00 ? 20 TRP A HB2  7  
ATOM 9934  H HB3  . TRP A 1 20 ? -3.635  6.803   -5.744  1.00 0.00 ? 20 TRP A HB3  7  
ATOM 9935  H HD1  . TRP A 1 20 ? -3.274  5.041   -7.676  1.00 0.00 ? 20 TRP A HD1  7  
ATOM 9936  H HE1  . TRP A 1 20 ? -3.178  2.480   -7.783  1.00 0.00 ? 20 TRP A HE1  7  
ATOM 9937  H HE3  . TRP A 1 20 ? -3.053  3.991   -2.680  1.00 0.00 ? 20 TRP A HE3  7  
ATOM 9938  H HZ2  . TRP A 1 20 ? -3.040  0.300   -6.030  1.00 0.00 ? 20 TRP A HZ2  7  
ATOM 9939  H HZ3  . TRP A 1 20 ? -2.946  1.634   -1.979  1.00 0.00 ? 20 TRP A HZ3  7  
ATOM 9940  H HH2  . TRP A 1 20 ? -2.940  -0.181  -3.618  1.00 0.00 ? 20 TRP A HH2  7  
ATOM 9941  N N    . LYS A 1 21 ? -0.800  7.297   -6.757  1.00 0.00 ? 21 LYS A N    7  
ATOM 9942  C CA   . LYS A 1 21 ? 0.138   7.231   -7.887  1.00 0.00 ? 21 LYS A CA   7  
ATOM 9943  C C    . LYS A 1 21 ? 1.604   7.252   -7.401  1.00 0.00 ? 21 LYS A C    7  
ATOM 9944  O O    . LYS A 1 21 ? 2.403   6.396   -7.786  1.00 0.00 ? 21 LYS A O    7  
ATOM 9945  C CB   . LYS A 1 21 ? -0.137  8.404   -8.861  1.00 0.00 ? 21 LYS A CB   7  
ATOM 9946  C CG   . LYS A 1 21 ? 0.788   8.457   -10.098 1.00 0.00 ? 21 LYS A CG   7  
ATOM 9947  C CD   . LYS A 1 21 ? 0.390   9.590   -11.075 1.00 0.00 ? 21 LYS A CD   7  
ATOM 9948  C CE   . LYS A 1 21 ? 1.364   9.753   -12.253 1.00 0.00 ? 21 LYS A CE   7  
ATOM 9949  N NZ   . LYS A 1 21 ? 2.713   10.183  -11.806 1.00 0.00 ? 21 LYS A NZ   7  
ATOM 9950  H H    . LYS A 1 21 ? -1.504  7.983   -6.783  1.00 0.00 ? 21 LYS A H    7  
ATOM 9951  H HA   . LYS A 1 21 ? -0.048  6.300   -8.412  1.00 0.00 ? 21 LYS A HA   7  
ATOM 9952  H HB2  . LYS A 1 21 ? -1.163  8.323   -9.215  1.00 0.00 ? 21 LYS A HB2  7  
ATOM 9953  H HB3  . LYS A 1 21 ? -0.040  9.341   -8.320  1.00 0.00 ? 21 LYS A HB3  7  
ATOM 9954  H HG2  . LYS A 1 21 ? 1.811   8.617   -9.766  1.00 0.00 ? 21 LYS A HG2  7  
ATOM 9955  H HG3  . LYS A 1 21 ? 0.729   7.506   -10.619 1.00 0.00 ? 21 LYS A HG3  7  
ATOM 9956  H HD2  . LYS A 1 21 ? -0.597  9.379   -11.469 1.00 0.00 ? 21 LYS A HD2  7  
ATOM 9957  H HD3  . LYS A 1 21 ? 0.355   10.526  -10.523 1.00 0.00 ? 21 LYS A HD3  7  
ATOM 9958  H HE2  . LYS A 1 21 ? 1.456   8.810   -12.778 1.00 0.00 ? 21 LYS A HE2  7  
ATOM 9959  H HE3  . LYS A 1 21 ? 0.972   10.500  -12.934 1.00 0.00 ? 21 LYS A HE3  7  
ATOM 9960  H HZ1  . LYS A 1 21 ? 3.358   10.232  -12.617 1.00 0.00 ? 21 LYS A HZ1  7  
ATOM 9961  H HZ2  . LYS A 1 21 ? 3.097   9.509   -11.114 1.00 0.00 ? 21 LYS A HZ2  7  
ATOM 9962  H HZ3  . LYS A 1 21 ? 2.664   11.120  -11.365 1.00 0.00 ? 21 LYS A HZ3  7  
ATOM 9963  N N    . ASP A 1 22 ? 1.925   8.208   -6.507  1.00 0.00 ? 22 ASP A N    7  
ATOM 9964  C CA   . ASP A 1 22 ? 3.283   8.367   -5.964  1.00 0.00 ? 22 ASP A CA   7  
ATOM 9965  C C    . ASP A 1 22 ? 3.620   7.197   -5.023  1.00 0.00 ? 22 ASP A C    7  
ATOM 9966  O O    . ASP A 1 22 ? 4.758   6.741   -4.990  1.00 0.00 ? 22 ASP A O    7  
ATOM 9967  C CB   . ASP A 1 22 ? 3.437   9.722   -5.236  1.00 0.00 ? 22 ASP A CB   7  
ATOM 9968  C CG   . ASP A 1 22 ? 4.889   9.986   -4.791  1.00 0.00 ? 22 ASP A CG   7  
ATOM 9969  O OD1  . ASP A 1 22 ? 5.708   10.379  -5.649  1.00 0.00 ? 22 ASP A OD1  7  
ATOM 9970  O OD2  . ASP A 1 22 ? 5.213   9.809   -3.601  1.00 0.00 ? 22 ASP A OD2  7  
ATOM 9971  H H    . ASP A 1 22 ? 1.225   8.812   -6.180  1.00 0.00 ? 22 ASP A H    7  
ATOM 9972  H HA   . ASP A 1 22 ? 3.976   8.349   -6.807  1.00 0.00 ? 22 ASP A HA   7  
ATOM 9973  H HB2  . ASP A 1 22 ? 3.129   10.524  -5.909  1.00 0.00 ? 22 ASP A HB2  7  
ATOM 9974  H HB3  . ASP A 1 22 ? 2.785   9.746   -4.367  1.00 0.00 ? 22 ASP A HB3  7  
ATOM 9975  N N    . PHE A 1 23 ? 2.604   6.705   -4.287  1.00 0.00 ? 23 PHE A N    7  
ATOM 9976  C CA   . PHE A 1 23 ? 2.742   5.519   -3.420  1.00 0.00 ? 23 PHE A CA   7  
ATOM 9977  C C    . PHE A 1 23 ? 3.250   4.315   -4.227  1.00 0.00 ? 23 PHE A C    7  
ATOM 9978  O O    . PHE A 1 23 ? 4.145   3.607   -3.785  1.00 0.00 ? 23 PHE A O    7  
ATOM 9979  C CB   . PHE A 1 23 ? 1.398   5.179   -2.710  1.00 0.00 ? 23 PHE A CB   7  
ATOM 9980  C CG   . PHE A 1 23 ? 1.351   3.776   -2.108  1.00 0.00 ? 23 PHE A CG   7  
ATOM 9981  C CD1  . PHE A 1 23 ? 2.263   3.384   -1.126  1.00 0.00 ? 23 PHE A CD1  7  
ATOM 9982  C CD2  . PHE A 1 23 ? 0.423   2.836   -2.554  1.00 0.00 ? 23 PHE A CD2  7  
ATOM 9983  C CE1  . PHE A 1 23 ? 2.240   2.103   -0.611  1.00 0.00 ? 23 PHE A CE1  7  
ATOM 9984  C CE2  . PHE A 1 23 ? 0.407   1.559   -2.037  1.00 0.00 ? 23 PHE A CE2  7  
ATOM 9985  C CZ   . PHE A 1 23 ? 1.312   1.196   -1.066  1.00 0.00 ? 23 PHE A CZ   7  
ATOM 9986  H H    . PHE A 1 23 ? 1.736   7.155   -4.325  1.00 0.00 ? 23 PHE A H    7  
ATOM 9987  H HA   . PHE A 1 23 ? 3.479   5.764   -2.662  1.00 0.00 ? 23 PHE A HA   7  
ATOM 9988  H HB2  . PHE A 1 23 ? 1.231   5.887   -1.905  1.00 0.00 ? 23 PHE A HB2  7  
ATOM 9989  H HB3  . PHE A 1 23 ? 0.586   5.272   -3.421  1.00 0.00 ? 23 PHE A HB3  7  
ATOM 9990  H HD1  . PHE A 1 23 ? 2.997   4.091   -0.761  1.00 0.00 ? 23 PHE A HD1  7  
ATOM 9991  H HD2  . PHE A 1 23 ? -0.297  3.112   -3.315  1.00 0.00 ? 23 PHE A HD2  7  
ATOM 9992  H HE1  . PHE A 1 23 ? 2.951   1.810   0.155   1.00 0.00 ? 23 PHE A HE1  7  
ATOM 9993  H HE2  . PHE A 1 23 ? -0.322  0.838   -2.395  1.00 0.00 ? 23 PHE A HE2  7  
ATOM 9994  H HZ   . PHE A 1 23 ? 1.294   0.190   -0.664  1.00 0.00 ? 23 PHE A HZ   7  
ATOM 9995  N N    . VAL A 1 24 ? 2.649   4.100   -5.398  1.00 0.00 ? 24 VAL A N    7  
ATOM 9996  C CA   . VAL A 1 24 ? 3.008   2.999   -6.288  1.00 0.00 ? 24 VAL A CA   7  
ATOM 9997  C C    . VAL A 1 24 ? 4.469   3.129   -6.756  1.00 0.00 ? 24 VAL A C    7  
ATOM 9998  O O    . VAL A 1 24 ? 5.346   2.437   -6.253  1.00 0.00 ? 24 VAL A O    7  
ATOM 9999  C CB   . VAL A 1 24 ? 2.030   2.943   -7.517  1.00 0.00 ? 24 VAL A CB   7  
ATOM 10000 C CG1  . VAL A 1 24 ? 2.464   1.874   -8.550  1.00 0.00 ? 24 VAL A CG1  7  
ATOM 10001 C CG2  . VAL A 1 24 ? 0.576   2.704   -7.036  1.00 0.00 ? 24 VAL A CG2  7  
ATOM 10002 H H    . VAL A 1 24 ? 1.923   4.697   -5.676  1.00 0.00 ? 24 VAL A H    7  
ATOM 10003 H HA   . VAL A 1 24 ? 2.898   2.066   -5.732  1.00 0.00 ? 24 VAL A HA   7  
ATOM 10004 H HB   . VAL A 1 24 ? 2.061   3.913   -8.014  1.00 0.00 ? 24 VAL A HB   7  
ATOM 10005 H HG11 . VAL A 1 24 ? 3.450   2.108   -8.933  1.00 0.00 ? 24 VAL A HG11 7  
ATOM 10006 H HG12 . VAL A 1 24 ? 1.762   1.852   -9.375  1.00 0.00 ? 24 VAL A HG12 7  
ATOM 10007 H HG13 . VAL A 1 24 ? 2.486   0.898   -8.079  1.00 0.00 ? 24 VAL A HG13 7  
ATOM 10008 H HG21 . VAL A 1 24 ? 0.516   1.759   -6.516  1.00 0.00 ? 24 VAL A HG21 7  
ATOM 10009 H HG22 . VAL A 1 24 ? -0.099  2.690   -7.884  1.00 0.00 ? 24 VAL A HG22 7  
ATOM 10010 H HG23 . VAL A 1 24 ? 0.278   3.497   -6.362  1.00 0.00 ? 24 VAL A HG23 7  
ATOM 10011 N N    . ASN A 1 25 ? 4.722   4.113   -7.625  1.00 0.00 ? 25 ASN A N    7  
ATOM 10012 C CA   . ASN A 1 25 ? 5.939   4.142   -8.461  1.00 0.00 ? 25 ASN A CA   7  
ATOM 10013 C C    . ASN A 1 25 ? 7.193   4.505   -7.640  1.00 0.00 ? 25 ASN A C    7  
ATOM 10014 O O    . ASN A 1 25 ? 8.295   4.027   -7.931  1.00 0.00 ? 25 ASN A O    7  
ATOM 10015 C CB   . ASN A 1 25 ? 5.755   5.120   -9.649  1.00 0.00 ? 25 ASN A CB   7  
ATOM 10016 C CG   . ASN A 1 25 ? 4.512   4.805   -10.487 1.00 0.00 ? 25 ASN A CG   7  
ATOM 10017 O OD1  . ASN A 1 25 ? 4.551   3.989   -11.404 1.00 0.00 ? 25 ASN A OD1  7  
ATOM 10018 N ND2  . ASN A 1 25 ? 3.405   5.460   -10.192 1.00 0.00 ? 25 ASN A ND2  7  
ATOM 10019 H H    . ASN A 1 25 ? 4.097   4.864   -7.659  1.00 0.00 ? 25 ASN A H    7  
ATOM 10020 H HA   . ASN A 1 25 ? 6.075   3.139   -8.869  1.00 0.00 ? 25 ASN A HA   7  
ATOM 10021 H HB2  . ASN A 1 25 ? 5.666   6.134   -9.272  1.00 0.00 ? 25 ASN A HB2  7  
ATOM 10022 H HB3  . ASN A 1 25 ? 6.623   5.062   -10.296 1.00 0.00 ? 25 ASN A HB3  7  
ATOM 10023 H HD21 . ASN A 1 25 ? 3.437   6.116   -9.467  1.00 0.00 ? 25 ASN A HD21 7  
ATOM 10024 H HD22 . ASN A 1 25 ? 2.591   5.257   -10.702 1.00 0.00 ? 25 ASN A HD22 7  
ATOM 10025 N N    . ASN A 1 26 ? 7.008   5.334   -6.601  1.00 0.00 ? 26 ASN A N    7  
ATOM 10026 C CA   . ASN A 1 26 ? 8.103   5.850   -5.764  1.00 0.00 ? 26 ASN A CA   7  
ATOM 10027 C C    . ASN A 1 26 ? 8.379   4.934   -4.543  1.00 0.00 ? 26 ASN A C    7  
ATOM 10028 O O    . ASN A 1 26 ? 9.491   4.948   -4.013  1.00 0.00 ? 26 ASN A O    7  
ATOM 10029 C CB   . ASN A 1 26 ? 7.724   7.292   -5.311  1.00 0.00 ? 26 ASN A CB   7  
ATOM 10030 C CG   . ASN A 1 26 ? 8.779   8.041   -4.507  1.00 0.00 ? 26 ASN A CG   7  
ATOM 10031 O OD1  . ASN A 1 26 ? 9.980   7.862   -4.701  1.00 0.00 ? 26 ASN A OD1  7  
ATOM 10032 N ND2  . ASN A 1 26 ? 8.333   8.911   -3.612  1.00 0.00 ? 26 ASN A ND2  7  
ATOM 10033 H H    . ASN A 1 26 ? 6.109   5.660   -6.387  1.00 0.00 ? 26 ASN A H    7  
ATOM 10034 H HA   . ASN A 1 26 ? 9.005   5.907   -6.370  1.00 0.00 ? 26 ASN A HA   7  
ATOM 10035 H HB2  . ASN A 1 26 ? 7.513   7.888   -6.190  1.00 0.00 ? 26 ASN A HB2  7  
ATOM 10036 H HB3  . ASN A 1 26 ? 6.816   7.240   -4.714  1.00 0.00 ? 26 ASN A HB3  7  
ATOM 10037 H HD21 . ASN A 1 26 ? 7.359   9.024   -3.520  1.00 0.00 ? 26 ASN A HD21 7  
ATOM 10038 H HD22 . ASN A 1 26 ? 8.988   9.418   -3.092  1.00 0.00 ? 26 ASN A HD22 7  
ATOM 10039 N N    . TYR A 1 27 ? 7.383   4.123   -4.092  1.00 0.00 ? 27 TYR A N    7  
ATOM 10040 C CA   . TYR A 1 27 ? 7.519   3.330   -2.834  1.00 0.00 ? 27 TYR A CA   7  
ATOM 10041 C C    . TYR A 1 27 ? 7.282   1.811   -3.035  1.00 0.00 ? 27 TYR A C    7  
ATOM 10042 O O    . TYR A 1 27 ? 8.207   1.011   -2.844  1.00 0.00 ? 27 TYR A O    7  
ATOM 10043 C CB   . TYR A 1 27 ? 6.574   3.893   -1.738  1.00 0.00 ? 27 TYR A CB   7  
ATOM 10044 C CG   . TYR A 1 27 ? 6.878   5.341   -1.321  1.00 0.00 ? 27 TYR A CG   7  
ATOM 10045 C CD1  . TYR A 1 27 ? 8.038   5.654   -0.611  1.00 0.00 ? 27 TYR A CD1  7  
ATOM 10046 C CD2  . TYR A 1 27 ? 6.013   6.396   -1.631  1.00 0.00 ? 27 TYR A CD2  7  
ATOM 10047 C CE1  . TYR A 1 27 ? 8.319   6.945   -0.219  1.00 0.00 ? 27 TYR A CE1  7  
ATOM 10048 C CE2  . TYR A 1 27 ? 6.294   7.694   -1.235  1.00 0.00 ? 27 TYR A CE2  7  
ATOM 10049 C CZ   . TYR A 1 27 ? 7.449   7.961   -0.532  1.00 0.00 ? 27 TYR A CZ   7  
ATOM 10050 O OH   . TYR A 1 27 ? 7.731   9.246   -0.125  1.00 0.00 ? 27 TYR A OH   7  
ATOM 10051 H H    . TYR A 1 27 ? 6.543   4.065   -4.604  1.00 0.00 ? 27 TYR A H    7  
ATOM 10052 H HA   . TYR A 1 27 ? 8.543   3.449   -2.478  1.00 0.00 ? 27 TYR A HA   7  
ATOM 10053 H HB2  . TYR A 1 27 ? 5.551   3.848   -2.093  1.00 0.00 ? 27 TYR A HB2  7  
ATOM 10054 H HB3  . TYR A 1 27 ? 6.654   3.275   -0.847  1.00 0.00 ? 27 TYR A HB3  7  
ATOM 10055 H HD1  . TYR A 1 27 ? 8.731   4.862   -0.357  1.00 0.00 ? 27 TYR A HD1  7  
ATOM 10056 H HD2  . TYR A 1 27 ? 5.108   6.191   -2.179  1.00 0.00 ? 27 TYR A HD2  7  
ATOM 10057 H HE1  . TYR A 1 27 ? 9.229   7.156   0.332   1.00 0.00 ? 27 TYR A HE1  7  
ATOM 10058 H HE2  . TYR A 1 27 ? 5.610   8.499   -1.488  1.00 0.00 ? 27 TYR A HE2  7  
ATOM 10059 H HH   . TYR A 1 27 ? 8.679   9.399   -0.188  1.00 0.00 ? 27 TYR A HH   7  
ATOM 10060 N N    . LEU A 1 28 ? 6.033   1.424   -3.379  1.00 0.00 ? 28 LEU A N    7  
ATOM 10061 C CA   . LEU A 1 28 ? 5.611   0.001   -3.494  1.00 0.00 ? 28 LEU A CA   7  
ATOM 10062 C C    . LEU A 1 28 ? 6.447   -0.749  -4.544  1.00 0.00 ? 28 LEU A C    7  
ATOM 10063 O O    . LEU A 1 28 ? 6.980   -1.831  -4.271  1.00 0.00 ? 28 LEU A O    7  
ATOM 10064 C CB   . LEU A 1 28 ? 4.088   -0.087  -3.805  1.00 0.00 ? 28 LEU A CB   7  
ATOM 10065 C CG   . LEU A 1 28 ? 3.437   -1.535  -3.813  1.00 0.00 ? 28 LEU A CG   7  
ATOM 10066 C CD1  . LEU A 1 28 ? 1.974   -1.499  -3.341  1.00 0.00 ? 28 LEU A CD1  7  
ATOM 10067 C CD2  . LEU A 1 28 ? 3.517   -2.217  -5.208  1.00 0.00 ? 28 LEU A CD2  7  
ATOM 10068 H H    . LEU A 1 28 ? 5.369   2.120   -3.532  1.00 0.00 ? 28 LEU A H    7  
ATOM 10069 H HA   . LEU A 1 28 ? 5.781   -0.459  -2.527  1.00 0.00 ? 28 LEU A HA   7  
ATOM 10070 H HB2  . LEU A 1 28 ? 3.576   0.521   -3.063  1.00 0.00 ? 28 LEU A HB2  7  
ATOM 10071 H HB3  . LEU A 1 28 ? 3.915   0.372   -4.774  1.00 0.00 ? 28 LEU A HB3  7  
ATOM 10072 H HG   . LEU A 1 28 ? 3.971   -2.166  -3.111  1.00 0.00 ? 28 LEU A HG   7  
ATOM 10073 H HD11 . LEU A 1 28 ? 1.935   -1.106  -2.333  1.00 0.00 ? 28 LEU A HD11 7  
ATOM 10074 H HD12 . LEU A 1 28 ? 1.565   -2.498  -3.347  1.00 0.00 ? 28 LEU A HD12 7  
ATOM 10075 H HD13 . LEU A 1 28 ? 1.391   -0.863  -3.995  1.00 0.00 ? 28 LEU A HD13 7  
ATOM 10076 H HD21 . LEU A 1 28 ? 4.553   -2.333  -5.495  1.00 0.00 ? 28 LEU A HD21 7  
ATOM 10077 H HD22 . LEU A 1 28 ? 3.010   -1.605  -5.944  1.00 0.00 ? 28 LEU A HD22 7  
ATOM 10078 H HD23 . LEU A 1 28 ? 3.050   -3.194  -5.172  1.00 0.00 ? 28 LEU A HD23 7  
ATOM 10079 N N    . SER A 1 29 ? 6.552   -0.145  -5.730  1.00 0.00 ? 29 SER A N    7  
ATOM 10080 C CA   . SER A 1 29 ? 7.332   -0.662  -6.862  1.00 0.00 ? 29 SER A CA   7  
ATOM 10081 C C    . SER A 1 29 ? 8.843   -0.710  -6.554  1.00 0.00 ? 29 SER A C    7  
ATOM 10082 O O    . SER A 1 29 ? 9.592   -1.437  -7.212  1.00 0.00 ? 29 SER A O    7  
ATOM 10083 C CB   . SER A 1 29 ? 7.069   0.229   -8.087  1.00 0.00 ? 29 SER A CB   7  
ATOM 10084 O OG   . SER A 1 29 ? 5.676   0.372   -8.320  1.00 0.00 ? 29 SER A OG   7  
ATOM 10085 H H    . SER A 1 29 ? 6.057   0.677   -5.874  1.00 0.00 ? 29 SER A H    7  
ATOM 10086 H HA   . SER A 1 29 ? 6.982   -1.668  -7.077  1.00 0.00 ? 29 SER A HA   7  
ATOM 10087 H HB2  . SER A 1 29 ? 7.490   1.212   -7.923  1.00 0.00 ? 29 SER A HB2  7  
ATOM 10088 H HB3  . SER A 1 29 ? 7.521   -0.213  -8.969  1.00 0.00 ? 29 SER A HB3  7  
ATOM 10089 H HG   . SER A 1 29 ? 5.436   -0.102  -9.117  1.00 0.00 ? 29 SER A HG   7  
ATOM 10090 N N    . LYS A 1 30 ? 9.282   0.082   -5.555  1.00 0.00 ? 30 LYS A N    7  
ATOM 10091 C CA   . LYS A 1 30 ? 10.693  0.143   -5.123  1.00 0.00 ? 30 LYS A CA   7  
ATOM 10092 C C    . LYS A 1 30 ? 10.944  -0.762  -3.898  1.00 0.00 ? 30 LYS A C    7  
ATOM 10093 O O    . LYS A 1 30 ? 12.068  -0.819  -3.401  1.00 0.00 ? 30 LYS A O    7  
ATOM 10094 C CB   . LYS A 1 30 ? 11.088  1.611   -4.809  1.00 0.00 ? 30 LYS A CB   7  
ATOM 10095 C CG   . LYS A 1 30 ? 10.938  2.580   -6.000  1.00 0.00 ? 30 LYS A CG   7  
ATOM 10096 C CD   . LYS A 1 30 ? 11.749  2.134   -7.241  1.00 0.00 ? 30 LYS A CD   7  
ATOM 10097 C CE   . LYS A 1 30 ? 11.643  3.126   -8.414  1.00 0.00 ? 30 LYS A CE   7  
ATOM 10098 N NZ   . LYS A 1 30 ? 12.226  4.453   -8.097  1.00 0.00 ? 30 LYS A NZ   7  
ATOM 10099 H H    . LYS A 1 30 ? 8.642   0.647   -5.076  1.00 0.00 ? 30 LYS A H    7  
ATOM 10100 H HA   . LYS A 1 30 ? 11.316  -0.214  -5.944  1.00 0.00 ? 30 LYS A HA   7  
ATOM 10101 H HB2  . LYS A 1 30 ? 10.464  1.980   -3.994  1.00 0.00 ? 30 LYS A HB2  7  
ATOM 10102 H HB3  . LYS A 1 30 ? 12.123  1.634   -4.483  1.00 0.00 ? 30 LYS A HB3  7  
ATOM 10103 H HG2  . LYS A 1 30 ? 9.887   2.639   -6.269  1.00 0.00 ? 30 LYS A HG2  7  
ATOM 10104 H HG3  . LYS A 1 30 ? 11.276  3.565   -5.691  1.00 0.00 ? 30 LYS A HG3  7  
ATOM 10105 H HD2  . LYS A 1 30 ? 12.794  2.040   -6.964  1.00 0.00 ? 30 LYS A HD2  7  
ATOM 10106 H HD3  . LYS A 1 30 ? 11.384  1.162   -7.570  1.00 0.00 ? 30 LYS A HD3  7  
ATOM 10107 H HE2  . LYS A 1 30 ? 12.164  2.718   -9.270  1.00 0.00 ? 30 LYS A HE2  7  
ATOM 10108 H HE3  . LYS A 1 30 ? 10.597  3.258   -8.672  1.00 0.00 ? 30 LYS A HE3  7  
ATOM 10109 H HZ1  . LYS A 1 30 ? 13.231  4.352   -7.853  1.00 0.00 ? 30 LYS A HZ1  7  
ATOM 10110 H HZ2  . LYS A 1 30 ? 11.727  4.884   -7.295  1.00 0.00 ? 30 LYS A HZ2  7  
ATOM 10111 H HZ3  . LYS A 1 30 ? 12.146  5.082   -8.915  1.00 0.00 ? 30 LYS A HZ3  7  
ATOM 10112 N N    . GLY A 1 31 ? 9.883   -1.453  -3.419  1.00 0.00 ? 31 GLY A N    7  
ATOM 10113 C CA   . GLY A 1 31 ? 9.973   -2.419  -2.311  1.00 0.00 ? 31 GLY A CA   7  
ATOM 10114 C C    . GLY A 1 31 ? 10.496  -1.859  -0.990  1.00 0.00 ? 31 GLY A C    7  
ATOM 10115 O O    . GLY A 1 31 ? 11.061  -2.608  -0.179  1.00 0.00 ? 31 GLY A O    7  
ATOM 10116 H H    . GLY A 1 31 ? 9.014   -1.333  -3.857  1.00 0.00 ? 31 GLY A H    7  
ATOM 10117 H HA2  . GLY A 1 31 ? 8.983   -2.810  -2.135  1.00 0.00 ? 31 GLY A HA2  7  
ATOM 10118 H HA3  . GLY A 1 31 ? 10.610  -3.241  -2.616  1.00 0.00 ? 31 GLY A HA3  7  
ATOM 10119 N N    . VAL A 1 32 ? 10.305  -0.545  -0.767  1.00 0.00 ? 32 VAL A N    7  
ATOM 10120 C CA   . VAL A 1 32 ? 10.724  0.129   0.487   1.00 0.00 ? 32 VAL A CA   7  
ATOM 10121 C C    . VAL A 1 32 ? 9.595   0.115   1.538   1.00 0.00 ? 32 VAL A C    7  
ATOM 10122 O O    . VAL A 1 32 ? 9.744   0.677   2.626   1.00 0.00 ? 32 VAL A O    7  
ATOM 10123 C CB   . VAL A 1 32 ? 11.209  1.606   0.221   1.00 0.00 ? 32 VAL A CB   7  
ATOM 10124 C CG1  . VAL A 1 32 ? 12.362  1.634   -0.809  1.00 0.00 ? 32 VAL A CG1  7  
ATOM 10125 C CG2  . VAL A 1 32 ? 10.044  2.527   -0.213  1.00 0.00 ? 32 VAL A CG2  7  
ATOM 10126 H H    . VAL A 1 32 ? 9.875   -0.013  -1.466  1.00 0.00 ? 32 VAL A H    7  
ATOM 10127 H HA   . VAL A 1 32 ? 11.564  -0.424  0.899   1.00 0.00 ? 32 VAL A HA   7  
ATOM 10128 H HB   . VAL A 1 32 ? 11.606  1.997   1.160   1.00 0.00 ? 32 VAL A HB   7  
ATOM 10129 H HG11 . VAL A 1 32 ? 12.019  1.226   -1.754  1.00 0.00 ? 32 VAL A HG11 7  
ATOM 10130 H HG12 . VAL A 1 32 ? 13.194  1.040   -0.447  1.00 0.00 ? 32 VAL A HG12 7  
ATOM 10131 H HG13 . VAL A 1 32 ? 12.694  2.653   -0.961  1.00 0.00 ? 32 VAL A HG13 7  
ATOM 10132 H HG21 . VAL A 1 32 ? 9.299   2.568   0.571   1.00 0.00 ? 32 VAL A HG21 7  
ATOM 10133 H HG22 . VAL A 1 32 ? 9.590   2.142   -1.116  1.00 0.00 ? 32 VAL A HG22 7  
ATOM 10134 H HG23 . VAL A 1 32 ? 10.415  3.530   -0.399  1.00 0.00 ? 32 VAL A HG23 7  
ATOM 10135 N N    . VAL A 1 33 ? 8.477   -0.554  1.200   1.00 0.00 ? 33 VAL A N    7  
ATOM 10136 C CA   . VAL A 1 33 ? 7.298   -0.671  2.069   1.00 0.00 ? 33 VAL A CA   7  
ATOM 10137 C C    . VAL A 1 33 ? 7.319   -2.052  2.758   1.00 0.00 ? 33 VAL A C    7  
ATOM 10138 O O    . VAL A 1 33 ? 7.427   -3.076  2.084   1.00 0.00 ? 33 VAL A O    7  
ATOM 10139 C CB   . VAL A 1 33 ? 5.961   -0.502  1.251   1.00 0.00 ? 33 VAL A CB   7  
ATOM 10140 C CG1  . VAL A 1 33 ? 4.727   -0.440  2.187   1.00 0.00 ? 33 VAL A CG1  7  
ATOM 10141 C CG2  . VAL A 1 33 ? 6.020   0.736   0.322   1.00 0.00 ? 33 VAL A CG2  7  
ATOM 10142 H H    . VAL A 1 33 ? 8.459   -1.013  0.340   1.00 0.00 ? 33 VAL A H    7  
ATOM 10143 H HA   . VAL A 1 33 ? 7.339   0.114   2.826   1.00 0.00 ? 33 VAL A HA   7  
ATOM 10144 H HB   . VAL A 1 33 ? 5.844   -1.381  0.618   1.00 0.00 ? 33 VAL A HB   7  
ATOM 10145 H HG11 . VAL A 1 33 ? 3.821   -0.344  1.595   1.00 0.00 ? 33 VAL A HG11 7  
ATOM 10146 H HG12 . VAL A 1 33 ? 4.810   0.417   2.843   1.00 0.00 ? 33 VAL A HG12 7  
ATOM 10147 H HG13 . VAL A 1 33 ? 4.667   -1.343  2.783   1.00 0.00 ? 33 VAL A HG13 7  
ATOM 10148 H HG21 . VAL A 1 33 ? 6.849   0.635   -0.372  1.00 0.00 ? 33 VAL A HG21 7  
ATOM 10149 H HG22 . VAL A 1 33 ? 6.159   1.632   0.913   1.00 0.00 ? 33 VAL A HG22 7  
ATOM 10150 H HG23 . VAL A 1 33 ? 5.099   0.822   -0.241  1.00 0.00 ? 33 VAL A HG23 7  
ATOM 10151 N N    . ASP A 1 34 ? 7.231   -2.055  4.094   1.00 0.00 ? 34 ASP A N    7  
ATOM 10152 C CA   . ASP A 1 34 ? 7.211   -3.271  4.928   1.00 0.00 ? 34 ASP A CA   7  
ATOM 10153 C C    . ASP A 1 34 ? 5.786   -3.827  5.008   1.00 0.00 ? 34 ASP A C    7  
ATOM 10154 O O    . ASP A 1 34 ? 5.550   -5.003  4.739   1.00 0.00 ? 34 ASP A O    7  
ATOM 10155 C CB   . ASP A 1 34 ? 7.728   -2.945  6.357   1.00 0.00 ? 34 ASP A CB   7  
ATOM 10156 C CG   . ASP A 1 34 ? 7.667   -4.145  7.322   1.00 0.00 ? 34 ASP A CG   7  
ATOM 10157 O OD1  . ASP A 1 34 ? 8.428   -5.115  7.122   1.00 0.00 ? 34 ASP A OD1  7  
ATOM 10158 O OD2  . ASP A 1 34 ? 6.860   -4.134  8.276   1.00 0.00 ? 34 ASP A OD2  7  
ATOM 10159 H H    . ASP A 1 34 ? 7.128   -1.206  4.543   1.00 0.00 ? 34 ASP A H    7  
ATOM 10160 H HA   . ASP A 1 34 ? 7.865   -4.009  4.475   1.00 0.00 ? 34 ASP A HA   7  
ATOM 10161 H HB2  . ASP A 1 34 ? 8.760   -2.617  6.290   1.00 0.00 ? 34 ASP A HB2  7  
ATOM 10162 H HB3  . ASP A 1 34 ? 7.141   -2.129  6.767   1.00 0.00 ? 34 ASP A HB3  7  
ATOM 10163 N N    . ARG A 1 35 ? 4.847   -2.941  5.370   1.00 0.00 ? 35 ARG A N    7  
ATOM 10164 C CA   . ARG A 1 35 ? 3.433   -3.294  5.572   1.00 0.00 ? 35 ARG A CA   7  
ATOM 10165 C C    . ARG A 1 35 ? 2.556   -2.058  5.337   1.00 0.00 ? 35 ARG A C    7  
ATOM 10166 O O    . ARG A 1 35 ? 3.042   -0.922  5.335   1.00 0.00 ? 35 ARG A O    7  
ATOM 10167 C CB   . ARG A 1 35 ? 3.199   -3.883  6.996   1.00 0.00 ? 35 ARG A CB   7  
ATOM 10168 C CG   . ARG A 1 35 ? 3.365   -2.881  8.157   1.00 0.00 ? 35 ARG A CG   7  
ATOM 10169 C CD   . ARG A 1 35 ? 3.189   -3.527  9.542   1.00 0.00 ? 35 ARG A CD   7  
ATOM 10170 N NE   . ARG A 1 35 ? 4.286   -4.445  9.872   1.00 0.00 ? 35 ARG A NE   7  
ATOM 10171 C CZ   . ARG A 1 35 ? 4.292   -5.314  10.889  1.00 0.00 ? 35 ARG A CZ   7  
ATOM 10172 N NH1  . ARG A 1 35 ? 3.245   -5.437  11.698  1.00 0.00 ? 35 ARG A NH1  7  
ATOM 10173 N NH2  . ARG A 1 35 ? 5.373   -6.036  11.107  1.00 0.00 ? 35 ARG A NH2  7  
ATOM 10174 H H    . ARG A 1 35 ? 5.118   -2.004  5.468   1.00 0.00 ? 35 ARG A H    7  
ATOM 10175 H HA   . ARG A 1 35 ? 3.162   -4.045  4.829   1.00 0.00 ? 35 ARG A HA   7  
ATOM 10176 H HB2  . ARG A 1 35 ? 2.194   -4.297  7.041   1.00 0.00 ? 35 ARG A HB2  7  
ATOM 10177 H HB3  . ARG A 1 35 ? 3.904   -4.696  7.144   1.00 0.00 ? 35 ARG A HB3  7  
ATOM 10178 H HG2  . ARG A 1 35 ? 4.357   -2.446  8.105   1.00 0.00 ? 35 ARG A HG2  7  
ATOM 10179 H HG3  . ARG A 1 35 ? 2.628   -2.090  8.045   1.00 0.00 ? 35 ARG A HG3  7  
ATOM 10180 H HD2  . ARG A 1 35 ? 3.158   -2.742  10.291  1.00 0.00 ? 35 ARG A HD2  7  
ATOM 10181 H HD3  . ARG A 1 35 ? 2.250   -4.070  9.559   1.00 0.00 ? 35 ARG A HD3  7  
ATOM 10182 H HE   . ARG A 1 35 ? 5.079   -4.409  9.293   1.00 0.00 ? 35 ARG A HE   7  
ATOM 10183 H HH11 . ARG A 1 35 ? 2.430   -4.866  11.561  1.00 0.00 ? 35 ARG A HH11 7  
ATOM 10184 H HH12 . ARG A 1 35 ? 3.263   -6.093  12.456  1.00 0.00 ? 35 ARG A HH12 7  
ATOM 10185 H HH21 . ARG A 1 35 ? 6.178   -5.928  10.519  1.00 0.00 ? 35 ARG A HH21 7  
ATOM 10186 H HH22 . ARG A 1 35 ? 5.395   -6.694  11.864  1.00 0.00 ? 35 ARG A HH22 7  
ATOM 10187 N N    . LEU A 1 36 ? 1.265   -2.300  5.110   1.00 0.00 ? 36 LEU A N    7  
ATOM 10188 C CA   . LEU A 1 36 ? 0.256   -1.255  4.947   1.00 0.00 ? 36 LEU A CA   7  
ATOM 10189 C C    . LEU A 1 36 ? -0.738  -1.349  6.106   1.00 0.00 ? 36 LEU A C    7  
ATOM 10190 O O    . LEU A 1 36 ? -1.615  -2.219  6.120   1.00 0.00 ? 36 LEU A O    7  
ATOM 10191 C CB   . LEU A 1 36 ? -0.446  -1.431  3.572   1.00 0.00 ? 36 LEU A CB   7  
ATOM 10192 C CG   . LEU A 1 36 ? 0.453   -1.136  2.334   1.00 0.00 ? 36 LEU A CG   7  
ATOM 10193 C CD1  . LEU A 1 36 ? -0.274  -1.434  1.010   1.00 0.00 ? 36 LEU A CD1  7  
ATOM 10194 C CD2  . LEU A 1 36 ? 0.998   0.313   2.378   1.00 0.00 ? 36 LEU A CD2  7  
ATOM 10195 H H    . LEU A 1 36 ? 0.972   -3.227  5.050   1.00 0.00 ? 36 LEU A H    7  
ATOM 10196 H HA   . LEU A 1 36 ? 0.744   -0.283  4.974   1.00 0.00 ? 36 LEU A HA   7  
ATOM 10197 H HB2  . LEU A 1 36 ? -0.807  -2.457  3.503   1.00 0.00 ? 36 LEU A HB2  7  
ATOM 10198 H HB3  . LEU A 1 36 ? -1.306  -0.772  3.535   1.00 0.00 ? 36 LEU A HB3  7  
ATOM 10199 H HG   . LEU A 1 36 ? 1.309   -1.798  2.370   1.00 0.00 ? 36 LEU A HG   7  
ATOM 10200 H HD11 . LEU A 1 36 ? -0.592  -2.467  0.996   1.00 0.00 ? 36 LEU A HD11 7  
ATOM 10201 H HD12 . LEU A 1 36 ? 0.399   -1.262  0.179   1.00 0.00 ? 36 LEU A HD12 7  
ATOM 10202 H HD13 . LEU A 1 36 ? -1.139  -0.790  0.908   1.00 0.00 ? 36 LEU A HD13 7  
ATOM 10203 H HD21 . LEU A 1 36 ? 0.177   1.020   2.350   1.00 0.00 ? 36 LEU A HD21 7  
ATOM 10204 H HD22 . LEU A 1 36 ? 1.645   0.484   1.528   1.00 0.00 ? 36 LEU A HD22 7  
ATOM 10205 H HD23 . LEU A 1 36 ? 1.567   0.461   3.286   1.00 0.00 ? 36 LEU A HD23 7  
ATOM 10206 N N    . GLU A 1 37 ? -0.571  -0.449  7.083   1.00 0.00 ? 37 GLU A N    7  
ATOM 10207 C CA   . GLU A 1 37 ? -1.415  -0.386  8.279   1.00 0.00 ? 37 GLU A CA   7  
ATOM 10208 C C    . GLU A 1 37 ? -2.641  0.482   7.982   1.00 0.00 ? 37 GLU A C    7  
ATOM 10209 O O    . GLU A 1 37 ? -2.570  1.715   8.016   1.00 0.00 ? 37 GLU A O    7  
ATOM 10210 C CB   . GLU A 1 37 ? -0.607  0.177   9.480   1.00 0.00 ? 37 GLU A CB   7  
ATOM 10211 C CG   . GLU A 1 37 ? 0.544   -0.742  9.942   1.00 0.00 ? 37 GLU A CG   7  
ATOM 10212 C CD   . GLU A 1 37 ? 1.428   -0.144  11.049  1.00 0.00 ? 37 GLU A CD   7  
ATOM 10213 O OE1  . GLU A 1 37 ? 0.920   0.618   11.898  1.00 0.00 ? 37 GLU A OE1  7  
ATOM 10214 O OE2  . GLU A 1 37 ? 2.649   -0.422  11.060  1.00 0.00 ? 37 GLU A OE2  7  
ATOM 10215 H H    . GLU A 1 37 ? 0.147   0.211   6.987   1.00 0.00 ? 37 GLU A H    7  
ATOM 10216 H HA   . GLU A 1 37 ? -1.743  -1.398  8.525   1.00 0.00 ? 37 GLU A HA   7  
ATOM 10217 H HB2  . GLU A 1 37 ? -0.186  1.136   9.196   1.00 0.00 ? 37 GLU A HB2  7  
ATOM 10218 H HB3  . GLU A 1 37 ? -1.280  0.329   10.321  1.00 0.00 ? 37 GLU A HB3  7  
ATOM 10219 H HG2  . GLU A 1 37 ? 0.121   -1.665  10.319  1.00 0.00 ? 37 GLU A HG2  7  
ATOM 10220 H HG3  . GLU A 1 37 ? 1.167   -0.968  9.082   1.00 0.00 ? 37 GLU A HG3  7  
ATOM 10221 N N    . VAL A 1 38 ? -3.770  -0.180  7.721   1.00 0.00 ? 38 VAL A N    7  
ATOM 10222 C CA   . VAL A 1 38 ? -4.995  0.483   7.275   1.00 0.00 ? 38 VAL A CA   7  
ATOM 10223 C C    . VAL A 1 38 ? -5.778  0.887   8.531   1.00 0.00 ? 38 VAL A C    7  
ATOM 10224 O O    . VAL A 1 38 ? -6.575  0.103   9.075   1.00 0.00 ? 38 VAL A O    7  
ATOM 10225 C CB   . VAL A 1 38 ? -5.845  -0.455  6.339   1.00 0.00 ? 38 VAL A CB   7  
ATOM 10226 C CG1  . VAL A 1 38 ? -7.019  0.312   5.692   1.00 0.00 ? 38 VAL A CG1  7  
ATOM 10227 C CG2  . VAL A 1 38 ? -4.953  -1.117  5.258   1.00 0.00 ? 38 VAL A CG2  7  
ATOM 10228 H H    . VAL A 1 38 ? -3.810  -1.129  7.933   1.00 0.00 ? 38 VAL A H    7  
ATOM 10229 H HA   . VAL A 1 38 ? -4.726  1.379   6.714   1.00 0.00 ? 38 VAL A HA   7  
ATOM 10230 H HB   . VAL A 1 38 ? -6.267  -1.250  6.952   1.00 0.00 ? 38 VAL A HB   7  
ATOM 10231 H HG11 . VAL A 1 38 ? -7.607  0.788   6.460   1.00 0.00 ? 38 VAL A HG11 7  
ATOM 10232 H HG12 . VAL A 1 38 ? -7.652  -0.374  5.140   1.00 0.00 ? 38 VAL A HG12 7  
ATOM 10233 H HG13 . VAL A 1 38 ? -6.641  1.070   5.014   1.00 0.00 ? 38 VAL A HG13 7  
ATOM 10234 H HG21 . VAL A 1 38 ? -5.553  -1.776  4.634   1.00 0.00 ? 38 VAL A HG21 7  
ATOM 10235 H HG22 . VAL A 1 38 ? -4.171  -1.697  5.733   1.00 0.00 ? 38 VAL A HG22 7  
ATOM 10236 H HG23 . VAL A 1 38 ? -4.501  -0.357  4.631   1.00 0.00 ? 38 VAL A HG23 7  
ATOM 10237 N N    . VAL A 1 39 ? -5.502  2.107   9.013   1.00 0.00 ? 39 VAL A N    7  
ATOM 10238 C CA   . VAL A 1 39 ? -6.038  2.598   10.278  1.00 0.00 ? 39 VAL A CA   7  
ATOM 10239 C C    . VAL A 1 39 ? -7.467  3.113   10.066  1.00 0.00 ? 39 VAL A C    7  
ATOM 10240 O O    . VAL A 1 39 ? -7.736  3.912   9.157   1.00 0.00 ? 39 VAL A O    7  
ATOM 10241 C CB   . VAL A 1 39 ? -5.150  3.725   10.908  1.00 0.00 ? 39 VAL A CB   7  
ATOM 10242 C CG1  . VAL A 1 39 ? -5.753  4.232   12.252  1.00 0.00 ? 39 VAL A CG1  7  
ATOM 10243 C CG2  . VAL A 1 39 ? -3.683  3.250   11.092  1.00 0.00 ? 39 VAL A CG2  7  
ATOM 10244 H H    . VAL A 1 39 ? -4.935  2.707   8.490   1.00 0.00 ? 39 VAL A H    7  
ATOM 10245 H HA   . VAL A 1 39 ? -6.058  1.759   10.982  1.00 0.00 ? 39 VAL A HA   7  
ATOM 10246 H HB   . VAL A 1 39 ? -5.139  4.562   10.217  1.00 0.00 ? 39 VAL A HB   7  
ATOM 10247 H HG11 . VAL A 1 39 ? -6.769  4.593   12.094  1.00 0.00 ? 39 VAL A HG11 7  
ATOM 10248 H HG12 . VAL A 1 39 ? -5.149  5.041   12.645  1.00 0.00 ? 39 VAL A HG12 7  
ATOM 10249 H HG13 . VAL A 1 39 ? -5.776  3.424   12.975  1.00 0.00 ? 39 VAL A HG13 7  
ATOM 10250 H HG21 . VAL A 1 39 ? -3.087  4.057   11.501  1.00 0.00 ? 39 VAL A HG21 7  
ATOM 10251 H HG22 . VAL A 1 39 ? -3.268  2.952   10.135  1.00 0.00 ? 39 VAL A HG22 7  
ATOM 10252 H HG23 . VAL A 1 39 ? -3.647  2.406   11.772  1.00 0.00 ? 39 VAL A HG23 7  
ATOM 10253 N N    . ASN A 1 40 ? -8.356  2.588   10.915  1.00 0.00 ? 40 ASN A N    7  
ATOM 10254 C CA   . ASN A 1 40 ? -9.785  2.868   10.966  1.00 0.00 ? 40 ASN A CA   7  
ATOM 10255 C C    . ASN A 1 40 ? -10.481 2.501   9.635   1.00 0.00 ? 40 ASN A C    7  
ATOM 10256 O O    . ASN A 1 40 ? -11.603 2.945   9.373   1.00 0.00 ? 40 ASN A O    7  
ATOM 10257 C CB   . ASN A 1 40 ? -10.055 4.343   11.386  1.00 0.00 ? 40 ASN A CB   7  
ATOM 10258 C CG   . ASN A 1 40 ? -11.296 4.485   12.262  1.00 0.00 ? 40 ASN A CG   7  
ATOM 10259 O OD1  . ASN A 1 40 ? -12.105 5.394   12.091  1.00 0.00 ? 40 ASN A OD1  7  
ATOM 10260 N ND2  . ASN A 1 40 ? -11.434 3.598   13.239  1.00 0.00 ? 40 ASN A ND2  7  
ATOM 10261 H H    . ASN A 1 40 ? -8.020  1.953   11.556  1.00 0.00 ? 40 ASN A H    7  
ATOM 10262 H HA   . ASN A 1 40 ? -10.184 2.205   11.738  1.00 0.00 ? 40 ASN A HA   7  
ATOM 10263 H HB2  . ASN A 1 40 ? -9.210  4.712   11.948  1.00 0.00 ? 40 ASN A HB2  7  
ATOM 10264 H HB3  . ASN A 1 40 ? -10.183 4.959   10.502  1.00 0.00 ? 40 ASN A HB3  7  
ATOM 10265 H HD21 . ASN A 1 40 ? -10.747 2.900   13.348  1.00 0.00 ? 40 ASN A HD21 7  
ATOM 10266 H HD22 . ASN A 1 40 ? -12.205 3.680   13.822  1.00 0.00 ? 40 ASN A HD22 7  
ATOM 10267 N N    . LYS A 1 41 ? -9.806  1.637   8.831   1.00 0.00 ? 41 LYS A N    7  
ATOM 10268 C CA   . LYS A 1 41 ? -10.118 1.331   7.410   1.00 0.00 ? 41 LYS A CA   7  
ATOM 10269 C C    . LYS A 1 41 ? -10.493 2.558   6.535   1.00 0.00 ? 41 LYS A C    7  
ATOM 10270 O O    . LYS A 1 41 ? -10.984 2.411   5.420   1.00 0.00 ? 41 LYS A O    7  
ATOM 10271 C CB   . LYS A 1 41 ? -11.112 0.135   7.252   1.00 0.00 ? 41 LYS A CB   7  
ATOM 10272 C CG   . LYS A 1 41 ? -12.494 0.286   7.909   1.00 0.00 ? 41 LYS A CG   7  
ATOM 10273 C CD   . LYS A 1 41 ? -13.444 -0.869  7.520   1.00 0.00 ? 41 LYS A CD   7  
ATOM 10274 C CE   . LYS A 1 41 ? -14.709 -0.919  8.382   1.00 0.00 ? 41 LYS A CE   7  
ATOM 10275 N NZ   . LYS A 1 41 ? -14.387 -1.179  9.805   1.00 0.00 ? 41 LYS A NZ   7  
ATOM 10276 H H    . LYS A 1 41 ? -9.077  1.110   9.219   1.00 0.00 ? 41 LYS A H    7  
ATOM 10277 H HA   . LYS A 1 41 ? -9.174  0.991   7.013   1.00 0.00 ? 41 LYS A HA   7  
ATOM 10278 H HB2  . LYS A 1 41 ? -11.261 -0.045  6.192   1.00 0.00 ? 41 LYS A HB2  7  
ATOM 10279 H HB3  . LYS A 1 41 ? -10.636 -0.749  7.673   1.00 0.00 ? 41 LYS A HB3  7  
ATOM 10280 H HG2  . LYS A 1 41 ? -12.364 0.296   8.988   1.00 0.00 ? 41 LYS A HG2  7  
ATOM 10281 H HG3  . LYS A 1 41 ? -12.932 1.229   7.595   1.00 0.00 ? 41 LYS A HG3  7  
ATOM 10282 H HD2  . LYS A 1 41 ? -13.734 -0.748  6.482   1.00 0.00 ? 41 LYS A HD2  7  
ATOM 10283 H HD3  . LYS A 1 41 ? -12.914 -1.814  7.627   1.00 0.00 ? 41 LYS A HD3  7  
ATOM 10284 H HE2  . LYS A 1 41 ? -15.232 0.027   8.311   1.00 0.00 ? 41 LYS A HE2  7  
ATOM 10285 H HE3  . LYS A 1 41 ? -15.355 -1.711  8.021   1.00 0.00 ? 41 LYS A HE3  7  
ATOM 10286 H HZ1  . LYS A 1 41 ? -15.260 -1.333  10.347  1.00 0.00 ? 41 LYS A HZ1  7  
ATOM 10287 H HZ2  . LYS A 1 41 ? -13.872 -0.373  10.210  1.00 0.00 ? 41 LYS A HZ2  7  
ATOM 10288 H HZ3  . LYS A 1 41 ? -13.791 -2.030  9.889   1.00 0.00 ? 41 LYS A HZ3  7  
ATOM 10289 N N    . ARG A 1 42 ? -10.139 3.758   7.012   1.00 0.00 ? 42 ARG A N    7  
ATOM 10290 C CA   . ARG A 1 42 ? -10.454 5.038   6.350   1.00 0.00 ? 42 ARG A CA   7  
ATOM 10291 C C    . ARG A 1 42 ? -9.229  5.510   5.564   1.00 0.00 ? 42 ARG A C    7  
ATOM 10292 O O    . ARG A 1 42 ? -9.353  6.166   4.524   1.00 0.00 ? 42 ARG A O    7  
ATOM 10293 C CB   . ARG A 1 42 ? -10.853 6.087   7.417   1.00 0.00 ? 42 ARG A CB   7  
ATOM 10294 C CG   . ARG A 1 42 ? -11.052 7.533   6.884   1.00 0.00 ? 42 ARG A CG   7  
ATOM 10295 C CD   . ARG A 1 42 ? -11.301 8.543   8.015   1.00 0.00 ? 42 ARG A CD   7  
ATOM 10296 N NE   . ARG A 1 42 ? -10.253 8.463   9.059   1.00 0.00 ? 42 ARG A NE   7  
ATOM 10297 C CZ   . ARG A 1 42 ? -10.462 8.099   10.337  1.00 0.00 ? 42 ARG A CZ   7  
ATOM 10298 N NH1  . ARG A 1 42 ? -11.680 7.794   10.765  1.00 0.00 ? 42 ARG A NH1  7  
ATOM 10299 N NH2  . ARG A 1 42 ? -9.443  8.018   11.171  1.00 0.00 ? 42 ARG A NH2  7  
ATOM 10300 H H    . ARG A 1 42 ? -9.605  3.784   7.829   1.00 0.00 ? 42 ARG A H    7  
ATOM 10301 H HA   . ARG A 1 42 ? -11.284 4.885   5.664   1.00 0.00 ? 42 ARG A HA   7  
ATOM 10302 H HB2  . ARG A 1 42 ? -11.779 5.768   7.879   1.00 0.00 ? 42 ARG A HB2  7  
ATOM 10303 H HB3  . ARG A 1 42 ? -10.079 6.110   8.184   1.00 0.00 ? 42 ARG A HB3  7  
ATOM 10304 H HG2  . ARG A 1 42 ? -10.163 7.838   6.339   1.00 0.00 ? 42 ARG A HG2  7  
ATOM 10305 H HG3  . ARG A 1 42 ? -11.901 7.542   6.207   1.00 0.00 ? 42 ARG A HG3  7  
ATOM 10306 H HD2  . ARG A 1 42 ? -11.308 9.548   7.600   1.00 0.00 ? 42 ARG A HD2  7  
ATOM 10307 H HD3  . ARG A 1 42 ? -12.274 8.341   8.457   1.00 0.00 ? 42 ARG A HD3  7  
ATOM 10308 H HE   . ARG A 1 42 ? -9.336  8.690   8.780   1.00 0.00 ? 42 ARG A HE   7  
ATOM 10309 H HH11 . ARG A 1 42 ? -12.459 7.825   10.138  1.00 0.00 ? 42 ARG A HH11 7  
ATOM 10310 H HH12 . ARG A 1 42 ? -11.828 7.522   11.724  1.00 0.00 ? 42 ARG A HH12 7  
ATOM 10311 H HH21 . ARG A 1 42 ? -8.515  8.223   10.853  1.00 0.00 ? 42 ARG A HH21 7  
ATOM 10312 H HH22 . ARG A 1 42 ? -9.596  7.749   12.128  1.00 0.00 ? 42 ARG A HH22 7  
ATOM 10313 N N    . PHE A 1 43 ? -8.039  5.148   6.069   1.00 0.00 ? 43 PHE A N    7  
ATOM 10314 C CA   . PHE A 1 43 ? -6.765  5.520   5.460   1.00 0.00 ? 43 PHE A CA   7  
ATOM 10315 C C    . PHE A 1 43 ? -5.733  4.420   5.694   1.00 0.00 ? 43 PHE A C    7  
ATOM 10316 O O    . PHE A 1 43 ? -5.800  3.685   6.681   1.00 0.00 ? 43 PHE A O    7  
ATOM 10317 C CB   . PHE A 1 43 ? -6.259  6.896   5.976   1.00 0.00 ? 43 PHE A CB   7  
ATOM 10318 C CG   . PHE A 1 43 ? -5.853  6.980   7.452   1.00 0.00 ? 43 PHE A CG   7  
ATOM 10319 C CD1  . PHE A 1 43 ? -6.817  7.073   8.459   1.00 0.00 ? 43 PHE A CD1  7  
ATOM 10320 C CD2  . PHE A 1 43 ? -4.504  7.007   7.830   1.00 0.00 ? 43 PHE A CD2  7  
ATOM 10321 C CE1  . PHE A 1 43 ? -6.445  7.186   9.786   1.00 0.00 ? 43 PHE A CE1  7  
ATOM 10322 C CE2  . PHE A 1 43 ? -4.136  7.129   9.154   1.00 0.00 ? 43 PHE A CE2  7  
ATOM 10323 C CZ   . PHE A 1 43 ? -5.106  7.220   10.132  1.00 0.00 ? 43 PHE A CZ   7  
ATOM 10324 H H    . PHE A 1 43 ? -8.013  4.564   6.859   1.00 0.00 ? 43 PHE A H    7  
ATOM 10325 H HA   . PHE A 1 43 ? -6.925  5.597   4.381   1.00 0.00 ? 43 PHE A HA   7  
ATOM 10326 H HB2  . PHE A 1 43 ? -5.402  7.193   5.379   1.00 0.00 ? 43 PHE A HB2  7  
ATOM 10327 H HB3  . PHE A 1 43 ? -7.045  7.628   5.807   1.00 0.00 ? 43 PHE A HB3  7  
ATOM 10328 H HD1  . PHE A 1 43 ? -7.870  7.044   8.198   1.00 0.00 ? 43 PHE A HD1  7  
ATOM 10329 H HD2  . PHE A 1 43 ? -3.734  6.935   7.068   1.00 0.00 ? 43 PHE A HD2  7  
ATOM 10330 H HE1  . PHE A 1 43 ? -7.203  7.259   10.559  1.00 0.00 ? 43 PHE A HE1  7  
ATOM 10331 H HE2  . PHE A 1 43 ? -3.088  7.149   9.430   1.00 0.00 ? 43 PHE A HE2  7  
ATOM 10332 H HZ   . PHE A 1 43 ? -4.818  7.316   11.172  1.00 0.00 ? 43 PHE A HZ   7  
ATOM 10333 N N    . VAL A 1 44 ? -4.785  4.336   4.767   1.00 0.00 ? 44 VAL A N    7  
ATOM 10334 C CA   . VAL A 1 44 ? -3.703  3.356   4.776   1.00 0.00 ? 44 VAL A CA   7  
ATOM 10335 C C    . VAL A 1 44 ? -2.391  4.087   5.047   1.00 0.00 ? 44 VAL A C    7  
ATOM 10336 O O    . VAL A 1 44 ? -2.069  5.060   4.359   1.00 0.00 ? 44 VAL A O    7  
ATOM 10337 C CB   . VAL A 1 44 ? -3.608  2.608   3.406   1.00 0.00 ? 44 VAL A CB   7  
ATOM 10338 C CG1  . VAL A 1 44 ? -2.481  1.555   3.412   1.00 0.00 ? 44 VAL A CG1  7  
ATOM 10339 C CG2  . VAL A 1 44 ? -4.960  1.977   3.023   1.00 0.00 ? 44 VAL A CG2  7  
ATOM 10340 H H    . VAL A 1 44 ? -4.798  4.995   4.053   1.00 0.00 ? 44 VAL A H    7  
ATOM 10341 H HA   . VAL A 1 44 ? -3.889  2.625   5.561   1.00 0.00 ? 44 VAL A HA   7  
ATOM 10342 H HB   . VAL A 1 44 ? -3.364  3.347   2.641   1.00 0.00 ? 44 VAL A HB   7  
ATOM 10343 H HG11 . VAL A 1 44 ? -1.528  2.029   3.626   1.00 0.00 ? 44 VAL A HG11 7  
ATOM 10344 H HG12 . VAL A 1 44 ? -2.421  1.074   2.440   1.00 0.00 ? 44 VAL A HG12 7  
ATOM 10345 H HG13 . VAL A 1 44 ? -2.682  0.805   4.166   1.00 0.00 ? 44 VAL A HG13 7  
ATOM 10346 H HG21 . VAL A 1 44 ? -4.886  1.511   2.048   1.00 0.00 ? 44 VAL A HG21 7  
ATOM 10347 H HG22 . VAL A 1 44 ? -5.729  2.742   2.989   1.00 0.00 ? 44 VAL A HG22 7  
ATOM 10348 H HG23 . VAL A 1 44 ? -5.235  1.230   3.753   1.00 0.00 ? 44 VAL A HG23 7  
ATOM 10349 N N    . ARG A 1 45 ? -1.645  3.601   6.038   1.00 0.00 ? 45 ARG A N    7  
ATOM 10350 C CA   . ARG A 1 45 ? -0.352  4.157   6.420   1.00 0.00 ? 45 ARG A CA   7  
ATOM 10351 C C    . ARG A 1 45 ? 0.731   3.265   5.812   1.00 0.00 ? 45 ARG A C    7  
ATOM 10352 O O    . ARG A 1 45 ? 0.758   2.046   6.047   1.00 0.00 ? 45 ARG A O    7  
ATOM 10353 C CB   . ARG A 1 45 ? -0.228  4.259   7.970   1.00 0.00 ? 45 ARG A CB   7  
ATOM 10354 C CG   . ARG A 1 45 ? 0.826   5.280   8.495   1.00 0.00 ? 45 ARG A CG   7  
ATOM 10355 C CD   . ARG A 1 45 ? 2.298   4.829   8.344   1.00 0.00 ? 45 ARG A CD   7  
ATOM 10356 N NE   . ARG A 1 45 ? 2.595   3.589   9.095   1.00 0.00 ? 45 ARG A NE   7  
ATOM 10357 C CZ   . ARG A 1 45 ? 3.243   3.529   10.276  1.00 0.00 ? 45 ARG A CZ   7  
ATOM 10358 N NH1  . ARG A 1 45 ? 3.675   4.626   10.886  1.00 0.00 ? 45 ARG A NH1  7  
ATOM 10359 N NH2  . ARG A 1 45 ? 3.449   2.367   10.854  1.00 0.00 ? 45 ARG A NH2  7  
ATOM 10360 H H    . ARG A 1 45 ? -1.960  2.813   6.508   1.00 0.00 ? 45 ARG A H    7  
ATOM 10361 H HA   . ARG A 1 45 ? -0.272  5.156   5.992   1.00 0.00 ? 45 ARG A HA   7  
ATOM 10362 H HB2  . ARG A 1 45 ? -1.194  4.548   8.371   1.00 0.00 ? 45 ARG A HB2  7  
ATOM 10363 H HB3  . ARG A 1 45 ? 0.019   3.280   8.373   1.00 0.00 ? 45 ARG A HB3  7  
ATOM 10364 H HG2  . ARG A 1 45 ? 0.699   6.213   7.955   1.00 0.00 ? 45 ARG A HG2  7  
ATOM 10365 H HG3  . ARG A 1 45 ? 0.630   5.464   9.547   1.00 0.00 ? 45 ARG A HG3  7  
ATOM 10366 H HD2  . ARG A 1 45 ? 2.506   4.651   7.295   1.00 0.00 ? 45 ARG A HD2  7  
ATOM 10367 H HD3  . ARG A 1 45 ? 2.946   5.626   8.696   1.00 0.00 ? 45 ARG A HD3  7  
ATOM 10368 H HE   . ARG A 1 45 ? 2.306   2.740   8.682   1.00 0.00 ? 45 ARG A HE   7  
ATOM 10369 H HH11 . ARG A 1 45 ? 3.528   5.528   10.473  1.00 0.00 ? 45 ARG A HH11 7  
ATOM 10370 H HH12 . ARG A 1 45 ? 4.151   4.560   11.766  1.00 0.00 ? 45 ARG A HH12 7  
ATOM 10371 H HH21 . ARG A 1 45 ? 3.129   1.523   10.419  1.00 0.00 ? 45 ARG A HH21 7  
ATOM 10372 H HH22 . ARG A 1 45 ? 3.926   2.319   11.735  1.00 0.00 ? 45 ARG A HH22 7  
ATOM 10373 N N    . VAL A 1 46 ? 1.617   3.894   5.045   1.00 0.00 ? 46 VAL A N    7  
ATOM 10374 C CA   . VAL A 1 46 ? 2.734   3.220   4.394   1.00 0.00 ? 46 VAL A CA   7  
ATOM 10375 C C    . VAL A 1 46 ? 3.855   3.097   5.421   1.00 0.00 ? 46 VAL A C    7  
ATOM 10376 O O    . VAL A 1 46 ? 4.515   4.093   5.761   1.00 0.00 ? 46 VAL A O    7  
ATOM 10377 C CB   . VAL A 1 46 ? 3.225   4.033   3.141   1.00 0.00 ? 46 VAL A CB   7  
ATOM 10378 C CG1  . VAL A 1 46 ? 4.349   3.295   2.368   1.00 0.00 ? 46 VAL A CG1  7  
ATOM 10379 C CG2  . VAL A 1 46 ? 2.035   4.395   2.224   1.00 0.00 ? 46 VAL A CG2  7  
ATOM 10380 H H    . VAL A 1 46 ? 1.527   4.861   4.949   1.00 0.00 ? 46 VAL A H    7  
ATOM 10381 H HA   . VAL A 1 46 ? 2.412   2.231   4.066   1.00 0.00 ? 46 VAL A HA   7  
ATOM 10382 H HB   . VAL A 1 46 ? 3.649   4.973   3.506   1.00 0.00 ? 46 VAL A HB   7  
ATOM 10383 H HG11 . VAL A 1 46 ? 4.677   3.900   1.529   1.00 0.00 ? 46 VAL A HG11 7  
ATOM 10384 H HG12 . VAL A 1 46 ? 3.975   2.350   1.998   1.00 0.00 ? 46 VAL A HG12 7  
ATOM 10385 H HG13 . VAL A 1 46 ? 5.190   3.113   3.026   1.00 0.00 ? 46 VAL A HG13 7  
ATOM 10386 H HG21 . VAL A 1 46 ? 1.572   3.489   1.852   1.00 0.00 ? 46 VAL A HG21 7  
ATOM 10387 H HG22 . VAL A 1 46 ? 2.383   4.988   1.385   1.00 0.00 ? 46 VAL A HG22 7  
ATOM 10388 H HG23 . VAL A 1 46 ? 1.303   4.968   2.781   1.00 0.00 ? 46 VAL A HG23 7  
ATOM 10389 N N    . THR A 1 47 ? 4.044   1.883   5.933   1.00 0.00 ? 47 THR A N    7  
ATOM 10390 C CA   . THR A 1 47 ? 5.081   1.582   6.908   1.00 0.00 ? 47 THR A CA   7  
ATOM 10391 C C    . THR A 1 47 ? 6.304   1.129   6.133   1.00 0.00 ? 47 THR A C    7  
ATOM 10392 O O    . THR A 1 47 ? 6.190   0.240   5.303   1.00 0.00 ? 47 THR A O    7  
ATOM 10393 C CB   . THR A 1 47 ? 4.631   0.464   7.893   1.00 0.00 ? 47 THR A CB   7  
ATOM 10394 O OG1  . THR A 1 47 ? 3.338   0.790   8.430   1.00 0.00 ? 47 THR A OG1  7  
ATOM 10395 C CG2  . THR A 1 47 ? 5.634   0.256   9.049   1.00 0.00 ? 47 THR A CG2  7  
ATOM 10396 H H    . THR A 1 47 ? 3.488   1.143   5.616   1.00 0.00 ? 47 THR A H    7  
ATOM 10397 H HA   . THR A 1 47 ? 5.308   2.482   7.478   1.00 0.00 ? 47 THR A HA   7  
ATOM 10398 H HB   . THR A 1 47 ? 4.542   -0.468  7.340   1.00 0.00 ? 47 THR A HB   7  
ATOM 10399 H HG1  . THR A 1 47 ? 3.023   0.051   8.966   1.00 0.00 ? 47 THR A HG1  7  
ATOM 10400 H HG21 . THR A 1 47 ? 5.743   1.174   9.611   1.00 0.00 ? 47 THR A HG21 7  
ATOM 10401 H HG22 . THR A 1 47 ? 6.599   -0.036  8.650   1.00 0.00 ? 47 THR A HG22 7  
ATOM 10402 H HG23 . THR A 1 47 ? 5.272   -0.524  9.707   1.00 0.00 ? 47 THR A HG23 7  
ATOM 10403 N N    . PHE A 1 48 ? 7.445   1.772   6.376   1.00 0.00 ? 48 PHE A N    7  
ATOM 10404 C CA   . PHE A 1 48 ? 8.689   1.491   5.648   1.00 0.00 ? 48 PHE A CA   7  
ATOM 10405 C C    . PHE A 1 48 ? 9.457   0.318   6.261   1.00 0.00 ? 48 PHE A C    7  
ATOM 10406 O O    . PHE A 1 48 ? 9.397   0.080   7.477   1.00 0.00 ? 48 PHE A O    7  
ATOM 10407 C CB   . PHE A 1 48 ? 9.584   2.738   5.609   1.00 0.00 ? 48 PHE A CB   7  
ATOM 10408 C CG   . PHE A 1 48 ? 8.957   3.930   4.901   1.00 0.00 ? 48 PHE A CG   7  
ATOM 10409 C CD1  . PHE A 1 48 ? 8.703   3.882   3.532   1.00 0.00 ? 48 PHE A CD1  7  
ATOM 10410 C CD2  . PHE A 1 48 ? 8.625   5.095   5.595   1.00 0.00 ? 48 PHE A CD2  7  
ATOM 10411 C CE1  . PHE A 1 48 ? 8.142   4.959   2.886   1.00 0.00 ? 48 PHE A CE1  7  
ATOM 10412 C CE2  . PHE A 1 48 ? 8.068   6.170   4.941   1.00 0.00 ? 48 PHE A CE2  7  
ATOM 10413 C CZ   . PHE A 1 48 ? 7.827   6.103   3.590   1.00 0.00 ? 48 PHE A CZ   7  
ATOM 10414 H H    . PHE A 1 48 ? 7.434   2.463   7.062   1.00 0.00 ? 48 PHE A H    7  
ATOM 10415 H HA   . PHE A 1 48 ? 8.421   1.232   4.621   1.00 0.00 ? 48 PHE A HA   7  
ATOM 10416 H HB2  . PHE A 1 48 ? 9.827   3.033   6.625   1.00 0.00 ? 48 PHE A HB2  7  
ATOM 10417 H HB3  . PHE A 1 48 ? 10.513  2.500   5.089   1.00 0.00 ? 48 PHE A HB3  7  
ATOM 10418 H HD1  . PHE A 1 48 ? 8.949   2.987   2.970   1.00 0.00 ? 48 PHE A HD1  7  
ATOM 10419 H HD2  . PHE A 1 48 ? 8.813   5.154   6.662   1.00 0.00 ? 48 PHE A HD2  7  
ATOM 10420 H HE1  . PHE A 1 48 ? 7.948   4.914   1.823   1.00 0.00 ? 48 PHE A HE1  7  
ATOM 10421 H HE2  . PHE A 1 48 ? 7.817   7.068   5.488   1.00 0.00 ? 48 PHE A HE2  7  
ATOM 10422 H HZ   . PHE A 1 48 ? 7.389   6.949   3.078   1.00 0.00 ? 48 PHE A HZ   7  
ATOM 10423 N N    . THR A 1 49 ? 10.173  -0.404  5.383   1.00 0.00 ? 49 THR A N    7  
ATOM 10424 C CA   . THR A 1 49 ? 11.111  -1.465  5.755   1.00 0.00 ? 49 THR A CA   7  
ATOM 10425 C C    . THR A 1 49 ? 12.250  -0.905  6.644   1.00 0.00 ? 49 THR A C    7  
ATOM 10426 O O    . THR A 1 49 ? 12.853  0.117   6.279   1.00 0.00 ? 49 THR A O    7  
ATOM 10427 C CB   . THR A 1 49 ? 11.716  -2.099  4.459   1.00 0.00 ? 49 THR A CB   7  
ATOM 10428 O OG1  . THR A 1 49 ? 12.074  -1.048  3.546   1.00 0.00 ? 49 THR A OG1  7  
ATOM 10429 C CG2  . THR A 1 49 ? 10.747  -3.069  3.758   1.00 0.00 ? 49 THR A CG2  7  
ATOM 10430 H H    . THR A 1 49 ? 10.056  -0.221  4.428   1.00 0.00 ? 49 THR A H    7  
ATOM 10431 H HA   . THR A 1 49 ? 10.561  -2.231  6.295   1.00 0.00 ? 49 THR A HA   7  
ATOM 10432 H HB   . THR A 1 49 ? 12.618  -2.649  4.723   1.00 0.00 ? 49 THR A HB   7  
ATOM 10433 H HG1  . THR A 1 49 ? 12.170  -0.220  4.033   1.00 0.00 ? 49 THR A HG1  7  
ATOM 10434 H HG21 . THR A 1 49 ? 11.212  -3.468  2.869   1.00 0.00 ? 49 THR A HG21 7  
ATOM 10435 H HG22 . THR A 1 49 ? 9.845   -2.540  3.477   1.00 0.00 ? 49 THR A HG22 7  
ATOM 10436 H HG23 . THR A 1 49 ? 10.491  -3.883  4.428   1.00 0.00 ? 49 THR A HG23 7  
ATOM 10437 N N    . PRO A 1 50 ? 12.534  -1.541  7.829   1.00 0.00 ? 50 PRO A N    7  
ATOM 10438 C CA   . PRO A 1 50 ? 13.669  -1.153  8.707   1.00 0.00 ? 50 PRO A CA   7  
ATOM 10439 C C    . PRO A 1 50 ? 15.018  -1.139  7.953   1.00 0.00 ? 50 PRO A C    7  
ATOM 10440 O O    . PRO A 1 50 ? 15.442  -2.162  7.418   1.00 0.00 ? 50 PRO A O    7  
ATOM 10441 C CB   . PRO A 1 50 ? 13.664  -2.247  9.812   1.00 0.00 ? 50 PRO A CB   7  
ATOM 10442 C CG   . PRO A 1 50 ? 12.250  -2.739  9.856   1.00 0.00 ? 50 PRO A CG   7  
ATOM 10443 C CD   . PRO A 1 50 ? 11.749  -2.665  8.426   1.00 0.00 ? 50 PRO A CD   7  
ATOM 10444 H HA   . PRO A 1 50 ? 13.494  -0.178  9.158   1.00 0.00 ? 50 PRO A HA   7  
ATOM 10445 H HB2  . PRO A 1 50 ? 14.353  -3.055  9.549   1.00 0.00 ? 50 PRO A HB2  7  
ATOM 10446 H HB3  . PRO A 1 50 ? 13.949  -1.825  10.769  1.00 0.00 ? 50 PRO A HB3  7  
ATOM 10447 H HG2  . PRO A 1 50 ? 12.219  -3.764  10.225  1.00 0.00 ? 50 PRO A HG2  7  
ATOM 10448 H HG3  . PRO A 1 50 ? 11.647  -2.100  10.492  1.00 0.00 ? 50 PRO A HG3  7  
ATOM 10449 H HD2  . PRO A 1 50 ? 11.950  -3.593  7.895   1.00 0.00 ? 50 PRO A HD2  7  
ATOM 10450 H HD3  . PRO A 1 50 ? 10.684  -2.450  8.399   1.00 0.00 ? 50 PRO A HD3  7  
ATOM 10451 N N    . GLY A 1 51 ? 15.661  0.036   7.893   1.00 0.00 ? 51 GLY A N    7  
ATOM 10452 C CA   . GLY A 1 51 ? 16.950  0.200   7.209   1.00 0.00 ? 51 GLY A CA   7  
ATOM 10453 C C    . GLY A 1 51 ? 16.812  0.932   5.880   1.00 0.00 ? 51 GLY A C    7  
ATOM 10454 O O    . GLY A 1 51 ? 17.772  1.539   5.396   1.00 0.00 ? 51 GLY A O    7  
ATOM 10455 H H    . GLY A 1 51 ? 15.251  0.811   8.327   1.00 0.00 ? 51 GLY A H    7  
ATOM 10456 H HA2  . GLY A 1 51 ? 17.602  0.771   7.853   1.00 0.00 ? 51 GLY A HA2  7  
ATOM 10457 H HA3  . GLY A 1 51 ? 17.409  -0.769  7.031   1.00 0.00 ? 51 GLY A HA3  7  
ATOM 10458 N N    . LYS A 1 52 ? 15.609  0.859   5.274   1.00 0.00 ? 52 LYS A N    7  
ATOM 10459 C CA   . LYS A 1 52 ? 15.265  1.586   4.027   1.00 0.00 ? 52 LYS A CA   7  
ATOM 10460 C C    . LYS A 1 52 ? 14.121  2.574   4.302   1.00 0.00 ? 52 LYS A C    7  
ATOM 10461 O O    . LYS A 1 52 ? 13.325  2.893   3.407   1.00 0.00 ? 52 LYS A O    7  
ATOM 10462 C CB   . LYS A 1 52 ? 14.857  0.584   2.911   1.00 0.00 ? 52 LYS A CB   7  
ATOM 10463 C CG   . LYS A 1 52 ? 15.964  -0.401  2.481   1.00 0.00 ? 52 LYS A CG   7  
ATOM 10464 C CD   . LYS A 1 52 ? 15.510  -1.349  1.343   1.00 0.00 ? 52 LYS A CD   7  
ATOM 10465 C CE   . LYS A 1 52 ? 14.320  -2.235  1.745   1.00 0.00 ? 52 LYS A CE   7  
ATOM 10466 N NZ   . LYS A 1 52 ? 13.868  -3.126  0.657   1.00 0.00 ? 52 LYS A NZ   7  
ATOM 10467 H H    . LYS A 1 52 ? 14.920  0.286   5.674   1.00 0.00 ? 52 LYS A H    7  
ATOM 10468 H HA   . LYS A 1 52 ? 16.133  2.155   3.689   1.00 0.00 ? 52 LYS A HA   7  
ATOM 10469 H HB2  . LYS A 1 52 ? 14.009  0.004   3.262   1.00 0.00 ? 52 LYS A HB2  7  
ATOM 10470 H HB3  . LYS A 1 52 ? 14.546  1.147   2.033   1.00 0.00 ? 52 LYS A HB3  7  
ATOM 10471 H HG2  . LYS A 1 52 ? 16.825  0.166   2.142   1.00 0.00 ? 52 LYS A HG2  7  
ATOM 10472 H HG3  . LYS A 1 52 ? 16.252  -0.997  3.343   1.00 0.00 ? 52 LYS A HG3  7  
ATOM 10473 H HD2  . LYS A 1 52 ? 15.223  -0.755  0.480   1.00 0.00 ? 52 LYS A HD2  7  
ATOM 10474 H HD3  . LYS A 1 52 ? 16.343  -1.986  1.068   1.00 0.00 ? 52 LYS A HD3  7  
ATOM 10475 H HE2  . LYS A 1 52 ? 14.603  -2.847  2.591   1.00 0.00 ? 52 LYS A HE2  7  
ATOM 10476 H HE3  . LYS A 1 52 ? 13.493  -1.600  2.031   1.00 0.00 ? 52 LYS A HE3  7  
ATOM 10477 H HZ1  . LYS A 1 52 ? 14.668  -3.674  0.288   1.00 0.00 ? 52 LYS A HZ1  7  
ATOM 10478 H HZ2  . LYS A 1 52 ? 13.461  -2.564  -0.114  1.00 0.00 ? 52 LYS A HZ2  7  
ATOM 10479 H HZ3  . LYS A 1 52 ? 13.147  -3.779  1.011   1.00 0.00 ? 52 LYS A HZ3  7  
ATOM 10480 N N    . THR A 1 53 ? 14.051  3.054   5.552   1.00 0.00 ? 53 THR A N    7  
ATOM 10481 C CA   . THR A 1 53 ? 13.077  4.066   5.974   1.00 0.00 ? 53 THR A CA   7  
ATOM 10482 C C    . THR A 1 53 ? 13.642  5.476   5.662   1.00 0.00 ? 53 THR A C    7  
ATOM 10483 O O    . THR A 1 53 ? 14.641  5.873   6.271   1.00 0.00 ? 53 THR A O    7  
ATOM 10484 C CB   . THR A 1 53 ? 12.775  3.927   7.510   1.00 0.00 ? 53 THR A CB   7  
ATOM 10485 O OG1  . THR A 1 53 ? 12.458  2.556   7.818   1.00 0.00 ? 53 THR A OG1  7  
ATOM 10486 C CG2  . THR A 1 53 ? 11.606  4.835   7.949   1.00 0.00 ? 53 THR A CG2  7  
ATOM 10487 H H    . THR A 1 53 ? 14.694  2.723   6.212   1.00 0.00 ? 53 THR A H    7  
ATOM 10488 H HA   . THR A 1 53 ? 12.151  3.906   5.425   1.00 0.00 ? 53 THR A HA   7  
ATOM 10489 H HB   . THR A 1 53 ? 13.665  4.206   8.067   1.00 0.00 ? 53 THR A HB   7  
ATOM 10490 H HG1  . THR A 1 53 ? 12.546  2.024   7.020   1.00 0.00 ? 53 THR A HG1  7  
ATOM 10491 H HG21 . THR A 1 53 ? 11.441  4.741   9.014   1.00 0.00 ? 53 THR A HG21 7  
ATOM 10492 H HG22 . THR A 1 53 ? 10.703  4.551   7.422   1.00 0.00 ? 53 THR A HG22 7  
ATOM 10493 H HG23 . THR A 1 53 ? 11.840  5.868   7.714   1.00 0.00 ? 53 THR A HG23 7  
ATOM 10494 N N    . PRO A 1 54 ? 13.061  6.240   4.676   1.00 0.00 ? 54 PRO A N    7  
ATOM 10495 C CA   . PRO A 1 54 ? 13.509  7.621   4.383   1.00 0.00 ? 54 PRO A CA   7  
ATOM 10496 C C    . PRO A 1 54 ? 13.159  8.589   5.537   1.00 0.00 ? 54 PRO A C    7  
ATOM 10497 O O    . PRO A 1 54 ? 12.023  8.602   6.019   1.00 0.00 ? 54 PRO A O    7  
ATOM 10498 C CB   . PRO A 1 54 ? 12.748  7.978   3.072   1.00 0.00 ? 54 PRO A CB   7  
ATOM 10499 C CG   . PRO A 1 54 ? 11.536  7.093   3.077   1.00 0.00 ? 54 PRO A CG   7  
ATOM 10500 C CD   . PRO A 1 54 ? 11.964  5.812   3.765   1.00 0.00 ? 54 PRO A CD   7  
ATOM 10501 H HA   . PRO A 1 54 ? 14.582  7.654   4.198   1.00 0.00 ? 54 PRO A HA   7  
ATOM 10502 H HB2  . PRO A 1 54 ? 12.470  9.036   3.059   1.00 0.00 ? 54 PRO A HB2  7  
ATOM 10503 H HB3  . PRO A 1 54 ? 13.366  7.760   2.204   1.00 0.00 ? 54 PRO A HB3  7  
ATOM 10504 H HG2  . PRO A 1 54 ? 10.727  7.576   3.630   1.00 0.00 ? 54 PRO A HG2  7  
ATOM 10505 H HG3  . PRO A 1 54 ? 11.211  6.883   2.063   1.00 0.00 ? 54 PRO A HG3  7  
ATOM 10506 H HD2  . PRO A 1 54 ? 11.143  5.389   4.330   1.00 0.00 ? 54 PRO A HD2  7  
ATOM 10507 H HD3  . PRO A 1 54 ? 12.328  5.089   3.042   1.00 0.00 ? 54 PRO A HD3  7  
ATOM 10508 N N    . VAL A 1 55 ? 14.161  9.365   5.992   1.00 0.00 ? 55 VAL A N    7  
ATOM 10509 C CA   . VAL A 1 55 ? 13.976  10.413  7.014   1.00 0.00 ? 55 VAL A CA   7  
ATOM 10510 C C    . VAL A 1 55 ? 13.232  11.625  6.396   1.00 0.00 ? 55 VAL A C    7  
ATOM 10511 O O    . VAL A 1 55 ? 12.515  12.351  7.089   1.00 0.00 ? 55 VAL A O    7  
ATOM 10512 C CB   . VAL A 1 55 ? 15.359  10.847  7.656   1.00 0.00 ? 55 VAL A CB   7  
ATOM 10513 C CG1  . VAL A 1 55 ? 16.308  11.500  6.616   1.00 0.00 ? 55 VAL A CG1  7  
ATOM 10514 C CG2  . VAL A 1 55 ? 15.150  11.761  8.890   1.00 0.00 ? 55 VAL A CG2  7  
ATOM 10515 H H    . VAL A 1 55 ? 15.056  9.229   5.623   1.00 0.00 ? 55 VAL A H    7  
ATOM 10516 H HA   . VAL A 1 55 ? 13.354  9.995   7.804   1.00 0.00 ? 55 VAL A HA   7  
ATOM 10517 H HB   . VAL A 1 55 ? 15.849  9.938   8.004   1.00 0.00 ? 55 VAL A HB   7  
ATOM 10518 H HG11 . VAL A 1 55 ? 17.253  11.755  7.084   1.00 0.00 ? 55 VAL A HG11 7  
ATOM 10519 H HG12 . VAL A 1 55 ? 15.854  12.398  6.220   1.00 0.00 ? 55 VAL A HG12 7  
ATOM 10520 H HG13 . VAL A 1 55 ? 16.489  10.807  5.802   1.00 0.00 ? 55 VAL A HG13 7  
ATOM 10521 H HG21 . VAL A 1 55 ? 14.535  11.250  9.621   1.00 0.00 ? 55 VAL A HG21 7  
ATOM 10522 H HG22 . VAL A 1 55 ? 14.654  12.675  8.587   1.00 0.00 ? 55 VAL A HG22 7  
ATOM 10523 H HG23 . VAL A 1 55 ? 16.106  12.005  9.339   1.00 0.00 ? 55 VAL A HG23 7  
ATOM 10524 N N    . ASP A 1 56 ? 13.401  11.803  5.069   1.00 0.00 ? 56 ASP A N    7  
ATOM 10525 C CA   . ASP A 1 56 ? 12.646  12.799  4.278   1.00 0.00 ? 56 ASP A CA   7  
ATOM 10526 C C    . ASP A 1 56 ? 11.178  12.346  4.098   1.00 0.00 ? 56 ASP A C    7  
ATOM 10527 O O    . ASP A 1 56 ? 10.263  13.170  4.023   1.00 0.00 ? 56 ASP A O    7  
ATOM 10528 C CB   . ASP A 1 56 ? 13.310  13.005  2.890   1.00 0.00 ? 56 ASP A CB   7  
ATOM 10529 C CG   . ASP A 1 56 ? 14.742  13.567  2.981   1.00 0.00 ? 56 ASP A CG   7  
ATOM 10530 O OD1  . ASP A 1 56 ? 14.907  14.797  3.118   1.00 0.00 ? 56 ASP A OD1  7  
ATOM 10531 O OD2  . ASP A 1 56 ? 15.711  12.784  2.928   1.00 0.00 ? 56 ASP A OD2  7  
ATOM 10532 H H    . ASP A 1 56 ? 14.070  11.253  4.608   1.00 0.00 ? 56 ASP A H    7  
ATOM 10533 H HA   . ASP A 1 56 ? 12.659  13.738  4.822   1.00 0.00 ? 56 ASP A HA   7  
ATOM 10534 H HB2  . ASP A 1 56 ? 13.339  12.054  2.363   1.00 0.00 ? 56 ASP A HB2  7  
ATOM 10535 H HB3  . ASP A 1 56 ? 12.707  13.698  2.308   1.00 0.00 ? 56 ASP A HB3  7  
ATOM 10536 N N    . GLY A 1 57 ? 10.979  11.014  4.006   1.00 0.00 ? 57 GLY A N    7  
ATOM 10537 C CA   . GLY A 1 57 ? 9.643   10.421  3.912   1.00 0.00 ? 57 GLY A CA   7  
ATOM 10538 C C    . GLY A 1 57 ? 8.942   10.364  5.270   1.00 0.00 ? 57 GLY A C    7  
ATOM 10539 O O    . GLY A 1 57 ? 7.715   10.478  5.331   1.00 0.00 ? 57 GLY A O    7  
ATOM 10540 H H    . GLY A 1 57 ? 11.758  10.427  4.012   1.00 0.00 ? 57 GLY A H    7  
ATOM 10541 H HA2  . GLY A 1 57 ? 9.041   10.995  3.213   1.00 0.00 ? 57 GLY A HA2  7  
ATOM 10542 H HA3  . GLY A 1 57 ? 9.744   9.413   3.535   1.00 0.00 ? 57 GLY A HA3  7  
ATOM 10543 N N    . GLN A 1 58 ? 9.753   10.227  6.355   1.00 0.00 ? 58 GLN A N    7  
ATOM 10544 C CA   . GLN A 1 58 ? 9.277   10.005  7.739   1.00 0.00 ? 58 GLN A CA   7  
ATOM 10545 C C    . GLN A 1 58 ? 8.345   8.771   7.774   1.00 0.00 ? 58 GLN A C    7  
ATOM 10546 O O    . GLN A 1 58 ? 8.828   7.626   7.797   1.00 0.00 ? 58 GLN A O    7  
ATOM 10547 C CB   . GLN A 1 58 ? 8.623   11.293  8.328   1.00 0.00 ? 58 GLN A CB   7  
ATOM 10548 C CG   . GLN A 1 58 ? 9.582   12.487  8.524   1.00 0.00 ? 58 GLN A CG   7  
ATOM 10549 C CD   . GLN A 1 58 ? 8.872   13.757  8.992   1.00 0.00 ? 58 GLN A CD   7  
ATOM 10550 O OE1  . GLN A 1 58 ? 7.715   13.999  8.649   1.00 0.00 ? 58 GLN A OE1  7  
ATOM 10551 N NE2  . GLN A 1 58 ? 9.562   14.595  9.750   1.00 0.00 ? 58 GLN A NE2  7  
ATOM 10552 H H    . GLN A 1 58 ? 10.720  10.280  6.211   1.00 0.00 ? 58 GLN A H    7  
ATOM 10553 H HA   . GLN A 1 58 ? 10.155  9.766   8.328   1.00 0.00 ? 58 GLN A HA   7  
ATOM 10554 H HB2  . GLN A 1 58 ? 7.832   11.615  7.659   1.00 0.00 ? 58 GLN A HB2  7  
ATOM 10555 H HB3  . GLN A 1 58 ? 8.181   11.050  9.289   1.00 0.00 ? 58 GLN A HB3  7  
ATOM 10556 H HG2  . GLN A 1 58 ? 10.331  12.211  9.267   1.00 0.00 ? 58 GLN A HG2  7  
ATOM 10557 H HG3  . GLN A 1 58 ? 10.078  12.696  7.588   1.00 0.00 ? 58 GLN A HG3  7  
ATOM 10558 H HE21 . GLN A 1 58 ? 10.481  14.354  9.990   1.00 0.00 ? 58 GLN A HE21 7  
ATOM 10559 H HE22 . GLN A 1 58 ? 9.122   15.421  10.046  1.00 0.00 ? 58 GLN A HE22 7  
ATOM 10560 N N    . TYR A 1 59 ? 7.024   9.008   7.791   1.00 0.00 ? 59 TYR A N    7  
ATOM 10561 C CA   . TYR A 1 59 ? 6.002   8.047   7.366   1.00 0.00 ? 59 TYR A CA   7  
ATOM 10562 C C    . TYR A 1 59 ? 5.026   8.762   6.444   1.00 0.00 ? 59 TYR A C    7  
ATOM 10563 O O    . TYR A 1 59 ? 4.524   9.849   6.772   1.00 0.00 ? 59 TYR A O    7  
ATOM 10564 C CB   . TYR A 1 59 ? 5.264   7.387   8.559   1.00 0.00 ? 59 TYR A CB   7  
ATOM 10565 C CG   . TYR A 1 59 ? 6.057   6.235   9.180   1.00 0.00 ? 59 TYR A CG   7  
ATOM 10566 C CD1  . TYR A 1 59 ? 6.203   5.024   8.494   1.00 0.00 ? 59 TYR A CD1  7  
ATOM 10567 C CD2  . TYR A 1 59 ? 6.665   6.350   10.427  1.00 0.00 ? 59 TYR A CD2  7  
ATOM 10568 C CE1  . TYR A 1 59 ? 6.916   3.978   9.033   1.00 0.00 ? 59 TYR A CE1  7  
ATOM 10569 C CE2  . TYR A 1 59 ? 7.379   5.297   10.967  1.00 0.00 ? 59 TYR A CE2  7  
ATOM 10570 C CZ   . TYR A 1 59 ? 7.501   4.116   10.266  1.00 0.00 ? 59 TYR A CZ   7  
ATOM 10571 O OH   . TYR A 1 59 ? 8.206   3.061   10.808  1.00 0.00 ? 59 TYR A OH   7  
ATOM 10572 H H    . TYR A 1 59 ? 6.709   9.870   8.114   1.00 0.00 ? 59 TYR A H    7  
ATOM 10573 H HA   . TYR A 1 59 ? 6.501   7.264   6.786   1.00 0.00 ? 59 TYR A HA   7  
ATOM 10574 H HB2  . TYR A 1 59 ? 5.074   8.131   9.326   1.00 0.00 ? 59 TYR A HB2  7  
ATOM 10575 H HB3  . TYR A 1 59 ? 4.311   6.985   8.224   1.00 0.00 ? 59 TYR A HB3  7  
ATOM 10576 H HD1  . TYR A 1 59 ? 5.742   4.910   7.523   1.00 0.00 ? 59 TYR A HD1  7  
ATOM 10577 H HD2  . TYR A 1 59 ? 6.569   7.276   10.981  1.00 0.00 ? 59 TYR A HD2  7  
ATOM 10578 H HE1  . TYR A 1 59 ? 7.011   3.048   8.481   1.00 0.00 ? 59 TYR A HE1  7  
ATOM 10579 H HE2  . TYR A 1 59 ? 7.844   5.406   11.939  1.00 0.00 ? 59 TYR A HE2  7  
ATOM 10580 H HH   . TYR A 1 59 ? 8.851   2.740   10.165  1.00 0.00 ? 59 TYR A HH   7  
ATOM 10581 N N    . VAL A 1 60 ? 4.753   8.133   5.310   1.00 0.00 ? 60 VAL A N    7  
ATOM 10582 C CA   . VAL A 1 60 ? 3.805   8.634   4.323   1.00 0.00 ? 60 VAL A CA   7  
ATOM 10583 C C    . VAL A 1 60 ? 2.543   7.772   4.401   1.00 0.00 ? 60 VAL A C    7  
ATOM 10584 O O    . VAL A 1 60 ? 2.588   6.634   4.883   1.00 0.00 ? 60 VAL A O    7  
ATOM 10585 C CB   . VAL A 1 60 ? 4.416   8.634   2.868   1.00 0.00 ? 60 VAL A CB   7  
ATOM 10586 C CG1  . VAL A 1 60 ? 5.676   9.529   2.790   1.00 0.00 ? 60 VAL A CG1  7  
ATOM 10587 C CG2  . VAL A 1 60 ? 4.729   7.207   2.367   1.00 0.00 ? 60 VAL A CG2  7  
ATOM 10588 H H    . VAL A 1 60 ? 5.201   7.283   5.131   1.00 0.00 ? 60 VAL A H    7  
ATOM 10589 H HA   . VAL A 1 60 ? 3.538   9.660   4.581   1.00 0.00 ? 60 VAL A HA   7  
ATOM 10590 H HB   . VAL A 1 60 ? 3.670   9.061   2.197   1.00 0.00 ? 60 VAL A HB   7  
ATOM 10591 H HG11 . VAL A 1 60 ? 5.421   10.543  3.069   1.00 0.00 ? 60 VAL A HG11 7  
ATOM 10592 H HG12 . VAL A 1 60 ? 6.070   9.528   1.782   1.00 0.00 ? 60 VAL A HG12 7  
ATOM 10593 H HG13 . VAL A 1 60 ? 6.435   9.154   3.470   1.00 0.00 ? 60 VAL A HG13 7  
ATOM 10594 H HG21 . VAL A 1 60 ? 5.399   6.712   3.057   1.00 0.00 ? 60 VAL A HG21 7  
ATOM 10595 H HG22 . VAL A 1 60 ? 5.190   7.252   1.386   1.00 0.00 ? 60 VAL A HG22 7  
ATOM 10596 H HG23 . VAL A 1 60 ? 3.813   6.634   2.295   1.00 0.00 ? 60 VAL A HG23 7  
ATOM 10597 N N    . TRP A 1 61 ? 1.410   8.339   3.989   1.00 0.00 ? 61 TRP A N    7  
ATOM 10598 C CA   . TRP A 1 61 ? 0.095   7.675   4.080   1.00 0.00 ? 61 TRP A CA   7  
ATOM 10599 C C    . TRP A 1 61 ? -0.875  8.289   3.070   1.00 0.00 ? 61 TRP A C    7  
ATOM 10600 O O    . TRP A 1 61 ? -0.528  9.234   2.387   1.00 0.00 ? 61 TRP A O    7  
ATOM 10601 C CB   . TRP A 1 61 ? -0.459  7.776   5.531   1.00 0.00 ? 61 TRP A CB   7  
ATOM 10602 C CG   . TRP A 1 61 ? -0.658  9.188   6.042   1.00 0.00 ? 61 TRP A CG   7  
ATOM 10603 C CD1  . TRP A 1 61 ? 0.305   10.045  6.502   1.00 0.00 ? 61 TRP A CD1  7  
ATOM 10604 C CD2  . TRP A 1 61 ? -1.906  9.888   6.171   1.00 0.00 ? 61 TRP A CD2  7  
ATOM 10605 N NE1  . TRP A 1 61 ? -0.265  11.227  6.900   1.00 0.00 ? 61 TRP A NE1  7  
ATOM 10606 C CE2  . TRP A 1 61 ? -1.619  11.156  6.706   1.00 0.00 ? 61 TRP A CE2  7  
ATOM 10607 C CE3  . TRP A 1 61 ? -3.231  9.562   5.871   1.00 0.00 ? 61 TRP A CE3  7  
ATOM 10608 C CZ2  . TRP A 1 61 ? -2.610  12.094  6.963   1.00 0.00 ? 61 TRP A CZ2  7  
ATOM 10609 C CZ3  . TRP A 1 61 ? -4.217  10.490  6.125   1.00 0.00 ? 61 TRP A CZ3  7  
ATOM 10610 C CH2  . TRP A 1 61 ? -3.902  11.747  6.663   1.00 0.00 ? 61 TRP A CH2  7  
ATOM 10611 H H    . TRP A 1 61 ? 1.449   9.248   3.615   1.00 0.00 ? 61 TRP A H    7  
ATOM 10612 H HA   . TRP A 1 61 ? 0.230   6.627   3.824   1.00 0.00 ? 61 TRP A HA   7  
ATOM 10613 H HB2  . TRP A 1 61 ? -1.414  7.267   5.585   1.00 0.00 ? 61 TRP A HB2  7  
ATOM 10614 H HB3  . TRP A 1 61 ? 0.228   7.272   6.205   1.00 0.00 ? 61 TRP A HB3  7  
ATOM 10615 H HD1  . TRP A 1 61 ? 1.362   9.811   6.541   1.00 0.00 ? 61 TRP A HD1  7  
ATOM 10616 H HE1  . TRP A 1 61 ? 0.220   11.999  7.264   1.00 0.00 ? 61 TRP A HE1  7  
ATOM 10617 H HE3  . TRP A 1 61 ? -3.487  8.600   5.454   1.00 0.00 ? 61 TRP A HE3  7  
ATOM 10618 H HZ2  . TRP A 1 61 ? -2.382  13.067  7.375   1.00 0.00 ? 61 TRP A HZ2  7  
ATOM 10619 H HZ3  . TRP A 1 61 ? -5.249  10.257  5.904   1.00 0.00 ? 61 TRP A HZ3  7  
ATOM 10620 H HH2  . TRP A 1 61 ? -4.707  12.450  6.846   1.00 0.00 ? 61 TRP A HH2  7  
ATOM 10621 N N    . PHE A 1 62 ? -2.076  7.723   2.961   1.00 0.00 ? 62 PHE A N    7  
ATOM 10622 C CA   . PHE A 1 62 ? -3.118  8.221   2.043   1.00 0.00 ? 62 PHE A CA   7  
ATOM 10623 C C    . PHE A 1 62 ? -4.501  7.765   2.514   1.00 0.00 ? 62 PHE A C    7  
ATOM 10624 O O    . PHE A 1 62 ? -4.633  6.676   3.069   1.00 0.00 ? 62 PHE A O    7  
ATOM 10625 C CB   . PHE A 1 62 ? -2.834  7.758   0.580   1.00 0.00 ? 62 PHE A CB   7  
ATOM 10626 C CG   . PHE A 1 62 ? -2.624  6.249   0.411   1.00 0.00 ? 62 PHE A CG   7  
ATOM 10627 C CD1  . PHE A 1 62 ? -1.361  5.677   0.606   1.00 0.00 ? 62 PHE A CD1  7  
ATOM 10628 C CD2  . PHE A 1 62 ? -3.681  5.399   0.081   1.00 0.00 ? 62 PHE A CD2  7  
ATOM 10629 C CE1  . PHE A 1 62 ? -1.169  4.319   0.472   1.00 0.00 ? 62 PHE A CE1  7  
ATOM 10630 C CE2  . PHE A 1 62 ? -3.481  4.041   -0.050  1.00 0.00 ? 62 PHE A CE2  7  
ATOM 10631 C CZ   . PHE A 1 62 ? -2.227  3.502   0.145   1.00 0.00 ? 62 PHE A CZ   7  
ATOM 10632 H H    . PHE A 1 62 ? -2.259  6.917   3.481   1.00 0.00 ? 62 PHE A H    7  
ATOM 10633 H HA   . PHE A 1 62 ? -3.092  9.307   2.076   1.00 0.00 ? 62 PHE A HA   7  
ATOM 10634 H HB2  . PHE A 1 62 ? -3.664  8.056   -0.051  1.00 0.00 ? 62 PHE A HB2  7  
ATOM 10635 H HB3  . PHE A 1 62 ? -1.942  8.263   0.224   1.00 0.00 ? 62 PHE A HB3  7  
ATOM 10636 H HD1  . PHE A 1 62 ? -0.522  6.313   0.865   1.00 0.00 ? 62 PHE A HD1  7  
ATOM 10637 H HD2  . PHE A 1 62 ? -4.671  5.813   -0.075  1.00 0.00 ? 62 PHE A HD2  7  
ATOM 10638 H HE1  . PHE A 1 62 ? -0.186  3.889   0.623   1.00 0.00 ? 62 PHE A HE1  7  
ATOM 10639 H HE2  . PHE A 1 62 ? -4.311  3.394   -0.308  1.00 0.00 ? 62 PHE A HE2  7  
ATOM 10640 H HZ   . PHE A 1 62 ? -2.077  2.433   0.040   1.00 0.00 ? 62 PHE A HZ   7  
ATOM 10641 N N    . ASN A 1 63 ? -5.525  8.596   2.272   1.00 0.00 ? 63 ASN A N    7  
ATOM 10642 C CA   . ASN A 1 63 ? -6.911  8.283   2.659   1.00 0.00 ? 63 ASN A CA   7  
ATOM 10643 C C    . ASN A 1 63 ? -7.606  7.560   1.491   1.00 0.00 ? 63 ASN A C    7  
ATOM 10644 O O    . ASN A 1 63 ? -7.515  7.998   0.333   1.00 0.00 ? 63 ASN A O    7  
ATOM 10645 C CB   . ASN A 1 63 ? -7.683  9.561   3.111   1.00 0.00 ? 63 ASN A CB   7  
ATOM 10646 C CG   . ASN A 1 63 ? -8.028  10.541  1.984   1.00 0.00 ? 63 ASN A CG   7  
ATOM 10647 O OD1  . ASN A 1 63 ? -9.116  10.499  1.418   1.00 0.00 ? 63 ASN A OD1  7  
ATOM 10648 N ND2  . ASN A 1 63 ? -7.111  11.418  1.644   1.00 0.00 ? 63 ASN A ND2  7  
ATOM 10649 H H    . ASN A 1 63 ? -5.346  9.414   1.761   1.00 0.00 ? 63 ASN A H    7  
ATOM 10650 H HA   . ASN A 1 63 ? -6.867  7.596   3.502   1.00 0.00 ? 63 ASN A HA   7  
ATOM 10651 H HB2  . ASN A 1 63 ? -8.612  9.261   3.581   1.00 0.00 ? 63 ASN A HB2  7  
ATOM 10652 H HB3  . ASN A 1 63 ? -7.090  10.090  3.850   1.00 0.00 ? 63 ASN A HB3  7  
ATOM 10653 H HD21 . ASN A 1 63 ? -6.254  11.404  2.119   1.00 0.00 ? 63 ASN A HD21 7  
ATOM 10654 H HD22 . ASN A 1 63 ? -7.323  12.054  0.930   1.00 0.00 ? 63 ASN A HD22 7  
ATOM 10655 N N    . ILE A 1 64 ? -8.251  6.421   1.790   1.00 0.00 ? 64 ILE A N    7  
ATOM 10656 C CA   . ILE A 1 64 ? -8.906  5.572   0.775   1.00 0.00 ? 64 ILE A CA   7  
ATOM 10657 C C    . ILE A 1 64 ? -10.432 5.762   0.787   1.00 0.00 ? 64 ILE A C    7  
ATOM 10658 O O    . ILE A 1 64 ? -11.040 5.964   -0.269  1.00 0.00 ? 64 ILE A O    7  
ATOM 10659 C CB   . ILE A 1 64 ? -8.539  4.042   0.961   1.00 0.00 ? 64 ILE A CB   7  
ATOM 10660 C CG1  . ILE A 1 64 ? -8.868  3.535   2.408   1.00 0.00 ? 64 ILE A CG1  7  
ATOM 10661 C CG2  . ILE A 1 64 ? -7.052  3.802   0.619   1.00 0.00 ? 64 ILE A CG2  7  
ATOM 10662 C CD1  . ILE A 1 64 ? -8.629  2.055   2.652   1.00 0.00 ? 64 ILE A CD1  7  
ATOM 10663 H H    . ILE A 1 64 ? -8.301  6.151   2.728   1.00 0.00 ? 64 ILE A H    7  
ATOM 10664 H HA   . ILE A 1 64 ? -8.538  5.880   -0.209  1.00 0.00 ? 64 ILE A HA   7  
ATOM 10665 H HB   . ILE A 1 64 ? -9.130  3.466   0.249   1.00 0.00 ? 64 ILE A HB   7  
ATOM 10666 H HG12 . ILE A 1 64 ? -8.264  4.079   3.121   1.00 0.00 ? 64 ILE A HG12 7  
ATOM 10667 H HG13 . ILE A 1 64 ? -9.912  3.731   2.621   1.00 0.00 ? 64 ILE A HG13 7  
ATOM 10668 H HG21 . ILE A 1 64 ? -6.852  4.123   -0.398  1.00 0.00 ? 64 ILE A HG21 7  
ATOM 10669 H HG22 . ILE A 1 64 ? -6.815  2.748   0.709   1.00 0.00 ? 64 ILE A HG22 7  
ATOM 10670 H HG23 . ILE A 1 64 ? -6.425  4.365   1.300   1.00 0.00 ? 64 ILE A HG23 7  
ATOM 10671 H HD11 . ILE A 1 64 ? -7.575  1.833   2.549   1.00 0.00 ? 64 ILE A HD11 7  
ATOM 10672 H HD12 . ILE A 1 64 ? -9.189  1.475   1.937   1.00 0.00 ? 64 ILE A HD12 7  
ATOM 10673 H HD13 . ILE A 1 64 ? -8.950  1.801   3.650   1.00 0.00 ? 64 ILE A HD13 7  
ATOM 10674 N N    . GLY A 1 65 ? -11.038 5.736   1.988   1.00 0.00 ? 65 GLY A N    7  
ATOM 10675 C CA   . GLY A 1 65 ? -12.487 5.642   2.123   1.00 0.00 ? 65 GLY A CA   7  
ATOM 10676 C C    . GLY A 1 65 ? -12.984 4.251   1.733   1.00 0.00 ? 65 GLY A C    7  
ATOM 10677 O O    . GLY A 1 65 ? -13.134 3.377   2.599   1.00 0.00 ? 65 GLY A O    7  
ATOM 10678 H H    . GLY A 1 65 ? -10.486 5.784   2.796   1.00 0.00 ? 65 GLY A H    7  
ATOM 10679 H HA2  . GLY A 1 65 ? -12.750 5.843   3.153   1.00 0.00 ? 65 GLY A HA2  7  
ATOM 10680 H HA3  . GLY A 1 65 ? -12.963 6.386   1.494   1.00 0.00 ? 65 GLY A HA3  7  
ATOM 10681 N N    . SER A 1 66 ? -13.174 4.033   0.415   1.00 0.00 ? 66 SER A N    7  
ATOM 10682 C CA   . SER A 1 66 ? -13.566 2.733   -0.136  1.00 0.00 ? 66 SER A CA   7  
ATOM 10683 C C    . SER A 1 66 ? -12.374 1.751   -0.065  1.00 0.00 ? 66 SER A C    7  
ATOM 10684 O O    . SER A 1 66 ? -11.456 1.769   -0.911  1.00 0.00 ? 66 SER A O    7  
ATOM 10685 C CB   . SER A 1 66 ? -14.078 2.879   -1.578  1.00 0.00 ? 66 SER A CB   7  
ATOM 10686 O OG   . SER A 1 66 ? -14.463 1.622   -2.103  1.00 0.00 ? 66 SER A OG   7  
ATOM 10687 H H    . SER A 1 66 ? -13.026 4.775   -0.206  1.00 0.00 ? 66 SER A H    7  
ATOM 10688 H HA   . SER A 1 66 ? -14.384 2.343   0.474   1.00 0.00 ? 66 SER A HA   7  
ATOM 10689 H HB2  . SER A 1 66 ? -14.934 3.540   -1.597  1.00 0.00 ? 66 SER A HB2  7  
ATOM 10690 H HB3  . SER A 1 66 ? -13.295 3.291   -2.202  1.00 0.00 ? 66 SER A HB3  7  
ATOM 10691 H HG   . SER A 1 66 ? -13.947 1.441   -2.890  1.00 0.00 ? 66 SER A HG   7  
ATOM 10692 N N    . VAL A 1 67 ? -12.397 0.945   1.003   1.00 0.00 ? 67 VAL A N    7  
ATOM 10693 C CA   . VAL A 1 67 ? -11.412 -0.121  1.267   1.00 0.00 ? 67 VAL A CA   7  
ATOM 10694 C C    . VAL A 1 67 ? -11.337 -1.103  0.092   1.00 0.00 ? 67 VAL A C    7  
ATOM 10695 O O    . VAL A 1 67 ? -10.253 -1.547  -0.276  1.00 0.00 ? 67 VAL A O    7  
ATOM 10696 C CB   . VAL A 1 67 ? -11.740 -0.933  2.580   1.00 0.00 ? 67 VAL A CB   7  
ATOM 10697 C CG1  . VAL A 1 67 ? -10.543 -1.825  2.989   1.00 0.00 ? 67 VAL A CG1  7  
ATOM 10698 C CG2  . VAL A 1 67 ? -12.159 0.004   3.730   1.00 0.00 ? 67 VAL A CG2  7  
ATOM 10699 H H    . VAL A 1 67 ? -13.100 1.117   1.665   1.00 0.00 ? 67 VAL A H    7  
ATOM 10700 H HA   . VAL A 1 67 ? -10.447 0.357   1.398   1.00 0.00 ? 67 VAL A HA   7  
ATOM 10701 H HB   . VAL A 1 67 ? -12.585 -1.591  2.367   1.00 0.00 ? 67 VAL A HB   7  
ATOM 10702 H HG11 . VAL A 1 67 ? -10.307 -2.514  2.187   1.00 0.00 ? 67 VAL A HG11 7  
ATOM 10703 H HG12 . VAL A 1 67 ? -10.787 -2.391  3.880   1.00 0.00 ? 67 VAL A HG12 7  
ATOM 10704 H HG13 . VAL A 1 67 ? -9.678  -1.204  3.190   1.00 0.00 ? 67 VAL A HG13 7  
ATOM 10705 H HG21 . VAL A 1 67 ? -12.412 -0.578  4.611   1.00 0.00 ? 67 VAL A HG21 7  
ATOM 10706 H HG22 . VAL A 1 67 ? -13.020 0.588   3.430   1.00 0.00 ? 67 VAL A HG22 7  
ATOM 10707 H HG23 . VAL A 1 67 ? -11.341 0.671   3.970   1.00 0.00 ? 67 VAL A HG23 7  
ATOM 10708 N N    . ASP A 1 68 ? -12.516 -1.410  -0.489  1.00 0.00 ? 68 ASP A N    7  
ATOM 10709 C CA   . ASP A 1 68 ? -12.655 -2.352  -1.615  1.00 0.00 ? 68 ASP A CA   7  
ATOM 10710 C C    . ASP A 1 68 ? -11.815 -1.902  -2.815  1.00 0.00 ? 68 ASP A C    7  
ATOM 10711 O O    . ASP A 1 68 ? -11.148 -2.718  -3.439  1.00 0.00 ? 68 ASP A O    7  
ATOM 10712 C CB   . ASP A 1 68 ? -14.141 -2.489  -2.046  1.00 0.00 ? 68 ASP A CB   7  
ATOM 10713 C CG   . ASP A 1 68 ? -15.068 -2.931  -0.904  1.00 0.00 ? 68 ASP A CG   7  
ATOM 10714 O OD1  . ASP A 1 68 ? -14.975 -4.091  -0.457  1.00 0.00 ? 68 ASP A OD1  7  
ATOM 10715 O OD2  . ASP A 1 68 ? -15.890 -2.117  -0.435  1.00 0.00 ? 68 ASP A OD2  7  
ATOM 10716 H H    . ASP A 1 68 ? -13.332 -0.979  -0.157  1.00 0.00 ? 68 ASP A H    7  
ATOM 10717 H HA   . ASP A 1 68 ? -12.299 -3.322  -1.274  1.00 0.00 ? 68 ASP A HA   7  
ATOM 10718 H HB2  . ASP A 1 68 ? -14.492 -1.537  -2.437  1.00 0.00 ? 68 ASP A HB2  7  
ATOM 10719 H HB3  . ASP A 1 68 ? -14.213 -3.230  -2.842  1.00 0.00 ? 68 ASP A HB3  7  
ATOM 10720 N N    . THR A 1 69 ? -11.843 -0.579  -3.102  1.00 0.00 ? 69 THR A N    7  
ATOM 10721 C CA   . THR A 1 69 ? -11.075 0.019   -4.205  1.00 0.00 ? 69 THR A CA   7  
ATOM 10722 C C    . THR A 1 69 ? -9.565  -0.126  -3.940  1.00 0.00 ? 69 THR A C    7  
ATOM 10723 O O    . THR A 1 69 ? -8.820  -0.502  -4.843  1.00 0.00 ? 69 THR A O    7  
ATOM 10724 C CB   . THR A 1 69 ? -11.430 1.525   -4.402  1.00 0.00 ? 69 THR A CB   7  
ATOM 10725 O OG1  . THR A 1 69 ? -12.848 1.669   -4.539  1.00 0.00 ? 69 THR A OG1  7  
ATOM 10726 C CG2  . THR A 1 69 ? -10.732 2.139   -5.635  1.00 0.00 ? 69 THR A CG2  7  
ATOM 10727 H H    . THR A 1 69 ? -12.391 0.012   -2.543  1.00 0.00 ? 69 THR A H    7  
ATOM 10728 H HA   . THR A 1 69 ? -11.338 -0.515  -5.116  1.00 0.00 ? 69 THR A HA   7  
ATOM 10729 H HB   . THR A 1 69 ? -11.120 2.074   -3.515  1.00 0.00 ? 69 THR A HB   7  
ATOM 10730 H HG1  . THR A 1 69 ? -13.108 1.390   -5.425  1.00 0.00 ? 69 THR A HG1  7  
ATOM 10731 H HG21 . THR A 1 69 ? -9.653  2.040   -5.536  1.00 0.00 ? 69 THR A HG21 7  
ATOM 10732 H HG22 . THR A 1 69 ? -10.991 3.190   -5.716  1.00 0.00 ? 69 THR A HG22 7  
ATOM 10733 H HG23 . THR A 1 69 ? -11.050 1.628   -6.530  1.00 0.00 ? 69 THR A HG23 7  
ATOM 10734 N N    . PHE A 1 70 ? -9.138  0.186   -2.687  1.00 0.00 ? 70 PHE A N    7  
ATOM 10735 C CA   . PHE A 1 70 ? -7.739  -0.007  -2.239  1.00 0.00 ? 70 PHE A CA   7  
ATOM 10736 C C    . PHE A 1 70 ? -7.261  -1.446  -2.505  1.00 0.00 ? 70 PHE A C    7  
ATOM 10737 O O    . PHE A 1 70 ? -6.204  -1.639  -3.090  1.00 0.00 ? 70 PHE A O    7  
ATOM 10738 C CB   . PHE A 1 70 ? -7.590  0.342   -0.727  1.00 0.00 ? 70 PHE A CB   7  
ATOM 10739 C CG   . PHE A 1 70 ? -6.278  -0.132  -0.086  1.00 0.00 ? 70 PHE A CG   7  
ATOM 10740 C CD1  . PHE A 1 70 ? -5.050  0.410   -0.478  1.00 0.00 ? 70 PHE A CD1  7  
ATOM 10741 C CD2  . PHE A 1 70 ? -6.271  -1.151  0.878   1.00 0.00 ? 70 PHE A CD2  7  
ATOM 10742 C CE1  . PHE A 1 70 ? -3.864  -0.046  0.074   1.00 0.00 ? 70 PHE A CE1  7  
ATOM 10743 C CE2  . PHE A 1 70 ? -5.086  -1.604  1.420   1.00 0.00 ? 70 PHE A CE2  7  
ATOM 10744 C CZ   . PHE A 1 70 ? -3.886  -1.051  1.022   1.00 0.00 ? 70 PHE A CZ   7  
ATOM 10745 H H    . PHE A 1 70 ? -9.780  0.583   -2.046  1.00 0.00 ? 70 PHE A H    7  
ATOM 10746 H HA   . PHE A 1 70 ? -7.121  0.682   -2.812  1.00 0.00 ? 70 PHE A HA   7  
ATOM 10747 H HB2  . PHE A 1 70 ? -7.645  1.417   -0.607  1.00 0.00 ? 70 PHE A HB2  7  
ATOM 10748 H HB3  . PHE A 1 70 ? -8.414  -0.105  -0.183  1.00 0.00 ? 70 PHE A HB3  7  
ATOM 10749 H HD1  . PHE A 1 70 ? -5.025  1.200   -1.221  1.00 0.00 ? 70 PHE A HD1  7  
ATOM 10750 H HD2  . PHE A 1 70 ? -7.206  -1.591  1.199   1.00 0.00 ? 70 PHE A HD2  7  
ATOM 10751 H HE1  . PHE A 1 70 ? -2.918  0.385   -0.236  1.00 0.00 ? 70 PHE A HE1  7  
ATOM 10752 H HE2  . PHE A 1 70 ? -5.094  -2.391  2.169   1.00 0.00 ? 70 PHE A HE2  7  
ATOM 10753 H HZ   . PHE A 1 70 ? -2.959  -1.409  1.454   1.00 0.00 ? 70 PHE A HZ   7  
ATOM 10754 N N    . GLU A 1 71 ? -8.068  -2.428  -2.058  1.00 0.00 ? 71 GLU A N    7  
ATOM 10755 C CA   . GLU A 1 71 ? -7.740  -3.862  -2.143  1.00 0.00 ? 71 GLU A CA   7  
ATOM 10756 C C    . GLU A 1 71 ? -7.628  -4.308  -3.604  1.00 0.00 ? 71 GLU A C    7  
ATOM 10757 O O    . GLU A 1 71 ? -6.669  -4.976  -3.973  1.00 0.00 ? 71 GLU A O    7  
ATOM 10758 C CB   . GLU A 1 71 ? -8.813  -4.702  -1.408  1.00 0.00 ? 71 GLU A CB   7  
ATOM 10759 C CG   . GLU A 1 71 ? -8.927  -4.404  0.097   1.00 0.00 ? 71 GLU A CG   7  
ATOM 10760 C CD   . GLU A 1 71 ? -10.106 -5.140  0.738   1.00 0.00 ? 71 GLU A CD   7  
ATOM 10761 O OE1  . GLU A 1 71 ? -9.939  -6.306  1.142   1.00 0.00 ? 71 GLU A OE1  7  
ATOM 10762 O OE2  . GLU A 1 71 ? -11.216 -4.576  0.800   1.00 0.00 ? 71 GLU A OE2  7  
ATOM 10763 H H    . GLU A 1 71 ? -8.924  -2.175  -1.661  1.00 0.00 ? 71 GLU A H    7  
ATOM 10764 H HA   . GLU A 1 71 ? -6.781  -4.016  -1.649  1.00 0.00 ? 71 GLU A HA   7  
ATOM 10765 H HB2  . GLU A 1 71 ? -9.782  -4.518  -1.863  1.00 0.00 ? 71 GLU A HB2  7  
ATOM 10766 H HB3  . GLU A 1 71 ? -8.574  -5.760  -1.519  1.00 0.00 ? 71 GLU A HB3  7  
ATOM 10767 H HG2  . GLU A 1 71 ? -8.005  -4.707  0.591   1.00 0.00 ? 71 GLU A HG2  7  
ATOM 10768 H HG3  . GLU A 1 71 ? -9.059  -3.334  0.234   1.00 0.00 ? 71 GLU A HG3  7  
ATOM 10769 N N    . ARG A 1 72 ? -8.615  -3.893  -4.424  1.00 0.00 ? 72 ARG A N    7  
ATOM 10770 C CA   . ARG A 1 72 ? -8.681  -4.223  -5.858  1.00 0.00 ? 72 ARG A CA   7  
ATOM 10771 C C    . ARG A 1 72 ? -7.440  -3.713  -6.609  1.00 0.00 ? 72 ARG A C    7  
ATOM 10772 O O    . ARG A 1 72 ? -6.808  -4.470  -7.352  1.00 0.00 ? 72 ARG A O    7  
ATOM 10773 C CB   . ARG A 1 72 ? -9.969  -3.631  -6.493  1.00 0.00 ? 72 ARG A CB   7  
ATOM 10774 C CG   . ARG A 1 72 ? -11.279 -4.347  -6.098  1.00 0.00 ? 72 ARG A CG   7  
ATOM 10775 C CD   . ARG A 1 72 ? -12.515 -3.706  -6.754  1.00 0.00 ? 72 ARG A CD   7  
ATOM 10776 N NE   . ARG A 1 72 ? -12.400 -3.684  -8.233  1.00 0.00 ? 72 ARG A NE   7  
ATOM 10777 C CZ   . ARG A 1 72 ? -12.401 -2.580  -9.004  1.00 0.00 ? 72 ARG A CZ   7  
ATOM 10778 N NH1  . ARG A 1 72 ? -12.527 -1.373  -8.461  1.00 0.00 ? 72 ARG A NH1  7  
ATOM 10779 N NH2  . ARG A 1 72 ? -12.236 -2.699  -10.313 1.00 0.00 ? 72 ARG A NH2  7  
ATOM 10780 H H    . ARG A 1 72 ? -9.332  -3.345  -4.052  1.00 0.00 ? 72 ARG A H    7  
ATOM 10781 H HA   . ARG A 1 72 ? -8.724  -5.306  -5.944  1.00 0.00 ? 72 ARG A HA   7  
ATOM 10782 H HB2  . ARG A 1 72 ? -10.052 -2.588  -6.203  1.00 0.00 ? 72 ARG A HB2  7  
ATOM 10783 H HB3  . ARG A 1 72 ? -9.883  -3.677  -7.577  1.00 0.00 ? 72 ARG A HB3  7  
ATOM 10784 H HG2  . ARG A 1 72 ? -11.218 -5.386  -6.406  1.00 0.00 ? 72 ARG A HG2  7  
ATOM 10785 H HG3  . ARG A 1 72 ? -11.391 -4.306  -5.018  1.00 0.00 ? 72 ARG A HG3  7  
ATOM 10786 H HD2  . ARG A 1 72 ? -13.398 -4.274  -6.478  1.00 0.00 ? 72 ARG A HD2  7  
ATOM 10787 H HD3  . ARG A 1 72 ? -12.619 -2.690  -6.382  1.00 0.00 ? 72 ARG A HD3  7  
ATOM 10788 H HE   . ARG A 1 72 ? -12.316 -4.557  -8.678  1.00 0.00 ? 72 ARG A HE   7  
ATOM 10789 H HH11 . ARG A 1 72 ? -12.620 -1.273  -7.466  1.00 0.00 ? 72 ARG A HH11 7  
ATOM 10790 H HH12 . ARG A 1 72 ? -12.527 -0.556  -9.038  1.00 0.00 ? 72 ARG A HH12 7  
ATOM 10791 H HH21 . ARG A 1 72 ? -12.110 -3.607  -10.725 1.00 0.00 ? 72 ARG A HH21 7  
ATOM 10792 H HH22 . ARG A 1 72 ? -12.237 -1.884  -10.898 1.00 0.00 ? 72 ARG A HH22 7  
ATOM 10793 N N    . ASN A 1 73 ? -7.104  -2.424  -6.388  1.00 0.00 ? 73 ASN A N    7  
ATOM 10794 C CA   . ASN A 1 73 ? -5.966  -1.757  -7.046  1.00 0.00 ? 73 ASN A CA   7  
ATOM 10795 C C    . ASN A 1 73 ? -4.652  -2.378  -6.582  1.00 0.00 ? 73 ASN A C    7  
ATOM 10796 O O    . ASN A 1 73 ? -3.780  -2.631  -7.400  1.00 0.00 ? 73 ASN A O    7  
ATOM 10797 C CB   . ASN A 1 73 ? -5.964  -0.233  -6.757  1.00 0.00 ? 73 ASN A CB   7  
ATOM 10798 C CG   . ASN A 1 73 ? -7.172  0.506   -7.328  1.00 0.00 ? 73 ASN A CG   7  
ATOM 10799 O OD1  . ASN A 1 73 ? -7.752  0.109   -8.345  1.00 0.00 ? 73 ASN A OD1  7  
ATOM 10800 N ND2  . ASN A 1 73 ? -7.556  1.585   -6.674  1.00 0.00 ? 73 ASN A ND2  7  
ATOM 10801 H H    . ASN A 1 73 ? -7.627  -1.897  -5.750  1.00 0.00 ? 73 ASN A H    7  
ATOM 10802 H HA   . ASN A 1 73 ? -6.071  -1.906  -8.119  1.00 0.00 ? 73 ASN A HA   7  
ATOM 10803 H HB2  . ASN A 1 73 ? -5.948  -0.076  -5.682  1.00 0.00 ? 73 ASN A HB2  7  
ATOM 10804 H HB3  . ASN A 1 73 ? -5.072  0.218   -7.184  1.00 0.00 ? 73 ASN A HB3  7  
ATOM 10805 H HD21 . ASN A 1 73 ? -7.052  1.840   -5.871  1.00 0.00 ? 73 ASN A HD21 7  
ATOM 10806 H HD22 . ASN A 1 73 ? -8.316  2.091   -7.021  1.00 0.00 ? 73 ASN A HD22 7  
ATOM 10807 N N    . LEU A 1 74 ? -4.547  -2.622  -5.259  1.00 0.00 ? 74 LEU A N    7  
ATOM 10808 C CA   . LEU A 1 74 ? -3.373  -3.246  -4.620  1.00 0.00 ? 74 LEU A CA   7  
ATOM 10809 C C    . LEU A 1 74 ? -3.067  -4.609  -5.258  1.00 0.00 ? 74 LEU A C    7  
ATOM 10810 O O    . LEU A 1 74 ? -1.934  -4.862  -5.644  1.00 0.00 ? 74 LEU A O    7  
ATOM 10811 C CB   . LEU A 1 74 ? -3.612  -3.411  -3.094  1.00 0.00 ? 74 LEU A CB   7  
ATOM 10812 C CG   . LEU A 1 74 ? -2.419  -3.988  -2.265  1.00 0.00 ? 74 LEU A CG   7  
ATOM 10813 C CD1  . LEU A 1 74 ? -1.202  -3.038  -2.287  1.00 0.00 ? 74 LEU A CD1  7  
ATOM 10814 C CD2  . LEU A 1 74 ? -2.849  -4.318  -0.822  1.00 0.00 ? 74 LEU A CD2  7  
ATOM 10815 H H    . LEU A 1 74 ? -5.284  -2.347  -4.681  1.00 0.00 ? 74 LEU A H    7  
ATOM 10816 H HA   . LEU A 1 74 ? -2.527  -2.580  -4.770  1.00 0.00 ? 74 LEU A HA   7  
ATOM 10817 H HB2  . LEU A 1 74 ? -3.871  -2.435  -2.688  1.00 0.00 ? 74 LEU A HB2  7  
ATOM 10818 H HB3  . LEU A 1 74 ? -4.471  -4.062  -2.959  1.00 0.00 ? 74 LEU A HB3  7  
ATOM 10819 H HG   . LEU A 1 74 ? -2.097  -4.918  -2.721  1.00 0.00 ? 74 LEU A HG   7  
ATOM 10820 H HD11 . LEU A 1 74 ? -1.471  -2.078  -1.862  1.00 0.00 ? 74 LEU A HD11 7  
ATOM 10821 H HD12 . LEU A 1 74 ? -0.869  -2.898  -3.308  1.00 0.00 ? 74 LEU A HD12 7  
ATOM 10822 H HD13 . LEU A 1 74 ? -0.393  -3.471  -1.711  1.00 0.00 ? 74 LEU A HD13 7  
ATOM 10823 H HD21 . LEU A 1 74 ? -2.011  -4.739  -0.281  1.00 0.00 ? 74 LEU A HD21 7  
ATOM 10824 H HD22 . LEU A 1 74 ? -3.656  -5.038  -0.841  1.00 0.00 ? 74 LEU A HD22 7  
ATOM 10825 H HD23 . LEU A 1 74 ? -3.181  -3.418  -0.320  1.00 0.00 ? 74 LEU A HD23 7  
ATOM 10826 N N    . GLU A 1 75 ? -4.101  -5.458  -5.381  1.00 0.00 ? 75 GLU A N    7  
ATOM 10827 C CA   . GLU A 1 75 ? -3.970  -6.823  -5.911  1.00 0.00 ? 75 GLU A CA   7  
ATOM 10828 C C    . GLU A 1 75 ? -3.588  -6.819  -7.398  1.00 0.00 ? 75 GLU A C    7  
ATOM 10829 O O    . GLU A 1 75 ? -2.656  -7.514  -7.791  1.00 0.00 ? 75 GLU A O    7  
ATOM 10830 C CB   . GLU A 1 75 ? -5.276  -7.632  -5.663  1.00 0.00 ? 75 GLU A CB   7  
ATOM 10831 C CG   . GLU A 1 75 ? -5.587  -7.916  -4.174  1.00 0.00 ? 75 GLU A CG   7  
ATOM 10832 C CD   . GLU A 1 75 ? -4.540  -8.823  -3.501  1.00 0.00 ? 75 GLU A CD   7  
ATOM 10833 O OE1  . GLU A 1 75 ? -3.420  -8.353  -3.193  1.00 0.00 ? 75 GLU A OE1  7  
ATOM 10834 O OE2  . GLU A 1 75 ? -4.834  -10.011 -3.268  1.00 0.00 ? 75 GLU A OE2  7  
ATOM 10835 H H    . GLU A 1 75 ? -4.987  -5.153  -5.093  1.00 0.00 ? 75 GLU A H    7  
ATOM 10836 H HA   . GLU A 1 75 ? -3.169  -7.305  -5.353  1.00 0.00 ? 75 GLU A HA   7  
ATOM 10837 H HB2  . GLU A 1 75 ? -6.111  -7.080  -6.081  1.00 0.00 ? 75 GLU A HB2  7  
ATOM 10838 H HB3  . GLU A 1 75 ? -5.204  -8.586  -6.176  1.00 0.00 ? 75 GLU A HB3  7  
ATOM 10839 H HG2  . GLU A 1 75 ? -5.629  -6.972  -3.634  1.00 0.00 ? 75 GLU A HG2  7  
ATOM 10840 H HG3  . GLU A 1 75 ? -6.567  -8.391  -4.110  1.00 0.00 ? 75 GLU A HG3  7  
ATOM 10841 N N    . THR A 1 76 ? -4.314  -6.029  -8.212  1.00 0.00 ? 76 THR A N    7  
ATOM 10842 C CA   . THR A 1 76 ? -4.081  -5.939  -9.673  1.00 0.00 ? 76 THR A CA   7  
ATOM 10843 C C    . THR A 1 76 ? -2.641  -5.441  -9.948  1.00 0.00 ? 76 THR A C    7  
ATOM 10844 O O    . THR A 1 76 ? -1.919  -5.989  -10.785 1.00 0.00 ? 76 THR A O    7  
ATOM 10845 C CB   . THR A 1 76 ? -5.131  -4.988  -10.353 1.00 0.00 ? 76 THR A CB   7  
ATOM 10846 O OG1  . THR A 1 76 ? -6.466  -5.367  -9.958  1.00 0.00 ? 76 THR A OG1  7  
ATOM 10847 C CG2  . THR A 1 76 ? -5.043  -5.038  -11.889 1.00 0.00 ? 76 THR A CG2  7  
ATOM 10848 H H    . THR A 1 76 ? -5.018  -5.479  -7.815  1.00 0.00 ? 76 THR A H    7  
ATOM 10849 H HA   . THR A 1 76 ? -4.199  -6.936  -10.091 1.00 0.00 ? 76 THR A HA   7  
ATOM 10850 H HB   . THR A 1 76 ? -4.945  -3.971  -10.023 1.00 0.00 ? 76 THR A HB   7  
ATOM 10851 H HG1  . THR A 1 76 ? -6.425  -5.822  -9.111  1.00 0.00 ? 76 THR A HG1  7  
ATOM 10852 H HG21 . THR A 1 76 ? -5.761  -4.356  -12.321 1.00 0.00 ? 76 THR A HG21 7  
ATOM 10853 H HG22 . THR A 1 76 ? -5.261  -6.039  -12.235 1.00 0.00 ? 76 THR A HG22 7  
ATOM 10854 H HG23 . THR A 1 76 ? -4.043  -4.759  -12.211 1.00 0.00 ? 76 THR A HG23 7  
ATOM 10855 N N    . LEU A 1 77 ? -2.259  -4.407  -9.185  1.00 0.00 ? 77 LEU A N    7  
ATOM 10856 C CA   . LEU A 1 77 ? -0.909  -3.813  -9.186  1.00 0.00 ? 77 LEU A CA   7  
ATOM 10857 C C    . LEU A 1 77 ? 0.174   -4.855  -8.843  1.00 0.00 ? 77 LEU A C    7  
ATOM 10858 O O    . LEU A 1 77 ? 1.130   -5.019  -9.593  1.00 0.00 ? 77 LEU A O    7  
ATOM 10859 C CB   . LEU A 1 77 ? -0.857  -2.649  -8.173  1.00 0.00 ? 77 LEU A CB   7  
ATOM 10860 C CG   . LEU A 1 77 ? 0.500   -1.905  -8.029  1.00 0.00 ? 77 LEU A CG   7  
ATOM 10861 C CD1  . LEU A 1 77 ? 0.920   -1.249  -9.362  1.00 0.00 ? 77 LEU A CD1  7  
ATOM 10862 C CD2  . LEU A 1 77 ? 0.432   -0.884  -6.875  1.00 0.00 ? 77 LEU A CD2  7  
ATOM 10863 H H    . LEU A 1 77 ? -2.948  -4.011  -8.620  1.00 0.00 ? 77 LEU A H    7  
ATOM 10864 H HA   . LEU A 1 77 ? -0.723  -3.415  -10.182 1.00 0.00 ? 77 LEU A HA   7  
ATOM 10865 H HB2  . LEU A 1 77 ? -1.617  -1.922  -8.457  1.00 0.00 ? 77 LEU A HB2  7  
ATOM 10866 H HB3  . LEU A 1 77 ? -1.132  -3.046  -7.200  1.00 0.00 ? 77 LEU A HB3  7  
ATOM 10867 H HG   . LEU A 1 77 ? 1.271   -2.624  -7.774  1.00 0.00 ? 77 LEU A HG   7  
ATOM 10868 H HD11 . LEU A 1 77 ? 1.028   -2.009  -10.123 1.00 0.00 ? 77 LEU A HD11 7  
ATOM 10869 H HD12 . LEU A 1 77 ? 1.871   -0.744  -9.234  1.00 0.00 ? 77 LEU A HD12 7  
ATOM 10870 H HD13 . LEU A 1 77 ? 0.174   -0.529  -9.673  1.00 0.00 ? 77 LEU A HD13 7  
ATOM 10871 H HD21 . LEU A 1 77 ? -0.346  -0.153  -7.071  1.00 0.00 ? 77 LEU A HD21 7  
ATOM 10872 H HD22 . LEU A 1 77 ? 1.384   -0.374  -6.785  1.00 0.00 ? 77 LEU A HD22 7  
ATOM 10873 H HD23 . LEU A 1 77 ? 0.218   -1.395  -5.947  1.00 0.00 ? 77 LEU A HD23 7  
ATOM 10874 N N    . GLN A 1 78 ? -0.005  -5.553  -7.706  1.00 0.00 ? 78 GLN A N    7  
ATOM 10875 C CA   . GLN A 1 78 ? 0.998   -6.487  -7.164  1.00 0.00 ? 78 GLN A CA   7  
ATOM 10876 C C    . GLN A 1 78 ? 1.207   -7.684  -8.111  1.00 0.00 ? 78 GLN A C    7  
ATOM 10877 O O    . GLN A 1 78 ? 2.346   -8.042  -8.406  1.00 0.00 ? 78 GLN A O    7  
ATOM 10878 C CB   . GLN A 1 78 ? 0.592   -6.946  -5.731  1.00 0.00 ? 78 GLN A CB   7  
ATOM 10879 C CG   . GLN A 1 78 ? 0.875   -5.897  -4.629  1.00 0.00 ? 78 GLN A CG   7  
ATOM 10880 C CD   . GLN A 1 78 ? 0.429   -6.319  -3.219  1.00 0.00 ? 78 GLN A CD   7  
ATOM 10881 O OE1  . GLN A 1 78 ? 1.082   -5.986  -2.224  1.00 0.00 ? 78 GLN A OE1  7  
ATOM 10882 N NE2  . GLN A 1 78 ? -0.713  -6.998  -3.109  1.00 0.00 ? 78 GLN A NE2  7  
ATOM 10883 H H    . GLN A 1 78 ? -0.855  -5.461  -7.232  1.00 0.00 ? 78 GLN A H    7  
ATOM 10884 H HA   . GLN A 1 78 ? 1.940   -5.941  -7.091  1.00 0.00 ? 78 GLN A HA   7  
ATOM 10885 H HB2  . GLN A 1 78 ? -0.470  -7.172  -5.720  1.00 0.00 ? 78 GLN A HB2  7  
ATOM 10886 H HB3  . GLN A 1 78 ? 1.138   -7.847  -5.476  1.00 0.00 ? 78 GLN A HB3  7  
ATOM 10887 H HG2  . GLN A 1 78 ? 1.941   -5.704  -4.606  1.00 0.00 ? 78 GLN A HG2  7  
ATOM 10888 H HG3  . GLN A 1 78 ? 0.361   -4.976  -4.886  1.00 0.00 ? 78 GLN A HG3  7  
ATOM 10889 H HE21 . GLN A 1 78 ? -1.221  -7.202  -3.922  1.00 0.00 ? 78 GLN A HE21 7  
ATOM 10890 H HE22 . GLN A 1 78 ? -1.009  -7.257  -2.212  1.00 0.00 ? 78 GLN A HE22 7  
ATOM 10891 N N    . GLN A 1 79 ? 0.096   -8.258  -8.615  1.00 0.00 ? 79 GLN A N    7  
ATOM 10892 C CA   . GLN A 1 79 ? 0.127   -9.385  -9.582  1.00 0.00 ? 79 GLN A CA   7  
ATOM 10893 C C    . GLN A 1 79 ? 0.859   -8.970  -10.879 1.00 0.00 ? 79 GLN A C    7  
ATOM 10894 O O    . GLN A 1 79 ? 1.607   -9.761  -11.461 1.00 0.00 ? 79 GLN A O    7  
ATOM 10895 C CB   . GLN A 1 79 ? -1.313  -9.861  -9.919  1.00 0.00 ? 79 GLN A CB   7  
ATOM 10896 C CG   . GLN A 1 79 ? -2.098  -10.471 -8.741  1.00 0.00 ? 79 GLN A CG   7  
ATOM 10897 C CD   . GLN A 1 79 ? -3.554  -10.763 -9.111  1.00 0.00 ? 79 GLN A CD   7  
ATOM 10898 O OE1  . GLN A 1 79 ? -3.892  -11.854 -9.562  1.00 0.00 ? 79 GLN A OE1  7  
ATOM 10899 N NE2  . GLN A 1 79 ? -4.421  -9.775  -8.960  1.00 0.00 ? 79 GLN A NE2  7  
ATOM 10900 H H    . GLN A 1 79 ? -0.773  -7.905  -8.338  1.00 0.00 ? 79 GLN A H    7  
ATOM 10901 H HA   . GLN A 1 79 ? 0.669   -10.203 -9.116  1.00 0.00 ? 79 GLN A HA   7  
ATOM 10902 H HB2  . GLN A 1 79 ? -1.874  -9.012  -10.291 1.00 0.00 ? 79 GLN A HB2  7  
ATOM 10903 H HB3  . GLN A 1 79 ? -1.261  -10.610 -10.707 1.00 0.00 ? 79 GLN A HB3  7  
ATOM 10904 H HG2  . GLN A 1 79 ? -1.622  -11.394 -8.441  1.00 0.00 ? 79 GLN A HG2  7  
ATOM 10905 H HG3  . GLN A 1 79 ? -2.084  -9.777  -7.907  1.00 0.00 ? 79 GLN A HG3  7  
ATOM 10906 H HE21 . GLN A 1 79 ? -4.092  -8.920  -8.628  1.00 0.00 ? 79 GLN A HE21 7  
ATOM 10907 H HE22 . GLN A 1 79 ? -5.360  -9.942  -9.197  1.00 0.00 ? 79 GLN A HE22 7  
ATOM 10908 N N    . GLU A 1 80 ? 0.634   -7.707  -11.302 1.00 0.00 ? 80 GLU A N    7  
ATOM 10909 C CA   . GLU A 1 80 ? 1.250   -7.116  -12.488 1.00 0.00 ? 80 GLU A CA   7  
ATOM 10910 C C    . GLU A 1 80 ? 2.774   -6.961  -12.300 1.00 0.00 ? 80 GLU A C    7  
ATOM 10911 O O    . GLU A 1 80 ? 3.558   -7.232  -13.217 1.00 0.00 ? 80 GLU A O    7  
ATOM 10912 C CB   . GLU A 1 80 ? 0.590   -5.739  -12.747 1.00 0.00 ? 80 GLU A CB   7  
ATOM 10913 C CG   . GLU A 1 80 ? 1.131   -4.995  -13.961 1.00 0.00 ? 80 GLU A CG   7  
ATOM 10914 C CD   . GLU A 1 80 ? 0.573   -3.572  -14.094 1.00 0.00 ? 80 GLU A CD   7  
ATOM 10915 O OE1  . GLU A 1 80 ? -0.489  -3.393  -14.722 1.00 0.00 ? 80 GLU A OE1  7  
ATOM 10916 O OE2  . GLU A 1 80 ? 1.192   -2.626  -13.560 1.00 0.00 ? 80 GLU A OE2  7  
ATOM 10917 H H    . GLU A 1 80 ? 0.025   -7.141  -10.796 1.00 0.00 ? 80 GLU A H    7  
ATOM 10918 H HA   . GLU A 1 80 ? 1.055   -7.766  -13.335 1.00 0.00 ? 80 GLU A HA   7  
ATOM 10919 H HB2  . GLU A 1 80 ? -0.478  -5.884  -12.886 1.00 0.00 ? 80 GLU A HB2  7  
ATOM 10920 H HB3  . GLU A 1 80 ? 0.736   -5.113  -11.868 1.00 0.00 ? 80 GLU A HB3  7  
ATOM 10921 H HG2  . GLU A 1 80 ? 2.210   -4.947  -13.872 1.00 0.00 ? 80 GLU A HG2  7  
ATOM 10922 H HG3  . GLU A 1 80 ? 0.880   -5.565  -14.847 1.00 0.00 ? 80 GLU A HG3  7  
ATOM 10923 N N    . LEU A 1 81 ? 3.175   -6.535  -11.089 1.00 0.00 ? 81 LEU A N    7  
ATOM 10924 C CA   . LEU A 1 81 ? 4.589   -6.304  -10.734 1.00 0.00 ? 81 LEU A CA   7  
ATOM 10925 C C    . LEU A 1 81 ? 5.260   -7.595  -10.219 1.00 0.00 ? 81 LEU A C    7  
ATOM 10926 O O    . LEU A 1 81 ? 6.432   -7.580  -9.835  1.00 0.00 ? 81 LEU A O    7  
ATOM 10927 C CB   . LEU A 1 81 ? 4.697   -5.170  -9.668  1.00 0.00 ? 81 LEU A CB   7  
ATOM 10928 C CG   . LEU A 1 81 ? 4.073   -3.790  -10.058 1.00 0.00 ? 81 LEU A CG   7  
ATOM 10929 C CD1  . LEU A 1 81 ? 4.364   -2.719  -8.982  1.00 0.00 ? 81 LEU A CD1  7  
ATOM 10930 C CD2  . LEU A 1 81 ? 4.532   -3.331  -11.463 1.00 0.00 ? 81 LEU A CD2  7  
ATOM 10931 H H    . LEU A 1 81 ? 2.492   -6.375  -10.404 1.00 0.00 ? 81 LEU A H    7  
ATOM 10932 H HA   . LEU A 1 81 ? 5.113   -5.985  -11.631 1.00 0.00 ? 81 LEU A HA   7  
ATOM 10933 H HB2  . LEU A 1 81 ? 4.213   -5.513  -8.758  1.00 0.00 ? 81 LEU A HB2  7  
ATOM 10934 H HB3  . LEU A 1 81 ? 5.750   -5.013  -9.449  1.00 0.00 ? 81 LEU A HB3  7  
ATOM 10935 H HG   . LEU A 1 81 ? 2.994   -3.903  -10.098 1.00 0.00 ? 81 LEU A HG   7  
ATOM 10936 H HD11 . LEU A 1 81 ? 3.892   -1.786  -9.262  1.00 0.00 ? 81 LEU A HD11 7  
ATOM 10937 H HD12 . LEU A 1 81 ? 5.432   -2.566  -8.885  1.00 0.00 ? 81 LEU A HD12 7  
ATOM 10938 H HD13 . LEU A 1 81 ? 3.961   -3.044  -8.029  1.00 0.00 ? 81 LEU A HD13 7  
ATOM 10939 H HD21 . LEU A 1 81 ? 4.202   -4.046  -12.203 1.00 0.00 ? 81 LEU A HD21 7  
ATOM 10940 H HD22 . LEU A 1 81 ? 5.613   -3.250  -11.494 1.00 0.00 ? 81 LEU A HD22 7  
ATOM 10941 H HD23 . LEU A 1 81 ? 4.097   -2.365  -11.690 1.00 0.00 ? 81 LEU A HD23 7  
ATOM 10942 N N    . GLY A 1 82 ? 4.502   -8.707  -10.182 1.00 0.00 ? 82 GLY A N    7  
ATOM 10943 C CA   . GLY A 1 82 ? 5.017   -9.995  -9.714  1.00 0.00 ? 82 GLY A CA   7  
ATOM 10944 C C    . GLY A 1 82 ? 5.076   -10.120 -8.188  1.00 0.00 ? 82 GLY A C    7  
ATOM 10945 O O    . GLY A 1 82 ? 5.406   -11.193 -7.677  1.00 0.00 ? 82 GLY A O    7  
ATOM 10946 H H    . GLY A 1 82 ? 3.570   -8.654  -10.483 1.00 0.00 ? 82 GLY A H    7  
ATOM 10947 H HA2  . GLY A 1 82 ? 4.370   -10.771 -10.098 1.00 0.00 ? 82 GLY A HA2  7  
ATOM 10948 H HA3  . GLY A 1 82 ? 6.013   -10.152 -10.114 1.00 0.00 ? 82 GLY A HA3  7  
ATOM 10949 N N    . ILE A 1 83 ? 4.742   -9.023  -7.469  1.00 0.00 ? 83 ILE A N    7  
ATOM 10950 C CA   . ILE A 1 83 ? 4.707   -8.964  -5.994  1.00 0.00 ? 83 ILE A CA   7  
ATOM 10951 C C    . ILE A 1 83 ? 3.557   -9.846  -5.472  1.00 0.00 ? 83 ILE A C    7  
ATOM 10952 O O    . ILE A 1 83 ? 2.391   -9.590  -5.764  1.00 0.00 ? 83 ILE A O    7  
ATOM 10953 C CB   . ILE A 1 83 ? 4.540   -7.470  -5.509  1.00 0.00 ? 83 ILE A CB   7  
ATOM 10954 C CG1  . ILE A 1 83 ? 5.771   -6.621  -5.975  1.00 0.00 ? 83 ILE A CG1  7  
ATOM 10955 C CG2  . ILE A 1 83 ? 4.320   -7.378  -3.974  1.00 0.00 ? 83 ILE A CG2  7  
ATOM 10956 C CD1  . ILE A 1 83 ? 5.743   -5.149  -5.590  1.00 0.00 ? 83 ILE A CD1  7  
ATOM 10957 H H    . ILE A 1 83 ? 4.465   -8.222  -7.953  1.00 0.00 ? 83 ILE A H    7  
ATOM 10958 H HA   . ILE A 1 83 ? 5.655   -9.344  -5.620  1.00 0.00 ? 83 ILE A HA   7  
ATOM 10959 H HB   . ILE A 1 83 ? 3.648   -7.067  -5.987  1.00 0.00 ? 83 ILE A HB   7  
ATOM 10960 H HG12 . ILE A 1 83 ? 6.671   -7.041  -5.552  1.00 0.00 ? 83 ILE A HG12 7  
ATOM 10961 H HG13 . ILE A 1 83 ? 5.842   -6.667  -7.057  1.00 0.00 ? 83 ILE A HG13 7  
ATOM 10962 H HG21 . ILE A 1 83 ? 3.405   -7.906  -3.699  1.00 0.00 ? 83 ILE A HG21 7  
ATOM 10963 H HG22 . ILE A 1 83 ? 4.227   -6.342  -3.675  1.00 0.00 ? 83 ILE A HG22 7  
ATOM 10964 H HG23 . ILE A 1 83 ? 5.157   -7.825  -3.455  1.00 0.00 ? 83 ILE A HG23 7  
ATOM 10965 H HD11 . ILE A 1 83 ? 4.869   -4.677  -6.012  1.00 0.00 ? 83 ILE A HD11 7  
ATOM 10966 H HD12 . ILE A 1 83 ? 6.632   -4.668  -5.973  1.00 0.00 ? 83 ILE A HD12 7  
ATOM 10967 H HD13 . ILE A 1 83 ? 5.724   -5.054  -4.512  1.00 0.00 ? 83 ILE A HD13 7  
ATOM 10968 N N    . GLU A 1 84 ? 3.906   -10.897 -4.722  1.00 0.00 ? 84 GLU A N    7  
ATOM 10969 C CA   . GLU A 1 84 ? 2.943   -11.916 -4.267  1.00 0.00 ? 84 GLU A CA   7  
ATOM 10970 C C    . GLU A 1 84 ? 3.515   -12.704 -3.076  1.00 0.00 ? 84 GLU A C    7  
ATOM 10971 O O    . GLU A 1 84 ? 4.739   -12.856 -2.956  1.00 0.00 ? 84 GLU A O    7  
ATOM 10972 C CB   . GLU A 1 84 ? 2.593   -12.899 -5.417  1.00 0.00 ? 84 GLU A CB   7  
ATOM 10973 C CG   . GLU A 1 84 ? 3.811   -13.641 -5.995  1.00 0.00 ? 84 GLU A CG   7  
ATOM 10974 C CD   . GLU A 1 84 ? 3.429   -14.679 -7.047  1.00 0.00 ? 84 GLU A CD   7  
ATOM 10975 O OE1  . GLU A 1 84 ? 2.880   -15.732 -6.669  1.00 0.00 ? 84 GLU A OE1  7  
ATOM 10976 O OE2  . GLU A 1 84 ? 3.656   -14.443 -8.251  1.00 0.00 ? 84 GLU A OE2  7  
ATOM 10977 H H    . GLU A 1 84 ? 4.844   -10.990 -4.459  1.00 0.00 ? 84 GLU A H    7  
ATOM 10978 H HA   . GLU A 1 84 ? 2.035   -11.403 -3.947  1.00 0.00 ? 84 GLU A HA   7  
ATOM 10979 H HB2  . GLU A 1 84 ? 1.883   -13.639 -5.050  1.00 0.00 ? 84 GLU A HB2  7  
ATOM 10980 H HB3  . GLU A 1 84 ? 2.122   -12.344 -6.221  1.00 0.00 ? 84 GLU A HB3  7  
ATOM 10981 H HG2  . GLU A 1 84 ? 4.481   -12.907 -6.434  1.00 0.00 ? 84 GLU A HG2  7  
ATOM 10982 H HG3  . GLU A 1 84 ? 4.332   -14.144 -5.184  1.00 0.00 ? 84 GLU A HG3  7  
ATOM 10983 N N    . GLY A 1 85 ? 2.593   -13.135 -2.191  1.00 0.00 ? 85 GLY A N    7  
ATOM 10984 C CA   . GLY A 1 85 ? 2.855   -14.079 -1.095  1.00 0.00 ? 85 GLY A CA   7  
ATOM 10985 C C    . GLY A 1 85 ? 4.027   -13.704 -0.198  1.00 0.00 ? 85 GLY A C    7  
ATOM 10986 O O    . GLY A 1 85 ? 3.867   -12.954 0.772   1.00 0.00 ? 85 GLY A O    7  
ATOM 10987 H H    . GLY A 1 85 ? 1.681   -12.781 -2.286  1.00 0.00 ? 85 GLY A H    7  
ATOM 10988 H HA2  . GLY A 1 85 ? 1.959   -14.127 -0.488  1.00 0.00 ? 85 GLY A HA2  7  
ATOM 10989 H HA3  . GLY A 1 85 ? 3.021   -15.070 -1.513  1.00 0.00 ? 85 GLY A HA3  7  
ATOM 10990 N N    . GLU A 1 86 ? 5.214   -14.188 -0.585  1.00 0.00 ? 86 GLU A N    7  
ATOM 10991 C CA   . GLU A 1 86 ? 6.464   -14.019 0.171   1.00 0.00 ? 86 GLU A CA   7  
ATOM 10992 C C    . GLU A 1 86 ? 6.883   -12.538 0.199   1.00 0.00 ? 86 GLU A C    7  
ATOM 10993 O O    . GLU A 1 86 ? 7.286   -12.016 1.242   1.00 0.00 ? 86 GLU A O    7  
ATOM 10994 C CB   . GLU A 1 86 ? 7.619   -14.877 -0.449  1.00 0.00 ? 86 GLU A CB   7  
ATOM 10995 C CG   . GLU A 1 86 ? 7.405   -16.417 -0.427  1.00 0.00 ? 86 GLU A CG   7  
ATOM 10996 C CD   . GLU A 1 86 ? 6.303   -16.935 -1.376  1.00 0.00 ? 86 GLU A CD   7  
ATOM 10997 O OE1  . GLU A 1 86 ? 6.560   -17.065 -2.588  1.00 0.00 ? 86 GLU A OE1  7  
ATOM 10998 O OE2  . GLU A 1 86 ? 5.169   -17.182 -0.920  1.00 0.00 ? 86 GLU A OE2  7  
ATOM 10999 H H    . GLU A 1 86 ? 5.248   -14.673 -1.435  1.00 0.00 ? 86 GLU A H    7  
ATOM 11000 H HA   . GLU A 1 86 ? 6.285   -14.351 1.192   1.00 0.00 ? 86 GLU A HA   7  
ATOM 11001 H HB2  . GLU A 1 86 ? 7.770   -14.571 -1.482  1.00 0.00 ? 86 GLU A HB2  7  
ATOM 11002 H HB3  . GLU A 1 86 ? 8.536   -14.663 0.098   1.00 0.00 ? 86 GLU A HB3  7  
ATOM 11003 H HG2  . GLU A 1 86 ? 8.340   -16.896 -0.706  1.00 0.00 ? 86 GLU A HG2  7  
ATOM 11004 H HG3  . GLU A 1 86 ? 7.162   -16.709 0.590   1.00 0.00 ? 86 GLU A HG3  7  
ATOM 11005 N N    . ASN A 1 87 ? 6.789   -11.881 -0.971  1.00 0.00 ? 87 ASN A N    7  
ATOM 11006 C CA   . ASN A 1 87 ? 7.201   -10.471 -1.150  1.00 0.00 ? 87 ASN A CA   7  
ATOM 11007 C C    . ASN A 1 87 ? 6.000   -9.514  -1.083  1.00 0.00 ? 87 ASN A C    7  
ATOM 11008 O O    . ASN A 1 87 ? 6.183   -8.294  -1.184  1.00 0.00 ? 87 ASN A O    7  
ATOM 11009 C CB   . ASN A 1 87 ? 7.942   -10.301 -2.499  1.00 0.00 ? 87 ASN A CB   7  
ATOM 11010 C CG   . ASN A 1 87 ? 9.211   -11.147 -2.593  1.00 0.00 ? 87 ASN A CG   7  
ATOM 11011 O OD1  . ASN A 1 87 ? 10.291  -10.713 -2.191  1.00 0.00 ? 87 ASN A OD1  7  
ATOM 11012 N ND2  . ASN A 1 87 ? 9.094   -12.357 -3.115  1.00 0.00 ? 87 ASN A ND2  7  
ATOM 11013 H H    . ASN A 1 87 ? 6.432   -12.364 -1.746  1.00 0.00 ? 87 ASN A H    7  
ATOM 11014 H HA   . ASN A 1 87 ? 7.885   -10.206 -0.344  1.00 0.00 ? 87 ASN A HA   7  
ATOM 11015 H HB2  . ASN A 1 87 ? 7.282   -10.580 -3.318  1.00 0.00 ? 87 ASN A HB2  7  
ATOM 11016 H HB3  . ASN A 1 87 ? 8.224   -9.261  -2.626  1.00 0.00 ? 87 ASN A HB3  7  
ATOM 11017 H HD21 . ASN A 1 87 ? 8.208   -12.648 -3.416  1.00 0.00 ? 87 ASN A HD21 7  
ATOM 11018 H HD22 . ASN A 1 87 ? 9.900   -12.910 -3.185  1.00 0.00 ? 87 ASN A HD22 7  
ATOM 11019 N N    . ARG A 1 88 ? 4.777   -10.063 -0.909  1.00 0.00 ? 88 ARG A N    7  
ATOM 11020 C CA   . ARG A 1 88 ? 3.550   -9.245  -0.868  1.00 0.00 ? 88 ARG A CA   7  
ATOM 11021 C C    . ARG A 1 88 ? 3.488   -8.416  0.417   1.00 0.00 ? 88 ARG A C    7  
ATOM 11022 O O    . ARG A 1 88 ? 3.706   -8.947  1.511   1.00 0.00 ? 88 ARG A O    7  
ATOM 11023 C CB   . ARG A 1 88 ? 2.275   -10.110 -0.963  1.00 0.00 ? 88 ARG A CB   7  
ATOM 11024 C CG   . ARG A 1 88 ? 0.981   -9.281  -1.047  1.00 0.00 ? 88 ARG A CG   7  
ATOM 11025 C CD   . ARG A 1 88 ? -0.291  -10.123 -1.016  1.00 0.00 ? 88 ARG A CD   7  
ATOM 11026 N NE   . ARG A 1 88 ? -1.470  -9.271  -1.144  1.00 0.00 ? 88 ARG A NE   7  
ATOM 11027 C CZ   . ARG A 1 88 ? -2.091  -8.633  -0.128  1.00 0.00 ? 88 ARG A CZ   7  
ATOM 11028 N NH1  . ARG A 1 88 ? -1.665  -8.753  1.125   1.00 0.00 ? 88 ARG A NH1  7  
ATOM 11029 N NH2  . ARG A 1 88 ? -3.144  -7.879  -0.380  1.00 0.00 ? 88 ARG A NH2  7  
ATOM 11030 H H    . ARG A 1 88 ? 4.708   -11.031 -0.784  1.00 0.00 ? 88 ARG A H    7  
ATOM 11031 H HA   . ARG A 1 88 ? 3.579   -8.574  -1.726  1.00 0.00 ? 88 ARG A HA   7  
ATOM 11032 H HB2  . ARG A 1 88 ? 2.341   -10.727 -1.853  1.00 0.00 ? 88 ARG A HB2  7  
ATOM 11033 H HB3  . ARG A 1 88 ? 2.219   -10.759 -0.096  1.00 0.00 ? 88 ARG A HB3  7  
ATOM 11034 H HG2  . ARG A 1 88 ? 0.951   -8.597  -0.204  1.00 0.00 ? 88 ARG A HG2  7  
ATOM 11035 H HG3  . ARG A 1 88 ? 0.995   -8.703  -1.966  1.00 0.00 ? 88 ARG A HG3  7  
ATOM 11036 H HD2  . ARG A 1 88 ? -0.276  -10.826 -1.841  1.00 0.00 ? 88 ARG A HD2  7  
ATOM 11037 H HD3  . ARG A 1 88 ? -0.342  -10.668 -0.077  1.00 0.00 ? 88 ARG A HD3  7  
ATOM 11038 H HE   . ARG A 1 88 ? -1.811  -9.150  -2.058  1.00 0.00 ? 88 ARG A HE   7  
ATOM 11039 H HH11 . ARG A 1 88 ? -0.863  -9.317  1.332   1.00 0.00 ? 88 ARG A HH11 7  
ATOM 11040 H HH12 . ARG A 1 88 ? -2.140  -8.277  1.869   1.00 0.00 ? 88 ARG A HH12 7  
ATOM 11041 H HH21 . ARG A 1 88 ? -3.475  -7.773  -1.324  1.00 0.00 ? 88 ARG A HH21 7  
ATOM 11042 H HH22 . ARG A 1 88 ? -3.617  -7.404  0.366   1.00 0.00 ? 88 ARG A HH22 7  
ATOM 11043 N N    . VAL A 1 89 ? 3.141   -7.132  0.260   1.00 0.00 ? 89 VAL A N    7  
ATOM 11044 C CA   . VAL A 1 89 ? 3.035   -6.181  1.369   1.00 0.00 ? 89 VAL A CA   7  
ATOM 11045 C C    . VAL A 1 89 ? 1.765   -6.508  2.216   1.00 0.00 ? 89 VAL A C    7  
ATOM 11046 O O    . VAL A 1 89 ? 0.642   -6.386  1.701   1.00 0.00 ? 89 VAL A O    7  
ATOM 11047 C CB   . VAL A 1 89 ? 2.978   -4.700  0.830   1.00 0.00 ? 89 VAL A CB   7  
ATOM 11048 C CG1  . VAL A 1 89 ? 3.031   -3.693  1.995   1.00 0.00 ? 89 VAL A CG1  7  
ATOM 11049 C CG2  . VAL A 1 89 ? 4.111   -4.425  -0.198  1.00 0.00 ? 89 VAL A CG2  7  
ATOM 11050 H H    . VAL A 1 89 ? 2.925   -6.817  -0.643  1.00 0.00 ? 89 VAL A H    7  
ATOM 11051 H HA   . VAL A 1 89 ? 3.924   -6.286  1.983   1.00 0.00 ? 89 VAL A HA   7  
ATOM 11052 H HB   . VAL A 1 89 ? 2.025   -4.564  0.317   1.00 0.00 ? 89 VAL A HB   7  
ATOM 11053 H HG11 . VAL A 1 89 ? 2.967   -2.681  1.613   1.00 0.00 ? 89 VAL A HG11 7  
ATOM 11054 H HG12 . VAL A 1 89 ? 3.962   -3.807  2.537   1.00 0.00 ? 89 VAL A HG12 7  
ATOM 11055 H HG13 . VAL A 1 89 ? 2.203   -3.868  2.675   1.00 0.00 ? 89 VAL A HG13 7  
ATOM 11056 H HG21 . VAL A 1 89 ? 5.076   -4.559  0.276   1.00 0.00 ? 89 VAL A HG21 7  
ATOM 11057 H HG22 . VAL A 1 89 ? 4.034   -3.410  -0.572  1.00 0.00 ? 89 VAL A HG22 7  
ATOM 11058 H HG23 . VAL A 1 89 ? 4.026   -5.115  -1.031  1.00 0.00 ? 89 VAL A HG23 7  
ATOM 11059 N N    . PRO A 1 90 ? 1.929   -6.979  3.508   1.00 0.00 ? 90 PRO A N    7  
ATOM 11060 C CA   . PRO A 1 90 ? 0.786   -7.379  4.377   1.00 0.00 ? 90 PRO A CA   7  
ATOM 11061 C C    . PRO A 1 90 ? -0.102  -6.187  4.798   1.00 0.00 ? 90 PRO A C    7  
ATOM 11062 O O    . PRO A 1 90 ? 0.391   -5.094  5.073   1.00 0.00 ? 90 PRO A O    7  
ATOM 11063 C CB   . PRO A 1 90 ? 1.475   -8.050  5.597   1.00 0.00 ? 90 PRO A CB   7  
ATOM 11064 C CG   . PRO A 1 90 ? 2.838   -7.425  5.653   1.00 0.00 ? 90 PRO A CG   7  
ATOM 11065 C CD   . PRO A 1 90 ? 3.232   -7.177  4.210   1.00 0.00 ? 90 PRO A CD   7  
ATOM 11066 H HA   . PRO A 1 90 ? 0.163   -8.117  3.870   1.00 0.00 ? 90 PRO A HA   7  
ATOM 11067 H HB2  . PRO A 1 90 ? 0.911   -7.865  6.515   1.00 0.00 ? 90 PRO A HB2  7  
ATOM 11068 H HB3  . PRO A 1 90 ? 1.562   -9.119  5.439   1.00 0.00 ? 90 PRO A HB3  7  
ATOM 11069 H HG2  . PRO A 1 90 ? 2.792   -6.487  6.207   1.00 0.00 ? 90 PRO A HG2  7  
ATOM 11070 H HG3  . PRO A 1 90 ? 3.549   -8.094  6.126   1.00 0.00 ? 90 PRO A HG3  7  
ATOM 11071 H HD2  . PRO A 1 90 ? 3.850   -6.289  4.129   1.00 0.00 ? 90 PRO A HD2  7  
ATOM 11072 H HD3  . PRO A 1 90 ? 3.762   -8.033  3.799   1.00 0.00 ? 90 PRO A HD3  7  
ATOM 11073 N N    . VAL A 1 91 ? -1.416  -6.444  4.856   1.00 0.00 ? 91 VAL A N    7  
ATOM 11074 C CA   . VAL A 1 91 ? -2.450  -5.435  5.132   1.00 0.00 ? 91 VAL A CA   7  
ATOM 11075 C C    . VAL A 1 91 ? -2.975  -5.627  6.573   1.00 0.00 ? 91 VAL A C    7  
ATOM 11076 O O    . VAL A 1 91 ? -3.524  -6.688  6.900   1.00 0.00 ? 91 VAL A O    7  
ATOM 11077 C CB   . VAL A 1 91 ? -3.610  -5.576  4.079   1.00 0.00 ? 91 VAL A CB   7  
ATOM 11078 C CG1  . VAL A 1 91 ? -4.720  -4.528  4.299   1.00 0.00 ? 91 VAL A CG1  7  
ATOM 11079 C CG2  . VAL A 1 91 ? -3.046  -5.506  2.638   1.00 0.00 ? 91 VAL A CG2  7  
ATOM 11080 H H    . VAL A 1 91 ? -1.701  -7.371  4.719   1.00 0.00 ? 91 VAL A H    7  
ATOM 11081 H HA   . VAL A 1 91 ? -2.013  -4.442  5.033   1.00 0.00 ? 91 VAL A HA   7  
ATOM 11082 H HB   . VAL A 1 91 ? -4.057  -6.561  4.207   1.00 0.00 ? 91 VAL A HB   7  
ATOM 11083 H HG11 . VAL A 1 91 ? -5.516  -4.677  3.576   1.00 0.00 ? 91 VAL A HG11 7  
ATOM 11084 H HG12 . VAL A 1 91 ? -4.313  -3.535  4.175   1.00 0.00 ? 91 VAL A HG12 7  
ATOM 11085 H HG13 . VAL A 1 91 ? -5.128  -4.623  5.299   1.00 0.00 ? 91 VAL A HG13 7  
ATOM 11086 H HG21 . VAL A 1 91 ? -3.848  -5.638  1.922   1.00 0.00 ? 91 VAL A HG21 7  
ATOM 11087 H HG22 . VAL A 1 91 ? -2.308  -6.292  2.492   1.00 0.00 ? 91 VAL A HG22 7  
ATOM 11088 H HG23 . VAL A 1 91 ? -2.577  -4.545  2.474   1.00 0.00 ? 91 VAL A HG23 7  
ATOM 11089 N N    . VAL A 1 92 ? -2.791  -4.594  7.430   1.00 0.00 ? 92 VAL A N    7  
ATOM 11090 C CA   . VAL A 1 92 ? -3.065  -4.676  8.880   1.00 0.00 ? 92 VAL A CA   7  
ATOM 11091 C C    . VAL A 1 92 ? -4.139  -3.638  9.279   1.00 0.00 ? 92 VAL A C    7  
ATOM 11092 O O    . VAL A 1 92 ? -3.826  -2.456  9.447   1.00 0.00 ? 92 VAL A O    7  
ATOM 11093 C CB   . VAL A 1 92 ? -1.756  -4.443  9.743   1.00 0.00 ? 92 VAL A CB   7  
ATOM 11094 C CG1  . VAL A 1 92 ? -1.999  -4.837  11.225  1.00 0.00 ? 92 VAL A CG1  7  
ATOM 11095 C CG2  . VAL A 1 92 ? -0.533  -5.190  9.146   1.00 0.00 ? 92 VAL A CG2  7  
ATOM 11096 H H    . VAL A 1 92 ? -2.483  -3.742  7.070   1.00 0.00 ? 92 VAL A H    7  
ATOM 11097 H HA   . VAL A 1 92 ? -3.442  -5.673  9.106   1.00 0.00 ? 92 VAL A HA   7  
ATOM 11098 H HB   . VAL A 1 92 ? -1.530  -3.375  9.724   1.00 0.00 ? 92 VAL A HB   7  
ATOM 11099 H HG11 . VAL A 1 92 ? -1.098  -4.673  11.806  1.00 0.00 ? 92 VAL A HG11 7  
ATOM 11100 H HG12 . VAL A 1 92 ? -2.271  -5.883  11.286  1.00 0.00 ? 92 VAL A HG12 7  
ATOM 11101 H HG13 . VAL A 1 92 ? -2.802  -4.238  11.642  1.00 0.00 ? 92 VAL A HG13 7  
ATOM 11102 H HG21 . VAL A 1 92 ? -0.356  -4.848  8.132   1.00 0.00 ? 92 VAL A HG21 7  
ATOM 11103 H HG22 . VAL A 1 92 ? -0.730  -6.255  9.133   1.00 0.00 ? 92 VAL A HG22 7  
ATOM 11104 H HG23 . VAL A 1 92 ? 0.348   -4.996  9.746   1.00 0.00 ? 92 VAL A HG23 7  
ATOM 11105 N N    . TYR A 1 93 ? -5.400  -4.085  9.408   1.00 0.00 ? 93 TYR A N    7  
ATOM 11106 C CA   . TYR A 1 93 ? -6.523  -3.224  9.833   1.00 0.00 ? 93 TYR A CA   7  
ATOM 11107 C C    . TYR A 1 93 ? -6.454  -2.953  11.341  1.00 0.00 ? 93 TYR A C    7  
ATOM 11108 O O    . TYR A 1 93 ? -6.684  -3.852  12.155  1.00 0.00 ? 93 TYR A O    7  
ATOM 11109 C CB   . TYR A 1 93 ? -7.873  -3.881  9.475   1.00 0.00 ? 93 TYR A CB   7  
ATOM 11110 C CG   . TYR A 1 93 ? -8.098  -4.016  7.971   1.00 0.00 ? 93 TYR A CG   7  
ATOM 11111 C CD1  . TYR A 1 93 ? -7.684  -5.157  7.277   1.00 0.00 ? 93 TYR A CD1  7  
ATOM 11112 C CD2  . TYR A 1 93 ? -8.698  -2.989  7.236   1.00 0.00 ? 93 TYR A CD2  7  
ATOM 11113 C CE1  . TYR A 1 93 ? -7.865  -5.268  5.916   1.00 0.00 ? 93 TYR A CE1  7  
ATOM 11114 C CE2  . TYR A 1 93 ? -8.883  -3.102  5.876   1.00 0.00 ? 93 TYR A CE2  7  
ATOM 11115 C CZ   . TYR A 1 93 ? -8.462  -4.238  5.220   1.00 0.00 ? 93 TYR A CZ   7  
ATOM 11116 O OH   . TYR A 1 93 ? -8.634  -4.346  3.855   1.00 0.00 ? 93 TYR A OH   7  
ATOM 11117 H H    . TYR A 1 93 ? -5.584  -5.026  9.211   1.00 0.00 ? 93 TYR A H    7  
ATOM 11118 H HA   . TYR A 1 93 ? -6.444  -2.276  9.296   1.00 0.00 ? 93 TYR A HA   7  
ATOM 11119 H HB2  . TYR A 1 93 ? -7.918  -4.872  9.919   1.00 0.00 ? 93 TYR A HB2  7  
ATOM 11120 H HB3  . TYR A 1 93 ? -8.687  -3.284  9.884   1.00 0.00 ? 93 TYR A HB3  7  
ATOM 11121 H HD1  . TYR A 1 93 ? -7.216  -5.967  7.822   1.00 0.00 ? 93 TYR A HD1  7  
ATOM 11122 H HD2  . TYR A 1 93 ? -9.032  -2.095  7.750   1.00 0.00 ? 93 TYR A HD2  7  
ATOM 11123 H HE1  . TYR A 1 93 ? -7.541  -6.164  5.396   1.00 0.00 ? 93 TYR A HE1  7  
ATOM 11124 H HE2  . TYR A 1 93 ? -9.351  -2.293  5.326   1.00 0.00 ? 93 TYR A HE2  7  
ATOM 11125 H HH   . TYR A 1 93 ? -8.407  -3.507  3.436   1.00 0.00 ? 93 TYR A HH   7  
ATOM 11126 N N    . ILE A 1 94 ? -6.131  -1.709  11.699  1.00 0.00 ? 94 ILE A N    7  
ATOM 11127 C CA   . ILE A 1 94 ? -5.981  -1.266  13.099  1.00 0.00 ? 94 ILE A CA   7  
ATOM 11128 C C    . ILE A 1 94 ? -7.071  -0.217  13.401  1.00 0.00 ? 94 ILE A C    7  
ATOM 11129 O O    . ILE A 1 94 ? -7.614  0.363   12.477  1.00 0.00 ? 94 ILE A O    7  
ATOM 11130 C CB   . ILE A 1 94 ? -4.548  -0.661  13.331  1.00 0.00 ? 94 ILE A CB   7  
ATOM 11131 C CG1  . ILE A 1 94 ? -3.459  -1.734  12.987  1.00 0.00 ? 94 ILE A CG1  7  
ATOM 11132 C CG2  . ILE A 1 94 ? -4.386  -0.117  14.778  1.00 0.00 ? 94 ILE A CG2  7  
ATOM 11133 C CD1  . ILE A 1 94 ? -2.022  -1.244  13.032  1.00 0.00 ? 94 ILE A CD1  7  
ATOM 11134 H H    . ILE A 1 94 ? -6.025  -1.034  10.997  1.00 0.00 ? 94 ILE A H    7  
ATOM 11135 H HA   . ILE A 1 94 ? -6.113  -2.119  13.767  1.00 0.00 ? 94 ILE A HA   7  
ATOM 11136 H HB   . ILE A 1 94 ? -4.429  0.181   12.652  1.00 0.00 ? 94 ILE A HB   7  
ATOM 11137 H HG12 . ILE A 1 94 ? -3.536  -2.557  13.685  1.00 0.00 ? 94 ILE A HG12 7  
ATOM 11138 H HG13 . ILE A 1 94 ? -3.637  -2.111  11.987  1.00 0.00 ? 94 ILE A HG13 7  
ATOM 11139 H HG21 . ILE A 1 94 ? -5.155  0.628   14.972  1.00 0.00 ? 94 ILE A HG21 7  
ATOM 11140 H HG22 . ILE A 1 94 ? -3.411  0.341   14.897  1.00 0.00 ? 94 ILE A HG22 7  
ATOM 11141 H HG23 . ILE A 1 94 ? -4.491  -0.926  15.491  1.00 0.00 ? 94 ILE A HG23 7  
ATOM 11142 H HD11 . ILE A 1 94 ? -1.901  -0.413  12.351  1.00 0.00 ? 94 ILE A HD11 7  
ATOM 11143 H HD12 . ILE A 1 94 ? -1.364  -2.048  12.745  1.00 0.00 ? 94 ILE A HD12 7  
ATOM 11144 H HD13 . ILE A 1 94 ? -1.778  -0.924  14.037  1.00 0.00 ? 94 ILE A HD13 7  
ATOM 11145 N N    . ALA A 1 95 ? -7.443  -0.062  14.695  1.00 0.00 ? 95 ALA A N    7  
ATOM 11146 C CA   . ALA A 1 95 ? -8.308  1.030   15.224  1.00 0.00 ? 95 ALA A CA   7  
ATOM 11147 C C    . ALA A 1 95 ? -9.795  0.917   14.821  1.00 0.00 ? 95 ALA A C    7  
ATOM 11148 O O    . ALA A 1 95 ? -10.619 1.690   15.298  1.00 0.00 ? 95 ALA A O    7  
ATOM 11149 C CB   . ALA A 1 95 ? -7.743  2.427   14.868  1.00 0.00 ? 95 ALA A CB   7  
ATOM 11150 H H    . ALA A 1 95 ? -7.114  -0.723  15.341  1.00 0.00 ? 95 ALA A H    7  
ATOM 11151 H HA   . ALA A 1 95 ? -8.264  0.939   16.305  1.00 0.00 ? 95 ALA A HA   7  
ATOM 11152 H HB1  . ALA A 1 95 ? -6.712  2.495   15.193  1.00 0.00 ? 95 ALA A HB1  7  
ATOM 11153 H HB2  . ALA A 1 95 ? -8.322  3.203   15.361  1.00 0.00 ? 95 ALA A HB2  7  
ATOM 11154 H HB3  . ALA A 1 95 ? -7.787  2.577   13.796  1.00 0.00 ? 95 ALA A HB3  7  
ATOM 11155 N N    . GLU A 1 96 ? -10.139 -0.023  13.936  1.00 0.00 ? 96 GLU A N    7  
ATOM 11156 C CA   . GLU A 1 96 ? -11.510 -0.194  13.445  1.00 0.00 ? 96 GLU A CA   7  
ATOM 11157 C C    . GLU A 1 96 ? -12.153 -1.475  13.988  1.00 0.00 ? 96 GLU A C    7  
ATOM 11158 O O    . GLU A 1 96 ? -11.542 -2.215  14.772  1.00 0.00 ? 96 GLU A O    7  
ATOM 11159 C CB   . GLU A 1 96 ? -11.508 -0.139  11.888  1.00 0.00 ? 96 GLU A CB   7  
ATOM 11160 C CG   . GLU A 1 96 ? -10.528 -1.100  11.159  1.00 0.00 ? 96 GLU A CG   7  
ATOM 11161 C CD   . GLU A 1 96 ? -11.098 -2.507  10.950  1.00 0.00 ? 96 GLU A CD   7  
ATOM 11162 O OE1  . GLU A 1 96 ? -11.872 -2.699  9.998   1.00 0.00 ? 96 GLU A OE1  7  
ATOM 11163 O OE2  . GLU A 1 96 ? -10.796 -3.416  11.739  1.00 0.00 ? 96 GLU A OE2  7  
ATOM 11164 H H    . GLU A 1 96 ? -9.449  -0.612  13.586  1.00 0.00 ? 96 GLU A H    7  
ATOM 11165 H HA   . GLU A 1 96 ? -12.088 0.641   13.813  1.00 0.00 ? 96 GLU A HA   7  
ATOM 11166 H HB2  . GLU A 1 96 ? -12.515 -0.338  11.528  1.00 0.00 ? 96 GLU A HB2  7  
ATOM 11167 H HB3  . GLU A 1 96 ? -11.255 0.872   11.596  1.00 0.00 ? 96 GLU A HB3  7  
ATOM 11168 H HG2  . GLU A 1 96 ? -10.287 -0.679  10.185  1.00 0.00 ? 96 GLU A HG2  7  
ATOM 11169 H HG3  . GLU A 1 96 ? -9.606  -1.169  11.738  1.00 0.00 ? 96 GLU A HG3  7  
ATOM 11170 N N    . SER A 1 97 ? -13.400 -1.717  13.577  1.00 0.00 ? 97 SER A N    7  
ATOM 11171 C CA   . SER A 1 97 ? -14.129 -2.954  13.883  1.00 0.00 ? 97 SER A CA   7  
ATOM 11172 C C    . SER A 1 97 ? -14.276 -3.780  12.603  1.00 0.00 ? 97 SER A C    7  
ATOM 11173 O O    . SER A 1 97 ? -14.577 -3.227  11.536  1.00 0.00 ? 97 SER A O    7  
ATOM 11174 C CB   . SER A 1 97 ? -15.509 -2.609  14.474  1.00 0.00 ? 97 SER A CB   7  
ATOM 11175 O OG   . SER A 1 97 ? -15.382 -1.776  15.610  1.00 0.00 ? 97 SER A OG   7  
ATOM 11176 H H    . SER A 1 97 ? -13.856 -1.036  13.043  1.00 0.00 ? 97 SER A H    7  
ATOM 11177 H HA   . SER A 1 97 ? -13.564 -3.528  14.614  1.00 0.00 ? 97 SER A HA   7  
ATOM 11178 H HB2  . SER A 1 97 ? -16.108 -2.091  13.732  1.00 0.00 ? 97 SER A HB2  7  
ATOM 11179 H HB3  . SER A 1 97 ? -16.013 -3.517  14.776  1.00 0.00 ? 97 SER A HB3  7  
ATOM 11180 H HG   . SER A 1 97 ? -14.466 -1.802  15.923  1.00 0.00 ? 97 SER A HG   7  
ATOM 11181 N N    . ASP A 1 98 ? -14.048 -5.097  12.712  1.00 0.00 ? 98 ASP A N    7  
ATOM 11182 C CA   . ASP A 1 98 ? -14.162 -6.030  11.574  1.00 0.00 ? 98 ASP A CA   7  
ATOM 11183 C C    . ASP A 1 98 ? -15.615 -6.140  11.088  1.00 0.00 ? 98 ASP A C    7  
ATOM 11184 O O    . ASP A 1 98 ? -15.862 -6.282  9.884   1.00 0.00 ? 98 ASP A O    7  
ATOM 11185 C CB   . ASP A 1 98 ? -13.606 -7.426  11.940  1.00 0.00 ? 98 ASP A CB   7  
ATOM 11186 C CG   . ASP A 1 98 ? -12.105 -7.405  12.248  1.00 0.00 ? 98 ASP A CG   7  
ATOM 11187 O OD1  . ASP A 1 98 ? -11.723 -6.998  13.365  1.00 0.00 ? 98 ASP A OD1  7  
ATOM 11188 O OD2  . ASP A 1 98 ? -11.289 -7.774  11.373  1.00 0.00 ? 98 ASP A OD2  7  
ATOM 11189 H H    . ASP A 1 98 ? -13.780 -5.453  13.583  1.00 0.00 ? 98 ASP A H    7  
ATOM 11190 H HA   . ASP A 1 98 ? -13.567 -5.620  10.764  1.00 0.00 ? 98 ASP A HA   7  
ATOM 11191 H HB2  . ASP A 1 98 ? -14.134 -7.809  12.812  1.00 0.00 ? 98 ASP A HB2  7  
ATOM 11192 H HB3  . ASP A 1 98 ? -13.782 -8.106  11.110  1.00 0.00 ? 98 ASP A HB3  7  
ATOM 11193 N N    . GLY A 1 99 ? -16.565 -6.048  12.038  1.00 0.00 ? 99 GLY A N    7  
ATOM 11194 C CA   . GLY A 1 99 ? -17.997 -6.148  11.738  1.00 0.00 ? 99 GLY A CA   7  
ATOM 11195 C C    . GLY A 1 99 ? -18.439 -7.576  11.385  1.00 0.00 ? 99 GLY A C    7  
ATOM 11196 O O    . GLY A 1 99 ? -17.826 -8.537  11.887  1.00 0.00 ? 99 GLY A O    7  
ATOM 11197 O OXT  . GLY A 1 99 ? -19.396 -7.745  10.607  1.00 0.00 ? 99 GLY A OXT  7  
ATOM 11198 H H    . GLY A 1 99 ? -16.288 -5.923  12.964  1.00 0.00 ? 99 GLY A H    7  
ATOM 11199 H HA2  . GLY A 1 99 ? -18.542 -5.825  12.612  1.00 0.00 ? 99 GLY A HA2  7  
ATOM 11200 H HA3  . GLY A 1 99 ? -18.239 -5.476  10.914  1.00 0.00 ? 99 GLY A HA3  7  
ATOM 11201 N N    . MET A 1 1  ? -3.803  0.960   31.617  1.00 0.00 ? 1  MET A N    8  
ATOM 11202 C CA   . MET A 1 1  ? -2.644  1.853   31.887  1.00 0.00 ? 1  MET A CA   8  
ATOM 11203 C C    . MET A 1 1  ? -3.005  2.918   32.945  1.00 0.00 ? 1  MET A C    8  
ATOM 11204 O O    . MET A 1 1  ? -2.292  3.918   33.100  1.00 0.00 ? 1  MET A O    8  
ATOM 11205 C CB   . MET A 1 1  ? -2.167  2.505   30.559  1.00 0.00 ? 1  MET A CB   8  
ATOM 11206 C CG   . MET A 1 1  ? -3.215  3.395   29.875  1.00 0.00 ? 1  MET A CG   8  
ATOM 11207 S SD   . MET A 1 1  ? -2.605  4.177   28.365  1.00 0.00 ? 1  MET A SD   8  
ATOM 11208 C CE   . MET A 1 1  ? -3.995  5.232   27.943  1.00 0.00 ? 1  MET A CE   8  
ATOM 11209 H H1   . MET A 1 1  ? -4.065  0.445   32.484  1.00 0.00 ? 1  MET A H1   8  
ATOM 11210 H H2   . MET A 1 1  ? -3.556  0.270   30.883  1.00 0.00 ? 1  MET A H2   8  
ATOM 11211 H H3   . MET A 1 1  ? -4.621  1.520   31.296  1.00 0.00 ? 1  MET A H3   8  
ATOM 11212 H HA   . MET A 1 1  ? -1.845  1.239   32.285  1.00 0.00 ? 1  MET A HA   8  
ATOM 11213 H HB2  . MET A 1 1  ? -1.291  3.108   30.759  1.00 0.00 ? 1  MET A HB2  8  
ATOM 11214 H HB3  . MET A 1 1  ? -1.890  1.718   29.867  1.00 0.00 ? 1  MET A HB3  8  
ATOM 11215 H HG2  . MET A 1 1  ? -4.079  2.793   29.627  1.00 0.00 ? 1  MET A HG2  8  
ATOM 11216 H HG3  . MET A 1 1  ? -3.513  4.173   30.567  1.00 0.00 ? 1  MET A HG3  8  
ATOM 11217 H HE1  . MET A 1 1  ? -3.778  5.761   27.027  1.00 0.00 ? 1  MET A HE1  8  
ATOM 11218 H HE2  . MET A 1 1  ? -4.161  5.944   28.740  1.00 0.00 ? 1  MET A HE2  8  
ATOM 11219 H HE3  . MET A 1 1  ? -4.882  4.631   27.807  1.00 0.00 ? 1  MET A HE3  8  
ATOM 11220 N N    . GLY A 1 2  ? -4.107  2.682   33.684  1.00 0.00 ? 2  GLY A N    8  
ATOM 11221 C CA   . GLY A 1 2  ? -4.569  3.589   34.734  1.00 0.00 ? 2  GLY A CA   8  
ATOM 11222 C C    . GLY A 1 2  ? -5.458  4.701   34.190  1.00 0.00 ? 2  GLY A C    8  
ATOM 11223 O O    . GLY A 1 2  ? -6.689  4.623   34.267  1.00 0.00 ? 2  GLY A O    8  
ATOM 11224 H H    . GLY A 1 2  ? -4.624  1.871   33.509  1.00 0.00 ? 2  GLY A H    8  
ATOM 11225 H HA2  . GLY A 1 2  ? -5.127  3.014   35.461  1.00 0.00 ? 2  GLY A HA2  8  
ATOM 11226 H HA3  . GLY A 1 2  ? -3.713  4.033   35.234  1.00 0.00 ? 2  GLY A HA3  8  
ATOM 11227 N N    . HIS A 1 3  ? -4.828  5.738   33.614  1.00 0.00 ? 3  HIS A N    8  
ATOM 11228 C CA   . HIS A 1 3  ? -5.527  6.913   33.051  1.00 0.00 ? 3  HIS A CA   8  
ATOM 11229 C C    . HIS A 1 3  ? -4.979  7.215   31.642  1.00 0.00 ? 3  HIS A C    8  
ATOM 11230 O O    . HIS A 1 3  ? -4.196  6.428   31.100  1.00 0.00 ? 3  HIS A O    8  
ATOM 11231 C CB   . HIS A 1 3  ? -5.362  8.137   33.999  1.00 0.00 ? 3  HIS A CB   8  
ATOM 11232 C CG   . HIS A 1 3  ? -5.904  7.926   35.395  1.00 0.00 ? 3  HIS A CG   8  
ATOM 11233 N ND1  . HIS A 1 3  ? -7.253  7.873   35.672  1.00 0.00 ? 3  HIS A ND1  8  
ATOM 11234 C CD2  . HIS A 1 3  ? -5.275  7.718   36.586  1.00 0.00 ? 3  HIS A CD2  8  
ATOM 11235 C CE1  . HIS A 1 3  ? -7.433  7.635   36.958  1.00 0.00 ? 3  HIS A CE1  8  
ATOM 11236 N NE2  . HIS A 1 3  ? -6.251  7.543   37.537  1.00 0.00 ? 3  HIS A NE2  8  
ATOM 11237 H H    . HIS A 1 3  ? -3.850  5.713   33.552  1.00 0.00 ? 3  HIS A H    8  
ATOM 11238 H HA   . HIS A 1 3  ? -6.585  6.683   32.954  1.00 0.00 ? 3  HIS A HA   8  
ATOM 11239 H HB2  . HIS A 1 3  ? -4.309  8.375   34.089  1.00 0.00 ? 3  HIS A HB2  8  
ATOM 11240 H HB3  . HIS A 1 3  ? -5.874  8.993   33.568  1.00 0.00 ? 3  HIS A HB3  8  
ATOM 11241 H HD1  . HIS A 1 3  ? -7.978  8.003   35.026  1.00 0.00 ? 3  HIS A HD1  8  
ATOM 11242 H HD2  . HIS A 1 3  ? -4.207  7.691   36.752  1.00 0.00 ? 3  HIS A HD2  8  
ATOM 11243 H HE1  . HIS A 1 3  ? -8.388  7.541   37.455  1.00 0.00 ? 3  HIS A HE1  8  
ATOM 11244 H HE2  . HIS A 1 3  ? -6.098  7.475   38.506  1.00 0.00 ? 3  HIS A HE2  8  
ATOM 11245 N N    . HIS A 1 4  ? -5.416  8.334   31.035  1.00 0.00 ? 4  HIS A N    8  
ATOM 11246 C CA   . HIS A 1 4  ? -4.976  8.749   29.678  1.00 0.00 ? 4  HIS A CA   8  
ATOM 11247 C C    . HIS A 1 4  ? -4.052  9.977   29.726  1.00 0.00 ? 4  HIS A C    8  
ATOM 11248 O O    . HIS A 1 4  ? -3.367  10.259  28.741  1.00 0.00 ? 4  HIS A O    8  
ATOM 11249 C CB   . HIS A 1 4  ? -6.205  9.040   28.778  1.00 0.00 ? 4  HIS A CB   8  
ATOM 11250 C CG   . HIS A 1 4  ? -7.079  7.831   28.533  1.00 0.00 ? 4  HIS A CG   8  
ATOM 11251 N ND1  . HIS A 1 4  ? -7.007  7.054   27.392  1.00 0.00 ? 4  HIS A ND1  8  
ATOM 11252 C CD2  . HIS A 1 4  ? -8.032  7.253   29.306  1.00 0.00 ? 4  HIS A CD2  8  
ATOM 11253 C CE1  . HIS A 1 4  ? -7.873  6.061   27.481  1.00 0.00 ? 4  HIS A CE1  8  
ATOM 11254 N NE2  . HIS A 1 4  ? -8.506  6.157   28.630  1.00 0.00 ? 4  HIS A NE2  8  
ATOM 11255 H H    . HIS A 1 4  ? -6.065  8.899   31.506  1.00 0.00 ? 4  HIS A H    8  
ATOM 11256 H HA   . HIS A 1 4  ? -4.416  7.926   29.233  1.00 0.00 ? 4  HIS A HA   8  
ATOM 11257 H HB2  . HIS A 1 4  ? -6.819  9.804   29.249  1.00 0.00 ? 4  HIS A HB2  8  
ATOM 11258 H HB3  . HIS A 1 4  ? -5.864  9.412   27.813  1.00 0.00 ? 4  HIS A HB3  8  
ATOM 11259 H HD1  . HIS A 1 4  ? -6.413  7.212   26.625  1.00 0.00 ? 4  HIS A HD1  8  
ATOM 11260 H HD2  . HIS A 1 4  ? -8.351  7.587   30.287  1.00 0.00 ? 4  HIS A HD2  8  
ATOM 11261 H HE1  . HIS A 1 4  ? -8.030  5.291   26.741  1.00 0.00 ? 4  HIS A HE1  8  
ATOM 11262 H HE2  . HIS A 1 4  ? -9.074  5.452   29.021  1.00 0.00 ? 4  HIS A HE2  8  
ATOM 11263 N N    . HIS A 1 5  ? -4.022  10.672  30.881  1.00 0.00 ? 5  HIS A N    8  
ATOM 11264 C CA   . HIS A 1 5  ? -3.266  11.940  31.078  1.00 0.00 ? 5  HIS A CA   8  
ATOM 11265 C C    . HIS A 1 5  ? -1.758  11.797  30.776  1.00 0.00 ? 5  HIS A C    8  
ATOM 11266 O O    . HIS A 1 5  ? -1.120  12.736  30.298  1.00 0.00 ? 5  HIS A O    8  
ATOM 11267 C CB   . HIS A 1 5  ? -3.486  12.463  32.522  1.00 0.00 ? 5  HIS A CB   8  
ATOM 11268 C CG   . HIS A 1 5  ? -2.625  13.647  32.912  1.00 0.00 ? 5  HIS A CG   8  
ATOM 11269 N ND1  . HIS A 1 5  ? -2.734  14.889  32.324  1.00 0.00 ? 5  HIS A ND1  8  
ATOM 11270 C CD2  . HIS A 1 5  ? -1.603  13.752  33.804  1.00 0.00 ? 5  HIS A CD2  8  
ATOM 11271 C CE1  . HIS A 1 5  ? -1.821  15.699  32.826  1.00 0.00 ? 5  HIS A CE1  8  
ATOM 11272 N NE2  . HIS A 1 5  ? -1.126  15.036  33.725  1.00 0.00 ? 5  HIS A NE2  8  
ATOM 11273 H H    . HIS A 1 5  ? -4.533  10.323  31.635  1.00 0.00 ? 5  HIS A H    8  
ATOM 11274 H HA   . HIS A 1 5  ? -3.677  12.666  30.384  1.00 0.00 ? 5  HIS A HA   8  
ATOM 11275 H HB2  . HIS A 1 5  ? -4.520  12.763  32.632  1.00 0.00 ? 5  HIS A HB2  8  
ATOM 11276 H HB3  . HIS A 1 5  ? -3.288  11.658  33.221  1.00 0.00 ? 5  HIS A HB3  8  
ATOM 11277 H HD1  . HIS A 1 5  ? -3.385  15.142  31.634  1.00 0.00 ? 5  HIS A HD1  8  
ATOM 11278 H HD2  . HIS A 1 5  ? -1.240  12.967  34.462  1.00 0.00 ? 5  HIS A HD2  8  
ATOM 11279 H HE1  . HIS A 1 5  ? -1.678  16.732  32.559  1.00 0.00 ? 5  HIS A HE1  8  
ATOM 11280 H HE2  . HIS A 1 5  ? -0.337  15.386  34.199  1.00 0.00 ? 5  HIS A HE2  8  
ATOM 11281 N N    . HIS A 1 6  ? -1.211  10.609  31.030  1.00 0.00 ? 6  HIS A N    8  
ATOM 11282 C CA   . HIS A 1 6  ? 0.233   10.313  30.858  1.00 0.00 ? 6  HIS A CA   8  
ATOM 11283 C C    . HIS A 1 6  ? 0.672   10.193  29.377  1.00 0.00 ? 6  HIS A C    8  
ATOM 11284 O O    . HIS A 1 6  ? 1.812   9.793   29.116  1.00 0.00 ? 6  HIS A O    8  
ATOM 11285 C CB   . HIS A 1 6  ? 0.610   9.027   31.644  1.00 0.00 ? 6  HIS A CB   8  
ATOM 11286 C CG   . HIS A 1 6  ? -0.035  7.769   31.123  1.00 0.00 ? 6  HIS A CG   8  
ATOM 11287 N ND1  . HIS A 1 6  ? 0.661   6.610   30.857  1.00 0.00 ? 6  HIS A ND1  8  
ATOM 11288 C CD2  . HIS A 1 6  ? -1.326  7.488   30.839  1.00 0.00 ? 6  HIS A CD2  8  
ATOM 11289 C CE1  . HIS A 1 6  ? -0.173  5.690   30.428  1.00 0.00 ? 6  HIS A CE1  8  
ATOM 11290 N NE2  . HIS A 1 6  ? -1.382  6.197   30.408  1.00 0.00 ? 6  HIS A NE2  8  
ATOM 11291 H H    . HIS A 1 6  ? -1.795  9.903   31.370  1.00 0.00 ? 6  HIS A H    8  
ATOM 11292 H HA   . HIS A 1 6  ? 0.785   11.139  31.290  1.00 0.00 ? 6  HIS A HA   8  
ATOM 11293 H HB2  . HIS A 1 6  ? 1.686   8.891   31.612  1.00 0.00 ? 6  HIS A HB2  8  
ATOM 11294 H HB3  . HIS A 1 6  ? 0.308   9.144   32.678  1.00 0.00 ? 6  HIS A HB3  8  
ATOM 11295 H HD1  . HIS A 1 6  ? 1.628   6.483   30.957  1.00 0.00 ? 6  HIS A HD1  8  
ATOM 11296 H HD2  . HIS A 1 6  ? -2.169  8.163   30.952  1.00 0.00 ? 6  HIS A HD2  8  
ATOM 11297 H HE1  . HIS A 1 6  ? 0.092   4.678   30.137  1.00 0.00 ? 6  HIS A HE1  8  
ATOM 11298 H HE2  . HIS A 1 6  ? -2.135  5.802   29.932  1.00 0.00 ? 6  HIS A HE2  8  
ATOM 11299 N N    . HIS A 1 7  ? -0.221  10.529  28.416  1.00 0.00 ? 7  HIS A N    8  
ATOM 11300 C CA   . HIS A 1 7  ? 0.121   10.546  26.981  1.00 0.00 ? 7  HIS A CA   8  
ATOM 11301 C C    . HIS A 1 7  ? 1.121   11.695  26.681  1.00 0.00 ? 7  HIS A C    8  
ATOM 11302 O O    . HIS A 1 7  ? 0.756   12.828  26.362  1.00 0.00 ? 7  HIS A O    8  
ATOM 11303 C CB   . HIS A 1 7  ? -1.168  10.608  26.096  1.00 0.00 ? 7  HIS A CB   8  
ATOM 11304 C CG   . HIS A 1 7  ? -1.912  11.930  26.113  1.00 0.00 ? 7  HIS A CG   8  
ATOM 11305 N ND1  . HIS A 1 7  ? -2.175  12.654  24.969  1.00 0.00 ? 7  HIS A ND1  8  
ATOM 11306 C CD2  . HIS A 1 7  ? -2.410  12.668  27.135  1.00 0.00 ? 7  HIS A CD2  8  
ATOM 11307 C CE1  . HIS A 1 7  ? -2.775  13.778  25.291  1.00 0.00 ? 7  HIS A CE1  8  
ATOM 11308 N NE2  . HIS A 1 7  ? -2.941  13.812  26.596  1.00 0.00 ? 7  HIS A NE2  8  
ATOM 11309 H H    . HIS A 1 7  ? -1.133  10.750  28.677  1.00 0.00 ? 7  HIS A H    8  
ATOM 11310 H HA   . HIS A 1 7  ? 0.627   9.607   26.769  1.00 0.00 ? 7  HIS A HA   8  
ATOM 11311 H HB2  . HIS A 1 7  ? -0.893  10.398  25.068  1.00 0.00 ? 7  HIS A HB2  8  
ATOM 11312 H HB3  . HIS A 1 7  ? -1.856  9.839   26.432  1.00 0.00 ? 7  HIS A HB3  8  
ATOM 11313 H HD1  . HIS A 1 7  ? -1.962  12.375  24.049  1.00 0.00 ? 7  HIS A HD1  8  
ATOM 11314 H HD2  . HIS A 1 7  ? -2.386  12.405  28.188  1.00 0.00 ? 7  HIS A HD2  8  
ATOM 11315 H HE1  . HIS A 1 7  ? -3.109  14.538  24.599  1.00 0.00 ? 7  HIS A HE1  8  
ATOM 11316 H HE2  . HIS A 1 7  ? -3.538  14.429  27.066  1.00 0.00 ? 7  HIS A HE2  8  
ATOM 11317 N N    . HIS A 1 8  ? 2.410   11.397  26.870  1.00 0.00 ? 8  HIS A N    8  
ATOM 11318 C CA   . HIS A 1 8  ? 3.500   12.356  26.628  1.00 0.00 ? 8  HIS A CA   8  
ATOM 11319 C C    . HIS A 1 8  ? 4.113   12.117  25.247  1.00 0.00 ? 8  HIS A C    8  
ATOM 11320 O O    . HIS A 1 8  ? 4.907   12.928  24.774  1.00 0.00 ? 8  HIS A O    8  
ATOM 11321 C CB   . HIS A 1 8  ? 4.550   12.254  27.750  1.00 0.00 ? 8  HIS A CB   8  
ATOM 11322 C CG   . HIS A 1 8  ? 3.998   12.557  29.128  1.00 0.00 ? 8  HIS A CG   8  
ATOM 11323 N ND1  . HIS A 1 8  ? 4.137   11.710  30.206  1.00 0.00 ? 8  HIS A ND1  8  
ATOM 11324 C CD2  . HIS A 1 8  ? 3.301   13.627  29.593  1.00 0.00 ? 8  HIS A CD2  8  
ATOM 11325 C CE1  . HIS A 1 8  ? 3.552   12.240  31.263  1.00 0.00 ? 8  HIS A CE1  8  
ATOM 11326 N NE2  . HIS A 1 8  ? 3.039   13.403  30.924  1.00 0.00 ? 8  HIS A NE2  8  
ATOM 11327 H H    . HIS A 1 8  ? 2.645   10.498  27.183  1.00 0.00 ? 8  HIS A H    8  
ATOM 11328 H HA   . HIS A 1 8  ? 3.085   13.363  26.634  1.00 0.00 ? 8  HIS A HA   8  
ATOM 11329 H HB2  . HIS A 1 8  ? 4.958   11.248  27.768  1.00 0.00 ? 8  HIS A HB2  8  
ATOM 11330 H HB3  . HIS A 1 8  ? 5.353   12.954  27.552  1.00 0.00 ? 8  HIS A HB3  8  
ATOM 11331 H HD1  . HIS A 1 8  ? 4.610   10.850  30.201  1.00 0.00 ? 8  HIS A HD1  8  
ATOM 11332 H HD2  . HIS A 1 8  ? 2.987   14.488  29.015  1.00 0.00 ? 8  HIS A HD2  8  
ATOM 11333 H HE1  . HIS A 1 8  ? 3.494   11.788  32.242  1.00 0.00 ? 8  HIS A HE1  8  
ATOM 11334 H HE2  . HIS A 1 8  ? 2.777   14.098  31.565  1.00 0.00 ? 8  HIS A HE2  8  
ATOM 11335 N N    . SER A 1 9  ? 3.741   10.988  24.615  1.00 0.00 ? 9  SER A N    8  
ATOM 11336 C CA   . SER A 1 9  ? 4.027   10.722  23.213  1.00 0.00 ? 9  SER A CA   8  
ATOM 11337 C C    . SER A 1 9  ? 3.102   11.615  22.376  1.00 0.00 ? 9  SER A C    8  
ATOM 11338 O O    . SER A 1 9  ? 1.915   11.302  22.192  1.00 0.00 ? 9  SER A O    8  
ATOM 11339 C CB   . SER A 1 9  ? 3.792   9.228   22.883  1.00 0.00 ? 9  SER A CB   8  
ATOM 11340 O OG   . SER A 1 9  ? 4.615   8.377   23.665  1.00 0.00 ? 9  SER A OG   8  
ATOM 11341 H H    . SER A 1 9  ? 3.241   10.317  25.117  1.00 0.00 ? 9  SER A H    8  
ATOM 11342 H HA   . SER A 1 9  ? 5.064   10.981  23.017  1.00 0.00 ? 9  SER A HA   8  
ATOM 11343 H HB2  . SER A 1 9  ? 2.760   8.973   23.084  1.00 0.00 ? 9  SER A HB2  8  
ATOM 11344 H HB3  . SER A 1 9  ? 4.005   9.048   21.838  1.00 0.00 ? 9  SER A HB3  8  
ATOM 11345 H HG   . SER A 1 9  ? 4.554   7.476   23.322  1.00 0.00 ? 9  SER A HG   8  
ATOM 11346 N N    . HIS A 1 10 ? 3.640   12.761  21.934  1.00 0.00 ? 10 HIS A N    8  
ATOM 11347 C CA   . HIS A 1 10 ? 2.901   13.741  21.115  1.00 0.00 ? 10 HIS A CA   8  
ATOM 11348 C C    . HIS A 1 10 ? 2.719   13.208  19.685  1.00 0.00 ? 10 HIS A C    8  
ATOM 11349 O O    . HIS A 1 10 ? 3.127   12.080  19.379  1.00 0.00 ? 10 HIS A O    8  
ATOM 11350 C CB   . HIS A 1 10 ? 3.650   15.099  21.109  1.00 0.00 ? 10 HIS A CB   8  
ATOM 11351 C CG   . HIS A 1 10 ? 3.829   15.701  22.480  1.00 0.00 ? 10 HIS A CG   8  
ATOM 11352 N ND1  . HIS A 1 10 ? 2.841   16.420  23.123  1.00 0.00 ? 10 HIS A ND1  8  
ATOM 11353 C CD2  . HIS A 1 10 ? 4.881   15.676  23.335  1.00 0.00 ? 10 HIS A CD2  8  
ATOM 11354 C CE1  . HIS A 1 10 ? 3.282   16.802  24.308  1.00 0.00 ? 10 HIS A CE1  8  
ATOM 11355 N NE2  . HIS A 1 10 ? 4.514   16.362  24.460  1.00 0.00 ? 10 HIS A NE2  8  
ATOM 11356 H H    . HIS A 1 10 ? 4.575   12.951  22.159  1.00 0.00 ? 10 HIS A H    8  
ATOM 11357 H HA   . HIS A 1 10 ? 1.917   13.885  21.559  1.00 0.00 ? 10 HIS A HA   8  
ATOM 11358 H HB2  . HIS A 1 10 ? 4.634   14.966  20.670  1.00 0.00 ? 10 HIS A HB2  8  
ATOM 11359 H HB3  . HIS A 1 10 ? 3.094   15.809  20.505  1.00 0.00 ? 10 HIS A HB3  8  
ATOM 11360 H HD1  . HIS A 1 10 ? 1.949   16.619  22.767  1.00 0.00 ? 10 HIS A HD1  8  
ATOM 11361 H HD2  . HIS A 1 10 ? 5.839   15.196  23.160  1.00 0.00 ? 10 HIS A HD2  8  
ATOM 11362 H HE1  . HIS A 1 10 ? 2.724   17.375  25.036  1.00 0.00 ? 10 HIS A HE1  8  
ATOM 11363 H HE2  . HIS A 1 10 ? 5.038   16.424  25.289  1.00 0.00 ? 10 HIS A HE2  8  
ATOM 11364 N N    . MET A 1 11 ? 2.150   14.030  18.786  1.00 0.00 ? 11 MET A N    8  
ATOM 11365 C CA   . MET A 1 11 ? 1.934   13.639  17.369  1.00 0.00 ? 11 MET A CA   8  
ATOM 11366 C C    . MET A 1 11 ? 3.239   13.740  16.530  1.00 0.00 ? 11 MET A C    8  
ATOM 11367 O O    . MET A 1 11 ? 3.202   14.093  15.344  1.00 0.00 ? 11 MET A O    8  
ATOM 11368 C CB   . MET A 1 11 ? 0.789   14.496  16.754  1.00 0.00 ? 11 MET A CB   8  
ATOM 11369 C CG   . MET A 1 11 ? -0.556  14.372  17.493  1.00 0.00 ? 11 MET A CG   8  
ATOM 11370 S SD   . MET A 1 11 ? -1.137  12.661  17.598  1.00 0.00 ? 11 MET A SD   8  
ATOM 11371 C CE   . MET A 1 11 ? -2.707  12.831  18.451  1.00 0.00 ? 11 MET A CE   8  
ATOM 11372 H H    . MET A 1 11 ? 1.845   14.911  19.081  1.00 0.00 ? 11 MET A H    8  
ATOM 11373 H HA   . MET A 1 11 ? 1.620   12.599  17.358  1.00 0.00 ? 11 MET A HA   8  
ATOM 11374 H HB2  . MET A 1 11 ? 1.084   15.539  16.754  1.00 0.00 ? 11 MET A HB2  8  
ATOM 11375 H HB3  . MET A 1 11 ? 0.633   14.182  15.727  1.00 0.00 ? 11 MET A HB3  8  
ATOM 11376 H HG2  . MET A 1 11 ? -0.437  14.756  18.500  1.00 0.00 ? 11 MET A HG2  8  
ATOM 11377 H HG3  . MET A 1 11 ? -1.303  14.960  16.974  1.00 0.00 ? 11 MET A HG3  8  
ATOM 11378 H HE1  . MET A 1 11 ? -2.543  13.271  19.424  1.00 0.00 ? 11 MET A HE1  8  
ATOM 11379 H HE2  . MET A 1 11 ? -3.158  11.855  18.568  1.00 0.00 ? 11 MET A HE2  8  
ATOM 11380 H HE3  . MET A 1 11 ? -3.367  13.461  17.876  1.00 0.00 ? 11 MET A HE3  8  
ATOM 11381 N N    . LYS A 1 12 ? 4.390   13.391  17.159  1.00 0.00 ? 12 LYS A N    8  
ATOM 11382 C CA   . LYS A 1 12 ? 5.693   13.281  16.490  1.00 0.00 ? 12 LYS A CA   8  
ATOM 11383 C C    . LYS A 1 12 ? 5.643   12.163  15.441  1.00 0.00 ? 12 LYS A C    8  
ATOM 11384 O O    . LYS A 1 12 ? 6.213   12.305  14.365  1.00 0.00 ? 12 LYS A O    8  
ATOM 11385 C CB   . LYS A 1 12 ? 6.818   13.009  17.521  1.00 0.00 ? 12 LYS A CB   8  
ATOM 11386 C CG   . LYS A 1 12 ? 8.244   12.931  16.920  1.00 0.00 ? 12 LYS A CG   8  
ATOM 11387 C CD   . LYS A 1 12 ? 9.330   12.624  17.982  1.00 0.00 ? 12 LYS A CD   8  
ATOM 11388 C CE   . LYS A 1 12 ? 10.737  12.530  17.368  1.00 0.00 ? 12 LYS A CE   8  
ATOM 11389 N NZ   . LYS A 1 12 ? 11.771  12.168  18.372  1.00 0.00 ? 12 LYS A NZ   8  
ATOM 11390 H H    . LYS A 1 12 ? 4.359   13.200  18.108  1.00 0.00 ? 12 LYS A H    8  
ATOM 11391 H HA   . LYS A 1 12 ? 5.888   14.231  15.993  1.00 0.00 ? 12 LYS A HA   8  
ATOM 11392 H HB2  . LYS A 1 12 ? 6.805   13.801  18.259  1.00 0.00 ? 12 LYS A HB2  8  
ATOM 11393 H HB3  . LYS A 1 12 ? 6.611   12.069  18.024  1.00 0.00 ? 12 LYS A HB3  8  
ATOM 11394 H HG2  . LYS A 1 12 ? 8.263   12.145  16.173  1.00 0.00 ? 12 LYS A HG2  8  
ATOM 11395 H HG3  . LYS A 1 12 ? 8.480   13.877  16.439  1.00 0.00 ? 12 LYS A HG3  8  
ATOM 11396 H HD2  . LYS A 1 12 ? 9.327   13.409  18.733  1.00 0.00 ? 12 LYS A HD2  8  
ATOM 11397 H HD3  . LYS A 1 12 ? 9.095   11.678  18.461  1.00 0.00 ? 12 LYS A HD3  8  
ATOM 11398 H HE2  . LYS A 1 12 ? 10.738  11.780  16.585  1.00 0.00 ? 12 LYS A HE2  8  
ATOM 11399 H HE3  . LYS A 1 12 ? 10.996  13.491  16.933  1.00 0.00 ? 12 LYS A HE3  8  
ATOM 11400 H HZ1  . LYS A 1 12 ? 11.518  11.272  18.838  1.00 0.00 ? 12 LYS A HZ1  8  
ATOM 11401 H HZ2  . LYS A 1 12 ? 11.845  12.915  19.098  1.00 0.00 ? 12 LYS A HZ2  8  
ATOM 11402 H HZ3  . LYS A 1 12 ? 12.695  12.053  17.908  1.00 0.00 ? 12 LYS A HZ3  8  
ATOM 11403 N N    . ARG A 1 13 ? 4.948   11.042  15.776  1.00 0.00 ? 13 ARG A N    8  
ATOM 11404 C CA   . ARG A 1 13 ? 4.604   10.011  14.779  1.00 0.00 ? 13 ARG A CA   8  
ATOM 11405 C C    . ARG A 1 13 ? 3.532   10.589  13.847  1.00 0.00 ? 13 ARG A C    8  
ATOM 11406 O O    . ARG A 1 13 ? 2.324   10.497  14.107  1.00 0.00 ? 13 ARG A O    8  
ATOM 11407 C CB   . ARG A 1 13 ? 4.126   8.677   15.430  1.00 0.00 ? 13 ARG A CB   8  
ATOM 11408 C CG   . ARG A 1 13 ? 3.706   7.557   14.431  1.00 0.00 ? 13 ARG A CG   8  
ATOM 11409 C CD   . ARG A 1 13 ? 4.834   7.142   13.462  1.00 0.00 ? 13 ARG A CD   8  
ATOM 11410 N NE   . ARG A 1 13 ? 6.040   6.657   14.178  1.00 0.00 ? 13 ARG A NE   8  
ATOM 11411 C CZ   . ARG A 1 13 ? 6.474   5.382   14.223  1.00 0.00 ? 13 ARG A CZ   8  
ATOM 11412 N NH1  . ARG A 1 13 ? 5.820   4.413   13.587  1.00 0.00 ? 13 ARG A NH1  8  
ATOM 11413 N NH2  . ARG A 1 13 ? 7.578   5.089   14.902  1.00 0.00 ? 13 ARG A NH2  8  
ATOM 11414 H H    . ARG A 1 13 ? 4.657   10.922  16.706  1.00 0.00 ? 13 ARG A H    8  
ATOM 11415 H HA   . ARG A 1 13 ? 5.503   9.811   14.196  1.00 0.00 ? 13 ARG A HA   8  
ATOM 11416 H HB2  . ARG A 1 13 ? 4.928   8.289   16.050  1.00 0.00 ? 13 ARG A HB2  8  
ATOM 11417 H HB3  . ARG A 1 13 ? 3.277   8.893   16.070  1.00 0.00 ? 13 ARG A HB3  8  
ATOM 11418 H HG2  . ARG A 1 13 ? 3.405   6.683   14.998  1.00 0.00 ? 13 ARG A HG2  8  
ATOM 11419 H HG3  . ARG A 1 13 ? 2.854   7.906   13.853  1.00 0.00 ? 13 ARG A HG3  8  
ATOM 11420 H HD2  . ARG A 1 13 ? 4.461   6.361   12.807  1.00 0.00 ? 13 ARG A HD2  8  
ATOM 11421 H HD3  . ARG A 1 13 ? 5.107   8.000   12.858  1.00 0.00 ? 13 ARG A HD3  8  
ATOM 11422 H HE   . ARG A 1 13 ? 6.558   7.335   14.657  1.00 0.00 ? 13 ARG A HE   8  
ATOM 11423 H HH11 . ARG A 1 13 ? 4.989   4.624   13.060  1.00 0.00 ? 13 ARG A HH11 8  
ATOM 11424 H HH12 . ARG A 1 13 ? 6.154   3.469   13.630  1.00 0.00 ? 13 ARG A HH12 8  
ATOM 11425 H HH21 . ARG A 1 13 ? 8.076   5.812   15.387  1.00 0.00 ? 13 ARG A HH21 8  
ATOM 11426 H HH22 . ARG A 1 13 ? 7.908   4.140   14.943  1.00 0.00 ? 13 ARG A HH22 8  
ATOM 11427 N N    . SER A 1 14 ? 4.025   11.269  12.817  1.00 0.00 ? 14 SER A N    8  
ATOM 11428 C CA   . SER A 1 14 ? 3.229   11.871  11.759  1.00 0.00 ? 14 SER A CA   8  
ATOM 11429 C C    . SER A 1 14 ? 3.578   11.140  10.453  1.00 0.00 ? 14 SER A C    8  
ATOM 11430 O O    . SER A 1 14 ? 4.169   10.043  10.485  1.00 0.00 ? 14 SER A O    8  
ATOM 11431 C CB   . SER A 1 14 ? 3.541   13.397  11.699  1.00 0.00 ? 14 SER A CB   8  
ATOM 11432 O OG   . SER A 1 14 ? 2.712   14.079  10.775  1.00 0.00 ? 14 SER A OG   8  
ATOM 11433 H H    . SER A 1 14 ? 5.000   11.365  12.760  1.00 0.00 ? 14 SER A H    8  
ATOM 11434 H HA   . SER A 1 14 ? 2.172   11.726  11.976  1.00 0.00 ? 14 SER A HA   8  
ATOM 11435 H HB2  . SER A 1 14 ? 3.380   13.833  12.677  1.00 0.00 ? 14 SER A HB2  8  
ATOM 11436 H HB3  . SER A 1 14 ? 4.577   13.546  11.415  1.00 0.00 ? 14 SER A HB3  8  
ATOM 11437 H HG   . SER A 1 14 ? 1.875   14.284  11.204  1.00 0.00 ? 14 SER A HG   8  
ATOM 11438 N N    . GLY A 1 15 ? 3.188   11.707  9.316   1.00 0.00 ? 15 GLY A N    8  
ATOM 11439 C CA   . GLY A 1 15 ? 3.564   11.167  8.023   1.00 0.00 ? 15 GLY A CA   8  
ATOM 11440 C C    . GLY A 1 15 ? 3.276   12.141  6.910   1.00 0.00 ? 15 GLY A C    8  
ATOM 11441 O O    . GLY A 1 15 ? 2.544   13.115  7.112   1.00 0.00 ? 15 GLY A O    8  
ATOM 11442 H H    . GLY A 1 15 ? 2.628   12.512  9.354   1.00 0.00 ? 15 GLY A H    8  
ATOM 11443 H HA2  . GLY A 1 15 ? 4.624   10.929  8.022   1.00 0.00 ? 15 GLY A HA2  8  
ATOM 11444 H HA3  . GLY A 1 15 ? 3.001   10.260  7.841   1.00 0.00 ? 15 GLY A HA3  8  
ATOM 11445 N N    . ARG A 1 16 ? 3.849   11.887  5.737   1.00 0.00 ? 16 ARG A N    8  
ATOM 11446 C CA   . ARG A 1 16 ? 3.584   12.683  4.534   1.00 0.00 ? 16 ARG A CA   8  
ATOM 11447 C C    . ARG A 1 16 ? 2.360   12.098  3.822   1.00 0.00 ? 16 ARG A C    8  
ATOM 11448 O O    . ARG A 1 16 ? 2.332   10.900  3.517   1.00 0.00 ? 16 ARG A O    8  
ATOM 11449 C CB   . ARG A 1 16 ? 4.821   12.686  3.592   1.00 0.00 ? 16 ARG A CB   8  
ATOM 11450 C CG   . ARG A 1 16 ? 4.553   13.295  2.194   1.00 0.00 ? 16 ARG A CG   8  
ATOM 11451 C CD   . ARG A 1 16 ? 5.789   13.321  1.288   1.00 0.00 ? 16 ARG A CD   8  
ATOM 11452 N NE   . ARG A 1 16 ? 5.444   13.761  -0.084  1.00 0.00 ? 16 ARG A NE   8  
ATOM 11453 C CZ   . ARG A 1 16 ? 6.108   14.681  -0.817  1.00 0.00 ? 16 ARG A CZ   8  
ATOM 11454 N NH1  . ARG A 1 16 ? 7.184   15.296  -0.339  1.00 0.00 ? 16 ARG A NH1  8  
ATOM 11455 N NH2  . ARG A 1 16 ? 5.670   14.984  -2.029  1.00 0.00 ? 16 ARG A NH2  8  
ATOM 11456 H H    . ARG A 1 16 ? 4.438   11.111  5.661   1.00 0.00 ? 16 ARG A H    8  
ATOM 11457 H HA   . ARG A 1 16 ? 3.369   13.711  4.840   1.00 0.00 ? 16 ARG A HA   8  
ATOM 11458 H HB2  . ARG A 1 16 ? 5.616   13.251  4.067   1.00 0.00 ? 16 ARG A HB2  8  
ATOM 11459 H HB3  . ARG A 1 16 ? 5.160   11.668  3.456   1.00 0.00 ? 16 ARG A HB3  8  
ATOM 11460 H HG2  . ARG A 1 16 ? 3.787   12.704  1.705   1.00 0.00 ? 16 ARG A HG2  8  
ATOM 11461 H HG3  . ARG A 1 16 ? 4.186   14.310  2.318   1.00 0.00 ? 16 ARG A HG3  8  
ATOM 11462 H HD2  . ARG A 1 16 ? 6.532   13.988  1.716   1.00 0.00 ? 16 ARG A HD2  8  
ATOM 11463 H HD3  . ARG A 1 16 ? 6.203   12.320  1.228   1.00 0.00 ? 16 ARG A HD3  8  
ATOM 11464 H HE   . ARG A 1 16 ? 4.655   13.336  -0.487  1.00 0.00 ? 16 ARG A HE   8  
ATOM 11465 H HH11 . ARG A 1 16 ? 7.528   15.078  0.581   1.00 0.00 ? 16 ARG A HH11 8  
ATOM 11466 H HH12 . ARG A 1 16 ? 7.668   15.967  -0.900  1.00 0.00 ? 16 ARG A HH12 8  
ATOM 11467 H HH21 . ARG A 1 16 ? 4.847   14.538  -2.396  1.00 0.00 ? 16 ARG A HH21 8  
ATOM 11468 H HH22 . ARG A 1 16 ? 6.158   15.664  -2.587  1.00 0.00 ? 16 ARG A HH22 8  
ATOM 11469 N N    . GLU A 1 17 ? 1.348   12.945  3.576   1.00 0.00 ? 17 GLU A N    8  
ATOM 11470 C CA   . GLU A 1 17 ? 0.165   12.555  2.822   1.00 0.00 ? 17 GLU A CA   8  
ATOM 11471 C C    . GLU A 1 17 ? 0.549   12.481  1.333   1.00 0.00 ? 17 GLU A C    8  
ATOM 11472 O O    . GLU A 1 17 ? 0.829   13.504  0.700   1.00 0.00 ? 17 GLU A O    8  
ATOM 11473 C CB   . GLU A 1 17 ? -0.977  13.577  3.058   1.00 0.00 ? 17 GLU A CB   8  
ATOM 11474 C CG   . GLU A 1 17 ? -2.311  13.203  2.400   1.00 0.00 ? 17 GLU A CG   8  
ATOM 11475 C CD   . GLU A 1 17 ? -3.388  14.275  2.606   1.00 0.00 ? 17 GLU A CD   8  
ATOM 11476 O OE1  . GLU A 1 17 ? -4.066  14.266  3.658   1.00 0.00 ? 17 GLU A OE1  8  
ATOM 11477 O OE2  . GLU A 1 17 ? -3.559  15.145  1.723   1.00 0.00 ? 17 GLU A OE2  8  
ATOM 11478 H H    . GLU A 1 17 ? 1.404   13.862  3.917   1.00 0.00 ? 17 GLU A H    8  
ATOM 11479 H HA   . GLU A 1 17 ? -0.157  11.571  3.168   1.00 0.00 ? 17 GLU A HA   8  
ATOM 11480 H HB2  . GLU A 1 17 ? -1.140  13.671  4.127   1.00 0.00 ? 17 GLU A HB2  8  
ATOM 11481 H HB3  . GLU A 1 17 ? -0.666  14.545  2.673   1.00 0.00 ? 17 GLU A HB3  8  
ATOM 11482 H HG2  . GLU A 1 17 ? -2.148  13.062  1.335   1.00 0.00 ? 17 GLU A HG2  8  
ATOM 11483 H HG3  . GLU A 1 17 ? -2.663  12.263  2.820   1.00 0.00 ? 17 GLU A HG3  8  
ATOM 11484 N N    . ILE A 1 18 ? 0.598   11.257  0.818   1.00 0.00 ? 18 ILE A N    8  
ATOM 11485 C CA   . ILE A 1 18 ? 0.905   10.953  -0.583  1.00 0.00 ? 18 ILE A CA   8  
ATOM 11486 C C    . ILE A 1 18 ? -0.390  10.517  -1.290  1.00 0.00 ? 18 ILE A C    8  
ATOM 11487 O O    . ILE A 1 18 ? -1.447  10.413  -0.653  1.00 0.00 ? 18 ILE A O    8  
ATOM 11488 C CB   . ILE A 1 18 ? 1.997   9.814   -0.675  1.00 0.00 ? 18 ILE A CB   8  
ATOM 11489 C CG1  . ILE A 1 18 ? 1.471   8.463   -0.074  1.00 0.00 ? 18 ILE A CG1  8  
ATOM 11490 C CG2  . ILE A 1 18 ? 3.307   10.256  0.032   1.00 0.00 ? 18 ILE A CG2  8  
ATOM 11491 C CD1  . ILE A 1 18 ? 2.451   7.303   -0.138  1.00 0.00 ? 18 ILE A CD1  8  
ATOM 11492 H H    . ILE A 1 18 ? 0.418   10.508  1.408   1.00 0.00 ? 18 ILE A H    8  
ATOM 11493 H HA   . ILE A 1 18 ? 1.290   11.848  -1.073  1.00 0.00 ? 18 ILE A HA   8  
ATOM 11494 H HB   . ILE A 1 18 ? 2.229   9.663   -1.729  1.00 0.00 ? 18 ILE A HB   8  
ATOM 11495 H HG12 . ILE A 1 18 ? 1.216   8.610   0.968   1.00 0.00 ? 18 ILE A HG12 8  
ATOM 11496 H HG13 . ILE A 1 18 ? 0.577   8.161   -0.607  1.00 0.00 ? 18 ILE A HG13 8  
ATOM 11497 H HG21 . ILE A 1 18 ? 3.670   11.177  -0.410  1.00 0.00 ? 18 ILE A HG21 8  
ATOM 11498 H HG22 . ILE A 1 18 ? 4.061   9.491   -0.084  1.00 0.00 ? 18 ILE A HG22 8  
ATOM 11499 H HG23 . ILE A 1 18 ? 3.119   10.416  1.088   1.00 0.00 ? 18 ILE A HG23 8  
ATOM 11500 H HD11 . ILE A 1 18 ? 3.327   7.530   0.454   1.00 0.00 ? 18 ILE A HD11 8  
ATOM 11501 H HD12 . ILE A 1 18 ? 2.745   7.127   -1.164  1.00 0.00 ? 18 ILE A HD12 8  
ATOM 11502 H HD13 . ILE A 1 18 ? 1.980   6.411   0.255   1.00 0.00 ? 18 ILE A HD13 8  
ATOM 11503 N N    . THR A 1 19 ? -0.317  10.291  -2.602  1.00 0.00 ? 19 THR A N    8  
ATOM 11504 C CA   . THR A 1 19 ? -1.420  9.676   -3.368  1.00 0.00 ? 19 THR A CA   8  
ATOM 11505 C C    . THR A 1 19 ? -1.156  8.173   -3.531  1.00 0.00 ? 19 THR A C    8  
ATOM 11506 O O    . THR A 1 19 ? -0.055  7.703   -3.223  1.00 0.00 ? 19 THR A O    8  
ATOM 11507 C CB   . THR A 1 19 ? -1.569  10.345  -4.770  1.00 0.00 ? 19 THR A CB   8  
ATOM 11508 O OG1  . THR A 1 19 ? -0.365  10.168  -5.538  1.00 0.00 ? 19 THR A OG1  8  
ATOM 11509 C CG2  . THR A 1 19 ? -1.886  11.847  -4.652  1.00 0.00 ? 19 THR A CG2  8  
ATOM 11510 H H    . THR A 1 19 ? 0.495   10.560  -3.074  1.00 0.00 ? 19 THR A H    8  
ATOM 11511 H HA   . THR A 1 19 ? -2.354  9.812   -2.817  1.00 0.00 ? 19 THR A HA   8  
ATOM 11512 H HB   . THR A 1 19 ? -2.387  9.864   -5.300  1.00 0.00 ? 19 THR A HB   8  
ATOM 11513 H HG1  . THR A 1 19 ? 0.249   10.893  -5.347  1.00 0.00 ? 19 THR A HG1  8  
ATOM 11514 H HG21 . THR A 1 19 ? -2.790  11.990  -4.074  1.00 0.00 ? 19 THR A HG21 8  
ATOM 11515 H HG22 . THR A 1 19 ? -2.020  12.270  -5.639  1.00 0.00 ? 19 THR A HG22 8  
ATOM 11516 H HG23 . THR A 1 19 ? -1.066  12.354  -4.160  1.00 0.00 ? 19 THR A HG23 8  
ATOM 11517 N N    . TRP A 1 20 ? -2.184  7.425   -3.985  1.00 0.00 ? 20 TRP A N    8  
ATOM 11518 C CA   . TRP A 1 20 ? -2.024  6.022   -4.411  1.00 0.00 ? 20 TRP A CA   8  
ATOM 11519 C C    . TRP A 1 20 ? -0.974  5.928   -5.538  1.00 0.00 ? 20 TRP A C    8  
ATOM 11520 O O    . TRP A 1 20 ? -0.140  5.034   -5.522  1.00 0.00 ? 20 TRP A O    8  
ATOM 11521 C CB   . TRP A 1 20 ? -3.378  5.397   -4.860  1.00 0.00 ? 20 TRP A CB   8  
ATOM 11522 C CG   . TRP A 1 20 ? -3.262  4.002   -5.454  1.00 0.00 ? 20 TRP A CG   8  
ATOM 11523 C CD1  . TRP A 1 20 ? -3.346  3.669   -6.777  1.00 0.00 ? 20 TRP A CD1  8  
ATOM 11524 C CD2  . TRP A 1 20 ? -3.033  2.767   -4.754  1.00 0.00 ? 20 TRP A CD2  8  
ATOM 11525 N NE1  . TRP A 1 20 ? -3.180  2.321   -6.944  1.00 0.00 ? 20 TRP A NE1  8  
ATOM 11526 C CE2  . TRP A 1 20 ? -2.993  1.742   -5.717  1.00 0.00 ? 20 TRP A CE2  8  
ATOM 11527 C CE3  . TRP A 1 20 ? -2.864  2.432   -3.412  1.00 0.00 ? 20 TRP A CE3  8  
ATOM 11528 C CZ2  . TRP A 1 20 ? -2.782  0.412   -5.376  1.00 0.00 ? 20 TRP A CZ2  8  
ATOM 11529 C CZ3  . TRP A 1 20 ? -2.654  1.111   -3.073  1.00 0.00 ? 20 TRP A CZ3  8  
ATOM 11530 C CH2  . TRP A 1 20 ? -2.618  0.115   -4.051  1.00 0.00 ? 20 TRP A CH2  8  
ATOM 11531 H H    . TRP A 1 20 ? -3.072  7.830   -3.985  1.00 0.00 ? 20 TRP A H    8  
ATOM 11532 H HA   . TRP A 1 20 ? -1.652  5.467   -3.548  1.00 0.00 ? 20 TRP A HA   8  
ATOM 11533 H HB2  . TRP A 1 20 ? -4.037  5.330   -4.006  1.00 0.00 ? 20 TRP A HB2  8  
ATOM 11534 H HB3  . TRP A 1 20 ? -3.839  6.041   -5.602  1.00 0.00 ? 20 TRP A HB3  8  
ATOM 11535 H HD1  . TRP A 1 20 ? -3.514  4.380   -7.572  1.00 0.00 ? 20 TRP A HD1  8  
ATOM 11536 H HE1  . TRP A 1 20 ? -3.193  1.846   -7.803  1.00 0.00 ? 20 TRP A HE1  8  
ATOM 11537 H HE3  . TRP A 1 20 ? -2.888  3.191   -2.644  1.00 0.00 ? 20 TRP A HE3  8  
ATOM 11538 H HZ2  . TRP A 1 20 ? -2.752  -0.371  -6.121  1.00 0.00 ? 20 TRP A HZ2  8  
ATOM 11539 H HZ3  . TRP A 1 20 ? -2.519  0.835   -2.033  1.00 0.00 ? 20 TRP A HZ3  8  
ATOM 11540 H HH2  . TRP A 1 20 ? -2.453  -0.909  -3.740  1.00 0.00 ? 20 TRP A HH2  8  
ATOM 11541 N N    . LYS A 1 21 ? -1.015  6.875   -6.499  1.00 0.00 ? 21 LYS A N    8  
ATOM 11542 C CA   . LYS A 1 21 ? -0.063  6.904   -7.638  1.00 0.00 ? 21 LYS A CA   8  
ATOM 11543 C C    . LYS A 1 21 ? 1.393   7.044   -7.161  1.00 0.00 ? 21 LYS A C    8  
ATOM 11544 O O    . LYS A 1 21 ? 2.267   6.273   -7.589  1.00 0.00 ? 21 LYS A O    8  
ATOM 11545 C CB   . LYS A 1 21 ? -0.411  8.052   -8.621  1.00 0.00 ? 21 LYS A CB   8  
ATOM 11546 C CG   . LYS A 1 21 ? 0.451   8.102   -9.905  1.00 0.00 ? 21 LYS A CG   8  
ATOM 11547 C CD   . LYS A 1 21 ? 0.037   9.228   -10.893 1.00 0.00 ? 21 LYS A CD   8  
ATOM 11548 C CE   . LYS A 1 21 ? -1.342  9.015   -11.557 1.00 0.00 ? 21 LYS A CE   8  
ATOM 11549 N NZ   . LYS A 1 21 ? -2.494  9.204   -10.624 1.00 0.00 ? 21 LYS A NZ   8  
ATOM 11550 H H    . LYS A 1 21 ? -1.716  7.559   -6.456  1.00 0.00 ? 21 LYS A H    8  
ATOM 11551 H HA   . LYS A 1 21 ? -0.168  5.958   -8.164  1.00 0.00 ? 21 LYS A HA   8  
ATOM 11552 H HB2  . LYS A 1 21 ? -1.451  7.948   -8.917  1.00 0.00 ? 21 LYS A HB2  8  
ATOM 11553 H HB3  . LYS A 1 21 ? -0.300  8.999   -8.103  1.00 0.00 ? 21 LYS A HB3  8  
ATOM 11554 H HG2  . LYS A 1 21 ? 1.484   8.262   -9.616  1.00 0.00 ? 21 LYS A HG2  8  
ATOM 11555 H HG3  . LYS A 1 21 ? 0.378   7.145   -10.416 1.00 0.00 ? 21 LYS A HG3  8  
ATOM 11556 H HD2  . LYS A 1 21 ? 0.011   10.170  -10.356 1.00 0.00 ? 21 LYS A HD2  8  
ATOM 11557 H HD3  . LYS A 1 21 ? 0.789   9.297   -11.672 1.00 0.00 ? 21 LYS A HD3  8  
ATOM 11558 H HE2  . LYS A 1 21 ? -1.448  9.716   -12.376 1.00 0.00 ? 21 LYS A HE2  8  
ATOM 11559 H HE3  . LYS A 1 21 ? -1.378  8.007   -11.954 1.00 0.00 ? 21 LYS A HE3  8  
ATOM 11560 H HZ1  . LYS A 1 21 ? -2.411  10.117  -10.129 1.00 0.00 ? 21 LYS A HZ1  8  
ATOM 11561 H HZ2  . LYS A 1 21 ? -2.514  8.440   -9.919  1.00 0.00 ? 21 LYS A HZ2  8  
ATOM 11562 H HZ3  . LYS A 1 21 ? -3.389  9.193   -11.153 1.00 0.00 ? 21 LYS A HZ3  8  
ATOM 11563 N N    . ASP A 1 22 ? 1.637   8.023   -6.269  1.00 0.00 ? 22 ASP A N    8  
ATOM 11564 C CA   . ASP A 1 22 ? 2.976   8.297   -5.713  1.00 0.00 ? 22 ASP A CA   8  
ATOM 11565 C C    . ASP A 1 22 ? 3.455   7.120   -4.856  1.00 0.00 ? 22 ASP A C    8  
ATOM 11566 O O    . ASP A 1 22 ? 4.648   6.772   -4.863  1.00 0.00 ? 22 ASP A O    8  
ATOM 11567 C CB   . ASP A 1 22 ? 2.944   9.589   -4.856  1.00 0.00 ? 22 ASP A CB   8  
ATOM 11568 C CG   . ASP A 1 22 ? 4.344   10.009  -4.367  1.00 0.00 ? 22 ASP A CG   8  
ATOM 11569 O OD1  . ASP A 1 22 ? 5.028   10.767  -5.092  1.00 0.00 ? 22 ASP A OD1  8  
ATOM 11570 O OD2  . ASP A 1 22 ? 4.760   9.596   -3.258  1.00 0.00 ? 22 ASP A OD2  8  
ATOM 11571 H H    . ASP A 1 22 ? 0.909   8.585   -5.935  1.00 0.00 ? 22 ASP A H    8  
ATOM 11572 H HA   . ASP A 1 22 ? 3.660   8.435   -6.545  1.00 0.00 ? 22 ASP A HA   8  
ATOM 11573 H HB2  . ASP A 1 22 ? 2.522   10.396  -5.444  1.00 0.00 ? 22 ASP A HB2  8  
ATOM 11574 H HB3  . ASP A 1 22 ? 2.301   9.432   -3.989  1.00 0.00 ? 22 ASP A HB3  8  
ATOM 11575 N N    . PHE A 1 23 ? 2.501   6.539   -4.105  1.00 0.00 ? 23 PHE A N    8  
ATOM 11576 C CA   . PHE A 1 23 ? 2.706   5.308   -3.334  1.00 0.00 ? 23 PHE A CA   8  
ATOM 11577 C C    . PHE A 1 23 ? 3.277   4.193   -4.221  1.00 0.00 ? 23 PHE A C    8  
ATOM 11578 O O    . PHE A 1 23 ? 4.319   3.621   -3.910  1.00 0.00 ? 23 PHE A O    8  
ATOM 11579 C CB   . PHE A 1 23 ? 1.382   4.842   -2.667  1.00 0.00 ? 23 PHE A CB   8  
ATOM 11580 C CG   . PHE A 1 23 ? 1.478   3.469   -2.004  1.00 0.00 ? 23 PHE A CG   8  
ATOM 11581 C CD1  . PHE A 1 23 ? 2.373   3.247   -0.962  1.00 0.00 ? 23 PHE A CD1  8  
ATOM 11582 C CD2  . PHE A 1 23 ? 0.709   2.396   -2.450  1.00 0.00 ? 23 PHE A CD2  8  
ATOM 11583 C CE1  . PHE A 1 23 ? 2.492   2.003   -0.389  1.00 0.00 ? 23 PHE A CE1  8  
ATOM 11584 C CE2  . PHE A 1 23 ? 0.835   1.149   -1.876  1.00 0.00 ? 23 PHE A CE2  8  
ATOM 11585 C CZ   . PHE A 1 23 ? 1.726   0.954   -0.845  1.00 0.00 ? 23 PHE A CZ   8  
ATOM 11586 H H    . PHE A 1 23 ? 1.634   6.982   -4.049  1.00 0.00 ? 23 PHE A H    8  
ATOM 11587 H HA   . PHE A 1 23 ? 3.420   5.535   -2.552  1.00 0.00 ? 23 PHE A HA   8  
ATOM 11588 H HB2  . PHE A 1 23 ? 1.096   5.559   -1.903  1.00 0.00 ? 23 PHE A HB2  8  
ATOM 11589 H HB3  . PHE A 1 23 ? 0.597   4.811   -3.419  1.00 0.00 ? 23 PHE A HB3  8  
ATOM 11590 H HD1  . PHE A 1 23 ? 2.978   4.068   -0.593  1.00 0.00 ? 23 PHE A HD1  8  
ATOM 11591 H HD2  . PHE A 1 23 ? 0.004   2.547   -3.260  1.00 0.00 ? 23 PHE A HD2  8  
ATOM 11592 H HE1  . PHE A 1 23 ? 3.189   1.847   0.421   1.00 0.00 ? 23 PHE A HE1  8  
ATOM 11593 H HE2  . PHE A 1 23 ? 0.230   0.323   -2.238  1.00 0.00 ? 23 PHE A HE2  8  
ATOM 11594 H HZ   . PHE A 1 23 ? 1.825   -0.024  -0.395  1.00 0.00 ? 23 PHE A HZ   8  
ATOM 11595 N N    . VAL A 1 24 ? 2.594   3.925   -5.339  1.00 0.00 ? 24 VAL A N    8  
ATOM 11596 C CA   . VAL A 1 24 ? 2.972   2.858   -6.273  1.00 0.00 ? 24 VAL A CA   8  
ATOM 11597 C C    . VAL A 1 24 ? 4.380   3.100   -6.835  1.00 0.00 ? 24 VAL A C    8  
ATOM 11598 O O    . VAL A 1 24 ? 5.226   2.211   -6.800  1.00 0.00 ? 24 VAL A O    8  
ATOM 11599 C CB   . VAL A 1 24 ? 1.921   2.740   -7.433  1.00 0.00 ? 24 VAL A CB   8  
ATOM 11600 C CG1  . VAL A 1 24 ? 2.366   1.738   -8.524  1.00 0.00 ? 24 VAL A CG1  8  
ATOM 11601 C CG2  . VAL A 1 24 ? 0.542   2.357   -6.855  1.00 0.00 ? 24 VAL A CG2  8  
ATOM 11602 H H    . VAL A 1 24 ? 1.814   4.476   -5.548  1.00 0.00 ? 24 VAL A H    8  
ATOM 11603 H HA   . VAL A 1 24 ? 2.974   1.923   -5.718  1.00 0.00 ? 24 VAL A HA   8  
ATOM 11604 H HB   . VAL A 1 24 ? 1.825   3.721   -7.901  1.00 0.00 ? 24 VAL A HB   8  
ATOM 11605 H HG11 . VAL A 1 24 ? 3.302   2.065   -8.961  1.00 0.00 ? 24 VAL A HG11 8  
ATOM 11606 H HG12 . VAL A 1 24 ? 1.615   1.688   -9.301  1.00 0.00 ? 24 VAL A HG12 8  
ATOM 11607 H HG13 . VAL A 1 24 ? 2.500   0.756   -8.090  1.00 0.00 ? 24 VAL A HG13 8  
ATOM 11608 H HG21 . VAL A 1 24 ? 0.597   1.379   -6.392  1.00 0.00 ? 24 VAL A HG21 8  
ATOM 11609 H HG22 . VAL A 1 24 ? -0.194  2.336   -7.648  1.00 0.00 ? 24 VAL A HG22 8  
ATOM 11610 H HG23 . VAL A 1 24 ? 0.239   3.081   -6.112  1.00 0.00 ? 24 VAL A HG23 8  
ATOM 11611 N N    . ASN A 1 25 ? 4.620   4.336   -7.283  1.00 0.00 ? 25 ASN A N    8  
ATOM 11612 C CA   . ASN A 1 25 ? 5.859   4.713   -7.976  1.00 0.00 ? 25 ASN A CA   8  
ATOM 11613 C C    . ASN A 1 25 ? 7.092   4.660   -7.052  1.00 0.00 ? 25 ASN A C    8  
ATOM 11614 O O    . ASN A 1 25 ? 8.061   3.949   -7.348  1.00 0.00 ? 25 ASN A O    8  
ATOM 11615 C CB   . ASN A 1 25 ? 5.705   6.112   -8.644  1.00 0.00 ? 25 ASN A CB   8  
ATOM 11616 C CG   . ASN A 1 25 ? 4.828   6.103   -9.921  1.00 0.00 ? 25 ASN A CG   8  
ATOM 11617 O OD1  . ASN A 1 25 ? 5.134   6.790   -10.898 1.00 0.00 ? 25 ASN A OD1  8  
ATOM 11618 N ND2  . ASN A 1 25 ? 3.709   5.381   -9.914  1.00 0.00 ? 25 ASN A ND2  8  
ATOM 11619 H H    . ASN A 1 25 ? 3.937   5.020   -7.136  1.00 0.00 ? 25 ASN A H    8  
ATOM 11620 H HA   . ASN A 1 25 ? 6.012   3.988   -8.767  1.00 0.00 ? 25 ASN A HA   8  
ATOM 11621 H HB2  . ASN A 1 25 ? 5.255   6.796   -7.933  1.00 0.00 ? 25 ASN A HB2  8  
ATOM 11622 H HB3  . ASN A 1 25 ? 6.688   6.493   -8.911  1.00 0.00 ? 25 ASN A HB3  8  
ATOM 11623 H HD21 . ASN A 1 25 ? 3.478   4.887   -9.106  1.00 0.00 ? 25 ASN A HD21 8  
ATOM 11624 H HD22 . ASN A 1 25 ? 3.158   5.371   -10.727 1.00 0.00 ? 25 ASN A HD22 8  
ATOM 11625 N N    . ASN A 1 26 ? 7.049   5.383   -5.932  1.00 0.00 ? 26 ASN A N    8  
ATOM 11626 C CA   . ASN A 1 26 ? 8.226   5.563   -5.058  1.00 0.00 ? 26 ASN A CA   8  
ATOM 11627 C C    . ASN A 1 26 ? 8.392   4.407   -4.056  1.00 0.00 ? 26 ASN A C    8  
ATOM 11628 O O    . ASN A 1 26 ? 9.515   4.117   -3.627  1.00 0.00 ? 26 ASN A O    8  
ATOM 11629 C CB   . ASN A 1 26 ? 8.129   6.911   -4.286  1.00 0.00 ? 26 ASN A CB   8  
ATOM 11630 C CG   . ASN A 1 26 ? 8.047   8.144   -5.190  1.00 0.00 ? 26 ASN A CG   8  
ATOM 11631 O OD1  . ASN A 1 26 ? 8.550   8.153   -6.316  1.00 0.00 ? 26 ASN A OD1  8  
ATOM 11632 N ND2  . ASN A 1 26 ? 7.427   9.194   -4.699  1.00 0.00 ? 26 ASN A ND2  8  
ATOM 11633 H H    . ASN A 1 26 ? 6.209   5.808   -5.661  1.00 0.00 ? 26 ASN A H    8  
ATOM 11634 H HA   . ASN A 1 26 ? 9.111   5.597   -5.691  1.00 0.00 ? 26 ASN A HA   8  
ATOM 11635 H HB2  . ASN A 1 26 ? 7.244   6.899   -3.657  1.00 0.00 ? 26 ASN A HB2  8  
ATOM 11636 H HB3  . ASN A 1 26 ? 9.002   7.023   -3.648  1.00 0.00 ? 26 ASN A HB3  8  
ATOM 11637 H HD21 . ASN A 1 26 ? 7.057   9.133   -3.792  1.00 0.00 ? 26 ASN A HD21 8  
ATOM 11638 H HD22 . ASN A 1 26 ? 7.341   9.989   -5.261  1.00 0.00 ? 26 ASN A HD22 8  
ATOM 11639 N N    . TYR A 1 27 ? 7.283   3.746   -3.671  1.00 0.00 ? 27 TYR A N    8  
ATOM 11640 C CA   . TYR A 1 27 ? 7.270   2.842   -2.500  1.00 0.00 ? 27 TYR A CA   8  
ATOM 11641 C C    . TYR A 1 27 ? 6.958   1.371   -2.883  1.00 0.00 ? 27 TYR A C    8  
ATOM 11642 O O    . TYR A 1 27 ? 7.830   0.491   -2.779  1.00 0.00 ? 27 TYR A O    8  
ATOM 11643 C CB   . TYR A 1 27 ? 6.254   3.373   -1.442  1.00 0.00 ? 27 TYR A CB   8  
ATOM 11644 C CG   . TYR A 1 27 ? 6.540   4.810   -0.971  1.00 0.00 ? 27 TYR A CG   8  
ATOM 11645 C CD1  . TYR A 1 27 ? 7.520   5.065   -0.018  1.00 0.00 ? 27 TYR A CD1  8  
ATOM 11646 C CD2  . TYR A 1 27 ? 5.845   5.905   -1.492  1.00 0.00 ? 27 TYR A CD2  8  
ATOM 11647 C CE1  . TYR A 1 27 ? 7.791   6.350   0.408   1.00 0.00 ? 27 TYR A CE1  8  
ATOM 11648 C CE2  . TYR A 1 27 ? 6.114   7.192   -1.067  1.00 0.00 ? 27 TYR A CE2  8  
ATOM 11649 C CZ   . TYR A 1 27 ? 7.089   7.406   -0.121  1.00 0.00 ? 27 TYR A CZ   8  
ATOM 11650 O OH   . TYR A 1 27 ? 7.353   8.678   0.312   1.00 0.00 ? 27 TYR A OH   8  
ATOM 11651 H H    . TYR A 1 27 ? 6.460   3.858   -4.191  1.00 0.00 ? 27 TYR A H    8  
ATOM 11652 H HA   . TYR A 1 27 ? 8.261   2.861   -2.048  1.00 0.00 ? 27 TYR A HA   8  
ATOM 11653 H HB2  . TYR A 1 27 ? 5.252   3.345   -1.859  1.00 0.00 ? 27 TYR A HB2  8  
ATOM 11654 H HB3  . TYR A 1 27 ? 6.280   2.728   -0.570  1.00 0.00 ? 27 TYR A HB3  8  
ATOM 11655 H HD1  . TYR A 1 27 ? 8.080   4.236   0.399   1.00 0.00 ? 27 TYR A HD1  8  
ATOM 11656 H HD2  . TYR A 1 27 ? 5.087   5.739   -2.240  1.00 0.00 ? 27 TYR A HD2  8  
ATOM 11657 H HE1  . TYR A 1 27 ? 8.552   6.517   1.157   1.00 0.00 ? 27 TYR A HE1  8  
ATOM 11658 H HE2  . TYR A 1 27 ? 5.563   8.026   -1.484  1.00 0.00 ? 27 TYR A HE2  8  
ATOM 11659 H HH   . TYR A 1 27 ? 8.295   8.766   0.474   1.00 0.00 ? 27 TYR A HH   8  
ATOM 11660 N N    . LEU A 1 28 ? 5.707   1.136   -3.305  1.00 0.00 ? 28 LEU A N    8  
ATOM 11661 C CA   . LEU A 1 28 ? 5.142   -0.209  -3.537  1.00 0.00 ? 28 LEU A CA   8  
ATOM 11662 C C    . LEU A 1 28 ? 5.915   -1.017  -4.604  1.00 0.00 ? 28 LEU A C    8  
ATOM 11663 O O    . LEU A 1 28 ? 6.205   -2.201  -4.394  1.00 0.00 ? 28 LEU A O    8  
ATOM 11664 C CB   . LEU A 1 28 ? 3.654   -0.074  -3.940  1.00 0.00 ? 28 LEU A CB   8  
ATOM 11665 C CG   . LEU A 1 28 ? 2.873   -1.401  -4.224  1.00 0.00 ? 28 LEU A CG   8  
ATOM 11666 C CD1  . LEU A 1 28 ? 2.859   -2.342  -2.999  1.00 0.00 ? 28 LEU A CD1  8  
ATOM 11667 C CD2  . LEU A 1 28 ? 1.440   -1.104  -4.706  1.00 0.00 ? 28 LEU A CD2  8  
ATOM 11668 H H    . LEU A 1 28 ? 5.123   1.906   -3.429  1.00 0.00 ? 28 LEU A H    8  
ATOM 11669 H HA   . LEU A 1 28 ? 5.194   -0.744  -2.592  1.00 0.00 ? 28 LEU A HA   8  
ATOM 11670 H HB2  . LEU A 1 28 ? 3.135   0.463   -3.151  1.00 0.00 ? 28 LEU A HB2  8  
ATOM 11671 H HB3  . LEU A 1 28 ? 3.610   0.537   -4.836  1.00 0.00 ? 28 LEU A HB3  8  
ATOM 11672 H HG   . LEU A 1 28 ? 3.381   -1.930  -5.023  1.00 0.00 ? 28 LEU A HG   8  
ATOM 11673 H HD11 . LEU A 1 28 ? 2.388   -1.848  -2.156  1.00 0.00 ? 28 LEU A HD11 8  
ATOM 11674 H HD12 . LEU A 1 28 ? 3.873   -2.608  -2.732  1.00 0.00 ? 28 LEU A HD12 8  
ATOM 11675 H HD13 . LEU A 1 28 ? 2.312   -3.243  -3.237  1.00 0.00 ? 28 LEU A HD13 8  
ATOM 11676 H HD21 . LEU A 1 28 ? 1.478   -0.491  -5.599  1.00 0.00 ? 28 LEU A HD21 8  
ATOM 11677 H HD22 . LEU A 1 28 ? 0.889   -0.576  -3.937  1.00 0.00 ? 28 LEU A HD22 8  
ATOM 11678 H HD23 . LEU A 1 28 ? 0.932   -2.029  -4.939  1.00 0.00 ? 28 LEU A HD23 8  
ATOM 11679 N N    . SER A 1 29 ? 6.247   -0.372  -5.741  1.00 0.00 ? 29 SER A N    8  
ATOM 11680 C CA   . SER A 1 29 ? 6.948   -1.032  -6.872  1.00 0.00 ? 29 SER A CA   8  
ATOM 11681 C C    . SER A 1 29 ? 8.371   -1.498  -6.491  1.00 0.00 ? 29 SER A C    8  
ATOM 11682 O O    . SER A 1 29 ? 8.929   -2.387  -7.138  1.00 0.00 ? 29 SER A O    8  
ATOM 11683 C CB   . SER A 1 29 ? 7.011   -0.070  -8.080  1.00 0.00 ? 29 SER A CB   8  
ATOM 11684 O OG   . SER A 1 29 ? 7.721   1.119   -7.755  1.00 0.00 ? 29 SER A OG   8  
ATOM 11685 H H    . SER A 1 29 ? 5.995   0.571   -5.848  1.00 0.00 ? 29 SER A H    8  
ATOM 11686 H HA   . SER A 1 29 ? 6.363   -1.904  -7.158  1.00 0.00 ? 29 SER A HA   8  
ATOM 11687 H HB2  . SER A 1 29 ? 7.506   -0.551  -8.912  1.00 0.00 ? 29 SER A HB2  8  
ATOM 11688 H HB3  . SER A 1 29 ? 6.006   0.202   -8.375  1.00 0.00 ? 29 SER A HB3  8  
ATOM 11689 H HG   . SER A 1 29 ? 7.098   1.839   -7.595  1.00 0.00 ? 29 SER A HG   8  
ATOM 11690 N N    . LYS A 1 30 ? 8.939   -0.897  -5.435  1.00 0.00 ? 30 LYS A N    8  
ATOM 11691 C CA   . LYS A 1 30 ? 10.301  -1.199  -4.953  1.00 0.00 ? 30 LYS A CA   8  
ATOM 11692 C C    . LYS A 1 30 ? 10.253  -2.164  -3.748  1.00 0.00 ? 30 LYS A C    8  
ATOM 11693 O O    . LYS A 1 30 ? 11.290  -2.684  -3.319  1.00 0.00 ? 30 LYS A O    8  
ATOM 11694 C CB   . LYS A 1 30 ? 11.010  0.113   -4.534  1.00 0.00 ? 30 LYS A CB   8  
ATOM 11695 C CG   . LYS A 1 30 ? 11.136  1.169   -5.656  1.00 0.00 ? 30 LYS A CG   8  
ATOM 11696 C CD   . LYS A 1 30 ? 11.885  2.427   -5.185  1.00 0.00 ? 30 LYS A CD   8  
ATOM 11697 C CE   . LYS A 1 30 ? 12.089  3.458   -6.301  1.00 0.00 ? 30 LYS A CE   8  
ATOM 11698 N NZ   . LYS A 1 30 ? 12.829  4.654   -5.810  1.00 0.00 ? 30 LYS A NZ   8  
ATOM 11699 H H    . LYS A 1 30 ? 8.404   -0.259  -4.921  1.00 0.00 ? 30 LYS A H    8  
ATOM 11700 H HA   . LYS A 1 30 ? 10.863  -1.669  -5.754  1.00 0.00 ? 30 LYS A HA   8  
ATOM 11701 H HB2  . LYS A 1 30 ? 10.455  0.557   -3.711  1.00 0.00 ? 30 LYS A HB2  8  
ATOM 11702 H HB3  . LYS A 1 30 ? 12.008  -0.128  -4.180  1.00 0.00 ? 30 LYS A HB3  8  
ATOM 11703 H HG2  . LYS A 1 30 ? 11.674  0.733   -6.494  1.00 0.00 ? 30 LYS A HG2  8  
ATOM 11704 H HG3  . LYS A 1 30 ? 10.143  1.454   -5.983  1.00 0.00 ? 30 LYS A HG3  8  
ATOM 11705 H HD2  . LYS A 1 30 ? 11.327  2.895   -4.379  1.00 0.00 ? 30 LYS A HD2  8  
ATOM 11706 H HD3  . LYS A 1 30 ? 12.861  2.133   -4.805  1.00 0.00 ? 30 LYS A HD3  8  
ATOM 11707 H HE2  . LYS A 1 30 ? 12.651  3.002   -7.108  1.00 0.00 ? 30 LYS A HE2  8  
ATOM 11708 H HE3  . LYS A 1 30 ? 11.120  3.773   -6.672  1.00 0.00 ? 30 LYS A HE3  8  
ATOM 11709 H HZ1  . LYS A 1 30 ? 13.770  4.374   -5.465  1.00 0.00 ? 30 LYS A HZ1  8  
ATOM 11710 H HZ2  . LYS A 1 30 ? 12.304  5.107   -5.031  1.00 0.00 ? 30 LYS A HZ2  8  
ATOM 11711 H HZ3  . LYS A 1 30 ? 12.947  5.341   -6.578  1.00 0.00 ? 30 LYS A HZ3  8  
ATOM 11712 N N    . GLY A 1 31 ? 9.028   -2.401  -3.238  1.00 0.00 ? 31 GLY A N    8  
ATOM 11713 C CA   . GLY A 1 31 ? 8.805   -3.167  -2.014  1.00 0.00 ? 31 GLY A CA   8  
ATOM 11714 C C    . GLY A 1 31 ? 9.493   -2.608  -0.775  1.00 0.00 ? 31 GLY A C    8  
ATOM 11715 O O    . GLY A 1 31 ? 9.956   -3.375  0.079   1.00 0.00 ? 31 GLY A O    8  
ATOM 11716 H H    . GLY A 1 31 ? 8.253   -2.122  -3.760  1.00 0.00 ? 31 GLY A H    8  
ATOM 11717 H HA2  . GLY A 1 31 ? 7.740   -3.194  -1.824  1.00 0.00 ? 31 GLY A HA2  8  
ATOM 11718 H HA3  . GLY A 1 31 ? 9.142   -4.183  -2.178  1.00 0.00 ? 31 GLY A HA3  8  
ATOM 11719 N N    . VAL A 1 32 ? 9.532   -1.264  -0.653  1.00 0.00 ? 32 VAL A N    8  
ATOM 11720 C CA   . VAL A 1 32 ? 10.073  -0.608  0.560   1.00 0.00 ? 32 VAL A CA   8  
ATOM 11721 C C    . VAL A 1 32 ? 9.019   -0.621  1.679   1.00 0.00 ? 32 VAL A C    8  
ATOM 11722 O O    . VAL A 1 32 ? 9.294   -0.206  2.793   1.00 0.00 ? 32 VAL A O    8  
ATOM 11723 C CB   . VAL A 1 32 ? 10.579  0.869   0.303   1.00 0.00 ? 32 VAL A CB   8  
ATOM 11724 C CG1  . VAL A 1 32 ? 11.530  0.938   -0.911  1.00 0.00 ? 32 VAL A CG1  8  
ATOM 11725 C CG2  . VAL A 1 32 ? 9.418   1.873   0.169   1.00 0.00 ? 32 VAL A CG2  8  
ATOM 11726 H H    . VAL A 1 32 ? 9.168   -0.707  -1.372  1.00 0.00 ? 32 VAL A H    8  
ATOM 11727 H HA   . VAL A 1 32 ? 10.923  -1.194  0.900   1.00 0.00 ? 32 VAL A HA   8  
ATOM 11728 H HB   . VAL A 1 32 ? 11.162  1.167   1.177   1.00 0.00 ? 32 VAL A HB   8  
ATOM 11729 H HG11 . VAL A 1 32 ? 11.891  1.949   -1.040  1.00 0.00 ? 32 VAL A HG11 8  
ATOM 11730 H HG12 . VAL A 1 32 ? 11.003  0.631   -1.806  1.00 0.00 ? 32 VAL A HG12 8  
ATOM 11731 H HG13 . VAL A 1 32 ? 12.373  0.276   -0.752  1.00 0.00 ? 32 VAL A HG13 8  
ATOM 11732 H HG21 . VAL A 1 32 ? 8.842   1.890   1.086   1.00 0.00 ? 32 VAL A HG21 8  
ATOM 11733 H HG22 . VAL A 1 32 ? 8.774   1.579   -0.649  1.00 0.00 ? 32 VAL A HG22 8  
ATOM 11734 H HG23 . VAL A 1 32 ? 9.807   2.865   -0.021  1.00 0.00 ? 32 VAL A HG23 8  
ATOM 11735 N N    . VAL A 1 33 ? 7.816   -1.134  1.357   1.00 0.00 ? 33 VAL A N    8  
ATOM 11736 C CA   . VAL A 1 33 ? 6.660   -1.134  2.257   1.00 0.00 ? 33 VAL A CA   8  
ATOM 11737 C C    . VAL A 1 33 ? 6.531   -2.516  2.919   1.00 0.00 ? 33 VAL A C    8  
ATOM 11738 O O    . VAL A 1 33 ? 6.519   -3.536  2.231   1.00 0.00 ? 33 VAL A O    8  
ATOM 11739 C CB   . VAL A 1 33 ? 5.340   -0.783  1.476   1.00 0.00 ? 33 VAL A CB   8  
ATOM 11740 C CG1  . VAL A 1 33 ? 4.149   -0.534  2.431   1.00 0.00 ? 33 VAL A CG1  8  
ATOM 11741 C CG2  . VAL A 1 33 ? 5.563   0.405   0.525   1.00 0.00 ? 33 VAL A CG2  8  
ATOM 11742 H H    . VAL A 1 33 ? 7.714   -1.557  0.488   1.00 0.00 ? 33 VAL A H    8  
ATOM 11743 H HA   . VAL A 1 33 ? 6.818   -0.375  3.026   1.00 0.00 ? 33 VAL A HA   8  
ATOM 11744 H HB   . VAL A 1 33 ? 5.081   -1.641  0.857   1.00 0.00 ? 33 VAL A HB   8  
ATOM 11745 H HG11 . VAL A 1 33 ? 3.258   -0.307  1.854   1.00 0.00 ? 33 VAL A HG11 8  
ATOM 11746 H HG12 . VAL A 1 33 ? 4.366   0.296   3.089   1.00 0.00 ? 33 VAL A HG12 8  
ATOM 11747 H HG13 . VAL A 1 33 ? 3.968   -1.420  3.024   1.00 0.00 ? 33 VAL A HG13 8  
ATOM 11748 H HG21 . VAL A 1 33 ? 6.358   0.164   -0.171  1.00 0.00 ? 33 VAL A HG21 8  
ATOM 11749 H HG22 . VAL A 1 33 ? 5.841   1.285   1.092   1.00 0.00 ? 33 VAL A HG22 8  
ATOM 11750 H HG23 . VAL A 1 33 ? 4.659   0.607   -0.029  1.00 0.00 ? 33 VAL A HG23 8  
ATOM 11751 N N    . ASP A 1 34 ? 6.437   -2.526  4.252   1.00 0.00 ? 34 ASP A N    8  
ATOM 11752 C CA   . ASP A 1 34 ? 6.381   -3.736  5.089   1.00 0.00 ? 34 ASP A CA   8  
ATOM 11753 C C    . ASP A 1 34 ? 4.936   -4.223  5.223   1.00 0.00 ? 34 ASP A C    8  
ATOM 11754 O O    . ASP A 1 34 ? 4.645   -5.408  5.049   1.00 0.00 ? 34 ASP A O    8  
ATOM 11755 C CB   . ASP A 1 34 ? 6.962   -3.367  6.478   1.00 0.00 ? 34 ASP A CB   8  
ATOM 11756 C CG   . ASP A 1 34 ? 6.919   -4.482  7.526   1.00 0.00 ? 34 ASP A CG   8  
ATOM 11757 O OD1  . ASP A 1 34 ? 7.765   -5.402  7.475   1.00 0.00 ? 34 ASP A OD1  8  
ATOM 11758 O OD2  . ASP A 1 34 ? 6.036   -4.445  8.406   1.00 0.00 ? 34 ASP A OD2  8  
ATOM 11759 H H    . ASP A 1 34 ? 6.370   -1.678  4.711   1.00 0.00 ? 34 ASP A H    8  
ATOM 11760 H HA   . ASP A 1 34 ? 6.995   -4.509  4.633   1.00 0.00 ? 34 ASP A HA   8  
ATOM 11761 H HB2  . ASP A 1 34 ? 7.997   -3.082  6.345   1.00 0.00 ? 34 ASP A HB2  8  
ATOM 11762 H HB3  . ASP A 1 34 ? 6.425   -2.502  6.864   1.00 0.00 ? 34 ASP A HB3  8  
ATOM 11763 N N    . ARG A 1 35 ? 4.050   -3.273  5.546   1.00 0.00 ? 35 ARG A N    8  
ATOM 11764 C CA   . ARG A 1 35 ? 2.613   -3.520  5.737   1.00 0.00 ? 35 ARG A CA   8  
ATOM 11765 C C    . ARG A 1 35 ? 1.830   -2.208  5.564   1.00 0.00 ? 35 ARG A C    8  
ATOM 11766 O O    . ARG A 1 35 ? 2.341   -1.112  5.846   1.00 0.00 ? 35 ARG A O    8  
ATOM 11767 C CB   . ARG A 1 35 ? 2.326   -4.183  7.116   1.00 0.00 ? 35 ARG A CB   8  
ATOM 11768 C CG   . ARG A 1 35 ? 2.764   -3.367  8.353   1.00 0.00 ? 35 ARG A CG   8  
ATOM 11769 C CD   . ARG A 1 35 ? 2.655   -4.163  9.666   1.00 0.00 ? 35 ARG A CD   8  
ATOM 11770 N NE   . ARG A 1 35 ? 3.522   -5.353  9.660   1.00 0.00 ? 35 ARG A NE   8  
ATOM 11771 C CZ   . ARG A 1 35 ? 3.429   -6.405  10.493  1.00 0.00 ? 35 ARG A CZ   8  
ATOM 11772 N NH1  . ARG A 1 35 ? 2.480   -6.467  11.434  1.00 0.00 ? 35 ARG A NH1  8  
ATOM 11773 N NH2  . ARG A 1 35 ? 4.311   -7.397  10.378  1.00 0.00 ? 35 ARG A NH2  8  
ATOM 11774 H H    . ARG A 1 35 ? 4.382   -2.363  5.653   1.00 0.00 ? 35 ARG A H    8  
ATOM 11775 H HA   . ARG A 1 35 ? 2.295   -4.201  4.950   1.00 0.00 ? 35 ARG A HA   8  
ATOM 11776 H HB2  . ARG A 1 35 ? 1.260   -4.375  7.201   1.00 0.00 ? 35 ARG A HB2  8  
ATOM 11777 H HB3  . ARG A 1 35 ? 2.844   -5.135  7.145   1.00 0.00 ? 35 ARG A HB3  8  
ATOM 11778 H HG2  . ARG A 1 35 ? 3.796   -3.061  8.220   1.00 0.00 ? 35 ARG A HG2  8  
ATOM 11779 H HG3  . ARG A 1 35 ? 2.142   -2.480  8.428   1.00 0.00 ? 35 ARG A HG3  8  
ATOM 11780 H HD2  . ARG A 1 35 ? 2.955   -3.519  10.485  1.00 0.00 ? 35 ARG A HD2  8