data_2LP3
# 
_entry.id   2LP3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LP3         
RCSB  RCSB102656   
BMRB  18231        
WWPDB D_1000102656 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
18231 BMRB unspecified . 
2LLS  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LP3 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-01-31 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Budzinska, M.'           1 
'Ruszczynska-Bartnik, K.' 2 
'Belczyk-Ciesielska, A.'  3 
'Bierzynski, A.'          4 
'Ejchart, A.'             5 
# 
_citation.id                        primary 
_citation.title                     
;Impact of calcium binding and thionylation of S100A1 protein on its nuclear magnetic resonance-derived structure and backbone dynamics.
;
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            52 
_citation.page_first                1149 
_citation.page_last                 1159 
_citation.year                      2013 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23351007 
_citation.pdbx_database_id_DOI      10.1021/bi3015407 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nowakowski, M.'          1 
primary 'Ruszczynska-Bartnik, K.' 2 
primary 'Budzinska, M.'           3 
primary 'Jaremko, L.'             4 
primary 'Jaremko, M.'             5 
primary 'Zdanowski, K.'           6 
primary 'Bierzynski, A.'          7 
primary 'Ejchart, A.'             8 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-A1' 10425.588 2 ? ? ? ? 
2 non-polymer syn 'CALCIUM ION'     40.078    4 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S-100 protein alpha chain, S-100 protein subunit alpha, S100 calcium-binding protein A1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA
LTVACNNFFWENS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA
LTVACNNFFWENS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  THR n 
1 7  ALA n 
1 8  MET n 
1 9  GLU n 
1 10 THR n 
1 11 LEU n 
1 12 ILE n 
1 13 ASN n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 ALA n 
1 18 HIS n 
1 19 SER n 
1 20 GLY n 
1 21 LYS n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 TYR n 
1 27 LYS n 
1 28 LEU n 
1 29 SER n 
1 30 LYS n 
1 31 LYS n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 LEU n 
1 38 GLN n 
1 39 THR n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 GLY n 
1 44 PHE n 
1 45 LEU n 
1 46 ASP n 
1 47 ALA n 
1 48 GLN n 
1 49 LYS n 
1 50 ASP n 
1 51 VAL n 
1 52 ASP n 
1 53 ALA n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 LYS n 
1 60 GLU n 
1 61 LEU n 
1 62 ASP n 
1 63 GLU n 
1 64 ASN n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 VAL n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 TYR n 
1 75 VAL n 
1 76 VAL n 
1 77 LEU n 
1 78 VAL n 
1 79 ALA n 
1 80 ALA n 
1 81 LEU n 
1 82 THR n 
1 83 VAL n 
1 84 ALA n 
1 85 CYS n 
1 86 ASN n 
1 87 ASN n 
1 88 PHE n 
1 89 PHE n 
1 90 TRP n 
1 91 GLU n 
1 92 ASN n 
1 93 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S100A1, S100A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET-30a+ 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A1_HUMAN 
_struct_ref.pdbx_db_accession          P23297 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA
LTVACNNFFWENS
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LP3 A 1 ? 93 ? P23297 2 ? 94 ? 1 93 
2 1 2LP3 B 1 ? 93 ? P23297 2 ? 94 ? 1 93 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'              
1 2  1 '2D 1H-15N HSQC NH2 only'     
2 3  2 '2D 1H-13C HSQC aliphatic'    
2 4  2 '2D 1H-13C HSQC aromatic'     
1 5  1 '3D CBCA(CO)NH'               
1 6  1 '3D HNCO'                     
1 7  1 '3D HNCA'                     
1 8  1 '3D HNCACB'                   
1 9  1 '3D HBHA(CO)NH'               
1 10 1 '3D HN(CO)CA'                 
2 11 2 '3D 1H-13C NOESY aliphatic'   
2 12 2 '3D HCCH-TOCSY'               
2 13 2 '3D 1H-13C NOESY aromatic'    
1 14 1 '3D 1H-15N NOESY'             
1 15 3 '2D 1H-15N heteronuclear NOE' 
1 16 3 '2D 1H-15N heteronuclear NOE' 
1 17 3 '2D 1H-15N heteronuclear NOE' 
1 18 3 '2D 1H-15N T1 relaxation'     
1 19 3 '2D 1H-15N T1 relaxation'     
1 20 3 '2D 1H-15N T1 relaxation'     
1 21 3 '2D 1H-15N T2 relaxation'     
1 22 3 '2D 1H-15N T2 relaxation'     
1 23 3 '2D 1H-15N T2 relaxation'     
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 50 7.2 ambient ? 310 K 
2 50 6.8 ambient ? 310 K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 

'10 % D2O, 90 % H2O, 50 mM sodium chloride, 10 mM CALCIUM ION, 0.8 mM [U-99% 13C; U-99% 15N] S100A1, 50 mM TRIS-d11, 90% H2O/10% D2O' 
1 '90% H2O/10% D2O' 
'100 % D2O, 50 mM sodium chloride, 10 mM CALCIUM ION, 0.8 mM [U-99% 13C; U-99% 15N] S100A1, 50 mM TRIS-d11, 100% D2O' 2 '100% D2O' 
'10 % D2O, 90 % H2O, 50 mM sodium chloride, 10 mM CALCIUM ION, 0.8 mM [U-99% 15N] S100A1, 50 mM TRIS-d11, 90% H2O/10% D2O' 3 
'90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
400 Varian INOVA               1 'Varian INOVA'             
500 Varian UNITYPLUS           2 'Varian UnityPlus'         
700 Varian 'Varian NMR System' 3 'Varian Varian NMR System' 
800 Varian 'Varian NMR System' 4 'Varian Varian NMR System' 
# 
_pdbx_nmr_refine.entry_id           2LP3 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            210 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LP3 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LP3 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ? 1 
'Guntert, Mumenthaler and Wuthrich'                 'data analysis'             CYANA      ? 2 
'Guntert, Mumenthaler and Wuthrich'                 'constraints assignment'    CYANA      ? 3 
'Guntert, Mumenthaler and Wuthrich'                 'structure solution'        CYANA      ? 4 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ? 5 
Goddard                                             'chemical shift assignment' SPARKY     ? 6 
Goddard                                             'data analysis'             SPARKY     ? 7 
'Keller and Wuthrich'                               'chemical shift assignment' CARA       ? 8 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LP3 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LP3 
_struct.title                     'Solution structure of S100A1 Ca2+' 
_struct.pdbx_descriptor           'Protein S100-A1' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LP3 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'calcium binding protein, S100 protein family, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 2  ? LYS A 21 ? SER A 2  LYS A 21 1 ? 20 
HELX_P HELX_P2  2  SER A 29 ? LEU A 41 ? SER A 29 LEU A 41 1 ? 13 
HELX_P HELX_P3  3  ASP A 46 ? ASP A 50 ? ASP A 46 ASP A 50 5 ? 5  
HELX_P HELX_P4  4  VAL A 51 ? ASP A 62 ? VAL A 51 ASP A 62 1 ? 12 
HELX_P HELX_P5  5  PHE A 71 ? SER A 93 ? PHE A 71 SER A 93 1 ? 23 
HELX_P HELX_P6  6  SER B 2  ? LYS B 21 ? SER B 2  LYS B 21 1 ? 20 
HELX_P HELX_P7  7  SER B 29 ? LEU B 41 ? SER B 29 LEU B 41 1 ? 13 
HELX_P HELX_P8  8  ASP B 46 ? ASP B 50 ? ASP B 46 ASP B 50 5 ? 5  
HELX_P HELX_P9  9  VAL B 51 ? ASP B 62 ? VAL B 51 ASP B 62 1 ? 12 
HELX_P HELX_P10 10 PHE B 71 ? SER B 93 ? PHE B 71 SER B 93 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 62 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 62 A CA 202 1_555 ? ? ? ? ? ? ? 4.221 ? 
metalc2  metalc ? ? B ASP 62 OD2 ? ? ? 1_555 F CA . CA ? ? B ASP 62 B CA 102 1_555 ? ? ? ? ? ? ? 4.221 ? 
metalc3  metalc ? ? B GLU 73 OE1 ? ? ? 1_555 F CA . CA ? ? B GLU 73 B CA 102 1_555 ? ? ? ? ? ? ? 3.169 ? 
metalc4  metalc ? ? A GLU 73 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 73 A CA 202 1_555 ? ? ? ? ? ? ? 3.168 ? 
metalc5  metalc ? ? A ASP 66 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 202 1_555 ? ? ? ? ? ? ? 2.309 ? 
metalc6  metalc ? ? B ASP 66 OD2 ? ? ? 1_555 F CA . CA ? ? B ASP 66 B CA 102 1_555 ? ? ? ? ? ? ? 2.308 ? 
metalc7  metalc ? ? A SER 19 O   ? ? ? 1_555 C CA . CA ? ? A SER 19 A CA 201 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc8  metalc ? ? B SER 19 O   ? ? ? 1_555 E CA . CA ? ? B SER 19 B CA 101 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc9  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 32 A CA 201 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc10 metalc ? ? B GLU 32 OE2 ? ? ? 1_555 E CA . CA ? ? B GLU 32 B CA 101 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc11 metalc ? ? A GLU 22 O   ? ? ? 1_555 C CA . CA ? ? A GLU 22 A CA 201 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc12 metalc ? ? B GLU 22 O   ? ? ? 1_555 E CA . CA ? ? B GLU 22 B CA 101 1_555 ? ? ? ? ? ? ? 2.483 ? 
metalc13 metalc ? ? B LYS 27 O   ? ? ? 1_555 E CA . CA ? ? B LYS 27 B CA 101 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc14 metalc ? ? A LYS 27 O   ? ? ? 1_555 C CA . CA ? ? A LYS 27 A CA 201 1_555 ? ? ? ? ? ? ? 2.519 ? 
metalc15 metalc ? ? A ASP 24 O   ? ? ? 1_555 C CA . CA ? ? A ASP 24 A CA 201 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc16 metalc ? ? B ASP 24 O   ? ? ? 1_555 E CA . CA ? ? B ASP 24 B CA 101 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc17 metalc ? ? B ASN 64 OD1 ? ? ? 1_555 F CA . CA ? ? B ASN 64 B CA 102 1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc18 metalc ? ? A ASN 64 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 64 A CA 202 1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc19 metalc ? ? A GLU 68 O   ? ? ? 1_555 D CA . CA ? ? A GLU 68 A CA 202 1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc20 metalc ? ? B GLU 68 O   ? ? ? 1_555 F CA . CA ? ? B GLU 68 B CA 102 1_555 ? ? ? ? ? ? ? 2.537 ? 
metalc21 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 73 A CA 202 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc22 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 F CA . CA ? ? B GLU 73 B CA 102 1_555 ? ? ? ? ? ? ? 2.313 ? 
metalc23 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 62 A CA 202 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc24 metalc ? ? B ASP 62 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 62 B CA 102 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc25 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 32 A CA 201 1_555 ? ? ? ? ? ? ? 2.391 ? 
metalc26 metalc ? ? B GLU 32 OE1 ? ? ? 1_555 E CA . CA ? ? B GLU 32 B CA 101 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc27 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 202 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc28 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 66 B CA 102 1_555 ? ? ? ? ? ? ? 2.869 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LYS A 27 ? LEU A 28 ? LYS A 27 LEU A 28 
A 2 VAL A 69 ? ASP A 70 ? VAL A 69 ASP A 70 
B 1 LYS B 27 ? LEU B 28 ? LYS B 27 LEU B 28 
B 2 VAL B 69 ? ASP B 70 ? VAL B 69 ASP B 70 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 28 ? N LEU A 28 O VAL A 69 ? O VAL A 69 
B 1 2 N LEU B 28 ? N LEU B 28 O VAL B 69 ? O VAL B 69 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 201' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 202' 
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 101' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 SER A 19 ? SER A 19 . ? 1_555 ? 
2  AC1 5 GLU A 22 ? GLU A 22 . ? 1_555 ? 
3  AC1 5 ASP A 24 ? ASP A 24 . ? 1_555 ? 
4  AC1 5 LYS A 27 ? LYS A 27 . ? 1_555 ? 
5  AC1 5 GLU A 32 ? GLU A 32 . ? 1_555 ? 
6  AC2 5 ASP A 62 ? ASP A 62 . ? 1_555 ? 
7  AC2 5 ASN A 64 ? ASN A 64 . ? 1_555 ? 
8  AC2 5 ASP A 66 ? ASP A 66 . ? 1_555 ? 
9  AC2 5 GLU A 68 ? GLU A 68 . ? 1_555 ? 
10 AC2 5 GLU A 73 ? GLU A 73 . ? 1_555 ? 
11 AC3 5 SER B 19 ? SER B 19 . ? 1_555 ? 
12 AC3 5 GLU B 22 ? GLU B 22 . ? 1_555 ? 
13 AC3 5 ASP B 24 ? ASP B 24 . ? 1_555 ? 
14 AC3 5 LYS B 27 ? LYS B 27 . ? 1_555 ? 
15 AC3 5 GLU B 32 ? GLU B 32 . ? 1_555 ? 
16 AC4 5 ASP B 62 ? ASP B 62 . ? 1_555 ? 
17 AC4 5 ASN B 64 ? ASN B 64 . ? 1_555 ? 
18 AC4 5 ASP B 66 ? ASP B 66 . ? 1_555 ? 
19 AC4 5 GLU B 68 ? GLU B 68 . ? 1_555 ? 
20 AC4 5 GLU B 73 ? GLU B 73 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2LP3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 153.979 -0.023  -13.987 1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 153.421 -1.135  -14.747 1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 153.060 -2.298  -13.828 1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 152.515 -3.307  -14.273 1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 153.839 0.898   -14.292 1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? 152.533 -0.802  -15.264 1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? 154.148 -1.472  -15.471 1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? 153.368 -2.147  -12.544 1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? 153.070 -3.191  -11.570 1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? 151.567 -3.304  -11.349 1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? 150.812 -2.393  -11.687 1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? 153.758 -2.879  -10.247 1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? 153.078 -1.807  -9.605  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? 153.802 -1.320  -12.246 1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? 153.442 -4.134  -11.942 1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? 153.731 -3.747  -9.610  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? 154.788 -2.604  -10.434 1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? 152.187 -2.101  -9.402  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . GLU A 1 3  ? 151.135 -4.431  -10.791 1.00 0.00 ? 3   GLU A N    1  
ATOM   20    C  CA   . GLU A 1 3  ? 149.715 -4.645  -10.549 1.00 0.00 ? 3   GLU A CA   1  
ATOM   21    C  C    . GLU A 1 3  ? 149.170 -3.601  -9.575  1.00 0.00 ? 3   GLU A C    1  
ATOM   22    O  O    . GLU A 1 3  ? 148.024 -3.161  -9.696  1.00 0.00 ? 3   GLU A O    1  
ATOM   23    C  CB   . GLU A 1 3  ? 149.488 -6.036  -9.953  1.00 0.00 ? 3   GLU A CB   1  
ATOM   24    C  CG   . GLU A 1 3  ? 149.956 -7.112  -10.933 1.00 0.00 ? 3   GLU A CG   1  
ATOM   25    C  CD   . GLU A 1 3  ? 149.632 -8.495  -10.377 1.00 0.00 ? 3   GLU A CD   1  
ATOM   26    O  OE1  . GLU A 1 3  ? 149.232 -8.571  -9.227  1.00 0.00 ? 3   GLU A OE1  1  
ATOM   27    O  OE2  . GLU A 1 3  ? 149.789 -9.458  -11.110 1.00 0.00 ? 3   GLU A OE2  1  
ATOM   28    H  H    . GLU A 1 3  ? 151.779 -5.130  -10.549 1.00 0.00 ? 3   GLU A H    1  
ATOM   29    H  HA   . GLU A 1 3  ? 149.180 -4.573  -11.483 1.00 0.00 ? 3   GLU A HA   1  
ATOM   30    H  HB2  . GLU A 1 3  ? 150.042 -6.125  -9.033  1.00 0.00 ? 3   GLU A HB2  1  
ATOM   31    H  HB3  . GLU A 1 3  ? 148.437 -6.170  -9.754  1.00 0.00 ? 3   GLU A HB3  1  
ATOM   32    H  HG2  . GLU A 1 3  ? 149.461 -6.978  -11.883 1.00 0.00 ? 3   GLU A HG2  1  
ATOM   33    H  HG3  . GLU A 1 3  ? 151.025 -7.029  -11.064 1.00 0.00 ? 3   GLU A HG3  1  
ATOM   34    N  N    . LEU A 1 4  ? 149.994 -3.212  -8.603  1.00 0.00 ? 4   LEU A N    1  
ATOM   35    C  CA   . LEU A 1 4  ? 149.571 -2.225  -7.613  1.00 0.00 ? 4   LEU A CA   1  
ATOM   36    C  C    . LEU A 1 4  ? 149.171 -0.919  -8.288  1.00 0.00 ? 4   LEU A C    1  
ATOM   37    O  O    . LEU A 1 4  ? 148.194 -0.276  -7.885  1.00 0.00 ? 4   LEU A O    1  
ATOM   38    C  CB   . LEU A 1 4  ? 150.707 -1.963  -6.618  1.00 0.00 ? 4   LEU A CB   1  
ATOM   39    C  CG   . LEU A 1 4  ? 150.235 -0.994  -5.523  1.00 0.00 ? 4   LEU A CG   1  
ATOM   40    C  CD1  . LEU A 1 4  ? 149.230 -1.695  -4.606  1.00 0.00 ? 4   LEU A CD1  1  
ATOM   41    C  CD2  . LEU A 1 4  ? 151.440 -0.535  -4.695  1.00 0.00 ? 4   LEU A CD2  1  
ATOM   42    H  H    . LEU A 1 4  ? 150.893 -3.596  -8.549  1.00 0.00 ? 4   LEU A H    1  
ATOM   43    H  HA   . LEU A 1 4  ? 148.721 -2.614  -7.075  1.00 0.00 ? 4   LEU A HA   1  
ATOM   44    H  HB2  . LEU A 1 4  ? 151.012 -2.897  -6.168  1.00 0.00 ? 4   LEU A HB2  1  
ATOM   45    H  HB3  . LEU A 1 4  ? 151.542 -1.530  -7.141  1.00 0.00 ? 4   LEU A HB3  1  
ATOM   46    H  HG   . LEU A 1 4  ? 149.766 -0.135  -5.977  1.00 0.00 ? 4   LEU A HG   1  
ATOM   47    H  HD11 . LEU A 1 4  ? 148.246 -1.637  -5.047  1.00 0.00 ? 4   LEU A HD11 1  
ATOM   48    H  HD12 . LEU A 1 4  ? 149.222 -1.207  -3.643  1.00 0.00 ? 4   LEU A HD12 1  
ATOM   49    H  HD13 . LEU A 1 4  ? 149.509 -2.730  -4.482  1.00 0.00 ? 4   LEU A HD13 1  
ATOM   50    H  HD21 . LEU A 1 4  ? 152.249 -0.261  -5.355  1.00 0.00 ? 4   LEU A HD21 1  
ATOM   51    H  HD22 . LEU A 1 4  ? 151.760 -1.338  -4.045  1.00 0.00 ? 4   LEU A HD22 1  
ATOM   52    H  HD23 . LEU A 1 4  ? 151.159 0.318   -4.096  1.00 0.00 ? 4   LEU A HD23 1  
ATOM   53    N  N    . GLU A 1 5  ? 149.917 -0.525  -9.316  1.00 0.00 ? 5   GLU A N    1  
ATOM   54    C  CA   . GLU A 1 5  ? 149.593 0.709   -10.009 1.00 0.00 ? 5   GLU A CA   1  
ATOM   55    C  C    . GLU A 1 5  ? 148.187 0.611   -10.566 1.00 0.00 ? 5   GLU A C    1  
ATOM   56    O  O    . GLU A 1 5  ? 147.402 1.557   -10.486 1.00 0.00 ? 5   GLU A O    1  
ATOM   57    C  CB   . GLU A 1 5  ? 150.587 0.951   -11.148 1.00 0.00 ? 5   GLU A CB   1  
ATOM   58    C  CG   . GLU A 1 5  ? 150.319 2.319   -11.777 1.00 0.00 ? 5   GLU A CG   1  
ATOM   59    C  CD   . GLU A 1 5  ? 151.236 2.531   -12.977 1.00 0.00 ? 5   GLU A CD   1  
ATOM   60    O  OE1  . GLU A 1 5  ? 152.000 1.629   -13.278 1.00 0.00 ? 5   GLU A OE1  1  
ATOM   61    O  OE2  . GLU A 1 5  ? 151.161 3.590   -13.575 1.00 0.00 ? 5   GLU A OE2  1  
ATOM   62    H  H    . GLU A 1 5  ? 150.682 -1.067  -9.607  1.00 0.00 ? 5   GLU A H    1  
ATOM   63    H  HA   . GLU A 1 5  ? 149.646 1.527   -9.314  1.00 0.00 ? 5   GLU A HA   1  
ATOM   64    H  HB2  . GLU A 1 5  ? 151.595 0.925   -10.757 1.00 0.00 ? 5   GLU A HB2  1  
ATOM   65    H  HB3  . GLU A 1 5  ? 150.470 0.184   -11.897 1.00 0.00 ? 5   GLU A HB3  1  
ATOM   66    H  HG2  . GLU A 1 5  ? 149.289 2.369   -12.099 1.00 0.00 ? 5   GLU A HG2  1  
ATOM   67    H  HG3  . GLU A 1 5  ? 150.503 3.093   -11.045 1.00 0.00 ? 5   GLU A HG3  1  
ATOM   68    N  N    . THR A 1 6  ? 147.863 -0.561  -11.095 1.00 0.00 ? 6   THR A N    1  
ATOM   69    C  CA   . THR A 1 6  ? 146.535 -0.805  -11.622 1.00 0.00 ? 6   THR A CA   1  
ATOM   70    C  C    . THR A 1 6  ? 145.507 -0.757  -10.499 1.00 0.00 ? 6   THR A C    1  
ATOM   71    O  O    . THR A 1 6  ? 144.391 -0.267  -10.678 1.00 0.00 ? 6   THR A O    1  
ATOM   72    C  CB   . THR A 1 6  ? 146.485 -2.175  -12.305 1.00 0.00 ? 6   THR A CB   1  
ATOM   73    O  OG1  . THR A 1 6  ? 147.504 -2.246  -13.293 1.00 0.00 ? 6   THR A OG1  1  
ATOM   74    C  CG2  . THR A 1 6  ? 145.118 -2.369  -12.964 1.00 0.00 ? 6   THR A CG2  1  
ATOM   75    H  H    . THR A 1 6  ? 148.524 -1.286  -11.100 1.00 0.00 ? 6   THR A H    1  
ATOM   76    H  HA   . THR A 1 6  ? 146.299 -0.044  -12.349 1.00 0.00 ? 6   THR A HA   1  
ATOM   77    H  HB   . THR A 1 6  ? 146.638 -2.950  -11.571 1.00 0.00 ? 6   THR A HB   1  
ATOM   78    H  HG1  . THR A 1 6  ? 147.656 -1.359  -13.626 1.00 0.00 ? 6   THR A HG1  1  
ATOM   79    H  HG21 . THR A 1 6  ? 144.843 -1.470  -13.496 1.00 0.00 ? 6   THR A HG21 1  
ATOM   80    H  HG22 . THR A 1 6  ? 144.379 -2.577  -12.205 1.00 0.00 ? 6   THR A HG22 1  
ATOM   81    H  HG23 . THR A 1 6  ? 145.166 -3.195  -13.656 1.00 0.00 ? 6   THR A HG23 1  
ATOM   82    N  N    . ALA A 1 7  ? 145.889 -1.305  -9.345  1.00 0.00 ? 7   ALA A N    1  
ATOM   83    C  CA   . ALA A 1 7  ? 144.985 -1.359  -8.202  1.00 0.00 ? 7   ALA A CA   1  
ATOM   84    C  C    . ALA A 1 7  ? 144.605 0.030   -7.684  1.00 0.00 ? 7   ALA A C    1  
ATOM   85    O  O    . ALA A 1 7  ? 143.428 0.282   -7.411  1.00 0.00 ? 7   ALA A O    1  
ATOM   86    C  CB   . ALA A 1 7  ? 145.628 -2.171  -7.073  1.00 0.00 ? 7   ALA A CB   1  
ATOM   87    H  H    . ALA A 1 7  ? 146.783 -1.705  -9.272  1.00 0.00 ? 7   ALA A H    1  
ATOM   88    H  HA   . ALA A 1 7  ? 144.081 -1.865  -8.508  1.00 0.00 ? 7   ALA A HA   1  
ATOM   89    H  HB1  . ALA A 1 7  ? 145.718 -3.207  -7.378  1.00 0.00 ? 7   ALA A HB1  1  
ATOM   90    H  HB2  . ALA A 1 7  ? 145.010 -2.110  -6.189  1.00 0.00 ? 7   ALA A HB2  1  
ATOM   91    H  HB3  . ALA A 1 7  ? 146.607 -1.773  -6.855  1.00 0.00 ? 7   ALA A HB3  1  
ATOM   92    N  N    . MET A 1 8  ? 145.572 0.947   -7.551  1.00 0.00 ? 8   MET A N    1  
ATOM   93    C  CA   . MET A 1 8  ? 145.214 2.273   -7.051  1.00 0.00 ? 8   MET A CA   1  
ATOM   94    C  C    . MET A 1 8  ? 144.171 2.864   -7.972  1.00 0.00 ? 8   MET A C    1  
ATOM   95    O  O    . MET A 1 8  ? 143.200 3.480   -7.531  1.00 0.00 ? 8   MET A O    1  
ATOM   96    C  CB   . MET A 1 8  ? 146.407 3.234   -7.057  1.00 0.00 ? 8   MET A CB   1  
ATOM   97    C  CG   . MET A 1 8  ? 147.507 2.761   -6.112  1.00 0.00 ? 8   MET A CG   1  
ATOM   98    S  SD   . MET A 1 8  ? 148.733 4.087   -5.942  1.00 0.00 ? 8   MET A SD   1  
ATOM   99    C  CE   . MET A 1 8  ? 149.092 4.334   -7.702  1.00 0.00 ? 8   MET A CE   1  
ATOM   100   H  H    . MET A 1 8  ? 146.501 0.729   -7.771  1.00 0.00 ? 8   MET A H    1  
ATOM   101   H  HA   . MET A 1 8  ? 144.817 2.193   -6.051  1.00 0.00 ? 8   MET A HA   1  
ATOM   102   H  HB2  . MET A 1 8  ? 146.803 3.294   -8.059  1.00 0.00 ? 8   MET A HB2  1  
ATOM   103   H  HB3  . MET A 1 8  ? 146.072 4.213   -6.750  1.00 0.00 ? 8   MET A HB3  1  
ATOM   104   H  HG2  . MET A 1 8  ? 147.083 2.529   -5.147  1.00 0.00 ? 8   MET A HG2  1  
ATOM   105   H  HG3  . MET A 1 8  ? 147.981 1.881   -6.520  1.00 0.00 ? 8   MET A HG3  1  
ATOM   106   H  HE1  . MET A 1 8  ? 149.081 3.382   -8.208  1.00 0.00 ? 8   MET A HE1  1  
ATOM   107   H  HE2  . MET A 1 8  ? 150.064 4.793   -7.816  1.00 0.00 ? 8   MET A HE2  1  
ATOM   108   H  HE3  . MET A 1 8  ? 148.340 4.983   -8.134  1.00 0.00 ? 8   MET A HE3  1  
ATOM   109   N  N    . GLU A 1 9  ? 144.374 2.641   -9.262  1.00 0.00 ? 9   GLU A N    1  
ATOM   110   C  CA   . GLU A 1 9  ? 143.445 3.120   -10.260 1.00 0.00 ? 9   GLU A CA   1  
ATOM   111   C  C    . GLU A 1 9  ? 142.116 2.399   -10.129 1.00 0.00 ? 9   GLU A C    1  
ATOM   112   O  O    . GLU A 1 9  ? 141.059 2.986   -10.336 1.00 0.00 ? 9   GLU A O    1  
ATOM   113   C  CB   . GLU A 1 9  ? 144.035 2.900   -11.651 1.00 0.00 ? 9   GLU A CB   1  
ATOM   114   C  CG   . GLU A 1 9  ? 145.267 3.786   -11.826 1.00 0.00 ? 9   GLU A CG   1  
ATOM   115   C  CD   . GLU A 1 9  ? 145.832 3.625   -13.233 1.00 0.00 ? 9   GLU A CD   1  
ATOM   116   O  OE1  . GLU A 1 9  ? 145.372 2.741   -13.937 1.00 0.00 ? 9   GLU A OE1  1  
ATOM   117   O  OE2  . GLU A 1 9  ? 146.717 4.386   -13.584 1.00 0.00 ? 9   GLU A OE2  1  
ATOM   118   H  H    . GLU A 1 9  ? 145.158 2.125   -9.543  1.00 0.00 ? 9   GLU A H    1  
ATOM   119   H  HA   . GLU A 1 9  ? 143.286 4.177   -10.112 1.00 0.00 ? 9   GLU A HA   1  
ATOM   120   H  HB2  . GLU A 1 9  ? 144.326 1.866   -11.757 1.00 0.00 ? 9   GLU A HB2  1  
ATOM   121   H  HB3  . GLU A 1 9  ? 143.303 3.152   -12.401 1.00 0.00 ? 9   GLU A HB3  1  
ATOM   122   H  HG2  . GLU A 1 9  ? 144.989 4.817   -11.666 1.00 0.00 ? 9   GLU A HG2  1  
ATOM   123   H  HG3  . GLU A 1 9  ? 146.016 3.500   -11.103 1.00 0.00 ? 9   GLU A HG3  1  
ATOM   124   N  N    . THR A 1 10 ? 142.180 1.114   -9.785  1.00 0.00 ? 10  THR A N    1  
ATOM   125   C  CA   . THR A 1 10 ? 140.968 0.322   -9.631  1.00 0.00 ? 10  THR A CA   1  
ATOM   126   C  C    . THR A 1 10 ? 140.072 0.886   -8.536  1.00 0.00 ? 10  THR A C    1  
ATOM   127   O  O    . THR A 1 10 ? 138.851 0.973   -8.702  1.00 0.00 ? 10  THR A O    1  
ATOM   128   C  CB   . THR A 1 10 ? 141.340 -1.122  -9.286  1.00 0.00 ? 10  THR A CB   1  
ATOM   129   O  OG1  . THR A 1 10 ? 142.226 -1.630  -10.273 1.00 0.00 ? 10  THR A OG1  1  
ATOM   130   C  CG2  . THR A 1 10 ? 140.076 -1.983  -9.239  1.00 0.00 ? 10  THR A CG2  1  
ATOM   131   H  H    . THR A 1 10 ? 143.054 0.697   -9.635  1.00 0.00 ? 10  THR A H    1  
ATOM   132   H  HA   . THR A 1 10 ? 140.428 0.322   -10.562 1.00 0.00 ? 10  THR A HA   1  
ATOM   133   H  HB   . THR A 1 10 ? 141.823 -1.148  -8.322  1.00 0.00 ? 10  THR A HB   1  
ATOM   134   H  HG1  . THR A 1 10 ? 142.073 -1.145  -11.088 1.00 0.00 ? 10  THR A HG1  1  
ATOM   135   H  HG21 . THR A 1 10 ? 140.319 -2.993  -9.535  1.00 0.00 ? 10  THR A HG21 1  
ATOM   136   H  HG22 . THR A 1 10 ? 139.336 -1.578  -9.914  1.00 0.00 ? 10  THR A HG22 1  
ATOM   137   H  HG23 . THR A 1 10 ? 139.682 -1.988  -8.234  1.00 0.00 ? 10  THR A HG23 1  
ATOM   138   N  N    . LEU A 1 11 ? 140.679 1.264   -7.414  1.00 0.00 ? 11  LEU A N    1  
ATOM   139   C  CA   . LEU A 1 11 ? 139.903 1.806   -6.303  1.00 0.00 ? 11  LEU A CA   1  
ATOM   140   C  C    . LEU A 1 11 ? 139.158 3.074   -6.720  1.00 0.00 ? 11  LEU A C    1  
ATOM   141   O  O    . LEU A 1 11 ? 137.961 3.240   -6.447  1.00 0.00 ? 11  LEU A O    1  
ATOM   142   C  CB   . LEU A 1 11 ? 140.867 2.141   -5.162  1.00 0.00 ? 11  LEU A CB   1  
ATOM   143   C  CG   . LEU A 1 11 ? 141.629 0.877   -4.757  1.00 0.00 ? 11  LEU A CG   1  
ATOM   144   C  CD1  . LEU A 1 11 ? 142.668 1.214   -3.682  1.00 0.00 ? 11  LEU A CD1  1  
ATOM   145   C  CD2  . LEU A 1 11 ? 140.642 -0.159  -4.212  1.00 0.00 ? 11  LEU A CD2  1  
ATOM   146   H  H    . LEU A 1 11 ? 141.659 1.165   -7.331  1.00 0.00 ? 11  LEU A H    1  
ATOM   147   H  HA   . LEU A 1 11 ? 139.194 1.068   -5.961  1.00 0.00 ? 11  LEU A HA   1  
ATOM   148   H  HB2  . LEU A 1 11 ? 141.567 2.896   -5.493  1.00 0.00 ? 11  LEU A HB2  1  
ATOM   149   H  HB3  . LEU A 1 11 ? 140.309 2.511   -4.315  1.00 0.00 ? 11  LEU A HB3  1  
ATOM   150   H  HG   . LEU A 1 11 ? 142.129 0.472   -5.619  1.00 0.00 ? 11  LEU A HG   1  
ATOM   151   H  HD11 . LEU A 1 11 ? 142.323 2.050   -3.092  1.00 0.00 ? 11  LEU A HD11 1  
ATOM   152   H  HD12 . LEU A 1 11 ? 143.605 1.472   -4.162  1.00 0.00 ? 11  LEU A HD12 1  
ATOM   153   H  HD13 . LEU A 1 11 ? 142.820 0.357   -3.041  1.00 0.00 ? 11  LEU A HD13 1  
ATOM   154   H  HD21 . LEU A 1 11 ? 139.840 0.344   -3.692  1.00 0.00 ? 11  LEU A HD21 1  
ATOM   155   H  HD22 . LEU A 1 11 ? 141.154 -0.822  -3.529  1.00 0.00 ? 11  LEU A HD22 1  
ATOM   156   H  HD23 . LEU A 1 11 ? 140.236 -0.732  -5.032  1.00 0.00 ? 11  LEU A HD23 1  
ATOM   157   N  N    . ILE A 1 12 ? 139.867 3.957   -7.408  1.00 0.00 ? 12  ILE A N    1  
ATOM   158   C  CA   . ILE A 1 12 ? 139.265 5.191   -7.878  1.00 0.00 ? 12  ILE A CA   1  
ATOM   159   C  C    . ILE A 1 12 ? 138.231 4.915   -8.961  1.00 0.00 ? 12  ILE A C    1  
ATOM   160   O  O    . ILE A 1 12 ? 137.165 5.528   -8.986  1.00 0.00 ? 12  ILE A O    1  
ATOM   161   C  CB   . ILE A 1 12 ? 140.354 6.131   -8.391  1.00 0.00 ? 12  ILE A CB   1  
ATOM   162   C  CG1  . ILE A 1 12 ? 141.333 6.412   -7.246  1.00 0.00 ? 12  ILE A CG1  1  
ATOM   163   C  CG2  . ILE A 1 12 ? 139.722 7.443   -8.862  1.00 0.00 ? 12  ILE A CG2  1  
ATOM   164   C  CD1  . ILE A 1 12 ? 142.508 7.248   -7.751  1.00 0.00 ? 12  ILE A CD1  1  
ATOM   165   H  H    . ILE A 1 12 ? 140.808 3.768   -7.613  1.00 0.00 ? 12  ILE A H    1  
ATOM   166   H  HA   . ILE A 1 12 ? 138.769 5.666   -7.046  1.00 0.00 ? 12  ILE A HA   1  
ATOM   167   H  HB   . ILE A 1 12 ? 140.879 5.665   -9.212  1.00 0.00 ? 12  ILE A HB   1  
ATOM   168   H  HG12 . ILE A 1 12 ? 140.820 6.952   -6.462  1.00 0.00 ? 12  ILE A HG12 1  
ATOM   169   H  HG13 . ILE A 1 12 ? 141.702 5.476   -6.853  1.00 0.00 ? 12  ILE A HG13 1  
ATOM   170   H  HG21 . ILE A 1 12 ? 139.208 7.278   -9.798  1.00 0.00 ? 12  ILE A HG21 1  
ATOM   171   H  HG22 . ILE A 1 12 ? 140.494 8.184   -9.001  1.00 0.00 ? 12  ILE A HG22 1  
ATOM   172   H  HG23 . ILE A 1 12 ? 139.018 7.790   -8.121  1.00 0.00 ? 12  ILE A HG23 1  
ATOM   173   H  HD11 . ILE A 1 12 ? 142.160 8.234   -8.018  1.00 0.00 ? 12  ILE A HD11 1  
ATOM   174   H  HD12 . ILE A 1 12 ? 142.943 6.771   -8.617  1.00 0.00 ? 12  ILE A HD12 1  
ATOM   175   H  HD13 . ILE A 1 12 ? 143.251 7.327   -6.970  1.00 0.00 ? 12  ILE A HD13 1  
ATOM   176   N  N    . ASN A 1 13 ? 138.562 3.994   -9.862  1.00 0.00 ? 13  ASN A N    1  
ATOM   177   C  CA   . ASN A 1 13 ? 137.656 3.654   -10.950 1.00 0.00 ? 13  ASN A CA   1  
ATOM   178   C  C    . ASN A 1 13 ? 136.328 3.126   -10.425 1.00 0.00 ? 13  ASN A C    1  
ATOM   179   O  O    . ASN A 1 13 ? 135.271 3.481   -10.947 1.00 0.00 ? 13  ASN A O    1  
ATOM   180   C  CB   . ASN A 1 13 ? 138.313 2.617   -11.862 1.00 0.00 ? 13  ASN A CB   1  
ATOM   181   C  CG   . ASN A 1 13 ? 139.575 3.208   -12.486 1.00 0.00 ? 13  ASN A CG   1  
ATOM   182   O  OD1  . ASN A 1 13 ? 139.586 4.378   -12.869 1.00 0.00 ? 13  ASN A OD1  1  
ATOM   183   N  ND2  . ASN A 1 13 ? 140.652 2.476   -12.598 1.00 0.00 ? 13  ASN A ND2  1  
ATOM   184   H  H    . ASN A 1 13 ? 139.429 3.542   -9.797  1.00 0.00 ? 13  ASN A H    1  
ATOM   185   H  HA   . ASN A 1 13 ? 137.467 4.545   -11.529 1.00 0.00 ? 13  ASN A HA   1  
ATOM   186   H  HB2  . ASN A 1 13 ? 138.571 1.741   -11.283 1.00 0.00 ? 13  ASN A HB2  1  
ATOM   187   H  HB3  . ASN A 1 13 ? 137.621 2.340   -12.644 1.00 0.00 ? 13  ASN A HB3  1  
ATOM   188   H  HD21 . ASN A 1 13 ? 140.651 1.549   -12.281 1.00 0.00 ? 13  ASN A HD21 1  
ATOM   189   H  HD22 . ASN A 1 13 ? 141.461 2.855   -13.000 1.00 0.00 ? 13  ASN A HD22 1  
ATOM   190   N  N    . VAL A 1 14 ? 136.366 2.299   -9.379  1.00 0.00 ? 14  VAL A N    1  
ATOM   191   C  CA   . VAL A 1 14 ? 135.119 1.791   -8.822  1.00 0.00 ? 14  VAL A CA   1  
ATOM   192   C  C    . VAL A 1 14 ? 134.430 2.891   -8.022  1.00 0.00 ? 14  VAL A C    1  
ATOM   193   O  O    . VAL A 1 14 ? 133.209 3.031   -8.063  1.00 0.00 ? 14  VAL A O    1  
ATOM   194   C  CB   . VAL A 1 14 ? 135.367 0.560   -7.942  1.00 0.00 ? 14  VAL A CB   1  
ATOM   195   C  CG1  . VAL A 1 14 ? 136.071 -0.517  -8.766  1.00 0.00 ? 14  VAL A CG1  1  
ATOM   196   C  CG2  . VAL A 1 14 ? 136.248 0.929   -6.749  1.00 0.00 ? 14  VAL A CG2  1  
ATOM   197   H  H    . VAL A 1 14 ? 137.228 2.049   -8.975  1.00 0.00 ? 14  VAL A H    1  
ATOM   198   H  HA   . VAL A 1 14 ? 134.469 1.505   -9.643  1.00 0.00 ? 14  VAL A HA   1  
ATOM   199   H  HB   . VAL A 1 14 ? 134.420 0.176   -7.588  1.00 0.00 ? 14  VAL A HB   1  
ATOM   200   H  HG11 . VAL A 1 14 ? 136.769 -0.051  -9.447  1.00 0.00 ? 14  VAL A HG11 1  
ATOM   201   H  HG12 . VAL A 1 14 ? 135.338 -1.077  -9.327  1.00 0.00 ? 14  VAL A HG12 1  
ATOM   202   H  HG13 . VAL A 1 14 ? 136.605 -1.183  -8.104  1.00 0.00 ? 14  VAL A HG13 1  
ATOM   203   H  HG21 . VAL A 1 14 ? 135.802 1.747   -6.205  1.00 0.00 ? 14  VAL A HG21 1  
ATOM   204   H  HG22 . VAL A 1 14 ? 137.224 1.217   -7.104  1.00 0.00 ? 14  VAL A HG22 1  
ATOM   205   H  HG23 . VAL A 1 14 ? 136.344 0.074   -6.096  1.00 0.00 ? 14  VAL A HG23 1  
ATOM   206   N  N    . PHE A 1 15 ? 135.229 3.692   -7.312  1.00 0.00 ? 15  PHE A N    1  
ATOM   207   C  CA   . PHE A 1 15 ? 134.681 4.792   -6.528  1.00 0.00 ? 15  PHE A CA   1  
ATOM   208   C  C    . PHE A 1 15 ? 133.933 5.797   -7.392  1.00 0.00 ? 15  PHE A C    1  
ATOM   209   O  O    . PHE A 1 15 ? 132.837 6.243   -7.037  1.00 0.00 ? 15  PHE A O    1  
ATOM   210   C  CB   . PHE A 1 15 ? 135.810 5.507   -5.790  1.00 0.00 ? 15  PHE A CB   1  
ATOM   211   C  CG   . PHE A 1 15 ? 135.238 6.654   -4.998  1.00 0.00 ? 15  PHE A CG   1  
ATOM   212   C  CD1  . PHE A 1 15 ? 134.612 6.433   -3.768  1.00 0.00 ? 15  PHE A CD1  1  
ATOM   213   C  CD2  . PHE A 1 15 ? 135.341 7.953   -5.507  1.00 0.00 ? 15  PHE A CD2  1  
ATOM   214   C  CE1  . PHE A 1 15 ? 134.088 7.515   -3.049  1.00 0.00 ? 15  PHE A CE1  1  
ATOM   215   C  CE2  . PHE A 1 15 ? 134.820 9.032   -4.791  1.00 0.00 ? 15  PHE A CE2  1  
ATOM   216   C  CZ   . PHE A 1 15 ? 134.192 8.814   -3.561  1.00 0.00 ? 15  PHE A CZ   1  
ATOM   217   H  H    . PHE A 1 15 ? 136.207 3.544   -7.325  1.00 0.00 ? 15  PHE A H    1  
ATOM   218   H  HA   . PHE A 1 15 ? 133.997 4.389   -5.797  1.00 0.00 ? 15  PHE A HA   1  
ATOM   219   H  HB2  . PHE A 1 15 ? 136.299 4.813   -5.121  1.00 0.00 ? 15  PHE A HB2  1  
ATOM   220   H  HB3  . PHE A 1 15 ? 136.526 5.885   -6.504  1.00 0.00 ? 15  PHE A HB3  1  
ATOM   221   H  HD1  . PHE A 1 15 ? 134.531 5.430   -3.374  1.00 0.00 ? 15  PHE A HD1  1  
ATOM   222   H  HD2  . PHE A 1 15 ? 135.828 8.121   -6.457  1.00 0.00 ? 15  PHE A HD2  1  
ATOM   223   H  HE1  . PHE A 1 15 ? 133.608 7.348   -2.099  1.00 0.00 ? 15  PHE A HE1  1  
ATOM   224   H  HE2  . PHE A 1 15 ? 134.906 10.032  -5.186  1.00 0.00 ? 15  PHE A HE2  1  
ATOM   225   H  HZ   . PHE A 1 15 ? 133.787 9.647   -3.006  1.00 0.00 ? 15  PHE A HZ   1  
ATOM   226   N  N    . HIS A 1 16 ? 134.533 6.162   -8.514  1.00 0.00 ? 16  HIS A N    1  
ATOM   227   C  CA   . HIS A 1 16 ? 133.924 7.131   -9.409  1.00 0.00 ? 16  HIS A CA   1  
ATOM   228   C  C    . HIS A 1 16 ? 132.558 6.662   -9.892  1.00 0.00 ? 16  HIS A C    1  
ATOM   229   O  O    . HIS A 1 16 ? 131.609 7.443   -9.944  1.00 0.00 ? 16  HIS A O    1  
ATOM   230   C  CB   . HIS A 1 16 ? 134.840 7.358   -10.614 1.00 0.00 ? 16  HIS A CB   1  
ATOM   231   C  CG   . HIS A 1 16 ? 134.266 8.437   -11.490 1.00 0.00 ? 16  HIS A CG   1  
ATOM   232   N  ND1  . HIS A 1 16 ? 133.438 8.155   -12.565 1.00 0.00 ? 16  HIS A ND1  1  
ATOM   233   C  CD2  . HIS A 1 16 ? 134.397 9.804   -11.467 1.00 0.00 ? 16  HIS A CD2  1  
ATOM   234   C  CE1  . HIS A 1 16 ? 133.107 9.326   -13.140 1.00 0.00 ? 16  HIS A CE1  1  
ATOM   235   N  NE2  . HIS A 1 16 ? 133.665 10.363  -12.510 1.00 0.00 ? 16  HIS A NE2  1  
ATOM   236   H  H    . HIS A 1 16 ? 135.409 5.781   -8.738  1.00 0.00 ? 16  HIS A H    1  
ATOM   237   H  HA   . HIS A 1 16 ? 133.807 8.066   -8.884  1.00 0.00 ? 16  HIS A HA   1  
ATOM   238   H  HB2  . HIS A 1 16 ? 135.818 7.657   -10.270 1.00 0.00 ? 16  HIS A HB2  1  
ATOM   239   H  HB3  . HIS A 1 16 ? 134.922 6.443   -11.180 1.00 0.00 ? 16  HIS A HB3  1  
ATOM   240   H  HD1  . HIS A 1 16 ? 133.148 7.265   -12.854 1.00 0.00 ? 16  HIS A HD1  1  
ATOM   241   H  HD2  . HIS A 1 16 ? 134.981 10.361  -10.748 1.00 0.00 ? 16  HIS A HD2  1  
ATOM   242   H  HE1  . HIS A 1 16 ? 132.467 9.415   -14.006 1.00 0.00 ? 16  HIS A HE1  1  
ATOM   243   H  HE2  . HIS A 1 16 ? 133.577 11.312  -12.733 1.00 0.00 ? 16  HIS A HE2  1  
ATOM   244   N  N    . ALA A 1 17 ? 132.469 5.392   -10.272 1.00 0.00 ? 17  ALA A N    1  
ATOM   245   C  CA   . ALA A 1 17 ? 131.212 4.858   -10.777 1.00 0.00 ? 17  ALA A CA   1  
ATOM   246   C  C    . ALA A 1 17 ? 130.135 4.749   -9.694  1.00 0.00 ? 17  ALA A C    1  
ATOM   247   O  O    . ALA A 1 17 ? 129.007 5.205   -9.882  1.00 0.00 ? 17  ALA A O    1  
ATOM   248   C  CB   . ALA A 1 17 ? 131.460 3.474   -11.379 1.00 0.00 ? 17  ALA A CB   1  
ATOM   249   H  H    . ALA A 1 17 ? 133.260 4.816   -10.230 1.00 0.00 ? 17  ALA A H    1  
ATOM   250   H  HA   . ALA A 1 17 ? 130.855 5.504   -11.557 1.00 0.00 ? 17  ALA A HA   1  
ATOM   251   H  HB1  . ALA A 1 17 ? 131.386 2.725   -10.604 1.00 0.00 ? 17  ALA A HB1  1  
ATOM   252   H  HB2  . ALA A 1 17 ? 132.449 3.443   -11.814 1.00 0.00 ? 17  ALA A HB2  1  
ATOM   253   H  HB3  . ALA A 1 17 ? 130.725 3.276   -12.144 1.00 0.00 ? 17  ALA A HB3  1  
ATOM   254   N  N    . HIS A 1 18 ? 130.479 4.113   -8.578  1.00 0.00 ? 18  HIS A N    1  
ATOM   255   C  CA   . HIS A 1 18 ? 129.521 3.916   -7.489  1.00 0.00 ? 18  HIS A CA   1  
ATOM   256   C  C    . HIS A 1 18 ? 129.064 5.210   -6.811  1.00 0.00 ? 18  HIS A C    1  
ATOM   257   O  O    . HIS A 1 18 ? 127.869 5.408   -6.591  1.00 0.00 ? 18  HIS A O    1  
ATOM   258   C  CB   . HIS A 1 18 ? 130.129 2.997   -6.440  1.00 0.00 ? 18  HIS A CB   1  
ATOM   259   C  CG   . HIS A 1 18 ? 130.404 1.652   -7.055  1.00 0.00 ? 18  HIS A CG   1  
ATOM   260   N  ND1  . HIS A 1 18 ? 129.399 0.877   -7.615  1.00 0.00 ? 18  HIS A ND1  1  
ATOM   261   C  CD2  . HIS A 1 18 ? 131.558 0.920   -7.191  1.00 0.00 ? 18  HIS A CD2  1  
ATOM   262   C  CE1  . HIS A 1 18 ? 129.962 -0.261  -8.058  1.00 0.00 ? 18  HIS A CE1  1  
ATOM   263   N  NE2  . HIS A 1 18 ? 131.276 -0.286  -7.825  1.00 0.00 ? 18  HIS A NE2  1  
ATOM   264   H  H    . HIS A 1 18 ? 131.384 3.749   -8.492  1.00 0.00 ? 18  HIS A H    1  
ATOM   265   H  HA   . HIS A 1 18 ? 128.650 3.424   -7.893  1.00 0.00 ? 18  HIS A HA   1  
ATOM   266   H  HB2  . HIS A 1 18 ? 131.053 3.430   -6.086  1.00 0.00 ? 18  HIS A HB2  1  
ATOM   267   H  HB3  . HIS A 1 18 ? 129.442 2.884   -5.615  1.00 0.00 ? 18  HIS A HB3  1  
ATOM   268   H  HD1  . HIS A 1 18 ? 128.450 1.116   -7.676  1.00 0.00 ? 18  HIS A HD1  1  
ATOM   269   H  HD2  . HIS A 1 18 ? 132.533 1.228   -6.845  1.00 0.00 ? 18  HIS A HD2  1  
ATOM   270   H  HE1  . HIS A 1 18 ? 129.417 -1.058  -8.543  1.00 0.00 ? 18  HIS A HE1  1  
ATOM   271   H  HE2  . HIS A 1 18 ? 131.908 -1.000  -8.052  1.00 0.00 ? 18  HIS A HE2  1  
ATOM   272   N  N    . SER A 1 19 ? 130.011 6.073   -6.450  1.00 0.00 ? 19  SER A N    1  
ATOM   273   C  CA   . SER A 1 19 ? 129.662 7.316   -5.762  1.00 0.00 ? 19  SER A CA   1  
ATOM   274   C  C    . SER A 1 19 ? 128.728 8.176   -6.605  1.00 0.00 ? 19  SER A C    1  
ATOM   275   O  O    . SER A 1 19 ? 127.852 8.865   -6.076  1.00 0.00 ? 19  SER A O    1  
ATOM   276   C  CB   . SER A 1 19 ? 130.928 8.095   -5.411  1.00 0.00 ? 19  SER A CB   1  
ATOM   277   O  OG   . SER A 1 19 ? 131.784 7.270   -4.632  1.00 0.00 ? 19  SER A OG   1  
ATOM   278   H  H    . SER A 1 19 ? 130.956 5.863   -6.624  1.00 0.00 ? 19  SER A H    1  
ATOM   279   H  HA   . SER A 1 19 ? 129.154 7.064   -4.844  1.00 0.00 ? 19  SER A HA   1  
ATOM   280   H  HB2  . SER A 1 19 ? 131.439 8.379   -6.310  1.00 0.00 ? 19  SER A HB2  1  
ATOM   281   H  HB3  . SER A 1 19 ? 130.661 8.983   -4.853  1.00 0.00 ? 19  SER A HB3  1  
ATOM   282   H  HG   . SER A 1 19 ? 131.772 6.389   -5.010  1.00 0.00 ? 19  SER A HG   1  
ATOM   283   N  N    . GLY A 1 20 ? 128.933 8.132   -7.915  1.00 0.00 ? 20  GLY A N    1  
ATOM   284   C  CA   . GLY A 1 20 ? 128.125 8.900   -8.857  1.00 0.00 ? 20  GLY A CA   1  
ATOM   285   C  C    . GLY A 1 20 ? 126.641 8.568   -8.764  1.00 0.00 ? 20  GLY A C    1  
ATOM   286   O  O    . GLY A 1 20 ? 125.797 9.395   -9.109  1.00 0.00 ? 20  GLY A O    1  
ATOM   287   H  H    . GLY A 1 20 ? 129.653 7.565   -8.262  1.00 0.00 ? 20  GLY A H    1  
ATOM   288   H  HA2  . GLY A 1 20 ? 128.247 9.950   -8.644  1.00 0.00 ? 20  GLY A HA2  1  
ATOM   289   H  HA3  . GLY A 1 20 ? 128.468 8.701   -9.860  1.00 0.00 ? 20  GLY A HA3  1  
ATOM   290   N  N    . LYS A 1 21 ? 126.313 7.353   -8.339  1.00 0.00 ? 21  LYS A N    1  
ATOM   291   C  CA   . LYS A 1 21 ? 124.912 6.959   -8.270  1.00 0.00 ? 21  LYS A CA   1  
ATOM   292   C  C    . LYS A 1 21 ? 124.114 7.936   -7.413  1.00 0.00 ? 21  LYS A C    1  
ATOM   293   O  O    . LYS A 1 21 ? 122.985 8.283   -7.759  1.00 0.00 ? 21  LYS A O    1  
ATOM   294   C  CB   . LYS A 1 21 ? 124.792 5.551   -7.682  1.00 0.00 ? 21  LYS A CB   1  
ATOM   295   C  CG   . LYS A 1 21 ? 125.492 4.551   -8.604  1.00 0.00 ? 21  LYS A CG   1  
ATOM   296   C  CD   . LYS A 1 21 ? 125.175 3.126   -8.146  1.00 0.00 ? 21  LYS A CD   1  
ATOM   297   C  CE   . LYS A 1 21 ? 125.773 2.891   -6.758  1.00 0.00 ? 21  LYS A CE   1  
ATOM   298   N  NZ   . LYS A 1 21 ? 126.004 1.432   -6.558  1.00 0.00 ? 21  LYS A NZ   1  
ATOM   299   H  H    . LYS A 1 21 ? 127.015 6.712   -8.099  1.00 0.00 ? 21  LYS A H    1  
ATOM   300   H  HA   . LYS A 1 21 ? 124.502 6.954   -9.268  1.00 0.00 ? 21  LYS A HA   1  
ATOM   301   H  HB2  . LYS A 1 21 ? 125.256 5.528   -6.707  1.00 0.00 ? 21  LYS A HB2  1  
ATOM   302   H  HB3  . LYS A 1 21 ? 123.750 5.287   -7.592  1.00 0.00 ? 21  LYS A HB3  1  
ATOM   303   H  HG2  . LYS A 1 21 ? 125.143 4.690   -9.617  1.00 0.00 ? 21  LYS A HG2  1  
ATOM   304   H  HG3  . LYS A 1 21 ? 126.559 4.711   -8.566  1.00 0.00 ? 21  LYS A HG3  1  
ATOM   305   H  HD2  . LYS A 1 21 ? 124.104 2.992   -8.105  1.00 0.00 ? 21  LYS A HD2  1  
ATOM   306   H  HD3  . LYS A 1 21 ? 125.601 2.421   -8.843  1.00 0.00 ? 21  LYS A HD3  1  
ATOM   307   H  HE2  . LYS A 1 21 ? 126.712 3.418   -6.676  1.00 0.00 ? 21  LYS A HE2  1  
ATOM   308   H  HE3  . LYS A 1 21 ? 125.090 3.254   -6.005  1.00 0.00 ? 21  LYS A HE3  1  
ATOM   309   H  HZ1  . LYS A 1 21 ? 125.729 0.916   -7.416  1.00 0.00 ? 21  LYS A HZ1  1  
ATOM   310   H  HZ2  . LYS A 1 21 ? 125.432 1.099   -5.753  1.00 0.00 ? 21  LYS A HZ2  1  
ATOM   311   H  HZ3  . LYS A 1 21 ? 127.010 1.263   -6.361  1.00 0.00 ? 21  LYS A HZ3  1  
ATOM   312   N  N    . GLU A 1 22 ? 124.701 8.410   -6.315  1.00 0.00 ? 22  GLU A N    1  
ATOM   313   C  CA   . GLU A 1 22 ? 124.006 9.378   -5.468  1.00 0.00 ? 22  GLU A CA   1  
ATOM   314   C  C    . GLU A 1 22 ? 124.947 10.464  -4.954  1.00 0.00 ? 22  GLU A C    1  
ATOM   315   O  O    . GLU A 1 22 ? 126.101 10.201  -4.602  1.00 0.00 ? 22  GLU A O    1  
ATOM   316   C  CB   . GLU A 1 22 ? 123.338 8.681   -4.283  1.00 0.00 ? 22  GLU A CB   1  
ATOM   317   C  CG   . GLU A 1 22 ? 122.307 7.676   -4.795  1.00 0.00 ? 22  GLU A CG   1  
ATOM   318   C  CD   . GLU A 1 22 ? 121.564 7.058   -3.618  1.00 0.00 ? 22  GLU A CD   1  
ATOM   319   O  OE1  . GLU A 1 22 ? 121.955 7.326   -2.494  1.00 0.00 ? 22  GLU A OE1  1  
ATOM   320   O  OE2  . GLU A 1 22 ? 120.617 6.329   -3.857  1.00 0.00 ? 22  GLU A OE2  1  
ATOM   321   H  H    . GLU A 1 22 ? 125.611 8.127   -6.086  1.00 0.00 ? 22  GLU A H    1  
ATOM   322   H  HA   . GLU A 1 22 ? 123.234 9.855   -6.055  1.00 0.00 ? 22  GLU A HA   1  
ATOM   323   H  HB2  . GLU A 1 22 ? 124.086 8.164   -3.699  1.00 0.00 ? 22  GLU A HB2  1  
ATOM   324   H  HB3  . GLU A 1 22 ? 122.844 9.416   -3.665  1.00 0.00 ? 22  GLU A HB3  1  
ATOM   325   H  HG2  . GLU A 1 22 ? 121.603 8.181   -5.441  1.00 0.00 ? 22  GLU A HG2  1  
ATOM   326   H  HG3  . GLU A 1 22 ? 122.809 6.898   -5.350  1.00 0.00 ? 22  GLU A HG3  1  
ATOM   327   N  N    . GLY A 1 23 ? 124.418 11.680  -4.880  1.00 0.00 ? 23  GLY A N    1  
ATOM   328   C  CA   . GLY A 1 23 ? 125.173 12.814  -4.369  1.00 0.00 ? 23  GLY A CA   1  
ATOM   329   C  C    . GLY A 1 23 ? 126.419 13.103  -5.196  1.00 0.00 ? 23  GLY A C    1  
ATOM   330   O  O    . GLY A 1 23 ? 126.456 12.880  -6.407  1.00 0.00 ? 23  GLY A O    1  
ATOM   331   H  H    . GLY A 1 23 ? 123.486 11.811  -5.150  1.00 0.00 ? 23  GLY A H    1  
ATOM   332   H  HA2  . GLY A 1 23 ? 124.538 13.688  -4.377  1.00 0.00 ? 23  GLY A HA2  1  
ATOM   333   H  HA3  . GLY A 1 23 ? 125.469 12.607  -3.351  1.00 0.00 ? 23  GLY A HA3  1  
ATOM   334   N  N    . ASP A 1 24 ? 127.435 13.601  -4.505  1.00 0.00 ? 24  ASP A N    1  
ATOM   335   C  CA   . ASP A 1 24 ? 128.713 13.939  -5.117  1.00 0.00 ? 24  ASP A CA   1  
ATOM   336   C  C    . ASP A 1 24 ? 129.612 12.710  -5.238  1.00 0.00 ? 24  ASP A C    1  
ATOM   337   O  O    . ASP A 1 24 ? 129.763 11.941  -4.282  1.00 0.00 ? 24  ASP A O    1  
ATOM   338   C  CB   . ASP A 1 24 ? 129.422 15.014  -4.292  1.00 0.00 ? 24  ASP A CB   1  
ATOM   339   C  CG   . ASP A 1 24 ? 130.687 15.472  -5.011  1.00 0.00 ? 24  ASP A CG   1  
ATOM   340   O  OD1  . ASP A 1 24 ? 130.900 15.035  -6.130  1.00 0.00 ? 24  ASP A OD1  1  
ATOM   341   O  OD2  . ASP A 1 24 ? 131.423 16.253  -4.432  1.00 0.00 ? 24  ASP A OD2  1  
ATOM   342   H  H    . ASP A 1 24 ? 127.322 13.746  -3.543  1.00 0.00 ? 24  ASP A H    1  
ATOM   343   H  HA   . ASP A 1 24 ? 128.529 14.330  -6.106  1.00 0.00 ? 24  ASP A HA   1  
ATOM   344   H  HB2  . ASP A 1 24 ? 128.760 15.858  -4.160  1.00 0.00 ? 24  ASP A HB2  1  
ATOM   345   H  HB3  . ASP A 1 24 ? 129.686 14.612  -3.328  1.00 0.00 ? 24  ASP A HB3  1  
ATOM   346   N  N    . LYS A 1 25 ? 130.208 12.530  -6.413  1.00 0.00 ? 25  LYS A N    1  
ATOM   347   C  CA   . LYS A 1 25 ? 131.102 11.397  -6.629  1.00 0.00 ? 25  LYS A CA   1  
ATOM   348   C  C    . LYS A 1 25 ? 132.208 11.423  -5.589  1.00 0.00 ? 25  LYS A C    1  
ATOM   349   O  O    . LYS A 1 25 ? 132.669 10.389  -5.109  1.00 0.00 ? 25  LYS A O    1  
ATOM   350   C  CB   . LYS A 1 25 ? 131.801 11.554  -7.989  1.00 0.00 ? 25  LYS A CB   1  
ATOM   351   C  CG   . LYS A 1 25 ? 130.809 11.475  -9.138  1.00 0.00 ? 25  LYS A CG   1  
ATOM   352   C  CD   . LYS A 1 25 ? 131.556 11.576  -10.468 1.00 0.00 ? 25  LYS A CD   1  
ATOM   353   C  CE   . LYS A 1 25 ? 130.548 11.621  -11.617 1.00 0.00 ? 25  LYS A CE   1  
ATOM   354   N  NZ   . LYS A 1 25 ? 129.961 10.265  -11.816 1.00 0.00 ? 25  LYS A NZ   1  
ATOM   355   H  H    . LYS A 1 25 ? 130.055 13.170  -7.137  1.00 0.00 ? 25  LYS A H    1  
ATOM   356   H  HA   . LYS A 1 25 ? 130.561 10.467  -6.594  1.00 0.00 ? 25  LYS A HA   1  
ATOM   357   H  HB2  . LYS A 1 25 ? 132.297 12.510  -8.023  1.00 0.00 ? 25  LYS A HB2  1  
ATOM   358   H  HB3  . LYS A 1 25 ? 132.536 10.770  -8.102  1.00 0.00 ? 25  LYS A HB3  1  
ATOM   359   H  HG2  . LYS A 1 25 ? 130.316 10.531  -9.093  1.00 0.00 ? 25  LYS A HG2  1  
ATOM   360   H  HG3  . LYS A 1 25 ? 130.089 12.275  -9.062  1.00 0.00 ? 25  LYS A HG3  1  
ATOM   361   H  HD2  . LYS A 1 25 ? 132.154 12.477  -10.477 1.00 0.00 ? 25  LYS A HD2  1  
ATOM   362   H  HD3  . LYS A 1 25 ? 132.196 10.717  -10.586 1.00 0.00 ? 25  LYS A HD3  1  
ATOM   363   H  HE2  . LYS A 1 25 ? 129.761 12.322  -11.380 1.00 0.00 ? 25  LYS A HE2  1  
ATOM   364   H  HE3  . LYS A 1 25 ? 131.047 11.933  -12.523 1.00 0.00 ? 25  LYS A HE3  1  
ATOM   365   H  HZ1  . LYS A 1 25 ? 129.454 10.236  -12.723 1.00 0.00 ? 25  LYS A HZ1  1  
ATOM   366   H  HZ2  . LYS A 1 25 ? 129.298 10.058  -11.041 1.00 0.00 ? 25  LYS A HZ2  1  
ATOM   367   H  HZ3  . LYS A 1 25 ? 130.720 9.556   -11.823 1.00 0.00 ? 25  LYS A HZ3  1  
ATOM   368   N  N    . TYR A 1 26 ? 132.654 12.634  -5.310  1.00 0.00 ? 26  TYR A N    1  
ATOM   369   C  CA   . TYR A 1 26 ? 133.756 12.879  -4.395  1.00 0.00 ? 26  TYR A CA   1  
ATOM   370   C  C    . TYR A 1 26 ? 133.359 12.618  -2.943  1.00 0.00 ? 26  TYR A C    1  
ATOM   371   O  O    . TYR A 1 26 ? 134.221 12.439  -2.083  1.00 0.00 ? 26  TYR A O    1  
ATOM   372   C  CB   . TYR A 1 26 ? 134.216 14.321  -4.592  1.00 0.00 ? 26  TYR A CB   1  
ATOM   373   C  CG   . TYR A 1 26 ? 134.596 14.563  -6.059  1.00 0.00 ? 26  TYR A CG   1  
ATOM   374   C  CD1  . TYR A 1 26 ? 134.495 13.542  -7.043  1.00 0.00 ? 26  TYR A CD1  1  
ATOM   375   C  CD2  . TYR A 1 26 ? 134.996 15.848  -6.449  1.00 0.00 ? 26  TYR A CD2  1  
ATOM   376   C  CE1  . TYR A 1 26 ? 134.793 13.819  -8.377  1.00 0.00 ? 26  TYR A CE1  1  
ATOM   377   C  CE2  . TYR A 1 26 ? 135.305 16.115  -7.790  1.00 0.00 ? 26  TYR A CE2  1  
ATOM   378   C  CZ   . TYR A 1 26 ? 135.202 15.102  -8.753  1.00 0.00 ? 26  TYR A CZ   1  
ATOM   379   O  OH   . TYR A 1 26 ? 135.496 15.373  -10.074 1.00 0.00 ? 26  TYR A OH   1  
ATOM   380   H  H    . TYR A 1 26 ? 132.254 13.398  -5.775  1.00 0.00 ? 26  TYR A H    1  
ATOM   381   H  HA   . TYR A 1 26 ? 134.574 12.221  -4.643  1.00 0.00 ? 26  TYR A HA   1  
ATOM   382   H  HB2  . TYR A 1 26 ? 133.416 14.992  -4.313  1.00 0.00 ? 26  TYR A HB2  1  
ATOM   383   H  HB3  . TYR A 1 26 ? 135.076 14.509  -3.966  1.00 0.00 ? 26  TYR A HB3  1  
ATOM   384   H  HD1  . TYR A 1 26 ? 134.207 12.543  -6.786  1.00 0.00 ? 26  TYR A HD1  1  
ATOM   385   H  HD2  . TYR A 1 26 ? 135.077 16.633  -5.712  1.00 0.00 ? 26  TYR A HD2  1  
ATOM   386   H  HE1  . TYR A 1 26 ? 134.696 13.034  -9.120  1.00 0.00 ? 26  TYR A HE1  1  
ATOM   387   H  HE2  . TYR A 1 26 ? 135.621 17.105  -8.083  1.00 0.00 ? 26  TYR A HE2  1  
ATOM   388   H  HH   . TYR A 1 26 ? 136.448 15.458  -10.154 1.00 0.00 ? 26  TYR A HH   1  
ATOM   389   N  N    . LYS A 1 27 ? 132.056 12.610  -2.671  1.00 0.00 ? 27  LYS A N    1  
ATOM   390   C  CA   . LYS A 1 27 ? 131.575 12.384  -1.309  1.00 0.00 ? 27  LYS A CA   1  
ATOM   391   C  C    . LYS A 1 27 ? 130.854 11.038  -1.255  1.00 0.00 ? 27  LYS A C    1  
ATOM   392   O  O    . LYS A 1 27 ? 130.052 10.715  -2.140  1.00 0.00 ? 27  LYS A O    1  
ATOM   393   C  CB   . LYS A 1 27 ? 130.603 13.509  -0.929  1.00 0.00 ? 27  LYS A CB   1  
ATOM   394   C  CG   . LYS A 1 27 ? 130.332 13.540  0.576   1.00 0.00 ? 27  LYS A CG   1  
ATOM   395   C  CD   . LYS A 1 27 ? 131.514 14.189  1.308   1.00 0.00 ? 27  LYS A CD   1  
ATOM   396   C  CE   . LYS A 1 27 ? 131.125 14.462  2.763   1.00 0.00 ? 27  LYS A CE   1  
ATOM   397   N  NZ   . LYS A 1 27 ? 132.150 15.339  3.396   1.00 0.00 ? 27  LYS A NZ   1  
ATOM   398   H  H    . LYS A 1 27 ? 131.412 12.768  -3.391  1.00 0.00 ? 27  LYS A H    1  
ATOM   399   H  HA   . LYS A 1 27 ? 132.407 12.375  -0.624  1.00 0.00 ? 27  LYS A HA   1  
ATOM   400   H  HB2  . LYS A 1 27 ? 131.019 14.456  -1.230  1.00 0.00 ? 27  LYS A HB2  1  
ATOM   401   H  HB3  . LYS A 1 27 ? 129.668 13.353  -1.443  1.00 0.00 ? 27  LYS A HB3  1  
ATOM   402   H  HG2  . LYS A 1 27 ? 129.442 14.117  0.760   1.00 0.00 ? 27  LYS A HG2  1  
ATOM   403   H  HG3  . LYS A 1 27 ? 130.193 12.534  0.940   1.00 0.00 ? 27  LYS A HG3  1  
ATOM   404   H  HD2  . LYS A 1 27 ? 132.364 13.526  1.284   1.00 0.00 ? 27  LYS A HD2  1  
ATOM   405   H  HD3  . LYS A 1 27 ? 131.769 15.121  0.825   1.00 0.00 ? 27  LYS A HD3  1  
ATOM   406   H  HE2  . LYS A 1 27 ? 130.168 14.958  2.789   1.00 0.00 ? 27  LYS A HE2  1  
ATOM   407   H  HE3  . LYS A 1 27 ? 131.063 13.529  3.302   1.00 0.00 ? 27  LYS A HE3  1  
ATOM   408   H  HZ1  . LYS A 1 27 ? 132.682 14.795  4.105   1.00 0.00 ? 27  LYS A HZ1  1  
ATOM   409   H  HZ2  . LYS A 1 27 ? 131.679 16.144  3.858   1.00 0.00 ? 27  LYS A HZ2  1  
ATOM   410   H  HZ3  . LYS A 1 27 ? 132.805 15.689  2.669   1.00 0.00 ? 27  LYS A HZ3  1  
ATOM   411   N  N    . LEU A 1 28 ? 131.156 10.242  -0.229  1.00 0.00 ? 28  LEU A N    1  
ATOM   412   C  CA   . LEU A 1 28 ? 130.542 8.925   -0.102  1.00 0.00 ? 28  LEU A CA   1  
ATOM   413   C  C    . LEU A 1 28 ? 129.422 8.989   0.944   1.00 0.00 ? 28  LEU A C    1  
ATOM   414   O  O    . LEU A 1 28 ? 129.625 9.494   2.049   1.00 0.00 ? 28  LEU A O    1  
ATOM   415   C  CB   . LEU A 1 28 ? 131.627 7.905   0.319   1.00 0.00 ? 28  LEU A CB   1  
ATOM   416   C  CG   . LEU A 1 28 ? 131.498 6.608   -0.499  1.00 0.00 ? 28  LEU A CG   1  
ATOM   417   C  CD1  . LEU A 1 28 ? 132.711 5.706   -0.236  1.00 0.00 ? 28  LEU A CD1  1  
ATOM   418   C  CD2  . LEU A 1 28 ? 130.218 5.859   -0.132  1.00 0.00 ? 28  LEU A CD2  1  
ATOM   419   H  H    . LEU A 1 28 ? 131.810 10.537  0.440   1.00 0.00 ? 28  LEU A H    1  
ATOM   420   H  HA   . LEU A 1 28 ? 130.122 8.632   -1.054  1.00 0.00 ? 28  LEU A HA   1  
ATOM   421   H  HB2  . LEU A 1 28 ? 132.603 8.336   0.147   1.00 0.00 ? 28  LEU A HB2  1  
ATOM   422   H  HB3  . LEU A 1 28 ? 131.522 7.673   1.369   1.00 0.00 ? 28  LEU A HB3  1  
ATOM   423   H  HG   . LEU A 1 28 ? 131.474 6.860   -1.548  1.00 0.00 ? 28  LEU A HG   1  
ATOM   424   H  HD11 . LEU A 1 28 ? 132.880 5.073   -1.095  1.00 0.00 ? 28  LEU A HD11 1  
ATOM   425   H  HD12 . LEU A 1 28 ? 132.520 5.090   0.631   1.00 0.00 ? 28  LEU A HD12 1  
ATOM   426   H  HD13 . LEU A 1 28 ? 133.586 6.313   -0.059  1.00 0.00 ? 28  LEU A HD13 1  
ATOM   427   H  HD21 . LEU A 1 28 ? 129.480 6.555   0.226   1.00 0.00 ? 28  LEU A HD21 1  
ATOM   428   H  HD22 . LEU A 1 28 ? 130.429 5.131   0.635   1.00 0.00 ? 28  LEU A HD22 1  
ATOM   429   H  HD23 . LEU A 1 28 ? 129.841 5.355   -1.010  1.00 0.00 ? 28  LEU A HD23 1  
ATOM   430   N  N    . SER A 1 29 ? 128.246 8.476   0.592   1.00 0.00 ? 29  SER A N    1  
ATOM   431   C  CA   . SER A 1 29 ? 127.103 8.482   1.509   1.00 0.00 ? 29  SER A CA   1  
ATOM   432   C  C    . SER A 1 29 ? 126.945 7.111   2.158   1.00 0.00 ? 29  SER A C    1  
ATOM   433   O  O    . SER A 1 29 ? 127.469 6.120   1.654   1.00 0.00 ? 29  SER A O    1  
ATOM   434   C  CB   . SER A 1 29 ? 125.824 8.847   0.758   1.00 0.00 ? 29  SER A CB   1  
ATOM   435   O  OG   . SER A 1 29 ? 125.476 7.786   -0.119  1.00 0.00 ? 29  SER A OG   1  
ATOM   436   H  H    . SER A 1 29 ? 128.140 8.087   -0.301  1.00 0.00 ? 29  SER A H    1  
ATOM   437   H  HA   . SER A 1 29 ? 127.276 9.216   2.282   1.00 0.00 ? 29  SER A HA   1  
ATOM   438   H  HB2  . SER A 1 29 ? 125.023 9.001   1.461   1.00 0.00 ? 29  SER A HB2  1  
ATOM   439   H  HB3  . SER A 1 29 ? 125.985 9.756   0.195   1.00 0.00 ? 29  SER A HB3  1  
ATOM   440   H  HG   . SER A 1 29 ? 125.068 7.092   0.402   1.00 0.00 ? 29  SER A HG   1  
ATOM   441   N  N    . LYS A 1 30 ? 126.242 7.055   3.288   1.00 0.00 ? 30  LYS A N    1  
ATOM   442   C  CA   . LYS A 1 30 ? 126.064 5.786   3.983   1.00 0.00 ? 30  LYS A CA   1  
ATOM   443   C  C    . LYS A 1 30 ? 125.437 4.742   3.071   1.00 0.00 ? 30  LYS A C    1  
ATOM   444   O  O    . LYS A 1 30 ? 125.852 3.584   3.083   1.00 0.00 ? 30  LYS A O    1  
ATOM   445   C  CB   . LYS A 1 30 ? 125.160 5.980   5.200   1.00 0.00 ? 30  LYS A CB   1  
ATOM   446   C  CG   . LYS A 1 30 ? 125.857 6.872   6.220   1.00 0.00 ? 30  LYS A CG   1  
ATOM   447   C  CD   . LYS A 1 30 ? 124.929 7.099   7.419   1.00 0.00 ? 30  LYS A CD   1  
ATOM   448   C  CE   . LYS A 1 30 ? 124.770 5.796   8.210   1.00 0.00 ? 30  LYS A CE   1  
ATOM   449   N  NZ   . LYS A 1 30 ? 123.672 4.984   7.614   1.00 0.00 ? 30  LYS A NZ   1  
ATOM   450   H  H    . LYS A 1 30 ? 125.858 7.872   3.663   1.00 0.00 ? 30  LYS A H    1  
ATOM   451   H  HA   . LYS A 1 30 ? 127.025 5.430   4.318   1.00 0.00 ? 30  LYS A HA   1  
ATOM   452   H  HB2  . LYS A 1 30 ? 124.234 6.442   4.890   1.00 0.00 ? 30  LYS A HB2  1  
ATOM   453   H  HB3  . LYS A 1 30 ? 124.951 5.020   5.647   1.00 0.00 ? 30  LYS A HB3  1  
ATOM   454   H  HG2  . LYS A 1 30 ? 126.766 6.389   6.547   1.00 0.00 ? 30  LYS A HG2  1  
ATOM   455   H  HG3  . LYS A 1 30 ? 126.096 7.821   5.765   1.00 0.00 ? 30  LYS A HG3  1  
ATOM   456   H  HD2  . LYS A 1 30 ? 125.348 7.861   8.060   1.00 0.00 ? 30  LYS A HD2  1  
ATOM   457   H  HD3  . LYS A 1 30 ? 123.961 7.421   7.066   1.00 0.00 ? 30  LYS A HD3  1  
ATOM   458   H  HE2  . LYS A 1 30 ? 125.692 5.236   8.176   1.00 0.00 ? 30  LYS A HE2  1  
ATOM   459   H  HE3  . LYS A 1 30 ? 124.528 6.028   9.236   1.00 0.00 ? 30  LYS A HE3  1  
ATOM   460   H  HZ1  . LYS A 1 30 ? 123.979 3.995   7.529   1.00 0.00 ? 30  LYS A HZ1  1  
ATOM   461   H  HZ2  . LYS A 1 30 ? 123.438 5.357   6.671   1.00 0.00 ? 30  LYS A HZ2  1  
ATOM   462   H  HZ3  . LYS A 1 30 ? 122.833 5.033   8.225   1.00 0.00 ? 30  LYS A HZ3  1  
ATOM   463   N  N    . LYS A 1 31 ? 124.457 5.139   2.262   1.00 0.00 ? 31  LYS A N    1  
ATOM   464   C  CA   . LYS A 1 31 ? 123.852 4.173   1.357   1.00 0.00 ? 31  LYS A CA   1  
ATOM   465   C  C    . LYS A 1 31 ? 124.882 3.622   0.404   1.00 0.00 ? 31  LYS A C    1  
ATOM   466   O  O    . LYS A 1 31 ? 124.971 2.411   0.185   1.00 0.00 ? 31  LYS A O    1  
ATOM   467   C  CB   . LYS A 1 31 ? 122.806 4.831   0.468   1.00 0.00 ? 31  LYS A CB   1  
ATOM   468   C  CG   . LYS A 1 31 ? 122.200 3.755   -0.445  1.00 0.00 ? 31  LYS A CG   1  
ATOM   469   C  CD   . LYS A 1 31 ? 121.385 4.413   -1.536  1.00 0.00 ? 31  LYS A CD   1  
ATOM   470   C  CE   . LYS A 1 31 ? 120.894 3.328   -2.485  1.00 0.00 ? 31  LYS A CE   1  
ATOM   471   N  NZ   . LYS A 1 31 ? 119.988 3.928   -3.505  1.00 0.00 ? 31  LYS A NZ   1  
ATOM   472   H  H    . LYS A 1 31 ? 124.159 6.073   2.263   1.00 0.00 ? 31  LYS A H    1  
ATOM   473   H  HA   . LYS A 1 31 ? 123.398 3.372   1.916   1.00 0.00 ? 31  LYS A HA   1  
ATOM   474   H  HB2  . LYS A 1 31 ? 122.032 5.269   1.082   1.00 0.00 ? 31  LYS A HB2  1  
ATOM   475   H  HB3  . LYS A 1 31 ? 123.269 5.596   -0.136  1.00 0.00 ? 31  LYS A HB3  1  
ATOM   476   H  HG2  . LYS A 1 31 ? 122.973 3.161   -0.903  1.00 0.00 ? 31  LYS A HG2  1  
ATOM   477   H  HG3  . LYS A 1 31 ? 121.557 3.113   0.138   1.00 0.00 ? 31  LYS A HG3  1  
ATOM   478   H  HD2  . LYS A 1 31 ? 120.548 4.944   -1.106  1.00 0.00 ? 31  LYS A HD2  1  
ATOM   479   H  HD3  . LYS A 1 31 ? 122.025 5.095   -2.077  1.00 0.00 ? 31  LYS A HD3  1  
ATOM   480   H  HE2  . LYS A 1 31 ? 121.754 2.884   -2.976  1.00 0.00 ? 31  LYS A HE2  1  
ATOM   481   H  HE3  . LYS A 1 31 ? 120.366 2.571   -1.926  1.00 0.00 ? 31  LYS A HE3  1  
ATOM   482   H  HZ1  . LYS A 1 31 ? 119.119 3.362   -3.572  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM   483   H  HZ2  . LYS A 1 31 ? 120.466 3.940   -4.429  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM   484   H  HZ3  . LYS A 1 31 ? 119.746 4.899   -3.227  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM   485   N  N    . GLU A 1 32 ? 125.630 4.528   -0.204  1.00 0.00 ? 32  GLU A N    1  
ATOM   486   C  CA   . GLU A 1 32 ? 126.602 4.111   -1.176  1.00 0.00 ? 32  GLU A CA   1  
ATOM   487   C  C    . GLU A 1 32 ? 127.644 3.230   -0.504  1.00 0.00 ? 32  GLU A C    1  
ATOM   488   O  O    . GLU A 1 32 ? 128.096 2.240   -1.069  1.00 0.00 ? 32  GLU A O    1  
ATOM   489   C  CB   . GLU A 1 32 ? 127.279 5.340   -1.803  1.00 0.00 ? 32  GLU A CB   1  
ATOM   490   C  CG   . GLU A 1 32 ? 126.264 6.138   -2.628  1.00 0.00 ? 32  GLU A CG   1  
ATOM   491   C  CD   . GLU A 1 32 ? 126.941 7.346   -3.287  1.00 0.00 ? 32  GLU A CD   1  
ATOM   492   O  OE1  . GLU A 1 32 ? 128.062 7.659   -2.917  1.00 0.00 ? 32  GLU A OE1  1  
ATOM   493   O  OE2  . GLU A 1 32 ? 126.320 7.951   -4.144  1.00 0.00 ? 32  GLU A OE2  1  
ATOM   494   H  H    . GLU A 1 32 ? 125.494 5.482   -0.022  1.00 0.00 ? 32  GLU A H    1  
ATOM   495   H  HA   . GLU A 1 32 ? 126.077 3.555   -1.953  1.00 0.00 ? 32  GLU A HA   1  
ATOM   496   H  HB2  . GLU A 1 32 ? 127.668 5.968   -1.015  1.00 0.00 ? 32  GLU A HB2  1  
ATOM   497   H  HB3  . GLU A 1 32 ? 128.088 5.020   -2.441  1.00 0.00 ? 32  GLU A HB3  1  
ATOM   498   H  HG2  . GLU A 1 32 ? 125.849 5.500   -3.395  1.00 0.00 ? 32  GLU A HG2  1  
ATOM   499   H  HG3  . GLU A 1 32 ? 125.469 6.482   -1.985  1.00 0.00 ? 32  GLU A HG3  1  
ATOM   500   N  N    . LEU A 1 33 ? 128.003 3.595   0.725   1.00 0.00 ? 33  LEU A N    1  
ATOM   501   C  CA   . LEU A 1 33 ? 128.977 2.827   1.488   1.00 0.00 ? 33  LEU A CA   1  
ATOM   502   C  C    . LEU A 1 33 ? 128.480 1.417   1.752   1.00 0.00 ? 33  LEU A C    1  
ATOM   503   O  O    . LEU A 1 33 ? 129.205 0.432   1.567   1.00 0.00 ? 33  LEU A O    1  
ATOM   504   C  CB   . LEU A 1 33 ? 129.213 3.535   2.819   1.00 0.00 ? 33  LEU A CB   1  
ATOM   505   C  CG   . LEU A 1 33 ? 130.214 2.749   3.654   1.00 0.00 ? 33  LEU A CG   1  
ATOM   506   C  CD1  . LEU A 1 33 ? 131.555 2.707   2.931   1.00 0.00 ? 33  LEU A CD1  1  
ATOM   507   C  CD2  . LEU A 1 33 ? 130.376 3.447   5.001   1.00 0.00 ? 33  LEU A CD2  1  
ATOM   508   H  H    . LEU A 1 33 ? 127.593 4.388   1.130   1.00 0.00 ? 33  LEU A H    1  
ATOM   509   H  HA   . LEU A 1 33 ? 129.904 2.786   0.941   1.00 0.00 ? 33  LEU A HA   1  
ATOM   510   H  HB2  . LEU A 1 33 ? 129.597 4.526   2.638   1.00 0.00 ? 33  LEU A HB2  1  
ATOM   511   H  HB3  . LEU A 1 33 ? 128.279 3.605   3.356   1.00 0.00 ? 33  LEU A HB3  1  
ATOM   512   H  HG   . LEU A 1 33 ? 129.858 1.744   3.810   1.00 0.00 ? 33  LEU A HG   1  
ATOM   513   H  HD11 . LEU A 1 33 ? 131.542 1.898   2.213   1.00 0.00 ? 33  LEU A HD11 1  
ATOM   514   H  HD12 . LEU A 1 33 ? 132.341 2.543   3.648   1.00 0.00 ? 33  LEU A HD12 1  
ATOM   515   H  HD13 . LEU A 1 33 ? 131.718 3.642   2.418   1.00 0.00 ? 33  LEU A HD13 1  
ATOM   516   H  HD21 . LEU A 1 33 ? 129.408 3.786   5.345   1.00 0.00 ? 33  LEU A HD21 1  
ATOM   517   H  HD22 . LEU A 1 33 ? 131.034 4.294   4.889   1.00 0.00 ? 33  LEU A HD22 1  
ATOM   518   H  HD23 . LEU A 1 33 ? 130.792 2.756   5.719   1.00 0.00 ? 33  LEU A HD23 1  
ATOM   519   N  N    . LYS A 1 34 ? 127.224 1.336   2.149   1.00 0.00 ? 34  LYS A N    1  
ATOM   520   C  CA   . LYS A 1 34 ? 126.592 0.061   2.408   1.00 0.00 ? 34  LYS A CA   1  
ATOM   521   C  C    . LYS A 1 34 ? 126.585 -0.794  1.169   1.00 0.00 ? 34  LYS A C    1  
ATOM   522   O  O    . LYS A 1 34 ? 126.854 -1.997  1.209   1.00 0.00 ? 34  LYS A O    1  
ATOM   523   C  CB   . LYS A 1 34 ? 125.169 0.333   2.915   1.00 0.00 ? 34  LYS A CB   1  
ATOM   524   C  CG   . LYS A 1 34 ? 124.334 -0.946  2.937   1.00 0.00 ? 34  LYS A CG   1  
ATOM   525   C  CD   . LYS A 1 34 ? 125.028 -1.998  3.769   1.00 0.00 ? 34  LYS A CD   1  
ATOM   526   C  CE   . LYS A 1 34 ? 124.027 -3.077  4.195   1.00 0.00 ? 34  LYS A CE   1  
ATOM   527   N  NZ   . LYS A 1 34 ? 122.831 -3.031  3.306   1.00 0.00 ? 34  LYS A NZ   1  
ATOM   528   H  H    . LYS A 1 34 ? 126.700 2.159   2.249   1.00 0.00 ? 34  LYS A H    1  
ATOM   529   H  HA   . LYS A 1 34 ? 127.141 -0.451  3.182   1.00 0.00 ? 34  LYS A HA   1  
ATOM   530   H  HB2  . LYS A 1 34 ? 125.228 0.729   3.923   1.00 0.00 ? 34  LYS A HB2  1  
ATOM   531   H  HB3  . LYS A 1 34 ? 124.693 1.060   2.274   1.00 0.00 ? 34  LYS A HB3  1  
ATOM   532   H  HG2  . LYS A 1 34 ? 123.364 -0.734  3.362   1.00 0.00 ? 34  LYS A HG2  1  
ATOM   533   H  HG3  . LYS A 1 34 ? 124.210 -1.312  1.928   1.00 0.00 ? 34  LYS A HG3  1  
ATOM   534   H  HD2  . LYS A 1 34 ? 125.793 -2.445  3.152   1.00 0.00 ? 34  LYS A HD2  1  
ATOM   535   H  HD3  . LYS A 1 34 ? 125.473 -1.544  4.638   1.00 0.00 ? 34  LYS A HD3  1  
ATOM   536   H  HE2  . LYS A 1 34 ? 124.491 -4.050  4.122   1.00 0.00 ? 34  LYS A HE2  1  
ATOM   537   H  HE3  . LYS A 1 34 ? 123.723 -2.899  5.217   1.00 0.00 ? 34  LYS A HE3  1  
ATOM   538   H  HZ1  . LYS A 1 34 ? 122.089 -2.454  3.752   1.00 0.00 ? 34  LYS A HZ1  1  
ATOM   539   H  HZ2  . LYS A 1 34 ? 122.475 -3.998  3.155   1.00 0.00 ? 34  LYS A HZ2  1  
ATOM   540   H  HZ3  . LYS A 1 34 ? 123.092 -2.610  2.393   1.00 0.00 ? 34  LYS A HZ3  1  
ATOM   541   N  N    . GLU A 1 35 ? 126.285 -0.159  0.068   1.00 0.00 ? 35  GLU A N    1  
ATOM   542   C  CA   . GLU A 1 35 ? 126.241 -0.856  -1.195  1.00 0.00 ? 35  GLU A CA   1  
ATOM   543   C  C    . GLU A 1 35 ? 127.625 -1.271  -1.677  1.00 0.00 ? 35  GLU A C    1  
ATOM   544   O  O    . GLU A 1 35 ? 127.782 -2.368  -2.204  1.00 0.00 ? 35  GLU A O    1  
ATOM   545   C  CB   . GLU A 1 35 ? 125.521 0.034   -2.187  1.00 0.00 ? 35  GLU A CB   1  
ATOM   546   C  CG   . GLU A 1 35 ? 124.077 0.168   -1.695  1.00 0.00 ? 35  GLU A CG   1  
ATOM   547   C  CD   . GLU A 1 35 ? 123.349 -1.169  -1.812  1.00 0.00 ? 35  GLU A CD   1  
ATOM   548   O  OE1  . GLU A 1 35 ? 123.846 -2.032  -2.516  1.00 0.00 ? 35  GLU A OE1  1  
ATOM   549   O  OE2  . GLU A 1 35 ? 122.307 -1.309  -1.194  1.00 0.00 ? 35  GLU A OE2  1  
ATOM   550   H  H    . GLU A 1 35 ? 126.101 0.808   0.106   1.00 0.00 ? 35  GLU A H    1  
ATOM   551   H  HA   . GLU A 1 35 ? 125.659 -1.753  -1.061  1.00 0.00 ? 35  GLU A HA   1  
ATOM   552   H  HB2  . GLU A 1 35 ? 125.994 1.006   -2.222  1.00 0.00 ? 35  GLU A HB2  1  
ATOM   553   H  HB3  . GLU A 1 35 ? 125.531 -0.418  -3.166  1.00 0.00 ? 35  GLU A HB3  1  
ATOM   554   H  HG2  . GLU A 1 35 ? 124.099 0.450   -0.642  1.00 0.00 ? 35  GLU A HG2  1  
ATOM   555   H  HG3  . GLU A 1 35 ? 123.558 0.921   -2.269  1.00 0.00 ? 35  GLU A HG3  1  
ATOM   556   N  N    . LEU A 1 36 ? 128.636 -0.421  -1.484  1.00 0.00 ? 36  LEU A N    1  
ATOM   557   C  CA   . LEU A 1 36 ? 129.981 -0.794  -1.911  1.00 0.00 ? 36  LEU A CA   1  
ATOM   558   C  C    . LEU A 1 36 ? 130.528 -1.956  -1.111  1.00 0.00 ? 36  LEU A C    1  
ATOM   559   O  O    . LEU A 1 36 ? 131.036 -2.913  -1.684  1.00 0.00 ? 36  LEU A O    1  
ATOM   560   C  CB   . LEU A 1 36 ? 130.945 0.387   -1.768  1.00 0.00 ? 36  LEU A CB   1  
ATOM   561   C  CG   . LEU A 1 36 ? 130.603 1.477   -2.782  1.00 0.00 ? 36  LEU A CG   1  
ATOM   562   C  CD1  . LEU A 1 36 ? 131.470 2.710   -2.501  1.00 0.00 ? 36  LEU A CD1  1  
ATOM   563   C  CD2  . LEU A 1 36 ? 130.893 0.957   -4.205  1.00 0.00 ? 36  LEU A CD2  1  
ATOM   564   H  H    . LEU A 1 36 ? 128.478 0.441   -1.044  1.00 0.00 ? 36  LEU A H    1  
ATOM   565   H  HA   . LEU A 1 36 ? 129.948 -1.084  -2.948  1.00 0.00 ? 36  LEU A HA   1  
ATOM   566   H  HB2  . LEU A 1 36 ? 130.866 0.791   -0.769  1.00 0.00 ? 36  LEU A HB2  1  
ATOM   567   H  HB3  . LEU A 1 36 ? 131.956 0.047   -1.936  1.00 0.00 ? 36  LEU A HB3  1  
ATOM   568   H  HG   . LEU A 1 36 ? 129.561 1.739   -2.699  1.00 0.00 ? 36  LEU A HG   1  
ATOM   569   H  HD11 . LEU A 1 36 ? 131.246 3.480   -3.224  1.00 0.00 ? 36  LEU A HD11 1  
ATOM   570   H  HD12 . LEU A 1 36 ? 132.513 2.441   -2.575  1.00 0.00 ? 36  LEU A HD12 1  
ATOM   571   H  HD13 . LEU A 1 36 ? 131.263 3.078   -1.508  1.00 0.00 ? 36  LEU A HD13 1  
ATOM   572   H  HD21 . LEU A 1 36 ? 131.466 1.688   -4.751  1.00 0.00 ? 36  LEU A HD21 1  
ATOM   573   H  HD22 . LEU A 1 36 ? 129.961 0.778   -4.718  1.00 0.00 ? 36  LEU A HD22 1  
ATOM   574   H  HD23 . LEU A 1 36 ? 131.457 0.034   -4.159  1.00 0.00 ? 36  LEU A HD23 1  
ATOM   575   N  N    . LEU A 1 37 ? 130.422 -1.889  0.208   1.00 0.00 ? 37  LEU A N    1  
ATOM   576   C  CA   . LEU A 1 37 ? 130.939 -2.983  1.011   1.00 0.00 ? 37  LEU A CA   1  
ATOM   577   C  C    . LEU A 1 37 ? 130.101 -4.236  0.819   1.00 0.00 ? 37  LEU A C    1  
ATOM   578   O  O    . LEU A 1 37 ? 130.631 -5.342  0.668   1.00 0.00 ? 37  LEU A O    1  
ATOM   579   C  CB   . LEU A 1 37 ? 130.928 -2.589  2.490   1.00 0.00 ? 37  LEU A CB   1  
ATOM   580   C  CG   . LEU A 1 37 ? 131.753 -1.314  2.705   1.00 0.00 ? 37  LEU A CG   1  
ATOM   581   C  CD1  . LEU A 1 37 ? 131.826 -1.005  4.203   1.00 0.00 ? 37  LEU A CD1  1  
ATOM   582   C  CD2  . LEU A 1 37 ? 133.173 -1.509  2.157   1.00 0.00 ? 37  LEU A CD2  1  
ATOM   583   H  H    . LEU A 1 37 ? 130.003 -1.109  0.638   1.00 0.00 ? 37  LEU A H    1  
ATOM   584   H  HA   . LEU A 1 37 ? 131.953 -3.191  0.710   1.00 0.00 ? 37  LEU A HA   1  
ATOM   585   H  HB2  . LEU A 1 37 ? 129.910 -2.413  2.805   1.00 0.00 ? 37  LEU A HB2  1  
ATOM   586   H  HB3  . LEU A 1 37 ? 131.349 -3.390  3.076   1.00 0.00 ? 37  LEU A HB3  1  
ATOM   587   H  HG   . LEU A 1 37 ? 131.278 -0.490  2.192   1.00 0.00 ? 37  LEU A HG   1  
ATOM   588   H  HD11 . LEU A 1 37 ? 132.611 -1.592  4.653   1.00 0.00 ? 37  LEU A HD11 1  
ATOM   589   H  HD12 . LEU A 1 37 ? 130.882 -1.250  4.666   1.00 0.00 ? 37  LEU A HD12 1  
ATOM   590   H  HD13 . LEU A 1 37 ? 132.035 0.045   4.344   1.00 0.00 ? 37  LEU A HD13 1  
ATOM   591   H  HD21 . LEU A 1 37 ? 133.466 -2.538  2.270   1.00 0.00 ? 37  LEU A HD21 1  
ATOM   592   H  HD22 . LEU A 1 37 ? 133.861 -0.882  2.702   1.00 0.00 ? 37  LEU A HD22 1  
ATOM   593   H  HD23 . LEU A 1 37 ? 133.194 -1.242  1.110   1.00 0.00 ? 37  LEU A HD23 1  
ATOM   594   N  N    . GLN A 1 38 ? 128.785 -4.046  0.829   1.00 0.00 ? 38  GLN A N    1  
ATOM   595   C  CA   . GLN A 1 38 ? 127.858 -5.153  0.677   1.00 0.00 ? 38  GLN A CA   1  
ATOM   596   C  C    . GLN A 1 38 ? 127.949 -5.837  -0.677  1.00 0.00 ? 38  GLN A C    1  
ATOM   597   O  O    . GLN A 1 38 ? 127.885 -7.060  -0.758  1.00 0.00 ? 38  GLN A O    1  
ATOM   598   C  CB   . GLN A 1 38 ? 126.435 -4.649  0.907   1.00 0.00 ? 38  GLN A CB   1  
ATOM   599   C  CG   . GLN A 1 38 ? 125.464 -5.824  0.885   1.00 0.00 ? 38  GLN A CG   1  
ATOM   600   C  CD   . GLN A 1 38 ? 124.049 -5.339  1.178   1.00 0.00 ? 38  GLN A CD   1  
ATOM   601   O  OE1  . GLN A 1 38 ? 123.850 -4.174  1.517   1.00 0.00 ? 38  GLN A OE1  1  
ATOM   602   N  NE2  . GLN A 1 38 ? 123.048 -6.169  1.065   1.00 0.00 ? 38  GLN A NE2  1  
ATOM   603   H  H    . GLN A 1 38 ? 128.430 -3.137  0.955   1.00 0.00 ? 38  GLN A H    1  
ATOM   604   H  HA   . GLN A 1 38 ? 128.081 -5.883  1.433   1.00 0.00 ? 38  GLN A HA   1  
ATOM   605   H  HB2  . GLN A 1 38 ? 126.383 -4.163  1.865   1.00 0.00 ? 38  GLN A HB2  1  
ATOM   606   H  HB3  . GLN A 1 38 ? 126.169 -3.949  0.130   1.00 0.00 ? 38  GLN A HB3  1  
ATOM   607   H  HG2  . GLN A 1 38 ? 125.487 -6.276  -0.089  1.00 0.00 ? 38  GLN A HG2  1  
ATOM   608   H  HG3  . GLN A 1 38 ? 125.757 -6.550  1.625   1.00 0.00 ? 38  GLN A HG3  1  
ATOM   609   H  HE21 . GLN A 1 38 ? 123.208 -7.097  0.794   1.00 0.00 ? 38  GLN A HE21 1  
ATOM   610   H  HE22 . GLN A 1 38 ? 122.136 -5.865  1.252   1.00 0.00 ? 38  GLN A HE22 1  
ATOM   611   N  N    . THR A 1 39 ? 128.069 -5.057  -1.740  1.00 0.00 ? 39  THR A N    1  
ATOM   612   C  CA   . THR A 1 39 ? 128.133 -5.645  -3.067  1.00 0.00 ? 39  THR A CA   1  
ATOM   613   C  C    . THR A 1 39 ? 129.542 -6.104  -3.433  1.00 0.00 ? 39  THR A C    1  
ATOM   614   O  O    . THR A 1 39 ? 129.722 -7.204  -3.953  1.00 0.00 ? 39  THR A O    1  
ATOM   615   C  CB   . THR A 1 39 ? 127.604 -4.652  -4.114  1.00 0.00 ? 39  THR A CB   1  
ATOM   616   O  OG1  . THR A 1 39 ? 127.120 -5.373  -5.239  1.00 0.00 ? 39  THR A OG1  1  
ATOM   617   C  CG2  . THR A 1 39 ? 128.714 -3.700  -4.561  1.00 0.00 ? 39  THR A CG2  1  
ATOM   618   H  H    . THR A 1 39 ? 128.096 -4.083  -1.633  1.00 0.00 ? 39  THR A H    1  
ATOM   619   H  HA   . THR A 1 39 ? 127.487 -6.511  -3.076  1.00 0.00 ? 39  THR A HA   1  
ATOM   620   H  HB   . THR A 1 39 ? 126.797 -4.078  -3.685  1.00 0.00 ? 39  THR A HB   1  
ATOM   621   H  HG1  . THR A 1 39 ? 126.825 -4.736  -5.894  1.00 0.00 ? 39  THR A HG1  1  
ATOM   622   H  HG21 . THR A 1 39 ? 129.196 -3.280  -3.694  1.00 0.00 ? 39  THR A HG21 1  
ATOM   623   H  HG22 . THR A 1 39 ? 128.289 -2.905  -5.156  1.00 0.00 ? 39  THR A HG22 1  
ATOM   624   H  HG23 . THR A 1 39 ? 129.440 -4.241  -5.152  1.00 0.00 ? 39  THR A HG23 1  
ATOM   625   N  N    . GLU A 1 40 ? 130.540 -5.254  -3.190  1.00 0.00 ? 40  GLU A N    1  
ATOM   626   C  CA   . GLU A 1 40 ? 131.908 -5.621  -3.546  1.00 0.00 ? 40  GLU A CA   1  
ATOM   627   C  C    . GLU A 1 40 ? 132.472 -6.675  -2.599  1.00 0.00 ? 40  GLU A C    1  
ATOM   628   O  O    . GLU A 1 40 ? 133.245 -7.538  -3.015  1.00 0.00 ? 40  GLU A O    1  
ATOM   629   C  CB   . GLU A 1 40 ? 132.808 -4.381  -3.540  1.00 0.00 ? 40  GLU A CB   1  
ATOM   630   C  CG   . GLU A 1 40 ? 132.313 -3.397  -4.608  1.00 0.00 ? 40  GLU A CG   1  
ATOM   631   C  CD   . GLU A 1 40 ? 133.223 -2.177  -4.685  1.00 0.00 ? 40  GLU A CD   1  
ATOM   632   O  OE1  . GLU A 1 40 ? 134.055 -2.026  -3.812  1.00 0.00 ? 40  GLU A OE1  1  
ATOM   633   O  OE2  . GLU A 1 40 ? 133.073 -1.410  -5.621  1.00 0.00 ? 40  GLU A OE2  1  
ATOM   634   H  H    . GLU A 1 40 ? 130.354 -4.381  -2.784  1.00 0.00 ? 40  GLU A H    1  
ATOM   635   H  HA   . GLU A 1 40 ? 131.901 -6.030  -4.545  1.00 0.00 ? 40  GLU A HA   1  
ATOM   636   H  HB2  . GLU A 1 40 ? 132.786 -3.917  -2.570  1.00 0.00 ? 40  GLU A HB2  1  
ATOM   637   H  HB3  . GLU A 1 40 ? 133.817 -4.678  -3.770  1.00 0.00 ? 40  GLU A HB3  1  
ATOM   638   H  HG2  . GLU A 1 40 ? 132.296 -3.887  -5.565  1.00 0.00 ? 40  GLU A HG2  1  
ATOM   639   H  HG3  . GLU A 1 40 ? 131.318 -3.076  -4.359  1.00 0.00 ? 40  GLU A HG3  1  
ATOM   640   N  N    . LEU A 1 41 ? 132.081 -6.611  -1.325  1.00 0.00 ? 41  LEU A N    1  
ATOM   641   C  CA   . LEU A 1 41 ? 132.558 -7.580  -0.341  1.00 0.00 ? 41  LEU A CA   1  
ATOM   642   C  C    . LEU A 1 41 ? 131.387 -8.288  0.325   1.00 0.00 ? 41  LEU A C    1  
ATOM   643   O  O    . LEU A 1 41 ? 131.330 -8.389  1.556   1.00 0.00 ? 41  LEU A O    1  
ATOM   644   C  CB   . LEU A 1 41 ? 133.412 -6.887  0.714   1.00 0.00 ? 41  LEU A CB   1  
ATOM   645   C  CG   . LEU A 1 41 ? 134.790 -6.533  0.132   1.00 0.00 ? 41  LEU A CG   1  
ATOM   646   C  CD1  . LEU A 1 41 ? 134.680 -5.339  -0.833  1.00 0.00 ? 41  LEU A CD1  1  
ATOM   647   C  CD2  . LEU A 1 41 ? 135.740 -6.183  1.283   1.00 0.00 ? 41  LEU A CD2  1  
ATOM   648   H  H    . LEU A 1 41 ? 131.455 -5.905  -1.040  1.00 0.00 ? 41  LEU A H    1  
ATOM   649   H  HA   . LEU A 1 41 ? 133.164 -8.321  -0.843  1.00 0.00 ? 41  LEU A HA   1  
ATOM   650   H  HB2  . LEU A 1 41 ? 132.915 -5.989  1.047   1.00 0.00 ? 41  LEU A HB2  1  
ATOM   651   H  HB3  . LEU A 1 41 ? 133.541 -7.556  1.546   1.00 0.00 ? 41  LEU A HB3  1  
ATOM   652   H  HG   . LEU A 1 41 ? 135.180 -7.387  -0.402  1.00 0.00 ? 41  LEU A HG   1  
ATOM   653   H  HD11 . LEU A 1 41 ? 135.519 -4.673  -0.687  1.00 0.00 ? 41  LEU A HD11 1  
ATOM   654   H  HD12 . LEU A 1 41 ? 133.762 -4.799  -0.655  1.00 0.00 ? 41  LEU A HD12 1  
ATOM   655   H  HD13 . LEU A 1 41 ? 134.689 -5.701  -1.851  1.00 0.00 ? 41  LEU A HD13 1  
ATOM   656   H  HD21 . LEU A 1 41 ? 136.659 -5.785  0.882   1.00 0.00 ? 41  LEU A HD21 1  
ATOM   657   H  HD22 . LEU A 1 41 ? 135.953 -7.073  1.858   1.00 0.00 ? 41  LEU A HD22 1  
ATOM   658   H  HD23 . LEU A 1 41 ? 135.277 -5.445  1.920   1.00 0.00 ? 41  LEU A HD23 1  
ATOM   659   N  N    . SER A 1 42 ? 130.453 -8.762  -0.489  1.00 0.00 ? 42  SER A N    1  
ATOM   660   C  CA   . SER A 1 42 ? 129.272 -9.440  0.025   1.00 0.00 ? 42  SER A CA   1  
ATOM   661   C  C    . SER A 1 42 ? 129.662 -10.590 0.940   1.00 0.00 ? 42  SER A C    1  
ATOM   662   O  O    . SER A 1 42 ? 128.953 -10.894 1.896   1.00 0.00 ? 42  SER A O    1  
ATOM   663   C  CB   . SER A 1 42 ? 128.437 -9.984  -1.136  1.00 0.00 ? 42  SER A CB   1  
ATOM   664   O  OG   . SER A 1 42 ? 128.150 -8.932  -2.047  1.00 0.00 ? 42  SER A OG   1  
ATOM   665   H  H    . SER A 1 42 ? 130.554 -8.641  -1.457  1.00 0.00 ? 42  SER A H    1  
ATOM   666   H  HA   . SER A 1 42 ? 128.675 -8.735  0.583   1.00 0.00 ? 42  SER A HA   1  
ATOM   667   H  HB2  . SER A 1 42 ? 128.990 -10.754 -1.648  1.00 0.00 ? 42  SER A HB2  1  
ATOM   668   H  HB3  . SER A 1 42 ? 127.516 -10.401 -0.750  1.00 0.00 ? 42  SER A HB3  1  
ATOM   669   H  HG   . SER A 1 42 ? 127.649 -9.300  -2.778  1.00 0.00 ? 42  SER A HG   1  
ATOM   670   N  N    . GLY A 1 43 ? 130.775 -11.238 0.634   1.00 0.00 ? 43  GLY A N    1  
ATOM   671   C  CA   . GLY A 1 43 ? 131.229 -12.366 1.435   1.00 0.00 ? 43  GLY A CA   1  
ATOM   672   C  C    . GLY A 1 43 ? 132.025 -11.926 2.667   1.00 0.00 ? 43  GLY A C    1  
ATOM   673   O  O    . GLY A 1 43 ? 131.608 -12.163 3.801   1.00 0.00 ? 43  GLY A O    1  
ATOM   674   H  H    . GLY A 1 43 ? 131.296 -10.962 -0.149  1.00 0.00 ? 43  GLY A H    1  
ATOM   675   H  HA2  . GLY A 1 43 ? 130.370 -12.933 1.759   1.00 0.00 ? 43  GLY A HA2  1  
ATOM   676   H  HA3  . GLY A 1 43 ? 131.856 -13.000 0.824   1.00 0.00 ? 43  GLY A HA3  1  
ATOM   677   N  N    . PHE A 1 44 ? 133.193 -11.331 2.436   1.00 0.00 ? 44  PHE A N    1  
ATOM   678   C  CA   . PHE A 1 44 ? 134.065 -10.915 3.535   1.00 0.00 ? 44  PHE A CA   1  
ATOM   679   C  C    . PHE A 1 44 ? 133.391 -9.928  4.500   1.00 0.00 ? 44  PHE A C    1  
ATOM   680   O  O    . PHE A 1 44 ? 133.529 -10.053 5.717   1.00 0.00 ? 44  PHE A O    1  
ATOM   681   C  CB   . PHE A 1 44 ? 135.320 -10.266 2.954   1.00 0.00 ? 44  PHE A CB   1  
ATOM   682   C  CG   . PHE A 1 44 ? 136.099 -11.300 2.177   1.00 0.00 ? 44  PHE A CG   1  
ATOM   683   C  CD1  . PHE A 1 44 ? 136.967 -12.174 2.842   1.00 0.00 ? 44  PHE A CD1  1  
ATOM   684   C  CD2  . PHE A 1 44 ? 135.952 -11.385 0.787   1.00 0.00 ? 44  PHE A CD2  1  
ATOM   685   C  CE1  . PHE A 1 44 ? 137.687 -13.131 2.117   1.00 0.00 ? 44  PHE A CE1  1  
ATOM   686   C  CE2  . PHE A 1 44 ? 136.672 -12.342 0.063   1.00 0.00 ? 44  PHE A CE2  1  
ATOM   687   C  CZ   . PHE A 1 44 ? 137.540 -13.216 0.729   1.00 0.00 ? 44  PHE A CZ   1  
ATOM   688   H  H    . PHE A 1 44 ? 133.490 -11.200 1.511   1.00 0.00 ? 44  PHE A H    1  
ATOM   689   H  HA   . PHE A 1 44 ? 134.368 -11.787 4.084   1.00 0.00 ? 44  PHE A HA   1  
ATOM   690   H  HB2  . PHE A 1 44 ? 135.036 -9.457  2.297   1.00 0.00 ? 44  PHE A HB2  1  
ATOM   691   H  HB3  . PHE A 1 44 ? 135.933 -9.882  3.755   1.00 0.00 ? 44  PHE A HB3  1  
ATOM   692   H  HD1  . PHE A 1 44 ? 137.081 -12.110 3.914   1.00 0.00 ? 44  PHE A HD1  1  
ATOM   693   H  HD2  . PHE A 1 44 ? 135.282 -10.711 0.273   1.00 0.00 ? 44  PHE A HD2  1  
ATOM   694   H  HE1  . PHE A 1 44 ? 138.358 -13.805 2.631   1.00 0.00 ? 44  PHE A HE1  1  
ATOM   695   H  HE2  . PHE A 1 44 ? 136.559 -12.407 -1.009  1.00 0.00 ? 44  PHE A HE2  1  
ATOM   696   H  HZ   . PHE A 1 44 ? 138.096 -13.954 0.170   1.00 0.00 ? 44  PHE A HZ   1  
ATOM   697   N  N    . LEU A 1 45 ? 132.680 -8.947  3.955   1.00 0.00 ? 45  LEU A N    1  
ATOM   698   C  CA   . LEU A 1 45 ? 132.002 -7.932  4.773   1.00 0.00 ? 45  LEU A CA   1  
ATOM   699   C  C    . LEU A 1 45 ? 130.529 -8.245  5.029   1.00 0.00 ? 45  LEU A C    1  
ATOM   700   O  O    . LEU A 1 45 ? 129.856 -7.456  5.683   1.00 0.00 ? 45  LEU A O    1  
ATOM   701   C  CB   . LEU A 1 45 ? 132.160 -6.539  4.156   1.00 0.00 ? 45  LEU A CB   1  
ATOM   702   C  CG   . LEU A 1 45 ? 133.482 -5.903  4.629   1.00 0.00 ? 45  LEU A CG   1  
ATOM   703   C  CD1  . LEU A 1 45 ? 134.665 -6.847  4.377   1.00 0.00 ? 45  LEU A CD1  1  
ATOM   704   C  CD2  . LEU A 1 45 ? 133.705 -4.590  3.877   1.00 0.00 ? 45  LEU A CD2  1  
ATOM   705   H  H    . LEU A 1 45 ? 132.608 -8.892  2.973   1.00 0.00 ? 45  LEU A H    1  
ATOM   706   H  HA   . LEU A 1 45 ? 132.491 -7.919  5.737   1.00 0.00 ? 45  LEU A HA   1  
ATOM   707   H  HB2  . LEU A 1 45 ? 132.161 -6.623  3.083   1.00 0.00 ? 45  LEU A HB2  1  
ATOM   708   H  HB3  . LEU A 1 45 ? 131.336 -5.913  4.464   1.00 0.00 ? 45  LEU A HB3  1  
ATOM   709   H  HG   . LEU A 1 45 ? 133.415 -5.699  5.688   1.00 0.00 ? 45  LEU A HG   1  
ATOM   710   H  HD11 . LEU A 1 45 ? 134.448 -7.489  3.544   1.00 0.00 ? 45  LEU A HD11 1  
ATOM   711   H  HD12 . LEU A 1 45 ? 134.836 -7.450  5.256   1.00 0.00 ? 45  LEU A HD12 1  
ATOM   712   H  HD13 . LEU A 1 45 ? 135.555 -6.268  4.163   1.00 0.00 ? 45  LEU A HD13 1  
ATOM   713   H  HD21 . LEU A 1 45 ? 133.341 -4.691  2.868   1.00 0.00 ? 45  LEU A HD21 1  
ATOM   714   H  HD22 . LEU A 1 45 ? 134.759 -4.359  3.860   1.00 0.00 ? 45  LEU A HD22 1  
ATOM   715   H  HD23 . LEU A 1 45 ? 133.171 -3.794  4.376   1.00 0.00 ? 45  LEU A HD23 1  
ATOM   716   N  N    . ASP A 1 46 ? 130.033 -9.355  4.475   1.00 0.00 ? 46  ASP A N    1  
ATOM   717   C  CA   . ASP A 1 46 ? 128.613 -9.727  4.604   1.00 0.00 ? 46  ASP A CA   1  
ATOM   718   C  C    . ASP A 1 46 ? 127.918 -9.010  5.766   1.00 0.00 ? 46  ASP A C    1  
ATOM   719   O  O    . ASP A 1 46 ? 127.658 -9.583  6.823   1.00 0.00 ? 46  ASP A O    1  
ATOM   720   C  CB   . ASP A 1 46 ? 128.502 -11.242 4.809   1.00 0.00 ? 46  ASP A CB   1  
ATOM   721   C  CG   . ASP A 1 46 ? 129.200 -11.657 6.103   1.00 0.00 ? 46  ASP A CG   1  
ATOM   722   O  OD1  . ASP A 1 46 ? 129.565 -10.782 6.869   1.00 0.00 ? 46  ASP A OD1  1  
ATOM   723   O  OD2  . ASP A 1 46 ? 129.380 -12.849 6.296   1.00 0.00 ? 46  ASP A OD2  1  
ATOM   724   H  H    . ASP A 1 46 ? 130.624 -9.919  3.933   1.00 0.00 ? 46  ASP A H    1  
ATOM   725   H  HA   . ASP A 1 46 ? 128.106 -9.471  3.687   1.00 0.00 ? 46  ASP A HA   1  
ATOM   726   H  HB2  . ASP A 1 46 ? 127.460 -11.520 4.861   1.00 0.00 ? 46  ASP A HB2  1  
ATOM   727   H  HB3  . ASP A 1 46 ? 128.965 -11.754 3.980   1.00 0.00 ? 46  ASP A HB3  1  
ATOM   728   N  N    . ALA A 1 47 ? 127.611 -7.734  5.524   1.00 0.00 ? 47  ALA A N    1  
ATOM   729   C  CA   . ALA A 1 47 ? 126.938 -6.880  6.498   1.00 0.00 ? 47  ALA A CA   1  
ATOM   730   C  C    . ALA A 1 47 ? 125.522 -7.369  6.780   1.00 0.00 ? 47  ALA A C    1  
ATOM   731   O  O    . ALA A 1 47 ? 124.924 -7.008  7.795   1.00 0.00 ? 47  ALA A O    1  
ATOM   732   C  CB   . ALA A 1 47 ? 126.886 -5.443  5.979   1.00 0.00 ? 47  ALA A CB   1  
ATOM   733   H  H    . ALA A 1 47 ? 127.844 -7.356  4.650   1.00 0.00 ? 47  ALA A H    1  
ATOM   734   H  HA   . ALA A 1 47 ? 127.501 -6.893  7.419   1.00 0.00 ? 47  ALA A HA   1  
ATOM   735   H  HB1  . ALA A 1 47 ? 126.236 -5.395  5.117   1.00 0.00 ? 47  ALA A HB1  1  
ATOM   736   H  HB2  . ALA A 1 47 ? 127.879 -5.124  5.699   1.00 0.00 ? 47  ALA A HB2  1  
ATOM   737   H  HB3  . ALA A 1 47 ? 126.504 -4.794  6.753   1.00 0.00 ? 47  ALA A HB3  1  
ATOM   738   N  N    . GLN A 1 48 ? 124.978 -8.164  5.868   1.00 0.00 ? 48  GLN A N    1  
ATOM   739   C  CA   . GLN A 1 48 ? 123.617 -8.662  6.026   1.00 0.00 ? 48  GLN A CA   1  
ATOM   740   C  C    . GLN A 1 48 ? 123.441 -9.360  7.362   1.00 0.00 ? 48  GLN A C    1  
ATOM   741   O  O    . GLN A 1 48 ? 122.381 -9.269  7.982   1.00 0.00 ? 48  GLN A O    1  
ATOM   742   C  CB   . GLN A 1 48 ? 123.304 -9.659  4.910   1.00 0.00 ? 48  GLN A CB   1  
ATOM   743   C  CG   . GLN A 1 48 ? 123.286 -8.939  3.561   1.00 0.00 ? 48  GLN A CG   1  
ATOM   744   C  CD   . GLN A 1 48 ? 123.027 -9.938  2.439   1.00 0.00 ? 48  GLN A CD   1  
ATOM   745   O  OE1  . GLN A 1 48 ? 123.172 -11.145 2.636   1.00 0.00 ? 48  GLN A OE1  1  
ATOM   746   N  NE2  . GLN A 1 48 ? 122.651 -9.506  1.267   1.00 0.00 ? 48  GLN A NE2  1  
ATOM   747   H  H    . GLN A 1 48 ? 125.491 -8.404  5.068   1.00 0.00 ? 48  GLN A H    1  
ATOM   748   H  HA   . GLN A 1 48 ? 122.926 -7.836  5.961   1.00 0.00 ? 48  GLN A HA   1  
ATOM   749   H  HB2  . GLN A 1 48 ? 124.068 -10.424 4.896   1.00 0.00 ? 48  GLN A HB2  1  
ATOM   750   H  HB3  . GLN A 1 48 ? 122.346 -10.118 5.094   1.00 0.00 ? 48  GLN A HB3  1  
ATOM   751   H  HG2  . GLN A 1 48 ? 122.505 -8.192  3.565   1.00 0.00 ? 48  GLN A HG2  1  
ATOM   752   H  HG3  . GLN A 1 48 ? 124.239 -8.458  3.399   1.00 0.00 ? 48  GLN A HG3  1  
ATOM   753   H  HE21 . GLN A 1 48 ? 122.537 -8.545  1.113   1.00 0.00 ? 48  GLN A HE21 1  
ATOM   754   H  HE22 . GLN A 1 48 ? 122.484 -10.142 0.541   1.00 0.00 ? 48  GLN A HE22 1  
ATOM   755   N  N    . LYS A 1 49 ? 124.474 -10.053 7.806   1.00 0.00 ? 49  LYS A N    1  
ATOM   756   C  CA   . LYS A 1 49 ? 124.397 -10.750 9.074   1.00 0.00 ? 49  LYS A CA   1  
ATOM   757   C  C    . LYS A 1 49 ? 124.114 -9.774  10.213  1.00 0.00 ? 49  LYS A C    1  
ATOM   758   O  O    . LYS A 1 49 ? 123.397 -10.101 11.158  1.00 0.00 ? 49  LYS A O    1  
ATOM   759   C  CB   . LYS A 1 49 ? 125.675 -11.506 9.318   1.00 0.00 ? 49  LYS A CB   1  
ATOM   760   C  CG   . LYS A 1 49 ? 125.795 -12.561 8.220   1.00 0.00 ? 49  LYS A CG   1  
ATOM   761   C  CD   . LYS A 1 49 ? 126.993 -13.443 8.520   1.00 0.00 ? 49  LYS A CD   1  
ATOM   762   C  CE   . LYS A 1 49 ? 126.626 -14.515 9.558   1.00 0.00 ? 49  LYS A CE   1  
ATOM   763   N  NZ   . LYS A 1 49 ? 126.431 -15.822 8.868   1.00 0.00 ? 49  LYS A NZ   1  
ATOM   764   H  H    . LYS A 1 49 ? 125.297 -10.093 7.277   1.00 0.00 ? 49  LYS A H    1  
ATOM   765   H  HA   . LYS A 1 49 ? 123.607 -11.470 9.022   1.00 0.00 ? 49  LYS A HA   1  
ATOM   766   H  HB2  . LYS A 1 49 ? 126.517 -10.827 9.273   1.00 0.00 ? 49  LYS A HB2  1  
ATOM   767   H  HB3  . LYS A 1 49 ? 125.640 -11.986 10.282  1.00 0.00 ? 49  LYS A HB3  1  
ATOM   768   H  HG2  . LYS A 1 49 ? 124.893 -13.155 8.182   1.00 0.00 ? 49  LYS A HG2  1  
ATOM   769   H  HG3  . LYS A 1 49 ? 125.942 -12.072 7.269   1.00 0.00 ? 49  LYS A HG3  1  
ATOM   770   H  HD2  . LYS A 1 49 ? 127.336 -13.915 7.611   1.00 0.00 ? 49  LYS A HD2  1  
ATOM   771   H  HD3  . LYS A 1 49 ? 127.767 -12.818 8.917   1.00 0.00 ? 49  LYS A HD3  1  
ATOM   772   H  HE2  . LYS A 1 49 ? 127.426 -14.608 10.278  1.00 0.00 ? 49  LYS A HE2  1  
ATOM   773   H  HE3  . LYS A 1 49 ? 125.716 -14.240 10.069  1.00 0.00 ? 49  LYS A HE3  1  
ATOM   774   H  HZ1  . LYS A 1 49 ? 125.467 -16.168 9.047   1.00 0.00 ? 49  LYS A HZ1  1  
ATOM   775   H  HZ2  . LYS A 1 49 ? 127.121 -16.512 9.231   1.00 0.00 ? 49  LYS A HZ2  1  
ATOM   776   H  HZ3  . LYS A 1 49 ? 126.567 -15.698 7.846   1.00 0.00 ? 49  LYS A HZ3  1  
ATOM   777   N  N    . ASP A 1 50 ? 124.676 -8.570  10.105  1.00 0.00 ? 50  ASP A N    1  
ATOM   778   C  CA   . ASP A 1 50 ? 124.472 -7.540  11.122  1.00 0.00 ? 50  ASP A CA   1  
ATOM   779   C  C    . ASP A 1 50 ? 124.295 -6.168  10.472  1.00 0.00 ? 50  ASP A C    1  
ATOM   780   O  O    . ASP A 1 50 ? 125.270 -5.455  10.236  1.00 0.00 ? 50  ASP A O    1  
ATOM   781   C  CB   . ASP A 1 50 ? 125.674 -7.496  12.071  1.00 0.00 ? 50  ASP A CB   1  
ATOM   782   C  CG   . ASP A 1 50 ? 125.750 -8.781  12.890  1.00 0.00 ? 50  ASP A CG   1  
ATOM   783   O  OD1  . ASP A 1 50 ? 124.779 -9.517  12.892  1.00 0.00 ? 50  ASP A OD1  1  
ATOM   784   O  OD2  . ASP A 1 50 ? 126.780 -9.008  13.502  1.00 0.00 ? 50  ASP A OD2  1  
ATOM   785   H  H    . ASP A 1 50 ? 125.229 -8.368  9.322   1.00 0.00 ? 50  ASP A H    1  
ATOM   786   H  HA   . ASP A 1 50 ? 123.586 -7.776  11.692  1.00 0.00 ? 50  ASP A HA   1  
ATOM   787   H  HB2  . ASP A 1 50 ? 126.581 -7.386  11.494  1.00 0.00 ? 50  ASP A HB2  1  
ATOM   788   H  HB3  . ASP A 1 50 ? 125.571 -6.654  12.739  1.00 0.00 ? 50  ASP A HB3  1  
ATOM   789   N  N    . VAL A 1 51 ? 123.048 -5.800  10.188  1.00 0.00 ? 51  VAL A N    1  
ATOM   790   C  CA   . VAL A 1 51 ? 122.765 -4.506  9.570   1.00 0.00 ? 51  VAL A CA   1  
ATOM   791   C  C    . VAL A 1 51 ? 123.222 -3.367  10.478  1.00 0.00 ? 51  VAL A C    1  
ATOM   792   O  O    . VAL A 1 51 ? 123.757 -2.360  10.013  1.00 0.00 ? 51  VAL A O    1  
ATOM   793   C  CB   . VAL A 1 51 ? 121.265 -4.375  9.300   1.00 0.00 ? 51  VAL A CB   1  
ATOM   794   C  CG1  . VAL A 1 51 ? 120.953 -2.956  8.822   1.00 0.00 ? 51  VAL A CG1  1  
ATOM   795   C  CG2  . VAL A 1 51 ? 120.852 -5.378  8.221   1.00 0.00 ? 51  VAL A CG2  1  
ATOM   796   H  H    . VAL A 1 51 ? 122.307 -6.405  10.401  1.00 0.00 ? 51  VAL A H    1  
ATOM   797   H  HA   . VAL A 1 51 ? 123.295 -4.442  8.631   1.00 0.00 ? 51  VAL A HA   1  
ATOM   798   H  HB   . VAL A 1 51 ? 120.716 -4.576  10.210  1.00 0.00 ? 51  VAL A HB   1  
ATOM   799   H  HG11 . VAL A 1 51 ? 121.041 -2.269  9.651   1.00 0.00 ? 51  VAL A HG11 1  
ATOM   800   H  HG12 . VAL A 1 51 ? 119.947 -2.921  8.430   1.00 0.00 ? 51  VAL A HG12 1  
ATOM   801   H  HG13 . VAL A 1 51 ? 121.651 -2.676  8.047   1.00 0.00 ? 51  VAL A HG13 1  
ATOM   802   H  HG21 . VAL A 1 51 ? 121.275 -5.080  7.272   1.00 0.00 ? 51  VAL A HG21 1  
ATOM   803   H  HG22 . VAL A 1 51 ? 119.775 -5.401  8.144   1.00 0.00 ? 51  VAL A HG22 1  
ATOM   804   H  HG23 . VAL A 1 51 ? 121.216 -6.360  8.484   1.00 0.00 ? 51  VAL A HG23 1  
ATOM   805   N  N    . ASP A 1 52 ? 123.005 -3.542  11.776  1.00 0.00 ? 52  ASP A N    1  
ATOM   806   C  CA   . ASP A 1 52 ? 123.389 -2.539  12.765  1.00 0.00 ? 52  ASP A CA   1  
ATOM   807   C  C    . ASP A 1 52 ? 124.875 -2.208  12.661  1.00 0.00 ? 52  ASP A C    1  
ATOM   808   O  O    . ASP A 1 52 ? 125.292 -1.082  12.932  1.00 0.00 ? 52  ASP A O    1  
ATOM   809   C  CB   . ASP A 1 52 ? 123.079 -3.053  14.173  1.00 0.00 ? 52  ASP A CB   1  
ATOM   810   C  CG   . ASP A 1 52 ? 123.269 -1.933  15.190  1.00 0.00 ? 52  ASP A CG   1  
ATOM   811   O  OD1  . ASP A 1 52 ? 123.522 -0.815  14.771  1.00 0.00 ? 52  ASP A OD1  1  
ATOM   812   O  OD2  . ASP A 1 52 ? 123.157 -2.209  16.373  1.00 0.00 ? 52  ASP A OD2  1  
ATOM   813   H  H    . ASP A 1 52 ? 122.574 -4.369  12.078  1.00 0.00 ? 52  ASP A H    1  
ATOM   814   H  HA   . ASP A 1 52 ? 122.818 -1.640  12.591  1.00 0.00 ? 52  ASP A HA   1  
ATOM   815   H  HB2  . ASP A 1 52 ? 122.057 -3.402  14.209  1.00 0.00 ? 52  ASP A HB2  1  
ATOM   816   H  HB3  . ASP A 1 52 ? 123.745 -3.869  14.411  1.00 0.00 ? 52  ASP A HB3  1  
ATOM   817   N  N    . ALA A 1 53 ? 125.669 -3.207  12.298  1.00 0.00 ? 53  ALA A N    1  
ATOM   818   C  CA   . ALA A 1 53 ? 127.114 -3.037  12.195  1.00 0.00 ? 53  ALA A CA   1  
ATOM   819   C  C    . ALA A 1 53 ? 127.494 -1.927  11.214  1.00 0.00 ? 53  ALA A C    1  
ATOM   820   O  O    . ALA A 1 53 ? 128.543 -1.301  11.367  1.00 0.00 ? 53  ALA A O    1  
ATOM   821   C  CB   . ALA A 1 53 ? 127.756 -4.350  11.746  1.00 0.00 ? 53  ALA A CB   1  
ATOM   822   H  H    . ALA A 1 53 ? 125.277 -4.088  12.119  1.00 0.00 ? 53  ALA A H    1  
ATOM   823   H  HA   . ALA A 1 53 ? 127.502 -2.782  13.169  1.00 0.00 ? 53  ALA A HA   1  
ATOM   824   H  HB1  . ALA A 1 53 ? 128.830 -4.236  11.728  1.00 0.00 ? 53  ALA A HB1  1  
ATOM   825   H  HB2  . ALA A 1 53 ? 127.404 -4.604  10.758  1.00 0.00 ? 53  ALA A HB2  1  
ATOM   826   H  HB3  . ALA A 1 53 ? 127.490 -5.136  12.438  1.00 0.00 ? 53  ALA A HB3  1  
ATOM   827   N  N    . VAL A 1 54 ? 126.663 -1.683  10.203  1.00 0.00 ? 54  VAL A N    1  
ATOM   828   C  CA   . VAL A 1 54 ? 126.988 -0.641  9.232   1.00 0.00 ? 54  VAL A CA   1  
ATOM   829   C  C    . VAL A 1 54 ? 127.193 0.697   9.932   1.00 0.00 ? 54  VAL A C    1  
ATOM   830   O  O    . VAL A 1 54 ? 128.152 1.416   9.641   1.00 0.00 ? 54  VAL A O    1  
ATOM   831   C  CB   . VAL A 1 54 ? 125.863 -0.511  8.206   1.00 0.00 ? 54  VAL A CB   1  
ATOM   832   C  CG1  . VAL A 1 54 ? 126.095 0.740   7.349   1.00 0.00 ? 54  VAL A CG1  1  
ATOM   833   C  CG2  . VAL A 1 54 ? 125.861 -1.748  7.312   1.00 0.00 ? 54  VAL A CG2  1  
ATOM   834   H  H    . VAL A 1 54 ? 125.839 -2.206  10.106  1.00 0.00 ? 54  VAL A H    1  
ATOM   835   H  HA   . VAL A 1 54 ? 127.895 -0.909  8.711   1.00 0.00 ? 54  VAL A HA   1  
ATOM   836   H  HB   . VAL A 1 54 ? 124.913 -0.431  8.712   1.00 0.00 ? 54  VAL A HB   1  
ATOM   837   H  HG11 . VAL A 1 54 ? 125.911 1.626   7.941   1.00 0.00 ? 54  VAL A HG11 1  
ATOM   838   H  HG12 . VAL A 1 54 ? 125.422 0.728   6.505   1.00 0.00 ? 54  VAL A HG12 1  
ATOM   839   H  HG13 . VAL A 1 54 ? 127.115 0.751   6.995   1.00 0.00 ? 54  VAL A HG13 1  
ATOM   840   H  HG21 . VAL A 1 54 ? 124.907 -1.830  6.818   1.00 0.00 ? 54  VAL A HG21 1  
ATOM   841   H  HG22 . VAL A 1 54 ? 126.031 -2.628  7.917   1.00 0.00 ? 54  VAL A HG22 1  
ATOM   842   H  HG23 . VAL A 1 54 ? 126.645 -1.662  6.576   1.00 0.00 ? 54  VAL A HG23 1  
ATOM   843   N  N    . ASP A 1 55 ? 126.310 1.026   10.871  1.00 0.00 ? 55  ASP A N    1  
ATOM   844   C  CA   . ASP A 1 55 ? 126.448 2.276   11.605  1.00 0.00 ? 55  ASP A CA   1  
ATOM   845   C  C    . ASP A 1 55 ? 127.762 2.289   12.381  1.00 0.00 ? 55  ASP A C    1  
ATOM   846   O  O    . ASP A 1 55 ? 128.466 3.300   12.439  1.00 0.00 ? 55  ASP A O    1  
ATOM   847   C  CB   . ASP A 1 55 ? 125.277 2.448   12.573  1.00 0.00 ? 55  ASP A CB   1  
ATOM   848   C  CG   . ASP A 1 55 ? 123.980 2.636   11.793  1.00 0.00 ? 55  ASP A CG   1  
ATOM   849   O  OD1  . ASP A 1 55 ? 124.058 2.861   10.597  1.00 0.00 ? 55  ASP A OD1  1  
ATOM   850   O  OD2  . ASP A 1 55 ? 122.928 2.550   12.405  1.00 0.00 ? 55  ASP A OD2  1  
ATOM   851   H  H    . ASP A 1 55 ? 125.572 0.415   11.082  1.00 0.00 ? 55  ASP A H    1  
ATOM   852   H  HA   . ASP A 1 55 ? 126.446 3.098   10.903  1.00 0.00 ? 55  ASP A HA   1  
ATOM   853   H  HB2  . ASP A 1 55 ? 125.196 1.571   13.198  1.00 0.00 ? 55  ASP A HB2  1  
ATOM   854   H  HB3  . ASP A 1 55 ? 125.449 3.315   13.194  1.00 0.00 ? 55  ASP A HB3  1  
ATOM   855   N  N    . LYS A 1 56 ? 128.101 1.153   12.974  1.00 0.00 ? 56  LYS A N    1  
ATOM   856   C  CA   . LYS A 1 56 ? 129.337 1.068   13.727  1.00 0.00 ? 56  LYS A CA   1  
ATOM   857   C  C    . LYS A 1 56 ? 130.521 1.347   12.817  1.00 0.00 ? 56  LYS A C    1  
ATOM   858   O  O    . LYS A 1 56 ? 131.477 2.016   13.209  1.00 0.00 ? 56  LYS A O    1  
ATOM   859   C  CB   . LYS A 1 56 ? 129.479 -0.322  14.347  1.00 0.00 ? 56  LYS A CB   1  
ATOM   860   C  CG   . LYS A 1 56 ? 128.290 -0.607  15.243  1.00 0.00 ? 56  LYS A CG   1  
ATOM   861   C  CD   . LYS A 1 56 ? 128.290 0.399   16.402  1.00 0.00 ? 56  LYS A CD   1  
ATOM   862   C  CE   . LYS A 1 56 ? 127.814 -0.305  17.653  1.00 0.00 ? 56  LYS A CE   1  
ATOM   863   N  NZ   . LYS A 1 56 ? 127.587 0.687   18.742  1.00 0.00 ? 56  LYS A NZ   1  
ATOM   864   H  H    . LYS A 1 56 ? 127.518 0.368   12.898  1.00 0.00 ? 56  LYS A H    1  
ATOM   865   H  HA   . LYS A 1 56 ? 129.318 1.804   14.516  1.00 0.00 ? 56  LYS A HA   1  
ATOM   866   H  HB2  . LYS A 1 56 ? 129.534 -1.067  13.571  1.00 0.00 ? 56  LYS A HB2  1  
ATOM   867   H  HB3  . LYS A 1 56 ? 130.370 -0.364  14.958  1.00 0.00 ? 56  LYS A HB3  1  
ATOM   868   H  HG2  . LYS A 1 56 ? 127.376 -0.506  14.672  1.00 0.00 ? 56  LYS A HG2  1  
ATOM   869   H  HG3  . LYS A 1 56 ? 128.365 -1.614  15.630  1.00 0.00 ? 56  LYS A HG3  1  
ATOM   870   H  HD2  . LYS A 1 56 ? 129.287 0.786   16.565  1.00 0.00 ? 56  LYS A HD2  1  
ATOM   871   H  HD3  . LYS A 1 56 ? 127.620 1.214   16.172  1.00 0.00 ? 56  LYS A HD3  1  
ATOM   872   H  HE2  . LYS A 1 56 ? 126.900 -0.836  17.441  1.00 0.00 ? 56  LYS A HE2  1  
ATOM   873   H  HE3  . LYS A 1 56 ? 128.582 -1.004  17.948  1.00 0.00 ? 56  LYS A HE3  1  
ATOM   874   H  HZ1  . LYS A 1 56 ? 128.159 0.430   19.570  1.00 0.00 ? 56  LYS A HZ1  1  
ATOM   875   H  HZ2  . LYS A 1 56 ? 126.579 0.691   19.001  1.00 0.00 ? 56  LYS A HZ2  1  
ATOM   876   H  HZ3  . LYS A 1 56 ? 127.865 1.633   18.412  1.00 0.00 ? 56  LYS A HZ3  1  
ATOM   877   N  N    . VAL A 1 57 ? 130.453 0.824   11.594  1.00 0.00 ? 57  VAL A N    1  
ATOM   878   C  CA   . VAL A 1 57 ? 131.532 1.024   10.641  1.00 0.00 ? 57  VAL A CA   1  
ATOM   879   C  C    . VAL A 1 57 ? 131.648 2.475   10.206  1.00 0.00 ? 57  VAL A C    1  
ATOM   880   O  O    . VAL A 1 57 ? 132.745 3.024   10.151  1.00 0.00 ? 57  VAL A O    1  
ATOM   881   C  CB   . VAL A 1 57 ? 131.324 0.134   9.416   1.00 0.00 ? 57  VAL A CB   1  
ATOM   882   C  CG1  . VAL A 1 57 ? 132.372 0.470   8.354   1.00 0.00 ? 57  VAL A CG1  1  
ATOM   883   C  CG2  . VAL A 1 57 ? 131.466 -1.334  9.824   1.00 0.00 ? 57  VAL A CG2  1  
ATOM   884   H  H    . VAL A 1 57 ? 129.667 0.296   11.335  1.00 0.00 ? 57  VAL A H    1  
ATOM   885   H  HA   . VAL A 1 57 ? 132.451 0.748   11.113  1.00 0.00 ? 57  VAL A HA   1  
ATOM   886   H  HB   . VAL A 1 57 ? 130.336 0.302   9.012   1.00 0.00 ? 57  VAL A HB   1  
ATOM   887   H  HG11 . VAL A 1 57 ? 132.483 -0.366  7.680   1.00 0.00 ? 57  VAL A HG11 1  
ATOM   888   H  HG12 . VAL A 1 57 ? 133.318 0.673   8.834   1.00 0.00 ? 57  VAL A HG12 1  
ATOM   889   H  HG13 . VAL A 1 57 ? 132.055 1.341   7.799   1.00 0.00 ? 57  VAL A HG13 1  
ATOM   890   H  HG21 . VAL A 1 57 ? 130.959 -1.498  10.764  1.00 0.00 ? 57  VAL A HG21 1  
ATOM   891   H  HG22 . VAL A 1 57 ? 132.513 -1.578  9.934   1.00 0.00 ? 57  VAL A HG22 1  
ATOM   892   H  HG23 . VAL A 1 57 ? 131.029 -1.964  9.064   1.00 0.00 ? 57  VAL A HG23 1  
ATOM   893   N  N    . MET A 1 58 ? 130.516 3.094   9.902   1.00 0.00 ? 58  MET A N    1  
ATOM   894   C  CA   . MET A 1 58 ? 130.530 4.485   9.475   1.00 0.00 ? 58  MET A CA   1  
ATOM   895   C  C    . MET A 1 58 ? 131.057 5.393   10.579  1.00 0.00 ? 58  MET A C    1  
ATOM   896   O  O    . MET A 1 58 ? 131.744 6.385   10.311  1.00 0.00 ? 58  MET A O    1  
ATOM   897   C  CB   . MET A 1 58 ? 129.117 4.914   9.046   1.00 0.00 ? 58  MET A CB   1  
ATOM   898   C  CG   . MET A 1 58 ? 128.374 5.557   10.221  1.00 0.00 ? 58  MET A CG   1  
ATOM   899   S  SD   . MET A 1 58 ? 128.908 7.277   10.422  1.00 0.00 ? 58  MET A SD   1  
ATOM   900   C  CE   . MET A 1 58 ? 127.888 7.997   9.117   1.00 0.00 ? 58  MET A CE   1  
ATOM   901   H  H    . MET A 1 58 ? 129.665 2.612   9.965   1.00 0.00 ? 58  MET A H    1  
ATOM   902   H  HA   . MET A 1 58 ? 131.185 4.571   8.621   1.00 0.00 ? 58  MET A HA   1  
ATOM   903   H  HB2  . MET A 1 58 ? 129.191 5.627   8.238   1.00 0.00 ? 58  MET A HB2  1  
ATOM   904   H  HB3  . MET A 1 58 ? 128.568 4.048   8.707   1.00 0.00 ? 58  MET A HB3  1  
ATOM   905   H  HG2  . MET A 1 58 ? 127.310 5.524   10.036  1.00 0.00 ? 58  MET A HG2  1  
ATOM   906   H  HG3  . MET A 1 58 ? 128.599 5.006   11.121  1.00 0.00 ? 58  MET A HG3  1  
ATOM   907   H  HE1  . MET A 1 58 ? 128.496 8.647   8.504   1.00 0.00 ? 58  MET A HE1  1  
ATOM   908   H  HE2  . MET A 1 58 ? 127.085 8.566   9.557   1.00 0.00 ? 58  MET A HE2  1  
ATOM   909   H  HE3  . MET A 1 58 ? 127.475 7.207   8.512   1.00 0.00 ? 58  MET A HE3  1  
ATOM   910   N  N    . LYS A 1 59 ? 130.707 5.070   11.818  1.00 0.00 ? 59  LYS A N    1  
ATOM   911   C  CA   . LYS A 1 59 ? 131.127 5.894   12.931  1.00 0.00 ? 59  LYS A CA   1  
ATOM   912   C  C    . LYS A 1 59 ? 132.645 5.999   12.965  1.00 0.00 ? 59  LYS A C    1  
ATOM   913   O  O    . LYS A 1 59 ? 133.195 7.077   13.191  1.00 0.00 ? 59  LYS A O    1  
ATOM   914   C  CB   . LYS A 1 59 ? 130.606 5.283   14.235  1.00 0.00 ? 59  LYS A CB   1  
ATOM   915   C  CG   . LYS A 1 59 ? 130.924 6.193   15.422  1.00 0.00 ? 59  LYS A CG   1  
ATOM   916   C  CD   . LYS A 1 59 ? 129.957 7.384   15.462  1.00 0.00 ? 59  LYS A CD   1  
ATOM   917   C  CE   . LYS A 1 59 ? 130.205 8.196   16.733  1.00 0.00 ? 59  LYS A CE   1  
ATOM   918   N  NZ   . LYS A 1 59 ? 129.125 9.212   16.892  1.00 0.00 ? 59  LYS A NZ   1  
ATOM   919   H  H    . LYS A 1 59 ? 130.130 4.281   11.980  1.00 0.00 ? 59  LYS A H    1  
ATOM   920   H  HA   . LYS A 1 59 ? 130.709 6.877   12.809  1.00 0.00 ? 59  LYS A HA   1  
ATOM   921   H  HB2  . LYS A 1 59 ? 129.536 5.151   14.163  1.00 0.00 ? 59  LYS A HB2  1  
ATOM   922   H  HB3  . LYS A 1 59 ? 131.074 4.321   14.389  1.00 0.00 ? 59  LYS A HB3  1  
ATOM   923   H  HG2  . LYS A 1 59 ? 130.830 5.628   16.336  1.00 0.00 ? 59  LYS A HG2  1  
ATOM   924   H  HG3  . LYS A 1 59 ? 131.933 6.558   15.329  1.00 0.00 ? 59  LYS A HG3  1  
ATOM   925   H  HD2  . LYS A 1 59 ? 130.118 8.014   14.603  1.00 0.00 ? 59  LYS A HD2  1  
ATOM   926   H  HD3  . LYS A 1 59 ? 128.939 7.023   15.462  1.00 0.00 ? 59  LYS A HD3  1  
ATOM   927   H  HE2  . LYS A 1 59 ? 130.208 7.537   17.588  1.00 0.00 ? 59  LYS A HE2  1  
ATOM   928   H  HE3  . LYS A 1 59 ? 131.160 8.696   16.661  1.00 0.00 ? 59  LYS A HE3  1  
ATOM   929   H  HZ1  . LYS A 1 59 ? 128.275 8.755   17.278  1.00 0.00 ? 59  LYS A HZ1  1  
ATOM   930   H  HZ2  . LYS A 1 59 ? 128.905 9.631   15.966  1.00 0.00 ? 59  LYS A HZ2  1  
ATOM   931   H  HZ3  . LYS A 1 59 ? 129.442 9.957   17.544  1.00 0.00 ? 59  LYS A HZ3  1  
ATOM   932   N  N    . GLU A 1 60 ? 133.323 4.883   12.715  1.00 0.00 ? 60  GLU A N    1  
ATOM   933   C  CA   . GLU A 1 60 ? 134.778 4.891   12.701  1.00 0.00 ? 60  GLU A CA   1  
ATOM   934   C  C    . GLU A 1 60 ? 135.299 5.740   11.543  1.00 0.00 ? 60  GLU A C    1  
ATOM   935   O  O    . GLU A 1 60 ? 136.314 6.425   11.670  1.00 0.00 ? 60  GLU A O    1  
ATOM   936   C  CB   . GLU A 1 60 ? 135.306 3.461   12.566  1.00 0.00 ? 60  GLU A CB   1  
ATOM   937   C  CG   . GLU A 1 60 ? 134.919 2.654   13.806  1.00 0.00 ? 60  GLU A CG   1  
ATOM   938   C  CD   . GLU A 1 60 ? 135.496 1.246   13.712  1.00 0.00 ? 60  GLU A CD   1  
ATOM   939   O  OE1  . GLU A 1 60 ? 136.005 0.905   12.657  1.00 0.00 ? 60  GLU A OE1  1  
ATOM   940   O  OE2  . GLU A 1 60 ? 135.421 0.529   14.697  1.00 0.00 ? 60  GLU A OE2  1  
ATOM   941   H  H    . GLU A 1 60 ? 132.839 4.052   12.524  1.00 0.00 ? 60  GLU A H    1  
ATOM   942   H  HA   . GLU A 1 60 ? 135.136 5.308   13.630  1.00 0.00 ? 60  GLU A HA   1  
ATOM   943   H  HB2  . GLU A 1 60 ? 134.878 3.002   11.687  1.00 0.00 ? 60  GLU A HB2  1  
ATOM   944   H  HB3  . GLU A 1 60 ? 136.382 3.483   12.474  1.00 0.00 ? 60  GLU A HB3  1  
ATOM   945   H  HG2  . GLU A 1 60 ? 135.307 3.143   14.687  1.00 0.00 ? 60  GLU A HG2  1  
ATOM   946   H  HG3  . GLU A 1 60 ? 133.843 2.595   13.873  1.00 0.00 ? 60  GLU A HG3  1  
ATOM   947   N  N    . LEU A 1 61 ? 134.601 5.677   10.409  1.00 0.00 ? 61  LEU A N    1  
ATOM   948   C  CA   . LEU A 1 61 ? 135.007 6.436   9.227   1.00 0.00 ? 61  LEU A CA   1  
ATOM   949   C  C    . LEU A 1 61 ? 134.873 7.935   9.420   1.00 0.00 ? 61  LEU A C    1  
ATOM   950   O  O    . LEU A 1 61 ? 135.697 8.700   8.920   1.00 0.00 ? 61  LEU A O    1  
ATOM   951   C  CB   . LEU A 1 61 ? 134.161 6.029   8.019   1.00 0.00 ? 61  LEU A CB   1  
ATOM   952   C  CG   . LEU A 1 61 ? 134.356 4.546   7.710   1.00 0.00 ? 61  LEU A CG   1  
ATOM   953   C  CD1  . LEU A 1 61 ? 133.534 4.176   6.475   1.00 0.00 ? 61  LEU A CD1  1  
ATOM   954   C  CD2  . LEU A 1 61 ? 135.838 4.277   7.432   1.00 0.00 ? 61  LEU A CD2  1  
ATOM   955   H  H    . LEU A 1 61 ? 133.804 5.107   10.364  1.00 0.00 ? 61  LEU A H    1  
ATOM   956   H  HA   . LEU A 1 61 ? 136.039 6.212   9.015   1.00 0.00 ? 61  LEU A HA   1  
ATOM   957   H  HB2  . LEU A 1 61 ? 133.119 6.215   8.232   1.00 0.00 ? 61  LEU A HB2  1  
ATOM   958   H  HB3  . LEU A 1 61 ? 134.461 6.611   7.163   1.00 0.00 ? 61  LEU A HB3  1  
ATOM   959   H  HG   . LEU A 1 61 ? 134.032 3.955   8.552   1.00 0.00 ? 61  LEU A HG   1  
ATOM   960   H  HD11 . LEU A 1 61 ? 133.379 3.107   6.451   1.00 0.00 ? 61  LEU A HD11 1  
ATOM   961   H  HD12 . LEU A 1 61 ? 134.061 4.484   5.585   1.00 0.00 ? 61  LEU A HD12 1  
ATOM   962   H  HD13 . LEU A 1 61 ? 132.578 4.676   6.518   1.00 0.00 ? 61  LEU A HD13 1  
ATOM   963   H  HD21 . LEU A 1 61 ? 136.296 5.159   7.008   1.00 0.00 ? 61  LEU A HD21 1  
ATOM   964   H  HD22 . LEU A 1 61 ? 135.932 3.459   6.740   1.00 0.00 ? 61  LEU A HD22 1  
ATOM   965   H  HD23 . LEU A 1 61 ? 136.334 4.027   8.358   1.00 0.00 ? 61  LEU A HD23 1  
ATOM   966   N  N    . ASP A 1 62 ? 133.827 8.368   10.109  1.00 0.00 ? 62  ASP A N    1  
ATOM   967   C  CA   . ASP A 1 62 ? 133.639 9.799   10.286  1.00 0.00 ? 62  ASP A CA   1  
ATOM   968   C  C    . ASP A 1 62 ? 134.547 10.367  11.365  1.00 0.00 ? 62  ASP A C    1  
ATOM   969   O  O    . ASP A 1 62 ? 134.130 10.532  12.511  1.00 0.00 ? 62  ASP A O    1  
ATOM   970   C  CB   . ASP A 1 62 ? 132.193 10.101  10.662  1.00 0.00 ? 62  ASP A CB   1  
ATOM   971   C  CG   . ASP A 1 62 ? 131.983 11.609  10.675  1.00 0.00 ? 62  ASP A CG   1  
ATOM   972   O  OD1  . ASP A 1 62 ? 132.702 12.295  9.960   1.00 0.00 ? 62  ASP A OD1  1  
ATOM   973   O  OD2  . ASP A 1 62 ? 131.103 12.057  11.389  1.00 0.00 ? 62  ASP A OD2  1  
ATOM   974   H  H    . ASP A 1 62 ? 133.170 7.731   10.473  1.00 0.00 ? 62  ASP A H    1  
ATOM   975   H  HA   . ASP A 1 62 ? 133.859 10.295  9.353   1.00 0.00 ? 62  ASP A HA   1  
ATOM   976   H  HB2  . ASP A 1 62 ? 131.530 9.650   9.937   1.00 0.00 ? 62  ASP A HB2  1  
ATOM   977   H  HB3  . ASP A 1 62 ? 131.983 9.702   11.642  1.00 0.00 ? 62  ASP A HB3  1  
ATOM   978   N  N    . GLU A 1 63 ? 135.765 10.725  10.985  1.00 0.00 ? 63  GLU A N    1  
ATOM   979   C  CA   . GLU A 1 63 ? 136.676 11.344  11.932  1.00 0.00 ? 63  GLU A CA   1  
ATOM   980   C  C    . GLU A 1 63 ? 136.141 12.708  12.325  1.00 0.00 ? 63  GLU A C    1  
ATOM   981   O  O    . GLU A 1 63 ? 136.255 13.146  13.470  1.00 0.00 ? 63  GLU A O    1  
ATOM   982   C  CB   . GLU A 1 63 ? 138.051 11.525  11.290  1.00 0.00 ? 63  GLU A CB   1  
ATOM   983   C  CG   . GLU A 1 63 ? 139.019 12.139  12.304  1.00 0.00 ? 63  GLU A CG   1  
ATOM   984   C  CD   . GLU A 1 63 ? 139.346 11.128  13.397  1.00 0.00 ? 63  GLU A CD   1  
ATOM   985   O  OE1  . GLU A 1 63 ? 139.234 9.944   13.134  1.00 0.00 ? 63  GLU A OE1  1  
ATOM   986   O  OE2  . GLU A 1 63 ? 139.704 11.556  14.483  1.00 0.00 ? 63  GLU A OE2  1  
ATOM   987   H  H    . GLU A 1 63 ? 136.035 10.616  10.050  1.00 0.00 ? 63  GLU A H    1  
ATOM   988   H  HA   . GLU A 1 63 ? 136.768 10.722  12.809  1.00 0.00 ? 63  GLU A HA   1  
ATOM   989   H  HB2  . GLU A 1 63 ? 138.428 10.563  10.971  1.00 0.00 ? 63  GLU A HB2  1  
ATOM   990   H  HB3  . GLU A 1 63 ? 137.966 12.178  10.435  1.00 0.00 ? 63  GLU A HB3  1  
ATOM   991   H  HG2  . GLU A 1 63 ? 139.922 12.434  11.798  1.00 0.00 ? 63  GLU A HG2  1  
ATOM   992   H  HG3  . GLU A 1 63 ? 138.566 13.014  12.749  1.00 0.00 ? 63  GLU A HG3  1  
ATOM   993   N  N    . ASN A 1 64 ? 135.591 13.380  11.326  1.00 0.00 ? 64  ASN A N    1  
ATOM   994   C  CA   . ASN A 1 64 ? 135.060 14.720  11.490  1.00 0.00 ? 64  ASN A CA   1  
ATOM   995   C  C    . ASN A 1 64 ? 133.956 14.774  12.540  1.00 0.00 ? 64  ASN A C    1  
ATOM   996   O  O    . ASN A 1 64 ? 133.813 15.764  13.258  1.00 0.00 ? 64  ASN A O    1  
ATOM   997   C  CB   . ASN A 1 64 ? 134.468 15.172  10.160  1.00 0.00 ? 64  ASN A CB   1  
ATOM   998   C  CG   . ASN A 1 64 ? 135.505 15.066  9.051   1.00 0.00 ? 64  ASN A CG   1  
ATOM   999   O  OD1  . ASN A 1 64 ? 135.227 14.470  8.005   1.00 0.00 ? 64  ASN A OD1  1  
ATOM   1000  N  ND2  . ASN A 1 64 ? 136.682 15.606  9.210   1.00 0.00 ? 64  ASN A ND2  1  
ATOM   1001  H  H    . ASN A 1 64 ? 135.566 12.968  10.438  1.00 0.00 ? 64  ASN A H    1  
ATOM   1002  H  HA   . ASN A 1 64 ? 135.862 15.387  11.766  1.00 0.00 ? 64  ASN A HA   1  
ATOM   1003  H  HB2  . ASN A 1 64 ? 133.623 14.547  9.918   1.00 0.00 ? 64  ASN A HB2  1  
ATOM   1004  H  HB3  . ASN A 1 64 ? 134.142 16.196  10.246  1.00 0.00 ? 64  ASN A HB3  1  
ATOM   1005  H  HD21 . ASN A 1 64 ? 136.896 16.078  10.042  1.00 0.00 ? 64  ASN A HD21 1  
ATOM   1006  H  HD22 . ASN A 1 64 ? 137.352 15.540  8.498   1.00 0.00 ? 64  ASN A HD22 1  
ATOM   1007  N  N    . GLY A 1 65 ? 133.144 13.725  12.581  1.00 0.00 ? 65  GLY A N    1  
ATOM   1008  C  CA   . GLY A 1 65 ? 132.014 13.680  13.498  1.00 0.00 ? 65  GLY A CA   1  
ATOM   1009  C  C    . GLY A 1 65 ? 130.797 14.264  12.786  1.00 0.00 ? 65  GLY A C    1  
ATOM   1010  O  O    . GLY A 1 65 ? 129.721 14.419  13.362  1.00 0.00 ? 65  GLY A O    1  
ATOM   1011  H  H    . GLY A 1 65 ? 133.286 12.984  11.957  1.00 0.00 ? 65  GLY A H    1  
ATOM   1012  H  HA2  . GLY A 1 65 ? 131.816 12.656  13.784  1.00 0.00 ? 65  GLY A HA2  1  
ATOM   1013  H  HA3  . GLY A 1 65 ? 132.230 14.269  14.376  1.00 0.00 ? 65  GLY A HA3  1  
ATOM   1014  N  N    . ASP A 1 66 ? 131.012 14.587  11.512  1.00 0.00 ? 66  ASP A N    1  
ATOM   1015  C  CA   . ASP A 1 66 ? 129.985 15.166  10.652  1.00 0.00 ? 66  ASP A CA   1  
ATOM   1016  C  C    . ASP A 1 66 ? 128.790 14.231  10.457  1.00 0.00 ? 66  ASP A C    1  
ATOM   1017  O  O    . ASP A 1 66 ? 127.655 14.684  10.304  1.00 0.00 ? 66  ASP A O    1  
ATOM   1018  C  CB   . ASP A 1 66 ? 130.616 15.532  9.299   1.00 0.00 ? 66  ASP A CB   1  
ATOM   1019  C  CG   . ASP A 1 66 ? 131.143 14.283  8.587   1.00 0.00 ? 66  ASP A CG   1  
ATOM   1020  O  OD1  . ASP A 1 66 ? 130.804 13.191  9.005   1.00 0.00 ? 66  ASP A OD1  1  
ATOM   1021  O  OD2  . ASP A 1 66 ? 131.897 14.438  7.639   1.00 0.00 ? 66  ASP A OD2  1  
ATOM   1022  H  H    . ASP A 1 66 ? 131.904 14.432  11.135  1.00 0.00 ? 66  ASP A H    1  
ATOM   1023  H  HA   . ASP A 1 66 ? 129.630 16.076  11.113  1.00 0.00 ? 66  ASP A HA   1  
ATOM   1024  H  HB2  . ASP A 1 66 ? 129.872 16.008  8.678   1.00 0.00 ? 66  ASP A HB2  1  
ATOM   1025  H  HB3  . ASP A 1 66 ? 131.434 16.218  9.464   1.00 0.00 ? 66  ASP A HB3  1  
ATOM   1026  N  N    . GLY A 1 67 ? 129.051 12.933  10.444  1.00 0.00 ? 67  GLY A N    1  
ATOM   1027  C  CA   . GLY A 1 67 ? 128.001 11.942  10.245  1.00 0.00 ? 67  GLY A CA   1  
ATOM   1028  C  C    . GLY A 1 67 ? 127.982 11.480  8.793   1.00 0.00 ? 67  GLY A C    1  
ATOM   1029  O  O    . GLY A 1 67 ? 127.252 10.558  8.432   1.00 0.00 ? 67  GLY A O    1  
ATOM   1030  H  H    . GLY A 1 67 ? 129.973 12.634  10.553  1.00 0.00 ? 67  GLY A H    1  
ATOM   1031  H  HA2  . GLY A 1 67 ? 128.184 11.094  10.890  1.00 0.00 ? 67  GLY A HA2  1  
ATOM   1032  H  HA3  . GLY A 1 67 ? 127.045 12.379  10.490  1.00 0.00 ? 67  GLY A HA3  1  
ATOM   1033  N  N    . GLU A 1 68 ? 128.816 12.115  7.972   1.00 0.00 ? 68  GLU A N    1  
ATOM   1034  C  CA   . GLU A 1 68 ? 128.925 11.753  6.562   1.00 0.00 ? 68  GLU A CA   1  
ATOM   1035  C  C    . GLU A 1 68 ? 130.353 11.264  6.312   1.00 0.00 ? 68  GLU A C    1  
ATOM   1036  O  O    . GLU A 1 68 ? 131.297 11.731  6.965   1.00 0.00 ? 68  GLU A O    1  
ATOM   1037  C  CB   . GLU A 1 68 ? 128.554 12.949  5.678   1.00 0.00 ? 68  GLU A CB   1  
ATOM   1038  C  CG   . GLU A 1 68 ? 128.432 12.507  4.215   1.00 0.00 ? 68  GLU A CG   1  
ATOM   1039  C  CD   . GLU A 1 68 ? 128.071 13.702  3.345   1.00 0.00 ? 68  GLU A CD   1  
ATOM   1040  O  OE1  . GLU A 1 68 ? 128.047 14.805  3.867   1.00 0.00 ? 68  GLU A OE1  1  
ATOM   1041  O  OE2  . GLU A 1 68 ? 127.822 13.497  2.171   1.00 0.00 ? 68  GLU A OE2  1  
ATOM   1042  H  H    . GLU A 1 68 ? 129.384 12.829  8.326   1.00 0.00 ? 68  GLU A H    1  
ATOM   1043  H  HA   . GLU A 1 68 ? 128.244 10.939  6.353   1.00 0.00 ? 68  GLU A HA   1  
ATOM   1044  H  HB2  . GLU A 1 68 ? 127.610 13.358  6.009   1.00 0.00 ? 68  GLU A HB2  1  
ATOM   1045  H  HB3  . GLU A 1 68 ? 129.319 13.706  5.759   1.00 0.00 ? 68  GLU A HB3  1  
ATOM   1046  H  HG2  . GLU A 1 68 ? 129.375 12.097  3.876   1.00 0.00 ? 68  GLU A HG2  1  
ATOM   1047  H  HG3  . GLU A 1 68 ? 127.660 11.756  4.129   1.00 0.00 ? 68  GLU A HG3  1  
ATOM   1048  N  N    . VAL A 1 69 ? 130.516 10.286  5.423   1.00 0.00 ? 69  VAL A N    1  
ATOM   1049  C  CA   . VAL A 1 69 ? 131.840 9.715   5.182   1.00 0.00 ? 69  VAL A CA   1  
ATOM   1050  C  C    . VAL A 1 69 ? 132.454 10.183  3.872   1.00 0.00 ? 69  VAL A C    1  
ATOM   1051  O  O    . VAL A 1 69 ? 131.807 10.191  2.824   1.00 0.00 ? 69  VAL A O    1  
ATOM   1052  C  CB   . VAL A 1 69 ? 131.731 8.191   5.164   1.00 0.00 ? 69  VAL A CB   1  
ATOM   1053  C  CG1  . VAL A 1 69 ? 133.123 7.583   5.001   1.00 0.00 ? 69  VAL A CG1  1  
ATOM   1054  C  CG2  . VAL A 1 69 ? 131.116 7.708   6.479   1.00 0.00 ? 69  VAL A CG2  1  
ATOM   1055  H  H    . VAL A 1 69 ? 129.736 9.915   4.959   1.00 0.00 ? 69  VAL A H    1  
ATOM   1056  H  HA   . VAL A 1 69 ? 132.497 9.996   5.992   1.00 0.00 ? 69  VAL A HA   1  
ATOM   1057  H  HB   . VAL A 1 69 ? 131.106 7.885   4.337   1.00 0.00 ? 69  VAL A HB   1  
ATOM   1058  H  HG11 . VAL A 1 69 ? 133.420 7.635   3.963   1.00 0.00 ? 69  VAL A HG11 1  
ATOM   1059  H  HG12 . VAL A 1 69 ? 133.107 6.552   5.320   1.00 0.00 ? 69  VAL A HG12 1  
ATOM   1060  H  HG13 . VAL A 1 69 ? 133.825 8.137   5.603   1.00 0.00 ? 69  VAL A HG13 1  
ATOM   1061  H  HG21 . VAL A 1 69 ? 131.505 8.297   7.296   1.00 0.00 ? 69  VAL A HG21 1  
ATOM   1062  H  HG22 . VAL A 1 69 ? 131.367 6.668   6.633   1.00 0.00 ? 69  VAL A HG22 1  
ATOM   1063  H  HG23 . VAL A 1 69 ? 130.043 7.816   6.435   1.00 0.00 ? 69  VAL A HG23 1  
ATOM   1064  N  N    . ASP A 1 70 ? 133.729 10.554  3.955   1.00 0.00 ? 70  ASP A N    1  
ATOM   1065  C  CA   . ASP A 1 70 ? 134.479 11.009  2.795   1.00 0.00 ? 70  ASP A CA   1  
ATOM   1066  C  C    . ASP A 1 70 ? 135.344 9.876   2.257   1.00 0.00 ? 70  ASP A C    1  
ATOM   1067  O  O    . ASP A 1 70 ? 135.763 8.987   3.008   1.00 0.00 ? 70  ASP A O    1  
ATOM   1068  C  CB   . ASP A 1 70 ? 135.378 12.189  3.171   1.00 0.00 ? 70  ASP A CB   1  
ATOM   1069  C  CG   . ASP A 1 70 ? 134.526 13.382  3.572   1.00 0.00 ? 70  ASP A CG   1  
ATOM   1070  O  OD1  . ASP A 1 70 ? 133.333 13.328  3.345   1.00 0.00 ? 70  ASP A OD1  1  
ATOM   1071  O  OD2  . ASP A 1 70 ? 135.078 14.328  4.109   1.00 0.00 ? 70  ASP A OD2  1  
ATOM   1072  H  H    . ASP A 1 70 ? 134.181 10.506  4.823   1.00 0.00 ? 70  ASP A H    1  
ATOM   1073  H  HA   . ASP A 1 70 ? 133.789 11.323  2.026   1.00 0.00 ? 70  ASP A HA   1  
ATOM   1074  H  HB2  . ASP A 1 70 ? 136.010 11.908  3.997   1.00 0.00 ? 70  ASP A HB2  1  
ATOM   1075  H  HB3  . ASP A 1 70 ? 135.991 12.456  2.325   1.00 0.00 ? 70  ASP A HB3  1  
ATOM   1076  N  N    . PHE A 1 71 ? 135.625 9.911   0.965   1.00 0.00 ? 71  PHE A N    1  
ATOM   1077  C  CA   . PHE A 1 71 ? 136.456 8.882   0.369   1.00 0.00 ? 71  PHE A CA   1  
ATOM   1078  C  C    . PHE A 1 71 ? 137.780 8.785   1.113   1.00 0.00 ? 71  PHE A C    1  
ATOM   1079  O  O    . PHE A 1 71 ? 138.287 7.688   1.345   1.00 0.00 ? 71  PHE A O    1  
ATOM   1080  C  CB   . PHE A 1 71 ? 136.694 9.186   -1.109  1.00 0.00 ? 71  PHE A CB   1  
ATOM   1081  C  CG   . PHE A 1 71 ? 137.507 8.076   -1.733  1.00 0.00 ? 71  PHE A CG   1  
ATOM   1082  C  CD1  . PHE A 1 71 ? 136.939 6.812   -1.934  1.00 0.00 ? 71  PHE A CD1  1  
ATOM   1083  C  CD2  . PHE A 1 71 ? 138.821 8.325   -2.145  1.00 0.00 ? 71  PHE A CD2  1  
ATOM   1084  C  CE1  . PHE A 1 71 ? 137.688 5.797   -2.542  1.00 0.00 ? 71  PHE A CE1  1  
ATOM   1085  C  CE2  . PHE A 1 71 ? 139.571 7.308   -2.748  1.00 0.00 ? 71  PHE A CE2  1  
ATOM   1086  C  CZ   . PHE A 1 71 ? 139.004 6.044   -2.948  1.00 0.00 ? 71  PHE A CZ   1  
ATOM   1087  H  H    . PHE A 1 71 ? 135.280 10.642  0.411   1.00 0.00 ? 71  PHE A H    1  
ATOM   1088  H  HA   . PHE A 1 71 ? 135.940 7.936   0.447   1.00 0.00 ? 71  PHE A HA   1  
ATOM   1089  H  HB2  . PHE A 1 71 ? 135.744 9.265   -1.614  1.00 0.00 ? 71  PHE A HB2  1  
ATOM   1090  H  HB3  . PHE A 1 71 ? 137.229 10.119  -1.202  1.00 0.00 ? 71  PHE A HB3  1  
ATOM   1091  H  HD1  . PHE A 1 71 ? 135.931 6.616   -1.610  1.00 0.00 ? 71  PHE A HD1  1  
ATOM   1092  H  HD2  . PHE A 1 71 ? 139.260 9.300   -1.991  1.00 0.00 ? 71  PHE A HD2  1  
ATOM   1093  H  HE1  . PHE A 1 71 ? 137.249 4.822   -2.696  1.00 0.00 ? 71  PHE A HE1  1  
ATOM   1094  H  HE2  . PHE A 1 71 ? 140.584 7.501   -3.065  1.00 0.00 ? 71  PHE A HE2  1  
ATOM   1095  H  HZ   . PHE A 1 71 ? 139.581 5.261   -3.415  1.00 0.00 ? 71  PHE A HZ   1  
ATOM   1096  N  N    . GLN A 1 72 ? 138.333 9.931   1.501   1.00 0.00 ? 72  GLN A N    1  
ATOM   1097  C  CA   . GLN A 1 72 ? 139.591 9.926   2.232   1.00 0.00 ? 72  GLN A CA   1  
ATOM   1098  C  C    . GLN A 1 72 ? 139.458 9.068   3.489   1.00 0.00 ? 72  GLN A C    1  
ATOM   1099  O  O    . GLN A 1 72 ? 140.363 8.309   3.834   1.00 0.00 ? 72  GLN A O    1  
ATOM   1100  C  CB   . GLN A 1 72 ? 139.973 11.355  2.625   1.00 0.00 ? 72  GLN A CB   1  
ATOM   1101  C  CG   . GLN A 1 72 ? 141.384 11.363  3.216   1.00 0.00 ? 72  GLN A CG   1  
ATOM   1102  C  CD   . GLN A 1 72 ? 141.787 12.786  3.584   1.00 0.00 ? 72  GLN A CD   1  
ATOM   1103  O  OE1  . GLN A 1 72 ? 141.072 13.737  3.265   1.00 0.00 ? 72  GLN A OE1  1  
ATOM   1104  N  NE2  . GLN A 1 72 ? 142.895 12.992  4.241   1.00 0.00 ? 72  GLN A NE2  1  
ATOM   1105  H  H    . GLN A 1 72 ? 137.887 10.780  1.303   1.00 0.00 ? 72  GLN A H    1  
ATOM   1106  H  HA   . GLN A 1 72 ? 140.365 9.519   1.601   1.00 0.00 ? 72  GLN A HA   1  
ATOM   1107  H  HB2  . GLN A 1 72 ? 139.944 11.989  1.750   1.00 0.00 ? 72  GLN A HB2  1  
ATOM   1108  H  HB3  . GLN A 1 72 ? 139.275 11.724  3.361   1.00 0.00 ? 72  GLN A HB3  1  
ATOM   1109  H  HG2  . GLN A 1 72 ? 141.405 10.744  4.101   1.00 0.00 ? 72  GLN A HG2  1  
ATOM   1110  H  HG3  . GLN A 1 72 ? 142.080 10.972  2.489   1.00 0.00 ? 72  GLN A HG3  1  
ATOM   1111  H  HE21 . GLN A 1 72 ? 143.462 12.234  4.494   1.00 0.00 ? 72  GLN A HE21 1  
ATOM   1112  H  HE22 . GLN A 1 72 ? 143.161 13.905  4.482   1.00 0.00 ? 72  GLN A HE22 1  
ATOM   1113  N  N    . GLU A 1 73 ? 138.315 9.177   4.164   1.00 0.00 ? 73  GLU A N    1  
ATOM   1114  C  CA   . GLU A 1 73 ? 138.077 8.376   5.361   1.00 0.00 ? 73  GLU A CA   1  
ATOM   1115  C  C    . GLU A 1 73 ? 137.949 6.896   4.991   1.00 0.00 ? 73  GLU A C    1  
ATOM   1116  O  O    . GLU A 1 73 ? 138.429 6.013   5.702   1.00 0.00 ? 73  GLU A O    1  
ATOM   1117  C  CB   . GLU A 1 73 ? 136.767 8.827   6.021   1.00 0.00 ? 73  GLU A CB   1  
ATOM   1118  C  CG   . GLU A 1 73 ? 136.882 10.268  6.533   1.00 0.00 ? 73  GLU A CG   1  
ATOM   1119  C  CD   . GLU A 1 73 ? 135.568 10.681  7.205   1.00 0.00 ? 73  GLU A CD   1  
ATOM   1120  O  OE1  . GLU A 1 73 ? 134.627 9.908   7.135   1.00 0.00 ? 73  GLU A OE1  1  
ATOM   1121  O  OE2  . GLU A 1 73 ? 135.518 11.761  7.778   1.00 0.00 ? 73  GLU A OE2  1  
ATOM   1122  H  H    . GLU A 1 73 ? 137.618 9.786   3.841   1.00 0.00 ? 73  GLU A H    1  
ATOM   1123  H  HA   . GLU A 1 73 ? 138.892 8.510   6.056   1.00 0.00 ? 73  GLU A HA   1  
ATOM   1124  H  HB2  . GLU A 1 73 ? 135.972 8.773   5.295   1.00 0.00 ? 73  GLU A HB2  1  
ATOM   1125  H  HB3  . GLU A 1 73 ? 136.541 8.172   6.848   1.00 0.00 ? 73  GLU A HB3  1  
ATOM   1126  H  HG2  . GLU A 1 73 ? 137.687 10.329  7.251   1.00 0.00 ? 73  GLU A HG2  1  
ATOM   1127  H  HG3  . GLU A 1 73 ? 137.087 10.929  5.709   1.00 0.00 ? 73  GLU A HG3  1  
ATOM   1128  N  N    . TYR A 1 74 ? 137.264 6.653   3.873   1.00 0.00 ? 74  TYR A N    1  
ATOM   1129  C  CA   . TYR A 1 74 ? 137.013 5.294   3.376   1.00 0.00 ? 74  TYR A CA   1  
ATOM   1130  C  C    . TYR A 1 74 ? 138.278 4.516   2.982   1.00 0.00 ? 74  TYR A C    1  
ATOM   1131  O  O    . TYR A 1 74 ? 138.397 3.312   3.263   1.00 0.00 ? 74  TYR A O    1  
ATOM   1132  C  CB   . TYR A 1 74 ? 136.068 5.388   2.177   1.00 0.00 ? 74  TYR A CB   1  
ATOM   1133  C  CG   . TYR A 1 74 ? 135.747 4.010   1.664   1.00 0.00 ? 74  TYR A CG   1  
ATOM   1134  C  CD1  . TYR A 1 74 ? 134.791 3.224   2.311   1.00 0.00 ? 74  TYR A CD1  1  
ATOM   1135  C  CD2  . TYR A 1 74 ? 136.397 3.527   0.525   1.00 0.00 ? 74  TYR A CD2  1  
ATOM   1136  C  CE1  . TYR A 1 74 ? 134.487 1.950   1.821   1.00 0.00 ? 74  TYR A CE1  1  
ATOM   1137  C  CE2  . TYR A 1 74 ? 136.096 2.252   0.034   1.00 0.00 ? 74  TYR A CE2  1  
ATOM   1138  C  CZ   . TYR A 1 74 ? 135.141 1.462   0.683   1.00 0.00 ? 74  TYR A CZ   1  
ATOM   1139  O  OH   . TYR A 1 74 ? 134.842 0.204   0.200   1.00 0.00 ? 74  TYR A OH   1  
ATOM   1140  H  H    . TYR A 1 74 ? 136.894 7.416   3.372   1.00 0.00 ? 74  TYR A H    1  
ATOM   1141  H  HA   . TYR A 1 74 ? 136.507 4.740   4.151   1.00 0.00 ? 74  TYR A HA   1  
ATOM   1142  H  HB2  . TYR A 1 74 ? 135.155 5.881   2.478   1.00 0.00 ? 74  TYR A HB2  1  
ATOM   1143  H  HB3  . TYR A 1 74 ? 136.543 5.959   1.393   1.00 0.00 ? 74  TYR A HB3  1  
ATOM   1144  H  HD1  . TYR A 1 74 ? 134.292 3.601   3.191   1.00 0.00 ? 74  TYR A HD1  1  
ATOM   1145  H  HD2  . TYR A 1 74 ? 137.128 4.143   0.024   1.00 0.00 ? 74  TYR A HD2  1  
ATOM   1146  H  HE1  . TYR A 1 74 ? 133.749 1.343   2.320   1.00 0.00 ? 74  TYR A HE1  1  
ATOM   1147  H  HE2  . TYR A 1 74 ? 136.602 1.878   -0.844  1.00 0.00 ? 74  TYR A HE2  1  
ATOM   1148  H  HH   . TYR A 1 74 ? 134.591 0.292   -0.721  1.00 0.00 ? 74  TYR A HH   1  
ATOM   1149  N  N    . VAL A 1 75 ? 139.204 5.187   2.304   1.00 0.00 ? 75  VAL A N    1  
ATOM   1150  C  CA   . VAL A 1 75 ? 140.416 4.515   1.848   1.00 0.00 ? 75  VAL A CA   1  
ATOM   1151  C  C    . VAL A 1 75 ? 141.266 4.023   3.009   1.00 0.00 ? 75  VAL A C    1  
ATOM   1152  O  O    . VAL A 1 75 ? 141.882 2.967   2.921   1.00 0.00 ? 75  VAL A O    1  
ATOM   1153  C  CB   . VAL A 1 75 ? 141.237 5.452   0.959   1.00 0.00 ? 75  VAL A CB   1  
ATOM   1154  C  CG1  . VAL A 1 75 ? 140.431 5.797   -0.295  1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1155  C  CG2  . VAL A 1 75 ? 141.539 6.738   1.722   1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1156  H  H    . VAL A 1 75 ? 139.057 6.130   2.083   1.00 0.00 ? 75  VAL A H    1  
ATOM   1157  H  HA   . VAL A 1 75 ? 140.126 3.660   1.257   1.00 0.00 ? 75  VAL A HA   1  
ATOM   1158  H  HB   . VAL A 1 75 ? 142.160 4.969   0.677   1.00 0.00 ? 75  VAL A HB   1  
ATOM   1159  H  HG11 . VAL A 1 75 ? 139.718 6.574   -0.063  1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1160  H  HG12 . VAL A 1 75 ? 139.906 4.917   -0.640  1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1161  H  HG13 . VAL A 1 75 ? 141.101 6.142   -1.069  1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1162  H  HG21 . VAL A 1 75 ? 141.955 6.500   2.688   1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1163  H  HG22 . VAL A 1 75 ? 140.624 7.290   1.851   1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1164  H  HG23 . VAL A 1 75 ? 142.241 7.333   1.164   1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1165  N  N    . VAL A 1 76 ? 141.317 4.772   4.096   1.00 0.00 ? 76  VAL A N    1  
ATOM   1166  C  CA   . VAL A 1 76 ? 142.116 4.328   5.222   1.00 0.00 ? 76  VAL A CA   1  
ATOM   1167  C  C    . VAL A 1 76 ? 141.566 3.019   5.788   1.00 0.00 ? 76  VAL A C    1  
ATOM   1168  O  O    . VAL A 1 76 ? 142.322 2.091   6.076   1.00 0.00 ? 76  VAL A O    1  
ATOM   1169  C  CB   . VAL A 1 76 ? 142.116 5.398   6.314   1.00 0.00 ? 76  VAL A CB   1  
ATOM   1170  C  CG1  . VAL A 1 76 ? 142.799 4.851   7.568   1.00 0.00 ? 76  VAL A CG1  1  
ATOM   1171  C  CG2  . VAL A 1 76 ? 142.875 6.631   5.817   1.00 0.00 ? 76  VAL A CG2  1  
ATOM   1172  H  H    . VAL A 1 76 ? 140.824 5.617   4.140   1.00 0.00 ? 76  VAL A H    1  
ATOM   1173  H  HA   . VAL A 1 76 ? 143.132 4.168   4.891   1.00 0.00 ? 76  VAL A HA   1  
ATOM   1174  H  HB   . VAL A 1 76 ? 141.097 5.671   6.550   1.00 0.00 ? 76  VAL A HB   1  
ATOM   1175  H  HG11 . VAL A 1 76 ? 142.083 4.296   8.156   1.00 0.00 ? 76  VAL A HG11 1  
ATOM   1176  H  HG12 . VAL A 1 76 ? 143.188 5.671   8.154   1.00 0.00 ? 76  VAL A HG12 1  
ATOM   1177  H  HG13 . VAL A 1 76 ? 143.611 4.199   7.280   1.00 0.00 ? 76  VAL A HG13 1  
ATOM   1178  H  HG21 . VAL A 1 76 ? 142.978 7.340   6.625   1.00 0.00 ? 76  VAL A HG21 1  
ATOM   1179  H  HG22 . VAL A 1 76 ? 142.328 7.087   5.006   1.00 0.00 ? 76  VAL A HG22 1  
ATOM   1180  H  HG23 . VAL A 1 76 ? 143.854 6.336   5.470   1.00 0.00 ? 76  VAL A HG23 1  
ATOM   1181  N  N    . LEU A 1 77 ? 140.244 2.957   5.956   1.00 0.00 ? 77  LEU A N    1  
ATOM   1182  C  CA   . LEU A 1 77 ? 139.607 1.759   6.502   1.00 0.00 ? 77  LEU A CA   1  
ATOM   1183  C  C    . LEU A 1 77 ? 139.686 0.550   5.569   1.00 0.00 ? 77  LEU A C    1  
ATOM   1184  O  O    . LEU A 1 77 ? 139.880 -0.572  6.033   1.00 0.00 ? 77  LEU A O    1  
ATOM   1185  C  CB   . LEU A 1 77 ? 138.137 2.044   6.816   1.00 0.00 ? 77  LEU A CB   1  
ATOM   1186  C  CG   . LEU A 1 77 ? 137.515 0.839   7.545   1.00 0.00 ? 77  LEU A CG   1  
ATOM   1187  C  CD1  . LEU A 1 77 ? 138.071 0.750   8.969   1.00 0.00 ? 77  LEU A CD1  1  
ATOM   1188  C  CD2  . LEU A 1 77 ? 135.993 1.003   7.610   1.00 0.00 ? 77  LEU A CD2  1  
ATOM   1189  H  H    . LEU A 1 77 ? 139.691 3.729   5.716   1.00 0.00 ? 77  LEU A H    1  
ATOM   1190  H  HA   . LEU A 1 77 ? 140.102 1.507   7.426   1.00 0.00 ? 77  LEU A HA   1  
ATOM   1191  H  HB2  . LEU A 1 77 ? 138.069 2.923   7.438   1.00 0.00 ? 77  LEU A HB2  1  
ATOM   1192  H  HB3  . LEU A 1 77 ? 137.606 2.214   5.892   1.00 0.00 ? 77  LEU A HB3  1  
ATOM   1193  H  HG   . LEU A 1 77 ? 137.751 -0.068  7.013   1.00 0.00 ? 77  LEU A HG   1  
ATOM   1194  H  HD11 . LEU A 1 77 ? 138.225 1.743   9.364   1.00 0.00 ? 77  LEU A HD11 1  
ATOM   1195  H  HD12 . LEU A 1 77 ? 139.011 0.217   8.956   1.00 0.00 ? 77  LEU A HD12 1  
ATOM   1196  H  HD13 . LEU A 1 77 ? 137.369 0.220   9.597   1.00 0.00 ? 77  LEU A HD13 1  
ATOM   1197  H  HD21 . LEU A 1 77 ? 135.549 0.087   7.971   1.00 0.00 ? 77  LEU A HD21 1  
ATOM   1198  H  HD22 . LEU A 1 77 ? 135.611 1.220   6.624   1.00 0.00 ? 77  LEU A HD22 1  
ATOM   1199  H  HD23 . LEU A 1 77 ? 135.745 1.811   8.281   1.00 0.00 ? 77  LEU A HD23 1  
ATOM   1200  N  N    . VAL A 1 78 ? 139.493 0.756   4.262   1.00 0.00 ? 78  VAL A N    1  
ATOM   1201  C  CA   . VAL A 1 78 ? 139.503 -0.388  3.340   1.00 0.00 ? 78  VAL A CA   1  
ATOM   1202  C  C    . VAL A 1 78 ? 140.818 -1.161  3.425   1.00 0.00 ? 78  VAL A C    1  
ATOM   1203  O  O    . VAL A 1 78 ? 140.836 -2.397  3.310   1.00 0.00 ? 78  VAL A O    1  
ATOM   1204  C  CB   . VAL A 1 78 ? 139.254 0.068   1.896   1.00 0.00 ? 78  VAL A CB   1  
ATOM   1205  C  CG1  . VAL A 1 78 ? 140.537 0.642   1.288   1.00 0.00 ? 78  VAL A CG1  1  
ATOM   1206  C  CG2  . VAL A 1 78 ? 138.782 -1.129  1.063   1.00 0.00 ? 78  VAL A CG2  1  
ATOM   1207  H  H    . VAL A 1 78 ? 139.300 1.667   3.923   1.00 0.00 ? 78  VAL A H    1  
ATOM   1208  H  HA   . VAL A 1 78 ? 138.702 -1.057  3.625   1.00 0.00 ? 78  VAL A HA   1  
ATOM   1209  H  HB   . VAL A 1 78 ? 138.488 0.830   1.891   1.00 0.00 ? 78  VAL A HB   1  
ATOM   1210  H  HG11 . VAL A 1 78 ? 141.090 -0.144  0.795   1.00 0.00 ? 78  VAL A HG11 1  
ATOM   1211  H  HG12 . VAL A 1 78 ? 141.143 1.068   2.065   1.00 0.00 ? 78  VAL A HG12 1  
ATOM   1212  H  HG13 . VAL A 1 78 ? 140.284 1.406   0.569   1.00 0.00 ? 78  VAL A HG13 1  
ATOM   1213  H  HG21 . VAL A 1 78 ? 139.346 -2.007  1.344   1.00 0.00 ? 78  VAL A HG21 1  
ATOM   1214  H  HG22 . VAL A 1 78 ? 138.937 -0.921  0.014   1.00 0.00 ? 78  VAL A HG22 1  
ATOM   1215  H  HG23 . VAL A 1 78 ? 137.732 -1.302  1.244   1.00 0.00 ? 78  VAL A HG23 1  
ATOM   1216  N  N    . ALA A 1 79 ? 141.916 -0.442  3.638   1.00 0.00 ? 79  ALA A N    1  
ATOM   1217  C  CA   . ALA A 1 79 ? 143.213 -1.088  3.735   1.00 0.00 ? 79  ALA A CA   1  
ATOM   1218  C  C    . ALA A 1 79 ? 143.214 -2.072  4.897   1.00 0.00 ? 79  ALA A C    1  
ATOM   1219  O  O    . ALA A 1 79 ? 143.778 -3.161  4.805   1.00 0.00 ? 79  ALA A O    1  
ATOM   1220  C  CB   . ALA A 1 79 ? 144.303 -0.034  3.948   1.00 0.00 ? 79  ALA A CB   1  
ATOM   1221  H  H    . ALA A 1 79 ? 141.849 0.532   3.730   1.00 0.00 ? 79  ALA A H    1  
ATOM   1222  H  HA   . ALA A 1 79 ? 143.414 -1.619  2.818   1.00 0.00 ? 79  ALA A HA   1  
ATOM   1223  H  HB1  . ALA A 1 79 ? 144.665 0.306   2.989   1.00 0.00 ? 79  ALA A HB1  1  
ATOM   1224  H  HB2  . ALA A 1 79 ? 145.119 -0.465  4.508   1.00 0.00 ? 79  ALA A HB2  1  
ATOM   1225  H  HB3  . ALA A 1 79 ? 143.893 0.802   4.495   1.00 0.00 ? 79  ALA A HB3  1  
ATOM   1226  N  N    . ALA A 1 80 ? 142.568 -1.688  5.989   1.00 0.00 ? 80  ALA A N    1  
ATOM   1227  C  CA   . ALA A 1 80 ? 142.490 -2.563  7.145   1.00 0.00 ? 80  ALA A CA   1  
ATOM   1228  C  C    . ALA A 1 80 ? 141.594 -3.770  6.855   1.00 0.00 ? 80  ALA A C    1  
ATOM   1229  O  O    . ALA A 1 80 ? 141.901 -4.893  7.255   1.00 0.00 ? 80  ALA A O    1  
ATOM   1230  C  CB   . ALA A 1 80 ? 141.938 -1.792  8.346   1.00 0.00 ? 80  ALA A CB   1  
ATOM   1231  H  H    . ALA A 1 80 ? 142.126 -0.813  6.011   1.00 0.00 ? 80  ALA A H    1  
ATOM   1232  H  HA   . ALA A 1 80 ? 143.484 -2.912  7.384   1.00 0.00 ? 80  ALA A HA   1  
ATOM   1233  H  HB1  . ALA A 1 80 ? 142.689 -1.106  8.709   1.00 0.00 ? 80  ALA A HB1  1  
ATOM   1234  H  HB2  . ALA A 1 80 ? 141.676 -2.487  9.130   1.00 0.00 ? 80  ALA A HB2  1  
ATOM   1235  H  HB3  . ALA A 1 80 ? 141.060 -1.239  8.046   1.00 0.00 ? 80  ALA A HB3  1  
ATOM   1236  N  N    . LEU A 1 81 ? 140.469 -3.520  6.175   1.00 0.00 ? 81  LEU A N    1  
ATOM   1237  C  CA   . LEU A 1 81 ? 139.517 -4.587  5.859   1.00 0.00 ? 81  LEU A CA   1  
ATOM   1238  C  C    . LEU A 1 81 ? 140.108 -5.656  4.944   1.00 0.00 ? 81  LEU A C    1  
ATOM   1239  O  O    . LEU A 1 81 ? 139.832 -6.845  5.124   1.00 0.00 ? 81  LEU A O    1  
ATOM   1240  C  CB   . LEU A 1 81 ? 138.268 -4.000  5.195   1.00 0.00 ? 81  LEU A CB   1  
ATOM   1241  C  CG   . LEU A 1 81 ? 137.603 -2.981  6.126   1.00 0.00 ? 81  LEU A CG   1  
ATOM   1242  C  CD1  . LEU A 1 81 ? 136.314 -2.469  5.478   1.00 0.00 ? 81  LEU A CD1  1  
ATOM   1243  C  CD2  . LEU A 1 81 ? 137.264 -3.643  7.466   1.00 0.00 ? 81  LEU A CD2  1  
ATOM   1244  H  H    . LEU A 1 81 ? 140.270 -2.601  5.898   1.00 0.00 ? 81  LEU A H    1  
ATOM   1245  H  HA   . LEU A 1 81 ? 139.221 -5.063  6.780   1.00 0.00 ? 81  LEU A HA   1  
ATOM   1246  H  HB2  . LEU A 1 81 ? 138.548 -3.513  4.273   1.00 0.00 ? 81  LEU A HB2  1  
ATOM   1247  H  HB3  . LEU A 1 81 ? 137.569 -4.796  4.982   1.00 0.00 ? 81  LEU A HB3  1  
ATOM   1248  H  HG   . LEU A 1 81 ? 138.275 -2.156  6.289   1.00 0.00 ? 81  LEU A HG   1  
ATOM   1249  H  HD11 . LEU A 1 81 ? 136.061 -1.506  5.893   1.00 0.00 ? 81  LEU A HD11 1  
ATOM   1250  H  HD12 . LEU A 1 81 ? 135.514 -3.168  5.670   1.00 0.00 ? 81  LEU A HD12 1  
ATOM   1251  H  HD13 . LEU A 1 81 ? 136.460 -2.375  4.412   1.00 0.00 ? 81  LEU A HD13 1  
ATOM   1252  H  HD21 . LEU A 1 81 ? 137.010 -4.679  7.302   1.00 0.00 ? 81  LEU A HD21 1  
ATOM   1253  H  HD22 . LEU A 1 81 ? 136.426 -3.134  7.920   1.00 0.00 ? 81  LEU A HD22 1  
ATOM   1254  H  HD23 . LEU A 1 81 ? 138.119 -3.582  8.123   1.00 0.00 ? 81  LEU A HD23 1  
ATOM   1255  N  N    . THR A 1 82 ? 140.914 -5.256  3.961   1.00 0.00 ? 82  THR A N    1  
ATOM   1256  C  CA   . THR A 1 82 ? 141.482 -6.261  3.065   1.00 0.00 ? 82  THR A CA   1  
ATOM   1257  C  C    . THR A 1 82 ? 142.306 -7.258  3.866   1.00 0.00 ? 82  THR A C    1  
ATOM   1258  O  O    . THR A 1 82 ? 142.221 -8.466  3.650   1.00 0.00 ? 82  THR A O    1  
ATOM   1259  C  CB   . THR A 1 82 ? 142.350 -5.616  1.981   1.00 0.00 ? 82  THR A CB   1  
ATOM   1260  O  OG1  . THR A 1 82 ? 143.143 -6.615  1.357   1.00 0.00 ? 82  THR A OG1  1  
ATOM   1261  C  CG2  . THR A 1 82 ? 143.254 -4.561  2.601   1.00 0.00 ? 82  THR A CG2  1  
ATOM   1262  H  H    . THR A 1 82 ? 141.112 -4.294  3.831   1.00 0.00 ? 82  THR A H    1  
ATOM   1263  H  HA   . THR A 1 82 ? 140.672 -6.792  2.588   1.00 0.00 ? 82  THR A HA   1  
ATOM   1264  H  HB   . THR A 1 82 ? 141.714 -5.149  1.245   1.00 0.00 ? 82  THR A HB   1  
ATOM   1265  H  HG1  . THR A 1 82 ? 143.939 -6.195  1.021   1.00 0.00 ? 82  THR A HG1  1  
ATOM   1266  H  HG21 . THR A 1 82 ? 143.797 -4.992  3.428   1.00 0.00 ? 82  THR A HG21 1  
ATOM   1267  H  HG22 . THR A 1 82 ? 142.650 -3.741  2.950   1.00 0.00 ? 82  THR A HG22 1  
ATOM   1268  H  HG23 . THR A 1 82 ? 143.953 -4.205  1.858   1.00 0.00 ? 82  THR A HG23 1  
ATOM   1269  N  N    . VAL A 1 83 ? 143.091 -6.744  4.806   1.00 0.00 ? 83  VAL A N    1  
ATOM   1270  C  CA   . VAL A 1 83 ? 143.909 -7.601  5.649   1.00 0.00 ? 83  VAL A CA   1  
ATOM   1271  C  C    . VAL A 1 83 ? 143.016 -8.497  6.498   1.00 0.00 ? 83  VAL A C    1  
ATOM   1272  O  O    . VAL A 1 83 ? 143.295 -9.681  6.684   1.00 0.00 ? 83  VAL A O    1  
ATOM   1273  C  CB   . VAL A 1 83 ? 144.796 -6.742  6.549   1.00 0.00 ? 83  VAL A CB   1  
ATOM   1274  C  CG1  . VAL A 1 83 ? 145.601 -7.641  7.491   1.00 0.00 ? 83  VAL A CG1  1  
ATOM   1275  C  CG2  . VAL A 1 83 ? 145.735 -5.904  5.681   1.00 0.00 ? 83  VAL A CG2  1  
ATOM   1276  H  H    . VAL A 1 83 ? 143.109 -5.774  4.944   1.00 0.00 ? 83  VAL A H    1  
ATOM   1277  H  HA   . VAL A 1 83 ? 144.536 -8.219  5.022   1.00 0.00 ? 83  VAL A HA   1  
ATOM   1278  H  HB   . VAL A 1 83 ? 144.175 -6.086  7.132   1.00 0.00 ? 83  VAL A HB   1  
ATOM   1279  H  HG11 . VAL A 1 83 ? 146.116 -8.396  6.915   1.00 0.00 ? 83  VAL A HG11 1  
ATOM   1280  H  HG12 . VAL A 1 83 ? 144.933 -8.118  8.193   1.00 0.00 ? 83  VAL A HG12 1  
ATOM   1281  H  HG13 . VAL A 1 83 ? 146.322 -7.043  8.029   1.00 0.00 ? 83  VAL A HG13 1  
ATOM   1282  H  HG21 . VAL A 1 83 ? 145.917 -6.415  4.752   1.00 0.00 ? 83  VAL A HG21 1  
ATOM   1283  H  HG22 . VAL A 1 83 ? 146.671 -5.749  6.198   1.00 0.00 ? 83  VAL A HG22 1  
ATOM   1284  H  HG23 . VAL A 1 83 ? 145.274 -4.950  5.478   1.00 0.00 ? 83  VAL A HG23 1  
ATOM   1285  N  N    . ALA A 1 84 ? 141.930 -7.914  7.001   1.00 0.00 ? 84  ALA A N    1  
ATOM   1286  C  CA   . ALA A 1 84 ? 140.982 -8.656  7.821   1.00 0.00 ? 84  ALA A CA   1  
ATOM   1287  C  C    . ALA A 1 84 ? 140.356 -9.778  7.008   1.00 0.00 ? 84  ALA A C    1  
ATOM   1288  O  O    . ALA A 1 84 ? 140.010 -10.831 7.542   1.00 0.00 ? 84  ALA A O    1  
ATOM   1289  C  CB   . ALA A 1 84 ? 139.888 -7.719  8.335   1.00 0.00 ? 84  ALA A CB   1  
ATOM   1290  H  H    . ALA A 1 84 ? 141.760 -6.968  6.808   1.00 0.00 ? 84  ALA A H    1  
ATOM   1291  H  HA   . ALA A 1 84 ? 141.505 -9.081  8.664   1.00 0.00 ? 84  ALA A HA   1  
ATOM   1292  H  HB1  . ALA A 1 84 ? 139.390 -8.176  9.178   1.00 0.00 ? 84  ALA A HB1  1  
ATOM   1293  H  HB2  . ALA A 1 84 ? 139.171 -7.537  7.549   1.00 0.00 ? 84  ALA A HB2  1  
ATOM   1294  H  HB3  . ALA A 1 84 ? 140.330 -6.783  8.643   1.00 0.00 ? 84  ALA A HB3  1  
ATOM   1295  N  N    . CYS A 1 85 ? 140.211 -9.540  5.708   1.00 0.00 ? 85  CYS A N    1  
ATOM   1296  C  CA   . CYS A 1 85 ? 139.621 -10.536 4.824   1.00 0.00 ? 85  CYS A CA   1  
ATOM   1297  C  C    . CYS A 1 85 ? 140.406 -11.845 4.897   1.00 0.00 ? 85  CYS A C    1  
ATOM   1298  O  O    . CYS A 1 85 ? 139.830 -12.931 4.821   1.00 0.00 ? 85  CYS A O    1  
ATOM   1299  C  CB   . CYS A 1 85 ? 139.605 -9.997  3.383   1.00 0.00 ? 85  CYS A CB   1  
ATOM   1300  S  SG   . CYS A 1 85 ? 141.085 -10.537 2.484   1.00 0.00 ? 85  CYS A SG   1  
ATOM   1301  H  H    . CYS A 1 85 ? 140.501 -8.677  5.339   1.00 0.00 ? 85  CYS A H    1  
ATOM   1302  H  HA   . CYS A 1 85 ? 138.605 -10.722 5.136   1.00 0.00 ? 85  CYS A HA   1  
ATOM   1303  H  HB2  . CYS A 1 85 ? 138.728 -10.363 2.875   1.00 0.00 ? 85  CYS A HB2  1  
ATOM   1304  H  HB3  . CYS A 1 85 ? 139.576 -8.918  3.409   1.00 0.00 ? 85  CYS A HB3  1  
ATOM   1305  H  HG   . CYS A 1 85 ? 141.807 -9.953  2.727   1.00 0.00 ? 85  CYS A HG   1  
ATOM   1306  N  N    . ASN A 1 86 ? 141.722 -11.731 5.051   1.00 0.00 ? 86  ASN A N    1  
ATOM   1307  C  CA   . ASN A 1 86 ? 142.577 -12.910 5.140   1.00 0.00 ? 86  ASN A CA   1  
ATOM   1308  C  C    . ASN A 1 86 ? 142.126 -13.819 6.280   1.00 0.00 ? 86  ASN A C    1  
ATOM   1309  O  O    . ASN A 1 86 ? 142.226 -15.047 6.190   1.00 0.00 ? 86  ASN A O    1  
ATOM   1310  C  CB   . ASN A 1 86 ? 144.028 -12.482 5.371   1.00 0.00 ? 86  ASN A CB   1  
ATOM   1311  C  CG   . ASN A 1 86 ? 144.539 -11.700 4.166   1.00 0.00 ? 86  ASN A CG   1  
ATOM   1312  O  OD1  . ASN A 1 86 ? 143.953 -11.769 3.086   1.00 0.00 ? 86  ASN A OD1  1  
ATOM   1313  N  ND2  . ASN A 1 86 ? 145.604 -10.955 4.289   1.00 0.00 ? 86  ASN A ND2  1  
ATOM   1314  H  H    . ASN A 1 86 ? 142.123 -10.839 5.110   1.00 0.00 ? 86  ASN A H    1  
ATOM   1315  H  HA   . ASN A 1 86 ? 142.519 -13.456 4.212   1.00 0.00 ? 86  ASN A HA   1  
ATOM   1316  H  HB2  . ASN A 1 86 ? 144.082 -11.861 6.253   1.00 0.00 ? 86  ASN A HB2  1  
ATOM   1317  H  HB3  . ASN A 1 86 ? 144.641 -13.361 5.513   1.00 0.00 ? 86  ASN A HB3  1  
ATOM   1318  H  HD21 . ASN A 1 86 ? 146.068 -10.901 5.150   1.00 0.00 ? 86  ASN A HD21 1  
ATOM   1319  H  HD22 . ASN A 1 86 ? 145.938 -10.449 3.519   1.00 0.00 ? 86  ASN A HD22 1  
ATOM   1320  N  N    . ASN A 1 87 ? 141.635 -13.213 7.358   1.00 0.00 ? 87  ASN A N    1  
ATOM   1321  C  CA   . ASN A 1 87 ? 141.184 -13.990 8.502   1.00 0.00 ? 87  ASN A CA   1  
ATOM   1322  C  C    . ASN A 1 87 ? 140.155 -15.020 8.061   1.00 0.00 ? 87  ASN A C    1  
ATOM   1323  O  O    . ASN A 1 87 ? 140.162 -16.157 8.531   1.00 0.00 ? 87  ASN A O    1  
ATOM   1324  C  CB   . ASN A 1 87 ? 140.570 -13.065 9.554   1.00 0.00 ? 87  ASN A CB   1  
ATOM   1325  C  CG   . ASN A 1 87 ? 140.375 -13.821 10.863  1.00 0.00 ? 87  ASN A CG   1  
ATOM   1326  O  OD1  . ASN A 1 87 ? 140.664 -15.016 10.941  1.00 0.00 ? 87  ASN A OD1  1  
ATOM   1327  N  ND2  . ASN A 1 87 ? 139.899 -13.194 11.905  1.00 0.00 ? 87  ASN A ND2  1  
ATOM   1328  H  H    . ASN A 1 87 ? 141.581 -12.235 7.382   1.00 0.00 ? 87  ASN A H    1  
ATOM   1329  H  HA   . ASN A 1 87 ? 142.031 -14.501 8.936   1.00 0.00 ? 87  ASN A HA   1  
ATOM   1330  H  HB2  . ASN A 1 87 ? 141.228 -12.225 9.720   1.00 0.00 ? 87  ASN A HB2  1  
ATOM   1331  H  HB3  . ASN A 1 87 ? 139.613 -12.707 9.203   1.00 0.00 ? 87  ASN A HB3  1  
ATOM   1332  H  HD21 . ASN A 1 87 ? 139.669 -12.243 11.841  1.00 0.00 ? 87  ASN A HD21 1  
ATOM   1333  H  HD22 . ASN A 1 87 ? 139.770 -13.674 12.749  1.00 0.00 ? 87  ASN A HD22 1  
ATOM   1334  N  N    . PHE A 1 88 ? 139.283 -14.628 7.137   1.00 0.00 ? 88  PHE A N    1  
ATOM   1335  C  CA   . PHE A 1 88 ? 138.280 -15.552 6.634   1.00 0.00 ? 88  PHE A CA   1  
ATOM   1336  C  C    . PHE A 1 88 ? 138.969 -16.752 5.995   1.00 0.00 ? 88  PHE A C    1  
ATOM   1337  O  O    . PHE A 1 88 ? 138.587 -17.899 6.223   1.00 0.00 ? 88  PHE A O    1  
ATOM   1338  C  CB   . PHE A 1 88 ? 137.390 -14.856 5.603   1.00 0.00 ? 88  PHE A CB   1  
ATOM   1339  C  CG   . PHE A 1 88 ? 136.279 -15.788 5.184   1.00 0.00 ? 88  PHE A CG   1  
ATOM   1340  C  CD1  . PHE A 1 88 ? 135.107 -15.866 5.947   1.00 0.00 ? 88  PHE A CD1  1  
ATOM   1341  C  CD2  . PHE A 1 88 ? 136.421 -16.575 4.036   1.00 0.00 ? 88  PHE A CD2  1  
ATOM   1342  C  CE1  . PHE A 1 88 ? 134.077 -16.731 5.559   1.00 0.00 ? 88  PHE A CE1  1  
ATOM   1343  C  CE2  . PHE A 1 88 ? 135.391 -17.440 3.648   1.00 0.00 ? 88  PHE A CE2  1  
ATOM   1344  C  CZ   . PHE A 1 88 ? 134.219 -17.518 4.409   1.00 0.00 ? 88  PHE A CZ   1  
ATOM   1345  H  H    . PHE A 1 88 ? 139.329 -13.716 6.781   1.00 0.00 ? 88  PHE A H    1  
ATOM   1346  H  HA   . PHE A 1 88 ? 137.668 -15.892 7.455   1.00 0.00 ? 88  PHE A HA   1  
ATOM   1347  H  HB2  . PHE A 1 88 ? 136.968 -13.962 6.038   1.00 0.00 ? 88  PHE A HB2  1  
ATOM   1348  H  HB3  . PHE A 1 88 ? 137.981 -14.591 4.739   1.00 0.00 ? 88  PHE A HB3  1  
ATOM   1349  H  HD1  . PHE A 1 88 ? 134.998 -15.260 6.833   1.00 0.00 ? 88  PHE A HD1  1  
ATOM   1350  H  HD2  . PHE A 1 88 ? 137.325 -16.514 3.448   1.00 0.00 ? 88  PHE A HD2  1  
ATOM   1351  H  HE1  . PHE A 1 88 ? 133.173 -16.791 6.147   1.00 0.00 ? 88  PHE A HE1  1  
ATOM   1352  H  HE2  . PHE A 1 88 ? 135.499 -18.046 2.761   1.00 0.00 ? 88  PHE A HE2  1  
ATOM   1353  H  HZ   . PHE A 1 88 ? 133.424 -18.185 4.111   1.00 0.00 ? 88  PHE A HZ   1  
ATOM   1354  N  N    . PHE A 1 89 ? 140.000 -16.467 5.201   1.00 0.00 ? 89  PHE A N    1  
ATOM   1355  C  CA   . PHE A 1 89 ? 140.760 -17.519 4.539   1.00 0.00 ? 89  PHE A CA   1  
ATOM   1356  C  C    . PHE A 1 89 ? 141.365 -18.458 5.575   1.00 0.00 ? 89  PHE A C    1  
ATOM   1357  O  O    . PHE A 1 89 ? 141.376 -19.676 5.396   1.00 0.00 ? 89  PHE A O    1  
ATOM   1358  C  CB   . PHE A 1 89 ? 141.870 -16.909 3.679   1.00 0.00 ? 89  PHE A CB   1  
ATOM   1359  C  CG   . PHE A 1 89 ? 142.544 -18.001 2.881   1.00 0.00 ? 89  PHE A CG   1  
ATOM   1360  C  CD1  . PHE A 1 89 ? 141.997 -18.409 1.658   1.00 0.00 ? 89  PHE A CD1  1  
ATOM   1361  C  CD2  . PHE A 1 89 ? 143.714 -18.605 3.358   1.00 0.00 ? 89  PHE A CD2  1  
ATOM   1362  C  CE1  . PHE A 1 89 ? 142.618 -19.419 0.915   1.00 0.00 ? 89  PHE A CE1  1  
ATOM   1363  C  CE2  . PHE A 1 89 ? 144.335 -19.616 2.615   1.00 0.00 ? 89  PHE A CE2  1  
ATOM   1364  C  CZ   . PHE A 1 89 ? 143.787 -20.023 1.393   1.00 0.00 ? 89  PHE A CZ   1  
ATOM   1365  H  H    . PHE A 1 89 ? 140.260 -15.532 5.069   1.00 0.00 ? 89  PHE A H    1  
ATOM   1366  H  HA   . PHE A 1 89 ? 140.095 -18.083 3.902   1.00 0.00 ? 89  PHE A HA   1  
ATOM   1367  H  HB2  . PHE A 1 89 ? 141.445 -16.180 3.006   1.00 0.00 ? 89  PHE A HB2  1  
ATOM   1368  H  HB3  . PHE A 1 89 ? 142.597 -16.429 4.316   1.00 0.00 ? 89  PHE A HB3  1  
ATOM   1369  H  HD1  . PHE A 1 89 ? 141.095 -17.944 1.289   1.00 0.00 ? 89  PHE A HD1  1  
ATOM   1370  H  HD2  . PHE A 1 89 ? 144.137 -18.291 4.300   1.00 0.00 ? 89  PHE A HD2  1  
ATOM   1371  H  HE1  . PHE A 1 89 ? 142.195 -19.733 -0.028  1.00 0.00 ? 89  PHE A HE1  1  
ATOM   1372  H  HE2  . PHE A 1 89 ? 145.236 -20.082 2.985   1.00 0.00 ? 89  PHE A HE2  1  
ATOM   1373  H  HZ   . PHE A 1 89 ? 144.265 -20.803 0.820   1.00 0.00 ? 89  PHE A HZ   1  
ATOM   1374  N  N    . TRP A 1 90 ? 141.873 -17.876 6.661   1.00 0.00 ? 90  TRP A N    1  
ATOM   1375  C  CA   . TRP A 1 90 ? 142.485 -18.670 7.722   1.00 0.00 ? 90  TRP A CA   1  
ATOM   1376  C  C    . TRP A 1 90 ? 141.514 -19.732 8.227   1.00 0.00 ? 90  TRP A C    1  
ATOM   1377  O  O    . TRP A 1 90 ? 141.922 -20.829 8.607   1.00 0.00 ? 90  TRP A O    1  
ATOM   1378  C  CB   . TRP A 1 90 ? 142.901 -17.776 8.884   1.00 0.00 ? 90  TRP A CB   1  
ATOM   1379  C  CG   . TRP A 1 90 ? 143.931 -16.793 8.428   1.00 0.00 ? 90  TRP A CG   1  
ATOM   1380  C  CD1  . TRP A 1 90 ? 144.411 -16.673 7.167   1.00 0.00 ? 90  TRP A CD1  1  
ATOM   1381  C  CD2  . TRP A 1 90 ? 144.635 -15.809 9.225   1.00 0.00 ? 90  TRP A CD2  1  
ATOM   1382  N  NE1  . TRP A 1 90 ? 145.351 -15.657 7.144   1.00 0.00 ? 90  TRP A NE1  1  
ATOM   1383  C  CE2  . TRP A 1 90 ? 145.525 -15.096 8.393   1.00 0.00 ? 90  TRP A CE2  1  
ATOM   1384  C  CE3  . TRP A 1 90 ? 144.574 -15.472 10.580  1.00 0.00 ? 90  TRP A CE3  1  
ATOM   1385  C  CZ2  . TRP A 1 90 ? 146.334 -14.075 8.896   1.00 0.00 ? 90  TRP A CZ2  1  
ATOM   1386  C  CZ3  . TRP A 1 90 ? 145.384 -14.448 11.096  1.00 0.00 ? 90  TRP A CZ3  1  
ATOM   1387  C  CH2  . TRP A 1 90 ? 146.263 -13.749 10.255  1.00 0.00 ? 90  TRP A CH2  1  
ATOM   1388  H  H    . TRP A 1 90 ? 141.840 -16.895 6.744   1.00 0.00 ? 90  TRP A H    1  
ATOM   1389  H  HA   . TRP A 1 90 ? 143.366 -19.155 7.338   1.00 0.00 ? 90  TRP A HA   1  
ATOM   1390  H  HB2  . TRP A 1 90 ? 142.039 -17.245 9.256   1.00 0.00 ? 90  TRP A HB2  1  
ATOM   1391  H  HB3  . TRP A 1 90 ? 143.314 -18.386 9.675   1.00 0.00 ? 90  TRP A HB3  1  
ATOM   1392  H  HD1  . TRP A 1 90 ? 144.101 -17.260 6.318   1.00 0.00 ? 90  TRP A HD1  1  
ATOM   1393  H  HE1  . TRP A 1 90 ? 145.844 -15.360 6.351   1.00 0.00 ? 90  TRP A HE1  1  
ATOM   1394  H  HE3  . TRP A 1 90 ? 143.901 -16.012 11.227  1.00 0.00 ? 90  TRP A HE3  1  
ATOM   1395  H  HZ2  . TRP A 1 90 ? 147.008 -13.542 8.242   1.00 0.00 ? 90  TRP A HZ2  1  
ATOM   1396  H  HZ3  . TRP A 1 90 ? 145.331 -14.196 12.146  1.00 0.00 ? 90  TRP A HZ3  1  
ATOM   1397  H  HH2  . TRP A 1 90 ? 146.885 -12.962 10.655  1.00 0.00 ? 90  TRP A HH2  1  
ATOM   1398  N  N    . GLU A 1 91 ? 140.228 -19.398 8.229   1.00 0.00 ? 91  GLU A N    1  
ATOM   1399  C  CA   . GLU A 1 91 ? 139.207 -20.331 8.692   1.00 0.00 ? 91  GLU A CA   1  
ATOM   1400  C  C    . GLU A 1 91 ? 139.275 -21.635 7.903   1.00 0.00 ? 91  GLU A C    1  
ATOM   1401  O  O    . GLU A 1 91 ? 139.001 -22.710 8.436   1.00 0.00 ? 91  GLU A O    1  
ATOM   1402  C  CB   . GLU A 1 91 ? 137.819 -19.708 8.534   1.00 0.00 ? 91  GLU A CB   1  
ATOM   1403  C  CG   . GLU A 1 91 ? 136.769 -20.636 9.148   1.00 0.00 ? 91  GLU A CG   1  
ATOM   1404  C  CD   . GLU A 1 91 ? 135.372 -20.074 8.908   1.00 0.00 ? 91  GLU A CD   1  
ATOM   1405  O  OE1  . GLU A 1 91 ? 135.273 -19.038 8.274   1.00 0.00 ? 91  GLU A OE1  1  
ATOM   1406  O  OE2  . GLU A 1 91 ? 134.422 -20.691 9.361   1.00 0.00 ? 91  GLU A OE2  1  
ATOM   1407  H  H    . GLU A 1 91 ? 139.961 -18.508 7.917   1.00 0.00 ? 91  GLU A H    1  
ATOM   1408  H  HA   . GLU A 1 91 ? 139.375 -20.545 9.737   1.00 0.00 ? 91  GLU A HA   1  
ATOM   1409  H  HB2  . GLU A 1 91 ? 137.795 -18.753 9.036   1.00 0.00 ? 91  GLU A HB2  1  
ATOM   1410  H  HB3  . GLU A 1 91 ? 137.604 -19.570 7.485   1.00 0.00 ? 91  GLU A HB3  1  
ATOM   1411  H  HG2  . GLU A 1 91 ? 136.846 -21.613 8.695   1.00 0.00 ? 91  GLU A HG2  1  
ATOM   1412  H  HG3  . GLU A 1 91 ? 136.943 -20.719 10.211  1.00 0.00 ? 91  GLU A HG3  1  
ATOM   1413  N  N    . ASN A 1 92 ? 139.640 -21.532 6.629   1.00 0.00 ? 92  ASN A N    1  
ATOM   1414  C  CA   . ASN A 1 92 ? 139.740 -22.712 5.777   1.00 0.00 ? 92  ASN A CA   1  
ATOM   1415  C  C    . ASN A 1 92 ? 140.669 -23.747 6.401   1.00 0.00 ? 92  ASN A C    1  
ATOM   1416  O  O    . ASN A 1 92 ? 140.431 -24.951 6.301   1.00 0.00 ? 92  ASN A O    1  
ATOM   1417  C  CB   . ASN A 1 92 ? 140.268 -22.316 4.396   1.00 0.00 ? 92  ASN A CB   1  
ATOM   1418  C  CG   . ASN A 1 92 ? 140.083 -23.471 3.418   1.00 0.00 ? 92  ASN A CG   1  
ATOM   1419  O  OD1  . ASN A 1 92 ? 139.603 -24.539 3.798   1.00 0.00 ? 92  ASN A OD1  1  
ATOM   1420  N  ND2  . ASN A 1 92 ? 140.438 -23.320 2.170   1.00 0.00 ? 92  ASN A ND2  1  
ATOM   1421  H  H    . ASN A 1 92 ? 139.847 -20.650 6.256   1.00 0.00 ? 92  ASN A H    1  
ATOM   1422  H  HA   . ASN A 1 92 ? 138.758 -23.146 5.662   1.00 0.00 ? 92  ASN A HA   1  
ATOM   1423  H  HB2  . ASN A 1 92 ? 139.727 -21.453 4.040   1.00 0.00 ? 92  ASN A HB2  1  
ATOM   1424  H  HB3  . ASN A 1 92 ? 141.318 -22.075 4.469   1.00 0.00 ? 92  ASN A HB3  1  
ATOM   1425  H  HD21 . ASN A 1 92 ? 140.821 -22.469 1.869   1.00 0.00 ? 92  ASN A HD21 1  
ATOM   1426  H  HD22 . ASN A 1 92 ? 140.322 -24.057 1.536   1.00 0.00 ? 92  ASN A HD22 1  
ATOM   1427  N  N    . SER A 1 93 ? 141.730 -23.272 7.047   1.00 0.00 ? 93  SER A N    1  
ATOM   1428  C  CA   . SER A 1 93 ? 142.688 -24.166 7.685   1.00 0.00 ? 93  SER A CA   1  
ATOM   1429  C  C    . SER A 1 93 ? 143.703 -23.371 8.500   1.00 0.00 ? 93  SER A C    1  
ATOM   1430  O  O    . SER A 1 93 ? 144.866 -23.379 8.131   1.00 0.00 ? 93  SER A O    1  
ATOM   1431  C  CB   . SER A 1 93 ? 143.417 -24.992 6.624   1.00 0.00 ? 93  SER A CB   1  
ATOM   1432  O  OG   . SER A 1 93 ? 144.378 -25.826 7.259   1.00 0.00 ? 93  SER A OG   1  
ATOM   1433  O  OXT  . SER A 1 93 ? 143.303 -22.766 9.481   1.00 0.00 ? 93  SER A OXT  1  
ATOM   1434  H  H    . SER A 1 93 ? 141.869 -22.303 7.095   1.00 0.00 ? 93  SER A H    1  
ATOM   1435  H  HA   . SER A 1 93 ? 142.157 -24.836 8.344   1.00 0.00 ? 93  SER A HA   1  
ATOM   1436  H  HB2  . SER A 1 93 ? 142.710 -25.606 6.095   1.00 0.00 ? 93  SER A HB2  1  
ATOM   1437  H  HB3  . SER A 1 93 ? 143.908 -24.327 5.926   1.00 0.00 ? 93  SER A HB3  1  
ATOM   1438  H  HG   . SER A 1 93 ? 145.040 -26.066 6.606   1.00 0.00 ? 93  SER A HG   1  
ATOM   1439  N  N    . GLY B 1 1  ? 132.593 -10.218 -7.157  1.00 0.00 ? 1   GLY B N    1  
ATOM   1440  C  CA   . GLY B 1 1  ? 132.979 -10.196 -8.562  1.00 0.00 ? 1   GLY B CA   1  
ATOM   1441  C  C    . GLY B 1 1  ? 133.379 -8.790  -8.995  1.00 0.00 ? 1   GLY B C    1  
ATOM   1442  O  O    . GLY B 1 1  ? 133.798 -8.576  -10.133 1.00 0.00 ? 1   GLY B O    1  
ATOM   1443  H  H1   . GLY B 1 1  ? 132.752 -11.021 -6.617  1.00 0.00 ? 1   GLY B H1   1  
ATOM   1444  H  HA2  . GLY B 1 1  ? 133.815 -10.866 -8.711  1.00 0.00 ? 1   GLY B HA2  1  
ATOM   1445  H  HA3  . GLY B 1 1  ? 132.147 -10.527 -9.165  1.00 0.00 ? 1   GLY B HA3  1  
ATOM   1446  N  N    . SER B 1 2  ? 133.246 -7.835  -8.082  1.00 0.00 ? 2   SER B N    1  
ATOM   1447  C  CA   . SER B 1 2  ? 133.597 -6.451  -8.382  1.00 0.00 ? 2   SER B CA   1  
ATOM   1448  C  C    . SER B 1 2  ? 135.106 -6.302  -8.532  1.00 0.00 ? 2   SER B C    1  
ATOM   1449  O  O    . SER B 1 2  ? 135.868 -7.165  -8.098  1.00 0.00 ? 2   SER B O    1  
ATOM   1450  C  CB   . SER B 1 2  ? 133.102 -5.537  -7.267  1.00 0.00 ? 2   SER B CB   1  
ATOM   1451  O  OG   . SER B 1 2  ? 133.925 -5.707  -6.121  1.00 0.00 ? 2   SER B OG   1  
ATOM   1452  H  H    . SER B 1 2  ? 132.906 -8.063  -7.191  1.00 0.00 ? 2   SER B H    1  
ATOM   1453  H  HA   . SER B 1 2  ? 133.121 -6.161  -9.307  1.00 0.00 ? 2   SER B HA   1  
ATOM   1454  H  HB2  . SER B 1 2  ? 133.155 -4.511  -7.591  1.00 0.00 ? 2   SER B HB2  1  
ATOM   1455  H  HB3  . SER B 1 2  ? 132.077 -5.784  -7.028  1.00 0.00 ? 2   SER B HB3  1  
ATOM   1456  H  HG   . SER B 1 2  ? 134.814 -5.426  -6.348  1.00 0.00 ? 2   SER B HG   1  
ATOM   1457  N  N    . GLU B 1 3  ? 135.531 -5.210  -9.160  1.00 0.00 ? 3   GLU B N    1  
ATOM   1458  C  CA   . GLU B 1 3  ? 136.955 -4.979  -9.367  1.00 0.00 ? 3   GLU B CA   1  
ATOM   1459  C  C    . GLU B 1 3  ? 137.685 -4.859  -8.029  1.00 0.00 ? 3   GLU B C    1  
ATOM   1460  O  O    . GLU B 1 3  ? 138.831 -5.292  -7.893  1.00 0.00 ? 3   GLU B O    1  
ATOM   1461  C  CB   . GLU B 1 3  ? 137.166 -3.685  -10.157 1.00 0.00 ? 3   GLU B CB   1  
ATOM   1462  C  CG   . GLU B 1 3  ? 136.512 -3.796  -11.534 1.00 0.00 ? 3   GLU B CG   1  
ATOM   1463  C  CD   . GLU B 1 3  ? 136.814 -2.546  -12.353 1.00 0.00 ? 3   GLU B CD   1  
ATOM   1464  O  OE1  . GLU B 1 3  ? 137.350 -1.606  -11.788 1.00 0.00 ? 3   GLU B OE1  1  
ATOM   1465  O  OE2  . GLU B 1 3  ? 136.506 -2.546  -13.534 1.00 0.00 ? 3   GLU B OE2  1  
ATOM   1466  H  H    . GLU B 1 3  ? 134.880 -4.558  -9.494  1.00 0.00 ? 3   GLU B H    1  
ATOM   1467  H  HA   . GLU B 1 3  ? 137.371 -5.803  -9.926  1.00 0.00 ? 3   GLU B HA   1  
ATOM   1468  H  HB2  . GLU B 1 3  ? 136.728 -2.862  -9.617  1.00 0.00 ? 3   GLU B HB2  1  
ATOM   1469  H  HB3  . GLU B 1 3  ? 138.223 -3.513  -10.280 1.00 0.00 ? 3   GLU B HB3  1  
ATOM   1470  H  HG2  . GLU B 1 3  ? 136.889 -4.667  -12.047 1.00 0.00 ? 3   GLU B HG2  1  
ATOM   1471  H  HG3  . GLU B 1 3  ? 135.441 -3.883  -11.410 1.00 0.00 ? 3   GLU B HG3  1  
ATOM   1472  N  N    . LEU B 1 4  ? 137.015 -4.263  -7.042  1.00 0.00 ? 4   LEU B N    1  
ATOM   1473  C  CA   . LEU B 1 4  ? 137.621 -4.088  -5.726  1.00 0.00 ? 4   LEU B CA   1  
ATOM   1474  C  C    . LEU B 1 4  ? 138.015 -5.432  -5.129  1.00 0.00 ? 4   LEU B C    1  
ATOM   1475  O  O    . LEU B 1 4  ? 139.074 -5.558  -4.501  1.00 0.00 ? 4   LEU B O    1  
ATOM   1476  C  CB   . LEU B 1 4  ? 136.639 -3.377  -4.788  1.00 0.00 ? 4   LEU B CB   1  
ATOM   1477  C  CG   . LEU B 1 4  ? 137.305 -3.111  -3.430  1.00 0.00 ? 4   LEU B CG   1  
ATOM   1478  C  CD1  . LEU B 1 4  ? 138.372 -2.025  -3.577  1.00 0.00 ? 4   LEU B CD1  1  
ATOM   1479  C  CD2  . LEU B 1 4  ? 136.246 -2.646  -2.424  1.00 0.00 ? 4   LEU B CD2  1  
ATOM   1480  H  H    . LEU B 1 4  ? 136.107 -3.932  -7.204  1.00 0.00 ? 4   LEU B H    1  
ATOM   1481  H  HA   . LEU B 1 4  ? 138.505 -3.479  -5.828  1.00 0.00 ? 4   LEU B HA   1  
ATOM   1482  H  HB2  . LEU B 1 4  ? 136.334 -2.440  -5.232  1.00 0.00 ? 4   LEU B HB2  1  
ATOM   1483  H  HB3  . LEU B 1 4  ? 135.774 -4.000  -4.643  1.00 0.00 ? 4   LEU B HB3  1  
ATOM   1484  H  HG   . LEU B 1 4  ? 137.768 -4.017  -3.069  1.00 0.00 ? 4   LEU B HG   1  
ATOM   1485  H  HD11 . LEU B 1 4  ? 139.295 -2.473  -3.915  1.00 0.00 ? 4   LEU B HD11 1  
ATOM   1486  H  HD12 . LEU B 1 4  ? 138.534 -1.546  -2.623  1.00 0.00 ? 4   LEU B HD12 1  
ATOM   1487  H  HD13 . LEU B 1 4  ? 138.045 -1.289  -4.297  1.00 0.00 ? 4   LEU B HD13 1  
ATOM   1488  H  HD21 . LEU B 1 4  ? 135.380 -3.288  -2.491  1.00 0.00 ? 4   LEU B HD21 1  
ATOM   1489  H  HD22 . LEU B 1 4  ? 135.961 -1.629  -2.644  1.00 0.00 ? 4   LEU B HD22 1  
ATOM   1490  H  HD23 . LEU B 1 4  ? 136.654 -2.697  -1.425  1.00 0.00 ? 4   LEU B HD23 1  
ATOM   1491  N  N    . GLU B 1 5  ? 137.171 -6.444  -5.325  1.00 0.00 ? 5   GLU B N    1  
ATOM   1492  C  CA   . GLU B 1 5  ? 137.483 -7.754  -4.787  1.00 0.00 ? 5   GLU B CA   1  
ATOM   1493  C  C    . GLU B 1 5  ? 138.799 -8.231  -5.369  1.00 0.00 ? 5   GLU B C    1  
ATOM   1494  O  O    . GLU B 1 5  ? 139.645 -8.783  -4.666  1.00 0.00 ? 5   GLU B O    1  
ATOM   1495  C  CB   . GLU B 1 5  ? 136.372 -8.747  -5.136  1.00 0.00 ? 5   GLU B CB   1  
ATOM   1496  C  CG   . GLU B 1 5  ? 136.645 -10.084 -4.446  1.00 0.00 ? 5   GLU B CG   1  
ATOM   1497  C  CD   . GLU B 1 5  ? 135.598 -11.111 -4.867  1.00 0.00 ? 5   GLU B CD   1  
ATOM   1498  O  OE1  . GLU B 1 5  ? 134.747 -10.765 -5.668  1.00 0.00 ? 5   GLU B OE1  1  
ATOM   1499  O  OE2  . GLU B 1 5  ? 135.665 -12.229 -4.381  1.00 0.00 ? 5   GLU B OE2  1  
ATOM   1500  H  H    . GLU B 1 5  ? 136.344 -6.303  -5.831  1.00 0.00 ? 5   GLU B H    1  
ATOM   1501  H  HA   . GLU B 1 5  ? 137.571 -7.686  -3.717  1.00 0.00 ? 5   GLU B HA   1  
ATOM   1502  H  HB2  . GLU B 1 5  ? 135.422 -8.355  -4.801  1.00 0.00 ? 5   GLU B HB2  1  
ATOM   1503  H  HB3  . GLU B 1 5  ? 136.344 -8.894  -6.205  1.00 0.00 ? 5   GLU B HB3  1  
ATOM   1504  H  HG2  . GLU B 1 5  ? 137.627 -10.437 -4.726  1.00 0.00 ? 5   GLU B HG2  1  
ATOM   1505  H  HG3  . GLU B 1 5  ? 136.603 -9.951  -3.376  1.00 0.00 ? 5   GLU B HG3  1  
ATOM   1506  N  N    . THR B 1 6  ? 138.978 -7.973  -6.658  1.00 0.00 ? 6   THR B N    1  
ATOM   1507  C  CA   . THR B 1 6  ? 140.212 -8.333  -7.331  1.00 0.00 ? 6   THR B CA   1  
ATOM   1508  C  C    . THR B 1 6  ? 141.374 -7.531  -6.761  1.00 0.00 ? 6   THR B C    1  
ATOM   1509  O  O    . THR B 1 6  ? 142.487 -8.037  -6.616  1.00 0.00 ? 6   THR B O    1  
ATOM   1510  C  CB   . THR B 1 6  ? 140.089 -8.065  -8.832  1.00 0.00 ? 6   THR B CB   1  
ATOM   1511  O  OG1  . THR B 1 6  ? 138.951 -8.746  -9.341  1.00 0.00 ? 6   THR B OG1  1  
ATOM   1512  C  CG2  . THR B 1 6  ? 141.346 -8.562  -9.546  1.00 0.00 ? 6   THR B CG2  1  
ATOM   1513  H  H    . THR B 1 6  ? 138.278 -7.503  -7.156  1.00 0.00 ? 6   THR B H    1  
ATOM   1514  H  HA   . THR B 1 6  ? 140.402 -9.385  -7.178  1.00 0.00 ? 6   THR B HA   1  
ATOM   1515  H  HB   . THR B 1 6  ? 139.980 -7.004  -9.001  1.00 0.00 ? 6   THR B HB   1  
ATOM   1516  H  HG1  . THR B 1 6  ? 138.814 -9.533  -8.810  1.00 0.00 ? 6   THR B HG1  1  
ATOM   1517  H  HG21 . THR B 1 6  ? 141.608 -9.541  -9.176  1.00 0.00 ? 6   THR B HG21 1  
ATOM   1518  H  HG22 . THR B 1 6  ? 142.161 -7.877  -9.361  1.00 0.00 ? 6   THR B HG22 1  
ATOM   1519  H  HG23 . THR B 1 6  ? 141.158 -8.618  -10.609 1.00 0.00 ? 6   THR B HG23 1  
ATOM   1520  N  N    . ALA B 1 7  ? 141.106 -6.255  -6.473  1.00 0.00 ? 7   ALA B N    1  
ATOM   1521  C  CA   . ALA B 1 7  ? 142.143 -5.368  -5.958  1.00 0.00 ? 7   ALA B CA   1  
ATOM   1522  C  C    . ALA B 1 7  ? 142.672 -5.808  -4.591  1.00 0.00 ? 7   ALA B C    1  
ATOM   1523  O  O    . ALA B 1 7  ? 143.888 -5.815  -4.378  1.00 0.00 ? 7   ALA B O    1  
ATOM   1524  C  CB   . ALA B 1 7  ? 141.597 -3.939  -5.863  1.00 0.00 ? 7   ALA B CB   1  
ATOM   1525  H  H    . ALA B 1 7  ? 140.205 -5.901  -6.637  1.00 0.00 ? 7   ALA B H    1  
ATOM   1526  H  HA   . ALA B 1 7  ? 142.966 -5.367  -6.656  1.00 0.00 ? 7   ALA B HA   1  
ATOM   1527  H  HB1  . ALA B 1 7  ? 141.403 -3.558  -6.857  1.00 0.00 ? 7   ALA B HB1  1  
ATOM   1528  H  HB2  . ALA B 1 7  ? 142.324 -3.308  -5.373  1.00 0.00 ? 7   ALA B HB2  1  
ATOM   1529  H  HB3  . ALA B 1 7  ? 140.680 -3.941  -5.293  1.00 0.00 ? 7   ALA B HB3  1  
ATOM   1530  N  N    . MET B 1 8  ? 141.790 -6.188  -3.658  1.00 0.00 ? 8   MET B N    1  
ATOM   1531  C  CA   . MET B 1 8  ? 142.291 -6.605  -2.351  1.00 0.00 ? 8   MET B CA   1  
ATOM   1532  C  C    . MET B 1 8  ? 143.246 -7.759  -2.551  1.00 0.00 ? 8   MET B C    1  
ATOM   1533  O  O    . MET B 1 8  ? 144.301 -7.838  -1.922  1.00 0.00 ? 8   MET B O    1  
ATOM   1534  C  CB   . MET B 1 8  ? 141.171 -7.107  -1.436  1.00 0.00 ? 8   MET B CB   1  
ATOM   1535  C  CG   . MET B 1 8  ? 140.171 -6.000  -1.119  1.00 0.00 ? 8   MET B CG   1  
ATOM   1536  S  SD   . MET B 1 8  ? 139.062 -6.579  0.195   1.00 0.00 ? 8   MET B SD   1  
ATOM   1537  C  CE   . MET B 1 8  ? 138.501 -8.110  -0.597  1.00 0.00 ? 8   MET B CE   1  
ATOM   1538  H  H    . MET B 1 8  ? 140.827 -6.175  -3.845  1.00 0.00 ? 8   MET B H    1  
ATOM   1539  H  HA   . MET B 1 8  ? 142.806 -5.782  -1.877  1.00 0.00 ? 8   MET B HA   1  
ATOM   1540  H  HB2  . MET B 1 8  ? 140.656 -7.919  -1.926  1.00 0.00 ? 8   MET B HB2  1  
ATOM   1541  H  HB3  . MET B 1 8  ? 141.604 -7.469  -0.514  1.00 0.00 ? 8   MET B HB3  1  
ATOM   1542  H  HG2  . MET B 1 8  ? 140.698 -5.117  -0.790  1.00 0.00 ? 8   MET B HG2  1  
ATOM   1543  H  HG3  . MET B 1 8  ? 139.594 -5.770  -2.002  1.00 0.00 ? 8   MET B HG3  1  
ATOM   1544  H  HE1  . MET B 1 8  ? 138.388 -7.946  -1.656  1.00 0.00 ? 8   MET B HE1  1  
ATOM   1545  H  HE2  . MET B 1 8  ? 137.554 -8.413  -0.174  1.00 0.00 ? 8   MET B HE2  1  
ATOM   1546  H  HE3  . MET B 1 8  ? 139.233 -8.891  -0.426  1.00 0.00 ? 8   MET B HE3  1  
ATOM   1547  N  N    . GLU B 1 9  ? 142.867 -8.644  -3.462  1.00 0.00 ? 9   GLU B N    1  
ATOM   1548  C  CA   . GLU B 1 9  ? 143.691 -9.787  -3.783  1.00 0.00 ? 9   GLU B CA   1  
ATOM   1549  C  C    . GLU B 1 9  ? 144.978 -9.335  -4.449  1.00 0.00 ? 9   GLU B C    1  
ATOM   1550  O  O    . GLU B 1 9  ? 146.036 -9.920  -4.236  1.00 0.00 ? 9   GLU B O    1  
ATOM   1551  C  CB   . GLU B 1 9  ? 142.918 -10.731 -4.701  1.00 0.00 ? 9   GLU B CB   1  
ATOM   1552  C  CG   . GLU B 1 9  ? 141.732 -11.321 -3.941  1.00 0.00 ? 9   GLU B CG   1  
ATOM   1553  C  CD   . GLU B 1 9  ? 140.986 -12.312 -4.825  1.00 0.00 ? 9   GLU B CD   1  
ATOM   1554  O  OE1  . GLU B 1 9  ? 141.297 -12.377 -6.003  1.00 0.00 ? 9   GLU B OE1  1  
ATOM   1555  O  OE2  . GLU B 1 9  ? 140.113 -12.994 -4.311  1.00 0.00 ? 9   GLU B OE2  1  
ATOM   1556  H  H    . GLU B 1 9  ? 142.022 -8.511  -3.939  1.00 0.00 ? 9   GLU B H    1  
ATOM   1557  H  HA   . GLU B 1 9  ? 143.934 -10.311 -2.871  1.00 0.00 ? 9   GLU B HA   1  
ATOM   1558  H  HB2  . GLU B 1 9  ? 142.552 -10.177 -5.553  1.00 0.00 ? 9   GLU B HB2  1  
ATOM   1559  H  HB3  . GLU B 1 9  ? 143.564 -11.527 -5.033  1.00 0.00 ? 9   GLU B HB3  1  
ATOM   1560  H  HG2  . GLU B 1 9  ? 142.094 -11.827 -3.059  1.00 0.00 ? 9   GLU B HG2  1  
ATOM   1561  H  HG3  . GLU B 1 9  ? 141.064 -10.526 -3.650  1.00 0.00 ? 9   GLU B HG3  1  
ATOM   1562  N  N    . THR B 1 10 ? 144.877 -8.289  -5.266  1.00 0.00 ? 10  THR B N    1  
ATOM   1563  C  CA   . THR B 1 10 ? 146.044 -7.769  -5.962  1.00 0.00 ? 10  THR B CA   1  
ATOM   1564  C  C    . THR B 1 10 ? 147.107 -7.289  -4.981  1.00 0.00 ? 10  THR B C    1  
ATOM   1565  O  O    . THR B 1 10 ? 148.299 -7.551  -5.162  1.00 0.00 ? 10  THR B O    1  
ATOM   1566  C  CB   . THR B 1 10 ? 145.629 -6.607  -6.866  1.00 0.00 ? 10  THR B CB   1  
ATOM   1567  O  OG1  . THR B 1 10 ? 144.594 -7.036  -7.740  1.00 0.00 ? 10  THR B OG1  1  
ATOM   1568  C  CG2  . THR B 1 10 ? 146.831 -6.135  -7.686  1.00 0.00 ? 10  THR B CG2  1  
ATOM   1569  H  H    . THR B 1 10 ? 144.004 -7.864  -5.402  1.00 0.00 ? 10  THR B H    1  
ATOM   1570  H  HA   . THR B 1 10 ? 146.463 -8.548  -6.576  1.00 0.00 ? 10  THR B HA   1  
ATOM   1571  H  HB   . THR B 1 10 ? 145.271 -5.790  -6.259  1.00 0.00 ? 10  THR B HB   1  
ATOM   1572  H  HG1  . THR B 1 10 ? 144.675 -7.986  -7.850  1.00 0.00 ? 10  THR B HG1  1  
ATOM   1573  H  HG21 . THR B 1 10 ? 146.489 -5.753  -8.636  1.00 0.00 ? 10  THR B HG21 1  
ATOM   1574  H  HG22 . THR B 1 10 ? 147.504 -6.964  -7.852  1.00 0.00 ? 10  THR B HG22 1  
ATOM   1575  H  HG23 . THR B 1 10 ? 147.348 -5.353  -7.149  1.00 0.00 ? 10  THR B HG23 1  
ATOM   1576  N  N    . LEU B 1 11 ? 146.671 -6.579  -3.943  1.00 0.00 ? 11  LEU B N    1  
ATOM   1577  C  CA   . LEU B 1 11 ? 147.615 -6.064  -2.953  1.00 0.00 ? 11  LEU B CA   1  
ATOM   1578  C  C    . LEU B 1 11 ? 148.380 -7.203  -2.281  1.00 0.00 ? 11  LEU B C    1  
ATOM   1579  O  O    . LEU B 1 11 ? 149.609 -7.161  -2.137  1.00 0.00 ? 11  LEU B O    1  
ATOM   1580  C  CB   . LEU B 1 11 ? 146.825 -5.292  -1.894  1.00 0.00 ? 11  LEU B CB   1  
ATOM   1581  C  CG   . LEU B 1 11 ? 146.041 -4.164  -2.571  1.00 0.00 ? 11  LEU B CG   1  
ATOM   1582  C  CD1  . LEU B 1 11 ? 145.169 -3.441  -1.538  1.00 0.00 ? 11  LEU B CD1  1  
ATOM   1583  C  CD2  . LEU B 1 11 ? 147.022 -3.172  -3.202  1.00 0.00 ? 11  LEU B CD2  1  
ATOM   1584  H  H    . LEU B 1 11 ? 145.706 -6.392  -3.848  1.00 0.00 ? 11  LEU B H    1  
ATOM   1585  H  HA   . LEU B 1 11 ? 148.312 -5.396  -3.432  1.00 0.00 ? 11  LEU B HA   1  
ATOM   1586  H  HB2  . LEU B 1 11 ? 146.139 -5.963  -1.397  1.00 0.00 ? 11  LEU B HB2  1  
ATOM   1587  H  HB3  . LEU B 1 11 ? 147.506 -4.871  -1.171  1.00 0.00 ? 11  LEU B HB3  1  
ATOM   1588  H  HG   . LEU B 1 11 ? 145.412 -4.579  -3.337  1.00 0.00 ? 11  LEU B HG   1  
ATOM   1589  H  HD11 . LEU B 1 11 ? 145.639 -3.490  -0.566  1.00 0.00 ? 11  LEU B HD11 1  
ATOM   1590  H  HD12 . LEU B 1 11 ? 144.198 -3.918  -1.496  1.00 0.00 ? 11  LEU B HD12 1  
ATOM   1591  H  HD13 . LEU B 1 11 ? 145.046 -2.406  -1.827  1.00 0.00 ? 11  LEU B HD13 1  
ATOM   1592  H  HD21 . LEU B 1 11 ? 147.914 -3.108  -2.596  1.00 0.00 ? 11  LEU B HD21 1  
ATOM   1593  H  HD22 . LEU B 1 11 ? 146.559 -2.198  -3.266  1.00 0.00 ? 11  LEU B HD22 1  
ATOM   1594  H  HD23 . LEU B 1 11 ? 147.283 -3.511  -4.194  1.00 0.00 ? 11  LEU B HD23 1  
ATOM   1595  N  N    . ILE B 1 12 ? 147.646 -8.235  -1.889  1.00 0.00 ? 12  ILE B N    1  
ATOM   1596  C  CA   . ILE B 1 12 ? 148.262 -9.386  -1.256  1.00 0.00 ? 12  ILE B CA   1  
ATOM   1597  C  C    . ILE B 1 12 ? 149.132 -10.153 -2.242  1.00 0.00 ? 12  ILE B C    1  
ATOM   1598  O  O    . ILE B 1 12 ? 150.222 -10.607 -1.901  1.00 0.00 ? 12  ILE B O    1  
ATOM   1599  C  CB   . ILE B 1 12 ? 147.179 -10.290 -0.668  1.00 0.00 ? 12  ILE B CB   1  
ATOM   1600  C  CG1  . ILE B 1 12 ? 146.373 -9.480  0.354   1.00 0.00 ? 12  ILE B CG1  1  
ATOM   1601  C  CG2  . ILE B 1 12 ? 147.828 -11.490 0.024   1.00 0.00 ? 12  ILE B CG2  1  
ATOM   1602  C  CD1  . ILE B 1 12 ? 145.198 -10.309 0.872   1.00 0.00 ? 12  ILE B CD1  1  
ATOM   1603  H  H    . ILE B 1 12 ? 146.679 -8.226  -2.041  1.00 0.00 ? 12  ILE B H    1  
ATOM   1604  H  HA   . ILE B 1 12 ? 148.888 -9.037  -0.448  1.00 0.00 ? 12  ILE B HA   1  
ATOM   1605  H  HB   . ILE B 1 12 ? 146.525 -10.634 -1.457  1.00 0.00 ? 12  ILE B HB   1  
ATOM   1606  H  HG12 . ILE B 1 12 ? 147.013 -9.209  1.180   1.00 0.00 ? 12  ILE B HG12 1  
ATOM   1607  H  HG13 . ILE B 1 12 ? 145.997 -8.584  -0.117  1.00 0.00 ? 12  ILE B HG13 1  
ATOM   1608  H  HG21 . ILE B 1 12 ? 148.209 -12.173 -0.722  1.00 0.00 ? 12  ILE B HG21 1  
ATOM   1609  H  HG22 . ILE B 1 12 ? 147.093 -11.996 0.633   1.00 0.00 ? 12  ILE B HG22 1  
ATOM   1610  H  HG23 . ILE B 1 12 ? 148.640 -11.150 0.648   1.00 0.00 ? 12  ILE B HG23 1  
ATOM   1611  H  HD11 . ILE B 1 12 ? 145.571 -11.133 1.461   1.00 0.00 ? 12  ILE B HD11 1  
ATOM   1612  H  HD12 . ILE B 1 12 ? 144.628 -10.688 0.038   1.00 0.00 ? 12  ILE B HD12 1  
ATOM   1613  H  HD13 . ILE B 1 12 ? 144.565 -9.684  1.489   1.00 0.00 ? 12  ILE B HD13 1  
ATOM   1614  N  N    . ASN B 1 13 ? 148.633 -10.302 -3.467  1.00 0.00 ? 13  ASN B N    1  
ATOM   1615  C  CA   . ASN B 1 13 ? 149.370 -11.026 -4.492  1.00 0.00 ? 13  ASN B CA   1  
ATOM   1616  C  C    . ASN B 1 13 ? 150.717 -10.375 -4.773  1.00 0.00 ? 13  ASN B C    1  
ATOM   1617  O  O    . ASN B 1 13 ? 151.720 -11.072 -4.929  1.00 0.00 ? 13  ASN B O    1  
ATOM   1618  C  CB   . ASN B 1 13 ? 148.539 -11.093 -5.773  1.00 0.00 ? 13  ASN B CB   1  
ATOM   1619  C  CG   . ASN B 1 13 ? 147.247 -11.864 -5.508  1.00 0.00 ? 13  ASN B CG   1  
ATOM   1620  O  OD1  . ASN B 1 13 ? 147.263 -12.869 -4.797  1.00 0.00 ? 13  ASN B OD1  1  
ATOM   1621  N  ND2  . ASN B 1 13 ? 146.121 -11.448 -6.023  1.00 0.00 ? 13  ASN B ND2  1  
ATOM   1622  H  H    . ASN B 1 13 ? 147.754 -9.924  -3.680  1.00 0.00 ? 13  ASN B H    1  
ATOM   1623  H  HA   . ASN B 1 13 ? 149.540 -12.033 -4.143  1.00 0.00 ? 13  ASN B HA   1  
ATOM   1624  H  HB2  . ASN B 1 13 ? 148.300 -10.091 -6.100  1.00 0.00 ? 13  ASN B HB2  1  
ATOM   1625  H  HB3  . ASN B 1 13 ? 149.106 -11.596 -6.542  1.00 0.00 ? 13  ASN B HB3  1  
ATOM   1626  H  HD21 . ASN B 1 13 ? 146.102 -10.642 -6.578  1.00 0.00 ? 13  ASN B HD21 1  
ATOM   1627  H  HD22 . ASN B 1 13 ? 145.293 -11.945 -5.854  1.00 0.00 ? 13  ASN B HD22 1  
ATOM   1628  N  N    . VAL B 1 14 ? 150.758 -9.042  -4.814  1.00 0.00 ? 14  VAL B N    1  
ATOM   1629  C  CA   . VAL B 1 14 ? 152.032 -8.373  -5.050  1.00 0.00 ? 14  VAL B CA   1  
ATOM   1630  C  C    . VAL B 1 14 ? 152.883 -8.435  -3.787  1.00 0.00 ? 14  VAL B C    1  
ATOM   1631  O  O    . VAL B 1 14 ? 154.097 -8.628  -3.853  1.00 0.00 ? 14  VAL B O    1  
ATOM   1632  C  CB   . VAL B 1 14 ? 151.819 -6.918  -5.485  1.00 0.00 ? 14  VAL B CB   1  
ATOM   1633  C  CG1  . VAL B 1 14 ? 150.949 -6.887  -6.741  1.00 0.00 ? 14  VAL B CG1  1  
ATOM   1634  C  CG2  . VAL B 1 14 ? 151.120 -6.129  -4.378  1.00 0.00 ? 14  VAL B CG2  1  
ATOM   1635  H  H    . VAL B 1 14 ? 149.940 -8.515  -4.667  1.00 0.00 ? 14  VAL B H    1  
ATOM   1636  H  HA   . VAL B 1 14 ? 152.553 -8.899  -5.842  1.00 0.00 ? 14  VAL B HA   1  
ATOM   1637  H  HB   . VAL B 1 14 ? 152.776 -6.465  -5.703  1.00 0.00 ? 14  VAL B HB   1  
ATOM   1638  H  HG11 . VAL B 1 14 ? 150.203 -7.666  -6.681  1.00 0.00 ? 14  VAL B HG11 1  
ATOM   1639  H  HG12 . VAL B 1 14 ? 151.568 -7.049  -7.611  1.00 0.00 ? 14  VAL B HG12 1  
ATOM   1640  H  HG13 . VAL B 1 14 ? 150.462 -5.927  -6.818  1.00 0.00 ? 14  VAL B HG13 1  
ATOM   1641  H  HG21 . VAL B 1 14 ? 151.682 -6.212  -3.462  1.00 0.00 ? 14  VAL B HG21 1  
ATOM   1642  H  HG22 . VAL B 1 14 ? 150.128 -6.522  -4.232  1.00 0.00 ? 14  VAL B HG22 1  
ATOM   1643  H  HG23 . VAL B 1 14 ? 151.054 -5.089  -4.666  1.00 0.00 ? 14  VAL B HG23 1  
ATOM   1644  N  N    . PHE B 1 15 ? 152.233 -8.295  -2.631  1.00 0.00 ? 15  PHE B N    1  
ATOM   1645  C  CA   . PHE B 1 15 ? 152.945 -8.361  -1.359  1.00 0.00 ? 15  PHE B CA   1  
ATOM   1646  C  C    . PHE B 1 15 ? 153.641 -9.700  -1.157  1.00 0.00 ? 15  PHE B C    1  
ATOM   1647  O  O    . PHE B 1 15 ? 154.799 -9.752  -0.731  1.00 0.00 ? 15  PHE B O    1  
ATOM   1648  C  CB   . PHE B 1 15 ? 151.965 -8.126  -0.211  1.00 0.00 ? 15  PHE B CB   1  
ATOM   1649  C  CG   . PHE B 1 15 ? 152.705 -8.215  1.098   1.00 0.00 ? 15  PHE B CG   1  
ATOM   1650  C  CD1  . PHE B 1 15 ? 153.465 -7.139  1.566   1.00 0.00 ? 15  PHE B CD1  1  
ATOM   1651  C  CD2  . PHE B 1 15 ? 152.620 -9.392  1.851   1.00 0.00 ? 15  PHE B CD2  1  
ATOM   1652  C  CE1  . PHE B 1 15 ? 154.145 -7.245  2.787   1.00 0.00 ? 15  PHE B CE1  1  
ATOM   1653  C  CE2  . PHE B 1 15 ? 153.295 -9.497  3.068   1.00 0.00 ? 15  PHE B CE2  1  
ATOM   1654  C  CZ   . PHE B 1 15 ? 154.058 -8.424  3.538   1.00 0.00 ? 15  PHE B CZ   1  
ATOM   1655  H  H    . PHE B 1 15 ? 151.254 -8.155  -2.632  1.00 0.00 ? 15  PHE B H    1  
ATOM   1656  H  HA   . PHE B 1 15 ? 153.687 -7.579  -1.338  1.00 0.00 ? 15  PHE B HA   1  
ATOM   1657  H  HB2  . PHE B 1 15 ? 151.522 -7.146  -0.310  1.00 0.00 ? 15  PHE B HB2  1  
ATOM   1658  H  HB3  . PHE B 1 15 ? 151.191 -8.878  -0.238  1.00 0.00 ? 15  PHE B HB3  1  
ATOM   1659  H  HD1  . PHE B 1 15 ? 153.531 -6.231  0.986   1.00 0.00 ? 15  PHE B HD1  1  
ATOM   1660  H  HD2  . PHE B 1 15 ? 152.030 -10.221 1.489   1.00 0.00 ? 15  PHE B HD2  1  
ATOM   1661  H  HE1  . PHE B 1 15 ? 154.729 -6.417  3.151   1.00 0.00 ? 15  PHE B HE1  1  
ATOM   1662  H  HE2  . PHE B 1 15 ? 153.224 -10.406 3.647   1.00 0.00 ? 15  PHE B HE2  1  
ATOM   1663  H  HZ   . PHE B 1 15 ? 154.582 -8.505  4.478   1.00 0.00 ? 15  PHE B HZ   1  
ATOM   1664  N  N    . HIS B 1 16 ? 152.927 -10.776 -1.450  1.00 0.00 ? 16  HIS B N    1  
ATOM   1665  C  CA   . HIS B 1 16 ? 153.479 -12.109 -1.278  1.00 0.00 ? 16  HIS B CA   1  
ATOM   1666  C  C    . HIS B 1 16 ? 154.740 -12.302 -2.109  1.00 0.00 ? 16  HIS B C    1  
ATOM   1667  O  O    . HIS B 1 16 ? 155.724 -12.870 -1.635  1.00 0.00 ? 16  HIS B O    1  
ATOM   1668  C  CB   . HIS B 1 16 ? 152.436 -13.151 -1.688  1.00 0.00 ? 16  HIS B CB   1  
ATOM   1669  C  CG   . HIS B 1 16 ? 152.961 -14.532 -1.413  1.00 0.00 ? 16  HIS B CG   1  
ATOM   1670  N  ND1  . HIS B 1 16 ? 153.627 -15.275 -2.376  1.00 0.00 ? 16  HIS B ND1  1  
ATOM   1671  C  CD2  . HIS B 1 16 ? 152.921 -15.321 -0.292  1.00 0.00 ? 16  HIS B CD2  1  
ATOM   1672  C  CE1  . HIS B 1 16 ? 153.957 -16.455 -1.820  1.00 0.00 ? 16  HIS B CE1  1  
ATOM   1673  N  NE2  . HIS B 1 16 ? 153.550 -16.536 -0.550  1.00 0.00 ? 16  HIS B NE2  1  
ATOM   1674  H  H    . HIS B 1 16 ? 152.008 -10.672 -1.775  1.00 0.00 ? 16  HIS B H    1  
ATOM   1675  H  HA   . HIS B 1 16 ? 153.720 -12.256 -0.237  1.00 0.00 ? 16  HIS B HA   1  
ATOM   1676  H  HB2  . HIS B 1 16 ? 151.529 -12.992 -1.124  1.00 0.00 ? 16  HIS B HB2  1  
ATOM   1677  H  HB3  . HIS B 1 16 ? 152.224 -13.050 -2.743  1.00 0.00 ? 16  HIS B HB3  1  
ATOM   1678  H  HD1  . HIS B 1 16 ? 153.822 -14.993 -3.293  1.00 0.00 ? 16  HIS B HD1  1  
ATOM   1679  H  HD2  . HIS B 1 16 ? 152.469 -15.043 0.649   1.00 0.00 ? 16  HIS B HD2  1  
ATOM   1680  H  HE1  . HIS B 1 16 ? 154.486 -17.241 -2.337  1.00 0.00 ? 16  HIS B HE1  1  
ATOM   1681  H  HE2  . HIS B 1 16 ? 153.669 -17.288 0.066   1.00 0.00 ? 16  HIS B HE2  1  
ATOM   1682  N  N    . ALA B 1 17 ? 154.700 -11.852 -3.358  1.00 0.00 ? 17  ALA B N    1  
ATOM   1683  C  CA   . ALA B 1 17 ? 155.847 -12.016 -4.241  1.00 0.00 ? 17  ALA B CA   1  
ATOM   1684  C  C    . ALA B 1 17 ? 157.043 -11.153 -3.828  1.00 0.00 ? 17  ALA B C    1  
ATOM   1685  O  O    . ALA B 1 17 ? 158.165 -11.648 -3.716  1.00 0.00 ? 17  ALA B O    1  
ATOM   1686  C  CB   . ALA B 1 17 ? 155.437 -11.655 -5.670  1.00 0.00 ? 17  ALA B CB   1  
ATOM   1687  H  H    . ALA B 1 17 ? 153.886 -11.424 -3.695  1.00 0.00 ? 17  ALA B H    1  
ATOM   1688  H  HA   . ALA B 1 17 ? 156.143 -13.048 -4.229  1.00 0.00 ? 17  ALA B HA   1  
ATOM   1689  H  HB1  . ALA B 1 17 ? 155.562 -10.592 -5.822  1.00 0.00 ? 17  ALA B HB1  1  
ATOM   1690  H  HB2  . ALA B 1 17 ? 154.401 -11.921 -5.825  1.00 0.00 ? 17  ALA B HB2  1  
ATOM   1691  H  HB3  . ALA B 1 17 ? 156.057 -12.194 -6.370  1.00 0.00 ? 17  ALA B HB3  1  
ATOM   1692  N  N    . HIS B 1 18 ? 156.803 -9.860  -3.636  1.00 0.00 ? 18  HIS B N    1  
ATOM   1693  C  CA   . HIS B 1 18 ? 157.876 -8.932  -3.274  1.00 0.00 ? 18  HIS B CA   1  
ATOM   1694  C  C    . HIS B 1 18 ? 158.497 -9.194  -1.899  1.00 0.00 ? 18  HIS B C    1  
ATOM   1695  O  O    . HIS B 1 18 ? 159.719 -9.212  -1.762  1.00 0.00 ? 18  HIS B O    1  
ATOM   1696  C  CB   . HIS B 1 18 ? 157.348 -7.507  -3.316  1.00 0.00 ? 18  HIS B CB   1  
ATOM   1697  C  CG   . HIS B 1 18 ? 156.913 -7.176  -4.718  1.00 0.00 ? 18  HIS B CG   1  
ATOM   1698  N  ND1  . HIS B 1 18 ? 157.788 -7.225  -5.792  1.00 0.00 ? 18  HIS B ND1  1  
ATOM   1699  C  CD2  . HIS B 1 18 ? 155.707 -6.775  -5.236  1.00 0.00 ? 18  HIS B CD2  1  
ATOM   1700  C  CE1  . HIS B 1 18 ? 157.103 -6.863  -6.892  1.00 0.00 ? 18  HIS B CE1  1  
ATOM   1701  N  NE2  . HIS B 1 18 ? 155.828 -6.578  -6.609  1.00 0.00 ? 18  HIS B NE2  1  
ATOM   1702  H  H    . HIS B 1 18 ? 155.894 -9.517  -3.762  1.00 0.00 ? 18  HIS B H    1  
ATOM   1703  H  HA   . HIS B 1 18 ? 158.656 -9.017  -4.014  1.00 0.00 ? 18  HIS B HA   1  
ATOM   1704  H  HB2  . HIS B 1 18 ? 156.505 -7.423  -2.646  1.00 0.00 ? 18  HIS B HB2  1  
ATOM   1705  H  HB3  . HIS B 1 18 ? 158.125 -6.823  -3.008  1.00 0.00 ? 18  HIS B HB3  1  
ATOM   1706  H  HD1  . HIS B 1 18 ? 158.735 -7.477  -5.757  1.00 0.00 ? 18  HIS B HD1  1  
ATOM   1707  H  HD2  . HIS B 1 18 ? 154.805 -6.620  -4.665  1.00 0.00 ? 18  HIS B HD2  1  
ATOM   1708  H  HE1  . HIS B 1 18 ? 157.530 -6.809  -7.882  1.00 0.00 ? 18  HIS B HE1  1  
ATOM   1709  H  HE2  . HIS B 1 18 ? 155.130 -6.292  -7.233  1.00 0.00 ? 18  HIS B HE2  1  
ATOM   1710  N  N    . SER B 1 19 ? 157.659 -9.361  -0.878  1.00 0.00 ? 19  SER B N    1  
ATOM   1711  C  CA   . SER B 1 19 ? 158.170 -9.576  0.475   1.00 0.00 ? 19  SER B CA   1  
ATOM   1712  C  C    . SER B 1 19 ? 159.044 -10.823 0.549   1.00 0.00 ? 19  SER B C    1  
ATOM   1713  O  O    . SER B 1 19 ? 160.021 -10.868 1.300   1.00 0.00 ? 19  SER B O    1  
ATOM   1714  C  CB   . SER B 1 19 ? 157.011 -9.680  1.464   1.00 0.00 ? 19  SER B CB   1  
ATOM   1715  O  OG   . SER B 1 19 ? 156.208 -8.510  1.371   1.00 0.00 ? 19  SER B OG   1  
ATOM   1716  H  H    . SER B 1 19 ? 156.689 -9.314  -1.030  1.00 0.00 ? 19  SER B H    1  
ATOM   1717  H  HA   . SER B 1 19 ? 158.774 -8.724  0.749   1.00 0.00 ? 19  SER B HA   1  
ATOM   1718  H  HB2  . SER B 1 19 ? 156.410 -10.536 1.227   1.00 0.00 ? 19  SER B HB2  1  
ATOM   1719  H  HB3  . SER B 1 19 ? 157.402 -9.782  2.468   1.00 0.00 ? 19  SER B HB3  1  
ATOM   1720  H  HG   . SER B 1 19 ? 156.119 -8.287  0.442   1.00 0.00 ? 19  SER B HG   1  
ATOM   1721  N  N    . GLY B 1 20 ? 158.673 -11.831 -0.230  1.00 0.00 ? 20  GLY B N    1  
ATOM   1722  C  CA   . GLY B 1 20 ? 159.403 -13.094 -0.272  1.00 0.00 ? 20  GLY B CA   1  
ATOM   1723  C  C    . GLY B 1 20 ? 160.863 -12.915 -0.670  1.00 0.00 ? 20  GLY B C    1  
ATOM   1724  O  O    . GLY B 1 20 ? 161.707 -13.739 -0.317  1.00 0.00 ? 20  GLY B O    1  
ATOM   1725  H  H    . GLY B 1 20 ? 157.879 -11.723 -0.796  1.00 0.00 ? 20  GLY B H    1  
ATOM   1726  H  HA2  . GLY B 1 20 ? 159.376 -13.543 0.708   1.00 0.00 ? 20  GLY B HA2  1  
ATOM   1727  H  HA3  . GLY B 1 20 ? 158.923 -13.755 -0.977  1.00 0.00 ? 20  GLY B HA3  1  
ATOM   1728  N  N    . LYS B 1 21 ? 161.163 -11.870 -1.432  1.00 0.00 ? 21  LYS B N    1  
ATOM   1729  C  CA   . LYS B 1 21 ? 162.533 -11.668 -1.883  1.00 0.00 ? 21  LYS B CA   1  
ATOM   1730  C  C    . LYS B 1 21 ? 163.494 -11.619 -0.699  1.00 0.00 ? 21  LYS B C    1  
ATOM   1731  O  O    . LYS B 1 21 ? 164.591 -12.174 -0.767  1.00 0.00 ? 21  LYS B O    1  
ATOM   1732  C  CB   . LYS B 1 21 ? 162.637 -10.365 -2.678  1.00 0.00 ? 21  LYS B CB   1  
ATOM   1733  C  CG   . LYS B 1 21 ? 161.765 -10.460 -3.930  1.00 0.00 ? 21  LYS B CG   1  
ATOM   1734  C  CD   . LYS B 1 21 ? 162.045 -9.262  -4.840  1.00 0.00 ? 21  LYS B CD   1  
ATOM   1735  C  CE   . LYS B 1 21 ? 161.613 -7.974  -4.137  1.00 0.00 ? 21  LYS B CE   1  
ATOM   1736  N  NZ   . LYS B 1 21 ? 161.318 -6.926  -5.155  1.00 0.00 ? 21  LYS B NZ   1  
ATOM   1737  H  H    . LYS B 1 21 ? 160.457 -11.251 -1.715  1.00 0.00 ? 21  LYS B H    1  
ATOM   1738  H  HA   . LYS B 1 21 ? 162.813 -12.489 -2.525  1.00 0.00 ? 21  LYS B HA   1  
ATOM   1739  H  HB2  . LYS B 1 21 ? 162.299 -9.542  -2.064  1.00 0.00 ? 21  LYS B HB2  1  
ATOM   1740  H  HB3  . LYS B 1 21 ? 163.663 -10.201 -2.968  1.00 0.00 ? 21  LYS B HB3  1  
ATOM   1741  H  HG2  . LYS B 1 21 ? 161.991 -11.375 -4.458  1.00 0.00 ? 21  LYS B HG2  1  
ATOM   1742  H  HG3  . LYS B 1 21 ? 160.723 -10.456 -3.646  1.00 0.00 ? 21  LYS B HG3  1  
ATOM   1743  H  HD2  . LYS B 1 21 ? 163.102 -9.217  -5.059  1.00 0.00 ? 21  LYS B HD2  1  
ATOM   1744  H  HD3  . LYS B 1 21 ? 161.491 -9.370  -5.760  1.00 0.00 ? 21  LYS B HD3  1  
ATOM   1745  H  HE2  . LYS B 1 21 ? 160.728 -8.164  -3.548  1.00 0.00 ? 21  LYS B HE2  1  
ATOM   1746  H  HE3  . LYS B 1 21 ? 162.408 -7.632  -3.490  1.00 0.00 ? 21  LYS B HE3  1  
ATOM   1747  H  HZ1  . LYS B 1 21 ? 161.449 -7.323  -6.108  1.00 0.00 ? 21  LYS B HZ1  1  
ATOM   1748  H  HZ2  . LYS B 1 21 ? 161.963 -6.122  -5.022  1.00 0.00 ? 21  LYS B HZ2  1  
ATOM   1749  H  HZ3  . LYS B 1 21 ? 160.335 -6.606  -5.049  1.00 0.00 ? 21  LYS B HZ3  1  
ATOM   1750  N  N    . GLU B 1 22 ? 163.081 -10.986 0.399   1.00 0.00 ? 22  GLU B N    1  
ATOM   1751  C  CA   . GLU B 1 22 ? 163.938 -10.932 1.583   1.00 0.00 ? 22  GLU B CA   1  
ATOM   1752  C  C    . GLU B 1 22 ? 163.141 -11.112 2.871   1.00 0.00 ? 22  GLU B C    1  
ATOM   1753  O  O    . GLU B 1 22 ? 162.025 -10.599 3.013   1.00 0.00 ? 22  GLU B O    1  
ATOM   1754  C  CB   . GLU B 1 22 ? 164.705 -9.611  1.638   1.00 0.00 ? 22  GLU B CB   1  
ATOM   1755  C  CG   . GLU B 1 22 ? 165.597 -9.486  0.404   1.00 0.00 ? 22  GLU B CG   1  
ATOM   1756  C  CD   . GLU B 1 22 ? 166.441 -8.223  0.507   1.00 0.00 ? 22  GLU B CD   1  
ATOM   1757  O  OE1  . GLU B 1 22 ? 166.212 -7.459  1.431   1.00 0.00 ? 22  GLU B OE1  1  
ATOM   1758  O  OE2  . GLU B 1 22 ? 167.302 -8.037  -0.336  1.00 0.00 ? 22  GLU B OE2  1  
ATOM   1759  H  H    . GLU B 1 22 ? 162.191 -10.577 0.421   1.00 0.00 ? 22  GLU B H    1  
ATOM   1760  H  HA   . GLU B 1 22 ? 164.659 -11.736 1.522   1.00 0.00 ? 22  GLU B HA   1  
ATOM   1761  H  HB2  . GLU B 1 22 ? 164.005 -8.789  1.662   1.00 0.00 ? 22  GLU B HB2  1  
ATOM   1762  H  HB3  . GLU B 1 22 ? 165.317 -9.588  2.526   1.00 0.00 ? 22  GLU B HB3  1  
ATOM   1763  H  HG2  . GLU B 1 22 ? 166.245 -10.348 0.339   1.00 0.00 ? 22  GLU B HG2  1  
ATOM   1764  H  HG3  . GLU B 1 22 ? 164.980 -9.432  -0.481  1.00 0.00 ? 22  GLU B HG3  1  
ATOM   1765  N  N    . GLY B 1 23 ? 163.750 -11.812 3.820   1.00 0.00 ? 23  GLY B N    1  
ATOM   1766  C  CA   . GLY B 1 23 ? 163.140 -12.034 5.122   1.00 0.00 ? 23  GLY B CA   1  
ATOM   1767  C  C    . GLY B 1 23 ? 161.820 -12.789 5.023   1.00 0.00 ? 23  GLY B C    1  
ATOM   1768  O  O    . GLY B 1 23 ? 161.616 -13.620 4.138   1.00 0.00 ? 23  GLY B O    1  
ATOM   1769  H  H    . GLY B 1 23 ? 164.648 -12.166 3.649   1.00 0.00 ? 23  GLY B H    1  
ATOM   1770  H  HA2  . GLY B 1 23 ? 163.823 -12.603 5.736   1.00 0.00 ? 23  GLY B HA2  1  
ATOM   1771  H  HA3  . GLY B 1 23 ? 162.961 -11.078 5.591   1.00 0.00 ? 23  GLY B HA3  1  
ATOM   1772  N  N    . ASP B 1 24 ? 160.932 -12.469 5.956   1.00 0.00 ? 24  ASP B N    1  
ATOM   1773  C  CA   . ASP B 1 24 ? 159.612 -13.079 6.028   1.00 0.00 ? 24  ASP B CA   1  
ATOM   1774  C  C    . ASP B 1 24 ? 158.629 -12.384 5.089   1.00 0.00 ? 24  ASP B C    1  
ATOM   1775  O  O    . ASP B 1 24 ? 158.551 -11.151 5.054   1.00 0.00 ? 24  ASP B O    1  
ATOM   1776  C  CB   . ASP B 1 24 ? 159.083 -13.018 7.461   1.00 0.00 ? 24  ASP B CB   1  
ATOM   1777  C  CG   . ASP B 1 24 ? 157.768 -13.785 7.564   1.00 0.00 ? 24  ASP B CG   1  
ATOM   1778  O  OD1  . ASP B 1 24 ? 157.389 -14.405 6.584   1.00 0.00 ? 24  ASP B OD1  1  
ATOM   1779  O  OD2  . ASP B 1 24 ? 157.162 -13.743 8.622   1.00 0.00 ? 24  ASP B OD2  1  
ATOM   1780  H  H    . ASP B 1 24 ? 161.175 -11.794 6.623   1.00 0.00 ? 24  ASP B H    1  
ATOM   1781  H  HA   . ASP B 1 24 ? 159.694 -14.116 5.736   1.00 0.00 ? 24  ASP B HA   1  
ATOM   1782  H  HB2  . ASP B 1 24 ? 159.809 -13.458 8.129   1.00 0.00 ? 24  ASP B HB2  1  
ATOM   1783  H  HB3  . ASP B 1 24 ? 158.917 -11.989 7.739   1.00 0.00 ? 24  ASP B HB3  1  
ATOM   1784  N  N    . LYS B 1 25 ? 157.879 -13.177 4.328   1.00 0.00 ? 25  LYS B N    1  
ATOM   1785  C  CA   . LYS B 1 25 ? 156.895 -12.617 3.409   1.00 0.00 ? 25  LYS B CA   1  
ATOM   1786  C  C    . LYS B 1 25 ? 155.933 -11.730 4.180   1.00 0.00 ? 25  LYS B C    1  
ATOM   1787  O  O    . LYS B 1 25 ? 155.471 -10.700 3.695   1.00 0.00 ? 25  LYS B O    1  
ATOM   1788  C  CB   . LYS B 1 25 ? 156.040 -13.753 2.823   1.00 0.00 ? 25  LYS B CB   1  
ATOM   1789  C  CG   . LYS B 1 25 ? 156.873 -14.686 1.961   1.00 0.00 ? 25  LYS B CG   1  
ATOM   1790  C  CD   . LYS B 1 25 ? 155.973 -15.763 1.354   1.00 0.00 ? 25  LYS B CD   1  
ATOM   1791  C  CE   . LYS B 1 25 ? 156.829 -16.772 0.586   1.00 0.00 ? 25  LYS B CE   1  
ATOM   1792  N  NZ   . LYS B 1 25 ? 157.298 -16.158 -0.688  1.00 0.00 ? 25  LYS B NZ   1  
ATOM   1793  H  H    . LYS B 1 25 ? 157.980 -14.150 4.396   1.00 0.00 ? 25  LYS B H    1  
ATOM   1794  H  HA   . LYS B 1 25 ? 157.376 -12.066 2.618   1.00 0.00 ? 25  LYS B HA   1  
ATOM   1795  H  HB2  . LYS B 1 25 ? 155.606 -14.320 3.630   1.00 0.00 ? 25  LYS B HB2  1  
ATOM   1796  H  HB3  . LYS B 1 25 ? 155.250 -13.327 2.223   1.00 0.00 ? 25  LYS B HB3  1  
ATOM   1797  H  HG2  . LYS B 1 25 ? 157.307 -14.118 1.170   1.00 0.00 ? 25  LYS B HG2  1  
ATOM   1798  H  HG3  . LYS B 1 25 ? 157.646 -15.149 2.553   1.00 0.00 ? 25  LYS B HG3  1  
ATOM   1799  H  HD2  . LYS B 1 25 ? 155.437 -16.270 2.143   1.00 0.00 ? 25  LYS B HD2  1  
ATOM   1800  H  HD3  . LYS B 1 25 ? 155.269 -15.303 0.677   1.00 0.00 ? 25  LYS B HD3  1  
ATOM   1801  H  HE2  . LYS B 1 25 ? 157.681 -17.051 1.187   1.00 0.00 ? 25  LYS B HE2  1  
ATOM   1802  H  HE3  . LYS B 1 25 ? 156.239 -17.650 0.367   1.00 0.00 ? 25  LYS B HE3  1  
ATOM   1803  H  HZ1  . LYS B 1 25 ? 157.683 -16.897 -1.309  1.00 0.00 ? 25  LYS B HZ1  1  
ATOM   1804  H  HZ2  . LYS B 1 25 ? 158.038 -15.456 -0.482  1.00 0.00 ? 25  LYS B HZ2  1  
ATOM   1805  H  HZ3  . LYS B 1 25 ? 156.500 -15.691 -1.163  1.00 0.00 ? 25  LYS B HZ3  1  
ATOM   1806  N  N    . TYR B 1 26 ? 155.603 -12.203 5.369   1.00 0.00 ? 26  TYR B N    1  
ATOM   1807  C  CA   . TYR B 1 26 ? 154.644 -11.548 6.241   1.00 0.00 ? 26  TYR B CA   1  
ATOM   1808  C  C    . TYR B 1 26 ? 155.203 -10.257 6.835   1.00 0.00 ? 26  TYR B C    1  
ATOM   1809  O  O    . TYR B 1 26 ? 154.447 -9.408  7.307   1.00 0.00 ? 26  TYR B O    1  
ATOM   1810  C  CB   . TYR B 1 26 ? 154.254 -12.538 7.336   1.00 0.00 ? 26  TYR B CB   1  
ATOM   1811  C  CG   . TYR B 1 26 ? 153.709 -13.831 6.716   1.00 0.00 ? 26  TYR B CG   1  
ATOM   1812  C  CD1  . TYR B 1 26 ? 153.619 -14.014 5.308   1.00 0.00 ? 26  TYR B CD1  1  
ATOM   1813  C  CD2  . TYR B 1 26 ? 153.345 -14.887 7.563   1.00 0.00 ? 26  TYR B CD2  1  
ATOM   1814  C  CE1  . TYR B 1 26 ? 153.174 -15.226 4.783   1.00 0.00 ? 26  TYR B CE1  1  
ATOM   1815  C  CE2  . TYR B 1 26 ? 152.886 -16.098 7.027   1.00 0.00 ? 26  TYR B CE2  1  
ATOM   1816  C  CZ   . TYR B 1 26 ? 152.803 -16.268 5.639   1.00 0.00 ? 26  TYR B CZ   1  
ATOM   1817  O  OH   . TYR B 1 26 ? 152.362 -17.467 5.117   1.00 0.00 ? 26  TYR B OH   1  
ATOM   1818  H  H    . TYR B 1 26 ? 155.989 -13.058 5.656   1.00 0.00 ? 26  TYR B H    1  
ATOM   1819  H  HA   . TYR B 1 26 ? 153.761 -11.301 5.673   1.00 0.00 ? 26  TYR B HA   1  
ATOM   1820  H  HB2  . TYR B 1 26 ? 155.123 -12.768 7.935   1.00 0.00 ? 26  TYR B HB2  1  
ATOM   1821  H  HB3  . TYR B 1 26 ? 153.494 -12.097 7.963   1.00 0.00 ? 26  TYR B HB3  1  
ATOM   1822  H  HD1  . TYR B 1 26 ? 153.874 -13.230 4.625   1.00 0.00 ? 26  TYR B HD1  1  
ATOM   1823  H  HD2  . TYR B 1 26 ? 153.407 -14.761 8.634   1.00 0.00 ? 26  TYR B HD2  1  
ATOM   1824  H  HE1  . TYR B 1 26 ? 153.126 -15.357 3.706   1.00 0.00 ? 26  TYR B HE1  1  
ATOM   1825  H  HE2  . TYR B 1 26 ? 152.600 -16.904 7.686   1.00 0.00 ? 26  TYR B HE2  1  
ATOM   1826  H  HH   . TYR B 1 26 ? 151.414 -17.523 5.258   1.00 0.00 ? 26  TYR B HH   1  
ATOM   1827  N  N    . LYS B 1 27 ? 156.526 -10.117 6.825   1.00 0.00 ? 27  LYS B N    1  
ATOM   1828  C  CA   . LYS B 1 27 ? 157.161 -8.925  7.384   1.00 0.00 ? 27  LYS B CA   1  
ATOM   1829  C  C    . LYS B 1 27 ? 157.796 -8.123  6.249   1.00 0.00 ? 27  LYS B C    1  
ATOM   1830  O  O    . LYS B 1 27 ? 158.458 -8.689  5.369   1.00 0.00 ? 27  LYS B O    1  
ATOM   1831  C  CB   . LYS B 1 27 ? 158.242 -9.356  8.384   1.00 0.00 ? 27  LYS B CB   1  
ATOM   1832  C  CG   . LYS B 1 27 ? 158.701 -8.188  9.260   1.00 0.00 ? 27  LYS B CG   1  
ATOM   1833  C  CD   . LYS B 1 27 ? 157.665 -7.917  10.357  1.00 0.00 ? 27  LYS B CD   1  
ATOM   1834  C  CE   . LYS B 1 27 ? 158.250 -6.941  11.380  1.00 0.00 ? 27  LYS B CE   1  
ATOM   1835  N  NZ   . LYS B 1 27 ? 157.372 -6.894  12.584  1.00 0.00 ? 27  LYS B NZ   1  
ATOM   1836  H  H    . LYS B 1 27 ? 157.084 -10.829 6.447   1.00 0.00 ? 27  LYS B H    1  
ATOM   1837  H  HA   . LYS B 1 27 ? 156.423 -8.319  7.884   1.00 0.00 ? 27  LYS B HA   1  
ATOM   1838  H  HB2  . LYS B 1 27 ? 157.852 -10.136 9.017   1.00 0.00 ? 27  LYS B HB2  1  
ATOM   1839  H  HB3  . LYS B 1 27 ? 159.092 -9.732  7.839   1.00 0.00 ? 27  LYS B HB3  1  
ATOM   1840  H  HG2  . LYS B 1 27 ? 159.643 -8.443  9.717   1.00 0.00 ? 27  LYS B HG2  1  
ATOM   1841  H  HG3  . LYS B 1 27 ? 158.821 -7.304  8.651   1.00 0.00 ? 27  LYS B HG3  1  
ATOM   1842  H  HD2  . LYS B 1 27 ? 156.778 -7.485  9.920   1.00 0.00 ? 27  LYS B HD2  1  
ATOM   1843  H  HD3  . LYS B 1 27 ? 157.412 -8.842  10.850  1.00 0.00 ? 27  LYS B HD3  1  
ATOM   1844  H  HE2  . LYS B 1 27 ? 159.233 -7.278  11.672  1.00 0.00 ? 27  LYS B HE2  1  
ATOM   1845  H  HE3  . LYS B 1 27 ? 158.322 -5.957  10.944  1.00 0.00 ? 27  LYS B HE3  1  
ATOM   1846  H  HZ1  . LYS B 1 27 ? 156.900 -5.969  12.633  1.00 0.00 ? 27  LYS B HZ1  1  
ATOM   1847  H  HZ2  . LYS B 1 27 ? 157.948 -7.037  13.438  1.00 0.00 ? 27  LYS B HZ2  1  
ATOM   1848  H  HZ3  . LYS B 1 27 ? 156.655 -7.644  12.519  1.00 0.00 ? 27  LYS B HZ3  1  
ATOM   1849  N  N    . LEU B 1 28 ? 157.575 -6.808  6.254   1.00 0.00 ? 28  LEU B N    1  
ATOM   1850  C  CA   . LEU B 1 28 ? 158.115 -5.959  5.199   1.00 0.00 ? 28  LEU B CA   1  
ATOM   1851  C  C    . LEU B 1 28 ? 159.360 -5.231  5.723   1.00 0.00 ? 28  LEU B C    1  
ATOM   1852  O  O    . LEU B 1 28 ? 159.331 -4.637  6.802   1.00 0.00 ? 28  LEU B O    1  
ATOM   1853  C  CB   . LEU B 1 28 ? 157.030 -4.944  4.767   1.00 0.00 ? 28  LEU B CB   1  
ATOM   1854  C  CG   . LEU B 1 28 ? 156.971 -4.830  3.234   1.00 0.00 ? 28  LEU B CG   1  
ATOM   1855  C  CD1  . LEU B 1 28 ? 155.747 -4.004  2.821   1.00 0.00 ? 28  LEU B CD1  1  
ATOM   1856  C  CD2  . LEU B 1 28 ? 158.238 -4.170  2.689   1.00 0.00 ? 28  LEU B CD2  1  
ATOM   1857  H  H    . LEU B 1 28 ? 157.031 -6.409  6.966   1.00 0.00 ? 28  LEU B H    1  
ATOM   1858  H  HA   . LEU B 1 28 ? 158.392 -6.570  4.353   1.00 0.00 ? 28  LEU B HA   1  
ATOM   1859  H  HB2  . LEU B 1 28 ? 156.068 -5.276  5.134   1.00 0.00 ? 28  LEU B HB2  1  
ATOM   1860  H  HB3  . LEU B 1 28 ? 157.251 -3.973  5.186   1.00 0.00 ? 28  LEU B HB3  1  
ATOM   1861  H  HG   . LEU B 1 28 ? 156.879 -5.821  2.816   1.00 0.00 ? 28  LEU B HG   1  
ATOM   1862  H  HD11 . LEU B 1 28 ? 155.432 -4.301  1.832   1.00 0.00 ? 28  LEU B HD11 1  
ATOM   1863  H  HD12 . LEU B 1 28 ? 156.006 -2.954  2.814   1.00 0.00 ? 28  LEU B HD12 1  
ATOM   1864  H  HD13 . LEU B 1 28 ? 154.942 -4.170  3.520   1.00 0.00 ? 28  LEU B HD13 1  
ATOM   1865  H  HD21 . LEU B 1 28 ? 159.057 -4.347  3.363   1.00 0.00 ? 28  LEU B HD21 1  
ATOM   1866  H  HD22 . LEU B 1 28 ? 158.079 -3.108  2.586   1.00 0.00 ? 28  LEU B HD22 1  
ATOM   1867  H  HD23 . LEU B 1 28 ? 158.468 -4.595  1.724   1.00 0.00 ? 28  LEU B HD23 1  
ATOM   1868  N  N    . SER B 1 29 ? 160.448 -5.281  4.958   1.00 0.00 ? 29  SER B N    1  
ATOM   1869  C  CA   . SER B 1 29 ? 161.694 -4.624  5.357   1.00 0.00 ? 29  SER B CA   1  
ATOM   1870  C  C    . SER B 1 29 ? 161.846 -3.296  4.624   1.00 0.00 ? 29  SER B C    1  
ATOM   1871  O  O    . SER B 1 29 ? 161.200 -3.074  3.601   1.00 0.00 ? 29  SER B O    1  
ATOM   1872  C  CB   . SER B 1 29 ? 162.890 -5.524  5.047   1.00 0.00 ? 29  SER B CB   1  
ATOM   1873  O  OG   . SER B 1 29 ? 163.056 -5.613  3.639   1.00 0.00 ? 29  SER B OG   1  
ATOM   1874  H  H    . SER B 1 29 ? 160.415 -5.769  4.109   1.00 0.00 ? 29  SER B H    1  
ATOM   1875  H  HA   . SER B 1 29 ? 161.668 -4.435  6.421   1.00 0.00 ? 29  SER B HA   1  
ATOM   1876  H  HB2  . SER B 1 29 ? 163.781 -5.105  5.482   1.00 0.00 ? 29  SER B HB2  1  
ATOM   1877  H  HB3  . SER B 1 29 ? 162.716 -6.507  5.463   1.00 0.00 ? 29  SER B HB3  1  
ATOM   1878  H  HG   . SER B 1 29 ? 163.482 -4.807  3.339   1.00 0.00 ? 29  SER B HG   1  
ATOM   1879  N  N    . LYS B 1 30 ? 162.681 -2.405  5.154   1.00 0.00 ? 30  LYS B N    1  
ATOM   1880  C  CA   . LYS B 1 30 ? 162.865 -1.102  4.526   1.00 0.00 ? 30  LYS B CA   1  
ATOM   1881  C  C    . LYS B 1 30 ? 163.305 -1.247  3.077   1.00 0.00 ? 30  LYS B C    1  
ATOM   1882  O  O    . LYS B 1 30 ? 162.821 -0.518  2.209   1.00 0.00 ? 30  LYS B O    1  
ATOM   1883  C  CB   . LYS B 1 30 ? 163.926 -0.302  5.281   1.00 0.00 ? 30  LYS B CB   1  
ATOM   1884  C  CG   . LYS B 1 30 ? 163.421 0.024   6.683   1.00 0.00 ? 30  LYS B CG   1  
ATOM   1885  C  CD   . LYS B 1 30 ? 164.505 0.788   7.451   1.00 0.00 ? 30  LYS B CD   1  
ATOM   1886  C  CE   . LYS B 1 30 ? 164.680 2.188   6.855   1.00 0.00 ? 30  LYS B CE   1  
ATOM   1887  N  NZ   . LYS B 1 30 ? 165.639 2.127   5.717   1.00 0.00 ? 30  LYS B NZ   1  
ATOM   1888  H  H    . LYS B 1 30 ? 163.160 -2.617  5.979   1.00 0.00 ? 30  LYS B H    1  
ATOM   1889  H  HA   . LYS B 1 30 ? 161.932 -0.561  4.558   1.00 0.00 ? 30  LYS B HA   1  
ATOM   1890  H  HB2  . LYS B 1 30 ? 164.833 -0.885  5.352   1.00 0.00 ? 30  LYS B HB2  1  
ATOM   1891  H  HB3  . LYS B 1 30 ? 164.128 0.615   4.751   1.00 0.00 ? 30  LYS B HB3  1  
ATOM   1892  H  HG2  . LYS B 1 30 ? 162.531 0.631   6.603   1.00 0.00 ? 30  LYS B HG2  1  
ATOM   1893  H  HG3  . LYS B 1 30 ? 163.187 -0.891  7.204   1.00 0.00 ? 30  LYS B HG3  1  
ATOM   1894  H  HD2  . LYS B 1 30 ? 164.220 0.871   8.489   1.00 0.00 ? 30  LYS B HD2  1  
ATOM   1895  H  HD3  . LYS B 1 30 ? 165.439 0.251   7.379   1.00 0.00 ? 30  LYS B HD3  1  
ATOM   1896  H  HE2  . LYS B 1 30 ? 163.727 2.554   6.503   1.00 0.00 ? 30  LYS B HE2  1  
ATOM   1897  H  HE3  . LYS B 1 30 ? 165.063 2.855   7.613   1.00 0.00 ? 30  LYS B HE3  1  
ATOM   1898  H  HZ1  . LYS B 1 30 ? 165.261 2.670   4.914   1.00 0.00 ? 30  LYS B HZ1  1  
ATOM   1899  H  HZ2  . LYS B 1 30 ? 165.777 1.136   5.432   1.00 0.00 ? 30  LYS B HZ2  1  
ATOM   1900  H  HZ3  . LYS B 1 30 ? 166.550 2.534   6.008   1.00 0.00 ? 30  LYS B HZ3  1  
ATOM   1901  N  N    . LYS B 1 31 ? 164.198 -2.192  2.795   1.00 0.00 ? 31  LYS B N    1  
ATOM   1902  C  CA   . LYS B 1 31 ? 164.620 -2.377  1.414   1.00 0.00 ? 31  LYS B CA   1  
ATOM   1903  C  C    . LYS B 1 31 ? 163.445 -2.744  0.544   1.00 0.00 ? 31  LYS B C    1  
ATOM   1904  O  O    . LYS B 1 31 ? 163.252 -2.190  -0.542  1.00 0.00 ? 31  LYS B O    1  
ATOM   1905  C  CB   . LYS B 1 31 ? 165.586 -3.547  1.285   1.00 0.00 ? 31  LYS B CB   1  
ATOM   1906  C  CG   . LYS B 1 31 ? 166.002 -3.672  -0.188  1.00 0.00 ? 31  LYS B CG   1  
ATOM   1907  C  CD   . LYS B 1 31 ? 166.713 -4.988  -0.405  1.00 0.00 ? 31  LYS B CD   1  
ATOM   1908  C  CE   . LYS B 1 31 ? 167.011 -5.130  -1.891  1.00 0.00 ? 31  LYS B CE   1  
ATOM   1909  N  NZ   . LYS B 1 31 ? 167.818 -6.361  -2.126  1.00 0.00 ? 31  LYS B NZ   1  
ATOM   1910  H  H    . LYS B 1 31 ? 164.551 -2.768  3.504   1.00 0.00 ? 31  LYS B H    1  
ATOM   1911  H  HA   . LYS B 1 31 ? 165.090 -1.480  1.046   1.00 0.00 ? 31  LYS B HA   1  
ATOM   1912  H  HB2  . LYS B 1 31 ? 166.458 -3.367  1.898   1.00 0.00 ? 31  LYS B HB2  1  
ATOM   1913  H  HB3  . LYS B 1 31 ? 165.100 -4.457  1.600   1.00 0.00 ? 31  LYS B HB3  1  
ATOM   1914  H  HG2  . LYS B 1 31 ? 165.141 -3.635  -0.833  1.00 0.00 ? 31  LYS B HG2  1  
ATOM   1915  H  HG3  . LYS B 1 31 ? 166.671 -2.863  -0.439  1.00 0.00 ? 31  LYS B HG3  1  
ATOM   1916  H  HD2  . LYS B 1 31 ? 167.630 -5.016  0.166   1.00 0.00 ? 31  LYS B HD2  1  
ATOM   1917  H  HD3  . LYS B 1 31 ? 166.056 -5.788  -0.098  1.00 0.00 ? 31  LYS B HD3  1  
ATOM   1918  H  HE2  . LYS B 1 31 ? 166.068 -5.201  -2.428  1.00 0.00 ? 31  LYS B HE2  1  
ATOM   1919  H  HE3  . LYS B 1 31 ? 167.556 -4.265  -2.235  1.00 0.00 ? 31  LYS B HE3  1  
ATOM   1920  H  HZ1  . LYS B 1 31 ? 168.634 -6.131  -2.728  1.00 0.00 ? 31  LYS B HZ1  1  
ATOM   1921  H  HZ2  . LYS B 1 31 ? 167.228 -7.076  -2.599  1.00 0.00 ? 31  LYS B HZ2  1  
ATOM   1922  H  HZ3  . LYS B 1 31 ? 168.154 -6.735  -1.217  1.00 0.00 ? 31  LYS B HZ3  1  
ATOM   1923  N  N    . GLU B 1 32 ? 162.686 -3.725  1.006   1.00 0.00 ? 32  GLU B N    1  
ATOM   1924  C  CA   . GLU B 1 32 ? 161.575 -4.190  0.223   1.00 0.00 ? 32  GLU B CA   1  
ATOM   1925  C  C    . GLU B 1 32 ? 160.571 -3.060  0.046   1.00 0.00 ? 32  GLU B C    1  
ATOM   1926  O  O    . GLU B 1 32 ? 159.990 -2.891  -1.021  1.00 0.00 ? 32  GLU B O    1  
ATOM   1927  C  CB   . GLU B 1 32 ? 160.904 -5.382  0.922   1.00 0.00 ? 32  GLU B CB   1  
ATOM   1928  C  CG   . GLU B 1 32 ? 161.855 -6.583  0.947   1.00 0.00 ? 32  GLU B CG   1  
ATOM   1929  C  CD   . GLU B 1 32 ? 161.179 -7.788  1.610   1.00 0.00 ? 32  GLU B CD   1  
ATOM   1930  O  OE1  . GLU B 1 32 ? 160.135 -7.609  2.220   1.00 0.00 ? 32  GLU B OE1  1  
ATOM   1931  O  OE2  . GLU B 1 32 ? 161.723 -8.875  1.512   1.00 0.00 ? 32  GLU B OE2  1  
ATOM   1932  H  H    . GLU B 1 32 ? 162.904 -4.157  1.857   1.00 0.00 ? 32  GLU B H    1  
ATOM   1933  H  HA   . GLU B 1 32 ? 161.962 -4.512  -0.744  1.00 0.00 ? 32  GLU B HA   1  
ATOM   1934  H  HB2  . GLU B 1 32 ? 160.658 -5.104  1.936   1.00 0.00 ? 32  GLU B HB2  1  
ATOM   1935  H  HB3  . GLU B 1 32 ? 160.001 -5.650  0.393   1.00 0.00 ? 32  GLU B HB3  1  
ATOM   1936  H  HG2  . GLU B 1 32 ? 162.128 -6.841  -0.066  1.00 0.00 ? 32  GLU B HG2  1  
ATOM   1937  H  HG3  . GLU B 1 32 ? 162.745 -6.324  1.499   1.00 0.00 ? 32  GLU B HG3  1  
ATOM   1938  N  N    . LEU B 1 33 ? 160.395 -2.272  1.105   1.00 0.00 ? 33  LEU B N    1  
ATOM   1939  C  CA   . LEU B 1 33 ? 159.479 -1.141  1.062   1.00 0.00 ? 33  LEU B CA   1  
ATOM   1940  C  C    . LEU B 1 33 ? 159.913 -0.120  0.028   1.00 0.00 ? 33  LEU B C    1  
ATOM   1941  O  O    . LEU B 1 33 ? 159.111 0.367   -0.776  1.00 0.00 ? 33  LEU B O    1  
ATOM   1942  C  CB   . LEU B 1 33 ? 159.457 -0.487  2.439   1.00 0.00 ? 33  LEU B CB   1  
ATOM   1943  C  CG   . LEU B 1 33 ? 158.520 0.714   2.429   1.00 0.00 ? 33  LEU B CG   1  
ATOM   1944  C  CD1  . LEU B 1 33 ? 157.101 0.247   2.140   1.00 0.00 ? 33  LEU B CD1  1  
ATOM   1945  C  CD2  . LEU B 1 33 ? 158.576 1.384   3.799   1.00 0.00 ? 33  LEU B CD2  1  
ATOM   1946  H  H    . LEU B 1 33 ? 160.902 -2.449  1.925   1.00 0.00 ? 33  LEU B H    1  
ATOM   1947  H  HA   . LEU B 1 33 ? 158.489 -1.495  0.825   1.00 0.00 ? 33  LEU B HA   1  
ATOM   1948  H  HB2  . LEU B 1 33 ? 159.118 -1.200  3.174   1.00 0.00 ? 33  LEU B HB2  1  
ATOM   1949  H  HB3  . LEU B 1 33 ? 160.454 -0.159  2.694   1.00 0.00 ? 33  LEU B HB3  1  
ATOM   1950  H  HG   . LEU B 1 33 ? 158.830 1.416   1.672   1.00 0.00 ? 33  LEU B HG   1  
ATOM   1951  H  HD11 . LEU B 1 33 ? 156.971 0.156   1.070   1.00 0.00 ? 33  LEU B HD11 1  
ATOM   1952  H  HD12 . LEU B 1 33 ? 156.402 0.968   2.530   1.00 0.00 ? 33  LEU B HD12 1  
ATOM   1953  H  HD13 . LEU B 1 33 ? 156.934 -0.713  2.606   1.00 0.00 ? 33  LEU B HD13 1  
ATOM   1954  H  HD21 . LEU B 1 33 ? 159.599 1.394   4.149   1.00 0.00 ? 33  LEU B HD21 1  
ATOM   1955  H  HD22 . LEU B 1 33 ? 157.964 0.829   4.493   1.00 0.00 ? 33  LEU B HD22 1  
ATOM   1956  H  HD23 . LEU B 1 33 ? 158.211 2.396   3.721   1.00 0.00 ? 33  LEU B HD23 1  
ATOM   1957  N  N    . LYS B 1 34 ? 161.203 0.166   0.038   1.00 0.00 ? 34  LYS B N    1  
ATOM   1958  C  CA   . LYS B 1 34 ? 161.780 1.095   -0.909  1.00 0.00 ? 34  LYS B CA   1  
ATOM   1959  C  C    . LYS B 1 34 ? 161.576 0.615   -2.321  1.00 0.00 ? 34  LYS B C    1  
ATOM   1960  O  O    . LYS B 1 34 ? 161.239 1.384   -3.224  1.00 0.00 ? 34  LYS B O    1  
ATOM   1961  C  CB   . LYS B 1 34 ? 163.270 1.248   -0.572  1.00 0.00 ? 34  LYS B CB   1  
ATOM   1962  C  CG   . LYS B 1 34 ? 164.018 1.976   -1.688  1.00 0.00 ? 34  LYS B CG   1  
ATOM   1963  C  CD   . LYS B 1 34 ? 163.369 3.314   -1.952  1.00 0.00 ? 34  LYS B CD   1  
ATOM   1964  C  CE   . LYS B 1 34 ? 164.345 4.236   -2.690  1.00 0.00 ? 34  LYS B CE   1  
ATOM   1965  N  NZ   . LYS B 1 34 ? 165.420 3.423   -3.327  1.00 0.00 ? 34  LYS B NZ   1  
ATOM   1966  H  H    . LYS B 1 34 ? 161.786 -0.279  0.688   1.00 0.00 ? 34  LYS B H    1  
ATOM   1967  H  HA   . LYS B 1 34 ? 161.301 2.055   -0.793  1.00 0.00 ? 34  LYS B HA   1  
ATOM   1968  H  HB2  . LYS B 1 34 ? 163.364 1.820   0.343   1.00 0.00 ? 34  LYS B HB2  1  
ATOM   1969  H  HB3  . LYS B 1 34 ? 163.706 0.270   -0.428  1.00 0.00 ? 34  LYS B HB3  1  
ATOM   1970  H  HG2  . LYS B 1 34 ? 165.045 2.129   -1.390  1.00 0.00 ? 34  LYS B HG2  1  
ATOM   1971  H  HG3  . LYS B 1 34 ? 163.990 1.380   -2.588  1.00 0.00 ? 34  LYS B HG3  1  
ATOM   1972  H  HD2  . LYS B 1 34 ? 162.505 3.136   -2.574  1.00 0.00 ? 34  LYS B HD2  1  
ATOM   1973  H  HD3  . LYS B 1 34 ? 163.067 3.765   -1.022  1.00 0.00 ? 34  LYS B HD3  1  
ATOM   1974  H  HE2  . LYS B 1 34 ? 163.814 4.788   -3.451  1.00 0.00 ? 34  LYS B HE2  1  
ATOM   1975  H  HE3  . LYS B 1 34 ? 164.787 4.927   -1.986  1.00 0.00 ? 34  LYS B HE3  1  
ATOM   1976  H  HZ1  . LYS B 1 34 ? 166.247 3.387   -2.697  1.00 0.00 ? 34  LYS B HZ1  1  
ATOM   1977  H  HZ2  . LYS B 1 34 ? 165.692 3.856   -4.233  1.00 0.00 ? 34  LYS B HZ2  1  
ATOM   1978  H  HZ3  . LYS B 1 34 ? 165.073 2.457   -3.494  1.00 0.00 ? 34  LYS B HZ3  1  
ATOM   1979  N  N    . GLU B 1 35 ? 161.774 -0.663  -2.499  1.00 0.00 ? 35  GLU B N    1  
ATOM   1980  C  CA   . GLU B 1 35 ? 161.614 -1.258  -3.803  1.00 0.00 ? 35  GLU B CA   1  
ATOM   1981  C  C    . GLU B 1 35 ? 160.157 -1.307  -4.244  1.00 0.00 ? 35  GLU B C    1  
ATOM   1982  O  O    . GLU B 1 35 ? 159.865 -1.064  -5.410  1.00 0.00 ? 35  GLU B O    1  
ATOM   1983  C  CB   . GLU B 1 35 ? 162.259 -2.629  -3.766  1.00 0.00 ? 35  GLU B CB   1  
ATOM   1984  C  CG   . GLU B 1 35 ? 163.759 -2.408  -3.552  1.00 0.00 ? 35  GLU B CG   1  
ATOM   1985  C  CD   . GLU B 1 35 ? 164.380 -1.748  -4.781  1.00 0.00 ? 35  GLU B CD   1  
ATOM   1986  O  OE1  . GLU B 1 35 ? 163.744 -1.764  -5.822  1.00 0.00 ? 35  GLU B OE1  1  
ATOM   1987  O  OE2  . GLU B 1 35 ? 165.481 -1.237  -4.662  1.00 0.00 ? 35  GLU B OE2  1  
ATOM   1988  H  H    . GLU B 1 35 ? 162.022 -1.223  -1.726  1.00 0.00 ? 35  GLU B H    1  
ATOM   1989  H  HA   . GLU B 1 35 ? 162.151 -0.652  -4.514  1.00 0.00 ? 35  GLU B HA   1  
ATOM   1990  H  HB2  . GLU B 1 35 ? 161.847 -3.207  -2.950  1.00 0.00 ? 35  GLU B HB2  1  
ATOM   1991  H  HB3  . GLU B 1 35 ? 162.097 -3.140  -4.701  1.00 0.00 ? 35  GLU B HB3  1  
ATOM   1992  H  HG2  . GLU B 1 35 ? 163.888 -1.733  -2.704  1.00 0.00 ? 35  GLU B HG2  1  
ATOM   1993  H  HG3  . GLU B 1 35 ? 164.248 -3.350  -3.353  1.00 0.00 ? 35  GLU B HG3  1  
ATOM   1994  N  N    . LEU B 1 36 ? 159.235 -1.597  -3.323  1.00 0.00 ? 36  LEU B N    1  
ATOM   1995  C  CA   . LEU B 1 36 ? 157.826 -1.630  -3.703  1.00 0.00 ? 36  LEU B CA   1  
ATOM   1996  C  C    . LEU B 1 36 ? 157.312 -0.262  -4.092  1.00 0.00 ? 36  LEU B C    1  
ATOM   1997  O  O    . LEU B 1 36 ? 156.675 -0.115  -5.129  1.00 0.00 ? 36  LEU B O    1  
ATOM   1998  C  CB   . LEU B 1 36 ? 156.964 -2.161  -2.553  1.00 0.00 ? 36  LEU B CB   1  
ATOM   1999  C  CG   . LEU B 1 36 ? 157.244 -3.644  -2.320  1.00 0.00 ? 36  LEU B CG   1  
ATOM   2000  C  CD1  . LEU B 1 36 ? 156.499 -4.102  -1.061  1.00 0.00 ? 36  LEU B CD1  1  
ATOM   2001  C  CD2  . LEU B 1 36 ? 156.744 -4.453  -3.537  1.00 0.00 ? 36  LEU B CD2  1  
ATOM   2002  H  H    . LEU B 1 36 ? 159.501 -1.772  -2.395  1.00 0.00 ? 36  LEU B H    1  
ATOM   2003  H  HA   . LEU B 1 36 ? 157.709 -2.288  -4.547  1.00 0.00 ? 36  LEU B HA   1  
ATOM   2004  H  HB2  . LEU B 1 36 ? 157.194 -1.609  -1.653  1.00 0.00 ? 36  LEU B HB2  1  
ATOM   2005  H  HB3  . LEU B 1 36 ? 155.921 -2.027  -2.796  1.00 0.00 ? 36  LEU B HB3  1  
ATOM   2006  H  HG   . LEU B 1 36 ? 158.303 -3.800  -2.194  1.00 0.00 ? 36  LEU B HG   1  
ATOM   2007  H  HD11 . LEU B 1 36 ? 156.679 -5.155  -0.900  1.00 0.00 ? 36  LEU B HD11 1  
ATOM   2008  H  HD12 . LEU B 1 36 ? 155.440 -3.934  -1.189  1.00 0.00 ? 36  LEU B HD12 1  
ATOM   2009  H  HD13 . LEU B 1 36 ? 156.853 -3.541  -0.209  1.00 0.00 ? 36  LEU B HD13 1  
ATOM   2010  H  HD21 . LEU B 1 36 ? 156.155 -5.289  -3.200  1.00 0.00 ? 36  LEU B HD21 1  
ATOM   2011  H  HD22 . LEU B 1 36 ? 157.591 -4.814  -4.098  1.00 0.00 ? 36  LEU B HD22 1  
ATOM   2012  H  HD23 . LEU B 1 36 ? 156.133 -3.828  -4.176  1.00 0.00 ? 36  LEU B HD23 1  
ATOM   2013  N  N    . LEU B 1 37 ? 157.587 0.746   -3.277  1.00 0.00 ? 37  LEU B N    1  
ATOM   2014  C  CA   . LEU B 1 37 ? 157.107 2.074   -3.613  1.00 0.00 ? 37  LEU B CA   1  
ATOM   2015  C  C    . LEU B 1 37 ? 157.832 2.616   -4.834  1.00 0.00 ? 37  LEU B C    1  
ATOM   2016  O  O    . LEU B 1 37 ? 157.219 3.190   -5.740  1.00 0.00 ? 37  LEU B O    1  
ATOM   2017  C  CB   . LEU B 1 37 ? 157.329 3.020   -2.431  1.00 0.00 ? 37  LEU B CB   1  
ATOM   2018  C  CG   . LEU B 1 37 ? 156.620 2.483   -1.182  1.00 0.00 ? 37  LEU B CG   1  
ATOM   2019  C  CD1  . LEU B 1 37 ? 156.757 3.498   -0.046  1.00 0.00 ? 37  LEU B CD1  1  
ATOM   2020  C  CD2  . LEU B 1 37 ? 155.134 2.251   -1.481  1.00 0.00 ? 37  LEU B CD2  1  
ATOM   2021  H  H    . LEU B 1 37 ? 158.106 0.597   -2.452  1.00 0.00 ? 37  LEU B H    1  
ATOM   2022  H  HA   . LEU B 1 37 ? 156.052 2.023   -3.828  1.00 0.00 ? 37  LEU B HA   1  
ATOM   2023  H  HB2  . LEU B 1 37 ? 158.389 3.102   -2.234  1.00 0.00 ? 37  LEU B HB2  1  
ATOM   2024  H  HB3  . LEU B 1 37 ? 156.936 3.994   -2.674  1.00 0.00 ? 37  LEU B HB3  1  
ATOM   2025  H  HG   . LEU B 1 37 ? 157.079 1.550   -0.885  1.00 0.00 ? 37  LEU B HG   1  
ATOM   2026  H  HD11 . LEU B 1 37 ? 155.998 4.260   -0.151  1.00 0.00 ? 37  LEU B HD11 1  
ATOM   2027  H  HD12 . LEU B 1 37 ? 157.734 3.956   -0.088  1.00 0.00 ? 37  LEU B HD12 1  
ATOM   2028  H  HD13 . LEU B 1 37 ? 156.635 2.997   0.902   1.00 0.00 ? 37  LEU B HD13 1  
ATOM   2029  H  HD21 . LEU B 1 37 ? 154.792 2.975   -2.199  1.00 0.00 ? 37  LEU B HD21 1  
ATOM   2030  H  HD22 . LEU B 1 37 ? 154.561 2.355   -0.572  1.00 0.00 ? 37  LEU B HD22 1  
ATOM   2031  H  HD23 . LEU B 1 37 ? 154.998 1.257   -1.879  1.00 0.00 ? 37  LEU B HD23 1  
ATOM   2032  N  N    . GLN B 1 38 ? 159.148 2.426   -4.842  1.00 0.00 ? 38  GLN B N    1  
ATOM   2033  C  CA   . GLN B 1 38 ? 159.977 2.908   -5.933  1.00 0.00 ? 38  GLN B CA   1  
ATOM   2034  C  C    . GLN B 1 38 ? 159.673 2.241   -7.263  1.00 0.00 ? 38  GLN B C    1  
ATOM   2035  O  O    . GLN B 1 38 ? 159.647 2.902   -8.297  1.00 0.00 ? 38  GLN B O    1  
ATOM   2036  C  CB   . GLN B 1 38 ? 161.446 2.702   -5.575  1.00 0.00 ? 38  GLN B CB   1  
ATOM   2037  C  CG   . GLN B 1 38 ? 162.331 3.323   -6.649  1.00 0.00 ? 38  GLN B CG   1  
ATOM   2038  C  CD   . GLN B 1 38 ? 163.799 3.178   -6.269  1.00 0.00 ? 38  GLN B CD   1  
ATOM   2039  O  OE1  . GLN B 1 38 ? 164.113 2.740   -5.162  1.00 0.00 ? 38  GLN B OE1  1  
ATOM   2040  N  NE2  . GLN B 1 38 ? 164.723 3.521   -7.123  1.00 0.00 ? 38  GLN B NE2  1  
ATOM   2041  H  H    . GLN B 1 38 ? 159.574 1.963   -4.086  1.00 0.00 ? 38  GLN B H    1  
ATOM   2042  H  HA   . GLN B 1 38 ? 159.804 3.963   -6.044  1.00 0.00 ? 38  GLN B HA   1  
ATOM   2043  H  HB2  . GLN B 1 38 ? 161.650 3.172   -4.630  1.00 0.00 ? 38  GLN B HB2  1  
ATOM   2044  H  HB3  . GLN B 1 38 ? 161.657 1.645   -5.506  1.00 0.00 ? 38  GLN B HB3  1  
ATOM   2045  H  HG2  . GLN B 1 38 ? 162.155 2.818   -7.579  1.00 0.00 ? 38  GLN B HG2  1  
ATOM   2046  H  HG3  . GLN B 1 38 ? 162.088 4.368   -6.758  1.00 0.00 ? 38  GLN B HG3  1  
ATOM   2047  H  HE21 . GLN B 1 38 ? 164.470 3.869   -8.004  1.00 0.00 ? 38  GLN B HE21 1  
ATOM   2048  H  HE22 . GLN B 1 38 ? 165.669 3.430   -6.886  1.00 0.00 ? 38  GLN B HE22 1  
ATOM   2049  N  N    . THR B 1 39 ? 159.469 0.933   -7.250  1.00 0.00 ? 39  THR B N    1  
ATOM   2050  C  CA   . THR B 1 39 ? 159.201 0.228   -8.492  1.00 0.00 ? 39  THR B CA   1  
ATOM   2051  C  C    . THR B 1 39 ? 157.731 0.299   -8.896  1.00 0.00 ? 39  THR B C    1  
ATOM   2052  O  O    . THR B 1 39 ? 157.417 0.553   -10.059 1.00 0.00 ? 39  THR B O    1  
ATOM   2053  C  CB   . THR B 1 39 ? 159.656 -1.236  -8.381  1.00 0.00 ? 39  THR B CB   1  
ATOM   2054  O  OG1  . THR B 1 39 ? 159.947 -1.735  -9.678  1.00 0.00 ? 39  THR B OG1  1  
ATOM   2055  C  CG2  . THR B 1 39 ? 158.560 -2.092  -7.742  1.00 0.00 ? 39  THR B CG2  1  
ATOM   2056  H  H    . THR B 1 39 ? 159.518 0.438   -6.405  1.00 0.00 ? 39  THR B H    1  
ATOM   2057  H  HA   . THR B 1 39 ? 159.784 0.697   -9.270  1.00 0.00 ? 39  THR B HA   1  
ATOM   2058  H  HB   . THR B 1 39 ? 160.545 -1.287  -7.771  1.00 0.00 ? 39  THR B HB   1  
ATOM   2059  H  HG1  . THR B 1 39 ? 160.197 -2.657  -9.592  1.00 0.00 ? 39  THR B HG1  1  
ATOM   2060  H  HG21 . THR B 1 39 ? 158.220 -1.620  -6.836  1.00 0.00 ? 39  THR B HG21 1  
ATOM   2061  H  HG22 . THR B 1 39 ? 158.957 -3.069  -7.510  1.00 0.00 ? 39  THR B HG22 1  
ATOM   2062  H  HG23 . THR B 1 39 ? 157.733 -2.194  -8.429  1.00 0.00 ? 39  THR B HG23 1  
ATOM   2063  N  N    . GLU B 1 40 ? 156.827 0.049   -7.949  1.00 0.00 ? 40  GLU B N    1  
ATOM   2064  C  CA   . GLU B 1 40 ? 155.405 0.071   -8.278  1.00 0.00 ? 40  GLU B CA   1  
ATOM   2065  C  C    . GLU B 1 40 ? 154.899 1.493   -8.492  1.00 0.00 ? 40  GLU B C    1  
ATOM   2066  O  O    . GLU B 1 40 ? 154.026 1.726   -9.329  1.00 0.00 ? 40  GLU B O    1  
ATOM   2067  C  CB   . GLU B 1 40 ? 154.593 -0.609  -7.170  1.00 0.00 ? 40  GLU B CB   1  
ATOM   2068  C  CG   . GLU B 1 40 ? 155.011 -2.082  -7.074  1.00 0.00 ? 40  GLU B CG   1  
ATOM   2069  C  CD   . GLU B 1 40 ? 154.177 -2.815  -6.028  1.00 0.00 ? 40  GLU B CD   1  
ATOM   2070  O  OE1  . GLU B 1 40 ? 153.475 -2.155  -5.291  1.00 0.00 ? 40  GLU B OE1  1  
ATOM   2071  O  OE2  . GLU B 1 40 ? 154.258 -4.031  -5.985  1.00 0.00 ? 40  GLU B OE2  1  
ATOM   2072  H  H    . GLU B 1 40 ? 157.118 -0.161  -7.035  1.00 0.00 ? 40  GLU B H    1  
ATOM   2073  H  HA   . GLU B 1 40 ? 155.259 -0.484  -9.193  1.00 0.00 ? 40  GLU B HA   1  
ATOM   2074  H  HB2  . GLU B 1 40 ? 154.767 -0.113  -6.231  1.00 0.00 ? 40  GLU B HB2  1  
ATOM   2075  H  HB3  . GLU B 1 40 ? 153.547 -0.551  -7.415  1.00 0.00 ? 40  GLU B HB3  1  
ATOM   2076  H  HG2  . GLU B 1 40 ? 154.877 -2.555  -8.030  1.00 0.00 ? 40  GLU B HG2  1  
ATOM   2077  H  HG3  . GLU B 1 40 ? 156.049 -2.138  -6.795  1.00 0.00 ? 40  GLU B HG3  1  
ATOM   2078  N  N    . LEU B 1 41 ? 155.450 2.448   -7.743  1.00 0.00 ? 41  LEU B N    1  
ATOM   2079  C  CA   . LEU B 1 41 ? 155.041 3.844   -7.879  1.00 0.00 ? 41  LEU B CA   1  
ATOM   2080  C  C    . LEU B 1 41 ? 156.240 4.725   -8.200  1.00 0.00 ? 41  LEU B C    1  
ATOM   2081  O  O    . LEU B 1 41 ? 156.446 5.765   -7.565  1.00 0.00 ? 41  LEU B O    1  
ATOM   2082  C  CB   . LEU B 1 41 ? 154.373 4.327   -6.596  1.00 0.00 ? 41  LEU B CB   1  
ATOM   2083  C  CG   . LEU B 1 41 ? 152.959 3.739   -6.482  1.00 0.00 ? 41  LEU B CG   1  
ATOM   2084  C  CD1  . LEU B 1 41 ? 153.021 2.246   -6.108  1.00 0.00 ? 41  LEU B CD1  1  
ATOM   2085  C  CD2  . LEU B 1 41 ? 152.185 4.510   -5.406  1.00 0.00 ? 41  LEU B CD2  1  
ATOM   2086  H  H    . LEU B 1 41 ? 156.151 2.214   -7.089  1.00 0.00 ? 41  LEU B H    1  
ATOM   2087  H  HA   . LEU B 1 41 ? 154.332 3.924   -8.690  1.00 0.00 ? 41  LEU B HA   1  
ATOM   2088  H  HB2  . LEU B 1 41 ? 154.965 4.025   -5.746  1.00 0.00 ? 41  LEU B HB2  1  
ATOM   2089  H  HB3  . LEU B 1 41 ? 154.308 5.400   -6.626  1.00 0.00 ? 41  LEU B HB3  1  
ATOM   2090  H  HG   . LEU B 1 41 ? 152.450 3.845   -7.429  1.00 0.00 ? 41  LEU B HG   1  
ATOM   2091  H  HD11 . LEU B 1 41 ? 152.251 2.017   -5.384  1.00 0.00 ? 41  LEU B HD11 1  
ATOM   2092  H  HD12 . LEU B 1 41 ? 153.987 2.008   -5.689  1.00 0.00 ? 41  LEU B HD12 1  
ATOM   2093  H  HD13 . LEU B 1 41 ? 152.861 1.650   -6.995  1.00 0.00 ? 41  LEU B HD13 1  
ATOM   2094  H  HD21 . LEU B 1 41 ? 151.249 4.009   -5.207  1.00 0.00 ? 41  LEU B HD21 1  
ATOM   2095  H  HD22 . LEU B 1 41 ? 151.990 5.514   -5.751  1.00 0.00 ? 41  LEU B HD22 1  
ATOM   2096  H  HD23 . LEU B 1 41 ? 152.771 4.548   -4.501  1.00 0.00 ? 41  LEU B HD23 1  
ATOM   2097  N  N    . SER B 1 42 ? 157.031 4.299   -9.176  1.00 0.00 ? 42  SER B N    1  
ATOM   2098  C  CA   . SER B 1 42 ? 158.223 5.040   -9.563  1.00 0.00 ? 42  SER B CA   1  
ATOM   2099  C  C    . SER B 1 42 ? 157.880 6.483   -9.897  1.00 0.00 ? 42  SER B C    1  
ATOM   2100  O  O    . SER B 1 42 ? 158.682 7.383   -9.666  1.00 0.00 ? 42  SER B O    1  
ATOM   2101  C  CB   . SER B 1 42 ? 158.868 4.384   -10.786 1.00 0.00 ? 42  SER B CB   1  
ATOM   2102  O  OG   . SER B 1 42 ? 159.104 3.009   -10.517 1.00 0.00 ? 42  SER B OG   1  
ATOM   2103  H  H    . SER B 1 42 ? 156.817 3.459   -9.634  1.00 0.00 ? 42  SER B H    1  
ATOM   2104  H  HA   . SER B 1 42 ? 158.928 5.026   -8.748  1.00 0.00 ? 42  SER B HA   1  
ATOM   2105  H  HB2  . SER B 1 42 ? 158.208 4.470   -11.632 1.00 0.00 ? 42  SER B HB2  1  
ATOM   2106  H  HB3  . SER B 1 42 ? 159.802 4.883   -11.009 1.00 0.00 ? 42  SER B HB3  1  
ATOM   2107  H  HG   . SER B 1 42 ? 159.484 2.613   -11.305 1.00 0.00 ? 42  SER B HG   1  
ATOM   2108  N  N    . GLY B 1 43 ? 156.696 6.697   -10.454 1.00 0.00 ? 43  GLY B N    1  
ATOM   2109  C  CA   . GLY B 1 43 ? 156.276 8.040   -10.826 1.00 0.00 ? 43  GLY B CA   1  
ATOM   2110  C  C    . GLY B 1 43 ? 155.672 8.812   -9.651  1.00 0.00 ? 43  GLY B C    1  
ATOM   2111  O  O    . GLY B 1 43 ? 156.213 9.833   -9.227  1.00 0.00 ? 43  GLY B O    1  
ATOM   2112  H  H    . GLY B 1 43 ? 156.100 5.938   -10.627 1.00 0.00 ? 43  GLY B H    1  
ATOM   2113  H  HA2  . GLY B 1 43 ? 157.133 8.583   -11.198 1.00 0.00 ? 43  GLY B HA2  1  
ATOM   2114  H  HA3  . GLY B 1 43 ? 155.540 7.969   -11.613 1.00 0.00 ? 43  GLY B HA3  1  
ATOM   2115  N  N    . PHE B 1 44 ? 154.526 8.346   -9.164  1.00 0.00 ? 44  PHE B N    1  
ATOM   2116  C  CA   . PHE B 1 44 ? 153.826 9.030   -8.076  1.00 0.00 ? 44  PHE B CA   1  
ATOM   2117  C  C    . PHE B 1 44 ? 154.679 9.169   -6.805  1.00 0.00 ? 44  PHE B C    1  
ATOM   2118  O  O    . PHE B 1 44 ? 154.687 10.225  -6.171  1.00 0.00 ? 44  PHE B O    1  
ATOM   2119  C  CB   . PHE B 1 44 ? 152.552 8.258   -7.740  1.00 0.00 ? 44  PHE B CB   1  
ATOM   2120  C  CG   . PHE B 1 44 ? 151.617 8.305   -8.925  1.00 0.00 ? 44  PHE B CG   1  
ATOM   2121  C  CD1  . PHE B 1 44 ? 150.787 9.414   -9.123  1.00 0.00 ? 44  PHE B CD1  1  
ATOM   2122  C  CD2  . PHE B 1 44 ? 151.582 7.235   -9.828  1.00 0.00 ? 44  PHE B CD2  1  
ATOM   2123  C  CE1  . PHE B 1 44 ? 149.920 9.454   -10.223 1.00 0.00 ? 44  PHE B CE1  1  
ATOM   2124  C  CE2  . PHE B 1 44 ? 150.717 7.275   -10.928 1.00 0.00 ? 44  PHE B CE2  1  
ATOM   2125  C  CZ   . PHE B 1 44 ? 149.886 8.384   -11.124 1.00 0.00 ? 44  PHE B CZ   1  
ATOM   2126  H  H    . PHE B 1 44 ? 154.123 7.548   -9.565  1.00 0.00 ? 44  PHE B H    1  
ATOM   2127  H  HA   . PHE B 1 44 ? 153.541 10.009  -8.411  1.00 0.00 ? 44  PHE B HA   1  
ATOM   2128  H  HB2  . PHE B 1 44 ? 152.801 7.231   -7.516  1.00 0.00 ? 44  PHE B HB2  1  
ATOM   2129  H  HB3  . PHE B 1 44 ? 152.071 8.709   -6.885  1.00 0.00 ? 44  PHE B HB3  1  
ATOM   2130  H  HD1  . PHE B 1 44 ? 150.813 10.239  -8.426  1.00 0.00 ? 44  PHE B HD1  1  
ATOM   2131  H  HD2  . PHE B 1 44 ? 152.223 6.379   -9.676  1.00 0.00 ? 44  PHE B HD2  1  
ATOM   2132  H  HE1  . PHE B 1 44 ? 149.279 10.309  -10.375 1.00 0.00 ? 44  PHE B HE1  1  
ATOM   2133  H  HE2  . PHE B 1 44 ? 150.690 6.449   -11.623 1.00 0.00 ? 44  PHE B HE2  1  
ATOM   2134  H  HZ   . PHE B 1 44 ? 149.219 8.413   -11.973 1.00 0.00 ? 44  PHE B HZ   1  
ATOM   2135  N  N    . LEU B 1 45 ? 155.377 8.102   -6.431  1.00 0.00 ? 45  LEU B N    1  
ATOM   2136  C  CA   . LEU B 1 45 ? 156.215 8.106   -5.224  1.00 0.00 ? 45  LEU B CA   1  
ATOM   2137  C  C    . LEU B 1 45 ? 157.684 8.405   -5.509  1.00 0.00 ? 45  LEU B C    1  
ATOM   2138  O  O    . LEU B 1 45 ? 158.485 8.412   -4.579  1.00 0.00 ? 45  LEU B O    1  
ATOM   2139  C  CB   . LEU B 1 45 ? 156.069 6.791   -4.453  1.00 0.00 ? 45  LEU B CB   1  
ATOM   2140  C  CG   . LEU B 1 45 ? 154.860 6.873   -3.500  1.00 0.00 ? 45  LEU B CG   1  
ATOM   2141  C  CD1  . LEU B 1 45 ? 153.597 7.310   -4.254  1.00 0.00 ? 45  LEU B CD1  1  
ATOM   2142  C  CD2  . LEU B 1 45 ? 154.628 5.501   -2.865  1.00 0.00 ? 45  LEU B CD2  1  
ATOM   2143  H  H    . LEU B 1 45 ? 155.326 7.280   -6.972  1.00 0.00 ? 45  LEU B H    1  
ATOM   2144  H  HA   . LEU B 1 45 ? 155.852 8.899   -4.585  1.00 0.00 ? 45  LEU B HA   1  
ATOM   2145  H  HB2  . LEU B 1 45 ? 155.926 5.983   -5.151  1.00 0.00 ? 45  LEU B HB2  1  
ATOM   2146  H  HB3  . LEU B 1 45 ? 156.964 6.611   -3.875  1.00 0.00 ? 45  LEU B HB3  1  
ATOM   2147  H  HG   . LEU B 1 45 ? 155.073 7.592   -2.723  1.00 0.00 ? 45  LEU B HG   1  
ATOM   2148  H  HD11 . LEU B 1 45 ? 153.666 7.015   -5.283  1.00 0.00 ? 45  LEU B HD11 1  
ATOM   2149  H  HD12 . LEU B 1 45 ? 153.501 8.384   -4.197  1.00 0.00 ? 45  LEU B HD12 1  
ATOM   2150  H  HD13 . LEU B 1 45 ? 152.726 6.850   -3.804  1.00 0.00 ? 45  LEU B HD13 1  
ATOM   2151  H  HD21 . LEU B 1 45 ? 154.855 4.731   -3.585  1.00 0.00 ? 45  LEU B HD21 1  
ATOM   2152  H  HD22 . LEU B 1 45 ? 153.596 5.415   -2.557  1.00 0.00 ? 45  LEU B HD22 1  
ATOM   2153  H  HD23 . LEU B 1 45 ? 155.269 5.390   -2.004  1.00 0.00 ? 45  LEU B HD23 1  
ATOM   2154  N  N    . ASP B 1 46 ? 158.035 8.594   -6.785  1.00 0.00 ? 46  ASP B N    1  
ATOM   2155  C  CA   . ASP B 1 46 ? 159.434 8.829   -7.186  1.00 0.00 ? 46  ASP B CA   1  
ATOM   2156  C  C    . ASP B 1 46 ? 160.314 9.285   -6.016  1.00 0.00 ? 46  ASP B C    1  
ATOM   2157  O  O    . ASP B 1 46 ? 160.669 10.456  -5.886  1.00 0.00 ? 46  ASP B O    1  
ATOM   2158  C  CB   . ASP B 1 46 ? 159.473 9.891   -8.291  1.00 0.00 ? 46  ASP B CB   1  
ATOM   2159  C  CG   . ASP B 1 46 ? 158.920 11.218  -7.774  1.00 0.00 ? 46  ASP B CG   1  
ATOM   2160  O  OD1  . ASP B 1 46 ? 158.710 11.330  -6.578  1.00 0.00 ? 46  ASP B OD1  1  
ATOM   2161  O  OD2  . ASP B 1 46 ? 158.690 12.096  -8.589  1.00 0.00 ? 46  ASP B OD2  1  
ATOM   2162  H  H    . ASP B 1 46 ? 157.346 8.535   -7.480  1.00 0.00 ? 46  ASP B H    1  
ATOM   2163  H  HA   . ASP B 1 46 ? 159.837 7.910   -7.583  1.00 0.00 ? 46  ASP B HA   1  
ATOM   2164  H  HB2  . ASP B 1 46 ? 160.494 10.033  -8.613  1.00 0.00 ? 46  ASP B HB2  1  
ATOM   2165  H  HB3  . ASP B 1 46 ? 158.878 9.563   -9.128  1.00 0.00 ? 46  ASP B HB3  1  
ATOM   2166  N  N    . ALA B 1 47 ? 160.669 8.308   -5.179  1.00 0.00 ? 47  ALA B N    1  
ATOM   2167  C  CA   . ALA B 1 47 ? 161.512 8.535   -4.009  1.00 0.00 ? 47  ALA B CA   1  
ATOM   2168  C  C    . ALA B 1 47 ? 162.918 8.963   -4.411  1.00 0.00 ? 47  ALA B C    1  
ATOM   2169  O  O    . ALA B 1 47 ? 163.660 9.520   -3.603  1.00 0.00 ? 47  ALA B O    1  
ATOM   2170  C  CB   . ALA B 1 47 ? 161.590 7.257   -3.172  1.00 0.00 ? 47  ALA B CB   1  
ATOM   2171  H  H    . ALA B 1 47 ? 160.352 7.399   -5.360  1.00 0.00 ? 47  ALA B H    1  
ATOM   2172  H  HA   . ALA B 1 47 ? 161.070 9.314   -3.407  1.00 0.00 ? 47  ALA B HA   1  
ATOM   2173  H  HB1  . ALA B 1 47 ? 162.127 6.498   -3.722  1.00 0.00 ? 47  ALA B HB1  1  
ATOM   2174  H  HB2  . ALA B 1 47 ? 160.592 6.906   -2.956  1.00 0.00 ? 47  ALA B HB2  1  
ATOM   2175  H  HB3  . ALA B 1 47 ? 162.107 7.464   -2.246  1.00 0.00 ? 47  ALA B HB3  1  
ATOM   2176  N  N    . GLN B 1 48 ? 163.291 8.675   -5.653  1.00 0.00 ? 48  GLN B N    1  
ATOM   2177  C  CA   . GLN B 1 48 ? 164.627 9.011   -6.130  1.00 0.00 ? 48  GLN B CA   1  
ATOM   2178  C  C    . GLN B 1 48 ? 164.926 10.485  -5.924  1.00 0.00 ? 48  GLN B C    1  
ATOM   2179  O  O    . GLN B 1 48 ? 166.059 10.859  -5.621  1.00 0.00 ? 48  GLN B O    1  
ATOM   2180  C  CB   . GLN B 1 48 ? 164.733 8.696   -7.621  1.00 0.00 ? 48  GLN B CB   1  
ATOM   2181  C  CG   . GLN B 1 48 ? 164.626 7.186   -7.840  1.00 0.00 ? 48  GLN B CG   1  
ATOM   2182  C  CD   . GLN B 1 48 ? 164.677 6.870   -9.330  1.00 0.00 ? 48  GLN B CD   1  
ATOM   2183  O  OE1  . GLN B 1 48 ? 164.482 7.758   -10.161 1.00 0.00 ? 48  GLN B OE1  1  
ATOM   2184  N  NE2  . GLN B 1 48 ? 164.929 5.651   -9.722  1.00 0.00 ? 48  GLN B NE2  1  
ATOM   2185  H  H    . GLN B 1 48 ? 162.667 8.210   -6.249  1.00 0.00 ? 48  GLN B H    1  
ATOM   2186  H  HA   . GLN B 1 48 ? 165.356 8.421   -5.595  1.00 0.00 ? 48  GLN B HA   1  
ATOM   2187  H  HB2  . GLN B 1 48 ? 163.926 9.190   -8.144  1.00 0.00 ? 48  GLN B HB2  1  
ATOM   2188  H  HB3  . GLN B 1 48 ? 165.675 9.057   -8.001  1.00 0.00 ? 48  GLN B HB3  1  
ATOM   2189  H  HG2  . GLN B 1 48 ? 165.447 6.693   -7.341  1.00 0.00 ? 48  GLN B HG2  1  
ATOM   2190  H  HG3  . GLN B 1 48 ? 163.693 6.830   -7.431  1.00 0.00 ? 48  GLN B HG3  1  
ATOM   2191  H  HE21 . GLN B 1 48 ? 165.085 4.947   -9.059  1.00 0.00 ? 48  GLN B HE21 1  
ATOM   2192  H  HE22 . GLN B 1 48 ? 164.964 5.441   -10.679 1.00 0.00 ? 48  GLN B HE22 1  
ATOM   2193  N  N    . LYS B 1 49 ? 163.916 11.319  -6.086  1.00 0.00 ? 49  LYS B N    1  
ATOM   2194  C  CA   . LYS B 1 49 ? 164.107 12.745  -5.907  1.00 0.00 ? 49  LYS B CA   1  
ATOM   2195  C  C    . LYS B 1 49 ? 164.592 13.054  -4.494  1.00 0.00 ? 49  LYS B C    1  
ATOM   2196  O  O    . LYS B 1 49 ? 165.401 13.959  -4.290  1.00 0.00 ? 49  LYS B O    1  
ATOM   2197  C  CB   . LYS B 1 49 ? 162.824 13.473  -6.208  1.00 0.00 ? 49  LYS B CB   1  
ATOM   2198  C  CG   . LYS B 1 49 ? 162.500 13.234  -7.681  1.00 0.00 ? 49  LYS B CG   1  
ATOM   2199  C  CD   . LYS B 1 49 ? 161.296 14.077  -8.058  1.00 0.00 ? 49  LYS B CD   1  
ATOM   2200  C  CE   . LYS B 1 49 ? 161.722 15.524  -8.352  1.00 0.00 ? 49  LYS B CE   1  
ATOM   2201  N  NZ   . LYS B 1 49 ? 161.745 15.741  -9.826  1.00 0.00 ? 49  LYS B NZ   1  
ATOM   2202  H  H    . LYS B 1 49 ? 163.031 10.974  -6.326  1.00 0.00 ? 49  LYS B H    1  
ATOM   2203  H  HA   . LYS B 1 49 ? 164.837 13.084  -6.613  1.00 0.00 ? 49  LYS B HA   1  
ATOM   2204  H  HB2  . LYS B 1 49 ? 162.030 13.085  -5.585  1.00 0.00 ? 49  LYS B HB2  1  
ATOM   2205  H  HB3  . LYS B 1 49 ? 162.950 14.528  -6.029  1.00 0.00 ? 49  LYS B HB3  1  
ATOM   2206  H  HG2  . LYS B 1 49 ? 163.351 13.502  -8.291  1.00 0.00 ? 49  LYS B HG2  1  
ATOM   2207  H  HG3  . LYS B 1 49 ? 162.266 12.190  -7.831  1.00 0.00 ? 49  LYS B HG3  1  
ATOM   2208  H  HD2  . LYS B 1 49 ? 160.812 13.654  -8.927  1.00 0.00 ? 49  LYS B HD2  1  
ATOM   2209  H  HD3  . LYS B 1 49 ? 160.620 14.070  -7.228  1.00 0.00 ? 49  LYS B HD3  1  
ATOM   2210  H  HE2  . LYS B 1 49 ? 161.015 16.206  -7.903  1.00 0.00 ? 49  LYS B HE2  1  
ATOM   2211  H  HE3  . LYS B 1 49 ? 162.706 15.711  -7.947  1.00 0.00 ? 49  LYS B HE3  1  
ATOM   2212  H  HZ1  . LYS B 1 49 ? 162.701 16.029  -10.118 1.00 0.00 ? 49  LYS B HZ1  1  
ATOM   2213  H  HZ2  . LYS B 1 49 ? 161.065 16.487  -10.077 1.00 0.00 ? 49  LYS B HZ2  1  
ATOM   2214  H  HZ3  . LYS B 1 49 ? 161.489 14.859  -10.311 1.00 0.00 ? 49  LYS B HZ3  1  
ATOM   2215  N  N    . ASP B 1 50 ? 164.100 12.283  -3.525  1.00 0.00 ? 50  ASP B N    1  
ATOM   2216  C  CA   . ASP B 1 50 ? 164.495 12.467  -2.130  1.00 0.00 ? 50  ASP B CA   1  
ATOM   2217  C  C    . ASP B 1 50 ? 164.675 11.116  -1.438  1.00 0.00 ? 50  ASP B C    1  
ATOM   2218  O  O    . ASP B 1 50 ? 163.726 10.564  -0.883  1.00 0.00 ? 50  ASP B O    1  
ATOM   2219  C  CB   . ASP B 1 50 ? 163.427 13.276  -1.385  1.00 0.00 ? 50  ASP B CB   1  
ATOM   2220  C  CG   . ASP B 1 50 ? 163.374 14.702  -1.922  1.00 0.00 ? 50  ASP B CG   1  
ATOM   2221  O  OD1  . ASP B 1 50 ? 164.289 15.084  -2.632  1.00 0.00 ? 50  ASP B OD1  1  
ATOM   2222  O  OD2  . ASP B 1 50 ? 162.418 15.394  -1.614  1.00 0.00 ? 50  ASP B OD2  1  
ATOM   2223  H  H    . ASP B 1 50 ? 163.467 11.572  -3.753  1.00 0.00 ? 50  ASP B H    1  
ATOM   2224  H  HA   . ASP B 1 50 ? 165.429 13.008  -2.095  1.00 0.00 ? 50  ASP B HA   1  
ATOM   2225  H  HB2  . ASP B 1 50 ? 162.465 12.807  -1.522  1.00 0.00 ? 50  ASP B HB2  1  
ATOM   2226  H  HB3  . ASP B 1 50 ? 163.667 13.300  -0.333  1.00 0.00 ? 50  ASP B HB3  1  
ATOM   2227  N  N    . VAL B 1 51 ? 165.898 10.591  -1.467  1.00 0.00 ? 51  VAL B N    1  
ATOM   2228  C  CA   . VAL B 1 51 ? 166.182 9.305   -0.833  1.00 0.00 ? 51  VAL B CA   1  
ATOM   2229  C  C    . VAL B 1 51 ? 165.916 9.379   0.670   1.00 0.00 ? 51  VAL B C    1  
ATOM   2230  O  O    . VAL B 1 51 ? 165.392 8.440   1.269   1.00 0.00 ? 51  VAL B O    1  
ATOM   2231  C  CB   . VAL B 1 51 ? 167.642 8.916   -1.075  1.00 0.00 ? 51  VAL B CB   1  
ATOM   2232  C  CG1  . VAL B 1 51 ? 167.979 7.666   -0.262  1.00 0.00 ? 51  VAL B CG1  1  
ATOM   2233  C  CG2  . VAL B 1 51 ? 167.850 8.627   -2.563  1.00 0.00 ? 51  VAL B CG2  1  
ATOM   2234  H  H    . VAL B 1 51 ? 166.620 11.076  -1.919  1.00 0.00 ? 51  VAL B H    1  
ATOM   2235  H  HA   . VAL B 1 51 ? 165.544 8.551   -1.265  1.00 0.00 ? 51  VAL B HA   1  
ATOM   2236  H  HB   . VAL B 1 51 ? 168.286 9.728   -0.770  1.00 0.00 ? 51  VAL B HB   1  
ATOM   2237  H  HG11 . VAL B 1 51 ? 168.041 7.923   0.785   1.00 0.00 ? 51  VAL B HG11 1  
ATOM   2238  H  HG12 . VAL B 1 51 ? 168.928 7.268   -0.590  1.00 0.00 ? 51  VAL B HG12 1  
ATOM   2239  H  HG13 . VAL B 1 51 ? 167.208 6.924   -0.405  1.00 0.00 ? 51  VAL B HG13 1  
ATOM   2240  H  HG21 . VAL B 1 51 ? 167.331 7.718   -2.829  1.00 0.00 ? 51  VAL B HG21 1  
ATOM   2241  H  HG22 . VAL B 1 51 ? 168.905 8.511   -2.764  1.00 0.00 ? 51  VAL B HG22 1  
ATOM   2242  H  HG23 . VAL B 1 51 ? 167.460 9.448   -3.147  1.00 0.00 ? 51  VAL B HG23 1  
ATOM   2243  N  N    . ASP B 1 52 ? 166.285 10.507  1.264   1.00 0.00 ? 52  ASP B N    1  
ATOM   2244  C  CA   . ASP B 1 52 ? 166.092 10.724  2.696   1.00 0.00 ? 52  ASP B CA   1  
ATOM   2245  C  C    . ASP B 1 52 ? 164.629 10.536  3.087   1.00 0.00 ? 52  ASP B C    1  
ATOM   2246  O  O    . ASP B 1 52 ? 164.322 10.106  4.198   1.00 0.00 ? 52  ASP B O    1  
ATOM   2247  C  CB   . ASP B 1 52 ? 166.544 12.135  3.074   1.00 0.00 ? 52  ASP B CB   1  
ATOM   2248  C  CG   . ASP B 1 52 ? 166.556 12.291  4.591   1.00 0.00 ? 52  ASP B CG   1  
ATOM   2249  O  OD1  . ASP B 1 52 ? 166.323 11.304  5.269   1.00 0.00 ? 52  ASP B OD1  1  
ATOM   2250  O  OD2  . ASP B 1 52 ? 166.798 13.394  5.052   1.00 0.00 ? 52  ASP B OD2  1  
ATOM   2251  H  H    . ASP B 1 52 ? 166.696 11.216  0.728   1.00 0.00 ? 52  ASP B H    1  
ATOM   2252  H  HA   . ASP B 1 52 ? 166.692 10.010  3.240   1.00 0.00 ? 52  ASP B HA   1  
ATOM   2253  H  HB2  . ASP B 1 52 ? 167.538 12.308  2.688   1.00 0.00 ? 52  ASP B HB2  1  
ATOM   2254  H  HB3  . ASP B 1 52 ? 165.863 12.856  2.646   1.00 0.00 ? 52  ASP B HB3  1  
ATOM   2255  N  N    . ALA B 1 53 ? 163.734 10.894  2.175   1.00 0.00 ? 53  ALA B N    1  
ATOM   2256  C  CA   . ALA B 1 53 ? 162.302 10.802  2.433   1.00 0.00 ? 53  ALA B CA   1  
ATOM   2257  C  C    . ALA B 1 53 ? 161.871 9.378   2.791   1.00 0.00 ? 53  ALA B C    1  
ATOM   2258  O  O    . ALA B 1 53 ? 160.892 9.192   3.514   1.00 0.00 ? 53  ALA B O    1  
ATOM   2259  C  CB   . ALA B 1 53 ? 161.525 11.268  1.202   1.00 0.00 ? 53  ALA B CB   1  
ATOM   2260  H  H    . ALA B 1 53 ? 164.043 11.253  1.317   1.00 0.00 ? 53  ALA B H    1  
ATOM   2261  H  HA   . ALA B 1 53 ? 162.056 11.452  3.258   1.00 0.00 ? 53  ALA B HA   1  
ATOM   2262  H  HB1  . ALA B 1 53 ? 160.466 11.254  1.416   1.00 0.00 ? 53  ALA B HB1  1  
ATOM   2263  H  HB2  . ALA B 1 53 ? 161.733 10.608  0.373   1.00 0.00 ? 53  ALA B HB2  1  
ATOM   2264  H  HB3  . ALA B 1 53 ? 161.826 12.273  0.946   1.00 0.00 ? 53  ALA B HB3  1  
ATOM   2265  N  N    . VAL B 1 54 ? 162.582 8.372   2.287   1.00 0.00 ? 54  VAL B N    1  
ATOM   2266  C  CA   . VAL B 1 54 ? 162.204 6.994   2.591   1.00 0.00 ? 54  VAL B CA   1  
ATOM   2267  C  C    . VAL B 1 54 ? 162.175 6.765   4.098   1.00 0.00 ? 54  VAL B C    1  
ATOM   2268  O  O    . VAL B 1 54 ? 161.235 6.165   4.622   1.00 0.00 ? 54  VAL B O    1  
ATOM   2269  C  CB   . VAL B 1 54 ? 163.197 6.024   1.951   1.00 0.00 ? 54  VAL B CB   1  
ATOM   2270  C  CG1  . VAL B 1 54 ? 162.938 4.606   2.475   1.00 0.00 ? 54  VAL B CG1  1  
ATOM   2271  C  CG2  . VAL B 1 54 ? 163.006 6.050   0.435   1.00 0.00 ? 54  VAL B CG2  1  
ATOM   2272  H  H    . VAL B 1 54 ? 163.352 8.554   1.709   1.00 0.00 ? 54  VAL B H    1  
ATOM   2273  H  HA   . VAL B 1 54 ? 161.224 6.795   2.185   1.00 0.00 ? 54  VAL B HA   1  
ATOM   2274  H  HB   . VAL B 1 54 ? 164.206 6.321   2.192   1.00 0.00 ? 54  VAL B HB   1  
ATOM   2275  H  HG11 . VAL B 1 54 ? 163.251 4.539   3.509   1.00 0.00 ? 54  VAL B HG11 1  
ATOM   2276  H  HG12 . VAL B 1 54 ? 163.498 3.895   1.884   1.00 0.00 ? 54  VAL B HG12 1  
ATOM   2277  H  HG13 . VAL B 1 54 ? 161.885 4.382   2.404   1.00 0.00 ? 54  VAL B HG13 1  
ATOM   2278  H  HG21 . VAL B 1 54 ? 163.884 5.643   -0.041  1.00 0.00 ? 54  VAL B HG21 1  
ATOM   2279  H  HG22 . VAL B 1 54 ? 162.860 7.069   0.110   1.00 0.00 ? 54  VAL B HG22 1  
ATOM   2280  H  HG23 . VAL B 1 54 ? 162.143 5.459   0.171   1.00 0.00 ? 54  VAL B HG23 1  
ATOM   2281  N  N    . ASP B 1 55 ? 163.189 7.264   4.801   1.00 0.00 ? 55  ASP B N    1  
ATOM   2282  C  CA   . ASP B 1 55 ? 163.222 7.111   6.248   1.00 0.00 ? 55  ASP B CA   1  
ATOM   2283  C  C    . ASP B 1 55 ? 162.021 7.808   6.881   1.00 0.00 ? 55  ASP B C    1  
ATOM   2284  O  O    . ASP B 1 55 ? 161.395 7.295   7.811   1.00 0.00 ? 55  ASP B O    1  
ATOM   2285  C  CB   . ASP B 1 55 ? 164.515 7.708   6.808   1.00 0.00 ? 55  ASP B CB   1  
ATOM   2286  C  CG   . ASP B 1 55 ? 165.714 6.892   6.335   1.00 0.00 ? 55  ASP B CG   1  
ATOM   2287  O  OD1  . ASP B 1 55 ? 165.500 5.805   5.823   1.00 0.00 ? 55  ASP B OD1  1  
ATOM   2288  O  OD2  . ASP B 1 55 ? 166.827 7.364   6.494   1.00 0.00 ? 55  ASP B OD2  1  
ATOM   2289  H  H    . ASP B 1 55 ? 163.906 7.750   4.343   1.00 0.00 ? 55  ASP B H    1  
ATOM   2290  H  HA   . ASP B 1 55 ? 163.189 6.061   6.493   1.00 0.00 ? 55  ASP B HA   1  
ATOM   2291  H  HB2  . ASP B 1 55 ? 164.618 8.727   6.463   1.00 0.00 ? 55  ASP B HB2  1  
ATOM   2292  H  HB3  . ASP B 1 55 ? 164.478 7.697   7.887   1.00 0.00 ? 55  ASP B HB3  1  
ATOM   2293  N  N    . LYS B 1 56 ? 161.689 8.982   6.364   1.00 0.00 ? 56  LYS B N    1  
ATOM   2294  C  CA   . LYS B 1 56 ? 160.555 9.713   6.895   1.00 0.00 ? 56  LYS B CA   1  
ATOM   2295  C  C    . LYS B 1 56 ? 159.284 8.894   6.732   1.00 0.00 ? 56  LYS B C    1  
ATOM   2296  O  O    . LYS B 1 56 ? 158.431 8.868   7.618   1.00 0.00 ? 56  LYS B O    1  
ATOM   2297  C  CB   . LYS B 1 56 ? 160.404 11.049  6.167   1.00 0.00 ? 56  LYS B CB   1  
ATOM   2298  C  CG   . LYS B 1 56 ? 161.676 11.860  6.315   1.00 0.00 ? 56  LYS B CG   1  
ATOM   2299  C  CD   . LYS B 1 56 ? 161.885 12.184  7.800   1.00 0.00 ? 56  LYS B CD   1  
ATOM   2300  C  CE   . LYS B 1 56 ? 162.470 13.575  7.913   1.00 0.00 ? 56  LYS B CE   1  
ATOM   2301  N  NZ   . LYS B 1 56 ? 162.895 13.838  9.316   1.00 0.00 ? 56  LYS B NZ   1  
ATOM   2302  H  H    . LYS B 1 56 ? 162.205 9.354   5.618   1.00 0.00 ? 56  LYS B H    1  
ATOM   2303  H  HA   . LYS B 1 56 ? 160.719 9.903   7.945   1.00 0.00 ? 56  LYS B HA   1  
ATOM   2304  H  HB2  . LYS B 1 56 ? 160.203 10.877  5.121   1.00 0.00 ? 56  LYS B HB2  1  
ATOM   2305  H  HB3  . LYS B 1 56 ? 159.597 11.619  6.605   1.00 0.00 ? 56  LYS B HB3  1  
ATOM   2306  H  HG2  . LYS B 1 56 ? 162.515 11.284  5.945   1.00 0.00 ? 56  LYS B HG2  1  
ATOM   2307  H  HG3  . LYS B 1 56 ? 161.585 12.775  5.747   1.00 0.00 ? 56  LYS B HG3  1  
ATOM   2308  H  HD2  . LYS B 1 56 ? 160.944 12.147  8.331   1.00 0.00 ? 56  LYS B HD2  1  
ATOM   2309  H  HD3  . LYS B 1 56 ? 162.571 11.472  8.231   1.00 0.00 ? 56  LYS B HD3  1  
ATOM   2310  H  HE2  . LYS B 1 56 ? 163.314 13.664  7.248   1.00 0.00 ? 56  LYS B HE2  1  
ATOM   2311  H  HE3  . LYS B 1 56 ? 161.702 14.278  7.623   1.00 0.00 ? 56  LYS B HE3  1  
ATOM   2312  H  HZ1  . LYS B 1 56 ? 162.418 14.691  9.670   1.00 0.00 ? 56  LYS B HZ1  1  
ATOM   2313  H  HZ2  . LYS B 1 56 ? 163.926 13.979  9.346   1.00 0.00 ? 56  LYS B HZ2  1  
ATOM   2314  H  HZ3  . LYS B 1 56 ? 162.638 13.027  9.915   1.00 0.00 ? 56  LYS B HZ3  1  
ATOM   2315  N  N    . VAL B 1 57 ? 159.166 8.226   5.587   1.00 0.00 ? 57  VAL B N    1  
ATOM   2316  C  CA   . VAL B 1 57 ? 157.988 7.413   5.323   1.00 0.00 ? 57  VAL B CA   1  
ATOM   2317  C  C    . VAL B 1 57 ? 157.912 6.205   6.241   1.00 0.00 ? 57  VAL B C    1  
ATOM   2318  O  O    . VAL B 1 57 ? 156.854 5.903   6.786   1.00 0.00 ? 57  VAL B O    1  
ATOM   2319  C  CB   . VAL B 1 57 ? 157.984 6.953   3.865   1.00 0.00 ? 57  VAL B CB   1  
ATOM   2320  C  CG1  . VAL B 1 57 ? 156.834 5.969   3.642   1.00 0.00 ? 57  VAL B CG1  1  
ATOM   2321  C  CG2  . VAL B 1 57 ? 157.801 8.166   2.950   1.00 0.00 ? 57  VAL B CG2  1  
ATOM   2322  H  H    . VAL B 1 57 ? 159.876 8.285   4.913   1.00 0.00 ? 57  VAL B H    1  
ATOM   2323  H  HA   . VAL B 1 57 ? 157.121 8.014   5.496   1.00 0.00 ? 57  VAL B HA   1  
ATOM   2324  H  HB   . VAL B 1 57 ? 158.922 6.466   3.638   1.00 0.00 ? 57  VAL B HB   1  
ATOM   2325  H  HG11 . VAL B 1 57 ? 156.586 5.938   2.592   1.00 0.00 ? 57  VAL B HG11 1  
ATOM   2326  H  HG12 . VAL B 1 57 ? 155.971 6.292   4.207   1.00 0.00 ? 57  VAL B HG12 1  
ATOM   2327  H  HG13 . VAL B 1 57 ? 157.133 4.986   3.972   1.00 0.00 ? 57  VAL B HG13 1  
ATOM   2328  H  HG21 . VAL B 1 57 ? 158.411 8.982   3.307   1.00 0.00 ? 57  VAL B HG21 1  
ATOM   2329  H  HG22 . VAL B 1 57 ? 156.763 8.465   2.953   1.00 0.00 ? 57  VAL B HG22 1  
ATOM   2330  H  HG23 . VAL B 1 57 ? 158.098 7.907   1.945   1.00 0.00 ? 57  VAL B HG23 1  
ATOM   2331  N  N    . MET B 1 58 ? 159.032 5.520   6.415   1.00 0.00 ? 58  MET B N    1  
ATOM   2332  C  CA   . MET B 1 58 ? 159.054 4.348   7.276   1.00 0.00 ? 58  MET B CA   1  
ATOM   2333  C  C    . MET B 1 58 ? 158.729 4.722   8.717   1.00 0.00 ? 58  MET B C    1  
ATOM   2334  O  O    . MET B 1 58 ? 158.078 3.958   9.440   1.00 0.00 ? 58  MET B O    1  
ATOM   2335  C  CB   . MET B 1 58 ? 160.426 3.659   7.190   1.00 0.00 ? 58  MET B CB   1  
ATOM   2336  C  CG   . MET B 1 58 ? 161.352 4.167   8.300   1.00 0.00 ? 58  MET B CG   1  
ATOM   2337  S  SD   . MET B 1 58 ? 160.957 3.333   9.860   1.00 0.00 ? 58  MET B SD   1  
ATOM   2338  C  CE   . MET B 1 58 ? 161.848 1.795   9.540   1.00 0.00 ? 58  MET B CE   1  
ATOM   2339  H  H    . MET B 1 58 ? 159.853 5.804   5.959   1.00 0.00 ? 58  MET B H    1  
ATOM   2340  H  HA   . MET B 1 58 ? 158.303 3.655   6.928   1.00 0.00 ? 58  MET B HA   1  
ATOM   2341  H  HB2  . MET B 1 58 ? 160.295 2.591   7.294   1.00 0.00 ? 58  MET B HB2  1  
ATOM   2342  H  HB3  . MET B 1 58 ? 160.871 3.871   6.229   1.00 0.00 ? 58  MET B HB3  1  
ATOM   2343  H  HG2  . MET B 1 58 ? 162.379 3.971   8.031   1.00 0.00 ? 58  MET B HG2  1  
ATOM   2344  H  HG3  . MET B 1 58 ? 161.207 5.230   8.417   1.00 0.00 ? 58  MET B HG3  1  
ATOM   2345  H  HE1  . MET B 1 58 ? 161.209 0.956   9.777   1.00 0.00 ? 58  MET B HE1  1  
ATOM   2346  H  HE2  . MET B 1 58 ? 162.734 1.756   10.153  1.00 0.00 ? 58  MET B HE2  1  
ATOM   2347  H  HE3  . MET B 1 58 ? 162.130 1.757   8.501   1.00 0.00 ? 58  MET B HE3  1  
ATOM   2348  N  N    . LYS B 1 59 ? 159.212 5.883   9.144   1.00 0.00 ? 59  LYS B N    1  
ATOM   2349  C  CA   . LYS B 1 59 ? 158.988 6.306   10.510  1.00 0.00 ? 59  LYS B CA   1  
ATOM   2350  C  C    . LYS B 1 59 ? 157.496 6.367   10.805  1.00 0.00 ? 59  LYS B C    1  
ATOM   2351  O  O    . LYS B 1 59 ? 157.049 5.939   11.869  1.00 0.00 ? 59  LYS B O    1  
ATOM   2352  C  CB   . LYS B 1 59 ? 159.629 7.681   10.721  1.00 0.00 ? 59  LYS B CB   1  
ATOM   2353  C  CG   . LYS B 1 59 ? 159.522 8.106   12.187  1.00 0.00 ? 59  LYS B CG   1  
ATOM   2354  C  CD   . LYS B 1 59 ? 160.561 7.365   13.040  1.00 0.00 ? 59  LYS B CD   1  
ATOM   2355  C  CE   . LYS B 1 59 ? 160.527 7.910   14.468  1.00 0.00 ? 59  LYS B CE   1  
ATOM   2356  N  NZ   . LYS B 1 59 ? 161.680 7.362   15.236  1.00 0.00 ? 59  LYS B NZ   1  
ATOM   2357  H  H    . LYS B 1 59 ? 159.753 6.446   8.536   1.00 0.00 ? 59  LYS B H    1  
ATOM   2358  H  HA   . LYS B 1 59 ? 159.449 5.594   11.171  1.00 0.00 ? 59  LYS B HA   1  
ATOM   2359  H  HB2  . LYS B 1 59 ? 160.671 7.634   10.440  1.00 0.00 ? 59  LYS B HB2  1  
ATOM   2360  H  HB3  . LYS B 1 59 ? 159.126 8.408   10.102  1.00 0.00 ? 59  LYS B HB3  1  
ATOM   2361  H  HG2  . LYS B 1 59 ? 159.694 9.168   12.259  1.00 0.00 ? 59  LYS B HG2  1  
ATOM   2362  H  HG3  . LYS B 1 59 ? 158.535 7.878   12.551  1.00 0.00 ? 59  LYS B HG3  1  
ATOM   2363  H  HD2  . LYS B 1 59 ? 160.333 6.310   13.058  1.00 0.00 ? 59  LYS B HD2  1  
ATOM   2364  H  HD3  . LYS B 1 59 ? 161.544 7.515   12.623  1.00 0.00 ? 59  LYS B HD3  1  
ATOM   2365  H  HE2  . LYS B 1 59 ? 160.590 8.988   14.443  1.00 0.00 ? 59  LYS B HE2  1  
ATOM   2366  H  HE3  . LYS B 1 59 ? 159.604 7.615   14.945  1.00 0.00 ? 59  LYS B HE3  1  
ATOM   2367  H  HZ1  . LYS B 1 59 ? 162.543 7.889   14.991  1.00 0.00 ? 59  LYS B HZ1  1  
ATOM   2368  H  HZ2  . LYS B 1 59 ? 161.808 6.357   14.998  1.00 0.00 ? 59  LYS B HZ2  1  
ATOM   2369  H  HZ3  . LYS B 1 59 ? 161.496 7.458   16.255  1.00 0.00 ? 59  LYS B HZ3  1  
ATOM   2370  N  N    . GLU B 1 60 ? 156.723 6.877   9.853   1.00 0.00 ? 60  GLU B N    1  
ATOM   2371  C  CA   . GLU B 1 60 ? 155.281 6.953   10.033  1.00 0.00 ? 60  GLU B CA   1  
ATOM   2372  C  C    . GLU B 1 60 ? 154.672 5.555   10.097  1.00 0.00 ? 60  GLU B C    1  
ATOM   2373  O  O    . GLU B 1 60 ? 153.728 5.310   10.847  1.00 0.00 ? 60  GLU B O    1  
ATOM   2374  C  CB   . GLU B 1 60 ? 154.651 7.733   8.879   1.00 0.00 ? 60  GLU B CB   1  
ATOM   2375  C  CG   . GLU B 1 60 ? 155.139 9.182   8.913   1.00 0.00 ? 60  GLU B CG   1  
ATOM   2376  C  CD   . GLU B 1 60 ? 154.466 9.986   7.806   1.00 0.00 ? 60  GLU B CD   1  
ATOM   2377  O  OE1  . GLU B 1 60 ? 153.807 9.380   6.977   1.00 0.00 ? 60  GLU B OE1  1  
ATOM   2378  O  OE2  . GLU B 1 60 ? 154.619 11.197  7.802   1.00 0.00 ? 60  GLU B OE2  1  
ATOM   2379  H  H    . GLU B 1 60 ? 157.125 7.190   9.015   1.00 0.00 ? 60  GLU B H    1  
ATOM   2380  H  HA   . GLU B 1 60 ? 155.070 7.469   10.958  1.00 0.00 ? 60  GLU B HA   1  
ATOM   2381  H  HB2  . GLU B 1 60 ? 154.934 7.279   7.940   1.00 0.00 ? 60  GLU B HB2  1  
ATOM   2382  H  HB3  . GLU B 1 60 ? 153.575 7.716   8.977   1.00 0.00 ? 60  GLU B HB3  1  
ATOM   2383  H  HG2  . GLU B 1 60 ? 154.898 9.619   9.871   1.00 0.00 ? 60  GLU B HG2  1  
ATOM   2384  H  HG3  . GLU B 1 60 ? 156.209 9.204   8.770   1.00 0.00 ? 60  GLU B HG3  1  
ATOM   2385  N  N    . LEU B 1 61 ? 155.217 4.641   9.292   1.00 0.00 ? 61  LEU B N    1  
ATOM   2386  C  CA   . LEU B 1 61 ? 154.714 3.269   9.256   1.00 0.00 ? 61  LEU B CA   1  
ATOM   2387  C  C    . LEU B 1 61 ? 154.966 2.518   10.550  1.00 0.00 ? 61  LEU B C    1  
ATOM   2388  O  O    . LEU B 1 61 ? 154.136 1.714   10.972  1.00 0.00 ? 61  LEU B O    1  
ATOM   2389  C  CB   . LEU B 1 61 ? 155.373 2.493   8.113   1.00 0.00 ? 61  LEU B CB   1  
ATOM   2390  C  CG   . LEU B 1 61 ? 155.048 3.145   6.772   1.00 0.00 ? 61  LEU B CG   1  
ATOM   2391  C  CD1  . LEU B 1 61 ? 155.682 2.326   5.646   1.00 0.00 ? 61  LEU B CD1  1  
ATOM   2392  C  CD2  . LEU B 1 61 ? 153.527 3.178   6.580   1.00 0.00 ? 61  LEU B CD2  1  
ATOM   2393  H  H    . LEU B 1 61 ? 155.964 4.896   8.710   1.00 0.00 ? 61  LEU B H    1  
ATOM   2394  H  HA   . LEU B 1 61 ? 153.652 3.298   9.081   1.00 0.00 ? 61  LEU B HA   1  
ATOM   2395  H  HB2  . LEU B 1 61 ? 156.444 2.485   8.257   1.00 0.00 ? 61  LEU B HB2  1  
ATOM   2396  H  HB3  . LEU B 1 61 ? 155.005 1.479   8.113   1.00 0.00 ? 61  LEU B HB3  1  
ATOM   2397  H  HG   . LEU B 1 61 ? 155.436 4.149   6.753   1.00 0.00 ? 61  LEU B HG   1  
ATOM   2398  H  HD11 . LEU B 1 61 ? 155.764 2.936   4.758   1.00 0.00 ? 61  LEU B HD11 1  
ATOM   2399  H  HD12 . LEU B 1 61 ? 155.067 1.464   5.436   1.00 0.00 ? 61  LEU B HD12 1  
ATOM   2400  H  HD13 . LEU B 1 61 ? 156.666 2.002   5.951   1.00 0.00 ? 61  LEU B HD13 1  
ATOM   2401  H  HD21 . LEU B 1 61 ? 153.077 2.340   7.093   1.00 0.00 ? 61  LEU B HD21 1  
ATOM   2402  H  HD22 . LEU B 1 61 ? 153.294 3.119   5.530   1.00 0.00 ? 61  LEU B HD22 1  
ATOM   2403  H  HD23 . LEU B 1 61 ? 153.138 4.099   6.987   1.00 0.00 ? 61  LEU B HD23 1  
ATOM   2404  N  N    . ASP B 1 62 ? 156.117 2.743   11.170  1.00 0.00 ? 62  ASP B N    1  
ATOM   2405  C  CA   . ASP B 1 62 ? 156.416 2.018   12.393  1.00 0.00 ? 62  ASP B CA   1  
ATOM   2406  C  C    . ASP B 1 62 ? 155.689 2.599   13.596  1.00 0.00 ? 62  ASP B C    1  
ATOM   2407  O  O    . ASP B 1 62 ? 156.256 3.389   14.349  1.00 0.00 ? 62  ASP B O    1  
ATOM   2408  C  CB   . ASP B 1 62 ? 157.913 2.046   12.673  1.00 0.00 ? 62  ASP B CB   1  
ATOM   2409  C  CG   . ASP B 1 62 ? 158.219 1.141   13.859  1.00 0.00 ? 62  ASP B CG   1  
ATOM   2410  O  OD1  . ASP B 1 62 ? 157.460 0.206   14.078  1.00 0.00 ? 62  ASP B OD1  1  
ATOM   2411  O  OD2  . ASP B 1 62 ? 159.208 1.389   14.525  1.00 0.00 ? 62  ASP B OD2  1  
ATOM   2412  H  H    . ASP B 1 62 ? 156.772 3.374   10.791  1.00 0.00 ? 62  ASP B H    1  
ATOM   2413  H  HA   . ASP B 1 62 ? 156.112 0.990   12.268  1.00 0.00 ? 62  ASP B HA   1  
ATOM   2414  H  HB2  . ASP B 1 62 ? 158.450 1.694   11.803  1.00 0.00 ? 62  ASP B HB2  1  
ATOM   2415  H  HB3  . ASP B 1 62 ? 158.220 3.055   12.904  1.00 0.00 ? 62  ASP B HB3  1  
ATOM   2416  N  N    . GLU B 1 63 ? 154.459 2.159   13.812  1.00 0.00 ? 63  GLU B N    1  
ATOM   2417  C  CA   . GLU B 1 63 ? 153.714 2.603   14.978  1.00 0.00 ? 63  GLU B CA   1  
ATOM   2418  C  C    . GLU B 1 63 ? 154.380 2.067   16.232  1.00 0.00 ? 63  GLU B C    1  
ATOM   2419  O  O    . GLU B 1 63 ? 154.440 2.728   17.269  1.00 0.00 ? 63  GLU B O    1  
ATOM   2420  C  CB   . GLU B 1 63 ? 152.283 2.069   14.918  1.00 0.00 ? 63  GLU B CB   1  
ATOM   2421  C  CG   . GLU B 1 63 ? 151.494 2.573   16.128  1.00 0.00 ? 63  GLU B CG   1  
ATOM   2422  C  CD   . GLU B 1 63 ? 151.243 4.072   16.005  1.00 0.00 ? 63  GLU B CD   1  
ATOM   2423  O  OE1  . GLU B 1 63 ? 151.246 4.563   14.888  1.00 0.00 ? 63  GLU B OE1  1  
ATOM   2424  O  OE2  . GLU B 1 63 ? 151.052 4.707   17.028  1.00 0.00 ? 63  GLU B OE2  1  
ATOM   2425  H  H    . GLU B 1 63 ? 154.066 1.493   13.209  1.00 0.00 ? 63  GLU B H    1  
ATOM   2426  H  HA   . GLU B 1 63 ? 153.695 3.682   15.008  1.00 0.00 ? 63  GLU B HA   1  
ATOM   2427  H  HB2  . GLU B 1 63 ? 151.810 2.413   14.010  1.00 0.00 ? 63  GLU B HB2  1  
ATOM   2428  H  HB3  . GLU B 1 63 ? 152.302 0.990   14.928  1.00 0.00 ? 63  GLU B HB3  1  
ATOM   2429  H  HG2  . GLU B 1 63 ? 150.554 2.049   16.180  1.00 0.00 ? 63  GLU B HG2  1  
ATOM   2430  H  HG3  . GLU B 1 63 ? 152.053 2.377   17.031  1.00 0.00 ? 63  GLU B HG3  1  
ATOM   2431  N  N    . ASN B 1 64 ? 154.842 0.833   16.112  1.00 0.00 ? 64  ASN B N    1  
ATOM   2432  C  CA   . ASN B 1 64 ? 155.473 0.130   17.212  1.00 0.00 ? 64  ASN B CA   1  
ATOM   2433  C  C    . ASN B 1 64 ? 156.702 0.866   17.734  1.00 0.00 ? 64  ASN B C    1  
ATOM   2434  O  O    . ASN B 1 64 ? 156.998 0.838   18.928  1.00 0.00 ? 64  ASN B O    1  
ATOM   2435  C  CB   . ASN B 1 64 ? 155.920 -1.242  16.717  1.00 0.00 ? 64  ASN B CB   1  
ATOM   2436  C  CG   . ASN B 1 64 ? 154.747 -2.000  16.112  1.00 0.00 ? 64  ASN B CG   1  
ATOM   2437  O  OD1  . ASN B 1 64 ? 154.852 -2.496  14.987  1.00 0.00 ? 64  ASN B OD1  1  
ATOM   2438  N  ND2  . ASN B 1 64 ? 153.636 -2.120  16.785  1.00 0.00 ? 64  ASN B ND2  1  
ATOM   2439  H  H    . ASN B 1 64 ? 154.728 0.368   15.258  1.00 0.00 ? 64  ASN B H    1  
ATOM   2440  H  HA   . ASN B 1 64 ? 154.757 0.001   18.009  1.00 0.00 ? 64  ASN B HA   1  
ATOM   2441  H  HB2  . ASN B 1 64 ? 156.686 -1.115  15.969  1.00 0.00 ? 64  ASN B HB2  1  
ATOM   2442  H  HB3  . ASN B 1 64 ? 156.319 -1.806  17.546  1.00 0.00 ? 64  ASN B HB3  1  
ATOM   2443  H  HD21 . ASN B 1 64 ? 153.559 -1.724  17.678  1.00 0.00 ? 64  ASN B HD21 1  
ATOM   2444  H  HD22 . ASN B 1 64 ? 152.879 -2.607  16.398  1.00 0.00 ? 64  ASN B HD22 1  
ATOM   2445  N  N    . GLY B 1 65 ? 157.445 1.474   16.818  1.00 0.00 ? 65  GLY B N    1  
ATOM   2446  C  CA   . GLY B 1 65 ? 158.677 2.162   17.178  1.00 0.00 ? 65  GLY B CA   1  
ATOM   2447  C  C    . GLY B 1 65 ? 159.827 1.166   17.072  1.00 0.00 ? 65  GLY B C    1  
ATOM   2448  O  O    . GLY B 1 65 ? 160.975 1.466   17.399  1.00 0.00 ? 65  GLY B O    1  
ATOM   2449  H  H    . GLY B 1 65 ? 157.179 1.427   15.875  1.00 0.00 ? 65  GLY B H    1  
ATOM   2450  H  HA2  . GLY B 1 65 ? 158.843 2.990   16.501  1.00 0.00 ? 65  GLY B HA2  1  
ATOM   2451  H  HA3  . GLY B 1 65 ? 158.610 2.526   18.191  1.00 0.00 ? 65  GLY B HA3  1  
ATOM   2452  N  N    . ASP B 1 66 ? 159.475 -0.031  16.608  1.00 0.00 ? 66  ASP B N    1  
ATOM   2453  C  CA   . ASP B 1 66 ? 160.421 -1.130  16.436  1.00 0.00 ? 66  ASP B CA   1  
ATOM   2454  C  C    . ASP B 1 66 ? 161.519 -0.803  15.423  1.00 0.00 ? 66  ASP B C    1  
ATOM   2455  O  O    . ASP B 1 66 ? 162.652 -1.267  15.553  1.00 0.00 ? 66  ASP B O    1  
ATOM   2456  C  CB   . ASP B 1 66 ? 159.648 -2.389  16.013  1.00 0.00 ? 66  ASP B CB   1  
ATOM   2457  C  CG   . ASP B 1 66 ? 158.958 -2.178  14.663  1.00 0.00 ? 66  ASP B CG   1  
ATOM   2458  O  OD1  . ASP B 1 66 ? 159.275 -1.214  13.994  1.00 0.00 ? 66  ASP B OD1  1  
ATOM   2459  O  OD2  . ASP B 1 66 ? 158.101 -2.981  14.324  1.00 0.00 ? 66  ASP B OD2  1  
ATOM   2460  H  H    . ASP B 1 66 ? 158.534 -0.184  16.376  1.00 0.00 ? 66  ASP B H    1  
ATOM   2461  H  HA   . ASP B 1 66 ? 160.887 -1.327  17.389  1.00 0.00 ? 66  ASP B HA   1  
ATOM   2462  H  HB2  . ASP B 1 66 ? 160.336 -3.217  15.935  1.00 0.00 ? 66  ASP B HB2  1  
ATOM   2463  H  HB3  . ASP B 1 66 ? 158.903 -2.616  16.762  1.00 0.00 ? 66  ASP B HB3  1  
ATOM   2464  N  N    . GLY B 1 67 ? 161.176 -0.021  14.412  1.00 0.00 ? 67  GLY B N    1  
ATOM   2465  C  CA   . GLY B 1 67 ? 162.128 0.346   13.371  1.00 0.00 ? 67  GLY B CA   1  
ATOM   2466  C  C    . GLY B 1 67 ? 161.935 -0.538  12.146  1.00 0.00 ? 67  GLY B C    1  
ATOM   2467  O  O    . GLY B 1 67 ? 162.553 -0.324  11.104  1.00 0.00 ? 67  GLY B O    1  
ATOM   2468  H  H    . GLY B 1 67 ? 160.258 0.304   14.353  1.00 0.00 ? 67  GLY B H    1  
ATOM   2469  H  HA2  . GLY B 1 67 ? 161.974 1.381   13.095  1.00 0.00 ? 67  GLY B HA2  1  
ATOM   2470  H  HA3  . GLY B 1 67 ? 163.133 0.221   13.742  1.00 0.00 ? 67  GLY B HA3  1  
ATOM   2471  N  N    . GLU B 1 68 ? 161.046 -1.522  12.275  1.00 0.00 ? 68  GLU B N    1  
ATOM   2472  C  CA   . GLU B 1 68 ? 160.736 -2.426  11.171  1.00 0.00 ? 68  GLU B CA   1  
ATOM   2473  C  C    . GLU B 1 68 ? 159.260 -2.242  10.814  1.00 0.00 ? 68  GLU B C    1  
ATOM   2474  O  O    . GLU B 1 68 ? 158.437 -1.939  11.690  1.00 0.00 ? 68  GLU B O    1  
ATOM   2475  C  CB   . GLU B 1 68 ? 161.069 -3.871  11.561  1.00 0.00 ? 68  GLU B CB   1  
ATOM   2476  C  CG   . GLU B 1 68 ? 160.977 -4.783  10.332  1.00 0.00 ? 68  GLU B CG   1  
ATOM   2477  C  CD   . GLU B 1 68 ? 161.301 -6.215  10.730  1.00 0.00 ? 68  GLU B CD   1  
ATOM   2478  O  OE1  . GLU B 1 68 ? 161.459 -6.459  11.916  1.00 0.00 ? 68  GLU B OE1  1  
ATOM   2479  O  OE2  . GLU B 1 68 ? 161.385 -7.047  9.845   1.00 0.00 ? 68  GLU B OE2  1  
ATOM   2480  H  H    . GLU B 1 68 ? 160.573 -1.629  13.125  1.00 0.00 ? 68  GLU B H    1  
ATOM   2481  H  HA   . GLU B 1 68 ? 161.333 -2.150  10.312  1.00 0.00 ? 68  GLU B HA   1  
ATOM   2482  H  HB2  . GLU B 1 68 ? 162.071 -3.911  11.963  1.00 0.00 ? 68  GLU B HB2  1  
ATOM   2483  H  HB3  . GLU B 1 68 ? 160.369 -4.210  12.309  1.00 0.00 ? 68  GLU B HB3  1  
ATOM   2484  H  HG2  . GLU B 1 68 ? 159.975 -4.750  9.924   1.00 0.00 ? 68  GLU B HG2  1  
ATOM   2485  H  HG3  . GLU B 1 68 ? 161.682 -4.452  9.584   1.00 0.00 ? 68  GLU B HG3  1  
ATOM   2486  N  N    . VAL B 1 69 ? 158.925 -2.358  9.530   1.00 0.00 ? 69  VAL B N    1  
ATOM   2487  C  CA   . VAL B 1 69 ? 157.548 -2.125  9.100   1.00 0.00 ? 69  VAL B CA   1  
ATOM   2488  C  C    . VAL B 1 69 ? 156.804 -3.413  8.781   1.00 0.00 ? 69  VAL B C    1  
ATOM   2489  O  O    . VAL B 1 69 ? 157.313 -4.296  8.090   1.00 0.00 ? 69  VAL B O    1  
ATOM   2490  C  CB   . VAL B 1 69 ? 157.555 -1.235  7.857   1.00 0.00 ? 69  VAL B CB   1  
ATOM   2491  C  CG1  . VAL B 1 69 ? 156.118 -0.915  7.451   1.00 0.00 ? 69  VAL B CG1  1  
ATOM   2492  C  CG2  . VAL B 1 69 ? 158.300 0.065   8.165   1.00 0.00 ? 69  VAL B CG2  1  
ATOM   2493  H  H    . VAL B 1 69 ? 159.614 -2.557  8.863   1.00 0.00 ? 69  VAL B H    1  
ATOM   2494  H  HA   . VAL B 1 69 ? 157.016 -1.604  9.883   1.00 0.00 ? 69  VAL B HA   1  
ATOM   2495  H  HB   . VAL B 1 69 ? 158.051 -1.753  7.047   1.00 0.00 ? 69  VAL B HB   1  
ATOM   2496  H  HG11 . VAL B 1 69 ? 155.697 -1.755  6.920   1.00 0.00 ? 69  VAL B HG11 1  
ATOM   2497  H  HG12 . VAL B 1 69 ? 156.110 -0.044  6.813   1.00 0.00 ? 69  VAL B HG12 1  
ATOM   2498  H  HG13 . VAL B 1 69 ? 155.535 -0.719  8.336   1.00 0.00 ? 69  VAL B HG13 1  
ATOM   2499  H  HG21 . VAL B 1 69 ? 158.056 0.391   9.166   1.00 0.00 ? 69  VAL B HG21 1  
ATOM   2500  H  HG22 . VAL B 1 69 ? 158.005 0.826   7.457   1.00 0.00 ? 69  VAL B HG22 1  
ATOM   2501  H  HG23 . VAL B 1 69 ? 159.364 -0.103  8.091   1.00 0.00 ? 69  VAL B HG23 1  
ATOM   2502  N  N    . ASP B 1 70 ? 155.576 -3.487  9.287   1.00 0.00 ? 70  ASP B N    1  
ATOM   2503  C  CA   . ASP B 1 70 ? 154.715 -4.639  9.063   1.00 0.00 ? 70  ASP B CA   1  
ATOM   2504  C  C    . ASP B 1 70 ? 153.720 -4.335  7.951   1.00 0.00 ? 70  ASP B C    1  
ATOM   2505  O  O    . ASP B 1 70 ? 153.343 -3.178  7.735   1.00 0.00 ? 70  ASP B O    1  
ATOM   2506  C  CB   . ASP B 1 70 ? 153.948 -4.986  10.341  1.00 0.00 ? 70  ASP B CB   1  
ATOM   2507  C  CG   . ASP B 1 70 ? 154.918 -5.434  11.423  1.00 0.00 ? 70  ASP B CG   1  
ATOM   2508  O  OD1  . ASP B 1 70 ? 156.067 -5.658  11.096  1.00 0.00 ? 70  ASP B OD1  1  
ATOM   2509  O  OD2  . ASP B 1 70 ? 154.499 -5.535  12.564  1.00 0.00 ? 70  ASP B OD2  1  
ATOM   2510  H  H    . ASP B 1 70 ? 155.234 -2.736  9.816   1.00 0.00 ? 70  ASP B H    1  
ATOM   2511  H  HA   . ASP B 1 70 ? 155.322 -5.485  8.776   1.00 0.00 ? 70  ASP B HA   1  
ATOM   2512  H  HB2  . ASP B 1 70 ? 153.409 -4.118  10.681  1.00 0.00 ? 70  ASP B HB2  1  
ATOM   2513  H  HB3  . ASP B 1 70 ? 153.251 -5.783  10.134  1.00 0.00 ? 70  ASP B HB3  1  
ATOM   2514  N  N    . PHE B 1 71 ? 153.281 -5.372  7.256   1.00 0.00 ? 71  PHE B N    1  
ATOM   2515  C  CA   . PHE B 1 71 ? 152.317 -5.181  6.188   1.00 0.00 ? 71  PHE B CA   1  
ATOM   2516  C  C    . PHE B 1 71 ? 151.094 -4.444  6.714   1.00 0.00 ? 71  PHE B C    1  
ATOM   2517  O  O    . PHE B 1 71 ? 150.552 -3.570  6.038   1.00 0.00 ? 71  PHE B O    1  
ATOM   2518  C  CB   . PHE B 1 71 ? 151.915 -6.528  5.591   1.00 0.00 ? 71  PHE B CB   1  
ATOM   2519  C  CG   . PHE B 1 71 ? 150.960 -6.312  4.440   1.00 0.00 ? 71  PHE B CG   1  
ATOM   2520  C  CD1  . PHE B 1 71 ? 151.417 -5.753  3.240   1.00 0.00 ? 71  PHE B CD1  1  
ATOM   2521  C  CD2  . PHE B 1 71 ? 149.623 -6.706  4.563   1.00 0.00 ? 71  PHE B CD2  1  
ATOM   2522  C  CE1  . PHE B 1 71 ? 150.535 -5.584  2.167   1.00 0.00 ? 71  PHE B CE1  1  
ATOM   2523  C  CE2  . PHE B 1 71 ? 148.740 -6.534  3.490   1.00 0.00 ? 71  PHE B CE2  1  
ATOM   2524  C  CZ   . PHE B 1 71 ? 149.196 -5.974  2.292   1.00 0.00 ? 71  PHE B CZ   1  
ATOM   2525  H  H    . PHE B 1 71 ? 153.598 -6.274  7.470   1.00 0.00 ? 71  PHE B H    1  
ATOM   2526  H  HA   . PHE B 1 71 ? 152.779 -4.585  5.412   1.00 0.00 ? 71  PHE B HA   1  
ATOM   2527  H  HB2  . PHE B 1 71 ? 152.796 -7.039  5.238   1.00 0.00 ? 71  PHE B HB2  1  
ATOM   2528  H  HB3  . PHE B 1 71 ? 151.432 -7.126  6.349   1.00 0.00 ? 71  PHE B HB3  1  
ATOM   2529  H  HD1  . PHE B 1 71 ? 152.444 -5.442  3.148   1.00 0.00 ? 71  PHE B HD1  1  
ATOM   2530  H  HD2  . PHE B 1 71 ? 149.271 -7.139  5.488   1.00 0.00 ? 71  PHE B HD2  1  
ATOM   2531  H  HE1  . PHE B 1 71 ? 150.888 -5.154  1.241   1.00 0.00 ? 71  PHE B HE1  1  
ATOM   2532  H  HE2  . PHE B 1 71 ? 147.710 -6.837  3.587   1.00 0.00 ? 71  PHE B HE2  1  
ATOM   2533  H  HZ   . PHE B 1 71 ? 148.516 -5.842  1.464   1.00 0.00 ? 71  PHE B HZ   1  
ATOM   2534  N  N    . GLN B 1 72 ? 150.668 -4.784  7.927   1.00 0.00 ? 72  GLN B N    1  
ATOM   2535  C  CA   . GLN B 1 72 ? 149.515 -4.117  8.512   1.00 0.00 ? 72  GLN B CA   1  
ATOM   2536  C  C    . GLN B 1 72 ? 149.751 -2.607  8.548   1.00 0.00 ? 72  GLN B C    1  
ATOM   2537  O  O    . GLN B 1 72 ? 148.850 -1.821  8.258   1.00 0.00 ? 72  GLN B O    1  
ATOM   2538  C  CB   . GLN B 1 72 ? 149.278 -4.633  9.933   1.00 0.00 ? 72  GLN B CB   1  
ATOM   2539  C  CG   . GLN B 1 72 ? 147.956 -4.076  10.465  1.00 0.00 ? 72  GLN B CG   1  
ATOM   2540  C  CD   . GLN B 1 72 ? 147.694 -4.607  11.870  1.00 0.00 ? 72  GLN B CD   1  
ATOM   2541  O  OE1  . GLN B 1 72 ? 148.421 -5.475  12.352  1.00 0.00 ? 72  GLN B OE1  1  
ATOM   2542  N  NE2  . GLN B 1 72 ? 146.693 -4.134  12.561  1.00 0.00 ? 72  GLN B NE2  1  
ATOM   2543  H  H    . GLN B 1 72 ? 151.139 -5.479  8.433   1.00 0.00 ? 72  GLN B H    1  
ATOM   2544  H  HA   . GLN B 1 72 ? 148.642 -4.328  7.913   1.00 0.00 ? 72  GLN B HA   1  
ATOM   2545  H  HB2  . GLN B 1 72 ? 149.236 -5.712  9.922   1.00 0.00 ? 72  GLN B HB2  1  
ATOM   2546  H  HB3  . GLN B 1 72 ? 150.085 -4.309  10.572  1.00 0.00 ? 72  GLN B HB3  1  
ATOM   2547  H  HG2  . GLN B 1 72 ? 148.007 -2.996  10.493  1.00 0.00 ? 72  GLN B HG2  1  
ATOM   2548  H  HG3  . GLN B 1 72 ? 147.151 -4.378  9.813   1.00 0.00 ? 72  GLN B HG3  1  
ATOM   2549  H  HE21 . GLN B 1 72 ? 146.115 -3.442  12.175  1.00 0.00 ? 72  GLN B HE21 1  
ATOM   2550  H  HE22 . GLN B 1 72 ? 146.518 -4.471  13.464  1.00 0.00 ? 72  GLN B HE22 1  
ATOM   2551  N  N    . GLU B 1 73 ? 150.974 -2.206  8.888   1.00 0.00 ? 73  GLU B N    1  
ATOM   2552  C  CA   . GLU B 1 73 ? 151.310 -0.787  8.922   1.00 0.00 ? 73  GLU B CA   1  
ATOM   2553  C  C    . GLU B 1 73 ? 151.296 -0.205  7.505   1.00 0.00 ? 73  GLU B C    1  
ATOM   2554  O  O    . GLU B 1 73 ? 150.855 0.923   7.278   1.00 0.00 ? 73  GLU B O    1  
ATOM   2555  C  CB   . GLU B 1 73 ? 152.718 -0.611  9.504   1.00 0.00 ? 73  GLU B CB   1  
ATOM   2556  C  CG   . GLU B 1 73 ? 152.762 -1.056  10.972  1.00 0.00 ? 73  GLU B CG   1  
ATOM   2557  C  CD   . GLU B 1 73 ? 154.173 -0.849  11.530  1.00 0.00 ? 73  GLU B CD   1  
ATOM   2558  O  OE1  . GLU B 1 73 ? 155.047 -0.503  10.752  1.00 0.00 ? 73  GLU B OE1  1  
ATOM   2559  O  OE2  . GLU B 1 73 ? 154.364 -1.040  12.723  1.00 0.00 ? 73  GLU B OE2  1  
ATOM   2560  H  H    . GLU B 1 73 ? 151.662 -2.872  9.097   1.00 0.00 ? 73  GLU B H    1  
ATOM   2561  H  HA   . GLU B 1 73 ? 150.600 -0.258  9.538   1.00 0.00 ? 73  GLU B HA   1  
ATOM   2562  H  HB2  . GLU B 1 73 ? 153.411 -1.209  8.934   1.00 0.00 ? 73  GLU B HB2  1  
ATOM   2563  H  HB3  . GLU B 1 73 ? 153.005 0.428   9.439   1.00 0.00 ? 73  GLU B HB3  1  
ATOM   2564  H  HG2  . GLU B 1 73 ? 152.058 -0.468  11.544  1.00 0.00 ? 73  GLU B HG2  1  
ATOM   2565  H  HG3  . GLU B 1 73 ? 152.496 -2.097  11.041  1.00 0.00 ? 73  GLU B HG3  1  
ATOM   2566  N  N    . TYR B 1 74 ? 151.818 -0.996  6.567   1.00 0.00 ? 74  TYR B N    1  
ATOM   2567  C  CA   . TYR B 1 74 ? 151.917 -0.597  5.157   1.00 0.00 ? 74  TYR B CA   1  
ATOM   2568  C  C    . TYR B 1 74 ? 150.567 -0.368  4.464   1.00 0.00 ? 74  TYR B C    1  
ATOM   2569  O  O    . TYR B 1 74 ? 150.407 0.585   3.681   1.00 0.00 ? 74  TYR B O    1  
ATOM   2570  C  CB   . TYR B 1 74 ? 152.707 -1.672  4.408   1.00 0.00 ? 74  TYR B CB   1  
ATOM   2571  C  CG   . TYR B 1 74 ? 152.872 -1.279  2.965   1.00 0.00 ? 74  TYR B CG   1  
ATOM   2572  C  CD1  . TYR B 1 74 ? 153.852 -0.353  2.597   1.00 0.00 ? 74  TYR B CD1  1  
ATOM   2573  C  CD2  . TYR B 1 74 ? 152.055 -1.859  1.993   1.00 0.00 ? 74  TYR B CD2  1  
ATOM   2574  C  CE1  . TYR B 1 74 ? 154.009 -0.002  1.252   1.00 0.00 ? 74  TYR B CE1  1  
ATOM   2575  C  CE2  . TYR B 1 74 ? 152.210 -1.509  0.646   1.00 0.00 ? 74  TYR B CE2  1  
ATOM   2576  C  CZ   . TYR B 1 74 ? 153.187 -0.578  0.276   1.00 0.00 ? 74  TYR B CZ   1  
ATOM   2577  O  OH   . TYR B 1 74 ? 153.342 -0.230  -1.051  1.00 0.00 ? 74  TYR B OH   1  
ATOM   2578  H  H    . TYR B 1 74 ? 152.170 -1.877  6.836   1.00 0.00 ? 74  TYR B H    1  
ATOM   2579  H  HA   . TYR B 1 74 ? 152.481 0.321   5.107   1.00 0.00 ? 74  TYR B HA   1  
ATOM   2580  H  HB2  . TYR B 1 74 ? 153.681 -1.784  4.863   1.00 0.00 ? 74  TYR B HB2  1  
ATOM   2581  H  HB3  . TYR B 1 74 ? 152.176 -2.609  4.464   1.00 0.00 ? 74  TYR B HB3  1  
ATOM   2582  H  HD1  . TYR B 1 74 ? 154.480 0.093   3.351   1.00 0.00 ? 74  TYR B HD1  1  
ATOM   2583  H  HD2  . TYR B 1 74 ? 151.308 -2.581  2.282   1.00 0.00 ? 74  TYR B HD2  1  
ATOM   2584  H  HE1  . TYR B 1 74 ? 154.764 0.712   0.967   1.00 0.00 ? 74  TYR B HE1  1  
ATOM   2585  H  HE2  . TYR B 1 74 ? 151.575 -1.954  -0.105  1.00 0.00 ? 74  TYR B HE2  1  
ATOM   2586  H  HH   . TYR B 1 74 ? 153.481 -1.037  -1.554  1.00 0.00 ? 74  TYR B HH   1  
ATOM   2587  N  N    . VAL B 1 75 ? 149.607 -1.250  4.719   1.00 0.00 ? 75  VAL B N    1  
ATOM   2588  C  CA   . VAL B 1 75 ? 148.306 -1.136  4.067   1.00 0.00 ? 75  VAL B CA   1  
ATOM   2589  C  C    . VAL B 1 75 ? 147.580 0.139   4.463   1.00 0.00 ? 75  VAL B C    1  
ATOM   2590  O  O    . VAL B 1 75 ? 146.892 0.739   3.644   1.00 0.00 ? 75  VAL B O    1  
ATOM   2591  C  CB   . VAL B 1 75 ? 147.441 -2.355  4.395   1.00 0.00 ? 75  VAL B CB   1  
ATOM   2592  C  CG1  . VAL B 1 75 ? 148.102 -3.615  3.832   1.00 0.00 ? 75  VAL B CG1  1  
ATOM   2593  C  CG2  . VAL B 1 75 ? 147.321 -2.495  5.910   1.00 0.00 ? 75  VAL B CG2  1  
ATOM   2594  H  H    . VAL B 1 75 ? 149.784 -2.001  5.323   1.00 0.00 ? 75  VAL B H    1  
ATOM   2595  H  HA   . VAL B 1 75 ? 148.465 -1.116  2.999   1.00 0.00 ? 75  VAL B HA   1  
ATOM   2596  H  HB   . VAL B 1 75 ? 146.461 -2.233  3.960   1.00 0.00 ? 75  VAL B HB   1  
ATOM   2597  H  HG11 . VAL B 1 75 ? 148.887 -3.939  4.500   1.00 0.00 ? 75  VAL B HG11 1  
ATOM   2598  H  HG12 . VAL B 1 75 ? 148.523 -3.398  2.862   1.00 0.00 ? 75  VAL B HG12 1  
ATOM   2599  H  HG13 . VAL B 1 75 ? 147.363 -4.397  3.738   1.00 0.00 ? 75  VAL B HG13 1  
ATOM   2600  H  HG21 . VAL B 1 75 ? 147.014 -1.555  6.339   1.00 0.00 ? 75  VAL B HG21 1  
ATOM   2601  H  HG22 . VAL B 1 75 ? 148.277 -2.780  6.313   1.00 0.00 ? 75  VAL B HG22 1  
ATOM   2602  H  HG23 . VAL B 1 75 ? 146.592 -3.253  6.147   1.00 0.00 ? 75  VAL B HG23 1  
ATOM   2603  N  N    . VAL B 1 76 ? 147.714 0.563   5.705   1.00 0.00 ? 76  VAL B N    1  
ATOM   2604  C  CA   . VAL B 1 76 ? 147.037 1.779   6.113   1.00 0.00 ? 76  VAL B CA   1  
ATOM   2605  C  C    . VAL B 1 76 ? 147.571 2.979   5.331   1.00 0.00 ? 76  VAL B C    1  
ATOM   2606  O  O    . VAL B 1 76 ? 146.799 3.813   4.854   1.00 0.00 ? 76  VAL B O    1  
ATOM   2607  C  CB   . VAL B 1 76 ? 147.243 2.012   7.611   1.00 0.00 ? 76  VAL B CB   1  
ATOM   2608  C  CG1  . VAL B 1 76 ? 146.690 3.385   7.997   1.00 0.00 ? 76  VAL B CG1  1  
ATOM   2609  C  CG2  . VAL B 1 76 ? 146.508 0.927   8.401   1.00 0.00 ? 76  VAL B CG2  1  
ATOM   2610  H  H    . VAL B 1 76 ? 148.262 0.063   6.345   1.00 0.00 ? 76  VAL B H    1  
ATOM   2611  H  HA   . VAL B 1 76 ? 145.980 1.674   5.919   1.00 0.00 ? 76  VAL B HA   1  
ATOM   2612  H  HB   . VAL B 1 76 ? 148.298 1.973   7.838   1.00 0.00 ? 76  VAL B HB   1  
ATOM   2613  H  HG11 . VAL B 1 76 ? 147.438 4.140   7.809   1.00 0.00 ? 76  VAL B HG11 1  
ATOM   2614  H  HG12 . VAL B 1 76 ? 146.431 3.388   9.045   1.00 0.00 ? 76  VAL B HG12 1  
ATOM   2615  H  HG13 . VAL B 1 76 ? 145.810 3.597   7.408   1.00 0.00 ? 76  VAL B HG13 1  
ATOM   2616  H  HG21 . VAL B 1 76 ? 146.553 1.156   9.455   1.00 0.00 ? 76  VAL B HG21 1  
ATOM   2617  H  HG22 . VAL B 1 76 ? 146.975 -0.030  8.219   1.00 0.00 ? 76  VAL B HG22 1  
ATOM   2618  H  HG23 . VAL B 1 76 ? 145.476 0.888   8.084   1.00 0.00 ? 76  VAL B HG23 1  
ATOM   2619  N  N    . LEU B 1 77 ? 148.896 3.066   5.212   1.00 0.00 ? 77  LEU B N    1  
ATOM   2620  C  CA   . LEU B 1 77 ? 149.520 4.179   4.497   1.00 0.00 ? 77  LEU B CA   1  
ATOM   2621  C  C    . LEU B 1 77 ? 149.246 4.161   2.991   1.00 0.00 ? 77  LEU B C    1  
ATOM   2622  O  O    . LEU B 1 77 ? 149.041 5.215   2.393   1.00 0.00 ? 77  LEU B O    1  
ATOM   2623  C  CB   . LEU B 1 77 ? 151.033 4.166   4.723   1.00 0.00 ? 77  LEU B CB   1  
ATOM   2624  C  CG   . LEU B 1 77 ? 151.664 5.428   4.111   1.00 0.00 ? 77  LEU B CG   1  
ATOM   2625  C  CD1  . LEU B 1 77 ? 151.287 6.656   4.946   1.00 0.00 ? 77  LEU B CD1  1  
ATOM   2626  C  CD2  . LEU B 1 77 ? 153.189 5.285   4.088   1.00 0.00 ? 77  LEU B CD2  1  
ATOM   2627  H  H    . LEU B 1 77 ? 149.462 2.378   5.620   1.00 0.00 ? 77  LEU B H    1  
ATOM   2628  H  HA   . LEU B 1 77 ? 149.130 5.099   4.900   1.00 0.00 ? 77  LEU B HA   1  
ATOM   2629  H  HB2  . LEU B 1 77 ? 151.234 4.133   5.782   1.00 0.00 ? 77  LEU B HB2  1  
ATOM   2630  H  HB3  . LEU B 1 77 ? 151.453 3.292   4.249   1.00 0.00 ? 77  LEU B HB3  1  
ATOM   2631  H  HG   . LEU B 1 77 ? 151.305 5.561   3.103   1.00 0.00 ? 77  LEU B HG   1  
ATOM   2632  H  HD11 . LEU B 1 77 ? 151.247 6.387   5.991   1.00 0.00 ? 77  LEU B HD11 1  
ATOM   2633  H  HD12 . LEU B 1 77 ? 150.322 7.023   4.631   1.00 0.00 ? 77  LEU B HD12 1  
ATOM   2634  H  HD13 . LEU B 1 77 ? 152.028 7.429   4.803   1.00 0.00 ? 77  LEU B HD13 1  
ATOM   2635  H  HD21 . LEU B 1 77 ? 153.616 6.094   3.512   1.00 0.00 ? 77  LEU B HD21 1  
ATOM   2636  H  HD22 . LEU B 1 77 ? 153.456 4.344   3.633   1.00 0.00 ? 77  LEU B HD22 1  
ATOM   2637  H  HD23 . LEU B 1 77 ? 153.570 5.324   5.097   1.00 0.00 ? 77  LEU B HD23 1  
ATOM   2638  N  N    . VAL B 1 78 ? 149.286 2.981   2.363   1.00 0.00 ? 78  VAL B N    1  
ATOM   2639  C  CA   . VAL B 1 78 ? 149.086 2.929   0.909   1.00 0.00 ? 78  VAL B CA   1  
ATOM   2640  C  C    . VAL B 1 78 ? 147.746 3.542   0.507   1.00 0.00 ? 78  VAL B C    1  
ATOM   2641  O  O    . VAL B 1 78 ? 147.636 4.188   -0.545  1.00 0.00 ? 78  VAL B O    1  
ATOM   2642  C  CB   . VAL B 1 78 ? 149.180 1.486   0.393   1.00 0.00 ? 78  VAL B CB   1  
ATOM   2643  C  CG1  . VAL B 1 78 ? 147.870 0.739   0.656   1.00 0.00 ? 78  VAL B CG1  1  
ATOM   2644  C  CG2  . VAL B 1 78 ? 149.466 1.505   -1.111  1.00 0.00 ? 78  VAL B CG2  1  
ATOM   2645  H  H    . VAL B 1 78 ? 149.492 2.153   2.869   1.00 0.00 ? 78  VAL B H    1  
ATOM   2646  H  HA   . VAL B 1 78 ? 149.873 3.505   0.441   1.00 0.00 ? 78  VAL B HA   1  
ATOM   2647  H  HB   . VAL B 1 78 ? 149.987 0.978   0.903   1.00 0.00 ? 78  VAL B HB   1  
ATOM   2648  H  HG11 . VAL B 1 78 ? 147.211 0.849   -0.192  1.00 0.00 ? 78  VAL B HG11 1  
ATOM   2649  H  HG12 . VAL B 1 78 ? 147.396 1.143   1.530   1.00 0.00 ? 78  VAL B HG12 1  
ATOM   2650  H  HG13 . VAL B 1 78 ? 148.079 -0.309  0.813   1.00 0.00 ? 78  VAL B HG13 1  
ATOM   2651  H  HG21 . VAL B 1 78 ? 148.888 2.290   -1.577  1.00 0.00 ? 78  VAL B HG21 1  
ATOM   2652  H  HG22 . VAL B 1 78 ? 149.194 0.554   -1.542  1.00 0.00 ? 78  VAL B HG22 1  
ATOM   2653  H  HG23 . VAL B 1 78 ? 150.518 1.687   -1.275  1.00 0.00 ? 78  VAL B HG23 1  
ATOM   2654  N  N    . ALA B 1 79 ? 146.732 3.351   1.345   1.00 0.00 ? 79  ALA B N    1  
ATOM   2655  C  CA   . ALA B 1 79 ? 145.420 3.898   1.050   1.00 0.00 ? 79  ALA B CA   1  
ATOM   2656  C  C    . ALA B 1 79 ? 145.503 5.415   0.947   1.00 0.00 ? 79  ALA B C    1  
ATOM   2657  O  O    . ALA B 1 79 ? 144.864 6.028   0.093   1.00 0.00 ? 79  ALA B O    1  
ATOM   2658  C  CB   . ALA B 1 79 ? 144.435 3.507   2.155   1.00 0.00 ? 79  ALA B CB   1  
ATOM   2659  H  H    . ALA B 1 79 ? 146.872 2.838   2.169   1.00 0.00 ? 79  ALA B H    1  
ATOM   2660  H  HA   . ALA B 1 79 ? 145.071 3.495   0.112   1.00 0.00 ? 79  ALA B HA   1  
ATOM   2661  H  HB1  . ALA B 1 79 ? 143.977 2.560   1.909   1.00 0.00 ? 79  ALA B HB1  1  
ATOM   2662  H  HB2  . ALA B 1 79 ? 143.670 4.264   2.244   1.00 0.00 ? 79  ALA B HB2  1  
ATOM   2663  H  HB3  . ALA B 1 79 ? 144.963 3.419   3.092   1.00 0.00 ? 79  ALA B HB3  1  
ATOM   2664  N  N    . ALA B 1 80 ? 146.304 6.016   1.814   1.00 0.00 ? 80  ALA B N    1  
ATOM   2665  C  CA   . ALA B 1 80 ? 146.473 7.459   1.784   1.00 0.00 ? 80  ALA B CA   1  
ATOM   2666  C  C    . ALA B 1 80 ? 147.245 7.892   0.536   1.00 0.00 ? 80  ALA B C    1  
ATOM   2667  O  O    . ALA B 1 80 ? 146.920 8.901   -0.088  1.00 0.00 ? 80  ALA B O    1  
ATOM   2668  C  CB   . ALA B 1 80 ? 147.219 7.922   3.036   1.00 0.00 ? 80  ALA B CB   1  
ATOM   2669  H  H    . ALA B 1 80 ? 146.800 5.483   2.470   1.00 0.00 ? 80  ALA B H    1  
ATOM   2670  H  HA   . ALA B 1 80 ? 145.496 7.922   1.771   1.00 0.00 ? 80  ALA B HA   1  
ATOM   2671  H  HB1  . ALA B 1 80 ? 146.564 7.849   3.892   1.00 0.00 ? 80  ALA B HB1  1  
ATOM   2672  H  HB2  . ALA B 1 80 ? 147.533 8.948   2.909   1.00 0.00 ? 80  ALA B HB2  1  
ATOM   2673  H  HB3  . ALA B 1 80 ? 148.086 7.297   3.191   1.00 0.00 ? 80  ALA B HB3  1  
ATOM   2674  N  N    . LEU B 1 81 ? 148.289 7.127   0.194   1.00 0.00 ? 81  LEU B N    1  
ATOM   2675  C  CA   . LEU B 1 81 ? 149.124 7.452   -0.964  1.00 0.00 ? 81  LEU B CA   1  
ATOM   2676  C  C    . LEU B 1 81 ? 148.356 7.397   -2.282  1.00 0.00 ? 81  LEU B C    1  
ATOM   2677  O  O    . LEU B 1 81 ? 148.576 8.234   -3.161  1.00 0.00 ? 81  LEU B O    1  
ATOM   2678  C  CB   . LEU B 1 81 ? 150.315 6.491   -1.044  1.00 0.00 ? 81  LEU B CB   1  
ATOM   2679  C  CG   . LEU B 1 81 ? 151.155 6.583   0.235   1.00 0.00 ? 81  LEU B CG   1  
ATOM   2680  C  CD1  . LEU B 1 81 ? 152.381 5.678   0.099   1.00 0.00 ? 81  LEU B CD1  1  
ATOM   2681  C  CD2  . LEU B 1 81 ? 151.617 8.029   0.451   1.00 0.00 ? 81  LEU B CD2  1  
ATOM   2682  H  H    . LEU B 1 81 ? 148.510 6.344   0.741   1.00 0.00 ? 81  LEU B H    1  
ATOM   2683  H  HA   . LEU B 1 81 ? 149.503 8.454   -0.840  1.00 0.00 ? 81  LEU B HA   1  
ATOM   2684  H  HB2  . LEU B 1 81 ? 149.952 5.481   -1.161  1.00 0.00 ? 81  LEU B HB2  1  
ATOM   2685  H  HB3  . LEU B 1 81 ? 150.928 6.753   -1.893  1.00 0.00 ? 81  LEU B HB3  1  
ATOM   2686  H  HG   . LEU B 1 81 ? 150.563 6.264   1.075   1.00 0.00 ? 81  LEU B HG   1  
ATOM   2687  H  HD11 . LEU B 1 81 ? 152.746 5.418   1.082   1.00 0.00 ? 81  LEU B HD11 1  
ATOM   2688  H  HD12 . LEU B 1 81 ? 153.154 6.198   -0.446  1.00 0.00 ? 81  LEU B HD12 1  
ATOM   2689  H  HD13 . LEU B 1 81 ? 152.108 4.779   -0.433  1.00 0.00 ? 81  LEU B HD13 1  
ATOM   2690  H  HD21 . LEU B 1 81 ? 151.784 8.502   -0.506  1.00 0.00 ? 81  LEU B HD21 1  
ATOM   2691  H  HD22 . LEU B 1 81 ? 152.536 8.034   1.018   1.00 0.00 ? 81  LEU B HD22 1  
ATOM   2692  H  HD23 . LEU B 1 81 ? 150.858 8.572   0.993   1.00 0.00 ? 81  LEU B HD23 1  
ATOM   2693  N  N    . THR B 1 82 ? 147.460 6.423   -2.439  1.00 0.00 ? 82  THR B N    1  
ATOM   2694  C  CA   . THR B 1 82 ? 146.720 6.344   -3.696  1.00 0.00 ? 82  THR B CA   1  
ATOM   2695  C  C    . THR B 1 82 ? 145.942 7.633   -3.918  1.00 0.00 ? 82  THR B C    1  
ATOM   2696  O  O    . THR B 1 82 ? 145.922 8.177   -5.022  1.00 0.00 ? 82  THR B O    1  
ATOM   2697  C  CB   . THR B 1 82 ? 145.766 5.147   -3.708  1.00 0.00 ? 82  THR B CB   1  
ATOM   2698  O  OG1  . THR B 1 82 ? 144.837 5.296   -4.774  1.00 0.00 ? 82  THR B OG1  1  
ATOM   2699  C  CG2  . THR B 1 82 ? 145.015 5.070   -2.386  1.00 0.00 ? 82  THR B CG2  1  
ATOM   2700  H  H    . THR B 1 82 ? 147.308 5.758   -1.721  1.00 0.00 ? 82  THR B H    1  
ATOM   2701  H  HA   . THR B 1 82 ? 147.429 6.229   -4.503  1.00 0.00 ? 82  THR B HA   1  
ATOM   2702  H  HB   . THR B 1 82 ? 146.331 4.240   -3.848  1.00 0.00 ? 82  THR B HB   1  
ATOM   2703  H  HG1  . THR B 1 82 ? 144.034 4.827   -4.534  1.00 0.00 ? 82  THR B HG1  1  
ATOM   2704  H  HG21 . THR B 1 82 ? 144.554 6.023   -2.177  1.00 0.00 ? 82  THR B HG21 1  
ATOM   2705  H  HG22 . THR B 1 82 ? 145.709 4.821   -1.602  1.00 0.00 ? 82  THR B HG22 1  
ATOM   2706  H  HG23 . THR B 1 82 ? 144.253 4.307   -2.450  1.00 0.00 ? 82  THR B HG23 1  
ATOM   2707  N  N    . VAL B 1 83 ? 145.316 8.127   -2.856  1.00 0.00 ? 83  VAL B N    1  
ATOM   2708  C  CA   . VAL B 1 83 ? 144.558 9.364   -2.943  1.00 0.00 ? 83  VAL B CA   1  
ATOM   2709  C  C    . VAL B 1 83 ? 145.493 10.521  -3.271  1.00 0.00 ? 83  VAL B C    1  
ATOM   2710  O  O    . VAL B 1 83 ? 145.164 11.396  -4.073  1.00 0.00 ? 83  VAL B O    1  
ATOM   2711  C  CB   . VAL B 1 83 ? 143.849 9.627   -1.616  1.00 0.00 ? 83  VAL B CB   1  
ATOM   2712  C  CG1  . VAL B 1 83 ? 143.113 10.968  -1.679  1.00 0.00 ? 83  VAL B CG1  1  
ATOM   2713  C  CG2  . VAL B 1 83 ? 142.863 8.491   -1.336  1.00 0.00 ? 83  VAL B CG2  1  
ATOM   2714  H  H    . VAL B 1 83 ? 145.378 7.658   -1.997  1.00 0.00 ? 83  VAL B H    1  
ATOM   2715  H  HA   . VAL B 1 83 ? 143.820 9.273   -3.725  1.00 0.00 ? 83  VAL B HA   1  
ATOM   2716  H  HB   . VAL B 1 83 ? 144.578 9.661   -0.827  1.00 0.00 ? 83  VAL B HB   1  
ATOM   2717  H  HG11 . VAL B 1 83 ? 142.482 10.991  -2.554  1.00 0.00 ? 83  VAL B HG11 1  
ATOM   2718  H  HG12 . VAL B 1 83 ? 143.833 11.771  -1.731  1.00 0.00 ? 83  VAL B HG12 1  
ATOM   2719  H  HG13 . VAL B 1 83 ? 142.505 11.086  -0.794  1.00 0.00 ? 83  VAL B HG13 1  
ATOM   2720  H  HG21 . VAL B 1 83 ? 142.534 8.066   -2.268  1.00 0.00 ? 83  VAL B HG21 1  
ATOM   2721  H  HG22 . VAL B 1 83 ? 142.010 8.872   -0.791  1.00 0.00 ? 83  VAL B HG22 1  
ATOM   2722  H  HG23 . VAL B 1 83 ? 143.354 7.730   -0.752  1.00 0.00 ? 83  VAL B HG23 1  
ATOM   2723  N  N    . ALA B 1 84 ? 146.669 10.506  -2.648  1.00 0.00 ? 84  ALA B N    1  
ATOM   2724  C  CA   . ALA B 1 84 ? 147.663 11.545  -2.878  1.00 0.00 ? 84  ALA B CA   1  
ATOM   2725  C  C    . ALA B 1 84 ? 148.110 11.526  -4.332  1.00 0.00 ? 84  ALA B C    1  
ATOM   2726  O  O    . ALA B 1 84 ? 148.451 12.561  -4.904  1.00 0.00 ? 84  ALA B O    1  
ATOM   2727  C  CB   . ALA B 1 84 ? 148.871 11.327  -1.966  1.00 0.00 ? 84  ALA B CB   1  
ATOM   2728  H  H    . ALA B 1 84 ? 146.872 9.776   -2.026  1.00 0.00 ? 84  ALA B H    1  
ATOM   2729  H  HA   . ALA B 1 84 ? 147.226 12.506  -2.656  1.00 0.00 ? 84  ALA B HA   1  
ATOM   2730  H  HB1  . ALA B 1 84 ? 149.440 12.241  -1.898  1.00 0.00 ? 84  ALA B HB1  1  
ATOM   2731  H  HB2  . ALA B 1 84 ? 149.493 10.544  -2.372  1.00 0.00 ? 84  ALA B HB2  1  
ATOM   2732  H  HB3  . ALA B 1 84 ? 148.531 11.041  -0.981  1.00 0.00 ? 84  ALA B HB3  1  
ATOM   2733  N  N    . CYS B 1 85 ? 148.104 10.336  -4.925  1.00 0.00 ? 85  CYS B N    1  
ATOM   2734  C  CA   . CYS B 1 85 ? 148.512 10.187  -6.314  1.00 0.00 ? 85  CYS B CA   1  
ATOM   2735  C  C    . CYS B 1 85 ? 147.662 11.078  -7.219  1.00 0.00 ? 85  CYS B C    1  
ATOM   2736  O  O    . CYS B 1 85 ? 148.154 11.629  -8.203  1.00 0.00 ? 85  CYS B O    1  
ATOM   2737  C  CB   . CYS B 1 85 ? 148.382 8.713   -6.732  1.00 0.00 ? 85  CYS B CB   1  
ATOM   2738  S  SG   . CYS B 1 85 ? 146.768 8.412   -7.504  1.00 0.00 ? 85  CYS B SG   1  
ATOM   2739  H  H    . CYS B 1 85 ? 147.824 9.543   -4.415  1.00 0.00 ? 85  CYS B H    1  
ATOM   2740  H  HA   . CYS B 1 85 ? 149.547 10.483  -6.407  1.00 0.00 ? 85  CYS B HA   1  
ATOM   2741  H  HB2  . CYS B 1 85 ? 149.163 8.469   -7.434  1.00 0.00 ? 85  CYS B HB2  1  
ATOM   2742  H  HB3  . CYS B 1 85 ? 148.482 8.086   -5.858  1.00 0.00 ? 85  CYS B HB3  1  
ATOM   2743  H  HG   . CYS B 1 85 ? 146.121 8.301   -6.805  1.00 0.00 ? 85  CYS B HG   1  
ATOM   2744  N  N    . ASN B 1 86 ? 146.386 11.216  -6.871  1.00 0.00 ? 86  ASN B N    1  
ATOM   2745  C  CA   . ASN B 1 86 ? 145.475 12.047  -7.651  1.00 0.00 ? 86  ASN B CA   1  
ATOM   2746  C  C    . ASN B 1 86 ? 146.008 13.472  -7.766  1.00 0.00 ? 86  ASN B C    1  
ATOM   2747  O  O    . ASN B 1 86 ? 145.821 14.141  -8.788  1.00 0.00 ? 86  ASN B O    1  
ATOM   2748  C  CB   . ASN B 1 86 ? 144.096 12.068  -6.992  1.00 0.00 ? 86  ASN B CB   1  
ATOM   2749  C  CG   . ASN B 1 86 ? 143.488 10.670  -7.010  1.00 0.00 ? 86  ASN B CG   1  
ATOM   2750  O  OD1  . ASN B 1 86 ? 143.927 9.810   -7.773  1.00 0.00 ? 86  ASN B OD1  1  
ATOM   2751  N  ND2  . ASN B 1 86 ? 142.497 10.390  -6.209  1.00 0.00 ? 86  ASN B ND2  1  
ATOM   2752  H  H    . ASN B 1 86 ? 146.053 10.756  -6.073  1.00 0.00 ? 86  ASN B H    1  
ATOM   2753  H  HA   . ASN B 1 86 ? 145.382 11.628  -8.642  1.00 0.00 ? 86  ASN B HA   1  
ATOM   2754  H  HB2  . ASN B 1 86 ? 144.193 12.403  -5.970  1.00 0.00 ? 86  ASN B HB2  1  
ATOM   2755  H  HB3  . ASN B 1 86 ? 143.451 12.745  -7.532  1.00 0.00 ? 86  ASN B HB3  1  
ATOM   2756  H  HD21 . ASN B 1 86 ? 142.148 11.075  -5.601  1.00 0.00 ? 86  ASN B HD21 1  
ATOM   2757  H  HD22 . ASN B 1 86 ? 142.100 9.493   -6.215  1.00 0.00 ? 86  ASN B HD22 1  
ATOM   2758  N  N    . ASN B 1 87 ? 146.669 13.940  -6.710  1.00 0.00 ? 87  ASN B N    1  
ATOM   2759  C  CA   . ASN B 1 87 ? 147.210 15.290  -6.715  1.00 0.00 ? 87  ASN B CA   1  
ATOM   2760  C  C    . ASN B 1 87 ? 148.109 15.488  -7.928  1.00 0.00 ? 87  ASN B C    1  
ATOM   2761  O  O    . ASN B 1 87 ? 148.088 16.544  -8.559  1.00 0.00 ? 87  ASN B O    1  
ATOM   2762  C  CB   . ASN B 1 87 ? 148.010 15.539  -5.436  1.00 0.00 ? 87  ASN B CB   1  
ATOM   2763  C  CG   . ASN B 1 87 ? 148.320 17.026  -5.295  1.00 0.00 ? 87  ASN B CG   1  
ATOM   2764  O  OD1  . ASN B 1 87 ? 147.968 17.819  -6.167  1.00 0.00 ? 87  ASN B OD1  1  
ATOM   2765  N  ND2  . ASN B 1 87 ? 148.963 17.452  -4.242  1.00 0.00 ? 87  ASN B ND2  1  
ATOM   2766  H  H    . ASN B 1 87 ? 146.788 13.372  -5.920  1.00 0.00 ? 87  ASN B H    1  
ATOM   2767  H  HA   . ASN B 1 87 ? 146.395 15.996  -6.762  1.00 0.00 ? 87  ASN B HA   1  
ATOM   2768  H  HB2  . ASN B 1 87 ? 147.432 15.211  -4.583  1.00 0.00 ? 87  ASN B HB2  1  
ATOM   2769  H  HB3  . ASN B 1 87 ? 148.935 14.984  -5.477  1.00 0.00 ? 87  ASN B HB3  1  
ATOM   2770  H  HD21 . ASN B 1 87 ? 149.242 16.818  -3.549  1.00 0.00 ? 87  ASN B HD21 1  
ATOM   2771  H  HD22 . ASN B 1 87 ? 149.166 18.406  -4.145  1.00 0.00 ? 87  ASN B HD22 1  
ATOM   2772  N  N    . PHE B 1 88 ? 148.880 14.460  -8.267  1.00 0.00 ? 88  PHE B N    1  
ATOM   2773  C  CA   . PHE B 1 88 ? 149.751 14.546  -9.428  1.00 0.00 ? 88  PHE B CA   1  
ATOM   2774  C  C    . PHE B 1 88 ? 148.911 14.797  -10.675 1.00 0.00 ? 88  PHE B C    1  
ATOM   2775  O  O    . PHE B 1 88 ? 149.245 15.641  -11.507 1.00 0.00 ? 88  PHE B O    1  
ATOM   2776  C  CB   . PHE B 1 88 ? 150.545 13.249  -9.590  1.00 0.00 ? 88  PHE B CB   1  
ATOM   2777  C  CG   . PHE B 1 88 ? 151.533 13.403  -10.721 1.00 0.00 ? 88  PHE B CG   1  
ATOM   2778  C  CD1  . PHE B 1 88 ? 152.784 13.984  -10.483 1.00 0.00 ? 88  PHE B CD1  1  
ATOM   2779  C  CD2  . PHE B 1 88 ? 151.198 12.963  -12.007 1.00 0.00 ? 88  PHE B CD2  1  
ATOM   2780  C  CE1  . PHE B 1 88 ? 153.700 14.125  -11.532 1.00 0.00 ? 88  PHE B CE1  1  
ATOM   2781  C  CE2  . PHE B 1 88 ? 152.115 13.105  -13.056 1.00 0.00 ? 88  PHE B CE2  1  
ATOM   2782  C  CZ   . PHE B 1 88 ? 153.365 13.687  -12.819 1.00 0.00 ? 88  PHE B CZ   1  
ATOM   2783  H  H    . PHE B 1 88 ? 148.847 13.633  -7.742  1.00 0.00 ? 88  PHE B H    1  
ATOM   2784  H  HA   . PHE B 1 88 ? 150.439 15.368  -9.294  1.00 0.00 ? 88  PHE B HA   1  
ATOM   2785  H  HB2  . PHE B 1 88 ? 151.076 13.037  -8.674  1.00 0.00 ? 88  PHE B HB2  1  
ATOM   2786  H  HB3  . PHE B 1 88 ? 149.868 12.439  -9.812  1.00 0.00 ? 88  PHE B HB3  1  
ATOM   2787  H  HD1  . PHE B 1 88 ? 153.043 14.323  -9.492  1.00 0.00 ? 88  PHE B HD1  1  
ATOM   2788  H  HD2  . PHE B 1 88 ? 150.233 12.514  -12.190 1.00 0.00 ? 88  PHE B HD2  1  
ATOM   2789  H  HE1  . PHE B 1 88 ? 154.666 14.574  -11.349 1.00 0.00 ? 88  PHE B HE1  1  
ATOM   2790  H  HE2  . PHE B 1 88 ? 151.856 12.766  -14.049 1.00 0.00 ? 88  PHE B HE2  1  
ATOM   2791  H  HZ   . PHE B 1 88 ? 154.073 13.796  -13.628 1.00 0.00 ? 88  PHE B HZ   1  
ATOM   2792  N  N    . PHE B 1 89 ? 147.808 14.058  -10.784 1.00 0.00 ? 89  PHE B N    1  
ATOM   2793  C  CA   . PHE B 1 89 ? 146.906 14.205  -11.919 1.00 0.00 ? 89  PHE B CA   1  
ATOM   2794  C  C    . PHE B 1 89 ? 146.378 15.633  -11.983 1.00 0.00 ? 89  PHE B C    1  
ATOM   2795  O  O    . PHE B 1 89 ? 146.267 16.218  -13.061 1.00 0.00 ? 89  PHE B O    1  
ATOM   2796  C  CB   . PHE B 1 89 ? 145.738 13.224  -11.796 1.00 0.00 ? 89  PHE B CB   1  
ATOM   2797  C  CG   . PHE B 1 89 ? 144.899 13.281  -13.053 1.00 0.00 ? 89  PHE B CG   1  
ATOM   2798  C  CD1  . PHE B 1 89 ? 145.262 12.513  -14.167 1.00 0.00 ? 89  PHE B CD1  1  
ATOM   2799  C  CD2  . PHE B 1 89 ? 143.764 14.099  -13.107 1.00 0.00 ? 89  PHE B CD2  1  
ATOM   2800  C  CE1  . PHE B 1 89 ? 144.488 12.563  -15.333 1.00 0.00 ? 89  PHE B CE1  1  
ATOM   2801  C  CE2  . PHE B 1 89 ? 142.991 14.148  -14.274 1.00 0.00 ? 89  PHE B CE2  1  
ATOM   2802  C  CZ   . PHE B 1 89 ? 143.354 13.380  -15.387 1.00 0.00 ? 89  PHE B CZ   1  
ATOM   2803  H  H    . PHE B 1 89 ? 147.594 13.410  -10.082 1.00 0.00 ? 89  PHE B H    1  
ATOM   2804  H  HA   . PHE B 1 89 ? 147.448 13.991  -12.827 1.00 0.00 ? 89  PHE B HA   1  
ATOM   2805  H  HB2  . PHE B 1 89 ? 146.120 12.223  -11.664 1.00 0.00 ? 89  PHE B HB2  1  
ATOM   2806  H  HB3  . PHE B 1 89 ? 145.129 13.493  -10.947 1.00 0.00 ? 89  PHE B HB3  1  
ATOM   2807  H  HD1  . PHE B 1 89 ? 146.137 11.883  -14.125 1.00 0.00 ? 89  PHE B HD1  1  
ATOM   2808  H  HD2  . PHE B 1 89 ? 143.483 14.690  -12.250 1.00 0.00 ? 89  PHE B HD2  1  
ATOM   2809  H  HE1  . PHE B 1 89 ? 144.768 11.970  -16.192 1.00 0.00 ? 89  PHE B HE1  1  
ATOM   2810  H  HE2  . PHE B 1 89 ? 142.116 14.779  -14.315 1.00 0.00 ? 89  PHE B HE2  1  
ATOM   2811  H  HZ   . PHE B 1 89 ? 142.757 13.418  -16.286 1.00 0.00 ? 89  PHE B HZ   1  
ATOM   2812  N  N    . TRP B 1 90 ? 146.048 16.186  -10.817 1.00 0.00 ? 90  TRP B N    1  
ATOM   2813  C  CA   . TRP B 1 90 ? 145.527 17.547  -10.750 1.00 0.00 ? 90  TRP B CA   1  
ATOM   2814  C  C    . TRP B 1 90 ? 146.485 18.523  -11.424 1.00 0.00 ? 90  TRP B C    1  
ATOM   2815  O  O    . TRP B 1 90 ? 146.059 19.509  -12.027 1.00 0.00 ? 90  TRP B O    1  
ATOM   2816  C  CB   . TRP B 1 90 ? 145.318 17.968  -9.300  1.00 0.00 ? 90  TRP B CB   1  
ATOM   2817  C  CG   . TRP B 1 90 ? 144.302 17.082  -8.653  1.00 0.00 ? 90  TRP B CG   1  
ATOM   2818  C  CD1  . TRP B 1 90 ? 143.678 16.031  -9.236  1.00 0.00 ? 90  TRP B CD1  1  
ATOM   2819  C  CD2  . TRP B 1 90 ? 143.770 17.175  -7.309  1.00 0.00 ? 90  TRP B CD2  1  
ATOM   2820  N  NE1  . TRP B 1 90 ? 142.809 15.465  -8.320  1.00 0.00 ? 90  TRP B NE1  1  
ATOM   2821  C  CE2  . TRP B 1 90 ? 142.829 16.140  -7.115  1.00 0.00 ? 90  TRP B CE2  1  
ATOM   2822  C  CE3  . TRP B 1 90 ? 144.022 18.053  -6.251  1.00 0.00 ? 90  TRP B CE3  1  
ATOM   2823  C  CZ2  . TRP B 1 90 ? 142.157 15.983  -5.903  1.00 0.00 ? 90  TRP B CZ2  1  
ATOM   2824  C  CZ3  . TRP B 1 90 ? 143.351 17.905  -5.026  1.00 0.00 ? 90  TRP B CZ3  1  
ATOM   2825  C  CH2  . TRP B 1 90 ? 142.419 16.869  -4.852  1.00 0.00 ? 90  TRP B CH2  1  
ATOM   2826  H  H    . TRP B 1 90 ? 146.154 15.664  -9.988  1.00 0.00 ? 90  TRP B H    1  
ATOM   2827  H  HA   . TRP B 1 90 ? 144.576 17.587  -11.252 1.00 0.00 ? 90  TRP B HA   1  
ATOM   2828  H  HB2  . TRP B 1 90 ? 146.253 17.892  -8.765  1.00 0.00 ? 90  TRP B HB2  1  
ATOM   2829  H  HB3  . TRP B 1 90 ? 144.971 18.991  -9.270  1.00 0.00 ? 90  TRP B HB3  1  
ATOM   2830  H  HD1  . TRP B 1 90 ? 143.839 15.685  -10.244 1.00 0.00 ? 90  TRP B HD1  1  
ATOM   2831  H  HE1  . TRP B 1 90 ? 142.238 14.685  -8.487  1.00 0.00 ? 90  TRP B HE1  1  
ATOM   2832  H  HE3  . TRP B 1 90 ? 144.737 18.850  -6.387  1.00 0.00 ? 90  TRP B HE3  1  
ATOM   2833  H  HZ2  . TRP B 1 90 ? 141.441 15.184  -5.776  1.00 0.00 ? 90  TRP B HZ2  1  
ATOM   2834  H  HZ3  . TRP B 1 90 ? 143.552 18.588  -4.215  1.00 0.00 ? 90  TRP B HZ3  1  
ATOM   2835  H  HH2  . TRP B 1 90 ? 141.903 16.759  -3.910  1.00 0.00 ? 90  TRP B HH2  1  
ATOM   2836  N  N    . GLU B 1 91 ? 147.780 18.244  -11.317 1.00 0.00 ? 91  GLU B N    1  
ATOM   2837  C  CA   . GLU B 1 91 ? 148.789 19.107  -11.921 1.00 0.00 ? 91  GLU B CA   1  
ATOM   2838  C  C    . GLU B 1 91 ? 148.539 19.259  -13.418 1.00 0.00 ? 91  GLU B C    1  
ATOM   2839  O  O    . GLU B 1 91 ? 148.810 20.311  -13.998 1.00 0.00 ? 91  GLU B O    1  
ATOM   2840  C  CB   . GLU B 1 91 ? 150.183 18.520  -11.692 1.00 0.00 ? 91  GLU B CB   1  
ATOM   2841  C  CG   . GLU B 1 91 ? 151.240 19.500  -12.204 1.00 0.00 ? 91  GLU B CG   1  
ATOM   2842  C  CD   . GLU B 1 91 ? 152.629 18.883  -12.073 1.00 0.00 ? 91  GLU B CD   1  
ATOM   2843  O  OE1  . GLU B 1 91 ? 152.713 17.749  -11.629 1.00 0.00 ? 91  GLU B OE1  1  
ATOM   2844  O  OE2  . GLU B 1 91 ? 153.588 19.553  -12.419 1.00 0.00 ? 91  GLU B OE2  1  
ATOM   2845  H  H    . GLU B 1 91 ? 148.061 17.446  -10.825 1.00 0.00 ? 91  GLU B H    1  
ATOM   2846  H  HA   . GLU B 1 91 ? 148.740 20.080  -11.458 1.00 0.00 ? 91  GLU B HA   1  
ATOM   2847  H  HB2  . GLU B 1 91 ? 150.331 18.349  -10.635 1.00 0.00 ? 91  GLU B HB2  1  
ATOM   2848  H  HB3  . GLU B 1 91 ? 150.272 17.585  -12.224 1.00 0.00 ? 91  GLU B HB3  1  
ATOM   2849  H  HG2  . GLU B 1 91 ? 151.044 19.726  -13.243 1.00 0.00 ? 91  GLU B HG2  1  
ATOM   2850  H  HG3  . GLU B 1 91 ? 151.197 20.409  -11.624 1.00 0.00 ? 91  GLU B HG3  1  
ATOM   2851  N  N    . ASN B 1 92 ? 148.023 18.204  -14.038 1.00 0.00 ? 92  ASN B N    1  
ATOM   2852  C  CA   . ASN B 1 92 ? 147.741 18.234  -15.470 1.00 0.00 ? 92  ASN B CA   1  
ATOM   2853  C  C    . ASN B 1 92 ? 146.835 19.411  -15.812 1.00 0.00 ? 92  ASN B C    1  
ATOM   2854  O  O    . ASN B 1 92 ? 146.983 20.035  -16.864 1.00 0.00 ? 92  ASN B O    1  
ATOM   2855  C  CB   . ASN B 1 92 ? 147.070 16.928  -15.898 1.00 0.00 ? 92  ASN B CB   1  
ATOM   2856  C  CG   . ASN B 1 92 ? 147.056 16.823  -17.419 1.00 0.00 ? 92  ASN B CG   1  
ATOM   2857  O  OD1  . ASN B 1 92 ? 147.512 17.736  -18.109 1.00 0.00 ? 92  ASN B OD1  1  
ATOM   2858  N  ND2  . ASN B 1 92 ? 146.557 15.760  -17.987 1.00 0.00 ? 92  ASN B ND2  1  
ATOM   2859  H  H    . ASN B 1 92 ? 147.828 17.392  -13.526 1.00 0.00 ? 92  ASN B H    1  
ATOM   2860  H  HA   . ASN B 1 92 ? 148.672 18.339  -16.008 1.00 0.00 ? 92  ASN B HA   1  
ATOM   2861  H  HB2  . ASN B 1 92 ? 147.617 16.092  -15.487 1.00 0.00 ? 92  ASN B HB2  1  
ATOM   2862  H  HB3  . ASN B 1 92 ? 146.056 16.910  -15.530 1.00 0.00 ? 92  ASN B HB3  1  
ATOM   2863  H  HD21 . ASN B 1 92 ? 146.195 15.035  -17.436 1.00 0.00 ? 92  ASN B HD21 1  
ATOM   2864  H  HD22 . ASN B 1 92 ? 146.545 15.685  -18.965 1.00 0.00 ? 92  ASN B HD22 1  
ATOM   2865  N  N    . SER B 1 93 ? 145.897 19.709  -14.920 1.00 0.00 ? 93  SER B N    1  
ATOM   2866  C  CA   . SER B 1 93 ? 144.972 20.815  -15.139 1.00 0.00 ? 93  SER B CA   1  
ATOM   2867  C  C    . SER B 1 93 ? 144.120 21.056  -13.896 1.00 0.00 ? 93  SER B C    1  
ATOM   2868  O  O    . SER B 1 93 ? 142.922 20.839  -13.972 1.00 0.00 ? 93  SER B O    1  
ATOM   2869  C  CB   . SER B 1 93 ? 144.064 20.508  -16.330 1.00 0.00 ? 93  SER B CB   1  
ATOM   2870  O  OG   . SER B 1 93 ? 143.140 21.575  -16.503 1.00 0.00 ? 93  SER B OG   1  
ATOM   2871  O  OXT  . SER B 1 93 ? 144.679 21.453  -12.887 1.00 0.00 ? 93  SER B OXT  1  
ATOM   2872  H  H    . SER B 1 93 ? 145.826 19.178  -14.099 1.00 0.00 ? 93  SER B H    1  
ATOM   2873  H  HA   . SER B 1 93 ? 145.538 21.709  -15.354 1.00 0.00 ? 93  SER B HA   1  
ATOM   2874  H  HB2  . SER B 1 93 ? 144.659 20.406  -17.222 1.00 0.00 ? 93  SER B HB2  1  
ATOM   2875  H  HB3  . SER B 1 93 ? 143.532 19.583  -16.146 1.00 0.00 ? 93  SER B HB3  1  
ATOM   2876  H  HG   . SER B 1 93 ? 142.387 21.237  -16.994 1.00 0.00 ? 93  SER B HG   1  
HETATM 2877  CA CA   . CA  C 2 .  ? 128.440 9.824   -3.859  1.00 0.00 ? 201 CA  A CA   1  
HETATM 2878  CA CA   . CA  D 2 .  ? 133.422 12.729  7.927   1.00 0.00 ? 202 CA  A CA   1  
HETATM 2879  CA CA   . CA  E 2 .  ? 159.779 -9.631  3.444   1.00 0.00 ? 101 CA  B CA   1  
HETATM 2880  CA CA   . CA  F 2 .  ? 156.518 -1.633  13.321  1.00 0.00 ? 102 CA  B CA   1  
ATOM   2881  N  N    . GLY A 1 1  ? 154.368 -1.313  -16.619 1.00 0.00 ? 1   GLY A N    2  
ATOM   2882  C  CA   . GLY A 1 1  ? 153.097 -1.914  -16.233 1.00 0.00 ? 1   GLY A CA   2  
ATOM   2883  C  C    . GLY A 1 1  ? 153.191 -2.543  -14.848 1.00 0.00 ? 1   GLY A C    2  
ATOM   2884  O  O    . GLY A 1 1  ? 153.877 -3.546  -14.656 1.00 0.00 ? 1   GLY A O    2  
ATOM   2885  H  H1   . GLY A 1 1  ? 155.140 -1.371  -16.019 1.00 0.00 ? 1   GLY A H1   2  
ATOM   2886  H  HA2  . GLY A 1 1  ? 152.332 -1.151  -16.228 1.00 0.00 ? 1   GLY A HA2  2  
ATOM   2887  H  HA3  . GLY A 1 1  ? 152.833 -2.677  -16.950 1.00 0.00 ? 1   GLY A HA3  2  
ATOM   2888  N  N    . SER A 1 2  ? 152.494 -1.946  -13.884 1.00 0.00 ? 2   SER A N    2  
ATOM   2889  C  CA   . SER A 1 2  ? 152.502 -2.453  -12.513 1.00 0.00 ? 2   SER A CA   2  
ATOM   2890  C  C    . SER A 1 2  ? 151.103 -2.866  -12.076 1.00 0.00 ? 2   SER A C    2  
ATOM   2891  O  O    . SER A 1 2  ? 150.133 -2.148  -12.321 1.00 0.00 ? 2   SER A O    2  
ATOM   2892  C  CB   . SER A 1 2  ? 153.009 -1.360  -11.578 1.00 0.00 ? 2   SER A CB   2  
ATOM   2893  O  OG   . SER A 1 2  ? 152.952 -1.826  -10.242 1.00 0.00 ? 2   SER A OG   2  
ATOM   2894  H  H    . SER A 1 2  ? 151.966 -1.149  -14.097 1.00 0.00 ? 2   SER A H    2  
ATOM   2895  H  HA   . SER A 1 2  ? 153.161 -3.305  -12.446 1.00 0.00 ? 2   SER A HA   2  
ATOM   2896  H  HB2  . SER A 1 2  ? 154.030 -1.115  -11.824 1.00 0.00 ? 2   SER A HB2  2  
ATOM   2897  H  HB3  . SER A 1 2  ? 152.394 -0.476  -11.690 1.00 0.00 ? 2   SER A HB3  2  
ATOM   2898  H  HG   . SER A 1 2  ? 153.849 -1.968  -9.937  1.00 0.00 ? 2   SER A HG   2  
ATOM   2899  N  N    . GLU A 1 3  ? 150.997 -4.018  -11.415 1.00 0.00 ? 3   GLU A N    2  
ATOM   2900  C  CA   . GLU A 1 3  ? 149.697 -4.476  -10.946 1.00 0.00 ? 3   GLU A CA   2  
ATOM   2901  C  C    . GLU A 1 3  ? 149.163 -3.507  -9.900  1.00 0.00 ? 3   GLU A C    2  
ATOM   2902  O  O    . GLU A 1 3  ? 147.967 -3.225  -9.840  1.00 0.00 ? 3   GLU A O    2  
ATOM   2903  C  CB   . GLU A 1 3  ? 149.819 -5.850  -10.283 1.00 0.00 ? 3   GLU A CB   2  
ATOM   2904  C  CG   . GLU A 1 3  ? 150.324 -6.892  -11.278 1.00 0.00 ? 3   GLU A CG   2  
ATOM   2905  C  CD   . GLU A 1 3  ? 150.318 -8.272  -10.629 1.00 0.00 ? 3   GLU A CD   2  
ATOM   2906  O  OE1  . GLU A 1 3  ? 150.094 -8.341  -9.432  1.00 0.00 ? 3   GLU A OE1  2  
ATOM   2907  O  OE2  . GLU A 1 3  ? 150.536 -9.239  -11.339 1.00 0.00 ? 3   GLU A OE2  2  
ATOM   2908  H  H    . GLU A 1 3  ? 151.799 -4.551  -11.232 1.00 0.00 ? 3   GLU A H    2  
ATOM   2909  H  HA   . GLU A 1 3  ? 149.009 -4.536  -11.775 1.00 0.00 ? 3   GLU A HA   2  
ATOM   2910  H  HB2  . GLU A 1 3  ? 150.512 -5.779  -9.465  1.00 0.00 ? 3   GLU A HB2  2  
ATOM   2911  H  HB3  . GLU A 1 3  ? 148.852 -6.154  -9.908  1.00 0.00 ? 3   GLU A HB3  2  
ATOM   2912  H  HG2  . GLU A 1 3  ? 149.694 -6.897  -12.156 1.00 0.00 ? 3   GLU A HG2  2  
ATOM   2913  H  HG3  . GLU A 1 3  ? 151.336 -6.645  -11.557 1.00 0.00 ? 3   GLU A HG3  2  
ATOM   2914  N  N    . LEU A 1 4  ? 150.078 -3.016  -9.065  1.00 0.00 ? 4   LEU A N    2  
ATOM   2915  C  CA   . LEU A 1 4  ? 149.722 -2.090  -7.999  1.00 0.00 ? 4   LEU A CA   2  
ATOM   2916  C  C    . LEU A 1 4  ? 149.138 -0.806  -8.568  1.00 0.00 ? 4   LEU A C    2  
ATOM   2917  O  O    . LEU A 1 4  ? 148.172 -0.264  -8.028  1.00 0.00 ? 4   LEU A O    2  
ATOM   2918  C  CB   . LEU A 1 4  ? 150.972 -1.772  -7.183  1.00 0.00 ? 4   LEU A CB   2  
ATOM   2919  C  CG   . LEU A 1 4  ? 150.619 -0.920  -5.961  1.00 0.00 ? 4   LEU A CG   2  
ATOM   2920  C  CD1  . LEU A 1 4  ? 149.788 -1.748  -4.979  1.00 0.00 ? 4   LEU A CD1  2  
ATOM   2921  C  CD2  . LEU A 1 4  ? 151.918 -0.479  -5.270  1.00 0.00 ? 4   LEU A CD2  2  
ATOM   2922  H  H    . LEU A 1 4  ? 151.013 -3.293  -9.164  1.00 0.00 ? 4   LEU A H    2  
ATOM   2923  H  HA   . LEU A 1 4  ? 148.993 -2.557  -7.356  1.00 0.00 ? 4   LEU A HA   2  
ATOM   2924  H  HB2  . LEU A 1 4  ? 151.439 -2.691  -6.861  1.00 0.00 ? 4   LEU A HB2  2  
ATOM   2925  H  HB3  . LEU A 1 4  ? 151.651 -1.222  -7.805  1.00 0.00 ? 4   LEU A HB3  2  
ATOM   2926  H  HG   . LEU A 1 4  ? 150.059 -0.051  -6.272  1.00 0.00 ? 4   LEU A HG   2  
ATOM   2927  H  HD11 . LEU A 1 4  ? 150.118 -2.776  -5.003  1.00 0.00 ? 4   LEU A HD11 2  
ATOM   2928  H  HD12 . LEU A 1 4  ? 148.747 -1.697  -5.259  1.00 0.00 ? 4   LEU A HD12 2  
ATOM   2929  H  HD13 . LEU A 1 4  ? 149.910 -1.353  -3.981  1.00 0.00 ? 4   LEU A HD13 2  
ATOM   2930  H  HD21 . LEU A 1 4  ? 152.681 -0.293  -6.012  1.00 0.00 ? 4   LEU A HD21 2  
ATOM   2931  H  HD22 . LEU A 1 4  ? 152.254 -1.259  -4.601  1.00 0.00 ? 4   LEU A HD22 2  
ATOM   2932  H  HD23 . LEU A 1 4  ? 151.738 0.424   -4.706  1.00 0.00 ? 4   LEU A HD23 2  
ATOM   2933  N  N    . GLU A 1 5  ? 149.716 -0.324  -9.667  1.00 0.00 ? 5   GLU A N    2  
ATOM   2934  C  CA   . GLU A 1 5  ? 149.207 0.893   -10.278 1.00 0.00 ? 5   GLU A CA   2  
ATOM   2935  C  C    . GLU A 1 5  ? 147.774 0.659   -10.711 1.00 0.00 ? 5   GLU A C    2  
ATOM   2936  O  O    . GLU A 1 5  ? 146.902 1.507   -10.525 1.00 0.00 ? 5   GLU A O    2  
ATOM   2937  C  CB   . GLU A 1 5  ? 150.061 1.276   -11.488 1.00 0.00 ? 5   GLU A CB   2  
ATOM   2938  C  CG   . GLU A 1 5  ? 149.598 2.629   -12.032 1.00 0.00 ? 5   GLU A CG   2  
ATOM   2939  C  CD   . GLU A 1 5  ? 150.375 2.975   -13.298 1.00 0.00 ? 5   GLU A CD   2  
ATOM   2940  O  OE1  . GLU A 1 5  ? 151.195 2.170   -13.705 1.00 0.00 ? 5   GLU A OE1  2  
ATOM   2941  O  OE2  . GLU A 1 5  ? 150.137 4.042   -13.841 1.00 0.00 ? 5   GLU A OE2  2  
ATOM   2942  H  H    . GLU A 1 5  ? 150.477 -0.792  -10.069 1.00 0.00 ? 5   GLU A H    2  
ATOM   2943  H  HA   . GLU A 1 5  ? 149.235 1.691   -9.557  1.00 0.00 ? 5   GLU A HA   2  
ATOM   2944  H  HB2  . GLU A 1 5  ? 151.097 1.343   -11.190 1.00 0.00 ? 5   GLU A HB2  2  
ATOM   2945  H  HB3  . GLU A 1 5  ? 149.954 0.526   -12.257 1.00 0.00 ? 5   GLU A HB3  2  
ATOM   2946  H  HG2  . GLU A 1 5  ? 148.543 2.581   -12.260 1.00 0.00 ? 5   GLU A HG2  2  
ATOM   2947  H  HG3  . GLU A 1 5  ? 149.770 3.392   -11.288 1.00 0.00 ? 5   GLU A HG3  2  
ATOM   2948  N  N    . THR A 1 6  ? 147.540 -0.528  -11.254 1.00 0.00 ? 6   THR A N    2  
ATOM   2949  C  CA   . THR A 1 6  ? 146.209 -0.916  -11.676 1.00 0.00 ? 6   THR A CA   2  
ATOM   2950  C  C    . THR A 1 6  ? 145.294 -1.007  -10.463 1.00 0.00 ? 6   THR A C    2  
ATOM   2951  O  O    . THR A 1 6  ? 144.115 -0.673  -10.533 1.00 0.00 ? 6   THR A O    2  
ATOM   2952  C  CB   . THR A 1 6  ? 146.261 -2.269  -12.393 1.00 0.00 ? 6   THR A CB   2  
ATOM   2953  O  OG1  . THR A 1 6  ? 147.210 -2.203  -13.448 1.00 0.00 ? 6   THR A OG1  2  
ATOM   2954  C  CG2  . THR A 1 6  ? 144.883 -2.605  -12.973 1.00 0.00 ? 6   THR A CG2  2  
ATOM   2955  H  H    . THR A 1 6  ? 148.277 -1.168  -11.344 1.00 0.00 ? 6   THR A H    2  
ATOM   2956  H  HA   . THR A 1 6  ? 145.823 -0.171  -12.356 1.00 0.00 ? 6   THR A HA   2  
ATOM   2957  H  HB   . THR A 1 6  ? 146.550 -3.037  -11.694 1.00 0.00 ? 6   THR A HB   2  
ATOM   2958  H  HG1  . THR A 1 6  ? 147.485 -3.100  -13.656 1.00 0.00 ? 6   THR A HG1  2  
ATOM   2959  H  HG21 . THR A 1 6  ? 144.112 -2.285  -12.289 1.00 0.00 ? 6   THR A HG21 2  
ATOM   2960  H  HG22 . THR A 1 6  ? 144.809 -3.671  -13.124 1.00 0.00 ? 6   THR A HG22 2  
ATOM   2961  H  HG23 . THR A 1 6  ? 144.758 -2.098  -13.919 1.00 0.00 ? 6   THR A HG23 2  
ATOM   2962  N  N    . ALA A 1 7  ? 145.852 -1.505  -9.358  1.00 0.00 ? 7   ALA A N    2  
ATOM   2963  C  CA   . ALA A 1 7  ? 145.080 -1.687  -8.136  1.00 0.00 ? 7   ALA A CA   2  
ATOM   2964  C  C    . ALA A 1 7  ? 144.587 -0.359  -7.547  1.00 0.00 ? 7   ALA A C    2  
ATOM   2965  O  O    . ALA A 1 7  ? 143.398 -0.222  -7.230  1.00 0.00 ? 7   ALA A O    2  
ATOM   2966  C  CB   . ALA A 1 7  ? 145.945 -2.422  -7.101  1.00 0.00 ? 7   ALA A CB   2  
ATOM   2967  H  H    . ALA A 1 7  ? 146.793 -1.780  -9.377  1.00 0.00 ? 7   ALA A H    2  
ATOM   2968  H  HA   . ALA A 1 7  ? 144.222 -2.302  -8.359  1.00 0.00 ? 7   ALA A HA   2  
ATOM   2969  H  HB1  . ALA A 1 7  ? 146.522 -1.704  -6.536  1.00 0.00 ? 7   ALA A HB1  2  
ATOM   2970  H  HB2  . ALA A 1 7  ? 146.620 -3.101  -7.607  1.00 0.00 ? 7   ALA A HB2  2  
ATOM   2971  H  HB3  . ALA A 1 7  ? 145.311 -2.981  -6.430  1.00 0.00 ? 7   ALA A HB3  2  
ATOM   2972  N  N    . MET A 1 8  ? 145.479 0.627   -7.402  1.00 0.00 ? 8   MET A N    2  
ATOM   2973  C  CA   . MET A 1 8  ? 145.048 1.901   -6.836  1.00 0.00 ? 8   MET A CA   2  
ATOM   2974  C  C    . MET A 1 8  ? 143.954 2.493   -7.699  1.00 0.00 ? 8   MET A C    2  
ATOM   2975  O  O    . MET A 1 8  ? 142.967 3.026   -7.198  1.00 0.00 ? 8   MET A O    2  
ATOM   2976  C  CB   . MET A 1 8  ? 146.193 2.919   -6.808  1.00 0.00 ? 8   MET A CB   2  
ATOM   2977  C  CG   . MET A 1 8  ? 147.328 2.452   -5.901  1.00 0.00 ? 8   MET A CG   2  
ATOM   2978  S  SD   . MET A 1 8  ? 148.501 3.819   -5.682  1.00 0.00 ? 8   MET A SD   2  
ATOM   2979  C  CE   . MET A 1 8  ? 148.833 4.158   -7.432  1.00 0.00 ? 8   MET A CE   2  
ATOM   2980  H  H    . MET A 1 8  ? 146.408 0.491   -7.660  1.00 0.00 ? 8   MET A H    2  
ATOM   2981  H  HA   . MET A 1 8  ? 144.680 1.749   -5.834  1.00 0.00 ? 8   MET A HA   2  
ATOM   2982  H  HB2  . MET A 1 8  ? 146.572 3.046   -7.811  1.00 0.00 ? 8   MET A HB2  2  
ATOM   2983  H  HB3  . MET A 1 8  ? 145.817 3.866   -6.449  1.00 0.00 ? 8   MET A HB3  2  
ATOM   2984  H  HG2  . MET A 1 8  ? 146.928 2.157   -4.943  1.00 0.00 ? 8   MET A HG2  2  
ATOM   2985  H  HG3  . MET A 1 8  ? 147.832 1.612   -6.357  1.00 0.00 ? 8   MET A HG3  2  
ATOM   2986  H  HE1  . MET A 1 8  ? 148.041 4.776   -7.836  1.00 0.00 ? 8   MET A HE1  2  
ATOM   2987  H  HE2  . MET A 1 8  ? 148.870 3.233   -7.978  1.00 0.00 ? 8   MET A HE2  2  
ATOM   2988  H  HE3  . MET A 1 8  ? 149.781 4.675   -7.528  1.00 0.00 ? 8   MET A HE3  2  
ATOM   2989  N  N    . GLU A 1 9  ? 144.138 2.377   -9.006  1.00 0.00 ? 9   GLU A N    2  
ATOM   2990  C  CA   . GLU A 1 9  ? 143.160 2.889   -9.941  1.00 0.00 ? 9   GLU A CA   2  
ATOM   2991  C  C    . GLU A 1 9  ? 141.864 2.106   -9.854  1.00 0.00 ? 9   GLU A C    2  
ATOM   2992  O  O    . GLU A 1 9  ? 140.779 2.672   -9.969  1.00 0.00 ? 9   GLU A O    2  
ATOM   2993  C  CB   . GLU A 1 9  ? 143.722 2.818   -11.359 1.00 0.00 ? 9   GLU A CB   2  
ATOM   2994  C  CG   . GLU A 1 9  ? 144.897 3.783   -11.486 1.00 0.00 ? 9   GLU A CG   2  
ATOM   2995  C  CD   . GLU A 1 9  ? 145.434 3.768   -12.913 1.00 0.00 ? 9   GLU A CD   2  
ATOM   2996  O  OE1  . GLU A 1 9  ? 145.005 2.919   -13.677 1.00 0.00 ? 9   GLU A OE1  2  
ATOM   2997  O  OE2  . GLU A 1 9  ? 146.264 4.607   -13.221 1.00 0.00 ? 9   GLU A OE2  2  
ATOM   2998  H  H    . GLU A 1 9  ? 144.943 1.931   -9.343  1.00 0.00 ? 9   GLU A H    2  
ATOM   2999  H  HA   . GLU A 1 9  ? 142.958 3.922   -9.703  1.00 0.00 ? 9   GLU A HA   2  
ATOM   3000  H  HB2  . GLU A 1 9  ? 144.067 1.813   -11.555 1.00 0.00 ? 9   GLU A HB2  2  
ATOM   3001  H  HB3  . GLU A 1 9  ? 142.958 3.087   -12.069 1.00 0.00 ? 9   GLU A HB3  2  
ATOM   3002  H  HG2  . GLU A 1 9  ? 144.563 4.779   -11.238 1.00 0.00 ? 9   GLU A HG2  2  
ATOM   3003  H  HG3  . GLU A 1 9  ? 145.679 3.486   -10.806 1.00 0.00 ? 9   GLU A HG3  2  
ATOM   3004  N  N    . THR A 1 10 ? 141.978 0.798   -9.651  1.00 0.00 ? 10  THR A N    2  
ATOM   3005  C  CA   . THR A 1 10 ? 140.794 -0.035  -9.558  1.00 0.00 ? 10  THR A CA   2  
ATOM   3006  C  C    . THR A 1 10 ? 139.933 0.378   -8.378  1.00 0.00 ? 10  THR A C    2  
ATOM   3007  O  O    . THR A 1 10 ? 138.717 0.504   -8.502  1.00 0.00 ? 10  THR A O    2  
ATOM   3008  C  CB   . THR A 1 10 ? 141.200 -1.502  -9.405  1.00 0.00 ? 10  THR A CB   2  
ATOM   3009  O  OG1  . THR A 1 10 ? 142.067 -1.866  -10.471 1.00 0.00 ? 10  THR A OG1  2  
ATOM   3010  C  CG2  . THR A 1 10 ? 139.953 -2.385  -9.436  1.00 0.00 ? 10  THR A CG2  2  
ATOM   3011  H  H    . THR A 1 10 ? 142.868 0.393   -9.568  1.00 0.00 ? 10  THR A H    2  
ATOM   3012  H  HA   . THR A 1 10 ? 140.219 0.069   -10.463 1.00 0.00 ? 10  THR A HA   2  
ATOM   3013  H  HB   . THR A 1 10 ? 141.709 -1.639  -8.463  1.00 0.00 ? 10  THR A HB   2  
ATOM   3014  H  HG1  . THR A 1 10 ? 141.739 -2.683  -10.853 1.00 0.00 ? 10  THR A HG1  2  
ATOM   3015  H  HG21 . THR A 1 10 ? 139.378 -2.166  -10.324 1.00 0.00 ? 10  THR A HG21 2  
ATOM   3016  H  HG22 . THR A 1 10 ? 139.350 -2.188  -8.560  1.00 0.00 ? 10  THR A HG22 2  
ATOM   3017  H  HG23 . THR A 1 10 ? 140.246 -3.424  -9.444  1.00 0.00 ? 10  THR A HG23 2  
ATOM   3018  N  N    . LEU A 1 11 ? 140.562 0.603   -7.229  1.00 0.00 ? 11  LEU A N    2  
ATOM   3019  C  CA   . LEU A 1 11 ? 139.796 1.004   -6.054  1.00 0.00 ? 11  LEU A CA   2  
ATOM   3020  C  C    . LEU A 1 11 ? 139.068 2.325   -6.307  1.00 0.00 ? 11  LEU A C    2  
ATOM   3021  O  O    . LEU A 1 11 ? 137.855 2.458   -6.061  1.00 0.00 ? 11  LEU A O    2  
ATOM   3022  C  CB   . LEU A 1 11 ? 140.767 1.175   -4.884  1.00 0.00 ? 11  LEU A CB   2  
ATOM   3023  C  CG   . LEU A 1 11 ? 141.498 -0.148  -4.634  1.00 0.00 ? 11  LEU A CG   2  
ATOM   3024  C  CD1  . LEU A 1 11 ? 142.572 0.048   -3.559  1.00 0.00 ? 11  LEU A CD1  2  
ATOM   3025  C  CD2  . LEU A 1 11 ? 140.493 -1.205  -4.166  1.00 0.00 ? 11  LEU A CD2  2  
ATOM   3026  H  H    . LEU A 1 11 ? 141.545 0.496   -7.172  1.00 0.00 ? 11  LEU A H    2  
ATOM   3027  H  HA   . LEU A 1 11 ? 139.078 0.237   -5.810  1.00 0.00 ? 11  LEU A HA   2  
ATOM   3028  H  HB2  . LEU A 1 11 ? 141.485 1.946   -5.122  1.00 0.00 ? 11  LEU A HB2  2  
ATOM   3029  H  HB3  . LEU A 1 11 ? 140.218 1.454   -3.997  1.00 0.00 ? 11  LEU A HB3  2  
ATOM   3030  H  HG   . LEU A 1 11 ? 141.961 -0.477  -5.548  1.00 0.00 ? 11  LEU A HG   2  
ATOM   3031  H  HD11 . LEU A 1 11 ? 143.497 0.361   -4.033  1.00 0.00 ? 11  LEU A HD11 2  
ATOM   3032  H  HD12 . LEU A 1 11 ? 142.734 -0.883  -3.036  1.00 0.00 ? 11  LEU A HD12 2  
ATOM   3033  H  HD13 . LEU A 1 11 ? 142.252 0.805   -2.859  1.00 0.00 ? 11  LEU A HD13 2  
ATOM   3034  H  HD21 . LEU A 1 11 ? 141.003 -1.950  -3.573  1.00 0.00 ? 11  LEU A HD21 2  
ATOM   3035  H  HD22 . LEU A 1 11 ? 140.042 -1.678  -5.026  1.00 0.00 ? 11  LEU A HD22 2  
ATOM   3036  H  HD23 . LEU A 1 11 ? 139.725 -0.734  -3.570  1.00 0.00 ? 11  LEU A HD23 2  
ATOM   3037  N  N    . ILE A 1 12 ? 139.807 3.287   -6.845  1.00 0.00 ? 12  ILE A N    2  
ATOM   3038  C  CA   . ILE A 1 12 ? 139.228 4.581   -7.150  1.00 0.00 ? 12  ILE A CA   2  
ATOM   3039  C  C    . ILE A 1 12 ? 138.107 4.434   -8.156  1.00 0.00 ? 12  ILE A C    2  
ATOM   3040  O  O    . ILE A 1 12 ? 137.063 5.054   -8.023  1.00 0.00 ? 12  ILE A O    2  
ATOM   3041  C  CB   . ILE A 1 12 ? 140.302 5.524   -7.693  1.00 0.00 ? 12  ILE A CB   2  
ATOM   3042  C  CG1  . ILE A 1 12 ? 141.392 5.709   -6.635  1.00 0.00 ? 12  ILE A CG1  2  
ATOM   3043  C  CG2  . ILE A 1 12 ? 139.675 6.880   -8.021  1.00 0.00 ? 12  ILE A CG2  2  
ATOM   3044  C  CD1  . ILE A 1 12 ? 142.546 6.525   -7.222  1.00 0.00 ? 12  ILE A CD1  2  
ATOM   3045  H  H    . ILE A 1 12 ? 140.750 3.118   -7.048  1.00 0.00 ? 12  ILE A H    2  
ATOM   3046  H  HA   . ILE A 1 12 ? 138.825 5.004   -6.243  1.00 0.00 ? 12  ILE A HA   2  
ATOM   3047  H  HB   . ILE A 1 12 ? 140.734 5.102   -8.589  1.00 0.00 ? 12  ILE A HB   2  
ATOM   3048  H  HG12 . ILE A 1 12 ? 140.980 6.230   -5.783  1.00 0.00 ? 12  ILE A HG12 2  
ATOM   3049  H  HG13 . ILE A 1 12 ? 141.758 4.744   -6.322  1.00 0.00 ? 12  ILE A HG13 2  
ATOM   3050  H  HG21 . ILE A 1 12 ? 139.188 7.273   -7.141  1.00 0.00 ? 12  ILE A HG21 2  
ATOM   3051  H  HG22 . ILE A 1 12 ? 138.949 6.759   -8.811  1.00 0.00 ? 12  ILE A HG22 2  
ATOM   3052  H  HG23 . ILE A 1 12 ? 140.446 7.565   -8.342  1.00 0.00 ? 12  ILE A HG23 2  
ATOM   3053  H  HD11 . ILE A 1 12 ? 142.154 7.413   -7.694  1.00 0.00 ? 12  ILE A HD11 2  
ATOM   3054  H  HD12 . ILE A 1 12 ? 143.072 5.931   -7.953  1.00 0.00 ? 12  ILE A HD12 2  
ATOM   3055  H  HD13 . ILE A 1 12 ? 143.225 6.807   -6.431  1.00 0.00 ? 12  ILE A HD13 2  
ATOM   3056  N  N    . ASN A 1 13 ? 138.332 3.611   -9.167  1.00 0.00 ? 13  ASN A N    2  
ATOM   3057  C  CA   . ASN A 1 13 ? 137.321 3.402   -10.185 1.00 0.00 ? 13  ASN A CA   2  
ATOM   3058  C  C    . ASN A 1 13 ? 136.042 2.796   -9.602  1.00 0.00 ? 13  ASN A C    2  
ATOM   3059  O  O    . ASN A 1 13 ? 134.945 3.181   -9.996  1.00 0.00 ? 13  ASN A O    2  
ATOM   3060  C  CB   . ASN A 1 13 ? 137.890 2.504   -11.287 1.00 0.00 ? 13  ASN A CB   2  
ATOM   3061  C  CG   . ASN A 1 13 ? 139.072 3.208   -11.953 1.00 0.00 ? 13  ASN A CG   2  
ATOM   3062  O  OD1  . ASN A 1 13 ? 139.007 4.410   -12.212 1.00 0.00 ? 13  ASN A OD1  2  
ATOM   3063  N  ND2  . ASN A 1 13 ? 140.163 2.542   -12.229 1.00 0.00 ? 13  ASN A ND2  2  
ATOM   3064  H  H    . ASN A 1 13 ? 139.190 3.141   -9.230  1.00 0.00 ? 13  ASN A H    2  
ATOM   3065  H  HA   . ASN A 1 13 ? 137.075 4.357   -10.622 1.00 0.00 ? 13  ASN A HA   2  
ATOM   3066  H  HB2  . ASN A 1 13 ? 138.222 1.571   -10.856 1.00 0.00 ? 13  ASN A HB2  2  
ATOM   3067  H  HB3  . ASN A 1 13 ? 137.126 2.311   -12.024 1.00 0.00 ? 13  ASN A HB3  2  
ATOM   3068  H  HD21 . ASN A 1 13 ? 140.229 1.592   -12.007 1.00 0.00 ? 13  ASN A HD21 2  
ATOM   3069  H  HD22 . ASN A 1 13 ? 140.917 2.996   -12.660 1.00 0.00 ? 13  ASN A HD22 2  
ATOM   3070  N  N    . VAL A 1 14 ? 136.175 1.850   -8.664  1.00 0.00 ? 14  VAL A N    2  
ATOM   3071  C  CA   . VAL A 1 14 ? 134.983 1.230   -8.069  1.00 0.00 ? 14  VAL A CA   2  
ATOM   3072  C  C    . VAL A 1 14 ? 134.213 2.206   -7.183  1.00 0.00 ? 14  VAL A C    2  
ATOM   3073  O  O    . VAL A 1 14 ? 133.004 2.367   -7.340  1.00 0.00 ? 14  VAL A O    2  
ATOM   3074  C  CB   . VAL A 1 14 ? 135.391 0.034   -7.223  1.00 0.00 ? 14  VAL A CB   2  
ATOM   3075  C  CG1  . VAL A 1 14 ? 134.179 -0.549  -6.501  1.00 0.00 ? 14  VAL A CG1  2  
ATOM   3076  C  CG2  . VAL A 1 14 ? 135.993 -1.036  -8.126  1.00 0.00 ? 14  VAL A CG2  2  
ATOM   3077  H  H    . VAL A 1 14 ? 137.071 1.565   -8.376  1.00 0.00 ? 14  VAL A H    2  
ATOM   3078  H  HA   . VAL A 1 14 ? 134.336 0.877   -8.864  1.00 0.00 ? 14  VAL A HA   2  
ATOM   3079  H  HB   . VAL A 1 14 ? 136.105 0.353   -6.495  1.00 0.00 ? 14  VAL A HB   2  
ATOM   3080  H  HG11 . VAL A 1 14 ? 133.846 0.140   -5.741  1.00 0.00 ? 14  VAL A HG11 2  
ATOM   3081  H  HG12 . VAL A 1 14 ? 134.461 -1.487  -6.039  1.00 0.00 ? 14  VAL A HG12 2  
ATOM   3082  H  HG13 . VAL A 1 14 ? 133.385 -0.720  -7.211  1.00 0.00 ? 14  VAL A HG13 2  
ATOM   3083  H  HG21 . VAL A 1 14 ? 136.355 -1.857  -7.526  1.00 0.00 ? 14  VAL A HG21 2  
ATOM   3084  H  HG22 . VAL A 1 14 ? 136.804 -0.615  -8.693  1.00 0.00 ? 14  VAL A HG22 2  
ATOM   3085  H  HG23 . VAL A 1 14 ? 135.232 -1.389  -8.803  1.00 0.00 ? 14  VAL A HG23 2  
ATOM   3086  N  N    . PHE A 1 15 ? 134.912 2.863   -6.246  1.00 0.00 ? 15  PHE A N    2  
ATOM   3087  C  CA   . PHE A 1 15 ? 134.226 3.812   -5.360  1.00 0.00 ? 15  PHE A CA   2  
ATOM   3088  C  C    . PHE A 1 15 ? 133.749 5.046   -6.117  1.00 0.00 ? 15  PHE A C    2  
ATOM   3089  O  O    . PHE A 1 15 ? 132.610 5.481   -5.959  1.00 0.00 ? 15  PHE A O    2  
ATOM   3090  C  CB   . PHE A 1 15 ? 135.122 4.183   -4.175  1.00 0.00 ? 15  PHE A CB   2  
ATOM   3091  C  CG   . PHE A 1 15 ? 135.234 2.967   -3.275  1.00 0.00 ? 15  PHE A CG   2  
ATOM   3092  C  CD1  . PHE A 1 15 ? 134.196 2.673   -2.386  1.00 0.00 ? 15  PHE A CD1  2  
ATOM   3093  C  CD2  . PHE A 1 15 ? 136.350 2.126   -3.340  1.00 0.00 ? 15  PHE A CD2  2  
ATOM   3094  C  CE1  . PHE A 1 15 ? 134.268 1.539   -1.568  1.00 0.00 ? 15  PHE A CE1  2  
ATOM   3095  C  CE2  . PHE A 1 15 ? 136.426 0.995   -2.519  1.00 0.00 ? 15  PHE A CE2  2  
ATOM   3096  C  CZ   . PHE A 1 15 ? 135.382 0.699   -1.635  1.00 0.00 ? 15  PHE A CZ   2  
ATOM   3097  H  H    . PHE A 1 15 ? 135.886 2.706   -6.150  1.00 0.00 ? 15  PHE A H    2  
ATOM   3098  H  HA   . PHE A 1 15 ? 133.350 3.326   -4.959  1.00 0.00 ? 15  PHE A HA   2  
ATOM   3099  H  HB2  . PHE A 1 15 ? 136.102 4.466   -4.534  1.00 0.00 ? 15  PHE A HB2  2  
ATOM   3100  H  HB3  . PHE A 1 15 ? 134.682 5.002   -3.625  1.00 0.00 ? 15  PHE A HB3  2  
ATOM   3101  H  HD1  . PHE A 1 15 ? 133.340 3.320   -2.332  1.00 0.00 ? 15  PHE A HD1  2  
ATOM   3102  H  HD2  . PHE A 1 15 ? 137.155 2.354   -4.010  1.00 0.00 ? 15  PHE A HD2  2  
ATOM   3103  H  HE1  . PHE A 1 15 ? 133.464 1.316   -0.883  1.00 0.00 ? 15  PHE A HE1  2  
ATOM   3104  H  HE2  . PHE A 1 15 ? 137.288 0.347   -2.573  1.00 0.00 ? 15  PHE A HE2  2  
ATOM   3105  H  HZ   . PHE A 1 15 ? 135.440 -0.175  -1.006  1.00 0.00 ? 15  PHE A HZ   2  
ATOM   3106  N  N    . HIS A 1 16 ? 134.616 5.582   -6.957  1.00 0.00 ? 16  HIS A N    2  
ATOM   3107  C  CA   . HIS A 1 16 ? 134.282 6.751   -7.764  1.00 0.00 ? 16  HIS A CA   2  
ATOM   3108  C  C    . HIS A 1 16 ? 133.113 6.456   -8.699  1.00 0.00 ? 16  HIS A C    2  
ATOM   3109  O  O    . HIS A 1 16 ? 132.257 7.309   -8.933  1.00 0.00 ? 16  HIS A O    2  
ATOM   3110  C  CB   . HIS A 1 16 ? 135.498 7.165   -8.596  1.00 0.00 ? 16  HIS A CB   2  
ATOM   3111  C  CG   . HIS A 1 16 ? 135.198 8.435   -9.342  1.00 0.00 ? 16  HIS A CG   2  
ATOM   3112  N  ND1  . HIS A 1 16 ? 135.021 9.649   -8.696  1.00 0.00 ? 16  HIS A ND1  2  
ATOM   3113  C  CD2  . HIS A 1 16 ? 135.050 8.699   -10.681 1.00 0.00 ? 16  HIS A CD2  2  
ATOM   3114  C  CE1  . HIS A 1 16 ? 134.780 10.578  -9.639  1.00 0.00 ? 16  HIS A CE1  2  
ATOM   3115  N  NE2  . HIS A 1 16 ? 134.786 10.052  -10.866 1.00 0.00 ? 16  HIS A NE2  2  
ATOM   3116  H  H    . HIS A 1 16 ? 135.502 5.175   -7.054  1.00 0.00 ? 16  HIS A H    2  
ATOM   3117  H  HA   . HIS A 1 16 ? 134.014 7.566   -7.110  1.00 0.00 ? 16  HIS A HA   2  
ATOM   3118  H  HB2  . HIS A 1 16 ? 136.345 7.323   -7.943  1.00 0.00 ? 16  HIS A HB2  2  
ATOM   3119  H  HB3  . HIS A 1 16 ? 135.731 6.383   -9.304  1.00 0.00 ? 16  HIS A HB3  2  
ATOM   3120  H  HD1  . HIS A 1 16 ? 135.062 9.802   -7.728  1.00 0.00 ? 16  HIS A HD1  2  
ATOM   3121  H  HD2  . HIS A 1 16 ? 135.126 7.966   -11.471 1.00 0.00 ? 16  HIS A HD2  2  
ATOM   3122  H  HE1  . HIS A 1 16 ? 134.611 11.623  -9.430  1.00 0.00 ? 16  HIS A HE1  2  
ATOM   3123  H  HE2  . HIS A 1 16 ? 134.637 10.519  -11.715 1.00 0.00 ? 16  HIS A HE2  2  
ATOM   3124  N  N    . ALA A 1 17 ? 133.116 5.252   -9.263  1.00 0.00 ? 17  ALA A N    2  
ATOM   3125  C  CA   . ALA A 1 17 ? 132.087 4.853   -10.217 1.00 0.00 ? 17  ALA A CA   2  
ATOM   3126  C  C    . ALA A 1 17 ? 130.684 4.866   -9.612  1.00 0.00 ? 17  ALA A C    2  
ATOM   3127  O  O    . ALA A 1 17 ? 129.732 5.308   -10.255 1.00 0.00 ? 17  ALA A O    2  
ATOM   3128  C  CB   . ALA A 1 17 ? 132.395 3.437   -10.710 1.00 0.00 ? 17  ALA A CB   2  
ATOM   3129  H  H    . ALA A 1 17 ? 133.846 4.629   -9.059  1.00 0.00 ? 17  ALA A H    2  
ATOM   3130  H  HA   . ALA A 1 17 ? 132.111 5.523   -11.061 1.00 0.00 ? 17  ALA A HA   2  
ATOM   3131  H  HB1  . ALA A 1 17 ? 133.191 3.474   -11.438 1.00 0.00 ? 17  ALA A HB1  2  
ATOM   3132  H  HB2  . ALA A 1 17 ? 131.512 3.012   -11.162 1.00 0.00 ? 17  ALA A HB2  2  
ATOM   3133  H  HB3  . ALA A 1 17 ? 132.703 2.821   -9.871  1.00 0.00 ? 17  ALA A HB3  2  
ATOM   3134  N  N    . HIS A 1 18 ? 130.551 4.375   -8.387  1.00 0.00 ? 18  HIS A N    2  
ATOM   3135  C  CA   . HIS A 1 18 ? 129.244 4.337   -7.738  1.00 0.00 ? 18  HIS A CA   2  
ATOM   3136  C  C    . HIS A 1 18 ? 128.926 5.622   -6.975  1.00 0.00 ? 18  HIS A C    2  
ATOM   3137  O  O    . HIS A 1 18 ? 127.759 5.965   -6.793  1.00 0.00 ? 18  HIS A O    2  
ATOM   3138  C  CB   . HIS A 1 18 ? 129.165 3.127   -6.809  1.00 0.00 ? 18  HIS A CB   2  
ATOM   3139  C  CG   . HIS A 1 18 ? 129.250 1.872   -7.639  1.00 0.00 ? 18  HIS A CG   2  
ATOM   3140  N  ND1  . HIS A 1 18 ? 128.203 1.453   -8.445  1.00 0.00 ? 18  HIS A ND1  2  
ATOM   3141  C  CD2  . HIS A 1 18 ? 130.247 0.943   -7.810  1.00 0.00 ? 18  HIS A CD2  2  
ATOM   3142  C  CE1  . HIS A 1 18 ? 128.589 0.320   -9.059  1.00 0.00 ? 18  HIS A CE1  2  
ATOM   3143  N  NE2  . HIS A 1 18 ? 129.827 -0.035  -8.707  1.00 0.00 ? 18  HIS A NE2  2  
ATOM   3144  H  H    . HIS A 1 18 ? 131.336 4.026   -7.916  1.00 0.00 ? 18  HIS A H    2  
ATOM   3145  H  HA   . HIS A 1 18 ? 128.494 4.213   -8.505  1.00 0.00 ? 18  HIS A HA   2  
ATOM   3146  H  HB2  . HIS A 1 18 ? 129.987 3.157   -6.108  1.00 0.00 ? 18  HIS A HB2  2  
ATOM   3147  H  HB3  . HIS A 1 18 ? 128.230 3.141   -6.270  1.00 0.00 ? 18  HIS A HB3  2  
ATOM   3148  H  HD1  . HIS A 1 18 ? 127.337 1.902   -8.550  1.00 0.00 ? 18  HIS A HD1  2  
ATOM   3149  H  HD2  . HIS A 1 18 ? 131.207 0.963   -7.319  1.00 0.00 ? 18  HIS A HD2  2  
ATOM   3150  H  HE1  . HIS A 1 18 ? 127.973 -0.234  -9.751  1.00 0.00 ? 18  HIS A HE1  2  
ATOM   3151  H  HE2  . HIS A 1 18 ? 130.332 -0.817  -9.014  1.00 0.00 ? 18  HIS A HE2  2  
ATOM   3152  N  N    . SER A 1 19 ? 129.958 6.327   -6.518  1.00 0.00 ? 19  SER A N    2  
ATOM   3153  C  CA   . SER A 1 19 ? 129.736 7.562   -5.768  1.00 0.00 ? 19  SER A CA   2  
ATOM   3154  C  C    . SER A 1 19 ? 128.932 8.560   -6.595  1.00 0.00 ? 19  SER A C    2  
ATOM   3155  O  O    . SER A 1 19 ? 128.094 9.292   -6.067  1.00 0.00 ? 19  SER A O    2  
ATOM   3156  C  CB   . SER A 1 19 ? 131.080 8.190   -5.395  1.00 0.00 ? 19  SER A CB   2  
ATOM   3157  O  OG   . SER A 1 19 ? 131.880 7.231   -4.722  1.00 0.00 ? 19  SER A OG   2  
ATOM   3158  H  H    . SER A 1 19 ? 130.873 6.012   -6.679  1.00 0.00 ? 19  SER A H    2  
ATOM   3159  H  HA   . SER A 1 19 ? 129.194 7.333   -4.864  1.00 0.00 ? 19  SER A HA   2  
ATOM   3160  H  HB2  . SER A 1 19 ? 131.590 8.509   -6.287  1.00 0.00 ? 19  SER A HB2  2  
ATOM   3161  H  HB3  . SER A 1 19 ? 130.910 9.046   -4.755  1.00 0.00 ? 19  SER A HB3  2  
ATOM   3162  H  HG   . SER A 1 19 ? 132.713 7.648   -4.494  1.00 0.00 ? 19  SER A HG   2  
ATOM   3163  N  N    . GLY A 1 20 ? 129.205 8.581   -7.894  1.00 0.00 ? 20  GLY A N    2  
ATOM   3164  C  CA   . GLY A 1 20 ? 128.524 9.486   -8.813  1.00 0.00 ? 20  GLY A CA   2  
ATOM   3165  C  C    . GLY A 1 20 ? 127.015 9.282   -8.840  1.00 0.00 ? 20  GLY A C    2  
ATOM   3166  O  O    . GLY A 1 20 ? 126.266 10.221  -9.115  1.00 0.00 ? 20  GLY A O    2  
ATOM   3167  H  H    . GLY A 1 20 ? 129.888 7.974   -8.244  1.00 0.00 ? 20  GLY A H    2  
ATOM   3168  H  HA2  . GLY A 1 20 ? 128.719 10.499  -8.503  1.00 0.00 ? 20  GLY A HA2  2  
ATOM   3169  H  HA3  . GLY A 1 20 ? 128.918 9.341   -9.807  1.00 0.00 ? 20  GLY A HA3  2  
ATOM   3170  N  N    . LYS A 1 21 ? 126.563 8.059   -8.595  1.00 0.00 ? 21  LYS A N    2  
ATOM   3171  C  CA   . LYS A 1 21 ? 125.133 7.785   -8.646  1.00 0.00 ? 21  LYS A CA   2  
ATOM   3172  C  C    . LYS A 1 21 ? 124.363 8.694   -7.694  1.00 0.00 ? 21  LYS A C    2  
ATOM   3173  O  O    . LYS A 1 21 ? 123.271 9.158   -8.027  1.00 0.00 ? 21  LYS A O    2  
ATOM   3174  C  CB   . LYS A 1 21 ? 124.866 6.323   -8.286  1.00 0.00 ? 21  LYS A CB   2  
ATOM   3175  C  CG   . LYS A 1 21 ? 125.532 5.413   -9.319  1.00 0.00 ? 21  LYS A CG   2  
ATOM   3176  C  CD   . LYS A 1 21 ? 125.072 3.969   -9.101  1.00 0.00 ? 21  LYS A CD   2  
ATOM   3177  C  CE   . LYS A 1 21 ? 125.559 3.466   -7.739  1.00 0.00 ? 21  LYS A CE   2  
ATOM   3178  N  NZ   . LYS A 1 21 ? 124.515 3.735   -6.710  1.00 0.00 ? 21  LYS A NZ   2  
ATOM   3179  H  H    . LYS A 1 21 ? 127.194 7.333   -8.407  1.00 0.00 ? 21  LYS A H    2  
ATOM   3180  H  HA   . LYS A 1 21 ? 124.783 7.961   -9.652  1.00 0.00 ? 21  LYS A HA   2  
ATOM   3181  H  HB2  . LYS A 1 21 ? 125.271 6.114   -7.305  1.00 0.00 ? 21  LYS A HB2  2  
ATOM   3182  H  HB3  . LYS A 1 21 ? 123.801 6.142   -8.282  1.00 0.00 ? 21  LYS A HB3  2  
ATOM   3183  H  HG2  . LYS A 1 21 ? 125.256 5.734   -10.312 1.00 0.00 ? 21  LYS A HG2  2  
ATOM   3184  H  HG3  . LYS A 1 21 ? 126.605 5.467   -9.207  1.00 0.00 ? 21  LYS A HG3  2  
ATOM   3185  H  HD2  . LYS A 1 21 ? 123.993 3.927   -9.135  1.00 0.00 ? 21  LYS A HD2  2  
ATOM   3186  H  HD3  . LYS A 1 21 ? 125.480 3.341   -9.880  1.00 0.00 ? 21  LYS A HD3  2  
ATOM   3187  H  HE2  . LYS A 1 21 ? 125.744 2.404   -7.793  1.00 0.00 ? 21  LYS A HE2  2  
ATOM   3188  H  HE3  . LYS A 1 21 ? 126.472 3.976   -7.467  1.00 0.00 ? 21  LYS A HE3  2  
ATOM   3189  H  HZ1  . LYS A 1 21 ? 123.876 4.481   -7.051  1.00 0.00 ? 21  LYS A HZ1  2  
ATOM   3190  H  HZ2  . LYS A 1 21 ? 124.971 4.045   -5.827  1.00 0.00 ? 21  LYS A HZ2  2  
ATOM   3191  H  HZ3  . LYS A 1 21 ? 123.970 2.867   -6.533  1.00 0.00 ? 21  LYS A HZ3  2  
ATOM   3192  N  N    . GLU A 1 22 ? 124.926 8.969   -6.519  1.00 0.00 ? 22  GLU A N    2  
ATOM   3193  C  CA   . GLU A 1 22 ? 124.252 9.850   -5.565  1.00 0.00 ? 22  GLU A CA   2  
ATOM   3194  C  C    . GLU A 1 22 ? 125.215 10.866  -4.949  1.00 0.00 ? 22  GLU A C    2  
ATOM   3195  O  O    . GLU A 1 22 ? 126.365 10.552  -4.639  1.00 0.00 ? 22  GLU A O    2  
ATOM   3196  C  CB   . GLU A 1 22 ? 123.602 9.017   -4.454  1.00 0.00 ? 22  GLU A CB   2  
ATOM   3197  C  CG   . GLU A 1 22 ? 122.558 8.075   -5.061  1.00 0.00 ? 22  GLU A CG   2  
ATOM   3198  C  CD   . GLU A 1 22 ? 121.444 8.878   -5.728  1.00 0.00 ? 22  GLU A CD   2  
ATOM   3199  O  OE1  . GLU A 1 22 ? 121.326 10.055  -5.429  1.00 0.00 ? 22  GLU A OE1  2  
ATOM   3200  O  OE2  . GLU A 1 22 ? 120.726 8.303   -6.529  1.00 0.00 ? 22  GLU A OE2  2  
ATOM   3201  H  H    . GLU A 1 22 ? 125.802 8.590   -6.297  1.00 0.00 ? 22  GLU A H    2  
ATOM   3202  H  HA   . GLU A 1 22 ? 123.475 10.392  -6.083  1.00 0.00 ? 22  GLU A HA   2  
ATOM   3203  H  HB2  . GLU A 1 22 ? 124.357 8.436   -3.949  1.00 0.00 ? 22  GLU A HB2  2  
ATOM   3204  H  HB3  . GLU A 1 22 ? 123.121 9.675   -3.747  1.00 0.00 ? 22  GLU A HB3  2  
ATOM   3205  H  HG2  . GLU A 1 22 ? 123.032 7.443   -5.797  1.00 0.00 ? 22  GLU A HG2  2  
ATOM   3206  H  HG3  . GLU A 1 22 ? 122.135 7.461   -4.280  1.00 0.00 ? 22  GLU A HG3  2  
ATOM   3207  N  N    . GLY A 1 23 ? 124.710 12.075  -4.739  1.00 0.00 ? 23  GLY A N    2  
ATOM   3208  C  CA   . GLY A 1 23 ? 125.487 13.141  -4.115  1.00 0.00 ? 23  GLY A CA   2  
ATOM   3209  C  C    . GLY A 1 23 ? 126.782 13.458  -4.861  1.00 0.00 ? 23  GLY A C    2  
ATOM   3210  O  O    . GLY A 1 23 ? 126.840 13.437  -6.090  1.00 0.00 ? 23  GLY A O    2  
ATOM   3211  H  H    . GLY A 1 23 ? 123.776 12.249  -4.983  1.00 0.00 ? 23  GLY A H    2  
ATOM   3212  H  HA2  . GLY A 1 23 ? 124.882 14.035  -4.077  1.00 0.00 ? 23  GLY A HA2  2  
ATOM   3213  H  HA3  . GLY A 1 23 ? 125.731 12.845  -3.105  1.00 0.00 ? 23  GLY A HA3  2  
ATOM   3214  N  N    . ASP A 1 24 ? 127.811 13.760  -4.073  1.00 0.00 ? 24  ASP A N    2  
ATOM   3215  C  CA   . ASP A 1 24 ? 129.135 14.102  -4.587  1.00 0.00 ? 24  ASP A CA   2  
ATOM   3216  C  C    . ASP A 1 24 ? 129.970 12.859  -4.887  1.00 0.00 ? 24  ASP A C    2  
ATOM   3217  O  O    . ASP A 1 24 ? 130.055 11.940  -4.067  1.00 0.00 ? 24  ASP A O    2  
ATOM   3218  C  CB   . ASP A 1 24 ? 129.873 14.986  -3.579  1.00 0.00 ? 24  ASP A CB   2  
ATOM   3219  C  CG   . ASP A 1 24 ? 131.192 15.466  -4.174  1.00 0.00 ? 24  ASP A CG   2  
ATOM   3220  O  OD1  . ASP A 1 24 ? 131.426 15.196  -5.342  1.00 0.00 ? 24  ASP A OD1  2  
ATOM   3221  O  OD2  . ASP A 1 24 ? 131.949 16.097  -3.455  1.00 0.00 ? 24  ASP A OD2  2  
ATOM   3222  H  H    . ASP A 1 24 ? 127.673 13.758  -3.103  1.00 0.00 ? 24  ASP A H    2  
ATOM   3223  H  HA   . ASP A 1 24 ? 129.013 14.661  -5.503  1.00 0.00 ? 24  ASP A HA   2  
ATOM   3224  H  HB2  . ASP A 1 24 ? 129.258 15.839  -3.334  1.00 0.00 ? 24  ASP A HB2  2  
ATOM   3225  H  HB3  . ASP A 1 24 ? 130.071 14.418  -2.684  1.00 0.00 ? 24  ASP A HB3  2  
ATOM   3226  N  N    . LYS A 1 25 ? 130.589 12.839  -6.064  1.00 0.00 ? 25  LYS A N    2  
ATOM   3227  C  CA   . LYS A 1 25 ? 131.428 11.710  -6.465  1.00 0.00 ? 25  LYS A CA   2  
ATOM   3228  C  C    . LYS A 1 25 ? 132.518 11.467  -5.428  1.00 0.00 ? 25  LYS A C    2  
ATOM   3229  O  O    . LYS A 1 25 ? 132.920 10.333  -5.167  1.00 0.00 ? 25  LYS A O    2  
ATOM   3230  C  CB   . LYS A 1 25 ? 132.169 12.072  -7.764  1.00 0.00 ? 25  LYS A CB   2  
ATOM   3231  C  CG   . LYS A 1 25 ? 131.206 12.274  -8.924  1.00 0.00 ? 25  LYS A CG   2  
ATOM   3232  C  CD   . LYS A 1 25 ? 131.995 12.569  -10.200 1.00 0.00 ? 25  LYS A CD   2  
ATOM   3233  C  CE   . LYS A 1 25 ? 131.025 12.897  -11.336 1.00 0.00 ? 25  LYS A CE   2  
ATOM   3234  N  NZ   . LYS A 1 25 ? 131.796 13.334  -12.535 1.00 0.00 ? 25  LYS A NZ   2  
ATOM   3235  H  H    . LYS A 1 25 ? 130.486 13.600  -6.673  1.00 0.00 ? 25  LYS A H    2  
ATOM   3236  H  HA   . LYS A 1 25 ? 130.834 10.824  -6.613  1.00 0.00 ? 25  LYS A HA   2  
ATOM   3237  H  HB2  . LYS A 1 25 ? 132.723 12.983  -7.611  1.00 0.00 ? 25  LYS A HB2  2  
ATOM   3238  H  HB3  . LYS A 1 25 ? 132.857 11.277  -8.010  1.00 0.00 ? 25  LYS A HB3  2  
ATOM   3239  H  HG2  . LYS A 1 25 ? 130.652 11.377  -9.065  1.00 0.00 ? 25  LYS A HG2  2  
ATOM   3240  H  HG3  . LYS A 1 25 ? 130.537 13.093  -8.712  1.00 0.00 ? 25  LYS A HG3  2  
ATOM   3241  H  HD2  . LYS A 1 25 ? 132.651 13.411  -10.030 1.00 0.00 ? 25  LYS A HD2  2  
ATOM   3242  H  HD3  . LYS A 1 25 ? 132.582 11.703  -10.468 1.00 0.00 ? 25  LYS A HD3  2  
ATOM   3243  H  HE2  . LYS A 1 25 ? 130.448 12.017  -11.582 1.00 0.00 ? 25  LYS A HE2  2  
ATOM   3244  H  HE3  . LYS A 1 25 ? 130.361 13.689  -11.026 1.00 0.00 ? 25  LYS A HE3  2  
ATOM   3245  H  HZ1  . LYS A 1 25 ? 131.151 13.781  -13.217 1.00 0.00 ? 25  LYS A HZ1  2  
ATOM   3246  H  HZ2  . LYS A 1 25 ? 132.250 12.508  -12.976 1.00 0.00 ? 25  LYS A HZ2  2  
ATOM   3247  H  HZ3  . LYS A 1 25 ? 132.523 14.020  -12.248 1.00 0.00 ? 25  LYS A HZ3  2  
ATOM   3248  N  N    . TYR A 1 26 ? 133.030 12.567  -4.908  1.00 0.00 ? 26  TYR A N    2  
ATOM   3249  C  CA   . TYR A 1 26 ? 134.134 12.549  -3.961  1.00 0.00 ? 26  TYR A CA   2  
ATOM   3250  C  C    . TYR A 1 26 ? 133.717 12.006  -2.594  1.00 0.00 ? 26  TYR A C    2  
ATOM   3251  O  O    . TYR A 1 26 ? 134.561 11.574  -1.808  1.00 0.00 ? 26  TYR A O    2  
ATOM   3252  C  CB   . TYR A 1 26 ? 134.673 13.973  -3.845  1.00 0.00 ? 26  TYR A CB   2  
ATOM   3253  C  CG   . TYR A 1 26 ? 135.072 14.506  -5.226  1.00 0.00 ? 26  TYR A CG   2  
ATOM   3254  C  CD1  . TYR A 1 26 ? 134.932 13.725  -6.407  1.00 0.00 ? 26  TYR A CD1  2  
ATOM   3255  C  CD2  . TYR A 1 26 ? 135.528 15.826  -5.335  1.00 0.00 ? 26  TYR A CD2  2  
ATOM   3256  C  CE1  . TYR A 1 26 ? 135.246 14.269  -7.652  1.00 0.00 ? 26  TYR A CE1  2  
ATOM   3257  C  CE2  . TYR A 1 26 ? 135.856 16.360  -6.589  1.00 0.00 ? 26  TYR A CE2  2  
ATOM   3258  C  CZ   . TYR A 1 26 ? 135.713 15.584  -7.746  1.00 0.00 ? 26  TYR A CZ   2  
ATOM   3259  O  OH   . TYR A 1 26 ? 136.023 16.119  -8.979  1.00 0.00 ? 26  TYR A OH   2  
ATOM   3260  H  H    . TYR A 1 26 ? 132.686 13.433  -5.211  1.00 0.00 ? 26  TYR A H    2  
ATOM   3261  H  HA   . TYR A 1 26 ? 134.920 11.917  -4.346  1.00 0.00 ? 26  TYR A HA   2  
ATOM   3262  H  HB2  . TYR A 1 26 ? 133.910 14.610  -3.423  1.00 0.00 ? 26  TYR A HB2  2  
ATOM   3263  H  HB3  . TYR A 1 26 ? 135.539 13.976  -3.199  1.00 0.00 ? 26  TYR A HB3  2  
ATOM   3264  H  HD1  . TYR A 1 26 ? 134.600 12.708  -6.368  1.00 0.00 ? 26  TYR A HD1  2  
ATOM   3265  H  HD2  . TYR A 1 26 ? 135.641 16.431  -4.447  1.00 0.00 ? 26  TYR A HD2  2  
ATOM   3266  H  HE1  . TYR A 1 26 ? 135.118 13.665  -8.545  1.00 0.00 ? 26  TYR A HE1  2  
ATOM   3267  H  HE2  . TYR A 1 26 ? 136.215 17.377  -6.664  1.00 0.00 ? 26  TYR A HE2  2  
ATOM   3268  H  HH   . TYR A 1 26 ? 136.696 16.792  -8.849  1.00 0.00 ? 26  TYR A HH   2  
ATOM   3269  N  N    . LYS A 1 27 ? 132.419 12.045  -2.305  1.00 0.00 ? 27  LYS A N    2  
ATOM   3270  C  CA   . LYS A 1 27 ? 131.915 11.568  -1.014  1.00 0.00 ? 27  LYS A CA   2  
ATOM   3271  C  C    . LYS A 1 27 ? 131.067 10.310  -1.116  1.00 0.00 ? 27  LYS A C    2  
ATOM   3272  O  O    . LYS A 1 27 ? 130.188 10.196  -1.973  1.00 0.00 ? 27  LYS A O    2  
ATOM   3273  C  CB   . LYS A 1 27 ? 131.015 12.630  -0.374  1.00 0.00 ? 27  LYS A CB   2  
ATOM   3274  C  CG   . LYS A 1 27 ? 131.767 13.927  -0.067  1.00 0.00 ? 27  LYS A CG   2  
ATOM   3275  C  CD   . LYS A 1 27 ? 132.769 13.669  1.063   1.00 0.00 ? 27  LYS A CD   2  
ATOM   3276  C  CE   . LYS A 1 27 ? 133.027 14.965  1.831   1.00 0.00 ? 27  LYS A CE   2  
ATOM   3277  N  NZ   . LYS A 1 27 ? 132.764 16.134  0.944   1.00 0.00 ? 27  LYS A NZ   2  
ATOM   3278  H  H    . LYS A 1 27 ? 131.791 12.411  -2.961  1.00 0.00 ? 27  LYS A H    2  
ATOM   3279  H  HA   . LYS A 1 27 ? 132.746 11.383  -0.351  1.00 0.00 ? 27  LYS A HA   2  
ATOM   3280  H  HB2  . LYS A 1 27 ? 130.205 12.851  -1.051  1.00 0.00 ? 27  LYS A HB2  2  
ATOM   3281  H  HB3  . LYS A 1 27 ? 130.601 12.234  0.541   1.00 0.00 ? 27  LYS A HB3  2  
ATOM   3282  H  HG2  . LYS A 1 27 ? 132.297 14.252  -0.952  1.00 0.00 ? 27  LYS A HG2  2  
ATOM   3283  H  HG3  . LYS A 1 27 ? 131.070 14.689  0.234   1.00 0.00 ? 27  LYS A HG3  2  
ATOM   3284  H  HD2  . LYS A 1 27 ? 132.371 12.928  1.741   1.00 0.00 ? 27  LYS A HD2  2  
ATOM   3285  H  HD3  . LYS A 1 27 ? 133.698 13.313  0.643   1.00 0.00 ? 27  LYS A HD3  2  
ATOM   3286  H  HE2  . LYS A 1 27 ? 132.361 15.002  2.692   1.00 0.00 ? 27  LYS A HE2  2  
ATOM   3287  H  HE3  . LYS A 1 27 ? 134.053 14.988  2.167   1.00 0.00 ? 27  LYS A HE3  2  
ATOM   3288  H  HZ1  . LYS A 1 27 ? 133.139 16.998  1.387   1.00 0.00 ? 27  LYS A HZ1  2  
ATOM   3289  H  HZ2  . LYS A 1 27 ? 131.738 16.236  0.800   1.00 0.00 ? 27  LYS A HZ2  2  
ATOM   3290  H  HZ3  . LYS A 1 27 ? 133.231 15.987  0.028   1.00 0.00 ? 27  LYS A HZ3  2  
ATOM   3291  N  N    . LEU A 1 28 ? 131.273 9.420   -0.145  1.00 0.00 ? 28  LEU A N    2  
ATOM   3292  C  CA   . LEU A 1 28 ? 130.458 8.223   -0.023  1.00 0.00 ? 28  LEU A CA   2  
ATOM   3293  C  C    . LEU A 1 28 ? 129.457 8.460   1.092   1.00 0.00 ? 28  LEU A C    2  
ATOM   3294  O  O    . LEU A 1 28 ? 129.808 8.941   2.169   1.00 0.00 ? 28  LEU A O    2  
ATOM   3295  C  CB   . LEU A 1 28 ? 131.299 6.961   0.275   1.00 0.00 ? 28  LEU A CB   2  
ATOM   3296  C  CG   . LEU A 1 28 ? 132.263 6.658   -0.876  1.00 0.00 ? 28  LEU A CG   2  
ATOM   3297  C  CD1  . LEU A 1 28 ? 133.023 5.369   -0.573  1.00 0.00 ? 28  LEU A CD1  2  
ATOM   3298  C  CD2  . LEU A 1 28 ? 131.460 6.471   -2.160  1.00 0.00 ? 28  LEU A CD2  2  
ATOM   3299  H  H    . LEU A 1 28 ? 131.934 9.619   0.550   1.00 0.00 ? 28  LEU A H    2  
ATOM   3300  H  HA   . LEU A 1 28 ? 129.910 8.075   -0.942  1.00 0.00 ? 28  LEU A HA   2  
ATOM   3301  H  HB2  . LEU A 1 28 ? 131.872 7.117   1.178   1.00 0.00 ? 28  LEU A HB2  2  
ATOM   3302  H  HB3  . LEU A 1 28 ? 130.640 6.118   0.415   1.00 0.00 ? 28  LEU A HB3  2  
ATOM   3303  H  HG   . LEU A 1 28 ? 132.960 7.459   -1.001  1.00 0.00 ? 28  LEU A HG   2  
ATOM   3304  H  HD11 . LEU A 1 28 ? 133.408 5.407   0.435   1.00 0.00 ? 28  LEU A HD11 2  
ATOM   3305  H  HD12 . LEU A 1 28 ? 133.843 5.265   -1.268  1.00 0.00 ? 28  LEU A HD12 2  
ATOM   3306  H  HD13 . LEU A 1 28 ? 132.355 4.526   -0.672  1.00 0.00 ? 28  LEU A HD13 2  
ATOM   3307  H  HD21 . LEU A 1 28 ? 132.030 5.877   -2.859  1.00 0.00 ? 28  LEU A HD21 2  
ATOM   3308  H  HD22 . LEU A 1 28 ? 131.251 7.435   -2.593  1.00 0.00 ? 28  LEU A HD22 2  
ATOM   3309  H  HD23 . LEU A 1 28 ? 130.531 5.966   -1.932  1.00 0.00 ? 28  LEU A HD23 2  
ATOM   3310  N  N    . SER A 1 29 ? 128.211 8.120   0.827   1.00 0.00 ? 29  SER A N    2  
ATOM   3311  C  CA   . SER A 1 29 ? 127.151 8.293   1.804   1.00 0.00 ? 29  SER A CA   2  
ATOM   3312  C  C    . SER A 1 29 ? 126.866 6.948   2.431   1.00 0.00 ? 29  SER A C    2  
ATOM   3313  O  O    . SER A 1 29 ? 127.283 5.927   1.903   1.00 0.00 ? 29  SER A O    2  
ATOM   3314  C  CB   . SER A 1 29 ? 125.893 8.849   1.140   1.00 0.00 ? 29  SER A CB   2  
ATOM   3315  O  OG   . SER A 1 29 ? 126.198 10.101  0.537   1.00 0.00 ? 29  SER A OG   2  
ATOM   3316  H  H    . SER A 1 29 ? 127.995 7.742   -0.050  1.00 0.00 ? 29  SER A H    2  
ATOM   3317  H  HA   . SER A 1 29 ? 127.480 8.978   2.573   1.00 0.00 ? 29  SER A HA   2  
ATOM   3318  H  HB2  . SER A 1 29 ? 125.546 8.165   0.385   1.00 0.00 ? 29  SER A HB2  2  
ATOM   3319  H  HB3  . SER A 1 29 ? 125.123 8.981   1.888   1.00 0.00 ? 29  SER A HB3  2  
ATOM   3320  H  HG   . SER A 1 29 ? 126.064 10.786  1.195   1.00 0.00 ? 29  SER A HG   2  
ATOM   3321  N  N    . LYS A 1 30 ? 126.192 6.924   3.563   1.00 0.00 ? 30  LYS A N    2  
ATOM   3322  C  CA   . LYS A 1 30 ? 125.937 5.649   4.199   1.00 0.00 ? 30  LYS A CA   2  
ATOM   3323  C  C    . LYS A 1 30 ? 125.320 4.697   3.184   1.00 0.00 ? 30  LYS A C    2  
ATOM   3324  O  O    . LYS A 1 30 ? 125.677 3.519   3.140   1.00 0.00 ? 30  LYS A O    2  
ATOM   3325  C  CB   . LYS A 1 30 ? 124.976 5.838   5.372   1.00 0.00 ? 30  LYS A CB   2  
ATOM   3326  C  CG   . LYS A 1 30 ? 124.796 4.510   6.104   1.00 0.00 ? 30  LYS A CG   2  
ATOM   3327  C  CD   . LYS A 1 30 ? 123.777 4.687   7.229   1.00 0.00 ? 30  LYS A CD   2  
ATOM   3328  C  CE   . LYS A 1 30 ? 123.703 3.404   8.053   1.00 0.00 ? 30  LYS A CE   2  
ATOM   3329  N  NZ   . LYS A 1 30 ? 122.466 3.418   8.884   1.00 0.00 ? 30  LYS A NZ   2  
ATOM   3330  H  H    . LYS A 1 30 ? 125.893 7.755   3.979   1.00 0.00 ? 30  LYS A H    2  
ATOM   3331  H  HA   . LYS A 1 30 ? 126.865 5.236   4.562   1.00 0.00 ? 30  LYS A HA   2  
ATOM   3332  H  HB2  . LYS A 1 30 ? 125.378 6.574   6.052   1.00 0.00 ? 30  LYS A HB2  2  
ATOM   3333  H  HB3  . LYS A 1 30 ? 124.019 6.175   5.001   1.00 0.00 ? 30  LYS A HB3  2  
ATOM   3334  H  HG2  . LYS A 1 30 ? 124.443 3.761   5.411   1.00 0.00 ? 30  LYS A HG2  2  
ATOM   3335  H  HG3  . LYS A 1 30 ? 125.741 4.199   6.523   1.00 0.00 ? 30  LYS A HG3  2  
ATOM   3336  H  HD2  . LYS A 1 30 ? 124.079 5.508   7.863   1.00 0.00 ? 30  LYS A HD2  2  
ATOM   3337  H  HD3  . LYS A 1 30 ? 122.805 4.897   6.806   1.00 0.00 ? 30  LYS A HD3  2  
ATOM   3338  H  HE2  . LYS A 1 30 ? 123.684 2.551   7.391   1.00 0.00 ? 30  LYS A HE2  2  
ATOM   3339  H  HE3  . LYS A 1 30 ? 124.569 3.341   8.694   1.00 0.00 ? 30  LYS A HE3  2  
ATOM   3340  H  HZ1  . LYS A 1 30 ? 121.812 4.139   8.520   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM   3341  H  HZ2  . LYS A 1 30 ? 122.714 3.639   9.870   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM   3342  H  HZ3  . LYS A 1 30 ? 122.009 2.485   8.841   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM   3343  N  N    . LYS A 1 31 ? 124.425 5.206   2.344   1.00 0.00 ? 31  LYS A N    2  
ATOM   3344  C  CA   . LYS A 1 31 ? 123.824 4.361   1.318   1.00 0.00 ? 31  LYS A CA   2  
ATOM   3345  C  C    . LYS A 1 31 ? 124.853 3.828   0.332   1.00 0.00 ? 31  LYS A C    2  
ATOM   3346  O  O    . LYS A 1 31 ? 124.882 2.631   0.032   1.00 0.00 ? 31  LYS A O    2  
ATOM   3347  C  CB   . LYS A 1 31 ? 122.854 5.176   0.470   1.00 0.00 ? 31  LYS A CB   2  
ATOM   3348  C  CG   . LYS A 1 31 ? 122.219 4.258   -0.585  1.00 0.00 ? 31  LYS A CG   2  
ATOM   3349  C  CD   . LYS A 1 31 ? 121.466 5.096   -1.597  1.00 0.00 ? 31  LYS A CD   2  
ATOM   3350  C  CE   . LYS A 1 31 ? 120.894 4.169   -2.662  1.00 0.00 ? 31  LYS A CE   2  
ATOM   3351  N  NZ   . LYS A 1 31 ? 119.795 3.350   -2.077  1.00 0.00 ? 31  LYS A NZ   2  
ATOM   3352  H  H    . LYS A 1 31 ? 124.189 6.156   2.396   1.00 0.00 ? 31  LYS A H    2  
ATOM   3353  H  HA   . LYS A 1 31 ? 123.292 3.544   1.778   1.00 0.00 ? 31  LYS A HA   2  
ATOM   3354  H  HB2  . LYS A 1 31 ? 122.081 5.592   1.102   1.00 0.00 ? 31  LYS A HB2  2  
ATOM   3355  H  HB3  . LYS A 1 31 ? 123.386 5.974   -0.023  1.00 0.00 ? 31  LYS A HB3  2  
ATOM   3356  H  HG2  . LYS A 1 31 ? 122.974 3.690   -1.102  1.00 0.00 ? 31  LYS A HG2  2  
ATOM   3357  H  HG3  . LYS A 1 31 ? 121.530 3.582   -0.103  1.00 0.00 ? 31  LYS A HG3  2  
ATOM   3358  H  HD2  . LYS A 1 31 ? 120.669 5.642   -1.109  1.00 0.00 ? 31  LYS A HD2  2  
ATOM   3359  H  HD3  . LYS A 1 31 ? 122.160 5.786   -2.061  1.00 0.00 ? 31  LYS A HD3  2  
ATOM   3360  H  HE2  . LYS A 1 31 ? 120.514 4.755   -3.485  1.00 0.00 ? 31  LYS A HE2  2  
ATOM   3361  H  HE3  . LYS A 1 31 ? 121.685 3.516   -3.017  1.00 0.00 ? 31  LYS A HE3  2  
ATOM   3362  H  HZ1  . LYS A 1 31 ? 119.170 3.014   -2.837  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM   3363  H  HZ2  . LYS A 1 31 ? 119.249 3.931   -1.409  1.00 0.00 ? 31  LYS A HZ2  2  
ATOM   3364  H  HZ3  . LYS A 1 31 ? 120.198 2.532   -1.579  1.00 0.00 ? 31  LYS A HZ3  2  
ATOM   3365  N  N    . GLU A 1 32 ? 125.647 4.738   -0.229  1.00 0.00 ? 32  GLU A N    2  
ATOM   3366  C  CA   . GLU A 1 32 ? 126.600 4.334   -1.246  1.00 0.00 ? 32  GLU A CA   2  
ATOM   3367  C  C    . GLU A 1 32 ? 127.638 3.388   -0.674  1.00 0.00 ? 32  GLU A C    2  
ATOM   3368  O  O    . GLU A 1 32 ? 128.032 2.407   -1.305  1.00 0.00 ? 32  GLU A O    2  
ATOM   3369  C  CB   . GLU A 1 32 ? 127.349 5.555   -1.786  1.00 0.00 ? 32  GLU A CB   2  
ATOM   3370  C  CG   . GLU A 1 32 ? 126.394 6.504   -2.508  1.00 0.00 ? 32  GLU A CG   2  
ATOM   3371  C  CD   . GLU A 1 32 ? 127.185 7.675   -3.088  1.00 0.00 ? 32  GLU A CD   2  
ATOM   3372  O  OE1  . GLU A 1 32 ? 128.349 7.805   -2.748  1.00 0.00 ? 32  GLU A OE1  2  
ATOM   3373  O  OE2  . GLU A 1 32 ? 126.622 8.419   -3.868  1.00 0.00 ? 32  GLU A OE2  2  
ATOM   3374  H  H    . GLU A 1 32 ? 125.548 5.685   0.002   1.00 0.00 ? 32  GLU A H    2  
ATOM   3375  H  HA   . GLU A 1 32 ? 126.051 3.863   -2.059  1.00 0.00 ? 32  GLU A HA   2  
ATOM   3376  H  HB2  . GLU A 1 32 ? 127.818 6.076   -0.961  1.00 0.00 ? 32  GLU A HB2  2  
ATOM   3377  H  HB3  . GLU A 1 32 ? 128.112 5.226   -2.476  1.00 0.00 ? 32  GLU A HB3  2  
ATOM   3378  H  HG2  . GLU A 1 32 ? 125.894 5.974   -3.307  1.00 0.00 ? 32  GLU A HG2  2  
ATOM   3379  H  HG3  . GLU A 1 32 ? 125.660 6.878   -1.809  1.00 0.00 ? 32  GLU A HG3  2  
ATOM   3380  N  N    . LEU A 1 33 ? 128.076 3.713   0.531   1.00 0.00 ? 33  LEU A N    2  
ATOM   3381  C  CA   . LEU A 1 33 ? 129.075 2.924   1.216   1.00 0.00 ? 33  LEU A CA   2  
ATOM   3382  C  C    . LEU A 1 33 ? 128.519 1.537   1.506   1.00 0.00 ? 33  LEU A C    2  
ATOM   3383  O  O    . LEU A 1 33 ? 129.192 0.522   1.320   1.00 0.00 ? 33  LEU A O    2  
ATOM   3384  C  CB   . LEU A 1 33 ? 129.425 3.646   2.517   1.00 0.00 ? 33  LEU A CB   2  
ATOM   3385  C  CG   . LEU A 1 33 ? 130.670 3.035   3.162   1.00 0.00 ? 33  LEU A CG   2  
ATOM   3386  C  CD1  . LEU A 1 33 ? 131.377 4.114   3.979   1.00 0.00 ? 33  LEU A CD1  2  
ATOM   3387  C  CD2  . LEU A 1 33 ? 130.275 1.885   4.097   1.00 0.00 ? 33  LEU A CD2  2  
ATOM   3388  H  H    . LEU A 1 33 ? 127.720 4.514   0.968   1.00 0.00 ? 33  LEU A H    2  
ATOM   3389  H  HA   . LEU A 1 33 ? 129.961 2.850   0.597   1.00 0.00 ? 33  LEU A HA   2  
ATOM   3390  H  HB2  . LEU A 1 33 ? 129.608 4.689   2.299   1.00 0.00 ? 33  LEU A HB2  2  
ATOM   3391  H  HB3  . LEU A 1 33 ? 128.591 3.571   3.199   1.00 0.00 ? 33  LEU A HB3  2  
ATOM   3392  H  HG   . LEU A 1 33 ? 131.336 2.671   2.393   1.00 0.00 ? 33  LEU A HG   2  
ATOM   3393  H  HD11 . LEU A 1 33 ? 130.712 4.474   4.752   1.00 0.00 ? 33  LEU A HD11 2  
ATOM   3394  H  HD12 . LEU A 1 33 ? 131.650 4.935   3.330   1.00 0.00 ? 33  LEU A HD12 2  
ATOM   3395  H  HD13 . LEU A 1 33 ? 132.263 3.700   4.430   1.00 0.00 ? 33  LEU A HD13 2  
ATOM   3396  H  HD21 . LEU A 1 33 ? 129.476 2.206   4.750   1.00 0.00 ? 33  LEU A HD21 2  
ATOM   3397  H  HD22 . LEU A 1 33 ? 131.129 1.599   4.692   1.00 0.00 ? 33  LEU A HD22 2  
ATOM   3398  H  HD23 . LEU A 1 33 ? 129.946 1.039   3.514   1.00 0.00 ? 33  LEU A HD23 2  
ATOM   3399  N  N    . LYS A 1 34 ? 127.259 1.515   1.930   1.00 0.00 ? 34  LYS A N    2  
ATOM   3400  C  CA   . LYS A 1 34 ? 126.571 0.266   2.216   1.00 0.00 ? 34  LYS A CA   2  
ATOM   3401  C  C    . LYS A 1 34 ? 126.472 -0.615  0.992   1.00 0.00 ? 34  LYS A C    2  
ATOM   3402  O  O    . LYS A 1 34 ? 126.760 -1.812  1.048   1.00 0.00 ? 34  LYS A O    2  
ATOM   3403  C  CB   . LYS A 1 34 ? 125.182 0.601   2.778   1.00 0.00 ? 34  LYS A CB   2  
ATOM   3404  C  CG   . LYS A 1 34 ? 124.283 -0.639  2.823   1.00 0.00 ? 34  LYS A CG   2  
ATOM   3405  C  CD   . LYS A 1 34 ? 124.930 -1.732  3.650   1.00 0.00 ? 34  LYS A CD   2  
ATOM   3406  C  CE   . LYS A 1 34 ? 123.883 -2.786  4.034   1.00 0.00 ? 34  LYS A CE   2  
ATOM   3407  N  NZ   . LYS A 1 34 ? 122.677 -2.638  3.168   1.00 0.00 ? 34  LYS A NZ   2  
ATOM   3408  H  H    . LYS A 1 34 ? 126.774 2.360   2.029   1.00 0.00 ? 34  LYS A H    2  
ATOM   3409  H  HA   . LYS A 1 34 ? 127.125 -0.264  2.976   1.00 0.00 ? 34  LYS A HA   2  
ATOM   3410  H  HB2  . LYS A 1 34 ? 125.296 0.986   3.784   1.00 0.00 ? 34  LYS A HB2  2  
ATOM   3411  H  HB3  . LYS A 1 34 ? 124.719 1.355   2.158   1.00 0.00 ? 34  LYS A HB3  2  
ATOM   3412  H  HG2  . LYS A 1 34 ? 123.335 -0.374  3.267   1.00 0.00 ? 34  LYS A HG2  2  
ATOM   3413  H  HG3  . LYS A 1 34 ? 124.116 -1.000  1.819   1.00 0.00 ? 34  LYS A HG3  2  
ATOM   3414  H  HD2  . LYS A 1 34 ? 125.694 -2.194  3.039   1.00 0.00 ? 34  LYS A HD2  2  
ATOM   3415  H  HD3  . LYS A 1 34 ? 125.374 -1.310  4.539   1.00 0.00 ? 34  LYS A HD3  2  
ATOM   3416  H  HE2  . LYS A 1 34 ? 124.299 -3.773  3.908   1.00 0.00 ? 34  LYS A HE2  2  
ATOM   3417  H  HE3  . LYS A 1 34 ? 123.599 -2.648  5.066   1.00 0.00 ? 34  LYS A HE3  2  
ATOM   3418  H  HZ1  . LYS A 1 34 ? 122.171 -3.544  3.121   1.00 0.00 ? 34  LYS A HZ1  2  
ATOM   3419  H  HZ2  . LYS A 1 34 ? 122.971 -2.352  2.212   1.00 0.00 ? 34  LYS A HZ2  2  
ATOM   3420  H  HZ3  . LYS A 1 34 ? 122.050 -1.913  3.569   1.00 0.00 ? 34  LYS A HZ3  2  
ATOM   3421  N  N    . GLU A 1 35 ? 126.073 -0.026  -0.112  1.00 0.00 ? 35  GLU A N    2  
ATOM   3422  C  CA   . GLU A 1 35 ? 125.951 -0.779  -1.339  1.00 0.00 ? 35  GLU A CA   2  
ATOM   3423  C  C    . GLU A 1 35 ? 127.311 -1.199  -1.889  1.00 0.00 ? 35  GLU A C    2  
ATOM   3424  O  O    . GLU A 1 35 ? 127.451 -2.305  -2.396  1.00 0.00 ? 35  GLU A O    2  
ATOM   3425  C  CB   . GLU A 1 35 ? 125.167 0.062   -2.331  1.00 0.00 ? 35  GLU A CB   2  
ATOM   3426  C  CG   . GLU A 1 35 ? 123.751 0.223   -1.774  1.00 0.00 ? 35  GLU A CG   2  
ATOM   3427  C  CD   . GLU A 1 35 ? 123.029 -1.120  -1.764  1.00 0.00 ? 35  GLU A CD   2  
ATOM   3428  O  OE1  . GLU A 1 35 ? 123.494 -2.026  -2.435  1.00 0.00 ? 35  GLU A OE1  2  
ATOM   3429  O  OE2  . GLU A 1 35 ? 122.022 -1.224  -1.083  1.00 0.00 ? 35  GLU A OE2  2  
ATOM   3430  H  H    . GLU A 1 35 ? 125.860 0.934   -0.104  1.00 0.00 ? 35  GLU A H    2  
ATOM   3431  H  HA   . GLU A 1 35 ? 125.387 -1.673  -1.131  1.00 0.00 ? 35  GLU A HA   2  
ATOM   3432  H  HB2  . GLU A 1 35 ? 125.635 1.031   -2.440  1.00 0.00 ? 35  GLU A HB2  2  
ATOM   3433  H  HB3  . GLU A 1 35 ? 125.126 -0.437  -3.286  1.00 0.00 ? 35  GLU A HB3  2  
ATOM   3434  H  HG2  . GLU A 1 35 ? 123.823 0.580   -0.748  1.00 0.00 ? 35  GLU A HG2  2  
ATOM   3435  H  HG3  . GLU A 1 35 ? 123.198 0.932   -2.373  1.00 0.00 ? 35  GLU A HG3  2  
ATOM   3436  N  N    . LEU A 1 36 ? 128.318 -0.329  -1.780  1.00 0.00 ? 36  LEU A N    2  
ATOM   3437  C  CA   . LEU A 1 36 ? 129.650 -0.682  -2.278  1.00 0.00 ? 36  LEU A CA   2  
ATOM   3438  C  C    . LEU A 1 36 ? 130.262 -1.837  -1.508  1.00 0.00 ? 36  LEU A C    2  
ATOM   3439  O  O    . LEU A 1 36 ? 130.757 -2.786  -2.108  1.00 0.00 ? 36  LEU A O    2  
ATOM   3440  C  CB   . LEU A 1 36 ? 130.571 0.536   -2.186  1.00 0.00 ? 36  LEU A CB   2  
ATOM   3441  C  CG   . LEU A 1 36 ? 130.165 1.556   -3.262  1.00 0.00 ? 36  LEU A CG   2  
ATOM   3442  C  CD1  . LEU A 1 36 ? 130.741 2.951   -2.940  1.00 0.00 ? 36  LEU A CD1  2  
ATOM   3443  C  CD2  . LEU A 1 36 ? 130.692 1.075   -4.640  1.00 0.00 ? 36  LEU A CD2  2  
ATOM   3444  H  H    . LEU A 1 36 ? 128.169 0.543   -1.360  1.00 0.00 ? 36  LEU A H    2  
ATOM   3445  H  HA   . LEU A 1 36 ? 129.571 -0.970  -3.312  1.00 0.00 ? 36  LEU A HA   2  
ATOM   3446  H  HB2  . LEU A 1 36 ? 130.471 0.979   -1.206  1.00 0.00 ? 36  LEU A HB2  2  
ATOM   3447  H  HB3  . LEU A 1 36 ? 131.595 0.232   -2.342  1.00 0.00 ? 36  LEU A HB3  2  
ATOM   3448  H  HG   . LEU A 1 36 ? 129.086 1.619   -3.298  1.00 0.00 ? 36  LEU A HG   2  
ATOM   3449  H  HD11 . LEU A 1 36 ? 131.520 3.195   -3.645  1.00 0.00 ? 36  LEU A HD11 2  
ATOM   3450  H  HD12 . LEU A 1 36 ? 131.146 2.966   -1.940  1.00 0.00 ? 36  LEU A HD12 2  
ATOM   3451  H  HD13 . LEU A 1 36 ? 129.953 3.685   -3.014  1.00 0.00 ? 36  LEU A HD13 2  
ATOM   3452  H  HD21 . LEU A 1 36 ? 131.150 0.099   -4.550  1.00 0.00 ? 36  LEU A HD21 2  
ATOM   3453  H  HD22 . LEU A 1 36 ? 131.430 1.771   -5.019  1.00 0.00 ? 36  LEU A HD22 2  
ATOM   3454  H  HD23 . LEU A 1 36 ? 129.867 1.017   -5.328  1.00 0.00 ? 36  LEU A HD23 2  
ATOM   3455  N  N    . LEU A 1 37 ? 130.207 -1.781  -0.183  1.00 0.00 ? 37  LEU A N    2  
ATOM   3456  C  CA   . LEU A 1 37 ? 130.764 -2.866  0.610   1.00 0.00 ? 37  LEU A CA   2  
ATOM   3457  C  C    . LEU A 1 37 ? 129.909 -4.124  0.534   1.00 0.00 ? 37  LEU A C    2  
ATOM   3458  O  O    . LEU A 1 37 ? 130.421 -5.226  0.299   1.00 0.00 ? 37  LEU A O    2  
ATOM   3459  C  CB   . LEU A 1 37 ? 130.908 -2.410  2.070   1.00 0.00 ? 37  LEU A CB   2  
ATOM   3460  C  CG   . LEU A 1 37 ? 132.222 -1.628  2.259   1.00 0.00 ? 37  LEU A CG   2  
ATOM   3461  C  CD1  . LEU A 1 37 ? 132.178 -0.296  1.508   1.00 0.00 ? 37  LEU A CD1  2  
ATOM   3462  C  CD2  . LEU A 1 37 ? 132.444 -1.351  3.752   1.00 0.00 ? 37  LEU A CD2  2  
ATOM   3463  H  H    . LEU A 1 37 ? 129.784 -1.014  0.260   1.00 0.00 ? 37  LEU A H    2  
ATOM   3464  H  HA   . LEU A 1 37 ? 131.746 -3.098  0.229   1.00 0.00 ? 37  LEU A HA   2  
ATOM   3465  H  HB2  . LEU A 1 37 ? 130.075 -1.768  2.320   1.00 0.00 ? 37  LEU A HB2  2  
ATOM   3466  H  HB3  . LEU A 1 37 ? 130.897 -3.268  2.720   1.00 0.00 ? 37  LEU A HB3  2  
ATOM   3467  H  HG   . LEU A 1 37 ? 133.045 -2.215  1.880   1.00 0.00 ? 37  LEU A HG   2  
ATOM   3468  H  HD11 . LEU A 1 37 ? 133.121 0.219   1.644   1.00 0.00 ? 37  LEU A HD11 2  
ATOM   3469  H  HD12 . LEU A 1 37 ? 131.380 0.313   1.899   1.00 0.00 ? 37  LEU A HD12 2  
ATOM   3470  H  HD13 . LEU A 1 37 ? 132.019 -0.475  0.457   1.00 0.00 ? 37  LEU A HD13 2  
ATOM   3471  H  HD21 . LEU A 1 37 ? 131.971 -0.418  4.022   1.00 0.00 ? 37  LEU A HD21 2  
ATOM   3472  H  HD22 . LEU A 1 37 ? 133.503 -1.286  3.952   1.00 0.00 ? 37  LEU A HD22 2  
ATOM   3473  H  HD23 . LEU A 1 37 ? 132.018 -2.150  4.340   1.00 0.00 ? 37  LEU A HD23 2  
ATOM   3474  N  N    . GLN A 1 38 ? 128.605 -3.953  0.721   1.00 0.00 ? 38  GLN A N    2  
ATOM   3475  C  CA   . GLN A 1 38 ? 127.685 -5.079  0.679   1.00 0.00 ? 38  GLN A CA   2  
ATOM   3476  C  C    . GLN A 1 38 ? 127.650 -5.757  -0.680  1.00 0.00 ? 38  GLN A C    2  
ATOM   3477  O  O    . GLN A 1 38 ? 127.618 -6.985  -0.767  1.00 0.00 ? 38  GLN A O    2  
ATOM   3478  C  CB   . GLN A 1 38 ? 126.277 -4.599  1.025   1.00 0.00 ? 38  GLN A CB   2  
ATOM   3479  C  CG   . GLN A 1 38 ? 125.336 -5.799  1.098   1.00 0.00 ? 38  GLN A CG   2  
ATOM   3480  C  CD   . GLN A 1 38 ? 123.930 -5.343  1.464   1.00 0.00 ? 38  GLN A CD   2  
ATOM   3481  O  OE1  . GLN A 1 38 ? 123.713 -4.167  1.742   1.00 0.00 ? 38  GLN A OE1  2  
ATOM   3482  N  NE2  . GLN A 1 38 ? 122.957 -6.211  1.482   1.00 0.00 ? 38  GLN A NE2  2  
ATOM   3483  H  H    . GLN A 1 38 ? 128.257 -3.052  0.895   1.00 0.00 ? 38  GLN A H    2  
ATOM   3484  H  HA   . GLN A 1 38 ? 127.989 -5.803  1.420   1.00 0.00 ? 38  GLN A HA   2  
ATOM   3485  H  HB2  . GLN A 1 38 ? 126.296 -4.098  1.981   1.00 0.00 ? 38  GLN A HB2  2  
ATOM   3486  H  HB3  . GLN A 1 38 ? 125.930 -3.916  0.266   1.00 0.00 ? 38  GLN A HB3  2  
ATOM   3487  H  HG2  . GLN A 1 38 ? 125.310 -6.279  0.138   1.00 0.00 ? 38  GLN A HG2  2  
ATOM   3488  H  HG3  . GLN A 1 38 ? 125.695 -6.495  1.838   1.00 0.00 ? 38  GLN A HG3  2  
ATOM   3489  H  HE21 . GLN A 1 38 ? 123.132 -7.149  1.261   1.00 0.00 ? 38  GLN A HE21 2  
ATOM   3490  H  HE22 . GLN A 1 38 ? 122.049 -5.924  1.716   1.00 0.00 ? 38  GLN A HE22 2  
ATOM   3491  N  N    . THR A 1 39 ? 127.624 -4.961  -1.739  1.00 0.00 ? 39  THR A N    2  
ATOM   3492  C  CA   . THR A 1 39 ? 127.554 -5.526  -3.075  1.00 0.00 ? 39  THR A CA   2  
ATOM   3493  C  C    . THR A 1 39 ? 128.914 -5.989  -3.593  1.00 0.00 ? 39  THR A C    2  
ATOM   3494  O  O    . THR A 1 39 ? 129.010 -7.058  -4.194  1.00 0.00 ? 39  THR A O    2  
ATOM   3495  C  CB   . THR A 1 39 ? 126.913 -4.522  -4.049  1.00 0.00 ? 39  THR A CB   2  
ATOM   3496  O  OG1  . THR A 1 39 ? 126.199 -5.234  -5.050  1.00 0.00 ? 39  THR A OG1  2  
ATOM   3497  C  CG2  . THR A 1 39 ? 127.984 -3.654  -4.714  1.00 0.00 ? 39  THR A CG2  2  
ATOM   3498  H  H    . THR A 1 39 ? 127.628 -3.988  -1.620  1.00 0.00 ? 39  THR A H    2  
ATOM   3499  H  HA   . THR A 1 39 ? 126.910 -6.392  -3.025  1.00 0.00 ? 39  THR A HA   2  
ATOM   3500  H  HB   . THR A 1 39 ? 126.229 -3.887  -3.508  1.00 0.00 ? 39  THR A HB   2  
ATOM   3501  H  HG1  . THR A 1 39 ? 125.816 -4.593  -5.652  1.00 0.00 ? 39  THR A HG1  2  
ATOM   3502  H  HG21 . THR A 1 39 ? 127.516 -2.801  -5.184  1.00 0.00 ? 39  THR A HG21 2  
ATOM   3503  H  HG22 . THR A 1 39 ? 128.508 -4.235  -5.458  1.00 0.00 ? 39  THR A HG22 2  
ATOM   3504  H  HG23 . THR A 1 39 ? 128.682 -3.314  -3.969  1.00 0.00 ? 39  THR A HG23 2  
ATOM   3505  N  N    . GLU A 1 40 ? 129.964 -5.183  -3.405  1.00 0.00 ? 40  GLU A N    2  
ATOM   3506  C  CA   . GLU A 1 40 ? 131.263 -5.585  -3.929  1.00 0.00 ? 40  GLU A CA   2  
ATOM   3507  C  C    . GLU A 1 40 ? 131.848 -6.744  -3.123  1.00 0.00 ? 40  GLU A C    2  
ATOM   3508  O  O    . GLU A 1 40 ? 132.488 -7.629  -3.687  1.00 0.00 ? 40  GLU A O    2  
ATOM   3509  C  CB   . GLU A 1 40 ? 132.249 -4.415  -3.890  1.00 0.00 ? 40  GLU A CB   2  
ATOM   3510  C  CG   . GLU A 1 40 ? 131.760 -3.254  -4.769  1.00 0.00 ? 40  GLU A CG   2  
ATOM   3511  C  CD   . GLU A 1 40 ? 131.611 -3.690  -6.225  1.00 0.00 ? 40  GLU A CD   2  
ATOM   3512  O  OE1  . GLU A 1 40 ? 132.176 -4.705  -6.586  1.00 0.00 ? 40  GLU A OE1  2  
ATOM   3513  O  OE2  . GLU A 1 40 ? 130.930 -2.994  -6.961  1.00 0.00 ? 40  GLU A OE2  2  
ATOM   3514  H  H    . GLU A 1 40 ? 129.859 -4.319  -2.945  1.00 0.00 ? 40  GLU A H    2  
ATOM   3515  H  HA   . GLU A 1 40 ? 131.139 -5.901  -4.952  1.00 0.00 ? 40  GLU A HA   2  
ATOM   3516  H  HB2  . GLU A 1 40 ? 132.371 -4.078  -2.875  1.00 0.00 ? 40  GLU A HB2  2  
ATOM   3517  H  HB3  . GLU A 1 40 ? 133.194 -4.752  -4.259  1.00 0.00 ? 40  GLU A HB3  2  
ATOM   3518  H  HG2  . GLU A 1 40 ? 130.812 -2.906  -4.404  1.00 0.00 ? 40  GLU A HG2  2  
ATOM   3519  H  HG3  . GLU A 1 40 ? 132.476 -2.447  -4.714  1.00 0.00 ? 40  GLU A HG3  2  
ATOM   3520  N  N    . LEU A 1 41 ? 131.608 -6.753  -1.806  1.00 0.00 ? 41  LEU A N    2  
ATOM   3521  C  CA   . LEU A 1 41 ? 132.110 -7.834  -0.951  1.00 0.00 ? 41  LEU A CA   2  
ATOM   3522  C  C    . LEU A 1 41 ? 130.965 -8.491  -0.196  1.00 0.00 ? 41  LEU A C    2  
ATOM   3523  O  O    . LEU A 1 41 ? 130.920 -8.458  1.040   1.00 0.00 ? 41  LEU A O    2  
ATOM   3524  C  CB   . LEU A 1 41 ? 133.151 -7.294  0.030   1.00 0.00 ? 41  LEU A CB   2  
ATOM   3525  C  CG   . LEU A 1 41 ? 134.327 -6.670  -0.739  1.00 0.00 ? 41  LEU A CG   2  
ATOM   3526  C  CD1  . LEU A 1 41 ? 135.391 -6.154  0.249   1.00 0.00 ? 41  LEU A CD1  2  
ATOM   3527  C  CD2  . LEU A 1 41 ? 134.957 -7.729  -1.659  1.00 0.00 ? 41  LEU A CD2  2  
ATOM   3528  H  H    . LEU A 1 41 ? 131.073 -6.028  -1.399  1.00 0.00 ? 41  LEU A H    2  
ATOM   3529  H  HA   . LEU A 1 41 ? 132.578 -8.583  -1.575  1.00 0.00 ? 41  LEU A HA   2  
ATOM   3530  H  HB2  . LEU A 1 41 ? 132.692 -6.547  0.652   1.00 0.00 ? 41  LEU A HB2  2  
ATOM   3531  H  HB3  . LEU A 1 41 ? 133.517 -8.102  0.648   1.00 0.00 ? 41  LEU A HB3  2  
ATOM   3532  H  HG   . LEU A 1 41 ? 133.963 -5.846  -1.335  1.00 0.00 ? 41  LEU A HG   2  
ATOM   3533  H  HD11 . LEU A 1 41 ? 135.234 -6.597  1.223   1.00 0.00 ? 41  LEU A HD11 2  
ATOM   3534  H  HD12 . LEU A 1 41 ? 135.312 -5.081  0.328   1.00 0.00 ? 41  LEU A HD12 2  
ATOM   3535  H  HD13 . LEU A 1 41 ? 136.379 -6.411  -0.106  1.00 0.00 ? 41  LEU A HD13 2  
ATOM   3536  H  HD21 . LEU A 1 41 ? 134.475 -7.701  -2.623  1.00 0.00 ? 41  LEU A HD21 2  
ATOM   3537  H  HD22 . LEU A 1 41 ? 134.833 -8.710  -1.224  1.00 0.00 ? 41  LEU A HD22 2  
ATOM   3538  H  HD23 . LEU A 1 41 ? 136.011 -7.522  -1.781  1.00 0.00 ? 41  LEU A HD23 2  
ATOM   3539  N  N    . SER A 1 42 ? 130.047 -9.087  -0.948  1.00 0.00 ? 42  SER A N    2  
ATOM   3540  C  CA   . SER A 1 42 ? 128.891 -9.747  -0.359  1.00 0.00 ? 42  SER A CA   2  
ATOM   3541  C  C    . SER A 1 42 ? 129.330 -10.862 0.577   1.00 0.00 ? 42  SER A C    2  
ATOM   3542  O  O    . SER A 1 42 ? 128.600 -11.229 1.495   1.00 0.00 ? 42  SER A O    2  
ATOM   3543  C  CB   . SER A 1 42 ? 128.002 -10.325 -1.461  1.00 0.00 ? 42  SER A CB   2  
ATOM   3544  O  OG   . SER A 1 42 ? 128.686 -11.393 -2.105  1.00 0.00 ? 42  SER A OG   2  
ATOM   3545  H  H    . SER A 1 42 ? 130.147 -9.077  -1.923  1.00 0.00 ? 42  SER A H    2  
ATOM   3546  H  HA   . SER A 1 42 ? 128.323 -9.023  0.203   1.00 0.00 ? 42  SER A HA   2  
ATOM   3547  H  HB2  . SER A 1 42 ? 127.088 -10.697 -1.030  1.00 0.00 ? 42  SER A HB2  2  
ATOM   3548  H  HB3  . SER A 1 42 ? 127.770 -9.547  -2.178  1.00 0.00 ? 42  SER A HB3  2  
ATOM   3549  H  HG   . SER A 1 42 ? 128.510 -11.332 -3.046  1.00 0.00 ? 42  SER A HG   2  
ATOM   3550  N  N    . GLY A 1 43 ? 130.518 -11.403 0.337   1.00 0.00 ? 43  GLY A N    2  
ATOM   3551  C  CA   . GLY A 1 43 ? 131.033 -12.480 1.170   1.00 0.00 ? 43  GLY A CA   2  
ATOM   3552  C  C    . GLY A 1 43 ? 131.748 -11.940 2.408   1.00 0.00 ? 43  GLY A C    2  
ATOM   3553  O  O    . GLY A 1 43 ? 131.260 -12.083 3.529   1.00 0.00 ? 43  GLY A O    2  
ATOM   3554  H  H    . GLY A 1 43 ? 131.055 -11.073 -0.413  1.00 0.00 ? 43  GLY A H    2  
ATOM   3555  H  HA2  . GLY A 1 43 ? 130.211 -13.108 1.483   1.00 0.00 ? 43  GLY A HA2  2  
ATOM   3556  H  HA3  . GLY A 1 43 ? 131.728 -13.071 0.594   1.00 0.00 ? 43  GLY A HA3  2  
ATOM   3557  N  N    . PHE A 1 44 ? 132.915 -11.335 2.200   1.00 0.00 ? 44  PHE A N    2  
ATOM   3558  C  CA   . PHE A 1 44 ? 133.698 -10.798 3.311   1.00 0.00 ? 44  PHE A CA   2  
ATOM   3559  C  C    . PHE A 1 44 ? 132.926 -9.767  4.146   1.00 0.00 ? 44  PHE A C    2  
ATOM   3560  O  O    . PHE A 1 44 ? 132.994 -9.789  5.375   1.00 0.00 ? 44  PHE A O    2  
ATOM   3561  C  CB   . PHE A 1 44 ? 134.998 -10.178 2.779   1.00 0.00 ? 44  PHE A CB   2  
ATOM   3562  C  CG   . PHE A 1 44 ? 135.819 -9.698  3.950   1.00 0.00 ? 44  PHE A CG   2  
ATOM   3563  C  CD1  . PHE A 1 44 ? 136.455 -10.620 4.779   1.00 0.00 ? 44  PHE A CD1  2  
ATOM   3564  C  CD2  . PHE A 1 44 ? 135.930 -8.331  4.211   1.00 0.00 ? 44  PHE A CD2  2  
ATOM   3565  C  CE1  . PHE A 1 44 ? 137.194 -10.177 5.885   1.00 0.00 ? 44  PHE A CE1  2  
ATOM   3566  C  CE2  . PHE A 1 44 ? 136.673 -7.884  5.308   1.00 0.00 ? 44  PHE A CE2  2  
ATOM   3567  C  CZ   . PHE A 1 44 ? 137.301 -8.808  6.148   1.00 0.00 ? 44  PHE A CZ   2  
ATOM   3568  H  H    . PHE A 1 44 ? 133.262 -11.261 1.287   1.00 0.00 ? 44  PHE A H    2  
ATOM   3569  H  HA   . PHE A 1 44 ? 133.971 -11.618 3.956   1.00 0.00 ? 44  PHE A HA   2  
ATOM   3570  H  HB2  . PHE A 1 44 ? 135.555 -10.922 2.225   1.00 0.00 ? 44  PHE A HB2  2  
ATOM   3571  H  HB3  . PHE A 1 44 ? 134.767 -9.344  2.135   1.00 0.00 ? 44  PHE A HB3  2  
ATOM   3572  H  HD1  . PHE A 1 44 ? 136.375 -11.673 4.568   1.00 0.00 ? 44  PHE A HD1  2  
ATOM   3573  H  HD2  . PHE A 1 44 ? 135.457 -7.620  3.555   1.00 0.00 ? 44  PHE A HD2  2  
ATOM   3574  H  HE1  . PHE A 1 44 ? 137.686 -10.891 6.527   1.00 0.00 ? 44  PHE A HE1  2  
ATOM   3575  H  HE2  . PHE A 1 44 ? 136.755 -6.828  5.511   1.00 0.00 ? 44  PHE A HE2  2  
ATOM   3576  H  HZ   . PHE A 1 44 ? 137.868 -8.464  6.999   1.00 0.00 ? 44  PHE A HZ   2  
ATOM   3577  N  N    . LEU A 1 45 ? 132.210 -8.859  3.487   1.00 0.00 ? 45  LEU A N    2  
ATOM   3578  C  CA   . LEU A 1 45 ? 131.452 -7.820  4.197   1.00 0.00 ? 45  LEU A CA   2  
ATOM   3579  C  C    . LEU A 1 45 ? 130.005 -8.211  4.487   1.00 0.00 ? 45  LEU A C    2  
ATOM   3580  O  O    . LEU A 1 45 ? 129.269 -7.419  5.074   1.00 0.00 ? 45  LEU A O    2  
ATOM   3581  C  CB   . LEU A 1 45 ? 131.538 -6.488  3.448   1.00 0.00 ? 45  LEU A CB   2  
ATOM   3582  C  CG   . LEU A 1 45 ? 133.016 -6.087  3.305   1.00 0.00 ? 45  LEU A CG   2  
ATOM   3583  C  CD1  . LEU A 1 45 ? 133.122 -4.734  2.606   1.00 0.00 ? 45  LEU A CD1  2  
ATOM   3584  C  CD2  . LEU A 1 45 ? 133.667 -5.964  4.694   1.00 0.00 ? 45  LEU A CD2  2  
ATOM   3585  H  H    . LEU A 1 45 ? 132.191 -8.876  2.500   1.00 0.00 ? 45  LEU A H    2  
ATOM   3586  H  HA   . LEU A 1 45 ? 131.919 -7.683  5.157   1.00 0.00 ? 45  LEU A HA   2  
ATOM   3587  H  HB2  . LEU A 1 45 ? 131.093 -6.595  2.468   1.00 0.00 ? 45  LEU A HB2  2  
ATOM   3588  H  HB3  . LEU A 1 45 ? 131.011 -5.726  4.003   1.00 0.00 ? 45  LEU A HB3  2  
ATOM   3589  H  HG   . LEU A 1 45 ? 133.535 -6.834  2.727   1.00 0.00 ? 45  LEU A HG   2  
ATOM   3590  H  HD11 . LEU A 1 45 ? 132.383 -4.667  1.826   1.00 0.00 ? 45  LEU A HD11 2  
ATOM   3591  H  HD12 . LEU A 1 45 ? 134.106 -4.628  2.180   1.00 0.00 ? 45  LEU A HD12 2  
ATOM   3592  H  HD13 . LEU A 1 45 ? 132.960 -3.949  3.327   1.00 0.00 ? 45  LEU A HD13 2  
ATOM   3593  H  HD21 . LEU A 1 45 ? 133.980 -6.936  5.044   1.00 0.00 ? 45  LEU A HD21 2  
ATOM   3594  H  HD22 . LEU A 1 45 ? 132.953 -5.548  5.389   1.00 0.00 ? 45  LEU A HD22 2  
ATOM   3595  H  HD23 . LEU A 1 45 ? 134.527 -5.313  4.632   1.00 0.00 ? 45  LEU A HD23 2  
ATOM   3596  N  N    . ASP A 1 46 ? 129.589 -9.402  4.052   1.00 0.00 ? 46  ASP A N    2  
ATOM   3597  C  CA   . ASP A 1 46 ? 128.204 -9.848  4.258   1.00 0.00 ? 46  ASP A CA   2  
ATOM   3598  C  C    . ASP A 1 46 ? 127.582 -9.174  5.483   1.00 0.00 ? 46  ASP A C    2  
ATOM   3599  O  O    . ASP A 1 46 ? 127.861 -9.536  6.626   1.00 0.00 ? 46  ASP A O    2  
ATOM   3600  C  CB   . ASP A 1 46 ? 128.175 -11.365 4.469   1.00 0.00 ? 46  ASP A CB   2  
ATOM   3601  C  CG   . ASP A 1 46 ? 126.731 -11.853 4.545   1.00 0.00 ? 46  ASP A CG   2  
ATOM   3602  O  OD1  . ASP A 1 46 ? 125.842 -11.045 4.329   1.00 0.00 ? 46  ASP A OD1  2  
ATOM   3603  O  OD2  . ASP A 1 46 ? 126.537 -13.025 4.818   1.00 0.00 ? 46  ASP A OD2  2  
ATOM   3604  H  H    . ASP A 1 46 ? 130.213 -9.981  3.569   1.00 0.00 ? 46  ASP A H    2  
ATOM   3605  H  HA   . ASP A 1 46 ? 127.620 -9.605  3.385   1.00 0.00 ? 46  ASP A HA   2  
ATOM   3606  H  HB2  . ASP A 1 46 ? 128.677 -11.854 3.651   1.00 0.00 ? 46  ASP A HB2  2  
ATOM   3607  H  HB3  . ASP A 1 46 ? 128.678 -11.606 5.393   1.00 0.00 ? 46  ASP A HB3  2  
ATOM   3608  N  N    . ALA A 1 47 ? 126.743 -8.178  5.210   1.00 0.00 ? 47  ALA A N    2  
ATOM   3609  C  CA   . ALA A 1 47 ? 126.065 -7.411  6.253   1.00 0.00 ? 47  ALA A CA   2  
ATOM   3610  C  C    . ALA A 1 47 ? 125.104 -8.276  7.062   1.00 0.00 ? 47  ALA A C    2  
ATOM   3611  O  O    . ALA A 1 47 ? 124.737 -7.924  8.182   1.00 0.00 ? 47  ALA A O    2  
ATOM   3612  C  CB   . ALA A 1 47 ? 125.294 -6.251  5.621   1.00 0.00 ? 47  ALA A CB   2  
ATOM   3613  H  H    . ALA A 1 47 ? 126.580 -7.944  4.273   1.00 0.00 ? 47  ALA A H    2  
ATOM   3614  H  HA   . ALA A 1 47 ? 126.809 -7.004  6.921   1.00 0.00 ? 47  ALA A HA   2  
ATOM   3615  H  HB1  . ALA A 1 47 ? 124.460 -6.639  5.055   1.00 0.00 ? 47  ALA A HB1  2  
ATOM   3616  H  HB2  . ALA A 1 47 ? 125.949 -5.698  4.964   1.00 0.00 ? 47  ALA A HB2  2  
ATOM   3617  H  HB3  . ALA A 1 47 ? 124.928 -5.596  6.399   1.00 0.00 ? 47  ALA A HB3  2  
ATOM   3618  N  N    . GLN A 1 48 ? 124.667 -9.385  6.479   1.00 0.00 ? 48  GLN A N    2  
ATOM   3619  C  CA   . GLN A 1 48 ? 123.713 -10.257 7.153   1.00 0.00 ? 48  GLN A CA   2  
ATOM   3620  C  C    . GLN A 1 48 ? 124.223 -10.691 8.525   1.00 0.00 ? 48  GLN A C    2  
ATOM   3621  O  O    . GLN A 1 48 ? 123.440 -10.828 9.463   1.00 0.00 ? 48  GLN A O    2  
ATOM   3622  C  CB   . GLN A 1 48 ? 123.455 -11.498 6.299   1.00 0.00 ? 48  GLN A CB   2  
ATOM   3623  C  CG   . GLN A 1 48 ? 122.766 -11.089 4.996   1.00 0.00 ? 48  GLN A CG   2  
ATOM   3624  C  CD   . GLN A 1 48 ? 122.552 -12.314 4.113   1.00 0.00 ? 48  GLN A CD   2  
ATOM   3625  O  OE1  . GLN A 1 48 ? 123.173 -13.354 4.331   1.00 0.00 ? 48  GLN A OE1  2  
ATOM   3626  N  NE2  . GLN A 1 48 ? 121.705 -12.252 3.122   1.00 0.00 ? 48  GLN A NE2  2  
ATOM   3627  H  H    . GLN A 1 48 ? 124.969 -9.606  5.573   1.00 0.00 ? 48  GLN A H    2  
ATOM   3628  H  HA   . GLN A 1 48 ? 122.783 -9.726  7.280   1.00 0.00 ? 48  GLN A HA   2  
ATOM   3629  H  HB2  . GLN A 1 48 ? 124.396 -11.980 6.073   1.00 0.00 ? 48  GLN A HB2  2  
ATOM   3630  H  HB3  . GLN A 1 48 ? 122.823 -12.184 6.842   1.00 0.00 ? 48  GLN A HB3  2  
ATOM   3631  H  HG2  . GLN A 1 48 ? 121.811 -10.639 5.222   1.00 0.00 ? 48  GLN A HG2  2  
ATOM   3632  H  HG3  . GLN A 1 48 ? 123.385 -10.375 4.473   1.00 0.00 ? 48  GLN A HG3  2  
ATOM   3633  H  HE21 . GLN A 1 48 ? 121.212 -11.423 2.950   1.00 0.00 ? 48  GLN A HE21 2  
ATOM   3634  H  HE22 . GLN A 1 48 ? 121.563 -13.035 2.550   1.00 0.00 ? 48  GLN A HE22 2  
ATOM   3635  N  N    . LYS A 1 49 ? 125.528 -10.904 8.648   1.00 0.00 ? 49  LYS A N    2  
ATOM   3636  C  CA   . LYS A 1 49 ? 126.082 -11.315 9.930   1.00 0.00 ? 49  LYS A CA   2  
ATOM   3637  C  C    . LYS A 1 49 ? 125.791 -10.287 11.019  1.00 0.00 ? 49  LYS A C    2  
ATOM   3638  O  O    . LYS A 1 49 ? 125.508 -10.643 12.162  1.00 0.00 ? 49  LYS A O    2  
ATOM   3639  C  CB   . LYS A 1 49 ? 127.565 -11.545 9.804   1.00 0.00 ? 49  LYS A CB   2  
ATOM   3640  C  CG   . LYS A 1 49 ? 127.742 -12.720 8.863   1.00 0.00 ? 49  LYS A CG   2  
ATOM   3641  C  CD   . LYS A 1 49 ? 129.154 -13.215 8.947   1.00 0.00 ? 49  LYS A CD   2  
ATOM   3642  C  CE   . LYS A 1 49 ? 130.101 -12.173 8.361   1.00 0.00 ? 49  LYS A CE   2  
ATOM   3643  N  NZ   . LYS A 1 49 ? 131.438 -12.786 8.128   1.00 0.00 ? 49  LYS A NZ   2  
ATOM   3644  H  H    . LYS A 1 49 ? 126.119 -10.780 7.876   1.00 0.00 ? 49  LYS A H    2  
ATOM   3645  H  HA   . LYS A 1 49 ? 125.646 -12.261 10.201  1.00 0.00 ? 49  LYS A HA   2  
ATOM   3646  H  HB2  . LYS A 1 49 ? 128.041 -10.664 9.397   1.00 0.00 ? 49  LYS A HB2  2  
ATOM   3647  H  HB3  . LYS A 1 49 ? 127.987 -11.783 10.768  1.00 0.00 ? 49  LYS A HB3  2  
ATOM   3648  H  HG2  . LYS A 1 49 ? 127.068 -13.519 9.134   1.00 0.00 ? 49  LYS A HG2  2  
ATOM   3649  H  HG3  . LYS A 1 49 ? 127.535 -12.403 7.852   1.00 0.00 ? 49  LYS A HG3  2  
ATOM   3650  H  HD2  . LYS A 1 49 ? 129.411 -13.401 9.982   1.00 0.00 ? 49  LYS A HD2  2  
ATOM   3651  H  HD3  . LYS A 1 49 ? 129.209 -14.119 8.398   1.00 0.00 ? 49  LYS A HD3  2  
ATOM   3652  H  HE2  . LYS A 1 49 ? 129.699 -11.812 7.426   1.00 0.00 ? 49  LYS A HE2  2  
ATOM   3653  H  HE3  . LYS A 1 49 ? 130.194 -11.350 9.052   1.00 0.00 ? 49  LYS A HE3  2  
ATOM   3654  H  HZ1  . LYS A 1 49 ? 131.360 -13.520 7.395   1.00 0.00 ? 49  LYS A HZ1  2  
ATOM   3655  H  HZ2  . LYS A 1 49 ? 131.782 -13.214 9.012   1.00 0.00 ? 49  LYS A HZ2  2  
ATOM   3656  H  HZ3  . LYS A 1 49 ? 132.105 -12.055 7.813   1.00 0.00 ? 49  LYS A HZ3  2  
ATOM   3657  N  N    . ASP A 1 50 ? 125.843 -9.010  10.645  1.00 0.00 ? 50  ASP A N    2  
ATOM   3658  C  CA   . ASP A 1 50 ? 125.569 -7.920  11.581  1.00 0.00 ? 50  ASP A CA   2  
ATOM   3659  C  C    . ASP A 1 50 ? 124.802 -6.805  10.872  1.00 0.00 ? 50  ASP A C    2  
ATOM   3660  O  O    . ASP A 1 50 ? 125.386 -6.011  10.135  1.00 0.00 ? 50  ASP A O    2  
ATOM   3661  C  CB   . ASP A 1 50 ? 126.878 -7.359  12.143  1.00 0.00 ? 50  ASP A CB   2  
ATOM   3662  C  CG   . ASP A 1 50 ? 127.568 -8.395  13.026  1.00 0.00 ? 50  ASP A CG   2  
ATOM   3663  O  OD1  . ASP A 1 50 ? 126.919 -9.356  13.399  1.00 0.00 ? 50  ASP A OD1  2  
ATOM   3664  O  OD2  . ASP A 1 50 ? 128.735 -8.204  13.326  1.00 0.00 ? 50  ASP A OD2  2  
ATOM   3665  H  H    . ASP A 1 50 ? 126.060 -8.795  9.713   1.00 0.00 ? 50  ASP A H    2  
ATOM   3666  H  HA   . ASP A 1 50 ? 124.969 -8.297  12.395  1.00 0.00 ? 50  ASP A HA   2  
ATOM   3667  H  HB2  . ASP A 1 50 ? 127.533 -7.097  11.325  1.00 0.00 ? 50  ASP A HB2  2  
ATOM   3668  H  HB3  . ASP A 1 50 ? 126.665 -6.478  12.729  1.00 0.00 ? 50  ASP A HB3  2  
ATOM   3669  N  N    . VAL A 1 51 ? 123.492 -6.760  11.081  1.00 0.00 ? 51  VAL A N    2  
ATOM   3670  C  CA   . VAL A 1 51 ? 122.659 -5.748  10.437  1.00 0.00 ? 51  VAL A CA   2  
ATOM   3671  C  C    . VAL A 1 51 ? 123.037 -4.325  10.860  1.00 0.00 ? 51  VAL A C    2  
ATOM   3672  O  O    . VAL A 1 51 ? 123.041 -3.411  10.035  1.00 0.00 ? 51  VAL A O    2  
ATOM   3673  C  CB   . VAL A 1 51 ? 121.190 -6.000  10.777  1.00 0.00 ? 51  VAL A CB   2  
ATOM   3674  C  CG1  . VAL A 1 51 ? 120.337 -4.844  10.249  1.00 0.00 ? 51  VAL A CG1  2  
ATOM   3675  C  CG2  . VAL A 1 51 ? 120.734 -7.308  10.125  1.00 0.00 ? 51  VAL A CG2  2  
ATOM   3676  H  H    . VAL A 1 51 ? 123.075 -7.426  11.666  1.00 0.00 ? 51  VAL A H    2  
ATOM   3677  H  HA   . VAL A 1 51 ? 122.780 -5.832  9.368   1.00 0.00 ? 51  VAL A HA   2  
ATOM   3678  H  HB   . VAL A 1 51 ? 121.076 -6.071  11.848  1.00 0.00 ? 51  VAL A HB   2  
ATOM   3679  H  HG11 . VAL A 1 51 ? 120.490 -3.973  10.868  1.00 0.00 ? 51  VAL A HG11 2  
ATOM   3680  H  HG12 . VAL A 1 51 ? 119.295 -5.126  10.275  1.00 0.00 ? 51  VAL A HG12 2  
ATOM   3681  H  HG13 . VAL A 1 51 ? 120.625 -4.620  9.233   1.00 0.00 ? 51  VAL A HG13 2  
ATOM   3682  H  HG21 . VAL A 1 51 ? 121.428 -8.096  10.376  1.00 0.00 ? 51  VAL A HG21 2  
ATOM   3683  H  HG22 . VAL A 1 51 ? 120.704 -7.183  9.052   1.00 0.00 ? 51  VAL A HG22 2  
ATOM   3684  H  HG23 . VAL A 1 51 ? 119.750 -7.566  10.485  1.00 0.00 ? 51  VAL A HG23 2  
ATOM   3685  N  N    . ASP A 1 52 ? 123.321 -4.130  12.146  1.00 0.00 ? 52  ASP A N    2  
ATOM   3686  C  CA   . ASP A 1 52 ? 123.659 -2.794  12.644  1.00 0.00 ? 52  ASP A CA   2  
ATOM   3687  C  C    . ASP A 1 52 ? 125.156 -2.495  12.554  1.00 0.00 ? 52  ASP A C    2  
ATOM   3688  O  O    . ASP A 1 52 ? 125.608 -1.447  13.017  1.00 0.00 ? 52  ASP A O    2  
ATOM   3689  C  CB   . ASP A 1 52 ? 123.202 -2.658  14.098  1.00 0.00 ? 52  ASP A CB   2  
ATOM   3690  C  CG   . ASP A 1 52 ? 123.999 -3.607  14.988  1.00 0.00 ? 52  ASP A CG   2  
ATOM   3691  O  OD1  . ASP A 1 52 ? 125.009 -4.112  14.528  1.00 0.00 ? 52  ASP A OD1  2  
ATOM   3692  O  OD2  . ASP A 1 52 ? 123.587 -3.813  16.118  1.00 0.00 ? 52  ASP A OD2  2  
ATOM   3693  H  H    . ASP A 1 52 ? 123.282 -4.884  12.770  1.00 0.00 ? 52  ASP A H    2  
ATOM   3694  H  HA   . ASP A 1 52 ? 123.129 -2.065  12.053  1.00 0.00 ? 52  ASP A HA   2  
ATOM   3695  H  HB2  . ASP A 1 52 ? 123.357 -1.641  14.428  1.00 0.00 ? 52  ASP A HB2  2  
ATOM   3696  H  HB3  . ASP A 1 52 ? 122.153 -2.901  14.167  1.00 0.00 ? 52  ASP A HB3  2  
ATOM   3697  N  N    . ALA A 1 53 ? 125.926 -3.402  11.968  1.00 0.00 ? 53  ALA A N    2  
ATOM   3698  C  CA   . ALA A 1 53 ? 127.367 -3.188  11.845  1.00 0.00 ? 53  ALA A CA   2  
ATOM   3699  C  C    . ALA A 1 53 ? 127.673 -1.976  10.965  1.00 0.00 ? 53  ALA A C    2  
ATOM   3700  O  O    . ALA A 1 53 ? 128.690 -1.304  11.151  1.00 0.00 ? 53  ALA A O    2  
ATOM   3701  C  CB   . ALA A 1 53 ? 128.040 -4.432  11.256  1.00 0.00 ? 53  ALA A CB   2  
ATOM   3702  H  H    . ALA A 1 53 ? 125.525 -4.223  11.613  1.00 0.00 ? 53  ALA A H    2  
ATOM   3703  H  HA   . ALA A 1 53 ? 127.774 -3.012  12.828  1.00 0.00 ? 53  ALA A HA   2  
ATOM   3704  H  HB1  . ALA A 1 53 ? 128.915 -4.142  10.692  1.00 0.00 ? 53  ALA A HB1  2  
ATOM   3705  H  HB2  . ALA A 1 53 ? 127.347 -4.940  10.603  1.00 0.00 ? 53  ALA A HB2  2  
ATOM   3706  H  HB3  . ALA A 1 53 ? 128.333 -5.093  12.056  1.00 0.00 ? 53  ALA A HB3  2  
ATOM   3707  N  N    . VAL A 1 54 ? 126.806 -1.718  9.991   1.00 0.00 ? 54  VAL A N    2  
ATOM   3708  C  CA   . VAL A 1 54 ? 127.023 -0.604  9.075   1.00 0.00 ? 54  VAL A CA   2  
ATOM   3709  C  C    . VAL A 1 54 ? 127.102 0.729   9.813   1.00 0.00 ? 54  VAL A C    2  
ATOM   3710  O  O    . VAL A 1 54 ? 127.969 1.552   9.516   1.00 0.00 ? 54  VAL A O    2  
ATOM   3711  C  CB   . VAL A 1 54 ? 125.883 -0.555  8.060   1.00 0.00 ? 54  VAL A CB   2  
ATOM   3712  C  CG1  . VAL A 1 54 ? 126.004 0.714   7.215   1.00 0.00 ? 54  VAL A CG1  2  
ATOM   3713  C  CG2  . VAL A 1 54 ? 125.966 -1.784  7.154   1.00 0.00 ? 54  VAL A CG2  2  
ATOM   3714  H  H    . VAL A 1 54 ? 126.025 -2.296  9.874   1.00 0.00 ? 54  VAL A H    2  
ATOM   3715  H  HA   . VAL A 1 54 ? 127.946 -0.762  8.539   1.00 0.00 ? 54  VAL A HA   2  
ATOM   3716  H  HB   . VAL A 1 54 ? 124.937 -0.552  8.582   1.00 0.00 ? 54  VAL A HB   2  
ATOM   3717  H  HG11 . VAL A 1 54 ? 127.027 0.836   6.893   1.00 0.00 ? 54  VAL A HG11 2  
ATOM   3718  H  HG12 . VAL A 1 54 ? 125.708 1.569   7.805   1.00 0.00 ? 54  VAL A HG12 2  
ATOM   3719  H  HG13 . VAL A 1 54 ? 125.361 0.632   6.351   1.00 0.00 ? 54  VAL A HG13 2  
ATOM   3720  H  HG21 . VAL A 1 54 ? 126.263 -2.642  7.738   1.00 0.00 ? 54  VAL A HG21 2  
ATOM   3721  H  HG22 . VAL A 1 54 ? 126.693 -1.609  6.376   1.00 0.00 ? 54  VAL A HG22 2  
ATOM   3722  H  HG23 . VAL A 1 54 ? 125.000 -1.967  6.711   1.00 0.00 ? 54  VAL A HG23 2  
ATOM   3723  N  N    . ASP A 1 55 ? 126.209 0.950   10.775  1.00 0.00 ? 55  ASP A N    2  
ATOM   3724  C  CA   . ASP A 1 55 ? 126.238 2.206   11.518  1.00 0.00 ? 55  ASP A CA   2  
ATOM   3725  C  C    . ASP A 1 55 ? 127.563 2.355   12.256  1.00 0.00 ? 55  ASP A C    2  
ATOM   3726  O  O    . ASP A 1 55 ? 128.181 3.426   12.264  1.00 0.00 ? 55  ASP A O    2  
ATOM   3727  C  CB   . ASP A 1 55 ? 125.098 2.234   12.540  1.00 0.00 ? 55  ASP A CB   2  
ATOM   3728  C  CG   . ASP A 1 55 ? 123.750 2.269   11.831  1.00 0.00 ? 55  ASP A CG   2  
ATOM   3729  O  OD1  . ASP A 1 55 ? 123.738 2.495   10.635  1.00 0.00 ? 55  ASP A OD1  2  
ATOM   3730  O  OD2  . ASP A 1 55 ? 122.747 2.071   12.497  1.00 0.00 ? 55  ASP A OD2  2  
ATOM   3731  H  H    . ASP A 1 55 ? 125.534 0.271   10.987  1.00 0.00 ? 55  ASP A H    2  
ATOM   3732  H  HA   . ASP A 1 55 ? 126.117 3.030   10.832  1.00 0.00 ? 55  ASP A HA   2  
ATOM   3733  H  HB2  . ASP A 1 55 ? 125.152 1.351   13.160  1.00 0.00 ? 55  ASP A HB2  2  
ATOM   3734  H  HB3  . ASP A 1 55 ? 125.197 3.113   13.161  1.00 0.00 ? 55  ASP A HB3  2  
ATOM   3735  N  N    . LYS A 1 56 ? 128.005 1.263   12.868  1.00 0.00 ? 56  LYS A N    2  
ATOM   3736  C  CA   . LYS A 1 56 ? 129.258 1.281   13.597  1.00 0.00 ? 56  LYS A CA   2  
ATOM   3737  C  C    . LYS A 1 56 ? 130.418 1.583   12.665  1.00 0.00 ? 56  LYS A C    2  
ATOM   3738  O  O    . LYS A 1 56 ? 131.342 2.311   13.024  1.00 0.00 ? 56  LYS A O    2  
ATOM   3739  C  CB   . LYS A 1 56 ? 129.485 -0.071  14.276  1.00 0.00 ? 56  LYS A CB   2  
ATOM   3740  C  CG   . LYS A 1 56 ? 128.328 -0.379  15.206  1.00 0.00 ? 56  LYS A CG   2  
ATOM   3741  C  CD   . LYS A 1 56 ? 128.294 0.678   16.319  1.00 0.00 ? 56  LYS A CD   2  
ATOM   3742  C  CE   . LYS A 1 56 ? 127.876 0.007   17.608  1.00 0.00 ? 56  LYS A CE   2  
ATOM   3743  N  NZ   . LYS A 1 56 ? 127.597 1.035   18.651  1.00 0.00 ? 56  LYS A NZ   2  
ATOM   3744  H  H    . LYS A 1 56 ? 127.480 0.436   12.824  1.00 0.00 ? 56  LYS A H    2  
ATOM   3745  H  HA   . LYS A 1 56 ? 129.211 2.046   14.357  1.00 0.00 ? 56  LYS A HA   2  
ATOM   3746  H  HB2  . LYS A 1 56 ? 129.568 -0.846  13.532  1.00 0.00 ? 56  LYS A HB2  2  
ATOM   3747  H  HB3  . LYS A 1 56 ? 130.387 -0.038  14.871  1.00 0.00 ? 56  LYS A HB3  2  
ATOM   3748  H  HG2  . LYS A 1 56 ? 127.401 -0.350  14.648  1.00 0.00 ? 56  LYS A HG2  2  
ATOM   3749  H  HG3  . LYS A 1 56 ? 128.464 -1.360  15.634  1.00 0.00 ? 56  LYS A HG3  2  
ATOM   3750  H  HD2  . LYS A 1 56 ? 129.272 1.123   16.446  1.00 0.00 ? 56  LYS A HD2  2  
ATOM   3751  H  HD3  . LYS A 1 56 ? 127.579 1.445   16.066  1.00 0.00 ? 56  LYS A HD3  2  
ATOM   3752  H  HE2  . LYS A 1 56 ? 126.997 -0.590  17.433  1.00 0.00 ? 56  LYS A HE2  2  
ATOM   3753  H  HE3  . LYS A 1 56 ? 128.690 -0.628  17.926  1.00 0.00 ? 56  LYS A HE3  2  
ATOM   3754  H  HZ1  . LYS A 1 56 ? 126.570 1.122   18.784  1.00 0.00 ? 56  LYS A HZ1  2  
ATOM   3755  H  HZ2  . LYS A 1 56 ? 127.988 1.950   18.347  1.00 0.00 ? 56  LYS A HZ2  2  
ATOM   3756  H  HZ3  . LYS A 1 56 ? 128.038 0.747   19.547  1.00 0.00 ? 56  LYS A HZ3  2  
ATOM   3757  N  N    . VAL A 1 57 ? 130.375 1.002   11.468  1.00 0.00 ? 57  VAL A N    2  
ATOM   3758  C  CA   . VAL A 1 57 ? 131.449 1.212   10.512  1.00 0.00 ? 57  VAL A CA   2  
ATOM   3759  C  C    . VAL A 1 57 ? 131.516 2.650   10.026  1.00 0.00 ? 57  VAL A C    2  
ATOM   3760  O  O    . VAL A 1 57 ? 132.589 3.242   9.990   1.00 0.00 ? 57  VAL A O    2  
ATOM   3761  C  CB   . VAL A 1 57 ? 131.271 0.274   9.317   1.00 0.00 ? 57  VAL A CB   2  
ATOM   3762  C  CG1  . VAL A 1 57 ? 132.307 0.612   8.243   1.00 0.00 ? 57  VAL A CG1  2  
ATOM   3763  C  CG2  . VAL A 1 57 ? 131.465 -1.173  9.774   1.00 0.00 ? 57  VAL A CG2  2  
ATOM   3764  H  H    . VAL A 1 57 ? 129.620 0.417   11.236  1.00 0.00 ? 57  VAL A H    2  
ATOM   3765  H  HA   . VAL A 1 57 ? 132.377 0.978   10.993  1.00 0.00 ? 57  VAL A HA   2  
ATOM   3766  H  HB   . VAL A 1 57 ? 130.278 0.396   8.910   1.00 0.00 ? 57  VAL A HB   2  
ATOM   3767  H  HG11 . VAL A 1 57 ? 131.960 1.452   7.660   1.00 0.00 ? 57  VAL A HG11 2  
ATOM   3768  H  HG12 . VAL A 1 57 ? 132.445 -0.242  7.596   1.00 0.00 ? 57  VAL A HG12 2  
ATOM   3769  H  HG13 . VAL A 1 57 ? 133.245 0.863   8.714   1.00 0.00 ? 57  VAL A HG13 2  
ATOM   3770  H  HG21 . VAL A 1 57 ? 130.981 -1.839  9.074   1.00 0.00 ? 57  VAL A HG21 2  
ATOM   3771  H  HG22 . VAL A 1 57 ? 131.029 -1.303  10.753  1.00 0.00 ? 57  VAL A HG22 2  
ATOM   3772  H  HG23 . VAL A 1 57 ? 132.520 -1.399  9.816   1.00 0.00 ? 57  VAL A HG23 2  
ATOM   3773  N  N    . MET A 1 58 ? 130.373 3.213   9.658   1.00 0.00 ? 58  MET A N    2  
ATOM   3774  C  CA   . MET A 1 58 ? 130.350 4.589   9.177   1.00 0.00 ? 58  MET A CA   2  
ATOM   3775  C  C    . MET A 1 58 ? 130.730 5.578   10.280  1.00 0.00 ? 58  MET A C    2  
ATOM   3776  O  O    . MET A 1 58 ? 131.408 6.585   10.023  1.00 0.00 ? 58  MET A O    2  
ATOM   3777  C  CB   . MET A 1 58 ? 128.970 4.914   8.588   1.00 0.00 ? 58  MET A CB   2  
ATOM   3778  C  CG   . MET A 1 58 ? 128.045 5.452   9.676   1.00 0.00 ? 58  MET A CG   2  
ATOM   3779  S  SD   . MET A 1 58 ? 128.381 7.211   9.941   1.00 0.00 ? 58  MET A SD   2  
ATOM   3780  C  CE   . MET A 1 58 ? 127.456 7.842   8.519   1.00 0.00 ? 58  MET A CE   2  
ATOM   3781  H  H    . MET A 1 58 ? 129.538 2.700   9.708   1.00 0.00 ? 58  MET A H    2  
ATOM   3782  H  HA   . MET A 1 58 ? 131.080 4.677   8.386   1.00 0.00 ? 58  MET A HA   2  
ATOM   3783  H  HB2  . MET A 1 58 ? 129.080 5.658   7.812   1.00 0.00 ? 58  MET A HB2  2  
ATOM   3784  H  HB3  . MET A 1 58 ? 128.541 4.018   8.166   1.00 0.00 ? 58  MET A HB3  2  
ATOM   3785  H  HG2  . MET A 1 58 ? 127.017 5.322   9.371   1.00 0.00 ? 58  MET A HG2  2  
ATOM   3786  H  HG3  . MET A 1 58 ? 128.223 4.906   10.587  1.00 0.00 ? 58  MET A HG3  2  
ATOM   3787  H  HE1  . MET A 1 58 ? 126.545 8.311   8.861   1.00 0.00 ? 58  MET A HE1  2  
ATOM   3788  H  HE2  . MET A 1 58 ? 127.213 7.027   7.856   1.00 0.00 ? 58  MET A HE2  2  
ATOM   3789  H  HE3  . MET A 1 58 ? 128.063 8.565   7.988   1.00 0.00 ? 58  MET A HE3  2  
ATOM   3790  N  N    . LYS A 1 59 ? 130.291 5.303   11.508  1.00 0.00 ? 59  LYS A N    2  
ATOM   3791  C  CA   . LYS A 1 59 ? 130.600 6.203   12.607  1.00 0.00 ? 59  LYS A CA   2  
ATOM   3792  C  C    . LYS A 1 59 ? 132.107 6.364   12.753  1.00 0.00 ? 59  LYS A C    2  
ATOM   3793  O  O    . LYS A 1 59 ? 132.602 7.471   12.968  1.00 0.00 ? 59  LYS A O    2  
ATOM   3794  C  CB   . LYS A 1 59 ? 130.013 5.659   13.911  1.00 0.00 ? 59  LYS A CB   2  
ATOM   3795  C  CG   . LYS A 1 59 ? 130.224 6.678   15.033  1.00 0.00 ? 59  LYS A CG   2  
ATOM   3796  C  CD   . LYS A 1 59 ? 129.694 6.106   16.349  1.00 0.00 ? 59  LYS A CD   2  
ATOM   3797  C  CE   . LYS A 1 59 ? 129.760 7.180   17.436  1.00 0.00 ? 59  LYS A CE   2  
ATOM   3798  N  NZ   . LYS A 1 59 ? 131.091 7.851   17.389  1.00 0.00 ? 59  LYS A NZ   2  
ATOM   3799  H  H    . LYS A 1 59 ? 129.744 4.495   11.672  1.00 0.00 ? 59  LYS A H    2  
ATOM   3800  H  HA   . LYS A 1 59 ? 130.162 7.169   12.403  1.00 0.00 ? 59  LYS A HA   2  
ATOM   3801  H  HB2  . LYS A 1 59 ? 128.955 5.479   13.781  1.00 0.00 ? 59  LYS A HB2  2  
ATOM   3802  H  HB3  . LYS A 1 59 ? 130.506 4.734   14.169  1.00 0.00 ? 59  LYS A HB3  2  
ATOM   3803  H  HG2  . LYS A 1 59 ? 131.279 6.891   15.130  1.00 0.00 ? 59  LYS A HG2  2  
ATOM   3804  H  HG3  . LYS A 1 59 ? 129.694 7.588   14.797  1.00 0.00 ? 59  LYS A HG3  2  
ATOM   3805  H  HD2  . LYS A 1 59 ? 128.669 5.790   16.216  1.00 0.00 ? 59  LYS A HD2  2  
ATOM   3806  H  HD3  . LYS A 1 59 ? 130.297 5.261   16.643  1.00 0.00 ? 59  LYS A HD3  2  
ATOM   3807  H  HE2  . LYS A 1 59 ? 128.982 7.910   17.268  1.00 0.00 ? 59  LYS A HE2  2  
ATOM   3808  H  HE3  . LYS A 1 59 ? 129.622 6.722   18.403  1.00 0.00 ? 59  LYS A HE3  2  
ATOM   3809  H  HZ1  . LYS A 1 59 ? 131.776 7.232   16.913  1.00 0.00 ? 59  LYS A HZ1  2  
ATOM   3810  H  HZ2  . LYS A 1 59 ? 131.414 8.047   18.359  1.00 0.00 ? 59  LYS A HZ2  2  
ATOM   3811  H  HZ3  . LYS A 1 59 ? 131.011 8.744   16.863  1.00 0.00 ? 59  LYS A HZ3  2  
ATOM   3812  N  N    . GLU A 1 60 ? 132.836 5.261   12.620  1.00 0.00 ? 60  GLU A N    2  
ATOM   3813  C  CA   . GLU A 1 60 ? 134.286 5.315   12.725  1.00 0.00 ? 60  GLU A CA   2  
ATOM   3814  C  C    . GLU A 1 60 ? 134.886 6.124   11.579  1.00 0.00 ? 60  GLU A C    2  
ATOM   3815  O  O    . GLU A 1 60 ? 135.865 6.847   11.764  1.00 0.00 ? 60  GLU A O    2  
ATOM   3816  C  CB   . GLU A 1 60 ? 134.864 3.898   12.708  1.00 0.00 ? 60  GLU A CB   2  
ATOM   3817  C  CG   . GLU A 1 60 ? 134.396 3.140   13.951  1.00 0.00 ? 60  GLU A CG   2  
ATOM   3818  C  CD   . GLU A 1 60 ? 135.017 1.748   13.979  1.00 0.00 ? 60  GLU A CD   2  
ATOM   3819  O  OE1  . GLU A 1 60 ? 135.625 1.373   12.989  1.00 0.00 ? 60  GLU A OE1  2  
ATOM   3820  O  OE2  . GLU A 1 60 ? 134.876 1.077   14.987  1.00 0.00 ? 60  GLU A OE2  2  
ATOM   3821  H  H    . GLU A 1 60 ? 132.394 4.405   12.438  1.00 0.00 ? 60  GLU A H    2  
ATOM   3822  H  HA   . GLU A 1 60 ? 134.551 5.785   13.660  1.00 0.00 ? 60  GLU A HA   2  
ATOM   3823  H  HB2  . GLU A 1 60 ? 134.523 3.382   11.821  1.00 0.00 ? 60  GLU A HB2  2  
ATOM   3824  H  HB3  . GLU A 1 60 ? 135.942 3.949   12.704  1.00 0.00 ? 60  GLU A HB3  2  
ATOM   3825  H  HG2  . GLU A 1 60 ? 134.694 3.683   14.835  1.00 0.00 ? 60  GLU A HG2  2  
ATOM   3826  H  HG3  . GLU A 1 60 ? 133.320 3.050   13.933  1.00 0.00 ? 60  GLU A HG3  2  
ATOM   3827  N  N    . LEU A 1 61 ? 134.296 5.992   10.389  1.00 0.00 ? 61  LEU A N    2  
ATOM   3828  C  CA   . LEU A 1 61 ? 134.793 6.716   9.222   1.00 0.00 ? 61  LEU A CA   2  
ATOM   3829  C  C    . LEU A 1 61 ? 134.601 8.213   9.346   1.00 0.00 ? 61  LEU A C    2  
ATOM   3830  O  O    . LEU A 1 61 ? 135.461 8.986   8.923   1.00 0.00 ? 61  LEU A O    2  
ATOM   3831  C  CB   . LEU A 1 61 ? 134.073 6.239   7.960   1.00 0.00 ? 61  LEU A CB   2  
ATOM   3832  C  CG   . LEU A 1 61 ? 134.356 4.759   7.727   1.00 0.00 ? 61  LEU A CG   2  
ATOM   3833  C  CD1  . LEU A 1 61 ? 133.628 4.302   6.463   1.00 0.00 ? 61  LEU A CD1  2  
ATOM   3834  C  CD2  . LEU A 1 61 ? 135.864 4.549   7.547   1.00 0.00 ? 61  LEU A CD2  2  
ATOM   3835  H  H    . LEU A 1 61 ? 133.522 5.399   10.297  1.00 0.00 ? 61  LEU A H    2  
ATOM   3836  H  HA   . LEU A 1 61 ? 135.846 6.515   9.113   1.00 0.00 ? 61  LEU A HA   2  
ATOM   3837  H  HB2  . LEU A 1 61 ? 133.010 6.389   8.077   1.00 0.00 ? 61  LEU A HB2  2  
ATOM   3838  H  HB3  . LEU A 1 61 ? 134.425 6.808   7.112   1.00 0.00 ? 61  LEU A HB3  2  
ATOM   3839  H  HG   . LEU A 1 61 ? 134.011 4.188   8.570   1.00 0.00 ? 61  LEU A HG   2  
ATOM   3840  H  HD11 . LEU A 1 61 ? 132.563 4.294   6.644   1.00 0.00 ? 61  LEU A HD11 2  
ATOM   3841  H  HD12 . LEU A 1 61 ? 133.956 3.309   6.199   1.00 0.00 ? 61  LEU A HD12 2  
ATOM   3842  H  HD13 . LEU A 1 61 ? 133.851 4.984   5.655   1.00 0.00 ? 61  LEU A HD13 2  
ATOM   3843  H  HD21 . LEU A 1 61 ? 136.312 4.328   8.504   1.00 0.00 ? 61  LEU A HD21 2  
ATOM   3844  H  HD22 . LEU A 1 61 ? 136.312 5.445   7.140   1.00 0.00 ? 61  LEU A HD22 2  
ATOM   3845  H  HD23 . LEU A 1 61 ? 136.034 3.730   6.872   1.00 0.00 ? 61  LEU A HD23 2  
ATOM   3846  N  N    . ASP A 1 62 ? 133.473 8.639   9.902   1.00 0.00 ? 62  ASP A N    2  
ATOM   3847  C  CA   . ASP A 1 62 ? 133.244 10.069  10.014  1.00 0.00 ? 62  ASP A CA   2  
ATOM   3848  C  C    . ASP A 1 62 ? 134.035 10.667  11.170  1.00 0.00 ? 62  ASP A C    2  
ATOM   3849  O  O    . ASP A 1 62 ? 133.488 10.919  12.243  1.00 0.00 ? 62  ASP A O    2  
ATOM   3850  C  CB   . ASP A 1 62 ? 131.761 10.350  10.223  1.00 0.00 ? 62  ASP A CB   2  
ATOM   3851  C  CG   . ASP A 1 62 ? 131.509 11.847  10.109  1.00 0.00 ? 62  ASP A CG   2  
ATOM   3852  O  OD1  . ASP A 1 62 ? 132.346 12.529  9.532   1.00 0.00 ? 62  ASP A OD1  2  
ATOM   3853  O  OD2  . ASP A 1 62 ? 130.493 12.289  10.614  1.00 0.00 ? 62  ASP A OD2  2  
ATOM   3854  H  H    . ASP A 1 62 ? 132.792 7.992   10.212  1.00 0.00 ? 62  ASP A H    2  
ATOM   3855  H  HA   . ASP A 1 62 ? 133.558 10.544  9.097   1.00 0.00 ? 62  ASP A HA   2  
ATOM   3856  H  HB2  . ASP A 1 62 ? 131.187 9.829   9.471   1.00 0.00 ? 62  ASP A HB2  2  
ATOM   3857  H  HB3  . ASP A 1 62 ? 131.465 10.009  11.203  1.00 0.00 ? 62  ASP A HB3  2  
ATOM   3858  N  N    . GLU A 1 63 ? 135.314 10.932  10.934  1.00 0.00 ? 63  GLU A N    2  
ATOM   3859  C  CA   . GLU A 1 63 ? 136.150 11.548  11.955  1.00 0.00 ? 63  GLU A CA   2  
ATOM   3860  C  C    . GLU A 1 63 ? 135.714 12.967  12.253  1.00 0.00 ? 63  GLU A C    2  
ATOM   3861  O  O    . GLU A 1 63 ? 135.776 13.428  13.393  1.00 0.00 ? 63  GLU A O    2  
ATOM   3862  C  CB   . GLU A 1 63 ? 137.610 11.564  11.495  1.00 0.00 ? 63  GLU A CB   2  
ATOM   3863  C  CG   . GLU A 1 63 ? 138.477 12.213  12.577  1.00 0.00 ? 63  GLU A CG   2  
ATOM   3864  C  CD   . GLU A 1 63 ? 139.932 12.266  12.124  1.00 0.00 ? 63  GLU A CD   2  
ATOM   3865  O  OE1  . GLU A 1 63 ? 140.199 11.853  11.007  1.00 0.00 ? 63  GLU A OE1  2  
ATOM   3866  O  OE2  . GLU A 1 63 ? 140.757 12.719  12.899  1.00 0.00 ? 63  GLU A OE2  2  
ATOM   3867  H  H    . GLU A 1 63 ? 135.692 10.740  10.050  1.00 0.00 ? 63  GLU A H    2  
ATOM   3868  H  HA   . GLU A 1 63 ? 136.082 10.966  12.859  1.00 0.00 ? 63  GLU A HA   2  
ATOM   3869  H  HB2  . GLU A 1 63 ? 137.943 10.551  11.322  1.00 0.00 ? 63  GLU A HB2  2  
ATOM   3870  H  HB3  . GLU A 1 63 ? 137.693 12.133  10.581  1.00 0.00 ? 63  GLU A HB3  2  
ATOM   3871  H  HG2  . GLU A 1 63 ? 138.135 13.223  12.750  1.00 0.00 ? 63  GLU A HG2  2  
ATOM   3872  H  HG3  . GLU A 1 63 ? 138.395 11.658  13.487  1.00 0.00 ? 63  GLU A HG3  2  
ATOM   3873  N  N    . ASN A 1 64 ? 135.331 13.667  11.207  1.00 0.00 ? 64  ASN A N    2  
ATOM   3874  C  CA   . ASN A 1 64 ? 134.947 15.056  11.337  1.00 0.00 ? 64  ASN A CA   2  
ATOM   3875  C  C    . ASN A 1 64 ? 133.779 15.243  12.301  1.00 0.00 ? 64  ASN A C    2  
ATOM   3876  O  O    . ASN A 1 64 ? 133.697 16.249  13.005  1.00 0.00 ? 64  ASN A O    2  
ATOM   3877  C  CB   . ASN A 1 64 ? 134.533 15.593  9.968   1.00 0.00 ? 64  ASN A CB   2  
ATOM   3878  C  CG   . ASN A 1 64 ? 135.654 15.388  8.958   1.00 0.00 ? 64  ASN A CG   2  
ATOM   3879  O  OD1  . ASN A 1 64 ? 135.416 14.843  7.877   1.00 0.00 ? 64  ASN A OD1  2  
ATOM   3880  N  ND2  . ASN A 1 64 ? 136.863 15.791  9.241   1.00 0.00 ? 64  ASN A ND2  2  
ATOM   3881  H  H    . ASN A 1 64 ? 135.344 13.252  10.319  1.00 0.00 ? 64  ASN A H    2  
ATOM   3882  H  HA   . ASN A 1 64 ? 135.802 15.607  11.696  1.00 0.00 ? 64  ASN A HA   2  
ATOM   3883  H  HB2  . ASN A 1 64 ? 133.650 15.071  9.631   1.00 0.00 ? 64  ASN A HB2  2  
ATOM   3884  H  HB3  . ASN A 1 64 ? 134.315 16.648  10.050  1.00 0.00 ? 64  ASN A HB3  2  
ATOM   3885  H  HD21 . ASN A 1 64 ? 137.046 16.223  10.102  1.00 0.00 ? 64  ASN A HD21 2  
ATOM   3886  H  HD22 . ASN A 1 64 ? 137.586 15.662  8.593   1.00 0.00 ? 64  ASN A HD22 2  
ATOM   3887  N  N    . GLY A 1 65 ? 132.854 14.294  12.285  1.00 0.00 ? 65  GLY A N    2  
ATOM   3888  C  CA   . GLY A 1 65 ? 131.662 14.390  13.117  1.00 0.00 ? 65  GLY A CA   2  
ATOM   3889  C  C    . GLY A 1 65 ? 130.577 15.088  12.306  1.00 0.00 ? 65  GLY A C    2  
ATOM   3890  O  O    . GLY A 1 65 ? 129.469 15.335  12.781  1.00 0.00 ? 65  GLY A O    2  
ATOM   3891  H  H    . GLY A 1 65 ? 132.954 13.534  11.675  1.00 0.00 ? 65  GLY A H    2  
ATOM   3892  H  HA2  . GLY A 1 65 ? 131.333 13.398  13.398  1.00 0.00 ? 65  GLY A HA2  2  
ATOM   3893  H  HA3  . GLY A 1 65 ? 131.877 14.969  14.001  1.00 0.00 ? 65  GLY A HA3  2  
ATOM   3894  N  N    . ASP A 1 66 ? 130.943 15.392  11.064  1.00 0.00 ? 66  ASP A N    2  
ATOM   3895  C  CA   . ASP A 1 66 ? 130.061 16.060  10.113  1.00 0.00 ? 66  ASP A CA   2  
ATOM   3896  C  C    . ASP A 1 66 ? 128.820 15.225  9.796   1.00 0.00 ? 66  ASP A C    2  
ATOM   3897  O  O    . ASP A 1 66 ? 127.748 15.766  9.524   1.00 0.00 ? 66  ASP A O    2  
ATOM   3898  C  CB   . ASP A 1 66 ? 130.856 16.368  8.835   1.00 0.00 ? 66  ASP A CB   2  
ATOM   3899  C  CG   . ASP A 1 66 ? 131.347 15.077  8.172   1.00 0.00 ? 66  ASP A CG   2  
ATOM   3900  O  OD1  . ASP A 1 66 ? 130.885 14.019  8.553   1.00 0.00 ? 66  ASP A OD1  2  
ATOM   3901  O  OD2  . ASP A 1 66 ? 132.201 15.164  7.304   1.00 0.00 ? 66  ASP A OD2  2  
ATOM   3902  H  H    . ASP A 1 66 ? 131.847 15.153  10.773  1.00 0.00 ? 66  ASP A H    2  
ATOM   3903  H  HA   . ASP A 1 66 ? 129.741 16.995  10.545  1.00 0.00 ? 66  ASP A HA   2  
ATOM   3904  H  HB2  . ASP A 1 66 ? 130.222 16.904  8.143   1.00 0.00 ? 66  ASP A HB2  2  
ATOM   3905  H  HB3  . ASP A 1 66 ? 131.707 16.984  9.086   1.00 0.00 ? 66  ASP A HB3  2  
ATOM   3906  N  N    . GLY A 1 67 ? 128.982 13.914  9.814   1.00 0.00 ? 67  GLY A N    2  
ATOM   3907  C  CA   . GLY A 1 67 ? 127.889 12.999  9.509   1.00 0.00 ? 67  GLY A CA   2  
ATOM   3908  C  C    . GLY A 1 67 ? 127.994 12.521  8.066   1.00 0.00 ? 67  GLY A C    2  
ATOM   3909  O  O    . GLY A 1 67 ? 127.251 11.641  7.634   1.00 0.00 ? 67  GLY A O    2  
ATOM   3910  H  H    . GLY A 1 67 ? 129.864 13.549  10.022  1.00 0.00 ? 67  GLY A H    2  
ATOM   3911  H  HA2  . GLY A 1 67 ? 127.938 12.149  10.175  1.00 0.00 ? 67  GLY A HA2  2  
ATOM   3912  H  HA3  . GLY A 1 67 ? 126.947 13.507  9.646   1.00 0.00 ? 67  GLY A HA3  2  
ATOM   3913  N  N    . GLU A 1 68 ? 128.948 13.095  7.337   1.00 0.00 ? 68  GLU A N    2  
ATOM   3914  C  CA   . GLU A 1 68 ? 129.184 12.714  5.950   1.00 0.00 ? 68  GLU A CA   2  
ATOM   3915  C  C    . GLU A 1 68 ? 130.525 11.997  5.858   1.00 0.00 ? 68  GLU A C    2  
ATOM   3916  O  O    . GLU A 1 68 ? 131.487 12.372  6.540   1.00 0.00 ? 68  GLU A O    2  
ATOM   3917  C  CB   . GLU A 1 68 ? 129.165 13.946  5.047   1.00 0.00 ? 68  GLU A CB   2  
ATOM   3918  C  CG   . GLU A 1 68 ? 129.212 13.500  3.584   1.00 0.00 ? 68  GLU A CG   2  
ATOM   3919  C  CD   . GLU A 1 68 ? 129.260 14.719  2.673   1.00 0.00 ? 68  GLU A CD   2  
ATOM   3920  O  OE1  . GLU A 1 68 ? 129.342 15.820  3.192   1.00 0.00 ? 68  GLU A OE1  2  
ATOM   3921  O  OE2  . GLU A 1 68 ? 129.191 14.536  1.471   1.00 0.00 ? 68  GLU A OE2  2  
ATOM   3922  H  H    . GLU A 1 68 ? 129.518 13.775  7.748   1.00 0.00 ? 68  GLU A H    2  
ATOM   3923  H  HA   . GLU A 1 68 ? 128.414 12.040  5.624   1.00 0.00 ? 68  GLU A HA   2  
ATOM   3924  H  HB2  . GLU A 1 68 ? 128.261 14.511  5.226   1.00 0.00 ? 68  GLU A HB2  2  
ATOM   3925  H  HB3  . GLU A 1 68 ? 130.024 14.564  5.261   1.00 0.00 ? 68  GLU A HB3  2  
ATOM   3926  H  HG2  . GLU A 1 68 ? 130.093 12.896  3.423   1.00 0.00 ? 68  GLU A HG2  2  
ATOM   3927  H  HG3  . GLU A 1 68 ? 128.328 12.915  3.355   1.00 0.00 ? 68  GLU A HG3  2  
ATOM   3928  N  N    . VAL A 1 69 ? 130.589 10.955  5.033   1.00 0.00 ? 69  VAL A N    2  
ATOM   3929  C  CA   . VAL A 1 69 ? 131.824 10.193  4.899   1.00 0.00 ? 69  VAL A CA   2  
ATOM   3930  C  C    . VAL A 1 69 ? 132.506 10.506  3.579   1.00 0.00 ? 69  VAL A C    2  
ATOM   3931  O  O    . VAL A 1 69 ? 131.878 10.507  2.520   1.00 0.00 ? 69  VAL A O    2  
ATOM   3932  C  CB   . VAL A 1 69 ? 131.520 8.694   4.962   1.00 0.00 ? 69  VAL A CB   2  
ATOM   3933  C  CG1  . VAL A 1 69 ? 132.829 7.905   4.931   1.00 0.00 ? 69  VAL A CG1  2  
ATOM   3934  C  CG2  . VAL A 1 69 ? 130.764 8.380   6.254   1.00 0.00 ? 69  VAL A CG2  2  
ATOM   3935  H  H    . VAL A 1 69 ? 129.794 10.687  4.526   1.00 0.00 ? 69  VAL A H    2  
ATOM   3936  H  HA   . VAL A 1 69 ? 132.491 10.445  5.711   1.00 0.00 ? 69  VAL A HA   2  
ATOM   3937  H  HB   . VAL A 1 69 ? 130.914 8.415   4.108   1.00 0.00 ? 69  VAL A HB   2  
ATOM   3938  H  HG11 . VAL A 1 69 ? 133.219 7.892   3.924   1.00 0.00 ? 69  VAL A HG11 2  
ATOM   3939  H  HG12 . VAL A 1 69 ? 132.649 6.893   5.262   1.00 0.00 ? 69  VAL A HG12 2  
ATOM   3940  H  HG13 . VAL A 1 69 ? 133.547 8.375   5.588   1.00 0.00 ? 69  VAL A HG13 2  
ATOM   3941  H  HG21 . VAL A 1 69 ? 129.993 9.120   6.410   1.00 0.00 ? 69  VAL A HG21 2  
ATOM   3942  H  HG22 . VAL A 1 69 ? 131.453 8.396   7.086   1.00 0.00 ? 69  VAL A HG22 2  
ATOM   3943  H  HG23 . VAL A 1 69 ? 130.313 7.401   6.179   1.00 0.00 ? 69  VAL A HG23 2  
ATOM   3944  N  N    . ASP A 1 70 ? 133.802 10.766  3.661   1.00 0.00 ? 70  ASP A N    2  
ATOM   3945  C  CA   . ASP A 1 70 ? 134.596 11.079  2.485   1.00 0.00 ? 70  ASP A CA   2  
ATOM   3946  C  C    . ASP A 1 70 ? 135.451 9.890   2.089   1.00 0.00 ? 70  ASP A C    2  
ATOM   3947  O  O    . ASP A 1 70 ? 135.908 9.123   2.941   1.00 0.00 ? 70  ASP A O    2  
ATOM   3948  C  CB   . ASP A 1 70 ? 135.487 12.293  2.750   1.00 0.00 ? 70  ASP A CB   2  
ATOM   3949  C  CG   . ASP A 1 70 ? 136.162 12.735  1.456   1.00 0.00 ? 70  ASP A CG   2  
ATOM   3950  O  OD1  . ASP A 1 70 ? 135.841 12.174  0.421   1.00 0.00 ? 70  ASP A OD1  2  
ATOM   3951  O  OD2  . ASP A 1 70 ? 136.989 13.630  1.518   1.00 0.00 ? 70  ASP A OD2  2  
ATOM   3952  H  H    . ASP A 1 70 ? 134.238 10.744  4.539   1.00 0.00 ? 70  ASP A H    2  
ATOM   3953  H  HA   . ASP A 1 70 ? 133.935 11.308  1.666   1.00 0.00 ? 70  ASP A HA   2  
ATOM   3954  H  HB2  . ASP A 1 70 ? 134.887 13.101  3.137   1.00 0.00 ? 70  ASP A HB2  2  
ATOM   3955  H  HB3  . ASP A 1 70 ? 136.243 12.030  3.471   1.00 0.00 ? 70  ASP A HB3  2  
ATOM   3956  N  N    . PHE A 1 71 ? 135.675 9.745   0.796   1.00 0.00 ? 71  PHE A N    2  
ATOM   3957  C  CA   . PHE A 1 71 ? 136.488 8.653   0.304   1.00 0.00 ? 71  PHE A CA   2  
ATOM   3958  C  C    . PHE A 1 71 ? 137.822 8.633   1.032   1.00 0.00 ? 71  PHE A C    2  
ATOM   3959  O  O    . PHE A 1 71 ? 138.333 7.565   1.367   1.00 0.00 ? 71  PHE A O    2  
ATOM   3960  C  CB   . PHE A 1 71 ? 136.697 8.806   -1.203  1.00 0.00 ? 71  PHE A CB   2  
ATOM   3961  C  CG   . PHE A 1 71 ? 137.508 7.649   -1.732  1.00 0.00 ? 71  PHE A CG   2  
ATOM   3962  C  CD1  . PHE A 1 71 ? 136.921 6.391   -1.913  1.00 0.00 ? 71  PHE A CD1  2  
ATOM   3963  C  CD2  . PHE A 1 71 ? 138.852 7.848   -2.064  1.00 0.00 ? 71  PHE A CD2  2  
ATOM   3964  C  CE1  . PHE A 1 71 ? 137.682 5.333   -2.421  1.00 0.00 ? 71  PHE A CE1  2  
ATOM   3965  C  CE2  . PHE A 1 71 ? 139.613 6.790   -2.573  1.00 0.00 ? 71  PHE A CE2  2  
ATOM   3966  C  CZ   . PHE A 1 71 ? 139.028 5.532   -2.751  1.00 0.00 ? 71  PHE A CZ   2  
ATOM   3967  H  H    . PHE A 1 71 ? 135.294 10.390  0.162   1.00 0.00 ? 71  PHE A H    2  
ATOM   3968  H  HA   . PHE A 1 71 ? 135.973 7.722   0.492   1.00 0.00 ? 71  PHE A HA   2  
ATOM   3969  H  HB2  . PHE A 1 71 ? 135.736 8.825   -1.698  1.00 0.00 ? 71  PHE A HB2  2  
ATOM   3970  H  HB3  . PHE A 1 71 ? 137.219 9.730   -1.401  1.00 0.00 ? 71  PHE A HB3  2  
ATOM   3971  H  HD1  . PHE A 1 71 ? 135.884 6.233   -1.655  1.00 0.00 ? 71  PHE A HD1  2  
ATOM   3972  H  HD2  . PHE A 1 71 ? 139.304 8.819   -1.927  1.00 0.00 ? 71  PHE A HD2  2  
ATOM   3973  H  HE1  . PHE A 1 71 ? 137.233 4.364   -2.559  1.00 0.00 ? 71  PHE A HE1  2  
ATOM   3974  H  HE2  . PHE A 1 71 ? 140.651 6.945   -2.827  1.00 0.00 ? 71  PHE A HE2  2  
ATOM   3975  H  HZ   . PHE A 1 71 ? 139.615 4.715   -3.145  1.00 0.00 ? 71  PHE A HZ   2  
ATOM   3976  N  N    . GLN A 1 72 ? 138.382 9.809   1.293   1.00 0.00 ? 72  GLN A N    2  
ATOM   3977  C  CA   . GLN A 1 72 ? 139.651 9.868   2.000   1.00 0.00 ? 72  GLN A CA   2  
ATOM   3978  C  C    . GLN A 1 72 ? 139.526 9.203   3.373   1.00 0.00 ? 72  GLN A C    2  
ATOM   3979  O  O    . GLN A 1 72 ? 140.432 8.486   3.800   1.00 0.00 ? 72  GLN A O    2  
ATOM   3980  C  CB   . GLN A 1 72 ? 140.079 11.326  2.177   1.00 0.00 ? 72  GLN A CB   2  
ATOM   3981  C  CG   . GLN A 1 72 ? 140.346 11.952  0.807   1.00 0.00 ? 72  GLN A CG   2  
ATOM   3982  C  CD   . GLN A 1 72 ? 140.719 13.422  0.969   1.00 0.00 ? 72  GLN A CD   2  
ATOM   3983  O  OE1  . GLN A 1 72 ? 140.487 14.010  2.025   1.00 0.00 ? 72  GLN A OE1  2  
ATOM   3984  N  NE2  . GLN A 1 72 ? 141.286 14.054  -0.022  1.00 0.00 ? 72  GLN A NE2  2  
ATOM   3985  H  H    . GLN A 1 72 ? 137.936 10.636  1.017   1.00 0.00 ? 72  GLN A H    2  
ATOM   3986  H  HA   . GLN A 1 72 ? 140.402 9.350   1.422   1.00 0.00 ? 72  GLN A HA   2  
ATOM   3987  H  HB2  . GLN A 1 72 ? 139.294 11.874  2.677   1.00 0.00 ? 72  GLN A HB2  2  
ATOM   3988  H  HB3  . GLN A 1 72 ? 140.981 11.367  2.770   1.00 0.00 ? 72  GLN A HB3  2  
ATOM   3989  H  HG2  . GLN A 1 72 ? 141.157 11.428  0.326   1.00 0.00 ? 72  GLN A HG2  2  
ATOM   3990  H  HG3  . GLN A 1 72 ? 139.457 11.875  0.198   1.00 0.00 ? 72  GLN A HG3  2  
ATOM   3991  H  HE21 . GLN A 1 72 ? 141.468 13.586  -0.862  1.00 0.00 ? 72  GLN A HE21 2  
ATOM   3992  H  HE22 . GLN A 1 72 ? 141.528 15.000  0.075   1.00 0.00 ? 72  GLN A HE22 2  
ATOM   3993  N  N    . GLU A 1 73 ? 138.394 9.417   4.053   1.00 0.00 ? 73  GLU A N    2  
ATOM   3994  C  CA   . GLU A 1 73 ? 138.189 8.789   5.359   1.00 0.00 ? 73  GLU A CA   2  
ATOM   3995  C  C    . GLU A 1 73 ? 138.064 7.276   5.194   1.00 0.00 ? 73  GLU A C    2  
ATOM   3996  O  O    . GLU A 1 73 ? 138.599 6.495   5.980   1.00 0.00 ? 73  GLU A O    2  
ATOM   3997  C  CB   . GLU A 1 73 ? 136.889 9.309   5.996   1.00 0.00 ? 73  GLU A CB   2  
ATOM   3998  C  CG   . GLU A 1 73 ? 136.990 10.806  6.316   1.00 0.00 ? 73  GLU A CG   2  
ATOM   3999  C  CD   . GLU A 1 73 ? 135.688 11.276  6.974   1.00 0.00 ? 73  GLU A CD   2  
ATOM   4000  O  OE1  . GLU A 1 73 ? 134.760 10.487  7.028   1.00 0.00 ? 73  GLU A OE1  2  
ATOM   4001  O  OE2  . GLU A 1 73 ? 135.627 12.422  7.401   1.00 0.00 ? 73  GLU A OE2  2  
ATOM   4002  H  H    . GLU A 1 73 ? 137.690 9.979   3.666   1.00 0.00 ? 73  GLU A H    2  
ATOM   4003  H  HA   . GLU A 1 73 ? 139.022 9.016   6.007   1.00 0.00 ? 73  GLU A HA   2  
ATOM   4004  H  HB2  . GLU A 1 73 ? 136.071 9.148   5.312   1.00 0.00 ? 73  GLU A HB2  2  
ATOM   4005  H  HB3  . GLU A 1 73 ? 136.700 8.764   6.910   1.00 0.00 ? 73  GLU A HB3  2  
ATOM   4006  H  HG2  . GLU A 1 73 ? 137.816 10.973  6.991   1.00 0.00 ? 73  GLU A HG2  2  
ATOM   4007  H  HG3  . GLU A 1 73 ? 137.154 11.359  5.407   1.00 0.00 ? 73  GLU A HG3  2  
ATOM   4008  N  N    . TYR A 1 74 ? 137.334 6.892   4.151   1.00 0.00 ? 74  TYR A N    2  
ATOM   4009  C  CA   . TYR A 1 74 ? 137.093 5.486   3.831   1.00 0.00 ? 74  TYR A CA   2  
ATOM   4010  C  C    . TYR A 1 74 ? 138.344 4.695   3.438   1.00 0.00 ? 74  TYR A C    2  
ATOM   4011  O  O    . TYR A 1 74 ? 138.480 3.515   3.789   1.00 0.00 ? 74  TYR A O    2  
ATOM   4012  C  CB   . TYR A 1 74 ? 136.057 5.392   2.712   1.00 0.00 ? 74  TYR A CB   2  
ATOM   4013  C  CG   . TYR A 1 74 ? 135.850 3.943   2.372   1.00 0.00 ? 74  TYR A CG   2  
ATOM   4014  C  CD1  . TYR A 1 74 ? 135.010 3.137   3.146   1.00 0.00 ? 74  TYR A CD1  2  
ATOM   4015  C  CD2  . TYR A 1 74 ? 136.521 3.407   1.277   1.00 0.00 ? 74  TYR A CD2  2  
ATOM   4016  C  CE1  . TYR A 1 74 ? 134.850 1.784   2.821   1.00 0.00 ? 74  TYR A CE1  2  
ATOM   4017  C  CE2  . TYR A 1 74 ? 136.364 2.062   0.948   1.00 0.00 ? 74  TYR A CE2  2  
ATOM   4018  C  CZ   . TYR A 1 74 ? 135.529 1.245   1.720   1.00 0.00 ? 74  TYR A CZ   2  
ATOM   4019  O  OH   . TYR A 1 74 ? 135.376 -0.087  1.397   1.00 0.00 ? 74  TYR A OH   2  
ATOM   4020  H  H    . TYR A 1 74 ? 136.937 7.581   3.576   1.00 0.00 ? 74  TYR A H    2  
ATOM   4021  H  HA   . TYR A 1 74 ? 136.669 5.018   4.704   1.00 0.00 ? 74  TYR A HA   2  
ATOM   4022  H  HB2  . TYR A 1 74 ? 135.124 5.826   3.044   1.00 0.00 ? 74  TYR A HB2  2  
ATOM   4023  H  HB3  . TYR A 1 74 ? 136.414 5.920   1.841   1.00 0.00 ? 74  TYR A HB3  2  
ATOM   4024  H  HD1  . TYR A 1 74 ? 134.492 3.556   3.994   1.00 0.00 ? 74  TYR A HD1  2  
ATOM   4025  H  HD2  . TYR A 1 74 ? 137.157 4.040   0.679   1.00 0.00 ? 74  TYR A HD2  2  
ATOM   4026  H  HE1  . TYR A 1 74 ? 134.203 1.159   3.418   1.00 0.00 ? 74  TYR A HE1  2  
ATOM   4027  H  HE2  . TYR A 1 74 ? 136.893 1.653   0.103   1.00 0.00 ? 74  TYR A HE2  2  
ATOM   4028  H  HH   . TYR A 1 74 ? 136.099 -0.337  0.817   1.00 0.00 ? 74  TYR A HH   2  
ATOM   4029  N  N    . VAL A 1 75 ? 139.227 5.313   2.663   1.00 0.00 ? 75  VAL A N    2  
ATOM   4030  C  CA   . VAL A 1 75 ? 140.408 4.603   2.190   1.00 0.00 ? 75  VAL A CA   2  
ATOM   4031  C  C    . VAL A 1 75 ? 141.256 4.075   3.337   1.00 0.00 ? 75  VAL A C    2  
ATOM   4032  O  O    . VAL A 1 75 ? 141.768 2.965   3.265   1.00 0.00 ? 75  VAL A O    2  
ATOM   4033  C  CB   . VAL A 1 75 ? 141.261 5.507   1.296   1.00 0.00 ? 75  VAL A CB   2  
ATOM   4034  C  CG1  . VAL A 1 75 ? 142.555 4.779   0.942   1.00 0.00 ? 75  VAL A CG1  2  
ATOM   4035  C  CG2  . VAL A 1 75 ? 140.488 5.862   0.010   1.00 0.00 ? 75  VAL A CG2  2  
ATOM   4036  H  H    . VAL A 1 75 ? 139.060 6.234   2.371   1.00 0.00 ? 75  VAL A H    2  
ATOM   4037  H  HA   . VAL A 1 75 ? 140.081 3.760   1.601   1.00 0.00 ? 75  VAL A HA   2  
ATOM   4038  H  HB   . VAL A 1 75 ? 141.507 6.409   1.832   1.00 0.00 ? 75  VAL A HB   2  
ATOM   4039  H  HG11 . VAL A 1 75 ? 142.369 3.716   0.870   1.00 0.00 ? 75  VAL A HG11 2  
ATOM   4040  H  HG12 . VAL A 1 75 ? 143.282 4.966   1.711   1.00 0.00 ? 75  VAL A HG12 2  
ATOM   4041  H  HG13 . VAL A 1 75 ? 142.927 5.143   -0.005  1.00 0.00 ? 75  VAL A HG13 2  
ATOM   4042  H  HG21 . VAL A 1 75 ? 140.106 6.868   0.088   1.00 0.00 ? 75  VAL A HG21 2  
ATOM   4043  H  HG22 . VAL A 1 75 ? 139.665 5.176   -0.127  1.00 0.00 ? 75  VAL A HG22 2  
ATOM   4044  H  HG23 . VAL A 1 75 ? 141.151 5.796   -0.841  1.00 0.00 ? 75  VAL A HG23 2  
ATOM   4045  N  N    . VAL A 1 76 ? 141.423 4.847   4.395   1.00 0.00 ? 76  VAL A N    2  
ATOM   4046  C  CA   . VAL A 1 76 ? 142.229 4.360   5.500   1.00 0.00 ? 76  VAL A CA   2  
ATOM   4047  C  C    . VAL A 1 76 ? 141.621 3.081   6.083   1.00 0.00 ? 76  VAL A C    2  
ATOM   4048  O  O    . VAL A 1 76 ? 142.337 2.122   6.371   1.00 0.00 ? 76  VAL A O    2  
ATOM   4049  C  CB   . VAL A 1 76 ? 142.319 5.427   6.591   1.00 0.00 ? 76  VAL A CB   2  
ATOM   4050  C  CG1  . VAL A 1 76 ? 142.999 4.839   7.829   1.00 0.00 ? 76  VAL A CG1  2  
ATOM   4051  C  CG2  . VAL A 1 76 ? 143.139 6.613   6.077   1.00 0.00 ? 76  VAL A CG2  2  
ATOM   4052  H  H    . VAL A 1 76 ? 141.015 5.738   4.433   1.00 0.00 ? 76  VAL A H    2  
ATOM   4053  H  HA   . VAL A 1 76 ? 143.224 4.144   5.141   1.00 0.00 ? 76  VAL A HA   2  
ATOM   4054  H  HB   . VAL A 1 76 ? 141.325 5.760   6.852   1.00 0.00 ? 76  VAL A HB   2  
ATOM   4055  H  HG11 . VAL A 1 76 ? 143.803 4.186   7.521   1.00 0.00 ? 76  VAL A HG11 2  
ATOM   4056  H  HG12 . VAL A 1 76 ? 142.277 4.275   8.402   1.00 0.00 ? 76  VAL A HG12 2  
ATOM   4057  H  HG13 . VAL A 1 76 ? 143.396 5.638   8.437   1.00 0.00 ? 76  VAL A HG13 2  
ATOM   4058  H  HG21 . VAL A 1 76 ? 143.180 7.379   6.837   1.00 0.00 ? 76  VAL A HG21 2  
ATOM   4059  H  HG22 . VAL A 1 76 ? 142.673 7.014   5.189   1.00 0.00 ? 76  VAL A HG22 2  
ATOM   4060  H  HG23 . VAL A 1 76 ? 144.140 6.284   5.842   1.00 0.00 ? 76  VAL A HG23 2  
ATOM   4061  N  N    . LEU A 1 77 ? 140.299 3.076   6.262   1.00 0.00 ? 77  LEU A N    2  
ATOM   4062  C  CA   . LEU A 1 77 ? 139.615 1.908   6.821   1.00 0.00 ? 77  LEU A CA   2  
ATOM   4063  C  C    . LEU A 1 77 ? 139.678 0.684   5.904   1.00 0.00 ? 77  LEU A C    2  
ATOM   4064  O  O    . LEU A 1 77 ? 139.837 -0.440  6.382   1.00 0.00 ? 77  LEU A O    2  
ATOM   4065  C  CB   . LEU A 1 77 ? 138.147 2.242   7.083   1.00 0.00 ? 77  LEU A CB   2  
ATOM   4066  C  CG   . LEU A 1 77 ? 137.462 1.073   7.812   1.00 0.00 ? 77  LEU A CG   2  
ATOM   4067  C  CD1  . LEU A 1 77 ? 137.964 0.998   9.258   1.00 0.00 ? 77  LEU A CD1  2  
ATOM   4068  C  CD2  . LEU A 1 77 ? 135.947 1.291   7.815   1.00 0.00 ? 77  LEU A CD2  2  
ATOM   4069  H  H    . LEU A 1 77 ? 139.777 3.870   6.020   1.00 0.00 ? 77  LEU A H    2  
ATOM   4070  H  HA   . LEU A 1 77 ? 140.078 1.657   7.762   1.00 0.00 ? 77  LEU A HA   2  
ATOM   4071  H  HB2  . LEU A 1 77 ? 138.083 3.137   7.683   1.00 0.00 ? 77  LEU A HB2  2  
ATOM   4072  H  HB3  . LEU A 1 77 ? 137.654 2.405   6.136   1.00 0.00 ? 77  LEU A HB3  2  
ATOM   4073  H  HG   . LEU A 1 77 ? 137.688 0.146   7.308   1.00 0.00 ? 77  LEU A HG   2  
ATOM   4074  H  HD11 . LEU A 1 77 ? 137.227 0.494   9.867   1.00 0.00 ? 77  LEU A HD11 2  
ATOM   4075  H  HD12 . LEU A 1 77 ? 138.123 1.994   9.640   1.00 0.00 ? 77  LEU A HD12 2  
ATOM   4076  H  HD13 . LEU A 1 77 ? 138.891 0.447   9.288   1.00 0.00 ? 77  LEU A HD13 2  
ATOM   4077  H  HD21 . LEU A 1 77 ? 135.458 0.401   8.184   1.00 0.00 ? 77  LEU A HD21 2  
ATOM   4078  H  HD22 . LEU A 1 77 ? 135.610 1.495   6.810   1.00 0.00 ? 77  LEU A HD22 2  
ATOM   4079  H  HD23 . LEU A 1 77 ? 135.703 2.125   8.455   1.00 0.00 ? 77  LEU A HD23 2  
ATOM   4080  N  N    . VAL A 1 78 ? 139.510 0.887   4.594   1.00 0.00 ? 78  VAL A N    2  
ATOM   4081  C  CA   . VAL A 1 78 ? 139.512 -0.253  3.671   1.00 0.00 ? 78  VAL A CA   2  
ATOM   4082  C  C    . VAL A 1 78 ? 140.835 -1.018  3.759   1.00 0.00 ? 78  VAL A C    2  
ATOM   4083  O  O    . VAL A 1 78 ? 140.873 -2.244  3.584   1.00 0.00 ? 78  VAL A O    2  
ATOM   4084  C  CB   . VAL A 1 78 ? 139.249 0.201   2.224   1.00 0.00 ? 78  VAL A CB   2  
ATOM   4085  C  CG1  . VAL A 1 78 ? 140.529 0.743   1.574   1.00 0.00 ? 78  VAL A CG1  2  
ATOM   4086  C  CG2  . VAL A 1 78 ? 138.723 -0.990  1.414   1.00 0.00 ? 78  VAL A CG2  2  
ATOM   4087  H  H    . VAL A 1 78 ? 139.350 1.799   4.253   1.00 0.00 ? 78  VAL A H    2  
ATOM   4088  H  HA   . VAL A 1 78 ? 138.710 -0.921  3.962   1.00 0.00 ? 78  VAL A HA   2  
ATOM   4089  H  HB   . VAL A 1 78 ? 138.501 0.981   2.232   1.00 0.00 ? 78  VAL A HB   2  
ATOM   4090  H  HG11 . VAL A 1 78 ? 140.998 -0.033  0.985   1.00 0.00 ? 78  VAL A HG11 2  
ATOM   4091  H  HG12 . VAL A 1 78 ? 141.210 1.069   2.333   1.00 0.00 ? 78  VAL A HG12 2  
ATOM   4092  H  HG13 . VAL A 1 78 ? 140.282 1.576   0.933   1.00 0.00 ? 78  VAL A HG13 2  
ATOM   4093  H  HG21 . VAL A 1 78 ? 138.482 -0.664  0.413   1.00 0.00 ? 78  VAL A HG21 2  
ATOM   4094  H  HG22 . VAL A 1 78 ? 137.837 -1.383  1.889   1.00 0.00 ? 78  VAL A HG22 2  
ATOM   4095  H  HG23 . VAL A 1 78 ? 139.480 -1.758  1.371   1.00 0.00 ? 78  VAL A HG23 2  
ATOM   4096  N  N    . ALA A 1 79 ? 141.916 -0.283  4.020   1.00 0.00 ? 79  ALA A N    2  
ATOM   4097  C  CA   . ALA A 1 79 ? 143.241 -0.884  4.110   1.00 0.00 ? 79  ALA A CA   2  
ATOM   4098  C  C    . ALA A 1 79 ? 143.292 -1.943  5.209   1.00 0.00 ? 79  ALA A C    2  
ATOM   4099  O  O    . ALA A 1 79 ? 143.872 -3.011  5.026   1.00 0.00 ? 79  ALA A O    2  
ATOM   4100  C  CB   . ALA A 1 79 ? 144.266 0.226   4.399   1.00 0.00 ? 79  ALA A CB   2  
ATOM   4101  H  H    . ALA A 1 79 ? 141.821 0.684   4.142   1.00 0.00 ? 79  ALA A H    2  
ATOM   4102  H  HA   . ALA A 1 79 ? 143.492 -1.344  3.169   1.00 0.00 ? 79  ALA A HA   2  
ATOM   4103  H  HB1  . ALA A 1 79 ? 144.625 0.144   5.415   1.00 0.00 ? 79  ALA A HB1  2  
ATOM   4104  H  HB2  . ALA A 1 79 ? 143.797 1.189   4.264   1.00 0.00 ? 79  ALA A HB2  2  
ATOM   4105  H  HB3  . ALA A 1 79 ? 145.099 0.137   3.715   1.00 0.00 ? 79  ALA A HB3  2  
ATOM   4106  N  N    . ALA A 1 80 ? 142.681 -1.661  6.345   1.00 0.00 ? 80  ALA A N    2  
ATOM   4107  C  CA   . ALA A 1 80 ? 142.679 -2.632  7.424   1.00 0.00 ? 80  ALA A CA   2  
ATOM   4108  C  C    . ALA A 1 80 ? 141.820 -3.845  7.064   1.00 0.00 ? 80  ALA A C    2  
ATOM   4109  O  O    . ALA A 1 80 ? 142.173 -4.982  7.373   1.00 0.00 ? 80  ALA A O    2  
ATOM   4110  C  CB   . ALA A 1 80 ? 142.167 -1.981  8.707   1.00 0.00 ? 80  ALA A CB   2  
ATOM   4111  H  H    . ALA A 1 80 ? 142.223 -0.801  6.455   1.00 0.00 ? 80  ALA A H    2  
ATOM   4112  H  HA   . ALA A 1 80 ? 143.693 -2.964  7.589   1.00 0.00 ? 80  ALA A HA   2  
ATOM   4113  H  HB1  . ALA A 1 80 ? 141.983 -2.743  9.449   1.00 0.00 ? 80  ALA A HB1  2  
ATOM   4114  H  HB2  . ALA A 1 80 ? 141.252 -1.448  8.500   1.00 0.00 ? 80  ALA A HB2  2  
ATOM   4115  H  HB3  . ALA A 1 80 ? 142.912 -1.291  9.078   1.00 0.00 ? 80  ALA A HB3  2  
ATOM   4116  N  N    . LEU A 1 81 ? 140.679 -3.585  6.423   1.00 0.00 ? 81  LEU A N    2  
ATOM   4117  C  CA   . LEU A 1 81 ? 139.756 -4.655  6.040   1.00 0.00 ? 81  LEU A CA   2  
ATOM   4118  C  C    . LEU A 1 81 ? 140.355 -5.626  5.019   1.00 0.00 ? 81  LEU A C    2  
ATOM   4119  O  O    . LEU A 1 81 ? 140.120 -6.839  5.097   1.00 0.00 ? 81  LEU A O    2  
ATOM   4120  C  CB   . LEU A 1 81 ? 138.478 -4.041  5.460   1.00 0.00 ? 81  LEU A CB   2  
ATOM   4121  C  CG   . LEU A 1 81 ? 137.829 -3.105  6.487   1.00 0.00 ? 81  LEU A CG   2  
ATOM   4122  C  CD1  . LEU A 1 81 ? 136.505 -2.582  5.926   1.00 0.00 ? 81  LEU A CD1  2  
ATOM   4123  C  CD2  . LEU A 1 81 ? 137.559 -3.867  7.789   1.00 0.00 ? 81  LEU A CD2  2  
ATOM   4124  H  H    . LEU A 1 81 ? 140.446 -2.656  6.217   1.00 0.00 ? 81  LEU A H    2  
ATOM   4125  H  HA   . LEU A 1 81 ? 139.494 -5.214  6.924   1.00 0.00 ? 81  LEU A HA   2  
ATOM   4126  H  HB2  . LEU A 1 81 ? 138.725 -3.480  4.570   1.00 0.00 ? 81  LEU A HB2  2  
ATOM   4127  H  HB3  . LEU A 1 81 ? 137.786 -4.828  5.206   1.00 0.00 ? 81  LEU A HB3  2  
ATOM   4128  H  HG   . LEU A 1 81 ? 138.489 -2.274  6.683   1.00 0.00 ? 81  LEU A HG   2  
ATOM   4129  H  HD11 . LEU A 1 81 ? 136.689 -2.046  5.006   1.00 0.00 ? 81  LEU A HD11 2  
ATOM   4130  H  HD12 . LEU A 1 81 ? 136.048 -1.918  6.644   1.00 0.00 ? 81  LEU A HD12 2  
ATOM   4131  H  HD13 . LEU A 1 81 ? 135.843 -3.413  5.732   1.00 0.00 ? 81  LEU A HD13 2  
ATOM   4132  H  HD21 . LEU A 1 81 ? 136.735 -3.408  8.313   1.00 0.00 ? 81  LEU A HD21 2  
ATOM   4133  H  HD22 . LEU A 1 81 ? 138.441 -3.838  8.412   1.00 0.00 ? 81  LEU A HD22 2  
ATOM   4134  H  HD23 . LEU A 1 81 ? 137.314 -4.894  7.560   1.00 0.00 ? 81  LEU A HD23 2  
ATOM   4135  N  N    . THR A 1 82 ? 141.118 -5.112  4.054   1.00 0.00 ? 82  THR A N    2  
ATOM   4136  C  CA   . THR A 1 82 ? 141.696 -5.999  3.045   1.00 0.00 ? 82  THR A CA   2  
ATOM   4137  C  C    . THR A 1 82 ? 142.600 -7.036  3.693   1.00 0.00 ? 82  THR A C    2  
ATOM   4138  O  O    . THR A 1 82 ? 142.576 -8.210  3.323   1.00 0.00 ? 82  THR A O    2  
ATOM   4139  C  CB   . THR A 1 82 ? 142.485 -5.210  2.000   1.00 0.00 ? 82  THR A CB   2  
ATOM   4140  O  OG1  . THR A 1 82 ? 143.292 -6.102  1.244   1.00 0.00 ? 82  THR A OG1  2  
ATOM   4141  C  CG2  . THR A 1 82 ? 143.370 -4.187  2.695   1.00 0.00 ? 82  THR A CG2  2  
ATOM   4142  H  H    . THR A 1 82 ? 141.275 -4.137  4.012   1.00 0.00 ? 82  THR A H    2  
ATOM   4143  H  HA   . THR A 1 82 ? 140.891 -6.517  2.546   1.00 0.00 ? 82  THR A HA   2  
ATOM   4144  H  HB   . THR A 1 82 ? 141.800 -4.698  1.343   1.00 0.00 ? 82  THR A HB   2  
ATOM   4145  H  HG1  . THR A 1 82 ? 143.910 -6.524  1.844   1.00 0.00 ? 82  THR A HG1  2  
ATOM   4146  H  HG21 . THR A 1 82 ? 143.964 -4.677  3.451   1.00 0.00 ? 82  THR A HG21 2  
ATOM   4147  H  HG22 . THR A 1 82 ? 142.744 -3.443  3.152   1.00 0.00 ? 82  THR A HG22 2  
ATOM   4148  H  HG23 . THR A 1 82 ? 144.019 -3.719  1.970   1.00 0.00 ? 82  THR A HG23 2  
ATOM   4149  N  N    . VAL A 1 83 ? 143.394 -6.606  4.666   1.00 0.00 ? 83  VAL A N    2  
ATOM   4150  C  CA   . VAL A 1 83 ? 144.288 -7.527  5.348   1.00 0.00 ? 83  VAL A CA   2  
ATOM   4151  C  C    . VAL A 1 83 ? 143.467 -8.605  6.046   1.00 0.00 ? 83  VAL A C    2  
ATOM   4152  O  O    . VAL A 1 83 ? 143.821 -9.783  6.023   1.00 0.00 ? 83  VAL A O    2  
ATOM   4153  C  CB   . VAL A 1 83 ? 145.139 -6.764  6.376   1.00 0.00 ? 83  VAL A CB   2  
ATOM   4154  C  CG1  . VAL A 1 83 ? 146.062 -7.736  7.146   1.00 0.00 ? 83  VAL A CG1  2  
ATOM   4155  C  CG2  . VAL A 1 83 ? 145.977 -5.692  5.652   1.00 0.00 ? 83  VAL A CG2  2  
ATOM   4156  H  H    . VAL A 1 83 ? 143.374 -5.662  4.928   1.00 0.00 ? 83  VAL A H    2  
ATOM   4157  H  HA   . VAL A 1 83 ? 144.941 -7.990  4.623   1.00 0.00 ? 83  VAL A HA   2  
ATOM   4158  H  HB   . VAL A 1 83 ? 144.479 -6.277  7.078   1.00 0.00 ? 83  VAL A HB   2  
ATOM   4159  H  HG11 . VAL A 1 83 ? 145.794 -8.759  6.926   1.00 0.00 ? 83  VAL A HG11 2  
ATOM   4160  H  HG12 . VAL A 1 83 ? 145.960 -7.563  8.208   1.00 0.00 ? 83  VAL A HG12 2  
ATOM   4161  H  HG13 . VAL A 1 83 ? 147.091 -7.569  6.857   1.00 0.00 ? 83  VAL A HG13 2  
ATOM   4162  H  HG21 . VAL A 1 83 ? 146.096 -5.963  4.615   1.00 0.00 ? 83  VAL A HG21 2  
ATOM   4163  H  HG22 . VAL A 1 83 ? 146.950 -5.616  6.116   1.00 0.00 ? 83  VAL A HG22 2  
ATOM   4164  H  HG23 . VAL A 1 83 ? 145.474 -4.739  5.718   1.00 0.00 ? 83  VAL A HG23 2  
ATOM   4165  N  N    . ALA A 1 84 ? 142.361 -8.190  6.659   1.00 0.00 ? 84  ALA A N    2  
ATOM   4166  C  CA   . ALA A 1 84 ? 141.489 -9.129  7.351   1.00 0.00 ? 84  ALA A CA   2  
ATOM   4167  C  C    . ALA A 1 84 ? 140.890 -10.128 6.366   1.00 0.00 ? 84  ALA A C    2  
ATOM   4168  O  O    . ALA A 1 84 ? 140.709 -11.301 6.691   1.00 0.00 ? 84  ALA A O    2  
ATOM   4169  C  CB   . ALA A 1 84 ? 140.370 -8.373  8.065   1.00 0.00 ? 84  ALA A CB   2  
ATOM   4170  H  H    . ALA A 1 84 ? 142.125 -7.239  6.638   1.00 0.00 ? 84  ALA A H    2  
ATOM   4171  H  HA   . ALA A 1 84 ? 142.069 -9.668  8.085   1.00 0.00 ? 84  ALA A HA   2  
ATOM   4172  H  HB1  . ALA A 1 84 ? 140.768 -7.886  8.943   1.00 0.00 ? 84  ALA A HB1  2  
ATOM   4173  H  HB2  . ALA A 1 84 ? 139.597 -9.067  8.360   1.00 0.00 ? 84  ALA A HB2  2  
ATOM   4174  H  HB3  . ALA A 1 84 ? 139.954 -7.631  7.400   1.00 0.00 ? 84  ALA A HB3  2  
ATOM   4175  N  N    . CYS A 1 85 ? 140.586 -9.656  5.157   1.00 0.00 ? 85  CYS A N    2  
ATOM   4176  C  CA   . CYS A 1 85 ? 140.009 -10.527 4.136   1.00 0.00 ? 85  CYS A CA   2  
ATOM   4177  C  C    . CYS A 1 85 ? 140.954 -11.680 3.801   1.00 0.00 ? 85  CYS A C    2  
ATOM   4178  O  O    . CYS A 1 85 ? 140.511 -12.786 3.495   1.00 0.00 ? 85  CYS A O    2  
ATOM   4179  C  CB   . CYS A 1 85 ? 139.672 -9.719  2.877   1.00 0.00 ? 85  CYS A CB   2  
ATOM   4180  S  SG   . CYS A 1 85 ? 141.072 -9.742  1.725   1.00 0.00 ? 85  CYS A SG   2  
ATOM   4181  H  H    . CYS A 1 85 ? 140.749 -8.705  4.953   1.00 0.00 ? 85  CYS A H    2  
ATOM   4182  H  HA   . CYS A 1 85 ? 139.097 -10.946 4.521   1.00 0.00 ? 85  CYS A HA   2  
ATOM   4183  H  HB2  . CYS A 1 85 ? 138.803 -10.152 2.397   1.00 0.00 ? 85  CYS A HB2  2  
ATOM   4184  H  HB3  . CYS A 1 85 ? 139.452 -8.699  3.156   1.00 0.00 ? 85  CYS A HB3  2  
ATOM   4185  H  HG   . CYS A 1 85 ? 141.715 -10.376 2.052   1.00 0.00 ? 85  CYS A HG   2  
ATOM   4186  N  N    . ASN A 1 86 ? 142.255 -11.416 3.860   1.00 0.00 ? 86  ASN A N    2  
ATOM   4187  C  CA   . ASN A 1 86 ? 143.244 -12.446 3.559   1.00 0.00 ? 86  ASN A CA   2  
ATOM   4188  C  C    . ASN A 1 86 ? 143.017 -13.681 4.430   1.00 0.00 ? 86  ASN A C    2  
ATOM   4189  O  O    . ASN A 1 86 ? 143.178 -14.823 3.976   1.00 0.00 ? 86  ASN A O    2  
ATOM   4190  C  CB   . ASN A 1 86 ? 144.652 -11.900 3.798   1.00 0.00 ? 86  ASN A CB   2  
ATOM   4191  C  CG   . ASN A 1 86 ? 145.692 -12.903 3.311   1.00 0.00 ? 86  ASN A CG   2  
ATOM   4192  O  OD1  . ASN A 1 86 ? 146.340 -13.567 4.119   1.00 0.00 ? 86  ASN A OD1  2  
ATOM   4193  N  ND2  . ASN A 1 86 ? 145.888 -13.056 2.030   1.00 0.00 ? 86  ASN A ND2  2  
ATOM   4194  H  H    . ASN A 1 86 ? 142.554 -10.517 4.109   1.00 0.00 ? 86  ASN A H    2  
ATOM   4195  H  HA   . ASN A 1 86 ? 143.151 -12.728 2.520   1.00 0.00 ? 86  ASN A HA   2  
ATOM   4196  H  HB2  . ASN A 1 86 ? 144.772 -10.971 3.261   1.00 0.00 ? 86  ASN A HB2  2  
ATOM   4197  H  HB3  . ASN A 1 86 ? 144.793 -11.723 4.854   1.00 0.00 ? 86  ASN A HB3  2  
ATOM   4198  H  HD21 . ASN A 1 86 ? 145.369 -12.528 1.388   1.00 0.00 ? 86  ASN A HD21 2  
ATOM   4199  H  HD22 . ASN A 1 86 ? 146.554 -13.699 1.710   1.00 0.00 ? 86  ASN A HD22 2  
ATOM   4200  N  N    . ASN A 1 87 ? 142.627 -13.455 5.680   1.00 0.00 ? 87  ASN A N    2  
ATOM   4201  C  CA   . ASN A 1 87 ? 142.384 -14.570 6.579   1.00 0.00 ? 87  ASN A CA   2  
ATOM   4202  C  C    . ASN A 1 87 ? 141.413 -15.533 5.920   1.00 0.00 ? 87  ASN A C    2  
ATOM   4203  O  O    . ASN A 1 87 ? 141.572 -16.748 6.015   1.00 0.00 ? 87  ASN A O    2  
ATOM   4204  C  CB   . ASN A 1 87 ? 141.798 -14.067 7.900   1.00 0.00 ? 87  ASN A CB   2  
ATOM   4205  C  CG   . ASN A 1 87 ? 141.828 -15.181 8.941   1.00 0.00 ? 87  ASN A CG   2  
ATOM   4206  O  OD1  . ASN A 1 87 ? 142.435 -16.227 8.714   1.00 0.00 ? 87  ASN A OD1  2  
ATOM   4207  N  ND2  . ASN A 1 87 ? 141.204 -15.017 10.075  1.00 0.00 ? 87  ASN A ND2  2  
ATOM   4208  H  H    . ASN A 1 87 ? 142.501 -12.536 5.996   1.00 0.00 ? 87  ASN A H    2  
ATOM   4209  H  HA   . ASN A 1 87 ? 143.315 -15.080 6.775   1.00 0.00 ? 87  ASN A HA   2  
ATOM   4210  H  HB2  . ASN A 1 87 ? 142.381 -13.228 8.254   1.00 0.00 ? 87  ASN A HB2  2  
ATOM   4211  H  HB3  . ASN A 1 87 ? 140.777 -13.752 7.742   1.00 0.00 ? 87  ASN A HB3  2  
ATOM   4212  H  HD21 . ASN A 1 87 ? 140.720 -14.183 10.253  1.00 0.00 ? 87  ASN A HD21 2  
ATOM   4213  H  HD22 . ASN A 1 87 ? 141.218 -15.729 10.749  1.00 0.00 ? 87  ASN A HD22 2  
ATOM   4214  N  N    . PHE A 1 88 ? 140.430 -14.981 5.218   1.00 0.00 ? 88  PHE A N    2  
ATOM   4215  C  CA   . PHE A 1 88 ? 139.469 -15.811 4.512   1.00 0.00 ? 88  PHE A CA   2  
ATOM   4216  C  C    . PHE A 1 88 ? 140.202 -16.690 3.507   1.00 0.00 ? 88  PHE A C    2  
ATOM   4217  O  O    . PHE A 1 88 ? 139.909 -17.877 3.371   1.00 0.00 ? 88  PHE A O    2  
ATOM   4218  C  CB   . PHE A 1 88 ? 138.443 -14.939 3.786   1.00 0.00 ? 88  PHE A CB   2  
ATOM   4219  C  CG   . PHE A 1 88 ? 137.379 -15.818 3.173   1.00 0.00 ? 88  PHE A CG   2  
ATOM   4220  C  CD1  . PHE A 1 88 ? 136.286 -16.233 3.942   1.00 0.00 ? 88  PHE A CD1  2  
ATOM   4221  C  CD2  . PHE A 1 88 ? 137.487 -16.217 1.836   1.00 0.00 ? 88  PHE A CD2  2  
ATOM   4222  C  CE1  . PHE A 1 88 ? 135.301 -17.048 3.374   1.00 0.00 ? 88  PHE A CE1  2  
ATOM   4223  C  CE2  . PHE A 1 88 ? 136.501 -17.032 1.268   1.00 0.00 ? 88  PHE A CE2  2  
ATOM   4224  C  CZ   . PHE A 1 88 ? 135.408 -17.448 2.036   1.00 0.00 ? 88  PHE A CZ   2  
ATOM   4225  H  H    . PHE A 1 88 ? 140.368 -14.006 5.152   1.00 0.00 ? 88  PHE A H    2  
ATOM   4226  H  HA   . PHE A 1 88 ? 138.956 -16.441 5.224   1.00 0.00 ? 88  PHE A HA   2  
ATOM   4227  H  HB2  . PHE A 1 88 ? 137.987 -14.258 4.490   1.00 0.00 ? 88  PHE A HB2  2  
ATOM   4228  H  HB3  . PHE A 1 88 ? 138.935 -14.376 3.007   1.00 0.00 ? 88  PHE A HB3  2  
ATOM   4229  H  HD1  . PHE A 1 88 ? 136.203 -15.925 4.974   1.00 0.00 ? 88  PHE A HD1  2  
ATOM   4230  H  HD2  . PHE A 1 88 ? 138.331 -15.897 1.242   1.00 0.00 ? 88  PHE A HD2  2  
ATOM   4231  H  HE1  . PHE A 1 88 ? 134.457 -17.369 3.967   1.00 0.00 ? 88  PHE A HE1  2  
ATOM   4232  H  HE2  . PHE A 1 88 ? 136.584 -17.341 0.235   1.00 0.00 ? 88  PHE A HE2  2  
ATOM   4233  H  HZ   . PHE A 1 88 ? 134.647 -18.077 1.598   1.00 0.00 ? 88  PHE A HZ   2  
ATOM   4234  N  N    . PHE A 1 89 ? 141.168 -16.093 2.807   1.00 0.00 ? 89  PHE A N    2  
ATOM   4235  C  CA   . PHE A 1 89 ? 141.945 -16.833 1.821   1.00 0.00 ? 89  PHE A CA   2  
ATOM   4236  C  C    . PHE A 1 89 ? 142.635 -18.008 2.493   1.00 0.00 ? 89  PHE A C    2  
ATOM   4237  O  O    . PHE A 1 89 ? 142.632 -19.127 1.980   1.00 0.00 ? 89  PHE A O    2  
ATOM   4238  C  CB   . PHE A 1 89 ? 143.009 -15.925 1.200   1.00 0.00 ? 89  PHE A CB   2  
ATOM   4239  C  CG   . PHE A 1 89 ? 143.692 -16.652 0.067   1.00 0.00 ? 89  PHE A CG   2  
ATOM   4240  C  CD1  . PHE A 1 89 ? 143.125 -16.642 -1.213  1.00 0.00 ? 89  PHE A CD1  2  
ATOM   4241  C  CD2  . PHE A 1 89 ? 144.891 -17.338 0.297   1.00 0.00 ? 89  PHE A CD2  2  
ATOM   4242  C  CE1  . PHE A 1 89 ? 143.758 -17.316 -2.265  1.00 0.00 ? 89  PHE A CE1  2  
ATOM   4243  C  CE2  . PHE A 1 89 ? 145.523 -18.012 -0.755  1.00 0.00 ? 89  PHE A CE2  2  
ATOM   4244  C  CZ   . PHE A 1 89 ? 144.957 -18.002 -2.034  1.00 0.00 ? 89  PHE A CZ   2  
ATOM   4245  H  H    . PHE A 1 89 ? 141.362 -15.145 2.961   1.00 0.00 ? 89  PHE A H    2  
ATOM   4246  H  HA   . PHE A 1 89 ? 141.289 -17.196 1.045   1.00 0.00 ? 89  PHE A HA   2  
ATOM   4247  H  HB2  . PHE A 1 89 ? 142.547 -15.024 0.833   1.00 0.00 ? 89  PHE A HB2  2  
ATOM   4248  H  HB3  . PHE A 1 89 ? 143.742 -15.670 1.948   1.00 0.00 ? 89  PHE A HB3  2  
ATOM   4249  H  HD1  . PHE A 1 89 ? 142.200 -16.113 -1.391  1.00 0.00 ? 89  PHE A HD1  2  
ATOM   4250  H  HD2  . PHE A 1 89 ? 145.327 -17.345 1.284   1.00 0.00 ? 89  PHE A HD2  2  
ATOM   4251  H  HE1  . PHE A 1 89 ? 143.322 -17.309 -3.252  1.00 0.00 ? 89  PHE A HE1  2  
ATOM   4252  H  HE2  . PHE A 1 89 ? 146.449 -18.541 -0.577  1.00 0.00 ? 89  PHE A HE2  2  
ATOM   4253  H  HZ   . PHE A 1 89 ? 145.446 -18.522 -2.845  1.00 0.00 ? 89  PHE A HZ   2  
ATOM   4254  N  N    . TRP A 1 90 ? 143.223 -17.737 3.653   1.00 0.00 ? 90  TRP A N    2  
ATOM   4255  C  CA   . TRP A 1 90 ? 143.915 -18.777 4.409   1.00 0.00 ? 90  TRP A CA   2  
ATOM   4256  C  C    . TRP A 1 90 ? 142.985 -19.939 4.753   1.00 0.00 ? 90  TRP A C    2  
ATOM   4257  O  O    . TRP A 1 90 ? 143.414 -21.091 4.796   1.00 0.00 ? 90  TRP A O    2  
ATOM   4258  C  CB   . TRP A 1 90 ? 144.528 -18.184 5.677   1.00 0.00 ? 90  TRP A CB   2  
ATOM   4259  C  CG   . TRP A 1 90 ? 145.747 -17.399 5.307   1.00 0.00 ? 90  TRP A CG   2  
ATOM   4260  C  CD1  . TRP A 1 90 ? 145.791 -16.059 5.129   1.00 0.00 ? 90  TRP A CD1  2  
ATOM   4261  C  CD2  . TRP A 1 90 ? 147.100 -17.887 5.073   1.00 0.00 ? 90  TRP A CD2  2  
ATOM   4262  N  NE1  . TRP A 1 90 ? 147.084 -15.696 4.796   1.00 0.00 ? 90  TRP A NE1  2  
ATOM   4263  C  CE2  . TRP A 1 90 ? 147.928 -16.786 4.751   1.00 0.00 ? 90  TRP A CE2  2  
ATOM   4264  C  CE3  . TRP A 1 90 ? 147.682 -19.167 5.108   1.00 0.00 ? 90  TRP A CE3  2  
ATOM   4265  C  CZ2  . TRP A 1 90 ? 149.285 -16.949 4.473   1.00 0.00 ? 90  TRP A CZ2  2  
ATOM   4266  C  CZ3  . TRP A 1 90 ? 149.049 -19.334 4.830   1.00 0.00 ? 90  TRP A CZ3  2  
ATOM   4267  C  CH2  . TRP A 1 90 ? 149.848 -18.227 4.512   1.00 0.00 ? 90  TRP A CH2  2  
ATOM   4268  H  H    . TRP A 1 90 ? 143.187 -16.812 4.010   1.00 0.00 ? 90  TRP A H    2  
ATOM   4269  H  HA   . TRP A 1 90 ? 144.717 -19.161 3.795   1.00 0.00 ? 90  TRP A HA   2  
ATOM   4270  H  HB2  . TRP A 1 90 ? 143.810 -17.536 6.157   1.00 0.00 ? 90  TRP A HB2  2  
ATOM   4271  H  HB3  . TRP A 1 90 ? 144.804 -18.980 6.353   1.00 0.00 ? 90  TRP A HB3  2  
ATOM   4272  H  HD1  . TRP A 1 90 ? 144.955 -15.385 5.222   1.00 0.00 ? 90  TRP A HD1  2  
ATOM   4273  H  HE1  . TRP A 1 90 ? 147.385 -14.780 4.613   1.00 0.00 ? 90  TRP A HE1  2  
ATOM   4274  H  HE3  . TRP A 1 90 ? 147.075 -20.027 5.351   1.00 0.00 ? 90  TRP A HE3  2  
ATOM   4275  H  HZ2  . TRP A 1 90 ? 149.897 -16.093 4.229   1.00 0.00 ? 90  TRP A HZ2  2  
ATOM   4276  H  HZ3  . TRP A 1 90 ? 149.486 -20.322 4.860   1.00 0.00 ? 90  TRP A HZ3  2  
ATOM   4277  H  HH2  . TRP A 1 90 ? 150.898 -18.362 4.300   1.00 0.00 ? 90  TRP A HH2  2  
ATOM   4278  N  N    . GLU A 1 91 ? 141.712 -19.638 4.998   1.00 0.00 ? 91  GLU A N    2  
ATOM   4279  C  CA   . GLU A 1 91 ? 140.748 -20.683 5.335   1.00 0.00 ? 91  GLU A CA   2  
ATOM   4280  C  C    . GLU A 1 91 ? 140.627 -21.692 4.197   1.00 0.00 ? 91  GLU A C    2  
ATOM   4281  O  O    . GLU A 1 91 ? 140.386 -22.877 4.431   1.00 0.00 ? 91  GLU A O    2  
ATOM   4282  C  CB   . GLU A 1 91 ? 139.374 -20.072 5.622   1.00 0.00 ? 91  GLU A CB   2  
ATOM   4283  C  CG   . GLU A 1 91 ? 139.453 -19.194 6.873   1.00 0.00 ? 91  GLU A CG   2  
ATOM   4284  C  CD   . GLU A 1 91 ? 138.074 -18.633 7.204   1.00 0.00 ? 91  GLU A CD   2  
ATOM   4285  O  OE1  . GLU A 1 91 ? 137.180 -18.795 6.389   1.00 0.00 ? 91  GLU A OE1  2  
ATOM   4286  O  OE2  . GLU A 1 91 ? 137.933 -18.051 8.266   1.00 0.00 ? 91  GLU A OE2  2  
ATOM   4287  H  H    . GLU A 1 91 ? 141.417 -18.705 4.951   1.00 0.00 ? 91  GLU A H    2  
ATOM   4288  H  HA   . GLU A 1 91 ? 141.090 -21.197 6.221   1.00 0.00 ? 91  GLU A HA   2  
ATOM   4289  H  HB2  . GLU A 1 91 ? 139.064 -19.472 4.780   1.00 0.00 ? 91  GLU A HB2  2  
ATOM   4290  H  HB3  . GLU A 1 91 ? 138.656 -20.861 5.785   1.00 0.00 ? 91  GLU A HB3  2  
ATOM   4291  H  HG2  . GLU A 1 91 ? 139.809 -19.786 7.704   1.00 0.00 ? 91  GLU A HG2  2  
ATOM   4292  H  HG3  . GLU A 1 91 ? 140.136 -18.380 6.696   1.00 0.00 ? 91  GLU A HG3  2  
ATOM   4293  N  N    . ASN A 1 92 ? 140.796 -21.218 2.968   1.00 0.00 ? 92  ASN A N    2  
ATOM   4294  C  CA   . ASN A 1 92 ? 140.700 -22.093 1.805   1.00 0.00 ? 92  ASN A CA   2  
ATOM   4295  C  C    . ASN A 1 92 ? 141.660 -23.272 1.940   1.00 0.00 ? 92  ASN A C    2  
ATOM   4296  O  O    . ASN A 1 92 ? 141.362 -24.380 1.497   1.00 0.00 ? 92  ASN A O    2  
ATOM   4297  C  CB   . ASN A 1 92 ? 141.029 -21.310 0.532   1.00 0.00 ? 92  ASN A CB   2  
ATOM   4298  C  CG   . ASN A 1 92 ? 140.025 -20.178 0.344   1.00 0.00 ? 92  ASN A CG   2  
ATOM   4299  O  OD1  . ASN A 1 92 ? 140.409 -19.055 0.018   1.00 0.00 ? 92  ASN A OD1  2  
ATOM   4300  N  ND2  . ASN A 1 92 ? 138.754 -20.407 0.531   1.00 0.00 ? 92  ASN A ND2  2  
ATOM   4301  H  H    . ASN A 1 92 ? 140.985 -20.265 2.840   1.00 0.00 ? 92  ASN A H    2  
ATOM   4302  H  HA   . ASN A 1 92 ? 139.691 -22.470 1.731   1.00 0.00 ? 92  ASN A HA   2  
ATOM   4303  H  HB2  . ASN A 1 92 ? 142.024 -20.897 0.613   1.00 0.00 ? 92  ASN A HB2  2  
ATOM   4304  H  HB3  . ASN A 1 92 ? 140.983 -21.973 -0.319  1.00 0.00 ? 92  ASN A HB3  2  
ATOM   4305  H  HD21 . ASN A 1 92 ? 138.450 -21.302 0.790   1.00 0.00 ? 92  ASN A HD21 2  
ATOM   4306  H  HD22 . ASN A 1 92 ? 138.104 -19.684 0.412   1.00 0.00 ? 92  ASN A HD22 2  
ATOM   4307  N  N    . SER A 1 93 ? 142.811 -23.024 2.555   1.00 0.00 ? 93  SER A N    2  
ATOM   4308  C  CA   . SER A 1 93 ? 143.806 -24.074 2.743   1.00 0.00 ? 93  SER A CA   2  
ATOM   4309  C  C    . SER A 1 93 ? 143.399 -24.999 3.885   1.00 0.00 ? 93  SER A C    2  
ATOM   4310  O  O    . SER A 1 93 ? 142.456 -24.665 4.585   1.00 0.00 ? 93  SER A O    2  
ATOM   4311  C  CB   . SER A 1 93 ? 145.169 -23.454 3.048   1.00 0.00 ? 93  SER A CB   2  
ATOM   4312  O  OG   . SER A 1 93 ? 146.081 -24.481 3.417   1.00 0.00 ? 93  SER A OG   2  
ATOM   4313  O  OXT  . SER A 1 93 ? 144.036 -26.027 4.044   1.00 0.00 ? 93  SER A OXT  2  
ATOM   4314  H  H    . SER A 1 93 ? 142.995 -22.121 2.889   1.00 0.00 ? 93  SER A H    2  
ATOM   4315  H  HA   . SER A 1 93 ? 143.881 -24.651 1.835   1.00 0.00 ? 93  SER A HA   2  
ATOM   4316  H  HB2  . SER A 1 93 ? 145.541 -22.948 2.173   1.00 0.00 ? 93  SER A HB2  2  
ATOM   4317  H  HB3  . SER A 1 93 ? 145.067 -22.742 3.857   1.00 0.00 ? 93  SER A HB3  2  
ATOM   4318  H  HG   . SER A 1 93 ? 145.895 -24.730 4.325   1.00 0.00 ? 93  SER A HG   2  
ATOM   4319  N  N    . GLY B 1 1  ? 131.132 -11.557 -8.908  1.00 0.00 ? 1   GLY B N    2  
ATOM   4320  C  CA   . GLY B 1 1  ? 132.394 -11.001 -9.383  1.00 0.00 ? 1   GLY B CA   2  
ATOM   4321  C  C    . GLY B 1 1  ? 132.490 -9.513  -9.060  1.00 0.00 ? 1   GLY B C    2  
ATOM   4322  O  O    . GLY B 1 1  ? 131.761 -8.697  -9.624  1.00 0.00 ? 1   GLY B O    2  
ATOM   4323  H  H1   . GLY B 1 1  ? 130.475 -10.977 -8.469  1.00 0.00 ? 1   GLY B H1   2  
ATOM   4324  H  HA2  . GLY B 1 1  ? 133.212 -11.521 -8.908  1.00 0.00 ? 1   GLY B HA2  2  
ATOM   4325  H  HA3  . GLY B 1 1  ? 132.460 -11.132 -10.452 1.00 0.00 ? 1   GLY B HA3  2  
ATOM   4326  N  N    . SER B 1 2  ? 133.393 -9.168  -8.146  1.00 0.00 ? 2   SER B N    2  
ATOM   4327  C  CA   . SER B 1 2  ? 133.580 -7.774  -7.749  1.00 0.00 ? 2   SER B CA   2  
ATOM   4328  C  C    . SER B 1 2  ? 134.993 -7.302  -8.067  1.00 0.00 ? 2   SER B C    2  
ATOM   4329  O  O    . SER B 1 2  ? 135.964 -8.014  -7.809  1.00 0.00 ? 2   SER B O    2  
ATOM   4330  C  CB   . SER B 1 2  ? 133.343 -7.645  -6.247  1.00 0.00 ? 2   SER B CB   2  
ATOM   4331  O  OG   . SER B 1 2  ? 133.593 -6.308  -5.849  1.00 0.00 ? 2   SER B OG   2  
ATOM   4332  H  H    . SER B 1 2  ? 133.945 -9.863  -7.730  1.00 0.00 ? 2   SER B H    2  
ATOM   4333  H  HA   . SER B 1 2  ? 132.871 -7.150  -8.272  1.00 0.00 ? 2   SER B HA   2  
ATOM   4334  H  HB2  . SER B 1 2  ? 132.320 -7.897  -6.019  1.00 0.00 ? 2   SER B HB2  2  
ATOM   4335  H  HB3  . SER B 1 2  ? 134.004 -8.319  -5.719  1.00 0.00 ? 2   SER B HB3  2  
ATOM   4336  H  HG   . SER B 1 2  ? 132.752 -5.901  -5.628  1.00 0.00 ? 2   SER B HG   2  
ATOM   4337  N  N    . GLU B 1 3  ? 135.111 -6.092  -8.615  1.00 0.00 ? 3   GLU B N    2  
ATOM   4338  C  CA   . GLU B 1 3  ? 136.428 -5.559  -8.934  1.00 0.00 ? 3   GLU B CA   2  
ATOM   4339  C  C    . GLU B 1 3  ? 137.219 -5.358  -7.649  1.00 0.00 ? 3   GLU B C    2  
ATOM   4340  O  O    . GLU B 1 3  ? 138.428 -5.586  -7.600  1.00 0.00 ? 3   GLU B O    2  
ATOM   4341  C  CB   . GLU B 1 3  ? 136.304 -4.196  -9.618  1.00 0.00 ? 3   GLU B CB   2  
ATOM   4342  C  CG   . GLU B 1 3  ? 135.544 -4.315  -10.936 1.00 0.00 ? 3   GLU B CG   2  
ATOM   4343  C  CD   . GLU B 1 3  ? 135.542 -2.970  -11.655 1.00 0.00 ? 3   GLU B CD   2  
ATOM   4344  O  OE1  . GLU B 1 3  ? 135.963 -1.998  -11.051 1.00 0.00 ? 3   GLU B OE1  2  
ATOM   4345  O  OE2  . GLU B 1 3  ? 135.117 -2.932  -12.798 1.00 0.00 ? 3   GLU B OE2  2  
ATOM   4346  H  H    . GLU B 1 3  ? 134.310 -5.556  -8.792  1.00 0.00 ? 3   GLU B H    2  
ATOM   4347  H  HA   . GLU B 1 3  ? 136.951 -6.242  -9.584  1.00 0.00 ? 3   GLU B HA   2  
ATOM   4348  H  HB2  . GLU B 1 3  ? 135.774 -3.528  -8.963  1.00 0.00 ? 3   GLU B HB2  2  
ATOM   4349  H  HB3  . GLU B 1 3  ? 137.290 -3.801  -9.810  1.00 0.00 ? 3   GLU B HB3  2  
ATOM   4350  H  HG2  . GLU B 1 3  ? 136.007 -5.063  -11.560 1.00 0.00 ? 3   GLU B HG2  2  
ATOM   4351  H  HG3  . GLU B 1 3  ? 134.523 -4.596  -10.726 1.00 0.00 ? 3   GLU B HG3  2  
ATOM   4352  N  N    . LEU B 1 4  ? 136.512 -4.911  -6.614  1.00 0.00 ? 4   LEU B N    2  
ATOM   4353  C  CA   . LEU B 1 4  ? 137.129 -4.653  -5.320  1.00 0.00 ? 4   LEU B CA   2  
ATOM   4354  C  C    . LEU B 1 4  ? 137.715 -5.927  -4.734  1.00 0.00 ? 4   LEU B C    2  
ATOM   4355  O  O    . LEU B 1 4  ? 138.804 -5.911  -4.158  1.00 0.00 ? 4   LEU B O    2  
ATOM   4356  C  CB   . LEU B 1 4  ? 136.075 -4.086  -4.373  1.00 0.00 ? 4   LEU B CB   2  
ATOM   4357  C  CG   . LEU B 1 4  ? 136.709 -3.659  -3.047  1.00 0.00 ? 4   LEU B CG   2  
ATOM   4358  C  CD1  . LEU B 1 4  ? 137.623 -2.455  -3.278  1.00 0.00 ? 4   LEU B CD1  2  
ATOM   4359  C  CD2  . LEU B 1 4  ? 135.595 -3.262  -2.067  1.00 0.00 ? 4   LEU B CD2  2  
ATOM   4360  H  H    . LEU B 1 4  ? 135.554 -4.741  -6.727  1.00 0.00 ? 4   LEU B H    2  
ATOM   4361  H  HA   . LEU B 1 4  ? 137.916 -3.926  -5.443  1.00 0.00 ? 4   LEU B HA   2  
ATOM   4362  H  HB2  . LEU B 1 4  ? 135.593 -3.237  -4.833  1.00 0.00 ? 4   LEU B HB2  2  
ATOM   4363  H  HB3  . LEU B 1 4  ? 135.347 -4.852  -4.180  1.00 0.00 ? 4   LEU B HB3  2  
ATOM   4364  H  HG   . LEU B 1 4  ? 137.281 -4.478  -2.636  1.00 0.00 ? 4   LEU B HG   2  
ATOM   4365  H  HD11 . LEU B 1 4  ? 137.206 -1.826  -4.051  1.00 0.00 ? 4   LEU B HD11 2  
ATOM   4366  H  HD12 . LEU B 1 4  ? 138.600 -2.798  -3.583  1.00 0.00 ? 4   LEU B HD12 2  
ATOM   4367  H  HD13 . LEU B 1 4  ? 137.712 -1.889  -2.362  1.00 0.00 ? 4   LEU B HD13 2  
ATOM   4368  H  HD21 . LEU B 1 4  ? 134.733 -3.897  -2.218  1.00 0.00 ? 4   LEU B HD21 2  
ATOM   4369  H  HD22 . LEU B 1 4  ? 135.312 -2.232  -2.239  1.00 0.00 ? 4   LEU B HD22 2  
ATOM   4370  H  HD23 . LEU B 1 4  ? 135.950 -3.373  -1.054  1.00 0.00 ? 4   LEU B HD23 2  
ATOM   4371  N  N    . GLU B 1 5  ? 136.998 -7.041  -4.889  1.00 0.00 ? 5   GLU B N    2  
ATOM   4372  C  CA   . GLU B 1 5  ? 137.497 -8.302  -4.368  1.00 0.00 ? 5   GLU B CA   2  
ATOM   4373  C  C    . GLU B 1 5  ? 138.806 -8.631  -5.057  1.00 0.00 ? 5   GLU B C    2  
ATOM   4374  O  O    . GLU B 1 5  ? 139.769 -9.070  -4.428  1.00 0.00 ? 5   GLU B O    2  
ATOM   4375  C  CB   . GLU B 1 5  ? 136.482 -9.418  -4.619  1.00 0.00 ? 5   GLU B CB   2  
ATOM   4376  C  CG   . GLU B 1 5  ? 136.959 -10.704 -3.943  1.00 0.00 ? 5   GLU B CG   2  
ATOM   4377  C  CD   . GLU B 1 5  ? 136.007 -11.850 -4.269  1.00 0.00 ? 5   GLU B CD   2  
ATOM   4378  O  OE1  . GLU B 1 5  ? 135.060 -11.616 -5.001  1.00 0.00 ? 5   GLU B OE1  2  
ATOM   4379  O  OE2  . GLU B 1 5  ? 136.239 -12.944 -3.781  1.00 0.00 ? 5   GLU B OE2  2  
ATOM   4380  H  H    . GLU B 1 5  ? 136.140 -7.011  -5.362  1.00 0.00 ? 5   GLU B H    2  
ATOM   4381  H  HA   . GLU B 1 5  ? 137.666 -8.207  -3.311  1.00 0.00 ? 5   GLU B HA   2  
ATOM   4382  H  HB2  . GLU B 1 5  ? 135.523 -9.131  -4.211  1.00 0.00 ? 5   GLU B HB2  2  
ATOM   4383  H  HB3  . GLU B 1 5  ? 136.386 -9.586  -5.681  1.00 0.00 ? 5   GLU B HB3  2  
ATOM   4384  H  HG2  . GLU B 1 5  ? 137.950 -10.949 -4.298  1.00 0.00 ? 5   GLU B HG2  2  
ATOM   4385  H  HG3  . GLU B 1 5  ? 136.989 -10.558 -2.874  1.00 0.00 ? 5   GLU B HG3  2  
ATOM   4386  N  N    . THR B 1 6  ? 138.836 -8.369  -6.357  1.00 0.00 ? 6   THR B N    2  
ATOM   4387  C  CA   . THR B 1 6  ? 140.033 -8.587  -7.143  1.00 0.00 ? 6   THR B CA   2  
ATOM   4388  C  C    . THR B 1 6  ? 141.135 -7.650  -6.669  1.00 0.00 ? 6   THR B C    2  
ATOM   4389  O  O    . THR B 1 6  ? 142.309 -8.009  -6.652  1.00 0.00 ? 6   THR B O    2  
ATOM   4390  C  CB   . THR B 1 6  ? 139.739 -8.338  -8.626  1.00 0.00 ? 6   THR B CB   2  
ATOM   4391  O  OG1  . THR B 1 6  ? 138.629 -9.132  -9.021  1.00 0.00 ? 6   THR B OG1  2  
ATOM   4392  C  CG2  . THR B 1 6  ? 140.957 -8.717  -9.472  1.00 0.00 ? 6   THR B CG2  2  
ATOM   4393  H  H    . THR B 1 6  ? 138.042 -7.991  -6.788  1.00 0.00 ? 6   THR B H    2  
ATOM   4394  H  HA   . THR B 1 6  ? 140.360 -9.608  -7.015  1.00 0.00 ? 6   THR B HA   2  
ATOM   4395  H  HB   . THR B 1 6  ? 139.509 -7.294  -8.778  1.00 0.00 ? 6   THR B HB   2  
ATOM   4396  H  HG1  . THR B 1 6  ? 138.244 -8.734  -9.806  1.00 0.00 ? 6   THR B HG1  2  
ATOM   4397  H  HG21 . THR B 1 6  ? 141.862 -8.436  -8.954  1.00 0.00 ? 6   THR B HG21 2  
ATOM   4398  H  HG22 . THR B 1 6  ? 140.911 -8.202  -10.419 1.00 0.00 ? 6   THR B HG22 2  
ATOM   4399  H  HG23 . THR B 1 6  ? 140.959 -9.783  -9.642  1.00 0.00 ? 6   THR B HG23 2  
ATOM   4400  N  N    . ALA B 1 7  ? 140.737 -6.424  -6.324  1.00 0.00 ? 7   ALA B N    2  
ATOM   4401  C  CA   . ALA B 1 7  ? 141.693 -5.412  -5.891  1.00 0.00 ? 7   ALA B CA   2  
ATOM   4402  C  C    . ALA B 1 7  ? 142.395 -5.786  -4.581  1.00 0.00 ? 7   ALA B C    2  
ATOM   4403  O  O    . ALA B 1 7  ? 143.629 -5.720  -4.496  1.00 0.00 ? 7   ALA B O    2  
ATOM   4404  C  CB   . ALA B 1 7  ? 140.961 -4.072  -5.722  1.00 0.00 ? 7   ALA B CB   2  
ATOM   4405  H  H    . ALA B 1 7  ? 139.787 -6.191  -6.389  1.00 0.00 ? 7   ALA B H    2  
ATOM   4406  H  HA   . ALA B 1 7  ? 142.440 -5.294  -6.661  1.00 0.00 ? 7   ALA B HA   2  
ATOM   4407  H  HB1  . ALA B 1 7  ? 140.556 -4.004  -4.722  1.00 0.00 ? 7   ALA B HB1  2  
ATOM   4408  H  HB2  . ALA B 1 7  ? 140.151 -4.006  -6.438  1.00 0.00 ? 7   ALA B HB2  2  
ATOM   4409  H  HB3  . ALA B 1 7  ? 141.650 -3.258  -5.888  1.00 0.00 ? 7   ALA B HB3  2  
ATOM   4410  N  N    . MET B 1 8  ? 141.633 -6.186  -3.558  1.00 0.00 ? 8   MET B N    2  
ATOM   4411  C  CA   . MET B 1 8  ? 142.267 -6.540  -2.291  1.00 0.00 ? 8   MET B CA   2  
ATOM   4412  C  C    . MET B 1 8  ? 143.240 -7.677  -2.516  1.00 0.00 ? 8   MET B C    2  
ATOM   4413  O  O    . MET B 1 8  ? 144.343 -7.688  -1.973  1.00 0.00 ? 8   MET B O    2  
ATOM   4414  C  CB   . MET B 1 8  ? 141.238 -7.031  -1.268  1.00 0.00 ? 8   MET B CB   2  
ATOM   4415  C  CG   . MET B 1 8  ? 140.243 -5.929  -0.911  1.00 0.00 ? 8   MET B CG   2  
ATOM   4416  S  SD   . MET B 1 8  ? 139.251 -6.476  0.507   1.00 0.00 ? 8   MET B SD   2  
ATOM   4417  C  CE   . MET B 1 8  ? 138.650 -8.040  -0.185  1.00 0.00 ? 8   MET B CE   2  
ATOM   4418  H  H    . MET B 1 8  ? 140.664 -6.228  -3.652  1.00 0.00 ? 8   MET B H    2  
ATOM   4419  H  HA   . MET B 1 8  ? 142.791 -5.685  -1.893  1.00 0.00 ? 8   MET B HA   2  
ATOM   4420  H  HB2  . MET B 1 8  ? 140.702 -7.870  -1.683  1.00 0.00 ? 8   MET B HB2  2  
ATOM   4421  H  HB3  . MET B 1 8  ? 141.753 -7.348  -0.372  1.00 0.00 ? 8   MET B HB3  2  
ATOM   4422  H  HG2  . MET B 1 8  ? 140.778 -5.027  -0.657  1.00 0.00 ? 8   MET B HG2  2  
ATOM   4423  H  HG3  . MET B 1 8  ? 139.596 -5.741  -1.754  1.00 0.00 ? 8   MET B HG3  2  
ATOM   4424  H  HE1  . MET B 1 8  ? 139.409 -8.802  -0.068  1.00 0.00 ? 8   MET B HE1  2  
ATOM   4425  H  HE2  . MET B 1 8  ? 138.435 -7.914  -1.231  1.00 0.00 ? 8   MET B HE2  2  
ATOM   4426  H  HE3  . MET B 1 8  ? 137.748 -8.343  0.336   1.00 0.00 ? 8   MET B HE3  2  
ATOM   4427  N  N    . GLU B 1 9  ? 142.821 -8.629  -3.337  1.00 0.00 ? 9   GLU B N    2  
ATOM   4428  C  CA   . GLU B 1 9  ? 143.662 -9.767  -3.645  1.00 0.00 ? 9   GLU B CA   2  
ATOM   4429  C  C    . GLU B 1 9  ? 144.879 -9.340  -4.443  1.00 0.00 ? 9   GLU B C    2  
ATOM   4430  O  O    . GLU B 1 9  ? 145.972 -9.868  -4.250  1.00 0.00 ? 9   GLU B O    2  
ATOM   4431  C  CB   . GLU B 1 9  ? 142.855 -10.800 -4.430  1.00 0.00 ? 9   GLU B CB   2  
ATOM   4432  C  CG   . GLU B 1 9  ? 141.766 -11.378 -3.532  1.00 0.00 ? 9   GLU B CG   2  
ATOM   4433  C  CD   . GLU B 1 9  ? 140.989 -12.455 -4.280  1.00 0.00 ? 9   GLU B CD   2  
ATOM   4434  O  OE1  . GLU B 1 9  ? 141.200 -12.588 -5.475  1.00 0.00 ? 9   GLU B OE1  2  
ATOM   4435  O  OE2  . GLU B 1 9  ? 140.193 -13.130 -3.649  1.00 0.00 ? 9   GLU B OE2  2  
ATOM   4436  H  H    . GLU B 1 9  ? 141.935 -8.559  -3.746  1.00 0.00 ? 9   GLU B H    2  
ATOM   4437  H  HA   . GLU B 1 9  ? 143.992 -10.217 -2.721  1.00 0.00 ? 9   GLU B HA   2  
ATOM   4438  H  HB2  . GLU B 1 9  ? 142.395 -10.319 -5.280  1.00 0.00 ? 9   GLU B HB2  2  
ATOM   4439  H  HB3  . GLU B 1 9  ? 143.504 -11.592 -4.764  1.00 0.00 ? 9   GLU B HB3  2  
ATOM   4440  H  HG2  . GLU B 1 9  ? 142.225 -11.811 -2.655  1.00 0.00 ? 9   GLU B HG2  2  
ATOM   4441  H  HG3  . GLU B 1 9  ? 141.092 -10.590 -3.235  1.00 0.00 ? 9   GLU B HG3  2  
ATOM   4442  N  N    . THR B 1 10 ? 144.687 -8.382  -5.344  1.00 0.00 ? 10  THR B N    2  
ATOM   4443  C  CA   . THR B 1 10 ? 145.792 -7.912  -6.159  1.00 0.00 ? 10  THR B CA   2  
ATOM   4444  C  C    . THR B 1 10 ? 146.879 -7.297  -5.294  1.00 0.00 ? 10  THR B C    2  
ATOM   4445  O  O    . THR B 1 10 ? 148.061 -7.578  -5.480  1.00 0.00 ? 10  THR B O    2  
ATOM   4446  C  CB   . THR B 1 10 ? 145.292 -6.871  -7.163  1.00 0.00 ? 10  THR B CB   2  
ATOM   4447  O  OG1  . THR B 1 10 ? 144.223 -7.422  -7.920  1.00 0.00 ? 10  THR B OG1  2  
ATOM   4448  C  CG2  . THR B 1 10 ? 146.432 -6.474  -8.101  1.00 0.00 ? 10  THR B CG2  2  
ATOM   4449  H  H    . THR B 1 10 ? 143.795 -7.995  -5.461  1.00 0.00 ? 10  THR B H    2  
ATOM   4450  H  HA   . THR B 1 10 ? 146.207 -8.743  -6.703  1.00 0.00 ? 10  THR B HA   2  
ATOM   4451  H  HB   . THR B 1 10 ? 144.945 -5.997  -6.635  1.00 0.00 ? 10  THR B HB   2  
ATOM   4452  H  HG1  . THR B 1 10 ? 144.405 -7.264  -8.850  1.00 0.00 ? 10  THR B HG1  2  
ATOM   4453  H  HG21 . THR B 1 10 ? 146.859 -7.362  -8.544  1.00 0.00 ? 10  THR B HG21 2  
ATOM   4454  H  HG22 . THR B 1 10 ? 147.193 -5.950  -7.541  1.00 0.00 ? 10  THR B HG22 2  
ATOM   4455  H  HG23 . THR B 1 10 ? 146.051 -5.831  -8.880  1.00 0.00 ? 10  THR B HG23 2  
ATOM   4456  N  N    . LEU B 1 11 ? 146.482 -6.465  -4.337  1.00 0.00 ? 11  LEU B N    2  
ATOM   4457  C  CA   . LEU B 1 11 ? 147.474 -5.841  -3.468  1.00 0.00 ? 11  LEU B CA   2  
ATOM   4458  C  C    . LEU B 1 11 ? 148.261 -6.901  -2.696  1.00 0.00 ? 11  LEU B C    2  
ATOM   4459  O  O    . LEU B 1 11 ? 149.505 -6.892  -2.659  1.00 0.00 ? 11  LEU B O    2  
ATOM   4460  C  CB   . LEU B 1 11 ? 146.743 -4.930  -2.482  1.00 0.00 ? 11  LEU B CB   2  
ATOM   4461  C  CG   . LEU B 1 11 ? 145.953 -3.873  -3.258  1.00 0.00 ? 11  LEU B CG   2  
ATOM   4462  C  CD1  . LEU B 1 11 ? 145.106 -3.042  -2.290  1.00 0.00 ? 11  LEU B CD1  2  
ATOM   4463  C  CD2  . LEU B 1 11 ? 146.928 -2.953  -4.001  1.00 0.00 ? 11  LEU B CD2  2  
ATOM   4464  H  H    . LEU B 1 11 ? 145.519 -6.269  -4.217  1.00 0.00 ? 11  LEU B H    2  
ATOM   4465  H  HA   . LEU B 1 11 ? 148.154 -5.250  -4.062  1.00 0.00 ? 11  LEU B HA   2  
ATOM   4466  H  HB2  . LEU B 1 11 ? 146.064 -5.519  -1.882  1.00 0.00 ? 11  LEU B HB2  2  
ATOM   4467  H  HB3  . LEU B 1 11 ? 147.461 -4.442  -1.840  1.00 0.00 ? 11  LEU B HB3  2  
ATOM   4468  H  HG   . LEU B 1 11 ? 145.310 -4.358  -3.971  1.00 0.00 ? 11  LEU B HG   2  
ATOM   4469  H  HD11 . LEU B 1 11 ? 144.144 -3.524  -2.155  1.00 0.00 ? 11  LEU B HD11 2  
ATOM   4470  H  HD12 . LEU B 1 11 ? 144.956 -2.052  -2.695  1.00 0.00 ? 11  LEU B HD12 2  
ATOM   4471  H  HD13 . LEU B 1 11 ? 145.609 -2.970  -1.337  1.00 0.00 ? 11  LEU B HD13 2  
ATOM   4472  H  HD21 . LEU B 1 11 ? 146.467 -1.989  -4.158  1.00 0.00 ? 11  LEU B HD21 2  
ATOM   4473  H  HD22 . LEU B 1 11 ? 147.178 -3.390  -4.956  1.00 0.00 ? 11  LEU B HD22 2  
ATOM   4474  H  HD23 . LEU B 1 11 ? 147.828 -2.829  -3.416  1.00 0.00 ? 11  LEU B HD23 2  
ATOM   4475  N  N    . ILE B 1 12 ? 147.526 -7.843  -2.114  1.00 0.00 ? 12  ILE B N    2  
ATOM   4476  C  CA   . ILE B 1 12 ? 148.154 -8.914  -1.367  1.00 0.00 ? 12  ILE B CA   2  
ATOM   4477  C  C    . ILE B 1 12 ? 149.065 -9.723  -2.265  1.00 0.00 ? 12  ILE B C    2  
ATOM   4478  O  O    . ILE B 1 12 ? 150.167 -10.082 -1.879  1.00 0.00 ? 12  ILE B O    2  
ATOM   4479  C  CB   . ILE B 1 12 ? 147.089 -9.818  -0.746  1.00 0.00 ? 12  ILE B CB   2  
ATOM   4480  C  CG1  . ILE B 1 12 ? 146.222 -8.993  0.208   1.00 0.00 ? 12  ILE B CG1  2  
ATOM   4481  C  CG2  . ILE B 1 12 ? 147.766 -10.949 0.031   1.00 0.00 ? 12  ILE B CG2  2  
ATOM   4482  C  CD1  . ILE B 1 12 ? 145.060 -9.848  0.717   1.00 0.00 ? 12  ILE B CD1  2  
ATOM   4483  H  H    . ILE B 1 12 ? 146.551 -7.819  -2.202  1.00 0.00 ? 12  ILE B H    2  
ATOM   4484  H  HA   . ILE B 1 12 ? 148.745 -8.483  -0.573  1.00 0.00 ? 12  ILE B HA   2  
ATOM   4485  H  HB   . ILE B 1 12 ? 146.471 -10.237 -1.528  1.00 0.00 ? 12  ILE B HB   2  
ATOM   4486  H  HG12 . ILE B 1 12 ? 146.821 -8.667  1.046   1.00 0.00 ? 12  ILE B HG12 2  
ATOM   4487  H  HG13 . ILE B 1 12 ? 145.833 -8.132  -0.311  1.00 0.00 ? 12  ILE B HG13 2  
ATOM   4488  H  HG21 . ILE B 1 12 ? 148.432 -10.529 0.770   1.00 0.00 ? 12  ILE B HG21 2  
ATOM   4489  H  HG22 . ILE B 1 12 ? 148.328 -11.568 -0.652  1.00 0.00 ? 12  ILE B HG22 2  
ATOM   4490  H  HG23 . ILE B 1 12 ? 147.014 -11.548 0.523   1.00 0.00 ? 12  ILE B HG23 2  
ATOM   4491  H  HD11 . ILE B 1 12 ? 145.438 -10.792 1.078   1.00 0.00 ? 12  ILE B HD11 2  
ATOM   4492  H  HD12 . ILE B 1 12 ? 144.362 -10.025 -0.089  1.00 0.00 ? 12  ILE B HD12 2  
ATOM   4493  H  HD13 . ILE B 1 12 ? 144.556 -9.330  1.520   1.00 0.00 ? 12  ILE B HD13 2  
ATOM   4494  N  N    . ASN B 1 13 ? 148.595 -10.011 -3.467  1.00 0.00 ? 13  ASN B N    2  
ATOM   4495  C  CA   . ASN B 1 13 ? 149.389 -10.781 -4.403  1.00 0.00 ? 13  ASN B CA   2  
ATOM   4496  C  C    . ASN B 1 13 ? 150.693 -10.065 -4.768  1.00 0.00 ? 13  ASN B C    2  
ATOM   4497  O  O    . ASN B 1 13 ? 151.734 -10.707 -4.885  1.00 0.00 ? 13  ASN B O    2  
ATOM   4498  C  CB   . ASN B 1 13 ? 148.560 -11.066 -5.658  1.00 0.00 ? 13  ASN B CB   2  
ATOM   4499  C  CG   . ASN B 1 13 ? 147.346 -11.915 -5.280  1.00 0.00 ? 13  ASN B CG   2  
ATOM   4500  O  OD1  . ASN B 1 13 ? 147.470 -12.849 -4.488  1.00 0.00 ? 13  ASN B OD1  2  
ATOM   4501  N  ND2  . ASN B 1 13 ? 146.170 -11.638 -5.778  1.00 0.00 ? 13  ASN B ND2  2  
ATOM   4502  H  H    . ASN B 1 13 ? 147.702 -9.702  -3.727  1.00 0.00 ? 13  ASN B H    2  
ATOM   4503  H  HA   . ASN B 1 13 ? 149.639 -11.725 -3.942  1.00 0.00 ? 13  ASN B HA   2  
ATOM   4504  H  HB2  . ASN B 1 13 ? 148.228 -10.133 -6.090  1.00 0.00 ? 13  ASN B HB2  2  
ATOM   4505  H  HB3  . ASN B 1 13 ? 149.163 -11.601 -6.375  1.00 0.00 ? 13  ASN B HB3  2  
ATOM   4506  H  HD21 . ASN B 1 13 ? 146.061 -10.883 -6.392  1.00 0.00 ? 13  ASN B HD21 2  
ATOM   4507  H  HD22 . ASN B 1 13 ? 145.395 -12.187 -5.537  1.00 0.00 ? 13  ASN B HD22 2  
ATOM   4508  N  N    . VAL B 1 14 ? 150.643 -8.741  -4.950  1.00 0.00 ? 14  VAL B N    2  
ATOM   4509  C  CA   . VAL B 1 14 ? 151.861 -8.001  -5.305  1.00 0.00 ? 14  VAL B CA   2  
ATOM   4510  C  C    . VAL B 1 14 ? 152.858 -7.952  -4.149  1.00 0.00 ? 14  VAL B C    2  
ATOM   4511  O  O    . VAL B 1 14 ? 154.030 -8.279  -4.324  1.00 0.00 ? 14  VAL B O    2  
ATOM   4512  C  CB   . VAL B 1 14 ? 151.505 -6.573  -5.690  1.00 0.00 ? 14  VAL B CB   2  
ATOM   4513  C  CG1  . VAL B 1 14 ? 152.769 -5.756  -5.946  1.00 0.00 ? 14  VAL B CG1  2  
ATOM   4514  C  CG2  . VAL B 1 14 ? 150.663 -6.595  -6.960  1.00 0.00 ? 14  VAL B CG2  2  
ATOM   4515  H  H    . VAL B 1 14 ? 149.790 -8.262  -4.851  1.00 0.00 ? 14  VAL B H    2  
ATOM   4516  H  HA   . VAL B 1 14 ? 152.327 -8.477  -6.161  1.00 0.00 ? 14  VAL B HA   2  
ATOM   4517  H  HB   . VAL B 1 14 ? 150.961 -6.124  -4.888  1.00 0.00 ? 14  VAL B HB   2  
ATOM   4518  H  HG11 . VAL B 1 14 ? 153.290 -5.597  -5.014  1.00 0.00 ? 14  VAL B HG11 2  
ATOM   4519  H  HG12 . VAL B 1 14 ? 152.490 -4.800  -6.371  1.00 0.00 ? 14  VAL B HG12 2  
ATOM   4520  H  HG13 . VAL B 1 14 ? 153.408 -6.286  -6.634  1.00 0.00 ? 14  VAL B HG13 2  
ATOM   4521  H  HG21 . VAL B 1 14 ? 150.341 -5.592  -7.199  1.00 0.00 ? 14  VAL B HG21 2  
ATOM   4522  H  HG22 . VAL B 1 14 ? 149.804 -7.226  -6.814  1.00 0.00 ? 14  VAL B HG22 2  
ATOM   4523  H  HG23 . VAL B 1 14 ? 151.260 -6.986  -7.769  1.00 0.00 ? 14  VAL B HG23 2  
ATOM   4524  N  N    . PHE B 1 15 ? 152.394 -7.541  -2.959  1.00 0.00 ? 15  PHE B N    2  
ATOM   4525  C  CA   . PHE B 1 15 ? 153.306 -7.469  -1.810  1.00 0.00 ? 15  PHE B CA   2  
ATOM   4526  C  C    . PHE B 1 15 ? 153.749 -8.855  -1.355  1.00 0.00 ? 15  PHE B C    2  
ATOM   4527  O  O    . PHE B 1 15 ? 154.932 -9.091  -1.117  1.00 0.00 ? 15  PHE B O    2  
ATOM   4528  C  CB   . PHE B 1 15 ? 152.667 -6.673  -0.668  1.00 0.00 ? 15  PHE B CB   2  
ATOM   4529  C  CG   . PHE B 1 15 ? 152.608 -5.216  -1.091  1.00 0.00 ? 15  PHE B CG   2  
ATOM   4530  C  CD1  . PHE B 1 15 ? 153.756 -4.425  -0.988  1.00 0.00 ? 15  PHE B CD1  2  
ATOM   4531  C  CD2  . PHE B 1 15 ? 151.429 -4.664  -1.602  1.00 0.00 ? 15  PHE B CD2  2  
ATOM   4532  C  CE1  . PHE B 1 15 ? 153.729 -3.087  -1.399  1.00 0.00 ? 15  PHE B CE1  2  
ATOM   4533  C  CE2  . PHE B 1 15 ? 151.398 -3.326  -2.009  1.00 0.00 ? 15  PHE B CE2  2  
ATOM   4534  C  CZ   . PHE B 1 15 ? 152.550 -2.538  -1.911  1.00 0.00 ? 15  PHE B CZ   2  
ATOM   4535  H  H    . PHE B 1 15 ? 151.442 -7.285  -2.857  1.00 0.00 ? 15  PHE B H    2  
ATOM   4536  H  HA   . PHE B 1 15 ? 154.192 -6.935  -2.116  1.00 0.00 ? 15  PHE B HA   2  
ATOM   4537  H  HB2  . PHE B 1 15 ? 151.669 -7.041  -0.482  1.00 0.00 ? 15  PHE B HB2  2  
ATOM   4538  H  HB3  . PHE B 1 15 ? 153.266 -6.766  0.224   1.00 0.00 ? 15  PHE B HB3  2  
ATOM   4539  H  HD1  . PHE B 1 15 ? 154.662 -4.846  -0.593  1.00 0.00 ? 15  PHE B HD1  2  
ATOM   4540  H  HD2  . PHE B 1 15 ? 150.542 -5.262  -1.669  1.00 0.00 ? 15  PHE B HD2  2  
ATOM   4541  H  HE1  . PHE B 1 15 ? 154.617 -2.479  -1.319  1.00 0.00 ? 15  PHE B HE1  2  
ATOM   4542  H  HE2  . PHE B 1 15 ? 150.486 -2.902  -2.403  1.00 0.00 ? 15  PHE B HE2  2  
ATOM   4543  H  HZ   . PHE B 1 15 ? 152.528 -1.505  -2.229  1.00 0.00 ? 15  PHE B HZ   2  
ATOM   4544  N  N    . HIS B 1 16 ? 152.799 -9.768  -1.267  1.00 0.00 ? 16  HIS B N    2  
ATOM   4545  C  CA   . HIS B 1 16 ? 153.087 -11.141 -0.868  1.00 0.00 ? 16  HIS B CA   2  
ATOM   4546  C  C    . HIS B 1 16 ? 154.045 -11.808 -1.850  1.00 0.00 ? 16  HIS B C    2  
ATOM   4547  O  O    . HIS B 1 16 ? 154.918 -12.582 -1.459  1.00 0.00 ? 16  HIS B O    2  
ATOM   4548  C  CB   . HIS B 1 16 ? 151.786 -11.944 -0.810  1.00 0.00 ? 16  HIS B CB   2  
ATOM   4549  C  CG   . HIS B 1 16 ? 152.062 -13.326 -0.287  1.00 0.00 ? 16  HIS B CG   2  
ATOM   4550  N  ND1  . HIS B 1 16 ? 152.456 -13.559 1.021   1.00 0.00 ? 16  HIS B ND1  2  
ATOM   4551  C  CD2  . HIS B 1 16 ? 151.995 -14.561 -0.884  1.00 0.00 ? 16  HIS B CD2  2  
ATOM   4552  C  CE1  . HIS B 1 16 ? 152.607 -14.888 1.168   1.00 0.00 ? 16  HIS B CE1  2  
ATOM   4553  N  NE2  . HIS B 1 16 ? 152.339 -15.545 0.037   1.00 0.00 ? 16  HIS B NE2  2  
ATOM   4554  H  H    . HIS B 1 16 ? 151.877 -9.521  -1.492  1.00 0.00 ? 16  HIS B H    2  
ATOM   4555  H  HA   . HIS B 1 16 ? 153.536 -11.135 0.113   1.00 0.00 ? 16  HIS B HA   2  
ATOM   4556  H  HB2  . HIS B 1 16 ? 151.085 -11.446 -0.156  1.00 0.00 ? 16  HIS B HB2  2  
ATOM   4557  H  HB3  . HIS B 1 16 ? 151.366 -12.016 -1.801  1.00 0.00 ? 16  HIS B HB3  2  
ATOM   4558  H  HD1  . HIS B 1 16 ? 152.598 -12.879 1.713   1.00 0.00 ? 16  HIS B HD1  2  
ATOM   4559  H  HD2  . HIS B 1 16 ? 151.717 -14.741 -1.912  1.00 0.00 ? 16  HIS B HD2  2  
ATOM   4560  H  HE1  . HIS B 1 16 ? 152.902 -15.365 2.090   1.00 0.00 ? 16  HIS B HE1  2  
ATOM   4561  H  HE2  . HIS B 1 16 ? 152.378 -16.514 -0.113  1.00 0.00 ? 16  HIS B HE2  2  
ATOM   4562  N  N    . ALA B 1 17 ? 153.836 -11.531 -3.134  1.00 0.00 ? 17  ALA B N    2  
ATOM   4563  C  CA   . ALA B 1 17 ? 154.645 -12.139 -4.186  1.00 0.00 ? 17  ALA B CA   2  
ATOM   4564  C  C    . ALA B 1 17 ? 156.128 -11.790 -4.069  1.00 0.00 ? 17  ALA B C    2  
ATOM   4565  O  O    . ALA B 1 17 ? 156.987 -12.651 -4.259  1.00 0.00 ? 17  ALA B O    2  
ATOM   4566  C  CB   . ALA B 1 17 ? 154.131 -11.652 -5.543  1.00 0.00 ? 17  ALA B CB   2  
ATOM   4567  H  H    . ALA B 1 17 ? 153.102 -10.931 -3.382  1.00 0.00 ? 17  ALA B H    2  
ATOM   4568  H  HA   . ALA B 1 17 ? 154.532 -13.211 -4.141  1.00 0.00 ? 17  ALA B HA   2  
ATOM   4569  H  HB1  . ALA B 1 17 ? 153.227 -12.183 -5.799  1.00 0.00 ? 17  ALA B HB1  2  
ATOM   4570  H  HB2  . ALA B 1 17 ? 154.880 -11.833 -6.299  1.00 0.00 ? 17  ALA B HB2  2  
ATOM   4571  H  HB3  . ALA B 1 17 ? 153.922 -10.588 -5.490  1.00 0.00 ? 17  ALA B HB3  2  
ATOM   4572  N  N    . HIS B 1 18 ? 156.429 -10.534 -3.769  1.00 0.00 ? 18  HIS B N    2  
ATOM   4573  C  CA   . HIS B 1 18 ? 157.821 -10.110 -3.651  1.00 0.00 ? 18  HIS B CA   2  
ATOM   4574  C  C    . HIS B 1 18 ? 158.378 -10.306 -2.241  1.00 0.00 ? 18  HIS B C    2  
ATOM   4575  O  O    . HIS B 1 18 ? 159.586 -10.469 -2.067  1.00 0.00 ? 18  HIS B O    2  
ATOM   4576  C  CB   . HIS B 1 18 ? 157.955 -8.652  -4.083  1.00 0.00 ? 18  HIS B CB   2  
ATOM   4577  C  CG   . HIS B 1 18 ? 157.616 -8.549  -5.548  1.00 0.00 ? 18  HIS B CG   2  
ATOM   4578  N  ND1  . HIS B 1 18 ? 158.465 -9.030  -6.534  1.00 0.00 ? 18  HIS B ND1  2  
ATOM   4579  C  CD2  . HIS B 1 18 ? 156.526 -8.039  -6.211  1.00 0.00 ? 18  HIS B CD2  2  
ATOM   4580  C  CE1  . HIS B 1 18 ? 157.879 -8.801  -7.722  1.00 0.00 ? 18  HIS B CE1  2  
ATOM   4581  N  NE2  . HIS B 1 18 ? 156.695 -8.199  -7.583  1.00 0.00 ? 18  HIS B NE2  2  
ATOM   4582  H  H    . HIS B 1 18 ? 155.711 -9.881  -3.635  1.00 0.00 ? 18  HIS B H    2  
ATOM   4583  H  HA   . HIS B 1 18 ? 158.411 -10.711 -4.327  1.00 0.00 ? 18  HIS B HA   2  
ATOM   4584  H  HB2  . HIS B 1 18 ? 157.274 -8.042  -3.508  1.00 0.00 ? 18  HIS B HB2  2  
ATOM   4585  H  HB3  . HIS B 1 18 ? 158.968 -8.316  -3.922  1.00 0.00 ? 18  HIS B HB3  2  
ATOM   4586  H  HD1  . HIS B 1 18 ? 159.335 -9.458  -6.389  1.00 0.00 ? 18  HIS B HD1  2  
ATOM   4587  H  HD2  . HIS B 1 18 ? 155.673 -7.575  -5.741  1.00 0.00 ? 18  HIS B HD2  2  
ATOM   4588  H  HE1  . HIS B 1 18 ? 158.313 -9.071  -8.673  1.00 0.00 ? 18  HIS B HE1  2  
ATOM   4589  H  HE2  . HIS B 1 18 ? 156.078 -7.928  -8.295  1.00 0.00 ? 18  HIS B HE2  2  
ATOM   4590  N  N    . SER B 1 19 ? 157.509 -10.277 -1.235  1.00 0.00 ? 19  SER B N    2  
ATOM   4591  C  CA   . SER B 1 19 ? 157.967 -10.443 0.143   1.00 0.00 ? 19  SER B CA   2  
ATOM   4592  C  C    . SER B 1 19 ? 158.699 -11.771 0.313   1.00 0.00 ? 19  SER B C    2  
ATOM   4593  O  O    . SER B 1 19 ? 159.677 -11.866 1.056   1.00 0.00 ? 19  SER B O    2  
ATOM   4594  C  CB   . SER B 1 19 ? 156.769 -10.408 1.094   1.00 0.00 ? 19  SER B CB   2  
ATOM   4595  O  OG   . SER B 1 19 ? 156.019 -9.226  0.865   1.00 0.00 ? 19  SER B OG   2  
ATOM   4596  H  H    . SER B 1 19 ? 156.557 -10.135 -1.418  1.00 0.00 ? 19  SER B H    2  
ATOM   4597  H  HA   . SER B 1 19 ? 158.637 -9.636  0.393   1.00 0.00 ? 19  SER B HA   2  
ATOM   4598  H  HB2  . SER B 1 19 ? 156.141 -11.263 0.917   1.00 0.00 ? 19  SER B HB2  2  
ATOM   4599  H  HB3  . SER B 1 19 ? 157.124 -10.430 2.117   1.00 0.00 ? 19  SER B HB3  2  
ATOM   4600  H  HG   . SER B 1 19 ? 155.277 -9.223  1.475   1.00 0.00 ? 19  SER B HG   2  
ATOM   4601  N  N    . GLY B 1 20 ? 158.205 -12.791 -0.378  1.00 0.00 ? 20  GLY B N    2  
ATOM   4602  C  CA   . GLY B 1 20 ? 158.791 -14.125 -0.314  1.00 0.00 ? 20  GLY B CA   2  
ATOM   4603  C  C    . GLY B 1 20 ? 160.249 -14.157 -0.756  1.00 0.00 ? 20  GLY B C    2  
ATOM   4604  O  O    . GLY B 1 20 ? 161.016 -15.004 -0.303  1.00 0.00 ? 20  GLY B O    2  
ATOM   4605  H  H    . GLY B 1 20 ? 157.420 -12.643 -0.945  1.00 0.00 ? 20  GLY B H    2  
ATOM   4606  H  HA2  . GLY B 1 20 ? 158.744 -14.472 0.705   1.00 0.00 ? 20  GLY B HA2  2  
ATOM   4607  H  HA3  . GLY B 1 20 ? 158.218 -14.792 -0.939  1.00 0.00 ? 20  GLY B HA3  2  
ATOM   4608  N  N    . LYS B 1 21 ? 160.626 -13.265 -1.664  1.00 0.00 ? 21  LYS B N    2  
ATOM   4609  C  CA   . LYS B 1 21 ? 161.995 -13.267 -2.161  1.00 0.00 ? 21  LYS B CA   2  
ATOM   4610  C  C    . LYS B 1 21 ? 162.998 -13.126 -1.019  1.00 0.00 ? 21  LYS B C    2  
ATOM   4611  O  O    . LYS B 1 21 ? 164.050 -13.765 -1.037  1.00 0.00 ? 21  LYS B O    2  
ATOM   4612  C  CB   . LYS B 1 21 ? 162.192 -12.125 -3.158  1.00 0.00 ? 21  LYS B CB   2  
ATOM   4613  C  CG   . LYS B 1 21 ? 161.278 -12.339 -4.366  1.00 0.00 ? 21  LYS B CG   2  
ATOM   4614  C  CD   . LYS B 1 21 ? 161.641 -11.338 -5.467  1.00 0.00 ? 21  LYS B CD   2  
ATOM   4615  C  CE   . LYS B 1 21 ? 161.358 -9.912  -4.987  1.00 0.00 ? 21  LYS B CE   2  
ATOM   4616  N  NZ   . LYS B 1 21 ? 162.585 -9.348  -4.358  1.00 0.00 ? 21  LYS B NZ   2  
ATOM   4617  H  H    . LYS B 1 21 ? 159.977 -12.624 -2.020  1.00 0.00 ? 21  LYS B H    2  
ATOM   4618  H  HA   . LYS B 1 21 ? 162.178 -14.202 -2.668  1.00 0.00 ? 21  LYS B HA   2  
ATOM   4619  H  HB2  . LYS B 1 21 ? 161.949 -11.185 -2.683  1.00 0.00 ? 21  LYS B HB2  2  
ATOM   4620  H  HB3  . LYS B 1 21 ? 163.221 -12.106 -3.488  1.00 0.00 ? 21  LYS B HB3  2  
ATOM   4621  H  HG2  . LYS B 1 21 ? 161.403 -13.346 -4.737  1.00 0.00 ? 21  LYS B HG2  2  
ATOM   4622  H  HG3  . LYS B 1 21 ? 160.251 -12.189 -4.071  1.00 0.00 ? 21  LYS B HG3  2  
ATOM   4623  H  HD2  . LYS B 1 21 ? 162.690 -11.436 -5.709  1.00 0.00 ? 21  LYS B HD2  2  
ATOM   4624  H  HD3  . LYS B 1 21 ? 161.049 -11.544 -6.347  1.00 0.00 ? 21  LYS B HD3  2  
ATOM   4625  H  HE2  . LYS B 1 21 ? 161.074 -9.300  -5.830  1.00 0.00 ? 21  LYS B HE2  2  
ATOM   4626  H  HE3  . LYS B 1 21 ? 160.555 -9.923  -4.265  1.00 0.00 ? 21  LYS B HE3  2  
ATOM   4627  H  HZ1  . LYS B 1 21 ? 163.217 -10.122 -4.075  1.00 0.00 ? 21  LYS B HZ1  2  
ATOM   4628  H  HZ2  . LYS B 1 21 ? 162.319 -8.793  -3.518  1.00 0.00 ? 21  LYS B HZ2  2  
ATOM   4629  H  HZ3  . LYS B 1 21 ? 163.075 -8.734  -5.038  1.00 0.00 ? 21  LYS B HZ3  2  
ATOM   4630  N  N    . GLU B 1 22 ? 162.675 -12.308 -0.019  1.00 0.00 ? 22  GLU B N    2  
ATOM   4631  C  CA   . GLU B 1 22 ? 163.581 -12.140 1.118   1.00 0.00 ? 22  GLU B CA   2  
ATOM   4632  C  C    . GLU B 1 22 ? 162.834 -12.178 2.452   1.00 0.00 ? 22  GLU B C    2  
ATOM   4633  O  O    . GLU B 1 22 ? 161.733 -11.642 2.584   1.00 0.00 ? 22  GLU B O    2  
ATOM   4634  C  CB   . GLU B 1 22 ? 164.340 -10.815 0.989   1.00 0.00 ? 22  GLU B CB   2  
ATOM   4635  C  CG   . GLU B 1 22 ? 165.175 -10.822 -0.293  1.00 0.00 ? 22  GLU B CG   2  
ATOM   4636  C  CD   . GLU B 1 22 ? 166.221 -11.932 -0.240  1.00 0.00 ? 22  GLU B CD   2  
ATOM   4637  O  OE1  . GLU B 1 22 ? 166.492 -12.413 0.847   1.00 0.00 ? 22  GLU B OE1  2  
ATOM   4638  O  OE2  . GLU B 1 22 ? 166.733 -12.285 -1.289  1.00 0.00 ? 22  GLU B OE2  2  
ATOM   4639  H  H    . GLU B 1 22 ? 161.822 -11.828 -0.037  1.00 0.00 ? 22  GLU B H    2  
ATOM   4640  H  HA   . GLU B 1 22 ? 164.299 -12.946 1.111   1.00 0.00 ? 22  GLU B HA   2  
ATOM   4641  H  HB2  . GLU B 1 22 ? 163.636 -9.998  0.954   1.00 0.00 ? 22  GLU B HB2  2  
ATOM   4642  H  HB3  . GLU B 1 22 ? 164.993 -10.691 1.839   1.00 0.00 ? 22  GLU B HB3  2  
ATOM   4643  H  HG2  . GLU B 1 22 ? 164.525 -10.983 -1.142  1.00 0.00 ? 22  GLU B HG2  2  
ATOM   4644  H  HG3  . GLU B 1 22 ? 165.672 -9.868  -0.401  1.00 0.00 ? 22  GLU B HG3  2  
ATOM   4645  N  N    . GLY B 1 23 ? 163.472 -12.783 3.446   1.00 0.00 ? 23  GLY B N    2  
ATOM   4646  C  CA   . GLY B 1 23 ? 162.913 -12.860 4.792   1.00 0.00 ? 23  GLY B CA   2  
ATOM   4647  C  C    . GLY B 1 23 ? 161.541 -13.530 4.835   1.00 0.00 ? 23  GLY B C    2  
ATOM   4648  O  O    . GLY B 1 23 ? 161.266 -14.488 4.114   1.00 0.00 ? 23  GLY B O    2  
ATOM   4649  H  H    . GLY B 1 23 ? 164.360 -13.163 3.279   1.00 0.00 ? 23  GLY B H    2  
ATOM   4650  H  HA2  . GLY B 1 23 ? 163.592 -13.421 5.417   1.00 0.00 ? 23  GLY B HA2  2  
ATOM   4651  H  HA3  . GLY B 1 23 ? 162.824 -11.859 5.187   1.00 0.00 ? 23  GLY B HA3  2  
ATOM   4652  N  N    . ASP B 1 24 ? 160.696 -12.995 5.713   1.00 0.00 ? 24  ASP B N    2  
ATOM   4653  C  CA   . ASP B 1 24 ? 159.337 -13.493 5.919   1.00 0.00 ? 24  ASP B CA   2  
ATOM   4654  C  C    . ASP B 1 24 ? 158.356 -12.909 4.903   1.00 0.00 ? 24  ASP B C    2  
ATOM   4655  O  O    . ASP B 1 24 ? 158.337 -11.698 4.667   1.00 0.00 ? 24  ASP B O    2  
ATOM   4656  C  CB   . ASP B 1 24 ? 158.868 -13.159 7.336   1.00 0.00 ? 24  ASP B CB   2  
ATOM   4657  C  CG   . ASP B 1 24 ? 157.513 -13.805 7.602   1.00 0.00 ? 24  ASP B CG   2  
ATOM   4658  O  OD1  . ASP B 1 24 ? 157.055 -14.549 6.749   1.00 0.00 ? 24  ASP B OD1  2  
ATOM   4659  O  OD2  . ASP B 1 24 ? 156.951 -13.548 8.654   1.00 0.00 ? 24  ASP B OD2  2  
ATOM   4660  H  H    . ASP B 1 24 ? 161.001 -12.236 6.253   1.00 0.00 ? 24  ASP B H    2  
ATOM   4661  H  HA   . ASP B 1 24 ? 159.346 -14.567 5.808   1.00 0.00 ? 24  ASP B HA   2  
ATOM   4662  H  HB2  . ASP B 1 24 ? 159.589 -13.532 8.049   1.00 0.00 ? 24  ASP B HB2  2  
ATOM   4663  H  HB3  . ASP B 1 24 ? 158.780 -12.091 7.442   1.00 0.00 ? 24  ASP B HB3  2  
ATOM   4664  N  N    . LYS B 1 25 ? 157.541 -13.778 4.310   1.00 0.00 ? 25  LYS B N    2  
ATOM   4665  C  CA   . LYS B 1 25 ? 156.549 -13.344 3.328   1.00 0.00 ? 25  LYS B CA   2  
ATOM   4666  C  C    . LYS B 1 25 ? 155.641 -12.278 3.929   1.00 0.00 ? 25  LYS B C    2  
ATOM   4667  O  O    . LYS B 1 25 ? 155.193 -11.354 3.251   1.00 0.00 ? 25  LYS B O    2  
ATOM   4668  C  CB   . LYS B 1 25 ? 155.628 -14.528 2.988   1.00 0.00 ? 25  LYS B CB   2  
ATOM   4669  C  CG   . LYS B 1 25 ? 156.387 -15.654 2.304   1.00 0.00 ? 25  LYS B CG   2  
ATOM   4670  C  CD   . LYS B 1 25 ? 155.415 -16.776 1.934   1.00 0.00 ? 25  LYS B CD   2  
ATOM   4671  C  CE   . LYS B 1 25 ? 156.196 -17.960 1.363   1.00 0.00 ? 25  LYS B CE   2  
ATOM   4672  N  NZ   . LYS B 1 25 ? 155.269 -19.108 1.147   1.00 0.00 ? 25  LYS B NZ   2  
ATOM   4673  H  H    . LYS B 1 25 ? 157.603 -14.728 4.542   1.00 0.00 ? 25  LYS B H    2  
ATOM   4674  H  HA   . LYS B 1 25 ? 157.028 -12.980 2.433   1.00 0.00 ? 25  LYS B HA   2  
ATOM   4675  H  HB2  . LYS B 1 25 ? 155.191 -14.905 3.897   1.00 0.00 ? 25  LYS B HB2  2  
ATOM   4676  H  HB3  . LYS B 1 25 ? 154.840 -14.184 2.334   1.00 0.00 ? 25  LYS B HB3  2  
ATOM   4677  H  HG2  . LYS B 1 25 ? 156.827 -15.276 1.413   1.00 0.00 ? 25  LYS B HG2  2  
ATOM   4678  H  HG3  . LYS B 1 25 ? 157.151 -16.038 2.962   1.00 0.00 ? 25  LYS B HG3  2  
ATOM   4679  H  HD2  . LYS B 1 25 ? 154.875 -17.090 2.816   1.00 0.00 ? 25  LYS B HD2  2  
ATOM   4680  H  HD3  . LYS B 1 25 ? 154.717 -16.417 1.194   1.00 0.00 ? 25  LYS B HD3  2  
ATOM   4681  H  HE2  . LYS B 1 25 ? 156.643 -17.677 0.422   1.00 0.00 ? 25  LYS B HE2  2  
ATOM   4682  H  HE3  . LYS B 1 25 ? 156.971 -18.249 2.057   1.00 0.00 ? 25  LYS B HE3  2  
ATOM   4683  H  HZ1  . LYS B 1 25 ? 155.821 -19.975 0.991   1.00 0.00 ? 25  LYS B HZ1  2  
ATOM   4684  H  HZ2  . LYS B 1 25 ? 154.674 -18.919 0.314   1.00 0.00 ? 25  LYS B HZ2  2  
ATOM   4685  H  HZ3  . LYS B 1 25 ? 154.666 -19.230 1.985   1.00 0.00 ? 25  LYS B HZ3  2  
ATOM   4686  N  N    . TYR B 1 26 ? 155.327 -12.482 5.195   1.00 0.00 ? 26  TYR B N    2  
ATOM   4687  C  CA   . TYR B 1 26 ? 154.408 -11.622 5.925   1.00 0.00 ? 26  TYR B CA   2  
ATOM   4688  C  C    . TYR B 1 26 ? 155.009 -10.247 6.216   1.00 0.00 ? 26  TYR B C    2  
ATOM   4689  O  O    . TYR B 1 26 ? 154.280 -9.289  6.479   1.00 0.00 ? 26  TYR B O    2  
ATOM   4690  C  CB   . TYR B 1 26 ? 154.025 -12.339 7.217   1.00 0.00 ? 26  TYR B CB   2  
ATOM   4691  C  CG   . TYR B 1 26 ? 153.438 -13.722 6.907   1.00 0.00 ? 26  TYR B CG   2  
ATOM   4692  C  CD1  . TYR B 1 26 ? 153.301 -14.202 5.575   1.00 0.00 ? 26  TYR B CD1  2  
ATOM   4693  C  CD2  . TYR B 1 26 ? 153.087 -14.562 7.972   1.00 0.00 ? 26  TYR B CD2  2  
ATOM   4694  C  CE1  . TYR B 1 26 ? 152.822 -15.489 5.336   1.00 0.00 ? 26  TYR B CE1  2  
ATOM   4695  C  CE2  . TYR B 1 26 ? 152.595 -15.851 7.723   1.00 0.00 ? 26  TYR B CE2  2  
ATOM   4696  C  CZ   . TYR B 1 26 ? 152.465 -16.314 6.407   1.00 0.00 ? 26  TYR B CZ   2  
ATOM   4697  O  OH   . TYR B 1 26 ? 151.991 -17.588 6.169   1.00 0.00 ? 26  TYR B OH   2  
ATOM   4698  H  H    . TYR B 1 26 ? 155.687 -13.274 5.646   1.00 0.00 ? 26  TYR B H    2  
ATOM   4699  H  HA   . TYR B 1 26 ? 153.515 -11.479 5.336   1.00 0.00 ? 26  TYR B HA   2  
ATOM   4700  H  HB2  . TYR B 1 26 ? 154.904 -12.454 7.835   1.00 0.00 ? 26  TYR B HB2  2  
ATOM   4701  H  HB3  . TYR B 1 26 ? 153.290 -11.752 7.747   1.00 0.00 ? 26  TYR B HB3  2  
ATOM   4702  H  HD1  . TYR B 1 26 ? 153.543 -13.588 4.731   1.00 0.00 ? 26  TYR B HD1  2  
ATOM   4703  H  HD2  . TYR B 1 26 ? 153.186 -14.211 8.988   1.00 0.00 ? 26  TYR B HD2  2  
ATOM   4704  H  HE1  . TYR B 1 26 ? 152.738 -15.847 4.315   1.00 0.00 ? 26  TYR B HE1  2  
ATOM   4705  H  HE2  . TYR B 1 26 ? 152.318 -16.490 8.549   1.00 0.00 ? 26  TYR B HE2  2  
ATOM   4706  H  HH   . TYR B 1 26 ? 151.413 -17.831 6.896   1.00 0.00 ? 26  TYR B HH   2  
ATOM   4707  N  N    . LYS B 1 27 ? 156.335 -10.155 6.188   1.00 0.00 ? 27  LYS B N    2  
ATOM   4708  C  CA   . LYS B 1 27 ? 157.013 -8.887  6.474   1.00 0.00 ? 27  LYS B CA   2  
ATOM   4709  C  C    . LYS B 1 27 ? 157.717 -8.286  5.267   1.00 0.00 ? 27  LYS B C    2  
ATOM   4710  O  O    . LYS B 1 27 ? 158.420 -8.975  4.524   1.00 0.00 ? 27  LYS B O    2  
ATOM   4711  C  CB   . LYS B 1 27 ? 158.103 -9.098  7.532   1.00 0.00 ? 27  LYS B CB   2  
ATOM   4712  C  CG   . LYS B 1 27 ? 157.532 -9.567  8.871   1.00 0.00 ? 27  LYS B CG   2  
ATOM   4713  C  CD   . LYS B 1 27 ? 156.724 -8.426  9.500   1.00 0.00 ? 27  LYS B CD   2  
ATOM   4714  C  CE   . LYS B 1 27 ? 156.720 -8.574  11.022  1.00 0.00 ? 27  LYS B CE   2  
ATOM   4715  N  NZ   . LYS B 1 27 ? 156.925 -10.005 11.388  1.00 0.00 ? 27  LYS B NZ   2  
ATOM   4716  H  H    . LYS B 1 27 ? 156.869 -10.952 5.987   1.00 0.00 ? 27  LYS B H    2  
ATOM   4717  H  HA   . LYS B 1 27 ? 156.299 -8.177  6.858   1.00 0.00 ? 27  LYS B HA   2  
ATOM   4718  H  HB2  . LYS B 1 27 ? 158.798 -9.839  7.171   1.00 0.00 ? 27  LYS B HB2  2  
ATOM   4719  H  HB3  . LYS B 1 27 ? 158.633 -8.169  7.678   1.00 0.00 ? 27  LYS B HB3  2  
ATOM   4720  H  HG2  . LYS B 1 27 ? 156.886 -10.419 8.707   1.00 0.00 ? 27  LYS B HG2  2  
ATOM   4721  H  HG3  . LYS B 1 27 ? 158.335 -9.848  9.530   1.00 0.00 ? 27  LYS B HG3  2  
ATOM   4722  H  HD2  . LYS B 1 27 ? 157.168 -7.478  9.237   1.00 0.00 ? 27  LYS B HD2  2  
ATOM   4723  H  HD3  . LYS B 1 27 ? 155.709 -8.465  9.136   1.00 0.00 ? 27  LYS B HD3  2  
ATOM   4724  H  HE2  . LYS B 1 27 ? 157.528 -7.972  11.436  1.00 0.00 ? 27  LYS B HE2  2  
ATOM   4725  H  HE3  . LYS B 1 27 ? 155.775 -8.231  11.416  1.00 0.00 ? 27  LYS B HE3  2  
ATOM   4726  H  HZ1  . LYS B 1 27 ? 156.710 -10.139 12.396  1.00 0.00 ? 27  LYS B HZ1  2  
ATOM   4727  H  HZ2  . LYS B 1 27 ? 157.915 -10.270 11.206  1.00 0.00 ? 27  LYS B HZ2  2  
ATOM   4728  H  HZ3  . LYS B 1 27 ? 156.294 -10.603 10.819  1.00 0.00 ? 27  LYS B HZ3  2  
ATOM   4729  N  N    . LEU B 1 28 ? 157.607 -6.962  5.161   1.00 0.00 ? 28  LEU B N    2  
ATOM   4730  C  CA   . LEU B 1 28 ? 158.323 -6.217  4.140   1.00 0.00 ? 28  LEU B CA   2  
ATOM   4731  C  C    . LEU B 1 28 ? 159.521 -5.562  4.801   1.00 0.00 ? 28  LEU B C    2  
ATOM   4732  O  O    . LEU B 1 28 ? 159.406 -4.966  5.872   1.00 0.00 ? 28  LEU B O    2  
ATOM   4733  C  CB   . LEU B 1 28 ? 157.439 -5.147  3.459   1.00 0.00 ? 28  LEU B CB   2  
ATOM   4734  C  CG   . LEU B 1 28 ? 156.266 -5.794  2.716   1.00 0.00 ? 28  LEU B CG   2  
ATOM   4735  C  CD1  . LEU B 1 28 ? 155.461 -4.711  2.002   1.00 0.00 ? 28  LEU B CD1  2  
ATOM   4736  C  CD2  . LEU B 1 28 ? 156.812 -6.771  1.679   1.00 0.00 ? 28  LEU B CD2  2  
ATOM   4737  H  H    . LEU B 1 28 ? 157.098 -6.472  5.840   1.00 0.00 ? 28  LEU B H    2  
ATOM   4738  H  HA   . LEU B 1 28 ? 158.686 -6.905  3.392   1.00 0.00 ? 28  LEU B HA   2  
ATOM   4739  H  HB2  . LEU B 1 28 ? 157.049 -4.473  4.208   1.00 0.00 ? 28  LEU B HB2  2  
ATOM   4740  H  HB3  . LEU B 1 28 ? 158.037 -4.586  2.755   1.00 0.00 ? 28  LEU B HB3  2  
ATOM   4741  H  HG   . LEU B 1 28 ? 155.630 -6.314  3.402   1.00 0.00 ? 28  LEU B HG   2  
ATOM   4742  H  HD11 . LEU B 1 28 ? 155.262 -3.899  2.686   1.00 0.00 ? 28  LEU B HD11 2  
ATOM   4743  H  HD12 . LEU B 1 28 ? 154.526 -5.129  1.659   1.00 0.00 ? 28  LEU B HD12 2  
ATOM   4744  H  HD13 . LEU B 1 28 ? 156.024 -4.342  1.159   1.00 0.00 ? 28  LEU B HD13 2  
ATOM   4745  H  HD21 . LEU B 1 28 ? 156.078 -6.918  0.901   1.00 0.00 ? 28  LEU B HD21 2  
ATOM   4746  H  HD22 . LEU B 1 28 ? 157.026 -7.713  2.156   1.00 0.00 ? 28  LEU B HD22 2  
ATOM   4747  H  HD23 . LEU B 1 28 ? 157.718 -6.368  1.250   1.00 0.00 ? 28  LEU B HD23 2  
ATOM   4748  N  N    . SER B 1 29 ? 160.666 -5.677  4.160   1.00 0.00 ? 29  SER B N    2  
ATOM   4749  C  CA   . SER B 1 29 ? 161.891 -5.098  4.680   1.00 0.00 ? 29  SER B CA   2  
ATOM   4750  C  C    . SER B 1 29 ? 162.163 -3.816  3.927   1.00 0.00 ? 29  SER B C    2  
ATOM   4751  O  O    . SER B 1 29 ? 161.571 -3.585  2.882   1.00 0.00 ? 29  SER B O    2  
ATOM   4752  C  CB   . SER B 1 29 ? 163.058 -6.071  4.514   1.00 0.00 ? 29  SER B CB   2  
ATOM   4753  O  OG   . SER B 1 29 ? 162.763 -7.276  5.211   1.00 0.00 ? 29  SER B OG   2  
ATOM   4754  H  H    . SER B 1 29 ? 160.690 -6.166  3.310   1.00 0.00 ? 29  SER B H    2  
ATOM   4755  H  HA   . SER B 1 29 ? 161.765 -4.871  5.730   1.00 0.00 ? 29  SER B HA   2  
ATOM   4756  H  HB2  . SER B 1 29 ? 163.206 -6.289  3.472   1.00 0.00 ? 29  SER B HB2  2  
ATOM   4757  H  HB3  . SER B 1 29 ? 163.955 -5.623  4.920   1.00 0.00 ? 29  SER B HB3  2  
ATOM   4758  H  HG   . SER B 1 29 ? 163.069 -7.177  6.114   1.00 0.00 ? 29  SER B HG   2  
ATOM   4759  N  N    . LYS B 1 30 ? 163.020 -2.962  4.448   1.00 0.00 ? 30  LYS B N    2  
ATOM   4760  C  CA   . LYS B 1 30 ? 163.269 -1.713  3.763   1.00 0.00 ? 30  LYS B CA   2  
ATOM   4761  C  C    . LYS B 1 30 ? 163.612 -1.999  2.307   1.00 0.00 ? 30  LYS B C    2  
ATOM   4762  O  O    . LYS B 1 30 ? 163.152 -1.296  1.408   1.00 0.00 ? 30  LYS B O    2  
ATOM   4763  C  CB   . LYS B 1 30 ? 164.434 -0.981  4.427   1.00 0.00 ? 30  LYS B CB   2  
ATOM   4764  C  CG   . LYS B 1 30 ? 164.621 0.385   3.768   1.00 0.00 ? 30  LYS B CG   2  
ATOM   4765  C  CD   . LYS B 1 30 ? 165.834 1.081   4.384   1.00 0.00 ? 30  LYS B CD   2  
ATOM   4766  C  CE   . LYS B 1 30 ? 165.937 2.501   3.832   1.00 0.00 ? 30  LYS B CE   2  
ATOM   4767  N  NZ   . LYS B 1 30 ? 167.297 3.044   4.111   1.00 0.00 ? 30  LYS B NZ   2  
ATOM   4768  H  H    . LYS B 1 30 ? 163.460 -3.158  5.299   1.00 0.00 ? 30  LYS B H    2  
ATOM   4769  H  HA   . LYS B 1 30 ? 162.385 -1.094  3.808   1.00 0.00 ? 30  LYS B HA   2  
ATOM   4770  H  HB2  . LYS B 1 30 ? 164.222 -0.847  5.478   1.00 0.00 ? 30  LYS B HB2  2  
ATOM   4771  H  HB3  . LYS B 1 30 ? 165.337 -1.560  4.311   1.00 0.00 ? 30  LYS B HB3  2  
ATOM   4772  H  HG2  . LYS B 1 30 ? 164.780 0.254   2.707   1.00 0.00 ? 30  LYS B HG2  2  
ATOM   4773  H  HG3  . LYS B 1 30 ? 163.741 0.988   3.929   1.00 0.00 ? 30  LYS B HG3  2  
ATOM   4774  H  HD2  . LYS B 1 30 ? 165.720 1.118   5.458   1.00 0.00 ? 30  LYS B HD2  2  
ATOM   4775  H  HD3  . LYS B 1 30 ? 166.730 0.535   4.135   1.00 0.00 ? 30  LYS B HD3  2  
ATOM   4776  H  HE2  . LYS B 1 30 ? 165.766 2.487   2.766   1.00 0.00 ? 30  LYS B HE2  2  
ATOM   4777  H  HE3  . LYS B 1 30 ? 165.194 3.124   4.308   1.00 0.00 ? 30  LYS B HE3  2  
ATOM   4778  H  HZ1  . LYS B 1 30 ? 167.938 2.264   4.357   1.00 0.00 ? 30  LYS B HZ1  2  
ATOM   4779  H  HZ2  . LYS B 1 30 ? 167.245 3.716   4.903   1.00 0.00 ? 30  LYS B HZ2  2  
ATOM   4780  H  HZ3  . LYS B 1 30 ? 167.656 3.530   3.265   1.00 0.00 ? 30  LYS B HZ3  2  
ATOM   4781  N  N    . LYS B 1 31 ? 164.389 -3.052  2.066   1.00 0.00 ? 31  LYS B N    2  
ATOM   4782  C  CA   . LYS B 1 31 ? 164.724 -3.411  0.693   1.00 0.00 ? 31  LYS B CA   2  
ATOM   4783  C  C    . LYS B 1 31 ? 163.495 -3.783  -0.125  1.00 0.00 ? 31  LYS B C    2  
ATOM   4784  O  O    . LYS B 1 31 ? 163.308 -3.300  -1.244  1.00 0.00 ? 31  LYS B O    2  
ATOM   4785  C  CB   . LYS B 1 31 ? 165.598 -4.660  0.676   1.00 0.00 ? 31  LYS B CB   2  
ATOM   4786  C  CG   . LYS B 1 31 ? 165.955 -5.002  -0.779  1.00 0.00 ? 31  LYS B CG   2  
ATOM   4787  C  CD   . LYS B 1 31 ? 166.590 -6.376  -0.833  1.00 0.00 ? 31  LYS B CD   2  
ATOM   4788  C  CE   . LYS B 1 31 ? 166.883 -6.713  -2.290  1.00 0.00 ? 31  LYS B CE   2  
ATOM   4789  N  NZ   . LYS B 1 31 ? 167.991 -5.853  -2.793  1.00 0.00 ? 31  LYS B NZ   2  
ATOM   4790  H  H    . LYS B 1 31 ? 164.712 -3.602  2.809   1.00 0.00 ? 31  LYS B H    2  
ATOM   4791  H  HA   . LYS B 1 31 ? 165.253 -2.602  0.218   1.00 0.00 ? 31  LYS B HA   2  
ATOM   4792  H  HB2  . LYS B 1 31 ? 166.502 -4.476  1.238   1.00 0.00 ? 31  LYS B HB2  2  
ATOM   4793  H  HB3  . LYS B 1 31 ? 165.059 -5.485  1.116   1.00 0.00 ? 31  LYS B HB3  2  
ATOM   4794  H  HG2  . LYS B 1 31 ? 165.073 -5.004  -1.398  1.00 0.00 ? 31  LYS B HG2  2  
ATOM   4795  H  HG3  . LYS B 1 31 ? 166.655 -4.273  -1.156  1.00 0.00 ? 31  LYS B HG3  2  
ATOM   4796  H  HD2  . LYS B 1 31 ? 167.504 -6.385  -0.256  1.00 0.00 ? 31  LYS B HD2  2  
ATOM   4797  H  HD3  . LYS B 1 31 ? 165.888 -7.097  -0.435  1.00 0.00 ? 31  LYS B HD3  2  
ATOM   4798  H  HE2  . LYS B 1 31 ? 167.164 -7.752  -2.371  1.00 0.00 ? 31  LYS B HE2  2  
ATOM   4799  H  HE3  . LYS B 1 31 ? 165.988 -6.533  -2.876  1.00 0.00 ? 31  LYS B HE3  2  
ATOM   4800  H  HZ1  . LYS B 1 31 ? 168.442 -6.309  -3.610  1.00 0.00 ? 31  LYS B HZ1  2  
ATOM   4801  H  HZ2  . LYS B 1 31 ? 168.695 -5.719  -2.038  1.00 0.00 ? 31  LYS B HZ2  2  
ATOM   4802  H  HZ3  . LYS B 1 31 ? 167.611 -4.929  -3.081  1.00 0.00 ? 31  LYS B HZ3  2  
ATOM   4803  N  N    . GLU B 1 32 ? 162.698 -4.707  0.410   1.00 0.00 ? 32  GLU B N    2  
ATOM   4804  C  CA   . GLU B 1 32 ? 161.550 -5.187  -0.336  1.00 0.00 ? 32  GLU B CA   2  
ATOM   4805  C  C    . GLU B 1 32 ? 160.550 -4.073  -0.572  1.00 0.00 ? 32  GLU B C    2  
ATOM   4806  O  O    . GLU B 1 32 ? 159.965 -3.949  -1.648  1.00 0.00 ? 32  GLU B O    2  
ATOM   4807  C  CB   . GLU B 1 32 ? 160.829 -6.285  0.450   1.00 0.00 ? 32  GLU B CB   2  
ATOM   4808  C  CG   . GLU B 1 32 ? 161.723 -7.513  0.616   1.00 0.00 ? 32  GLU B CG   2  
ATOM   4809  C  CD   . GLU B 1 32 ? 160.948 -8.608  1.347   1.00 0.00 ? 32  GLU B CD   2  
ATOM   4810  O  OE1  . GLU B 1 32 ? 159.877 -8.313  1.852   1.00 0.00 ? 32  GLU B OE1  2  
ATOM   4811  O  OE2  . GLU B 1 32 ? 161.429 -9.725  1.385   1.00 0.00 ? 32  GLU B OE2  2  
ATOM   4812  H  H    . GLU B 1 32 ? 162.918 -5.102  1.279   1.00 0.00 ? 32  GLU B H    2  
ATOM   4813  H  HA   . GLU B 1 32 ? 161.905 -5.597  -1.279  1.00 0.00 ? 32  GLU B HA   2  
ATOM   4814  H  HB2  . GLU B 1 32 ? 160.559 -5.901  1.426   1.00 0.00 ? 32  GLU B HB2  2  
ATOM   4815  H  HB3  . GLU B 1 32 ? 159.931 -6.568  -0.079  1.00 0.00 ? 32  GLU B HB3  2  
ATOM   4816  H  HG2  . GLU B 1 32 ? 162.026 -7.872  -0.357  1.00 0.00 ? 32  GLU B HG2  2  
ATOM   4817  H  HG3  . GLU B 1 32 ? 162.597 -7.247  1.191   1.00 0.00 ? 32  GLU B HG3  2  
ATOM   4818  N  N    . LEU B 1 33 ? 160.359 -3.273  0.464   1.00 0.00 ? 33  LEU B N    2  
ATOM   4819  C  CA   . LEU B 1 33 ? 159.430 -2.166  0.411   1.00 0.00 ? 33  LEU B CA   2  
ATOM   4820  C  C    . LEU B 1 33 ? 159.905 -1.151  -0.619  1.00 0.00 ? 33  LEU B C    2  
ATOM   4821  O  O    . LEU B 1 33 ? 159.123 -0.628  -1.415  1.00 0.00 ? 33  LEU B O    2  
ATOM   4822  C  CB   . LEU B 1 33 ? 159.378 -1.537  1.803   1.00 0.00 ? 33  LEU B CB   2  
ATOM   4823  C  CG   . LEU B 1 33 ? 158.216 -0.547  1.912   1.00 0.00 ? 33  LEU B CG   2  
ATOM   4824  C  CD1  . LEU B 1 33 ? 157.761 -0.487  3.369   1.00 0.00 ? 33  LEU B CD1  2  
ATOM   4825  C  CD2  . LEU B 1 33 ? 158.667 0.852   1.474   1.00 0.00 ? 33  LEU B CD2  2  
ATOM   4826  H  H    . LEU B 1 33 ? 160.856 -3.438  1.292   1.00 0.00 ? 33  LEU B H    2  
ATOM   4827  H  HA   . LEU B 1 33 ? 158.446 -2.536  0.148   1.00 0.00 ? 33  LEU B HA   2  
ATOM   4828  H  HB2  . LEU B 1 33 ? 159.253 -2.322  2.536   1.00 0.00 ? 33  LEU B HB2  2  
ATOM   4829  H  HB3  . LEU B 1 33 ? 160.309 -1.023  1.994   1.00 0.00 ? 33  LEU B HB3  2  
ATOM   4830  H  HG   . LEU B 1 33 ? 157.397 -0.881  1.291   1.00 0.00 ? 33  LEU B HG   2  
ATOM   4831  H  HD11 . LEU B 1 33 ? 158.579 -0.148  3.988   1.00 0.00 ? 33  LEU B HD11 2  
ATOM   4832  H  HD12 . LEU B 1 33 ? 157.452 -1.471  3.689   1.00 0.00 ? 33  LEU B HD12 2  
ATOM   4833  H  HD13 . LEU B 1 33 ? 156.934 0.197   3.457   1.00 0.00 ? 33  LEU B HD13 2  
ATOM   4834  H  HD21 . LEU B 1 33 ? 159.592 1.106   1.969   1.00 0.00 ? 33  LEU B HD21 2  
ATOM   4835  H  HD22 . LEU B 1 33 ? 157.908 1.571   1.742   1.00 0.00 ? 33  LEU B HD22 2  
ATOM   4836  H  HD23 . LEU B 1 33 ? 158.814 0.869   0.406   1.00 0.00 ? 33  LEU B HD23 2  
ATOM   4837  N  N    . LYS B 1 34 ? 161.212 -0.911  -0.610  1.00 0.00 ? 34  LYS B N    2  
ATOM   4838  C  CA   . LYS B 1 34 ? 161.827 0.007   -1.555  1.00 0.00 ? 34  LYS B CA   2  
ATOM   4839  C  C    . LYS B 1 34 ? 161.633 -0.443  -2.985  1.00 0.00 ? 34  LYS B C    2  
ATOM   4840  O  O    . LYS B 1 34 ? 161.255 0.345   -3.852  1.00 0.00 ? 34  LYS B O    2  
ATOM   4841  C  CB   . LYS B 1 34 ? 163.317 0.130   -1.206  1.00 0.00 ? 34  LYS B CB   2  
ATOM   4842  C  CG   . LYS B 1 34 ? 164.098 0.833   -2.320  1.00 0.00 ? 34  LYS B CG   2  
ATOM   4843  C  CD   . LYS B 1 34 ? 163.510 2.202   -2.594  1.00 0.00 ? 34  LYS B CD   2  
ATOM   4844  C  CE   . LYS B 1 34 ? 164.513 3.049   -3.391  1.00 0.00 ? 34  LYS B CE   2  
ATOM   4845  N  NZ   . LYS B 1 34 ? 165.557 2.167   -3.988  1.00 0.00 ? 34  LYS B NZ   2  
ATOM   4846  H  H    . LYS B 1 34 ? 161.779 -1.384  0.034   1.00 0.00 ? 34  LYS B H    2  
ATOM   4847  H  HA   . LYS B 1 34 ? 161.371 0.977   -1.437  1.00 0.00 ? 34  LYS B HA   2  
ATOM   4848  H  HB2  . LYS B 1 34 ? 163.414 0.706   -0.294  1.00 0.00 ? 34  LYS B HB2  2  
ATOM   4849  H  HB3  . LYS B 1 34 ? 163.728 -0.857  -1.050  1.00 0.00 ? 34  LYS B HB3  2  
ATOM   4850  H  HG2  . LYS B 1 34 ? 165.129 0.942   -2.017  1.00 0.00 ? 34  LYS B HG2  2  
ATOM   4851  H  HG3  . LYS B 1 34 ? 164.055 0.238   -3.222  1.00 0.00 ? 34  LYS B HG3  2  
ATOM   4852  H  HD2  . LYS B 1 34 ? 162.614 2.064   -3.184  1.00 0.00 ? 34  LYS B HD2  2  
ATOM   4853  H  HD3  . LYS B 1 34 ? 163.270 2.693   -1.664  1.00 0.00 ? 34  LYS B HD3  2  
ATOM   4854  H  HE2  . LYS B 1 34 ? 163.995 3.580   -4.176  1.00 0.00 ? 34  LYS B HE2  2  
ATOM   4855  H  HE3  . LYS B 1 34 ? 164.985 3.762   -2.731  1.00 0.00 ? 34  LYS B HE3  2  
ATOM   4856  H  HZ1  . LYS B 1 34 ? 165.966 2.630   -4.824  1.00 0.00 ? 34  LYS B HZ1  2  
ATOM   4857  H  HZ2  . LYS B 1 34 ? 165.126 1.262   -4.268  1.00 0.00 ? 34  LYS B HZ2  2  
ATOM   4858  H  HZ3  . LYS B 1 34 ? 166.307 1.995   -3.289  1.00 0.00 ? 34  LYS B HZ3  2  
ATOM   4859  N  N    . GLU B 1 35 ? 161.882 -1.710  -3.230  1.00 0.00 ? 35  GLU B N    2  
ATOM   4860  C  CA   . GLU B 1 35 ? 161.720 -2.242  -4.563  1.00 0.00 ? 35  GLU B CA   2  
ATOM   4861  C  C    . GLU B 1 35 ? 160.254 -2.307  -4.979  1.00 0.00 ? 35  GLU B C    2  
ATOM   4862  O  O    . GLU B 1 35 ? 159.931 -2.031  -6.127  1.00 0.00 ? 35  GLU B O    2  
ATOM   4863  C  CB   . GLU B 1 35 ? 162.390 -3.604  -4.610  1.00 0.00 ? 35  GLU B CB   2  
ATOM   4864  C  CG   . GLU B 1 35 ? 163.890 -3.384  -4.405  1.00 0.00 ? 35  GLU B CG   2  
ATOM   4865  C  CD   . GLU B 1 35 ? 164.482 -2.631  -5.593  1.00 0.00 ? 35  GLU B CD   2  
ATOM   4866  O  OE1  . GLU B 1 35 ? 163.829 -2.579  -6.622  1.00 0.00 ? 35  GLU B OE1  2  
ATOM   4867  O  OE2  . GLU B 1 35 ? 165.580 -2.116  -5.456  1.00 0.00 ? 35  GLU B OE2  2  
ATOM   4868  H  H    . GLU B 1 35 ? 162.177 -2.300  -2.500  1.00 0.00 ? 35  GLU B H    2  
ATOM   4869  H  HA   . GLU B 1 35 ? 162.232 -1.590  -5.250  1.00 0.00 ? 35  GLU B HA   2  
ATOM   4870  H  HB2  . GLU B 1 35 ? 161.997 -4.233  -3.822  1.00 0.00 ? 35  GLU B HB2  2  
ATOM   4871  H  HB3  . GLU B 1 35 ? 162.218 -4.066  -5.569  1.00 0.00 ? 35  GLU B HB3  2  
ATOM   4872  H  HG2  . GLU B 1 35 ? 164.030 -2.776  -3.513  1.00 0.00 ? 35  GLU B HG2  2  
ATOM   4873  H  HG3  . GLU B 1 35 ? 164.390 -4.334  -4.289  1.00 0.00 ? 35  GLU B HG3  2  
ATOM   4874  N  N    . LEU B 1 36 ? 159.361 -2.655  -4.049  1.00 0.00 ? 36  LEU B N    2  
ATOM   4875  C  CA   . LEU B 1 36 ? 157.938 -2.720  -4.385  1.00 0.00 ? 36  LEU B CA   2  
ATOM   4876  C  C    . LEU B 1 36 ? 157.371 -1.360  -4.747  1.00 0.00 ? 36  LEU B C    2  
ATOM   4877  O  O    . LEU B 1 36 ? 156.697 -1.223  -5.763  1.00 0.00 ? 36  LEU B O    2  
ATOM   4878  C  CB   . LEU B 1 36 ? 157.157 -3.299  -3.203  1.00 0.00 ? 36  LEU B CB   2  
ATOM   4879  C  CG   . LEU B 1 36 ? 157.457 -4.802  -3.092  1.00 0.00 ? 36  LEU B CG   2  
ATOM   4880  C  CD1  . LEU B 1 36 ? 157.071 -5.336  -1.696  1.00 0.00 ? 36  LEU B CD1  2  
ATOM   4881  C  CD2  . LEU B 1 36 ? 156.657 -5.561  -4.182  1.00 0.00 ? 36  LEU B CD2  2  
ATOM   4882  H  H    . LEU B 1 36 ? 159.659 -2.859  -3.138  1.00 0.00 ? 36  LEU B H    2  
ATOM   4883  H  HA   . LEU B 1 36 ? 157.808 -3.376  -5.231  1.00 0.00 ? 36  LEU B HA   2  
ATOM   4884  H  HB2  . LEU B 1 36 ? 157.466 -2.796  -2.298  1.00 0.00 ? 36  LEU B HB2  2  
ATOM   4885  H  HB3  . LEU B 1 36 ? 156.099 -3.151  -3.356  1.00 0.00 ? 36  LEU B HB3  2  
ATOM   4886  H  HG   . LEU B 1 36 ? 158.514 -4.964  -3.251  1.00 0.00 ? 36  LEU B HG   2  
ATOM   4887  H  HD11 . LEU B 1 36 ? 156.206 -5.975  -1.776  1.00 0.00 ? 36  LEU B HD11 2  
ATOM   4888  H  HD12 . LEU B 1 36 ? 156.850 -4.516  -1.030  1.00 0.00 ? 36  LEU B HD12 2  
ATOM   4889  H  HD13 . LEU B 1 36 ? 157.896 -5.905  -1.293  1.00 0.00 ? 36  LEU B HD13 2  
ATOM   4890  H  HD21 . LEU B 1 36 ? 156.137 -4.863  -4.826  1.00 0.00 ? 36  LEU B HD21 2  
ATOM   4891  H  HD22 . LEU B 1 36 ? 155.927 -6.216  -3.722  1.00 0.00 ? 36  LEU B HD22 2  
ATOM   4892  H  HD23 . LEU B 1 36 ? 157.340 -6.146  -4.774  1.00 0.00 ? 36  LEU B HD23 2  
ATOM   4893  N  N    . LEU B 1 37 ? 157.661 -0.348  -3.941  1.00 0.00 ? 37  LEU B N    2  
ATOM   4894  C  CA   . LEU B 1 37 ? 157.159 0.984   -4.243  1.00 0.00 ? 37  LEU B CA   2  
ATOM   4895  C  C    . LEU B 1 37 ? 157.874 1.605   -5.437  1.00 0.00 ? 37  LEU B C    2  
ATOM   4896  O  O    . LEU B 1 37 ? 157.233 2.126   -6.358  1.00 0.00 ? 37  LEU B O    2  
ATOM   4897  C  CB   . LEU B 1 37 ? 157.314 1.881   -3.006  1.00 0.00 ? 37  LEU B CB   2  
ATOM   4898  C  CG   . LEU B 1 37 ? 156.126 1.675   -2.044  1.00 0.00 ? 37  LEU B CG   2  
ATOM   4899  C  CD1  . LEU B 1 37 ? 156.155 0.275   -1.431  1.00 0.00 ? 37  LEU B CD1  2  
ATOM   4900  C  CD2  . LEU B 1 37 ? 156.195 2.715   -0.916  1.00 0.00 ? 37  LEU B CD2  2  
ATOM   4901  H  H    . LEU B 1 37 ? 158.221 -0.495  -3.148  1.00 0.00 ? 37  LEU B H    2  
ATOM   4902  H  HA   . LEU B 1 37 ? 156.109 0.907   -4.477  1.00 0.00 ? 37  LEU B HA   2  
ATOM   4903  H  HB2  . LEU B 1 37 ? 158.230 1.620   -2.496  1.00 0.00 ? 37  LEU B HB2  2  
ATOM   4904  H  HB3  . LEU B 1 37 ? 157.362 2.912   -3.310  1.00 0.00 ? 37  LEU B HB3  2  
ATOM   4905  H  HG   . LEU B 1 37 ? 155.202 1.802   -2.588  1.00 0.00 ? 37  LEU B HG   2  
ATOM   4906  H  HD11 . LEU B 1 37 ? 155.299 0.156   -0.778  1.00 0.00 ? 37  LEU B HD11 2  
ATOM   4907  H  HD12 . LEU B 1 37 ? 157.060 0.149   -0.861  1.00 0.00 ? 37  LEU B HD12 2  
ATOM   4908  H  HD13 . LEU B 1 37 ? 156.111 -0.465  -2.214  1.00 0.00 ? 37  LEU B HD13 2  
ATOM   4909  H  HD21 . LEU B 1 37 ? 156.788 2.327   -0.102  1.00 0.00 ? 37  LEU B HD21 2  
ATOM   4910  H  HD22 . LEU B 1 37 ? 155.197 2.927   -0.563  1.00 0.00 ? 37  LEU B HD22 2  
ATOM   4911  H  HD23 . LEU B 1 37 ? 156.645 3.626   -1.284  1.00 0.00 ? 37  LEU B HD23 2  
ATOM   4912  N  N    . GLN B 1 38 ? 159.200 1.536   -5.419  1.00 0.00 ? 38  GLN B N    2  
ATOM   4913  C  CA   . GLN B 1 38 ? 159.995 2.100   -6.500  1.00 0.00 ? 38  GLN B CA   2  
ATOM   4914  C  C    . GLN B 1 38 ? 159.732 1.426   -7.834  1.00 0.00 ? 38  GLN B C    2  
ATOM   4915  O  O    . GLN B 1 38 ? 159.641 2.092   -8.866  1.00 0.00 ? 38  GLN B O    2  
ATOM   4916  C  CB   . GLN B 1 38 ? 161.479 1.962   -6.163  1.00 0.00 ? 38  GLN B CB   2  
ATOM   4917  C  CG   . GLN B 1 38 ? 162.310 2.658   -7.237  1.00 0.00 ? 38  GLN B CG   2  
ATOM   4918  C  CD   . GLN B 1 38 ? 163.793 2.552   -6.909  1.00 0.00 ? 38  GLN B CD   2  
ATOM   4919  O  OE1  . GLN B 1 38 ? 164.157 2.046   -5.850  1.00 0.00 ? 38  GLN B OE1  2  
ATOM   4920  N  NE2  . GLN B 1 38 ? 164.675 3.002   -7.759  1.00 0.00 ? 38  GLN B NE2  2  
ATOM   4921  H  H    . GLN B 1 38 ? 159.650 1.103   -4.664  1.00 0.00 ? 38  GLN B H    2  
ATOM   4922  H  HA   . GLN B 1 38 ? 159.764 3.150   -6.589  1.00 0.00 ? 38  GLN B HA   2  
ATOM   4923  H  HB2  . GLN B 1 38 ? 161.672 2.421   -5.205  1.00 0.00 ? 38  GLN B HB2  2  
ATOM   4924  H  HB3  . GLN B 1 38 ? 161.746 0.917   -6.123  1.00 0.00 ? 38  GLN B HB3  2  
ATOM   4925  H  HG2  . GLN B 1 38 ? 162.125 2.183   -8.183  1.00 0.00 ? 38  GLN B HG2  2  
ATOM   4926  H  HG3  . GLN B 1 38 ? 162.026 3.696   -7.298  1.00 0.00 ? 38  GLN B HG3  2  
ATOM   4927  H  HE21 . GLN B 1 38 ? 164.381 3.406   -8.602  1.00 0.00 ? 38  GLN B HE21 2  
ATOM   4928  H  HE22 . GLN B 1 38 ? 165.631 2.937   -7.553  1.00 0.00 ? 38  GLN B HE22 2  
ATOM   4929  N  N    . THR B 1 39 ? 159.642 0.103   -7.824  1.00 0.00 ? 39  THR B N    2  
ATOM   4930  C  CA   . THR B 1 39 ? 159.427 -0.623  -9.062  1.00 0.00 ? 39  THR B CA   2  
ATOM   4931  C  C    . THR B 1 39 ? 157.963 -0.638  -9.494  1.00 0.00 ? 39  THR B C    2  
ATOM   4932  O  O    . THR B 1 39 ? 157.668 -0.463  -10.676 1.00 0.00 ? 39  THR B O    2  
ATOM   4933  C  CB   . THR B 1 39 ? 159.973 -2.057  -8.944  1.00 0.00 ? 39  THR B CB   2  
ATOM   4934  O  OG1  . THR B 1 39 ? 160.436 -2.485  -10.216 1.00 0.00 ? 39  THR B OG1  2  
ATOM   4935  C  CG2  . THR B 1 39 ? 158.884 -3.013  -8.455  1.00 0.00 ? 39  THR B CG2  2  
ATOM   4936  H  H    . THR B 1 39 ? 159.745 -0.387  -6.981  1.00 0.00 ? 39  THR B H    2  
ATOM   4937  H  HA   . THR B 1 39 ? 159.993 -0.120  -9.833  1.00 0.00 ? 39  THR B HA   2  
ATOM   4938  H  HB   . THR B 1 39 ? 160.795 -2.069  -8.245  1.00 0.00 ? 39  THR B HB   2  
ATOM   4939  H  HG1  . THR B 1 39 ? 160.763 -3.384  -10.126 1.00 0.00 ? 39  THR B HG1  2  
ATOM   4940  H  HG21 . THR B 1 39 ? 159.335 -3.941  -8.134  1.00 0.00 ? 39  THR B HG21 2  
ATOM   4941  H  HG22 . THR B 1 39 ? 158.188 -3.209  -9.258  1.00 0.00 ? 39  THR B HG22 2  
ATOM   4942  H  HG23 . THR B 1 39 ? 158.360 -2.564  -7.630  1.00 0.00 ? 39  THR B HG23 2  
ATOM   4943  N  N    . GLU B 1 40 ? 157.036 -0.880  -8.560  1.00 0.00 ? 40  GLU B N    2  
ATOM   4944  C  CA   . GLU B 1 40 ? 155.637 -0.941  -8.957  1.00 0.00 ? 40  GLU B CA   2  
ATOM   4945  C  C    . GLU B 1 40 ? 155.102 0.448   -9.306  1.00 0.00 ? 40  GLU B C    2  
ATOM   4946  O  O    . GLU B 1 40 ? 154.298 0.588   -10.225 1.00 0.00 ? 40  GLU B O    2  
ATOM   4947  C  CB   . GLU B 1 40 ? 154.779 -1.526  -7.832  1.00 0.00 ? 40  GLU B CB   2  
ATOM   4948  C  CG   . GLU B 1 40 ? 155.206 -2.965  -7.508  1.00 0.00 ? 40  GLU B CG   2  
ATOM   4949  C  CD   . GLU B 1 40 ? 155.059 -3.873  -8.728  1.00 0.00 ? 40  GLU B CD   2  
ATOM   4950  O  OE1  . GLU B 1 40 ? 154.353 -3.499  -9.645  1.00 0.00 ? 40  GLU B OE1  2  
ATOM   4951  O  OE2  . GLU B 1 40 ? 155.660 -4.935  -8.723  1.00 0.00 ? 40  GLU B OE2  2  
ATOM   4952  H  H    . GLU B 1 40 ? 157.296 -1.044  -7.625  1.00 0.00 ? 40  GLU B H    2  
ATOM   4953  H  HA   . GLU B 1 40 ? 155.551 -1.574  -9.826  1.00 0.00 ? 40  GLU B HA   2  
ATOM   4954  H  HB2  . GLU B 1 40 ? 154.867 -0.913  -6.953  1.00 0.00 ? 40  GLU B HB2  2  
ATOM   4955  H  HB3  . GLU B 1 40 ? 153.758 -1.534  -8.150  1.00 0.00 ? 40  GLU B HB3  2  
ATOM   4956  H  HG2  . GLU B 1 40 ? 156.231 -2.968  -7.184  1.00 0.00 ? 40  GLU B HG2  2  
ATOM   4957  H  HG3  . GLU B 1 40 ? 154.585 -3.345  -6.711  1.00 0.00 ? 40  GLU B HG3  2  
ATOM   4958  N  N    . LEU B 1 41 ? 155.567 1.478   -8.587  1.00 0.00 ? 41  LEU B N    2  
ATOM   4959  C  CA   . LEU B 1 41 ? 155.129 2.850   -8.861  1.00 0.00 ? 41  LEU B CA   2  
ATOM   4960  C  C    . LEU B 1 41 ? 156.327 3.745   -9.144  1.00 0.00 ? 41  LEU B C    2  
ATOM   4961  O  O    . LEU B 1 41 ? 156.590 4.703   -8.404  1.00 0.00 ? 41  LEU B O    2  
ATOM   4962  C  CB   . LEU B 1 41 ? 154.327 3.398   -7.678  1.00 0.00 ? 41  LEU B CB   2  
ATOM   4963  C  CG   . LEU B 1 41 ? 153.095 2.514   -7.424  1.00 0.00 ? 41  LEU B CG   2  
ATOM   4964  C  CD1  . LEU B 1 41 ? 152.270 3.081   -6.253  1.00 0.00 ? 41  LEU B CD1  2  
ATOM   4965  C  CD2  . LEU B 1 41 ? 152.222 2.475   -8.691  1.00 0.00 ? 41  LEU B CD2  2  
ATOM   4966  H  H    . LEU B 1 41 ? 156.227 1.318   -7.868  1.00 0.00 ? 41  LEU B H    2  
ATOM   4967  H  HA   . LEU B 1 41 ? 154.496 2.848   -9.735  1.00 0.00 ? 41  LEU B HA   2  
ATOM   4968  H  HB2  . LEU B 1 41 ? 154.951 3.402   -6.803  1.00 0.00 ? 41  LEU B HB2  2  
ATOM   4969  H  HB3  . LEU B 1 41 ? 154.006 4.405   -7.897  1.00 0.00 ? 41  LEU B HB3  2  
ATOM   4970  H  HG   . LEU B 1 41 ? 153.419 1.513   -7.181  1.00 0.00 ? 41  LEU B HG   2  
ATOM   4971  H  HD11 . LEU B 1 41 ? 152.555 4.108   -6.066  1.00 0.00 ? 41  LEU B HD11 2  
ATOM   4972  H  HD12 . LEU B 1 41 ? 152.455 2.492   -5.369  1.00 0.00 ? 41  LEU B HD12 2  
ATOM   4973  H  HD13 . LEU B 1 41 ? 151.216 3.041   -6.491  1.00 0.00 ? 41  LEU B HD13 2  
ATOM   4974  H  HD21 . LEU B 1 41 ? 152.527 1.652   -9.314  1.00 0.00 ? 41  LEU B HD21 2  
ATOM   4975  H  HD22 . LEU B 1 41 ? 152.334 3.401   -9.237  1.00 0.00 ? 41  LEU B HD22 2  
ATOM   4976  H  HD23 . LEU B 1 41 ? 151.186 2.348   -8.412  1.00 0.00 ? 41  LEU B HD23 2  
ATOM   4977  N  N    . SER B 1 42 ? 157.042 3.427   -10.215 1.00 0.00 ? 42  SER B N    2  
ATOM   4978  C  CA   . SER B 1 42 ? 158.221 4.190   -10.598 1.00 0.00 ? 42  SER B CA   2  
ATOM   4979  C  C    . SER B 1 42 ? 157.857 5.642   -10.862 1.00 0.00 ? 42  SER B C    2  
ATOM   4980  O  O    . SER B 1 42 ? 158.700 6.527   -10.747 1.00 0.00 ? 42  SER B O    2  
ATOM   4981  C  CB   . SER B 1 42 ? 158.849 3.583   -11.853 1.00 0.00 ? 42  SER B CB   2  
ATOM   4982  O  OG   . SER B 1 42 ? 157.972 3.776   -12.957 1.00 0.00 ? 42  SER B OG   2  
ATOM   4983  H  H    . SER B 1 42 ? 156.775 2.655   -10.757 1.00 0.00 ? 42  SER B H    2  
ATOM   4984  H  HA   . SER B 1 42 ? 158.941 4.149   -9.796  1.00 0.00 ? 42  SER B HA   2  
ATOM   4985  H  HB2  . SER B 1 42 ? 159.788 4.069   -12.059 1.00 0.00 ? 42  SER B HB2  2  
ATOM   4986  H  HB3  . SER B 1 42 ? 159.018 2.526   -11.695 1.00 0.00 ? 42  SER B HB3  2  
ATOM   4987  H  HG   . SER B 1 42 ? 157.984 2.976   -13.487 1.00 0.00 ? 42  SER B HG   2  
ATOM   4988  N  N    . GLY B 1 43 ? 156.603 5.880   -11.223 1.00 0.00 ? 43  GLY B N    2  
ATOM   4989  C  CA   . GLY B 1 43 ? 156.149 7.236   -11.504 1.00 0.00 ? 43  GLY B CA   2  
ATOM   4990  C  C    . GLY B 1 43 ? 155.711 7.956   -10.228 1.00 0.00 ? 43  GLY B C    2  
ATOM   4991  O  O    . GLY B 1 43 ? 156.373 8.891   -9.776  1.00 0.00 ? 43  GLY B O    2  
ATOM   4992  H  H    . GLY B 1 43 ? 155.973 5.134   -11.304 1.00 0.00 ? 43  GLY B H    2  
ATOM   4993  H  HA2  . GLY B 1 43 ? 156.956 7.790   -11.963 1.00 0.00 ? 43  GLY B HA2  2  
ATOM   4994  H  HA3  . GLY B 1 43 ? 155.314 7.195   -12.187 1.00 0.00 ? 43  GLY B HA3  2  
ATOM   4995  N  N    . PHE B 1 44 ? 154.584 7.530   -9.665  1.00 0.00 ? 44  PHE B N    2  
ATOM   4996  C  CA   . PHE B 1 44 ? 154.057 8.157   -8.454  1.00 0.00 ? 44  PHE B CA   2  
ATOM   4997  C  C    . PHE B 1 44 ? 155.052 8.132   -7.286  1.00 0.00 ? 44  PHE B C    2  
ATOM   4998  O  O    . PHE B 1 44 ? 155.198 9.127   -6.576  1.00 0.00 ? 44  PHE B O    2  
ATOM   4999  C  CB   . PHE B 1 44 ? 152.743 7.477   -8.045  1.00 0.00 ? 44  PHE B CB   2  
ATOM   5000  C  CG   . PHE B 1 44 ? 152.186 8.190   -6.838  1.00 0.00 ? 44  PHE B CG   2  
ATOM   5001  C  CD1  . PHE B 1 44 ? 151.627 9.459   -6.976  1.00 0.00 ? 44  PHE B CD1  2  
ATOM   5002  C  CD2  . PHE B 1 44 ? 152.244 7.585   -5.581  1.00 0.00 ? 44  PHE B CD2  2  
ATOM   5003  C  CE1  . PHE B 1 44 ? 151.135 10.135  -5.851  1.00 0.00 ? 44  PHE B CE1  2  
ATOM   5004  C  CE2  . PHE B 1 44 ? 151.746 8.252   -4.458  1.00 0.00 ? 44  PHE B CE2  2  
ATOM   5005  C  CZ   . PHE B 1 44 ? 151.196 9.531   -4.592  1.00 0.00 ? 44  PHE B CZ   2  
ATOM   5006  H  H    . PHE B 1 44 ? 154.090 6.790   -10.077 1.00 0.00 ? 44  PHE B H    2  
ATOM   5007  H  HA   . PHE B 1 44 ? 153.831 9.188   -8.682  1.00 0.00 ? 44  PHE B HA   2  
ATOM   5008  H  HB2  . PHE B 1 44 ? 152.036 7.533   -8.859  1.00 0.00 ? 44  PHE B HB2  2  
ATOM   5009  H  HB3  . PHE B 1 44 ? 152.932 6.443   -7.798  1.00 0.00 ? 44  PHE B HB3  2  
ATOM   5010  H  HD1  . PHE B 1 44 ? 151.576 9.918   -7.949  1.00 0.00 ? 44  PHE B HD1  2  
ATOM   5011  H  HD2  . PHE B 1 44 ? 152.655 6.595   -5.482  1.00 0.00 ? 44  PHE B HD2  2  
ATOM   5012  H  HE1  . PHE B 1 44 ? 150.703 11.119  -5.959  1.00 0.00 ? 44  PHE B HE1  2  
ATOM   5013  H  HE2  . PHE B 1 44 ? 151.794 7.785   -3.487  1.00 0.00 ? 44  PHE B HE2  2  
ATOM   5014  H  HZ   . PHE B 1 44 ? 150.819 10.050  -3.724  1.00 0.00 ? 44  PHE B HZ   2  
ATOM   5015  N  N    . LEU B 1 45 ? 155.718 7.000   -7.073  1.00 0.00 ? 45  LEU B N    2  
ATOM   5016  C  CA   . LEU B 1 45 ? 156.677 6.873   -5.968  1.00 0.00 ? 45  LEU B CA   2  
ATOM   5017  C  C    . LEU B 1 45 ? 158.113 7.210   -6.362  1.00 0.00 ? 45  LEU B C    2  
ATOM   5018  O  O    . LEU B 1 45 ? 159.007 7.136   -5.519  1.00 0.00 ? 45  LEU B O    2  
ATOM   5019  C  CB   . LEU B 1 45 ? 156.579 5.484   -5.330  1.00 0.00 ? 45  LEU B CB   2  
ATOM   5020  C  CG   . LEU B 1 45 ? 155.139 5.259   -4.837  1.00 0.00 ? 45  LEU B CG   2  
ATOM   5021  C  CD1  . LEU B 1 45 ? 155.032 3.900   -4.150  1.00 0.00 ? 45  LEU B CD1  2  
ATOM   5022  C  CD2  . LEU B 1 45 ? 154.755 6.346   -3.817  1.00 0.00 ? 45  LEU B CD2  2  
ATOM   5023  H  H    . LEU B 1 45 ? 155.562 6.225   -7.664  1.00 0.00 ? 45  LEU B H    2  
ATOM   5024  H  HA   . LEU B 1 45 ? 156.400 7.593   -5.218  1.00 0.00 ? 45  LEU B HA   2  
ATOM   5025  H  HB2  . LEU B 1 45 ? 156.833 4.732   -6.064  1.00 0.00 ? 45  LEU B HB2  2  
ATOM   5026  H  HB3  . LEU B 1 45 ? 157.259 5.420   -4.495  1.00 0.00 ? 45  LEU B HB3  2  
ATOM   5027  H  HG   . LEU B 1 45 ? 154.464 5.296   -5.676  1.00 0.00 ? 45  LEU B HG   2  
ATOM   5028  H  HD11 . LEU B 1 45 ? 155.626 3.174   -4.683  1.00 0.00 ? 45  LEU B HD11 2  
ATOM   5029  H  HD12 . LEU B 1 45 ? 154.000 3.584   -4.141  1.00 0.00 ? 45  LEU B HD12 2  
ATOM   5030  H  HD13 . LEU B 1 45 ? 155.387 3.985   -3.137  1.00 0.00 ? 45  LEU B HD13 2  
ATOM   5031  H  HD21 . LEU B 1 45 ? 154.424 7.235   -4.330  1.00 0.00 ? 45  LEU B HD21 2  
ATOM   5032  H  HD22 . LEU B 1 45 ? 155.613 6.584   -3.207  1.00 0.00 ? 45  LEU B HD22 2  
ATOM   5033  H  HD23 . LEU B 1 45 ? 153.958 5.980   -3.185  1.00 0.00 ? 45  LEU B HD23 2  
ATOM   5034  N  N    . ASP B 1 46 ? 158.340 7.546   -7.634  1.00 0.00 ? 46  ASP B N    2  
ATOM   5035  C  CA   . ASP B 1 46 ? 159.694 7.856   -8.111  1.00 0.00 ? 46  ASP B CA   2  
ATOM   5036  C  C    . ASP B 1 46 ? 160.578 8.368   -6.972  1.00 0.00 ? 46  ASP B C    2  
ATOM   5037  O  O    . ASP B 1 46 ? 160.473 9.518   -6.545  1.00 0.00 ? 46  ASP B O    2  
ATOM   5038  C  CB   . ASP B 1 46 ? 159.628 8.933   -9.197  1.00 0.00 ? 46  ASP B CB   2  
ATOM   5039  C  CG   . ASP B 1 46 ? 161.013 9.159   -9.793  1.00 0.00 ? 46  ASP B CG   2  
ATOM   5040  O  OD1  . ASP B 1 46 ? 161.918 8.424   -9.434  1.00 0.00 ? 46  ASP B OD1  2  
ATOM   5041  O  OD2  . ASP B 1 46 ? 161.149 10.065  -10.600 1.00 0.00 ? 46  ASP B OD2  2  
ATOM   5042  H  H    . ASP B 1 46 ? 157.591 7.565   -8.266  1.00 0.00 ? 46  ASP B H    2  
ATOM   5043  H  HA   . ASP B 1 46 ? 160.136 6.965   -8.529  1.00 0.00 ? 46  ASP B HA   2  
ATOM   5044  H  HB2  . ASP B 1 46 ? 158.947 8.624   -9.974  1.00 0.00 ? 46  ASP B HB2  2  
ATOM   5045  H  HB3  . ASP B 1 46 ? 159.275 9.856   -8.763  1.00 0.00 ? 46  ASP B HB3  2  
ATOM   5046  N  N    . ALA B 1 47 ? 161.441 7.478   -6.487  1.00 0.00 ? 47  ALA B N    2  
ATOM   5047  C  CA   . ALA B 1 47 ? 162.355 7.785   -5.389  1.00 0.00 ? 47  ALA B CA   2  
ATOM   5048  C  C    . ALA B 1 47 ? 163.363 8.863   -5.773  1.00 0.00 ? 47  ALA B C    2  
ATOM   5049  O  O    . ALA B 1 47 ? 163.951 9.510   -4.906  1.00 0.00 ? 47  ALA B O    2  
ATOM   5050  C  CB   . ALA B 1 47 ? 163.103 6.519   -4.971  1.00 0.00 ? 47  ALA B CB   2  
ATOM   5051  H  H    . ALA B 1 47 ? 161.457 6.579   -6.875  1.00 0.00 ? 47  ALA B H    2  
ATOM   5052  H  HA   . ALA B 1 47 ? 161.778 8.135   -4.546  1.00 0.00 ? 47  ALA B HA   2  
ATOM   5053  H  HB1  . ALA B 1 47 ? 163.788 6.230   -5.754  1.00 0.00 ? 47  ALA B HB1  2  
ATOM   5054  H  HB2  . ALA B 1 47 ? 162.394 5.721   -4.800  1.00 0.00 ? 47  ALA B HB2  2  
ATOM   5055  H  HB3  . ALA B 1 47 ? 163.655 6.710   -4.062  1.00 0.00 ? 47  ALA B HB3  2  
ATOM   5056  N  N    . GLN B 1 48 ? 163.592 9.029   -7.069  1.00 0.00 ? 48  GLN B N    2  
ATOM   5057  C  CA   . GLN B 1 48 ? 164.569 10.006  -7.536  1.00 0.00 ? 48  GLN B CA   2  
ATOM   5058  C  C    . GLN B 1 48 ? 164.270 11.401  -6.994  1.00 0.00 ? 48  GLN B C    2  
ATOM   5059  O  O    . GLN B 1 48 ? 165.192 12.160  -6.693  1.00 0.00 ? 48  GLN B O    2  
ATOM   5060  C  CB   . GLN B 1 48 ? 164.563 10.052  -9.065  1.00 0.00 ? 48  GLN B CB   2  
ATOM   5061  C  CG   . GLN B 1 48 ? 165.047 8.711   -9.619  1.00 0.00 ? 48  GLN B CG   2  
ATOM   5062  C  CD   . GLN B 1 48 ? 164.995 8.727   -11.143 1.00 0.00 ? 48  GLN B CD   2  
ATOM   5063  O  OE1  . GLN B 1 48 ? 164.333 9.581   -11.733 1.00 0.00 ? 48  GLN B OE1  2  
ATOM   5064  N  NE2  . GLN B 1 48 ? 165.657 7.829   -11.819 1.00 0.00 ? 48  GLN B NE2  2  
ATOM   5065  H  H    . GLN B 1 48 ? 163.118 8.471   -7.720  1.00 0.00 ? 48  GLN B H    2  
ATOM   5066  H  HA   . GLN B 1 48 ? 165.550 9.705   -7.203  1.00 0.00 ? 48  GLN B HA   2  
ATOM   5067  H  HB2  . GLN B 1 48 ? 163.558 10.244  -9.413  1.00 0.00 ? 48  GLN B HB2  2  
ATOM   5068  H  HB3  . GLN B 1 48 ? 165.218 10.839  -9.404  1.00 0.00 ? 48  GLN B HB3  2  
ATOM   5069  H  HG2  . GLN B 1 48 ? 166.063 8.535   -9.297  1.00 0.00 ? 48  GLN B HG2  2  
ATOM   5070  H  HG3  . GLN B 1 48 ? 164.412 7.920   -9.248  1.00 0.00 ? 48  GLN B HG3  2  
ATOM   5071  H  HE21 . GLN B 1 48 ? 166.184 7.150   -11.347 1.00 0.00 ? 48  GLN B HE21 2  
ATOM   5072  H  HE22 . GLN B 1 48 ? 165.629 7.833   -12.799 1.00 0.00 ? 48  GLN B HE22 2  
ATOM   5073  N  N    . LYS B 1 49 ? 162.994 11.741  -6.861  1.00 0.00 ? 49  LYS B N    2  
ATOM   5074  C  CA   . LYS B 1 49 ? 162.639 13.055  -6.345  1.00 0.00 ? 49  LYS B CA   2  
ATOM   5075  C  C    . LYS B 1 49 ? 163.206 13.275  -4.945  1.00 0.00 ? 49  LYS B C    2  
ATOM   5076  O  O    . LYS B 1 49 ? 163.653 14.372  -4.612  1.00 0.00 ? 49  LYS B O    2  
ATOM   5077  C  CB   . LYS B 1 49 ? 161.143 13.224  -6.342  1.00 0.00 ? 49  LYS B CB   2  
ATOM   5078  C  CG   . LYS B 1 49 ? 160.701 13.199  -7.791  1.00 0.00 ? 49  LYS B CG   2  
ATOM   5079  C  CD   . LYS B 1 49 ? 159.287 13.688  -7.888  1.00 0.00 ? 49  LYS B CD   2  
ATOM   5080  C  CE   . LYS B 1 49 ? 158.350 12.678  -7.237  1.00 0.00 ? 49  LYS B CE   2  
ATOM   5081  N  NZ   . LYS B 1 49 ? 156.942 12.979  -7.625  1.00 0.00 ? 49  LYS B NZ   2  
ATOM   5082  H  H    . LYS B 1 49 ? 162.291 11.107  -7.109  1.00 0.00 ? 49  LYS B H    2  
ATOM   5083  H  HA   . LYS B 1 49 ? 163.032 13.802  -7.015  1.00 0.00 ? 49  LYS B HA   2  
ATOM   5084  H  HB2  . LYS B 1 49 ? 160.683 12.412  -5.796  1.00 0.00 ? 49  LYS B HB2  2  
ATOM   5085  H  HB3  . LYS B 1 49 ? 160.877 14.169  -5.895  1.00 0.00 ? 49  LYS B HB3  2  
ATOM   5086  H  HG2  . LYS B 1 49 ? 161.339 13.836  -8.386  1.00 0.00 ? 49  LYS B HG2  2  
ATOM   5087  H  HG3  . LYS B 1 49 ? 160.755 12.188  -8.165  1.00 0.00 ? 49  LYS B HG3  2  
ATOM   5088  H  HD2  . LYS B 1 49 ? 159.201 14.644  -7.388  1.00 0.00 ? 49  LYS B HD2  2  
ATOM   5089  H  HD3  . LYS B 1 49 ? 159.058 13.801  -8.916  1.00 0.00 ? 49  LYS B HD3  2  
ATOM   5090  H  HE2  . LYS B 1 49 ? 158.611 11.684  -7.565  1.00 0.00 ? 49  LYS B HE2  2  
ATOM   5091  H  HE3  . LYS B 1 49 ? 158.450 12.740  -6.164  1.00 0.00 ? 49  LYS B HE3  2  
ATOM   5092  H  HZ1  . LYS B 1 49 ? 156.826 12.831  -8.647  1.00 0.00 ? 49  LYS B HZ1  2  
ATOM   5093  H  HZ2  . LYS B 1 49 ? 156.722 13.968  -7.389  1.00 0.00 ? 49  LYS B HZ2  2  
ATOM   5094  H  HZ3  . LYS B 1 49 ? 156.297 12.347  -7.109  1.00 0.00 ? 49  LYS B HZ3  2  
ATOM   5095  N  N    . ASP B 1 50 ? 163.202 12.215  -4.140  1.00 0.00 ? 50  ASP B N    2  
ATOM   5096  C  CA   . ASP B 1 50 ? 163.730 12.278  -2.778  1.00 0.00 ? 50  ASP B CA   2  
ATOM   5097  C  C    . ASP B 1 50 ? 164.456 10.977  -2.439  1.00 0.00 ? 50  ASP B C    2  
ATOM   5098  O  O    . ASP B 1 50 ? 163.825 9.966   -2.137  1.00 0.00 ? 50  ASP B O    2  
ATOM   5099  C  CB   . ASP B 1 50 ? 162.594 12.502  -1.777  1.00 0.00 ? 50  ASP B CB   2  
ATOM   5100  C  CG   . ASP B 1 50 ? 161.981 13.887  -1.965  1.00 0.00 ? 50  ASP B CG   2  
ATOM   5101  O  OD1  . ASP B 1 50 ? 162.599 14.705  -2.623  1.00 0.00 ? 50  ASP B OD1  2  
ATOM   5102  O  OD2  . ASP B 1 50 ? 160.905 14.113  -1.434  1.00 0.00 ? 50  ASP B OD2  2  
ATOM   5103  H  H    . ASP B 1 50 ? 162.845 11.365  -4.474  1.00 0.00 ? 50  ASP B H    2  
ATOM   5104  H  HA   . ASP B 1 50 ? 164.428 13.100  -2.708  1.00 0.00 ? 50  ASP B HA   2  
ATOM   5105  H  HB2  . ASP B 1 50 ? 161.832 11.753  -1.930  1.00 0.00 ? 50  ASP B HB2  2  
ATOM   5106  H  HB3  . ASP B 1 50 ? 162.983 12.419  -0.773  1.00 0.00 ? 50  ASP B HB3  2  
ATOM   5107  N  N    . VAL B 1 51 ? 165.781 11.001  -2.511  1.00 0.00 ? 51  VAL B N    2  
ATOM   5108  C  CA   . VAL B 1 51 ? 166.574 9.808   -2.229  1.00 0.00 ? 51  VAL B CA   2  
ATOM   5109  C  C    . VAL B 1 51 ? 166.404 9.321   -0.787  1.00 0.00 ? 51  VAL B C    2  
ATOM   5110  O  O    . VAL B 1 51 ? 166.335 8.116   -0.541  1.00 0.00 ? 51  VAL B O    2  
ATOM   5111  C  CB   . VAL B 1 51 ? 168.053 10.100  -2.489  1.00 0.00 ? 51  VAL B CB   2  
ATOM   5112  C  CG1  . VAL B 1 51 ? 168.897 8.911   -2.028  1.00 0.00 ? 51  VAL B CG1  2  
ATOM   5113  C  CG2  . VAL B 1 51 ? 168.269 10.329  -3.987  1.00 0.00 ? 51  VAL B CG2  2  
ATOM   5114  H  H    . VAL B 1 51 ? 166.234 11.830  -2.773  1.00 0.00 ? 51  VAL B H    2  
ATOM   5115  H  HA   . VAL B 1 51 ? 166.261 9.021   -2.897  1.00 0.00 ? 51  VAL B HA   2  
ATOM   5116  H  HB   . VAL B 1 51 ? 168.345 10.984  -1.942  1.00 0.00 ? 51  VAL B HB   2  
ATOM   5117  H  HG11 . VAL B 1 51 ? 168.932 8.893   -0.948  1.00 0.00 ? 51  VAL B HG11 2  
ATOM   5118  H  HG12 . VAL B 1 51 ? 169.899 9.009   -2.419  1.00 0.00 ? 51  VAL B HG12 2  
ATOM   5119  H  HG13 . VAL B 1 51 ? 168.457 7.994   -2.390  1.00 0.00 ? 51  VAL B HG13 2  
ATOM   5120  H  HG21 . VAL B 1 51 ? 167.565 11.064  -4.344  1.00 0.00 ? 51  VAL B HG21 2  
ATOM   5121  H  HG22 . VAL B 1 51 ? 168.123 9.400   -4.517  1.00 0.00 ? 51  VAL B HG22 2  
ATOM   5122  H  HG23 . VAL B 1 51 ? 169.276 10.684  -4.154  1.00 0.00 ? 51  VAL B HG23 2  
ATOM   5123  N  N    . ASP B 1 52 ? 166.367 10.249  0.166   1.00 0.00 ? 52  ASP B N    2  
ATOM   5124  C  CA   . ASP B 1 52 ? 166.239 9.871   1.576   1.00 0.00 ? 52  ASP B CA   2  
ATOM   5125  C  C    . ASP B 1 52 ? 164.781 9.752   2.024   1.00 0.00 ? 52  ASP B C    2  
ATOM   5126  O  O    . ASP B 1 52 ? 164.512 9.528   3.204   1.00 0.00 ? 52  ASP B O    2  
ATOM   5127  C  CB   . ASP B 1 52 ? 166.954 10.903  2.450   1.00 0.00 ? 52  ASP B CB   2  
ATOM   5128  C  CG   . ASP B 1 52 ? 166.245 12.251  2.355   1.00 0.00 ? 52  ASP B CG   2  
ATOM   5129  O  OD1  . ASP B 1 52 ? 165.130 12.279  1.862   1.00 0.00 ? 52  ASP B OD1  2  
ATOM   5130  O  OD2  . ASP B 1 52 ? 166.828 13.235  2.777   1.00 0.00 ? 52  ASP B OD2  2  
ATOM   5131  H  H    . ASP B 1 52 ? 166.447 11.196  -0.076  1.00 0.00 ? 52  ASP B H    2  
ATOM   5132  H  HA   . ASP B 1 52 ? 166.721 8.916   1.718   1.00 0.00 ? 52  ASP B HA   2  
ATOM   5133  H  HB2  . ASP B 1 52 ? 166.949 10.567  3.477   1.00 0.00 ? 52  ASP B HB2  2  
ATOM   5134  H  HB3  . ASP B 1 52 ? 167.974 11.012  2.113   1.00 0.00 ? 52  ASP B HB3  2  
ATOM   5135  N  N    . ALA B 1 53 ? 163.844 9.899   1.096   1.00 0.00 ? 53  ALA B N    2  
ATOM   5136  C  CA   . ALA B 1 53 ? 162.429 9.798   1.447   1.00 0.00 ? 53  ALA B CA   2  
ATOM   5137  C  C    . ALA B 1 53 ? 162.082 8.398   1.952   1.00 0.00 ? 53  ALA B C    2  
ATOM   5138  O  O    . ALA B 1 53 ? 161.176 8.231   2.771   1.00 0.00 ? 53  ALA B O    2  
ATOM   5139  C  CB   . ALA B 1 53 ? 161.557 10.138  0.234   1.00 0.00 ? 53  ALA B CB   2  
ATOM   5140  H  H    . ALA B 1 53 ? 164.104 10.076  0.169   1.00 0.00 ? 53  ALA B H    2  
ATOM   5141  H  HA   . ALA B 1 53 ? 162.217 10.510  2.231   1.00 0.00 ? 53  ALA B HA   2  
ATOM   5142  H  HB1  . ALA B 1 53 ? 160.624 9.594   0.290   1.00 0.00 ? 53  ALA B HB1  2  
ATOM   5143  H  HB2  . ALA B 1 53 ? 162.077 9.866   -0.671  1.00 0.00 ? 53  ALA B HB2  2  
ATOM   5144  H  HB3  . ALA B 1 53 ? 161.351 11.198  0.227   1.00 0.00 ? 53  ALA B HB3  2  
ATOM   5145  N  N    . VAL B 1 54 ? 162.783 7.393   1.437   1.00 0.00 ? 54  VAL B N    2  
ATOM   5146  C  CA   . VAL B 1 54 ? 162.509 6.015   1.826   1.00 0.00 ? 54  VAL B CA   2  
ATOM   5147  C  C    . VAL B 1 54 ? 162.677 5.806   3.328   1.00 0.00 ? 54  VAL B C    2  
ATOM   5148  O  O    . VAL B 1 54 ? 161.847 5.152   3.960   1.00 0.00 ? 54  VAL B O    2  
ATOM   5149  C  CB   . VAL B 1 54 ? 163.452 5.080   1.075   1.00 0.00 ? 54  VAL B CB   2  
ATOM   5150  C  CG1  . VAL B 1 54 ? 163.298 3.656   1.612   1.00 0.00 ? 54  VAL B CG1  2  
ATOM   5151  C  CG2  . VAL B 1 54 ? 163.105 5.106   -0.414  1.00 0.00 ? 54  VAL B CG2  2  
ATOM   5152  H  H    . VAL B 1 54 ? 163.478 7.580   0.773   1.00 0.00 ? 54  VAL B H    2  
ATOM   5153  H  HA   . VAL B 1 54 ? 161.495 5.765   1.550   1.00 0.00 ? 54  VAL B HA   2  
ATOM   5154  H  HB   . VAL B 1 54 ? 164.472 5.409   1.215   1.00 0.00 ? 54  VAL B HB   2  
ATOM   5155  H  HG11 . VAL B 1 54 ? 162.248 3.417   1.699   1.00 0.00 ? 54  VAL B HG11 2  
ATOM   5156  H  HG12 . VAL B 1 54 ? 163.766 3.585   2.582   1.00 0.00 ? 54  VAL B HG12 2  
ATOM   5157  H  HG13 . VAL B 1 54 ? 163.770 2.962   0.932   1.00 0.00 ? 54  VAL B HG13 2  
ATOM   5158  H  HG21 . VAL B 1 54 ? 162.841 6.113   -0.704  1.00 0.00 ? 54  VAL B HG21 2  
ATOM   5159  H  HG22 . VAL B 1 54 ? 162.271 4.447   -0.601  1.00 0.00 ? 54  VAL B HG22 2  
ATOM   5160  H  HG23 . VAL B 1 54 ? 163.958 4.780   -0.987  1.00 0.00 ? 54  VAL B HG23 2  
ATOM   5161  N  N    . ASP B 1 55 ? 163.742 6.358   3.907   1.00 0.00 ? 55  ASP B N    2  
ATOM   5162  C  CA   . ASP B 1 55 ? 163.953 6.196   5.342   1.00 0.00 ? 55  ASP B CA   2  
ATOM   5163  C  C    . ASP B 1 55 ? 162.796 6.809   6.122   1.00 0.00 ? 55  ASP B C    2  
ATOM   5164  O  O    . ASP B 1 55 ? 162.286 6.225   7.085   1.00 0.00 ? 55  ASP B O    2  
ATOM   5165  C  CB   . ASP B 1 55 ? 165.253 6.890   5.760   1.00 0.00 ? 55  ASP B CB   2  
ATOM   5166  C  CG   . ASP B 1 55 ? 166.454 6.187   5.139   1.00 0.00 ? 55  ASP B CG   2  
ATOM   5167  O  OD1  . ASP B 1 55 ? 166.276 5.101   4.619   1.00 0.00 ? 55  ASP B OD1  2  
ATOM   5168  O  OD2  . ASP B 1 55 ? 167.537 6.747   5.194   1.00 0.00 ? 55  ASP B OD2  2  
ATOM   5169  H  H    . ASP B 1 55 ? 164.380 6.876   3.373   1.00 0.00 ? 55  ASP B H    2  
ATOM   5170  H  HA   . ASP B 1 55 ? 164.024 5.145   5.575   1.00 0.00 ? 55  ASP B HA   2  
ATOM   5171  H  HB2  . ASP B 1 55 ? 165.230 7.918   5.428   1.00 0.00 ? 55  ASP B HB2  2  
ATOM   5172  H  HB3  . ASP B 1 55 ? 165.341 6.864   6.835   1.00 0.00 ? 55  ASP B HB3  2  
ATOM   5173  N  N    . LYS B 1 56 ? 162.374 7.990   5.689   1.00 0.00 ? 56  LYS B N    2  
ATOM   5174  C  CA   . LYS B 1 56 ? 161.274 8.669   6.346   1.00 0.00 ? 56  LYS B CA   2  
ATOM   5175  C  C    . LYS B 1 56 ? 160.000 7.849   6.247   1.00 0.00 ? 56  LYS B C    2  
ATOM   5176  O  O    . LYS B 1 56 ? 159.220 7.777   7.197   1.00 0.00 ? 56  LYS B O    2  
ATOM   5177  C  CB   . LYS B 1 56 ? 161.051 10.040  5.709   1.00 0.00 ? 56  LYS B CB   2  
ATOM   5178  C  CG   . LYS B 1 56 ? 162.321 10.862  5.803   1.00 0.00 ? 56  LYS B CG   2  
ATOM   5179  C  CD   . LYS B 1 56 ? 162.641 11.108  7.284   1.00 0.00 ? 56  LYS B CD   2  
ATOM   5180  C  CE   . LYS B 1 56 ? 163.218 12.498  7.429   1.00 0.00 ? 56  LYS B CE   2  
ATOM   5181  N  NZ   . LYS B 1 56 ? 163.766 12.684  8.802   1.00 0.00 ? 56  LYS B NZ   2  
ATOM   5182  H  H    . LYS B 1 56 ? 162.807 8.407   4.914   1.00 0.00 ? 56  LYS B H    2  
ATOM   5183  H  HA   . LYS B 1 56 ? 161.521 8.807   7.388   1.00 0.00 ? 56  LYS B HA   2  
ATOM   5184  H  HB2  . LYS B 1 56 ? 160.772 9.923   4.674   1.00 0.00 ? 56  LYS B HB2  2  
ATOM   5185  H  HB3  . LYS B 1 56 ? 160.274 10.572  6.239   1.00 0.00 ? 56  LYS B HB3  2  
ATOM   5186  H  HG2  . LYS B 1 56 ? 163.135 10.321  5.338   1.00 0.00 ? 56  LYS B HG2  2  
ATOM   5187  H  HG3  . LYS B 1 56 ? 162.176 11.805  5.296   1.00 0.00 ? 56  LYS B HG3  2  
ATOM   5188  H  HD2  . LYS B 1 56 ? 161.744 11.027  7.883   1.00 0.00 ? 56  LYS B HD2  2  
ATOM   5189  H  HD3  . LYS B 1 56 ? 163.367 10.383  7.621   1.00 0.00 ? 56  LYS B HD3  2  
ATOM   5190  H  HE2  . LYS B 1 56 ? 163.998 12.640  6.699   1.00 0.00 ? 56  LYS B HE2  2  
ATOM   5191  H  HE3  . LYS B 1 56 ? 162.421 13.203  7.252   1.00 0.00 ? 56  LYS B HE3  2  
ATOM   5192  H  HZ1  . LYS B 1 56 ? 164.804 12.646  8.770   1.00 0.00 ? 56  LYS B HZ1  2  
ATOM   5193  H  HZ2  . LYS B 1 56 ? 163.410 11.926  9.421   1.00 0.00 ? 56  LYS B HZ2  2  
ATOM   5194  H  HZ3  . LYS B 1 56 ? 163.465 13.606  9.174   1.00 0.00 ? 56  LYS B HZ3  2  
ATOM   5195  N  N    . VAL B 1 57 ? 159.781 7.244   5.081   1.00 0.00 ? 57  VAL B N    2  
ATOM   5196  C  CA   . VAL B 1 57 ? 158.580 6.453   4.879   1.00 0.00 ? 57  VAL B CA   2  
ATOM   5197  C  C    . VAL B 1 57 ? 158.555 5.208   5.750   1.00 0.00 ? 57  VAL B C    2  
ATOM   5198  O  O    . VAL B 1 57 ? 157.549 4.917   6.387   1.00 0.00 ? 57  VAL B O    2  
ATOM   5199  C  CB   . VAL B 1 57 ? 158.462 6.053   3.408   1.00 0.00 ? 57  VAL B CB   2  
ATOM   5200  C  CG1  . VAL B 1 57 ? 157.289 5.088   3.232   1.00 0.00 ? 57  VAL B CG1  2  
ATOM   5201  C  CG2  . VAL B 1 57 ? 158.225 7.303   2.558   1.00 0.00 ? 57  VAL B CG2  2  
ATOM   5202  H  H    . VAL B 1 57 ? 160.429 7.346   4.350   1.00 0.00 ? 57  VAL B H    2  
ATOM   5203  H  HA   . VAL B 1 57 ? 157.732 7.056   5.137   1.00 0.00 ? 57  VAL B HA   2  
ATOM   5204  H  HB   . VAL B 1 57 ? 159.375 5.569   3.093   1.00 0.00 ? 57  VAL B HB   2  
ATOM   5205  H  HG11 . VAL B 1 57 ? 157.600 4.089   3.500   1.00 0.00 ? 57  VAL B HG11 2  
ATOM   5206  H  HG12 . VAL B 1 57 ? 156.963 5.100   2.203   1.00 0.00 ? 57  VAL B HG12 2  
ATOM   5207  H  HG13 . VAL B 1 57 ? 156.472 5.394   3.871   1.00 0.00 ? 57  VAL B HG13 2  
ATOM   5208  H  HG21 . VAL B 1 57 ? 158.518 7.106   1.537   1.00 0.00 ? 57  VAL B HG21 2  
ATOM   5209  H  HG22 . VAL B 1 57 ? 158.812 8.121   2.949   1.00 0.00 ? 57  VAL B HG22 2  
ATOM   5210  H  HG23 . VAL B 1 57 ? 157.178 7.565   2.588   1.00 0.00 ? 57  VAL B HG23 2  
ATOM   5211  N  N    . MET B 1 58 ? 159.661 4.476   5.783   1.00 0.00 ? 58  MET B N    2  
ATOM   5212  C  CA   . MET B 1 58 ? 159.720 3.265   6.591   1.00 0.00 ? 58  MET B CA   2  
ATOM   5213  C  C    . MET B 1 58 ? 159.628 3.579   8.085   1.00 0.00 ? 58  MET B C    2  
ATOM   5214  O  O    . MET B 1 58 ? 159.006 2.829   8.853   1.00 0.00 ? 58  MET B O    2  
ATOM   5215  C  CB   . MET B 1 58 ? 160.999 2.480   6.265   1.00 0.00 ? 58  MET B CB   2  
ATOM   5216  C  CG   . MET B 1 58 ? 162.144 2.939   7.163   1.00 0.00 ? 58  MET B CG   2  
ATOM   5217  S  SD   . MET B 1 58 ? 162.015 2.121   8.774   1.00 0.00 ? 58  MET B SD   2  
ATOM   5218  C  CE   . MET B 1 58 ? 162.728 0.531   8.283   1.00 0.00 ? 58  MET B CE   2  
ATOM   5219  H  H    . MET B 1 58 ? 160.443 4.751   5.259   1.00 0.00 ? 58  MET B H    2  
ATOM   5220  H  HA   . MET B 1 58 ? 158.874 2.648   6.328   1.00 0.00 ? 58  MET B HA   2  
ATOM   5221  H  HB2  . MET B 1 58 ? 160.821 1.426   6.422   1.00 0.00 ? 58  MET B HB2  2  
ATOM   5222  H  HB3  . MET B 1 58 ? 161.268 2.646   5.232   1.00 0.00 ? 58  MET B HB3  2  
ATOM   5223  H  HG2  . MET B 1 58 ? 163.088 2.685   6.703   1.00 0.00 ? 58  MET B HG2  2  
ATOM   5224  H  HG3  . MET B 1 58 ? 162.081 4.007   7.291   1.00 0.00 ? 58  MET B HG3  2  
ATOM   5225  H  HE1  . MET B 1 58 ? 163.723 0.442   8.696   1.00 0.00 ? 58  MET B HE1  2  
ATOM   5226  H  HE2  . MET B 1 58 ? 162.780 0.474   7.209   1.00 0.00 ? 58  MET B HE2  2  
ATOM   5227  H  HE3  . MET B 1 58 ? 162.105 -0.271  8.655   1.00 0.00 ? 58  MET B HE3  2  
ATOM   5228  N  N    . LYS B 1 59 ? 160.249 4.681   8.505   1.00 0.00 ? 59  LYS B N    2  
ATOM   5229  C  CA   . LYS B 1 59 ? 160.218 5.040   9.913   1.00 0.00 ? 59  LYS B CA   2  
ATOM   5230  C  C    . LYS B 1 59 ? 158.779 5.191   10.390  1.00 0.00 ? 59  LYS B C    2  
ATOM   5231  O  O    . LYS B 1 59 ? 158.428 4.739   11.480  1.00 0.00 ? 59  LYS B O    2  
ATOM   5232  C  CB   . LYS B 1 59 ? 160.974 6.350   10.138  1.00 0.00 ? 59  LYS B CB   2  
ATOM   5233  C  CG   . LYS B 1 59 ? 161.052 6.646   11.636  1.00 0.00 ? 59  LYS B CG   2  
ATOM   5234  C  CD   . LYS B 1 59 ? 161.753 7.988   11.856  1.00 0.00 ? 59  LYS B CD   2  
ATOM   5235  C  CE   . LYS B 1 59 ? 161.972 8.211   13.354  1.00 0.00 ? 59  LYS B CE   2  
ATOM   5236  N  NZ   . LYS B 1 59 ? 160.718 7.887   14.092  1.00 0.00 ? 59  LYS B NZ   2  
ATOM   5237  H  H    . LYS B 1 59 ? 160.743 5.249   7.863   1.00 0.00 ? 59  LYS B H    2  
ATOM   5238  H  HA   . LYS B 1 59 ? 160.697 4.259   10.486  1.00 0.00 ? 59  LYS B HA   2  
ATOM   5239  H  HB2  . LYS B 1 59 ? 161.973 6.263   9.735   1.00 0.00 ? 59  LYS B HB2  2  
ATOM   5240  H  HB3  . LYS B 1 59 ? 160.454 7.155   9.640   1.00 0.00 ? 59  LYS B HB3  2  
ATOM   5241  H  HG2  . LYS B 1 59 ? 160.053 6.688   12.046  1.00 0.00 ? 59  LYS B HG2  2  
ATOM   5242  H  HG3  . LYS B 1 59 ? 161.611 5.865   12.129  1.00 0.00 ? 59  LYS B HG3  2  
ATOM   5243  H  HD2  . LYS B 1 59 ? 162.706 7.983   11.348  1.00 0.00 ? 59  LYS B HD2  2  
ATOM   5244  H  HD3  . LYS B 1 59 ? 161.138 8.784   11.462  1.00 0.00 ? 59  LYS B HD3  2  
ATOM   5245  H  HE2  . LYS B 1 59 ? 162.769 7.570   13.700  1.00 0.00 ? 59  LYS B HE2  2  
ATOM   5246  H  HE3  . LYS B 1 59 ? 162.237 9.243   13.529  1.00 0.00 ? 59  LYS B HE3  2  
ATOM   5247  H  HZ1  . LYS B 1 59 ? 159.908 7.943   13.443  1.00 0.00 ? 59  LYS B HZ1  2  
ATOM   5248  H  HZ2  . LYS B 1 59 ? 160.589 8.568   14.869  1.00 0.00 ? 59  LYS B HZ2  2  
ATOM   5249  H  HZ3  . LYS B 1 59 ? 160.783 6.926   14.481  1.00 0.00 ? 59  LYS B HZ3  2  
ATOM   5250  N  N    . GLU B 1 60 ? 157.944 5.813   9.565   1.00 0.00 ? 60  GLU B N    2  
ATOM   5251  C  CA   . GLU B 1 60 ? 156.545 5.992   9.923   1.00 0.00 ? 60  GLU B CA   2  
ATOM   5252  C  C    . GLU B 1 60 ? 155.827 4.647   10.003  1.00 0.00 ? 60  GLU B C    2  
ATOM   5253  O  O    . GLU B 1 60 ? 154.964 4.444   10.856  1.00 0.00 ? 60  GLU B O    2  
ATOM   5254  C  CB   . GLU B 1 60 ? 155.851 6.880   8.888   1.00 0.00 ? 60  GLU B CB   2  
ATOM   5255  C  CG   . GLU B 1 60 ? 156.461 8.283   8.929   1.00 0.00 ? 60  GLU B CG   2  
ATOM   5256  C  CD   . GLU B 1 60 ? 155.734 9.196   7.948   1.00 0.00 ? 60  GLU B CD   2  
ATOM   5257  O  OE1  . GLU B 1 60 ? 154.932 8.690   7.181   1.00 0.00 ? 60  GLU B OE1  2  
ATOM   5258  O  OE2  . GLU B 1 60 ? 155.991 10.388  7.978   1.00 0.00 ? 60  GLU B OE2  2  
ATOM   5259  H  H    . GLU B 1 60 ? 158.271 6.145   8.701   1.00 0.00 ? 60  GLU B H    2  
ATOM   5260  H  HA   . GLU B 1 60 ? 156.489 6.474   10.886  1.00 0.00 ? 60  GLU B HA   2  
ATOM   5261  H  HB2  . GLU B 1 60 ? 155.984 6.457   7.904   1.00 0.00 ? 60  GLU B HB2  2  
ATOM   5262  H  HB3  . GLU B 1 60 ? 154.798 6.941   9.115   1.00 0.00 ? 60  GLU B HB3  2  
ATOM   5263  H  HG2  . GLU B 1 60 ? 156.370 8.684   9.927   1.00 0.00 ? 60  GLU B HG2  2  
ATOM   5264  H  HG3  . GLU B 1 60 ? 157.505 8.227   8.659   1.00 0.00 ? 60  GLU B HG3  2  
ATOM   5265  N  N    . LEU B 1 61 ? 156.186 3.730   9.102   1.00 0.00 ? 61  LEU B N    2  
ATOM   5266  C  CA   . LEU B 1 61 ? 155.559 2.411   9.084   1.00 0.00 ? 61  LEU B CA   2  
ATOM   5267  C  C    . LEU B 1 61 ? 155.900 1.592   10.312  1.00 0.00 ? 61  LEU B C    2  
ATOM   5268  O  O    . LEU B 1 61 ? 155.050 0.867   10.829  1.00 0.00 ? 61  LEU B O    2  
ATOM   5269  C  CB   . LEU B 1 61 ? 156.000 1.632   7.845   1.00 0.00 ? 61  LEU B CB   2  
ATOM   5270  C  CG   . LEU B 1 61 ? 155.553 2.364   6.583   1.00 0.00 ? 61  LEU B CG   2  
ATOM   5271  C  CD1  . LEU B 1 61 ? 156.005 1.570   5.357   1.00 0.00 ? 61  LEU B CD1  2  
ATOM   5272  C  CD2  . LEU B 1 61 ? 154.023 2.479   6.576   1.00 0.00 ? 61  LEU B CD2  2  
ATOM   5273  H  H    . LEU B 1 61 ? 156.876 3.946   8.442   1.00 0.00 ? 61  LEU B H    2  
ATOM   5274  H  HA   . LEU B 1 61 ? 154.489 2.539   9.046   1.00 0.00 ? 61  LEU B HA   2  
ATOM   5275  H  HB2  . LEU B 1 61 ? 157.077 1.541   7.844   1.00 0.00 ? 61  LEU B HB2  2  
ATOM   5276  H  HB3  . LEU B 1 61 ? 155.557 0.648   7.864   1.00 0.00 ? 61  LEU B HB3  2  
ATOM   5277  H  HG   . LEU B 1 61 ? 155.989 3.346   6.561   1.00 0.00 ? 61  LEU B HG   2  
ATOM   5278  H  HD11 . LEU B 1 61 ? 157.080 1.626   5.270   1.00 0.00 ? 61  LEU B HD11 2  
ATOM   5279  H  HD12 . LEU B 1 61 ? 155.550 1.988   4.471   1.00 0.00 ? 61  LEU B HD12 2  
ATOM   5280  H  HD13 . LEU B 1 61 ? 155.706 0.539   5.466   1.00 0.00 ? 61  LEU B HD13 2  
ATOM   5281  H  HD21 . LEU B 1 61 ? 153.732 3.411   7.035   1.00 0.00 ? 61  LEU B HD21 2  
ATOM   5282  H  HD22 . LEU B 1 61 ? 153.592 1.656   7.129   1.00 0.00 ? 61  LEU B HD22 2  
ATOM   5283  H  HD23 . LEU B 1 61 ? 153.667 2.450   5.562   1.00 0.00 ? 61  LEU B HD23 2  
ATOM   5284  N  N    . ASP B 1 62 ? 157.139 1.678   10.775  1.00 0.00 ? 62  ASP B N    2  
ATOM   5285  C  CA   . ASP B 1 62 ? 157.510 0.887   11.936  1.00 0.00 ? 62  ASP B CA   2  
ATOM   5286  C  C    . ASP B 1 62 ? 156.988 1.515   13.223  1.00 0.00 ? 62  ASP B C    2  
ATOM   5287  O  O    . ASP B 1 62 ? 157.736 2.167   13.952  1.00 0.00 ? 62  ASP B O    2  
ATOM   5288  C  CB   . ASP B 1 62 ? 159.025 0.754   12.022  1.00 0.00 ? 62  ASP B CB   2  
ATOM   5289  C  CG   . ASP B 1 62 ? 159.384 -0.258  13.099  1.00 0.00 ? 62  ASP B CG   2  
ATOM   5290  O  OD1  . ASP B 1 62 ? 158.523 -1.054  13.452  1.00 0.00 ? 62  ASP B OD1  2  
ATOM   5291  O  OD2  . ASP B 1 62 ? 160.508 -0.212  13.566  1.00 0.00 ? 62  ASP B OD2  2  
ATOM   5292  H  H    . ASP B 1 62 ? 157.805 2.254   10.323  1.00 0.00 ? 62  ASP B H    2  
ATOM   5293  H  HA   . ASP B 1 62 ? 157.084 -0.099  11.835  1.00 0.00 ? 62  ASP B HA   2  
ATOM   5294  H  HB2  . ASP B 1 62 ? 159.411 0.420   11.069  1.00 0.00 ? 62  ASP B HB2  2  
ATOM   5295  H  HB3  . ASP B 1 62 ? 159.458 1.711   12.269  1.00 0.00 ? 62  ASP B HB3  2  
ATOM   5296  N  N    . GLU B 1 63 ? 155.717 1.281   13.520  1.00 0.00 ? 63  GLU B N    2  
ATOM   5297  C  CA   . GLU B 1 63 ? 155.130 1.793   14.749  1.00 0.00 ? 63  GLU B CA   2  
ATOM   5298  C  C    . GLU B 1 63 ? 155.733 1.139   15.973  1.00 0.00 ? 63  GLU B C    2  
ATOM   5299  O  O    . GLU B 1 63 ? 155.914 1.772   17.013  1.00 0.00 ? 63  GLU B O    2  
ATOM   5300  C  CB   . GLU B 1 63 ? 153.620 1.546   14.750  1.00 0.00 ? 63  GLU B CB   2  
ATOM   5301  C  CG   . GLU B 1 63 ? 153.015 2.093   16.047  1.00 0.00 ? 63  GLU B CG   2  
ATOM   5302  C  CD   . GLU B 1 63 ? 151.514 1.828   16.080  1.00 0.00 ? 63  GLU B CD   2  
ATOM   5303  O  OE1  . GLU B 1 63 ? 151.021 1.214   15.148  1.00 0.00 ? 63  GLU B OE1  2  
ATOM   5304  O  OE2  . GLU B 1 63 ? 150.880 2.244   17.035  1.00 0.00 ? 63  GLU B OE2  2  
ATOM   5305  H  H    . GLU B 1 63 ? 155.175 0.728   12.919  1.00 0.00 ? 63  GLU B H    2  
ATOM   5306  H  HA   . GLU B 1 63 ? 155.303 2.857   14.802  1.00 0.00 ? 63  GLU B HA   2  
ATOM   5307  H  HB2  . GLU B 1 63 ? 153.173 2.048   13.904  1.00 0.00 ? 63  GLU B HB2  2  
ATOM   5308  H  HB3  . GLU B 1 63 ? 153.428 0.487   14.684  1.00 0.00 ? 63  GLU B HB3  2  
ATOM   5309  H  HG2  . GLU B 1 63 ? 153.471 1.592   16.889  1.00 0.00 ? 63  GLU B HG2  2  
ATOM   5310  H  HG3  . GLU B 1 63 ? 153.206 3.141   16.122  1.00 0.00 ? 63  GLU B HG3  2  
ATOM   5311  N  N    . ASN B 1 64 ? 155.989 -0.147  15.853  1.00 0.00 ? 64  ASN B N    2  
ATOM   5312  C  CA   . ASN B 1 64 ? 156.510 -0.912  16.964  1.00 0.00 ? 64  ASN B CA   2  
ATOM   5313  C  C    . ASN B 1 64 ? 157.840 -0.363  17.470  1.00 0.00 ? 64  ASN B C    2  
ATOM   5314  O  O    . ASN B 1 64 ? 158.132 -0.416  18.664  1.00 0.00 ? 64  ASN B O    2  
ATOM   5315  C  CB   . ASN B 1 64 ? 156.723 -2.359  16.521  1.00 0.00 ? 64  ASN B CB   2  
ATOM   5316  C  CG   . ASN B 1 64 ? 155.429 -2.939  15.967  1.00 0.00 ? 64  ASN B CG   2  
ATOM   5317  O  OD1  . ASN B 1 64 ? 155.426 -3.490  14.863  1.00 0.00 ? 64  ASN B OD1  2  
ATOM   5318  N  ND2  . ASN B 1 64 ? 154.330 -2.851  16.663  1.00 0.00 ? 64  ASN B ND2  2  
ATOM   5319  H  H    . ASN B 1 64 ? 155.784 -0.602  15.009  1.00 0.00 ? 64  ASN B H    2  
ATOM   5320  H  HA   . ASN B 1 64 ? 155.782 -0.884  17.760  1.00 0.00 ? 64  ASN B HA   2  
ATOM   5321  H  HB2  . ASN B 1 64 ? 157.485 -2.390  15.756  1.00 0.00 ? 64  ASN B HB2  2  
ATOM   5322  H  HB3  . ASN B 1 64 ? 157.043 -2.947  17.368  1.00 0.00 ? 64  ASN B HB3  2  
ATOM   5323  H  HD21 . ASN B 1 64 ? 154.338 -2.412  17.539  1.00 0.00 ? 64  ASN B HD21 2  
ATOM   5324  H  HD22 . ASN B 1 64 ? 153.494 -3.224  16.309  1.00 0.00 ? 64  ASN B HD22 2  
ATOM   5325  N  N    . GLY B 1 65 ? 158.661 0.114   16.544  1.00 0.00 ? 65  GLY B N    2  
ATOM   5326  C  CA   . GLY B 1 65 ? 159.984 0.613   16.896  1.00 0.00 ? 65  GLY B CA   2  
ATOM   5327  C  C    . GLY B 1 65 ? 160.967 -0.545  16.788  1.00 0.00 ? 65  GLY B C    2  
ATOM   5328  O  O    . GLY B 1 65 ? 162.160 -0.416  17.067  1.00 0.00 ? 65  GLY B O    2  
ATOM   5329  H  H    . GLY B 1 65 ? 158.389 0.096   15.603  1.00 0.00 ? 65  GLY B H    2  
ATOM   5330  H  HA2  . GLY B 1 65 ? 160.268 1.404   16.215  1.00 0.00 ? 65  GLY B HA2  2  
ATOM   5331  H  HA3  . GLY B 1 65 ? 159.979 0.985   17.909  1.00 0.00 ? 65  GLY B HA3  2  
ATOM   5332  N  N    . ASP B 1 66 ? 160.419 -1.684  16.370  1.00 0.00 ? 66  ASP B N    2  
ATOM   5333  C  CA   . ASP B 1 66 ? 161.174 -2.918  16.193  1.00 0.00 ? 66  ASP B CA   2  
ATOM   5334  C  C    . ASP B 1 66 ? 162.263 -2.776  15.129  1.00 0.00 ? 66  ASP B C    2  
ATOM   5335  O  O    . ASP B 1 66 ? 163.313 -3.412  15.212  1.00 0.00 ? 66  ASP B O    2  
ATOM   5336  C  CB   . ASP B 1 66 ? 160.199 -4.048  15.833  1.00 0.00 ? 66  ASP B CB   2  
ATOM   5337  C  CG   . ASP B 1 66 ? 159.489 -3.754  14.507  1.00 0.00 ? 66  ASP B CG   2  
ATOM   5338  O  OD1  . ASP B 1 66 ? 159.915 -2.856  13.809  1.00 0.00 ? 66  ASP B OD1  2  
ATOM   5339  O  OD2  . ASP B 1 66 ? 158.507 -4.422  14.222  1.00 0.00 ? 66  ASP B OD2  2  
ATOM   5340  H  H    . ASP B 1 66 ? 159.459 -1.692  16.171  1.00 0.00 ? 66  ASP B H    2  
ATOM   5341  H  HA   . ASP B 1 66 ? 161.647 -3.166  17.131  1.00 0.00 ? 66  ASP B HA   2  
ATOM   5342  H  HB2  . ASP B 1 66 ? 160.746 -4.975  15.745  1.00 0.00 ? 66  ASP B HB2  2  
ATOM   5343  H  HB3  . ASP B 1 66 ? 159.462 -4.145  16.617  1.00 0.00 ? 66  ASP B HB3  2  
ATOM   5344  N  N    . GLY B 1 67 ? 161.991 -1.960  14.126  1.00 0.00 ? 67  GLY B N    2  
ATOM   5345  C  CA   . GLY B 1 67 ? 162.930 -1.748  13.031  1.00 0.00 ? 67  GLY B CA   2  
ATOM   5346  C  C    . GLY B 1 67 ? 162.533 -2.596  11.830  1.00 0.00 ? 67  GLY B C    2  
ATOM   5347  O  O    . GLY B 1 67 ? 163.108 -2.475  10.749  1.00 0.00 ? 67  GLY B O    2  
ATOM   5348  H  H    . GLY B 1 67 ? 161.131 -1.498  14.113  1.00 0.00 ? 67  GLY B H    2  
ATOM   5349  H  HA2  . GLY B 1 67 ? 162.924 -0.703  12.752  1.00 0.00 ? 67  GLY B HA2  2  
ATOM   5350  H  HA3  . GLY B 1 67 ? 163.922 -2.028  13.349  1.00 0.00 ? 67  GLY B HA3  2  
ATOM   5351  N  N    . GLU B 1 68 ? 161.520 -3.437  12.028  1.00 0.00 ? 68  GLU B N    2  
ATOM   5352  C  CA   . GLU B 1 68 ? 161.012 -4.287  10.960  1.00 0.00 ? 68  GLU B CA   2  
ATOM   5353  C  C    . GLU B 1 68 ? 159.618 -3.812  10.572  1.00 0.00 ? 68  GLU B C    2  
ATOM   5354  O  O    . GLU B 1 68 ? 158.827 -3.411  11.435  1.00 0.00 ? 68  GLU B O    2  
ATOM   5355  C  CB   . GLU B 1 68 ? 160.980 -5.747  11.409  1.00 0.00 ? 68  GLU B CB   2  
ATOM   5356  C  CG   . GLU B 1 68 ? 160.640 -6.636  10.211  1.00 0.00 ? 68  GLU B CG   2  
ATOM   5357  C  CD   . GLU B 1 68 ? 160.540 -8.089  10.657  1.00 0.00 ? 68  GLU B CD   2  
ATOM   5358  O  OE1  . GLU B 1 68 ? 160.647 -8.333  11.847  1.00 0.00 ? 68  GLU B OE1  2  
ATOM   5359  O  OE2  . GLU B 1 68 ? 160.380 -8.939  9.799   1.00 0.00 ? 68  GLU B OE2  2  
ATOM   5360  H  H    . GLU B 1 68 ? 161.092 -3.469  12.908  1.00 0.00 ? 68  GLU B H    2  
ATOM   5361  H  HA   . GLU B 1 68 ? 161.650 -4.209  10.100  1.00 0.00 ? 68  GLU B HA   2  
ATOM   5362  H  HB2  . GLU B 1 68 ? 161.948 -6.024  11.802  1.00 0.00 ? 68  GLU B HB2  2  
ATOM   5363  H  HB3  . GLU B 1 68 ? 160.229 -5.874  12.174  1.00 0.00 ? 68  GLU B HB3  2  
ATOM   5364  H  HG2  . GLU B 1 68 ? 159.695 -6.324  9.792   1.00 0.00 ? 68  GLU B HG2  2  
ATOM   5365  H  HG3  . GLU B 1 68 ? 161.414 -6.543  9.459   1.00 0.00 ? 68  GLU B HG3  2  
ATOM   5366  N  N    . VAL B 1 69 ? 159.320 -3.834  9.276   1.00 0.00 ? 69  VAL B N    2  
ATOM   5367  C  CA   . VAL B 1 69 ? 158.018 -3.373  8.808   1.00 0.00 ? 69  VAL B CA   2  
ATOM   5368  C  C    . VAL B 1 69 ? 157.147 -4.549  8.407   1.00 0.00 ? 69  VAL B C    2  
ATOM   5369  O  O    . VAL B 1 69 ? 157.577 -5.447  7.683   1.00 0.00 ? 69  VAL B O    2  
ATOM   5370  C  CB   . VAL B 1 69 ? 158.196 -2.449  7.601   1.00 0.00 ? 69  VAL B CB   2  
ATOM   5371  C  CG1  . VAL B 1 69 ? 156.837 -1.883  7.188   1.00 0.00 ? 69  VAL B CG1  2  
ATOM   5372  C  CG2  . VAL B 1 69 ? 159.135 -1.300  7.972   1.00 0.00 ? 69  VAL B CG2  2  
ATOM   5373  H  H    . VAL B 1 69 ? 159.987 -4.146  8.629   1.00 0.00 ? 69  VAL B H    2  
ATOM   5374  H  HA   . VAL B 1 69 ? 157.528 -2.822  9.597   1.00 0.00 ? 69  VAL B HA   2  
ATOM   5375  H  HB   . VAL B 1 69 ? 158.615 -3.011  6.776   1.00 0.00 ? 69  VAL B HB   2  
ATOM   5376  H  HG11 . VAL B 1 69 ? 156.277 -2.640  6.657   1.00 0.00 ? 69  VAL B HG11 2  
ATOM   5377  H  HG12 . VAL B 1 69 ? 156.983 -1.028  6.543   1.00 0.00 ? 69  VAL B HG12 2  
ATOM   5378  H  HG13 . VAL B 1 69 ? 156.289 -1.582  8.068   1.00 0.00 ? 69  VAL B HG13 2  
ATOM   5379  H  HG21 . VAL B 1 69 ? 159.984 -1.689  8.516   1.00 0.00 ? 69  VAL B HG21 2  
ATOM   5380  H  HG22 . VAL B 1 69 ? 158.607 -0.588  8.590   1.00 0.00 ? 69  VAL B HG22 2  
ATOM   5381  H  HG23 . VAL B 1 69 ? 159.478 -0.811  7.072   1.00 0.00 ? 69  VAL B HG23 2  
ATOM   5382  N  N    . ASP B 1 70 ? 155.912 -4.527  8.889   1.00 0.00 ? 70  ASP B N    2  
ATOM   5383  C  CA   . ASP B 1 70 ? 154.955 -5.580  8.591   1.00 0.00 ? 70  ASP B CA   2  
ATOM   5384  C  C    . ASP B 1 70 ? 153.943 -5.103  7.566   1.00 0.00 ? 70  ASP B C    2  
ATOM   5385  O  O    . ASP B 1 70 ? 153.577 -3.926  7.534   1.00 0.00 ? 70  ASP B O    2  
ATOM   5386  C  CB   . ASP B 1 70 ? 154.233 -6.021  9.865   1.00 0.00 ? 70  ASP B CB   2  
ATOM   5387  C  CG   . ASP B 1 70 ? 153.384 -7.256  9.581   1.00 0.00 ? 70  ASP B CG   2  
ATOM   5388  O  OD1  . ASP B 1 70 ? 153.468 -7.767  8.478   1.00 0.00 ? 70  ASP B OD1  2  
ATOM   5389  O  OD2  . ASP B 1 70 ? 152.662 -7.671  10.473  1.00 0.00 ? 70  ASP B OD2  2  
ATOM   5390  H  H    . ASP B 1 70 ? 155.636 -3.779  9.458   1.00 0.00 ? 70  ASP B H    2  
ATOM   5391  H  HA   . ASP B 1 70 ? 155.480 -6.426  8.181   1.00 0.00 ? 70  ASP B HA   2  
ATOM   5392  H  HB2  . ASP B 1 70 ? 154.961 -6.252  10.629  1.00 0.00 ? 70  ASP B HB2  2  
ATOM   5393  H  HB3  . ASP B 1 70 ? 153.596 -5.225  10.210  1.00 0.00 ? 70  ASP B HB3  2  
ATOM   5394  N  N    . PHE B 1 71 ? 153.484 -6.024  6.738   1.00 0.00 ? 71  PHE B N    2  
ATOM   5395  C  CA   . PHE B 1 71 ? 152.505 -5.686  5.727   1.00 0.00 ? 71  PHE B CA   2  
ATOM   5396  C  C    . PHE B 1 71 ? 151.323 -4.978  6.368   1.00 0.00 ? 71  PHE B C    2  
ATOM   5397  O  O    . PHE B 1 71 ? 150.785 -4.025  5.806   1.00 0.00 ? 71  PHE B O    2  
ATOM   5398  C  CB   . PHE B 1 71 ? 152.050 -6.956  5.007   1.00 0.00 ? 71  PHE B CB   2  
ATOM   5399  C  CG   . PHE B 1 71 ? 151.059 -6.608  3.923   1.00 0.00 ? 71  PHE B CG   2  
ATOM   5400  C  CD1  . PHE B 1 71 ? 151.493 -6.047  2.716   1.00 0.00 ? 71  PHE B CD1  2  
ATOM   5401  C  CD2  . PHE B 1 71 ? 149.700 -6.874  4.123   1.00 0.00 ? 71  PHE B CD2  2  
ATOM   5402  C  CE1  . PHE B 1 71 ? 150.564 -5.748  1.714   1.00 0.00 ? 71  PHE B CE1  2  
ATOM   5403  C  CE2  . PHE B 1 71 ? 148.773 -6.575  3.120   1.00 0.00 ? 71  PHE B CE2  2  
ATOM   5404  C  CZ   . PHE B 1 71 ? 149.204 -6.010  1.915   1.00 0.00 ? 71  PHE B CZ   2  
ATOM   5405  H  H    . PHE B 1 71 ? 153.803 -6.947  6.814   1.00 0.00 ? 71  PHE B H    2  
ATOM   5406  H  HA   . PHE B 1 71 ? 152.960 -5.022  5.008   1.00 0.00 ? 71  PHE B HA   2  
ATOM   5407  H  HB2  . PHE B 1 71 ? 152.906 -7.445  4.566   1.00 0.00 ? 71  PHE B HB2  2  
ATOM   5408  H  HB3  . PHE B 1 71 ? 151.583 -7.623  5.717   1.00 0.00 ? 71  PHE B HB3  2  
ATOM   5409  H  HD1  . PHE B 1 71 ? 152.541 -5.838  2.560   1.00 0.00 ? 71  PHE B HD1  2  
ATOM   5410  H  HD2  . PHE B 1 71 ? 149.366 -7.309  5.053   1.00 0.00 ? 71  PHE B HD2  2  
ATOM   5411  H  HE1  . PHE B 1 71 ? 150.895 -5.312  0.785   1.00 0.00 ? 71  PHE B HE1  2  
ATOM   5412  H  HE2  . PHE B 1 71 ? 147.725 -6.779  3.277   1.00 0.00 ? 71  PHE B HE2  2  
ATOM   5413  H  HZ   . PHE B 1 71 ? 148.488 -5.779  1.141   1.00 0.00 ? 71  PHE B HZ   2  
ATOM   5414  N  N    . GLN B 1 72 ? 150.922 -5.430  7.552   1.00 0.00 ? 72  GLN B N    2  
ATOM   5415  C  CA   . GLN B 1 72 ? 149.806 -4.793  8.233   1.00 0.00 ? 72  GLN B CA   2  
ATOM   5416  C  C    . GLN B 1 72 ? 150.110 -3.314  8.482   1.00 0.00 ? 72  GLN B C    2  
ATOM   5417  O  O    . GLN B 1 72 ? 149.235 -2.463  8.320   1.00 0.00 ? 72  GLN B O    2  
ATOM   5418  C  CB   . GLN B 1 72 ? 149.546 -5.491  9.569   1.00 0.00 ? 72  GLN B CB   2  
ATOM   5419  C  CG   . GLN B 1 72 ? 149.099 -6.932  9.315   1.00 0.00 ? 72  GLN B CG   2  
ATOM   5420  C  CD   . GLN B 1 72 ? 148.891 -7.655  10.641  1.00 0.00 ? 72  GLN B CD   2  
ATOM   5421  O  OE1  . GLN B 1 72 ? 149.355 -7.190  11.682  1.00 0.00 ? 72  GLN B OE1  2  
ATOM   5422  N  NE2  . GLN B 1 72 ? 148.217 -8.772  10.666  1.00 0.00 ? 72  GLN B NE2  2  
ATOM   5423  H  H    . GLN B 1 72 ? 151.385 -6.187  7.970   1.00 0.00 ? 72  GLN B H    2  
ATOM   5424  H  HA   . GLN B 1 72 ? 148.923 -4.873  7.617   1.00 0.00 ? 72  GLN B HA   2  
ATOM   5425  H  HB2  . GLN B 1 72 ? 150.452 -5.492  10.157  1.00 0.00 ? 72  GLN B HB2  2  
ATOM   5426  H  HB3  . GLN B 1 72 ? 148.769 -4.965  10.105  1.00 0.00 ? 72  GLN B HB3  2  
ATOM   5427  H  HG2  . GLN B 1 72 ? 148.173 -6.927  8.761   1.00 0.00 ? 72  GLN B HG2  2  
ATOM   5428  H  HG3  . GLN B 1 72 ? 149.857 -7.446  8.743   1.00 0.00 ? 72  GLN B HG3  2  
ATOM   5429  H  HE21 . GLN B 1 72 ? 147.849 -9.142  9.836   1.00 0.00 ? 72  GLN B HE21 2  
ATOM   5430  H  HE22 . GLN B 1 72 ? 148.079 -9.243  11.514  1.00 0.00 ? 72  GLN B HE22 2  
ATOM   5431  N  N    . GLU B 1 73 ? 151.359 -3.001  8.849   1.00 0.00 ? 73  GLU B N    2  
ATOM   5432  C  CA   . GLU B 1 73 ? 151.734 -1.604  9.076   1.00 0.00 ? 73  GLU B CA   2  
ATOM   5433  C  C    . GLU B 1 73 ? 151.694 -0.836  7.756   1.00 0.00 ? 73  GLU B C    2  
ATOM   5434  O  O    . GLU B 1 73 ? 151.237 0.304   7.688   1.00 0.00 ? 73  GLU B O    2  
ATOM   5435  C  CB   . GLU B 1 73 ? 153.165 -1.526  9.632   1.00 0.00 ? 73  GLU B CB   2  
ATOM   5436  C  CG   . GLU B 1 73 ? 153.253 -2.163  11.024  1.00 0.00 ? 73  GLU B CG   2  
ATOM   5437  C  CD   . GLU B 1 73 ? 154.687 -2.038  11.553  1.00 0.00 ? 73  GLU B CD   2  
ATOM   5438  O  OE1  . GLU B 1 73 ? 155.536 -1.601  10.794  1.00 0.00 ? 73  GLU B OE1  2  
ATOM   5439  O  OE2  . GLU B 1 73 ? 154.922 -2.394  12.701  1.00 0.00 ? 73  GLU B OE2  2  
ATOM   5440  H  H    . GLU B 1 73 ? 152.031 -3.708  8.947   1.00 0.00 ? 73  GLU B H    2  
ATOM   5441  H  HA   . GLU B 1 73 ? 151.050 -1.154  9.779   1.00 0.00 ? 73  GLU B HA   2  
ATOM   5442  H  HB2  . GLU B 1 73 ? 153.834 -2.045  8.962   1.00 0.00 ? 73  GLU B HB2  2  
ATOM   5443  H  HB3  . GLU B 1 73 ? 153.463 -0.490  9.698   1.00 0.00 ? 73  GLU B HB3  2  
ATOM   5444  H  HG2  . GLU B 1 73 ? 152.576 -1.654  11.694  1.00 0.00 ? 73  GLU B HG2  2  
ATOM   5445  H  HG3  . GLU B 1 73 ? 152.982 -3.204  10.963  1.00 0.00 ? 73  GLU B HG3  2  
ATOM   5446  N  N    . TYR B 1 74 ? 152.193 -1.496  6.716   1.00 0.00 ? 74  TYR B N    2  
ATOM   5447  C  CA   . TYR B 1 74 ? 152.250 -0.927  5.372   1.00 0.00 ? 74  TYR B CA   2  
ATOM   5448  C  C    . TYR B 1 74 ? 150.886 -0.653  4.735   1.00 0.00 ? 74  TYR B C    2  
ATOM   5449  O  O    . TYR B 1 74 ? 150.710 0.348   4.026   1.00 0.00 ? 74  TYR B O    2  
ATOM   5450  C  CB   . TYR B 1 74 ? 153.062 -1.850  4.464   1.00 0.00 ? 74  TYR B CB   2  
ATOM   5451  C  CG   . TYR B 1 74 ? 153.079 -1.267  3.080   1.00 0.00 ? 74  TYR B CG   2  
ATOM   5452  C  CD1  . TYR B 1 74 ? 153.967 -0.240  2.744   1.00 0.00 ? 74  TYR B CD1  2  
ATOM   5453  C  CD2  . TYR B 1 74 ? 152.181 -1.754  2.134   1.00 0.00 ? 74  TYR B CD2  2  
ATOM   5454  C  CE1  . TYR B 1 74 ? 153.949 0.301   1.452   1.00 0.00 ? 74  TYR B CE1  2  
ATOM   5455  C  CE2  . TYR B 1 74 ? 152.160 -1.220  0.847   1.00 0.00 ? 74  TYR B CE2  2  
ATOM   5456  C  CZ   . TYR B 1 74 ? 153.042 -0.189  0.503   1.00 0.00 ? 74  TYR B CZ   2  
ATOM   5457  O  OH   . TYR B 1 74 ? 153.018 0.343   -0.771  1.00 0.00 ? 74  TYR B OH   2  
ATOM   5458  H  H    . TYR B 1 74 ? 152.543 -2.404  6.859   1.00 0.00 ? 74  TYR B H    2  
ATOM   5459  H  HA   . TYR B 1 74 ? 152.779 0.011   5.434   1.00 0.00 ? 74  TYR B HA   2  
ATOM   5460  H  HB2  . TYR B 1 74 ? 154.073 -1.930  4.839   1.00 0.00 ? 74  TYR B HB2  2  
ATOM   5461  H  HB3  . TYR B 1 74 ? 152.606 -2.828  4.439   1.00 0.00 ? 74  TYR B HB3  2  
ATOM   5462  H  HD1  . TYR B 1 74 ? 154.661 0.136   3.479   1.00 0.00 ? 74  TYR B HD1  2  
ATOM   5463  H  HD2  . TYR B 1 74 ? 151.508 -2.554  2.399   1.00 0.00 ? 74  TYR B HD2  2  
ATOM   5464  H  HE1  . TYR B 1 74 ? 154.632 1.095   1.190   1.00 0.00 ? 74  TYR B HE1  2  
ATOM   5465  H  HE2  . TYR B 1 74 ? 151.457 -1.599  0.123   1.00 0.00 ? 74  TYR B HE2  2  
ATOM   5466  H  HH   . TYR B 1 74 ? 152.186 0.095   -1.180  1.00 0.00 ? 74  TYR B HH   2  
ATOM   5467  N  N    . VAL B 1 75 ? 149.938 -1.562  4.928   1.00 0.00 ? 75  VAL B N    2  
ATOM   5468  C  CA   . VAL B 1 75 ? 148.634 -1.408  4.296   1.00 0.00 ? 75  VAL B CA   2  
ATOM   5469  C  C    . VAL B 1 75 ? 147.957 -0.105  4.693   1.00 0.00 ? 75  VAL B C    2  
ATOM   5470  O  O    . VAL B 1 75 ? 147.345 0.550   3.860   1.00 0.00 ? 75  VAL B O    2  
ATOM   5471  C  CB   . VAL B 1 75 ? 147.722 -2.586  4.642   1.00 0.00 ? 75  VAL B CB   2  
ATOM   5472  C  CG1  . VAL B 1 75 ? 146.326 -2.315  4.084   1.00 0.00 ? 75  VAL B CG1  2  
ATOM   5473  C  CG2  . VAL B 1 75 ? 148.285 -3.888  4.040   1.00 0.00 ? 75  VAL B CG2  2  
ATOM   5474  H  H    . VAL B 1 75 ? 150.132 -2.363  5.459   1.00 0.00 ? 75  VAL B H    2  
ATOM   5475  H  HA   . VAL B 1 75 ? 148.778 -1.398  3.226   1.00 0.00 ? 75  VAL B HA   2  
ATOM   5476  H  HB   . VAL B 1 75 ? 147.653 -2.681  5.713   1.00 0.00 ? 75  VAL B HB   2  
ATOM   5477  H  HG11 . VAL B 1 75 ? 146.402 -1.750  3.167   1.00 0.00 ? 75  VAL B HG11 2  
ATOM   5478  H  HG12 . VAL B 1 75 ? 145.765 -1.753  4.808   1.00 0.00 ? 75  VAL B HG12 2  
ATOM   5479  H  HG13 . VAL B 1 75 ? 145.829 -3.254  3.889   1.00 0.00 ? 75  VAL B HG13 2  
ATOM   5480  H  HG21 . VAL B 1 75 ? 148.761 -4.466  4.818   1.00 0.00 ? 75  VAL B HG21 2  
ATOM   5481  H  HG22 . VAL B 1 75 ? 149.009 -3.657  3.271   1.00 0.00 ? 75  VAL B HG22 2  
ATOM   5482  H  HG23 . VAL B 1 75 ? 147.481 -4.465  3.609   1.00 0.00 ? 75  VAL B HG23 2  
ATOM   5483  N  N    . VAL B 1 76 ? 148.047 0.285   5.951   1.00 0.00 ? 76  VAL B N    2  
ATOM   5484  C  CA   . VAL B 1 76 ? 147.408 1.527   6.349   1.00 0.00 ? 76  VAL B CA   2  
ATOM   5485  C  C    . VAL B 1 76 ? 147.993 2.706   5.567   1.00 0.00 ? 76  VAL B C    2  
ATOM   5486  O  O    . VAL B 1 76 ? 147.258 3.574   5.098   1.00 0.00 ? 76  VAL B O    2  
ATOM   5487  C  CB   . VAL B 1 76 ? 147.604 1.759   7.848   1.00 0.00 ? 76  VAL B CB   2  
ATOM   5488  C  CG1  . VAL B 1 76 ? 147.102 3.155   8.219   1.00 0.00 ? 76  VAL B CG1  2  
ATOM   5489  C  CG2  . VAL B 1 76 ? 146.814 0.710   8.632   1.00 0.00 ? 76  VAL B CG2  2  
ATOM   5490  H  H    . VAL B 1 76 ? 148.532 -0.256  6.608   1.00 0.00 ? 76  VAL B H    2  
ATOM   5491  H  HA   . VAL B 1 76 ? 146.350 1.459   6.143   1.00 0.00 ? 76  VAL B HA   2  
ATOM   5492  H  HB   . VAL B 1 76 ? 148.654 1.678   8.089   1.00 0.00 ? 76  VAL B HB   2  
ATOM   5493  H  HG11 . VAL B 1 76 ? 146.203 3.374   7.663   1.00 0.00 ? 76  VAL B HG11 2  
ATOM   5494  H  HG12 . VAL B 1 76 ? 147.860 3.886   7.979   1.00 0.00 ? 76  VAL B HG12 2  
ATOM   5495  H  HG13 . VAL B 1 76 ? 146.889 3.191   9.277   1.00 0.00 ? 76  VAL B HG13 2  
ATOM   5496  H  HG21 . VAL B 1 76 ? 146.973 0.857   9.690   1.00 0.00 ? 76  VAL B HG21 2  
ATOM   5497  H  HG22 . VAL B 1 76 ? 147.150 -0.278  8.352   1.00 0.00 ? 76  VAL B HG22 2  
ATOM   5498  H  HG23 . VAL B 1 76 ? 145.762 0.809   8.409   1.00 0.00 ? 76  VAL B HG23 2  
ATOM   5499  N  N    . LEU B 1 77 ? 149.320 2.735   5.435   1.00 0.00 ? 77  LEU B N    2  
ATOM   5500  C  CA   . LEU B 1 77 ? 149.986 3.822   4.713   1.00 0.00 ? 77  LEU B CA   2  
ATOM   5501  C  C    . LEU B 1 77 ? 149.657 3.835   3.218   1.00 0.00 ? 77  LEU B C    2  
ATOM   5502  O  O    . LEU B 1 77 ? 149.485 4.904   2.632   1.00 0.00 ? 77  LEU B O    2  
ATOM   5503  C  CB   . LEU B 1 77 ? 151.500 3.699   4.874   1.00 0.00 ? 77  LEU B CB   2  
ATOM   5504  C  CG   . LEU B 1 77 ? 152.197 4.921   4.251   1.00 0.00 ? 77  LEU B CG   2  
ATOM   5505  C  CD1  . LEU B 1 77 ? 151.953 6.158   5.119   1.00 0.00 ? 77  LEU B CD1  2  
ATOM   5506  C  CD2  . LEU B 1 77 ? 153.703 4.660   4.160   1.00 0.00 ? 77  LEU B CD2  2  
ATOM   5507  H  H    . LEU B 1 77 ? 149.860 2.020   5.833   1.00 0.00 ? 77  LEU B H    2  
ATOM   5508  H  HA   . LEU B 1 77 ? 149.674 4.761   5.142   1.00 0.00 ? 77  LEU B HA   2  
ATOM   5509  H  HB2  . LEU B 1 77 ? 151.748 3.632   5.923   1.00 0.00 ? 77  LEU B HB2  2  
ATOM   5510  H  HB3  . LEU B 1 77 ? 151.833 2.806   4.366   1.00 0.00 ? 77  LEU B HB3  2  
ATOM   5511  H  HG   . LEU B 1 77 ? 151.806 5.098   3.261   1.00 0.00 ? 77  LEU B HG   2  
ATOM   5512  H  HD11 . LEU B 1 77 ? 152.737 6.880   4.945   1.00 0.00 ? 77  LEU B HD11 2  
ATOM   5513  H  HD12 . LEU B 1 77 ? 151.950 5.876   6.162   1.00 0.00 ? 77  LEU B HD12 2  
ATOM   5514  H  HD13 . LEU B 1 77 ? 151.000 6.596   4.863   1.00 0.00 ? 77  LEU B HD13 2  
ATOM   5515  H  HD21 . LEU B 1 77 ? 154.169 5.444   3.582   1.00 0.00 ? 77  LEU B HD21 2  
ATOM   5516  H  HD22 . LEU B 1 77 ? 153.876 3.709   3.678   1.00 0.00 ? 77  LEU B HD22 2  
ATOM   5517  H  HD23 . LEU B 1 77 ? 154.128 4.644   5.152   1.00 0.00 ? 77  LEU B HD23 2  
ATOM   5518  N  N    . VAL B 1 78 ? 149.609 2.658   2.588   1.00 0.00 ? 78  VAL B N    2  
ATOM   5519  C  CA   . VAL B 1 78 ? 149.346 2.611   1.146   1.00 0.00 ? 78  VAL B CA   2  
ATOM   5520  C  C    . VAL B 1 78 ? 147.998 3.257   0.821   1.00 0.00 ? 78  VAL B C    2  
ATOM   5521  O  O    . VAL B 1 78 ? 147.821 3.859   -0.246  1.00 0.00 ? 78  VAL B O    2  
ATOM   5522  C  CB   . VAL B 1 78 ? 149.391 1.167   0.618   1.00 0.00 ? 78  VAL B CB   2  
ATOM   5523  C  CG1  . VAL B 1 78 ? 148.069 0.436   0.893   1.00 0.00 ? 78  VAL B CG1  2  
ATOM   5524  C  CG2  . VAL B 1 78 ? 149.660 1.193   -0.891  1.00 0.00 ? 78  VAL B CG2  2  
ATOM   5525  H  H    . VAL B 1 78 ? 149.787 1.824   3.086   1.00 0.00 ? 78  VAL B H    2  
ATOM   5526  H  HA   . VAL B 1 78 ? 150.125 3.174   0.645   1.00 0.00 ? 78  VAL B HA   2  
ATOM   5527  H  HB   . VAL B 1 78 ? 150.193 0.637   1.110   1.00 0.00 ? 78  VAL B HB   2  
ATOM   5528  H  HG11 . VAL B 1 78 ? 147.438 0.476   0.017   1.00 0.00 ? 78  VAL B HG11 2  
ATOM   5529  H  HG12 . VAL B 1 78 ? 147.563 0.902   1.713   1.00 0.00 ? 78  VAL B HG12 2  
ATOM   5530  H  HG13 . VAL B 1 78 ? 148.273 -0.597  1.138   1.00 0.00 ? 78  VAL B HG13 2  
ATOM   5531  H  HG21 . VAL B 1 78 ? 149.750 0.181   -1.259  1.00 0.00 ? 78  VAL B HG21 2  
ATOM   5532  H  HG22 . VAL B 1 78 ? 150.578 1.729   -1.083  1.00 0.00 ? 78  VAL B HG22 2  
ATOM   5533  H  HG23 . VAL B 1 78 ? 148.842 1.687   -1.395  1.00 0.00 ? 78  VAL B HG23 2  
ATOM   5534  N  N    . ALA B 1 79 ? 147.047 3.118   1.745   1.00 0.00 ? 79  ALA B N    2  
ATOM   5535  C  CA   . ALA B 1 79 ? 145.711 3.666   1.553   1.00 0.00 ? 79  ALA B CA   2  
ATOM   5536  C  C    . ALA B 1 79 ? 145.760 5.181   1.361   1.00 0.00 ? 79  ALA B C    2  
ATOM   5537  O  O    . ALA B 1 79 ? 145.065 5.729   0.508   1.00 0.00 ? 79  ALA B O    2  
ATOM   5538  C  CB   . ALA B 1 79 ? 144.853 3.318   2.783   1.00 0.00 ? 79  ALA B CB   2  
ATOM   5539  H  H    . ALA B 1 79 ? 147.247 2.623   2.568   1.00 0.00 ? 79  ALA B H    2  
ATOM   5540  H  HA   . ALA B 1 79 ? 145.260 3.218   0.684   1.00 0.00 ? 79  ALA B HA   2  
ATOM   5541  H  HB1  . ALA B 1 79 ? 144.672 4.206   3.372   1.00 0.00 ? 79  ALA B HB1  2  
ATOM   5542  H  HB2  . ALA B 1 79 ? 145.374 2.590   3.386   1.00 0.00 ? 79  ALA B HB2  2  
ATOM   5543  H  HB3  . ALA B 1 79 ? 143.909 2.903   2.459   1.00 0.00 ? 79  ALA B HB3  2  
ATOM   5544  N  N    . ALA B 1 80 ? 146.582 5.859   2.140   1.00 0.00 ? 80  ALA B N    2  
ATOM   5545  C  CA   . ALA B 1 80 ? 146.688 7.300   1.996   1.00 0.00 ? 80  ALA B CA   2  
ATOM   5546  C  C    . ALA B 1 80 ? 147.361 7.668   0.673   1.00 0.00 ? 80  ALA B C    2  
ATOM   5547  O  O    . ALA B 1 80 ? 146.970 8.630   0.012   1.00 0.00 ? 80  ALA B O    2  
ATOM   5548  C  CB   . ALA B 1 80 ? 147.472 7.883   3.170   1.00 0.00 ? 80  ALA B CB   2  
ATOM   5549  H  H    . ALA B 1 80 ? 147.127 5.390   2.806   1.00 0.00 ? 80  ALA B H    2  
ATOM   5550  H  HA   . ALA B 1 80 ? 145.693 7.721   2.006   1.00 0.00 ? 80  ALA B HA   2  
ATOM   5551  H  HB1  . ALA B 1 80 ? 147.716 8.913   2.964   1.00 0.00 ? 80  ALA B HB1  2  
ATOM   5552  H  HB2  . ALA B 1 80 ? 148.380 7.317   3.313   1.00 0.00 ? 80  ALA B HB2  2  
ATOM   5553  H  HB3  . ALA B 1 80 ? 146.867 7.827   4.065   1.00 0.00 ? 80  ALA B HB3  2  
ATOM   5554  N  N    . LEU B 1 81 ? 148.391 6.903   0.306   1.00 0.00 ? 81  LEU B N    2  
ATOM   5555  C  CA   . LEU B 1 81 ? 149.135 7.163   -0.928  1.00 0.00 ? 81  LEU B CA   2  
ATOM   5556  C  C    . LEU B 1 81 ? 148.283 6.988   -2.189  1.00 0.00 ? 81  LEU B C    2  
ATOM   5557  O  O    . LEU B 1 81 ? 148.421 7.757   -3.147  1.00 0.00 ? 81  LEU B O    2  
ATOM   5558  C  CB   . LEU B 1 81 ? 150.340 6.219   -1.001  1.00 0.00 ? 81  LEU B CB   2  
ATOM   5559  C  CG   . LEU B 1 81 ? 151.238 6.414   0.225   1.00 0.00 ? 81  LEU B CG   2  
ATOM   5560  C  CD1  . LEU B 1 81 ? 152.485 5.539   0.082   1.00 0.00 ? 81  LEU B CD1  2  
ATOM   5561  C  CD2  . LEU B 1 81 ? 151.664 7.883   0.331   1.00 0.00 ? 81  LEU B CD2  2  
ATOM   5562  H  H    . LEU B 1 81 ? 148.664 6.160   0.883   1.00 0.00 ? 81  LEU B H    2  
ATOM   5563  H  HA   . LEU B 1 81 ? 149.497 8.177   -0.903  1.00 0.00 ? 81  LEU B HA   2  
ATOM   5564  H  HB2  . LEU B 1 81 ? 149.992 5.197   -1.031  1.00 0.00 ? 81  LEU B HB2  2  
ATOM   5565  H  HB3  . LEU B 1 81 ? 150.906 6.430   -1.894  1.00 0.00 ? 81  LEU B HB3  2  
ATOM   5566  H  HG   . LEU B 1 81 ? 150.698 6.128   1.116   1.00 0.00 ? 81  LEU B HG   2  
ATOM   5567  H  HD11 . LEU B 1 81 ? 152.190 4.503   0.005   1.00 0.00 ? 81  LEU B HD11 2  
ATOM   5568  H  HD12 . LEU B 1 81 ? 153.117 5.669   0.947   1.00 0.00 ? 81  LEU B HD12 2  
ATOM   5569  H  HD13 . LEU B 1 81 ? 153.027 5.827   -0.806  1.00 0.00 ? 81  LEU B HD13 2  
ATOM   5570  H  HD21 . LEU B 1 81 ? 152.606 7.950   0.857   1.00 0.00 ? 81  LEU B HD21 2  
ATOM   5571  H  HD22 . LEU B 1 81 ? 150.911 8.438   0.871   1.00 0.00 ? 81  LEU B HD22 2  
ATOM   5572  H  HD23 . LEU B 1 81 ? 151.775 8.298   -0.660  1.00 0.00 ? 81  LEU B HD23 2  
ATOM   5573  N  N    . THR B 1 82 ? 147.412 5.979   -2.209  1.00 0.00 ? 82  THR B N    2  
ATOM   5574  C  CA   . THR B 1 82 ? 146.590 5.763   -3.400  1.00 0.00 ? 82  THR B CA   2  
ATOM   5575  C  C    . THR B 1 82 ? 145.725 6.980   -3.687  1.00 0.00 ? 82  THR B C    2  
ATOM   5576  O  O    . THR B 1 82 ? 145.582 7.390   -4.839  1.00 0.00 ? 82  THR B O    2  
ATOM   5577  C  CB   . THR B 1 82 ? 145.703 4.528   -3.242  1.00 0.00 ? 82  THR B CB   2  
ATOM   5578  O  OG1  . THR B 1 82 ? 144.700 4.534   -4.249  1.00 0.00 ? 82  THR B OG1  2  
ATOM   5579  C  CG2  . THR B 1 82 ? 145.047 4.542   -1.871  1.00 0.00 ? 82  THR B CG2  2  
ATOM   5580  H  H    . THR B 1 82 ? 147.334 5.373   -1.431  1.00 0.00 ? 82  THR B H    2  
ATOM   5581  H  HA   . THR B 1 82 ? 147.247 5.607   -4.242  1.00 0.00 ? 82  THR B HA   2  
ATOM   5582  H  HB   . THR B 1 82 ? 146.304 3.638   -3.338  1.00 0.00 ? 82  THR B HB   2  
ATOM   5583  H  HG1  . THR B 1 82 ? 144.162 5.320   -4.126  1.00 0.00 ? 82  THR B HG1  2  
ATOM   5584  H  HG21 . THR B 1 82 ? 144.554 5.489   -1.716  1.00 0.00 ? 82  THR B HG21 2  
ATOM   5585  H  HG22 . THR B 1 82 ? 145.805 4.402   -1.124  1.00 0.00 ? 82  THR B HG22 2  
ATOM   5586  H  HG23 . THR B 1 82 ? 144.324 3.742   -1.807  1.00 0.00 ? 82  THR B HG23 2  
ATOM   5587  N  N    . VAL B 1 83 ? 145.156 7.563   -2.640  1.00 0.00 ? 83  VAL B N    2  
ATOM   5588  C  CA   . VAL B 1 83 ? 144.317 8.738   -2.817  1.00 0.00 ? 83  VAL B CA   2  
ATOM   5589  C  C    . VAL B 1 83 ? 145.150 9.868   -3.410  1.00 0.00 ? 83  VAL B C    2  
ATOM   5590  O  O    . VAL B 1 83 ? 144.695 10.590  -4.299  1.00 0.00 ? 83  VAL B O    2  
ATOM   5591  C  CB   . VAL B 1 83 ? 143.728 9.170   -1.464  1.00 0.00 ? 83  VAL B CB   2  
ATOM   5592  C  CG1  . VAL B 1 83 ? 142.874 10.448  -1.626  1.00 0.00 ? 83  VAL B CG1  2  
ATOM   5593  C  CG2  . VAL B 1 83 ? 142.875 8.024   -0.888  1.00 0.00 ? 83  VAL B CG2  2  
ATOM   5594  H  H    . VAL B 1 83 ? 145.304 7.203   -1.740  1.00 0.00 ? 83  VAL B H    2  
ATOM   5595  H  HA   . VAL B 1 83 ? 143.509 8.498   -3.493  1.00 0.00 ? 83  VAL B HA   2  
ATOM   5596  H  HB   . VAL B 1 83 ? 144.542 9.377   -0.785  1.00 0.00 ? 83  VAL B HB   2  
ATOM   5597  H  HG11 . VAL B 1 83 ? 143.008 10.864  -2.613  1.00 0.00 ? 83  VAL B HG11 2  
ATOM   5598  H  HG12 . VAL B 1 83 ? 143.174 11.178  -0.888  1.00 0.00 ? 83  VAL B HG12 2  
ATOM   5599  H  HG13 . VAL B 1 83 ? 141.828 10.207  -1.482  1.00 0.00 ? 83  VAL B HG13 2  
ATOM   5600  H  HG21 . VAL B 1 83 ? 142.553 7.374   -1.685  1.00 0.00 ? 83  VAL B HG21 2  
ATOM   5601  H  HG22 . VAL B 1 83 ? 142.010 8.432   -0.386  1.00 0.00 ? 83  VAL B HG22 2  
ATOM   5602  H  HG23 . VAL B 1 83 ? 143.464 7.458   -0.181  1.00 0.00 ? 83  VAL B HG23 2  
ATOM   5603  N  N    . ALA B 1 84 ? 146.378 10.009  -2.918  1.00 0.00 ? 84  ALA B N    2  
ATOM   5604  C  CA   . ALA B 1 84 ? 147.271 11.047  -3.414  1.00 0.00 ? 84  ALA B CA   2  
ATOM   5605  C  C    . ALA B 1 84 ? 147.599 10.812  -4.885  1.00 0.00 ? 84  ALA B C    2  
ATOM   5606  O  O    . ALA B 1 84 ? 147.730 11.760  -5.660  1.00 0.00 ? 84  ALA B O    2  
ATOM   5607  C  CB   . ALA B 1 84 ? 148.561 11.060  -2.593  1.00 0.00 ? 84  ALA B CB   2  
ATOM   5608  H  H    . ALA B 1 84 ? 146.689 9.399   -2.216  1.00 0.00 ? 84  ALA B H    2  
ATOM   5609  H  HA   . ALA B 1 84 ? 146.784 12.005  -3.312  1.00 0.00 ? 84  ALA B HA   2  
ATOM   5610  H  HB1  . ALA B 1 84 ? 148.368 11.498  -1.625  1.00 0.00 ? 84  ALA B HB1  2  
ATOM   5611  H  HB2  . ALA B 1 84 ? 149.310 11.643  -3.109  1.00 0.00 ? 84  ALA B HB2  2  
ATOM   5612  H  HB3  . ALA B 1 84 ? 148.918 10.049  -2.464  1.00 0.00 ? 84  ALA B HB3  2  
ATOM   5613  N  N    . CYS B 1 85 ? 147.726 9.541   -5.266  1.00 0.00 ? 85  CYS B N    2  
ATOM   5614  C  CA   . CYS B 1 85 ? 148.037 9.204   -6.654  1.00 0.00 ? 85  CYS B CA   2  
ATOM   5615  C  C    . CYS B 1 85 ? 146.951 9.714   -7.599  1.00 0.00 ? 85  CYS B C    2  
ATOM   5616  O  O    . CYS B 1 85 ? 147.234 10.099  -8.732  1.00 0.00 ? 85  CYS B O    2  
ATOM   5617  C  CB   . CYS B 1 85 ? 148.218 7.689   -6.805  1.00 0.00 ? 85  CYS B CB   2  
ATOM   5618  S  SG   . CYS B 1 85 ? 146.641 6.911   -7.249  1.00 0.00 ? 85  CYS B SG   2  
ATOM   5619  H  H    . CYS B 1 85 ? 147.615 8.821   -4.603  1.00 0.00 ? 85  CYS B H    2  
ATOM   5620  H  HA   . CYS B 1 85 ? 148.962 9.682   -6.923  1.00 0.00 ? 85  CYS B HA   2  
ATOM   5621  H  HB2  . CYS B 1 85 ? 148.948 7.493   -7.580  1.00 0.00 ? 85  CYS B HB2  2  
ATOM   5622  H  HB3  . CYS B 1 85 ? 148.572 7.277   -5.871  1.00 0.00 ? 85  CYS B HB3  2  
ATOM   5623  H  HG   . CYS B 1 85 ? 146.013 7.608   -7.450  1.00 0.00 ? 85  CYS B HG   2  
ATOM   5624  N  N    . ASN B 1 86 ? 145.708 9.717   -7.128  1.00 0.00 ? 86  ASN B N    2  
ATOM   5625  C  CA   . ASN B 1 86 ? 144.596 10.185  -7.948  1.00 0.00 ? 86  ASN B CA   2  
ATOM   5626  C  C    . ASN B 1 86 ? 144.863 11.598  -8.461  1.00 0.00 ? 86  ASN B C    2  
ATOM   5627  O  O    . ASN B 1 86 ? 144.525 11.940  -9.603  1.00 0.00 ? 86  ASN B O    2  
ATOM   5628  C  CB   . ASN B 1 86 ? 143.305 10.170  -7.128  1.00 0.00 ? 86  ASN B CB   2  
ATOM   5629  C  CG   . ASN B 1 86 ? 142.112 10.478  -8.026  1.00 0.00 ? 86  ASN B CG   2  
ATOM   5630  O  OD1  . ASN B 1 86 ? 141.560 11.576  -7.970  1.00 0.00 ? 86  ASN B OD1  2  
ATOM   5631  N  ND2  . ASN B 1 86 ? 141.682 9.570   -8.859  1.00 0.00 ? 86  ASN B ND2  2  
ATOM   5632  H  H    . ASN B 1 86 ? 145.537 9.401   -6.216  1.00 0.00 ? 86  ASN B H    2  
ATOM   5633  H  HA   . ASN B 1 86 ? 144.480 9.522   -8.792  1.00 0.00 ? 86  ASN B HA   2  
ATOM   5634  H  HB2  . ASN B 1 86 ? 143.175 9.194   -6.682  1.00 0.00 ? 86  ASN B HB2  2  
ATOM   5635  H  HB3  . ASN B 1 86 ? 143.366 10.915  -6.349  1.00 0.00 ? 86  ASN B HB3  2  
ATOM   5636  H  HD21 . ASN B 1 86 ? 142.125 8.697   -8.905  1.00 0.00 ? 86  ASN B HD21 2  
ATOM   5637  H  HD22 . ASN B 1 86 ? 140.916 9.761   -9.440  1.00 0.00 ? 86  ASN B HD22 2  
ATOM   5638  N  N    . ASN B 1 87 ? 145.484 12.421  -7.621  1.00 0.00 ? 87  ASN B N    2  
ATOM   5639  C  CA   . ASN B 1 87 ? 145.781 13.784  -8.026  1.00 0.00 ? 87  ASN B CA   2  
ATOM   5640  C  C    . ASN B 1 87 ? 146.533 13.755  -9.344  1.00 0.00 ? 87  ASN B C    2  
ATOM   5641  O  O    . ASN B 1 87 ? 146.287 14.576  -10.226 1.00 0.00 ? 87  ASN B O    2  
ATOM   5642  C  CB   . ASN B 1 87 ? 146.631 14.479  -6.960  1.00 0.00 ? 87  ASN B CB   2  
ATOM   5643  C  CG   . ASN B 1 87 ? 146.686 15.978  -7.233  1.00 0.00 ? 87  ASN B CG   2  
ATOM   5644  O  OD1  . ASN B 1 87 ? 145.959 16.481  -8.089  1.00 0.00 ? 87  ASN B OD1  2  
ATOM   5645  N  ND2  . ASN B 1 87 ? 147.512 16.725  -6.553  1.00 0.00 ? 87  ASN B ND2  2  
ATOM   5646  H  H    . ASN B 1 87 ? 145.743 12.108  -6.729  1.00 0.00 ? 87  ASN B H    2  
ATOM   5647  H  HA   . ASN B 1 87 ? 144.858 14.328  -8.154  1.00 0.00 ? 87  ASN B HA   2  
ATOM   5648  H  HB2  . ASN B 1 87 ? 146.194 14.307  -5.987  1.00 0.00 ? 87  ASN B HB2  2  
ATOM   5649  H  HB3  . ASN B 1 87 ? 147.632 14.075  -6.981  1.00 0.00 ? 87  ASN B HB3  2  
ATOM   5650  H  HD21 . ASN B 1 87 ? 148.090 16.323  -5.872  1.00 0.00 ? 87  ASN B HD21 2  
ATOM   5651  H  HD22 . ASN B 1 87 ? 147.553 17.690  -6.723  1.00 0.00 ? 87  ASN B HD22 2  
ATOM   5652  N  N    . PHE B 1 88 ? 147.423 12.779  -9.488  1.00 0.00 ? 88  PHE B N    2  
ATOM   5653  C  CA   . PHE B 1 88 ? 148.169 12.634  -10.725 1.00 0.00 ? 88  PHE B CA   2  
ATOM   5654  C  C    . PHE B 1 88 ? 147.196 12.429  -11.879 1.00 0.00 ? 88  PHE B C    2  
ATOM   5655  O  O    . PHE B 1 88 ? 147.356 13.009  -12.953 1.00 0.00 ? 88  PHE B O    2  
ATOM   5656  C  CB   . PHE B 1 88 ? 149.124 11.443  -10.634 1.00 0.00 ? 88  PHE B CB   2  
ATOM   5657  C  CG   . PHE B 1 88 ? 149.982 11.391  -11.876 1.00 0.00 ? 88  PHE B CG   2  
ATOM   5658  C  CD1  . PHE B 1 88 ? 151.153 12.156  -11.950 1.00 0.00 ? 88  PHE B CD1  2  
ATOM   5659  C  CD2  . PHE B 1 88 ? 149.608 10.580  -12.953 1.00 0.00 ? 88  PHE B CD2  2  
ATOM   5660  C  CE1  . PHE B 1 88 ? 151.948 12.108  -13.101 1.00 0.00 ? 88  PHE B CE1  2  
ATOM   5661  C  CE2  . PHE B 1 88 ? 150.403 10.532  -14.104 1.00 0.00 ? 88  PHE B CE2  2  
ATOM   5662  C  CZ   . PHE B 1 88 ? 151.574 11.296  -14.178 1.00 0.00 ? 88  PHE B CZ   2  
ATOM   5663  H  H    . PHE B 1 88 ? 147.557 12.135  -8.761  1.00 0.00 ? 88  PHE B H    2  
ATOM   5664  H  HA   . PHE B 1 88 ? 148.741 13.534  -10.900 1.00 0.00 ? 88  PHE B HA   2  
ATOM   5665  H  HB2  . PHE B 1 88 ? 149.754 11.553  -9.764  1.00 0.00 ? 88  PHE B HB2  2  
ATOM   5666  H  HB3  . PHE B 1 88 ? 148.554 10.530  -10.555 1.00 0.00 ? 88  PHE B HB3  2  
ATOM   5667  H  HD1  . PHE B 1 88 ? 151.442 12.783  -11.118 1.00 0.00 ? 88  PHE B HD1  2  
ATOM   5668  H  HD2  . PHE B 1 88 ? 148.704 9.989   -12.896 1.00 0.00 ? 88  PHE B HD2  2  
ATOM   5669  H  HE1  . PHE B 1 88 ? 152.851 12.698  -13.157 1.00 0.00 ? 88  PHE B HE1  2  
ATOM   5670  H  HE2  . PHE B 1 88 ? 150.114 9.905   -14.935 1.00 0.00 ? 88  PHE B HE2  2  
ATOM   5671  H  HZ   . PHE B 1 88 ? 152.188 11.260  -15.065 1.00 0.00 ? 88  PHE B HZ   2  
ATOM   5672  N  N    . PHE B 1 89 ? 146.179 11.599  -11.645 1.00 0.00 ? 89  PHE B N    2  
ATOM   5673  C  CA   . PHE B 1 89 ? 145.179 11.330  -12.670 1.00 0.00 ? 89  PHE B CA   2  
ATOM   5674  C  C    . PHE B 1 89 ? 144.517 12.630  -13.091 1.00 0.00 ? 89  PHE B C    2  
ATOM   5675  O  O    . PHE B 1 89 ? 144.333 12.897  -14.278 1.00 0.00 ? 89  PHE B O    2  
ATOM   5676  C  CB   . PHE B 1 89 ? 144.108 10.384  -12.124 1.00 0.00 ? 89  PHE B CB   2  
ATOM   5677  C  CG   . PHE B 1 89 ? 143.176 9.982   -13.241 1.00 0.00 ? 89  PHE B CG   2  
ATOM   5678  C  CD1  . PHE B 1 89 ? 143.507 8.909   -14.078 1.00 0.00 ? 89  PHE B CD1  2  
ATOM   5679  C  CD2  . PHE B 1 89 ? 141.979 10.682  -13.442 1.00 0.00 ? 89  PHE B CD2  2  
ATOM   5680  C  CE1  . PHE B 1 89 ? 142.643 8.537   -15.115 1.00 0.00 ? 89  PHE B CE1  2  
ATOM   5681  C  CE2  . PHE B 1 89 ? 141.115 10.309  -14.478 1.00 0.00 ? 89  PHE B CE2  2  
ATOM   5682  C  CZ   . PHE B 1 89 ? 141.447 9.236   -15.315 1.00 0.00 ? 89  PHE B CZ   2  
ATOM   5683  H  H    . PHE B 1 89 ? 146.100 11.168  -10.768 1.00 0.00 ? 89  PHE B H    2  
ATOM   5684  H  HA   . PHE B 1 89 ? 145.654 10.874  -13.525 1.00 0.00 ? 89  PHE B HA   2  
ATOM   5685  H  HB2  . PHE B 1 89 ? 144.575 9.511   -11.703 1.00 0.00 ? 89  PHE B HB2  2  
ATOM   5686  H  HB3  . PHE B 1 89 ? 143.542 10.890  -11.358 1.00 0.00 ? 89  PHE B HB3  2  
ATOM   5687  H  HD1  . PHE B 1 89 ? 144.430 8.369   -13.923 1.00 0.00 ? 89  PHE B HD1  2  
ATOM   5688  H  HD2  . PHE B 1 89 ? 141.724 11.510  -12.797 1.00 0.00 ? 89  PHE B HD2  2  
ATOM   5689  H  HE1  . PHE B 1 89 ? 142.899 7.709   -15.759 1.00 0.00 ? 89  PHE B HE1  2  
ATOM   5690  H  HE2  . PHE B 1 89 ? 140.193 10.849  -14.633 1.00 0.00 ? 89  PHE B HE2  2  
ATOM   5691  H  HZ   . PHE B 1 89 ? 140.780 8.949   -16.114 1.00 0.00 ? 89  PHE B HZ   2  
ATOM   5692  N  N    . TRP B 1 90 ? 144.169 13.440  -12.096 1.00 0.00 ? 90  TRP B N    2  
ATOM   5693  C  CA   . TRP B 1 90 ? 143.530 14.727  -12.362 1.00 0.00 ? 90  TRP B CA   2  
ATOM   5694  C  C    . TRP B 1 90 ? 144.401 15.618  -13.247 1.00 0.00 ? 90  TRP B C    2  
ATOM   5695  O  O    . TRP B 1 90 ? 143.885 16.383  -14.061 1.00 0.00 ? 90  TRP B O    2  
ATOM   5696  C  CB   . TRP B 1 90 ? 143.203 15.432  -11.045 1.00 0.00 ? 90  TRP B CB   2  
ATOM   5697  C  CG   . TRP B 1 90 ? 142.012 14.772  -10.424 1.00 0.00 ? 90  TRP B CG   2  
ATOM   5698  C  CD1  . TRP B 1 90 ? 142.055 13.829  -9.456  1.00 0.00 ? 90  TRP B CD1  2  
ATOM   5699  C  CD2  . TRP B 1 90 ? 140.601 14.999  -10.711 1.00 0.00 ? 90  TRP B CD2  2  
ATOM   5700  N  NE1  . TRP B 1 90 ? 140.760 13.459  -9.135  1.00 0.00 ? 90  TRP B NE1  2  
ATOM   5701  C  CE2  . TRP B 1 90 ? 139.830 14.154  -9.879  1.00 0.00 ? 90  TRP B CE2  2  
ATOM   5702  C  CE3  . TRP B 1 90 ? 139.923 15.848  -11.604 1.00 0.00 ? 90  TRP B CE3  2  
ATOM   5703  C  CZ2  . TRP B 1 90 ? 138.435 14.150  -9.932  1.00 0.00 ? 90  TRP B CZ2  2  
ATOM   5704  C  CZ3  . TRP B 1 90 ? 138.520 15.847  -11.661 1.00 0.00 ? 90  TRP B CZ3  2  
ATOM   5705  C  CH2  . TRP B 1 90 ? 137.778 15.000  -10.825 1.00 0.00 ? 90  TRP B CH2  2  
ATOM   5706  H  H    . TRP B 1 90 ? 144.347 13.165  -11.161 1.00 0.00 ? 90  TRP B H    2  
ATOM   5707  H  HA   . TRP B 1 90 ? 142.602 14.541  -12.884 1.00 0.00 ? 90  TRP B HA   2  
ATOM   5708  H  HB2  . TRP B 1 90 ? 144.048 15.358  -10.377 1.00 0.00 ? 90  TRP B HB2  2  
ATOM   5709  H  HB3  . TRP B 1 90 ? 142.981 16.470  -11.237 1.00 0.00 ? 90  TRP B HB3  2  
ATOM   5710  H  HD1  . TRP B 1 90 ? 142.949 13.423  -9.013  1.00 0.00 ? 90  TRP B HD1  2  
ATOM   5711  H  HE1  . TRP B 1 90 ? 140.514 12.790  -8.462  1.00 0.00 ? 90  TRP B HE1  2  
ATOM   5712  H  HE3  . TRP B 1 90 ? 140.486 16.505  -12.251 1.00 0.00 ? 90  TRP B HE3  2  
ATOM   5713  H  HZ2  . TRP B 1 90 ? 137.868 13.495  -9.288  1.00 0.00 ? 90  TRP B HZ2  2  
ATOM   5714  H  HZ3  . TRP B 1 90 ? 138.010 16.503  -12.350 1.00 0.00 ? 90  TRP B HZ3  2  
ATOM   5715  H  HH2  . TRP B 1 90 ? 136.699 15.003  -10.874 1.00 0.00 ? 90  TRP B HH2  2  
ATOM   5716  N  N    . GLU B 1 91 ? 145.717 15.519  -13.088 1.00 0.00 ? 91  GLU B N    2  
ATOM   5717  C  CA   . GLU B 1 91 ? 146.631 16.331  -13.890 1.00 0.00 ? 91  GLU B CA   2  
ATOM   5718  C  C    . GLU B 1 91 ? 146.460 16.025  -15.375 1.00 0.00 ? 91  GLU B C    2  
ATOM   5719  O  O    . GLU B 1 91 ? 146.634 16.901  -16.222 1.00 0.00 ? 91  GLU B O    2  
ATOM   5720  C  CB   . GLU B 1 91 ? 148.082 16.071  -13.478 1.00 0.00 ? 91  GLU B CB   2  
ATOM   5721  C  CG   . GLU B 1 91 ? 148.300 16.542  -12.040 1.00 0.00 ? 91  GLU B CG   2  
ATOM   5722  C  CD   . GLU B 1 91 ? 149.759 16.347  -11.644 1.00 0.00 ? 91  GLU B CD   2  
ATOM   5723  O  OE1  . GLU B 1 91 ? 150.479 15.719  -12.402 1.00 0.00 ? 91  GLU B OE1  2  
ATOM   5724  O  OE2  . GLU B 1 91 ? 150.135 16.828  -10.587 1.00 0.00 ? 91  GLU B OE2  2  
ATOM   5725  H  H    . GLU B 1 91 ? 146.079 14.894  -12.426 1.00 0.00 ? 91  GLU B H    2  
ATOM   5726  H  HA   . GLU B 1 91 ? 146.405 17.374  -13.723 1.00 0.00 ? 91  GLU B HA   2  
ATOM   5727  H  HB2  . GLU B 1 91 ? 148.291 15.013  -13.548 1.00 0.00 ? 91  GLU B HB2  2  
ATOM   5728  H  HB3  . GLU B 1 91 ? 148.744 16.612  -14.136 1.00 0.00 ? 91  GLU B HB3  2  
ATOM   5729  H  HG2  . GLU B 1 91 ? 148.045 17.589  -11.965 1.00 0.00 ? 91  GLU B HG2  2  
ATOM   5730  H  HG3  . GLU B 1 91 ? 147.671 15.972  -11.376 1.00 0.00 ? 91  GLU B HG3  2  
ATOM   5731  N  N    . ASN B 1 92 ? 146.122 14.777  -15.685 1.00 0.00 ? 92  ASN B N    2  
ATOM   5732  C  CA   . ASN B 1 92 ? 145.935 14.372  -17.074 1.00 0.00 ? 92  ASN B CA   2  
ATOM   5733  C  C    . ASN B 1 92 ? 144.914 15.273  -17.762 1.00 0.00 ? 92  ASN B C    2  
ATOM   5734  O  O    . ASN B 1 92 ? 145.031 15.561  -18.953 1.00 0.00 ? 92  ASN B O    2  
ATOM   5735  C  CB   . ASN B 1 92 ? 145.459 12.920  -17.135 1.00 0.00 ? 92  ASN B CB   2  
ATOM   5736  C  CG   . ASN B 1 92 ? 146.509 12.001  -16.522 1.00 0.00 ? 92  ASN B CG   2  
ATOM   5737  O  OD1  . ASN B 1 92 ? 146.174 11.099  -15.753 1.00 0.00 ? 92  ASN B OD1  2  
ATOM   5738  N  ND2  . ASN B 1 92 ? 147.768 12.175  -16.817 1.00 0.00 ? 92  ASN B ND2  2  
ATOM   5739  H  H    . ASN B 1 92 ? 145.997 14.120  -14.969 1.00 0.00 ? 92  ASN B H    2  
ATOM   5740  H  HA   . ASN B 1 92 ? 146.878 14.452  -17.592 1.00 0.00 ? 92  ASN B HA   2  
ATOM   5741  H  HB2  . ASN B 1 92 ? 144.533 12.823  -16.586 1.00 0.00 ? 92  ASN B HB2  2  
ATOM   5742  H  HB3  . ASN B 1 92 ? 145.296 12.639  -18.165 1.00 0.00 ? 92  ASN B HB3  2  
ATOM   5743  H  HD21 . ASN B 1 92 ? 148.033 12.893  -17.429 1.00 0.00 ? 92  ASN B HD21 2  
ATOM   5744  H  HD22 . ASN B 1 92 ? 148.449 11.588  -16.427 1.00 0.00 ? 92  ASN B HD22 2  
ATOM   5745  N  N    . SER B 1 93 ? 143.914 15.713  -17.006 1.00 0.00 ? 93  SER B N    2  
ATOM   5746  C  CA   . SER B 1 93 ? 142.879 16.582  -17.556 1.00 0.00 ? 93  SER B CA   2  
ATOM   5747  C  C    . SER B 1 93 ? 143.397 18.010  -17.697 1.00 0.00 ? 93  SER B C    2  
ATOM   5748  O  O    . SER B 1 93 ? 144.474 18.281  -17.190 1.00 0.00 ? 93  SER B O    2  
ATOM   5749  C  CB   . SER B 1 93 ? 141.651 16.570  -16.647 1.00 0.00 ? 93  SER B CB   2  
ATOM   5750  O  OG   . SER B 1 93 ? 140.731 17.562  -17.089 1.00 0.00 ? 93  SER B OG   2  
ATOM   5751  O  OXT  . SER B 1 93 ? 142.711 18.810  -18.308 1.00 0.00 ? 93  SER B OXT  2  
ATOM   5752  H  H    . SER B 1 93 ? 143.871 15.451  -16.063 1.00 0.00 ? 93  SER B H    2  
ATOM   5753  H  HA   . SER B 1 93 ? 142.596 16.214  -18.531 1.00 0.00 ? 93  SER B HA   2  
ATOM   5754  H  HB2  . SER B 1 93 ? 141.177 15.604  -16.691 1.00 0.00 ? 93  SER B HB2  2  
ATOM   5755  H  HB3  . SER B 1 93 ? 141.955 16.775  -15.630 1.00 0.00 ? 93  SER B HB3  2  
ATOM   5756  H  HG   . SER B 1 93 ? 141.050 18.416  -16.790 1.00 0.00 ? 93  SER B HG   2  
HETATM 5757  CA CA   . CA  C 2 .  ? 128.577 9.989   -3.793  1.00 0.00 ? 201 CA  A CA   2  
HETATM 5758  CA CA   . CA  D 2 .  ? 133.486 13.263  7.761   1.00 0.00 ? 202 CA  A CA   2  
HETATM 5759  CA CA   . CA  E 2 .  ? 159.663 -10.436 3.019   1.00 0.00 ? 101 CA  B CA   2  
HETATM 5760  CA CA   . CA  F 2 .  ? 157.158 -2.802  13.203  1.00 0.00 ? 102 CA  B CA   2  
ATOM   5761  N  N    . GLY A 1 1  ? 154.541 -2.591  -15.629 1.00 0.00 ? 1   GLY A N    3  
ATOM   5762  C  CA   . GLY A 1 1  ? 153.277 -2.181  -15.029 1.00 0.00 ? 1   GLY A CA   3  
ATOM   5763  C  C    . GLY A 1 1  ? 152.776 -3.230  -14.042 1.00 0.00 ? 1   GLY A C    3  
ATOM   5764  O  O    . GLY A 1 1  ? 152.068 -4.164  -14.420 1.00 0.00 ? 1   GLY A O    3  
ATOM   5765  H  H1   . GLY A 1 1  ? 154.996 -1.999  -16.264 1.00 0.00 ? 1   GLY A H1   3  
ATOM   5766  H  HA2  . GLY A 1 1  ? 153.416 -1.243  -14.512 1.00 0.00 ? 1   GLY A HA2  3  
ATOM   5767  H  HA3  . GLY A 1 1  ? 152.540 -2.051  -15.808 1.00 0.00 ? 1   GLY A HA3  3  
ATOM   5768  N  N    . SER A 1 2  ? 153.149 -3.070  -12.777 1.00 0.00 ? 2   SER A N    3  
ATOM   5769  C  CA   . SER A 1 2  ? 152.731 -4.009  -11.743 1.00 0.00 ? 2   SER A CA   3  
ATOM   5770  C  C    . SER A 1 2  ? 151.215 -3.999  -11.592 1.00 0.00 ? 2   SER A C    3  
ATOM   5771  O  O    . SER A 1 2  ? 150.557 -3.009  -11.913 1.00 0.00 ? 2   SER A O    3  
ATOM   5772  C  CB   . SER A 1 2  ? 153.379 -3.638  -10.415 1.00 0.00 ? 2   SER A CB   3  
ATOM   5773  O  OG   . SER A 1 2  ? 154.792 -3.634  -10.566 1.00 0.00 ? 2   SER A OG   3  
ATOM   5774  H  H    . SER A 1 2  ? 153.713 -2.306  -12.534 1.00 0.00 ? 2   SER A H    3  
ATOM   5775  H  HA   . SER A 1 2  ? 153.050 -5.003  -12.021 1.00 0.00 ? 2   SER A HA   3  
ATOM   5776  H  HB2  . SER A 1 2  ? 153.053 -2.656  -10.117 1.00 0.00 ? 2   SER A HB2  3  
ATOM   5777  H  HB3  . SER A 1 2  ? 153.089 -4.356  -9.659  1.00 0.00 ? 2   SER A HB3  3  
ATOM   5778  H  HG   . SER A 1 2  ? 154.997 -3.308  -11.445 1.00 0.00 ? 2   SER A HG   3  
ATOM   5779  N  N    . GLU A 1 3  ? 150.661 -5.109  -11.114 1.00 0.00 ? 3   GLU A N    3  
ATOM   5780  C  CA   . GLU A 1 3  ? 149.217 -5.211  -10.942 1.00 0.00 ? 3   GLU A CA   3  
ATOM   5781  C  C    . GLU A 1 3  ? 148.715 -4.178  -9.932  1.00 0.00 ? 3   GLU A C    3  
ATOM   5782  O  O    . GLU A 1 3  ? 147.610 -3.654  -10.062 1.00 0.00 ? 3   GLU A O    3  
ATOM   5783  C  CB   . GLU A 1 3  ? 148.848 -6.607  -10.429 1.00 0.00 ? 3   GLU A CB   3  
ATOM   5784  C  CG   . GLU A 1 3  ? 149.273 -7.672  -11.438 1.00 0.00 ? 3   GLU A CG   3  
ATOM   5785  C  CD   . GLU A 1 3  ? 148.800 -9.045  -10.973 1.00 0.00 ? 3   GLU A CD   3  
ATOM   5786  O  OE1  . GLU A 1 3  ? 148.331 -9.140  -9.851  1.00 0.00 ? 3   GLU A OE1  3  
ATOM   5787  O  OE2  . GLU A 1 3  ? 148.913 -9.983  -11.746 1.00 0.00 ? 3   GLU A OE2  3  
ATOM   5788  H  H    . GLU A 1 3  ? 151.231 -5.872  -10.882 1.00 0.00 ? 3   GLU A H    3  
ATOM   5789  H  HA   . GLU A 1 3  ? 148.733 -5.046  -11.892 1.00 0.00 ? 3   GLU A HA   3  
ATOM   5790  H  HB2  . GLU A 1 3  ? 149.350 -6.786  -9.493  1.00 0.00 ? 3   GLU A HB2  3  
ATOM   5791  H  HB3  . GLU A 1 3  ? 147.780 -6.662  -10.280 1.00 0.00 ? 3   GLU A HB3  3  
ATOM   5792  H  HG2  . GLU A 1 3  ? 148.848 -7.448  -12.405 1.00 0.00 ? 3   GLU A HG2  3  
ATOM   5793  H  HG3  . GLU A 1 3  ? 150.352 -7.679  -11.507 1.00 0.00 ? 3   GLU A HG3  3  
ATOM   5794  N  N    . LEU A 1 4  ? 149.527 -3.915  -8.911  1.00 0.00 ? 4   LEU A N    3  
ATOM   5795  C  CA   . LEU A 1 4  ? 149.151 -2.970  -7.863  1.00 0.00 ? 4   LEU A CA   3  
ATOM   5796  C  C    . LEU A 1 4  ? 148.895 -1.569  -8.419  1.00 0.00 ? 4   LEU A C    3  
ATOM   5797  O  O    . LEU A 1 4  ? 147.939 -0.888  -8.008  1.00 0.00 ? 4   LEU A O    3  
ATOM   5798  C  CB   . LEU A 1 4  ? 150.267 -2.941  -6.810  1.00 0.00 ? 4   LEU A CB   3  
ATOM   5799  C  CG   . LEU A 1 4  ? 149.825 -2.143  -5.566  1.00 0.00 ? 4   LEU A CG   3  
ATOM   5800  C  CD1  . LEU A 1 4  ? 150.437 -2.765  -4.295  1.00 0.00 ? 4   LEU A CD1  3  
ATOM   5801  C  CD2  . LEU A 1 4  ? 150.303 -0.688  -5.691  1.00 0.00 ? 4   LEU A CD2  3  
ATOM   5802  H  H    . LEU A 1 4  ? 150.388 -4.380  -8.851  1.00 0.00 ? 4   LEU A H    3  
ATOM   5803  H  HA   . LEU A 1 4  ? 148.246 -3.323  -7.391  1.00 0.00 ? 4   LEU A HA   3  
ATOM   5804  H  HB2  . LEU A 1 4  ? 150.498 -3.956  -6.526  1.00 0.00 ? 4   LEU A HB2  3  
ATOM   5805  H  HB3  . LEU A 1 4  ? 151.146 -2.486  -7.239  1.00 0.00 ? 4   LEU A HB3  3  
ATOM   5806  H  HG   . LEU A 1 4  ? 148.747 -2.163  -5.489  1.00 0.00 ? 4   LEU A HG   3  
ATOM   5807  H  HD11 . LEU A 1 4  ? 149.716 -3.427  -3.839  1.00 0.00 ? 4   LEU A HD11 3  
ATOM   5808  H  HD12 . LEU A 1 4  ? 150.697 -1.986  -3.592  1.00 0.00 ? 4   LEU A HD12 3  
ATOM   5809  H  HD13 . LEU A 1 4  ? 151.324 -3.327  -4.545  1.00 0.00 ? 4   LEU A HD13 3  
ATOM   5810  H  HD21 . LEU A 1 4  ? 149.781 -0.200  -6.499  1.00 0.00 ? 4   LEU A HD21 3  
ATOM   5811  H  HD22 . LEU A 1 4  ? 151.366 -0.672  -5.887  1.00 0.00 ? 4   LEU A HD22 3  
ATOM   5812  H  HD23 . LEU A 1 4  ? 150.103 -0.165  -4.767  1.00 0.00 ? 4   LEU A HD23 3  
ATOM   5813  N  N    . GLU A 1 5  ? 149.721 -1.136  -9.370  1.00 0.00 ? 5   GLU A N    3  
ATOM   5814  C  CA   . GLU A 1 5  ? 149.516 0.182   -9.949  1.00 0.00 ? 5   GLU A CA   3  
ATOM   5815  C  C    . GLU A 1 5  ? 148.143 0.219   -10.594 1.00 0.00 ? 5   GLU A C    3  
ATOM   5816  O  O    . GLU A 1 5  ? 147.402 1.193   -10.465 1.00 0.00 ? 5   GLU A O    3  
ATOM   5817  C  CB   . GLU A 1 5  ? 150.593 0.475   -10.997 1.00 0.00 ? 5   GLU A CB   3  
ATOM   5818  C  CG   . GLU A 1 5  ? 150.445 1.915   -11.492 1.00 0.00 ? 5   GLU A CG   3  
ATOM   5819  C  CD   . GLU A 1 5  ? 151.449 2.187   -12.607 1.00 0.00 ? 5   GLU A CD   3  
ATOM   5820  O  OE1  . GLU A 1 5  ? 152.177 1.274   -12.958 1.00 0.00 ? 5   GLU A OE1  3  
ATOM   5821  O  OE2  . GLU A 1 5  ? 151.475 3.305   -13.093 1.00 0.00 ? 5   GLU A OE2  3  
ATOM   5822  H  H    . GLU A 1 5  ? 150.453 -1.704  -9.683  1.00 0.00 ? 5   GLU A H    3  
ATOM   5823  H  HA   . GLU A 1 5  ? 149.564 0.926   -9.169  1.00 0.00 ? 5   GLU A HA   3  
ATOM   5824  H  HB2  . GLU A 1 5  ? 151.570 0.343   -10.554 1.00 0.00 ? 5   GLU A HB2  3  
ATOM   5825  H  HB3  . GLU A 1 5  ? 150.479 -0.204  -11.828 1.00 0.00 ? 5   GLU A HB3  3  
ATOM   5826  H  HG2  . GLU A 1 5  ? 149.443 2.064   -11.867 1.00 0.00 ? 5   GLU A HG2  3  
ATOM   5827  H  HG3  . GLU A 1 5  ? 150.627 2.595   -10.674 1.00 0.00 ? 5   GLU A HG3  3  
ATOM   5828  N  N    . THR A 1 6  ? 147.796 -0.884  -11.248 1.00 0.00 ? 6   THR A N    3  
ATOM   5829  C  CA   . THR A 1 6  ? 146.491 -1.013  -11.868 1.00 0.00 ? 6   THR A CA   3  
ATOM   5830  C  C    . THR A 1 6  ? 145.415 -1.001  -10.795 1.00 0.00 ? 6   THR A C    3  
ATOM   5831  O  O    . THR A 1 6  ? 144.328 -0.452  -10.985 1.00 0.00 ? 6   THR A O    3  
ATOM   5832  C  CB   . THR A 1 6  ? 146.412 -2.316  -12.669 1.00 0.00 ? 6   THR A CB   3  
ATOM   5833  O  OG1  . THR A 1 6  ? 147.484 -2.364  -13.599 1.00 0.00 ? 6   THR A OG1  3  
ATOM   5834  C  CG2  . THR A 1 6  ? 145.080 -2.376  -13.418 1.00 0.00 ? 6   THR A CG2  3  
ATOM   5835  H  H    . THR A 1 6  ? 148.420 -1.639  -11.282 1.00 0.00 ? 6   THR A H    3  
ATOM   5836  H  HA   . THR A 1 6  ? 146.334 -0.180  -12.537 1.00 0.00 ? 6   THR A HA   3  
ATOM   5837  H  HB   . THR A 1 6  ? 146.479 -3.156  -11.996 1.00 0.00 ? 6   THR A HB   3  
ATOM   5838  H  HG1  . THR A 1 6  ? 147.624 -1.476  -13.937 1.00 0.00 ? 6   THR A HG1  3  
ATOM   5839  H  HG21 . THR A 1 6  ? 144.267 -2.367  -12.708 1.00 0.00 ? 6   THR A HG21 3  
ATOM   5840  H  HG22 . THR A 1 6  ? 145.038 -3.282  -14.003 1.00 0.00 ? 6   THR A HG22 3  
ATOM   5841  H  HG23 . THR A 1 6  ? 144.997 -1.521  -14.072 1.00 0.00 ? 6   THR A HG23 3  
ATOM   5842  N  N    . ALA A 1 7  ? 145.724 -1.643  -9.665  1.00 0.00 ? 7   ALA A N    3  
ATOM   5843  C  CA   . ALA A 1 7  ? 144.774 -1.733  -8.569  1.00 0.00 ? 7   ALA A CA   3  
ATOM   5844  C  C    . ALA A 1 7  ? 144.421 -0.357  -8.015  1.00 0.00 ? 7   ALA A C    3  
ATOM   5845  O  O    . ALA A 1 7  ? 143.247 -0.086  -7.744  1.00 0.00 ? 7   ALA A O    3  
ATOM   5846  C  CB   . ALA A 1 7  ? 145.348 -2.610  -7.451  1.00 0.00 ? 7   ALA A CB   3  
ATOM   5847  H  H    . ALA A 1 7  ? 146.599 -2.076  -9.583  1.00 0.00 ? 7   ALA A H    3  
ATOM   5848  H  HA   . ALA A 1 7  ? 143.871 -2.198  -8.934  1.00 0.00 ? 7   ALA A HA   3  
ATOM   5849  H  HB1  . ALA A 1 7  ? 144.646 -2.655  -6.632  1.00 0.00 ? 7   ALA A HB1  3  
ATOM   5850  H  HB2  . ALA A 1 7  ? 146.278 -2.188  -7.103  1.00 0.00 ? 7   ALA A HB2  3  
ATOM   5851  H  HB3  . ALA A 1 7  ? 145.524 -3.608  -7.828  1.00 0.00 ? 7   ALA A HB3  3  
ATOM   5852  N  N    . MET A 1 8  ? 145.408 0.533   -7.858  1.00 0.00 ? 8   MET A N    3  
ATOM   5853  C  CA   . MET A 1 8  ? 145.064 1.855   -7.338  1.00 0.00 ? 8   MET A CA   3  
ATOM   5854  C  C    . MET A 1 8  ? 144.026 2.468   -8.254  1.00 0.00 ? 8   MET A C    3  
ATOM   5855  O  O    . MET A 1 8  ? 143.062 3.089   -7.806  1.00 0.00 ? 8   MET A O    3  
ATOM   5856  C  CB   . MET A 1 8  ? 146.257 2.815   -7.337  1.00 0.00 ? 8   MET A CB   3  
ATOM   5857  C  CG   . MET A 1 8  ? 147.364 2.347   -6.398  1.00 0.00 ? 8   MET A CG   3  
ATOM   5858  S  SD   . MET A 1 8  ? 148.573 3.690   -6.210  1.00 0.00 ? 8   MET A SD   3  
ATOM   5859  C  CE   . MET A 1 8  ? 148.939 3.986   -7.964  1.00 0.00 ? 8   MET A CE   3  
ATOM   5860  H  H    . MET A 1 8  ? 146.340 0.300   -8.084  1.00 0.00 ? 8   MET A H    3  
ATOM   5861  H  HA   . MET A 1 8  ? 144.666 1.764   -6.339  1.00 0.00 ? 8   MET A HA   3  
ATOM   5862  H  HB2  . MET A 1 8  ? 146.650 2.875   -8.339  1.00 0.00 ? 8   MET A HB2  3  
ATOM   5863  H  HB3  . MET A 1 8  ? 145.922 3.795   -7.029  1.00 0.00 ? 8   MET A HB3  3  
ATOM   5864  H  HG2  . MET A 1 8  ? 146.942 2.099   -5.435  1.00 0.00 ? 8   MET A HG2  3  
ATOM   5865  H  HG3  . MET A 1 8  ? 147.850 1.478   -6.816  1.00 0.00 ? 8   MET A HG3  3  
ATOM   5866  H  HE1  . MET A 1 8  ? 148.127 4.543   -8.412  1.00 0.00 ? 8   MET A HE1  3  
ATOM   5867  H  HE2  . MET A 1 8  ? 149.053 3.046   -8.477  1.00 0.00 ? 8   MET A HE2  3  
ATOM   5868  H  HE3  . MET A 1 8  ? 149.855 4.559   -8.048  1.00 0.00 ? 8   MET A HE3  3  
ATOM   5869  N  N    . GLU A 1 9  ? 144.232 2.263   -9.549  1.00 0.00 ? 9   GLU A N    3  
ATOM   5870  C  CA   . GLU A 1 9  ? 143.311 2.770   -10.545 1.00 0.00 ? 9   GLU A CA   3  
ATOM   5871  C  C    . GLU A 1 9  ? 141.970 2.068   -10.451 1.00 0.00 ? 9   GLU A C    3  
ATOM   5872  O  O    . GLU A 1 9  ? 140.935 2.680   -10.668 1.00 0.00 ? 9   GLU A O    3  
ATOM   5873  C  CB   . GLU A 1 9  ? 143.908 2.598   -11.939 1.00 0.00 ? 9   GLU A CB   3  
ATOM   5874  C  CG   . GLU A 1 9  ? 145.126 3.507   -12.080 1.00 0.00 ? 9   GLU A CG   3  
ATOM   5875  C  CD   . GLU A 1 9  ? 145.703 3.394   -13.487 1.00 0.00 ? 9   GLU A CD   3  
ATOM   5876  O  OE1  . GLU A 1 9  ? 145.260 2.523   -14.219 1.00 0.00 ? 9   GLU A OE1  3  
ATOM   5877  O  OE2  . GLU A 1 9  ? 146.579 4.179   -13.812 1.00 0.00 ? 9   GLU A OE2  3  
ATOM   5878  H  H    . GLU A 1 9  ? 145.014 1.747   -9.836  1.00 0.00 ? 9   GLU A H    3  
ATOM   5879  H  HA   . GLU A 1 9  ? 143.159 3.824   -10.366 1.00 0.00 ? 9   GLU A HA   3  
ATOM   5880  H  HB2  . GLU A 1 9  ? 144.211 1.571   -12.074 1.00 0.00 ? 9   GLU A HB2  3  
ATOM   5881  H  HB3  . GLU A 1 9  ? 143.173 2.862   -12.684 1.00 0.00 ? 9   GLU A HB3  3  
ATOM   5882  H  HG2  . GLU A 1 9  ? 144.827 4.529   -11.896 1.00 0.00 ? 9   GLU A HG2  3  
ATOM   5883  H  HG3  . GLU A 1 9  ? 145.876 3.217   -11.360 1.00 0.00 ? 9   GLU A HG3  3  
ATOM   5884  N  N    . THR A 1 10 ? 141.990 0.776   -10.134 1.00 0.00 ? 10  THR A N    3  
ATOM   5885  C  CA   . THR A 1 10 ? 140.745 0.026   -10.025 1.00 0.00 ? 10  THR A CA   3  
ATOM   5886  C  C    . THR A 1 10 ? 139.862 0.592   -8.917  1.00 0.00 ? 10  THR A C    3  
ATOM   5887  O  O    . THR A 1 10 ? 138.649 0.756   -9.093  1.00 0.00 ? 10  THR A O    3  
ATOM   5888  C  CB   . THR A 1 10 ? 141.049 -1.443  -9.731  1.00 0.00 ? 10  THR A CB   3  
ATOM   5889  O  OG1  . THR A 1 10 ? 141.932 -1.950  -10.723 1.00 0.00 ? 10  THR A OG1  3  
ATOM   5890  C  CG2  . THR A 1 10 ? 139.749 -2.249  -9.742  1.00 0.00 ? 10  THR A CG2  3  
ATOM   5891  H  H    . THR A 1 10 ? 142.846 0.325   -9.975  1.00 0.00 ? 10  THR A H    3  
ATOM   5892  H  HA   . THR A 1 10 ? 140.214 0.087   -10.960 1.00 0.00 ? 10  THR A HA   3  
ATOM   5893  H  HB   . THR A 1 10 ? 141.512 -1.529  -8.760  1.00 0.00 ? 10  THR A HB   3  
ATOM   5894  H  HG1  . THR A 1 10 ? 141.786 -1.452  -11.531 1.00 0.00 ? 10  THR A HG1  3  
ATOM   5895  H  HG21 . THR A 1 10 ? 139.085 -1.851  -10.497 1.00 0.00 ? 10  THR A HG21 3  
ATOM   5896  H  HG22 . THR A 1 10 ? 139.275 -2.181  -8.774  1.00 0.00 ? 10  THR A HG22 3  
ATOM   5897  H  HG23 . THR A 1 10 ? 139.967 -3.283  -9.964  1.00 0.00 ? 10  THR A HG23 3  
ATOM   5898  N  N    . LEU A 1 11 ? 140.477 0.892   -7.772  1.00 0.00 ? 11  LEU A N    3  
ATOM   5899  C  CA   . LEU A 1 11 ? 139.725 1.433   -6.641  1.00 0.00 ? 11  LEU A CA   3  
ATOM   5900  C  C    . LEU A 1 11 ? 139.066 2.765   -7.004  1.00 0.00 ? 11  LEU A C    3  
ATOM   5901  O  O    . LEU A 1 11 ? 137.882 3.006   -6.725  1.00 0.00 ? 11  LEU A O    3  
ATOM   5902  C  CB   . LEU A 1 11 ? 140.701 1.655   -5.483  1.00 0.00 ? 11  LEU A CB   3  
ATOM   5903  C  CG   . LEU A 1 11 ? 141.374 0.328   -5.123  1.00 0.00 ? 11  LEU A CG   3  
ATOM   5904  C  CD1  . LEU A 1 11 ? 142.437 0.563   -4.043  1.00 0.00 ? 11  LEU A CD1  3  
ATOM   5905  C  CD2  . LEU A 1 11 ? 140.320 -0.651  -4.594  1.00 0.00 ? 11  LEU A CD2  3  
ATOM   5906  H  H    . LEU A 1 11 ? 141.450 0.738   -7.687  1.00 0.00 ? 11  LEU A H    3  
ATOM   5907  H  HA   . LEU A 1 11 ? 138.973 0.726   -6.335  1.00 0.00 ? 11  LEU A HA   3  
ATOM   5908  H  HB2  . LEU A 1 11 ? 141.453 2.373   -5.779  1.00 0.00 ? 11  LEU A HB2  3  
ATOM   5909  H  HB3  . LEU A 1 11 ? 140.163 2.029   -4.626  1.00 0.00 ? 11  LEU A HB3  3  
ATOM   5910  H  HG   . LEU A 1 11 ? 141.841 -0.088  -5.999  1.00 0.00 ? 11  LEU A HG   3  
ATOM   5911  H  HD11 . LEU A 1 11 ? 143.380 0.806   -4.518  1.00 0.00 ? 11  LEU A HD11 3  
ATOM   5912  H  HD12 . LEU A 1 11 ? 142.555 -0.331  -3.449  1.00 0.00 ? 11  LEU A HD12 3  
ATOM   5913  H  HD13 . LEU A 1 11 ? 142.133 1.381   -3.407  1.00 0.00 ? 11  LEU A HD13 3  
ATOM   5914  H  HD21 . LEU A 1 11 ? 140.793 -1.372  -3.944  1.00 0.00 ? 11  LEU A HD21 3  
ATOM   5915  H  HD22 . LEU A 1 11 ? 139.859 -1.164  -5.422  1.00 0.00 ? 11  LEU A HD22 3  
ATOM   5916  H  HD23 . LEU A 1 11 ? 139.569 -0.107  -4.041  1.00 0.00 ? 11  LEU A HD23 3  
ATOM   5917  N  N    . ILE A 1 12 ? 139.837 3.625   -7.649  1.00 0.00 ? 12  ILE A N    3  
ATOM   5918  C  CA   . ILE A 1 12 ? 139.325 4.916   -8.061  1.00 0.00 ? 12  ILE A CA   3  
ATOM   5919  C  C    . ILE A 1 12 ? 138.280 4.759   -9.159  1.00 0.00 ? 12  ILE A C    3  
ATOM   5920  O  O    . ILE A 1 12 ? 137.262 5.453   -9.170  1.00 0.00 ? 12  ILE A O    3  
ATOM   5921  C  CB   . ILE A 1 12 ? 140.484 5.797   -8.527  1.00 0.00 ? 12  ILE A CB   3  
ATOM   5922  C  CG1  . ILE A 1 12 ? 141.480 5.937   -7.369  1.00 0.00 ? 12  ILE A CG1  3  
ATOM   5923  C  CG2  . ILE A 1 12 ? 139.956 7.179   -8.919  1.00 0.00 ? 12  ILE A CG2  3  
ATOM   5924  C  CD1  . ILE A 1 12 ? 142.728 6.689   -7.835  1.00 0.00 ? 12  ILE A CD1  3  
ATOM   5925  H  H    . ILE A 1 12 ? 140.763 3.382   -7.859  1.00 0.00 ? 12  ILE A H    3  
ATOM   5926  H  HA   . ILE A 1 12 ? 138.858 5.388   -7.206  1.00 0.00 ? 12  ILE A HA   3  
ATOM   5927  H  HB   . ILE A 1 12 ? 140.973 5.338   -9.374  1.00 0.00 ? 12  ILE A HB   3  
ATOM   5928  H  HG12 . ILE A 1 12 ? 141.014 6.483   -6.562  1.00 0.00 ? 12  ILE A HG12 3  
ATOM   5929  H  HG13 . ILE A 1 12 ? 141.764 4.956   -7.020  1.00 0.00 ? 12  ILE A HG13 3  
ATOM   5930  H  HG21 . ILE A 1 12 ? 140.777 7.880   -8.954  1.00 0.00 ? 12  ILE A HG21 3  
ATOM   5931  H  HG22 . ILE A 1 12 ? 139.234 7.508   -8.187  1.00 0.00 ? 12  ILE A HG22 3  
ATOM   5932  H  HG23 . ILE A 1 12 ? 139.488 7.123   -9.889  1.00 0.00 ? 12  ILE A HG23 3  
ATOM   5933  H  HD11 . ILE A 1 12 ? 142.478 7.723   -8.019  1.00 0.00 ? 12  ILE A HD11 3  
ATOM   5934  H  HD12 . ILE A 1 12 ? 143.101 6.239   -8.742  1.00 0.00 ? 12  ILE A HD12 3  
ATOM   5935  H  HD13 . ILE A 1 12 ? 143.486 6.634   -7.065  1.00 0.00 ? 12  ILE A HD13 3  
ATOM   5936  N  N    . ASN A 1 13 ? 138.547 3.846   -10.094 1.00 0.00 ? 13  ASN A N    3  
ATOM   5937  C  CA   . ASN A 1 13 ? 137.633 3.612   -11.201 1.00 0.00 ? 13  ASN A CA   3  
ATOM   5938  C  C    . ASN A 1 13 ? 136.268 3.167   -10.698 1.00 0.00 ? 13  ASN A C    3  
ATOM   5939  O  O    . ASN A 1 13 ? 135.240 3.624   -11.196 1.00 0.00 ? 13  ASN A O    3  
ATOM   5940  C  CB   . ASN A 1 13 ? 138.198 2.534   -12.131 1.00 0.00 ? 13  ASN A CB   3  
ATOM   5941  C  CG   . ASN A 1 13 ? 139.506 3.002   -12.766 1.00 0.00 ? 13  ASN A CG   3  
ATOM   5942  O  OD1  . ASN A 1 13 ? 140.071 2.300   -13.605 1.00 0.00 ? 13  ASN A OD1  3  
ATOM   5943  N  ND2  . ASN A 1 13 ? 140.040 4.137   -12.400 1.00 0.00 ? 13  ASN A ND2  3  
ATOM   5944  H  H    . ASN A 1 13 ? 139.378 3.329   -10.038 1.00 0.00 ? 13  ASN A H    3  
ATOM   5945  H  HA   . ASN A 1 13 ? 137.519 4.527   -11.762 1.00 0.00 ? 13  ASN A HA   3  
ATOM   5946  H  HB2  . ASN A 1 13 ? 138.380 1.634   -11.562 1.00 0.00 ? 13  ASN A HB2  3  
ATOM   5947  H  HB3  . ASN A 1 13 ? 137.478 2.324   -12.909 1.00 0.00 ? 13  ASN A HB3  3  
ATOM   5948  H  HD21 . ASN A 1 13 ? 139.607 4.688   -11.718 1.00 0.00 ? 13  ASN A HD21 3  
ATOM   5949  H  HD22 . ASN A 1 13 ? 140.877 4.437   -12.811 1.00 0.00 ? 13  ASN A HD22 3  
ATOM   5950  N  N    . VAL A 1 14 ? 136.253 2.293   -9.690  1.00 0.00 ? 14  VAL A N    3  
ATOM   5951  C  CA   . VAL A 1 14 ? 134.980 1.847   -9.139  1.00 0.00 ? 14  VAL A CA   3  
ATOM   5952  C  C    . VAL A 1 14 ? 134.373 2.962   -8.299  1.00 0.00 ? 14  VAL A C    3  
ATOM   5953  O  O    . VAL A 1 14 ? 133.155 3.134   -8.258  1.00 0.00 ? 14  VAL A O    3  
ATOM   5954  C  CB   . VAL A 1 14 ? 135.161 0.585   -8.286  1.00 0.00 ? 14  VAL A CB   3  
ATOM   5955  C  CG1  . VAL A 1 14 ? 135.787 -0.522  -9.136  1.00 0.00 ? 14  VAL A CG1  3  
ATOM   5956  C  CG2  . VAL A 1 14 ? 136.084 0.879   -7.104  1.00 0.00 ? 14  VAL A CG2  3  
ATOM   5957  H  H    . VAL A 1 14 ? 137.101 1.963   -9.309  1.00 0.00 ? 14  VAL A H    3  
ATOM   5958  H  HA   . VAL A 1 14 ? 134.308 1.615   -9.957  1.00 0.00 ? 14  VAL A HA   3  
ATOM   5959  H  HB   . VAL A 1 14 ? 134.198 0.257   -7.921  1.00 0.00 ? 14  VAL A HB   3  
ATOM   5960  H  HG11 . VAL A 1 14 ? 136.329 -1.203  -8.497  1.00 0.00 ? 14  VAL A HG11 3  
ATOM   5961  H  HG12 . VAL A 1 14 ? 136.465 -0.086  -9.855  1.00 0.00 ? 14  VAL A HG12 3  
ATOM   5962  H  HG13 . VAL A 1 14 ? 135.008 -1.060  -9.656  1.00 0.00 ? 14  VAL A HG13 3  
ATOM   5963  H  HG21 . VAL A 1 14 ? 135.717 1.729   -6.552  1.00 0.00 ? 14  VAL A HG21 3  
ATOM   5964  H  HG22 . VAL A 1 14 ? 137.070 1.085   -7.475  1.00 0.00 ? 14  VAL A HG22 3  
ATOM   5965  H  HG23 . VAL A 1 14 ? 136.119 0.019   -6.455  1.00 0.00 ? 14  VAL A HG23 3  
ATOM   5966  N  N    . PHE A 1 15 ? 135.241 3.714   -7.621  1.00 0.00 ? 15  PHE A N    3  
ATOM   5967  C  CA   . PHE A 1 15 ? 134.789 4.809   -6.771  1.00 0.00 ? 15  PHE A CA   3  
ATOM   5968  C  C    . PHE A 1 15 ? 134.005 5.865   -7.552  1.00 0.00 ? 15  PHE A C    3  
ATOM   5969  O  O    . PHE A 1 15 ? 132.926 6.296   -7.132  1.00 0.00 ? 15  PHE A O    3  
ATOM   5970  C  CB   . PHE A 1 15 ? 136.018 5.475   -6.152  1.00 0.00 ? 15  PHE A CB   3  
ATOM   5971  C  CG   . PHE A 1 15 ? 135.585 6.538   -5.184  1.00 0.00 ? 15  PHE A CG   3  
ATOM   5972  C  CD1  . PHE A 1 15 ? 135.320 6.198   -3.859  1.00 0.00 ? 15  PHE A CD1  3  
ATOM   5973  C  CD2  . PHE A 1 15 ? 135.451 7.863   -5.612  1.00 0.00 ? 15  PHE A CD2  3  
ATOM   5974  C  CE1  . PHE A 1 15 ? 134.920 7.182   -2.957  1.00 0.00 ? 15  PHE A CE1  3  
ATOM   5975  C  CE2  . PHE A 1 15 ? 135.050 8.851   -4.708  1.00 0.00 ? 15  PHE A CE2  3  
ATOM   5976  C  CZ   . PHE A 1 15 ? 134.783 8.510   -3.378  1.00 0.00 ? 15  PHE A CZ   3  
ATOM   5977  H  H    . PHE A 1 15 ? 136.211 3.519   -7.682  1.00 0.00 ? 15  PHE A H    3  
ATOM   5978  H  HA   . PHE A 1 15 ? 134.170 4.416   -5.980  1.00 0.00 ? 15  PHE A HA   3  
ATOM   5979  H  HB2  . PHE A 1 15 ? 136.605 4.734   -5.630  1.00 0.00 ? 15  PHE A HB2  3  
ATOM   5980  H  HB3  . PHE A 1 15 ? 136.615 5.923   -6.931  1.00 0.00 ? 15  PHE A HB3  3  
ATOM   5981  H  HD1  . PHE A 1 15 ? 135.424 5.175   -3.532  1.00 0.00 ? 15  PHE A HD1  3  
ATOM   5982  H  HD2  . PHE A 1 15 ? 135.657 8.123   -6.640  1.00 0.00 ? 15  PHE A HD2  3  
ATOM   5983  H  HE1  . PHE A 1 15 ? 134.718 6.916   -1.938  1.00 0.00 ? 15  PHE A HE1  3  
ATOM   5984  H  HE2  . PHE A 1 15 ? 134.945 9.874   -5.035  1.00 0.00 ? 15  PHE A HE2  3  
ATOM   5985  H  HZ   . PHE A 1 15 ? 134.474 9.268   -2.676  1.00 0.00 ? 15  PHE A HZ   3  
ATOM   5986  N  N    . HIS A 1 16 ? 134.566 6.286   -8.679  1.00 0.00 ? 16  HIS A N    3  
ATOM   5987  C  CA   . HIS A 1 16 ? 133.940 7.308   -9.510  1.00 0.00 ? 16  HIS A CA   3  
ATOM   5988  C  C    . HIS A 1 16 ? 132.573 6.885   -10.040 1.00 0.00 ? 16  HIS A C    3  
ATOM   5989  O  O    . HIS A 1 16 ? 131.635 7.683   -10.067 1.00 0.00 ? 16  HIS A O    3  
ATOM   5990  C  CB   . HIS A 1 16 ? 134.858 7.629   -10.692 1.00 0.00 ? 16  HIS A CB   3  
ATOM   5991  C  CG   . HIS A 1 16 ? 134.268 8.750   -11.502 1.00 0.00 ? 16  HIS A CG   3  
ATOM   5992  N  ND1  . HIS A 1 16 ? 134.154 10.040  -11.009 1.00 0.00 ? 16  HIS A ND1  3  
ATOM   5993  C  CD2  . HIS A 1 16 ? 133.761 8.790   -12.777 1.00 0.00 ? 16  HIS A CD2  3  
ATOM   5994  C  CE1  . HIS A 1 16 ? 133.598 10.795  -11.974 1.00 0.00 ? 16  HIS A CE1  3  
ATOM   5995  N  NE2  . HIS A 1 16 ? 133.338 10.082  -13.072 1.00 0.00 ? 16  HIS A NE2  3  
ATOM   5996  H  H    . HIS A 1 16 ? 135.431 5.912   -8.950  1.00 0.00 ? 16  HIS A H    3  
ATOM   5997  H  HA   . HIS A 1 16 ? 133.820 8.204   -8.923  1.00 0.00 ? 16  HIS A HA   3  
ATOM   5998  H  HB2  . HIS A 1 16 ? 135.828 7.924   -10.322 1.00 0.00 ? 16  HIS A HB2  3  
ATOM   5999  H  HB3  . HIS A 1 16 ? 134.961 6.752   -11.313 1.00 0.00 ? 16  HIS A HB3  3  
ATOM   6000  H  HD1  . HIS A 1 16 ? 134.428 10.346  -10.119 1.00 0.00 ? 16  HIS A HD1  3  
ATOM   6001  H  HD2  . HIS A 1 16 ? 133.697 7.947   -13.449 1.00 0.00 ? 16  HIS A HD2  3  
ATOM   6002  H  HE1  . HIS A 1 16 ? 133.392 11.850  -11.873 1.00 0.00 ? 16  HIS A HE1  3  
ATOM   6003  H  HE2  . HIS A 1 16 ? 132.936 10.402  -13.907 1.00 0.00 ? 16  HIS A HE2  3  
ATOM   6004  N  N    . ALA A 1 17 ? 132.480 5.647   -10.507 1.00 0.00 ? 17  ALA A N    3  
ATOM   6005  C  CA   . ALA A 1 17 ? 131.236 5.155   -11.089 1.00 0.00 ? 17  ALA A CA   3  
ATOM   6006  C  C    . ALA A 1 17 ? 130.075 5.088   -10.095 1.00 0.00 ? 17  ALA A C    3  
ATOM   6007  O  O    . ALA A 1 17 ? 128.937 5.392   -10.453 1.00 0.00 ? 17  ALA A O    3  
ATOM   6008  C  CB   . ALA A 1 17 ? 131.472 3.763   -11.676 1.00 0.00 ? 17  ALA A CB   3  
ATOM   6009  H  H    . ALA A 1 17 ? 133.269 5.067   -10.495 1.00 0.00 ? 17  ALA A H    3  
ATOM   6010  H  HA   . ALA A 1 17 ? 130.957 5.812   -11.895 1.00 0.00 ? 17  ALA A HA   3  
ATOM   6011  H  HB1  . ALA A 1 17 ? 132.116 3.841   -12.539 1.00 0.00 ? 17  ALA A HB1  3  
ATOM   6012  H  HB2  . ALA A 1 17 ? 130.526 3.332   -11.971 1.00 0.00 ? 17  ALA A HB2  3  
ATOM   6013  H  HB3  . ALA A 1 17 ? 131.938 3.133   -10.933 1.00 0.00 ? 17  ALA A HB3  3  
ATOM   6014  N  N    . HIS A 1 18 ? 130.340 4.648   -8.868  1.00 0.00 ? 18  HIS A N    3  
ATOM   6015  C  CA   . HIS A 1 18 ? 129.261 4.512   -7.886  1.00 0.00 ? 18  HIS A CA   3  
ATOM   6016  C  C    . HIS A 1 18 ? 129.024 5.757   -7.033  1.00 0.00 ? 18  HIS A C    3  
ATOM   6017  O  O    . HIS A 1 18 ? 127.896 6.008   -6.608  1.00 0.00 ? 18  HIS A O    3  
ATOM   6018  C  CB   . HIS A 1 18 ? 129.579 3.346   -6.962  1.00 0.00 ? 18  HIS A CB   3  
ATOM   6019  C  CG   . HIS A 1 18 ? 129.700 2.080   -7.767  1.00 0.00 ? 18  HIS A CG   3  
ATOM   6020  N  ND1  . HIS A 1 18 ? 128.616 1.515   -8.420  1.00 0.00 ? 18  HIS A ND1  3  
ATOM   6021  C  CD2  . HIS A 1 18 ? 130.768 1.258   -8.029  1.00 0.00 ? 18  HIS A CD2  3  
ATOM   6022  C  CE1  . HIS A 1 18 ? 129.052 0.401   -9.038  1.00 0.00 ? 18  HIS A CE1  3  
ATOM   6023  N  NE2  . HIS A 1 18 ? 130.355 0.198   -8.832  1.00 0.00 ? 18  HIS A NE2  3  
ATOM   6024  H  H    . HIS A 1 18 ? 131.253 4.383   -8.631  1.00 0.00 ? 18  HIS A H    3  
ATOM   6025  H  HA   . HIS A 1 18 ? 128.349 4.282   -8.413  1.00 0.00 ? 18  HIS A HA   3  
ATOM   6026  H  HB2  . HIS A 1 18 ? 130.511 3.545   -6.457  1.00 0.00 ? 18  HIS A HB2  3  
ATOM   6027  H  HB3  . HIS A 1 18 ? 128.789 3.236   -6.233  1.00 0.00 ? 18  HIS A HB3  3  
ATOM   6028  H  HD1  . HIS A 1 18 ? 127.700 1.862   -8.430  1.00 0.00 ? 18  HIS A HD1  3  
ATOM   6029  H  HD2  . HIS A 1 18 ? 131.772 1.406   -7.664  1.00 0.00 ? 18  HIS A HD2  3  
ATOM   6030  H  HE1  . HIS A 1 18 ? 128.423 -0.249  -9.629  1.00 0.00 ? 18  HIS A HE1  3  
ATOM   6031  H  HE2  . HIS A 1 18 ? 130.904 -0.538  -9.174  1.00 0.00 ? 18  HIS A HE2  3  
ATOM   6032  N  N    . SER A 1 19 ? 130.071 6.519   -6.749  1.00 0.00 ? 19  SER A N    3  
ATOM   6033  C  CA   . SER A 1 19 ? 129.905 7.702   -5.907  1.00 0.00 ? 19  SER A CA   3  
ATOM   6034  C  C    . SER A 1 19 ? 128.980 8.728   -6.555  1.00 0.00 ? 19  SER A C    3  
ATOM   6035  O  O    . SER A 1 19 ? 128.281 9.474   -5.870  1.00 0.00 ? 19  SER A O    3  
ATOM   6036  C  CB   . SER A 1 19 ? 131.270 8.335   -5.648  1.00 0.00 ? 19  SER A CB   3  
ATOM   6037  O  OG   . SER A 1 19 ? 131.786 8.841   -6.873  1.00 0.00 ? 19  SER A OG   3  
ATOM   6038  H  H    . SER A 1 19 ? 130.964 6.277   -7.084  1.00 0.00 ? 19  SER A H    3  
ATOM   6039  H  HA   . SER A 1 19 ? 129.481 7.397   -4.960  1.00 0.00 ? 19  SER A HA   3  
ATOM   6040  H  HB2  . SER A 1 19 ? 131.169 9.143   -4.945  1.00 0.00 ? 19  SER A HB2  3  
ATOM   6041  H  HB3  . SER A 1 19 ? 131.942 7.589   -5.243  1.00 0.00 ? 19  SER A HB3  3  
ATOM   6042  H  HG   . SER A 1 19 ? 132.312 8.150   -7.281  1.00 0.00 ? 19  SER A HG   3  
ATOM   6043  N  N    . GLY A 1 20 ? 128.996 8.766   -7.875  1.00 0.00 ? 20  GLY A N    3  
ATOM   6044  C  CA   . GLY A 1 20 ? 128.178 9.705   -8.631  1.00 0.00 ? 20  GLY A CA   3  
ATOM   6045  C  C    . GLY A 1 20 ? 126.673 9.549   -8.392  1.00 0.00 ? 20  GLY A C    3  
ATOM   6046  O  O    . GLY A 1 20 ? 125.918 10.506  -8.569  1.00 0.00 ? 20  GLY A O    3  
ATOM   6047  H  H    . GLY A 1 20 ? 129.585 8.150   -8.361  1.00 0.00 ? 20  GLY A H    3  
ATOM   6048  H  HA2  . GLY A 1 20 ? 128.462 10.704  -8.345  1.00 0.00 ? 20  GLY A HA2  3  
ATOM   6049  H  HA3  . GLY A 1 20 ? 128.382 9.579   -9.682  1.00 0.00 ? 20  GLY A HA3  3  
ATOM   6050  N  N    . LYS A 1 21 ? 126.220 8.340   -8.064  1.00 0.00 ? 21  LYS A N    3  
ATOM   6051  C  CA   . LYS A 1 21 ? 124.781 8.110   -7.902  1.00 0.00 ? 21  LYS A CA   3  
ATOM   6052  C  C    . LYS A 1 21 ? 124.126 9.025   -6.861  1.00 0.00 ? 21  LYS A C    3  
ATOM   6053  O  O    . LYS A 1 21 ? 123.017 9.510   -7.087  1.00 0.00 ? 21  LYS A O    3  
ATOM   6054  C  CB   . LYS A 1 21 ? 124.517 6.657   -7.500  1.00 0.00 ? 21  LYS A CB   3  
ATOM   6055  C  CG   . LYS A 1 21 ? 124.998 5.713   -8.604  1.00 0.00 ? 21  LYS A CG   3  
ATOM   6056  C  CD   . LYS A 1 21 ? 124.474 4.297   -8.331  1.00 0.00 ? 21  LYS A CD   3  
ATOM   6057  C  CE   . LYS A 1 21 ? 125.055 3.759   -7.019  1.00 0.00 ? 21  LYS A CE   3  
ATOM   6058  N  NZ   . LYS A 1 21 ? 126.521 4.014   -6.975  1.00 0.00 ? 21  LYS A NZ   3  
ATOM   6059  H  H    . LYS A 1 21 ? 126.845 7.590   -7.984  1.00 0.00 ? 21  LYS A H    3  
ATOM   6060  H  HA   . LYS A 1 21 ? 124.304 8.282   -8.854  1.00 0.00 ? 21  LYS A HA   3  
ATOM   6061  H  HB2  . LYS A 1 21 ? 125.048 6.439   -6.585  1.00 0.00 ? 21  LYS A HB2  3  
ATOM   6062  H  HB3  . LYS A 1 21 ? 123.459 6.514   -7.344  1.00 0.00 ? 21  LYS A HB3  3  
ATOM   6063  H  HG2  . LYS A 1 21 ? 124.626 6.057   -9.558  1.00 0.00 ? 21  LYS A HG2  3  
ATOM   6064  H  HG3  . LYS A 1 21 ? 126.077 5.699   -8.623  1.00 0.00 ? 21  LYS A HG3  3  
ATOM   6065  H  HD2  . LYS A 1 21 ? 123.396 4.323   -8.260  1.00 0.00 ? 21  LYS A HD2  3  
ATOM   6066  H  HD3  . LYS A 1 21 ? 124.763 3.647   -9.142  1.00 0.00 ? 21  LYS A HD3  3  
ATOM   6067  H  HE2  . LYS A 1 21 ? 124.579 4.252   -6.185  1.00 0.00 ? 21  LYS A HE2  3  
ATOM   6068  H  HE3  . LYS A 1 21 ? 124.873 2.696   -6.958  1.00 0.00 ? 21  LYS A HE3  3  
ATOM   6069  H  HZ1  . LYS A 1 21 ? 126.705 5.022   -7.141  1.00 0.00 ? 21  LYS A HZ1  3  
ATOM   6070  H  HZ2  . LYS A 1 21 ? 126.992 3.447   -7.710  1.00 0.00 ? 21  LYS A HZ2  3  
ATOM   6071  H  HZ3  . LYS A 1 21 ? 126.892 3.746   -6.041  1.00 0.00 ? 21  LYS A HZ3  3  
ATOM   6072  N  N    . GLU A 1 22 ? 124.782 9.269   -5.727  1.00 0.00 ? 22  GLU A N    3  
ATOM   6073  C  CA   . GLU A 1 22 ? 124.182 10.138  -4.707  1.00 0.00 ? 22  GLU A CA   3  
ATOM   6074  C  C    . GLU A 1 22 ? 125.207 11.037  -4.024  1.00 0.00 ? 22  GLU A C    3  
ATOM   6075  O  O    . GLU A 1 22 ? 126.372 10.673  -3.873  1.00 0.00 ? 22  GLU A O    3  
ATOM   6076  C  CB   . GLU A 1 22 ? 123.469 9.300   -3.646  1.00 0.00 ? 22  GLU A CB   3  
ATOM   6077  C  CG   . GLU A 1 22 ? 122.355 8.482   -4.300  1.00 0.00 ? 22  GLU A CG   3  
ATOM   6078  C  CD   . GLU A 1 22 ? 121.579 7.726   -3.229  1.00 0.00 ? 22  GLU A CD   3  
ATOM   6079  O  OE1  . GLU A 1 22 ? 121.996 7.772   -2.083  1.00 0.00 ? 22  GLU A OE1  3  
ATOM   6080  O  OE2  . GLU A 1 22 ? 120.573 7.124   -3.568  1.00 0.00 ? 22  GLU A OE2  3  
ATOM   6081  H  H    . GLU A 1 22 ? 125.663 8.867   -5.574  1.00 0.00 ? 22  GLU A H    3  
ATOM   6082  H  HA   . GLU A 1 22 ? 123.446 10.770  -5.184  1.00 0.00 ? 22  GLU A HA   3  
ATOM   6083  H  HB2  . GLU A 1 22 ? 124.179 8.633   -3.178  1.00 0.00 ? 22  GLU A HB2  3  
ATOM   6084  H  HB3  . GLU A 1 22 ? 123.042 9.951   -2.899  1.00 0.00 ? 22  GLU A HB3  3  
ATOM   6085  H  HG2  . GLU A 1 22 ? 121.687 9.145   -4.830  1.00 0.00 ? 22  GLU A HG2  3  
ATOM   6086  H  HG3  . GLU A 1 22 ? 122.787 7.776   -4.994  1.00 0.00 ? 22  GLU A HG3  3  
ATOM   6087  N  N    . GLY A 1 23 ? 124.749 12.203  -3.581  1.00 0.00 ? 23  GLY A N    3  
ATOM   6088  C  CA   . GLY A 1 23 ? 125.617 13.136  -2.877  1.00 0.00 ? 23  GLY A CA   3  
ATOM   6089  C  C    . GLY A 1 23 ? 126.708 13.657  -3.792  1.00 0.00 ? 23  GLY A C    3  
ATOM   6090  O  O    . GLY A 1 23 ? 126.548 13.695  -5.012  1.00 0.00 ? 23  GLY A O    3  
ATOM   6091  H  H    . GLY A 1 23 ? 123.804 12.429  -3.709  1.00 0.00 ? 23  GLY A H    3  
ATOM   6092  H  HA2  . GLY A 1 23 ? 125.027 13.966  -2.517  1.00 0.00 ? 23  GLY A HA2  3  
ATOM   6093  H  HA3  . GLY A 1 23 ? 126.071 12.632  -2.037  1.00 0.00 ? 23  GLY A HA3  3  
ATOM   6094  N  N    . ASP A 1 24 ? 127.831 14.035  -3.196  1.00 0.00 ? 24  ASP A N    3  
ATOM   6095  C  CA   . ASP A 1 24 ? 128.955 14.524  -3.973  1.00 0.00 ? 24  ASP A CA   3  
ATOM   6096  C  C    . ASP A 1 24 ? 129.599 13.366  -4.723  1.00 0.00 ? 24  ASP A C    3  
ATOM   6097  O  O    . ASP A 1 24 ? 129.773 12.275  -4.170  1.00 0.00 ? 24  ASP A O    3  
ATOM   6098  C  CB   . ASP A 1 24 ? 129.986 15.180  -3.053  1.00 0.00 ? 24  ASP A CB   3  
ATOM   6099  C  CG   . ASP A 1 24 ? 129.399 16.440  -2.424  1.00 0.00 ? 24  ASP A CG   3  
ATOM   6100  O  OD1  . ASP A 1 24 ? 128.363 16.883  -2.891  1.00 0.00 ? 24  ASP A OD1  3  
ATOM   6101  O  OD2  . ASP A 1 24 ? 129.995 16.943  -1.485  1.00 0.00 ? 24  ASP A OD2  3  
ATOM   6102  H  H    . ASP A 1 24 ? 127.909 13.966  -2.221  1.00 0.00 ? 24  ASP A H    3  
ATOM   6103  H  HA   . ASP A 1 24 ? 128.601 15.255  -4.684  1.00 0.00 ? 24  ASP A HA   3  
ATOM   6104  H  HB2  . ASP A 1 24 ? 130.263 14.485  -2.272  1.00 0.00 ? 24  ASP A HB2  3  
ATOM   6105  H  HB3  . ASP A 1 24 ? 130.862 15.442  -3.626  1.00 0.00 ? 24  ASP A HB3  3  
ATOM   6106  N  N    . LYS A 1 25 ? 129.949 13.605  -5.978  1.00 0.00 ? 25  LYS A N    3  
ATOM   6107  C  CA   . LYS A 1 25 ? 130.580 12.573  -6.786  1.00 0.00 ? 25  LYS A CA   3  
ATOM   6108  C  C    . LYS A 1 25 ? 131.882 12.127  -6.139  1.00 0.00 ? 25  LYS A C    3  
ATOM   6109  O  O    . LYS A 1 25 ? 132.266 10.961  -6.191  1.00 0.00 ? 25  LYS A O    3  
ATOM   6110  C  CB   . LYS A 1 25 ? 130.942 13.159  -8.159  1.00 0.00 ? 25  LYS A CB   3  
ATOM   6111  C  CG   . LYS A 1 25 ? 129.691 13.570  -8.924  1.00 0.00 ? 25  LYS A CG   3  
ATOM   6112  C  CD   . LYS A 1 25 ? 130.088 14.272  -10.229 1.00 0.00 ? 25  LYS A CD   3  
ATOM   6113  C  CE   . LYS A 1 25 ? 130.765 13.280  -11.180 1.00 0.00 ? 25  LYS A CE   3  
ATOM   6114  N  NZ   . LYS A 1 25 ? 130.030 11.983  -11.168 1.00 0.00 ? 25  LYS A NZ   3  
ATOM   6115  H  H    . LYS A 1 25 ? 129.786 14.491  -6.365  1.00 0.00 ? 25  LYS A H    3  
ATOM   6116  H  HA   . LYS A 1 25 ? 129.916 11.734  -6.912  1.00 0.00 ? 25  LYS A HA   3  
ATOM   6117  H  HB2  . LYS A 1 25 ? 131.572 14.019  -8.022  1.00 0.00 ? 25  LYS A HB2  3  
ATOM   6118  H  HB3  . LYS A 1 25 ? 131.478 12.414  -8.729  1.00 0.00 ? 25  LYS A HB3  3  
ATOM   6119  H  HG2  . LYS A 1 25 ? 129.122 12.697  -9.155  1.00 0.00 ? 25  LYS A HG2  3  
ATOM   6120  H  HG3  . LYS A 1 25 ? 129.100 14.242  -8.321  1.00 0.00 ? 25  LYS A HG3  3  
ATOM   6121  H  HD2  . LYS A 1 25 ? 129.203 14.673  -10.701 1.00 0.00 ? 25  LYS A HD2  3  
ATOM   6122  H  HD3  . LYS A 1 25 ? 130.772 15.077  -10.007 1.00 0.00 ? 25  LYS A HD3  3  
ATOM   6123  H  HE2  . LYS A 1 25 ? 130.760 13.684  -12.181 1.00 0.00 ? 25  LYS A HE2  3  
ATOM   6124  H  HE3  . LYS A 1 25 ? 131.785 13.119  -10.865 1.00 0.00 ? 25  LYS A HE3  3  
ATOM   6125  H  HZ1  . LYS A 1 25 ? 130.410 11.375  -10.417 1.00 0.00 ? 25  LYS A HZ1  3  
ATOM   6126  H  HZ2  . LYS A 1 25 ? 130.144 11.512  -12.089 1.00 0.00 ? 25  LYS A HZ2  3  
ATOM   6127  H  HZ3  . LYS A 1 25 ? 129.020 12.158  -10.992 1.00 0.00 ? 25  LYS A HZ3  3  
ATOM   6128  N  N    . TYR A 1 26 ? 132.584 13.109  -5.605  1.00 0.00 ? 26  TYR A N    3  
ATOM   6129  C  CA   . TYR A 1 26 ? 133.898 12.898  -5.019  1.00 0.00 ? 26  TYR A CA   3  
ATOM   6130  C  C    . TYR A 1 26 ? 133.857 12.134  -3.693  1.00 0.00 ? 26  TYR A C    3  
ATOM   6131  O  O    . TYR A 1 26 ? 134.815 11.438  -3.358  1.00 0.00 ? 26  TYR A O    3  
ATOM   6132  C  CB   . TYR A 1 26 ? 134.555 14.265  -4.845  1.00 0.00 ? 26  TYR A CB   3  
ATOM   6133  C  CG   . TYR A 1 26 ? 134.629 14.998  -6.191  1.00 0.00 ? 26  TYR A CG   3  
ATOM   6134  C  CD1  . TYR A 1 26 ? 134.108 14.436  -7.389  1.00 0.00 ? 26  TYR A CD1  3  
ATOM   6135  C  CD2  . TYR A 1 26 ? 135.177 16.288  -6.229  1.00 0.00 ? 26  TYR A CD2  3  
ATOM   6136  C  CE1  . TYR A 1 26 ? 134.145 15.158  -8.581  1.00 0.00 ? 26  TYR A CE1  3  
ATOM   6137  C  CE2  . TYR A 1 26 ? 135.221 17.003  -7.434  1.00 0.00 ? 26  TYR A CE2  3  
ATOM   6138  C  CZ   . TYR A 1 26 ? 134.704 16.440  -8.607  1.00 0.00 ? 26  TYR A CZ   3  
ATOM   6139  O  OH   . TYR A 1 26 ? 134.740 17.152  -9.789  1.00 0.00 ? 26  TYR A OH   3  
ATOM   6140  H  H    . TYR A 1 26 ? 132.234 14.022  -5.658  1.00 0.00 ? 26  TYR A H    3  
ATOM   6141  H  HA   . TYR A 1 26 ? 134.497 12.324  -5.708  1.00 0.00 ? 26  TYR A HA   3  
ATOM   6142  H  HB2  . TYR A 1 26 ? 133.976 14.853  -4.148  1.00 0.00 ? 26  TYR A HB2  3  
ATOM   6143  H  HB3  . TYR A 1 26 ? 135.554 14.134  -4.457  1.00 0.00 ? 26  TYR A HB3  3  
ATOM   6144  H  HD1  . TYR A 1 26 ? 133.691 13.449  -7.409  1.00 0.00 ? 26  TYR A HD1  3  
ATOM   6145  H  HD2  . TYR A 1 26 ? 135.578 16.728  -5.327  1.00 0.00 ? 26  TYR A HD2  3  
ATOM   6146  H  HE1  . TYR A 1 26 ? 133.730 14.721  -9.484  1.00 0.00 ? 26  TYR A HE1  3  
ATOM   6147  H  HE2  . TYR A 1 26 ? 135.653 17.993  -7.457  1.00 0.00 ? 26  TYR A HE2  3  
ATOM   6148  H  HH   . TYR A 1 26 ? 135.284 17.931  -9.649  1.00 0.00 ? 26  TYR A HH   3  
ATOM   6149  N  N    . LYS A 1 27 ? 132.773 12.276  -2.923  1.00 0.00 ? 27  LYS A N    3  
ATOM   6150  C  CA   . LYS A 1 27 ? 132.687 11.590  -1.626  1.00 0.00 ? 27  LYS A CA   3  
ATOM   6151  C  C    . LYS A 1 27 ? 131.485 10.648  -1.558  1.00 0.00 ? 27  LYS A C    3  
ATOM   6152  O  O    . LYS A 1 27 ? 130.491 10.832  -2.258  1.00 0.00 ? 27  LYS A O    3  
ATOM   6153  C  CB   . LYS A 1 27 ? 132.614 12.604  -0.484  1.00 0.00 ? 27  LYS A CB   3  
ATOM   6154  C  CG   . LYS A 1 27 ? 133.816 13.549  -0.574  1.00 0.00 ? 27  LYS A CG   3  
ATOM   6155  C  CD   . LYS A 1 27 ? 134.007 14.299  0.749   1.00 0.00 ? 27  LYS A CD   3  
ATOM   6156  C  CE   . LYS A 1 27 ? 132.763 15.085  1.124   1.00 0.00 ? 27  LYS A CE   3  
ATOM   6157  N  NZ   . LYS A 1 27 ? 132.409 16.031  0.028   1.00 0.00 ? 27  LYS A NZ   3  
ATOM   6158  H  H    . LYS A 1 27 ? 132.039 12.855  -3.217  1.00 0.00 ? 27  LYS A H    3  
ATOM   6159  H  HA   . LYS A 1 27 ? 133.580 10.998  -1.488  1.00 0.00 ? 27  LYS A HA   3  
ATOM   6160  H  HB2  . LYS A 1 27 ? 131.699 13.171  -0.571  1.00 0.00 ? 27  LYS A HB2  3  
ATOM   6161  H  HB3  . LYS A 1 27 ? 132.633 12.087  0.463   1.00 0.00 ? 27  LYS A HB3  3  
ATOM   6162  H  HG2  . LYS A 1 27 ? 134.706 12.975  -0.792  1.00 0.00 ? 27  LYS A HG2  3  
ATOM   6163  H  HG3  . LYS A 1 27 ? 133.650 14.264  -1.366  1.00 0.00 ? 27  LYS A HG3  3  
ATOM   6164  H  HD2  . LYS A 1 27 ? 134.211 13.597  1.527   1.00 0.00 ? 27  LYS A HD2  3  
ATOM   6165  H  HD3  . LYS A 1 27 ? 134.840 14.978  0.656   1.00 0.00 ? 27  LYS A HD3  3  
ATOM   6166  H  HE2  . LYS A 1 27 ? 131.947 14.401  1.301   1.00 0.00 ? 27  LYS A HE2  3  
ATOM   6167  H  HE3  . LYS A 1 27 ? 132.968 15.632  2.028   1.00 0.00 ? 27  LYS A HE3  3  
ATOM   6168  H  HZ1  . LYS A 1 27 ? 133.215 16.661  -0.161  1.00 0.00 ? 27  LYS A HZ1  3  
ATOM   6169  H  HZ2  . LYS A 1 27 ? 131.584 16.597  0.312   1.00 0.00 ? 27  LYS A HZ2  3  
ATOM   6170  H  HZ3  . LYS A 1 27 ? 132.183 15.494  -0.833  1.00 0.00 ? 27  LYS A HZ3  3  
ATOM   6171  N  N    . LEU A 1 28 ? 131.605 9.628   -0.708  1.00 0.00 ? 28  LEU A N    3  
ATOM   6172  C  CA   . LEU A 1 28 ? 130.553 8.624   -0.535  1.00 0.00 ? 28  LEU A CA   3  
ATOM   6173  C  C    . LEU A 1 28 ? 129.555 8.980   0.558   1.00 0.00 ? 28  LEU A C    3  
ATOM   6174  O  O    . LEU A 1 28 ? 129.904 9.527   1.604   1.00 0.00 ? 28  LEU A O    3  
ATOM   6175  C  CB   . LEU A 1 28 ? 131.186 7.270   -0.197  1.00 0.00 ? 28  LEU A CB   3  
ATOM   6176  C  CG   . LEU A 1 28 ? 132.095 6.837   -1.332  1.00 0.00 ? 28  LEU A CG   3  
ATOM   6177  C  CD1  . LEU A 1 28 ? 132.847 5.568   -0.918  1.00 0.00 ? 28  LEU A CD1  3  
ATOM   6178  C  CD2  . LEU A 1 28 ? 131.252 6.525   -2.573  1.00 0.00 ? 28  LEU A CD2  3  
ATOM   6179  H  H    . LEU A 1 28 ? 132.433 9.540   -0.190  1.00 0.00 ? 28  LEU A H    3  
ATOM   6180  H  HA   . LEU A 1 28 ? 130.018 8.524   -1.464  1.00 0.00 ? 28  LEU A HA   3  
ATOM   6181  H  HB2  . LEU A 1 28 ? 131.776 7.363   0.706   1.00 0.00 ? 28  LEU A HB2  3  
ATOM   6182  H  HB3  . LEU A 1 28 ? 130.415 6.533   -0.049  1.00 0.00 ? 28  LEU A HB3  3  
ATOM   6183  H  HG   . LEU A 1 28 ? 132.782 7.631   -1.552  1.00 0.00 ? 28  LEU A HG   3  
ATOM   6184  H  HD11 . LEU A 1 28 ? 133.629 5.824   -0.220  1.00 0.00 ? 28  LEU A HD11 3  
ATOM   6185  H  HD12 . LEU A 1 28 ? 133.283 5.107   -1.793  1.00 0.00 ? 28  LEU A HD12 3  
ATOM   6186  H  HD13 . LEU A 1 28 ? 132.159 4.878   -0.453  1.00 0.00 ? 28  LEU A HD13 3  
ATOM   6187  H  HD21 . LEU A 1 28 ? 131.079 7.432   -3.130  1.00 0.00 ? 28  LEU A HD21 3  
ATOM   6188  H  HD22 . LEU A 1 28 ? 130.307 6.099   -2.270  1.00 0.00 ? 28  LEU A HD22 3  
ATOM   6189  H  HD23 . LEU A 1 28 ? 131.778 5.816   -3.197  1.00 0.00 ? 28  LEU A HD23 3  
ATOM   6190  N  N    . SER A 1 29 ? 128.309 8.605   0.295   1.00 0.00 ? 29  SER A N    3  
ATOM   6191  C  CA   . SER A 1 29 ? 127.211 8.805   1.228   1.00 0.00 ? 29  SER A CA   3  
ATOM   6192  C  C    . SER A 1 29 ? 127.001 7.495   1.972   1.00 0.00 ? 29  SER A C    3  
ATOM   6193  O  O    . SER A 1 29 ? 127.431 6.446   1.496   1.00 0.00 ? 29  SER A O    3  
ATOM   6194  C  CB   . SER A 1 29 ? 125.937 9.199   0.483   1.00 0.00 ? 29  SER A CB   3  
ATOM   6195  O  OG   . SER A 1 29 ? 124.920 9.511   1.426   1.00 0.00 ? 29  SER A OG   3  
ATOM   6196  H  H    . SER A 1 29 ? 128.127 8.146   -0.550  1.00 0.00 ? 29  SER A H    3  
ATOM   6197  H  HA   . SER A 1 29 ? 127.475 9.581   1.932   1.00 0.00 ? 29  SER A HA   3  
ATOM   6198  H  HB2  . SER A 1 29 ? 126.128 10.063  -0.131  1.00 0.00 ? 29  SER A HB2  3  
ATOM   6199  H  HB3  . SER A 1 29 ? 125.620 8.378   -0.145  1.00 0.00 ? 29  SER A HB3  3  
ATOM   6200  H  HG   . SER A 1 29 ? 125.228 10.244  1.964   1.00 0.00 ? 29  SER A HG   3  
ATOM   6201  N  N    . LYS A 1 30 ? 126.389 7.534   3.146   1.00 0.00 ? 30  LYS A N    3  
ATOM   6202  C  CA   . LYS A 1 30 ? 126.219 6.300   3.900   1.00 0.00 ? 30  LYS A CA   3  
ATOM   6203  C  C    . LYS A 1 30 ? 125.555 5.230   3.039   1.00 0.00 ? 30  LYS A C    3  
ATOM   6204  O  O    . LYS A 1 30 ? 125.982 4.073   3.052   1.00 0.00 ? 30  LYS A O    3  
ATOM   6205  C  CB   . LYS A 1 30 ? 125.359 6.560   5.139   1.00 0.00 ? 30  LYS A CB   3  
ATOM   6206  C  CG   . LYS A 1 30 ? 125.273 5.283   5.977   1.00 0.00 ? 30  LYS A CG   3  
ATOM   6207  C  CD   . LYS A 1 30 ? 124.359 5.523   7.180   1.00 0.00 ? 30  LYS A CD   3  
ATOM   6208  C  CE   . LYS A 1 30 ? 124.385 4.297   8.094   1.00 0.00 ? 30  LYS A CE   3  
ATOM   6209  N  NZ   . LYS A 1 30 ? 123.808 4.655   9.422   1.00 0.00 ? 30  LYS A NZ   3  
ATOM   6210  H  H    . LYS A 1 30 ? 126.086 8.388   3.517   1.00 0.00 ? 30  LYS A H    3  
ATOM   6211  H  HA   . LYS A 1 30 ? 127.189 5.946   4.217   1.00 0.00 ? 30  LYS A HA   3  
ATOM   6212  H  HB2  . LYS A 1 30 ? 125.805 7.349   5.727   1.00 0.00 ? 30  LYS A HB2  3  
ATOM   6213  H  HB3  . LYS A 1 30 ? 124.367 6.854   4.831   1.00 0.00 ? 30  LYS A HB3  3  
ATOM   6214  H  HG2  . LYS A 1 30 ? 124.870 4.482   5.373   1.00 0.00 ? 30  LYS A HG2  3  
ATOM   6215  H  HG3  . LYS A 1 30 ? 126.258 5.011   6.324   1.00 0.00 ? 30  LYS A HG3  3  
ATOM   6216  H  HD2  . LYS A 1 30 ? 124.704 6.388   7.727   1.00 0.00 ? 30  LYS A HD2  3  
ATOM   6217  H  HD3  . LYS A 1 30 ? 123.349 5.692   6.837   1.00 0.00 ? 30  LYS A HD3  3  
ATOM   6218  H  HE2  . LYS A 1 30 ? 123.799 3.505   7.650   1.00 0.00 ? 30  LYS A HE2  3  
ATOM   6219  H  HE3  . LYS A 1 30 ? 125.403 3.964   8.222   1.00 0.00 ? 30  LYS A HE3  3  
ATOM   6220  H  HZ1  . LYS A 1 30 ? 124.564 4.678   10.134  1.00 0.00 ? 30  LYS A HZ1  3  
ATOM   6221  H  HZ2  . LYS A 1 30 ? 123.096 3.946   9.692   1.00 0.00 ? 30  LYS A HZ2  3  
ATOM   6222  H  HZ3  . LYS A 1 30 ? 123.360 5.592   9.363   1.00 0.00 ? 30  LYS A HZ3  3  
ATOM   6223  N  N    . LYS A 1 31 ? 124.543 5.604   2.262   1.00 0.00 ? 31  LYS A N    3  
ATOM   6224  C  CA   . LYS A 1 31 ? 123.907 4.620   1.395   1.00 0.00 ? 31  LYS A CA   3  
ATOM   6225  C  C    . LYS A 1 31 ? 124.887 4.046   0.395   1.00 0.00 ? 31  LYS A C    3  
ATOM   6226  O  O    . LYS A 1 31 ? 124.939 2.832   0.175   1.00 0.00 ? 31  LYS A O    3  
ATOM   6227  C  CB   . LYS A 1 31 ? 122.818 5.267   0.548   1.00 0.00 ? 31  LYS A CB   3  
ATOM   6228  C  CG   . LYS A 1 31 ? 122.171 4.184   -0.330  1.00 0.00 ? 31  LYS A CG   3  
ATOM   6229  C  CD   . LYS A 1 31 ? 121.292 4.832   -1.379  1.00 0.00 ? 31  LYS A CD   3  
ATOM   6230  C  CE   . LYS A 1 31 ? 120.748 3.737   -2.286  1.00 0.00 ? 31  LYS A CE   3  
ATOM   6231  N  NZ   . LYS A 1 31 ? 119.779 2.893   -1.533  1.00 0.00 ? 31  LYS A NZ   3  
ATOM   6232  H  H    . LYS A 1 31 ? 124.246 6.538   2.253   1.00 0.00 ? 31  LYS A H    3  
ATOM   6233  H  HA   . LYS A 1 31 ? 123.476 3.830   1.987   1.00 0.00 ? 31  LYS A HA   3  
ATOM   6234  H  HB2  . LYS A 1 31 ? 122.071 5.709   1.192   1.00 0.00 ? 31  LYS A HB2  3  
ATOM   6235  H  HB3  . LYS A 1 31 ? 123.250 6.029   -0.083  1.00 0.00 ? 31  LYS A HB3  3  
ATOM   6236  H  HG2  . LYS A 1 31 ? 122.923 3.595   -0.828  1.00 0.00 ? 31  LYS A HG2  3  
ATOM   6237  H  HG3  . LYS A 1 31 ? 121.565 3.539   0.288   1.00 0.00 ? 31  LYS A HG3  3  
ATOM   6238  H  HD2  . LYS A 1 31 ? 120.480 5.367   -0.907  1.00 0.00 ? 31  LYS A HD2  3  
ATOM   6239  H  HD3  . LYS A 1 31 ? 121.897 5.510   -1.964  1.00 0.00 ? 31  LYS A HD3  3  
ATOM   6240  H  HE2  . LYS A 1 31 ? 120.257 4.185   -3.137  1.00 0.00 ? 31  LYS A HE2  3  
ATOM   6241  H  HE3  . LYS A 1 31 ? 121.578 3.125   -2.627  1.00 0.00 ? 31  LYS A HE3  3  
ATOM   6242  H  HZ1  . LYS A 1 31 ? 118.869 2.877   -2.034  1.00 0.00 ? 31  LYS A HZ1  3  
ATOM   6243  H  HZ2  . LYS A 1 31 ? 119.645 3.288   -0.579  1.00 0.00 ? 31  LYS A HZ2  3  
ATOM   6244  H  HZ3  . LYS A 1 31 ? 120.148 1.924   -1.457  1.00 0.00 ? 31  LYS A HZ3  3  
ATOM   6245  N  N    . GLU A 1 32 ? 125.618 4.934   -0.264  1.00 0.00 ? 32  GLU A N    3  
ATOM   6246  C  CA   . GLU A 1 32 ? 126.525 4.491   -1.295  1.00 0.00 ? 32  GLU A CA   3  
ATOM   6247  C  C    . GLU A 1 32 ? 127.585 3.590   -0.705  1.00 0.00 ? 32  GLU A C    3  
ATOM   6248  O  O    . GLU A 1 32 ? 127.977 2.588   -1.295  1.00 0.00 ? 32  GLU A O    3  
ATOM   6249  C  CB   . GLU A 1 32 ? 127.228 5.696   -1.922  1.00 0.00 ? 32  GLU A CB   3  
ATOM   6250  C  CG   . GLU A 1 32 ? 126.205 6.580   -2.636  1.00 0.00 ? 32  GLU A CG   3  
ATOM   6251  C  CD   . GLU A 1 32 ? 126.905 7.754   -3.317  1.00 0.00 ? 32  GLU A CD   3  
ATOM   6252  O  OE1  . GLU A 1 32 ? 128.074 7.976   -3.037  1.00 0.00 ? 32  GLU A OE1  3  
ATOM   6253  O  OE2  . GLU A 1 32 ? 126.264 8.410   -4.117  1.00 0.00 ? 32  GLU A OE2  3  
ATOM   6254  H  H    . GLU A 1 32 ? 125.504 5.891   -0.089  1.00 0.00 ? 32  GLU A H    3  
ATOM   6255  H  HA   . GLU A 1 32 ? 125.950 3.971   -2.061  1.00 0.00 ? 32  GLU A HA   3  
ATOM   6256  H  HB2  . GLU A 1 32 ? 127.725 6.261   -1.139  1.00 0.00 ? 32  GLU A HB2  3  
ATOM   6257  H  HB3  . GLU A 1 32 ? 127.962 5.350   -2.634  1.00 0.00 ? 32  GLU A HB3  3  
ATOM   6258  H  HG2  . GLU A 1 32 ? 125.685 5.994   -3.380  1.00 0.00 ? 32  GLU A HG2  3  
ATOM   6259  H  HG3  . GLU A 1 32 ? 125.493 6.956   -1.917  1.00 0.00 ? 32  GLU A HG3  3  
ATOM   6260  N  N    . LEU A 1 33 ? 128.041 3.971   0.475   1.00 0.00 ? 33  LEU A N    3  
ATOM   6261  C  CA   . LEU A 1 33 ? 129.063 3.215   1.161   1.00 0.00 ? 33  LEU A CA   3  
ATOM   6262  C  C    . LEU A 1 33 ? 128.536 1.820   1.481   1.00 0.00 ? 33  LEU A C    3  
ATOM   6263  O  O    . LEU A 1 33 ? 129.229 0.812   1.296   1.00 0.00 ? 33  LEU A O    3  
ATOM   6264  C  CB   . LEU A 1 33 ? 129.415 3.978   2.435   1.00 0.00 ? 33  LEU A CB   3  
ATOM   6265  C  CG   . LEU A 1 33 ? 130.697 3.435   3.059   1.00 0.00 ? 33  LEU A CG   3  
ATOM   6266  C  CD1  . LEU A 1 33 ? 131.363 4.556   3.854   1.00 0.00 ? 33  LEU A CD1  3  
ATOM   6267  C  CD2  . LEU A 1 33 ? 130.376 2.271   4.001   1.00 0.00 ? 33  LEU A CD2  3  
ATOM   6268  H  H    . LEU A 1 33 ? 127.684 4.783   0.890   1.00 0.00 ? 33  LEU A H    3  
ATOM   6269  H  HA   . LEU A 1 33 ? 129.937 3.140   0.530   1.00 0.00 ? 33  LEU A HA   3  
ATOM   6270  H  HB2  . LEU A 1 33 ? 129.549 5.023   2.190   1.00 0.00 ? 33  LEU A HB2  3  
ATOM   6271  H  HB3  . LEU A 1 33 ? 128.603 3.884   3.140   1.00 0.00 ? 33  LEU A HB3  3  
ATOM   6272  H  HG   . LEU A 1 33 ? 131.367 3.104   2.275   1.00 0.00 ? 33  LEU A HG   3  
ATOM   6273  H  HD11 . LEU A 1 33 ? 130.621 5.051   4.463   1.00 0.00 ? 33  LEU A HD11 3  
ATOM   6274  H  HD12 . LEU A 1 33 ? 131.799 5.269   3.168   1.00 0.00 ? 33  LEU A HD12 3  
ATOM   6275  H  HD13 . LEU A 1 33 ? 132.131 4.142   4.485   1.00 0.00 ? 33  LEU A HD13 3  
ATOM   6276  H  HD21 . LEU A 1 33 ? 129.569 2.551   4.663   1.00 0.00 ? 33  LEU A HD21 3  
ATOM   6277  H  HD22 . LEU A 1 33 ? 131.251 2.033   4.586   1.00 0.00 ? 33  LEU A HD22 3  
ATOM   6278  H  HD23 . LEU A 1 33 ? 130.086 1.409   3.422   1.00 0.00 ? 33  LEU A HD23 3  
ATOM   6279  N  N    . LYS A 1 34 ? 127.277 1.777   1.912   1.00 0.00 ? 34  LYS A N    3  
ATOM   6280  C  CA   . LYS A 1 34 ? 126.616 0.516   2.208   1.00 0.00 ? 34  LYS A CA   3  
ATOM   6281  C  C    . LYS A 1 34 ? 126.535 -0.374  0.987   1.00 0.00 ? 34  LYS A C    3  
ATOM   6282  O  O    . LYS A 1 34 ? 126.827 -1.568  1.052   1.00 0.00 ? 34  LYS A O    3  
ATOM   6283  C  CB   . LYS A 1 34 ? 125.218 0.824   2.770   1.00 0.00 ? 34  LYS A CB   3  
ATOM   6284  C  CG   . LYS A 1 34 ? 124.310 -0.415  2.759   1.00 0.00 ? 34  LYS A CG   3  
ATOM   6285  C  CD   . LYS A 1 34 ? 124.933 -1.553  3.546   1.00 0.00 ? 34  LYS A CD   3  
ATOM   6286  C  CE   . LYS A 1 34 ? 123.868 -2.610  3.863   1.00 0.00 ? 34  LYS A CE   3  
ATOM   6287  N  NZ   . LYS A 1 34 ? 122.682 -2.413  2.981   1.00 0.00 ? 34  LYS A NZ   3  
ATOM   6288  H  H    . LYS A 1 34 ? 126.772 2.616   2.001   1.00 0.00 ? 34  LYS A H    3  
ATOM   6289  H  HA   . LYS A 1 34 ? 127.181 0.002   2.970   1.00 0.00 ? 34  LYS A HA   3  
ATOM   6290  H  HB2  . LYS A 1 34 ? 125.324 1.167   3.791   1.00 0.00 ? 34  LYS A HB2  3  
ATOM   6291  H  HB3  . LYS A 1 34 ? 124.762 1.605   2.179   1.00 0.00 ? 34  LYS A HB3  3  
ATOM   6292  H  HG2  . LYS A 1 34 ? 123.359 -0.160  3.201   1.00 0.00 ? 34  LYS A HG2  3  
ATOM   6293  H  HG3  . LYS A 1 34 ? 124.151 -0.733  1.738   1.00 0.00 ? 34  LYS A HG3  3  
ATOM   6294  H  HD2  . LYS A 1 34 ? 125.698 -1.999  2.930   1.00 0.00 ? 34  LYS A HD2  3  
ATOM   6295  H  HD3  . LYS A 1 34 ? 125.366 -1.178  4.461   1.00 0.00 ? 34  LYS A HD3  3  
ATOM   6296  H  HE2  . LYS A 1 34 ? 124.277 -3.596  3.698   1.00 0.00 ? 34  LYS A HE2  3  
ATOM   6297  H  HE3  . LYS A 1 34 ? 123.565 -2.516  4.896   1.00 0.00 ? 34  LYS A HE3  3  
ATOM   6298  H  HZ1  . LYS A 1 34 ? 122.996 -2.302  1.996   1.00 0.00 ? 34  LYS A HZ1  3  
ATOM   6299  H  HZ2  . LYS A 1 34 ? 122.167 -1.560  3.280   1.00 0.00 ? 34  LYS A HZ2  3  
ATOM   6300  H  HZ3  . LYS A 1 34 ? 122.056 -3.240  3.051   1.00 0.00 ? 34  LYS A HZ3  3  
ATOM   6301  N  N    . GLU A 1 35 ? 126.149 0.202   -0.127  1.00 0.00 ? 35  GLU A N    3  
ATOM   6302  C  CA   . GLU A 1 35 ? 126.044 -0.572  -1.342  1.00 0.00 ? 35  GLU A CA   3  
ATOM   6303  C  C    . GLU A 1 35 ? 127.406 -1.052  -1.836  1.00 0.00 ? 35  GLU A C    3  
ATOM   6304  O  O    . GLU A 1 35 ? 127.522 -2.181  -2.307  1.00 0.00 ? 35  GLU A O    3  
ATOM   6305  C  CB   . GLU A 1 35 ? 125.323 0.271   -2.377  1.00 0.00 ? 35  GLU A CB   3  
ATOM   6306  C  CG   . GLU A 1 35 ? 123.895 0.489   -1.872  1.00 0.00 ? 35  GLU A CG   3  
ATOM   6307  C  CD   . GLU A 1 35 ? 123.127 -0.829  -1.860  1.00 0.00 ? 35  GLU A CD   3  
ATOM   6308  O  OE1  . GLU A 1 35 ? 123.583 -1.763  -2.500  1.00 0.00 ? 35  GLU A OE1  3  
ATOM   6309  O  OE2  . GLU A 1 35 ? 122.095 -0.886  -1.212  1.00 0.00 ? 35  GLU A OE2  3  
ATOM   6310  H  H    . GLU A 1 35 ? 125.929 1.162   -0.134  1.00 0.00 ? 35  GLU A H    3  
ATOM   6311  H  HA   . GLU A 1 35 ? 125.442 -1.443  -1.135  1.00 0.00 ? 35  GLU A HA   3  
ATOM   6312  H  HB2  . GLU A 1 35 ? 125.826 1.222   -2.490  1.00 0.00 ? 35  GLU A HB2  3  
ATOM   6313  H  HB3  . GLU A 1 35 ? 125.297 -0.248  -3.323  1.00 0.00 ? 35  GLU A HB3  3  
ATOM   6314  H  HG2  . GLU A 1 35 ? 123.946 0.862   -0.850  1.00 0.00 ? 35  GLU A HG2  3  
ATOM   6315  H  HG3  . GLU A 1 35 ? 123.386 1.205   -2.501  1.00 0.00 ? 35  GLU A HG3  3  
ATOM   6316  N  N    . LEU A 1 36 ? 128.447 -0.222  -1.715  1.00 0.00 ? 36  LEU A N    3  
ATOM   6317  C  CA   . LEU A 1 36 ? 129.767 -0.668  -2.156  1.00 0.00 ? 36  LEU A CA   3  
ATOM   6318  C  C    . LEU A 1 36 ? 130.295 -1.798  -1.291  1.00 0.00 ? 36  LEU A C    3  
ATOM   6319  O  O    . LEU A 1 36 ? 130.772 -2.795  -1.817  1.00 0.00 ? 36  LEU A O    3  
ATOM   6320  C  CB   . LEU A 1 36 ? 130.772 0.491   -2.154  1.00 0.00 ? 36  LEU A CB   3  
ATOM   6321  C  CG   . LEU A 1 36 ? 130.356 1.555   -3.174  1.00 0.00 ? 36  LEU A CG   3  
ATOM   6322  C  CD1  . LEU A 1 36 ? 131.398 2.676   -3.190  1.00 0.00 ? 36  LEU A CD1  3  
ATOM   6323  C  CD2  . LEU A 1 36 ? 130.278 0.920   -4.569  1.00 0.00 ? 36  LEU A CD2  3  
ATOM   6324  H  H    . LEU A 1 36 ? 128.331 0.668   -1.320  1.00 0.00 ? 36  LEU A H    3  
ATOM   6325  H  HA   . LEU A 1 36 ? 129.684 -1.042  -3.162  1.00 0.00 ? 36  LEU A HA   3  
ATOM   6326  H  HB2  . LEU A 1 36 ? 130.806 0.932   -1.169  1.00 0.00 ? 36  LEU A HB2  3  
ATOM   6327  H  HB3  . LEU A 1 36 ? 131.751 0.114   -2.411  1.00 0.00 ? 36  LEU A HB3  3  
ATOM   6328  H  HG   . LEU A 1 36 ? 129.395 1.959   -2.908  1.00 0.00 ? 36  LEU A HG   3  
ATOM   6329  H  HD11 . LEU A 1 36 ? 131.748 2.856   -2.183  1.00 0.00 ? 36  LEU A HD11 3  
ATOM   6330  H  HD12 . LEU A 1 36 ? 130.952 3.577   -3.583  1.00 0.00 ? 36  LEU A HD12 3  
ATOM   6331  H  HD13 . LEU A 1 36 ? 132.231 2.385   -3.813  1.00 0.00 ? 36  LEU A HD13 3  
ATOM   6332  H  HD21 . LEU A 1 36 ? 129.277 0.550   -4.740  1.00 0.00 ? 36  LEU A HD21 3  
ATOM   6333  H  HD22 . LEU A 1 36 ? 130.980 0.102   -4.638  1.00 0.00 ? 36  LEU A HD22 3  
ATOM   6334  H  HD23 . LEU A 1 36 ? 130.519 1.653   -5.317  1.00 0.00 ? 36  LEU A HD23 3  
ATOM   6335  N  N    . LEU A 1 37 ? 130.193 -1.674  0.030   1.00 0.00 ? 37  LEU A N    3  
ATOM   6336  C  CA   . LEU A 1 37 ? 130.674 -2.758  0.879   1.00 0.00 ? 37  LEU A CA   3  
ATOM   6337  C  C    . LEU A 1 37 ? 129.793 -3.986  0.724   1.00 0.00 ? 37  LEU A C    3  
ATOM   6338  O  O    . LEU A 1 37 ? 130.277 -5.116  0.655   1.00 0.00 ? 37  LEU A O    3  
ATOM   6339  C  CB   . LEU A 1 37 ? 130.681 -2.331  2.351   1.00 0.00 ? 37  LEU A CB   3  
ATOM   6340  C  CG   . LEU A 1 37 ? 131.577 -1.104  2.547   1.00 0.00 ? 37  LEU A CG   3  
ATOM   6341  C  CD1  . LEU A 1 37 ? 131.667 -0.782  4.039   1.00 0.00 ? 37  LEU A CD1  3  
ATOM   6342  C  CD2  . LEU A 1 37 ? 132.981 -1.398  2.014   1.00 0.00 ? 37  LEU A CD2  3  
ATOM   6343  H  H    . LEU A 1 37 ? 129.786 -0.869  0.428   1.00 0.00 ? 37  LEU A H    3  
ATOM   6344  H  HA   . LEU A 1 37 ? 131.678 -3.018  0.583   1.00 0.00 ? 37  LEU A HA   3  
ATOM   6345  H  HB2  . LEU A 1 37 ? 129.674 -2.090  2.657   1.00 0.00 ? 37  LEU A HB2  3  
ATOM   6346  H  HB3  . LEU A 1 37 ? 131.054 -3.144  2.956   1.00 0.00 ? 37  LEU A HB3  3  
ATOM   6347  H  HG   . LEU A 1 37 ? 131.155 -0.261  2.019   1.00 0.00 ? 37  LEU A HG   3  
ATOM   6348  H  HD11 . LEU A 1 37 ? 130.684 -0.548  4.419   1.00 0.00 ? 37  LEU A HD11 3  
ATOM   6349  H  HD12 . LEU A 1 37 ? 132.322 0.065   4.185   1.00 0.00 ? 37  LEU A HD12 3  
ATOM   6350  H  HD13 . LEU A 1 37 ? 132.063 -1.636  4.568   1.00 0.00 ? 37  LEU A HD13 3  
ATOM   6351  H  HD21 . LEU A 1 37 ? 133.002 -1.239  0.948   1.00 0.00 ? 37  LEU A HD21 3  
ATOM   6352  H  HD22 . LEU A 1 37 ? 133.241 -2.421  2.232   1.00 0.00 ? 37  LEU A HD22 3  
ATOM   6353  H  HD23 . LEU A 1 37 ? 133.691 -0.737  2.490   1.00 0.00 ? 37  LEU A HD23 3  
ATOM   6354  N  N    . GLN A 1 38 ? 128.493 -3.743  0.676   1.00 0.00 ? 38  GLN A N    3  
ATOM   6355  C  CA   . GLN A 1 38 ? 127.526 -4.818  0.547   1.00 0.00 ? 38  GLN A CA   3  
ATOM   6356  C  C    . GLN A 1 38 ? 127.660 -5.584  -0.760  1.00 0.00 ? 38  GLN A C    3  
ATOM   6357  O  O    . GLN A 1 38 ? 127.556 -6.811  -0.778  1.00 0.00 ? 38  GLN A O    3  
ATOM   6358  C  CB   . GLN A 1 38 ? 126.122 -4.234  0.669   1.00 0.00 ? 38  GLN A CB   3  
ATOM   6359  C  CG   . GLN A 1 38 ? 125.095 -5.355  0.662   1.00 0.00 ? 38  GLN A CG   3  
ATOM   6360  C  CD   . GLN A 1 38 ? 123.696 -4.788  0.868   1.00 0.00 ? 38  GLN A CD   3  
ATOM   6361  O  OE1  . GLN A 1 38 ? 123.542 -3.598  1.140   1.00 0.00 ? 38  GLN A OE1  3  
ATOM   6362  N  NE2  . GLN A 1 38 ? 122.661 -5.575  0.754   1.00 0.00 ? 38  GLN A NE2  3  
ATOM   6363  H  H    . GLN A 1 38 ? 128.175 -2.819  0.740   1.00 0.00 ? 38  GLN A H    3  
ATOM   6364  H  HA   . GLN A 1 38 ? 127.675 -5.508  1.359   1.00 0.00 ? 38  GLN A HA   3  
ATOM   6365  H  HB2  . GLN A 1 38 ? 126.046 -3.689  1.590   1.00 0.00 ? 38  GLN A HB2  3  
ATOM   6366  H  HB3  . GLN A 1 38 ? 125.933 -3.570  -0.161  1.00 0.00 ? 38  GLN A HB3  3  
ATOM   6367  H  HG2  . GLN A 1 38 ? 125.138 -5.849  -0.284  1.00 0.00 ? 38  GLN A HG2  3  
ATOM   6368  H  HG3  . GLN A 1 38 ? 125.322 -6.059  1.445   1.00 0.00 ? 38  GLN A HG3  3  
ATOM   6369  H  HE21 . GLN A 1 38 ? 122.786 -6.522  0.538   1.00 0.00 ? 38  GLN A HE21 3  
ATOM   6370  H  HE22 . GLN A 1 38 ? 121.757 -5.217  0.885   1.00 0.00 ? 38  GLN A HE22 3  
ATOM   6371  N  N    . THR A 1 39 ? 127.868 -4.867  -1.855  1.00 0.00 ? 39  THR A N    3  
ATOM   6372  C  CA   . THR A 1 39 ? 127.984 -5.523  -3.146  1.00 0.00 ? 39  THR A CA   3  
ATOM   6373  C  C    . THR A 1 39 ? 129.403 -6.015  -3.423  1.00 0.00 ? 39  THR A C    3  
ATOM   6374  O  O    . THR A 1 39 ? 129.593 -7.134  -3.899  1.00 0.00 ? 39  THR A O    3  
ATOM   6375  C  CB   . THR A 1 39 ? 127.531 -4.573  -4.263  1.00 0.00 ? 39  THR A CB   3  
ATOM   6376  O  OG1  . THR A 1 39 ? 127.189 -5.332  -5.414  1.00 0.00 ? 39  THR A OG1  3  
ATOM   6377  C  CG2  . THR A 1 39 ? 128.656 -3.597  -4.612  1.00 0.00 ? 39  THR A CG2  3  
ATOM   6378  H  H    . THR A 1 39 ? 127.929 -3.891  -1.795  1.00 0.00 ? 39  THR A H    3  
ATOM   6379  H  HA   . THR A 1 39 ? 127.322 -6.378  -3.145  1.00 0.00 ? 39  THR A HA   3  
ATOM   6380  H  HB   . THR A 1 39 ? 126.668 -4.016  -3.931  1.00 0.00 ? 39  THR A HB   3  
ATOM   6381  H  HG1  . THR A 1 39 ? 127.059 -4.721  -6.143  1.00 0.00 ? 39  THR A HG1  3  
ATOM   6382  H  HG21 . THR A 1 39 ? 129.448 -4.125  -5.123  1.00 0.00 ? 39  THR A HG21 3  
ATOM   6383  H  HG22 . THR A 1 39 ? 129.042 -3.157  -3.707  1.00 0.00 ? 39  THR A HG22 3  
ATOM   6384  H  HG23 . THR A 1 39 ? 128.270 -2.819  -5.254  1.00 0.00 ? 39  THR A HG23 3  
ATOM   6385  N  N    . GLU A 1 40 ? 130.397 -5.168  -3.156  1.00 0.00 ? 40  GLU A N    3  
ATOM   6386  C  CA   . GLU A 1 40 ? 131.781 -5.548  -3.426  1.00 0.00 ? 40  GLU A CA   3  
ATOM   6387  C  C    . GLU A 1 40 ? 132.263 -6.591  -2.433  1.00 0.00 ? 40  GLU A C    3  
ATOM   6388  O  O    . GLU A 1 40 ? 133.040 -7.481  -2.775  1.00 0.00 ? 40  GLU A O    3  
ATOM   6389  C  CB   . GLU A 1 40 ? 132.683 -4.325  -3.276  1.00 0.00 ? 40  GLU A CB   3  
ATOM   6390  C  CG   . GLU A 1 40 ? 132.290 -3.250  -4.288  1.00 0.00 ? 40  GLU A CG   3  
ATOM   6391  C  CD   . GLU A 1 40 ? 133.216 -2.054  -4.134  1.00 0.00 ? 40  GLU A CD   3  
ATOM   6392  O  OE1  . GLU A 1 40 ? 133.910 -2.004  -3.134  1.00 0.00 ? 40  GLU A OE1  3  
ATOM   6393  O  OE2  . GLU A 1 40 ? 133.201 -1.197  -5.003  1.00 0.00 ? 40  GLU A OE2  3  
ATOM   6394  H  H    . GLU A 1 40 ? 130.196 -4.280  -2.794  1.00 0.00 ? 40  GLU A H    3  
ATOM   6395  H  HA   . GLU A 1 40 ? 131.866 -5.932  -4.430  1.00 0.00 ? 40  GLU A HA   3  
ATOM   6396  H  HB2  . GLU A 1 40 ? 132.601 -3.935  -2.276  1.00 0.00 ? 40  GLU A HB2  3  
ATOM   6397  H  HB3  . GLU A 1 40 ? 133.706 -4.619  -3.456  1.00 0.00 ? 40  GLU A HB3  3  
ATOM   6398  H  HG2  . GLU A 1 40 ? 132.375 -3.644  -5.286  1.00 0.00 ? 40  GLU A HG2  3  
ATOM   6399  H  HG3  . GLU A 1 40 ? 131.273 -2.940  -4.108  1.00 0.00 ? 40  GLU A HG3  3  
ATOM   6400  N  N    . LEU A 1 41 ? 131.795 -6.461  -1.196  1.00 0.00 ? 41  LEU A N    3  
ATOM   6401  C  CA   . LEU A 1 41 ? 132.181 -7.374  -0.131  1.00 0.00 ? 41  LEU A CA   3  
ATOM   6402  C  C    . LEU A 1 41 ? 130.959 -8.050  0.472   1.00 0.00 ? 41  LEU A C    3  
ATOM   6403  O  O    . LEU A 1 41 ? 130.820 -8.119  1.694   1.00 0.00 ? 41  LEU A O    3  
ATOM   6404  C  CB   . LEU A 1 41 ? 132.939 -6.608  0.951   1.00 0.00 ? 41  LEU A CB   3  
ATOM   6405  C  CG   . LEU A 1 41 ? 134.141 -5.883  0.341   1.00 0.00 ? 41  LEU A CG   3  
ATOM   6406  C  CD1  . LEU A 1 41 ? 134.929 -5.188  1.454   1.00 0.00 ? 41  LEU A CD1  3  
ATOM   6407  C  CD2  . LEU A 1 41 ? 135.050 -6.894  -0.364  1.00 0.00 ? 41  LEU A CD2  3  
ATOM   6408  H  H    . LEU A 1 41 ? 131.179 -5.722  -0.988  1.00 0.00 ? 41  LEU A H    3  
ATOM   6409  H  HA   . LEU A 1 41 ? 132.831 -8.135  -0.536  1.00 0.00 ? 41  LEU A HA   3  
ATOM   6410  H  HB2  . LEU A 1 41 ? 132.283 -5.884  1.402   1.00 0.00 ? 41  LEU A HB2  3  
ATOM   6411  H  HB3  . LEU A 1 41 ? 133.283 -7.301  1.697   1.00 0.00 ? 41  LEU A HB3  3  
ATOM   6412  H  HG   . LEU A 1 41 ? 133.796 -5.145  -0.370  1.00 0.00 ? 41  LEU A HG   3  
ATOM   6413  H  HD11 . LEU A 1 41 ? 135.157 -5.901  2.233   1.00 0.00 ? 41  LEU A HD11 3  
ATOM   6414  H  HD12 . LEU A 1 41 ? 134.341 -4.383  1.865   1.00 0.00 ? 41  LEU A HD12 3  
ATOM   6415  H  HD13 . LEU A 1 41 ? 135.850 -4.792  1.051   1.00 0.00 ? 41  LEU A HD13 3  
ATOM   6416  H  HD21 . LEU A 1 41 ? 134.738 -7.006  -1.387  1.00 0.00 ? 41  LEU A HD21 3  
ATOM   6417  H  HD22 . LEU A 1 41 ? 134.988 -7.847  0.139   1.00 0.00 ? 41  LEU A HD22 3  
ATOM   6418  H  HD23 . LEU A 1 41 ? 136.069 -6.539  -0.340  1.00 0.00 ? 41  LEU A HD23 3  
ATOM   6419  N  N    . SER A 1 42 ? 130.072 -8.541  -0.381  1.00 0.00 ? 42  SER A N    3  
ATOM   6420  C  CA   . SER A 1 42 ? 128.866 -9.195  0.099   1.00 0.00 ? 42  SER A CA   3  
ATOM   6421  C  C    . SER A 1 42 ? 129.238 -10.360 1.003   1.00 0.00 ? 42  SER A C    3  
ATOM   6422  O  O    . SER A 1 42 ? 128.461 -10.758 1.868   1.00 0.00 ? 42  SER A O    3  
ATOM   6423  C  CB   . SER A 1 42 ? 128.037 -9.701  -1.082  1.00 0.00 ? 42  SER A CB   3  
ATOM   6424  O  OG   . SER A 1 42 ? 128.734 -10.761 -1.724  1.00 0.00 ? 42  SER A OG   3  
ATOM   6425  H  H    . SER A 1 42 ? 130.228 -8.455  -1.345  1.00 0.00 ? 42  SER A H    3  
ATOM   6426  H  HA   . SER A 1 42 ? 128.278 -8.484  0.661   1.00 0.00 ? 42  SER A HA   3  
ATOM   6427  H  HB2  . SER A 1 42 ? 127.088 -10.066 -0.727  1.00 0.00 ? 42  SER A HB2  3  
ATOM   6428  H  HB3  . SER A 1 42 ? 127.871 -8.890  -1.779  1.00 0.00 ? 42  SER A HB3  3  
ATOM   6429  H  HG   . SER A 1 42 ? 128.390 -11.590 -1.387  1.00 0.00 ? 42  SER A HG   3  
ATOM   6430  N  N    . GLY A 1 43 ? 130.433 -10.898 0.794   1.00 0.00 ? 43  GLY A N    3  
ATOM   6431  C  CA   . GLY A 1 43 ? 130.908 -12.018 1.595   1.00 0.00 ? 43  GLY A CA   3  
ATOM   6432  C  C    . GLY A 1 43 ? 131.598 -11.546 2.878   1.00 0.00 ? 43  GLY A C    3  
ATOM   6433  O  O    . GLY A 1 43 ? 131.102 -11.781 3.980   1.00 0.00 ? 43  GLY A O    3  
ATOM   6434  H  H    . GLY A 1 43 ? 131.008 -10.535 0.088   1.00 0.00 ? 43  GLY A H    3  
ATOM   6435  H  HA2  . GLY A 1 43 ? 130.068 -12.644 1.857   1.00 0.00 ? 43  GLY A HA2  3  
ATOM   6436  H  HA3  . GLY A 1 43 ? 131.609 -12.595 1.012   1.00 0.00 ? 43  GLY A HA3  3  
ATOM   6437  N  N    . PHE A 1 44 ? 132.760 -10.910 2.730   1.00 0.00 ? 44  PHE A N    3  
ATOM   6438  C  CA   . PHE A 1 44 ? 133.527 -10.447 3.890   1.00 0.00 ? 44  PHE A CA   3  
ATOM   6439  C  C    . PHE A 1 44 ? 132.723 -9.487  4.778   1.00 0.00 ? 44  PHE A C    3  
ATOM   6440  O  O    . PHE A 1 44 ? 132.742 -9.600  6.004   1.00 0.00 ? 44  PHE A O    3  
ATOM   6441  C  CB   . PHE A 1 44 ? 134.795 -9.744  3.404   1.00 0.00 ? 44  PHE A CB   3  
ATOM   6442  C  CG   . PHE A 1 44 ? 135.697 -10.751 2.733   1.00 0.00 ? 44  PHE A CG   3  
ATOM   6443  C  CD1  . PHE A 1 44 ? 136.568 -11.534 3.499   1.00 0.00 ? 44  PHE A CD1  3  
ATOM   6444  C  CD2  . PHE A 1 44 ? 135.662 -10.903 1.341   1.00 0.00 ? 44  PHE A CD2  3  
ATOM   6445  C  CE1  . PHE A 1 44 ? 137.402 -12.470 2.876   1.00 0.00 ? 44  PHE A CE1  3  
ATOM   6446  C  CE2  . PHE A 1 44 ? 136.497 -11.837 0.717   1.00 0.00 ? 44  PHE A CE2  3  
ATOM   6447  C  CZ   . PHE A 1 44 ? 137.367 -12.620 1.484   1.00 0.00 ? 44  PHE A CZ   3  
ATOM   6448  H  H    . PHE A 1 44 ? 133.121 -10.770 1.829   1.00 0.00 ? 44  PHE A H    3  
ATOM   6449  H  HA   . PHE A 1 44 ? 133.821 -11.301 4.471   1.00 0.00 ? 44  PHE A HA   3  
ATOM   6450  H  HB2  . PHE A 1 44 ? 134.531 -8.970  2.699   1.00 0.00 ? 44  PHE A HB2  3  
ATOM   6451  H  HB3  . PHE A 1 44 ? 135.310 -9.305  4.246   1.00 0.00 ? 44  PHE A HB3  3  
ATOM   6452  H  HD1  . PHE A 1 44 ? 136.595 -11.417 4.572   1.00 0.00 ? 44  PHE A HD1  3  
ATOM   6453  H  HD2  . PHE A 1 44 ? 134.991 -10.298 0.749   1.00 0.00 ? 44  PHE A HD2  3  
ATOM   6454  H  HE1  . PHE A 1 44 ? 138.074 -13.073 3.468   1.00 0.00 ? 44  PHE A HE1  3  
ATOM   6455  H  HE2  . PHE A 1 44 ? 136.470 -11.954 -0.357  1.00 0.00 ? 44  PHE A HE2  3  
ATOM   6456  H  HZ   . PHE A 1 44 ? 138.011 -13.342 1.003   1.00 0.00 ? 44  PHE A HZ   3  
ATOM   6457  N  N    . LEU A 1 45 ? 132.019 -8.550  4.152   1.00 0.00 ? 45  LEU A N    3  
ATOM   6458  C  CA   . LEU A 1 45 ? 131.206 -7.569  4.880   1.00 0.00 ? 45  LEU A CA   3  
ATOM   6459  C  C    . LEU A 1 45 ? 129.771 -8.047  5.074   1.00 0.00 ? 45  LEU A C    3  
ATOM   6460  O  O    . LEU A 1 45 ? 128.964 -7.329  5.662   1.00 0.00 ? 45  LEU A O    3  
ATOM   6461  C  CB   . LEU A 1 45 ? 131.194 -6.201  4.182   1.00 0.00 ? 45  LEU A CB   3  
ATOM   6462  C  CG   . LEU A 1 45 ? 132.546 -5.444  4.312   1.00 0.00 ? 45  LEU A CG   3  
ATOM   6463  C  CD1  . LEU A 1 45 ? 132.459 -4.442  5.466   1.00 0.00 ? 45  LEU A CD1  3  
ATOM   6464  C  CD2  . LEU A 1 45 ? 133.739 -6.381  4.577   1.00 0.00 ? 45  LEU A CD2  3  
ATOM   6465  H  H    . LEU A 1 45 ? 132.042 -8.512  3.171   1.00 0.00 ? 45  LEU A H    3  
ATOM   6466  H  HA   . LEU A 1 45 ? 131.632 -7.442  5.860   1.00 0.00 ? 45  LEU A HA   3  
ATOM   6467  H  HB2  . LEU A 1 45 ? 130.974 -6.349  3.139   1.00 0.00 ? 45  LEU A HB2  3  
ATOM   6468  H  HB3  . LEU A 1 45 ? 130.408 -5.599  4.616   1.00 0.00 ? 45  LEU A HB3  3  
ATOM   6469  H  HG   . LEU A 1 45 ? 132.725 -4.896  3.397   1.00 0.00 ? 45  LEU A HG   3  
ATOM   6470  H  HD11 . LEU A 1 45 ? 132.317 -4.975  6.395   1.00 0.00 ? 45  LEU A HD11 3  
ATOM   6471  H  HD12 . LEU A 1 45 ? 131.624 -3.776  5.302   1.00 0.00 ? 45  LEU A HD12 3  
ATOM   6472  H  HD13 . LEU A 1 45 ? 133.373 -3.869  5.516   1.00 0.00 ? 45  LEU A HD13 3  
ATOM   6473  H  HD21 . LEU A 1 45 ? 134.655 -5.817  4.480   1.00 0.00 ? 45  LEU A HD21 3  
ATOM   6474  H  HD22 . LEU A 1 45 ? 133.747 -7.180  3.864   1.00 0.00 ? 45  LEU A HD22 3  
ATOM   6475  H  HD23 . LEU A 1 45 ? 133.680 -6.783  5.574   1.00 0.00 ? 45  LEU A HD23 3  
ATOM   6476  N  N    . ASP A 1 46 ? 129.443 -9.223  4.532   1.00 0.00 ? 46  ASP A N    3  
ATOM   6477  C  CA   . ASP A 1 46 ? 128.072 -9.745  4.610   1.00 0.00 ? 46  ASP A CA   3  
ATOM   6478  C  C    . ASP A 1 46 ? 127.327 -9.167  5.812   1.00 0.00 ? 46  ASP A C    3  
ATOM   6479  O  O    . ASP A 1 46 ? 127.663 -9.432  6.966   1.00 0.00 ? 46  ASP A O    3  
ATOM   6480  C  CB   . ASP A 1 46 ? 128.106 -11.270 4.732   1.00 0.00 ? 46  ASP A CB   3  
ATOM   6481  C  CG   . ASP A 1 46 ? 126.690 -11.830 4.656   1.00 0.00 ? 46  ASP A CG   3  
ATOM   6482  O  OD1  . ASP A 1 46 ? 125.779 -11.054 4.413   1.00 0.00 ? 46  ASP A OD1  3  
ATOM   6483  O  OD2  . ASP A 1 46 ? 126.536 -13.025 4.843   1.00 0.00 ? 46  ASP A OD2  3  
ATOM   6484  H  H    . ASP A 1 46 ? 130.121 -9.729  4.038   1.00 0.00 ? 46  ASP A H    3  
ATOM   6485  H  HA   . ASP A 1 46 ? 127.544 -9.479  3.707   1.00 0.00 ? 46  ASP A HA   3  
ATOM   6486  H  HB2  . ASP A 1 46 ? 128.699 -11.684 3.931   1.00 0.00 ? 46  ASP A HB2  3  
ATOM   6487  H  HB3  . ASP A 1 46 ? 128.546 -11.543 5.679   1.00 0.00 ? 46  ASP A HB3  3  
ATOM   6488  N  N    . ALA A 1 47 ? 126.323 -8.350  5.503   1.00 0.00 ? 47  ALA A N    3  
ATOM   6489  C  CA   . ALA A 1 47 ? 125.513 -7.684  6.517   1.00 0.00 ? 47  ALA A CA   3  
ATOM   6490  C  C    . ALA A 1 47 ? 124.752 -8.678  7.383   1.00 0.00 ? 47  ALA A C    3  
ATOM   6491  O  O    . ALA A 1 47 ? 124.423 -8.381  8.532   1.00 0.00 ? 47  ALA A O    3  
ATOM   6492  C  CB   . ALA A 1 47 ? 124.520 -6.736  5.844   1.00 0.00 ? 47  ALA A CB   3  
ATOM   6493  H  H    . ALA A 1 47 ? 126.130 -8.177  4.558   1.00 0.00 ? 47  ALA A H    3  
ATOM   6494  H  HA   . ALA A 1 47 ? 126.164 -7.101  7.151   1.00 0.00 ? 47  ALA A HA   3  
ATOM   6495  H  HB1  . ALA A 1 47 ? 124.266 -5.936  6.524   1.00 0.00 ? 47  ALA A HB1  3  
ATOM   6496  H  HB2  . ALA A 1 47 ? 123.625 -7.279  5.579   1.00 0.00 ? 47  ALA A HB2  3  
ATOM   6497  H  HB3  . ALA A 1 47 ? 124.966 -6.321  4.952   1.00 0.00 ? 47  ALA A HB3  3  
ATOM   6498  N  N    . GLN A 1 48 ? 124.450 -9.848  6.834   1.00 0.00 ? 48  GLN A N    3  
ATOM   6499  C  CA   . GLN A 1 48 ? 123.699 -10.838 7.592   1.00 0.00 ? 48  GLN A CA   3  
ATOM   6500  C  C    . GLN A 1 48 ? 124.414 -11.159 8.898   1.00 0.00 ? 48  GLN A C    3  
ATOM   6501  O  O    . GLN A 1 48 ? 123.772 -11.355 9.930   1.00 0.00 ? 48  GLN A O    3  
ATOM   6502  C  CB   . GLN A 1 48 ? 123.538 -12.116 6.767   1.00 0.00 ? 48  GLN A CB   3  
ATOM   6503  C  CG   . GLN A 1 48 ? 122.685 -11.824 5.531   1.00 0.00 ? 48  GLN A CG   3  
ATOM   6504  C  CD   . GLN A 1 48 ? 122.560 -13.080 4.675   1.00 0.00 ? 48  GLN A CD   3  
ATOM   6505  O  OE1  . GLN A 1 48 ? 123.333 -14.024 4.840   1.00 0.00 ? 48  GLN A OE1  3  
ATOM   6506  N  NE2  . GLN A 1 48 ? 121.628 -13.148 3.765   1.00 0.00 ? 48  GLN A NE2  3  
ATOM   6507  H  H    . GLN A 1 48 ? 124.715 -10.037 5.910   1.00 0.00 ? 48  GLN A H    3  
ATOM   6508  H  HA   . GLN A 1 48 ? 122.720 -10.441 7.815   1.00 0.00 ? 48  GLN A HA   3  
ATOM   6509  H  HB2  . GLN A 1 48 ? 124.511 -12.470 6.459   1.00 0.00 ? 48  GLN A HB2  3  
ATOM   6510  H  HB3  . GLN A 1 48 ? 123.053 -12.872 7.366   1.00 0.00 ? 48  GLN A HB3  3  
ATOM   6511  H  HG2  . GLN A 1 48 ? 121.701 -11.504 5.843   1.00 0.00 ? 48  GLN A HG2  3  
ATOM   6512  H  HG3  . GLN A 1 48 ? 123.150 -11.041 4.951   1.00 0.00 ? 48  GLN A HG3  3  
ATOM   6513  H  HE21 . GLN A 1 48 ? 121.014 -12.396 3.635   1.00 0.00 ? 48  GLN A HE21 3  
ATOM   6514  H  HE22 . GLN A 1 48 ? 121.542 -13.951 3.210   1.00 0.00 ? 48  GLN A HE22 3  
ATOM   6515  N  N    . LYS A 1 49 ? 125.743 -11.191 8.862   1.00 0.00 ? 49  LYS A N    3  
ATOM   6516  C  CA   . LYS A 1 49 ? 126.504 -11.465 10.074  1.00 0.00 ? 49  LYS A CA   3  
ATOM   6517  C  C    . LYS A 1 49 ? 126.192 -10.381 11.089  1.00 0.00 ? 49  LYS A C    3  
ATOM   6518  O  O    . LYS A 1 49 ? 126.034 -10.635 12.283  1.00 0.00 ? 49  LYS A O    3  
ATOM   6519  C  CB   . LYS A 1 49 ? 128.000 -11.417 9.765   1.00 0.00 ? 49  LYS A CB   3  
ATOM   6520  C  CG   . LYS A 1 49 ? 128.330 -12.360 8.609   1.00 0.00 ? 49  LYS A CG   3  
ATOM   6521  C  CD   . LYS A 1 49 ? 128.035 -13.810 8.984   1.00 0.00 ? 49  LYS A CD   3  
ATOM   6522  C  CE   . LYS A 1 49 ? 128.534 -14.698 7.855   1.00 0.00 ? 49  LYS A CE   3  
ATOM   6523  N  NZ   . LYS A 1 49 ? 128.503 -16.124 8.285   1.00 0.00 ? 49  LYS A NZ   3  
ATOM   6524  H  H    . LYS A 1 49 ? 126.213 -11.012 8.021   1.00 0.00 ? 49  LYS A H    3  
ATOM   6525  H  HA   . LYS A 1 49 ? 126.237 -12.426 10.479  1.00 0.00 ? 49  LYS A HA   3  
ATOM   6526  H  HB2  . LYS A 1 49 ? 128.277 -10.408 9.494   1.00 0.00 ? 49  LYS A HB2  3  
ATOM   6527  H  HB3  . LYS A 1 49 ? 128.556 -11.718 10.640  1.00 0.00 ? 49  LYS A HB3  3  
ATOM   6528  H  HG2  . LYS A 1 49 ? 127.735 -12.088 7.749   1.00 0.00 ? 49  LYS A HG2  3  
ATOM   6529  H  HG3  . LYS A 1 49 ? 129.377 -12.263 8.361   1.00 0.00 ? 49  LYS A HG3  3  
ATOM   6530  H  HD2  . LYS A 1 49 ? 128.542 -14.062 9.903   1.00 0.00 ? 49  LYS A HD2  3  
ATOM   6531  H  HD3  . LYS A 1 49 ? 126.973 -13.953 9.099   1.00 0.00 ? 49  LYS A HD3  3  
ATOM   6532  H  HE2  . LYS A 1 49 ? 127.896 -14.561 6.995   1.00 0.00 ? 49  LYS A HE2  3  
ATOM   6533  H  HE3  . LYS A 1 49 ? 129.543 -14.414 7.603   1.00 0.00 ? 49  LYS A HE3  3  
ATOM   6534  H  HZ1  . LYS A 1 49 ? 129.156 -16.261 9.081   1.00 0.00 ? 49  LYS A HZ1  3  
ATOM   6535  H  HZ2  . LYS A 1 49 ? 128.792 -16.731 7.490   1.00 0.00 ? 49  LYS A HZ2  3  
ATOM   6536  H  HZ3  . LYS A 1 49 ? 127.539 -16.377 8.581   1.00 0.00 ? 49  LYS A HZ3  3  
ATOM   6537  N  N    . ASP A 1 50 ? 126.100 -9.165  10.571  1.00 0.00 ? 50  ASP A N    3  
ATOM   6538  C  CA   . ASP A 1 50 ? 125.798 -7.994  11.390  1.00 0.00 ? 50  ASP A CA   3  
ATOM   6539  C  C    . ASP A 1 50 ? 125.200 -6.868  10.554  1.00 0.00 ? 50  ASP A C    3  
ATOM   6540  O  O    . ASP A 1 50 ? 125.935 -6.068  9.983   1.00 0.00 ? 50  ASP A O    3  
ATOM   6541  C  CB   . ASP A 1 50 ? 127.066 -7.465  12.064  1.00 0.00 ? 50  ASP A CB   3  
ATOM   6542  C  CG   . ASP A 1 50 ? 126.716 -6.269  12.938  1.00 0.00 ? 50  ASP A CG   3  
ATOM   6543  O  OD1  . ASP A 1 50 ? 125.551 -5.913  12.970  1.00 0.00 ? 50  ASP A OD1  3  
ATOM   6544  O  OD2  . ASP A 1 50 ? 127.613 -5.726  13.559  1.00 0.00 ? 50  ASP A OD2  3  
ATOM   6545  H  H    . ASP A 1 50 ? 126.240 -9.058  9.603   1.00 0.00 ? 50  ASP A H    3  
ATOM   6546  H  HA   . ASP A 1 50 ? 125.092 -8.277  12.154  1.00 0.00 ? 50  ASP A HA   3  
ATOM   6547  H  HB2  . ASP A 1 50 ? 127.505 -8.227  12.678  1.00 0.00 ? 50  ASP A HB2  3  
ATOM   6548  H  HB3  . ASP A 1 50 ? 127.769 -7.168  11.309  1.00 0.00 ? 50  ASP A HB3  3  
ATOM   6549  N  N    . VAL A 1 51 ? 123.883 -6.766  10.499  1.00 0.00 ? 51  VAL A N    3  
ATOM   6550  C  CA   . VAL A 1 51 ? 123.284 -5.674  9.744   1.00 0.00 ? 51  VAL A CA   3  
ATOM   6551  C  C    . VAL A 1 51 ? 123.742 -4.356  10.363  1.00 0.00 ? 51  VAL A C    3  
ATOM   6552  O  O    . VAL A 1 51 ? 124.063 -3.392  9.666   1.00 0.00 ? 51  VAL A O    3  
ATOM   6553  C  CB   . VAL A 1 51 ? 121.758 -5.771  9.788   1.00 0.00 ? 51  VAL A CB   3  
ATOM   6554  C  CG1  . VAL A 1 51 ? 121.148 -4.522  9.149   1.00 0.00 ? 51  VAL A CG1  3  
ATOM   6555  C  CG2  . VAL A 1 51 ? 121.303 -7.011  9.016   1.00 0.00 ? 51  VAL A CG2  3  
ATOM   6556  H  H    . VAL A 1 51 ? 123.315 -7.402  10.984  1.00 0.00 ? 51  VAL A H    3  
ATOM   6557  H  HA   . VAL A 1 51 ? 123.618 -5.724  8.717   1.00 0.00 ? 51  VAL A HA   3  
ATOM   6558  H  HB   . VAL A 1 51 ? 121.432 -5.844  10.816  1.00 0.00 ? 51  VAL A HB   3  
ATOM   6559  H  HG11 . VAL A 1 51 ? 121.629 -4.330  8.201   1.00 0.00 ? 51  VAL A HG11 3  
ATOM   6560  H  HG12 . VAL A 1 51 ? 121.293 -3.675  9.803   1.00 0.00 ? 51  VAL A HG12 3  
ATOM   6561  H  HG13 . VAL A 1 51 ? 120.090 -4.678  8.991   1.00 0.00 ? 51  VAL A HG13 3  
ATOM   6562  H  HG21 . VAL A 1 51 ? 121.956 -7.839  9.250   1.00 0.00 ? 51  VAL A HG21 3  
ATOM   6563  H  HG22 . VAL A 1 51 ? 121.342 -6.810  7.956   1.00 0.00 ? 51  VAL A HG22 3  
ATOM   6564  H  HG23 . VAL A 1 51 ? 120.291 -7.260  9.299   1.00 0.00 ? 51  VAL A HG23 3  
ATOM   6565  N  N    . ASP A 1 52 ? 123.776 -4.352  11.691  1.00 0.00 ? 52  ASP A N    3  
ATOM   6566  C  CA   . ASP A 1 52 ? 124.204 -3.196  12.476  1.00 0.00 ? 52  ASP A CA   3  
ATOM   6567  C  C    . ASP A 1 52 ? 125.651 -2.790  12.179  1.00 0.00 ? 52  ASP A C    3  
ATOM   6568  O  O    . ASP A 1 52 ? 126.023 -1.633  12.373  1.00 0.00 ? 52  ASP A O    3  
ATOM   6569  C  CB   . ASP A 1 52 ? 124.054 -3.490  13.971  1.00 0.00 ? 52  ASP A CB   3  
ATOM   6570  C  CG   . ASP A 1 52 ? 124.270 -2.212  14.776  1.00 0.00 ? 52  ASP A CG   3  
ATOM   6571  O  OD1  . ASP A 1 52 ? 124.414 -1.167  14.162  1.00 0.00 ? 52  ASP A OD1  3  
ATOM   6572  O  OD2  . ASP A 1 52 ? 124.288 -2.297  15.992  1.00 0.00 ? 52  ASP A OD2  3  
ATOM   6573  H  H    . ASP A 1 52 ? 123.514 -5.167  12.167  1.00 0.00 ? 52  ASP A H    3  
ATOM   6574  H  HA   . ASP A 1 52 ? 123.561 -2.364  12.231  1.00 0.00 ? 52  ASP A HA   3  
ATOM   6575  H  HB2  . ASP A 1 52 ? 123.062 -3.872  14.164  1.00 0.00 ? 52  ASP A HB2  3  
ATOM   6576  H  HB3  . ASP A 1 52 ? 124.784 -4.224  14.270  1.00 0.00 ? 52  ASP A HB3  3  
ATOM   6577  N  N    . ALA A 1 53 ? 126.485 -3.752  11.778  1.00 0.00 ? 53  ALA A N    3  
ATOM   6578  C  CA   . ALA A 1 53 ? 127.903 -3.462  11.550  1.00 0.00 ? 53  ALA A CA   3  
ATOM   6579  C  C    . ALA A 1 53 ? 128.104 -2.271  10.610  1.00 0.00 ? 53  ALA A C    3  
ATOM   6580  O  O    . ALA A 1 53 ? 129.088 -1.542  10.742  1.00 0.00 ? 53  ALA A O    3  
ATOM   6581  C  CB   . ALA A 1 53 ? 128.622 -4.672  10.949  1.00 0.00 ? 53  ALA A CB   3  
ATOM   6582  H  H    . ALA A 1 53 ? 126.156 -4.671  11.687  1.00 0.00 ? 53  ALA A H    3  
ATOM   6583  H  HA   . ALA A 1 53 ? 128.357 -3.251  12.502  1.00 0.00 ? 53  ALA A HA   3  
ATOM   6584  H  HB1  . ALA A 1 53 ? 129.500 -4.342  10.410  1.00 0.00 ? 53  ALA A HB1  3  
ATOM   6585  H  HB2  . ALA A 1 53 ? 127.964 -5.185  10.272  1.00 0.00 ? 53  ALA A HB2  3  
ATOM   6586  H  HB3  . ALA A 1 53 ? 128.925 -5.336  11.742  1.00 0.00 ? 53  ALA A HB3  3  
ATOM   6587  N  N    . VAL A 1 54 ? 127.196 -2.072  9.657   1.00 0.00 ? 54  VAL A N    3  
ATOM   6588  C  CA   . VAL A 1 54 ? 127.357 -0.958  8.727   1.00 0.00 ? 54  VAL A CA   3  
ATOM   6589  C  C    . VAL A 1 54 ? 127.444 0.362   9.490   1.00 0.00 ? 54  VAL A C    3  
ATOM   6590  O  O    . VAL A 1 54 ? 128.332 1.183   9.240   1.00 0.00 ? 54  VAL A O    3  
ATOM   6591  C  CB   . VAL A 1 54 ? 126.163 -0.909  7.772   1.00 0.00 ? 54  VAL A CB   3  
ATOM   6592  C  CG1  . VAL A 1 54 ? 126.209 0.383   6.953   1.00 0.00 ? 54  VAL A CG1  3  
ATOM   6593  C  CG2  . VAL A 1 54 ? 126.220 -2.113  6.828   1.00 0.00 ? 54  VAL A CG2  3  
ATOM   6594  H  H    . VAL A 1 54 ? 126.429 -2.676  9.573   1.00 0.00 ? 54  VAL A H    3  
ATOM   6595  H  HA   . VAL A 1 54 ? 128.255 -1.097  8.147   1.00 0.00 ? 54  VAL A HA   3  
ATOM   6596  H  HB   . VAL A 1 54 ? 125.245 -0.941  8.342   1.00 0.00 ? 54  VAL A HB   3  
ATOM   6597  H  HG11 . VAL A 1 54 ? 125.992 1.225   7.595   1.00 0.00 ? 54  VAL A HG11 3  
ATOM   6598  H  HG12 . VAL A 1 54 ? 125.475 0.335   6.163   1.00 0.00 ? 54  VAL A HG12 3  
ATOM   6599  H  HG13 . VAL A 1 54 ? 127.193 0.501   6.525   1.00 0.00 ? 54  VAL A HG13 3  
ATOM   6600  H  HG21 . VAL A 1 54 ? 126.582 -2.976  7.367   1.00 0.00 ? 54  VAL A HG21 3  
ATOM   6601  H  HG22 . VAL A 1 54 ? 126.889 -1.895  6.008   1.00 0.00 ? 54  VAL A HG22 3  
ATOM   6602  H  HG23 . VAL A 1 54 ? 125.232 -2.316  6.443   1.00 0.00 ? 54  VAL A HG23 3  
ATOM   6603  N  N    . ASP A 1 55 ? 126.538 0.552   10.442  1.00 0.00 ? 55  ASP A N    3  
ATOM   6604  C  CA   . ASP A 1 55 ? 126.554 1.765   11.245  1.00 0.00 ? 55  ASP A CA   3  
ATOM   6605  C  C    . ASP A 1 55 ? 127.823 1.841   12.090  1.00 0.00 ? 55  ASP A C    3  
ATOM   6606  O  O    . ASP A 1 55 ? 128.429 2.904   12.242  1.00 0.00 ? 55  ASP A O    3  
ATOM   6607  C  CB   . ASP A 1 55 ? 125.329 1.801   12.161  1.00 0.00 ? 55  ASP A CB   3  
ATOM   6608  C  CG   . ASP A 1 55 ? 124.060 1.931   11.329  1.00 0.00 ? 55  ASP A CG   3  
ATOM   6609  O  OD1  . ASP A 1 55 ? 124.175 2.230   10.152  1.00 0.00 ? 55  ASP A OD1  3  
ATOM   6610  O  OD2  . ASP A 1 55 ? 122.990 1.729   11.880  1.00 0.00 ? 55  ASP A OD2  3  
ATOM   6611  H  H    . ASP A 1 55 ? 125.864 -0.138  10.617  1.00 0.00 ? 55  ASP A H    3  
ATOM   6612  H  HA   . ASP A 1 55 ? 126.519 2.621   10.588  1.00 0.00 ? 55  ASP A HA   3  
ATOM   6613  H  HB2  . ASP A 1 55 ? 125.288 0.888   12.739  1.00 0.00 ? 55  ASP A HB2  3  
ATOM   6614  H  HB3  . ASP A 1 55 ? 125.407 2.646   12.830  1.00 0.00 ? 55  ASP A HB3  3  
ATOM   6615  N  N    . LYS A 1 56 ? 128.221 0.703   12.650  1.00 0.00 ? 56  LYS A N    3  
ATOM   6616  C  CA   . LYS A 1 56 ? 129.404 0.674   13.494  1.00 0.00 ? 56  LYS A CA   3  
ATOM   6617  C  C    . LYS A 1 56 ? 130.637 1.126   12.732  1.00 0.00 ? 56  LYS A C    3  
ATOM   6618  O  O    . LYS A 1 56 ? 131.463 1.866   13.267  1.00 0.00 ? 56  LYS A O    3  
ATOM   6619  C  CB   . LYS A 1 56 ? 129.628 -0.741  14.027  1.00 0.00 ? 56  LYS A CB   3  
ATOM   6620  C  CG   . LYS A 1 56 ? 128.413 -1.194  14.812  1.00 0.00 ? 56  LYS A CG   3  
ATOM   6621  C  CD   . LYS A 1 56 ? 128.249 -0.284  16.037  1.00 0.00 ? 56  LYS A CD   3  
ATOM   6622  C  CE   . LYS A 1 56 ? 127.762 -1.121  17.200  1.00 0.00 ? 56  LYS A CE   3  
ATOM   6623  N  NZ   . LYS A 1 56 ? 127.447 -0.245  18.362  1.00 0.00 ? 56  LYS A NZ   3  
ATOM   6624  H  H    . LYS A 1 56 ? 127.704 -0.117  12.507  1.00 0.00 ? 56  LYS A H    3  
ATOM   6625  H  HA   . LYS A 1 56 ? 129.251 1.336   14.331  1.00 0.00 ? 56  LYS A HA   3  
ATOM   6626  H  HB2  . LYS A 1 56 ? 129.802 -1.419  13.206  1.00 0.00 ? 56  LYS A HB2  3  
ATOM   6627  H  HB3  . LYS A 1 56 ? 130.477 -0.753  14.695  1.00 0.00 ? 56  LYS A HB3  3  
ATOM   6628  H  HG2  . LYS A 1 56 ? 127.534 -1.124  14.186  1.00 0.00 ? 56  LYS A HG2  3  
ATOM   6629  H  HG3  . LYS A 1 56 ? 128.552 -2.217  15.129  1.00 0.00 ? 56  LYS A HG3  3  
ATOM   6630  H  HD2  . LYS A 1 56 ? 129.194 0.173   16.297  1.00 0.00 ? 56  LYS A HD2  3  
ATOM   6631  H  HD3  . LYS A 1 56 ? 127.523 0.485   15.822  1.00 0.00 ? 56  LYS A HD3  3  
ATOM   6632  H  HE2  . LYS A 1 56 ? 126.883 -1.672  16.903  1.00 0.00 ? 56  LYS A HE2  3  
ATOM   6633  H  HE3  . LYS A 1 56 ? 128.552 -1.809  17.461  1.00 0.00 ? 56  LYS A HE3  3  
ATOM   6634  H  HZ1  . LYS A 1 56 ? 127.602 -0.771  19.245  1.00 0.00 ? 56  LYS A HZ1  3  
ATOM   6635  H  HZ2  . LYS A 1 56 ? 126.453 0.059   18.308  1.00 0.00 ? 56  LYS A HZ2  3  
ATOM   6636  H  HZ3  . LYS A 1 56 ? 128.067 0.590   18.346  1.00 0.00 ? 56  LYS A HZ3  3  
ATOM   6637  N  N    . VAL A 1 57 ? 130.770 0.690   11.484  1.00 0.00 ? 57  VAL A N    3  
ATOM   6638  C  CA   . VAL A 1 57 ? 131.927 1.092   10.704  1.00 0.00 ? 57  VAL A CA   3  
ATOM   6639  C  C    . VAL A 1 57 ? 131.800 2.518   10.200  1.00 0.00 ? 57  VAL A C    3  
ATOM   6640  O  O    . VAL A 1 57 ? 132.785 3.251   10.167  1.00 0.00 ? 57  VAL A O    3  
ATOM   6641  C  CB   . VAL A 1 57 ? 132.159 0.129   9.537   1.00 0.00 ? 57  VAL A CB   3  
ATOM   6642  C  CG1  . VAL A 1 57 ? 132.356 -1.288  10.077  1.00 0.00 ? 57  VAL A CG1  3  
ATOM   6643  C  CG2  . VAL A 1 57 ? 130.948 0.145   8.606   1.00 0.00 ? 57  VAL A CG2  3  
ATOM   6644  H  H    . VAL A 1 57 ? 130.090 0.101   11.091  1.00 0.00 ? 57  VAL A H    3  
ATOM   6645  H  HA   . VAL A 1 57 ? 132.782 1.055   11.349  1.00 0.00 ? 57  VAL A HA   3  
ATOM   6646  H  HB   . VAL A 1 57 ? 133.041 0.433   8.990   1.00 0.00 ? 57  VAL A HB   3  
ATOM   6647  H  HG11 . VAL A 1 57 ? 133.382 -1.413  10.393  1.00 0.00 ? 57  VAL A HG11 3  
ATOM   6648  H  HG12 . VAL A 1 57 ? 132.129 -2.004  9.302   1.00 0.00 ? 57  VAL A HG12 3  
ATOM   6649  H  HG13 . VAL A 1 57 ? 131.698 -1.446  10.919  1.00 0.00 ? 57  VAL A HG13 3  
ATOM   6650  H  HG21 . VAL A 1 57 ? 130.094 -0.245  9.133   1.00 0.00 ? 57  VAL A HG21 3  
ATOM   6651  H  HG22 . VAL A 1 57 ? 131.150 -0.470  7.742   1.00 0.00 ? 57  VAL A HG22 3  
ATOM   6652  H  HG23 . VAL A 1 57 ? 130.747 1.156   8.289   1.00 0.00 ? 57  VAL A HG23 3  
ATOM   6653  N  N    . MET A 1 58 ? 130.597 2.922   9.813   1.00 0.00 ? 58  MET A N    3  
ATOM   6654  C  CA   . MET A 1 58 ? 130.412 4.278   9.319   1.00 0.00 ? 58  MET A CA   3  
ATOM   6655  C  C    . MET A 1 58 ? 130.727 5.319   10.397  1.00 0.00 ? 58  MET A C    3  
ATOM   6656  O  O    . MET A 1 58 ? 131.318 6.359   10.099  1.00 0.00 ? 58  MET A O    3  
ATOM   6657  C  CB   . MET A 1 58 ? 128.990 4.446   8.762   1.00 0.00 ? 58  MET A CB   3  
ATOM   6658  C  CG   . MET A 1 58 ? 128.067 5.037   9.822   1.00 0.00 ? 58  MET A CG   3  
ATOM   6659  S  SD   . MET A 1 58 ? 128.323 6.828   9.925   1.00 0.00 ? 58  MET A SD   3  
ATOM   6660  C  CE   . MET A 1 58 ? 127.620 7.263   8.314   1.00 0.00 ? 58  MET A CE   3  
ATOM   6661  H  H    . MET A 1 58 ? 129.830 2.304   9.856   1.00 0.00 ? 58  MET A H    3  
ATOM   6662  H  HA   . MET A 1 58 ? 131.107 4.433   8.507   1.00 0.00 ? 58  MET A HA   3  
ATOM   6663  H  HB2  . MET A 1 58 ? 129.015 5.104   7.906   1.00 0.00 ? 58  MET A HB2  3  
ATOM   6664  H  HB3  . MET A 1 58 ? 128.610 3.482   8.457   1.00 0.00 ? 58  MET A HB3  3  
ATOM   6665  H  HG2  . MET A 1 58 ? 127.041 4.832   9.558   1.00 0.00 ? 58  MET A HG2  3  
ATOM   6666  H  HG3  . MET A 1 58 ? 128.292 4.582   10.773  1.00 0.00 ? 58  MET A HG3  3  
ATOM   6667  H  HE1  . MET A 1 58 ? 128.420 7.508   7.627   1.00 0.00 ? 58  MET A HE1  3  
ATOM   6668  H  HE2  . MET A 1 58 ? 126.970 8.115   8.422   1.00 0.00 ? 58  MET A HE2  3  
ATOM   6669  H  HE3  . MET A 1 58 ? 127.052 6.427   7.930   1.00 0.00 ? 58  MET A HE3  3  
ATOM   6670  N  N    . LYS A 1 59 ? 130.348 5.048   11.648  1.00 0.00 ? 59  LYS A N    3  
ATOM   6671  C  CA   . LYS A 1 59 ? 130.635 6.008   12.708  1.00 0.00 ? 59  LYS A CA   3  
ATOM   6672  C  C    . LYS A 1 59 ? 132.135 6.250   12.833  1.00 0.00 ? 59  LYS A C    3  
ATOM   6673  O  O    . LYS A 1 59 ? 132.569 7.380   13.055  1.00 0.00 ? 59  LYS A O    3  
ATOM   6674  C  CB   . LYS A 1 59 ? 130.074 5.526   14.049  1.00 0.00 ? 59  LYS A CB   3  
ATOM   6675  C  CG   . LYS A 1 59 ? 128.544 5.543   14.002  1.00 0.00 ? 59  LYS A CG   3  
ATOM   6676  C  CD   . LYS A 1 59 ? 127.985 5.023   15.329  1.00 0.00 ? 59  LYS A CD   3  
ATOM   6677  C  CE   . LYS A 1 59 ? 128.294 6.022   16.447  1.00 0.00 ? 59  LYS A CE   3  
ATOM   6678  N  NZ   . LYS A 1 59 ? 127.332 5.826   17.568  1.00 0.00 ? 59  LYS A NZ   3  
ATOM   6679  H  H    . LYS A 1 59 ? 129.877 4.203   11.855  1.00 0.00 ? 59  LYS A H    3  
ATOM   6680  H  HA   . LYS A 1 59 ? 130.160 6.945   12.456  1.00 0.00 ? 59  LYS A HA   3  
ATOM   6681  H  HB2  . LYS A 1 59 ? 130.418 4.521   14.241  1.00 0.00 ? 59  LYS A HB2  3  
ATOM   6682  H  HB3  . LYS A 1 59 ? 130.414 6.181   14.836  1.00 0.00 ? 59  LYS A HB3  3  
ATOM   6683  H  HG2  . LYS A 1 59 ? 128.201 6.555   13.839  1.00 0.00 ? 59  LYS A HG2  3  
ATOM   6684  H  HG3  . LYS A 1 59 ? 128.199 4.917   13.198  1.00 0.00 ? 59  LYS A HG3  3  
ATOM   6685  H  HD2  . LYS A 1 59 ? 126.915 4.898   15.244  1.00 0.00 ? 59  LYS A HD2  3  
ATOM   6686  H  HD3  . LYS A 1 59 ? 128.441 4.072   15.563  1.00 0.00 ? 59  LYS A HD3  3  
ATOM   6687  H  HE2  . LYS A 1 59 ? 129.301 5.862   16.805  1.00 0.00 ? 59  LYS A HE2  3  
ATOM   6688  H  HE3  . LYS A 1 59 ? 128.204 7.030   16.067  1.00 0.00 ? 59  LYS A HE3  3  
ATOM   6689  H  HZ1  . LYS A 1 59 ? 127.226 4.810   17.761  1.00 0.00 ? 59  LYS A HZ1  3  
ATOM   6690  H  HZ2  . LYS A 1 59 ? 126.409 6.229   17.306  1.00 0.00 ? 59  LYS A HZ2  3  
ATOM   6691  H  HZ3  . LYS A 1 59 ? 127.689 6.302   18.419  1.00 0.00 ? 59  LYS A HZ3  3  
ATOM   6692  N  N    . GLU A 1 60 ? 132.929 5.192   12.682  1.00 0.00 ? 60  GLU A N    3  
ATOM   6693  C  CA   . GLU A 1 60 ? 134.377 5.341   12.775  1.00 0.00 ? 60  GLU A CA   3  
ATOM   6694  C  C    . GLU A 1 60 ? 134.896 6.214   11.639  1.00 0.00 ? 60  GLU A C    3  
ATOM   6695  O  O    . GLU A 1 60 ? 135.800 7.030   11.829  1.00 0.00 ? 60  GLU A O    3  
ATOM   6696  C  CB   . GLU A 1 60 ? 135.047 3.967   12.714  1.00 0.00 ? 60  GLU A CB   3  
ATOM   6697  C  CG   . GLU A 1 60 ? 134.642 3.146   13.941  1.00 0.00 ? 60  GLU A CG   3  
ATOM   6698  C  CD   . GLU A 1 60 ? 135.356 1.799   13.926  1.00 0.00 ? 60  GLU A CD   3  
ATOM   6699  O  OE1  . GLU A 1 60 ? 135.979 1.492   12.923  1.00 0.00 ? 60  GLU A OE1  3  
ATOM   6700  O  OE2  . GLU A 1 60 ? 135.270 1.094   14.918  1.00 0.00 ? 60  GLU A OE2  3  
ATOM   6701  H  H    . GLU A 1 60 ? 132.540 4.311   12.499  1.00 0.00 ? 60  GLU A H    3  
ATOM   6702  H  HA   . GLU A 1 60 ? 134.622 5.808   13.717  1.00 0.00 ? 60  GLU A HA   3  
ATOM   6703  H  HB2  . GLU A 1 60 ? 134.735 3.453   11.817  1.00 0.00 ? 60  GLU A HB2  3  
ATOM   6704  H  HB3  . GLU A 1 60 ? 136.120 4.090   12.705  1.00 0.00 ? 60  GLU A HB3  3  
ATOM   6705  H  HG2  . GLU A 1 60 ? 134.911 3.685   14.837  1.00 0.00 ? 60  GLU A HG2  3  
ATOM   6706  H  HG3  . GLU A 1 60 ? 133.575 2.985   13.926  1.00 0.00 ? 60  GLU A HG3  3  
ATOM   6707  N  N    . LEU A 1 61 ? 134.305 6.046   10.458  1.00 0.00 ? 61  LEU A N    3  
ATOM   6708  C  CA   . LEU A 1 61 ? 134.698 6.833   9.295   1.00 0.00 ? 61  LEU A CA   3  
ATOM   6709  C  C    . LEU A 1 61 ? 134.333 8.295   9.478   1.00 0.00 ? 61  LEU A C    3  
ATOM   6710  O  O    . LEU A 1 61 ? 135.055 9.190   9.044   1.00 0.00 ? 61  LEU A O    3  
ATOM   6711  C  CB   . LEU A 1 61 ? 133.981 6.310   8.054   1.00 0.00 ? 61  LEU A CB   3  
ATOM   6712  C  CG   . LEU A 1 61 ? 134.359 4.854   7.805   1.00 0.00 ? 61  LEU A CG   3  
ATOM   6713  C  CD1  . LEU A 1 61 ? 133.596 4.343   6.582   1.00 0.00 ? 61  LEU A CD1  3  
ATOM   6714  C  CD2  . LEU A 1 61 ? 135.867 4.755   7.542   1.00 0.00 ? 61  LEU A CD2  3  
ATOM   6715  H  H    . LEU A 1 61 ? 133.584 5.389   10.372  1.00 0.00 ? 61  LEU A H    3  
ATOM   6716  H  HA   . LEU A 1 61 ? 135.762 6.746   9.147   1.00 0.00 ? 61  LEU A HA   3  
ATOM   6717  H  HB2  . LEU A 1 61 ? 132.913 6.387   8.197   1.00 0.00 ? 61  LEU A HB2  3  
ATOM   6718  H  HB3  . LEU A 1 61 ? 134.272 6.902   7.206   1.00 0.00 ? 61  LEU A HB3  3  
ATOM   6719  H  HG   . LEU A 1 61 ? 134.102 4.261   8.666   1.00 0.00 ? 61  LEU A HG   3  
ATOM   6720  H  HD11 . LEU A 1 61 ? 132.570 4.678   6.636   1.00 0.00 ? 61  LEU A HD11 3  
ATOM   6721  H  HD12 . LEU A 1 61 ? 133.620 3.263   6.567   1.00 0.00 ? 61  LEU A HD12 3  
ATOM   6722  H  HD13 . LEU A 1 61 ? 134.055 4.726   5.683   1.00 0.00 ? 61  LEU A HD13 3  
ATOM   6723  H  HD21 . LEU A 1 61 ? 136.376 4.512   8.463   1.00 0.00 ? 61  LEU A HD21 3  
ATOM   6724  H  HD22 . LEU A 1 61 ? 136.237 5.699   7.166   1.00 0.00 ? 61  LEU A HD22 3  
ATOM   6725  H  HD23 . LEU A 1 61 ? 136.054 3.984   6.813   1.00 0.00 ? 61  LEU A HD23 3  
ATOM   6726  N  N    . ASP A 1 62 ? 133.189 8.522   10.109  1.00 0.00 ? 62  ASP A N    3  
ATOM   6727  C  CA   . ASP A 1 62 ? 132.696 9.873   10.332  1.00 0.00 ? 62  ASP A CA   3  
ATOM   6728  C  C    . ASP A 1 62 ? 133.120 10.442  11.673  1.00 0.00 ? 62  ASP A C    3  
ATOM   6729  O  O    . ASP A 1 62 ? 132.400 11.238  12.275  1.00 0.00 ? 62  ASP A O    3  
ATOM   6730  C  CB   . ASP A 1 62 ? 131.182 9.917   10.155  1.00 0.00 ? 62  ASP A CB   3  
ATOM   6731  C  CG   . ASP A 1 62 ? 130.853 9.777   8.671   1.00 0.00 ? 62  ASP A CG   3  
ATOM   6732  O  OD1  . ASP A 1 62 ? 131.755 9.980   7.862   1.00 0.00 ? 62  ASP A OD1  3  
ATOM   6733  O  OD2  . ASP A 1 62 ? 129.705 9.506   8.361   1.00 0.00 ? 62  ASP A OD2  3  
ATOM   6734  H  H    . ASP A 1 62 ? 132.651 7.759   10.413  1.00 0.00 ? 62  ASP A H    3  
ATOM   6735  H  HA   . ASP A 1 62 ? 133.129 10.507  9.572   1.00 0.00 ? 62  ASP A HA   3  
ATOM   6736  H  HB2  . ASP A 1 62 ? 130.733 9.099   10.703  1.00 0.00 ? 62  ASP A HB2  3  
ATOM   6737  H  HB3  . ASP A 1 62 ? 130.800 10.857  10.522  1.00 0.00 ? 62  ASP A HB3  3  
ATOM   6738  N  N    . GLU A 1 63 ? 134.321 10.088  12.105  1.00 0.00 ? 63  GLU A N    3  
ATOM   6739  C  CA   . GLU A 1 63 ? 134.847 10.639  13.339  1.00 0.00 ? 63  GLU A CA   3  
ATOM   6740  C  C    . GLU A 1 63 ? 134.728 12.135  13.304  1.00 0.00 ? 63  GLU A C    3  
ATOM   6741  O  O    . GLU A 1 63 ? 134.577 12.792  14.334  1.00 0.00 ? 63  GLU A O    3  
ATOM   6742  C  CB   . GLU A 1 63 ? 136.316 10.263  13.509  1.00 0.00 ? 63  GLU A CB   3  
ATOM   6743  C  CG   . GLU A 1 63 ? 136.866 10.957  14.758  1.00 0.00 ? 63  GLU A CG   3  
ATOM   6744  C  CD   . GLU A 1 63 ? 138.332 10.594  14.964  1.00 0.00 ? 63  GLU A CD   3  
ATOM   6745  O  OE1  . GLU A 1 63 ? 138.869 9.885   14.129  1.00 0.00 ? 63  GLU A OE1  3  
ATOM   6746  O  OE2  . GLU A 1 63 ? 138.895 11.030  15.954  1.00 0.00 ? 63  GLU A OE2  3  
ATOM   6747  H  H    . GLU A 1 63 ? 134.877 9.489   11.563  1.00 0.00 ? 63  GLU A H    3  
ATOM   6748  H  HA   . GLU A 1 63 ? 134.281 10.254  14.173  1.00 0.00 ? 63  GLU A HA   3  
ATOM   6749  H  HB2  . GLU A 1 63 ? 136.404 9.192   13.621  1.00 0.00 ? 63  GLU A HB2  3  
ATOM   6750  H  HB3  . GLU A 1 63 ? 136.876 10.585  12.644  1.00 0.00 ? 63  GLU A HB3  3  
ATOM   6751  H  HG2  . GLU A 1 63 ? 136.800 12.028  14.619  1.00 0.00 ? 63  GLU A HG2  3  
ATOM   6752  H  HG3  . GLU A 1 63 ? 136.287 10.687  15.608  1.00 0.00 ? 63  GLU A HG3  3  
ATOM   6753  N  N    . ASN A 1 64 ? 134.821 12.664  12.114  1.00 0.00 ? 64  ASN A N    3  
ATOM   6754  C  CA   . ASN A 1 64 ? 134.750 14.084  11.938  1.00 0.00 ? 64  ASN A CA   3  
ATOM   6755  C  C    . ASN A 1 64 ? 133.492 14.601  12.617  1.00 0.00 ? 64  ASN A C    3  
ATOM   6756  O  O    . ASN A 1 64 ? 133.424 15.747  13.061  1.00 0.00 ? 64  ASN A O    3  
ATOM   6757  C  CB   . ASN A 1 64 ? 134.622 14.421  10.453  1.00 0.00 ? 64  ASN A CB   3  
ATOM   6758  C  CG   . ASN A 1 64 ? 135.636 13.657  9.618   1.00 0.00 ? 64  ASN A CG   3  
ATOM   6759  O  OD1  . ASN A 1 64 ? 135.249 13.006  8.638   1.00 0.00 ? 64  ASN A OD1  3  
ATOM   6760  N  ND2  . ASN A 1 64 ? 136.902 13.691  9.937   1.00 0.00 ? 64  ASN A ND2  3  
ATOM   6761  H  H    . ASN A 1 64 ? 134.957 12.085  11.335  1.00 0.00 ? 64  ASN A H    3  
ATOM   6762  H  HA   . ASN A 1 64 ? 135.629 14.536  12.368  1.00 0.00 ? 64  ASN A HA   3  
ATOM   6763  H  HB2  . ASN A 1 64 ? 133.631 14.165  10.121  1.00 0.00 ? 64  ASN A HB2  3  
ATOM   6764  H  HB3  . ASN A 1 64 ? 134.779 15.481  10.319  1.00 0.00 ? 64  ASN A HB3  3  
ATOM   6765  H  HD21 . ASN A 1 64 ? 137.199 14.208  10.713  1.00 0.00 ? 64  ASN A HD21 3  
ATOM   6766  H  HD22 . ASN A 1 64 ? 137.556 13.197  9.397   1.00 0.00 ? 64  ASN A HD22 3  
ATOM   6767  N  N    . GLY A 1 65 ? 132.476 13.747  12.623  1.00 0.00 ? 65  GLY A N    3  
ATOM   6768  C  CA   . GLY A 1 65 ? 131.179 14.105  13.168  1.00 0.00 ? 65  GLY A CA   3  
ATOM   6769  C  C    . GLY A 1 65 ? 130.270 14.493  12.012  1.00 0.00 ? 65  GLY A C    3  
ATOM   6770  O  O    . GLY A 1 65 ? 129.124 14.902  12.203  1.00 0.00 ? 65  GLY A O    3  
ATOM   6771  H  H    . GLY A 1 65 ? 132.591 12.867  12.208  1.00 0.00 ? 65  GLY A H    3  
ATOM   6772  H  HA2  . GLY A 1 65 ? 130.761 13.260  13.698  1.00 0.00 ? 65  GLY A HA2  3  
ATOM   6773  H  HA3  . GLY A 1 65 ? 131.282 14.944  13.838  1.00 0.00 ? 65  GLY A HA3  3  
ATOM   6774  N  N    . ASP A 1 66 ? 130.808 14.336  10.801  1.00 0.00 ? 66  ASP A N    3  
ATOM   6775  C  CA   . ASP A 1 66 ? 130.086 14.636  9.593   1.00 0.00 ? 66  ASP A CA   3  
ATOM   6776  C  C    . ASP A 1 66 ? 129.338 13.408  9.105   1.00 0.00 ? 66  ASP A C    3  
ATOM   6777  O  O    . ASP A 1 66 ? 129.896 12.328  8.928   1.00 0.00 ? 66  ASP A O    3  
ATOM   6778  C  CB   . ASP A 1 66 ? 131.039 15.165  8.507   1.00 0.00 ? 66  ASP A CB   3  
ATOM   6779  C  CG   . ASP A 1 66 ? 132.096 14.125  8.111   1.00 0.00 ? 66  ASP A CG   3  
ATOM   6780  O  OD1  . ASP A 1 66 ? 131.959 12.973  8.485   1.00 0.00 ? 66  ASP A OD1  3  
ATOM   6781  O  OD2  . ASP A 1 66 ? 133.035 14.504  7.432   1.00 0.00 ? 66  ASP A OD2  3  
ATOM   6782  H  H    . ASP A 1 66 ? 131.705 13.993  10.724  1.00 0.00 ? 66  ASP A H    3  
ATOM   6783  H  HA   . ASP A 1 66 ? 129.363 15.407  9.814   1.00 0.00 ? 66  ASP A HA   3  
ATOM   6784  H  HB2  . ASP A 1 66 ? 130.464 15.428  7.633   1.00 0.00 ? 66  ASP A HB2  3  
ATOM   6785  H  HB3  . ASP A 1 66 ? 131.538 16.049  8.877   1.00 0.00 ? 66  ASP A HB3  3  
ATOM   6786  N  N    . GLY A 1 67 ? 128.063 13.601  8.900   1.00 0.00 ? 67  GLY A N    3  
ATOM   6787  C  CA   . GLY A 1 67 ? 127.191 12.536  8.430   1.00 0.00 ? 67  GLY A CA   3  
ATOM   6788  C  C    . GLY A 1 67 ? 127.746 11.915  7.154   1.00 0.00 ? 67  GLY A C    3  
ATOM   6789  O  O    . GLY A 1 67 ? 127.449 10.765  6.830   1.00 0.00 ? 67  GLY A O    3  
ATOM   6790  H  H    . GLY A 1 67 ? 127.698 14.487  9.075   1.00 0.00 ? 67  GLY A H    3  
ATOM   6791  H  HA2  . GLY A 1 67 ? 127.115 11.775  9.195   1.00 0.00 ? 67  GLY A HA2  3  
ATOM   6792  H  HA3  . GLY A 1 67 ? 126.211 12.940  8.229   1.00 0.00 ? 67  GLY A HA3  3  
ATOM   6793  N  N    . GLU A 1 68 ? 128.535 12.694  6.420   1.00 0.00 ? 68  GLU A N    3  
ATOM   6794  C  CA   . GLU A 1 68 ? 129.106 12.224  5.162   1.00 0.00 ? 68  GLU A CA   3  
ATOM   6795  C  C    . GLU A 1 68 ? 130.513 11.660  5.381   1.00 0.00 ? 68  GLU A C    3  
ATOM   6796  O  O    . GLU A 1 68 ? 131.274 12.127  6.243   1.00 0.00 ? 68  GLU A O    3  
ATOM   6797  C  CB   . GLU A 1 68 ? 129.127 13.368  4.147   1.00 0.00 ? 68  GLU A CB   3  
ATOM   6798  C  CG   . GLU A 1 68 ? 129.498 12.825  2.770   1.00 0.00 ? 68  GLU A CG   3  
ATOM   6799  C  CD   . GLU A 1 68 ? 129.562 13.969  1.768   1.00 0.00 ? 68  GLU A CD   3  
ATOM   6800  O  OE1  . GLU A 1 68 ? 129.366 15.101  2.179   1.00 0.00 ? 68  GLU A OE1  3  
ATOM   6801  O  OE2  . GLU A 1 68 ? 129.804 13.699  0.605   1.00 0.00 ? 68  GLU A OE2  3  
ATOM   6802  H  H    . GLU A 1 68 ? 128.723 13.608  6.722   1.00 0.00 ? 68  GLU A H    3  
ATOM   6803  H  HA   . GLU A 1 68 ? 128.484 11.438  4.767   1.00 0.00 ? 68  GLU A HA   3  
ATOM   6804  H  HB2  . GLU A 1 68 ? 128.153 13.832  4.104   1.00 0.00 ? 68  GLU A HB2  3  
ATOM   6805  H  HB3  . GLU A 1 68 ? 129.864 14.101  4.447   1.00 0.00 ? 68  GLU A HB3  3  
ATOM   6806  H  HG2  . GLU A 1 68 ? 130.460 12.337  2.822   1.00 0.00 ? 68  GLU A HG2  3  
ATOM   6807  H  HG3  . GLU A 1 68 ? 128.751 12.112  2.451   1.00 0.00 ? 68  GLU A HG3  3  
ATOM   6808  N  N    . VAL A 1 69 ? 130.843 10.624  4.615   1.00 0.00 ? 69  VAL A N    3  
ATOM   6809  C  CA   . VAL A 1 69 ? 132.141 9.978   4.748   1.00 0.00 ? 69  VAL A CA   3  
ATOM   6810  C  C    . VAL A 1 69 ? 133.082 10.401  3.633   1.00 0.00 ? 69  VAL A C    3  
ATOM   6811  O  O    . VAL A 1 69 ? 132.724 10.383  2.455   1.00 0.00 ? 69  VAL A O    3  
ATOM   6812  C  CB   . VAL A 1 69 ? 131.957 8.463   4.689   1.00 0.00 ? 69  VAL A CB   3  
ATOM   6813  C  CG1  . VAL A 1 69 ? 133.315 7.779   4.846   1.00 0.00 ? 69  VAL A CG1  3  
ATOM   6814  C  CG2  . VAL A 1 69 ? 131.028 8.018   5.821   1.00 0.00 ? 69  VAL A CG2  3  
ATOM   6815  H  H    . VAL A 1 69 ? 130.195 10.278  3.966   1.00 0.00 ? 69  VAL A H    3  
ATOM   6816  H  HA   . VAL A 1 69 ? 132.576 10.239  5.701   1.00 0.00 ? 69  VAL A HA   3  
ATOM   6817  H  HB   . VAL A 1 69 ? 131.525 8.188   3.737   1.00 0.00 ? 69  VAL A HB   3  
ATOM   6818  H  HG11 . VAL A 1 69 ? 133.799 7.718   3.882   1.00 0.00 ? 69  VAL A HG11 3  
ATOM   6819  H  HG12 . VAL A 1 69 ? 133.173 6.785   5.239   1.00 0.00 ? 69  VAL A HG12 3  
ATOM   6820  H  HG13 . VAL A 1 69 ? 133.932 8.353   5.521   1.00 0.00 ? 69  VAL A HG13 3  
ATOM   6821  H  HG21 . VAL A 1 69 ? 131.591 7.942   6.740   1.00 0.00 ? 69  VAL A HG21 3  
ATOM   6822  H  HG22 . VAL A 1 69 ? 130.601 7.057   5.581   1.00 0.00 ? 69  VAL A HG22 3  
ATOM   6823  H  HG23 . VAL A 1 69 ? 130.237 8.744   5.943   1.00 0.00 ? 69  VAL A HG23 3  
ATOM   6824  N  N    . ASP A 1 70 ? 134.293 10.775  4.023   1.00 0.00 ? 70  ASP A N    3  
ATOM   6825  C  CA   . ASP A 1 70 ? 135.299 11.196  3.065   1.00 0.00 ? 70  ASP A CA   3  
ATOM   6826  C  C    . ASP A 1 70 ? 136.022 9.983   2.484   1.00 0.00 ? 70  ASP A C    3  
ATOM   6827  O  O    . ASP A 1 70 ? 136.286 9.011   3.192   1.00 0.00 ? 70  ASP A O    3  
ATOM   6828  C  CB   . ASP A 1 70 ? 136.303 12.133  3.736   1.00 0.00 ? 70  ASP A CB   3  
ATOM   6829  C  CG   . ASP A 1 70 ? 135.613 13.422  4.173   1.00 0.00 ? 70  ASP A CG   3  
ATOM   6830  O  OD1  . ASP A 1 70 ? 134.480 13.629  3.776   1.00 0.00 ? 70  ASP A OD1  3  
ATOM   6831  O  OD2  . ASP A 1 70 ? 136.226 14.175  4.913   1.00 0.00 ? 70  ASP A OD2  3  
ATOM   6832  H  H    . ASP A 1 70 ? 134.516 10.761  4.977   1.00 0.00 ? 70  ASP A H    3  
ATOM   6833  H  HA   . ASP A 1 70 ? 134.812 11.723  2.266   1.00 0.00 ? 70  ASP A HA   3  
ATOM   6834  H  HB2  . ASP A 1 70 ? 136.725 11.645  4.597   1.00 0.00 ? 70  ASP A HB2  3  
ATOM   6835  H  HB3  . ASP A 1 70 ? 137.090 12.373  3.036   1.00 0.00 ? 70  ASP A HB3  3  
ATOM   6836  N  N    . PHE A 1 71 ? 136.347 10.044  1.197   1.00 0.00 ? 71  PHE A N    3  
ATOM   6837  C  CA   . PHE A 1 71 ? 137.046 8.938   0.552   1.00 0.00 ? 71  PHE A CA   3  
ATOM   6838  C  C    . PHE A 1 71 ? 138.343 8.606   1.274   1.00 0.00 ? 71  PHE A C    3  
ATOM   6839  O  O    . PHE A 1 71 ? 138.667 7.434   1.460   1.00 0.00 ? 71  PHE A O    3  
ATOM   6840  C  CB   . PHE A 1 71 ? 137.324 9.282   -0.915  1.00 0.00 ? 71  PHE A CB   3  
ATOM   6841  C  CG   . PHE A 1 71 ? 138.088 8.164   -1.595  1.00 0.00 ? 71  PHE A CG   3  
ATOM   6842  C  CD1  . PHE A 1 71 ? 137.579 6.858   -1.626  1.00 0.00 ? 71  PHE A CD1  3  
ATOM   6843  C  CD2  . PHE A 1 71 ? 139.297 8.454   -2.241  1.00 0.00 ? 71  PHE A CD2  3  
ATOM   6844  C  CE1  . PHE A 1 71 ? 138.280 5.849   -2.299  1.00 0.00 ? 71  PHE A CE1  3  
ATOM   6845  C  CE2  . PHE A 1 71 ? 140.000 7.444   -2.906  1.00 0.00 ? 71  PHE A CE2  3  
ATOM   6846  C  CZ   . PHE A 1 71 ? 139.490 6.142   -2.936  1.00 0.00 ? 71  PHE A CZ   3  
ATOM   6847  H  H    . PHE A 1 71 ? 136.119 10.843  0.677   1.00 0.00 ? 71  PHE A H    3  
ATOM   6848  H  HA   . PHE A 1 71 ? 136.407 8.070   0.585   1.00 0.00 ? 71  PHE A HA   3  
ATOM   6849  H  HB2  . PHE A 1 71 ? 136.386 9.429   -1.430  1.00 0.00 ? 71  PHE A HB2  3  
ATOM   6850  H  HB3  . PHE A 1 71 ? 137.905 10.192  -0.964  1.00 0.00 ? 71  PHE A HB3  3  
ATOM   6851  H  HD1  . PHE A 1 71 ? 136.657 6.625   -1.121  1.00 0.00 ? 71  PHE A HD1  3  
ATOM   6852  H  HD2  . PHE A 1 71 ? 139.692 9.459   -2.218  1.00 0.00 ? 71  PHE A HD2  3  
ATOM   6853  H  HE1  . PHE A 1 71 ? 137.887 4.844   -2.326  1.00 0.00 ? 71  PHE A HE1  3  
ATOM   6854  H  HE2  . PHE A 1 71 ? 140.934 7.669   -3.398  1.00 0.00 ? 71  PHE A HE2  3  
ATOM   6855  H  HZ   . PHE A 1 71 ? 140.030 5.362   -3.455  1.00 0.00 ? 71  PHE A HZ   3  
ATOM   6856  N  N    . GLN A 1 72 ? 139.082 9.624   1.696   1.00 0.00 ? 72  GLN A N    3  
ATOM   6857  C  CA   . GLN A 1 72 ? 140.326 9.367   2.403   1.00 0.00 ? 72  GLN A CA   3  
ATOM   6858  C  C    . GLN A 1 72 ? 140.051 8.520   3.642   1.00 0.00 ? 72  GLN A C    3  
ATOM   6859  O  O    . GLN A 1 72 ? 140.795 7.588   3.946   1.00 0.00 ? 72  GLN A O    3  
ATOM   6860  C  CB   . GLN A 1 72 ? 140.978 10.688  2.817   1.00 0.00 ? 72  GLN A CB   3  
ATOM   6861  C  CG   . GLN A 1 72 ? 142.370 10.414  3.388   1.00 0.00 ? 72  GLN A CG   3  
ATOM   6862  C  CD   . GLN A 1 72 ? 142.974 11.704  3.931   1.00 0.00 ? 72  GLN A CD   3  
ATOM   6863  O  OE1  . GLN A 1 72 ? 142.417 12.315  4.843   1.00 0.00 ? 72  GLN A OE1  3  
ATOM   6864  N  NE2  . GLN A 1 72 ? 144.087 12.158  3.422   1.00 0.00 ? 72  GLN A NE2  3  
ATOM   6865  H  H    . GLN A 1 72 ? 138.787 10.546  1.538   1.00 0.00 ? 72  GLN A H    3  
ATOM   6866  H  HA   . GLN A 1 72 ? 140.999 8.831   1.751   1.00 0.00 ? 72  GLN A HA   3  
ATOM   6867  H  HB2  . GLN A 1 72 ? 141.062 11.334  1.954   1.00 0.00 ? 72  GLN A HB2  3  
ATOM   6868  H  HB3  . GLN A 1 72 ? 140.371 11.169  3.570   1.00 0.00 ? 72  GLN A HB3  3  
ATOM   6869  H  HG2  . GLN A 1 72 ? 142.294 9.689   4.186   1.00 0.00 ? 72  GLN A HG2  3  
ATOM   6870  H  HG3  . GLN A 1 72 ? 143.006 10.023  2.608   1.00 0.00 ? 72  GLN A HG3  3  
ATOM   6871  H  HE21 . GLN A 1 72 ? 144.528 11.671  2.696   1.00 0.00 ? 72  GLN A HE21 3  
ATOM   6872  H  HE22 . GLN A 1 72 ? 144.481 12.987  3.766   1.00 0.00 ? 72  GLN A HE22 3  
ATOM   6873  N  N    . GLU A 1 73 ? 138.961 8.836   4.342   1.00 0.00 ? 73  GLU A N    3  
ATOM   6874  C  CA   . GLU A 1 73 ? 138.586 8.077   5.532   1.00 0.00 ? 73  GLU A CA   3  
ATOM   6875  C  C    . GLU A 1 73 ? 138.185 6.652   5.159   1.00 0.00 ? 73  GLU A C    3  
ATOM   6876  O  O    . GLU A 1 73 ? 138.523 5.694   5.854   1.00 0.00 ? 73  GLU A O    3  
ATOM   6877  C  CB   . GLU A 1 73 ? 137.411 8.786   6.223   1.00 0.00 ? 73  GLU A CB   3  
ATOM   6878  C  CG   . GLU A 1 73 ? 137.893 10.134  6.766   1.00 0.00 ? 73  GLU A CG   3  
ATOM   6879  C  CD   . GLU A 1 73 ? 136.760 10.888  7.472   1.00 0.00 ? 73  GLU A CD   3  
ATOM   6880  O  OE1  . GLU A 1 73 ? 135.597 10.537  7.281   1.00 0.00 ? 73  GLU A OE1  3  
ATOM   6881  O  OE2  . GLU A 1 73 ? 137.079 11.806  8.206   1.00 0.00 ? 73  GLU A OE2  3  
ATOM   6882  H  H    . GLU A 1 73 ? 138.394 9.578   4.044   1.00 0.00 ? 73  GLU A H    3  
ATOM   6883  H  HA   . GLU A 1 73 ? 139.424 8.044   6.210   1.00 0.00 ? 73  GLU A HA   3  
ATOM   6884  H  HB2  . GLU A 1 73 ? 136.615 8.945   5.511   1.00 0.00 ? 73  GLU A HB2  3  
ATOM   6885  H  HB3  . GLU A 1 73 ? 137.052 8.177   7.039   1.00 0.00 ? 73  GLU A HB3  3  
ATOM   6886  H  HG2  . GLU A 1 73 ? 138.692 9.962   7.472   1.00 0.00 ? 73  GLU A HG2  3  
ATOM   6887  H  HG3  . GLU A 1 73 ? 138.267 10.732  5.951   1.00 0.00 ? 73  GLU A HG3  3  
ATOM   6888  N  N    . TYR A 1 74 ? 137.464 6.530   4.051   1.00 0.00 ? 74  TYR A N    3  
ATOM   6889  C  CA   . TYR A 1 74 ? 137.009 5.230   3.563   1.00 0.00 ? 74  TYR A CA   3  
ATOM   6890  C  C    . TYR A 1 74 ? 138.153 4.312   3.127   1.00 0.00 ? 74  TYR A C    3  
ATOM   6891  O  O    . TYR A 1 74 ? 138.170 3.116   3.451   1.00 0.00 ? 74  TYR A O    3  
ATOM   6892  C  CB   . TYR A 1 74 ? 136.055 5.467   2.389   1.00 0.00 ? 74  TYR A CB   3  
ATOM   6893  C  CG   . TYR A 1 74 ? 135.561 4.153   1.842   1.00 0.00 ? 74  TYR A CG   3  
ATOM   6894  C  CD1  . TYR A 1 74 ? 134.523 3.464   2.475   1.00 0.00 ? 74  TYR A CD1  3  
ATOM   6895  C  CD2  . TYR A 1 74 ? 136.134 3.638   0.676   1.00 0.00 ? 74  TYR A CD2  3  
ATOM   6896  C  CE1  . TYR A 1 74 ? 134.063 2.253   1.943   1.00 0.00 ? 74  TYR A CE1  3  
ATOM   6897  C  CE2  . TYR A 1 74 ? 135.679 2.430   0.145   1.00 0.00 ? 74  TYR A CE2  3  
ATOM   6898  C  CZ   . TYR A 1 74 ? 134.644 1.736   0.777   1.00 0.00 ? 74  TYR A CZ   3  
ATOM   6899  O  OH   . TYR A 1 74 ? 134.193 0.547   0.249   1.00 0.00 ? 74  TYR A OH   3  
ATOM   6900  H  H    . TYR A 1 74 ? 137.231 7.337   3.543   1.00 0.00 ? 74  TYR A H    3  
ATOM   6901  H  HA   . TYR A 1 74 ? 136.458 4.741   4.350   1.00 0.00 ? 74  TYR A HA   3  
ATOM   6902  H  HB2  . TYR A 1 74 ? 135.213 6.052   2.727   1.00 0.00 ? 74  TYR A HB2  3  
ATOM   6903  H  HB3  . TYR A 1 74 ? 136.574 6.006   1.611   1.00 0.00 ? 74  TYR A HB3  3  
ATOM   6904  H  HD1  . TYR A 1 74 ? 134.082 3.861   3.375   1.00 0.00 ? 74  TYR A HD1  3  
ATOM   6905  H  HD2  . TYR A 1 74 ? 136.931 4.177   0.186   1.00 0.00 ? 74  TYR A HD2  3  
ATOM   6906  H  HE1  . TYR A 1 74 ? 133.262 1.718   2.431   1.00 0.00 ? 74  TYR A HE1  3  
ATOM   6907  H  HE2  . TYR A 1 74 ? 136.126 2.031   -0.754  1.00 0.00 ? 74  TYR A HE2  3  
ATOM   6908  H  HH   . TYR A 1 74 ? 134.805 -0.145  0.511   1.00 0.00 ? 74  TYR A HH   3  
ATOM   6909  N  N    . VAL A 1 75 ? 139.094 4.865   2.371   1.00 0.00 ? 75  VAL A N    3  
ATOM   6910  C  CA   . VAL A 1 75 ? 140.204 4.069   1.870   1.00 0.00 ? 75  VAL A CA   3  
ATOM   6911  C  C    . VAL A 1 75 ? 141.060 3.539   3.015   1.00 0.00 ? 75  VAL A C    3  
ATOM   6912  O  O    . VAL A 1 75 ? 141.475 2.380   2.997   1.00 0.00 ? 75  VAL A O    3  
ATOM   6913  C  CB   . VAL A 1 75 ? 141.052 4.914   0.914   1.00 0.00 ? 75  VAL A CB   3  
ATOM   6914  C  CG1  . VAL A 1 75 ? 142.228 4.088   0.353   1.00 0.00 ? 75  VAL A CG1  3  
ATOM   6915  C  CG2  . VAL A 1 75 ? 140.168 5.405   -0.236  1.00 0.00 ? 75  VAL A CG2  3  
ATOM   6916  H  H    . VAL A 1 75 ? 139.025 5.811   2.126   1.00 0.00 ? 75  VAL A H    3  
ATOM   6917  H  HA   . VAL A 1 75 ? 139.805 3.229   1.321   1.00 0.00 ? 75  VAL A HA   3  
ATOM   6918  H  HB   . VAL A 1 75 ? 141.442 5.768   1.451   1.00 0.00 ? 75  VAL A HB   3  
ATOM   6919  H  HG11 . VAL A 1 75 ? 142.011 3.786   -0.662  1.00 0.00 ? 75  VAL A HG11 3  
ATOM   6920  H  HG12 . VAL A 1 75 ? 142.387 3.208   0.954   1.00 0.00 ? 75  VAL A HG12 3  
ATOM   6921  H  HG13 . VAL A 1 75 ? 143.120 4.690   0.357   1.00 0.00 ? 75  VAL A HG13 3  
ATOM   6922  H  HG21 . VAL A 1 75 ? 140.599 6.297   -0.663  1.00 0.00 ? 75  VAL A HG21 3  
ATOM   6923  H  HG22 . VAL A 1 75 ? 139.180 5.625   0.137   1.00 0.00 ? 75  VAL A HG22 3  
ATOM   6924  H  HG23 . VAL A 1 75 ? 140.105 4.636   -0.992  1.00 0.00 ? 75  VAL A HG23 3  
ATOM   6925  N  N    . VAL A 1 76 ? 141.329 4.380   4.009   1.00 0.00 ? 76  VAL A N    3  
ATOM   6926  C  CA   . VAL A 1 76 ? 142.143 3.943   5.132   1.00 0.00 ? 76  VAL A CA   3  
ATOM   6927  C  C    . VAL A 1 76 ? 141.477 2.781   5.857   1.00 0.00 ? 76  VAL A C    3  
ATOM   6928  O  O    . VAL A 1 76 ? 142.130 1.791   6.189   1.00 0.00 ? 76  VAL A O    3  
ATOM   6929  C  CB   . VAL A 1 76 ? 142.347 5.106   6.107   1.00 0.00 ? 76  VAL A CB   3  
ATOM   6930  C  CG1  . VAL A 1 76 ? 143.007 4.593   7.392   1.00 0.00 ? 76  VAL A CG1  3  
ATOM   6931  C  CG2  . VAL A 1 76 ? 143.244 6.161   5.455   1.00 0.00 ? 76  VAL A CG2  3  
ATOM   6932  H  H    . VAL A 1 76 ? 140.984 5.297   3.982   1.00 0.00 ? 76  VAL A H    3  
ATOM   6933  H  HA   . VAL A 1 76 ? 143.106 3.624   4.765   1.00 0.00 ? 76  VAL A HA   3  
ATOM   6934  H  HB   . VAL A 1 76 ? 141.389 5.545   6.347   1.00 0.00 ? 76  VAL A HB   3  
ATOM   6935  H  HG11 . VAL A 1 76 ? 143.631 3.742   7.165   1.00 0.00 ? 76  VAL A HG11 3  
ATOM   6936  H  HG12 . VAL A 1 76 ? 142.241 4.298   8.095   1.00 0.00 ? 76  VAL A HG12 3  
ATOM   6937  H  HG13 . VAL A 1 76 ? 143.610 5.376   7.829   1.00 0.00 ? 76  VAL A HG13 3  
ATOM   6938  H  HG21 . VAL A 1 76 ? 144.278 5.865   5.553   1.00 0.00 ? 76  VAL A HG21 3  
ATOM   6939  H  HG22 . VAL A 1 76 ? 143.094 7.113   5.942   1.00 0.00 ? 76  VAL A HG22 3  
ATOM   6940  H  HG23 . VAL A 1 76 ? 142.993 6.249   4.408   1.00 0.00 ? 76  VAL A HG23 3  
ATOM   6941  N  N    . LEU A 1 77 ? 140.172 2.897   6.088   1.00 0.00 ? 77  LEU A N    3  
ATOM   6942  C  CA   . LEU A 1 77 ? 139.440 1.832   6.759   1.00 0.00 ? 77  LEU A CA   3  
ATOM   6943  C  C    . LEU A 1 77 ? 139.455 0.558   5.925   1.00 0.00 ? 77  LEU A C    3  
ATOM   6944  O  O    . LEU A 1 77 ? 139.586 -0.540  6.460   1.00 0.00 ? 77  LEU A O    3  
ATOM   6945  C  CB   . LEU A 1 77 ? 138.001 2.272   7.013   1.00 0.00 ? 77  LEU A CB   3  
ATOM   6946  C  CG   . LEU A 1 77 ? 137.258 1.199   7.822   1.00 0.00 ? 77  LEU A CG   3  
ATOM   6947  C  CD1  . LEU A 1 77 ? 137.777 1.178   9.263   1.00 0.00 ? 77  LEU A CD1  3  
ATOM   6948  C  CD2  . LEU A 1 77 ? 135.761 1.519   7.829   1.00 0.00 ? 77  LEU A CD2  3  
ATOM   6949  H  H    . LEU A 1 77 ? 139.698 3.701   5.793   1.00 0.00 ? 77  LEU A H    3  
ATOM   6950  H  HA   . LEU A 1 77 ? 139.913 1.632   7.708   1.00 0.00 ? 77  LEU A HA   3  
ATOM   6951  H  HB2  . LEU A 1 77 ? 138.009 3.199   7.564   1.00 0.00 ? 77  LEU A HB2  3  
ATOM   6952  H  HB3  . LEU A 1 77 ? 137.502 2.417   6.068   1.00 0.00 ? 77  LEU A HB3  3  
ATOM   6953  H  HG   . LEU A 1 77 ? 137.416 0.230   7.370   1.00 0.00 ? 77  LEU A HG   3  
ATOM   6954  H  HD11 . LEU A 1 77 ? 137.992 2.184   9.587   1.00 0.00 ? 77  LEU A HD11 3  
ATOM   6955  H  HD12 . LEU A 1 77 ? 138.676 0.582   9.313   1.00 0.00 ? 77  LEU A HD12 3  
ATOM   6956  H  HD13 . LEU A 1 77 ? 137.025 0.746   9.907   1.00 0.00 ? 77  LEU A HD13 3  
ATOM   6957  H  HD21 . LEU A 1 77 ? 135.212 0.663   8.196   1.00 0.00 ? 77  LEU A HD21 3  
ATOM   6958  H  HD22 . LEU A 1 77 ? 135.438 1.750   6.825   1.00 0.00 ? 77  LEU A HD22 3  
ATOM   6959  H  HD23 . LEU A 1 77 ? 135.578 2.367   8.471   1.00 0.00 ? 77  LEU A HD23 3  
ATOM   6960  N  N    . VAL A 1 78 ? 139.322 0.710   4.607   1.00 0.00 ? 78  VAL A N    3  
ATOM   6961  C  CA   . VAL A 1 78 ? 139.322 -0.451  3.721   1.00 0.00 ? 78  VAL A CA   3  
ATOM   6962  C  C    . VAL A 1 78 ? 140.624 -1.227  3.840   1.00 0.00 ? 78  VAL A C    3  
ATOM   6963  O  O    . VAL A 1 78 ? 140.629 -2.461  3.804   1.00 0.00 ? 78  VAL A O    3  
ATOM   6964  C  CB   . VAL A 1 78 ? 139.129 -0.013  2.270   1.00 0.00 ? 78  VAL A CB   3  
ATOM   6965  C  CG1  . VAL A 1 78 ? 139.372 -1.204  1.339   1.00 0.00 ? 78  VAL A CG1  3  
ATOM   6966  C  CG2  . VAL A 1 78 ? 137.697 0.479   2.082   1.00 0.00 ? 78  VAL A CG2  3  
ATOM   6967  H  H    . VAL A 1 78 ? 139.215 1.617   4.227   1.00 0.00 ? 78  VAL A H    3  
ATOM   6968  H  HA   . VAL A 1 78 ? 138.505 -1.100  3.999   1.00 0.00 ? 78  VAL A HA   3  
ATOM   6969  H  HB   . VAL A 1 78 ? 139.822 0.781   2.034   1.00 0.00 ? 78  VAL A HB   3  
ATOM   6970  H  HG11 . VAL A 1 78 ? 140.435 -1.349  1.209   1.00 0.00 ? 78  VAL A HG11 3  
ATOM   6971  H  HG12 . VAL A 1 78 ? 138.916 -1.010  0.380   1.00 0.00 ? 78  VAL A HG12 3  
ATOM   6972  H  HG13 . VAL A 1 78 ? 138.938 -2.093  1.771   1.00 0.00 ? 78  VAL A HG13 3  
ATOM   6973  H  HG21 . VAL A 1 78 ? 137.652 1.132   1.224   1.00 0.00 ? 78  VAL A HG21 3  
ATOM   6974  H  HG22 . VAL A 1 78 ? 137.383 1.016   2.963   1.00 0.00 ? 78  VAL A HG22 3  
ATOM   6975  H  HG23 . VAL A 1 78 ? 137.046 -0.368  1.925   1.00 0.00 ? 78  VAL A HG23 3  
ATOM   6976  N  N    . ALA A 1 79 ? 141.727 -0.499  3.967   1.00 0.00 ? 79  ALA A N    3  
ATOM   6977  C  CA   . ALA A 1 79 ? 143.028 -1.137  4.063   1.00 0.00 ? 79  ALA A CA   3  
ATOM   6978  C  C    . ALA A 1 79 ? 143.066 -2.096  5.245   1.00 0.00 ? 79  ALA A C    3  
ATOM   6979  O  O    . ALA A 1 79 ? 143.612 -3.192  5.150   1.00 0.00 ? 79  ALA A O    3  
ATOM   6980  C  CB   . ALA A 1 79 ? 144.104 -0.065  4.241   1.00 0.00 ? 79  ALA A CB   3  
ATOM   6981  H  H    . ALA A 1 79 ? 141.665 0.480   3.980   1.00 0.00 ? 79  ALA A H    3  
ATOM   6982  H  HA   . ALA A 1 79 ? 143.223 -1.680  3.154   1.00 0.00 ? 79  ALA A HA   3  
ATOM   6983  H  HB1  . ALA A 1 79 ? 143.720 0.729   4.863   1.00 0.00 ? 79  ALA A HB1  3  
ATOM   6984  H  HB2  . ALA A 1 79 ? 144.378 0.336   3.276   1.00 0.00 ? 79  ALA A HB2  3  
ATOM   6985  H  HB3  . ALA A 1 79 ? 144.974 -0.499  4.712   1.00 0.00 ? 79  ALA A HB3  3  
ATOM   6986  N  N    . ALA A 1 80 ? 142.474 -1.695  6.356   1.00 0.00 ? 80  ALA A N    3  
ATOM   6987  C  CA   . ALA A 1 80 ? 142.451 -2.561  7.521   1.00 0.00 ? 80  ALA A CA   3  
ATOM   6988  C  C    . ALA A 1 80 ? 141.563 -3.786  7.289   1.00 0.00 ? 80  ALA A C    3  
ATOM   6989  O  O    . ALA A 1 80 ? 141.908 -4.896  7.694   1.00 0.00 ? 80  ALA A O    3  
ATOM   6990  C  CB   . ALA A 1 80 ? 141.956 -1.779  8.737   1.00 0.00 ? 80  ALA A CB   3  
ATOM   6991  H  H    . ALA A 1 80 ? 142.039 -0.818  6.389   1.00 0.00 ? 80  ALA A H    3  
ATOM   6992  H  HA   . ALA A 1 80 ? 143.458 -2.898  7.719   1.00 0.00 ? 80  ALA A HA   3  
ATOM   6993  H  HB1  . ALA A 1 80 ? 141.807 -2.454  9.565   1.00 0.00 ? 80  ALA A HB1  3  
ATOM   6994  H  HB2  . ALA A 1 80 ? 141.022 -1.292  8.496   1.00 0.00 ? 80  ALA A HB2  3  
ATOM   6995  H  HB3  . ALA A 1 80 ? 142.692 -1.034  9.006   1.00 0.00 ? 80  ALA A HB3  3  
ATOM   6996  N  N    . LEU A 1 81 ? 140.405 -3.573  6.657   1.00 0.00 ? 81  LEU A N    3  
ATOM   6997  C  CA   . LEU A 1 81 ? 139.468 -4.671  6.407   1.00 0.00 ? 81  LEU A CA   3  
ATOM   6998  C  C    . LEU A 1 81 ? 140.024 -5.737  5.462   1.00 0.00 ? 81  LEU A C    3  
ATOM   6999  O  O    . LEU A 1 81 ? 139.819 -6.935  5.688   1.00 0.00 ? 81  LEU A O    3  
ATOM   7000  C  CB   . LEU A 1 81 ? 138.160 -4.121  5.826   1.00 0.00 ? 81  LEU A CB   3  
ATOM   7001  C  CG   . LEU A 1 81 ? 137.530 -3.115  6.797   1.00 0.00 ? 81  LEU A CG   3  
ATOM   7002  C  CD1  . LEU A 1 81 ? 136.185 -2.647  6.237   1.00 0.00 ? 81  LEU A CD1  3  
ATOM   7003  C  CD2  . LEU A 1 81 ? 137.304 -3.777  8.161   1.00 0.00 ? 81  LEU A CD2  3  
ATOM   7004  H  H    . LEU A 1 81 ? 140.173 -2.666  6.370   1.00 0.00 ? 81  LEU A H    3  
ATOM   7005  H  HA   . LEU A 1 81 ? 139.245 -5.146  7.349   1.00 0.00 ? 81  LEU A HA   3  
ATOM   7006  H  HB2  . LEU A 1 81 ? 138.366 -3.632  4.886   1.00 0.00 ? 81  LEU A HB2  3  
ATOM   7007  H  HB3  . LEU A 1 81 ? 137.471 -4.937  5.662   1.00 0.00 ? 81  LEU A HB3  3  
ATOM   7008  H  HG   . LEU A 1 81 ? 138.186 -2.267  6.911   1.00 0.00 ? 81  LEU A HG   3  
ATOM   7009  H  HD11 . LEU A 1 81 ? 135.875 -1.748  6.748   1.00 0.00 ? 81  LEU A HD11 3  
ATOM   7010  H  HD12 . LEU A 1 81 ? 135.444 -3.419  6.387   1.00 0.00 ? 81  LEU A HD12 3  
ATOM   7011  H  HD13 . LEU A 1 81 ? 136.284 -2.445  5.181   1.00 0.00 ? 81  LEU A HD13 3  
ATOM   7012  H  HD21 . LEU A 1 81 ? 138.200 -3.687  8.757   1.00 0.00 ? 81  LEU A HD21 3  
ATOM   7013  H  HD22 . LEU A 1 81 ? 137.070 -4.822  8.020   1.00 0.00 ? 81  LEU A HD22 3  
ATOM   7014  H  HD23 . LEU A 1 81 ? 136.484 -3.290  8.669   1.00 0.00 ? 81  LEU A HD23 3  
ATOM   7015  N  N    . THR A 1 82 ? 140.729 -5.330  4.405   1.00 0.00 ? 82  THR A N    3  
ATOM   7016  C  CA   . THR A 1 82 ? 141.264 -6.331  3.487   1.00 0.00 ? 82  THR A CA   3  
ATOM   7017  C  C    . THR A 1 82 ? 142.285 -7.196  4.209   1.00 0.00 ? 82  THR A C    3  
ATOM   7018  O  O    . THR A 1 82 ? 142.314 -8.413  4.035   1.00 0.00 ? 82  THR A O    3  
ATOM   7019  C  CB   . THR A 1 82 ? 141.882 -5.692  2.236   1.00 0.00 ? 82  THR A CB   3  
ATOM   7020  O  OG1  . THR A 1 82 ? 142.637 -6.671  1.535   1.00 0.00 ? 82  THR A OG1  3  
ATOM   7021  C  CG2  . THR A 1 82 ? 142.791 -4.537  2.625   1.00 0.00 ? 82  THR A CG2  3  
ATOM   7022  H  H    . THR A 1 82 ? 140.878 -4.368  4.243   1.00 0.00 ? 82  THR A H    3  
ATOM   7023  H  HA   . THR A 1 82 ? 140.449 -6.968  3.175   1.00 0.00 ? 82  THR A HA   3  
ATOM   7024  H  HB   . THR A 1 82 ? 141.093 -5.324  1.598   1.00 0.00 ? 82  THR A HB   3  
ATOM   7025  H  HG1  . THR A 1 82 ? 142.077 -7.440  1.406   1.00 0.00 ? 82  THR A HG1  3  
ATOM   7026  H  HG21 . THR A 1 82 ? 142.205 -3.637  2.712   1.00 0.00 ? 82  THR A HG21 3  
ATOM   7027  H  HG22 . THR A 1 82 ? 143.546 -4.405  1.864   1.00 0.00 ? 82  THR A HG22 3  
ATOM   7028  H  HG23 . THR A 1 82 ? 143.266 -4.757  3.566   1.00 0.00 ? 82  THR A HG23 3  
ATOM   7029  N  N    . VAL A 1 83 ? 143.106 -6.566  5.044   1.00 0.00 ? 83  VAL A N    3  
ATOM   7030  C  CA   . VAL A 1 83 ? 144.096 -7.309  5.806   1.00 0.00 ? 83  VAL A CA   3  
ATOM   7031  C  C    . VAL A 1 83 ? 143.386 -8.290  6.730   1.00 0.00 ? 83  VAL A C    3  
ATOM   7032  O  O    . VAL A 1 83 ? 143.795 -9.442  6.869   1.00 0.00 ? 83  VAL A O    3  
ATOM   7033  C  CB   . VAL A 1 83 ? 144.948 -6.347  6.634   1.00 0.00 ? 83  VAL A CB   3  
ATOM   7034  C  CG1  . VAL A 1 83 ? 145.876 -7.144  7.553   1.00 0.00 ? 83  VAL A CG1  3  
ATOM   7035  C  CG2  . VAL A 1 83 ? 145.783 -5.472  5.700   1.00 0.00 ? 83  VAL A CG2  3  
ATOM   7036  H  H    . VAL A 1 83 ? 143.029 -5.597  5.163   1.00 0.00 ? 83  VAL A H    3  
ATOM   7037  H  HA   . VAL A 1 83 ? 144.735 -7.856  5.126   1.00 0.00 ? 83  VAL A HA   3  
ATOM   7038  H  HB   . VAL A 1 83 ? 144.302 -5.722  7.234   1.00 0.00 ? 83  VAL A HB   3  
ATOM   7039  H  HG11 . VAL A 1 83 ? 145.308 -7.539  8.383   1.00 0.00 ? 83  VAL A HG11 3  
ATOM   7040  H  HG12 . VAL A 1 83 ? 146.656 -6.499  7.925   1.00 0.00 ? 83  VAL A HG12 3  
ATOM   7041  H  HG13 . VAL A 1 83 ? 146.316 -7.961  6.999   1.00 0.00 ? 83  VAL A HG13 3  
ATOM   7042  H  HG21 . VAL A 1 83 ? 146.081 -4.573  6.219   1.00 0.00 ? 83  VAL A HG21 3  
ATOM   7043  H  HG22 . VAL A 1 83 ? 145.193 -5.207  4.834   1.00 0.00 ? 83  VAL A HG22 3  
ATOM   7044  H  HG23 . VAL A 1 83 ? 146.661 -6.016  5.386   1.00 0.00 ? 83  VAL A HG23 3  
ATOM   7045  N  N    . ALA A 1 84 ? 142.304 -7.817  7.346   1.00 0.00 ? 84  ALA A N    3  
ATOM   7046  C  CA   . ALA A 1 84 ? 141.517 -8.654  8.241   1.00 0.00 ? 84  ALA A CA   3  
ATOM   7047  C  C    . ALA A 1 84 ? 140.887 -9.802  7.470   1.00 0.00 ? 84  ALA A C    3  
ATOM   7048  O  O    . ALA A 1 84 ? 140.680 -10.885 8.010   1.00 0.00 ? 84  ALA A O    3  
ATOM   7049  C  CB   . ALA A 1 84 ? 140.424 -7.832  8.922   1.00 0.00 ? 84  ALA A CB   3  
ATOM   7050  H  H    . ALA A 1 84 ? 142.023 -6.893  7.182   1.00 0.00 ? 84  ALA A H    3  
ATOM   7051  H  HA   . ALA A 1 84 ? 142.169 -9.061  9.000   1.00 0.00 ? 84  ALA A HA   3  
ATOM   7052  H  HB1  . ALA A 1 84 ? 140.862 -6.958  9.381   1.00 0.00 ? 84  ALA A HB1  3  
ATOM   7053  H  HB2  . ALA A 1 84 ? 139.943 -8.435  9.680   1.00 0.00 ? 84  ALA A HB2  3  
ATOM   7054  H  HB3  . ALA A 1 84 ? 139.693 -7.526  8.188   1.00 0.00 ? 84  ALA A HB3  3  
ATOM   7055  N  N    . CYS A 1 85 ? 140.572 -9.556  6.201   1.00 0.00 ? 85  CYS A N    3  
ATOM   7056  C  CA   . CYS A 1 85 ? 139.957 -10.588 5.379   1.00 0.00 ? 85  CYS A CA   3  
ATOM   7057  C  C    . CYS A 1 85 ? 140.806 -11.856 5.404   1.00 0.00 ? 85  CYS A C    3  
ATOM   7058  O  O    . CYS A 1 85 ? 140.279 -12.969 5.380   1.00 0.00 ? 85  CYS A O    3  
ATOM   7059  C  CB   . CYS A 1 85 ? 139.789 -10.080 3.940   1.00 0.00 ? 85  CYS A CB   3  
ATOM   7060  S  SG   . CYS A 1 85 ? 141.226 -10.541 2.932   1.00 0.00 ? 85  CYS A SG   3  
ATOM   7061  H  H    . CYS A 1 85 ? 140.749 -8.667  5.818   1.00 0.00 ? 85  CYS A H    3  
ATOM   7062  H  HA   . CYS A 1 85 ? 138.981 -10.817 5.782   1.00 0.00 ? 85  CYS A HA   3  
ATOM   7063  H  HB2  . CYS A 1 85 ? 138.899 -10.514 3.509   1.00 0.00 ? 85  CYS A HB2  3  
ATOM   7064  H  HB3  . CYS A 1 85 ? 139.690 -9.004  3.951   1.00 0.00 ? 85  CYS A HB3  3  
ATOM   7065  H  HG   . CYS A 1 85 ? 141.385 -11.480 3.055   1.00 0.00 ? 85  CYS A HG   3  
ATOM   7066  N  N    . ASN A 1 86 ? 142.121 -11.679 5.467   1.00 0.00 ? 86  ASN A N    3  
ATOM   7067  C  CA   . ASN A 1 86 ? 143.032 -12.816 5.511   1.00 0.00 ? 86  ASN A CA   3  
ATOM   7068  C  C    . ASN A 1 86 ? 142.688 -13.731 6.685   1.00 0.00 ? 86  ASN A C    3  
ATOM   7069  O  O    . ASN A 1 86 ? 142.780 -14.960 6.587   1.00 0.00 ? 86  ASN A O    3  
ATOM   7070  C  CB   . ASN A 1 86 ? 144.473 -12.322 5.656   1.00 0.00 ? 86  ASN A CB   3  
ATOM   7071  C  CG   . ASN A 1 86 ? 145.447 -13.466 5.396   1.00 0.00 ? 86  ASN A CG   3  
ATOM   7072  O  OD1  . ASN A 1 86 ? 145.025 -14.596 5.145   1.00 0.00 ? 86  ASN A OD1  3  
ATOM   7073  N  ND2  . ASN A 1 86 ? 146.731 -13.242 5.442   1.00 0.00 ? 86  ASN A ND2  3  
ATOM   7074  H  H    . ASN A 1 86 ? 142.485 -10.769 5.493   1.00 0.00 ? 86  ASN A H    3  
ATOM   7075  H  HA   . ASN A 1 86 ? 142.948 -13.372 4.592   1.00 0.00 ? 86  ASN A HA   3  
ATOM   7076  H  HB2  . ASN A 1 86 ? 144.653 -11.529 4.944   1.00 0.00 ? 86  ASN A HB2  3  
ATOM   7077  H  HB3  . ASN A 1 86 ? 144.623 -11.945 6.657   1.00 0.00 ? 86  ASN A HB3  3  
ATOM   7078  H  HD21 . ASN A 1 86 ? 147.064 -12.342 5.642   1.00 0.00 ? 86  ASN A HD21 3  
ATOM   7079  H  HD22 . ASN A 1 86 ? 147.362 -13.973 5.276   1.00 0.00 ? 86  ASN A HD22 3  
ATOM   7080  N  N    . ASN A 1 87 ? 142.294 -13.119 7.800   1.00 0.00 ? 87  ASN A N    3  
ATOM   7081  C  CA   . ASN A 1 87 ? 141.951 -13.881 8.992   1.00 0.00 ? 87  ASN A CA   3  
ATOM   7082  C  C    . ASN A 1 87 ? 140.898 -14.931 8.669   1.00 0.00 ? 87  ASN A C    3  
ATOM   7083  O  O    . ASN A 1 87 ? 140.928 -16.035 9.213   1.00 0.00 ? 87  ASN A O    3  
ATOM   7084  C  CB   . ASN A 1 87 ? 141.421 -12.942 10.079  1.00 0.00 ? 87  ASN A CB   3  
ATOM   7085  C  CG   . ASN A 1 87 ? 142.517 -11.973 10.510  1.00 0.00 ? 87  ASN A CG   3  
ATOM   7086  O  OD1  . ASN A 1 87 ? 143.696 -12.213 10.251  1.00 0.00 ? 87  ASN A OD1  3  
ATOM   7087  N  ND2  . ASN A 1 87 ? 142.197 -10.886 11.157  1.00 0.00 ? 87  ASN A ND2  3  
ATOM   7088  H  H    . ASN A 1 87 ? 142.241 -12.140 7.820   1.00 0.00 ? 87  ASN A H    3  
ATOM   7089  H  HA   . ASN A 1 87 ? 142.837 -14.375 9.360   1.00 0.00 ? 87  ASN A HA   3  
ATOM   7090  H  HB2  . ASN A 1 87 ? 140.580 -12.387 9.696   1.00 0.00 ? 87  ASN A HB2  3  
ATOM   7091  H  HB3  . ASN A 1 87 ? 141.105 -13.521 10.932  1.00 0.00 ? 87  ASN A HB3  3  
ATOM   7092  H  HD21 . ASN A 1 87 ? 141.257 -10.698 11.363  1.00 0.00 ? 87  ASN A HD21 3  
ATOM   7093  H  HD22 . ASN A 1 87 ? 142.896 -10.259 11.437  1.00 0.00 ? 87  ASN A HD22 3  
ATOM   7094  N  N    . PHE A 1 88 ? 139.977 -14.597 7.772   1.00 0.00 ? 88  PHE A N    3  
ATOM   7095  C  CA   . PHE A 1 88 ? 138.946 -15.549 7.394   1.00 0.00 ? 88  PHE A CA   3  
ATOM   7096  C  C    . PHE A 1 88 ? 139.615 -16.800 6.840   1.00 0.00 ? 88  PHE A C    3  
ATOM   7097  O  O    . PHE A 1 88 ? 139.263 -17.921 7.208   1.00 0.00 ? 88  PHE A O    3  
ATOM   7098  C  CB   . PHE A 1 88 ? 138.032 -14.954 6.331   1.00 0.00 ? 88  PHE A CB   3  
ATOM   7099  C  CG   . PHE A 1 88 ? 136.860 -15.874 6.203   1.00 0.00 ? 88  PHE A CG   3  
ATOM   7100  C  CD1  . PHE A 1 88 ? 136.996 -17.062 5.503   1.00 0.00 ? 88  PHE A CD1  3  
ATOM   7101  C  CD2  . PHE A 1 88 ? 135.644 -15.550 6.818   1.00 0.00 ? 88  PHE A CD2  3  
ATOM   7102  C  CE1  . PHE A 1 88 ? 135.926 -17.937 5.413   1.00 0.00 ? 88  PHE A CE1  3  
ATOM   7103  C  CE2  . PHE A 1 88 ? 134.560 -16.427 6.721   1.00 0.00 ? 88  PHE A CE2  3  
ATOM   7104  C  CZ   . PHE A 1 88 ? 134.702 -17.626 6.018   1.00 0.00 ? 88  PHE A CZ   3  
ATOM   7105  H  H    . PHE A 1 88 ? 139.999 -13.710 7.355   1.00 0.00 ? 88  PHE A H    3  
ATOM   7106  H  HA   . PHE A 1 88 ? 138.349 -15.831 8.248   1.00 0.00 ? 88  PHE A HA   3  
ATOM   7107  H  HB2  . PHE A 1 88 ? 137.702 -13.970 6.636   1.00 0.00 ? 88  PHE A HB2  3  
ATOM   7108  H  HB3  . PHE A 1 88 ? 138.553 -14.893 5.387   1.00 0.00 ? 88  PHE A HB3  3  
ATOM   7109  H  HD1  . PHE A 1 88 ? 137.934 -17.307 5.028   1.00 0.00 ? 88  PHE A HD1  3  
ATOM   7110  H  HD2  . PHE A 1 88 ? 135.542 -14.621 7.360   1.00 0.00 ? 88  PHE A HD2  3  
ATOM   7111  H  HE1  . PHE A 1 88 ? 136.047 -18.853 4.887   1.00 0.00 ? 88  PHE A HE1  3  
ATOM   7112  H  HE2  . PHE A 1 88 ? 133.620 -16.180 7.190   1.00 0.00 ? 88  PHE A HE2  3  
ATOM   7113  H  HZ   . PHE A 1 88 ? 133.871 -18.312 5.944   1.00 0.00 ? 88  PHE A HZ   3  
ATOM   7114  N  N    . PHE A 1 89 ? 140.602 -16.595 5.970   1.00 0.00 ? 89  PHE A N    3  
ATOM   7115  C  CA   . PHE A 1 89 ? 141.339 -17.711 5.390   1.00 0.00 ? 89  PHE A CA   3  
ATOM   7116  C  C    . PHE A 1 89 ? 142.082 -18.493 6.464   1.00 0.00 ? 89  PHE A C    3  
ATOM   7117  O  O    . PHE A 1 89 ? 142.053 -19.724 6.479   1.00 0.00 ? 89  PHE A O    3  
ATOM   7118  C  CB   . PHE A 1 89 ? 142.325 -17.185 4.349   1.00 0.00 ? 89  PHE A CB   3  
ATOM   7119  C  CG   . PHE A 1 89 ? 141.560 -16.712 3.134   1.00 0.00 ? 89  PHE A CG   3  
ATOM   7120  C  CD1  . PHE A 1 89 ? 141.104 -15.392 3.057   1.00 0.00 ? 89  PHE A CD1  3  
ATOM   7121  C  CD2  . PHE A 1 89 ? 141.297 -17.604 2.085   1.00 0.00 ? 89  PHE A CD2  3  
ATOM   7122  C  CE1  . PHE A 1 89 ? 140.389 -14.961 1.933   1.00 0.00 ? 89  PHE A CE1  3  
ATOM   7123  C  CE2  . PHE A 1 89 ? 140.583 -17.173 0.962   1.00 0.00 ? 89  PHE A CE2  3  
ATOM   7124  C  CZ   . PHE A 1 89 ? 140.130 -15.851 0.885   1.00 0.00 ? 89  PHE A CZ   3  
ATOM   7125  H  H    . PHE A 1 89 ? 140.850 -15.678 5.730   1.00 0.00 ? 89  PHE A H    3  
ATOM   7126  H  HA   . PHE A 1 89 ? 140.639 -18.372 4.901   1.00 0.00 ? 89  PHE A HA   3  
ATOM   7127  H  HB2  . PHE A 1 89 ? 142.879 -16.357 4.768   1.00 0.00 ? 89  PHE A HB2  3  
ATOM   7128  H  HB3  . PHE A 1 89 ? 143.008 -17.968 4.068   1.00 0.00 ? 89  PHE A HB3  3  
ATOM   7129  H  HD1  . PHE A 1 89 ? 141.299 -14.707 3.865   1.00 0.00 ? 89  PHE A HD1  3  
ATOM   7130  H  HD2  . PHE A 1 89 ? 141.650 -18.623 2.144   1.00 0.00 ? 89  PHE A HD2  3  
ATOM   7131  H  HE1  . PHE A 1 89 ? 140.040 -13.941 1.874   1.00 0.00 ? 89  PHE A HE1  3  
ATOM   7132  H  HE2  . PHE A 1 89 ? 140.381 -17.860 0.154   1.00 0.00 ? 89  PHE A HE2  3  
ATOM   7133  H  HZ   . PHE A 1 89 ? 139.579 -15.519 0.018   1.00 0.00 ? 89  PHE A HZ   3  
ATOM   7134  N  N    . TRP A 1 90 ? 142.730 -17.774 7.376   1.00 0.00 ? 90  TRP A N    3  
ATOM   7135  C  CA   . TRP A 1 90 ? 143.456 -18.429 8.460   1.00 0.00 ? 90  TRP A CA   3  
ATOM   7136  C  C    . TRP A 1 90 ? 142.514 -19.281 9.306   1.00 0.00 ? 90  TRP A C    3  
ATOM   7137  O  O    . TRP A 1 90 ? 142.900 -20.335 9.810   1.00 0.00 ? 90  TRP A O    3  
ATOM   7138  C  CB   . TRP A 1 90 ? 144.171 -17.393 9.329   1.00 0.00 ? 90  TRP A CB   3  
ATOM   7139  C  CG   . TRP A 1 90 ? 145.385 -16.901 8.605   1.00 0.00 ? 90  TRP A CG   3  
ATOM   7140  C  CD1  . TRP A 1 90 ? 145.466 -15.745 7.910   1.00 0.00 ? 90  TRP A CD1  3  
ATOM   7141  C  CD2  . TRP A 1 90 ? 146.694 -17.533 8.501   1.00 0.00 ? 90  TRP A CD2  3  
ATOM   7142  N  NE1  . TRP A 1 90 ? 146.740 -15.629 7.382   1.00 0.00 ? 90  TRP A NE1  3  
ATOM   7143  C  CE2  . TRP A 1 90 ? 147.534 -16.706 7.720   1.00 0.00 ? 90  TRP A CE2  3  
ATOM   7144  C  CE3  . TRP A 1 90 ? 147.228 -18.734 9.004   1.00 0.00 ? 90  TRP A CE3  3  
ATOM   7145  C  CZ2  . TRP A 1 90 ? 148.856 -17.056 7.447   1.00 0.00 ? 90  TRP A CZ2  3  
ATOM   7146  C  CZ3  . TRP A 1 90 ? 148.559 -19.089 8.731   1.00 0.00 ? 90  TRP A CZ3  3  
ATOM   7147  C  CH2  . TRP A 1 90 ? 149.371 -18.252 7.954   1.00 0.00 ? 90  TRP A CH2  3  
ATOM   7148  H  H    . TRP A 1 90 ? 142.710 -16.789 7.324   1.00 0.00 ? 90  TRP A H    3  
ATOM   7149  H  HA   . TRP A 1 90 ? 144.200 -19.079 8.025   1.00 0.00 ? 90  TRP A HA   3  
ATOM   7150  H  HB2  . TRP A 1 90 ? 143.506 -16.566 9.526   1.00 0.00 ? 90  TRP A HB2  3  
ATOM   7151  H  HB3  . TRP A 1 90 ? 144.467 -17.848 10.263  1.00 0.00 ? 90  TRP A HB3  3  
ATOM   7152  H  HD1  . TRP A 1 90 ? 144.669 -15.034 7.783   1.00 0.00 ? 90  TRP A HD1  3  
ATOM   7153  H  HE1  . TRP A 1 90 ? 147.058 -14.881 6.835   1.00 0.00 ? 90  TRP A HE1  3  
ATOM   7154  H  HE3  . TRP A 1 90 ? 146.611 -19.387 9.603   1.00 0.00 ? 90  TRP A HE3  3  
ATOM   7155  H  HZ2  . TRP A 1 90 ? 149.478 -16.406 6.848   1.00 0.00 ? 90  TRP A HZ2  3  
ATOM   7156  H  HZ3  . TRP A 1 90 ? 148.959 -20.013 9.121   1.00 0.00 ? 90  TRP A HZ3  3  
ATOM   7157  H  HH2  . TRP A 1 90 ? 150.394 -18.530 7.747   1.00 0.00 ? 90  TRP A HH2  3  
ATOM   7158  N  N    . GLU A 1 91 ? 141.278 -18.816 9.455   1.00 0.00 ? 91  GLU A N    3  
ATOM   7159  C  CA   . GLU A 1 91 ? 140.289 -19.543 10.241  1.00 0.00 ? 91  GLU A CA   3  
ATOM   7160  C  C    . GLU A 1 91 ? 140.101 -20.955 9.694   1.00 0.00 ? 91  GLU A C    3  
ATOM   7161  O  O    . GLU A 1 91 ? 139.846 -21.894 10.447  1.00 0.00 ? 91  GLU A O    3  
ATOM   7162  C  CB   . GLU A 1 91 ? 138.951 -18.801 10.213  1.00 0.00 ? 91  GLU A CB   3  
ATOM   7163  C  CG   . GLU A 1 91 ? 137.961 -19.494 11.149  1.00 0.00 ? 91  GLU A CG   3  
ATOM   7164  C  CD   . GLU A 1 91 ? 136.595 -18.822 11.052  1.00 0.00 ? 91  GLU A CD   3  
ATOM   7165  O  OE1  . GLU A 1 91 ? 136.467 -17.894 10.270  1.00 0.00 ? 91  GLU A OE1  3  
ATOM   7166  O  OE2  . GLU A 1 91 ? 135.697 -19.245 11.760  1.00 0.00 ? 91  GLU A OE2  3  
ATOM   7167  H  H    . GLU A 1 91 ? 141.027 -17.969 9.030   1.00 0.00 ? 91  GLU A H    3  
ATOM   7168  H  HA   . GLU A 1 91 ? 140.630 -19.606 11.264  1.00 0.00 ? 91  GLU A HA   3  
ATOM   7169  H  HB2  . GLU A 1 91 ? 139.100 -17.780 10.535  1.00 0.00 ? 91  GLU A HB2  3  
ATOM   7170  H  HB3  . GLU A 1 91 ? 138.557 -18.807 9.207   1.00 0.00 ? 91  GLU A HB3  3  
ATOM   7171  H  HG2  . GLU A 1 91 ? 137.870 -20.533 10.870  1.00 0.00 ? 91  GLU A HG2  3  
ATOM   7172  H  HG3  . GLU A 1 91 ? 138.321 -19.426 12.165  1.00 0.00 ? 91  GLU A HG3  3  
ATOM   7173  N  N    . ASN A 1 92 ? 140.229 -21.096 8.378   1.00 0.00 ? 92  ASN A N    3  
ATOM   7174  C  CA   . ASN A 1 92 ? 140.070 -22.398 7.740   1.00 0.00 ? 92  ASN A CA   3  
ATOM   7175  C  C    . ASN A 1 92 ? 141.009 -23.423 8.367   1.00 0.00 ? 92  ASN A C    3  
ATOM   7176  O  O    . ASN A 1 92 ? 140.651 -24.589 8.529   1.00 0.00 ? 92  ASN A O    3  
ATOM   7177  C  CB   . ASN A 1 92 ? 140.362 -22.284 6.243   1.00 0.00 ? 92  ASN A CB   3  
ATOM   7178  C  CG   . ASN A 1 92 ? 140.016 -23.594 5.543   1.00 0.00 ? 92  ASN A CG   3  
ATOM   7179  O  OD1  . ASN A 1 92 ? 140.909 -24.357 5.176   1.00 0.00 ? 92  ASN A OD1  3  
ATOM   7180  N  ND2  . ASN A 1 92 ? 138.765 -23.902 5.335   1.00 0.00 ? 92  ASN A ND2  3  
ATOM   7181  H  H    . ASN A 1 92 ? 140.432 -20.311 7.828   1.00 0.00 ? 92  ASN A H    3  
ATOM   7182  H  HA   . ASN A 1 92 ? 139.051 -22.730 7.871   1.00 0.00 ? 92  ASN A HA   3  
ATOM   7183  H  HB2  . ASN A 1 92 ? 139.769 -21.485 5.821   1.00 0.00 ? 92  ASN A HB2  3  
ATOM   7184  H  HB3  . ASN A 1 92 ? 141.410 -22.068 6.098   1.00 0.00 ? 92  ASN A HB3  3  
ATOM   7185  H  HD21 . ASN A 1 92 ? 138.056 -23.292 5.628   1.00 0.00 ? 92  ASN A HD21 3  
ATOM   7186  H  HD22 . ASN A 1 92 ? 138.535 -24.742 4.886   1.00 0.00 ? 92  ASN A HD22 3  
ATOM   7187  N  N    . SER A 1 93 ? 142.212 -22.981 8.716   1.00 0.00 ? 93  SER A N    3  
ATOM   7188  C  CA   . SER A 1 93 ? 143.195 -23.870 9.324   1.00 0.00 ? 93  SER A CA   3  
ATOM   7189  C  C    . SER A 1 93 ? 144.381 -23.074 9.859   1.00 0.00 ? 93  SER A C    3  
ATOM   7190  O  O    . SER A 1 93 ? 144.378 -22.765 11.039  1.00 0.00 ? 93  SER A O    3  
ATOM   7191  C  CB   . SER A 1 93 ? 143.684 -24.888 8.294   1.00 0.00 ? 93  SER A CB   3  
ATOM   7192  O  OG   . SER A 1 93 ? 142.659 -25.843 8.053   1.00 0.00 ? 93  SER A OG   3  
ATOM   7193  O  OXT  . SER A 1 93 ? 145.275 -22.785 9.080   1.00 0.00 ? 93  SER A OXT  3  
ATOM   7194  H  H    . SER A 1 93 ? 142.444 -22.041 8.562   1.00 0.00 ? 93  SER A H    3  
ATOM   7195  H  HA   . SER A 1 93 ? 142.730 -24.400 10.142  1.00 0.00 ? 93  SER A HA   3  
ATOM   7196  H  HB2  . SER A 1 93 ? 143.923 -24.385 7.372   1.00 0.00 ? 93  SER A HB2  3  
ATOM   7197  H  HB3  . SER A 1 93 ? 144.571 -25.383 8.670   1.00 0.00 ? 93  SER A HB3  3  
ATOM   7198  H  HG   . SER A 1 93 ? 142.111 -25.895 8.840   1.00 0.00 ? 93  SER A HG   3  
ATOM   7199  N  N    . GLY B 1 1  ? 130.543 -9.813  -9.290  1.00 0.00 ? 1   GLY B N    3  
ATOM   7200  C  CA   . GLY B 1 1  ? 131.926 -9.697  -8.843  1.00 0.00 ? 1   GLY B CA   3  
ATOM   7201  C  C    . GLY B 1 1  ? 132.499 -8.327  -9.190  1.00 0.00 ? 1   GLY B C    3  
ATOM   7202  O  O    . GLY B 1 1  ? 133.041 -8.128  -10.277 1.00 0.00 ? 1   GLY B O    3  
ATOM   7203  H  H1   . GLY B 1 1  ? 130.036 -10.632 -9.108  1.00 0.00 ? 1   GLY B H1   3  
ATOM   7204  H  HA2  . GLY B 1 1  ? 131.966 -9.840  -7.772  1.00 0.00 ? 1   GLY B HA2  3  
ATOM   7205  H  HA3  . GLY B 1 1  ? 132.519 -10.459 -9.324  1.00 0.00 ? 1   GLY B HA3  3  
ATOM   7206  N  N    . SER B 1 2  ? 132.375 -7.387  -8.259  1.00 0.00 ? 2   SER B N    3  
ATOM   7207  C  CA   . SER B 1 2  ? 132.884 -6.039  -8.479  1.00 0.00 ? 2   SER B CA   3  
ATOM   7208  C  C    . SER B 1 2  ? 134.398 -6.062  -8.654  1.00 0.00 ? 2   SER B C    3  
ATOM   7209  O  O    . SER B 1 2  ? 135.073 -6.972  -8.174  1.00 0.00 ? 2   SER B O    3  
ATOM   7210  C  CB   . SER B 1 2  ? 132.520 -5.149  -7.295  1.00 0.00 ? 2   SER B CB   3  
ATOM   7211  O  OG   . SER B 1 2  ? 131.109 -5.144  -7.127  1.00 0.00 ? 2   SER B OG   3  
ATOM   7212  H  H    . SER B 1 2  ? 131.933 -7.603  -7.412  1.00 0.00 ? 2   SER B H    3  
ATOM   7213  H  HA   . SER B 1 2  ? 132.433 -5.632  -9.371  1.00 0.00 ? 2   SER B HA   3  
ATOM   7214  H  HB2  . SER B 1 2  ? 132.983 -5.534  -6.401  1.00 0.00 ? 2   SER B HB2  3  
ATOM   7215  H  HB3  . SER B 1 2  ? 132.876 -4.144  -7.478  1.00 0.00 ? 2   SER B HB3  3  
ATOM   7216  H  HG   . SER B 1 2  ? 130.781 -6.021  -7.344  1.00 0.00 ? 2   SER B HG   3  
ATOM   7217  N  N    . GLU B 1 3  ? 134.926 -5.063  -9.356  1.00 0.00 ? 3   GLU B N    3  
ATOM   7218  C  CA   . GLU B 1 3  ? 136.363 -4.996  -9.595  1.00 0.00 ? 3   GLU B CA   3  
ATOM   7219  C  C    . GLU B 1 3  ? 137.128 -4.861  -8.279  1.00 0.00 ? 3   GLU B C    3  
ATOM   7220  O  O    . GLU B 1 3  ? 138.235 -5.379  -8.136  1.00 0.00 ? 3   GLU B O    3  
ATOM   7221  C  CB   . GLU B 1 3  ? 136.692 -3.781  -10.470 1.00 0.00 ? 3   GLU B CB   3  
ATOM   7222  C  CG   . GLU B 1 3  ? 135.999 -3.902  -11.826 1.00 0.00 ? 3   GLU B CG   3  
ATOM   7223  C  CD   . GLU B 1 3  ? 136.422 -2.749  -12.730 1.00 0.00 ? 3   GLU B CD   3  
ATOM   7224  O  OE1  . GLU B 1 3  ? 137.074 -1.843  -12.236 1.00 0.00 ? 3   GLU B OE1  3  
ATOM   7225  O  OE2  . GLU B 1 3  ? 136.087 -2.788  -13.903 1.00 0.00 ? 3   GLU B OE2  3  
ATOM   7226  H  H    . GLU B 1 3  ? 134.341 -4.369  -9.724  1.00 0.00 ? 3   GLU B H    3  
ATOM   7227  H  HA   . GLU B 1 3  ? 136.682 -5.892  -10.104 1.00 0.00 ? 3   GLU B HA   3  
ATOM   7228  H  HB2  . GLU B 1 3  ? 136.351 -2.885  -9.978  1.00 0.00 ? 3   GLU B HB2  3  
ATOM   7229  H  HB3  . GLU B 1 3  ? 137.759 -3.725  -10.619 1.00 0.00 ? 3   GLU B HB3  3  
ATOM   7230  H  HG2  . GLU B 1 3  ? 136.262 -4.842  -12.288 1.00 0.00 ? 3   GLU B HG2  3  
ATOM   7231  H  HG3  . GLU B 1 3  ? 134.928 -3.855  -11.679 1.00 0.00 ? 3   GLU B HG3  3  
ATOM   7232  N  N    . LEU B 1 4  ? 136.539 -4.136  -7.331  1.00 0.00 ? 4   LEU B N    3  
ATOM   7233  C  CA   . LEU B 1 4  ? 137.181 -3.907  -6.038  1.00 0.00 ? 4   LEU B CA   3  
ATOM   7234  C  C    . LEU B 1 4  ? 137.458 -5.216  -5.295  1.00 0.00 ? 4   LEU B C    3  
ATOM   7235  O  O    . LEU B 1 4  ? 138.528 -5.385  -4.688  1.00 0.00 ? 4   LEU B O    3  
ATOM   7236  C  CB   . LEU B 1 4  ? 136.279 -2.989  -5.203  1.00 0.00 ? 4   LEU B CB   3  
ATOM   7237  C  CG   . LEU B 1 4  ? 137.006 -2.523  -3.925  1.00 0.00 ? 4   LEU B CG   3  
ATOM   7238  C  CD1  . LEU B 1 4  ? 136.578 -1.084  -3.569  1.00 0.00 ? 4   LEU B CD1  3  
ATOM   7239  C  CD2  . LEU B 1 4  ? 136.646 -3.455  -2.757  1.00 0.00 ? 4   LEU B CD2  3  
ATOM   7240  H  H    . LEU B 1 4  ? 135.665 -3.732  -7.510  1.00 0.00 ? 4   LEU B H    3  
ATOM   7241  H  HA   . LEU B 1 4  ? 138.120 -3.403  -6.205  1.00 0.00 ? 4   LEU B HA   3  
ATOM   7242  H  HB2  . LEU B 1 4  ? 136.013 -2.132  -5.800  1.00 0.00 ? 4   LEU B HB2  3  
ATOM   7243  H  HB3  . LEU B 1 4  ? 135.381 -3.524  -4.933  1.00 0.00 ? 4   LEU B HB3  3  
ATOM   7244  H  HG   . LEU B 1 4  ? 138.074 -2.547  -4.089  1.00 0.00 ? 4   LEU B HG   3  
ATOM   7245  H  HD11 . LEU B 1 4  ? 137.307 -0.390  -3.958  1.00 0.00 ? 4   LEU B HD11 3  
ATOM   7246  H  HD12 . LEU B 1 4  ? 136.519 -0.973  -2.495  1.00 0.00 ? 4   LEU B HD12 3  
ATOM   7247  H  HD13 . LEU B 1 4  ? 135.613 -0.866  -4.002  1.00 0.00 ? 4   LEU B HD13 3  
ATOM   7248  H  HD21 . LEU B 1 4  ? 137.056 -4.436  -2.934  1.00 0.00 ? 4   LEU B HD21 3  
ATOM   7249  H  HD22 . LEU B 1 4  ? 135.571 -3.524  -2.669  1.00 0.00 ? 4   LEU B HD22 3  
ATOM   7250  H  HD23 . LEU B 1 4  ? 137.054 -3.055  -1.841  1.00 0.00 ? 4   LEU B HD23 3  
ATOM   7251  N  N    . GLU B 1 5  ? 136.518 -6.156  -5.356  1.00 0.00 ? 5   GLU B N    3  
ATOM   7252  C  CA   . GLU B 1 5  ? 136.733 -7.427  -4.686  1.00 0.00 ? 5   GLU B CA   3  
ATOM   7253  C  C    . GLU B 1 5  ? 137.965 -8.084  -5.278  1.00 0.00 ? 5   GLU B C    3  
ATOM   7254  O  O    . GLU B 1 5  ? 138.802 -8.636  -4.562  1.00 0.00 ? 5   GLU B O    3  
ATOM   7255  C  CB   . GLU B 1 5  ? 135.517 -8.338  -4.870  1.00 0.00 ? 5   GLU B CB   3  
ATOM   7256  C  CG   . GLU B 1 5  ? 135.701 -9.611  -4.042  1.00 0.00 ? 5   GLU B CG   3  
ATOM   7257  C  CD   . GLU B 1 5  ? 134.543 -10.570 -4.295  1.00 0.00 ? 5   GLU B CD   3  
ATOM   7258  O  OE1  . GLU B 1 5  ? 133.683 -10.232 -5.092  1.00 0.00 ? 5   GLU B OE1  3  
ATOM   7259  O  OE2  . GLU B 1 5  ? 134.531 -11.627 -3.686  1.00 0.00 ? 5   GLU B OE2  3  
ATOM   7260  H  H    . GLU B 1 5  ? 135.692 -5.997  -5.860  1.00 0.00 ? 5   GLU B H    3  
ATOM   7261  H  HA   . GLU B 1 5  ? 136.892 -7.253  -3.631  1.00 0.00 ? 5   GLU B HA   3  
ATOM   7262  H  HB2  . GLU B 1 5  ? 134.627 -7.820  -4.542  1.00 0.00 ? 5   GLU B HB2  3  
ATOM   7263  H  HB3  . GLU B 1 5  ? 135.417 -8.600  -5.912  1.00 0.00 ? 5   GLU B HB3  3  
ATOM   7264  H  HG2  . GLU B 1 5  ? 136.629 -10.088 -4.322  1.00 0.00 ? 5   GLU B HG2  3  
ATOM   7265  H  HG3  . GLU B 1 5  ? 135.731 -9.355  -2.993  1.00 0.00 ? 5   GLU B HG3  3  
ATOM   7266  N  N    . THR B 1 6  ? 138.089 -7.970  -6.595  1.00 0.00 ? 6   THR B N    3  
ATOM   7267  C  CA   . THR B 1 6  ? 139.244 -8.502  -7.291  1.00 0.00 ? 6   THR B CA   3  
ATOM   7268  C  C    . THR B 1 6  ? 140.493 -7.754  -6.850  1.00 0.00 ? 6   THR B C    3  
ATOM   7269  O  O    . THR B 1 6  ? 141.572 -8.334  -6.720  1.00 0.00 ? 6   THR B O    3  
ATOM   7270  C  CB   . THR B 1 6  ? 139.062 -8.360  -8.805  1.00 0.00 ? 6   THR B CB   3  
ATOM   7271  O  OG1  . THR B 1 6  ? 137.840 -8.974  -9.193  1.00 0.00 ? 6   THR B OG1  3  
ATOM   7272  C  CG2  . THR B 1 6  ? 140.227 -9.038  -9.527  1.00 0.00 ? 6   THR B CG2  3  
ATOM   7273  H  H    . THR B 1 6  ? 137.403 -7.487  -7.102  1.00 0.00 ? 6   THR B H    3  
ATOM   7274  H  HA   . THR B 1 6  ? 139.354 -9.548  -7.047  1.00 0.00 ? 6   THR B HA   3  
ATOM   7275  H  HB   . THR B 1 6  ? 139.040 -7.314  -9.069  1.00 0.00 ? 6   THR B HB   3  
ATOM   7276  H  HG1  . THR B 1 6  ? 137.723 -9.763  -8.659  1.00 0.00 ? 6   THR B HG1  3  
ATOM   7277  H  HG21 . THR B 1 6  ? 141.152 -8.553  -9.252  1.00 0.00 ? 6   THR B HG21 3  
ATOM   7278  H  HG22 . THR B 1 6  ? 140.083 -8.960  -10.595 1.00 0.00 ? 6   THR B HG22 3  
ATOM   7279  H  HG23 . THR B 1 6  ? 140.269 -10.079 -9.244  1.00 0.00 ? 6   THR B HG23 3  
ATOM   7280  N  N    . ALA B 1 7  ? 140.334 -6.445  -6.648  1.00 0.00 ? 7   ALA B N    3  
ATOM   7281  C  CA   . ALA B 1 7  ? 141.454 -5.606  -6.251  1.00 0.00 ? 7   ALA B CA   3  
ATOM   7282  C  C    . ALA B 1 7  ? 142.022 -6.027  -4.900  1.00 0.00 ? 7   ALA B C    3  
ATOM   7283  O  O    . ALA B 1 7  ? 143.245 -6.081  -4.737  1.00 0.00 ? 7   ALA B O    3  
ATOM   7284  C  CB   . ALA B 1 7  ? 141.013 -4.140  -6.192  1.00 0.00 ? 7   ALA B CB   3  
ATOM   7285  H  H    . ALA B 1 7  ? 139.452 -6.039  -6.787  1.00 0.00 ? 7   ALA B H    3  
ATOM   7286  H  HA   . ALA B 1 7  ? 142.231 -5.697  -6.993  1.00 0.00 ? 7   ALA B HA   3  
ATOM   7287  H  HB1  . ALA B 1 7  ? 141.843 -3.526  -5.878  1.00 0.00 ? 7   ALA B HB1  3  
ATOM   7288  H  HB2  . ALA B 1 7  ? 140.200 -4.034  -5.488  1.00 0.00 ? 7   ALA B HB2  3  
ATOM   7289  H  HB3  . ALA B 1 7  ? 140.682 -3.822  -7.173  1.00 0.00 ? 7   ALA B HB3  3  
ATOM   7290  N  N    . MET B 1 8  ? 141.163 -6.350  -3.926  1.00 0.00 ? 8   MET B N    3  
ATOM   7291  C  CA   . MET B 1 8  ? 141.711 -6.763  -2.636  1.00 0.00 ? 8   MET B CA   3  
ATOM   7292  C  C    . MET B 1 8  ? 142.619 -7.952  -2.868  1.00 0.00 ? 8   MET B C    3  
ATOM   7293  O  O    . MET B 1 8  ? 143.700 -8.057  -2.288  1.00 0.00 ? 8   MET B O    3  
ATOM   7294  C  CB   . MET B 1 8  ? 140.629 -7.233  -1.659  1.00 0.00 ? 8   MET B CB   3  
ATOM   7295  C  CG   . MET B 1 8  ? 139.671 -6.107  -1.287  1.00 0.00 ? 8   MET B CG   3  
ATOM   7296  S  SD   . MET B 1 8  ? 138.641 -6.658  0.105   1.00 0.00 ? 8   MET B SD   3  
ATOM   7297  C  CE   . MET B 1 8  ? 137.995 -8.195  -0.615  1.00 0.00 ? 8   MET B CE   3  
ATOM   7298  H  H    . MET B 1 8  ? 140.189 -6.304  -4.075  1.00 0.00 ? 8   MET B H    3  
ATOM   7299  H  HA   . MET B 1 8  ? 142.273 -5.951  -2.198  1.00 0.00 ? 8   MET B HA   3  
ATOM   7300  H  HB2  . MET B 1 8  ? 140.070 -8.028  -2.126  1.00 0.00 ? 8   MET B HB2  3  
ATOM   7301  H  HB3  . MET B 1 8  ? 141.101 -7.609  -0.763  1.00 0.00 ? 8   MET B HB3  3  
ATOM   7302  H  HG2  . MET B 1 8  ? 140.235 -5.231  -0.999  1.00 0.00 ? 8   MET B HG2  3  
ATOM   7303  H  HG3  . MET B 1 8  ? 139.041 -5.872  -2.132  1.00 0.00 ? 8   MET B HG3  3  
ATOM   7304  H  HE1  . MET B 1 8  ? 138.760 -8.959  -0.580  1.00 0.00 ? 8   MET B HE1  3  
ATOM   7305  H  HE2  . MET B 1 8  ? 137.706 -8.025  -1.640  1.00 0.00 ? 8   MET B HE2  3  
ATOM   7306  H  HE3  . MET B 1 8  ? 137.133 -8.524  -0.045  1.00 0.00 ? 8   MET B HE3  3  
ATOM   7307  N  N    . GLU B 1 9  ? 142.168 -8.838  -3.747  1.00 0.00 ? 9   GLU B N    3  
ATOM   7308  C  CA   . GLU B 1 9  ? 142.936 -10.015 -4.089  1.00 0.00 ? 9   GLU B CA   3  
ATOM   7309  C  C    . GLU B 1 9  ? 144.205 -9.638  -4.832  1.00 0.00 ? 9   GLU B C    3  
ATOM   7310  O  O    . GLU B 1 9  ? 145.235 -10.271 -4.659  1.00 0.00 ? 9   GLU B O    3  
ATOM   7311  C  CB   . GLU B 1 9  ? 142.088 -10.965 -4.930  1.00 0.00 ? 9   GLU B CB   3  
ATOM   7312  C  CG   . GLU B 1 9  ? 140.950 -11.515 -4.074  1.00 0.00 ? 9   GLU B CG   3  
ATOM   7313  C  CD   . GLU B 1 9  ? 140.123 -12.510 -4.878  1.00 0.00 ? 9   GLU B CD   3  
ATOM   7314  O  OE1  . GLU B 1 9  ? 140.347 -12.607 -6.074  1.00 0.00 ? 9   GLU B OE1  3  
ATOM   7315  O  OE2  . GLU B 1 9  ? 139.277 -13.162 -4.288  1.00 0.00 ? 9   GLU B OE2  3  
ATOM   7316  H  H    . GLU B 1 9  ? 141.304 -8.684  -4.184  1.00 0.00 ? 9   GLU B H    3  
ATOM   7317  H  HA   . GLU B 1 9  ? 143.212 -10.522 -3.176  1.00 0.00 ? 9   GLU B HA   3  
ATOM   7318  H  HB2  . GLU B 1 9  ? 141.675 -10.426 -5.770  1.00 0.00 ? 9   GLU B HB2  3  
ATOM   7319  H  HB3  . GLU B 1 9  ? 142.697 -11.781 -5.285  1.00 0.00 ? 9   GLU B HB3  3  
ATOM   7320  H  HG2  . GLU B 1 9  ? 141.369 -12.011 -3.208  1.00 0.00 ? 9   GLU B HG2  3  
ATOM   7321  H  HG3  . GLU B 1 9  ? 140.318 -10.701 -3.750  1.00 0.00 ? 9   GLU B HG3  3  
ATOM   7322  N  N    . THR B 1 10 ? 144.126 -8.608  -5.670  1.00 0.00 ? 10  THR B N    3  
ATOM   7323  C  CA   . THR B 1 10 ? 145.297 -8.182  -6.424  1.00 0.00 ? 10  THR B CA   3  
ATOM   7324  C  C    . THR B 1 10 ? 146.413 -7.723  -5.488  1.00 0.00 ? 10  THR B C    3  
ATOM   7325  O  O    . THR B 1 10 ? 147.584 -8.071  -5.678  1.00 0.00 ? 10  THR B O    3  
ATOM   7326  C  CB   . THR B 1 10 ? 144.921 -7.036  -7.364  1.00 0.00 ? 10  THR B CB   3  
ATOM   7327  O  OG1  . THR B 1 10 ? 143.833 -7.439  -8.185  1.00 0.00 ? 10  THR B OG1  3  
ATOM   7328  C  CG2  . THR B 1 10 ? 146.120 -6.677  -8.242  1.00 0.00 ? 10  THR B CG2  3  
ATOM   7329  H  H    . THR B 1 10 ? 143.275 -8.133  -5.782  1.00 0.00 ? 10  THR B H    3  
ATOM   7330  H  HA   . THR B 1 10 ? 145.655 -9.008  -7.014  1.00 0.00 ? 10  THR B HA   3  
ATOM   7331  H  HB   . THR B 1 10 ? 144.634 -6.172  -6.785  1.00 0.00 ? 10  THR B HB   3  
ATOM   7332  H  HG1  . THR B 1 10 ? 143.875 -8.392  -8.286  1.00 0.00 ? 10  THR B HG1  3  
ATOM   7333  H  HG21 . THR B 1 10 ? 146.670 -7.575  -8.484  1.00 0.00 ? 10  THR B HG21 3  
ATOM   7334  H  HG22 . THR B 1 10 ? 146.764 -5.993  -7.711  1.00 0.00 ? 10  THR B HG22 3  
ATOM   7335  H  HG23 . THR B 1 10 ? 145.774 -6.211  -9.153  1.00 0.00 ? 10  THR B HG23 3  
ATOM   7336  N  N    . LEU B 1 11 ? 146.041 -6.940  -4.475  1.00 0.00 ? 11  LEU B N    3  
ATOM   7337  C  CA   . LEU B 1 11 ? 147.030 -6.435  -3.521  1.00 0.00 ? 11  LEU B CA   3  
ATOM   7338  C  C    . LEU B 1 11 ? 147.730 -7.585  -2.794  1.00 0.00 ? 11  LEU B C    3  
ATOM   7339  O  O    . LEU B 1 11 ? 148.961 -7.615  -2.652  1.00 0.00 ? 11  LEU B O    3  
ATOM   7340  C  CB   . LEU B 1 11 ? 146.301 -5.564  -2.497  1.00 0.00 ? 11  LEU B CB   3  
ATOM   7341  C  CG   . LEU B 1 11 ? 145.585 -4.418  -3.219  1.00 0.00 ? 11  LEU B CG   3  
ATOM   7342  C  CD1  . LEU B 1 11 ? 144.760 -3.607  -2.215  1.00 0.00 ? 11  LEU B CD1  3  
ATOM   7343  C  CD2  . LEU B 1 11 ? 146.625 -3.503  -3.877  1.00 0.00 ? 11  LEU B CD2  3  
ATOM   7344  H  H    . LEU B 1 11 ? 145.090 -6.692  -4.372  1.00 0.00 ? 11  LEU B H    3  
ATOM   7345  H  HA   . LEU B 1 11 ? 147.758 -5.835  -4.039  1.00 0.00 ? 11  LEU B HA   3  
ATOM   7346  H  HB2  . LEU B 1 11 ? 145.576 -6.163  -1.965  1.00 0.00 ? 11  LEU B HB2  3  
ATOM   7347  H  HB3  . LEU B 1 11 ? 147.015 -5.156  -1.799  1.00 0.00 ? 11  LEU B HB3  3  
ATOM   7348  H  HG   . LEU B 1 11 ? 144.934 -4.821  -3.976  1.00 0.00 ? 11  LEU B HG   3  
ATOM   7349  H  HD11 . LEU B 1 11 ? 143.773 -4.045  -2.130  1.00 0.00 ? 11  LEU B HD11 3  
ATOM   7350  H  HD12 . LEU B 1 11 ? 144.670 -2.587  -2.557  1.00 0.00 ? 11  LEU B HD12 3  
ATOM   7351  H  HD13 . LEU B 1 11 ? 145.244 -3.622  -1.250  1.00 0.00 ? 11  LEU B HD13 3  
ATOM   7352  H  HD21 . LEU B 1 11 ? 146.215 -2.511  -3.986  1.00 0.00 ? 11  LEU B HD21 3  
ATOM   7353  H  HD22 . LEU B 1 11 ? 146.884 -3.893  -4.850  1.00 0.00 ? 11  LEU B HD22 3  
ATOM   7354  H  HD23 . LEU B 1 11 ? 147.509 -3.460  -3.258  1.00 0.00 ? 11  LEU B HD23 3  
ATOM   7355  N  N    . ILE B 1 12 ? 146.936 -8.545  -2.348  1.00 0.00 ? 12  ILE B N    3  
ATOM   7356  C  CA   . ILE B 1 12 ? 147.480 -9.695  -1.656  1.00 0.00 ? 12  ILE B CA   3  
ATOM   7357  C  C    . ILE B 1 12 ? 148.294 -10.567 -2.607  1.00 0.00 ? 12  ILE B C    3  
ATOM   7358  O  O    . ILE B 1 12 ? 149.350 -11.084 -2.244  1.00 0.00 ? 12  ILE B O    3  
ATOM   7359  C  CB   . ILE B 1 12 ? 146.340 -10.490 -1.021  1.00 0.00 ? 12  ILE B CB   3  
ATOM   7360  C  CG1  . ILE B 1 12 ? 145.584 -9.568  -0.057  1.00 0.00 ? 12  ILE B CG1  3  
ATOM   7361  C  CG2  . ILE B 1 12 ? 146.910 -11.681 -0.247  1.00 0.00 ? 12  ILE B CG2  3  
ATOM   7362  C  CD1  . ILE B 1 12 ? 144.345 -10.278 0.492   1.00 0.00 ? 12  ILE B CD1  3  
ATOM   7363  H  H    . ILE B 1 12 ? 145.970 -8.481  -2.498  1.00 0.00 ? 12  ILE B H    3  
ATOM   7364  H  HA   . ILE B 1 12 ? 148.133 -9.344  -0.868  1.00 0.00 ? 12  ILE B HA   3  
ATOM   7365  H  HB   . ILE B 1 12 ? 145.669 -10.843 -1.790  1.00 0.00 ? 12  ILE B HB   3  
ATOM   7366  H  HG12 . ILE B 1 12 ? 146.235 -9.298  0.763   1.00 0.00 ? 12  ILE B HG12 3  
ATOM   7367  H  HG13 . ILE B 1 12 ? 145.280 -8.675  -0.581  1.00 0.00 ? 12  ILE B HG13 3  
ATOM   7368  H  HG21 . ILE B 1 12 ? 146.163 -12.058 0.436   1.00 0.00 ? 12  ILE B HG21 3  
ATOM   7369  H  HG22 . ILE B 1 12 ? 147.780 -11.364 0.310   1.00 0.00 ? 12  ILE B HG22 3  
ATOM   7370  H  HG23 . ILE B 1 12 ? 147.191 -12.460 -0.940  1.00 0.00 ? 12  ILE B HG23 3  
ATOM   7371  H  HD11 . ILE B 1 12 ? 144.650 -11.069 1.160   1.00 0.00 ? 12  ILE B HD11 3  
ATOM   7372  H  HD12 . ILE B 1 12 ? 143.777 -10.693 -0.325  1.00 0.00 ? 12  ILE B HD12 3  
ATOM   7373  H  HD13 . ILE B 1 12 ? 143.735 -9.565  1.032   1.00 0.00 ? 12  ILE B HD13 3  
ATOM   7374  N  N    . ASN B 1 13 ? 147.782 -10.733 -3.828  1.00 0.00 ? 13  ASN B N    3  
ATOM   7375  C  CA   . ASN B 1 13 ? 148.458 -11.554 -4.821  1.00 0.00 ? 13  ASN B CA   3  
ATOM   7376  C  C    . ASN B 1 13 ? 149.846 -11.009 -5.125  1.00 0.00 ? 13  ASN B C    3  
ATOM   7377  O  O    . ASN B 1 13 ? 150.805 -11.772 -5.236  1.00 0.00 ? 13  ASN B O    3  
ATOM   7378  C  CB   . ASN B 1 13 ? 147.642 -11.591 -6.116  1.00 0.00 ? 13  ASN B CB   3  
ATOM   7379  C  CG   . ASN B 1 13 ? 146.289 -12.260 -5.879  1.00 0.00 ? 13  ASN B CG   3  
ATOM   7380  O  OD1  . ASN B 1 13 ? 145.521 -12.452 -6.824  1.00 0.00 ? 13  ASN B OD1  3  
ATOM   7381  N  ND2  . ASN B 1 13 ? 145.933 -12.605 -4.671  1.00 0.00 ? 13  ASN B ND2  3  
ATOM   7382  H  H    . ASN B 1 13 ? 146.931 -10.303 -4.056  1.00 0.00 ? 13  ASN B H    3  
ATOM   7383  H  HA   . ASN B 1 13 ? 148.552 -12.560 -4.441  1.00 0.00 ? 13  ASN B HA   3  
ATOM   7384  H  HB2  . ASN B 1 13 ? 147.485 -10.582 -6.465  1.00 0.00 ? 13  ASN B HB2  3  
ATOM   7385  H  HB3  . ASN B 1 13 ? 148.188 -12.146 -6.863  1.00 0.00 ? 13  ASN B HB3  3  
ATOM   7386  H  HD21 . ASN B 1 13 ? 146.528 -12.435 -3.915  1.00 0.00 ? 13  ASN B HD21 3  
ATOM   7387  H  HD22 . ASN B 1 13 ? 145.064 -13.037 -4.522  1.00 0.00 ? 13  ASN B HD22 3  
ATOM   7388  N  N    . VAL B 1 14 ? 149.963 -9.684  -5.234  1.00 0.00 ? 14  VAL B N    3  
ATOM   7389  C  CA   . VAL B 1 14 ? 151.268 -9.093  -5.496  1.00 0.00 ? 14  VAL B CA   3  
ATOM   7390  C  C    . VAL B 1 14 ? 152.114 -9.153  -4.232  1.00 0.00 ? 14  VAL B C    3  
ATOM   7391  O  O    . VAL B 1 14 ? 153.330 -9.334  -4.289  1.00 0.00 ? 14  VAL B O    3  
ATOM   7392  C  CB   . VAL B 1 14 ? 151.130 -7.640  -5.969  1.00 0.00 ? 14  VAL B CB   3  
ATOM   7393  C  CG1  . VAL B 1 14 ? 150.265 -7.592  -7.230  1.00 0.00 ? 14  VAL B CG1  3  
ATOM   7394  C  CG2  . VAL B 1 14 ? 150.464 -6.796  -4.883  1.00 0.00 ? 14  VAL B CG2  3  
ATOM   7395  H  H    . VAL B 1 14 ? 149.170 -9.106  -5.123  1.00 0.00 ? 14  VAL B H    3  
ATOM   7396  H  HA   . VAL B 1 14 ? 151.758 -9.664  -6.276  1.00 0.00 ? 14  VAL B HA   3  
ATOM   7397  H  HB   . VAL B 1 14 ? 152.109 -7.240  -6.189  1.00 0.00 ? 14  VAL B HB   3  
ATOM   7398  H  HG11 . VAL B 1 14 ? 149.786 -6.626  -7.301  1.00 0.00 ? 14  VAL B HG11 3  
ATOM   7399  H  HG12 . VAL B 1 14 ? 149.512 -8.364  -7.181  1.00 0.00 ? 14  VAL B HG12 3  
ATOM   7400  H  HG13 . VAL B 1 14 ? 150.887 -7.750  -8.099  1.00 0.00 ? 14  VAL B HG13 3  
ATOM   7401  H  HG21 . VAL B 1 14 ? 150.999 -6.902  -3.953  1.00 0.00 ? 14  VAL B HG21 3  
ATOM   7402  H  HG22 . VAL B 1 14 ? 149.450 -7.127  -4.758  1.00 0.00 ? 14  VAL B HG22 3  
ATOM   7403  H  HG23 . VAL B 1 14 ? 150.468 -5.761  -5.181  1.00 0.00 ? 14  VAL B HG23 3  
ATOM   7404  N  N    . PHE B 1 15 ? 151.451 -8.989  -3.085  1.00 0.00 ? 15  PHE B N    3  
ATOM   7405  C  CA   . PHE B 1 15 ? 152.145 -9.015  -1.803  1.00 0.00 ? 15  PHE B CA   3  
ATOM   7406  C  C    . PHE B 1 15 ? 152.869 -10.340 -1.561  1.00 0.00 ? 15  PHE B C    3  
ATOM   7407  O  O    . PHE B 1 15 ? 154.038 -10.364 -1.166  1.00 0.00 ? 15  PHE B O    3  
ATOM   7408  C  CB   . PHE B 1 15 ? 151.113 -8.814  -0.694  1.00 0.00 ? 15  PHE B CB   3  
ATOM   7409  C  CG   . PHE B 1 15 ? 151.805 -8.725  0.635   1.00 0.00 ? 15  PHE B CG   3  
ATOM   7410  C  CD1  . PHE B 1 15 ? 152.272 -7.493  1.088   1.00 0.00 ? 15  PHE B CD1  3  
ATOM   7411  C  CD2  . PHE B 1 15 ? 151.978 -9.875  1.413   1.00 0.00 ? 15  PHE B CD2  3  
ATOM   7412  C  CE1  . PHE B 1 15 ? 152.913 -7.406  2.322   1.00 0.00 ? 15  PHE B CE1  3  
ATOM   7413  C  CE2  . PHE B 1 15 ? 152.622 -9.788  2.652   1.00 0.00 ? 15  PHE B CE2  3  
ATOM   7414  C  CZ   . PHE B 1 15 ? 153.091 -8.551  3.107   1.00 0.00 ? 15  PHE B CZ   3  
ATOM   7415  H  H    . PHE B 1 15 ? 150.473 -8.833  -3.102  1.00 0.00 ? 15  PHE B H    3  
ATOM   7416  H  HA   . PHE B 1 15 ? 152.858 -8.207  -1.765  1.00 0.00 ? 15  PHE B HA   3  
ATOM   7417  H  HB2  . PHE B 1 15 ? 150.565 -7.901  -0.873  1.00 0.00 ? 15  PHE B HB2  3  
ATOM   7418  H  HB3  . PHE B 1 15 ? 150.427 -9.648  -0.685  1.00 0.00 ? 15  PHE B HB3  3  
ATOM   7419  H  HD1  . PHE B 1 15 ? 152.136 -6.608  0.485   1.00 0.00 ? 15  PHE B HD1  3  
ATOM   7420  H  HD2  . PHE B 1 15 ? 151.615 -10.828 1.059   1.00 0.00 ? 15  PHE B HD2  3  
ATOM   7421  H  HE1  . PHE B 1 15 ? 153.269 -6.456  2.668   1.00 0.00 ? 15  PHE B HE1  3  
ATOM   7422  H  HE2  . PHE B 1 15 ? 152.758 -10.673 3.254   1.00 0.00 ? 15  PHE B HE2  3  
ATOM   7423  H  HZ   . PHE B 1 15 ? 153.588 -8.480  4.061   1.00 0.00 ? 15  PHE B HZ   3  
ATOM   7424  N  N    . HIS B 1 16 ? 152.154 -11.437 -1.782  1.00 0.00 ? 16  HIS B N    3  
ATOM   7425  C  CA   . HIS B 1 16 ? 152.711 -12.769 -1.566  1.00 0.00 ? 16  HIS B CA   3  
ATOM   7426  C  C    . HIS B 1 16 ? 153.917 -13.057 -2.454  1.00 0.00 ? 16  HIS B C    3  
ATOM   7427  O  O    . HIS B 1 16 ? 154.903 -13.643 -2.005  1.00 0.00 ? 16  HIS B O    3  
ATOM   7428  C  CB   . HIS B 1 16 ? 151.630 -13.817 -1.835  1.00 0.00 ? 16  HIS B CB   3  
ATOM   7429  C  CG   . HIS B 1 16 ? 152.162 -15.188 -1.522  1.00 0.00 ? 16  HIS B CG   3  
ATOM   7430  N  ND1  . HIS B 1 16 ? 152.478 -15.583 -0.232  1.00 0.00 ? 16  HIS B ND1  3  
ATOM   7431  C  CD2  . HIS B 1 16 ? 152.435 -16.270 -2.323  1.00 0.00 ? 16  HIS B CD2  3  
ATOM   7432  C  CE1  . HIS B 1 16 ? 152.917 -16.854 -0.293  1.00 0.00 ? 16  HIS B CE1  3  
ATOM   7433  N  NE2  . HIS B 1 16 ? 152.912 -17.319 -1.544  1.00 0.00 ? 16  HIS B NE2  3  
ATOM   7434  H  H    . HIS B 1 16 ? 151.226 -11.350 -2.081  1.00 0.00 ? 16  HIS B H    3  
ATOM   7435  H  HA   . HIS B 1 16 ? 153.015 -12.853 -0.534  1.00 0.00 ? 16  HIS B HA   3  
ATOM   7436  H  HB2  . HIS B 1 16 ? 150.771 -13.615 -1.212  1.00 0.00 ? 16  HIS B HB2  3  
ATOM   7437  H  HB3  . HIS B 1 16 ? 151.338 -13.774 -2.873  1.00 0.00 ? 16  HIS B HB3  3  
ATOM   7438  H  HD1  . HIS B 1 16 ? 152.396 -15.037 0.578   1.00 0.00 ? 16  HIS B HD1  3  
ATOM   7439  H  HD2  . HIS B 1 16 ? 152.300 -16.300 -3.393  1.00 0.00 ? 16  HIS B HD2  3  
ATOM   7440  H  HE1  . HIS B 1 16 ? 153.232 -17.427 0.565   1.00 0.00 ? 16  HIS B HE1  3  
ATOM   7441  H  HE2  . HIS B 1 16 ? 153.185 -18.210 -1.849  1.00 0.00 ? 16  HIS B HE2  3  
ATOM   7442  N  N    . ALA B 1 17 ? 153.814 -12.691 -3.724  1.00 0.00 ? 17  ALA B N    3  
ATOM   7443  C  CA   . ALA B 1 17 ? 154.883 -12.969 -4.677  1.00 0.00 ? 17  ALA B CA   3  
ATOM   7444  C  C    . ALA B 1 17 ? 156.194 -12.243 -4.360  1.00 0.00 ? 17  ALA B C    3  
ATOM   7445  O  O    . ALA B 1 17 ? 157.271 -12.813 -4.529  1.00 0.00 ? 17  ALA B O    3  
ATOM   7446  C  CB   . ALA B 1 17 ? 154.423 -12.575 -6.081  1.00 0.00 ? 17  ALA B CB   3  
ATOM   7447  H  H    . ALA B 1 17 ? 152.990 -12.262 -4.036  1.00 0.00 ? 17  ALA B H    3  
ATOM   7448  H  HA   . ALA B 1 17 ? 155.072 -14.028 -4.675  1.00 0.00 ? 17  ALA B HA   3  
ATOM   7449  H  HB1  . ALA B 1 17 ? 153.644 -13.249 -6.406  1.00 0.00 ? 17  ALA B HB1  3  
ATOM   7450  H  HB2  . ALA B 1 17 ? 155.258 -12.634 -6.763  1.00 0.00 ? 17  ALA B HB2  3  
ATOM   7451  H  HB3  . ALA B 1 17 ? 154.041 -11.565 -6.065  1.00 0.00 ? 17  ALA B HB3  3  
ATOM   7452  N  N    . HIS B 1 18 ? 156.114 -10.981 -3.947  1.00 0.00 ? 18  HIS B N    3  
ATOM   7453  C  CA   . HIS B 1 18 ? 157.335 -10.217 -3.677  1.00 0.00 ? 18  HIS B CA   3  
ATOM   7454  C  C    . HIS B 1 18 ? 157.831 -10.311 -2.235  1.00 0.00 ? 18  HIS B C    3  
ATOM   7455  O  O    . HIS B 1 18 ? 159.034 -10.228 -1.992  1.00 0.00 ? 18  HIS B O    3  
ATOM   7456  C  CB   . HIS B 1 18 ? 157.084 -8.753  -4.008  1.00 0.00 ? 18  HIS B CB   3  
ATOM   7457  C  CG   . HIS B 1 18 ? 156.708 -8.620  -5.458  1.00 0.00 ? 18  HIS B CG   3  
ATOM   7458  N  ND1  . HIS B 1 18 ? 157.601 -8.894  -6.482  1.00 0.00 ? 18  HIS B ND1  3  
ATOM   7459  C  CD2  . HIS B 1 18 ? 155.541 -8.236  -6.072  1.00 0.00 ? 18  HIS B CD2  3  
ATOM   7460  C  CE1  . HIS B 1 18 ? 156.965 -8.676  -7.646  1.00 0.00 ? 18  HIS B CE1  3  
ATOM   7461  N  NE2  . HIS B 1 18 ? 155.706 -8.273  -7.454  1.00 0.00 ? 18  HIS B NE2  3  
ATOM   7462  H  H    . HIS B 1 18 ? 155.239 -10.551 -3.856  1.00 0.00 ? 18  HIS B H    3  
ATOM   7463  H  HA   . HIS B 1 18 ? 158.113 -10.579 -4.329  1.00 0.00 ? 18  HIS B HA   3  
ATOM   7464  H  HB2  . HIS B 1 18 ? 156.278 -8.390  -3.389  1.00 0.00 ? 18  HIS B HB2  3  
ATOM   7465  H  HB3  . HIS B 1 18 ? 157.978 -8.180  -3.812  1.00 0.00 ? 18  HIS B HB3  3  
ATOM   7466  H  HD1  . HIS B 1 18 ? 158.529 -9.194  -6.376  1.00 0.00 ? 18  HIS B HD1  3  
ATOM   7467  H  HD2  . HIS B 1 18 ? 154.635 -7.947  -5.562  1.00 0.00 ? 18  HIS B HD2  3  
ATOM   7468  H  HE1  . HIS B 1 18 ? 157.417 -8.809  -8.618  1.00 0.00 ? 18  HIS B HE1  3  
ATOM   7469  H  HE2  . HIS B 1 18 ? 155.041 -8.050  -8.139  1.00 0.00 ? 18  HIS B HE2  3  
ATOM   7470  N  N    . SER B 1 19 ? 156.925 -10.451 -1.278  1.00 0.00 ? 19  SER B N    3  
ATOM   7471  C  CA   . SER B 1 19 ? 157.344 -10.510 0.120   1.00 0.00 ? 19  SER B CA   3  
ATOM   7472  C  C    . SER B 1 19 ? 158.228 -11.725 0.392   1.00 0.00 ? 19  SER B C    3  
ATOM   7473  O  O    . SER B 1 19 ? 159.101 -11.694 1.258   1.00 0.00 ? 19  SER B O    3  
ATOM   7474  C  CB   . SER B 1 19 ? 156.110 -10.564 1.018   1.00 0.00 ? 19  SER B CB   3  
ATOM   7475  O  OG   . SER B 1 19 ? 155.431 -11.793 0.799   1.00 0.00 ? 19  SER B OG   3  
ATOM   7476  H  H    . SER B 1 19 ? 155.969 -10.490 -1.505  1.00 0.00 ? 19  SER B H    3  
ATOM   7477  H  HA   . SER B 1 19 ? 157.903 -9.614  0.353   1.00 0.00 ? 19  SER B HA   3  
ATOM   7478  H  HB2  . SER B 1 19 ? 156.409 -10.501 2.051   1.00 0.00 ? 19  SER B HB2  3  
ATOM   7479  H  HB3  . SER B 1 19 ? 155.458 -9.733  0.782   1.00 0.00 ? 19  SER B HB3  3  
ATOM   7480  H  HG   . SER B 1 19 ? 154.780 -11.653 0.107   1.00 0.00 ? 19  SER B HG   3  
ATOM   7481  N  N    . GLY B 1 20 ? 157.978 -12.793 -0.344  1.00 0.00 ? 20  GLY B N    3  
ATOM   7482  C  CA   . GLY B 1 20 ? 158.729 -14.032 -0.184  1.00 0.00 ? 20  GLY B CA   3  
ATOM   7483  C  C    . GLY B 1 20 ? 160.232 -13.884 -0.438  1.00 0.00 ? 20  GLY B C    3  
ATOM   7484  O  O    . GLY B 1 20 ? 161.026 -14.668 0.083   1.00 0.00 ? 20  GLY B O    3  
ATOM   7485  H  H    . GLY B 1 20 ? 157.260 -12.755 -1.009  1.00 0.00 ? 20  GLY B H    3  
ATOM   7486  H  HA2  . GLY B 1 20 ? 158.592 -14.382 0.826   1.00 0.00 ? 20  GLY B HA2  3  
ATOM   7487  H  HA3  . GLY B 1 20 ? 158.329 -14.772 -0.860  1.00 0.00 ? 20  GLY B HA3  3  
ATOM   7488  N  N    . LYS B 1 21 ? 160.626 -12.936 -1.289  1.00 0.00 ? 21  LYS B N    3  
ATOM   7489  C  CA   . LYS B 1 21 ? 162.044 -12.799 -1.634  1.00 0.00 ? 21  LYS B CA   3  
ATOM   7490  C  C    . LYS B 1 21 ? 162.955 -12.583 -0.420  1.00 0.00 ? 21  LYS B C    3  
ATOM   7491  O  O    . LYS B 1 21 ? 164.044 -13.153 -0.366  1.00 0.00 ? 21  LYS B O    3  
ATOM   7492  C  CB   . LYS B 1 21 ? 162.244 -11.628 -2.601  1.00 0.00 ? 21  LYS B CB   3  
ATOM   7493  C  CG   . LYS B 1 21 ? 161.491 -11.892 -3.906  1.00 0.00 ? 21  LYS B CG   3  
ATOM   7494  C  CD   . LYS B 1 21 ? 161.925 -10.871 -4.963  1.00 0.00 ? 21  LYS B CD   3  
ATOM   7495  C  CE   . LYS B 1 21 ? 161.543 -9.455  -4.523  1.00 0.00 ? 21  LYS B CE   3  
ATOM   7496  N  NZ   . LYS B 1 21 ? 160.137 -9.441  -4.032  1.00 0.00 ? 21  LYS B NZ   3  
ATOM   7497  H  H    . LYS B 1 21 ? 159.960 -12.366 -1.725  1.00 0.00 ? 21  LYS B H    3  
ATOM   7498  H  HA   . LYS B 1 21 ? 162.357 -13.701 -2.136  1.00 0.00 ? 21  LYS B HA   3  
ATOM   7499  H  HB2  . LYS B 1 21 ? 161.869 -10.724 -2.146  1.00 0.00 ? 21  LYS B HB2  3  
ATOM   7500  H  HB3  . LYS B 1 21 ? 163.296 -11.514 -2.813  1.00 0.00 ? 21  LYS B HB3  3  
ATOM   7501  H  HG2  . LYS B 1 21 ? 161.716 -12.891 -4.254  1.00 0.00 ? 21  LYS B HG2  3  
ATOM   7502  H  HG3  . LYS B 1 21 ? 160.429 -11.802 -3.734  1.00 0.00 ? 21  LYS B HG3  3  
ATOM   7503  H  HD2  . LYS B 1 21 ? 162.996 -10.928 -5.095  1.00 0.00 ? 21  LYS B HD2  3  
ATOM   7504  H  HD3  . LYS B 1 21 ? 161.438 -11.097 -5.900  1.00 0.00 ? 21  LYS B HD3  3  
ATOM   7505  H  HE2  . LYS B 1 21 ? 162.203 -9.133  -3.732  1.00 0.00 ? 21  LYS B HE2  3  
ATOM   7506  H  HE3  . LYS B 1 21 ? 161.636 -8.782  -5.363  1.00 0.00 ? 21  LYS B HE3  3  
ATOM   7507  H  HZ1  . LYS B 1 21 ? 160.018 -10.164 -3.297  1.00 0.00 ? 21  LYS B HZ1  3  
ATOM   7508  H  HZ2  . LYS B 1 21 ? 159.494 -9.641  -4.825  1.00 0.00 ? 21  LYS B HZ2  3  
ATOM   7509  H  HZ3  . LYS B 1 21 ? 159.918 -8.506  -3.636  1.00 0.00 ? 21  LYS B HZ3  3  
ATOM   7510  N  N    . GLU B 1 22 ? 162.537 -11.772 0.551   1.00 0.00 ? 22  GLU B N    3  
ATOM   7511  C  CA   . GLU B 1 22 ? 163.386 -11.539 1.727   1.00 0.00 ? 22  GLU B CA   3  
ATOM   7512  C  C    . GLU B 1 22 ? 162.584 -11.446 3.020   1.00 0.00 ? 22  GLU B C    3  
ATOM   7513  O  O    . GLU B 1 22 ? 161.436 -11.003 3.028   1.00 0.00 ? 22  GLU B O    3  
ATOM   7514  C  CB   . GLU B 1 22 ? 164.199 -10.256 1.551   1.00 0.00 ? 22  GLU B CB   3  
ATOM   7515  C  CG   . GLU B 1 22 ? 165.099 -10.383 0.322   1.00 0.00 ? 22  GLU B CG   3  
ATOM   7516  C  CD   . GLU B 1 22 ? 165.983 -9.148  0.206   1.00 0.00 ? 22  GLU B CD   3  
ATOM   7517  O  OE1  . GLU B 1 22 ? 165.785 -8.230  0.985   1.00 0.00 ? 22  GLU B OE1  3  
ATOM   7518  O  OE2  . GLU B 1 22 ? 166.854 -9.144  -0.648  1.00 0.00 ? 22  GLU B OE2  3  
ATOM   7519  H  H    . GLU B 1 22 ? 161.666 -11.329 0.479   1.00 0.00 ? 22  GLU B H    3  
ATOM   7520  H  HA   . GLU B 1 22 ? 164.077 -12.364 1.820   1.00 0.00 ? 22  GLU B HA   3  
ATOM   7521  H  HB2  . GLU B 1 22 ? 163.528 -9.421  1.421   1.00 0.00 ? 22  GLU B HB2  3  
ATOM   7522  H  HB3  . GLU B 1 22 ? 164.809 -10.095 2.426   1.00 0.00 ? 22  GLU B HB3  3  
ATOM   7523  H  HG2  . GLU B 1 22 ? 165.719 -11.263 0.419   1.00 0.00 ? 22  GLU B HG2  3  
ATOM   7524  H  HG3  . GLU B 1 22 ? 164.488 -10.470 -0.564  1.00 0.00 ? 22  GLU B HG3  3  
ATOM   7525  N  N    . GLY B 1 23 ? 163.218 -11.839 4.121   1.00 0.00 ? 23  GLY B N    3  
ATOM   7526  C  CA   . GLY B 1 23 ? 162.577 -11.763 5.427   1.00 0.00 ? 23  GLY B CA   3  
ATOM   7527  C  C    . GLY B 1 23 ? 161.390 -12.705 5.503   1.00 0.00 ? 23  GLY B C    3  
ATOM   7528  O  O    . GLY B 1 23 ? 161.333 -13.710 4.795   1.00 0.00 ? 23  GLY B O    3  
ATOM   7529  H  H    . GLY B 1 23 ? 164.140 -12.160 4.057   1.00 0.00 ? 23  GLY B H    3  
ATOM   7530  H  HA2  . GLY B 1 23 ? 163.294 -12.031 6.190   1.00 0.00 ? 23  GLY B HA2  3  
ATOM   7531  H  HA3  . GLY B 1 23 ? 162.236 -10.753 5.597   1.00 0.00 ? 23  GLY B HA3  3  
ATOM   7532  N  N    . ASP B 1 24 ? 160.431 -12.358 6.351   1.00 0.00 ? 24  ASP B N    3  
ATOM   7533  C  CA   . ASP B 1 24 ? 159.235 -13.168 6.488   1.00 0.00 ? 24  ASP B CA   3  
ATOM   7534  C  C    . ASP B 1 24 ? 158.366 -13.008 5.248   1.00 0.00 ? 24  ASP B C    3  
ATOM   7535  O  O    . ASP B 1 24 ? 158.194 -11.898 4.734   1.00 0.00 ? 24  ASP B O    3  
ATOM   7536  C  CB   . ASP B 1 24 ? 158.448 -12.740 7.729   1.00 0.00 ? 24  ASP B CB   3  
ATOM   7537  C  CG   . ASP B 1 24 ? 159.248 -13.054 8.988   1.00 0.00 ? 24  ASP B CG   3  
ATOM   7538  O  OD1  . ASP B 1 24 ? 160.219 -13.784 8.883   1.00 0.00 ? 24  ASP B OD1  3  
ATOM   7539  O  OD2  . ASP B 1 24 ? 158.879 -12.557 10.040  1.00 0.00 ? 24  ASP B OD2  3  
ATOM   7540  H  H    . ASP B 1 24 ? 160.522 -11.536 6.876   1.00 0.00 ? 24  ASP B H    3  
ATOM   7541  H  HA   . ASP B 1 24 ? 159.519 -14.204 6.592   1.00 0.00 ? 24  ASP B HA   3  
ATOM   7542  H  HB2  . ASP B 1 24 ? 158.255 -11.678 7.681   1.00 0.00 ? 24  ASP B HB2  3  
ATOM   7543  H  HB3  . ASP B 1 24 ? 157.510 -13.275 7.759   1.00 0.00 ? 24  ASP B HB3  3  
ATOM   7544  N  N    . LYS B 1 25 ? 157.819 -14.116 4.770   1.00 0.00 ? 25  LYS B N    3  
ATOM   7545  C  CA   . LYS B 1 25 ? 156.963 -14.079 3.594   1.00 0.00 ? 25  LYS B CA   3  
ATOM   7546  C  C    . LYS B 1 25 ? 155.763 -13.181 3.850   1.00 0.00 ? 25  LYS B C    3  
ATOM   7547  O  O    . LYS B 1 25 ? 155.274 -12.486 2.964   1.00 0.00 ? 25  LYS B O    3  
ATOM   7548  C  CB   . LYS B 1 25 ? 156.414 -15.489 3.325   1.00 0.00 ? 25  LYS B CB   3  
ATOM   7549  C  CG   . LYS B 1 25 ? 157.541 -16.457 2.982   1.00 0.00 ? 25  LYS B CG   3  
ATOM   7550  C  CD   . LYS B 1 25 ? 156.982 -17.878 2.852   1.00 0.00 ? 25  LYS B CD   3  
ATOM   7551  C  CE   . LYS B 1 25 ? 156.059 -17.974 1.632   1.00 0.00 ? 25  LYS B CE   3  
ATOM   7552  N  NZ   . LYS B 1 25 ? 156.665 -17.251 0.478   1.00 0.00 ? 25  LYS B NZ   3  
ATOM   7553  H  H    . LYS B 1 25 ? 157.989 -14.972 5.219   1.00 0.00 ? 25  LYS B H    3  
ATOM   7554  H  HA   . LYS B 1 25 ? 157.516 -13.734 2.737   1.00 0.00 ? 25  LYS B HA   3  
ATOM   7555  H  HB2  . LYS B 1 25 ? 155.901 -15.843 4.200   1.00 0.00 ? 25  LYS B HB2  3  
ATOM   7556  H  HB3  . LYS B 1 25 ? 155.721 -15.444 2.499   1.00 0.00 ? 25  LYS B HB3  3  
ATOM   7557  H  HG2  . LYS B 1 25 ? 157.979 -16.165 2.054   1.00 0.00 ? 25  LYS B HG2  3  
ATOM   7558  H  HG3  . LYS B 1 25 ? 158.289 -16.435 3.761   1.00 0.00 ? 25  LYS B HG3  3  
ATOM   7559  H  HD2  . LYS B 1 25 ? 157.800 -18.574 2.737   1.00 0.00 ? 25  LYS B HD2  3  
ATOM   7560  H  HD3  . LYS B 1 25 ? 156.423 -18.126 3.742   1.00 0.00 ? 25  LYS B HD3  3  
ATOM   7561  H  HE2  . LYS B 1 25 ? 155.920 -19.013 1.369   1.00 0.00 ? 25  LYS B HE2  3  
ATOM   7562  H  HE3  . LYS B 1 25 ? 155.102 -17.536 1.870   1.00 0.00 ? 25  LYS B HE3  3  
ATOM   7563  H  HZ1  . LYS B 1 25 ? 156.372 -16.254 0.501   1.00 0.00 ? 25  LYS B HZ1  3  
ATOM   7564  H  HZ2  . LYS B 1 25 ? 156.345 -17.688 -0.410  1.00 0.00 ? 25  LYS B HZ2  3  
ATOM   7565  H  HZ3  . LYS B 1 25 ? 157.701 -17.307 0.540   1.00 0.00 ? 25  LYS B HZ3  3  
ATOM   7566  N  N    . TYR B 1 26 ? 155.259 -13.285 5.066   1.00 0.00 ? 26  TYR B N    3  
ATOM   7567  C  CA   . TYR B 1 26 ? 154.058 -12.576 5.475   1.00 0.00 ? 26  TYR B CA   3  
ATOM   7568  C  C    . TYR B 1 26 ? 154.268 -11.067 5.633   1.00 0.00 ? 26  TYR B C    3  
ATOM   7569  O  O    . TYR B 1 26 ? 153.327 -10.295 5.447   1.00 0.00 ? 26  TYR B O    3  
ATOM   7570  C  CB   . TYR B 1 26 ? 153.569 -13.201 6.778   1.00 0.00 ? 26  TYR B CB   3  
ATOM   7571  C  CG   . TYR B 1 26 ? 153.321 -14.704 6.591   1.00 0.00 ? 26  TYR B CG   3  
ATOM   7572  C  CD1  . TYR B 1 26 ? 153.567 -15.363 5.353   1.00 0.00 ? 26  TYR B CD1  3  
ATOM   7573  C  CD2  . TYR B 1 26 ? 152.893 -15.460 7.690   1.00 0.00 ? 26  TYR B CD2  3  
ATOM   7574  C  CE1  . TYR B 1 26 ? 153.382 -16.740 5.240   1.00 0.00 ? 26  TYR B CE1  3  
ATOM   7575  C  CE2  . TYR B 1 26 ? 152.698 -16.844 7.563   1.00 0.00 ? 26  TYR B CE2  3  
ATOM   7576  C  CZ   . TYR B 1 26 ? 152.944 -17.482 6.341   1.00 0.00 ? 26  TYR B CZ   3  
ATOM   7577  O  OH   . TYR B 1 26 ? 152.762 -18.845 6.225   1.00 0.00 ? 26  TYR B OH   3  
ATOM   7578  H  H    . TYR B 1 26 ? 155.675 -13.909 5.697   1.00 0.00 ? 26  TYR B H    3  
ATOM   7579  H  HA   . TYR B 1 26 ? 153.296 -12.723 4.726   1.00 0.00 ? 26  TYR B HA   3  
ATOM   7580  H  HB2  . TYR B 1 26 ? 154.314 -13.054 7.546   1.00 0.00 ? 26  TYR B HB2  3  
ATOM   7581  H  HB3  . TYR B 1 26 ? 152.648 -12.725 7.079   1.00 0.00 ? 26  TYR B HB3  3  
ATOM   7582  H  HD1  . TYR B 1 26 ? 153.883 -14.822 4.485   1.00 0.00 ? 26  TYR B HD1  3  
ATOM   7583  H  HD2  . TYR B 1 26 ? 152.701 -14.975 8.635   1.00 0.00 ? 26  TYR B HD2  3  
ATOM   7584  H  HE1  . TYR B 1 26 ? 153.588 -17.230 4.293   1.00 0.00 ? 26  TYR B HE1  3  
ATOM   7585  H  HE2  . TYR B 1 26 ? 152.360 -17.419 8.413   1.00 0.00 ? 26  TYR B HE2  3  
ATOM   7586  H  HH   . TYR B 1 26 ? 152.322 -19.154 7.021   1.00 0.00 ? 26  TYR B HH   3  
ATOM   7587  N  N    . LYS B 1 27 ? 155.481 -10.639 5.999   1.00 0.00 ? 27  LYS B N    3  
ATOM   7588  C  CA   . LYS B 1 27 ? 155.736 -9.205  6.194   1.00 0.00 ? 27  LYS B CA   3  
ATOM   7589  C  C    . LYS B 1 27 ? 156.840 -8.691  5.272   1.00 0.00 ? 27  LYS B C    3  
ATOM   7590  O  O    . LYS B 1 27 ? 157.705 -9.447  4.833   1.00 0.00 ? 27  LYS B O    3  
ATOM   7591  C  CB   . LYS B 1 27 ? 156.102 -8.915  7.651   1.00 0.00 ? 27  LYS B CB   3  
ATOM   7592  C  CG   . LYS B 1 27 ? 154.993 -9.448  8.563   1.00 0.00 ? 27  LYS B CG   3  
ATOM   7593  C  CD   . LYS B 1 27 ? 155.110 -8.832  9.960   1.00 0.00 ? 27  LYS B CD   3  
ATOM   7594  C  CE   . LYS B 1 27 ? 156.466 -9.121  10.580  1.00 0.00 ? 27  LYS B CE   3  
ATOM   7595  N  NZ   . LYS B 1 27 ? 156.701 -10.591 10.629  1.00 0.00 ? 27  LYS B NZ   3  
ATOM   7596  H  H    . LYS B 1 27 ? 156.199 -11.287 6.156   1.00 0.00 ? 27  LYS B H    3  
ATOM   7597  H  HA   . LYS B 1 27 ? 154.831 -8.659  5.964   1.00 0.00 ? 27  LYS B HA   3  
ATOM   7598  H  HB2  . LYS B 1 27 ? 157.033 -9.408  7.886   1.00 0.00 ? 27  LYS B HB2  3  
ATOM   7599  H  HB3  . LYS B 1 27 ? 156.207 -7.851  7.794   1.00 0.00 ? 27  LYS B HB3  3  
ATOM   7600  H  HG2  . LYS B 1 27 ? 154.031 -9.195  8.140   1.00 0.00 ? 27  LYS B HG2  3  
ATOM   7601  H  HG3  . LYS B 1 27 ? 155.077 -10.522 8.639   1.00 0.00 ? 27  LYS B HG3  3  
ATOM   7602  H  HD2  . LYS B 1 27 ? 154.987 -7.774  9.893   1.00 0.00 ? 27  LYS B HD2  3  
ATOM   7603  H  HD3  . LYS B 1 27 ? 154.339 -9.240  10.595  1.00 0.00 ? 27  LYS B HD3  3  
ATOM   7604  H  HE2  . LYS B 1 27 ? 157.236 -8.642  9.994   1.00 0.00 ? 27  LYS B HE2  3  
ATOM   7605  H  HE3  . LYS B 1 27 ? 156.477 -8.713  11.577  1.00 0.00 ? 27  LYS B HE3  3  
ATOM   7606  H  HZ1  . LYS B 1 27 ? 155.936 -11.048 11.164  1.00 0.00 ? 27  LYS B HZ1  3  
ATOM   7607  H  HZ2  . LYS B 1 27 ? 157.613 -10.781 11.096  1.00 0.00 ? 27  LYS B HZ2  3  
ATOM   7608  H  HZ3  . LYS B 1 27 ? 156.722 -10.973 9.662   1.00 0.00 ? 27  LYS B HZ3  3  
ATOM   7609  N  N    . LEU B 1 28 ? 156.783 -7.393  4.978   1.00 0.00 ? 28  LEU B N    3  
ATOM   7610  C  CA   . LEU B 1 28 ? 157.754 -6.745  4.094   1.00 0.00 ? 28  LEU B CA   3  
ATOM   7611  C  C    . LEU B 1 28 ? 158.961 -6.182  4.833   1.00 0.00 ? 28  LEU B C    3  
ATOM   7612  O  O    . LEU B 1 28 ? 158.855 -5.650  5.939   1.00 0.00 ? 28  LEU B O    3  
ATOM   7613  C  CB   . LEU B 1 28 ? 157.074 -5.605  3.330   1.00 0.00 ? 28  LEU B CB   3  
ATOM   7614  C  CG   . LEU B 1 28 ? 155.941 -6.162  2.487   1.00 0.00 ? 28  LEU B CG   3  
ATOM   7615  C  CD1  . LEU B 1 28 ? 155.164 -5.003  1.856   1.00 0.00 ? 28  LEU B CD1  3  
ATOM   7616  C  CD2  . LEU B 1 28 ? 156.516 -7.035  1.367   1.00 0.00 ? 28  LEU B CD2  3  
ATOM   7617  H  H    . LEU B 1 28 ? 156.057 -6.854  5.357   1.00 0.00 ? 28  LEU B H    3  
ATOM   7618  H  HA   . LEU B 1 28 ? 158.104 -7.469  3.378   1.00 0.00 ? 28  LEU B HA   3  
ATOM   7619  H  HB2  . LEU B 1 28 ? 156.666 -4.891  4.034   1.00 0.00 ? 28  LEU B HB2  3  
ATOM   7620  H  HB3  . LEU B 1 28 ? 157.790 -5.113  2.692   1.00 0.00 ? 28  LEU B HB3  3  
ATOM   7621  H  HG   . LEU B 1 28 ? 155.300 -6.753  3.113   1.00 0.00 ? 28  LEU B HG   3  
ATOM   7622  H  HD11 . LEU B 1 28 ? 154.546 -4.533  2.606   1.00 0.00 ? 28  LEU B HD11 3  
ATOM   7623  H  HD12 . LEU B 1 28 ? 154.539 -5.380  1.060   1.00 0.00 ? 28  LEU B HD12 3  
ATOM   7624  H  HD13 . LEU B 1 28 ? 155.859 -4.279  1.457   1.00 0.00 ? 28  LEU B HD13 3  
ATOM   7625  H  HD21 . LEU B 1 28 ? 156.668 -8.039  1.732   1.00 0.00 ? 28  LEU B HD21 3  
ATOM   7626  H  HD22 . LEU B 1 28 ? 157.458 -6.623  1.036   1.00 0.00 ? 28  LEU B HD22 3  
ATOM   7627  H  HD23 . LEU B 1 28 ? 155.825 -7.056  0.537   1.00 0.00 ? 28  LEU B HD23 3  
ATOM   7628  N  N    . SER B 1 29 ? 160.100 -6.276  4.160   1.00 0.00 ? 29  SER B N    3  
ATOM   7629  C  CA   . SER B 1 29 ? 161.360 -5.755  4.665   1.00 0.00 ? 29  SER B CA   3  
ATOM   7630  C  C    . SER B 1 29 ? 161.582 -4.395  4.020   1.00 0.00 ? 29  SER B C    3  
ATOM   7631  O  O    . SER B 1 29 ? 160.982 -4.102  2.988   1.00 0.00 ? 29  SER B O    3  
ATOM   7632  C  CB   . SER B 1 29 ? 162.511 -6.699  4.315   1.00 0.00 ? 29  SER B CB   3  
ATOM   7633  O  OG   . SER B 1 29 ? 163.705 -6.230  4.930   1.00 0.00 ? 29  SER B OG   3  
ATOM   7634  H  H    . SER B 1 29 ? 160.085 -6.686  3.270   1.00 0.00 ? 29  SER B H    3  
ATOM   7635  H  HA   . SER B 1 29 ? 161.298 -5.640  5.737   1.00 0.00 ? 29  SER B HA   3  
ATOM   7636  H  HB2  . SER B 1 29 ? 162.292 -7.689  4.677   1.00 0.00 ? 29  SER B HB2  3  
ATOM   7637  H  HB3  . SER B 1 29 ? 162.635 -6.730  3.242   1.00 0.00 ? 29  SER B HB3  3  
ATOM   7638  H  HG   . SER B 1 29 ? 163.564 -6.216  5.878   1.00 0.00 ? 29  SER B HG   3  
ATOM   7639  N  N    . LYS B 1 30 ? 162.395 -3.542  4.625   1.00 0.00 ? 30  LYS B N    3  
ATOM   7640  C  CA   . LYS B 1 30 ? 162.586 -2.216  4.055   1.00 0.00 ? 30  LYS B CA   3  
ATOM   7641  C  C    . LYS B 1 30 ? 162.987 -2.315  2.585   1.00 0.00 ? 30  LYS B C    3  
ATOM   7642  O  O    . LYS B 1 30 ? 162.467 -1.570  1.751   1.00 0.00 ? 30  LYS B O    3  
ATOM   7643  C  CB   . LYS B 1 30 ? 163.674 -1.468  4.826   1.00 0.00 ? 30  LYS B CB   3  
ATOM   7644  C  CG   . LYS B 1 30 ? 163.794 -0.042  4.286   1.00 0.00 ? 30  LYS B CG   3  
ATOM   7645  C  CD   . LYS B 1 30 ? 164.927 0.686   5.013   1.00 0.00 ? 30  LYS B CD   3  
ATOM   7646  C  CE   . LYS B 1 30 ? 164.956 2.152   4.576   1.00 0.00 ? 30  LYS B CE   3  
ATOM   7647  N  NZ   . LYS B 1 30 ? 165.790 2.938   5.528   1.00 0.00 ? 30  LYS B NZ   3  
ATOM   7648  H  H    . LYS B 1 30 ? 162.837 -3.790  5.464   1.00 0.00 ? 30  LYS B H    3  
ATOM   7649  H  HA   . LYS B 1 30 ? 161.661 -1.665  4.131   1.00 0.00 ? 30  LYS B HA   3  
ATOM   7650  H  HB2  . LYS B 1 30 ? 163.414 -1.436  5.875   1.00 0.00 ? 30  LYS B HB2  3  
ATOM   7651  H  HB3  . LYS B 1 30 ? 164.617 -1.978  4.704   1.00 0.00 ? 30  LYS B HB3  3  
ATOM   7652  H  HG2  . LYS B 1 30 ? 164.008 -0.075  3.227   1.00 0.00 ? 30  LYS B HG2  3  
ATOM   7653  H  HG3  . LYS B 1 30 ? 162.867 0.486   4.449   1.00 0.00 ? 30  LYS B HG3  3  
ATOM   7654  H  HD2  . LYS B 1 30 ? 164.765 0.631   6.079   1.00 0.00 ? 30  LYS B HD2  3  
ATOM   7655  H  HD3  . LYS B 1 30 ? 165.869 0.222   4.766   1.00 0.00 ? 30  LYS B HD3  3  
ATOM   7656  H  HE2  . LYS B 1 30 ? 165.377 2.225   3.585   1.00 0.00 ? 30  LYS B HE2  3  
ATOM   7657  H  HE3  . LYS B 1 30 ? 163.950 2.546   4.569   1.00 0.00 ? 30  LYS B HE3  3  
ATOM   7658  H  HZ1  . LYS B 1 30 ? 165.179 3.555   6.099   1.00 0.00 ? 30  LYS B HZ1  3  
ATOM   7659  H  HZ2  . LYS B 1 30 ? 166.471 3.517   4.995   1.00 0.00 ? 30  LYS B HZ2  3  
ATOM   7660  H  HZ3  . LYS B 1 30 ? 166.305 2.288   6.156   1.00 0.00 ? 30  LYS B HZ3  3  
ATOM   7661  N  N    . LYS B 1 31 ? 163.872 -3.248  2.249   1.00 0.00 ? 31  LYS B N    3  
ATOM   7662  C  CA   . LYS B 1 31 ? 164.253 -3.401  0.850   1.00 0.00 ? 31  LYS B CA   3  
ATOM   7663  C  C    . LYS B 1 31 ? 163.061 -3.761  -0.012  1.00 0.00 ? 31  LYS B C    3  
ATOM   7664  O  O    . LYS B 1 31 ? 162.861 -3.199  -1.094  1.00 0.00 ? 31  LYS B O    3  
ATOM   7665  C  CB   . LYS B 1 31 ? 165.227 -4.561  0.675   1.00 0.00 ? 31  LYS B CB   3  
ATOM   7666  C  CG   . LYS B 1 31 ? 165.605 -4.662  -0.810  1.00 0.00 ? 31  LYS B CG   3  
ATOM   7667  C  CD   . LYS B 1 31 ? 166.336 -5.963  -1.065  1.00 0.00 ? 31  LYS B CD   3  
ATOM   7668  C  CE   . LYS B 1 31 ? 166.609 -6.074  -2.559  1.00 0.00 ? 31  LYS B CE   3  
ATOM   7669  N  NZ   . LYS B 1 31 ? 167.617 -5.053  -2.963  1.00 0.00 ? 31  LYS B NZ   3  
ATOM   7670  H  H    . LYS B 1 31 ? 164.247 -3.844  2.931   1.00 0.00 ? 31  LYS B H    3  
ATOM   7671  H  HA   . LYS B 1 31 ? 164.710 -2.494  0.490   1.00 0.00 ? 31  LYS B HA   3  
ATOM   7672  H  HB2  . LYS B 1 31 ? 166.113 -4.382  1.267   1.00 0.00 ? 31  LYS B HB2  3  
ATOM   7673  H  HB3  . LYS B 1 31 ? 164.758 -5.480  0.990   1.00 0.00 ? 31  LYS B HB3  3  
ATOM   7674  H  HG2  . LYS B 1 31 ? 164.726 -4.634  -1.433  1.00 0.00 ? 31  LYS B HG2  3  
ATOM   7675  H  HG3  . LYS B 1 31 ? 166.252 -3.839  -1.071  1.00 0.00 ? 31  LYS B HG3  3  
ATOM   7676  H  HD2  . LYS B 1 31 ? 167.265 -5.984  -0.511  1.00 0.00 ? 31  LYS B HD2  3  
ATOM   7677  H  HD3  . LYS B 1 31 ? 165.700 -6.781  -0.759  1.00 0.00 ? 31  LYS B HD3  3  
ATOM   7678  H  HE2  . LYS B 1 31 ? 166.978 -7.061  -2.786  1.00 0.00 ? 31  LYS B HE2  3  
ATOM   7679  H  HE3  . LYS B 1 31 ? 165.680 -5.900  -3.094  1.00 0.00 ? 31  LYS B HE3  3  
ATOM   7680  H  HZ1  . LYS B 1 31 ? 168.417 -5.523  -3.430  1.00 0.00 ? 31  LYS B HZ1  3  
ATOM   7681  H  HZ2  . LYS B 1 31 ? 167.955 -4.547  -2.119  1.00 0.00 ? 31  LYS B HZ2  3  
ATOM   7682  H  HZ3  . LYS B 1 31 ? 167.182 -4.378  -3.622  1.00 0.00 ? 31  LYS B HZ3  3  
ATOM   7683  N  N    . GLU B 1 32 ? 162.307 -4.752  0.440   1.00 0.00 ? 32  GLU B N    3  
ATOM   7684  C  CA   . GLU B 1 32 ? 161.194 -5.222  -0.349  1.00 0.00 ? 32  GLU B CA   3  
ATOM   7685  C  C    . GLU B 1 32 ? 160.181 -4.116  -0.530  1.00 0.00 ? 32  GLU B C    3  
ATOM   7686  O  O    . GLU B 1 32 ? 159.601 -3.945  -1.599  1.00 0.00 ? 32  GLU B O    3  
ATOM   7687  C  CB   . GLU B 1 32 ? 160.501 -6.381  0.368   1.00 0.00 ? 32  GLU B CB   3  
ATOM   7688  C  CG   . GLU B 1 32 ? 161.455 -7.572  0.470   1.00 0.00 ? 32  GLU B CG   3  
ATOM   7689  C  CD   . GLU B 1 32 ? 160.753 -8.756  1.132   1.00 0.00 ? 32  GLU B CD   3  
ATOM   7690  O  OE1  . GLU B 1 32 ? 159.678 -8.562  1.680   1.00 0.00 ? 32  GLU B OE1  3  
ATOM   7691  O  OE2  . GLU B 1 32 ? 161.296 -9.843  1.072   1.00 0.00 ? 32  GLU B OE2  3  
ATOM   7692  H  H    . GLU B 1 32 ? 162.537 -5.201  1.281   1.00 0.00 ? 32  GLU B H    3  
ATOM   7693  H  HA   . GLU B 1 32 ? 161.573 -5.567  -1.310  1.00 0.00 ? 32  GLU B HA   3  
ATOM   7694  H  HB2  . GLU B 1 32 ? 160.204 -6.056  1.360   1.00 0.00 ? 32  GLU B HB2  3  
ATOM   7695  H  HB3  . GLU B 1 32 ? 159.624 -6.672  -0.191  1.00 0.00 ? 32  GLU B HB3  3  
ATOM   7696  H  HG2  . GLU B 1 32 ? 161.777 -7.856  -0.520  1.00 0.00 ? 32  GLU B HG2  3  
ATOM   7697  H  HG3  . GLU B 1 32 ? 162.315 -7.292  1.059   1.00 0.00 ? 32  GLU B HG3  3  
ATOM   7698  N  N    . LEU B 1 33 ? 159.978 -3.368  0.539   1.00 0.00 ? 33  LEU B N    3  
ATOM   7699  C  CA   . LEU B 1 33 ? 159.032 -2.277  0.522   1.00 0.00 ? 33  LEU B CA   3  
ATOM   7700  C  C    . LEU B 1 33 ? 159.481 -1.230  -0.493  1.00 0.00 ? 33  LEU B C    3  
ATOM   7701  O  O    . LEU B 1 33 ? 158.678 -0.708  -1.276  1.00 0.00 ? 33  LEU B O    3  
ATOM   7702  C  CB   . LEU B 1 33 ? 158.985 -1.694  1.932   1.00 0.00 ? 33  LEU B CB   3  
ATOM   7703  C  CG   . LEU B 1 33 ? 157.790 -0.757  2.093   1.00 0.00 ? 33  LEU B CG   3  
ATOM   7704  C  CD1  . LEU B 1 33 ? 157.381 -0.741  3.563   1.00 0.00 ? 33  LEU B CD1  3  
ATOM   7705  C  CD2  . LEU B 1 33 ? 158.170 0.662   1.661   1.00 0.00 ? 33  LEU B CD2  3  
ATOM   7706  H  H    . LEU B 1 33 ? 160.476 -3.560  1.361   1.00 0.00 ? 33  LEU B H    3  
ATOM   7707  H  HA   . LEU B 1 33 ? 158.056 -2.653  0.252   1.00 0.00 ? 33  LEU B HA   3  
ATOM   7708  H  HB2  . LEU B 1 33 ? 158.903 -2.506  2.642   1.00 0.00 ? 33  LEU B HB2  3  
ATOM   7709  H  HB3  . LEU B 1 33 ? 159.898 -1.151  2.122   1.00 0.00 ? 33  LEU B HB3  3  
ATOM   7710  H  HG   . LEU B 1 33 ? 156.964 -1.119  1.494   1.00 0.00 ? 33  LEU B HG   3  
ATOM   7711  H  HD11 . LEU B 1 33 ? 158.263 -0.622  4.178   1.00 0.00 ? 33  LEU B HD11 3  
ATOM   7712  H  HD12 . LEU B 1 33 ? 156.896 -1.674  3.810   1.00 0.00 ? 33  LEU B HD12 3  
ATOM   7713  H  HD13 . LEU B 1 33 ? 156.705 0.078   3.739   1.00 0.00 ? 33  LEU B HD13 3  
ATOM   7714  H  HD21 . LEU B 1 33 ? 159.104 0.946   2.124   1.00 0.00 ? 33  LEU B HD21 3  
ATOM   7715  H  HD22 . LEU B 1 33 ? 157.396 1.347   1.969   1.00 0.00 ? 33  LEU B HD22 3  
ATOM   7716  H  HD23 . LEU B 1 33 ? 158.274 0.696   0.588   1.00 0.00 ? 33  LEU B HD23 3  
ATOM   7717  N  N    . LYS B 1 34 ? 160.788 -0.976  -0.502  1.00 0.00 ? 34  LYS B N    3  
ATOM   7718  C  CA   . LYS B 1 34 ? 161.375 -0.040  -1.449  1.00 0.00 ? 34  LYS B CA   3  
ATOM   7719  C  C    . LYS B 1 34 ? 161.156 -0.481  -2.880  1.00 0.00 ? 34  LYS B C    3  
ATOM   7720  O  O    . LYS B 1 34 ? 160.774 0.315   -3.738  1.00 0.00 ? 34  LYS B O    3  
ATOM   7721  C  CB   . LYS B 1 34 ? 162.873 0.094   -1.128  1.00 0.00 ? 34  LYS B CB   3  
ATOM   7722  C  CG   . LYS B 1 34 ? 163.649 0.749   -2.281  1.00 0.00 ? 34  LYS B CG   3  
ATOM   7723  C  CD   . LYS B 1 34 ? 163.078 2.115   -2.613  1.00 0.00 ? 34  LYS B CD   3  
ATOM   7724  C  CE   . LYS B 1 34 ? 164.084 2.908   -3.458  1.00 0.00 ? 34  LYS B CE   3  
ATOM   7725  N  NZ   . LYS B 1 34 ? 165.105 1.982   -4.027  1.00 0.00 ? 34  LYS B NZ   3  
ATOM   7726  H  H    . LYS B 1 34 ? 161.374 -1.455  0.126   1.00 0.00 ? 34  LYS B H    3  
ATOM   7727  H  HA   . LYS B 1 34 ? 160.912 0.924   -1.313  1.00 0.00 ? 34  LYS B HA   3  
ATOM   7728  H  HB2  . LYS B 1 34 ? 162.984 0.707   -0.242  1.00 0.00 ? 34  LYS B HB2  3  
ATOM   7729  H  HB3  . LYS B 1 34 ? 163.284 -0.887  -0.934  1.00 0.00 ? 34  LYS B HB3  3  
ATOM   7730  H  HG2  . LYS B 1 34 ? 164.683 0.861   -1.990  1.00 0.00 ? 34  LYS B HG2  3  
ATOM   7731  H  HG3  . LYS B 1 34 ? 163.594 0.117   -3.154  1.00 0.00 ? 34  LYS B HG3  3  
ATOM   7732  H  HD2  . LYS B 1 34 ? 162.178 1.963   -3.188  1.00 0.00 ? 34  LYS B HD2  3  
ATOM   7733  H  HD3  . LYS B 1 34 ? 162.852 2.654   -1.707  1.00 0.00 ? 34  LYS B HD3  3  
ATOM   7734  H  HE2  . LYS B 1 34 ? 163.565 3.407   -4.263  1.00 0.00 ? 34  LYS B HE2  3  
ATOM   7735  H  HE3  . LYS B 1 34 ? 164.574 3.643   -2.837  1.00 0.00 ? 34  LYS B HE3  3  
ATOM   7736  H  HZ1  . LYS B 1 34 ? 164.630 1.163   -4.455  1.00 0.00 ? 34  LYS B HZ1  3  
ATOM   7737  H  HZ2  . LYS B 1 34 ? 165.740 1.660   -3.269  1.00 0.00 ? 34  LYS B HZ2  3  
ATOM   7738  H  HZ3  . LYS B 1 34 ? 165.656 2.479   -4.754  1.00 0.00 ? 34  LYS B HZ3  3  
ATOM   7739  N  N    . GLU B 1 35 ? 161.386 -1.747  -3.140  1.00 0.00 ? 35  GLU B N    3  
ATOM   7740  C  CA   . GLU B 1 35 ? 161.202 -2.254  -4.480  1.00 0.00 ? 35  GLU B CA   3  
ATOM   7741  C  C    . GLU B 1 35 ? 159.736 -2.235  -4.904  1.00 0.00 ? 35  GLU B C    3  
ATOM   7742  O  O    . GLU B 1 35 ? 159.437 -1.918  -6.053  1.00 0.00 ? 35  GLU B O    3  
ATOM   7743  C  CB   . GLU B 1 35 ? 161.799 -3.648  -4.542  1.00 0.00 ? 35  GLU B CB   3  
ATOM   7744  C  CG   . GLU B 1 35 ? 163.308 -3.506  -4.330  1.00 0.00 ? 35  GLU B CG   3  
ATOM   7745  C  CD   . GLU B 1 35 ? 163.944 -2.772  -5.507  1.00 0.00 ? 35  GLU B CD   3  
ATOM   7746  O  OE1  . GLU B 1 35 ? 163.298 -2.676  -6.538  1.00 0.00 ? 35  GLU B OE1  3  
ATOM   7747  O  OE2  . GLU B 1 35 ? 165.066 -2.317  -5.359  1.00 0.00 ? 35  GLU B OE2  3  
ATOM   7748  H  H    . GLU B 1 35 ? 161.687 -2.349  -2.422  1.00 0.00 ? 35  GLU B H    3  
ATOM   7749  H  HA   . GLU B 1 35 ? 161.750 -1.620  -5.157  1.00 0.00 ? 35  GLU B HA   3  
ATOM   7750  H  HB2  . GLU B 1 35 ? 161.371 -4.265  -3.764  1.00 0.00 ? 35  GLU B HB2  3  
ATOM   7751  H  HB3  . GLU B 1 35 ? 161.608 -4.088  -5.509  1.00 0.00 ? 35  GLU B HB3  3  
ATOM   7752  H  HG2  . GLU B 1 35 ? 163.474 -2.916  -3.431  1.00 0.00 ? 35  GLU B HG2  3  
ATOM   7753  H  HG3  . GLU B 1 35 ? 163.758 -4.481  -4.220  1.00 0.00 ? 35  GLU B HG3  3  
ATOM   7754  N  N    . LEU B 1 36 ? 158.812 -2.545  -3.989  1.00 0.00 ? 36  LEU B N    3  
ATOM   7755  C  CA   . LEU B 1 36 ? 157.400 -2.507  -4.362  1.00 0.00 ? 36  LEU B CA   3  
ATOM   7756  C  C    . LEU B 1 36 ? 156.936 -1.094  -4.661  1.00 0.00 ? 36  LEU B C    3  
ATOM   7757  O  O    . LEU B 1 36 ? 156.285 -0.868  -5.674  1.00 0.00 ? 36  LEU B O    3  
ATOM   7758  C  CB   . LEU B 1 36 ? 156.520 -3.113  -3.263  1.00 0.00 ? 36  LEU B CB   3  
ATOM   7759  C  CG   . LEU B 1 36 ? 156.841 -4.600  -3.086  1.00 0.00 ? 36  LEU B CG   3  
ATOM   7760  C  CD1  . LEU B 1 36 ? 155.917 -5.194  -2.019  1.00 0.00 ? 36  LEU B CD1  3  
ATOM   7761  C  CD2  . LEU B 1 36 ? 156.611 -5.332  -4.416  1.00 0.00 ? 36  LEU B CD2  3  
ATOM   7762  H  H    . LEU B 1 36 ? 159.077 -2.778  -3.074  1.00 0.00 ? 36  LEU B H    3  
ATOM   7763  H  HA   . LEU B 1 36 ? 157.268 -3.087  -5.260  1.00 0.00 ? 36  LEU B HA   3  
ATOM   7764  H  HB2  . LEU B 1 36 ? 156.703 -2.595  -2.332  1.00 0.00 ? 36  LEU B HB2  3  
ATOM   7765  H  HB3  . LEU B 1 36 ? 155.481 -3.002  -3.535  1.00 0.00 ? 36  LEU B HB3  3  
ATOM   7766  H  HG   . LEU B 1 36 ? 157.867 -4.719  -2.782  1.00 0.00 ? 36  LEU B HG   3  
ATOM   7767  H  HD11 . LEU B 1 36 ? 155.771 -4.473  -1.227  1.00 0.00 ? 36  LEU B HD11 3  
ATOM   7768  H  HD12 . LEU B 1 36 ? 156.365 -6.089  -1.612  1.00 0.00 ? 36  LEU B HD12 3  
ATOM   7769  H  HD13 . LEU B 1 36 ? 154.964 -5.439  -2.463  1.00 0.00 ? 36  LEU B HD13 3  
ATOM   7770  H  HD21 . LEU B 1 36 ? 157.527 -5.334  -4.987  1.00 0.00 ? 36  LEU B HD21 3  
ATOM   7771  H  HD22 . LEU B 1 36 ? 155.836 -4.830  -4.978  1.00 0.00 ? 36  LEU B HD22 3  
ATOM   7772  H  HD23 . LEU B 1 36 ? 156.307 -6.345  -4.225  1.00 0.00 ? 36  LEU B HD23 3  
ATOM   7773  N  N    . LEU B 1 37 ? 157.285 -0.129  -3.812  1.00 0.00 ? 37  LEU B N    3  
ATOM   7774  C  CA   . LEU B 1 37 ? 156.867 1.241   -4.092  1.00 0.00 ? 37  LEU B CA   3  
ATOM   7775  C  C    . LEU B 1 37 ? 157.592 1.777   -5.315  1.00 0.00 ? 37  LEU B C    3  
ATOM   7776  O  O    . LEU B 1 37 ? 157.004 2.447   -6.165  1.00 0.00 ? 37  LEU B O    3  
ATOM   7777  C  CB   . LEU B 1 37 ? 157.162 2.152   -2.896  1.00 0.00 ? 37  LEU B CB   3  
ATOM   7778  C  CG   . LEU B 1 37 ? 156.430 1.649   -1.649  1.00 0.00 ? 37  LEU B CG   3  
ATOM   7779  C  CD1  . LEU B 1 37 ? 156.638 2.647   -0.508  1.00 0.00 ? 37  LEU B CD1  3  
ATOM   7780  C  CD2  . LEU B 1 37 ? 154.933 1.529   -1.939  1.00 0.00 ? 37  LEU B CD2  3  
ATOM   7781  H  H    . LEU B 1 37 ? 157.827 -0.334  -3.014  1.00 0.00 ? 37  LEU B H    3  
ATOM   7782  H  HA   . LEU B 1 37 ? 155.808 1.253   -4.291  1.00 0.00 ? 37  LEU B HA   3  
ATOM   7783  H  HB2  . LEU B 1 37 ? 158.226 2.158   -2.707  1.00 0.00 ? 37  LEU B HB2  3  
ATOM   7784  H  HB3  . LEU B 1 37 ? 156.834 3.155   -3.121  1.00 0.00 ? 37  LEU B HB3  3  
ATOM   7785  H  HG   . LEU B 1 37 ? 156.825 0.685   -1.361  1.00 0.00 ? 37  LEU B HG   3  
ATOM   7786  H  HD11 . LEU B 1 37 ? 157.690 2.719   -0.278  1.00 0.00 ? 37  LEU B HD11 3  
ATOM   7787  H  HD12 . LEU B 1 37 ? 156.099 2.312   0.366   1.00 0.00 ? 37  LEU B HD12 3  
ATOM   7788  H  HD13 . LEU B 1 37 ? 156.268 3.617   -0.807  1.00 0.00 ? 37  LEU B HD13 3  
ATOM   7789  H  HD21 . LEU B 1 37 ? 154.736 0.589   -2.430  1.00 0.00 ? 37  LEU B HD21 3  
ATOM   7790  H  HD22 . LEU B 1 37 ? 154.626 2.341   -2.579  1.00 0.00 ? 37  LEU B HD22 3  
ATOM   7791  H  HD23 . LEU B 1 37 ? 154.382 1.573   -1.011  1.00 0.00 ? 37  LEU B HD23 3  
ATOM   7792  N  N    . GLN B 1 38 ? 158.879 1.477   -5.383  1.00 0.00 ? 38  GLN B N    3  
ATOM   7793  C  CA   . GLN B 1 38 ? 159.707 1.935   -6.484  1.00 0.00 ? 38  GLN B CA   3  
ATOM   7794  C  C    . GLN B 1 38 ? 159.274 1.371   -7.828  1.00 0.00 ? 38  GLN B C    3  
ATOM   7795  O  O    . GLN B 1 38 ? 159.262 2.085   -8.830  1.00 0.00 ? 38  GLN B O    3  
ATOM   7796  C  CB   . GLN B 1 38 ? 161.157 1.553   -6.201  1.00 0.00 ? 38  GLN B CB   3  
ATOM   7797  C  CG   . GLN B 1 38 ? 162.061 2.131   -7.278  1.00 0.00 ? 38  GLN B CG   3  
ATOM   7798  C  CD   . GLN B 1 38 ? 163.520 1.828   -6.960  1.00 0.00 ? 38  GLN B CD   3  
ATOM   7799  O  OE1  . GLN B 1 38 ? 163.826 1.314   -5.885  1.00 0.00 ? 38  GLN B OE1  3  
ATOM   7800  N  NE2  . GLN B 1 38 ? 164.443 2.117   -7.835  1.00 0.00 ? 38  GLN B NE2  3  
ATOM   7801  H  H    . GLN B 1 38 ? 159.285 0.943   -4.669  1.00 0.00 ? 38  GLN B H    3  
ATOM   7802  H  HA   . GLN B 1 38 ? 159.645 3.008   -6.531  1.00 0.00 ? 38  GLN B HA   3  
ATOM   7803  H  HB2  . GLN B 1 38 ? 161.445 1.949   -5.246  1.00 0.00 ? 38  GLN B HB2  3  
ATOM   7804  H  HB3  . GLN B 1 38 ? 161.252 0.478   -6.191  1.00 0.00 ? 38  GLN B HB3  3  
ATOM   7805  H  HG2  . GLN B 1 38 ? 161.805 1.682   -8.213  1.00 0.00 ? 38  GLN B HG2  3  
ATOM   7806  H  HG3  . GLN B 1 38 ? 161.916 3.196   -7.341  1.00 0.00 ? 38  GLN B HG3  3  
ATOM   7807  H  HE21 . GLN B 1 38 ? 164.197 2.527   -8.690  1.00 0.00 ? 38  GLN B HE21 3  
ATOM   7808  H  HE22 . GLN B 1 38 ? 165.383 1.924   -7.637  1.00 0.00 ? 38  GLN B HE22 3  
ATOM   7809  N  N    . THR B 1 39 ? 158.938 0.089   -7.858  1.00 0.00 ? 39  THR B N    3  
ATOM   7810  C  CA   . THR B 1 39 ? 158.534 -0.530  -9.109  1.00 0.00 ? 39  THR B CA   3  
ATOM   7811  C  C    . THR B 1 39 ? 157.049 -0.327  -9.406  1.00 0.00 ? 39  THR B C    3  
ATOM   7812  O  O    . THR B 1 39 ? 156.678 -0.013  -10.537 1.00 0.00 ? 39  THR B O    3  
ATOM   7813  C  CB   . THR B 1 39 ? 158.863 -2.028  -9.086  1.00 0.00 ? 39  THR B CB   3  
ATOM   7814  O  OG1  . THR B 1 39 ? 158.923 -2.516  -10.420 1.00 0.00 ? 39  THR B OG1  3  
ATOM   7815  C  CG2  . THR B 1 39 ? 157.786 -2.793  -8.314  1.00 0.00 ? 39  THR B CG2  3  
ATOM   7816  H  H    . THR B 1 39 ? 158.977 -0.445  -7.038  1.00 0.00 ? 39  THR B H    3  
ATOM   7817  H  HA   . THR B 1 39 ? 159.105 -0.074  -9.905  1.00 0.00 ? 39  THR B HA   3  
ATOM   7818  H  HB   . THR B 1 39 ? 159.817 -2.179  -8.606  1.00 0.00 ? 39  THR B HB   3  
ATOM   7819  H  HG1  . THR B 1 39 ? 158.976 -3.474  -10.383 1.00 0.00 ? 39  THR B HG1  3  
ATOM   7820  H  HG21 . THR B 1 39 ? 156.872 -2.809  -8.889  1.00 0.00 ? 39  THR B HG21 3  
ATOM   7821  H  HG22 . THR B 1 39 ? 157.608 -2.305  -7.369  1.00 0.00 ? 39  THR B HG22 3  
ATOM   7822  H  HG23 . THR B 1 39 ? 158.119 -3.805  -8.139  1.00 0.00 ? 39  THR B HG23 3  
ATOM   7823  N  N    . GLU B 1 40 ? 156.200 -0.536  -8.401  1.00 0.00 ? 40  GLU B N    3  
ATOM   7824  C  CA   . GLU B 1 40 ? 154.761 -0.396  -8.613  1.00 0.00 ? 40  GLU B CA   3  
ATOM   7825  C  C    . GLU B 1 40 ? 154.374 1.062   -8.775  1.00 0.00 ? 40  GLU B C    3  
ATOM   7826  O  O    . GLU B 1 40 ? 153.471 1.397   -9.541  1.00 0.00 ? 40  GLU B O    3  
ATOM   7827  C  CB   . GLU B 1 40 ? 154.014 -0.932  -7.394  1.00 0.00 ? 40  GLU B CB   3  
ATOM   7828  C  CG   . GLU B 1 40 ? 154.315 -2.417  -7.199  1.00 0.00 ? 40  GLU B CG   3  
ATOM   7829  C  CD   . GLU B 1 40 ? 153.543 -2.932  -5.996  1.00 0.00 ? 40  GLU B CD   3  
ATOM   7830  O  OE1  . GLU B 1 40 ? 153.046 -2.106  -5.250  1.00 0.00 ? 40  GLU B OE1  3  
ATOM   7831  O  OE2  . GLU B 1 40 ? 153.478 -4.139  -5.824  1.00 0.00 ? 40  GLU B OE2  3  
ATOM   7832  H  H    . GLU B 1 40 ? 156.541 -0.801  -7.523  1.00 0.00 ? 40  GLU B H    3  
ATOM   7833  H  HA   . GLU B 1 40 ? 154.463 -0.954  -9.487  1.00 0.00 ? 40  GLU B HA   3  
ATOM   7834  H  HB2  . GLU B 1 40 ? 154.309 -0.381  -6.516  1.00 0.00 ? 40  GLU B HB2  3  
ATOM   7835  H  HB3  . GLU B 1 40 ? 152.953 -0.806  -7.547  1.00 0.00 ? 40  GLU B HB3  3  
ATOM   7836  H  HG2  . GLU B 1 40 ? 154.017 -2.965  -8.077  1.00 0.00 ? 40  GLU B HG2  3  
ATOM   7837  H  HG3  . GLU B 1 40 ? 155.372 -2.553  -7.030  1.00 0.00 ? 40  GLU B HG3  3  
ATOM   7838  N  N    . LEU B 1 41 ? 155.065 1.924   -8.036  1.00 0.00 ? 41  LEU B N    3  
ATOM   7839  C  CA   . LEU B 1 41 ? 154.796 3.353   -8.072  1.00 0.00 ? 41  LEU B CA   3  
ATOM   7840  C  C    . LEU B 1 41 ? 156.041 4.129   -8.477  1.00 0.00 ? 41  LEU B C    3  
ATOM   7841  O  O    . LEU B 1 41 ? 156.390 5.128   -7.846  1.00 0.00 ? 41  LEU B O    3  
ATOM   7842  C  CB   . LEU B 1 41 ? 154.315 3.819   -6.700  1.00 0.00 ? 41  LEU B CB   3  
ATOM   7843  C  CG   . LEU B 1 41 ? 153.093 3.006   -6.264  1.00 0.00 ? 41  LEU B CG   3  
ATOM   7844  C  CD1  . LEU B 1 41 ? 152.583 3.543   -4.923  1.00 0.00 ? 41  LEU B CD1  3  
ATOM   7845  C  CD2  . LEU B 1 41 ? 151.986 3.137   -7.313  1.00 0.00 ? 41  LEU B CD2  3  
ATOM   7846  H  H    . LEU B 1 41 ? 155.772 1.588   -7.440  1.00 0.00 ? 41  LEU B H    3  
ATOM   7847  H  HA   . LEU B 1 41 ? 154.018 3.549   -8.795  1.00 0.00 ? 41  LEU B HA   3  
ATOM   7848  H  HB2  . LEU B 1 41 ? 155.103 3.682   -5.981  1.00 0.00 ? 41  LEU B HB2  3  
ATOM   7849  H  HB3  . LEU B 1 41 ? 154.050 4.859   -6.753  1.00 0.00 ? 41  LEU B HB3  3  
ATOM   7850  H  HG   . LEU B 1 41 ? 153.371 1.967   -6.154  1.00 0.00 ? 41  LEU B HG   3  
ATOM   7851  H  HD11 . LEU B 1 41 ? 152.436 4.610   -4.996  1.00 0.00 ? 41  LEU B HD11 3  
ATOM   7852  H  HD12 . LEU B 1 41 ? 153.307 3.330   -4.152  1.00 0.00 ? 41  LEU B HD12 3  
ATOM   7853  H  HD13 . LEU B 1 41 ? 151.646 3.066   -4.679  1.00 0.00 ? 41  LEU B HD13 3  
ATOM   7854  H  HD21 . LEU B 1 41 ? 152.098 2.364   -8.054  1.00 0.00 ? 41  LEU B HD21 3  
ATOM   7855  H  HD22 . LEU B 1 41 ? 152.051 4.104   -7.788  1.00 0.00 ? 41  LEU B HD22 3  
ATOM   7856  H  HD23 . LEU B 1 41 ? 151.023 3.035   -6.835  1.00 0.00 ? 41  LEU B HD23 3  
ATOM   7857  N  N    . SER B 1 42 ? 156.712 3.668   -9.521  1.00 0.00 ? 42  SER B N    3  
ATOM   7858  C  CA   . SER B 1 42 ? 157.922 4.334   -9.976  1.00 0.00 ? 42  SER B CA   3  
ATOM   7859  C  C    . SER B 1 42 ? 157.615 5.786   -10.309 1.00 0.00 ? 42  SER B C    3  
ATOM   7860  O  O    . SER B 1 42 ? 158.495 6.644   -10.261 1.00 0.00 ? 42  SER B O    3  
ATOM   7861  C  CB   . SER B 1 42 ? 158.476 3.628   -11.214 1.00 0.00 ? 42  SER B CB   3  
ATOM   7862  O  OG   . SER B 1 42 ? 157.582 3.819   -12.303 1.00 0.00 ? 42  SER B OG   3  
ATOM   7863  H  H    . SER B 1 42 ? 156.395 2.866   -9.986  1.00 0.00 ? 42  SER B H    3  
ATOM   7864  H  HA   . SER B 1 42 ? 158.662 4.299   -9.191  1.00 0.00 ? 42  SER B HA   3  
ATOM   7865  H  HB2  . SER B 1 42 ? 159.438 4.043   -11.467 1.00 0.00 ? 42  SER B HB2  3  
ATOM   7866  H  HB3  . SER B 1 42 ? 158.586 2.572   -11.006 1.00 0.00 ? 42  SER B HB3  3  
ATOM   7867  H  HG   . SER B 1 42 ? 157.906 4.556   -12.827 1.00 0.00 ? 42  SER B HG   3  
ATOM   7868  N  N    . GLY B 1 43 ? 156.357 6.052   -10.644 1.00 0.00 ? 43  GLY B N    3  
ATOM   7869  C  CA   . GLY B 1 43 ? 155.935 7.405   -10.981 1.00 0.00 ? 43  GLY B CA   3  
ATOM   7870  C  C    . GLY B 1 43 ? 155.531 8.200   -9.737  1.00 0.00 ? 43  GLY B C    3  
ATOM   7871  O  O    . GLY B 1 43 ? 156.193 9.172   -9.371  1.00 0.00 ? 43  GLY B O    3  
ATOM   7872  H  H    . GLY B 1 43 ? 155.701 5.326   -10.663 1.00 0.00 ? 43  GLY B H    3  
ATOM   7873  H  HA2  . GLY B 1 43 ? 156.749 7.914   -11.476 1.00 0.00 ? 43  GLY B HA2  3  
ATOM   7874  H  HA3  . GLY B 1 43 ? 155.092 7.353   -11.652 1.00 0.00 ? 43  GLY B HA3  3  
ATOM   7875  N  N    . PHE B 1 44 ? 154.422 7.804   -9.109  1.00 0.00 ? 44  PHE B N    3  
ATOM   7876  C  CA   . PHE B 1 44 ? 153.921 8.515   -7.931  1.00 0.00 ? 44  PHE B CA   3  
ATOM   7877  C  C    . PHE B 1 44 ? 154.955 8.569   -6.795  1.00 0.00 ? 44  PHE B C    3  
ATOM   7878  O  O    . PHE B 1 44 ? 155.145 9.611   -6.169  1.00 0.00 ? 44  PHE B O    3  
ATOM   7879  C  CB   . PHE B 1 44 ? 152.655 7.821   -7.428  1.00 0.00 ? 44  PHE B CB   3  
ATOM   7880  C  CG   . PHE B 1 44 ? 151.560 7.974   -8.457  1.00 0.00 ? 44  PHE B CG   3  
ATOM   7881  C  CD1  . PHE B 1 44 ? 150.775 9.133   -8.476  1.00 0.00 ? 44  PHE B CD1  3  
ATOM   7882  C  CD2  . PHE B 1 44 ? 151.332 6.958   -9.393  1.00 0.00 ? 44  PHE B CD2  3  
ATOM   7883  C  CE1  . PHE B 1 44 ? 149.761 9.276   -9.431  1.00 0.00 ? 44  PHE B CE1  3  
ATOM   7884  C  CE2  . PHE B 1 44 ? 150.318 7.102   -10.347 1.00 0.00 ? 44  PHE B CE2  3  
ATOM   7885  C  CZ   . PHE B 1 44 ? 149.533 8.260   -10.367 1.00 0.00 ? 44  PHE B CZ   3  
ATOM   7886  H  H    . PHE B 1 44 ? 153.921 7.038   -9.459  1.00 0.00 ? 44  PHE B H    3  
ATOM   7887  H  HA   . PHE B 1 44 ? 153.660 9.517   -8.217  1.00 0.00 ? 44  PHE B HA   3  
ATOM   7888  H  HB2  . PHE B 1 44 ? 152.856 6.771   -7.271  1.00 0.00 ? 44  PHE B HB2  3  
ATOM   7889  H  HB3  . PHE B 1 44 ? 152.340 8.270   -6.498  1.00 0.00 ? 44  PHE B HB3  3  
ATOM   7890  H  HD1  . PHE B 1 44 ? 150.951 9.916   -7.753  1.00 0.00 ? 44  PHE B HD1  3  
ATOM   7891  H  HD2  . PHE B 1 44 ? 151.937 6.065   -9.378  1.00 0.00 ? 44  PHE B HD2  3  
ATOM   7892  H  HE1  . PHE B 1 44 ? 149.156 10.170  -9.446  1.00 0.00 ? 44  PHE B HE1  3  
ATOM   7893  H  HE2  . PHE B 1 44 ? 150.141 6.318   -11.069 1.00 0.00 ? 44  PHE B HE2  3  
ATOM   7894  H  HZ   . PHE B 1 44 ? 148.752 8.371   -11.103 1.00 0.00 ? 44  PHE B HZ   3  
ATOM   7895  N  N    . LEU B 1 45 ? 155.615 7.444   -6.542  1.00 0.00 ? 45  LEU B N    3  
ATOM   7896  C  CA   . LEU B 1 45 ? 156.632 7.358   -5.487  1.00 0.00 ? 45  LEU B CA   3  
ATOM   7897  C  C    . LEU B 1 45 ? 158.028 7.672   -6.010  1.00 0.00 ? 45  LEU B C    3  
ATOM   7898  O  O    . LEU B 1 45 ? 158.989 7.633   -5.242  1.00 0.00 ? 45  LEU B O    3  
ATOM   7899  C  CB   . LEU B 1 45 ? 156.640 5.981   -4.809  1.00 0.00 ? 45  LEU B CB   3  
ATOM   7900  C  CG   . LEU B 1 45 ? 155.406 5.750   -3.891  1.00 0.00 ? 45  LEU B CG   3  
ATOM   7901  C  CD1  . LEU B 1 45 ? 155.789 6.054   -2.440  1.00 0.00 ? 45  LEU B CD1  3  
ATOM   7902  C  CD2  . LEU B 1 45 ? 154.201 6.631   -4.267  1.00 0.00 ? 45  LEU B CD2  3  
ATOM   7903  H  H    . LEU B 1 45 ? 155.421 6.646   -7.080  1.00 0.00 ? 45  LEU B H    3  
ATOM   7904  H  HA   . LEU B 1 45 ? 156.400 8.098   -4.739  1.00 0.00 ? 45  LEU B HA   3  
ATOM   7905  H  HB2  . LEU B 1 45 ? 156.656 5.222   -5.573  1.00 0.00 ? 45  LEU B HB2  3  
ATOM   7906  H  HB3  . LEU B 1 45 ? 157.542 5.892   -4.219  1.00 0.00 ? 45  LEU B HB3  3  
ATOM   7907  H  HG   . LEU B 1 45 ? 155.117 4.709   -3.957  1.00 0.00 ? 45  LEU B HG   3  
ATOM   7908  H  HD11 . LEU B 1 45 ? 156.046 7.099   -2.347  1.00 0.00 ? 45  LEU B HD11 3  
ATOM   7909  H  HD12 . LEU B 1 45 ? 156.636 5.448   -2.157  1.00 0.00 ? 45  LEU B HD12 3  
ATOM   7910  H  HD13 . LEU B 1 45 ? 154.954 5.830   -1.793  1.00 0.00 ? 45  LEU B HD13 3  
ATOM   7911  H  HD21 . LEU B 1 45 ? 153.336 6.297   -3.712  1.00 0.00 ? 45  LEU B HD21 3  
ATOM   7912  H  HD22 . LEU B 1 45 ? 153.995 6.546   -5.315  1.00 0.00 ? 45  LEU B HD22 3  
ATOM   7913  H  HD23 . LEU B 1 45 ? 154.402 7.659   -4.017  1.00 0.00 ? 45  LEU B HD23 3  
ATOM   7914  N  N    . ASP B 1 46 ? 158.147 7.921   -7.316  1.00 0.00 ? 46  ASP B N    3  
ATOM   7915  C  CA   . ASP B 1 46 ? 159.457 8.173   -7.931  1.00 0.00 ? 46  ASP B CA   3  
ATOM   7916  C  C    . ASP B 1 46 ? 160.454 8.711   -6.906  1.00 0.00 ? 46  ASP B C    3  
ATOM   7917  O  O    . ASP B 1 46 ? 160.308 9.817   -6.385  1.00 0.00 ? 46  ASP B O    3  
ATOM   7918  C  CB   . ASP B 1 46 ? 159.310 9.191   -9.064  1.00 0.00 ? 46  ASP B CB   3  
ATOM   7919  C  CG   . ASP B 1 46 ? 160.633 9.342   -9.806  1.00 0.00 ? 46  ASP B CG   3  
ATOM   7920  O  OD1  . ASP B 1 46 ? 161.550 8.600   -9.495  1.00 0.00 ? 46  ASP B OD1  3  
ATOM   7921  O  OD2  . ASP B 1 46 ? 160.711 10.195  -10.673 1.00 0.00 ? 46  ASP B OD2  3  
ATOM   7922  H  H    . ASP B 1 46 ? 157.349 7.895   -7.885  1.00 0.00 ? 46  ASP B H    3  
ATOM   7923  H  HA   . ASP B 1 46 ? 159.838 7.249   -8.340  1.00 0.00 ? 46  ASP B HA   3  
ATOM   7924  H  HB2  . ASP B 1 46 ? 158.547 8.858   -9.752  1.00 0.00 ? 46  ASP B HB2  3  
ATOM   7925  H  HB3  . ASP B 1 46 ? 159.023 10.146  -8.651  1.00 0.00 ? 46  ASP B HB3  3  
ATOM   7926  N  N    . ALA B 1 47 ? 161.456 7.885   -6.619  1.00 0.00 ? 47  ALA B N    3  
ATOM   7927  C  CA   . ALA B 1 47 ? 162.490 8.216   -5.645  1.00 0.00 ? 47  ALA B CA   3  
ATOM   7928  C  C    . ALA B 1 47 ? 163.302 9.434   -6.066  1.00 0.00 ? 47  ALA B C    3  
ATOM   7929  O  O    . ALA B 1 47 ? 163.857 10.136  -5.220  1.00 0.00 ? 47  ALA B O    3  
ATOM   7930  C  CB   . ALA B 1 47 ? 163.428 7.021   -5.462  1.00 0.00 ? 47  ALA B CB   3  
ATOM   7931  H  H    . ALA B 1 47 ? 161.492 7.013   -7.065  1.00 0.00 ? 47  ALA B H    3  
ATOM   7932  H  HA   . ALA B 1 47 ? 162.019 8.426   -4.698  1.00 0.00 ? 47  ALA B HA   3  
ATOM   7933  H  HB1  . ALA B 1 47 ? 163.870 7.057   -4.477  1.00 0.00 ? 47  ALA B HB1  3  
ATOM   7934  H  HB2  . ALA B 1 47 ? 164.209 7.058   -6.208  1.00 0.00 ? 47  ALA B HB2  3  
ATOM   7935  H  HB3  . ALA B 1 47 ? 162.869 6.104   -5.572  1.00 0.00 ? 47  ALA B HB3  3  
ATOM   7936  N  N    . GLN B 1 48 ? 163.395 9.674   -7.367  1.00 0.00 ? 48  GLN B N    3  
ATOM   7937  C  CA   . GLN B 1 48 ? 164.178 10.804  -7.847  1.00 0.00 ? 48  GLN B CA   3  
ATOM   7938  C  C    . GLN B 1 48 ? 163.682 12.098  -7.213  1.00 0.00 ? 48  GLN B C    3  
ATOM   7939  O  O    . GLN B 1 48 ? 164.478 12.977  -6.884  1.00 0.00 ? 48  GLN B O    3  
ATOM   7940  C  CB   . GLN B 1 48 ? 164.073 10.905  -9.370  1.00 0.00 ? 48  GLN B CB   3  
ATOM   7941  C  CG   . GLN B 1 48 ? 164.714 9.672   -10.010 1.00 0.00 ? 48  GLN B CG   3  
ATOM   7942  C  CD   . GLN B 1 48 ? 164.570 9.737   -11.526 1.00 0.00 ? 48  GLN B CD   3  
ATOM   7943  O  OE1  . GLN B 1 48 ? 163.758 10.506  -12.041 1.00 0.00 ? 48  GLN B OE1  3  
ATOM   7944  N  NE2  . GLN B 1 48 ? 165.314 8.972   -12.277 1.00 0.00 ? 48  GLN B NE2  3  
ATOM   7945  H  H    . GLN B 1 48 ? 162.953 9.078   -8.008  1.00 0.00 ? 48  GLN B H    3  
ATOM   7946  H  HA   . GLN B 1 48 ? 165.212 10.655  -7.577  1.00 0.00 ? 48  GLN B HA   3  
ATOM   7947  H  HB2  . GLN B 1 48 ? 163.033 10.960  -9.655  1.00 0.00 ? 48  GLN B HB2  3  
ATOM   7948  H  HB3  . GLN B 1 48 ? 164.588 11.792  -9.708  1.00 0.00 ? 48  GLN B HB3  3  
ATOM   7949  H  HG2  . GLN B 1 48 ? 165.762 9.638   -9.750  1.00 0.00 ? 48  GLN B HG2  3  
ATOM   7950  H  HG3  . GLN B 1 48 ? 164.225 8.783   -9.642  1.00 0.00 ? 48  GLN B HG3  3  
ATOM   7951  H  HE21 . GLN B 1 48 ? 165.960 8.361   -11.866 1.00 0.00 ? 48  GLN B HE21 3  
ATOM   7952  H  HE22 . GLN B 1 48 ? 165.228 9.009   -13.252 1.00 0.00 ? 48  GLN B HE22 3  
ATOM   7953  N  N    . LYS B 1 49 ? 162.372 12.209  -7.022  1.00 0.00 ? 49  LYS B N    3  
ATOM   7954  C  CA   . LYS B 1 49 ? 161.818 13.403  -6.398  1.00 0.00 ? 49  LYS B CA   3  
ATOM   7955  C  C    . LYS B 1 49 ? 162.403 13.528  -5.004  1.00 0.00 ? 49  LYS B C    3  
ATOM   7956  O  O    . LYS B 1 49 ? 162.748 14.614  -4.538  1.00 0.00 ? 49  LYS B O    3  
ATOM   7957  C  CB   . LYS B 1 49 ? 160.302 13.263  -6.271  1.00 0.00 ? 49  LYS B CB   3  
ATOM   7958  C  CG   . LYS B 1 49 ? 159.687 12.943  -7.633  1.00 0.00 ? 49  LYS B CG   3  
ATOM   7959  C  CD   . LYS B 1 49 ? 159.912 14.088  -8.618  1.00 0.00 ? 49  LYS B CD   3  
ATOM   7960  C  CE   . LYS B 1 49 ? 159.142 13.771  -9.890  1.00 0.00 ? 49  LYS B CE   3  
ATOM   7961  N  NZ   . LYS B 1 49 ? 159.121 14.968  -10.778 1.00 0.00 ? 49  LYS B NZ   3  
ATOM   7962  H  H    . LYS B 1 49 ? 161.776 11.475  -7.284  1.00 0.00 ? 49  LYS B H    3  
ATOM   7963  H  HA   . LYS B 1 49 ? 162.066 14.278  -6.973  1.00 0.00 ? 49  LYS B HA   3  
ATOM   7964  H  HB2  . LYS B 1 49 ? 160.072 12.467  -5.578  1.00 0.00 ? 49  LYS B HB2  3  
ATOM   7965  H  HB3  . LYS B 1 49 ? 159.886 14.189  -5.902  1.00 0.00 ? 49  LYS B HB3  3  
ATOM   7966  H  HG2  . LYS B 1 49 ? 160.140 12.045  -8.024  1.00 0.00 ? 49  LYS B HG2  3  
ATOM   7967  H  HG3  . LYS B 1 49 ? 158.625 12.782  -7.513  1.00 0.00 ? 49  LYS B HG3  3  
ATOM   7968  H  HD2  . LYS B 1 49 ? 159.557 15.014  -8.194  1.00 0.00 ? 49  LYS B HD2  3  
ATOM   7969  H  HD3  . LYS B 1 49 ? 160.961 14.170  -8.855  1.00 0.00 ? 49  LYS B HD3  3  
ATOM   7970  H  HE2  . LYS B 1 49 ? 159.624 12.949  -10.396 1.00 0.00 ? 49  LYS B HE2  3  
ATOM   7971  H  HE3  . LYS B 1 49 ? 158.133 13.492  -9.631  1.00 0.00 ? 49  LYS B HE3  3  
ATOM   7972  H  HZ1  . LYS B 1 49 ? 158.611 15.742  -10.306 1.00 0.00 ? 49  LYS B HZ1  3  
ATOM   7973  H  HZ2  . LYS B 1 49 ? 158.640 14.729  -11.669 1.00 0.00 ? 49  LYS B HZ2  3  
ATOM   7974  H  HZ3  . LYS B 1 49 ? 160.095 15.269  -10.978 1.00 0.00 ? 49  LYS B HZ3  3  
ATOM   7975  N  N    . ASP B 1 50 ? 162.509 12.376  -4.356  1.00 0.00 ? 50  ASP B N    3  
ATOM   7976  C  CA   . ASP B 1 50 ? 163.057 12.294  -3.005  1.00 0.00 ? 50  ASP B CA   3  
ATOM   7977  C  C    . ASP B 1 50 ? 163.595 10.899  -2.704  1.00 0.00 ? 50  ASP B C    3  
ATOM   7978  O  O    . ASP B 1 50 ? 162.844 10.031  -2.271  1.00 0.00 ? 50  ASP B O    3  
ATOM   7979  C  CB   . ASP B 1 50 ? 161.984 12.624  -1.966  1.00 0.00 ? 50  ASP B CB   3  
ATOM   7980  C  CG   . ASP B 1 50 ? 162.590 12.565  -0.571  1.00 0.00 ? 50  ASP B CG   3  
ATOM   7981  O  OD1  . ASP B 1 50 ? 163.769 12.273  -0.478  1.00 0.00 ? 50  ASP B OD1  3  
ATOM   7982  O  OD2  . ASP B 1 50 ? 161.871 12.813  0.382   1.00 0.00 ? 50  ASP B OD2  3  
ATOM   7983  H  H    . ASP B 1 50 ? 162.209 11.556  -4.810  1.00 0.00 ? 50  ASP B H    3  
ATOM   7984  H  HA   . ASP B 1 50 ? 163.861 13.007  -2.911  1.00 0.00 ? 50  ASP B HA   3  
ATOM   7985  H  HB2  . ASP B 1 50 ? 161.595 13.609  -2.135  1.00 0.00 ? 50  ASP B HB2  3  
ATOM   7986  H  HB3  . ASP B 1 50 ? 161.186 11.911  -2.044  1.00 0.00 ? 50  ASP B HB3  3  
ATOM   7987  N  N    . VAL B 1 51 ? 164.884 10.676  -2.892  1.00 0.00 ? 51  VAL B N    3  
ATOM   7988  C  CA   . VAL B 1 51 ? 165.434 9.365   -2.573  1.00 0.00 ? 51  VAL B CA   3  
ATOM   7989  C  C    . VAL B 1 51 ? 165.214 9.104   -1.083  1.00 0.00 ? 51  VAL B C    3  
ATOM   7990  O  O    . VAL B 1 51 ? 164.861 8.000   -0.667  1.00 0.00 ? 51  VAL B O    3  
ATOM   7991  C  CB   . VAL B 1 51 ? 166.928 9.322   -2.896  1.00 0.00 ? 51  VAL B CB   3  
ATOM   7992  C  CG1  . VAL B 1 51 ? 167.523 8.007   -2.386  1.00 0.00 ? 51  VAL B CG1  3  
ATOM   7993  C  CG2  . VAL B 1 51 ? 167.124 9.415   -4.410  1.00 0.00 ? 51  VAL B CG2  3  
ATOM   7994  H  H    . VAL B 1 51 ? 165.470 11.392  -3.216  1.00 0.00 ? 51  VAL B H    3  
ATOM   7995  H  HA   . VAL B 1 51 ? 164.919 8.610   -3.149  1.00 0.00 ? 51  VAL B HA   3  
ATOM   7996  H  HB   . VAL B 1 51 ? 167.424 10.152  -2.414  1.00 0.00 ? 51  VAL B HB   3  
ATOM   7997  H  HG11 . VAL B 1 51 ? 166.900 7.184   -2.700  1.00 0.00 ? 51  VAL B HG11 3  
ATOM   7998  H  HG12 . VAL B 1 51 ? 167.575 8.030   -1.308  1.00 0.00 ? 51  VAL B HG12 3  
ATOM   7999  H  HG13 . VAL B 1 51 ? 168.517 7.882   -2.791  1.00 0.00 ? 51  VAL B HG13 3  
ATOM   8000  H  HG21 . VAL B 1 51 ? 166.452 10.158  -4.815  1.00 0.00 ? 51  VAL B HG21 3  
ATOM   8001  H  HG22 . VAL B 1 51 ? 166.914 8.457   -4.861  1.00 0.00 ? 51  VAL B HG22 3  
ATOM   8002  H  HG23 . VAL B 1 51 ? 168.144 9.699   -4.625  1.00 0.00 ? 51  VAL B HG23 3  
ATOM   8003  N  N    . ASP B 1 52 ? 165.419 10.159  -0.301  1.00 0.00 ? 52  ASP B N    3  
ATOM   8004  C  CA   . ASP B 1 52 ? 165.245 10.124  1.148   1.00 0.00 ? 52  ASP B CA   3  
ATOM   8005  C  C    . ASP B 1 52 ? 163.810 9.774   1.557   1.00 0.00 ? 52  ASP B C    3  
ATOM   8006  O  O    . ASP B 1 52 ? 163.584 9.264   2.654   1.00 0.00 ? 52  ASP B O    3  
ATOM   8007  C  CB   . ASP B 1 52 ? 165.633 11.474  1.758   1.00 0.00 ? 52  ASP B CB   3  
ATOM   8008  C  CG   . ASP B 1 52 ? 165.679 11.362  3.279   1.00 0.00 ? 52  ASP B CG   3  
ATOM   8009  O  OD1  . ASP B 1 52 ? 165.522 10.260  3.777   1.00 0.00 ? 52  ASP B OD1  3  
ATOM   8010  O  OD2  . ASP B 1 52 ? 165.872 12.380  3.922   1.00 0.00 ? 52  ASP B OD2  3  
ATOM   8011  H  H    . ASP B 1 52 ? 165.687 11.004  -0.719  1.00 0.00 ? 52  ASP B H    3  
ATOM   8012  H  HA   . ASP B 1 52 ? 165.905 9.370   1.551   1.00 0.00 ? 52  ASP B HA   3  
ATOM   8013  H  HB2  . ASP B 1 52 ? 166.604 11.768  1.390   1.00 0.00 ? 52  ASP B HB2  3  
ATOM   8014  H  HB3  . ASP B 1 52 ? 164.904 12.218  1.480   1.00 0.00 ? 52  ASP B HB3  3  
ATOM   8015  N  N    . ALA B 1 53 ? 162.834 10.110  0.709   1.00 0.00 ? 53  ALA B N    3  
ATOM   8016  C  CA   . ALA B 1 53 ? 161.431 9.881   1.060   1.00 0.00 ? 53  ALA B CA   3  
ATOM   8017  C  C    . ALA B 1 53 ? 161.173 8.437   1.495   1.00 0.00 ? 53  ALA B C    3  
ATOM   8018  O  O    . ALA B 1 53 ? 160.298 8.190   2.326   1.00 0.00 ? 53  ALA B O    3  
ATOM   8019  C  CB   . ALA B 1 53 ? 160.509 10.198  -0.120  1.00 0.00 ? 53  ALA B CB   3  
ATOM   8020  H  H    . ALA B 1 53 ? 163.056 10.561  -0.131  1.00 0.00 ? 53  ALA B H    3  
ATOM   8021  H  HA   . ALA B 1 53 ? 161.175 10.551  1.864   1.00 0.00 ? 53  ALA B HA   3  
ATOM   8022  H  HB1  . ALA B 1 53 ? 159.583 9.650   -0.014  1.00 0.00 ? 53  ALA B HB1  3  
ATOM   8023  H  HB2  . ALA B 1 53 ? 160.987 9.910   -1.039  1.00 0.00 ? 53  ALA B HB2  3  
ATOM   8024  H  HB3  . ALA B 1 53 ? 160.295 11.254  -0.132  1.00 0.00 ? 53  ALA B HB3  3  
ATOM   8025  N  N    . VAL B 1 54 ? 161.909 7.479   0.936   1.00 0.00 ? 54  VAL B N    3  
ATOM   8026  C  CA   . VAL B 1 54 ? 161.685 6.084   1.308   1.00 0.00 ? 54  VAL B CA   3  
ATOM   8027  C  C    . VAL B 1 54 ? 161.855 5.904   2.813   1.00 0.00 ? 54  VAL B C    3  
ATOM   8028  O  O    . VAL B 1 54 ? 161.014 5.291   3.480   1.00 0.00 ? 54  VAL B O    3  
ATOM   8029  C  CB   . VAL B 1 54 ? 162.689 5.191   0.576   1.00 0.00 ? 54  VAL B CB   3  
ATOM   8030  C  CG1  . VAL B 1 54 ? 162.612 3.768   1.134   1.00 0.00 ? 54  VAL B CG1  3  
ATOM   8031  C  CG2  . VAL B 1 54 ? 162.355 5.172   -0.917  1.00 0.00 ? 54  VAL B CG2  3  
ATOM   8032  H  H    . VAL B 1 54 ? 162.591 7.707   0.270   1.00 0.00 ? 54  VAL B H    3  
ATOM   8033  H  HA   . VAL B 1 54 ? 160.689 5.790   1.020   1.00 0.00 ? 54  VAL B HA   3  
ATOM   8034  H  HB   . VAL B 1 54 ? 163.687 5.580   0.719   1.00 0.00 ? 54  VAL B HB   3  
ATOM   8035  H  HG11 . VAL B 1 54 ? 163.015 3.750   2.136   1.00 0.00 ? 54  VAL B HG11 3  
ATOM   8036  H  HG12 . VAL B 1 54 ? 163.185 3.103   0.505   1.00 0.00 ? 54  VAL B HG12 3  
ATOM   8037  H  HG13 . VAL B 1 54 ? 161.582 3.444   1.155   1.00 0.00 ? 54  VAL B HG13 3  
ATOM   8038  H  HG21 . VAL B 1 54 ? 162.020 6.151   -1.224  1.00 0.00 ? 54  VAL B HG21 3  
ATOM   8039  H  HG22 . VAL B 1 54 ? 161.572 4.451   -1.101  1.00 0.00 ? 54  VAL B HG22 3  
ATOM   8040  H  HG23 . VAL B 1 54 ? 163.234 4.899   -1.479  1.00 0.00 ? 54  VAL B HG23 3  
ATOM   8041  N  N    . ASP B 1 55 ? 162.931 6.462   3.357   1.00 0.00 ? 55  ASP B N    3  
ATOM   8042  C  CA   . ASP B 1 55 ? 163.167 6.371   4.790   1.00 0.00 ? 55  ASP B CA   3  
ATOM   8043  C  C    . ASP B 1 55 ? 162.081 7.110   5.568   1.00 0.00 ? 55  ASP B C    3  
ATOM   8044  O  O    . ASP B 1 55 ? 161.611 6.645   6.609   1.00 0.00 ? 55  ASP B O    3  
ATOM   8045  C  CB   . ASP B 1 55 ? 164.534 6.967   5.131   1.00 0.00 ? 55  ASP B CB   3  
ATOM   8046  C  CG   . ASP B 1 55 ? 165.640 6.113   4.522   1.00 0.00 ? 55  ASP B CG   3  
ATOM   8047  O  OD1  . ASP B 1 55 ? 165.344 5.010   4.096   1.00 0.00 ? 55  ASP B OD1  3  
ATOM   8048  O  OD2  . ASP B 1 55 ? 166.769 6.577   4.491   1.00 0.00 ? 55  ASP B OD2  3  
ATOM   8049  H  H    . ASP B 1 55 ? 163.560 6.957   2.790   1.00 0.00 ? 55  ASP B H    3  
ATOM   8050  H  HA   . ASP B 1 55 ? 163.160 5.332   5.079   1.00 0.00 ? 55  ASP B HA   3  
ATOM   8051  H  HB2  . ASP B 1 55 ? 164.596 7.971   4.736   1.00 0.00 ? 55  ASP B HB2  3  
ATOM   8052  H  HB3  . ASP B 1 55 ? 164.654 6.996   6.204   1.00 0.00 ? 55  ASP B HB3  3  
ATOM   8053  N  N    . LYS B 1 56 ? 161.690 8.274   5.062   1.00 0.00 ? 56  LYS B N    3  
ATOM   8054  C  CA   . LYS B 1 56 ? 160.679 9.068   5.741   1.00 0.00 ? 56  LYS B CA   3  
ATOM   8055  C  C    . LYS B 1 56 ? 159.375 8.303   5.878   1.00 0.00 ? 56  LYS B C    3  
ATOM   8056  O  O    . LYS B 1 56 ? 158.729 8.354   6.925   1.00 0.00 ? 56  LYS B O    3  
ATOM   8057  C  CB   . LYS B 1 56 ? 160.429 10.363  4.968   1.00 0.00 ? 56  LYS B CB   3  
ATOM   8058  C  CG   . LYS B 1 56 ? 161.719 11.149  4.848   1.00 0.00 ? 56  LYS B CG   3  
ATOM   8059  C  CD   . LYS B 1 56 ? 162.181 11.559  6.255   1.00 0.00 ? 56  LYS B CD   3  
ATOM   8060  C  CE   . LYS B 1 56 ? 162.791 12.941  6.179   1.00 0.00 ? 56  LYS B CE   3  
ATOM   8061  N  NZ   . LYS B 1 56 ? 163.386 13.308  7.495   1.00 0.00 ? 56  LYS B NZ   3  
ATOM   8062  H  H    . LYS B 1 56 ? 162.097 8.609   4.236   1.00 0.00 ? 56  LYS B H    3  
ATOM   8063  H  HA   . LYS B 1 56 ? 161.039 9.320   6.727   1.00 0.00 ? 56  LYS B HA   3  
ATOM   8064  H  HB2  . LYS B 1 56 ? 160.050 10.136  3.985   1.00 0.00 ? 56  LYS B HB2  3  
ATOM   8065  H  HB3  . LYS B 1 56 ? 159.715 10.978  5.500   1.00 0.00 ? 56  LYS B HB3  3  
ATOM   8066  H  HG2  . LYS B 1 56 ? 162.475 10.531  4.382   1.00 0.00 ? 56  LYS B HG2  3  
ATOM   8067  H  HG3  . LYS B 1 56 ? 161.548 12.029  4.247   1.00 0.00 ? 56  LYS B HG3  3  
ATOM   8068  H  HD2  . LYS B 1 56 ? 161.342 11.575  6.938   1.00 0.00 ? 56  LYS B HD2  3  
ATOM   8069  H  HD3  . LYS B 1 56 ? 162.922 10.859  6.609   1.00 0.00 ? 56  LYS B HD3  3  
ATOM   8070  H  HE2  . LYS B 1 56 ? 163.549 12.959  5.413   1.00 0.00 ? 56  LYS B HE2  3  
ATOM   8071  H  HE3  . LYS B 1 56 ? 162.002 13.634  5.928   1.00 0.00 ? 56  LYS B HE3  3  
ATOM   8072  H  HZ1  . LYS B 1 56 ? 163.345 14.339  7.619   1.00 0.00 ? 56  LYS B HZ1  3  
ATOM   8073  H  HZ2  . LYS B 1 56 ? 164.377 12.992  7.526   1.00 0.00 ? 56  LYS B HZ2  3  
ATOM   8074  H  HZ3  . LYS B 1 56 ? 162.851 12.849  8.259   1.00 0.00 ? 56  LYS B HZ3  3  
ATOM   8075  N  N    . VAL B 1 57 ? 158.983 7.587   4.830   1.00 0.00 ? 57  VAL B N    3  
ATOM   8076  C  CA   . VAL B 1 57 ? 157.745 6.830   4.902   1.00 0.00 ? 57  VAL B CA   3  
ATOM   8077  C  C    . VAL B 1 57 ? 157.908 5.559   5.718   1.00 0.00 ? 57  VAL B C    3  
ATOM   8078  O  O    . VAL B 1 57 ? 157.003 5.181   6.456   1.00 0.00 ? 57  VAL B O    3  
ATOM   8079  C  CB   . VAL B 1 57 ? 157.222 6.504   3.501   1.00 0.00 ? 57  VAL B CB   3  
ATOM   8080  C  CG1  . VAL B 1 57 ? 156.999 7.803   2.727   1.00 0.00 ? 57  VAL B CG1  3  
ATOM   8081  C  CG2  . VAL B 1 57 ? 158.243 5.648   2.756   1.00 0.00 ? 57  VAL B CG2  3  
ATOM   8082  H  H    . VAL B 1 57 ? 159.526 7.569   4.013   1.00 0.00 ? 57  VAL B H    3  
ATOM   8083  H  HA   . VAL B 1 57 ? 157.020 7.440   5.400   1.00 0.00 ? 57  VAL B HA   3  
ATOM   8084  H  HB   . VAL B 1 57 ? 156.287 5.967   3.581   1.00 0.00 ? 57  VAL B HB   3  
ATOM   8085  H  HG11 . VAL B 1 57 ? 156.040 8.223   2.995   1.00 0.00 ? 57  VAL B HG11 3  
ATOM   8086  H  HG12 . VAL B 1 57 ? 157.020 7.600   1.666   1.00 0.00 ? 57  VAL B HG12 3  
ATOM   8087  H  HG13 . VAL B 1 57 ? 157.780 8.508   2.973   1.00 0.00 ? 57  VAL B HG13 3  
ATOM   8088  H  HG21 . VAL B 1 57 ? 159.140 6.224   2.600   1.00 0.00 ? 57  VAL B HG21 3  
ATOM   8089  H  HG22 . VAL B 1 57 ? 157.836 5.350   1.801   1.00 0.00 ? 57  VAL B HG22 3  
ATOM   8090  H  HG23 . VAL B 1 57 ? 158.475 4.769   3.337   1.00 0.00 ? 57  VAL B HG23 3  
ATOM   8091  N  N    . MET B 1 58 ? 159.053 4.902   5.598   1.00 0.00 ? 58  MET B N    3  
ATOM   8092  C  CA   . MET B 1 58 ? 159.268 3.677   6.353   1.00 0.00 ? 58  MET B CA   3  
ATOM   8093  C  C    . MET B 1 58 ? 159.246 3.934   7.861   1.00 0.00 ? 58  MET B C    3  
ATOM   8094  O  O    . MET B 1 58 ? 158.707 3.125   8.620   1.00 0.00 ? 58  MET B O    3  
ATOM   8095  C  CB   . MET B 1 58 ? 160.577 3.006   5.907   1.00 0.00 ? 58  MET B CB   3  
ATOM   8096  C  CG   . MET B 1 58 ? 161.723 3.408   6.828   1.00 0.00 ? 58  MET B CG   3  
ATOM   8097  S  SD   . MET B 1 58 ? 161.652 2.435   8.354   1.00 0.00 ? 58  MET B SD   3  
ATOM   8098  C  CE   . MET B 1 58 ? 162.091 0.832   7.637   1.00 0.00 ? 58  MET B CE   3  
ATOM   8099  H  H    . MET B 1 58 ? 159.757 5.239   4.995   1.00 0.00 ? 58  MET B H    3  
ATOM   8100  H  HA   . MET B 1 58 ? 158.456 3.002   6.128   1.00 0.00 ? 58  MET B HA   3  
ATOM   8101  H  HB2  . MET B 1 58 ? 160.458 1.932   5.936   1.00 0.00 ? 58  MET B HB2  3  
ATOM   8102  H  HB3  . MET B 1 58 ? 160.808 3.311   4.897   1.00 0.00 ? 58  MET B HB3  3  
ATOM   8103  H  HG2  . MET B 1 58 ? 162.663 3.229   6.327   1.00 0.00 ? 58  MET B HG2  3  
ATOM   8104  H  HG3  . MET B 1 58 ? 161.632 4.457   7.060   1.00 0.00 ? 58  MET B HG3  3  
ATOM   8105  H  HE1  . MET B 1 58 ? 161.207 0.211   7.575   1.00 0.00 ? 58  MET B HE1  3  
ATOM   8106  H  HE2  . MET B 1 58 ? 162.825 0.346   8.259   1.00 0.00 ? 58  MET B HE2  3  
ATOM   8107  H  HE3  . MET B 1 58 ? 162.502 0.980   6.648   1.00 0.00 ? 58  MET B HE3  3  
ATOM   8108  N  N    . LYS B 1 59 ? 159.817 5.055   8.307   1.00 0.00 ? 59  LYS B N    3  
ATOM   8109  C  CA   . LYS B 1 59 ? 159.811 5.345   9.738   1.00 0.00 ? 59  LYS B CA   3  
ATOM   8110  C  C    . LYS B 1 59 ? 158.386 5.432   10.270  1.00 0.00 ? 59  LYS B C    3  
ATOM   8111  O  O    . LYS B 1 59 ? 158.102 4.967   11.374  1.00 0.00 ? 59  LYS B O    3  
ATOM   8112  C  CB   . LYS B 1 59 ? 160.558 6.647   10.036  1.00 0.00 ? 59  LYS B CB   3  
ATOM   8113  C  CG   . LYS B 1 59 ? 162.051 6.463   9.746   1.00 0.00 ? 59  LYS B CG   3  
ATOM   8114  C  CD   . LYS B 1 59 ? 162.789 7.779   10.005  1.00 0.00 ? 59  LYS B CD   3  
ATOM   8115  C  CE   . LYS B 1 59 ? 162.776 8.092   11.505  1.00 0.00 ? 59  LYS B CE   3  
ATOM   8116  N  NZ   . LYS B 1 59 ? 163.902 9.013   11.828  1.00 0.00 ? 59  LYS B NZ   3  
ATOM   8117  H  H    . LYS B 1 59 ? 160.239 5.686   7.673   1.00 0.00 ? 59  LYS B H    3  
ATOM   8118  H  HA   . LYS B 1 59 ? 160.317 4.538   10.249  1.00 0.00 ? 59  LYS B HA   3  
ATOM   8119  H  HB2  . LYS B 1 59 ? 160.165 7.437   9.412   1.00 0.00 ? 59  LYS B HB2  3  
ATOM   8120  H  HB3  . LYS B 1 59 ? 160.424 6.908   11.074  1.00 0.00 ? 59  LYS B HB3  3  
ATOM   8121  H  HG2  . LYS B 1 59 ? 162.448 5.694   10.394  1.00 0.00 ? 59  LYS B HG2  3  
ATOM   8122  H  HG3  . LYS B 1 59 ? 162.188 6.171   8.721   1.00 0.00 ? 59  LYS B HG3  3  
ATOM   8123  H  HD2  . LYS B 1 59 ? 163.810 7.690   9.665   1.00 0.00 ? 59  LYS B HD2  3  
ATOM   8124  H  HD3  . LYS B 1 59 ? 162.299 8.578   9.470   1.00 0.00 ? 59  LYS B HD3  3  
ATOM   8125  H  HE2  . LYS B 1 59 ? 161.840 8.563   11.766  1.00 0.00 ? 59  LYS B HE2  3  
ATOM   8126  H  HE3  . LYS B 1 59 ? 162.888 7.177   12.066  1.00 0.00 ? 59  LYS B HE3  3  
ATOM   8127  H  HZ1  . LYS B 1 59 ? 163.949 9.768   11.116  1.00 0.00 ? 59  LYS B HZ1  3  
ATOM   8128  H  HZ2  . LYS B 1 59 ? 164.796 8.480   11.830  1.00 0.00 ? 59  LYS B HZ2  3  
ATOM   8129  H  HZ3  . LYS B 1 59 ? 163.747 9.434   12.766  1.00 0.00 ? 59  LYS B HZ3  3  
ATOM   8130  N  N    . GLU B 1 60 ? 157.486 6.020   9.485   1.00 0.00 ? 60  GLU B N    3  
ATOM   8131  C  CA   . GLU B 1 60 ? 156.097 6.135   9.916   1.00 0.00 ? 60  GLU B CA   3  
ATOM   8132  C  C    . GLU B 1 60 ? 155.464 4.754   10.042  1.00 0.00 ? 60  GLU B C    3  
ATOM   8133  O  O    . GLU B 1 60 ? 154.686 4.496   10.962  1.00 0.00 ? 60  GLU B O    3  
ATOM   8134  C  CB   . GLU B 1 60 ? 155.306 6.975   8.912   1.00 0.00 ? 60  GLU B CB   3  
ATOM   8135  C  CG   . GLU B 1 60 ? 155.849 8.405   8.902   1.00 0.00 ? 60  GLU B CG   3  
ATOM   8136  C  CD   . GLU B 1 60 ? 155.026 9.269   7.952   1.00 0.00 ? 60  GLU B CD   3  
ATOM   8137  O  OE1  . GLU B 1 60 ? 154.209 8.714   7.236   1.00 0.00 ? 60  GLU B OE1  3  
ATOM   8138  O  OE2  . GLU B 1 60 ? 155.225 10.473  7.955   1.00 0.00 ? 60  GLU B OE2  3  
ATOM   8139  H  H    . GLU B 1 60 ? 157.756 6.371   8.610   1.00 0.00 ? 60  GLU B H    3  
ATOM   8140  H  HA   . GLU B 1 60 ? 156.069 6.624   10.879  1.00 0.00 ? 60  GLU B HA   3  
ATOM   8141  H  HB2  . GLU B 1 60 ? 155.405 6.543   7.926   1.00 0.00 ? 60  GLU B HB2  3  
ATOM   8142  H  HB3  . GLU B 1 60 ? 154.265 6.989   9.196   1.00 0.00 ? 60  GLU B HB3  3  
ATOM   8143  H  HG2  . GLU B 1 60 ? 155.795 8.815   9.899   1.00 0.00 ? 60  GLU B HG2  3  
ATOM   8144  H  HG3  . GLU B 1 60 ? 156.879 8.395   8.574   1.00 0.00 ? 60  GLU B HG3  3  
ATOM   8145  N  N    . LEU B 1 61 ? 155.816 3.866   9.116   1.00 0.00 ? 61  LEU B N    3  
ATOM   8146  C  CA   . LEU B 1 61 ? 155.295 2.504   9.134   1.00 0.00 ? 61  LEU B CA   3  
ATOM   8147  C  C    . LEU B 1 61 ? 155.816 1.737   10.336  1.00 0.00 ? 61  LEU B C    3  
ATOM   8148  O  O    . LEU B 1 61 ? 155.111 0.919   10.923  1.00 0.00 ? 61  LEU B O    3  
ATOM   8149  C  CB   . LEU B 1 61 ? 155.727 1.771   7.870   1.00 0.00 ? 61  LEU B CB   3  
ATOM   8150  C  CG   . LEU B 1 61 ? 155.182 2.483   6.636   1.00 0.00 ? 61  LEU B CG   3  
ATOM   8151  C  CD1  . LEU B 1 61 ? 155.665 1.753   5.382   1.00 0.00 ? 61  LEU B CD1  3  
ATOM   8152  C  CD2  . LEU B 1 61 ? 153.648 2.470   6.676   1.00 0.00 ? 61  LEU B CD2  3  
ATOM   8153  H  H    . LEU B 1 61 ? 156.449 4.129   8.415   1.00 0.00 ? 61  LEU B H    3  
ATOM   8154  H  HA   . LEU B 1 61 ? 154.216 2.535   9.169   1.00 0.00 ? 61  LEU B HA   3  
ATOM   8155  H  HB2  . LEU B 1 61 ? 156.806 1.742   7.821   1.00 0.00 ? 61  LEU B HB2  3  
ATOM   8156  H  HB3  . LEU B 1 61 ? 155.342 0.767   7.897   1.00 0.00 ? 61  LEU B HB3  3  
ATOM   8157  H  HG   . LEU B 1 61 ? 155.534 3.500   6.621   1.00 0.00 ? 61  LEU B HG   3  
ATOM   8158  H  HD11 . LEU B 1 61 ? 156.708 1.502   5.496   1.00 0.00 ? 61  LEU B HD11 3  
ATOM   8159  H  HD12 . LEU B 1 61 ? 155.541 2.393   4.521   1.00 0.00 ? 61  LEU B HD12 3  
ATOM   8160  H  HD13 . LEU B 1 61 ? 155.088 0.850   5.245   1.00 0.00 ? 61  LEU B HD13 3  
ATOM   8161  H  HD21 . LEU B 1 61 ? 153.292 3.393   7.109   1.00 0.00 ? 61  LEU B HD21 3  
ATOM   8162  H  HD22 . LEU B 1 61 ? 153.303 1.636   7.271   1.00 0.00 ? 61  LEU B HD22 3  
ATOM   8163  H  HD23 . LEU B 1 61 ? 153.264 2.373   5.672   1.00 0.00 ? 61  LEU B HD23 3  
ATOM   8164  N  N    . ASP B 1 62 ? 157.069 1.997   10.677  1.00 0.00 ? 62  ASP B N    3  
ATOM   8165  C  CA   . ASP B 1 62 ? 157.713 1.318   11.790  1.00 0.00 ? 62  ASP B CA   3  
ATOM   8166  C  C    . ASP B 1 62 ? 157.590 2.076   13.098  1.00 0.00 ? 62  ASP B C    3  
ATOM   8167  O  O    . ASP B 1 62 ? 158.474 2.011   13.951  1.00 0.00 ? 62  ASP B O    3  
ATOM   8168  C  CB   . ASP B 1 62 ? 159.169 1.015   11.452  1.00 0.00 ? 62  ASP B CB   3  
ATOM   8169  C  CG   . ASP B 1 62 ? 159.213 -0.108  10.417  1.00 0.00 ? 62  ASP B CG   3  
ATOM   8170  O  OD1  . ASP B 1 62 ? 158.203 -0.792  10.269  1.00 0.00 ? 62  ASP B OD1  3  
ATOM   8171  O  OD2  . ASP B 1 62 ? 160.259 -0.295  9.816   1.00 0.00 ? 62  ASP B OD2  3  
ATOM   8172  H  H    . ASP B 1 62 ? 157.582 2.650   10.153  1.00 0.00 ? 62  ASP B H    3  
ATOM   8173  H  HA   . ASP B 1 62 ? 157.210 0.371   11.929  1.00 0.00 ? 62  ASP B HA   3  
ATOM   8174  H  HB2  . ASP B 1 62 ? 159.635 1.900   11.040  1.00 0.00 ? 62  ASP B HB2  3  
ATOM   8175  H  HB3  . ASP B 1 62 ? 159.694 0.705   12.342  1.00 0.00 ? 62  ASP B HB3  3  
ATOM   8176  N  N    . GLU B 1 63 ? 156.459 2.740   13.283  1.00 0.00 ? 63  GLU B N    3  
ATOM   8177  C  CA   . GLU B 1 63 ? 156.215 3.434   14.533  1.00 0.00 ? 63  GLU B CA   3  
ATOM   8178  C  C    . GLU B 1 63 ? 156.459 2.497   15.678  1.00 0.00 ? 63  GLU B C    3  
ATOM   8179  O  O    . GLU B 1 63 ? 156.850 2.905   16.771  1.00 0.00 ? 63  GLU B O    3  
ATOM   8180  C  CB   . GLU B 1 63 ? 154.771 3.928   14.597  1.00 0.00 ? 63  GLU B CB   3  
ATOM   8181  C  CG   . GLU B 1 63 ? 154.519 4.550   15.972  1.00 0.00 ? 63  GLU B CG   3  
ATOM   8182  C  CD   . GLU B 1 63 ? 153.087 5.064   16.066  1.00 0.00 ? 63  GLU B CD   3  
ATOM   8183  O  OE1  . GLU B 1 63 ? 152.348 4.877   15.114  1.00 0.00 ? 63  GLU B OE1  3  
ATOM   8184  O  OE2  . GLU B 1 63 ? 152.751 5.639   17.089  1.00 0.00 ? 63  GLU B OE2  3  
ATOM   8185  H  H    . GLU B 1 63 ? 155.763 2.721   12.593  1.00 0.00 ? 63  GLU B H    3  
ATOM   8186  H  HA   . GLU B 1 63 ? 156.883 4.278   14.611  1.00 0.00 ? 63  GLU B HA   3  
ATOM   8187  H  HB2  . GLU B 1 63 ? 154.609 4.669   13.827  1.00 0.00 ? 63  GLU B HB2  3  
ATOM   8188  H  HB3  . GLU B 1 63 ? 154.098 3.098   14.449  1.00 0.00 ? 63  GLU B HB3  3  
ATOM   8189  H  HG2  . GLU B 1 63 ? 154.654 3.790   16.729  1.00 0.00 ? 63  GLU B HG2  3  
ATOM   8190  H  HG3  . GLU B 1 63 ? 155.213 5.336   16.148  1.00 0.00 ? 63  GLU B HG3  3  
ATOM   8191  N  N    . ASN B 1 64 ? 156.202 1.242   15.422  1.00 0.00 ? 64  ASN B N    3  
ATOM   8192  C  CA   . ASN B 1 64 ? 156.367 0.241   16.434  1.00 0.00 ? 64  ASN B CA   3  
ATOM   8193  C  C    . ASN B 1 64 ? 157.767 0.355   17.013  1.00 0.00 ? 64  ASN B C    3  
ATOM   8194  O  O    . ASN B 1 64 ? 158.016 0.012   18.169  1.00 0.00 ? 64  ASN B O    3  
ATOM   8195  C  CB   . ASN B 1 64 ? 156.257 -1.152  15.815  1.00 0.00 ? 64  ASN B CB   3  
ATOM   8196  C  CG   . ASN B 1 64 ? 155.045 -1.263  14.904  1.00 0.00 ? 64  ASN B CG   3  
ATOM   8197  O  OD1  . ASN B 1 64 ? 155.191 -1.684  13.748  1.00 0.00 ? 64  ASN B OD1  3  
ATOM   8198  N  ND2  . ASN B 1 64 ? 153.865 -0.916  15.342  1.00 0.00 ? 64  ASN B ND2  3  
ATOM   8199  H  H    . ASN B 1 64 ? 155.878 0.984   14.533  1.00 0.00 ? 64  ASN B H    3  
ATOM   8200  H  HA   . ASN B 1 64 ? 155.624 0.388   17.199  1.00 0.00 ? 64  ASN B HA   3  
ATOM   8201  H  HB2  . ASN B 1 64 ? 157.146 -1.350  15.241  1.00 0.00 ? 64  ASN B HB2  3  
ATOM   8202  H  HB3  . ASN B 1 64 ? 156.174 -1.882  16.605  1.00 0.00 ? 64  ASN B HB3  3  
ATOM   8203  H  HD21 . ASN B 1 64 ? 153.760 -0.586  16.258  1.00 0.00 ? 64  ASN B HD21 3  
ATOM   8204  H  HD22 . ASN B 1 64 ? 153.084 -0.989  14.755  1.00 0.00 ? 64  ASN B HD22 3  
ATOM   8205  N  N    . GLY B 1 65 ? 158.688 0.783   16.158  1.00 0.00 ? 65  GLY B N    3  
ATOM   8206  C  CA   . GLY B 1 65 ? 160.088 0.883   16.527  1.00 0.00 ? 65  GLY B CA   3  
ATOM   8207  C  C    . GLY B 1 65 ? 160.807 -0.350  15.999  1.00 0.00 ? 65  GLY B C    3  
ATOM   8208  O  O    . GLY B 1 65 ? 162.000 -0.547  16.229  1.00 0.00 ? 65  GLY B O    3  
ATOM   8209  H  H    . GLY B 1 65 ? 158.422 0.993   15.239  1.00 0.00 ? 65  GLY B H    3  
ATOM   8210  H  HA2  . GLY B 1 65 ? 160.516 1.775   16.090  1.00 0.00 ? 65  GLY B HA2  3  
ATOM   8211  H  HA3  . GLY B 1 65 ? 160.182 0.919   17.601  1.00 0.00 ? 65  GLY B HA3  3  
ATOM   8212  N  N    . ASP B 1 66 ? 160.048 -1.168  15.267  1.00 0.00 ? 66  ASP B N    3  
ATOM   8213  C  CA   . ASP B 1 66 ? 160.566 -2.371  14.672  1.00 0.00 ? 66  ASP B CA   3  
ATOM   8214  C  C    . ASP B 1 66 ? 161.102 -2.087  13.280  1.00 0.00 ? 66  ASP B C    3  
ATOM   8215  O  O    . ASP B 1 66 ? 160.426 -1.526  12.420  1.00 0.00 ? 66  ASP B O    3  
ATOM   8216  C  CB   . ASP B 1 66 ? 159.485 -3.466  14.630  1.00 0.00 ? 66  ASP B CB   3  
ATOM   8217  C  CG   . ASP B 1 66 ? 158.285 -3.059  13.764  1.00 0.00 ? 66  ASP B CG   3  
ATOM   8218  O  OD1  . ASP B 1 66 ? 158.383 -2.081  13.043  1.00 0.00 ? 66  ASP B OD1  3  
ATOM   8219  O  OD2  . ASP B 1 66 ? 157.278 -3.742  13.838  1.00 0.00 ? 66  ASP B OD2  3  
ATOM   8220  H  H    . ASP B 1 66 ? 159.125 -0.941  15.111  1.00 0.00 ? 66  ASP B H    3  
ATOM   8221  H  HA   . ASP B 1 66 ? 161.383 -2.727  15.283  1.00 0.00 ? 66  ASP B HA   3  
ATOM   8222  H  HB2  . ASP B 1 66 ? 159.917 -4.370  14.227  1.00 0.00 ? 66  ASP B HB2  3  
ATOM   8223  H  HB3  . ASP B 1 66 ? 159.143 -3.660  15.636  1.00 0.00 ? 66  ASP B HB3  3  
ATOM   8224  N  N    . GLY B 1 67 ? 162.331 -2.480  13.086  1.00 0.00 ? 67  GLY B N    3  
ATOM   8225  C  CA   . GLY B 1 67 ? 163.005 -2.290  11.811  1.00 0.00 ? 67  GLY B CA   3  
ATOM   8226  C  C    . GLY B 1 67 ? 162.177 -2.878  10.674  1.00 0.00 ? 67  GLY B C    3  
ATOM   8227  O  O    . GLY B 1 67 ? 162.307 -2.468  9.520   1.00 0.00 ? 67  GLY B O    3  
ATOM   8228  H  H    . GLY B 1 67 ? 162.799 -2.907  13.824  1.00 0.00 ? 67  GLY B H    3  
ATOM   8229  H  HA2  . GLY B 1 67 ? 163.149 -1.232  11.639  1.00 0.00 ? 67  GLY B HA2  3  
ATOM   8230  H  HA3  . GLY B 1 67 ? 163.966 -2.780  11.838  1.00 0.00 ? 67  GLY B HA3  3  
ATOM   8231  N  N    . GLU B 1 68 ? 161.343 -3.860  11.007  1.00 0.00 ? 68  GLU B N    3  
ATOM   8232  C  CA   . GLU B 1 68 ? 160.516 -4.523  10.005  1.00 0.00 ? 68  GLU B CA   3  
ATOM   8233  C  C    . GLU B 1 68 ? 159.126 -3.883  9.937   1.00 0.00 ? 68  GLU B C    3  
ATOM   8234  O  O    . GLU B 1 68 ? 158.576 -3.412  10.944  1.00 0.00 ? 68  GLU B O    3  
ATOM   8235  C  CB   . GLU B 1 68 ? 160.416 -6.014  10.327  1.00 0.00 ? 68  GLU B CB   3  
ATOM   8236  C  CG   . GLU B 1 68 ? 159.758 -6.747  9.160   1.00 0.00 ? 68  GLU B CG   3  
ATOM   8237  C  CD   . GLU B 1 68 ? 159.618 -8.225  9.497   1.00 0.00 ? 68  GLU B CD   3  
ATOM   8238  O  OE1  . GLU B 1 68 ? 159.985 -8.598  10.598  1.00 0.00 ? 68  GLU B OE1  3  
ATOM   8239  O  OE2  . GLU B 1 68 ? 159.149 -8.964  8.648   1.00 0.00 ? 68  GLU B OE2  3  
ATOM   8240  H  H    . GLU B 1 68 ? 161.294 -4.153  11.942  1.00 0.00 ? 68  GLU B H    3  
ATOM   8241  H  HA   . GLU B 1 68 ? 160.984 -4.418  9.040   1.00 0.00 ? 68  GLU B HA   3  
ATOM   8242  H  HB2  . GLU B 1 68 ? 161.405 -6.416  10.494  1.00 0.00 ? 68  GLU B HB2  3  
ATOM   8243  H  HB3  . GLU B 1 68 ? 159.814 -6.152  11.214  1.00 0.00 ? 68  GLU B HB3  3  
ATOM   8244  H  HG2  . GLU B 1 68 ? 158.780 -6.325  8.976   1.00 0.00 ? 68  GLU B HG2  3  
ATOM   8245  H  HG3  . GLU B 1 68 ? 160.369 -6.638  8.275   1.00 0.00 ? 68  GLU B HG3  3  
ATOM   8246  N  N    . VAL B 1 69 ? 158.573 -3.837  8.730   1.00 0.00 ? 69  VAL B N    3  
ATOM   8247  C  CA   . VAL B 1 69 ? 157.267 -3.226  8.526   1.00 0.00 ? 69  VAL B CA   3  
ATOM   8248  C  C    . VAL B 1 69 ? 156.184 -4.281  8.381   1.00 0.00 ? 69  VAL B C    3  
ATOM   8249  O  O    . VAL B 1 69 ? 156.322 -5.237  7.618   1.00 0.00 ? 69  VAL B O    3  
ATOM   8250  C  CB   . VAL B 1 69 ? 157.300 -2.377  7.256   1.00 0.00 ? 69  VAL B CB   3  
ATOM   8251  C  CG1  . VAL B 1 69 ? 155.937 -1.719  7.048   1.00 0.00 ? 69  VAL B CG1  3  
ATOM   8252  C  CG2  . VAL B 1 69 ? 158.373 -1.294  7.396   1.00 0.00 ? 69  VAL B CG2  3  
ATOM   8253  H  H    . VAL B 1 69 ? 159.060 -4.202  7.961   1.00 0.00 ? 69  VAL B H    3  
ATOM   8254  H  HA   . VAL B 1 69 ? 157.035 -2.588  9.365   1.00 0.00 ? 69  VAL B HA   3  
ATOM   8255  H  HB   . VAL B 1 69 ? 157.528 -3.006  6.408   1.00 0.00 ? 69  VAL B HB   3  
ATOM   8256  H  HG11 . VAL B 1 69 ? 155.285 -2.403  6.525   1.00 0.00 ? 69  VAL B HG11 3  
ATOM   8257  H  HG12 . VAL B 1 69 ? 156.057 -0.821  6.462   1.00 0.00 ? 69  VAL B HG12 3  
ATOM   8258  H  HG13 . VAL B 1 69 ? 155.505 -1.474  8.006   1.00 0.00 ? 69  VAL B HG13 3  
ATOM   8259  H  HG21 . VAL B 1 69 ? 157.980 -0.469  7.972   1.00 0.00 ? 69  VAL B HG21 3  
ATOM   8260  H  HG22 . VAL B 1 69 ? 158.663 -0.945  6.416   1.00 0.00 ? 69  VAL B HG22 3  
ATOM   8261  H  HG23 . VAL B 1 69 ? 159.235 -1.706  7.901   1.00 0.00 ? 69  VAL B HG23 3  
ATOM   8262  N  N    . ASP B 1 70 ? 155.100 -4.088  9.122   1.00 0.00 ? 70  ASP B N    3  
ATOM   8263  C  CA   . ASP B 1 70 ? 153.980 -5.010  9.078   1.00 0.00 ? 70  ASP B CA   3  
ATOM   8264  C  C    . ASP B 1 70 ? 153.060 -4.677  7.907   1.00 0.00 ? 70  ASP B C    3  
ATOM   8265  O  O    . ASP B 1 70 ? 152.841 -3.506  7.595   1.00 0.00 ? 70  ASP B O    3  
ATOM   8266  C  CB   . ASP B 1 70 ? 153.201 -4.953  10.392  1.00 0.00 ? 70  ASP B CB   3  
ATOM   8267  C  CG   . ASP B 1 70 ? 154.071 -5.443  11.545  1.00 0.00 ? 70  ASP B CG   3  
ATOM   8268  O  OD1  . ASP B 1 70 ? 155.129 -5.985  11.276  1.00 0.00 ? 70  ASP B OD1  3  
ATOM   8269  O  OD2  . ASP B 1 70 ? 153.671 -5.255  12.683  1.00 0.00 ? 70  ASP B OD2  3  
ATOM   8270  H  H    . ASP B 1 70 ? 155.052 -3.302  9.705   1.00 0.00 ? 70  ASP B H    3  
ATOM   8271  H  HA   . ASP B 1 70 ? 154.362 -6.005  8.945   1.00 0.00 ? 70  ASP B HA   3  
ATOM   8272  H  HB2  . ASP B 1 70 ? 152.899 -3.937  10.582  1.00 0.00 ? 70  ASP B HB2  3  
ATOM   8273  H  HB3  . ASP B 1 70 ? 152.327 -5.581  10.316  1.00 0.00 ? 70  ASP B HB3  3  
ATOM   8274  N  N    . PHE B 1 71 ? 152.516 -5.705  7.265   1.00 0.00 ? 71  PHE B N    3  
ATOM   8275  C  CA   . PHE B 1 71 ? 151.616 -5.488  6.138   1.00 0.00 ? 71  PHE B CA   3  
ATOM   8276  C  C    . PHE B 1 71 ? 150.445 -4.598  6.527   1.00 0.00 ? 71  PHE B C    3  
ATOM   8277  O  O    . PHE B 1 71 ? 150.055 -3.717  5.762   1.00 0.00 ? 71  PHE B O    3  
ATOM   8278  C  CB   . PHE B 1 71 ? 151.112 -6.834  5.607   1.00 0.00 ? 71  PHE B CB   3  
ATOM   8279  C  CG   . PHE B 1 71 ? 150.141 -6.631  4.462   1.00 0.00 ? 71  PHE B CG   3  
ATOM   8280  C  CD1  . PHE B 1 71 ? 150.518 -5.916  3.316   1.00 0.00 ? 71  PHE B CD1  3  
ATOM   8281  C  CD2  . PHE B 1 71 ? 148.867 -7.210  4.532   1.00 0.00 ? 71  PHE B CD2  3  
ATOM   8282  C  CE1  . PHE B 1 71 ? 149.619 -5.779  2.249   1.00 0.00 ? 71  PHE B CE1  3  
ATOM   8283  C  CE2  . PHE B 1 71 ? 147.969 -7.066  3.469   1.00 0.00 ? 71  PHE B CE2  3  
ATOM   8284  C  CZ   . PHE B 1 71 ? 148.345 -6.353  2.327   1.00 0.00 ? 71  PHE B CZ   3  
ATOM   8285  H  H    . PHE B 1 71 ? 152.718 -6.619  7.555   1.00 0.00 ? 71  PHE B H    3  
ATOM   8286  H  HA   . PHE B 1 71 ? 152.170 -4.998  5.354   1.00 0.00 ? 71  PHE B HA   3  
ATOM   8287  H  HB2  . PHE B 1 71 ? 151.952 -7.416  5.257   1.00 0.00 ? 71  PHE B HB2  3  
ATOM   8288  H  HB3  . PHE B 1 71 ? 150.617 -7.368  6.403   1.00 0.00 ? 71  PHE B HB3  3  
ATOM   8289  H  HD1  . PHE B 1 71 ? 151.490 -5.459  3.260   1.00 0.00 ? 71  PHE B HD1  3  
ATOM   8290  H  HD2  . PHE B 1 71 ? 148.575 -7.762  5.413   1.00 0.00 ? 71  PHE B HD2  3  
ATOM   8291  H  HE1  . PHE B 1 71 ? 149.909 -5.230  1.366   1.00 0.00 ? 71  PHE B HE1  3  
ATOM   8292  H  HE2  . PHE B 1 71 ? 146.986 -7.509  3.529   1.00 0.00 ? 71  PHE B HE2  3  
ATOM   8293  H  HZ   . PHE B 1 71 ? 147.654 -6.246  1.504   1.00 0.00 ? 71  PHE B HZ   3  
ATOM   8294  N  N    . GLN B 1 72 ? 149.888 -4.812  7.712   1.00 0.00 ? 72  GLN B N    3  
ATOM   8295  C  CA   . GLN B 1 72 ? 148.774 -3.983  8.143   1.00 0.00 ? 72  GLN B CA   3  
ATOM   8296  C  C    . GLN B 1 72 ? 149.188 -2.515  8.141   1.00 0.00 ? 72  GLN B C    3  
ATOM   8297  O  O    . GLN B 1 72 ? 148.430 -1.646  7.712   1.00 0.00 ? 72  GLN B O    3  
ATOM   8298  C  CB   . GLN B 1 72 ? 148.328 -4.391  9.549   1.00 0.00 ? 72  GLN B CB   3  
ATOM   8299  C  CG   . GLN B 1 72 ? 147.041 -3.648  9.912   1.00 0.00 ? 72  GLN B CG   3  
ATOM   8300  C  CD   . GLN B 1 72 ? 146.662 -3.940  11.360  1.00 0.00 ? 72  GLN B CD   3  
ATOM   8301  O  OE1  . GLN B 1 72 ? 147.426 -3.634  12.276  1.00 0.00 ? 72  GLN B OE1  3  
ATOM   8302  N  NE2  . GLN B 1 72 ? 145.522 -4.517  11.623  1.00 0.00 ? 72  GLN B NE2  3  
ATOM   8303  H  H    . GLN B 1 72 ? 150.232 -5.518  8.298   1.00 0.00 ? 72  GLN B H    3  
ATOM   8304  H  HA   . GLN B 1 72 ? 147.949 -4.117  7.459   1.00 0.00 ? 72  GLN B HA   3  
ATOM   8305  H  HB2  . GLN B 1 72 ? 148.148 -5.456  9.574   1.00 0.00 ? 72  GLN B HB2  3  
ATOM   8306  H  HB3  . GLN B 1 72 ? 149.099 -4.139  10.259  1.00 0.00 ? 72  GLN B HB3  3  
ATOM   8307  H  HG2  . GLN B 1 72 ? 147.193 -2.586  9.788   1.00 0.00 ? 72  GLN B HG2  3  
ATOM   8308  H  HG3  . GLN B 1 72 ? 146.243 -3.974  9.261   1.00 0.00 ? 72  GLN B HG3  3  
ATOM   8309  H  HE21 . GLN B 1 72 ? 144.915 -4.760  10.893  1.00 0.00 ? 72  GLN B HE21 3  
ATOM   8310  H  HE22 . GLN B 1 72 ? 145.272 -4.708  12.552  1.00 0.00 ? 72  GLN B HE22 3  
ATOM   8311  N  N    . GLU B 1 73 ? 150.410 -2.248  8.605   1.00 0.00 ? 73  GLU B N    3  
ATOM   8312  C  CA   . GLU B 1 73 ? 150.923 -0.881  8.628   1.00 0.00 ? 73  GLU B CA   3  
ATOM   8313  C  C    . GLU B 1 73 ? 151.121 -0.354  7.209   1.00 0.00 ? 73  GLU B C    3  
ATOM   8314  O  O    . GLU B 1 73 ? 150.828 0.805   6.914   1.00 0.00 ? 73  GLU B O    3  
ATOM   8315  C  CB   . GLU B 1 73 ? 152.261 -0.865  9.382   1.00 0.00 ? 73  GLU B CB   3  
ATOM   8316  C  CG   . GLU B 1 73 ? 152.008 -1.202  10.854  1.00 0.00 ? 73  GLU B CG   3  
ATOM   8317  C  CD   . GLU B 1 73 ? 153.311 -1.197  11.659  1.00 0.00 ? 73  GLU B CD   3  
ATOM   8318  O  OE1  . GLU B 1 73 ? 154.385 -1.242  11.062  1.00 0.00 ? 73  GLU B OE1  3  
ATOM   8319  O  OE2  . GLU B 1 73 ? 153.212 -1.139  12.872  1.00 0.00 ? 73  GLU B OE2  3  
ATOM   8320  H  H    . GLU B 1 73 ? 150.978 -2.982  8.920   1.00 0.00 ? 73  GLU B H    3  
ATOM   8321  H  HA   . GLU B 1 73 ? 150.220 -0.248  9.146   1.00 0.00 ? 73  GLU B HA   3  
ATOM   8322  H  HB2  . GLU B 1 73 ? 152.928 -1.598  8.951   1.00 0.00 ? 73  GLU B HB2  3  
ATOM   8323  H  HB3  . GLU B 1 73 ? 152.704 0.116   9.309   1.00 0.00 ? 73  GLU B HB3  3  
ATOM   8324  H  HG2  . GLU B 1 73 ? 151.335 -0.467  11.271  1.00 0.00 ? 73  GLU B HG2  3  
ATOM   8325  H  HG3  . GLU B 1 73 ? 151.549 -2.175  10.921  1.00 0.00 ? 73  GLU B HG3  3  
ATOM   8326  N  N    . TYR B 1 74 ? 151.617 -1.225  6.338   1.00 0.00 ? 74  TYR B N    3  
ATOM   8327  C  CA   . TYR B 1 74 ? 151.859 -0.871  4.941   1.00 0.00 ? 74  TYR B CA   3  
ATOM   8328  C  C    . TYR B 1 74 ? 150.577 -0.561  4.164   1.00 0.00 ? 74  TYR B C    3  
ATOM   8329  O  O    . TYR B 1 74 ? 150.511 0.418   3.406   1.00 0.00 ? 74  TYR B O    3  
ATOM   8330  C  CB   . TYR B 1 74 ? 152.604 -2.030  4.275   1.00 0.00 ? 74  TYR B CB   3  
ATOM   8331  C  CG   . TYR B 1 74 ? 152.873 -1.718  2.826   1.00 0.00 ? 74  TYR B CG   3  
ATOM   8332  C  CD1  . TYR B 1 74 ? 153.941 -0.894  2.462   1.00 0.00 ? 74  TYR B CD1  3  
ATOM   8333  C  CD2  . TYR B 1 74 ? 152.055 -2.281  1.842   1.00 0.00 ? 74  TYR B CD2  3  
ATOM   8334  C  CE1  . TYR B 1 74 ? 154.188 -0.628  1.110   1.00 0.00 ? 74  TYR B CE1  3  
ATOM   8335  C  CE2  . TYR B 1 74 ? 152.299 -2.016  0.492   1.00 0.00 ? 74  TYR B CE2  3  
ATOM   8336  C  CZ   . TYR B 1 74 ? 153.364 -1.189  0.125   1.00 0.00 ? 74  TYR B CZ   3  
ATOM   8337  O  OH   . TYR B 1 74 ? 153.604 -0.934  -1.207  1.00 0.00 ? 74  TYR B OH   3  
ATOM   8338  H  H    . TYR B 1 74 ? 151.826 -2.135  6.641   1.00 0.00 ? 74  TYR B H    3  
ATOM   8339  H  HA   . TYR B 1 74 ? 152.496 -0.001  4.913   1.00 0.00 ? 74  TYR B HA   3  
ATOM   8340  H  HB2  . TYR B 1 74 ? 153.543 -2.190  4.785   1.00 0.00 ? 74  TYR B HB2  3  
ATOM   8341  H  HB3  . TYR B 1 74 ? 152.004 -2.925  4.343   1.00 0.00 ? 74  TYR B HB3  3  
ATOM   8342  H  HD1  . TYR B 1 74 ? 154.569 -0.459  3.222   1.00 0.00 ? 74  TYR B HD1  3  
ATOM   8343  H  HD2  . TYR B 1 74 ? 151.237 -2.922  2.126   1.00 0.00 ? 74  TYR B HD2  3  
ATOM   8344  H  HE1  . TYR B 1 74 ? 155.012 0.008   0.825   1.00 0.00 ? 74  TYR B HE1  3  
ATOM   8345  H  HE2  . TYR B 1 74 ? 151.663 -2.449  -0.267  1.00 0.00 ? 74  TYR B HE2  3  
ATOM   8346  H  HH   . TYR B 1 74 ? 152.989 -0.254  -1.494  1.00 0.00 ? 74  TYR B HH   3  
ATOM   8347  N  N    . VAL B 1 75 ? 149.571 -1.409  4.330   1.00 0.00 ? 75  VAL B N    3  
ATOM   8348  C  CA   . VAL B 1 75 ? 148.321 -1.227  3.607   1.00 0.00 ? 75  VAL B CA   3  
ATOM   8349  C  C    . VAL B 1 75 ? 147.640 0.077   4.006   1.00 0.00 ? 75  VAL B C    3  
ATOM   8350  O  O    . VAL B 1 75 ? 147.126 0.799   3.150   1.00 0.00 ? 75  VAL B O    3  
ATOM   8351  C  CB   . VAL B 1 75 ? 147.395 -2.418  3.874   1.00 0.00 ? 75  VAL B CB   3  
ATOM   8352  C  CG1  . VAL B 1 75 ? 146.068 -2.261  3.102   1.00 0.00 ? 75  VAL B CG1  3  
ATOM   8353  C  CG2  . VAL B 1 75 ? 148.100 -3.705  3.436   1.00 0.00 ? 75  VAL B CG2  3  
ATOM   8354  H  H    . VAL B 1 75 ? 149.679 -2.179  4.927   1.00 0.00 ? 75  VAL B H    3  
ATOM   8355  H  HA   . VAL B 1 75 ? 148.539 -1.192  2.551   1.00 0.00 ? 75  VAL B HA   3  
ATOM   8356  H  HB   . VAL B 1 75 ? 147.185 -2.471  4.933   1.00 0.00 ? 75  VAL B HB   3  
ATOM   8357  H  HG11 . VAL B 1 75 ? 146.072 -2.904  2.233   1.00 0.00 ? 75  VAL B HG11 3  
ATOM   8358  H  HG12 . VAL B 1 75 ? 145.940 -1.240  2.782   1.00 0.00 ? 75  VAL B HG12 3  
ATOM   8359  H  HG13 . VAL B 1 75 ? 145.249 -2.540  3.742   1.00 0.00 ? 75  VAL B HG13 3  
ATOM   8360  H  HG21 . VAL B 1 75 ? 147.680 -4.543  3.971   1.00 0.00 ? 75  VAL B HG21 3  
ATOM   8361  H  HG22 . VAL B 1 75 ? 149.155 -3.631  3.650   1.00 0.00 ? 75  VAL B HG22 3  
ATOM   8362  H  HG23 . VAL B 1 75 ? 147.958 -3.848  2.374   1.00 0.00 ? 75  VAL B HG23 3  
ATOM   8363  N  N    . VAL B 1 76 ? 147.630 0.383   5.299   1.00 0.00 ? 76  VAL B N    3  
ATOM   8364  C  CA   . VAL B 1 76 ? 146.995 1.610   5.753   1.00 0.00 ? 76  VAL B CA   3  
ATOM   8365  C  C    . VAL B 1 76 ? 147.672 2.826   5.133   1.00 0.00 ? 76  VAL B C    3  
ATOM   8366  O  O    . VAL B 1 76 ? 147.003 3.744   4.658   1.00 0.00 ? 76  VAL B O    3  
ATOM   8367  C  CB   . VAL B 1 76 ? 147.074 1.703   7.279   1.00 0.00 ? 76  VAL B CB   3  
ATOM   8368  C  CG1  . VAL B 1 76 ? 146.612 3.091   7.738   1.00 0.00 ? 76  VAL B CG1  3  
ATOM   8369  C  CG2  . VAL B 1 76 ? 146.173 0.630   7.897   1.00 0.00 ? 76  VAL B CG2  3  
ATOM   8370  H  H    . VAL B 1 76 ? 148.045 -0.222  5.950   1.00 0.00 ? 76  VAL B H    3  
ATOM   8371  H  HA   . VAL B 1 76 ? 145.957 1.599   5.458   1.00 0.00 ? 76  VAL B HA   3  
ATOM   8372  H  HB   . VAL B 1 76 ? 148.095 1.542   7.594   1.00 0.00 ? 76  VAL B HB   3  
ATOM   8373  H  HG11 . VAL B 1 76 ? 145.882 3.478   7.042   1.00 0.00 ? 76  VAL B HG11 3  
ATOM   8374  H  HG12 . VAL B 1 76 ? 147.460 3.757   7.774   1.00 0.00 ? 76  VAL B HG12 3  
ATOM   8375  H  HG13 . VAL B 1 76 ? 146.169 3.019   8.721   1.00 0.00 ? 76  VAL B HG13 3  
ATOM   8376  H  HG21 . VAL B 1 76 ? 145.151 0.979   7.904   1.00 0.00 ? 76  VAL B HG21 3  
ATOM   8377  H  HG22 . VAL B 1 76 ? 146.493 0.430   8.909   1.00 0.00 ? 76  VAL B HG22 3  
ATOM   8378  H  HG23 . VAL B 1 76 ? 146.239 -0.276  7.312   1.00 0.00 ? 76  VAL B HG23 3  
ATOM   8379  N  N    . LEU B 1 77 ? 149.002 2.822   5.124   1.00 0.00 ? 77  LEU B N    3  
ATOM   8380  C  CA   . LEU B 1 77 ? 149.745 3.930   4.540   1.00 0.00 ? 77  LEU B CA   3  
ATOM   8381  C  C    . LEU B 1 77 ? 149.466 4.036   3.047   1.00 0.00 ? 77  LEU B C    3  
ATOM   8382  O  O    . LEU B 1 77 ? 149.334 5.135   2.511   1.00 0.00 ? 77  LEU B O    3  
ATOM   8383  C  CB   . LEU B 1 77 ? 151.239 3.738   4.778   1.00 0.00 ? 77  LEU B CB   3  
ATOM   8384  C  CG   . LEU B 1 77 ? 152.016 4.958   4.265   1.00 0.00 ? 77  LEU B CG   3  
ATOM   8385  C  CD1  . LEU B 1 77 ? 151.764 6.160   5.179   1.00 0.00 ? 77  LEU B CD1  3  
ATOM   8386  C  CD2  . LEU B 1 77 ? 153.512 4.636   4.255   1.00 0.00 ? 77  LEU B CD2  3  
ATOM   8387  H  H    . LEU B 1 77 ? 149.487 2.061   5.507   1.00 0.00 ? 77  LEU B H    3  
ATOM   8388  H  HA   . LEU B 1 77 ? 149.432 4.846   5.017   1.00 0.00 ? 77  LEU B HA   3  
ATOM   8389  H  HB2  . LEU B 1 77 ? 151.413 3.616   5.837   1.00 0.00 ? 77  LEU B HB2  3  
ATOM   8390  H  HB3  . LEU B 1 77 ? 151.573 2.856   4.253   1.00 0.00 ? 77  LEU B HB3  3  
ATOM   8391  H  HG   . LEU B 1 77 ? 151.693 5.197   3.262   1.00 0.00 ? 77  LEU B HG   3  
ATOM   8392  H  HD11 . LEU B 1 77 ? 151.701 5.831   6.206   1.00 0.00 ? 77  LEU B HD11 3  
ATOM   8393  H  HD12 . LEU B 1 77 ? 150.838 6.639   4.897   1.00 0.00 ? 77  LEU B HD12 3  
ATOM   8394  H  HD13 . LEU B 1 77 ? 152.578 6.864   5.077   1.00 0.00 ? 77  LEU B HD13 3  
ATOM   8395  H  HD21 . LEU B 1 77 ? 154.038 5.393   3.692   1.00 0.00 ? 77  LEU B HD21 3  
ATOM   8396  H  HD22 . LEU B 1 77 ? 153.670 3.671   3.796   1.00 0.00 ? 77  LEU B HD22 3  
ATOM   8397  H  HD23 . LEU B 1 77 ? 153.884 4.618   5.268   1.00 0.00 ? 77  LEU B HD23 3  
ATOM   8398  N  N    . VAL B 1 78 ? 149.374 2.887   2.378   1.00 0.00 ? 78  VAL B N    3  
ATOM   8399  C  CA   . VAL B 1 78 ? 149.110 2.884   0.941   1.00 0.00 ? 78  VAL B CA   3  
ATOM   8400  C  C    . VAL B 1 78 ? 147.787 3.561   0.628   1.00 0.00 ? 78  VAL B C    3  
ATOM   8401  O  O    . VAL B 1 78 ? 147.665 4.277   -0.372  1.00 0.00 ? 78  VAL B O    3  
ATOM   8402  C  CB   . VAL B 1 78 ? 149.079 1.451   0.408   1.00 0.00 ? 78  VAL B CB   3  
ATOM   8403  C  CG1  . VAL B 1 78 ? 148.567 1.451   -1.034  1.00 0.00 ? 78  VAL B CG1  3  
ATOM   8404  C  CG2  . VAL B 1 78 ? 150.493 0.877   0.434   1.00 0.00 ? 78  VAL B CG2  3  
ATOM   8405  H  H    . VAL B 1 78 ? 149.492 2.029   2.856   1.00 0.00 ? 78  VAL B H    3  
ATOM   8406  H  HA   . VAL B 1 78 ? 149.903 3.421   0.440   1.00 0.00 ? 78  VAL B HA   3  
ATOM   8407  H  HB   . VAL B 1 78 ? 148.430 0.848   1.025   1.00 0.00 ? 78  VAL B HB   3  
ATOM   8408  H  HG11 . VAL B 1 78 ? 147.491 1.532   -1.034  1.00 0.00 ? 78  VAL B HG11 3  
ATOM   8409  H  HG12 . VAL B 1 78 ? 148.860 0.532   -1.520  1.00 0.00 ? 78  VAL B HG12 3  
ATOM   8410  H  HG13 . VAL B 1 78 ? 148.991 2.290   -1.566  1.00 0.00 ? 78  VAL B HG13 3  
ATOM   8411  H  HG21 . VAL B 1 78 ? 150.443 -0.201  0.445   1.00 0.00 ? 78  VAL B HG21 3  
ATOM   8412  H  HG22 . VAL B 1 78 ? 151.006 1.225   1.316   1.00 0.00 ? 78  VAL B HG22 3  
ATOM   8413  H  HG23 . VAL B 1 78 ? 151.026 1.204   -0.446  1.00 0.00 ? 78  VAL B HG23 3  
ATOM   8414  N  N    . ALA B 1 79 ? 146.795 3.323   1.476   1.00 0.00 ? 79  ALA B N    3  
ATOM   8415  C  CA   . ALA B 1 79 ? 145.481 3.901   1.258   1.00 0.00 ? 79  ALA B CA   3  
ATOM   8416  C  C    . ALA B 1 79 ? 145.569 5.419   1.191   1.00 0.00 ? 79  ALA B C    3  
ATOM   8417  O  O    . ALA B 1 79 ? 144.918 6.053   0.364   1.00 0.00 ? 79  ALA B O    3  
ATOM   8418  C  CB   . ALA B 1 79 ? 144.553 3.494   2.405   1.00 0.00 ? 79  ALA B CB   3  
ATOM   8419  H  H    . ALA B 1 79 ? 146.946 2.740   2.248   1.00 0.00 ? 79  ALA B H    3  
ATOM   8420  H  HA   . ALA B 1 79 ? 145.077 3.524   0.333   1.00 0.00 ? 79  ALA B HA   3  
ATOM   8421  H  HB1  . ALA B 1 79 ? 145.113 3.474   3.329   1.00 0.00 ? 79  ALA B HB1  3  
ATOM   8422  H  HB2  . ALA B 1 79 ? 144.149 2.512   2.211   1.00 0.00 ? 79  ALA B HB2  3  
ATOM   8423  H  HB3  . ALA B 1 79 ? 143.747 4.207   2.490   1.00 0.00 ? 79  ALA B HB3  3  
ATOM   8424  N  N    . ALA B 1 80 ? 146.384 6.006   2.050   1.00 0.00 ? 80  ALA B N    3  
ATOM   8425  C  CA   . ALA B 1 80 ? 146.537 7.450   2.038   1.00 0.00 ? 80  ALA B CA   3  
ATOM   8426  C  C    . ALA B 1 80 ? 147.255 7.924   0.771   1.00 0.00 ? 80  ALA B C    3  
ATOM   8427  O  O    . ALA B 1 80 ? 146.891 8.944   0.188   1.00 0.00 ? 80  ALA B O    3  
ATOM   8428  C  CB   . ALA B 1 80 ? 147.311 7.898   3.276   1.00 0.00 ? 80  ALA B CB   3  
ATOM   8429  H  H    . ALA B 1 80 ? 146.895 5.465   2.687   1.00 0.00 ? 80  ALA B H    3  
ATOM   8430  H  HA   . ALA B 1 80 ? 145.556 7.900   2.065   1.00 0.00 ? 80  ALA B HA   3  
ATOM   8431  H  HB1  . ALA B 1 80 ? 147.544 8.949   3.195   1.00 0.00 ? 80  ALA B HB1  3  
ATOM   8432  H  HB2  . ALA B 1 80 ? 148.225 7.330   3.354   1.00 0.00 ? 80  ALA B HB2  3  
ATOM   8433  H  HB3  . ALA B 1 80 ? 146.704 7.730   4.156   1.00 0.00 ? 80  ALA B HB3  3  
ATOM   8434  N  N    . LEU B 1 81 ? 148.295 7.190   0.365   1.00 0.00 ? 81  LEU B N    3  
ATOM   8435  C  CA   . LEU B 1 81 ? 149.071 7.569   -0.819  1.00 0.00 ? 81  LEU B CA   3  
ATOM   8436  C  C    . LEU B 1 81 ? 148.260 7.510   -2.115  1.00 0.00 ? 81  LEU B C    3  
ATOM   8437  O  O    . LEU B 1 81 ? 148.394 8.392   -2.971  1.00 0.00 ? 81  LEU B O    3  
ATOM   8438  C  CB   . LEU B 1 81 ? 150.297 6.659   -0.956  1.00 0.00 ? 81  LEU B CB   3  
ATOM   8439  C  CG   . LEU B 1 81 ? 151.179 6.767   0.294   1.00 0.00 ? 81  LEU B CG   3  
ATOM   8440  C  CD1  . LEU B 1 81 ? 152.439 5.920   0.099   1.00 0.00 ? 81  LEU B CD1  3  
ATOM   8441  C  CD2  . LEU B 1 81 ? 151.585 8.227   0.523   1.00 0.00 ? 81  LEU B CD2  3  
ATOM   8442  H  H    . LEU B 1 81 ? 148.553 6.395   0.877   1.00 0.00 ? 81  LEU B H    3  
ATOM   8443  H  HA   . LEU B 1 81 ? 149.415 8.582   -0.688  1.00 0.00 ? 81  LEU B HA   3  
ATOM   8444  H  HB2  . LEU B 1 81 ? 149.972 5.637   -1.077  1.00 0.00 ? 81  LEU B HB2  3  
ATOM   8445  H  HB3  . LEU B 1 81 ? 150.869 6.958   -1.821  1.00 0.00 ? 81  LEU B HB3  3  
ATOM   8446  H  HG   . LEU B 1 81 ? 150.633 6.405   1.152   1.00 0.00 ? 81  LEU B HG   3  
ATOM   8447  H  HD11 . LEU B 1 81 ? 152.914 5.755   1.055   1.00 0.00 ? 81  LEU B HD11 3  
ATOM   8448  H  HD12 . LEU B 1 81 ? 153.122 6.436   -0.558  1.00 0.00 ? 81  LEU B HD12 3  
ATOM   8449  H  HD13 . LEU B 1 81 ? 152.169 4.968   -0.336  1.00 0.00 ? 81  LEU B HD13 3  
ATOM   8450  H  HD21 . LEU B 1 81 ? 150.822 8.726   1.101   1.00 0.00 ? 81  LEU B HD21 3  
ATOM   8451  H  HD22 . LEU B 1 81 ? 151.696 8.723   -0.430  1.00 0.00 ? 81  LEU B HD22 3  
ATOM   8452  H  HD23 . LEU B 1 81 ? 152.523 8.264   1.058   1.00 0.00 ? 81  LEU B HD23 3  
ATOM   8453  N  N    . THR B 1 82 ? 147.418 6.489   -2.281  1.00 0.00 ? 82  THR B N    3  
ATOM   8454  C  CA   . THR B 1 82 ? 146.637 6.412   -3.513  1.00 0.00 ? 82  THR B CA   3  
ATOM   8455  C  C    . THR B 1 82 ? 145.690 7.598   -3.597  1.00 0.00 ? 82  THR B C    3  
ATOM   8456  O  O    . THR B 1 82 ? 145.522 8.195   -4.659  1.00 0.00 ? 82  THR B O    3  
ATOM   8457  C  CB   . THR B 1 82 ? 145.866 5.092   -3.624  1.00 0.00 ? 82  THR B CB   3  
ATOM   8458  O  OG1  . THR B 1 82 ? 144.914 5.192   -4.673  1.00 0.00 ? 82  THR B OG1  3  
ATOM   8459  C  CG2  . THR B 1 82 ? 145.148 4.786   -2.319  1.00 0.00 ? 82  THR B CG2  3  
ATOM   8460  H  H    . THR B 1 82 ? 147.327 5.797   -1.584  1.00 0.00 ? 82  THR B H    3  
ATOM   8461  H  HA   . THR B 1 82 ? 147.325 6.475   -4.346  1.00 0.00 ? 82  THR B HA   3  
ATOM   8462  H  HB   . THR B 1 82 ? 146.558 4.292   -3.844  1.00 0.00 ? 82  THR B HB   3  
ATOM   8463  H  HG1  . THR B 1 82 ? 145.369 5.502   -5.458  1.00 0.00 ? 82  THR B HG1  3  
ATOM   8464  H  HG21 . THR B 1 82 ? 145.820 4.260   -1.658  1.00 0.00 ? 82  THR B HG21 3  
ATOM   8465  H  HG22 . THR B 1 82 ? 144.285 4.170   -2.521  1.00 0.00 ? 82  THR B HG22 3  
ATOM   8466  H  HG23 . THR B 1 82 ? 144.834 5.707   -1.859  1.00 0.00 ? 82  THR B HG23 3  
ATOM   8467  N  N    . VAL B 1 83 ? 145.092 7.955   -2.464  1.00 0.00 ? 83  VAL B N    3  
ATOM   8468  C  CA   . VAL B 1 83 ? 144.190 9.096   -2.433  1.00 0.00 ? 83  VAL B CA   3  
ATOM   8469  C  C    . VAL B 1 83 ? 144.964 10.355  -2.800  1.00 0.00 ? 83  VAL B C    3  
ATOM   8470  O  O    . VAL B 1 83 ? 144.485 11.196  -3.560  1.00 0.00 ? 83  VAL B O    3  
ATOM   8471  C  CB   . VAL B 1 83 ? 143.591 9.251   -1.036  1.00 0.00 ? 83  VAL B CB   3  
ATOM   8472  C  CG1  . VAL B 1 83 ? 142.776 10.543  -0.968  1.00 0.00 ? 83  VAL B CG1  3  
ATOM   8473  C  CG2  . VAL B 1 83 ? 142.685 8.057   -0.735  1.00 0.00 ? 83  VAL B CG2  3  
ATOM   8474  H  H    . VAL B 1 83 ? 145.275 7.459   -1.640  1.00 0.00 ? 83  VAL B H    3  
ATOM   8475  H  HA   . VAL B 1 83 ? 143.394 8.943   -3.148  1.00 0.00 ? 83  VAL B HA   3  
ATOM   8476  H  HB   . VAL B 1 83 ? 144.388 9.292   -0.306  1.00 0.00 ? 83  VAL B HB   3  
ATOM   8477  H  HG11 . VAL B 1 83 ? 143.445 11.388  -0.900  1.00 0.00 ? 83  VAL B HG11 3  
ATOM   8478  H  HG12 . VAL B 1 83 ? 142.135 10.519  -0.098  1.00 0.00 ? 83  VAL B HG12 3  
ATOM   8479  H  HG13 . VAL B 1 83 ? 142.171 10.634  -1.859  1.00 0.00 ? 83  VAL B HG13 3  
ATOM   8480  H  HG21 . VAL B 1 83 ? 142.566 7.955   0.334   1.00 0.00 ? 83  VAL B HG21 3  
ATOM   8481  H  HG22 . VAL B 1 83 ? 143.130 7.157   -1.134  1.00 0.00 ? 83  VAL B HG22 3  
ATOM   8482  H  HG23 . VAL B 1 83 ? 141.719 8.214   -1.192  1.00 0.00 ? 83  VAL B HG23 3  
ATOM   8483  N  N    . ALA B 1 84 ? 146.177 10.462  -2.261  1.00 0.00 ? 84  ALA B N    3  
ATOM   8484  C  CA   . ALA B 1 84 ? 147.033 11.606  -2.545  1.00 0.00 ? 84  ALA B CA   3  
ATOM   8485  C  C    . ALA B 1 84 ? 147.410 11.628  -4.017  1.00 0.00 ? 84  ALA B C    3  
ATOM   8486  O  O    . ALA B 1 84 ? 147.611 12.690  -4.600  1.00 0.00 ? 84  ALA B O    3  
ATOM   8487  C  CB   . ALA B 1 84 ? 148.301 11.552  -1.693  1.00 0.00 ? 84  ALA B CB   3  
ATOM   8488  H  H    . ALA B 1 84 ? 146.507 9.750   -1.674  1.00 0.00 ? 84  ALA B H    3  
ATOM   8489  H  HA   . ALA B 1 84 ? 146.494 12.511  -2.309  1.00 0.00 ? 84  ALA B HA   3  
ATOM   8490  H  HB1  . ALA B 1 84 ? 148.031 11.430  -0.655  1.00 0.00 ? 84  ALA B HB1  3  
ATOM   8491  H  HB2  . ALA B 1 84 ? 148.853 12.473  -1.817  1.00 0.00 ? 84  ALA B HB2  3  
ATOM   8492  H  HB3  . ALA B 1 84 ? 148.912 10.720  -2.008  1.00 0.00 ? 84  ALA B HB3  3  
ATOM   8493  N  N    . CYS B 1 85 ? 147.512 10.445  -4.617  1.00 0.00 ? 85  CYS B N    3  
ATOM   8494  C  CA   . CYS B 1 85 ? 147.877 10.359  -6.025  1.00 0.00 ? 85  CYS B CA   3  
ATOM   8495  C  C    . CYS B 1 85 ? 146.935 11.219  -6.864  1.00 0.00 ? 85  CYS B C    3  
ATOM   8496  O  O    . CYS B 1 85 ? 147.346 11.822  -7.855  1.00 0.00 ? 85  CYS B O    3  
ATOM   8497  C  CB   . CYS B 1 85 ? 147.829 8.896   -6.489  1.00 0.00 ? 85  CYS B CB   3  
ATOM   8498  S  SG   . CYS B 1 85 ? 146.200 8.504   -7.184  1.00 0.00 ? 85  CYS B SG   3  
ATOM   8499  H  H    . CYS B 1 85 ? 147.352 9.622   -4.103  1.00 0.00 ? 85  CYS B H    3  
ATOM   8500  H  HA   . CYS B 1 85 ? 148.884 10.729  -6.146  1.00 0.00 ? 85  CYS B HA   3  
ATOM   8501  H  HB2  . CYS B 1 85 ? 148.583 8.736   -7.242  1.00 0.00 ? 85  CYS B HB2  3  
ATOM   8502  H  HB3  . CYS B 1 85 ? 148.023 8.248   -5.647  1.00 0.00 ? 85  CYS B HB3  3  
ATOM   8503  H  HG   . CYS B 1 85 ? 145.981 9.180   -7.828  1.00 0.00 ? 85  CYS B HG   3  
ATOM   8504  N  N    . ASN B 1 86 ? 145.672 11.280  -6.451  1.00 0.00 ? 86  ASN B N    3  
ATOM   8505  C  CA   . ASN B 1 86 ? 144.686 12.082  -7.165  1.00 0.00 ? 86  ASN B CA   3  
ATOM   8506  C  C    . ASN B 1 86 ? 145.152 13.532  -7.268  1.00 0.00 ? 86  ASN B C    3  
ATOM   8507  O  O    . ASN B 1 86 ? 144.934 14.203  -8.284  1.00 0.00 ? 86  ASN B O    3  
ATOM   8508  C  CB   . ASN B 1 86 ? 143.345 12.029  -6.430  1.00 0.00 ? 86  ASN B CB   3  
ATOM   8509  C  CG   . ASN B 1 86 ? 142.242 12.599  -7.315  1.00 0.00 ? 86  ASN B CG   3  
ATOM   8510  O  OD1  . ASN B 1 86 ? 142.508 13.041  -8.432  1.00 0.00 ? 86  ASN B OD1  3  
ATOM   8511  N  ND2  . ASN B 1 86 ? 141.012 12.615  -6.880  1.00 0.00 ? 86  ASN B ND2  3  
ATOM   8512  H  H    . ASN B 1 86 ? 145.403 10.787  -5.649  1.00 0.00 ? 86  ASN B H    3  
ATOM   8513  H  HA   . ASN B 1 86 ? 144.554 11.680  -8.156  1.00 0.00 ? 86  ASN B HA   3  
ATOM   8514  H  HB2  . ASN B 1 86 ? 143.113 11.003  -6.182  1.00 0.00 ? 86  ASN B HB2  3  
ATOM   8515  H  HB3  . ASN B 1 86 ? 143.411 12.610  -5.522  1.00 0.00 ? 86  ASN B HB3  3  
ATOM   8516  H  HD21 . ASN B 1 86 ? 140.802 12.262  -5.990  1.00 0.00 ? 86  ASN B HD21 3  
ATOM   8517  H  HD22 . ASN B 1 86 ? 140.297 12.980  -7.443  1.00 0.00 ? 86  ASN B HD22 3  
ATOM   8518  N  N    . ASN B 1 87 ? 145.793 14.014  -6.205  1.00 0.00 ? 87  ASN B N    3  
ATOM   8519  C  CA   . ASN B 1 87 ? 146.274 15.387  -6.178  1.00 0.00 ? 87  ASN B CA   3  
ATOM   8520  C  C    . ASN B 1 87 ? 147.153 15.668  -7.388  1.00 0.00 ? 87  ASN B C    3  
ATOM   8521  O  O    . ASN B 1 87 ? 147.121 16.767  -7.941  1.00 0.00 ? 87  ASN B O    3  
ATOM   8522  C  CB   . ASN B 1 87 ? 147.071 15.637  -4.895  1.00 0.00 ? 87  ASN B CB   3  
ATOM   8523  C  CG   . ASN B 1 87 ? 146.162 15.494  -3.680  1.00 0.00 ? 87  ASN B CG   3  
ATOM   8524  O  OD1  . ASN B 1 87 ? 144.939 15.540  -3.810  1.00 0.00 ? 87  ASN B OD1  3  
ATOM   8525  N  ND2  . ASN B 1 87 ? 146.689 15.324  -2.498  1.00 0.00 ? 87  ASN B ND2  3  
ATOM   8526  H  H    . ASN B 1 87 ? 145.936 13.436  -5.427  1.00 0.00 ? 87  ASN B H    3  
ATOM   8527  H  HA   . ASN B 1 87 ? 145.426 16.056  -6.197  1.00 0.00 ? 87  ASN B HA   3  
ATOM   8528  H  HB2  . ASN B 1 87 ? 147.877 14.924  -4.828  1.00 0.00 ? 87  ASN B HB2  3  
ATOM   8529  H  HB3  . ASN B 1 87 ? 147.482 16.634  -4.915  1.00 0.00 ? 87  ASN B HB3  3  
ATOM   8530  H  HD21 . ASN B 1 87 ? 147.663 15.289  -2.397  1.00 0.00 ? 87  ASN B HD21 3  
ATOM   8531  H  HD22 . ASN B 1 87 ? 146.111 15.231  -1.712  1.00 0.00 ? 87  ASN B HD22 3  
ATOM   8532  N  N    . PHE B 1 88 ? 147.925 14.672  -7.809  1.00 0.00 ? 88  PHE B N    3  
ATOM   8533  C  CA   . PHE B 1 88 ? 148.782 14.854  -8.970  1.00 0.00 ? 88  PHE B CA   3  
ATOM   8534  C  C    . PHE B 1 88 ? 147.914 15.228  -10.164 1.00 0.00 ? 88  PHE B C    3  
ATOM   8535  O  O    . PHE B 1 88 ? 148.224 16.162  -10.903 1.00 0.00 ? 88  PHE B O    3  
ATOM   8536  C  CB   . PHE B 1 88 ? 149.540 13.569  -9.279  1.00 0.00 ? 88  PHE B CB   3  
ATOM   8537  C  CG   . PHE B 1 88 ? 150.583 13.917  -10.293 1.00 0.00 ? 88  PHE B CG   3  
ATOM   8538  C  CD1  . PHE B 1 88 ? 150.217 14.089  -11.619 1.00 0.00 ? 88  PHE B CD1  3  
ATOM   8539  C  CD2  . PHE B 1 88 ? 151.913 14.101  -9.896  1.00 0.00 ? 88  PHE B CD2  3  
ATOM   8540  C  CE1  . PHE B 1 88 ? 151.172 14.449  -12.557 1.00 0.00 ? 88  PHE B CE1  3  
ATOM   8541  C  CE2  . PHE B 1 88 ? 152.879 14.454  -10.842 1.00 0.00 ? 88  PHE B CE2  3  
ATOM   8542  C  CZ   . PHE B 1 88 ? 152.507 14.631  -12.178 1.00 0.00 ? 88  PHE B CZ   3  
ATOM   8543  H  H    . PHE B 1 88 ? 147.909 13.810  -7.344  1.00 0.00 ? 88  PHE B H    3  
ATOM   8544  H  HA   . PHE B 1 88 ? 149.493 15.647  -8.804  1.00 0.00 ? 88  PHE B HA   3  
ATOM   8545  H  HB2  . PHE B 1 88 ? 150.006 13.191  -8.380  1.00 0.00 ? 88  PHE B HB2  3  
ATOM   8546  H  HB3  . PHE B 1 88 ? 148.866 12.832  -9.687  1.00 0.00 ? 88  PHE B HB3  3  
ATOM   8547  H  HD1  . PHE B 1 88 ? 149.191 13.944  -11.922 1.00 0.00 ? 88  PHE B HD1  3  
ATOM   8548  H  HD2  . PHE B 1 88 ? 152.194 13.962  -8.862  1.00 0.00 ? 88  PHE B HD2  3  
ATOM   8549  H  HE1  . PHE B 1 88 ? 150.876 14.593  -13.568 1.00 0.00 ? 88  PHE B HE1  3  
ATOM   8550  H  HE2  . PHE B 1 88 ? 153.907 14.593  -10.543 1.00 0.00 ? 88  PHE B HE2  3  
ATOM   8551  H  HZ   . PHE B 1 88 ? 153.245 14.911  -12.914 1.00 0.00 ? 88  PHE B HZ   3  
ATOM   8552  N  N    . PHE B 1 89 ? 146.810 14.503  -10.330 1.00 0.00 ? 89  PHE B N    3  
ATOM   8553  C  CA   . PHE B 1 89 ? 145.885 14.780  -11.422 1.00 0.00 ? 89  PHE B CA   3  
ATOM   8554  C  C    . PHE B 1 89 ? 145.279 16.171  -11.284 1.00 0.00 ? 89  PHE B C    3  
ATOM   8555  O  O    . PHE B 1 89 ? 145.199 16.921  -12.257 1.00 0.00 ? 89  PHE B O    3  
ATOM   8556  C  CB   . PHE B 1 89 ? 144.779 13.725  -11.434 1.00 0.00 ? 89  PHE B CB   3  
ATOM   8557  C  CG   . PHE B 1 89 ? 145.353 12.409  -11.903 1.00 0.00 ? 89  PHE B CG   3  
ATOM   8558  C  CD1  . PHE B 1 89 ? 145.905 11.512  -10.981 1.00 0.00 ? 89  PHE B CD1  3  
ATOM   8559  C  CD2  . PHE B 1 89 ? 145.342 12.090  -13.266 1.00 0.00 ? 89  PHE B CD2  3  
ATOM   8560  C  CE1  . PHE B 1 89 ? 146.442 10.296  -11.421 1.00 0.00 ? 89  PHE B CE1  3  
ATOM   8561  C  CE2  . PHE B 1 89 ? 145.879 10.876  -13.706 1.00 0.00 ? 89  PHE B CE2  3  
ATOM   8562  C  CZ   . PHE B 1 89 ? 146.428 9.978   -12.784 1.00 0.00 ? 89  PHE B CZ   3  
ATOM   8563  H  H    . PHE B 1 89 ? 146.606 13.782  -9.699  1.00 0.00 ? 89  PHE B H    3  
ATOM   8564  H  HA   . PHE B 1 89 ? 146.423 14.727  -12.356 1.00 0.00 ? 89  PHE B HA   3  
ATOM   8565  H  HB2  . PHE B 1 89 ? 144.385 13.610  -10.434 1.00 0.00 ? 89  PHE B HB2  3  
ATOM   8566  H  HB3  . PHE B 1 89 ? 143.988 14.035  -12.096 1.00 0.00 ? 89  PHE B HB3  3  
ATOM   8567  H  HD1  . PHE B 1 89 ? 145.921 11.759  -9.933  1.00 0.00 ? 89  PHE B HD1  3  
ATOM   8568  H  HD2  . PHE B 1 89 ? 144.917 12.782  -13.978 1.00 0.00 ? 89  PHE B HD2  3  
ATOM   8569  H  HE1  . PHE B 1 89 ? 146.866 9.605   -10.708 1.00 0.00 ? 89  PHE B HE1  3  
ATOM   8570  H  HE2  . PHE B 1 89 ? 145.871 10.631  -14.758 1.00 0.00 ? 89  PHE B HE2  3  
ATOM   8571  H  HZ   . PHE B 1 89 ? 146.843 9.040   -13.123 1.00 0.00 ? 89  PHE B HZ   3  
ATOM   8572  N  N    . TRP B 1 90 ? 144.871 16.518  -10.067 1.00 0.00 ? 90  TRP B N    3  
ATOM   8573  C  CA   . TRP B 1 90 ? 144.296 17.839  -9.826  1.00 0.00 ? 90  TRP B CA   3  
ATOM   8574  C  C    . TRP B 1 90 ? 145.292 18.938  -10.178 1.00 0.00 ? 90  TRP B C    3  
ATOM   8575  O  O    . TRP B 1 90 ? 144.911 20.008  -10.653 1.00 0.00 ? 90  TRP B O    3  
ATOM   8576  C  CB   . TRP B 1 90 ? 143.844 17.970  -8.370  1.00 0.00 ? 90  TRP B CB   3  
ATOM   8577  C  CG   . TRP B 1 90 ? 142.569 17.207  -8.184  1.00 0.00 ? 90  TRP B CG   3  
ATOM   8578  C  CD1  . TRP B 1 90 ? 142.468 15.967  -7.656  1.00 0.00 ? 90  TRP B CD1  3  
ATOM   8579  C  CD2  . TRP B 1 90 ? 141.211 17.623  -8.511  1.00 0.00 ? 90  TRP B CD2  3  
ATOM   8580  N  NE1  . TRP B 1 90 ? 141.137 15.592  -7.644  1.00 0.00 ? 90  TRP B NE1  3  
ATOM   8581  C  CE2  . TRP B 1 90 ? 140.323 16.580  -8.158  1.00 0.00 ? 90  TRP B CE2  3  
ATOM   8582  C  CE3  . TRP B 1 90 ? 140.670 18.792  -9.077  1.00 0.00 ? 90  TRP B CE3  3  
ATOM   8583  C  CZ2  . TRP B 1 90 ? 138.946 16.693  -8.359  1.00 0.00 ? 90  TRP B CZ2  3  
ATOM   8584  C  CZ3  . TRP B 1 90 ? 139.285 18.909  -9.279  1.00 0.00 ? 90  TRP B CZ3  3  
ATOM   8585  C  CH2  . TRP B 1 90 ? 138.425 17.861  -8.920  1.00 0.00 ? 90  TRP B CH2  3  
ATOM   8586  H  H    . TRP B 1 90 ? 144.969 15.883  -9.320  1.00 0.00 ? 90  TRP B H    3  
ATOM   8587  H  HA   . TRP B 1 90 ? 143.430 17.952  -10.462 1.00 0.00 ? 90  TRP B HA   3  
ATOM   8588  H  HB2  . TRP B 1 90 ? 144.605 17.567  -7.718  1.00 0.00 ? 90  TRP B HB2  3  
ATOM   8589  H  HB3  . TRP B 1 90 ? 143.679 19.010  -8.135  1.00 0.00 ? 90  TRP B HB3  3  
ATOM   8590  H  HD1  . TRP B 1 90 ? 143.291 15.366  -7.309  1.00 0.00 ? 90  TRP B HD1  3  
ATOM   8591  H  HE1  . TRP B 1 90 ? 140.793 14.736  -7.312  1.00 0.00 ? 90  TRP B HE1  3  
ATOM   8592  H  HE3  . TRP B 1 90 ? 141.323 19.605  -9.355  1.00 0.00 ? 90  TRP B HE3  3  
ATOM   8593  H  HZ2  . TRP B 1 90 ? 138.288 15.883  -8.082  1.00 0.00 ? 90  TRP B HZ2  3  
ATOM   8594  H  HZ3  . TRP B 1 90 ? 138.880 19.811  -9.713  1.00 0.00 ? 90  TRP B HZ3  3  
ATOM   8595  H  HH2  . TRP B 1 90 ? 137.361 17.957  -9.079  1.00 0.00 ? 90  TRP B HH2  3  
ATOM   8596  N  N    . GLU B 1 91 ? 146.573 18.665  -9.944  1.00 0.00 ? 91  GLU B N    3  
ATOM   8597  C  CA   . GLU B 1 91 ? 147.618 19.638  -10.242 1.00 0.00 ? 91  GLU B CA   3  
ATOM   8598  C  C    . GLU B 1 91 ? 147.576 20.037  -11.713 1.00 0.00 ? 91  GLU B C    3  
ATOM   8599  O  O    . GLU B 1 91 ? 147.878 21.177  -12.066 1.00 0.00 ? 91  GLU B O    3  
ATOM   8600  C  CB   . GLU B 1 91 ? 148.989 19.048  -9.909  1.00 0.00 ? 91  GLU B CB   3  
ATOM   8601  C  CG   . GLU B 1 91 ? 150.065 20.120  -10.090 1.00 0.00 ? 91  GLU B CG   3  
ATOM   8602  C  CD   . GLU B 1 91 ? 151.446 19.515  -9.859  1.00 0.00 ? 91  GLU B CD   3  
ATOM   8603  O  OE1  . GLU B 1 91 ? 151.515 18.325  -9.600  1.00 0.00 ? 91  GLU B OE1  3  
ATOM   8604  O  OE2  . GLU B 1 91 ? 152.415 20.252  -9.943  1.00 0.00 ? 91  GLU B OE2  3  
ATOM   8605  H  H    . GLU B 1 91 ? 146.817 17.796  -9.565  1.00 0.00 ? 91  GLU B H    3  
ATOM   8606  H  HA   . GLU B 1 91 ? 147.461 20.518  -9.635  1.00 0.00 ? 91  GLU B HA   3  
ATOM   8607  H  HB2  . GLU B 1 91 ? 148.993 18.702  -8.885  1.00 0.00 ? 91  GLU B HB2  3  
ATOM   8608  H  HB3  . GLU B 1 91 ? 149.195 18.219  -10.569 1.00 0.00 ? 91  GLU B HB3  3  
ATOM   8609  H  HG2  . GLU B 1 91 ? 150.010 20.515  -11.094 1.00 0.00 ? 91  GLU B HG2  3  
ATOM   8610  H  HG3  . GLU B 1 91 ? 149.900 20.916  -9.381  1.00 0.00 ? 91  GLU B HG3  3  
ATOM   8611  N  N    . ASN B 1 92 ? 147.203 19.089  -12.567 1.00 0.00 ? 92  ASN B N    3  
ATOM   8612  C  CA   . ASN B 1 92 ? 147.127 19.353  -14.000 1.00 0.00 ? 92  ASN B CA   3  
ATOM   8613  C  C    . ASN B 1 92 ? 146.227 20.551  -14.281 1.00 0.00 ? 92  ASN B C    3  
ATOM   8614  O  O    . ASN B 1 92 ? 146.503 21.350  -15.177 1.00 0.00 ? 92  ASN B O    3  
ATOM   8615  C  CB   . ASN B 1 92 ? 146.583 18.122  -14.729 1.00 0.00 ? 92  ASN B CB   3  
ATOM   8616  C  CG   . ASN B 1 92 ? 146.679 18.325  -16.237 1.00 0.00 ? 92  ASN B CG   3  
ATOM   8617  O  OD1  . ASN B 1 92 ? 145.670 18.573  -16.896 1.00 0.00 ? 92  ASN B OD1  3  
ATOM   8618  N  ND2  . ASN B 1 92 ? 147.840 18.233  -16.826 1.00 0.00 ? 92  ASN B ND2  3  
ATOM   8619  H  H    . ASN B 1 92 ? 146.975 18.199  -12.229 1.00 0.00 ? 92  ASN B H    3  
ATOM   8620  H  HA   . ASN B 1 92 ? 148.119 19.565  -14.370 1.00 0.00 ? 92  ASN B HA   3  
ATOM   8621  H  HB2  . ASN B 1 92 ? 147.160 17.254  -14.446 1.00 0.00 ? 92  ASN B HB2  3  
ATOM   8622  H  HB3  . ASN B 1 92 ? 145.550 17.971  -14.453 1.00 0.00 ? 92  ASN B HB3  3  
ATOM   8623  H  HD21 . ASN B 1 92 ? 148.643 18.035  -16.299 1.00 0.00 ? 92  ASN B HD21 3  
ATOM   8624  H  HD22 . ASN B 1 92 ? 147.909 18.362  -17.795 1.00 0.00 ? 92  ASN B HD22 3  
ATOM   8625  N  N    . SER B 1 93 ? 145.150 20.671  -13.511 1.00 0.00 ? 93  SER B N    3  
ATOM   8626  C  CA   . SER B 1 93 ? 144.217 21.777  -13.688 1.00 0.00 ? 93  SER B CA   3  
ATOM   8627  C  C    . SER B 1 93 ? 143.222 21.828  -12.532 1.00 0.00 ? 93  SER B C    3  
ATOM   8628  O  O    . SER B 1 93 ? 143.463 22.578  -11.601 1.00 0.00 ? 93  SER B O    3  
ATOM   8629  C  CB   . SER B 1 93 ? 143.462 21.616  -15.006 1.00 0.00 ? 93  SER B CB   3  
ATOM   8630  O  OG   . SER B 1 93 ? 144.337 21.908  -16.087 1.00 0.00 ? 93  SER B OG   3  
ATOM   8631  O  OXT  . SER B 1 93 ? 142.233 21.117  -12.596 1.00 0.00 ? 93  SER B OXT  3  
ATOM   8632  H  H    . SER B 1 93 ? 144.982 20.004  -12.812 1.00 0.00 ? 93  SER B H    3  
ATOM   8633  H  HA   . SER B 1 93 ? 144.771 22.703  -13.714 1.00 0.00 ? 93  SER B HA   3  
ATOM   8634  H  HB2  . SER B 1 93 ? 143.108 20.603  -15.101 1.00 0.00 ? 93  SER B HB2  3  
ATOM   8635  H  HB3  . SER B 1 93 ? 142.616 22.292  -15.021 1.00 0.00 ? 93  SER B HB3  3  
ATOM   8636  H  HG   . SER B 1 93 ? 145.010 22.514  -15.769 1.00 0.00 ? 93  SER B HG   3  
HETATM 8637  CA CA   . CA  C 2 .  ? 128.683 10.100  -3.608  1.00 0.00 ? 201 CA  A CA   3  
HETATM 8638  CA CA   . CA  D 2 .  ? 133.441 11.506  7.560   1.00 0.00 ? 202 CA  A CA   3  
HETATM 8639  CA CA   . CA  E 2 .  ? 159.169 -10.240 3.141   1.00 0.00 ? 101 CA  B CA   3  
HETATM 8640  CA CA   . CA  F 2 .  ? 156.633 -1.798  11.606  1.00 0.00 ? 102 CA  B CA   3  
ATOM   8641  N  N    . GLY A 1 1  ? 151.614 -1.280  -16.499 1.00 0.00 ? 1   GLY A N    4  
ATOM   8642  C  CA   . GLY A 1 1  ? 152.805 -1.812  -15.845 1.00 0.00 ? 1   GLY A CA   4  
ATOM   8643  C  C    . GLY A 1 1  ? 152.432 -2.873  -14.815 1.00 0.00 ? 1   GLY A C    4  
ATOM   8644  O  O    . GLY A 1 1  ? 151.704 -3.818  -15.119 1.00 0.00 ? 1   GLY A O    4  
ATOM   8645  H  H1   . GLY A 1 1  ? 151.162 -1.802  -17.194 1.00 0.00 ? 1   GLY A H1   4  
ATOM   8646  H  HA2  . GLY A 1 1  ? 153.452 -2.252  -16.592 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   8647  H  HA3  . GLY A 1 1  ? 153.328 -1.008  -15.350 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   8648  N  N    . SER A 1 2  ? 152.938 -2.711  -13.597 1.00 0.00 ? 2   SER A N    4  
ATOM   8649  C  CA   . SER A 1 2  ? 152.651 -3.662  -12.530 1.00 0.00 ? 2   SER A CA   4  
ATOM   8650  C  C    . SER A 1 2  ? 151.162 -3.677  -12.208 1.00 0.00 ? 2   SER A C    4  
ATOM   8651  O  O    . SER A 1 2  ? 150.448 -2.714  -12.482 1.00 0.00 ? 2   SER A O    4  
ATOM   8652  C  CB   . SER A 1 2  ? 153.437 -3.300  -11.275 1.00 0.00 ? 2   SER A CB   4  
ATOM   8653  O  OG   . SER A 1 2  ? 154.825 -3.283  -11.577 1.00 0.00 ? 2   SER A OG   4  
ATOM   8654  H  H    . SER A 1 2  ? 153.513 -1.939  -13.413 1.00 0.00 ? 2   SER A H    4  
ATOM   8655  H  HA   . SER A 1 2  ? 152.949 -4.649  -12.853 1.00 0.00 ? 2   SER A HA   4  
ATOM   8656  H  HB2  . SER A 1 2  ? 153.136 -2.327  -10.927 1.00 0.00 ? 2   SER A HB2  4  
ATOM   8657  H  HB3  . SER A 1 2  ? 153.232 -4.034  -10.506 1.00 0.00 ? 2   SER A HB3  4  
ATOM   8658  H  HG   . SER A 1 2  ? 154.979 -3.894  -12.302 1.00 0.00 ? 2   SER A HG   4  
ATOM   8659  N  N    . GLU A 1 3  ? 150.700 -4.784  -11.636 1.00 0.00 ? 3   GLU A N    4  
ATOM   8660  C  CA   . GLU A 1 3  ? 149.290 -4.917  -11.296 1.00 0.00 ? 3   GLU A CA   4  
ATOM   8661  C  C    . GLU A 1 3  ? 148.862 -3.859  -10.281 1.00 0.00 ? 3   GLU A C    4  
ATOM   8662  O  O    . GLU A 1 3  ? 147.729 -3.382  -10.321 1.00 0.00 ? 3   GLU A O    4  
ATOM   8663  C  CB   . GLU A 1 3  ? 149.027 -6.306  -10.705 1.00 0.00 ? 3   GLU A CB   4  
ATOM   8664  C  CG   . GLU A 1 3  ? 149.326 -7.379  -11.752 1.00 0.00 ? 3   GLU A CG   4  
ATOM   8665  C  CD   . GLU A 1 3  ? 148.983 -8.758  -11.196 1.00 0.00 ? 3   GLU A CD   4  
ATOM   8666  O  OE1  . GLU A 1 3  ? 148.703 -8.843  -10.012 1.00 0.00 ? 3   GLU A OE1  4  
ATOM   8667  O  OE2  . GLU A 1 3  ? 149.006 -9.706  -11.963 1.00 0.00 ? 3   GLU A OE2  4  
ATOM   8668  H  H    . GLU A 1 3  ? 151.314 -5.524  -11.449 1.00 0.00 ? 3   GLU A H    4  
ATOM   8669  H  HA   . GLU A 1 3  ? 148.700 -4.804  -12.192 1.00 0.00 ? 3   GLU A HA   4  
ATOM   8670  H  HB2  . GLU A 1 3  ? 149.662 -6.456  -9.846  1.00 0.00 ? 3   GLU A HB2  4  
ATOM   8671  H  HB3  . GLU A 1 3  ? 147.992 -6.378  -10.405 1.00 0.00 ? 3   GLU A HB3  4  
ATOM   8672  H  HG2  . GLU A 1 3  ? 148.738 -7.192  -12.639 1.00 0.00 ? 3   GLU A HG2  4  
ATOM   8673  H  HG3  . GLU A 1 3  ? 150.376 -7.349  -12.001 1.00 0.00 ? 3   GLU A HG3  4  
ATOM   8674  N  N    . LEU A 1 4  ? 149.760 -3.503  -9.361  1.00 0.00 ? 4   LEU A N    4  
ATOM   8675  C  CA   . LEU A 1 4  ? 149.429 -2.508  -8.342  1.00 0.00 ? 4   LEU A CA   4  
ATOM   8676  C  C    . LEU A 1 4  ? 149.035 -1.175  -8.969  1.00 0.00 ? 4   LEU A C    4  
ATOM   8677  O  O    . LEU A 1 4  ? 148.100 -0.517  -8.501  1.00 0.00 ? 4   LEU A O    4  
ATOM   8678  C  CB   . LEU A 1 4  ? 150.622 -2.298  -7.406  1.00 0.00 ? 4   LEU A CB   4  
ATOM   8679  C  CG   . LEU A 1 4  ? 150.248 -1.317  -6.284  1.00 0.00 ? 4   LEU A CG   4  
ATOM   8680  C  CD1  . LEU A 1 4  ? 149.233 -1.965  -5.338  1.00 0.00 ? 4   LEU A CD1  4  
ATOM   8681  C  CD2  . LEU A 1 4  ? 151.509 -0.944  -5.498  1.00 0.00 ? 4   LEU A CD2  4  
ATOM   8682  H  H    . LEU A 1 4  ? 150.647 -3.919  -9.364  1.00 0.00 ? 4   LEU A H    4  
ATOM   8683  H  HA   . LEU A 1 4  ? 148.597 -2.873  -7.761  1.00 0.00 ? 4   LEU A HA   4  
ATOM   8684  H  HB2  . LEU A 1 4  ? 150.908 -3.243  -6.977  1.00 0.00 ? 4   LEU A HB2  4  
ATOM   8685  H  HB3  . LEU A 1 4  ? 151.447 -1.897  -7.969  1.00 0.00 ? 4   LEU A HB3  4  
ATOM   8686  H  HG   . LEU A 1 4  ? 149.818 -0.423  -6.711  1.00 0.00 ? 4   LEU A HG   4  
ATOM   8687  H  HD11 . LEU A 1 4  ? 149.348 -1.552  -4.345  1.00 0.00 ? 4   LEU A HD11 4  
ATOM   8688  H  HD12 . LEU A 1 4  ? 149.394 -3.031  -5.304  1.00 0.00 ? 4   LEU A HD12 4  
ATOM   8689  H  HD13 . LEU A 1 4  ? 148.237 -1.762  -5.696  1.00 0.00 ? 4   LEU A HD13 4  
ATOM   8690  H  HD21 . LEU A 1 4  ? 151.820 -1.786  -4.898  1.00 0.00 ? 4   LEU A HD21 4  
ATOM   8691  H  HD22 . LEU A 1 4  ? 151.296 -0.102  -4.856  1.00 0.00 ? 4   LEU A HD22 4  
ATOM   8692  H  HD23 . LEU A 1 4  ? 152.296 -0.682  -6.187  1.00 0.00 ? 4   LEU A HD23 4  
ATOM   8693  N  N    . GLU A 1 5  ? 149.735 -0.771  -10.029 1.00 0.00 ? 5   GLU A N    4  
ATOM   8694  C  CA   . GLU A 1 5  ? 149.397 0.490   -10.667 1.00 0.00 ? 5   GLU A CA   4  
ATOM   8695  C  C    . GLU A 1 5  ? 147.961 0.422   -11.145 1.00 0.00 ? 5   GLU A C    4  
ATOM   8696  O  O    . GLU A 1 5  ? 147.189 1.368   -10.989 1.00 0.00 ? 5   GLU A O    4  
ATOM   8697  C  CB   . GLU A 1 5  ? 150.330 0.750   -11.853 1.00 0.00 ? 5   GLU A CB   4  
ATOM   8698  C  CG   . GLU A 1 5  ? 150.052 2.142   -12.424 1.00 0.00 ? 5   GLU A CG   4  
ATOM   8699  C  CD   . GLU A 1 5  ? 150.904 2.374   -13.668 1.00 0.00 ? 5   GLU A CD   4  
ATOM   8700  O  OE1  . GLU A 1 5  ? 151.631 1.469   -14.040 1.00 0.00 ? 5   GLU A OE1  4  
ATOM   8701  O  OE2  . GLU A 1 5  ? 150.816 3.453   -14.228 1.00 0.00 ? 5   GLU A OE2  4  
ATOM   8702  H  H    . GLU A 1 5  ? 150.467 -1.322  -10.376 1.00 0.00 ? 5   GLU A H    4  
ATOM   8703  H  HA   . GLU A 1 5  ? 149.499 1.289   -9.952  1.00 0.00 ? 5   GLU A HA   4  
ATOM   8704  H  HB2  . GLU A 1 5  ? 151.357 0.693   -11.522 1.00 0.00 ? 5   GLU A HB2  4  
ATOM   8705  H  HB3  . GLU A 1 5  ? 150.154 0.008   -12.617 1.00 0.00 ? 5   GLU A HB3  4  
ATOM   8706  H  HG2  . GLU A 1 5  ? 149.007 2.220   -12.685 1.00 0.00 ? 5   GLU A HG2  4  
ATOM   8707  H  HG3  . GLU A 1 5  ? 150.294 2.888   -11.681 1.00 0.00 ? 5   GLU A HG3  4  
ATOM   8708  N  N    . THR A 1 6  ? 147.604 -0.734  -11.686 1.00 0.00 ? 6   THR A N    4  
ATOM   8709  C  CA   . THR A 1 6  ? 146.250 -0.969  -12.141 1.00 0.00 ? 6   THR A CA   4  
ATOM   8710  C  C    . THR A 1 6  ? 145.296 -0.967  -10.954 1.00 0.00 ? 6   THR A C    4  
ATOM   8711  O  O    . THR A 1 6  ? 144.158 -0.518  -11.056 1.00 0.00 ? 6   THR A O    4  
ATOM   8712  C  CB   . THR A 1 6  ? 146.165 -2.314  -12.867 1.00 0.00 ? 6   THR A CB   4  
ATOM   8713  O  OG1  . THR A 1 6  ? 147.122 -2.343  -13.917 1.00 0.00 ? 6   THR A OG1  4  
ATOM   8714  C  CG2  . THR A 1 6  ? 144.762 -2.495  -13.448 1.00 0.00 ? 6   THR A CG2  4  
ATOM   8715  H  H    . THR A 1 6  ? 148.263 -1.457  -11.747 1.00 0.00 ? 6   THR A H    4  
ATOM   8716  H  HA   . THR A 1 6  ? 145.964 -0.183  -12.824 1.00 0.00 ? 6   THR A HA   4  
ATOM   8717  H  HB   . THR A 1 6  ? 146.368 -3.113  -12.171 1.00 0.00 ? 6   THR A HB   4  
ATOM   8718  H  HG1  . THR A 1 6  ? 147.224 -1.449  -14.251 1.00 0.00 ? 6   THR A HG1  4  
ATOM   8719  H  HG21 . THR A 1 6  ? 144.752 -3.352  -14.104 1.00 0.00 ? 6   THR A HG21 4  
ATOM   8720  H  HG22 . THR A 1 6  ? 144.487 -1.612  -14.006 1.00 0.00 ? 6   THR A HG22 4  
ATOM   8721  H  HG23 . THR A 1 6  ? 144.057 -2.648  -12.645 1.00 0.00 ? 6   THR A HG23 4  
ATOM   8722  N  N    . ALA A 1 7  ? 145.770 -1.523  -9.838  1.00 0.00 ? 7   ALA A N    4  
ATOM   8723  C  CA   . ALA A 1 7  ? 144.953 -1.637  -8.635  1.00 0.00 ? 7   ALA A CA   4  
ATOM   8724  C  C    . ALA A 1 7  ? 144.555 -0.277  -8.053  1.00 0.00 ? 7   ALA A C    4  
ATOM   8725  O  O    . ALA A 1 7  ? 143.383 -0.065  -7.727  1.00 0.00 ? 7   ALA A O    4  
ATOM   8726  C  CB   . ALA A 1 7  ? 145.724 -2.443  -7.580  1.00 0.00 ? 7   ALA A CB   4  
ATOM   8727  H  H    . ALA A 1 7  ? 146.678 -1.894  -9.836  1.00 0.00 ? 7   ALA A H    4  
ATOM   8728  H  HA   . ALA A 1 7  ? 144.054 -2.180  -8.883  1.00 0.00 ? 7   ALA A HA   4  
ATOM   8729  H  HB1  . ALA A 1 7  ? 146.595 -1.886  -7.265  1.00 0.00 ? 7   ALA A HB1  4  
ATOM   8730  H  HB2  . ALA A 1 7  ? 146.039 -3.389  -8.003  1.00 0.00 ? 7   ALA A HB2  4  
ATOM   8731  H  HB3  . ALA A 1 7  ? 145.088 -2.627  -6.728  1.00 0.00 ? 7   ALA A HB3  4  
ATOM   8732  N  N    . MET A 1 8  ? 145.503 0.658   -7.926  1.00 0.00 ? 8   MET A N    4  
ATOM   8733  C  CA   . MET A 1 8  ? 145.141 1.958   -7.366  1.00 0.00 ? 8   MET A CA   4  
ATOM   8734  C  C    . MET A 1 8  ? 144.054 2.580   -8.218  1.00 0.00 ? 8   MET A C    4  
ATOM   8735  O  O    . MET A 1 8  ? 143.091 3.152   -7.707  1.00 0.00 ? 8   MET A O    4  
ATOM   8736  C  CB   . MET A 1 8  ? 146.334 2.921   -7.366  1.00 0.00 ? 8   MET A CB   4  
ATOM   8737  C  CG   . MET A 1 8  ? 147.445 2.417   -6.449  1.00 0.00 ? 8   MET A CG   4  
ATOM   8738  S  SD   . MET A 1 8  ? 148.703 3.713   -6.286  1.00 0.00 ? 8   MET A SD   4  
ATOM   8739  C  CE   . MET A 1 8  ? 149.061 3.938   -8.049  1.00 0.00 ? 8   MET A CE   4  
ATOM   8740  H  H    . MET A 1 8  ? 146.427 0.468   -8.191  1.00 0.00 ? 8   MET A H    4  
ATOM   8741  H  HA   . MET A 1 8  ? 144.782 1.831   -6.356  1.00 0.00 ? 8   MET A HA   4  
ATOM   8742  H  HB2  . MET A 1 8  ? 146.715 3.008   -8.371  1.00 0.00 ? 8   MET A HB2  4  
ATOM   8743  H  HB3  . MET A 1 8  ? 146.006 3.892   -7.025  1.00 0.00 ? 8   MET A HB3  4  
ATOM   8744  H  HG2  . MET A 1 8  ? 147.035 2.183   -5.477  1.00 0.00 ? 8   MET A HG2  4  
ATOM   8745  H  HG3  . MET A 1 8  ? 147.892 1.531   -6.876  1.00 0.00 ? 8   MET A HG3  4  
ATOM   8746  H  HE1  . MET A 1 8  ? 148.334 4.615   -8.480  1.00 0.00 ? 8   MET A HE1  4  
ATOM   8747  H  HE2  . MET A 1 8  ? 149.003 2.990   -8.554  1.00 0.00 ? 8   MET A HE2  4  
ATOM   8748  H  HE3  . MET A 1 8  ? 150.057 4.351   -8.165  1.00 0.00 ? 8   MET A HE3  4  
ATOM   8749  N  N    . GLU A 1 9  ? 144.209 2.434   -9.526  1.00 0.00 ? 9   GLU A N    4  
ATOM   8750  C  CA   . GLU A 1 9  ? 143.229 2.951   -10.456 1.00 0.00 ? 9   GLU A CA   4  
ATOM   8751  C  C    . GLU A 1 9  ? 141.920 2.188   -10.343 1.00 0.00 ? 9   GLU A C    4  
ATOM   8752  O  O    . GLU A 1 9  ? 140.849 2.761   -10.494 1.00 0.00 ? 9   GLU A O    4  
ATOM   8753  C  CB   . GLU A 1 9  ? 143.776 2.874   -11.879 1.00 0.00 ? 9   GLU A CB   4  
ATOM   8754  C  CG   . GLU A 1 9  ? 144.940 3.851   -12.021 1.00 0.00 ? 9   GLU A CG   4  
ATOM   8755  C  CD   . GLU A 1 9  ? 145.468 3.832   -13.452 1.00 0.00 ? 9   GLU A CD   4  
ATOM   8756  O  OE1  . GLU A 1 9  ? 145.042 2.975   -14.208 1.00 0.00 ? 9   GLU A OE1  4  
ATOM   8757  O  OE2  . GLU A 1 9  ? 146.291 4.675   -13.769 1.00 0.00 ? 9   GLU A OE2  4  
ATOM   8758  H  H    . GLU A 1 9  ? 144.988 1.948   -9.867  1.00 0.00 ? 9   GLU A H    4  
ATOM   8759  H  HA   . GLU A 1 9  ? 143.042 3.988   -10.218 1.00 0.00 ? 9   GLU A HA   4  
ATOM   8760  H  HB2  . GLU A 1 9  ? 144.127 1.870   -12.073 1.00 0.00 ? 9   GLU A HB2  4  
ATOM   8761  H  HB3  . GLU A 1 9  ? 143.001 3.132   -12.583 1.00 0.00 ? 9   GLU A HB3  4  
ATOM   8762  H  HG2  . GLU A 1 9  ? 144.595 4.847   -11.779 1.00 0.00 ? 9   GLU A HG2  4  
ATOM   8763  H  HG3  . GLU A 1 9  ? 145.731 3.569   -11.343 1.00 0.00 ? 9   GLU A HG3  4  
ATOM   8764  N  N    . THR A 1 10 ? 142.015 0.886   -10.088 1.00 0.00 ? 10  THR A N    4  
ATOM   8765  C  CA   . THR A 1 10 ? 140.819 0.065   -9.968  1.00 0.00 ? 10  THR A CA   4  
ATOM   8766  C  C    . THR A 1 10 ? 139.949 0.531   -8.810  1.00 0.00 ? 10  THR A C    4  
ATOM   8767  O  O    . THR A 1 10 ? 138.728 0.624   -8.937  1.00 0.00 ? 10  THR A O    4  
ATOM   8768  C  CB   . THR A 1 10 ? 141.214 -1.397  -9.750  1.00 0.00 ? 10  THR A CB   4  
ATOM   8769  O  OG1  . THR A 1 10 ? 142.085 -1.811  -10.794 1.00 0.00 ? 10  THR A OG1  4  
ATOM   8770  C  CG2  . THR A 1 10 ? 139.960 -2.273  -9.751  1.00 0.00 ? 10  THR A CG2  4  
ATOM   8771  H  H    . THR A 1 10 ? 142.898 0.475   -9.985  1.00 0.00 ? 10  THR A H    4  
ATOM   8772  H  HA   . THR A 1 10 ? 140.251 0.135   -10.881 1.00 0.00 ? 10  THR A HA   4  
ATOM   8773  H  HB   . THR A 1 10 ? 141.717 -1.497  -8.800  1.00 0.00 ? 10  THR A HB   4  
ATOM   8774  H  HG1  . THR A 1 10 ? 141.567 -2.310  -11.431 1.00 0.00 ? 10  THR A HG1  4  
ATOM   8775  H  HG21 . THR A 1 10 ? 140.246 -3.310  -9.658  1.00 0.00 ? 10  THR A HG21 4  
ATOM   8776  H  HG22 . THR A 1 10 ? 139.423 -2.130  -10.676 1.00 0.00 ? 10  THR A HG22 4  
ATOM   8777  H  HG23 . THR A 1 10 ? 139.328 -1.997  -8.920  1.00 0.00 ? 10  THR A HG23 4  
ATOM   8778  N  N    . LEU A 1 11 ? 140.579 0.823   -7.674  1.00 0.00 ? 11  LEU A N    4  
ATOM   8779  C  CA   . LEU A 1 11 ? 139.821 1.271   -6.506  1.00 0.00 ? 11  LEU A CA   4  
ATOM   8780  C  C    . LEU A 1 11 ? 139.083 2.579   -6.799  1.00 0.00 ? 11  LEU A C    4  
ATOM   8781  O  O    . LEU A 1 11 ? 137.884 2.731   -6.511  1.00 0.00 ? 11  LEU A O    4  
ATOM   8782  C  CB   . LEU A 1 11 ? 140.807 1.499   -5.359  1.00 0.00 ? 11  LEU A CB   4  
ATOM   8783  C  CG   . LEU A 1 11 ? 141.563 0.200   -5.072  1.00 0.00 ? 11  LEU A CG   4  
ATOM   8784  C  CD1  . LEU A 1 11 ? 142.645 0.448   -4.016  1.00 0.00 ? 11  LEU A CD1  4  
ATOM   8785  C  CD2  . LEU A 1 11 ? 140.580 -0.856  -4.559  1.00 0.00 ? 11  LEU A CD2  4  
ATOM   8786  H  H    . LEU A 1 11 ? 141.563 0.726   -7.618  1.00 0.00 ? 11  LEU A H    4  
ATOM   8787  H  HA   . LEU A 1 11 ? 139.112 0.511   -6.220  1.00 0.00 ? 11  LEU A HA   4  
ATOM   8788  H  HB2  . LEU A 1 11 ? 141.509 2.272   -5.636  1.00 0.00 ? 11  LEU A HB2  4  
ATOM   8789  H  HB3  . LEU A 1 11 ? 140.267 1.803   -4.475  1.00 0.00 ? 11  LEU A HB3  4  
ATOM   8790  H  HG   . LEU A 1 11 ? 142.022 -0.153  -5.978  1.00 0.00 ? 11  LEU A HG   4  
ATOM   8791  H  HD11 . LEU A 1 11 ? 142.815 -0.457  -3.450  1.00 0.00 ? 11  LEU A HD11 4  
ATOM   8792  H  HD12 . LEU A 1 11 ? 142.329 1.236   -3.349  1.00 0.00 ? 11  LEU A HD12 4  
ATOM   8793  H  HD13 . LEU A 1 11 ? 143.565 0.738   -4.511  1.00 0.00 ? 11  LEU A HD13 4  
ATOM   8794  H  HD21 . LEU A 1 11 ? 141.110 -1.577  -3.952  1.00 0.00 ? 11  LEU A HD21 4  
ATOM   8795  H  HD22 . LEU A 1 11 ? 140.126 -1.361  -5.400  1.00 0.00 ? 11  LEU A HD22 4  
ATOM   8796  H  HD23 . LEU A 1 11 ? 139.813 -0.380  -3.967  1.00 0.00 ? 11  LEU A HD23 4  
ATOM   8797  N  N    . ILE A 1 12 ? 139.805 3.516   -7.397  1.00 0.00 ? 12  ILE A N    4  
ATOM   8798  C  CA   . ILE A 1 12 ? 139.225 4.801   -7.742  1.00 0.00 ? 12  ILE A CA   4  
ATOM   8799  C  C    . ILE A 1 12 ? 138.145 4.638   -8.800  1.00 0.00 ? 12  ILE A C    4  
ATOM   8800  O  O    . ILE A 1 12 ? 137.075 5.245   -8.713  1.00 0.00 ? 12  ILE A O    4  
ATOM   8801  C  CB   . ILE A 1 12 ? 140.329 5.740   -8.223  1.00 0.00 ? 12  ILE A CB   4  
ATOM   8802  C  CG1  . ILE A 1 12 ? 141.361 5.887   -7.097  1.00 0.00 ? 12  ILE A CG1  4  
ATOM   8803  C  CG2  . ILE A 1 12 ? 139.734 7.106   -8.555  1.00 0.00 ? 12  ILE A CG2  4  
ATOM   8804  C  CD1  . ILE A 1 12 ? 142.543 6.738   -7.564  1.00 0.00 ? 12  ILE A CD1  4  
ATOM   8805  H  H    . ILE A 1 12 ? 140.743 3.335   -7.618  1.00 0.00 ? 12  ILE A H    4  
ATOM   8806  H  HA   . ILE A 1 12 ? 138.777 5.224   -6.857  1.00 0.00 ? 12  ILE A HA   4  
ATOM   8807  H  HB   . ILE A 1 12 ? 140.804 5.326   -9.099  1.00 0.00 ? 12  ILE A HB   4  
ATOM   8808  H  HG12 . ILE A 1 12 ? 140.894 6.361   -6.246  1.00 0.00 ? 12  ILE A HG12 4  
ATOM   8809  H  HG13 . ILE A 1 12 ? 141.717 4.909   -6.810  1.00 0.00 ? 12  ILE A HG13 4  
ATOM   8810  H  HG21 . ILE A 1 12 ? 139.131 7.447   -7.728  1.00 0.00 ? 12  ILE A HG21 4  
ATOM   8811  H  HG22 . ILE A 1 12 ? 139.120 7.024   -9.440  1.00 0.00 ? 12  ILE A HG22 4  
ATOM   8812  H  HG23 . ILE A 1 12 ? 140.531 7.812   -8.735  1.00 0.00 ? 12  ILE A HG23 4  
ATOM   8813  H  HD11 . ILE A 1 12 ? 142.617 6.705   -8.642  1.00 0.00 ? 12  ILE A HD11 4  
ATOM   8814  H  HD12 . ILE A 1 12 ? 143.456 6.354   -7.128  1.00 0.00 ? 12  ILE A HD12 4  
ATOM   8815  H  HD13 . ILE A 1 12 ? 142.396 7.758   -7.243  1.00 0.00 ? 12  ILE A HD13 4  
ATOM   8816  N  N    . ASN A 1 13 ? 138.428 3.800   -9.792  1.00 0.00 ? 13  ASN A N    4  
ATOM   8817  C  CA   . ASN A 1 13 ? 137.468 3.552   -10.849 1.00 0.00 ? 13  ASN A CA   4  
ATOM   8818  C  C    . ASN A 1 13 ? 136.190 3.003   -10.241 1.00 0.00 ? 13  ASN A C    4  
ATOM   8819  O  O    . ASN A 1 13 ? 135.084 3.352   -10.657 1.00 0.00 ? 13  ASN A O    4  
ATOM   8820  C  CB   . ASN A 1 13 ? 138.031 2.539   -11.850 1.00 0.00 ? 13  ASN A CB   4  
ATOM   8821  C  CG   . ASN A 1 13 ? 139.278 3.094   -12.539 1.00 0.00 ? 13  ASN A CG   4  
ATOM   8822  O  OD1  . ASN A 1 13 ? 139.818 2.456   -13.442 1.00 0.00 ? 13  ASN A OD1  4  
ATOM   8823  N  ND2  . ASN A 1 13 ? 139.791 4.230   -12.149 1.00 0.00 ? 13  ASN A ND2  4  
ATOM   8824  H  H    . ASN A 1 13 ? 139.291 3.335   -9.802  1.00 0.00 ? 13  ASN A H    4  
ATOM   8825  H  HA   . ASN A 1 13 ? 137.252 4.478   -11.362 1.00 0.00 ? 13  ASN A HA   4  
ATOM   8826  H  HB2  . ASN A 1 13 ? 138.289 1.629   -11.329 1.00 0.00 ? 13  ASN A HB2  4  
ATOM   8827  H  HB3  . ASN A 1 13 ? 137.280 2.321   -12.595 1.00 0.00 ? 13  ASN A HB3  4  
ATOM   8828  H  HD21 . ASN A 1 13 ? 139.381 4.729   -11.413 1.00 0.00 ? 13  ASN A HD21 4  
ATOM   8829  H  HD22 . ASN A 1 13 ? 140.588 4.585   -12.594 1.00 0.00 ? 13  ASN A HD22 4  
ATOM   8830  N  N    . VAL A 1 14 ? 136.356 2.151   -9.229  1.00 0.00 ? 14  VAL A N    4  
ATOM   8831  C  CA   . VAL A 1 14 ? 135.213 1.571   -8.545  1.00 0.00 ? 14  VAL A CA   4  
ATOM   8832  C  C    . VAL A 1 14 ? 134.439 2.675   -7.843  1.00 0.00 ? 14  VAL A C    4  
ATOM   8833  O  O    . VAL A 1 14 ? 133.208 2.710   -7.876  1.00 0.00 ? 14  VAL A O    4  
ATOM   8834  C  CB   . VAL A 1 14 ? 135.691 0.555   -7.507  1.00 0.00 ? 14  VAL A CB   4  
ATOM   8835  C  CG1  . VAL A 1 14 ? 134.495 -0.003  -6.740  1.00 0.00 ? 14  VAL A CG1  4  
ATOM   8836  C  CG2  . VAL A 1 14 ? 136.458 -0.592  -8.197  1.00 0.00 ? 14  VAL A CG2  4  
ATOM   8837  H  H    . VAL A 1 14 ? 137.264 1.922   -8.934  1.00 0.00 ? 14  VAL A H    4  
ATOM   8838  H  HA   . VAL A 1 14 ? 134.574 1.076   -9.262  1.00 0.00 ? 14  VAL A HA   4  
ATOM   8839  H  HB   . VAL A 1 14 ? 136.339 1.056   -6.808  1.00 0.00 ? 14  VAL A HB   4  
ATOM   8840  H  HG11 . VAL A 1 14 ? 134.838 -0.764  -6.054  1.00 0.00 ? 14  VAL A HG11 4  
ATOM   8841  H  HG12 . VAL A 1 14 ? 133.792 -0.435  -7.436  1.00 0.00 ? 14  VAL A HG12 4  
ATOM   8842  H  HG13 . VAL A 1 14 ? 134.017 0.790   -6.187  1.00 0.00 ? 14  VAL A HG13 4  
ATOM   8843  H  HG21 . VAL A 1 14 ? 137.388 -0.768  -7.674  1.00 0.00 ? 14  VAL A HG21 4  
ATOM   8844  H  HG22 . VAL A 1 14 ? 136.670 -0.329  -9.223  1.00 0.00 ? 14  VAL A HG22 4  
ATOM   8845  H  HG23 . VAL A 1 14 ? 135.863 -1.494  -8.178  1.00 0.00 ? 14  VAL A HG23 4  
ATOM   8846  N  N    . PHE A 1 15 ? 135.182 3.580   -7.201  1.00 0.00 ? 15  PHE A N    4  
ATOM   8847  C  CA   . PHE A 1 15 ? 134.558 4.689   -6.484  1.00 0.00 ? 15  PHE A CA   4  
ATOM   8848  C  C    . PHE A 1 15 ? 133.701 5.572   -7.388  1.00 0.00 ? 15  PHE A C    4  
ATOM   8849  O  O    . PHE A 1 15 ? 132.543 5.849   -7.071  1.00 0.00 ? 15  PHE A O    4  
ATOM   8850  C  CB   . PHE A 1 15 ? 135.648 5.540   -5.840  1.00 0.00 ? 15  PHE A CB   4  
ATOM   8851  C  CG   . PHE A 1 15 ? 135.008 6.672   -5.085  1.00 0.00 ? 15  PHE A CG   4  
ATOM   8852  C  CD1  . PHE A 1 15 ? 134.415 6.442   -3.845  1.00 0.00 ? 15  PHE A CD1  4  
ATOM   8853  C  CD2  . PHE A 1 15 ? 135.020 7.960   -5.631  1.00 0.00 ? 15  PHE A CD2  4  
ATOM   8854  C  CE1  . PHE A 1 15 ? 133.828 7.501   -3.148  1.00 0.00 ? 15  PHE A CE1  4  
ATOM   8855  C  CE2  . PHE A 1 15 ? 134.434 9.020   -4.934  1.00 0.00 ? 15  PHE A CE2  4  
ATOM   8856  C  CZ   . PHE A 1 15 ? 133.837 8.790   -3.691  1.00 0.00 ? 15  PHE A CZ   4  
ATOM   8857  H  H    . PHE A 1 15 ? 136.170 3.490   -7.201  1.00 0.00 ? 15  PHE A H    4  
ATOM   8858  H  HA   . PHE A 1 15 ? 133.932 4.291   -5.698  1.00 0.00 ? 15  PHE A HA   4  
ATOM   8859  H  HB2  . PHE A 1 15 ? 136.225 4.932   -5.158  1.00 0.00 ? 15  PHE A HB2  4  
ATOM   8860  H  HB3  . PHE A 1 15 ? 136.296 5.939   -6.605  1.00 0.00 ? 15  PHE A HB3  4  
ATOM   8861  H  HD1  . PHE A 1 15 ? 134.408 5.447   -3.425  1.00 0.00 ? 15  PHE A HD1  4  
ATOM   8862  H  HD2  . PHE A 1 15 ? 135.482 8.136   -6.591  1.00 0.00 ? 15  PHE A HD2  4  
ATOM   8863  H  HE1  . PHE A 1 15 ? 133.370 7.321   -2.194  1.00 0.00 ? 15  PHE A HE1  4  
ATOM   8864  H  HE2  . PHE A 1 15 ? 134.445 10.013  -5.354  1.00 0.00 ? 15  PHE A HE2  4  
ATOM   8865  H  HZ   . PHE A 1 15 ? 133.382 9.607   -3.150  1.00 0.00 ? 15  PHE A HZ   4  
ATOM   8866  N  N    . HIS A 1 16 ? 134.256 6.002   -8.515  1.00 0.00 ? 16  HIS A N    4  
ATOM   8867  C  CA   . HIS A 1 16 ? 133.497 6.840   -9.440  1.00 0.00 ? 16  HIS A CA   4  
ATOM   8868  C  C    . HIS A 1 16 ? 132.244 6.133   -9.943  1.00 0.00 ? 16  HIS A C    4  
ATOM   8869  O  O    . HIS A 1 16 ? 131.201 6.758   -10.137 1.00 0.00 ? 16  HIS A O    4  
ATOM   8870  C  CB   . HIS A 1 16 ? 134.364 7.265   -10.626 1.00 0.00 ? 16  HIS A CB   4  
ATOM   8871  C  CG   . HIS A 1 16 ? 135.376 8.282   -10.172 1.00 0.00 ? 16  HIS A CG   4  
ATOM   8872  N  ND1  . HIS A 1 16 ? 136.646 7.935   -9.740  1.00 0.00 ? 16  HIS A ND1  4  
ATOM   8873  C  CD2  . HIS A 1 16 ? 135.311 9.650   -10.083 1.00 0.00 ? 16  HIS A CD2  4  
ATOM   8874  C  CE1  . HIS A 1 16 ? 137.287 9.077   -9.414  1.00 0.00 ? 16  HIS A CE1  4  
ATOM   8875  N  NE2  . HIS A 1 16 ? 136.516 10.149  -9.605  1.00 0.00 ? 16  HIS A NE2  4  
ATOM   8876  H  H    . HIS A 1 16 ? 135.180 5.748   -8.731  1.00 0.00 ? 16  HIS A H    4  
ATOM   8877  H  HA   . HIS A 1 16 ? 133.191 7.731   -8.911  1.00 0.00 ? 16  HIS A HA   4  
ATOM   8878  H  HB2  . HIS A 1 16 ? 134.876 6.402   -11.025 1.00 0.00 ? 16  HIS A HB2  4  
ATOM   8879  H  HB3  . HIS A 1 16 ? 133.739 7.699   -11.392 1.00 0.00 ? 16  HIS A HB3  4  
ATOM   8880  H  HD1  . HIS A 1 16 ? 137.013 7.028   -9.682  1.00 0.00 ? 16  HIS A HD1  4  
ATOM   8881  H  HD2  . HIS A 1 16 ? 134.451 10.249  -10.344 1.00 0.00 ? 16  HIS A HD2  4  
ATOM   8882  H  HE1  . HIS A 1 16 ? 138.300 9.121   -9.046  1.00 0.00 ? 16  HIS A HE1  4  
ATOM   8883  H  HE2  . HIS A 1 16 ? 136.750 11.086  -9.443  1.00 0.00 ? 16  HIS A HE2  4  
ATOM   8884  N  N    . ALA A 1 17 ? 132.371 4.839   -10.192 1.00 0.00 ? 17  ALA A N    4  
ATOM   8885  C  CA   . ALA A 1 17 ? 131.261 4.057   -10.721 1.00 0.00 ? 17  ALA A CA   4  
ATOM   8886  C  C    . ALA A 1 17 ? 130.057 3.997   -9.777  1.00 0.00 ? 17  ALA A C    4  
ATOM   8887  O  O    . ALA A 1 17 ? 128.914 4.035   -10.231 1.00 0.00 ? 17  ALA A O    4  
ATOM   8888  C  CB   . ALA A 1 17 ? 131.749 2.632   -11.001 1.00 0.00 ? 17  ALA A CB   4  
ATOM   8889  H  H    . ALA A 1 17 ? 133.236 4.405   -10.046 1.00 0.00 ? 17  ALA A H    4  
ATOM   8890  H  HA   . ALA A 1 17 ? 130.945 4.495   -11.654 1.00 0.00 ? 17  ALA A HA   4  
ATOM   8891  H  HB1  . ALA A 1 17 ? 132.445 2.331   -10.227 1.00 0.00 ? 17  ALA A HB1  4  
ATOM   8892  H  HB2  . ALA A 1 17 ? 132.246 2.605   -11.960 1.00 0.00 ? 17  ALA A HB2  4  
ATOM   8893  H  HB3  . ALA A 1 17 ? 130.908 1.955   -11.012 1.00 0.00 ? 17  ALA A HB3  4  
ATOM   8894  N  N    . HIS A 1 18 ? 130.300 3.864   -8.474  1.00 0.00 ? 18  HIS A N    4  
ATOM   8895  C  CA   . HIS A 1 18 ? 129.191 3.757   -7.520  1.00 0.00 ? 18  HIS A CA   4  
ATOM   8896  C  C    . HIS A 1 18 ? 128.889 5.050   -6.765  1.00 0.00 ? 18  HIS A C    4  
ATOM   8897  O  O    . HIS A 1 18 ? 127.729 5.444   -6.647  1.00 0.00 ? 18  HIS A O    4  
ATOM   8898  C  CB   . HIS A 1 18 ? 129.513 2.665   -6.509  1.00 0.00 ? 18  HIS A CB   4  
ATOM   8899  C  CG   . HIS A 1 18 ? 129.734 1.366   -7.233  1.00 0.00 ? 18  HIS A CG   4  
ATOM   8900  N  ND1  . HIS A 1 18 ? 128.699 0.677   -7.849  1.00 0.00 ? 18  HIS A ND1  4  
ATOM   8901  C  CD2  . HIS A 1 18 ? 130.863 0.616   -7.450  1.00 0.00 ? 18  HIS A CD2  4  
ATOM   8902  C  CE1  . HIS A 1 18 ? 129.222 -0.432  -8.402  1.00 0.00 ? 18  HIS A CE1  4  
ATOM   8903  N  NE2  . HIS A 1 18 ? 130.538 -0.519  -8.187  1.00 0.00 ? 18  HIS A NE2  4  
ATOM   8904  H  H    . HIS A 1 18 ? 131.225 3.808   -8.154  1.00 0.00 ? 18  HIS A H    4  
ATOM   8905  H  HA   . HIS A 1 18 ? 128.303 3.459   -8.056  1.00 0.00 ? 18  HIS A HA   4  
ATOM   8906  H  HB2  . HIS A 1 18 ? 130.407 2.938   -5.972  1.00 0.00 ? 18  HIS A HB2  4  
ATOM   8907  H  HB3  . HIS A 1 18 ? 128.694 2.560   -5.812  1.00 0.00 ? 18  HIS A HB3  4  
ATOM   8908  H  HD1  . HIS A 1 18 ? 127.758 0.951   -7.877  1.00 0.00 ? 18  HIS A HD1  4  
ATOM   8909  H  HD2  . HIS A 1 18 ? 131.853 0.868   -7.100  1.00 0.00 ? 18  HIS A HD2  4  
ATOM   8910  H  HE1  . HIS A 1 18 ? 128.649 -1.164  -8.951  1.00 0.00 ? 18  HIS A HE1  4  
ATOM   8911  H  HE2  . HIS A 1 18 ? 131.145 -1.228  -8.486  1.00 0.00 ? 18  HIS A HE2  4  
ATOM   8912  N  N    . SER A 1 19 ? 129.919 5.687   -6.217  1.00 0.00 ? 19  SER A N    4  
ATOM   8913  C  CA   . SER A 1 19 ? 129.708 6.904   -5.438  1.00 0.00 ? 19  SER A CA   4  
ATOM   8914  C  C    . SER A 1 19 ? 129.011 7.983   -6.262  1.00 0.00 ? 19  SER A C    4  
ATOM   8915  O  O    . SER A 1 19 ? 128.212 8.760   -5.737  1.00 0.00 ? 19  SER A O    4  
ATOM   8916  C  CB   . SER A 1 19 ? 131.041 7.430   -4.903  1.00 0.00 ? 19  SER A CB   4  
ATOM   8917  O  OG   . SER A 1 19 ? 131.686 6.403   -4.161  1.00 0.00 ? 19  SER A OG   4  
ATOM   8918  H  H    . SER A 1 19 ? 130.823 5.319   -6.311  1.00 0.00 ? 19  SER A H    4  
ATOM   8919  H  HA   . SER A 1 19 ? 129.081 6.658   -4.599  1.00 0.00 ? 19  SER A HA   4  
ATOM   8920  H  HB2  . SER A 1 19 ? 131.671 7.722   -5.720  1.00 0.00 ? 19  SER A HB2  4  
ATOM   8921  H  HB3  . SER A 1 19 ? 130.859 8.287   -4.267  1.00 0.00 ? 19  SER A HB3  4  
ATOM   8922  H  HG   . SER A 1 19 ? 131.055 6.055   -3.527  1.00 0.00 ? 19  SER A HG   4  
ATOM   8923  N  N    . GLY A 1 20 ? 129.327 8.027   -7.545  1.00 0.00 ? 20  GLY A N    4  
ATOM   8924  C  CA   . GLY A 1 20 ? 128.738 9.011   -8.446  1.00 0.00 ? 20  GLY A CA   4  
ATOM   8925  C  C    . GLY A 1 20 ? 127.210 8.937   -8.482  1.00 0.00 ? 20  GLY A C    4  
ATOM   8926  O  O    . GLY A 1 20 ? 126.544 9.937   -8.748  1.00 0.00 ? 20  GLY A O    4  
ATOM   8927  H  H    . GLY A 1 20 ? 129.974 7.383   -7.901  1.00 0.00 ? 20  GLY A H    4  
ATOM   8928  H  HA2  . GLY A 1 20 ? 129.030 9.996   -8.121  1.00 0.00 ? 20  GLY A HA2  4  
ATOM   8929  H  HA3  . GLY A 1 20 ? 129.118 8.843   -9.443  1.00 0.00 ? 20  GLY A HA3  4  
ATOM   8930  N  N    . LYS A 1 21 ? 126.660 7.745   -8.269  1.00 0.00 ? 21  LYS A N    4  
ATOM   8931  C  CA   . LYS A 1 21 ? 125.210 7.560   -8.344  1.00 0.00 ? 21  LYS A CA   4  
ATOM   8932  C  C    . LYS A 1 21 ? 124.435 8.462   -7.379  1.00 0.00 ? 21  LYS A C    4  
ATOM   8933  O  O    . LYS A 1 21 ? 123.366 8.959   -7.732  1.00 0.00 ? 21  LYS A O    4  
ATOM   8934  C  CB   . LYS A 1 21 ? 124.859 6.104   -8.035  1.00 0.00 ? 21  LYS A CB   4  
ATOM   8935  C  CG   . LYS A 1 21 ? 125.495 5.185   -9.080  1.00 0.00 ? 21  LYS A CG   4  
ATOM   8936  C  CD   . LYS A 1 21 ? 124.945 3.766   -8.908  1.00 0.00 ? 21  LYS A CD   4  
ATOM   8937  C  CE   . LYS A 1 21 ? 125.349 3.208   -7.537  1.00 0.00 ? 21  LYS A CE   4  
ATOM   8938  N  NZ   . LYS A 1 21 ? 125.652 1.754   -7.664  1.00 0.00 ? 21  LYS A NZ   4  
ATOM   8939  H  H    . LYS A 1 21 ? 127.237 6.971   -8.101  1.00 0.00 ? 21  LYS A H    4  
ATOM   8940  H  HA   . LYS A 1 21 ? 124.888 7.778   -9.350  1.00 0.00 ? 21  LYS A HA   4  
ATOM   8941  H  HB2  . LYS A 1 21 ? 125.232 5.845   -7.055  1.00 0.00 ? 21  LYS A HB2  4  
ATOM   8942  H  HB3  . LYS A 1 21 ? 123.787 5.981   -8.055  1.00 0.00 ? 21  LYS A HB3  4  
ATOM   8943  H  HG2  . LYS A 1 21 ? 125.259 5.547   -10.070 1.00 0.00 ? 21  LYS A HG2  4  
ATOM   8944  H  HG3  . LYS A 1 21 ? 126.565 5.173   -8.945  1.00 0.00 ? 21  LYS A HG3  4  
ATOM   8945  H  HD2  . LYS A 1 21 ? 123.866 3.788   -8.983  1.00 0.00 ? 21  LYS A HD2  4  
ATOM   8946  H  HD3  . LYS A 1 21 ? 125.344 3.130   -9.683  1.00 0.00 ? 21  LYS A HD3  4  
ATOM   8947  H  HE2  . LYS A 1 21 ? 126.223 3.727   -7.172  1.00 0.00 ? 21  LYS A HE2  4  
ATOM   8948  H  HE3  . LYS A 1 21 ? 124.535 3.344   -6.840  1.00 0.00 ? 21  LYS A HE3  4  
ATOM   8949  H  HZ1  . LYS A 1 21 ? 126.679 1.608   -7.606  1.00 0.00 ? 21  LYS A HZ1  4  
ATOM   8950  H  HZ2  . LYS A 1 21 ? 125.301 1.406   -8.580  1.00 0.00 ? 21  LYS A HZ2  4  
ATOM   8951  H  HZ3  . LYS A 1 21 ? 125.187 1.234   -6.893  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM   8952  N  N    . GLU A 1 22 ? 124.948 8.672   -6.165  1.00 0.00 ? 22  GLU A N    4  
ATOM   8953  C  CA   . GLU A 1 22 ? 124.238 9.515   -5.194  1.00 0.00 ? 22  GLU A CA   4  
ATOM   8954  C  C    . GLU A 1 22 ? 125.130 10.616  -4.624  1.00 0.00 ? 22  GLU A C    4  
ATOM   8955  O  O    . GLU A 1 22 ? 126.345 10.456  -4.495  1.00 0.00 ? 22  GLU A O    4  
ATOM   8956  C  CB   . GLU A 1 22 ? 123.693 8.652   -4.051  1.00 0.00 ? 22  GLU A CB   4  
ATOM   8957  C  CG   . GLU A 1 22 ? 122.707 7.623   -4.610  1.00 0.00 ? 22  GLU A CG   4  
ATOM   8958  C  CD   . GLU A 1 22 ? 121.514 8.327   -5.249  1.00 0.00 ? 22  GLU A CD   4  
ATOM   8959  O  OE1  . GLU A 1 22 ? 121.308 9.492   -4.955  1.00 0.00 ? 22  GLU A OE1  4  
ATOM   8960  O  OE2  . GLU A 1 22 ? 120.815 7.684   -6.016  1.00 0.00 ? 22  GLU A OE2  4  
ATOM   8961  H  H    . GLU A 1 22 ? 125.798 8.251   -5.916  1.00 0.00 ? 22  GLU A H    4  
ATOM   8962  H  HA   . GLU A 1 22 ? 123.403 9.986   -5.690  1.00 0.00 ? 22  GLU A HA   4  
ATOM   8963  H  HB2  . GLU A 1 22 ? 124.509 8.141   -3.563  1.00 0.00 ? 22  GLU A HB2  4  
ATOM   8964  H  HB3  . GLU A 1 22 ? 123.185 9.282   -3.338  1.00 0.00 ? 22  GLU A HB3  4  
ATOM   8965  H  HG2  . GLU A 1 22 ? 123.205 7.018   -5.352  1.00 0.00 ? 22  GLU A HG2  4  
ATOM   8966  H  HG3  . GLU A 1 22 ? 122.359 6.990   -3.807  1.00 0.00 ? 22  GLU A HG3  4  
ATOM   8967  N  N    . GLY A 1 23 ? 124.506 11.731  -4.262  1.00 0.00 ? 23  GLY A N    4  
ATOM   8968  C  CA   . GLY A 1 23 ? 125.234 12.846  -3.677  1.00 0.00 ? 23  GLY A CA   4  
ATOM   8969  C  C    . GLY A 1 23 ? 126.337 13.325  -4.605  1.00 0.00 ? 23  GLY A C    4  
ATOM   8970  O  O    . GLY A 1 23 ? 126.317 13.060  -5.807  1.00 0.00 ? 23  GLY A O    4  
ATOM   8971  H  H    . GLY A 1 23 ? 123.534 11.796  -4.375  1.00 0.00 ? 23  GLY A H    4  
ATOM   8972  H  HA2  . GLY A 1 23 ? 124.546 13.660  -3.493  1.00 0.00 ? 23  GLY A HA2  4  
ATOM   8973  H  HA3  . GLY A 1 23 ? 125.671 12.531  -2.742  1.00 0.00 ? 23  GLY A HA3  4  
ATOM   8974  N  N    . ASP A 1 24 ? 127.312 14.017  -4.029  1.00 0.00 ? 24  ASP A N    4  
ATOM   8975  C  CA   . ASP A 1 24 ? 128.439 14.513  -4.802  1.00 0.00 ? 24  ASP A CA   4  
ATOM   8976  C  C    . ASP A 1 24 ? 129.362 13.363  -5.191  1.00 0.00 ? 24  ASP A C    4  
ATOM   8977  O  O    . ASP A 1 24 ? 129.591 12.437  -4.402  1.00 0.00 ? 24  ASP A O    4  
ATOM   8978  C  CB   . ASP A 1 24 ? 129.221 15.546  -3.987  1.00 0.00 ? 24  ASP A CB   4  
ATOM   8979  C  CG   . ASP A 1 24 ? 128.361 16.783  -3.754  1.00 0.00 ? 24  ASP A CG   4  
ATOM   8980  O  OD1  . ASP A 1 24 ? 127.339 16.904  -4.410  1.00 0.00 ? 24  ASP A OD1  4  
ATOM   8981  O  OD2  . ASP A 1 24 ? 128.737 17.593  -2.923  1.00 0.00 ? 24  ASP A OD2  4  
ATOM   8982  H  H    . ASP A 1 24 ? 127.280 14.183  -3.065  1.00 0.00 ? 24  ASP A H    4  
ATOM   8983  H  HA   . ASP A 1 24 ? 128.069 14.984  -5.700  1.00 0.00 ? 24  ASP A HA   4  
ATOM   8984  H  HB2  . ASP A 1 24 ? 129.496 15.116  -3.036  1.00 0.00 ? 24  ASP A HB2  4  
ATOM   8985  H  HB3  . ASP A 1 24 ? 130.112 15.827  -4.526  1.00 0.00 ? 24  ASP A HB3  4  
ATOM   8986  N  N    . LYS A 1 25 ? 129.893 13.425  -6.407  1.00 0.00 ? 25  LYS A N    4  
ATOM   8987  C  CA   . LYS A 1 25 ? 130.803 12.393  -6.883  1.00 0.00 ? 25  LYS A CA   4  
ATOM   8988  C  C    . LYS A 1 25 ? 132.023 12.315  -5.983  1.00 0.00 ? 25  LYS A C    4  
ATOM   8989  O  O    . LYS A 1 25 ? 132.571 11.245  -5.727  1.00 0.00 ? 25  LYS A O    4  
ATOM   8990  C  CB   . LYS A 1 25 ? 131.312 12.766  -8.283  1.00 0.00 ? 25  LYS A CB   4  
ATOM   8991  C  CG   . LYS A 1 25 ? 130.168 12.787  -9.289  1.00 0.00 ? 25  LYS A CG   4  
ATOM   8992  C  CD   . LYS A 1 25 ? 130.721 13.076  -10.685 1.00 0.00 ? 25  LYS A CD   4  
ATOM   8993  C  CE   . LYS A 1 25 ? 129.564 13.217  -11.674 1.00 0.00 ? 25  LYS A CE   4  
ATOM   8994  N  NZ   . LYS A 1 25 ? 128.898 11.897  -11.851 1.00 0.00 ? 25  LYS A NZ   4  
ATOM   8995  H  H    . LYS A 1 25 ? 129.677 14.185  -6.989  1.00 0.00 ? 25  LYS A H    4  
ATOM   8996  H  HA   . LYS A 1 25 ? 130.303 11.440  -6.919  1.00 0.00 ? 25  LYS A HA   4  
ATOM   8997  H  HB2  . LYS A 1 25 ? 131.768 13.744  -8.246  1.00 0.00 ? 25  LYS A HB2  4  
ATOM   8998  H  HB3  . LYS A 1 25 ? 132.048 12.041  -8.598  1.00 0.00 ? 25  LYS A HB3  4  
ATOM   8999  H  HG2  . LYS A 1 25 ? 129.693 11.829  -9.291  1.00 0.00 ? 25  LYS A HG2  4  
ATOM   9000  H  HG3  . LYS A 1 25 ? 129.455 13.550  -9.017  1.00 0.00 ? 25  LYS A HG3  4  
ATOM   9001  H  HD2  . LYS A 1 25 ? 131.292 13.995  -10.663 1.00 0.00 ? 25  LYS A HD2  4  
ATOM   9002  H  HD3  . LYS A 1 25 ? 131.360 12.264  -10.994 1.00 0.00 ? 25  LYS A HD3  4  
ATOM   9003  H  HE2  . LYS A 1 25 ? 128.850 13.932  -11.294 1.00 0.00 ? 25  LYS A HE2  4  
ATOM   9004  H  HE3  . LYS A 1 25 ? 129.944 13.560  -12.626 1.00 0.00 ? 25  LYS A HE3  4  
ATOM   9005  H  HZ1  . LYS A 1 25 ? 128.501 11.833  -12.810 1.00 0.00 ? 25  LYS A HZ1  4  
ATOM   9006  H  HZ2  . LYS A 1 25 ? 128.134 11.798  -11.151 1.00 0.00 ? 25  LYS A HZ2  4  
ATOM   9007  H  HZ3  . LYS A 1 25 ? 129.593 11.136  -11.716 1.00 0.00 ? 25  LYS A HZ3  4  
ATOM   9008  N  N    . TYR A 1 26 ? 132.471 13.491  -5.582  1.00 0.00 ? 26  TYR A N    4  
ATOM   9009  C  CA   . TYR A 1 26 ? 133.678 13.643  -4.785  1.00 0.00 ? 26  TYR A CA   4  
ATOM   9010  C  C    . TYR A 1 26 ? 133.476 13.213  -3.334  1.00 0.00 ? 26  TYR A C    4  
ATOM   9011  O  O    . TYR A 1 26 ? 134.445 12.968  -2.617  1.00 0.00 ? 26  TYR A O    4  
ATOM   9012  C  CB   . TYR A 1 26 ? 134.113 15.104  -4.867  1.00 0.00 ? 26  TYR A CB   4  
ATOM   9013  C  CG   . TYR A 1 26 ? 134.315 15.524  -6.328  1.00 0.00 ? 26  TYR A CG   4  
ATOM   9014  C  CD1  . TYR A 1 26 ? 134.087 14.629  -7.411  1.00 0.00 ? 26  TYR A CD1  4  
ATOM   9015  C  CD2  . TYR A 1 26 ? 134.681 16.847  -6.606  1.00 0.00 ? 26  TYR A CD2  4  
ATOM   9016  C  CE1  . TYR A 1 26 ? 134.227 15.068  -8.727  1.00 0.00 ? 26  TYR A CE1  4  
ATOM   9017  C  CE2  . TYR A 1 26 ? 134.832 17.277  -7.932  1.00 0.00 ? 26  TYR A CE2  4  
ATOM   9018  C  CZ   . TYR A 1 26 ? 134.603 16.389  -8.990  1.00 0.00 ? 26  TYR A CZ   4  
ATOM   9019  O  OH   . TYR A 1 26 ? 134.741 16.821  -10.294 1.00 0.00 ? 26  TYR A OH   4  
ATOM   9020  H  H    . TYR A 1 26 ? 132.003 14.299  -5.881  1.00 0.00 ? 26  TYR A H    4  
ATOM   9021  H  HA   . TYR A 1 26 ? 134.458 13.030  -5.209  1.00 0.00 ? 26  TYR A HA   4  
ATOM   9022  H  HB2  . TYR A 1 26 ? 133.355 15.727  -4.418  1.00 0.00 ? 26  TYR A HB2  4  
ATOM   9023  H  HB3  . TYR A 1 26 ? 135.042 15.229  -4.330  1.00 0.00 ? 26  TYR A HB3  4  
ATOM   9024  H  HD1  . TYR A 1 26 ? 133.819 13.606  -7.243  1.00 0.00 ? 26  TYR A HD1  4  
ATOM   9025  H  HD2  . TYR A 1 26 ? 134.858 17.537  -5.794  1.00 0.00 ? 26  TYR A HD2  4  
ATOM   9026  H  HE1  . TYR A 1 26 ? 134.035 14.378  -9.543  1.00 0.00 ? 26  TYR A HE1  4  
ATOM   9027  H  HE2  . TYR A 1 26 ? 135.122 18.297  -8.138  1.00 0.00 ? 26  TYR A HE2  4  
ATOM   9028  H  HH   . TYR A 1 26 ? 133.882 16.761  -10.719 1.00 0.00 ? 26  TYR A HH   4  
ATOM   9029  N  N    . LYS A 1 27 ? 132.222 13.146  -2.890  1.00 0.00 ? 27  LYS A N    4  
ATOM   9030  C  CA   . LYS A 1 27 ? 131.936 12.771  -1.504  1.00 0.00 ? 27  LYS A CA   4  
ATOM   9031  C  C    . LYS A 1 27 ? 131.226 11.419  -1.456  1.00 0.00 ? 27  LYS A C    4  
ATOM   9032  O  O    . LYS A 1 27 ? 130.377 11.118  -2.301  1.00 0.00 ? 27  LYS A O    4  
ATOM   9033  C  CB   . LYS A 1 27 ? 131.055 13.844  -0.852  1.00 0.00 ? 27  LYS A CB   4  
ATOM   9034  C  CG   . LYS A 1 27 ? 130.981 13.638  0.668   1.00 0.00 ? 27  LYS A CG   4  
ATOM   9035  C  CD   . LYS A 1 27 ? 132.268 14.154  1.331   1.00 0.00 ? 27  LYS A CD   4  
ATOM   9036  C  CE   . LYS A 1 27 ? 132.119 14.112  2.851   1.00 0.00 ? 27  LYS A CE   4  
ATOM   9037  N  NZ   . LYS A 1 27 ? 131.164 15.171  3.284   1.00 0.00 ? 27  LYS A NZ   4  
ATOM   9038  H  H    . LYS A 1 27 ? 131.483 13.368  -3.494  1.00 0.00 ? 27  LYS A H    4  
ATOM   9039  H  HA   . LYS A 1 27 ? 132.863 12.695  -0.962  1.00 0.00 ? 27  LYS A HA   4  
ATOM   9040  H  HB2  . LYS A 1 27 ? 131.471 14.819  -1.059  1.00 0.00 ? 27  LYS A HB2  4  
ATOM   9041  H  HB3  . LYS A 1 27 ? 130.060 13.787  -1.266  1.00 0.00 ? 27  LYS A HB3  4  
ATOM   9042  H  HG2  . LYS A 1 27 ? 130.133 14.179  1.062   1.00 0.00 ? 27  LYS A HG2  4  
ATOM   9043  H  HG3  . LYS A 1 27 ? 130.866 12.586  0.882   1.00 0.00 ? 27  LYS A HG3  4  
ATOM   9044  H  HD2  . LYS A 1 27 ? 133.102 13.534  1.044   1.00 0.00 ? 27  LYS A HD2  4  
ATOM   9045  H  HD3  . LYS A 1 27 ? 132.451 15.171  1.019   1.00 0.00 ? 27  LYS A HD3  4  
ATOM   9046  H  HE2  . LYS A 1 27 ? 131.748 13.145  3.151   1.00 0.00 ? 27  LYS A HE2  4  
ATOM   9047  H  HE3  . LYS A 1 27 ? 133.081 14.286  3.311   1.00 0.00 ? 27  LYS A HE3  4  
ATOM   9048  H  HZ1  . LYS A 1 27 ? 131.689 15.960  3.710   1.00 0.00 ? 27  LYS A HZ1  4  
ATOM   9049  H  HZ2  . LYS A 1 27 ? 130.503 14.776  3.983   1.00 0.00 ? 27  LYS A HZ2  4  
ATOM   9050  H  HZ3  . LYS A 1 27 ? 130.632 15.516  2.461   1.00 0.00 ? 27  LYS A HZ3  4  
ATOM   9051  N  N    . LEU A 1 28 ? 131.599 10.598  -0.474  1.00 0.00 ? 28  LEU A N    4  
ATOM   9052  C  CA   . LEU A 1 28 ? 131.012 9.270   -0.343  1.00 0.00 ? 28  LEU A CA   4  
ATOM   9053  C  C    . LEU A 1 28 ? 129.885 9.332   0.700   1.00 0.00 ? 28  LEU A C    4  
ATOM   9054  O  O    . LEU A 1 28 ? 130.075 9.865   1.792   1.00 0.00 ? 28  LEU A O    4  
ATOM   9055  C  CB   . LEU A 1 28 ? 132.106 8.290   0.119   1.00 0.00 ? 28  LEU A CB   4  
ATOM   9056  C  CG   . LEU A 1 28 ? 131.726 6.839   -0.239  1.00 0.00 ? 28  LEU A CG   4  
ATOM   9057  C  CD1  . LEU A 1 28 ? 132.950 5.908   -0.128  1.00 0.00 ? 28  LEU A CD1  4  
ATOM   9058  C  CD2  . LEU A 1 28 ? 130.621 6.338   0.678   1.00 0.00 ? 28  LEU A CD2  4  
ATOM   9059  H  H    . LEU A 1 28 ? 132.291 10.884  0.158   1.00 0.00 ? 28  LEU A H    4  
ATOM   9060  H  HA   . LEU A 1 28 ? 130.613 8.952   -1.294  1.00 0.00 ? 28  LEU A HA   4  
ATOM   9061  H  HB2  . LEU A 1 28 ? 133.036 8.553   -0.360  1.00 0.00 ? 28  LEU A HB2  4  
ATOM   9062  H  HB3  . LEU A 1 28 ? 132.225 8.373   1.189   1.00 0.00 ? 28  LEU A HB3  4  
ATOM   9063  H  HG   . LEU A 1 28 ? 131.372 6.813   -1.261  1.00 0.00 ? 28  LEU A HG   4  
ATOM   9064  H  HD11 . LEU A 1 28 ? 132.895 5.336   0.791   1.00 0.00 ? 28  LEU A HD11 4  
ATOM   9065  H  HD12 . LEU A 1 28 ? 133.860 6.488   -0.131  1.00 0.00 ? 28  LEU A HD12 4  
ATOM   9066  H  HD13 . LEU A 1 28 ? 132.956 5.229   -0.968  1.00 0.00 ? 28  LEU A HD13 4  
ATOM   9067  H  HD21 . LEU A 1 28 ? 129.688 6.744   0.349   1.00 0.00 ? 28  LEU A HD21 4  
ATOM   9068  H  HD22 . LEU A 1 28 ? 130.818 6.647   1.693   1.00 0.00 ? 28  LEU A HD22 4  
ATOM   9069  H  HD23 . LEU A 1 28 ? 130.581 5.261   0.624   1.00 0.00 ? 28  LEU A HD23 4  
ATOM   9070  N  N    . SER A 1 29 ? 128.714 8.801   0.361   1.00 0.00 ? 29  SER A N    4  
ATOM   9071  C  CA   . SER A 1 29 ? 127.568 8.822   1.280   1.00 0.00 ? 29  SER A CA   4  
ATOM   9072  C  C    . SER A 1 29 ? 127.377 7.467   1.958   1.00 0.00 ? 29  SER A C    4  
ATOM   9073  O  O    . SER A 1 29 ? 127.745 6.430   1.413   1.00 0.00 ? 29  SER A O    4  
ATOM   9074  C  CB   . SER A 1 29 ? 126.302 9.215   0.526   1.00 0.00 ? 29  SER A CB   4  
ATOM   9075  O  OG   . SER A 1 29 ? 125.215 9.288   1.439   1.00 0.00 ? 29  SER A OG   4  
ATOM   9076  H  H    . SER A 1 29 ? 128.610 8.397   -0.526  1.00 0.00 ? 29  SER A H    4  
ATOM   9077  H  HA   . SER A 1 29 ? 127.754 9.562   2.043   1.00 0.00 ? 29  SER A HA   4  
ATOM   9078  H  HB2  . SER A 1 29 ? 126.444 10.180  0.069   1.00 0.00 ? 29  SER A HB2  4  
ATOM   9079  H  HB3  . SER A 1 29 ? 126.096 8.481   -0.241  1.00 0.00 ? 29  SER A HB3  4  
ATOM   9080  H  HG   . SER A 1 29 ? 124.400 9.251   0.933   1.00 0.00 ? 29  SER A HG   4  
ATOM   9081  N  N    . LYS A 1 30 ? 126.821 7.481   3.170   1.00 0.00 ? 30  LYS A N    4  
ATOM   9082  C  CA   . LYS A 1 30 ? 126.628 6.240   3.914   1.00 0.00 ? 30  LYS A CA   4  
ATOM   9083  C  C    . LYS A 1 30 ? 125.866 5.220   3.079   1.00 0.00 ? 30  LYS A C    4  
ATOM   9084  O  O    . LYS A 1 30 ? 126.214 4.040   3.080   1.00 0.00 ? 30  LYS A O    4  
ATOM   9085  C  CB   . LYS A 1 30 ? 125.842 6.517   5.197   1.00 0.00 ? 30  LYS A CB   4  
ATOM   9086  C  CG   . LYS A 1 30 ? 125.747 5.233   6.026   1.00 0.00 ? 30  LYS A CG   4  
ATOM   9087  C  CD   . LYS A 1 30 ? 124.891 5.487   7.270   1.00 0.00 ? 30  LYS A CD   4  
ATOM   9088  C  CE   . LYS A 1 30 ? 124.927 4.254   8.177   1.00 0.00 ? 30  LYS A CE   4  
ATOM   9089  N  NZ   . LYS A 1 30 ? 124.636 4.663   9.580   1.00 0.00 ? 30  LYS A NZ   4  
ATOM   9090  H  H    . LYS A 1 30 ? 126.561 8.332   3.574   1.00 0.00 ? 30  LYS A H    4  
ATOM   9091  H  HA   . LYS A 1 30 ? 127.593 5.833   4.175   1.00 0.00 ? 30  LYS A HA   4  
ATOM   9092  H  HB2  . LYS A 1 30 ? 126.348 7.281   5.771   1.00 0.00 ? 30  LYS A HB2  4  
ATOM   9093  H  HB3  . LYS A 1 30 ? 124.848 6.855   4.946   1.00 0.00 ? 30  LYS A HB3  4  
ATOM   9094  H  HG2  . LYS A 1 30 ? 125.295 4.453   5.431   1.00 0.00 ? 30  LYS A HG2  4  
ATOM   9095  H  HG3  . LYS A 1 30 ? 126.737 4.927   6.329   1.00 0.00 ? 30  LYS A HG3  4  
ATOM   9096  H  HD2  . LYS A 1 30 ? 125.276 6.340   7.804   1.00 0.00 ? 30  LYS A HD2  4  
ATOM   9097  H  HD3  . LYS A 1 30 ? 123.872 5.679   6.971   1.00 0.00 ? 30  LYS A HD3  4  
ATOM   9098  H  HE2  . LYS A 1 30 ? 124.184 3.543   7.848   1.00 0.00 ? 30  LYS A HE2  4  
ATOM   9099  H  HE3  . LYS A 1 30 ? 125.906 3.800   8.131   1.00 0.00 ? 30  LYS A HE3  4  
ATOM   9100  H  HZ1  . LYS A 1 30 ? 123.607 4.721   9.719   1.00 0.00 ? 30  LYS A HZ1  4  
ATOM   9101  H  HZ2  . LYS A 1 30 ? 125.064 5.593   9.766   1.00 0.00 ? 30  LYS A HZ2  4  
ATOM   9102  H  HZ3  . LYS A 1 30 ? 125.031 3.961   10.236  1.00 0.00 ? 30  LYS A HZ3  4  
ATOM   9103  N  N    . LYS A 1 31 ? 124.853 5.659   2.340   1.00 0.00 ? 31  LYS A N    4  
ATOM   9104  C  CA   . LYS A 1 31 ? 124.128 4.717   1.499   1.00 0.00 ? 31  LYS A CA   4  
ATOM   9105  C  C    . LYS A 1 31 ? 125.070 4.068   0.512   1.00 0.00 ? 31  LYS A C    4  
ATOM   9106  O  O    . LYS A 1 31 ? 125.066 2.845   0.313   1.00 0.00 ? 31  LYS A O    4  
ATOM   9107  C  CB   . LYS A 1 31 ? 123.105 5.450   0.643   1.00 0.00 ? 31  LYS A CB   4  
ATOM   9108  C  CG   . LYS A 1 31 ? 122.369 4.432   -0.238  1.00 0.00 ? 31  LYS A CG   4  
ATOM   9109  C  CD   . LYS A 1 31 ? 121.583 5.168   -1.303  1.00 0.00 ? 31  LYS A CD   4  
ATOM   9110  C  CE   . LYS A 1 31 ? 120.973 4.140   -2.246  1.00 0.00 ? 31  LYS A CE   4  
ATOM   9111  N  NZ   . LYS A 1 31 ? 120.129 4.830   -3.262  1.00 0.00 ? 31  LYS A NZ   4  
ATOM   9112  H  H    . LYS A 1 31 ? 124.615 6.609   2.340   1.00 0.00 ? 31  LYS A H    4  
ATOM   9113  H  HA   . LYS A 1 31 ? 123.636 3.970   2.101   1.00 0.00 ? 31  LYS A HA   4  
ATOM   9114  H  HB2  . LYS A 1 31 ? 122.396 5.958   1.282   1.00 0.00 ? 31  LYS A HB2  4  
ATOM   9115  H  HB3  . LYS A 1 31 ? 123.606 6.170   0.015   1.00 0.00 ? 31  LYS A HB3  4  
ATOM   9116  H  HG2  . LYS A 1 31 ? 123.066 3.767   -0.719  1.00 0.00 ? 31  LYS A HG2  4  
ATOM   9117  H  HG3  . LYS A 1 31 ? 121.688 3.858   0.371   1.00 0.00 ? 31  LYS A HG3  4  
ATOM   9118  H  HD2  . LYS A 1 31 ? 120.805 5.764   -0.846  1.00 0.00 ? 31  LYS A HD2  4  
ATOM   9119  H  HD3  . LYS A 1 31 ? 122.262 5.802   -1.858  1.00 0.00 ? 31  LYS A HD3  4  
ATOM   9120  H  HE2  . LYS A 1 31 ? 121.777 3.604   -2.741  1.00 0.00 ? 31  LYS A HE2  4  
ATOM   9121  H  HE3  . LYS A 1 31 ? 120.370 3.445   -1.682  1.00 0.00 ? 31  LYS A HE3  4  
ATOM   9122  H  HZ1  . LYS A 1 31 ? 120.739 5.258   -3.987  1.00 0.00 ? 31  LYS A HZ1  4  
ATOM   9123  H  HZ2  . LYS A 1 31 ? 119.567 5.574   -2.798  1.00 0.00 ? 31  LYS A HZ2  4  
ATOM   9124  H  HZ3  . LYS A 1 31 ? 119.492 4.142   -3.711  1.00 0.00 ? 31  LYS A HZ3  4  
ATOM   9125  N  N    . GLU A 1 32 ? 125.853 4.910   -0.137  1.00 0.00 ? 32  GLU A N    4  
ATOM   9126  C  CA   . GLU A 1 32 ? 126.759 4.425   -1.139  1.00 0.00 ? 32  GLU A CA   4  
ATOM   9127  C  C    . GLU A 1 32 ? 127.754 3.471   -0.502  1.00 0.00 ? 32  GLU A C    4  
ATOM   9128  O  O    . GLU A 1 32 ? 128.141 2.466   -1.093  1.00 0.00 ? 32  GLU A O    4  
ATOM   9129  C  CB   . GLU A 1 32 ? 127.508 5.604   -1.764  1.00 0.00 ? 32  GLU A CB   4  
ATOM   9130  C  CG   . GLU A 1 32 ? 126.532 6.501   -2.527  1.00 0.00 ? 32  GLU A CG   4  
ATOM   9131  C  CD   . GLU A 1 32 ? 127.283 7.667   -3.173  1.00 0.00 ? 32  GLU A CD   4  
ATOM   9132  O  OE1  . GLU A 1 32 ? 128.421 7.905   -2.798  1.00 0.00 ? 32  GLU A OE1  4  
ATOM   9133  O  OE2  . GLU A 1 32 ? 126.718 8.293   -4.047  1.00 0.00 ? 32  GLU A OE2  4  
ATOM   9134  H  H    . GLU A 1 32 ? 125.791 5.871   0.043   1.00 0.00 ? 32  GLU A H    4  
ATOM   9135  H  HA   . GLU A 1 32 ? 126.172 3.919   -1.906  1.00 0.00 ? 32  GLU A HA   4  
ATOM   9136  H  HB2  . GLU A 1 32 ? 127.981 6.174   -0.983  1.00 0.00 ? 32  GLU A HB2  4  
ATOM   9137  H  HB3  . GLU A 1 32 ? 128.260 5.232   -2.445  1.00 0.00 ? 32  GLU A HB3  4  
ATOM   9138  H  HG2  . GLU A 1 32 ? 126.042 5.922   -3.297  1.00 0.00 ? 32  GLU A HG2  4  
ATOM   9139  H  HG3  . GLU A 1 32 ? 125.792 6.887   -1.844  1.00 0.00 ? 32  GLU A HG3  4  
ATOM   9140  N  N    . LEU A 1 33 ? 128.155 3.802   0.725   1.00 0.00 ? 33  LEU A N    4  
ATOM   9141  C  CA   . LEU A 1 33 ? 129.098 2.975   1.461   1.00 0.00 ? 33  LEU A CA   4  
ATOM   9142  C  C    . LEU A 1 33 ? 128.525 1.591   1.716   1.00 0.00 ? 33  LEU A C    4  
ATOM   9143  O  O    . LEU A 1 33 ? 129.187 0.570   1.497   1.00 0.00 ? 33  LEU A O    4  
ATOM   9144  C  CB   . LEU A 1 33 ? 129.383 3.649   2.798   1.00 0.00 ? 33  LEU A CB   4  
ATOM   9145  C  CG   . LEU A 1 33 ? 130.387 2.824   3.585   1.00 0.00 ? 33  LEU A CG   4  
ATOM   9146  C  CD1  . LEU A 1 33 ? 131.729 2.839   2.867   1.00 0.00 ? 33  LEU A CD1  4  
ATOM   9147  C  CD2  . LEU A 1 33 ? 130.531 3.430   4.977   1.00 0.00 ? 33  LEU A CD2  4  
ATOM   9148  H  H    . LEU A 1 33 ? 127.801 4.615   1.142   1.00 0.00 ? 33  LEU A H    4  
ATOM   9149  H  HA   . LEU A 1 33 ? 130.016 2.890   0.902   1.00 0.00 ? 33  LEU A HA   4  
ATOM   9150  H  HB2  . LEU A 1 33 ? 129.780 4.637   2.628   1.00 0.00 ? 33  LEU A HB2  4  
ATOM   9151  H  HB3  . LEU A 1 33 ? 128.466 3.726   3.360   1.00 0.00 ? 33  LEU A HB3  4  
ATOM   9152  H  HG   . LEU A 1 33 ? 130.041 1.808   3.671   1.00 0.00 ? 33  LEU A HG   4  
ATOM   9153  H  HD11 . LEU A 1 33 ? 132.513 2.666   3.581   1.00 0.00 ? 33  LEU A HD11 4  
ATOM   9154  H  HD12 . LEU A 1 33 ? 131.876 3.796   2.390   1.00 0.00 ? 33  LEU A HD12 4  
ATOM   9155  H  HD13 . LEU A 1 33 ? 131.739 2.057   2.121   1.00 0.00 ? 33  LEU A HD13 4  
ATOM   9156  H  HD21 . LEU A 1 33 ? 131.357 2.962   5.491   1.00 0.00 ? 33  LEU A HD21 4  
ATOM   9157  H  HD22 . LEU A 1 33 ? 129.619 3.265   5.532   1.00 0.00 ? 33  LEU A HD22 4  
ATOM   9158  H  HD23 . LEU A 1 33 ? 130.712 4.491   4.889   1.00 0.00 ? 33  LEU A HD23 4  
ATOM   9159  N  N    . LYS A 1 34 ? 127.272 1.575   2.139   1.00 0.00 ? 34  LYS A N    4  
ATOM   9160  C  CA   . LYS A 1 34 ? 126.578 0.330   2.385   1.00 0.00 ? 34  LYS A CA   4  
ATOM   9161  C  C    . LYS A 1 34 ? 126.511 -0.486  1.128   1.00 0.00 ? 34  LYS A C    4  
ATOM   9162  O  O    . LYS A 1 34 ? 126.704 -1.704  1.130   1.00 0.00 ? 34  LYS A O    4  
ATOM   9163  C  CB   . LYS A 1 34 ? 125.173 0.653   2.921   1.00 0.00 ? 34  LYS A CB   4  
ATOM   9164  C  CG   . LYS A 1 34 ? 124.276 -0.588  2.899   1.00 0.00 ? 34  LYS A CG   4  
ATOM   9165  C  CD   . LYS A 1 34 ? 124.919 -1.709  3.689   1.00 0.00 ? 34  LYS A CD   4  
ATOM   9166  C  CE   . LYS A 1 34 ? 123.920 -2.855  3.902   1.00 0.00 ? 34  LYS A CE   4  
ATOM   9167  N  NZ   . LYS A 1 34 ? 124.630 -4.158  3.779   1.00 0.00 ? 34  LYS A NZ   4  
ATOM   9168  H  H    . LYS A 1 34 ? 126.796 2.422   2.263   1.00 0.00 ? 34  LYS A H    4  
ATOM   9169  H  HA   . LYS A 1 34 ? 127.115 -0.228  3.137   1.00 0.00 ? 34  LYS A HA   4  
ATOM   9170  H  HB2  . LYS A 1 34 ? 125.260 1.004   3.941   1.00 0.00 ? 34  LYS A HB2  4  
ATOM   9171  H  HB3  . LYS A 1 34 ? 124.728 1.426   2.313   1.00 0.00 ? 34  LYS A HB3  4  
ATOM   9172  H  HG2  . LYS A 1 34 ? 123.320 -0.345  3.339   1.00 0.00 ? 34  LYS A HG2  4  
ATOM   9173  H  HG3  . LYS A 1 34 ? 124.129 -0.909  1.879   1.00 0.00 ? 34  LYS A HG3  4  
ATOM   9174  H  HD2  . LYS A 1 34 ? 125.752 -2.070  3.114   1.00 0.00 ? 34  LYS A HD2  4  
ATOM   9175  H  HD3  . LYS A 1 34 ? 125.263 -1.339  4.642   1.00 0.00 ? 34  LYS A HD3  4  
ATOM   9176  H  HE2  . LYS A 1 34 ? 123.488 -2.775  4.889   1.00 0.00 ? 34  LYS A HE2  4  
ATOM   9177  H  HE3  . LYS A 1 34 ? 123.136 -2.802  3.161   1.00 0.00 ? 34  LYS A HE3  4  
ATOM   9178  H  HZ1  . LYS A 1 34 ? 124.714 -4.414  2.775   1.00 0.00 ? 34  LYS A HZ1  4  
ATOM   9179  H  HZ2  . LYS A 1 34 ? 124.093 -4.894  4.282   1.00 0.00 ? 34  LYS A HZ2  4  
ATOM   9180  H  HZ3  . LYS A 1 34 ? 125.579 -4.077  4.195   1.00 0.00 ? 34  LYS A HZ3  4  
ATOM   9181  N  N    . GLU A 1 35 ? 126.244 0.198   0.053   1.00 0.00 ? 35  GLU A N    4  
ATOM   9182  C  CA   . GLU A 1 35 ? 126.145 -0.465  -1.224  1.00 0.00 ? 35  GLU A CA   4  
ATOM   9183  C  C    . GLU A 1 35 ? 127.494 -0.976  -1.717  1.00 0.00 ? 35  GLU A C    4  
ATOM   9184  O  O    . GLU A 1 35 ? 127.566 -2.074  -2.264  1.00 0.00 ? 35  GLU A O    4  
ATOM   9185  C  CB   . GLU A 1 35 ? 125.490 0.501   -2.187  1.00 0.00 ? 35  GLU A CB   4  
ATOM   9186  C  CG   . GLU A 1 35 ? 124.065 0.726   -1.675  1.00 0.00 ? 35  GLU A CG   4  
ATOM   9187  C  CD   . GLU A 1 35 ? 123.236 -0.545  -1.831  1.00 0.00 ? 35  GLU A CD   4  
ATOM   9188  O  OE1  . GLU A 1 35 ? 123.658 -1.416  -2.573  1.00 0.00 ? 35  GLU A OE1  4  
ATOM   9189  O  OE2  . GLU A 1 35 ? 122.191 -0.628  -1.207  1.00 0.00 ? 35  GLU A OE2  4  
ATOM   9190  H  H    . GLU A 1 35 ? 126.116 1.178   0.120   1.00 0.00 ? 35  GLU A H    4  
ATOM   9191  H  HA   . GLU A 1 35 ? 125.496 -1.317  -1.107  1.00 0.00 ? 35  GLU A HA   4  
ATOM   9192  H  HB2  . GLU A 1 35 ? 126.035 1.435   -2.201  1.00 0.00 ? 35  GLU A HB2  4  
ATOM   9193  H  HB3  . GLU A 1 35 ? 125.456 0.074   -3.177  1.00 0.00 ? 35  GLU A HB3  4  
ATOM   9194  H  HG2  . GLU A 1 35 ? 124.121 0.964   -0.609  1.00 0.00 ? 35  GLU A HG2  4  
ATOM   9195  H  HG3  . GLU A 1 35 ? 123.602 1.539   -2.212  1.00 0.00 ? 35  GLU A HG3  4  
ATOM   9196  N  N    . LEU A 1 36 ? 128.569 -0.210  -1.508  1.00 0.00 ? 36  LEU A N    4  
ATOM   9197  C  CA   . LEU A 1 36 ? 129.879 -0.682  -1.946  1.00 0.00 ? 36  LEU A CA   4  
ATOM   9198  C  C    . LEU A 1 36 ? 130.341 -1.896  -1.166  1.00 0.00 ? 36  LEU A C    4  
ATOM   9199  O  O    . LEU A 1 36 ? 130.747 -2.891  -1.753  1.00 0.00 ? 36  LEU A O    4  
ATOM   9200  C  CB   . LEU A 1 36 ? 130.942 0.410   -1.783  1.00 0.00 ? 36  LEU A CB   4  
ATOM   9201  C  CG   . LEU A 1 36 ? 130.732 1.530   -2.805  1.00 0.00 ? 36  LEU A CG   4  
ATOM   9202  C  CD1  . LEU A 1 36 ? 131.692 2.685   -2.489  1.00 0.00 ? 36  LEU A CD1  4  
ATOM   9203  C  CD2  . LEU A 1 36 ? 131.039 0.988   -4.220  1.00 0.00 ? 36  LEU A CD2  4  
ATOM   9204  H  H    . LEU A 1 36 ? 128.481 0.651   -1.050  1.00 0.00 ? 36  LEU A H    4  
ATOM   9205  H  HA   . LEU A 1 36 ? 129.817 -0.948  -2.988  1.00 0.00 ? 36  LEU A HA   4  
ATOM   9206  H  HB2  . LEU A 1 36 ? 130.874 0.821   -0.787  1.00 0.00 ? 36  LEU A HB2  4  
ATOM   9207  H  HB3  . LEU A 1 36 ? 131.923 -0.021  -1.923  1.00 0.00 ? 36  LEU A HB3  4  
ATOM   9208  H  HG   . LEU A 1 36 ? 129.711 1.879   -2.759  1.00 0.00 ? 36  LEU A HG   4  
ATOM   9209  H  HD11 . LEU A 1 36 ? 131.326 3.592   -2.948  1.00 0.00 ? 36  LEU A HD11 4  
ATOM   9210  H  HD12 . LEU A 1 36 ? 132.673 2.455   -2.881  1.00 0.00 ? 36  LEU A HD12 4  
ATOM   9211  H  HD13 . LEU A 1 36 ? 131.753 2.823   -1.420  1.00 0.00 ? 36  LEU A HD13 4  
ATOM   9212  H  HD21 . LEU A 1 36 ? 131.493 0.009   -4.156  1.00 0.00 ? 36  LEU A HD21 4  
ATOM   9213  H  HD22 . LEU A 1 36 ? 131.722 1.652   -4.732  1.00 0.00 ? 36  LEU A HD22 4  
ATOM   9214  H  HD23 . LEU A 1 36 ? 130.120 0.917   -4.778  1.00 0.00 ? 36  LEU A HD23 4  
ATOM   9215  N  N    . LEU A 1 37 ? 130.283 -1.822  0.158   1.00 0.00 ? 37  LEU A N    4  
ATOM   9216  C  CA   . LEU A 1 37 ? 130.730 -2.955  0.953   1.00 0.00 ? 37  LEU A CA   4  
ATOM   9217  C  C    . LEU A 1 37 ? 129.803 -4.147  0.791   1.00 0.00 ? 37  LEU A C    4  
ATOM   9218  O  O    . LEU A 1 37 ? 130.252 -5.289  0.665   1.00 0.00 ? 37  LEU A O    4  
ATOM   9219  C  CB   . LEU A 1 37 ? 130.791 -2.556  2.431   1.00 0.00 ? 37  LEU A CB   4  
ATOM   9220  C  CG   . LEU A 1 37 ? 131.724 -1.353  2.611   1.00 0.00 ? 37  LEU A CG   4  
ATOM   9221  C  CD1  . LEU A 1 37 ? 131.866 -1.038  4.103   1.00 0.00 ? 37  LEU A CD1  4  
ATOM   9222  C  CD2  . LEU A 1 37 ? 133.104 -1.672  2.027   1.00 0.00 ? 37  LEU A CD2  4  
ATOM   9223  H  H    . LEU A 1 37 ? 129.951 -1.006  0.598   1.00 0.00 ? 37  LEU A H    4  
ATOM   9224  H  HA   . LEU A 1 37 ? 131.719 -3.240  0.631   1.00 0.00 ? 37  LEU A HA   4  
ATOM   9225  H  HB2  . LEU A 1 37 ? 129.800 -2.295  2.773   1.00 0.00 ? 37  LEU A HB2  4  
ATOM   9226  H  HB3  . LEU A 1 37 ? 131.163 -3.386  3.011   1.00 0.00 ? 37  LEU A HB3  4  
ATOM   9227  H  HG   . LEU A 1 37 ? 131.306 -0.496  2.102   1.00 0.00 ? 37  LEU A HG   4  
ATOM   9228  H  HD11 . LEU A 1 37 ? 132.643 -1.656  4.529   1.00 0.00 ? 37  LEU A HD11 4  
ATOM   9229  H  HD12 . LEU A 1 37 ? 130.931 -1.237  4.604   1.00 0.00 ? 37  LEU A HD12 4  
ATOM   9230  H  HD13 . LEU A 1 37 ? 132.126 0.003   4.226   1.00 0.00 ? 37  LEU A HD13 4  
ATOM   9231  H  HD21 . LEU A 1 37 ? 133.106 -1.452  0.969   1.00 0.00 ? 37  LEU A HD21 4  
ATOM   9232  H  HD22 . LEU A 1 37 ? 133.325 -2.718  2.177   1.00 0.00 ? 37  LEU A HD22 4  
ATOM   9233  H  HD23 . LEU A 1 37 ? 133.853 -1.072  2.520   1.00 0.00 ? 37  LEU A HD23 4  
ATOM   9234  N  N    . GLN A 1 38 ? 128.504 -3.870  0.805   1.00 0.00 ? 38  GLN A N    4  
ATOM   9235  C  CA   . GLN A 1 38 ? 127.510 -4.921  0.682   1.00 0.00 ? 38  GLN A CA   4  
ATOM   9236  C  C    . GLN A 1 38 ? 127.551 -5.641  -0.652  1.00 0.00 ? 38  GLN A C    4  
ATOM   9237  O  O    . GLN A 1 38 ? 127.430 -6.864  -0.701  1.00 0.00 ? 38  GLN A O    4  
ATOM   9238  C  CB   . GLN A 1 38 ? 126.123 -4.329  0.915   1.00 0.00 ? 38  GLN A CB   4  
ATOM   9239  C  CG   . GLN A 1 38 ? 125.076 -5.436  0.900   1.00 0.00 ? 38  GLN A CG   4  
ATOM   9240  C  CD   . GLN A 1 38 ? 123.684 -4.845  1.094   1.00 0.00 ? 38  GLN A CD   4  
ATOM   9241  O  OE1  . GLN A 1 38 ? 123.210 -4.080  0.256   1.00 0.00 ? 38  GLN A OE1  4  
ATOM   9242  N  NE2  . GLN A 1 38 ? 122.996 -5.159  2.159   1.00 0.00 ? 38  GLN A NE2  4  
ATOM   9243  H  H    . GLN A 1 38 ? 128.209 -2.938  0.915   1.00 0.00 ? 38  GLN A H    4  
ATOM   9244  H  HA   . GLN A 1 38 ? 127.697 -5.646  1.452   1.00 0.00 ? 38  GLN A HA   4  
ATOM   9245  H  HB2  . GLN A 1 38 ? 126.107 -3.839  1.870   1.00 0.00 ? 38  GLN A HB2  4  
ATOM   9246  H  HB3  . GLN A 1 38 ? 125.900 -3.614  0.137   1.00 0.00 ? 38  GLN A HB3  4  
ATOM   9247  H  HG2  . GLN A 1 38 ? 125.114 -5.936  -0.047  1.00 0.00 ? 38  GLN A HG2  4  
ATOM   9248  H  HG3  . GLN A 1 38 ? 125.284 -6.142  1.686   1.00 0.00 ? 38  GLN A HG3  4  
ATOM   9249  H  HE21 . GLN A 1 38 ? 123.375 -5.770  2.825   1.00 0.00 ? 38  GLN A HE21 4  
ATOM   9250  H  HE22 . GLN A 1 38 ? 122.100 -4.783  2.291   1.00 0.00 ? 38  GLN A HE22 4  
ATOM   9251  N  N    . THR A 1 39 ? 127.697 -4.896  -1.736  1.00 0.00 ? 39  THR A N    4  
ATOM   9252  C  CA   . THR A 1 39 ? 127.717 -5.530  -3.042  1.00 0.00 ? 39  THR A CA   4  
ATOM   9253  C  C    . THR A 1 39 ? 129.103 -6.053  -3.409  1.00 0.00 ? 39  THR A C    4  
ATOM   9254  O  O    . THR A 1 39 ? 129.236 -7.175  -3.897  1.00 0.00 ? 39  THR A O    4  
ATOM   9255  C  CB   . THR A 1 39 ? 127.210 -4.555  -4.114  1.00 0.00 ? 39  THR A CB   4  
ATOM   9256  O  OG1  . THR A 1 39 ? 126.713 -5.293  -5.221  1.00 0.00 ? 39  THR A OG1  4  
ATOM   9257  C  CG2  . THR A 1 39 ? 128.344 -3.641  -4.582  1.00 0.00 ? 39  THR A CG2  4  
ATOM   9258  H  H    . THR A 1 39 ? 127.774 -3.921  -1.660  1.00 0.00 ? 39  THR A H    4  
ATOM   9259  H  HA   . THR A 1 39 ? 127.037 -6.371  -3.010  1.00 0.00 ? 39  THR A HA   4  
ATOM   9260  H  HB   . THR A 1 39 ? 126.417 -3.951  -3.701  1.00 0.00 ? 39  THR A HB   4  
ATOM   9261  H  HG1  . THR A 1 39 ? 126.743 -6.226  -4.993  1.00 0.00 ? 39  THR A HG1  4  
ATOM   9262  H  HG21 . THR A 1 39 ? 127.937 -2.851  -5.197  1.00 0.00 ? 39  THR A HG21 4  
ATOM   9263  H  HG22 . THR A 1 39 ? 129.057 -4.213  -5.157  1.00 0.00 ? 39  THR A HG22 4  
ATOM   9264  H  HG23 . THR A 1 39 ? 128.833 -3.212  -3.724  1.00 0.00 ? 39  THR A HG23 4  
ATOM   9265  N  N    . GLU A 1 40 ? 130.133 -5.230  -3.206  1.00 0.00 ? 40  GLU A N    4  
ATOM   9266  C  CA   . GLU A 1 40 ? 131.485 -5.651  -3.568  1.00 0.00 ? 40  GLU A CA   4  
ATOM   9267  C  C    . GLU A 1 40 ? 132.038 -6.683  -2.592  1.00 0.00 ? 40  GLU A C    4  
ATOM   9268  O  O    . GLU A 1 40 ? 132.789 -7.575  -2.986  1.00 0.00 ? 40  GLU A O    4  
ATOM   9269  C  CB   . GLU A 1 40 ? 132.420 -4.442  -3.613  1.00 0.00 ? 40  GLU A CB   4  
ATOM   9270  C  CG   . GLU A 1 40 ? 131.924 -3.468  -4.685  1.00 0.00 ? 40  GLU A CG   4  
ATOM   9271  C  CD   . GLU A 1 40 ? 132.873 -2.284  -4.820  1.00 0.00 ? 40  GLU A CD   4  
ATOM   9272  O  OE1  . GLU A 1 40 ? 133.757 -2.158  -3.994  1.00 0.00 ? 40  GLU A OE1  4  
ATOM   9273  O  OE2  . GLU A 1 40 ? 132.694 -1.516  -5.748  1.00 0.00 ? 40  GLU A OE2  4  
ATOM   9274  H  H    . GLU A 1 40 ? 129.980 -4.338  -2.826  1.00 0.00 ? 40  GLU A H    4  
ATOM   9275  H  HA   . GLU A 1 40 ? 131.454 -6.093  -4.552  1.00 0.00 ? 40  GLU A HA   4  
ATOM   9276  H  HB2  . GLU A 1 40 ? 132.442 -3.958  -2.653  1.00 0.00 ? 40  GLU A HB2  4  
ATOM   9277  H  HB3  . GLU A 1 40 ? 133.412 -4.774  -3.866  1.00 0.00 ? 40  GLU A HB3  4  
ATOM   9278  H  HG2  . GLU A 1 40 ? 131.857 -3.980  -5.628  1.00 0.00 ? 40  GLU A HG2  4  
ATOM   9279  H  HG3  . GLU A 1 40 ? 130.950 -3.106  -4.410  1.00 0.00 ? 40  GLU A HG3  4  
ATOM   9280  N  N    . LEU A 1 41 ? 131.669 -6.559  -1.318  1.00 0.00 ? 41  LEU A N    4  
ATOM   9281  C  CA   . LEU A 1 41 ? 132.145 -7.493  -0.301  1.00 0.00 ? 41  LEU A CA   4  
ATOM   9282  C  C    . LEU A 1 41 ? 130.977 -8.165  0.405   1.00 0.00 ? 41  LEU A C    4  
ATOM   9283  O  O    . LEU A 1 41 ? 130.907 -8.176  1.636   1.00 0.00 ? 41  LEU A O    4  
ATOM   9284  C  CB   . LEU A 1 41 ? 133.023 -6.763  0.716   1.00 0.00 ? 41  LEU A CB   4  
ATOM   9285  C  CG   . LEU A 1 41 ? 134.430 -6.539  0.134   1.00 0.00 ? 41  LEU A CG   4  
ATOM   9286  C  CD1  . LEU A 1 41 ? 134.396 -5.463  -0.962  1.00 0.00 ? 41  LEU A CD1  4  
ATOM   9287  C  CD2  . LEU A 1 41 ? 135.373 -6.093  1.257   1.00 0.00 ? 41  LEU A CD2  4  
ATOM   9288  H  H    . LEU A 1 41 ? 131.067 -5.826  -1.053  1.00 0.00 ? 41  LEU A H    4  
ATOM   9289  H  HA   . LEU A 1 41 ? 132.738 -8.259  -0.780  1.00 0.00 ? 41  LEU A HA   4  
ATOM   9290  H  HB2  . LEU A 1 41 ? 132.575 -5.810  0.958   1.00 0.00 ? 41  LEU A HB2  4  
ATOM   9291  H  HB3  . LEU A 1 41 ? 133.096 -7.360  1.607   1.00 0.00 ? 41  LEU A HB3  4  
ATOM   9292  H  HG   . LEU A 1 41 ? 134.794 -7.466  -0.287  1.00 0.00 ? 41  LEU A HG   4  
ATOM   9293  H  HD11 . LEU A 1 41 ? 133.524 -4.837  -0.839  1.00 0.00 ? 41  LEU A HD11 4  
ATOM   9294  H  HD12 . LEU A 1 41 ? 134.361 -5.939  -1.929  1.00 0.00 ? 41  LEU A HD12 4  
ATOM   9295  H  HD13 . LEU A 1 41 ? 135.286 -4.854  -0.900  1.00 0.00 ? 41  LEU A HD13 4  
ATOM   9296  H  HD21 . LEU A 1 41 ? 136.281 -5.697  0.827   1.00 0.00 ? 41  LEU A HD21 4  
ATOM   9297  H  HD22 . LEU A 1 41 ? 135.611 -6.938  1.885   1.00 0.00 ? 41  LEU A HD22 4  
ATOM   9298  H  HD23 . LEU A 1 41 ? 134.892 -5.329  1.847   1.00 0.00 ? 41  LEU A HD23 4  
ATOM   9299  N  N    . SER A 1 42 ? 130.067 -8.731  -0.376  1.00 0.00 ? 42  SER A N    4  
ATOM   9300  C  CA   . SER A 1 42 ? 128.907 -9.398  0.191   1.00 0.00 ? 42  SER A CA   4  
ATOM   9301  C  C    . SER A 1 42 ? 129.356 -10.513 1.120   1.00 0.00 ? 42  SER A C    4  
ATOM   9302  O  O    . SER A 1 42 ? 128.634 -10.898 2.037   1.00 0.00 ? 42  SER A O    4  
ATOM   9303  C  CB   . SER A 1 42 ? 128.036 -9.976  -0.923  1.00 0.00 ? 42  SER A CB   4  
ATOM   9304  O  OG   . SER A 1 42 ? 128.732 -11.040 -1.560  1.00 0.00 ? 42  SER A OG   4  
ATOM   9305  H  H    . SER A 1 42 ? 130.177 -8.695  -1.349  1.00 0.00 ? 42  SER A H    4  
ATOM   9306  H  HA   . SER A 1 42 ? 128.328 -8.681  0.755   1.00 0.00 ? 42  SER A HA   4  
ATOM   9307  H  HB2  . SER A 1 42 ? 127.117 -10.353 -0.507  1.00 0.00 ? 42  SER A HB2  4  
ATOM   9308  H  HB3  . SER A 1 42 ? 127.809 -9.199  -1.642  1.00 0.00 ? 42  SER A HB3  4  
ATOM   9309  H  HG   . SER A 1 42 ? 129.506 -11.246 -1.030  1.00 0.00 ? 42  SER A HG   4  
ATOM   9310  N  N    . GLY A 1 43 ? 130.554 -11.029 0.873   1.00 0.00 ? 43  GLY A N    4  
ATOM   9311  C  CA   . GLY A 1 43 ? 131.099 -12.102 1.693   1.00 0.00 ? 43  GLY A CA   4  
ATOM   9312  C  C    . GLY A 1 43 ? 131.871 -11.559 2.896   1.00 0.00 ? 43  GLY A C    4  
ATOM   9313  O  O    . GLY A 1 43 ? 131.445 -11.718 4.040   1.00 0.00 ? 43  GLY A O    4  
ATOM   9314  H  H    . GLY A 1 43 ? 131.083 -10.680 0.126   1.00 0.00 ? 43  GLY A H    4  
ATOM   9315  H  HA2  . GLY A 1 43 ? 130.286 -12.722 2.045   1.00 0.00 ? 43  GLY A HA2  4  
ATOM   9316  H  HA3  . GLY A 1 43 ? 131.765 -12.702 1.092   1.00 0.00 ? 43  GLY A HA3  4  
ATOM   9317  N  N    . PHE A 1 44 ? 133.023 -10.942 2.633   1.00 0.00 ? 44  PHE A N    4  
ATOM   9318  C  CA   . PHE A 1 44 ? 133.864 -10.412 3.708   1.00 0.00 ? 44  PHE A CA   4  
ATOM   9319  C  C    . PHE A 1 44 ? 133.121 -9.390  4.579   1.00 0.00 ? 44  PHE A C    4  
ATOM   9320  O  O    . PHE A 1 44 ? 133.227 -9.417  5.804   1.00 0.00 ? 44  PHE A O    4  
ATOM   9321  C  CB   . PHE A 1 44 ? 135.096 -9.744  3.096   1.00 0.00 ? 44  PHE A CB   4  
ATOM   9322  C  CG   . PHE A 1 44 ? 135.946 -10.791 2.417   1.00 0.00 ? 44  PHE A CG   4  
ATOM   9323  C  CD1  . PHE A 1 44 ? 136.861 -11.543 3.162   1.00 0.00 ? 44  PHE A CD1  4  
ATOM   9324  C  CD2  . PHE A 1 44 ? 135.815 -11.012 1.040   1.00 0.00 ? 44  PHE A CD2  4  
ATOM   9325  C  CE1  . PHE A 1 44 ? 137.646 -12.516 2.530   1.00 0.00 ? 44  PHE A CE1  4  
ATOM   9326  C  CE2  . PHE A 1 44 ? 136.600 -11.984 0.409   1.00 0.00 ? 44  PHE A CE2  4  
ATOM   9327  C  CZ   . PHE A 1 44 ? 137.515 -12.736 1.154   1.00 0.00 ? 44  PHE A CZ   4  
ATOM   9328  H  H    . PHE A 1 44 ? 133.324 -10.863 1.705   1.00 0.00 ? 44  PHE A H    4  
ATOM   9329  H  HA   . PHE A 1 44 ? 134.197 -11.226 4.326   1.00 0.00 ? 44  PHE A HA   4  
ATOM   9330  H  HB2  . PHE A 1 44 ? 134.783 -9.007  2.372   1.00 0.00 ? 44  PHE A HB2  4  
ATOM   9331  H  HB3  . PHE A 1 44 ? 135.671 -9.265  3.875   1.00 0.00 ? 44  PHE A HB3  4  
ATOM   9332  H  HD1  . PHE A 1 44 ? 136.962 -11.374 4.224   1.00 0.00 ? 44  PHE A HD1  4  
ATOM   9333  H  HD2  . PHE A 1 44 ? 135.109 -10.430 0.466   1.00 0.00 ? 44  PHE A HD2  4  
ATOM   9334  H  HE1  . PHE A 1 44 ? 138.352 -13.097 3.105   1.00 0.00 ? 44  PHE A HE1  4  
ATOM   9335  H  HE2  . PHE A 1 44 ? 136.498 -12.153 -0.652  1.00 0.00 ? 44  PHE A HE2  4  
ATOM   9336  H  HZ   . PHE A 1 44 ? 138.120 -13.487 0.667   1.00 0.00 ? 44  PHE A HZ   4  
ATOM   9337  N  N    . LEU A 1 45 ? 132.376 -8.494  3.939   1.00 0.00 ? 45  LEU A N    4  
ATOM   9338  C  CA   . LEU A 1 45 ? 131.620 -7.464  4.657   1.00 0.00 ? 45  LEU A CA   4  
ATOM   9339  C  C    . LEU A 1 45 ? 130.195 -7.905  4.971   1.00 0.00 ? 45  LEU A C    4  
ATOM   9340  O  O    . LEU A 1 45 ? 129.450 -7.149  5.587   1.00 0.00 ? 45  LEU A O    4  
ATOM   9341  C  CB   . LEU A 1 45 ? 131.606 -6.135  3.889   1.00 0.00 ? 45  LEU A CB   4  
ATOM   9342  C  CG   . LEU A 1 45 ? 132.939 -5.359  4.041   1.00 0.00 ? 45  LEU A CG   4  
ATOM   9343  C  CD1  . LEU A 1 45 ? 132.837 -4.409  5.237   1.00 0.00 ? 45  LEU A CD1  4  
ATOM   9344  C  CD2  . LEU A 1 45 ? 134.147 -6.288  4.259   1.00 0.00 ? 45  LEU A CD2  4  
ATOM   9345  H  H    . LEU A 1 45 ? 132.327 -8.521  2.957   1.00 0.00 ? 45  LEU A H    4  
ATOM   9346  H  HA   . LEU A 1 45 ? 132.109 -7.294  5.602   1.00 0.00 ? 45  LEU A HA   4  
ATOM   9347  H  HB2  . LEU A 1 45 ? 131.436 -6.336  2.845   1.00 0.00 ? 45  LEU A HB2  4  
ATOM   9348  H  HB3  . LEU A 1 45 ? 130.796 -5.524  4.262   1.00 0.00 ? 45  LEU A HB3  4  
ATOM   9349  H  HG   . LEU A 1 45 ? 133.100 -4.771  3.147   1.00 0.00 ? 45  LEU A HG   4  
ATOM   9350  H  HD11 . LEU A 1 45 ? 131.979 -3.765  5.115   1.00 0.00 ? 45  LEU A HD11 4  
ATOM   9351  H  HD12 . LEU A 1 45 ? 133.732 -3.808  5.297   1.00 0.00 ? 45  LEU A HD12 4  
ATOM   9352  H  HD13 . LEU A 1 45 ? 132.728 -4.984  6.145   1.00 0.00 ? 45  LEU A HD13 4  
ATOM   9353  H  HD21 . LEU A 1 45 ? 135.056 -5.732  4.079   1.00 0.00 ? 45  LEU A HD21 4  
ATOM   9354  H  HD22 . LEU A 1 45 ? 134.104 -7.117  3.581   1.00 0.00 ? 45  LEU A HD22 4  
ATOM   9355  H  HD23 . LEU A 1 45 ? 134.156 -6.649  5.275   1.00 0.00 ? 45  LEU A HD23 4  
ATOM   9356  N  N    . ASP A 1 46 ? 129.820 -9.102  4.511   1.00 0.00 ? 46  ASP A N    4  
ATOM   9357  C  CA   . ASP A 1 46 ? 128.457 -9.623  4.703   1.00 0.00 ? 46  ASP A CA   4  
ATOM   9358  C  C    . ASP A 1 46 ? 127.721 -8.937  5.859   1.00 0.00 ? 46  ASP A C    4  
ATOM   9359  O  O    . ASP A 1 46 ? 127.563 -9.492  6.945   1.00 0.00 ? 46  ASP A O    4  
ATOM   9360  C  CB   . ASP A 1 46 ? 128.525 -11.132 4.970   1.00 0.00 ? 46  ASP A CB   4  
ATOM   9361  C  CG   . ASP A 1 46 ? 129.304 -11.412 6.254   1.00 0.00 ? 46  ASP A CG   4  
ATOM   9362  O  OD1  . ASP A 1 46 ? 129.593 -10.469 6.972   1.00 0.00 ? 46  ASP A OD1  4  
ATOM   9363  O  OD2  . ASP A 1 46 ? 129.623 -12.566 6.486   1.00 0.00 ? 46  ASP A OD2  4  
ATOM   9364  H  H    . ASP A 1 46 ? 130.463 -9.635  4.000   1.00 0.00 ? 46  ASP A H    4  
ATOM   9365  H  HA   . ASP A 1 46 ? 127.897 -9.464  3.795   1.00 0.00 ? 46  ASP A HA   4  
ATOM   9366  H  HB2  . ASP A 1 46 ? 127.522 -11.523 5.069   1.00 0.00 ? 46  ASP A HB2  4  
ATOM   9367  H  HB3  . ASP A 1 46 ? 129.018 -11.620 4.144   1.00 0.00 ? 46  ASP A HB3  4  
ATOM   9368  N  N    . ALA A 1 47 ? 127.263 -7.716  5.586   1.00 0.00 ? 47  ALA A N    4  
ATOM   9369  C  CA   . ALA A 1 47 ? 126.532 -6.918  6.563   1.00 0.00 ? 47  ALA A CA   4  
ATOM   9370  C  C    . ALA A 1 47 ? 125.220 -7.588  6.950   1.00 0.00 ? 47  ALA A C    4  
ATOM   9371  O  O    . ALA A 1 47 ? 124.703 -7.373  8.045   1.00 0.00 ? 47  ALA A O    4  
ATOM   9372  C  CB   . ALA A 1 47 ? 126.249 -5.528  5.987   1.00 0.00 ? 47  ALA A CB   4  
ATOM   9373  H  H    . ALA A 1 47 ? 127.419 -7.343  4.693   1.00 0.00 ? 47  ALA A H    4  
ATOM   9374  H  HA   . ALA A 1 47 ? 127.140 -6.806  7.447   1.00 0.00 ? 47  ALA A HA   4  
ATOM   9375  H  HB1  . ALA A 1 47 ? 127.100 -4.886  6.162   1.00 0.00 ? 47  ALA A HB1  4  
ATOM   9376  H  HB2  . ALA A 1 47 ? 125.377 -5.107  6.467   1.00 0.00 ? 47  ALA A HB2  4  
ATOM   9377  H  HB3  . ALA A 1 47 ? 126.073 -5.608  4.925   1.00 0.00 ? 47  ALA A HB3  4  
ATOM   9378  N  N    . GLN A 1 48 ? 124.673 -8.387  6.041   1.00 0.00 ? 48  GLN A N    4  
ATOM   9379  C  CA   . GLN A 1 48 ? 123.409 -9.059  6.304   1.00 0.00 ? 48  GLN A CA   4  
ATOM   9380  C  C    . GLN A 1 48 ? 123.474 -9.816  7.624   1.00 0.00 ? 48  GLN A C    4  
ATOM   9381  O  O    . GLN A 1 48 ? 122.496 -9.858  8.371   1.00 0.00 ? 48  GLN A O    4  
ATOM   9382  C  CB   . GLN A 1 48 ? 123.087 -10.034 5.171   1.00 0.00 ? 48  GLN A CB   4  
ATOM   9383  C  CG   . GLN A 1 48 ? 121.670 -10.580 5.354   1.00 0.00 ? 48  GLN A CG   4  
ATOM   9384  C  CD   . GLN A 1 48 ? 121.386 -11.658 4.313   1.00 0.00 ? 48  GLN A CD   4  
ATOM   9385  O  OE1  . GLN A 1 48 ? 122.097 -12.662 4.248   1.00 0.00 ? 48  GLN A OE1  4  
ATOM   9386  N  NE2  . GLN A 1 48 ? 120.385 -11.509 3.490   1.00 0.00 ? 48  GLN A NE2  4  
ATOM   9387  H  H    . GLN A 1 48 ? 125.119 -8.513  5.177   1.00 0.00 ? 48  GLN A H    4  
ATOM   9388  H  HA   . GLN A 1 48 ? 122.624 -8.320  6.361   1.00 0.00 ? 48  GLN A HA   4  
ATOM   9389  H  HB2  . GLN A 1 48 ? 123.156 -9.520  4.222   1.00 0.00 ? 48  GLN A HB2  4  
ATOM   9390  H  HB3  . GLN A 1 48 ? 123.792 -10.852 5.187   1.00 0.00 ? 48  GLN A HB3  4  
ATOM   9391  H  HG2  . GLN A 1 48 ? 121.575 -11.003 6.344   1.00 0.00 ? 48  GLN A HG2  4  
ATOM   9392  H  HG3  . GLN A 1 48 ? 120.958 -9.776  5.238   1.00 0.00 ? 48  GLN A HG3  4  
ATOM   9393  H  HE21 . GLN A 1 48 ? 119.820 -10.710 3.544   1.00 0.00 ? 48  GLN A HE21 4  
ATOM   9394  H  HE22 . GLN A 1 48 ? 120.196 -12.197 2.819   1.00 0.00 ? 48  GLN A HE22 4  
ATOM   9395  N  N    . LYS A 1 49 ? 124.629 -10.403 7.917   1.00 0.00 ? 49  LYS A N    4  
ATOM   9396  C  CA   . LYS A 1 49 ? 124.789 -11.140 9.163   1.00 0.00 ? 49  LYS A CA   4  
ATOM   9397  C  C    . LYS A 1 49 ? 124.522 -10.192 10.316  1.00 0.00 ? 49  LYS A C    4  
ATOM   9398  O  O    . LYS A 1 49 ? 123.916 -10.555 11.323  1.00 0.00 ? 49  LYS A O    4  
ATOM   9399  C  CB   . LYS A 1 49 ? 126.227 -11.644 9.280   1.00 0.00 ? 49  LYS A CB   4  
ATOM   9400  C  CG   . LYS A 1 49 ? 126.605 -12.444 8.035   1.00 0.00 ? 49  LYS A CG   4  
ATOM   9401  C  CD   . LYS A 1 49 ? 125.741 -13.696 7.903   1.00 0.00 ? 49  LYS A CD   4  
ATOM   9402  C  CE   . LYS A 1 49 ? 126.268 -14.508 6.732   1.00 0.00 ? 49  LYS A CE   4  
ATOM   9403  N  NZ   . LYS A 1 49 ? 125.657 -15.867 6.744   1.00 0.00 ? 49  LYS A NZ   4  
ATOM   9404  H  H    . LYS A 1 49 ? 125.381 -10.334 7.293   1.00 0.00 ? 49  LYS A H    4  
ATOM   9405  H  HA   . LYS A 1 49 ? 124.099 -11.965 9.206   1.00 0.00 ? 49  LYS A HA   4  
ATOM   9406  H  HB2  . LYS A 1 49 ? 126.895 -10.800 9.379   1.00 0.00 ? 49  LYS A HB2  4  
ATOM   9407  H  HB3  . LYS A 1 49 ? 126.316 -12.275 10.151  1.00 0.00 ? 49  LYS A HB3  4  
ATOM   9408  H  HG2  . LYS A 1 49 ? 126.469 -11.825 7.161   1.00 0.00 ? 49  LYS A HG2  4  
ATOM   9409  H  HG3  . LYS A 1 49 ? 127.643 -12.735 8.104   1.00 0.00 ? 49  LYS A HG3  4  
ATOM   9410  H  HD2  . LYS A 1 49 ? 125.798 -14.279 8.810   1.00 0.00 ? 49  LYS A HD2  4  
ATOM   9411  H  HD3  . LYS A 1 49 ? 124.719 -13.420 7.707   1.00 0.00 ? 49  LYS A HD3  4  
ATOM   9412  H  HE2  . LYS A 1 49 ? 126.012 -14.000 5.813   1.00 0.00 ? 49  LYS A HE2  4  
ATOM   9413  H  HE3  . LYS A 1 49 ? 127.340 -14.589 6.810   1.00 0.00 ? 49  LYS A HE3  4  
ATOM   9414  H  HZ1  . LYS A 1 49 ? 125.296 -16.076 7.696   1.00 0.00 ? 49  LYS A HZ1  4  
ATOM   9415  H  HZ2  . LYS A 1 49 ? 126.375 -16.573 6.481   1.00 0.00 ? 49  LYS A HZ2  4  
ATOM   9416  H  HZ3  . LYS A 1 49 ? 124.871 -15.901 6.064   1.00 0.00 ? 49  LYS A HZ3  4  
ATOM   9417  N  N    . ASP A 1 50 ? 124.981 -8.962  10.130  1.00 0.00 ? 50  ASP A N    4  
ATOM   9418  C  CA   . ASP A 1 50 ? 124.807 -7.910  11.131  1.00 0.00 ? 50  ASP A CA   4  
ATOM   9419  C  C    . ASP A 1 50 ? 124.544 -6.563  10.458  1.00 0.00 ? 50  ASP A C    4  
ATOM   9420  O  O    . ASP A 1 50 ? 125.478 -5.814  10.174  1.00 0.00 ? 50  ASP A O    4  
ATOM   9421  C  CB   . ASP A 1 50 ? 126.064 -7.796  11.999  1.00 0.00 ? 50  ASP A CB   4  
ATOM   9422  C  CG   . ASP A 1 50 ? 126.242 -9.048  12.853  1.00 0.00 ? 50  ASP A CG   4  
ATOM   9423  O  OD1  . ASP A 1 50 ? 125.294 -9.804  12.970  1.00 0.00 ? 50  ASP A OD1  4  
ATOM   9424  O  OD2  . ASP A 1 50 ? 127.324 -9.224  13.389  1.00 0.00 ? 50  ASP A OD2  4  
ATOM   9425  H  H    . ASP A 1 50 ? 125.449 -8.760  9.288   1.00 0.00 ? 50  ASP A H    4  
ATOM   9426  H  HA   . ASP A 1 50 ? 123.967 -8.160  11.762  1.00 0.00 ? 50  ASP A HA   4  
ATOM   9427  H  HB2  . ASP A 1 50 ? 126.927 -7.675  11.362  1.00 0.00 ? 50  ASP A HB2  4  
ATOM   9428  H  HB3  . ASP A 1 50 ? 125.974 -6.935  12.645  1.00 0.00 ? 50  ASP A HB3  4  
ATOM   9429  N  N    . VAL A 1 51 ? 123.274 -6.256  10.209  1.00 0.00 ? 51  VAL A N    4  
ATOM   9430  C  CA   . VAL A 1 51 ? 122.920 -4.989  9.575   1.00 0.00 ? 51  VAL A CA   4  
ATOM   9431  C  C    . VAL A 1 51 ? 123.365 -3.815  10.445  1.00 0.00 ? 51  VAL A C    4  
ATOM   9432  O  O    . VAL A 1 51 ? 123.848 -2.800  9.943   1.00 0.00 ? 51  VAL A O    4  
ATOM   9433  C  CB   . VAL A 1 51 ? 121.408 -4.919  9.355   1.00 0.00 ? 51  VAL A CB   4  
ATOM   9434  C  CG1  . VAL A 1 51 ? 121.028 -3.523  8.859   1.00 0.00 ? 51  VAL A CG1  4  
ATOM   9435  C  CG2  . VAL A 1 51 ? 120.999 -5.959  8.309   1.00 0.00 ? 51  VAL A CG2  4  
ATOM   9436  H  H    . VAL A 1 51 ? 122.566 -6.886  10.460  1.00 0.00 ? 51  VAL A H    4  
ATOM   9437  H  HA   . VAL A 1 51 ? 123.416 -4.923  8.619   1.00 0.00 ? 51  VAL A HA   4  
ATOM   9438  H  HB   . VAL A 1 51 ? 120.899 -5.121  10.286  1.00 0.00 ? 51  VAL A HB   4  
ATOM   9439  H  HG11 . VAL A 1 51 ? 121.036 -2.832  9.689   1.00 0.00 ? 51  VAL A HG11 4  
ATOM   9440  H  HG12 . VAL A 1 51 ? 120.040 -3.551  8.424   1.00 0.00 ? 51  VAL A HG12 4  
ATOM   9441  H  HG13 . VAL A 1 51 ? 121.740 -3.199  8.114   1.00 0.00 ? 51  VAL A HG13 4  
ATOM   9442  H  HG21 . VAL A 1 51 ? 121.237 -5.590  7.323   1.00 0.00 ? 51  VAL A HG21 4  
ATOM   9443  H  HG22 . VAL A 1 51 ? 119.937 -6.142  8.380   1.00 0.00 ? 51  VAL A HG22 4  
ATOM   9444  H  HG23 . VAL A 1 51 ? 121.535 -6.879  8.488   1.00 0.00 ? 51  VAL A HG23 4  
ATOM   9445  N  N    . ASP A 1 52 ? 123.198 -3.972  11.752  1.00 0.00 ? 52  ASP A N    4  
ATOM   9446  C  CA   . ASP A 1 52 ? 123.580 -2.937  12.709  1.00 0.00 ? 52  ASP A CA   4  
ATOM   9447  C  C    . ASP A 1 52 ? 125.051 -2.561  12.550  1.00 0.00 ? 52  ASP A C    4  
ATOM   9448  O  O    . ASP A 1 52 ? 125.439 -1.416  12.780  1.00 0.00 ? 52  ASP A O    4  
ATOM   9449  C  CB   . ASP A 1 52 ? 123.330 -3.429  14.136  1.00 0.00 ? 52  ASP A CB   4  
ATOM   9450  C  CG   . ASP A 1 52 ? 123.514 -2.282  15.122  1.00 0.00 ? 52  ASP A CG   4  
ATOM   9451  O  OD1  . ASP A 1 52 ? 123.720 -1.166  14.672  1.00 0.00 ? 52  ASP A OD1  4  
ATOM   9452  O  OD2  . ASP A 1 52 ? 123.448 -2.534  16.313  1.00 0.00 ? 52  ASP A OD2  4  
ATOM   9453  H  H    . ASP A 1 52 ? 122.809 -4.807  12.085  1.00 0.00 ? 52  ASP A H    4  
ATOM   9454  H  HA   . ASP A 1 52 ? 122.975 -2.059  12.534  1.00 0.00 ? 52  ASP A HA   4  
ATOM   9455  H  HB2  . ASP A 1 52 ? 122.322 -3.809  14.211  1.00 0.00 ? 52  ASP A HB2  4  
ATOM   9456  H  HB3  . ASP A 1 52 ? 124.029 -4.218  14.370  1.00 0.00 ? 52  ASP A HB3  4  
ATOM   9457  N  N    . ALA A 1 53 ? 125.866 -3.543  12.187  1.00 0.00 ? 53  ALA A N    4  
ATOM   9458  C  CA   . ALA A 1 53 ? 127.301 -3.326  12.035  1.00 0.00 ? 53  ALA A CA   4  
ATOM   9459  C  C    . ALA A 1 53 ? 127.610 -2.232  11.013  1.00 0.00 ? 53  ALA A C    4  
ATOM   9460  O  O    . ALA A 1 53 ? 128.631 -1.552  11.124  1.00 0.00 ? 53  ALA A O    4  
ATOM   9461  C  CB   . ALA A 1 53 ? 127.977 -4.628  11.602  1.00 0.00 ? 53  ALA A CB   4  
ATOM   9462  H  H    . ALA A 1 53 ? 125.499 -4.440  12.041  1.00 0.00 ? 53  ALA A H    4  
ATOM   9463  H  HA   . ALA A 1 53 ? 127.709 -3.031  12.990  1.00 0.00 ? 53  ALA A HA   4  
ATOM   9464  H  HB1  . ALA A 1 53 ? 127.701 -5.420  12.282  1.00 0.00 ? 53  ALA A HB1  4  
ATOM   9465  H  HB2  . ALA A 1 53 ? 129.050 -4.499  11.616  1.00 0.00 ? 53  ALA A HB2  4  
ATOM   9466  H  HB3  . ALA A 1 53 ? 127.659 -4.884  10.602  1.00 0.00 ? 53  ALA A HB3  4  
ATOM   9467  N  N    . VAL A 1 54 ? 126.745 -2.056  10.017  1.00 0.00 ? 54  VAL A N    4  
ATOM   9468  C  CA   . VAL A 1 54 ? 126.997 -1.029  9.010   1.00 0.00 ? 54  VAL A CA   4  
ATOM   9469  C  C    . VAL A 1 54 ? 127.149 0.334   9.675   1.00 0.00 ? 54  VAL A C    4  
ATOM   9470  O  O    . VAL A 1 54 ? 128.070 1.095   9.356   1.00 0.00 ? 54  VAL A O    4  
ATOM   9471  C  CB   . VAL A 1 54 ? 125.833 -0.973  8.019   1.00 0.00 ? 54  VAL A CB   4  
ATOM   9472  C  CG1  . VAL A 1 54 ? 125.982 0.259   7.123   1.00 0.00 ? 54  VAL A CG1  4  
ATOM   9473  C  CG2  . VAL A 1 54 ? 125.841 -2.235  7.153   1.00 0.00 ? 54  VAL A CG2  4  
ATOM   9474  H  H    . VAL A 1 54 ? 125.944 -2.618  9.956   1.00 0.00 ? 54  VAL A H    4  
ATOM   9475  H  HA   . VAL A 1 54 ? 127.902 -1.266  8.472   1.00 0.00 ? 54  VAL A HA   4  
ATOM   9476  H  HB   . VAL A 1 54 ? 124.900 -0.913  8.562   1.00 0.00 ? 54  VAL A HB   4  
ATOM   9477  H  HG11 . VAL A 1 54 ? 125.274 0.202   6.310   1.00 0.00 ? 54  VAL A HG11 4  
ATOM   9478  H  HG12 . VAL A 1 54 ? 126.985 0.297   6.725   1.00 0.00 ? 54  VAL A HG12 4  
ATOM   9479  H  HG13 . VAL A 1 54 ? 125.792 1.153   7.702   1.00 0.00 ? 54  VAL A HG13 4  
ATOM   9480  H  HG21 . VAL A 1 54 ? 126.097 -3.089  7.764   1.00 0.00 ? 54  VAL A HG21 4  
ATOM   9481  H  HG22 . VAL A 1 54 ? 126.571 -2.126  6.365   1.00 0.00 ? 54  VAL A HG22 4  
ATOM   9482  H  HG23 . VAL A 1 54 ? 124.863 -2.382  6.721   1.00 0.00 ? 54  VAL A HG23 4  
ATOM   9483  N  N    . ASP A 1 55 ? 126.261 0.635   10.618  1.00 0.00 ? 55  ASP A N    4  
ATOM   9484  C  CA   . ASP A 1 55 ? 126.345 1.904   11.319  1.00 0.00 ? 55  ASP A CA   4  
ATOM   9485  C  C    . ASP A 1 55 ? 127.668 2.001   12.065  1.00 0.00 ? 55  ASP A C    4  
ATOM   9486  O  O    . ASP A 1 55 ? 128.324 3.040   12.069  1.00 0.00 ? 55  ASP A O    4  
ATOM   9487  C  CB   . ASP A 1 55 ? 125.185 2.035   12.307  1.00 0.00 ? 55  ASP A CB   4  
ATOM   9488  C  CG   . ASP A 1 55 ? 123.864 2.137   11.551  1.00 0.00 ? 55  ASP A CG   4  
ATOM   9489  O  OD1  . ASP A 1 55 ? 123.907 2.339   10.348  1.00 0.00 ? 55  ASP A OD1  4  
ATOM   9490  O  OD2  . ASP A 1 55 ? 122.829 2.009   12.185  1.00 0.00 ? 55  ASP A OD2  4  
ATOM   9491  H  H    . ASP A 1 55 ? 125.557 -0.006  10.850  1.00 0.00 ? 55  ASP A H    4  
ATOM   9492  H  HA   . ASP A 1 55 ? 126.286 2.708   10.600  1.00 0.00 ? 55  ASP A HA   4  
ATOM   9493  H  HB2  . ASP A 1 55 ? 125.163 1.169   12.952  1.00 0.00 ? 55  ASP A HB2  4  
ATOM   9494  H  HB3  . ASP A 1 55 ? 125.322 2.923   12.905  1.00 0.00 ? 55  ASP A HB3  4  
ATOM   9495  N  N    . LYS A 1 56 ? 128.075 0.902   12.683  1.00 0.00 ? 56  LYS A N    4  
ATOM   9496  C  CA   . LYS A 1 56 ? 129.331 0.905   13.407  1.00 0.00 ? 56  LYS A CA   4  
ATOM   9497  C  C    . LYS A 1 56 ? 130.471 1.233   12.459  1.00 0.00 ? 56  LYS A C    4  
ATOM   9498  O  O    . LYS A 1 56 ? 131.404 1.954   12.815  1.00 0.00 ? 56  LYS A O    4  
ATOM   9499  C  CB   . LYS A 1 56 ? 129.573 -0.461  14.051  1.00 0.00 ? 56  LYS A CB   4  
ATOM   9500  C  CG   . LYS A 1 56 ? 128.430 -0.798  14.988  1.00 0.00 ? 56  LYS A CG   4  
ATOM   9501  C  CD   . LYS A 1 56 ? 128.410 0.227   16.132  1.00 0.00 ? 56  LYS A CD   4  
ATOM   9502  C  CE   . LYS A 1 56 ? 128.041 -0.481  17.420  1.00 0.00 ? 56  LYS A CE   4  
ATOM   9503  N  NZ   . LYS A 1 56 ? 126.670 -1.055  17.307  1.00 0.00 ? 56  LYS A NZ   4  
ATOM   9504  H  H    . LYS A 1 56 ? 127.533 0.086   12.644  1.00 0.00 ? 56  LYS A H    4  
ATOM   9505  H  HA   . LYS A 1 56 ? 129.291 1.656   14.181  1.00 0.00 ? 56  LYS A HA   4  
ATOM   9506  H  HB2  . LYS A 1 56 ? 129.651 -1.219  13.286  1.00 0.00 ? 56  LYS A HB2  4  
ATOM   9507  H  HB3  . LYS A 1 56 ? 130.484 -0.437  14.634  1.00 0.00 ? 56  LYS A HB3  4  
ATOM   9508  H  HG2  . LYS A 1 56 ? 127.496 -0.755  14.444  1.00 0.00 ? 56  LYS A HG2  4  
ATOM   9509  H  HG3  . LYS A 1 56 ? 128.573 -1.792  15.384  1.00 0.00 ? 56  LYS A HG3  4  
ATOM   9510  H  HD2  . LYS A 1 56 ? 129.383 0.685   16.245  1.00 0.00 ? 56  LYS A HD2  4  
ATOM   9511  H  HD3  . LYS A 1 56 ? 127.676 0.988   15.920  1.00 0.00 ? 56  LYS A HD3  4  
ATOM   9512  H  HE2  . LYS A 1 56 ? 128.758 -1.272  17.579  1.00 0.00 ? 56  LYS A HE2  4  
ATOM   9513  H  HE3  . LYS A 1 56 ? 128.083 0.218   18.239  1.00 0.00 ? 56  LYS A HE3  4  
ATOM   9514  H  HZ1  . LYS A 1 56 ? 126.382 -1.073  16.309  1.00 0.00 ? 56  LYS A HZ1  4  
ATOM   9515  H  HZ2  . LYS A 1 56 ? 126.004 -0.468  17.851  1.00 0.00 ? 56  LYS A HZ2  4  
ATOM   9516  H  HZ3  . LYS A 1 56 ? 126.668 -2.024  17.685  1.00 0.00 ? 56  LYS A HZ3  4  
ATOM   9517  N  N    . VAL A 1 57 ? 130.392 0.696   11.245  1.00 0.00 ? 57  VAL A N    4  
ATOM   9518  C  CA   . VAL A 1 57 ? 131.430 0.942   10.259  1.00 0.00 ? 57  VAL A CA   4  
ATOM   9519  C  C    . VAL A 1 57 ? 131.468 2.393   9.815   1.00 0.00 ? 57  VAL A C    4  
ATOM   9520  O  O    . VAL A 1 57 ? 132.540 2.987   9.709   1.00 0.00 ? 57  VAL A O    4  
ATOM   9521  C  CB   . VAL A 1 57 ? 131.228 0.036   9.043   1.00 0.00 ? 57  VAL A CB   4  
ATOM   9522  C  CG1  . VAL A 1 57 ? 132.226 0.417   7.950   1.00 0.00 ? 57  VAL A CG1  4  
ATOM   9523  C  CG2  . VAL A 1 57 ? 131.455 -1.422  9.454   1.00 0.00 ? 57  VAL A CG2  4  
ATOM   9524  H  H    . VAL A 1 57 ? 129.627 0.126   11.014  1.00 0.00 ? 57  VAL A H    4  
ATOM   9525  H  HA   . VAL A 1 57 ? 132.372 0.712   10.705  1.00 0.00 ? 57  VAL A HA   4  
ATOM   9526  H  HB   . VAL A 1 57 ? 130.221 0.154   8.670   1.00 0.00 ? 57  VAL A HB   4  
ATOM   9527  H  HG11 . VAL A 1 57 ? 133.181 0.651   8.398   1.00 0.00 ? 57  VAL A HG11 4  
ATOM   9528  H  HG12 . VAL A 1 57 ? 131.860 1.280   7.413   1.00 0.00 ? 57  VAL A HG12 4  
ATOM   9529  H  HG13 . VAL A 1 57 ? 132.343 -0.411  7.264   1.00 0.00 ? 57  VAL A HG13 4  
ATOM   9530  H  HG21 . VAL A 1 57 ? 130.955 -1.613  10.392  1.00 0.00 ? 57  VAL A HG21 4  
ATOM   9531  H  HG22 . VAL A 1 57 ? 132.514 -1.604  9.566   1.00 0.00 ? 57  VAL A HG22 4  
ATOM   9532  H  HG23 . VAL A 1 57 ? 131.056 -2.075  8.693   1.00 0.00 ? 57  VAL A HG23 4  
ATOM   9533  N  N    . MET A 1 58 ? 130.303 2.967   9.550   1.00 0.00 ? 58  MET A N    4  
ATOM   9534  C  CA   . MET A 1 58 ? 130.261 4.352   9.113   1.00 0.00 ? 58  MET A CA   4  
ATOM   9535  C  C    . MET A 1 58 ? 130.748 5.308   10.207  1.00 0.00 ? 58  MET A C    4  
ATOM   9536  O  O    . MET A 1 58 ? 131.423 6.293   9.911   1.00 0.00 ? 58  MET A O    4  
ATOM   9537  C  CB   . MET A 1 58 ? 128.847 4.718   8.639   1.00 0.00 ? 58  MET A CB   4  
ATOM   9538  C  CG   . MET A 1 58 ? 128.040 5.301   9.793   1.00 0.00 ? 58  MET A CG   4  
ATOM   9539  S  SD   . MET A 1 58 ? 128.482 7.044   10.036  1.00 0.00 ? 58  MET A SD   4  
ATOM   9540  C  CE   . MET A 1 58 ? 127.379 7.756   8.793   1.00 0.00 ? 58  MET A CE   4  
ATOM   9541  H  H    . MET A 1 58 ? 129.467 2.451   9.642   1.00 0.00 ? 58  MET A H    4  
ATOM   9542  H  HA   . MET A 1 58 ? 130.929 4.453   8.270   1.00 0.00 ? 58  MET A HA   4  
ATOM   9543  H  HB2  . MET A 1 58 ? 128.914 5.446   7.845   1.00 0.00 ? 58  MET A HB2  4  
ATOM   9544  H  HB3  . MET A 1 58 ? 128.353 3.831   8.270   1.00 0.00 ? 58  MET A HB3  4  
ATOM   9545  H  HG2  . MET A 1 58 ? 126.984 5.220   9.575   1.00 0.00 ? 58  MET A HG2  4  
ATOM   9546  H  HG3  . MET A 1 58 ? 128.269 4.742   10.685  1.00 0.00 ? 58  MET A HG3  4  
ATOM   9547  H  HE1  . MET A 1 58 ? 127.706 8.761   8.556   1.00 0.00 ? 58  MET A HE1  4  
ATOM   9548  H  HE2  . MET A 1 58 ? 126.373 7.791   9.179   1.00 0.00 ? 58  MET A HE2  4  
ATOM   9549  H  HE3  . MET A 1 58 ? 127.401 7.147   7.900   1.00 0.00 ? 58  MET A HE3  4  
ATOM   9550  N  N    . LYS A 1 59 ? 130.401 5.030   11.468  1.00 0.00 ? 59  LYS A N    4  
ATOM   9551  C  CA   . LYS A 1 59 ? 130.829 5.915   12.551  1.00 0.00 ? 59  LYS A CA   4  
ATOM   9552  C  C    . LYS A 1 59 ? 132.346 6.022   12.625  1.00 0.00 ? 59  LYS A C    4  
ATOM   9553  O  O    . LYS A 1 59 ? 132.880 7.100   12.889  1.00 0.00 ? 59  LYS A O    4  
ATOM   9554  C  CB   . LYS A 1 59 ? 130.279 5.441   13.899  1.00 0.00 ? 59  LYS A CB   4  
ATOM   9555  C  CG   . LYS A 1 59 ? 128.756 5.595   13.920  1.00 0.00 ? 59  LYS A CG   4  
ATOM   9556  C  CD   . LYS A 1 59 ? 128.225 5.216   15.303  1.00 0.00 ? 59  LYS A CD   4  
ATOM   9557  C  CE   . LYS A 1 59 ? 126.696 5.255   15.292  1.00 0.00 ? 59  LYS A CE   4  
ATOM   9558  N  NZ   . LYS A 1 59 ? 126.177 4.744   16.592  1.00 0.00 ? 59  LYS A NZ   4  
ATOM   9559  H  H    . LYS A 1 59 ? 129.847 4.236   11.667  1.00 0.00 ? 59  LYS A H    4  
ATOM   9560  H  HA   . LYS A 1 59 ? 130.432 6.901   12.356  1.00 0.00 ? 59  LYS A HA   4  
ATOM   9561  H  HB2  . LYS A 1 59 ? 130.538 4.403   14.047  1.00 0.00 ? 59  LYS A HB2  4  
ATOM   9562  H  HB3  . LYS A 1 59 ? 130.709 6.035   14.692  1.00 0.00 ? 59  LYS A HB3  4  
ATOM   9563  H  HG2  . LYS A 1 59 ? 128.498 6.621   13.705  1.00 0.00 ? 59  LYS A HG2  4  
ATOM   9564  H  HG3  . LYS A 1 59 ? 128.316 4.955   13.179  1.00 0.00 ? 59  LYS A HG3  4  
ATOM   9565  H  HD2  . LYS A 1 59 ? 128.558 4.220   15.556  1.00 0.00 ? 59  LYS A HD2  4  
ATOM   9566  H  HD3  . LYS A 1 59 ? 128.595 5.917   16.036  1.00 0.00 ? 59  LYS A HD3  4  
ATOM   9567  H  HE2  . LYS A 1 59 ? 126.363 6.273   15.146  1.00 0.00 ? 59  LYS A HE2  4  
ATOM   9568  H  HE3  . LYS A 1 59 ? 126.326 4.637   14.488  1.00 0.00 ? 59  LYS A HE3  4  
ATOM   9569  H  HZ1  . LYS A 1 59 ? 126.471 3.756   16.719  1.00 0.00 ? 59  LYS A HZ1  4  
ATOM   9570  H  HZ2  . LYS A 1 59 ? 125.138 4.801   16.596  1.00 0.00 ? 59  LYS A HZ2  4  
ATOM   9571  H  HZ3  . LYS A 1 59 ? 126.559 5.319   17.369  1.00 0.00 ? 59  LYS A HZ3  4  
ATOM   9572  N  N    . GLU A 1 60 ? 133.049 4.918   12.387  1.00 0.00 ? 60  GLU A N    4  
ATOM   9573  C  CA   . GLU A 1 60 ? 134.504 4.964   12.437  1.00 0.00 ? 60  GLU A CA   4  
ATOM   9574  C  C    . GLU A 1 60 ? 135.030 5.886   11.344  1.00 0.00 ? 60  GLU A C    4  
ATOM   9575  O  O    . GLU A 1 60 ? 135.979 6.643   11.555  1.00 0.00 ? 60  GLU A O    4  
ATOM   9576  C  CB   . GLU A 1 60 ? 135.080 3.560   12.246  1.00 0.00 ? 60  GLU A CB   4  
ATOM   9577  C  CG   . GLU A 1 60 ? 134.662 2.673   13.421  1.00 0.00 ? 60  GLU A CG   4  
ATOM   9578  C  CD   . GLU A 1 60 ? 135.285 1.289   13.277  1.00 0.00 ? 60  GLU A CD   4  
ATOM   9579  O  OE1  . GLU A 1 60 ? 135.852 1.022   12.230  1.00 0.00 ? 60  GLU A OE1  4  
ATOM   9580  O  OE2  . GLU A 1 60 ? 135.186 0.516   14.216  1.00 0.00 ? 60  GLU A OE2  4  
ATOM   9581  H  H    . GLU A 1 60 ? 132.590 4.079   12.175  1.00 0.00 ? 60  GLU A H    4  
ATOM   9582  H  HA   . GLU A 1 60 ? 134.813 5.343   13.399  1.00 0.00 ? 60  GLU A HA   4  
ATOM   9583  H  HB2  . GLU A 1 60 ? 134.705 3.138   11.326  1.00 0.00 ? 60  GLU A HB2  4  
ATOM   9584  H  HB3  . GLU A 1 60 ? 136.158 3.615   12.206  1.00 0.00 ? 60  GLU A HB3  4  
ATOM   9585  H  HG2  . GLU A 1 60 ? 134.995 3.122   14.345  1.00 0.00 ? 60  GLU A HG2  4  
ATOM   9586  H  HG3  . GLU A 1 60 ? 133.586 2.580   13.435  1.00 0.00 ? 60  GLU A HG3  4  
ATOM   9587  N  N    . LEU A 1 61 ? 134.386 5.833   10.183  1.00 0.00 ? 61  LEU A N    4  
ATOM   9588  C  CA   . LEU A 1 61 ? 134.769 6.682   9.063   1.00 0.00 ? 61  LEU A CA   4  
ATOM   9589  C  C    . LEU A 1 61 ? 134.459 8.140   9.374   1.00 0.00 ? 61  LEU A C    4  
ATOM   9590  O  O    . LEU A 1 61 ? 135.179 9.048   8.957   1.00 0.00 ? 61  LEU A O    4  
ATOM   9591  C  CB   . LEU A 1 61 ? 134.000 6.266   7.809   1.00 0.00 ? 61  LEU A CB   4  
ATOM   9592  C  CG   . LEU A 1 61 ? 134.279 4.798   7.485   1.00 0.00 ? 61  LEU A CG   4  
ATOM   9593  C  CD1  . LEU A 1 61 ? 133.574 4.428   6.181   1.00 0.00 ? 61  LEU A CD1  4  
ATOM   9594  C  CD2  . LEU A 1 61 ? 135.786 4.584   7.322   1.00 0.00 ? 61  LEU A CD2  4  
ATOM   9595  H  H    . LEU A 1 61 ? 133.625 5.222   10.084  1.00 0.00 ? 61  LEU A H    4  
ATOM   9596  H  HA   . LEU A 1 61 ? 135.826 6.577   8.882   1.00 0.00 ? 61  LEU A HA   4  
ATOM   9597  H  HB2  . LEU A 1 61 ? 132.941 6.403   7.975   1.00 0.00 ? 61  LEU A HB2  4  
ATOM   9598  H  HB3  . LEU A 1 61 ? 134.315 6.879   6.978   1.00 0.00 ? 61  LEU A HB3  4  
ATOM   9599  H  HG   . LEU A 1 61 ? 133.907 4.175   8.286   1.00 0.00 ? 61  LEU A HG   4  
ATOM   9600  H  HD11 . LEU A 1 61 ? 134.078 4.905   5.354   1.00 0.00 ? 61  LEU A HD11 4  
ATOM   9601  H  HD12 . LEU A 1 61 ? 132.549 4.765   6.220   1.00 0.00 ? 61  LEU A HD12 4  
ATOM   9602  H  HD13 . LEU A 1 61 ? 133.598 3.357   6.049   1.00 0.00 ? 61  LEU A HD13 4  
ATOM   9603  H  HD21 . LEU A 1 61 ? 136.229 5.465   6.881   1.00 0.00 ? 61  LEU A HD21 4  
ATOM   9604  H  HD22 . LEU A 1 61 ? 135.961 3.733   6.681   1.00 0.00 ? 61  LEU A HD22 4  
ATOM   9605  H  HD23 . LEU A 1 61 ? 136.228 4.404   8.289   1.00 0.00 ? 61  LEU A HD23 4  
ATOM   9606  N  N    . ASP A 1 62 ? 133.357 8.346   10.088  1.00 0.00 ? 62  ASP A N    4  
ATOM   9607  C  CA   . ASP A 1 62 ? 132.907 9.686   10.440  1.00 0.00 ? 62  ASP A CA   4  
ATOM   9608  C  C    . ASP A 1 62 ? 133.324 10.106  11.835  1.00 0.00 ? 62  ASP A C    4  
ATOM   9609  O  O    . ASP A 1 62 ? 132.614 10.859  12.502  1.00 0.00 ? 62  ASP A O    4  
ATOM   9610  C  CB   . ASP A 1 62 ? 131.398 9.797   10.264  1.00 0.00 ? 62  ASP A CB   4  
ATOM   9611  C  CG   . ASP A 1 62 ? 131.082 9.753   8.777   1.00 0.00 ? 62  ASP A CG   4  
ATOM   9612  O  OD1  . ASP A 1 62 ? 132.016 9.905   7.997   1.00 0.00 ? 62  ASP A OD1  4  
ATOM   9613  O  OD2  . ASP A 1 62 ? 129.925 9.570   8.436   1.00 0.00 ? 62  ASP A OD2  4  
ATOM   9614  H  H    . ASP A 1 62 ? 132.821 7.575   10.368  1.00 0.00 ? 62  ASP A H    4  
ATOM   9615  H  HA   . ASP A 1 62 ? 133.366 10.379  9.749   1.00 0.00 ? 62  ASP A HA   4  
ATOM   9616  H  HB2  . ASP A 1 62 ? 130.913 8.970   10.765  1.00 0.00 ? 62  ASP A HB2  4  
ATOM   9617  H  HB3  . ASP A 1 62 ? 131.050 10.731  10.679  1.00 0.00 ? 62  ASP A HB3  4  
ATOM   9618  N  N    . GLU A 1 63 ? 134.500 9.673   12.254  1.00 0.00 ? 63  GLU A N    4  
ATOM   9619  C  CA   . GLU A 1 63 ? 135.005 10.085  13.548  1.00 0.00 ? 63  GLU A CA   4  
ATOM   9620  C  C    . GLU A 1 63 ? 134.900 11.577  13.670  1.00 0.00 ? 63  GLU A C    4  
ATOM   9621  O  O    . GLU A 1 63 ? 134.756 12.124  14.763  1.00 0.00 ? 63  GLU A O    4  
ATOM   9622  C  CB   . GLU A 1 63 ? 136.468 9.677   13.703  1.00 0.00 ? 63  GLU A CB   4  
ATOM   9623  C  CG   . GLU A 1 63 ? 137.002 10.228  15.027  1.00 0.00 ? 63  GLU A CG   4  
ATOM   9624  C  CD   . GLU A 1 63 ? 138.459 9.828   15.219  1.00 0.00 ? 63  GLU A CD   4  
ATOM   9625  O  OE1  . GLU A 1 63 ? 139.005 9.207   14.322  1.00 0.00 ? 63  GLU A OE1  4  
ATOM   9626  O  OE2  . GLU A 1 63 ? 139.009 10.149  16.259  1.00 0.00 ? 63  GLU A OE2  4  
ATOM   9627  H  H    . GLU A 1 63 ? 135.051 9.111   11.669  1.00 0.00 ? 63  GLU A H    4  
ATOM   9628  H  HA   . GLU A 1 63 ? 134.422 9.618   14.326  1.00 0.00 ? 63  GLU A HA   4  
ATOM   9629  H  HB2  . GLU A 1 63 ? 136.544 8.599   13.702  1.00 0.00 ? 63  GLU A HB2  4  
ATOM   9630  H  HB3  . GLU A 1 63 ? 137.046 10.082  12.887  1.00 0.00 ? 63  GLU A HB3  4  
ATOM   9631  H  HG2  . GLU A 1 63 ? 136.949 11.309  15.002  1.00 0.00 ? 63  GLU A HG2  4  
ATOM   9632  H  HG3  . GLU A 1 63 ? 136.405 9.875   15.833  1.00 0.00 ? 63  GLU A HG3  4  
ATOM   9633  N  N    . ASN A 1 64 ? 135.008 12.228  12.543  1.00 0.00 ? 64  ASN A N    4  
ATOM   9634  C  CA   . ASN A 1 64 ? 134.964 13.660  12.519  1.00 0.00 ? 64  ASN A CA   4  
ATOM   9635  C  C    . ASN A 1 64 ? 133.710 14.143  13.235  1.00 0.00 ? 64  ASN A C    4  
ATOM   9636  O  O    . ASN A 1 64 ? 133.697 15.207  13.853  1.00 0.00 ? 64  ASN A O    4  
ATOM   9637  C  CB   . ASN A 1 64 ? 134.867 14.136  11.071  1.00 0.00 ? 64  ASN A CB   4  
ATOM   9638  C  CG   . ASN A 1 64 ? 135.876 13.417  10.190  1.00 0.00 ? 64  ASN A CG   4  
ATOM   9639  O  OD1  . ASN A 1 64 ? 135.481 12.811  9.183   1.00 0.00 ? 64  ASN A OD1  4  
ATOM   9640  N  ND2  . ASN A 1 64 ? 137.144 13.440  10.496  1.00 0.00 ? 64  ASN A ND2  4  
ATOM   9641  H  H    . ASN A 1 64 ? 135.147 11.732  11.708  1.00 0.00 ? 64  ASN A H    4  
ATOM   9642  H  HA   . ASN A 1 64 ? 135.849 14.045  12.996  1.00 0.00 ? 64  ASN A HA   4  
ATOM   9643  H  HB2  . ASN A 1 64 ? 133.872 13.942  10.701  1.00 0.00 ? 64  ASN A HB2  4  
ATOM   9644  H  HB3  . ASN A 1 64 ? 135.058 15.198  11.036  1.00 0.00 ? 64  ASN A HB3  4  
ATOM   9645  H  HD21 . ASN A 1 64 ? 137.446 13.922  11.295  1.00 0.00 ? 64  ASN A HD21 4  
ATOM   9646  H  HD22 . ASN A 1 64 ? 137.794 12.977  9.929   1.00 0.00 ? 64  ASN A HD22 4  
ATOM   9647  N  N    . GLY A 1 65 ? 132.643 13.361  13.098  1.00 0.00 ? 65  GLY A N    4  
ATOM   9648  C  CA   . GLY A 1 65 ? 131.359 13.715  13.682  1.00 0.00 ? 65  GLY A CA   4  
ATOM   9649  C  C    . GLY A 1 65 ? 130.527 14.438  12.632  1.00 0.00 ? 65  GLY A C    4  
ATOM   9650  O  O    . GLY A 1 65 ? 129.422 14.911  12.900  1.00 0.00 ? 65  GLY A O    4  
ATOM   9651  H  H    . GLY A 1 65 ? 132.716 12.544  12.564  1.00 0.00 ? 65  GLY A H    4  
ATOM   9652  H  HA2  . GLY A 1 65 ? 130.846 12.816  13.999  1.00 0.00 ? 65  GLY A HA2  4  
ATOM   9653  H  HA3  . GLY A 1 65 ? 131.510 14.366  14.529  1.00 0.00 ? 65  GLY A HA3  4  
ATOM   9654  N  N    . ASP A 1 66 ? 131.091 14.516  11.429  1.00 0.00 ? 66  ASP A N    4  
ATOM   9655  C  CA   . ASP A 1 66 ? 130.440 15.178  10.305  1.00 0.00 ? 66  ASP A CA   4  
ATOM   9656  C  C    . ASP A 1 66 ? 129.113 14.512  9.932   1.00 0.00 ? 66  ASP A C    4  
ATOM   9657  O  O    . ASP A 1 66 ? 128.160 15.189  9.545   1.00 0.00 ? 66  ASP A O    4  
ATOM   9658  C  CB   . ASP A 1 66 ? 131.404 15.187  9.104   1.00 0.00 ? 66  ASP A CB   4  
ATOM   9659  C  CG   . ASP A 1 66 ? 131.733 13.759  8.642   1.00 0.00 ? 66  ASP A CG   4  
ATOM   9660  O  OD1  . ASP A 1 66 ? 131.041 12.846  9.046   1.00 0.00 ? 66  ASP A OD1  4  
ATOM   9661  O  OD2  . ASP A 1 66 ? 132.690 13.599  7.898   1.00 0.00 ? 66  ASP A OD2  4  
ATOM   9662  H  H    . ASP A 1 66 ? 131.977 14.118  11.295  1.00 0.00 ? 66  ASP A H    4  
ATOM   9663  H  HA   . ASP A 1 66 ? 130.240 16.202  10.584  1.00 0.00 ? 66  ASP A HA   4  
ATOM   9664  H  HB2  . ASP A 1 66 ? 130.946 15.726  8.287   1.00 0.00 ? 66  ASP A HB2  4  
ATOM   9665  H  HB3  . ASP A 1 66 ? 132.319 15.686  9.388   1.00 0.00 ? 66  ASP A HB3  4  
ATOM   9666  N  N    . GLY A 1 67 ? 129.057 13.194  10.046  1.00 0.00 ? 67  GLY A N    4  
ATOM   9667  C  CA   . GLY A 1 67 ? 127.846 12.452  9.715   1.00 0.00 ? 67  GLY A CA   4  
ATOM   9668  C  C    . GLY A 1 67 ? 127.887 12.008  8.257   1.00 0.00 ? 67  GLY A C    4  
ATOM   9669  O  O    . GLY A 1 67 ? 127.029 11.256  7.795   1.00 0.00 ? 67  GLY A O    4  
ATOM   9670  H  H    . GLY A 1 67 ? 129.847 12.705  10.358  1.00 0.00 ? 67  GLY A H    4  
ATOM   9671  H  HA2  . GLY A 1 67 ? 127.772 11.583  10.355  1.00 0.00 ? 67  GLY A HA2  4  
ATOM   9672  H  HA3  . GLY A 1 67 ? 126.984 13.084  9.868   1.00 0.00 ? 67  GLY A HA3  4  
ATOM   9673  N  N    . GLU A 1 68 ? 128.907 12.481  7.544   1.00 0.00 ? 68  GLU A N    4  
ATOM   9674  C  CA   . GLU A 1 68 ? 129.092 12.142  6.135   1.00 0.00 ? 68  GLU A CA   4  
ATOM   9675  C  C    . GLU A 1 68 ? 130.425 11.415  5.979   1.00 0.00 ? 68  GLU A C    4  
ATOM   9676  O  O    . GLU A 1 68 ? 131.366 11.668  6.743   1.00 0.00 ? 68  GLU A O    4  
ATOM   9677  C  CB   . GLU A 1 68 ? 129.085 13.408  5.278   1.00 0.00 ? 68  GLU A CB   4  
ATOM   9678  C  CG   . GLU A 1 68 ? 128.991 13.028  3.798   1.00 0.00 ? 68  GLU A CG   4  
ATOM   9679  C  CD   . GLU A 1 68 ? 127.593 12.503  3.489   1.00 0.00 ? 68  GLU A CD   4  
ATOM   9680  O  OE1  . GLU A 1 68 ? 126.679 12.848  4.220   1.00 0.00 ? 68  GLU A OE1  4  
ATOM   9681  O  OE2  . GLU A 1 68 ? 127.456 11.772  2.524   1.00 0.00 ? 68  GLU A OE2  4  
ATOM   9682  H  H    . GLU A 1 68 ? 129.557 13.072  7.979   1.00 0.00 ? 68  GLU A H    4  
ATOM   9683  H  HA   . GLU A 1 68 ? 128.292 11.490  5.815   1.00 0.00 ? 68  GLU A HA   4  
ATOM   9684  H  HB2  . GLU A 1 68 ? 128.236 14.020  5.548   1.00 0.00 ? 68  GLU A HB2  4  
ATOM   9685  H  HB3  . GLU A 1 68 ? 129.996 13.962  5.449   1.00 0.00 ? 68  GLU A HB3  4  
ATOM   9686  H  HG2  . GLU A 1 68 ? 129.193 13.896  3.188   1.00 0.00 ? 68  GLU A HG2  4  
ATOM   9687  H  HG3  . GLU A 1 68 ? 129.713 12.255  3.575   1.00 0.00 ? 68  GLU A HG3  4  
ATOM   9688  N  N    . VAL A 1 69 ? 130.520 10.505  5.013   1.00 0.00 ? 69  VAL A N    4  
ATOM   9689  C  CA   . VAL A 1 69 ? 131.764 9.763   4.838   1.00 0.00 ? 69  VAL A CA   4  
ATOM   9690  C  C    . VAL A 1 69 ? 132.599 10.312  3.687   1.00 0.00 ? 69  VAL A C    4  
ATOM   9691  O  O    . VAL A 1 69 ? 132.123 10.488  2.568   1.00 0.00 ? 69  VAL A O    4  
ATOM   9692  C  CB   . VAL A 1 69 ? 131.444 8.294   4.562   1.00 0.00 ? 69  VAL A CB   4  
ATOM   9693  C  CG1  . VAL A 1 69 ? 132.745 7.500   4.446   1.00 0.00 ? 69  VAL A CG1  4  
ATOM   9694  C  CG2  . VAL A 1 69 ? 130.603 7.734   5.711   1.00 0.00 ? 69  VAL A CG2  4  
ATOM   9695  H  H    . VAL A 1 69 ? 129.752 10.320  4.432   1.00 0.00 ? 69  VAL A H    4  
ATOM   9696  H  HA   . VAL A 1 69 ? 132.344 9.819   5.746   1.00 0.00 ? 69  VAL A HA   4  
ATOM   9697  H  HB   . VAL A 1 69 ? 130.891 8.215   3.637   1.00 0.00 ? 69  VAL A HB   4  
ATOM   9698  H  HG11 . VAL A 1 69 ? 132.558 6.466   4.693   1.00 0.00 ? 69  VAL A HG11 4  
ATOM   9699  H  HG12 . VAL A 1 69 ? 133.477 7.907   5.129   1.00 0.00 ? 69  VAL A HG12 4  
ATOM   9700  H  HG13 . VAL A 1 69 ? 133.119 7.568   3.436   1.00 0.00 ? 69  VAL A HG13 4  
ATOM   9701  H  HG21 . VAL A 1 69 ? 129.603 8.140   5.658   1.00 0.00 ? 69  VAL A HG21 4  
ATOM   9702  H  HG22 . VAL A 1 69 ? 131.053 8.009   6.654   1.00 0.00 ? 69  VAL A HG22 4  
ATOM   9703  H  HG23 . VAL A 1 69 ? 130.559 6.658   5.634   1.00 0.00 ? 69  VAL A HG23 4  
ATOM   9704  N  N    . ASP A 1 70 ? 133.865 10.557  3.995   1.00 0.00 ? 70  ASP A N    4  
ATOM   9705  C  CA   . ASP A 1 70 ? 134.826 11.062  3.026   1.00 0.00 ? 70  ASP A CA   4  
ATOM   9706  C  C    . ASP A 1 70 ? 135.614 9.910   2.413   1.00 0.00 ? 70  ASP A C    4  
ATOM   9707  O  O    . ASP A 1 70 ? 136.142 9.059   3.135   1.00 0.00 ? 70  ASP A O    4  
ATOM   9708  C  CB   . ASP A 1 70 ? 135.775 12.054  3.694   1.00 0.00 ? 70  ASP A CB   4  
ATOM   9709  C  CG   . ASP A 1 70 ? 136.698 12.677  2.652   1.00 0.00 ? 70  ASP A CG   4  
ATOM   9710  O  OD1  . ASP A 1 70 ? 136.506 12.402  1.480   1.00 0.00 ? 70  ASP A OD1  4  
ATOM   9711  O  OD2  . ASP A 1 70 ? 137.583 13.420  3.043   1.00 0.00 ? 70  ASP A OD2  4  
ATOM   9712  H  H    . ASP A 1 70 ? 134.170 10.374  4.908   1.00 0.00 ? 70  ASP A H    4  
ATOM   9713  H  HA   . ASP A 1 70 ? 134.289 11.572  2.240   1.00 0.00 ? 70  ASP A HA   4  
ATOM   9714  H  HB2  . ASP A 1 70 ? 135.199 12.831  4.175   1.00 0.00 ? 70  ASP A HB2  4  
ATOM   9715  H  HB3  . ASP A 1 70 ? 136.363 11.538  4.432   1.00 0.00 ? 70  ASP A HB3  4  
ATOM   9716  N  N    . PHE A 1 71 ? 135.695 9.870   1.091   1.00 0.00 ? 71  PHE A N    4  
ATOM   9717  C  CA   . PHE A 1 71 ? 136.428 8.796   0.436   1.00 0.00 ? 71  PHE A CA   4  
ATOM   9718  C  C    . PHE A 1 71 ? 137.833 8.658   1.003   1.00 0.00 ? 71  PHE A C    4  
ATOM   9719  O  O    . PHE A 1 71 ? 138.309 7.542   1.210   1.00 0.00 ? 71  PHE A O    4  
ATOM   9720  C  CB   . PHE A 1 71 ? 136.512 9.047   -1.067  1.00 0.00 ? 71  PHE A CB   4  
ATOM   9721  C  CG   . PHE A 1 71 ? 137.266 7.909   -1.715  1.00 0.00 ? 71  PHE A CG   4  
ATOM   9722  C  CD1  . PHE A 1 71 ? 136.638 6.680   -1.940  1.00 0.00 ? 71  PHE A CD1  4  
ATOM   9723  C  CD2  . PHE A 1 71 ? 138.599 8.097   -2.104  1.00 0.00 ? 71  PHE A CD2  4  
ATOM   9724  C  CE1  . PHE A 1 71 ? 137.344 5.636   -2.552  1.00 0.00 ? 71  PHE A CE1  4  
ATOM   9725  C  CE2  . PHE A 1 71 ? 139.307 7.054   -2.714  1.00 0.00 ? 71  PHE A CE2  4  
ATOM   9726  C  CZ   . PHE A 1 71 ? 138.678 5.823   -2.938  1.00 0.00 ? 71  PHE A CZ   4  
ATOM   9727  H  H    . PHE A 1 71 ? 135.259 10.563  0.553   1.00 0.00 ? 71  PHE A H    4  
ATOM   9728  H  HA   . PHE A 1 71 ? 135.897 7.870   0.599   1.00 0.00 ? 71  PHE A HA   4  
ATOM   9729  H  HB2  . PHE A 1 71 ? 135.516 9.104   -1.481  1.00 0.00 ? 71  PHE A HB2  4  
ATOM   9730  H  HB3  . PHE A 1 71 ? 137.034 9.974   -1.250  1.00 0.00 ? 71  PHE A HB3  4  
ATOM   9731  H  HD1  . PHE A 1 71 ? 135.615 6.535   -1.633  1.00 0.00 ? 71  PHE A HD1  4  
ATOM   9732  H  HD2  . PHE A 1 71 ? 139.083 9.047   -1.931  1.00 0.00 ? 71  PHE A HD2  4  
ATOM   9733  H  HE1  . PHE A 1 71 ? 136.859 4.687   -2.727  1.00 0.00 ? 71  PHE A HE1  4  
ATOM   9734  H  HE2  . PHE A 1 71 ? 140.338 7.201   -3.012  1.00 0.00 ? 71  PHE A HE2  4  
ATOM   9735  H  HZ   . PHE A 1 71 ? 139.221 5.017   -3.410  1.00 0.00 ? 71  PHE A HZ   4  
ATOM   9736  N  N    . GLN A 1 72 ? 138.502 9.774   1.266   1.00 0.00 ? 72  GLN A N    4  
ATOM   9737  C  CA   . GLN A 1 72 ? 139.845 9.691   1.815   1.00 0.00 ? 72  GLN A CA   4  
ATOM   9738  C  C    . GLN A 1 72 ? 139.822 8.881   3.109   1.00 0.00 ? 72  GLN A C    4  
ATOM   9739  O  O    . GLN A 1 72 ? 140.693 8.043   3.343   1.00 0.00 ? 72  GLN A O    4  
ATOM   9740  C  CB   . GLN A 1 72 ? 140.387 11.095  2.092   1.00 0.00 ? 72  GLN A CB   4  
ATOM   9741  C  CG   . GLN A 1 72 ? 141.863 11.005  2.487   1.00 0.00 ? 72  GLN A CG   4  
ATOM   9742  C  CD   . GLN A 1 72 ? 142.422 12.402  2.732   1.00 0.00 ? 72  GLN A CD   4  
ATOM   9743  O  OE1  . GLN A 1 72 ? 141.748 13.397  2.465   1.00 0.00 ? 72  GLN A OE1  4  
ATOM   9744  N  NE2  . GLN A 1 72 ? 143.622 12.537  3.227   1.00 0.00 ? 72  GLN A NE2  4  
ATOM   9745  H  H    . GLN A 1 72 ? 138.092 10.647  1.094   1.00 0.00 ? 72  GLN A H    4  
ATOM   9746  H  HA   . GLN A 1 72 ? 140.489 9.198   1.102   1.00 0.00 ? 72  GLN A HA   4  
ATOM   9747  H  HB2  . GLN A 1 72 ? 140.288 11.700  1.204   1.00 0.00 ? 72  GLN A HB2  4  
ATOM   9748  H  HB3  . GLN A 1 72 ? 139.828 11.544  2.900   1.00 0.00 ? 72  GLN A HB3  4  
ATOM   9749  H  HG2  . GLN A 1 72 ? 141.957 10.418  3.389   1.00 0.00 ? 72  GLN A HG2  4  
ATOM   9750  H  HG3  . GLN A 1 72 ? 142.418 10.531  1.691   1.00 0.00 ? 72  GLN A HG3  4  
ATOM   9751  H  HE21 . GLN A 1 72 ? 144.157 11.744  3.440   1.00 0.00 ? 72  GLN A HE21 4  
ATOM   9752  H  HE22 . GLN A 1 72 ? 143.988 13.432  3.387   1.00 0.00 ? 72  GLN A HE22 4  
ATOM   9753  N  N    . GLU A 1 73 ? 138.799 9.113   3.933   1.00 0.00 ? 73  GLU A N    4  
ATOM   9754  C  CA   . GLU A 1 73 ? 138.656 8.370   5.181   1.00 0.00 ? 73  GLU A CA   4  
ATOM   9755  C  C    . GLU A 1 73 ? 138.363 6.897   4.899   1.00 0.00 ? 73  GLU A C    4  
ATOM   9756  O  O    . GLU A 1 73 ? 138.870 6.008   5.582   1.00 0.00 ? 73  GLU A O    4  
ATOM   9757  C  CB   . GLU A 1 73 ? 137.525 8.993   6.009   1.00 0.00 ? 73  GLU A CB   4  
ATOM   9758  C  CG   . GLU A 1 73 ? 137.953 10.394  6.454   1.00 0.00 ? 73  GLU A CG   4  
ATOM   9759  C  CD   . GLU A 1 73 ? 136.861 11.074  7.286   1.00 0.00 ? 73  GLU A CD   4  
ATOM   9760  O  OE1  . GLU A 1 73 ? 135.738 10.576  7.317   1.00 0.00 ? 73  GLU A OE1  4  
ATOM   9761  O  OE2  . GLU A 1 73 ? 137.166 12.092  7.880   1.00 0.00 ? 73  GLU A OE2  4  
ATOM   9762  H  H    . GLU A 1 73 ? 138.120 9.775   3.684   1.00 0.00 ? 73  GLU A H    4  
ATOM   9763  H  HA   . GLU A 1 73 ? 139.578 8.443   5.739   1.00 0.00 ? 73  GLU A HA   4  
ATOM   9764  H  HB2  . GLU A 1 73 ? 136.630 9.060   5.407   1.00 0.00 ? 73  GLU A HB2  4  
ATOM   9765  H  HB3  . GLU A 1 73 ? 137.333 8.382   6.878   1.00 0.00 ? 73  GLU A HB3  4  
ATOM   9766  H  HG2  . GLU A 1 73 ? 138.847 10.310  7.055   1.00 0.00 ? 73  GLU A HG2  4  
ATOM   9767  H  HG3  . GLU A 1 73 ? 138.171 10.994  5.587   1.00 0.00 ? 73  GLU A HG3  4  
ATOM   9768  N  N    . TYR A 1 74 ? 137.547 6.655   3.875   1.00 0.00 ? 74  TYR A N    4  
ATOM   9769  C  CA   . TYR A 1 74 ? 137.189 5.292   3.482   1.00 0.00 ? 74  TYR A CA   4  
ATOM   9770  C  C    . TYR A 1 74 ? 138.383 4.466   3.015   1.00 0.00 ? 74  TYR A C    4  
ATOM   9771  O  O    . TYR A 1 74 ? 138.494 3.280   3.338   1.00 0.00 ? 74  TYR A O    4  
ATOM   9772  C  CB   . TYR A 1 74 ? 136.136 5.332   2.376   1.00 0.00 ? 74  TYR A CB   4  
ATOM   9773  C  CG   . TYR A 1 74 ? 135.806 3.925   1.943   1.00 0.00 ? 74  TYR A CG   4  
ATOM   9774  C  CD1  . TYR A 1 74 ? 134.992 3.109   2.733   1.00 0.00 ? 74  TYR A CD1  4  
ATOM   9775  C  CD2  . TYR A 1 74 ? 136.310 3.442   0.728   1.00 0.00 ? 74  TYR A CD2  4  
ATOM   9776  C  CE1  . TYR A 1 74 ? 134.686 1.807   2.312   1.00 0.00 ? 74  TYR A CE1  4  
ATOM   9777  C  CE2  . TYR A 1 74 ? 136.005 2.145   0.308   1.00 0.00 ? 74  TYR A CE2  4  
ATOM   9778  C  CZ   . TYR A 1 74 ? 135.192 1.326   1.099   1.00 0.00 ? 74  TYR A CZ   4  
ATOM   9779  O  OH   . TYR A 1 74 ? 134.891 0.045   0.685   1.00 0.00 ? 74  TYR A OH   4  
ATOM   9780  H  H    . TYR A 1 74 ? 137.181 7.412   3.365   1.00 0.00 ? 74  TYR A H    4  
ATOM   9781  H  HA   . TYR A 1 74 ? 136.754 4.798   4.338   1.00 0.00 ? 74  TYR A HA   4  
ATOM   9782  H  HB2  . TYR A 1 74 ? 135.242 5.815   2.747   1.00 0.00 ? 74  TYR A HB2  4  
ATOM   9783  H  HB3  . TYR A 1 74 ? 136.520 5.887   1.533   1.00 0.00 ? 74  TYR A HB3  4  
ATOM   9784  H  HD1  . TYR A 1 74 ? 134.607 3.480   3.669   1.00 0.00 ? 74  TYR A HD1  4  
ATOM   9785  H  HD2  . TYR A 1 74 ? 136.937 4.074   0.117   1.00 0.00 ? 74  TYR A HD2  4  
ATOM   9786  H  HE1  . TYR A 1 74 ? 134.060 1.173   2.922   1.00 0.00 ? 74  TYR A HE1  4  
ATOM   9787  H  HE2  . TYR A 1 74 ? 136.397 1.775   -0.628  1.00 0.00 ? 74  TYR A HE2  4  
ATOM   9788  H  HH   . TYR A 1 74 ? 135.339 -0.109  -0.150  1.00 0.00 ? 74  TYR A HH   4  
ATOM   9789  N  N    . VAL A 1 75 ? 139.255 5.080   2.231   1.00 0.00 ? 75  VAL A N    4  
ATOM   9790  C  CA   . VAL A 1 75 ? 140.403 4.363   1.699   1.00 0.00 ? 75  VAL A CA   4  
ATOM   9791  C  C    . VAL A 1 75 ? 141.280 3.813   2.818   1.00 0.00 ? 75  VAL A C    4  
ATOM   9792  O  O    . VAL A 1 75 ? 141.743 2.676   2.744   1.00 0.00 ? 75  VAL A O    4  
ATOM   9793  C  CB   . VAL A 1 75 ? 141.216 5.296   0.796   1.00 0.00 ? 75  VAL A CB   4  
ATOM   9794  C  CG1  . VAL A 1 75 ? 142.517 4.609   0.368   1.00 0.00 ? 75  VAL A CG1  4  
ATOM   9795  C  CG2  . VAL A 1 75 ? 140.388 5.659   -0.445  1.00 0.00 ? 75  VAL A CG2  4  
ATOM   9796  H  H    . VAL A 1 75 ? 139.110 6.018   1.983   1.00 0.00 ? 75  VAL A H    4  
ATOM   9797  H  HA   . VAL A 1 75 ? 140.047 3.534   1.106   1.00 0.00 ? 75  VAL A HA   4  
ATOM   9798  H  HB   . VAL A 1 75 ? 141.455 6.198   1.343   1.00 0.00 ? 75  VAL A HB   4  
ATOM   9799  H  HG11 . VAL A 1 75 ? 143.300 4.873   1.060   1.00 0.00 ? 75  VAL A HG11 4  
ATOM   9800  H  HG12 . VAL A 1 75 ? 142.792 4.934   -0.624  1.00 0.00 ? 75  VAL A HG12 4  
ATOM   9801  H  HG13 . VAL A 1 75 ? 142.381 3.537   0.370   1.00 0.00 ? 75  VAL A HG13 4  
ATOM   9802  H  HG21 . VAL A 1 75 ? 141.051 5.880   -1.269  1.00 0.00 ? 75  VAL A HG21 4  
ATOM   9803  H  HG22 . VAL A 1 75 ? 139.782 6.526   -0.232  1.00 0.00 ? 75  VAL A HG22 4  
ATOM   9804  H  HG23 . VAL A 1 75 ? 139.748 4.831   -0.713  1.00 0.00 ? 75  VAL A HG23 4  
ATOM   9805  N  N    . VAL A 1 76 ? 141.504 4.611   3.854   1.00 0.00 ? 76  VAL A N    4  
ATOM   9806  C  CA   . VAL A 1 76 ? 142.324 4.157   4.969   1.00 0.00 ? 76  VAL A CA   4  
ATOM   9807  C  C    . VAL A 1 76 ? 141.674 2.979   5.692   1.00 0.00 ? 76  VAL A C    4  
ATOM   9808  O  O    . VAL A 1 76 ? 142.350 2.016   6.058   1.00 0.00 ? 76  VAL A O    4  
ATOM   9809  C  CB   . VAL A 1 76 ? 142.534 5.306   5.957   1.00 0.00 ? 76  VAL A CB   4  
ATOM   9810  C  CG1  . VAL A 1 76 ? 143.247 4.783   7.205   1.00 0.00 ? 76  VAL A CG1  4  
ATOM   9811  C  CG2  . VAL A 1 76 ? 143.389 6.392   5.301   1.00 0.00 ? 76  VAL A CG2  4  
ATOM   9812  H  H    . VAL A 1 76 ? 141.110 5.509   3.872   1.00 0.00 ? 76  VAL A H    4  
ATOM   9813  H  HA   . VAL A 1 76 ? 143.284 3.846   4.593   1.00 0.00 ? 76  VAL A HA   4  
ATOM   9814  H  HB   . VAL A 1 76 ? 141.576 5.720   6.236   1.00 0.00 ? 76  VAL A HB   4  
ATOM   9815  H  HG11 . VAL A 1 76 ? 143.962 4.027   6.920   1.00 0.00 ? 76  VAL A HG11 4  
ATOM   9816  H  HG12 . VAL A 1 76 ? 142.521 4.356   7.881   1.00 0.00 ? 76  VAL A HG12 4  
ATOM   9817  H  HG13 . VAL A 1 76 ? 143.759 5.597   7.695   1.00 0.00 ? 76  VAL A HG13 4  
ATOM   9818  H  HG21 . VAL A 1 76 ? 142.831 6.855   4.500   1.00 0.00 ? 76  VAL A HG21 4  
ATOM   9819  H  HG22 . VAL A 1 76 ? 144.290 5.949   4.901   1.00 0.00 ? 76  VAL A HG22 4  
ATOM   9820  H  HG23 . VAL A 1 76 ? 143.649 7.138   6.036   1.00 0.00 ? 76  VAL A HG23 4  
ATOM   9821  N  N    . LEU A 1 77 ? 140.365 3.070   5.913   1.00 0.00 ? 77  LEU A N    4  
ATOM   9822  C  CA   . LEU A 1 77 ? 139.642 2.013   6.615   1.00 0.00 ? 77  LEU A CA   4  
ATOM   9823  C  C    . LEU A 1 77 ? 139.676 0.711   5.803   1.00 0.00 ? 77  LEU A C    4  
ATOM   9824  O  O    . LEU A 1 77 ? 139.844 -0.371  6.354   1.00 0.00 ? 77  LEU A O    4  
ATOM   9825  C  CB   . LEU A 1 77 ? 138.191 2.483   6.833   1.00 0.00 ? 77  LEU A CB   4  
ATOM   9826  C  CG   . LEU A 1 77 ? 137.482 1.706   7.970   1.00 0.00 ? 77  LEU A CG   4  
ATOM   9827  C  CD1  . LEU A 1 77 ? 137.789 0.212   7.920   1.00 0.00 ? 77  LEU A CD1  4  
ATOM   9828  C  CD2  . LEU A 1 77 ? 137.945 2.251   9.326   1.00 0.00 ? 77  LEU A CD2  4  
ATOM   9829  H  H    . LEU A 1 77 ? 139.881 3.867   5.612   1.00 0.00 ? 77  LEU A H    4  
ATOM   9830  H  HA   . LEU A 1 77 ? 140.105 1.844   7.575   1.00 0.00 ? 77  LEU A HA   4  
ATOM   9831  H  HB2  . LEU A 1 77 ? 138.198 3.534   7.075   1.00 0.00 ? 77  LEU A HB2  4  
ATOM   9832  H  HB3  . LEU A 1 77 ? 137.639 2.341   5.915   1.00 0.00 ? 77  LEU A HB3  4  
ATOM   9833  H  HG   . LEU A 1 77 ? 136.415 1.848   7.880   1.00 0.00 ? 77  LEU A HG   4  
ATOM   9834  H  HD11 . LEU A 1 77 ? 138.806 0.046   8.237   1.00 0.00 ? 77  LEU A HD11 4  
ATOM   9835  H  HD12 . LEU A 1 77 ? 137.644 -0.159  6.918   1.00 0.00 ? 77  LEU A HD12 4  
ATOM   9836  H  HD13 . LEU A 1 77 ? 137.121 -0.310  8.589   1.00 0.00 ? 77  LEU A HD13 4  
ATOM   9837  H  HD21 . LEU A 1 77 ? 138.939 1.889   9.538   1.00 0.00 ? 77  LEU A HD21 4  
ATOM   9838  H  HD22 . LEU A 1 77 ? 137.268 1.913   10.097  1.00 0.00 ? 77  LEU A HD22 4  
ATOM   9839  H  HD23 . LEU A 1 77 ? 137.952 3.330   9.304   1.00 0.00 ? 77  LEU A HD23 4  
ATOM   9840  N  N    . VAL A 1 78 ? 139.532 0.814   4.485   1.00 0.00 ? 78  VAL A N    4  
ATOM   9841  C  CA   . VAL A 1 78 ? 139.549 -0.385  3.642   1.00 0.00 ? 78  VAL A CA   4  
ATOM   9842  C  C    . VAL A 1 78 ? 140.869 -1.135  3.737   1.00 0.00 ? 78  VAL A C    4  
ATOM   9843  O  O    . VAL A 1 78 ? 140.887 -2.366  3.721   1.00 0.00 ? 78  VAL A O    4  
ATOM   9844  C  CB   . VAL A 1 78 ? 139.291 -0.025  2.174   1.00 0.00 ? 78  VAL A CB   4  
ATOM   9845  C  CG1  . VAL A 1 78 ? 139.561 -1.248  1.292   1.00 0.00 ? 78  VAL A CG1  4  
ATOM   9846  C  CG2  . VAL A 1 78 ? 137.832 0.393   1.991   1.00 0.00 ? 78  VAL A CG2  4  
ATOM   9847  H  H    . VAL A 1 78 ? 139.407 1.701   4.073   1.00 0.00 ? 78  VAL A H    4  
ATOM   9848  H  HA   . VAL A 1 78 ? 138.764 -1.045  3.975   1.00 0.00 ? 78  VAL A HA   4  
ATOM   9849  H  HB   . VAL A 1 78 ? 139.942 0.786   1.880   1.00 0.00 ? 78  VAL A HB   4  
ATOM   9850  H  HG11 . VAL A 1 78 ? 139.101 -2.120  1.734   1.00 0.00 ? 78  VAL A HG11 4  
ATOM   9851  H  HG12 . VAL A 1 78 ? 140.626 -1.406  1.211   1.00 0.00 ? 78  VAL A HG12 4  
ATOM   9852  H  HG13 . VAL A 1 78 ? 139.145 -1.081  0.308   1.00 0.00 ? 78  VAL A HG13 4  
ATOM   9853  H  HG21 . VAL A 1 78 ? 137.198 -0.223  2.610   1.00 0.00 ? 78  VAL A HG21 4  
ATOM   9854  H  HG22 . VAL A 1 78 ? 137.555 0.264   0.956   1.00 0.00 ? 78  VAL A HG22 4  
ATOM   9855  H  HG23 . VAL A 1 78 ? 137.715 1.427   2.269   1.00 0.00 ? 78  VAL A HG23 4  
ATOM   9856  N  N    . ALA A 1 79 ? 141.967 -0.398  3.795   1.00 0.00 ? 79  ALA A N    4  
ATOM   9857  C  CA   . ALA A 1 79 ? 143.282 -1.020  3.837   1.00 0.00 ? 79  ALA A CA   4  
ATOM   9858  C  C    . ALA A 1 79 ? 143.442 -1.944  5.047   1.00 0.00 ? 79  ALA A C    4  
ATOM   9859  O  O    . ALA A 1 79 ? 144.050 -3.006  4.942   1.00 0.00 ? 79  ALA A O    4  
ATOM   9860  C  CB   . ALA A 1 79 ? 144.353 0.082   3.865   1.00 0.00 ? 79  ALA A CB   4  
ATOM   9861  H  H    . ALA A 1 79 ? 141.894 0.580   3.775   1.00 0.00 ? 79  ALA A H    4  
ATOM   9862  H  HA   . ALA A 1 79 ? 143.415 -1.605  2.938   1.00 0.00 ? 79  ALA A HA   4  
ATOM   9863  H  HB1  . ALA A 1 79 ? 144.888 0.051   4.803   1.00 0.00 ? 79  ALA A HB1  4  
ATOM   9864  H  HB2  . ALA A 1 79 ? 143.877 1.046   3.760   1.00 0.00 ? 79  ALA A HB2  4  
ATOM   9865  H  HB3  . ALA A 1 79 ? 145.048 -0.062  3.050   1.00 0.00 ? 79  ALA A HB3  4  
ATOM   9866  N  N    . ALA A 1 80 ? 142.908 -1.547  6.192   1.00 0.00 ? 80  ALA A N    4  
ATOM   9867  C  CA   . ALA A 1 80 ? 143.027 -2.384  7.381   1.00 0.00 ? 80  ALA A CA   4  
ATOM   9868  C  C    . ALA A 1 80 ? 142.197 -3.666  7.259   1.00 0.00 ? 80  ALA A C    4  
ATOM   9869  O  O    . ALA A 1 80 ? 142.652 -4.751  7.624   1.00 0.00 ? 80  ALA A O    4  
ATOM   9870  C  CB   . ALA A 1 80 ? 142.575 -1.599  8.612   1.00 0.00 ? 80  ALA A CB   4  
ATOM   9871  H  H    . ALA A 1 80 ? 142.433 -0.691  6.241   1.00 0.00 ? 80  ALA A H    4  
ATOM   9872  H  HA   . ALA A 1 80 ? 144.063 -2.655  7.510   1.00 0.00 ? 80  ALA A HA   4  
ATOM   9873  H  HB1  . ALA A 1 80 ? 141.568 -1.239  8.461   1.00 0.00 ? 80  ALA A HB1  4  
ATOM   9874  H  HB2  . ALA A 1 80 ? 143.238 -0.761  8.767   1.00 0.00 ? 80  ALA A HB2  4  
ATOM   9875  H  HB3  . ALA A 1 80 ? 142.600 -2.242  9.479   1.00 0.00 ? 80  ALA A HB3  4  
ATOM   9876  N  N    . LEU A 1 81 ? 140.969 -3.524  6.763   1.00 0.00 ? 81  LEU A N    4  
ATOM   9877  C  CA   . LEU A 1 81 ? 140.060 -4.667  6.615   1.00 0.00 ? 81  LEU A CA   4  
ATOM   9878  C  C    . LEU A 1 81 ? 140.513 -5.668  5.555   1.00 0.00 ? 81  LEU A C    4  
ATOM   9879  O  O    . LEU A 1 81 ? 140.362 -6.877  5.745   1.00 0.00 ? 81  LEU A O    4  
ATOM   9880  C  CB   . LEU A 1 81 ? 138.640 -4.185  6.285   1.00 0.00 ? 81  LEU A CB   4  
ATOM   9881  C  CG   . LEU A 1 81 ? 137.954 -3.551  7.513   1.00 0.00 ? 81  LEU A CG   4  
ATOM   9882  C  CD1  . LEU A 1 81 ? 137.294 -4.650  8.350   1.00 0.00 ? 81  LEU A CD1  4  
ATOM   9883  C  CD2  . LEU A 1 81 ? 138.955 -2.780  8.388   1.00 0.00 ? 81  LEU A CD2  4  
ATOM   9884  H  H    . LEU A 1 81 ? 140.666 -2.635  6.499   1.00 0.00 ? 81  LEU A H    4  
ATOM   9885  H  HA   . LEU A 1 81 ? 140.023 -5.191  7.555   1.00 0.00 ? 81  LEU A HA   4  
ATOM   9886  H  HB2  . LEU A 1 81 ? 138.693 -3.451  5.494   1.00 0.00 ? 81  LEU A HB2  4  
ATOM   9887  H  HB3  . LEU A 1 81 ? 138.052 -5.026  5.947   1.00 0.00 ? 81  LEU A HB3  4  
ATOM   9888  H  HG   . LEU A 1 81 ? 137.187 -2.870  7.168   1.00 0.00 ? 81  LEU A HG   4  
ATOM   9889  H  HD11 . LEU A 1 81 ? 137.914 -5.533  8.340   1.00 0.00 ? 81  LEU A HD11 4  
ATOM   9890  H  HD12 . LEU A 1 81 ? 136.326 -4.885  7.933   1.00 0.00 ? 81  LEU A HD12 4  
ATOM   9891  H  HD13 . LEU A 1 81 ? 137.173 -4.305  9.367   1.00 0.00 ? 81  LEU A HD13 4  
ATOM   9892  H  HD21 . LEU A 1 81 ? 139.496 -2.076  7.785   1.00 0.00 ? 81  LEU A HD21 4  
ATOM   9893  H  HD22 . LEU A 1 81 ? 139.645 -3.464  8.854   1.00 0.00 ? 81  LEU A HD22 4  
ATOM   9894  H  HD23 . LEU A 1 81 ? 138.415 -2.247  9.157   1.00 0.00 ? 81  LEU A HD23 4  
ATOM   9895  N  N    . THR A 1 82 ? 141.050 -5.190  4.436   1.00 0.00 ? 82  THR A N    4  
ATOM   9896  C  CA   . THR A 1 82 ? 141.476 -6.125  3.395   1.00 0.00 ? 82  THR A CA   4  
ATOM   9897  C  C    . THR A 1 82 ? 142.518 -7.082  3.952   1.00 0.00 ? 82  THR A C    4  
ATOM   9898  O  O    . THR A 1 82 ? 142.461 -8.287  3.707   1.00 0.00 ? 82  THR A O    4  
ATOM   9899  C  CB   . THR A 1 82 ? 142.031 -5.396  2.161   1.00 0.00 ? 82  THR A CB   4  
ATOM   9900  O  OG1  . THR A 1 82 ? 142.691 -6.334  1.323   1.00 0.00 ? 82  THR A OG1  4  
ATOM   9901  C  CG2  . THR A 1 82 ? 143.020 -4.306  2.574   1.00 0.00 ? 82  THR A CG2  4  
ATOM   9902  H  H    . THR A 1 82 ? 141.142 -4.222  4.306   1.00 0.00 ? 82  THR A H    4  
ATOM   9903  H  HA   . THR A 1 82 ? 140.615 -6.704  3.090   1.00 0.00 ? 82  THR A HA   4  
ATOM   9904  H  HB   . THR A 1 82 ? 141.216 -4.946  1.616   1.00 0.00 ? 82  THR A HB   4  
ATOM   9905  H  HG1  . THR A 1 82 ? 143.006 -7.054  1.875   1.00 0.00 ? 82  THR A HG1  4  
ATOM   9906  H  HG21 . THR A 1 82 ? 142.611 -3.741  3.388   1.00 0.00 ? 82  THR A HG21 4  
ATOM   9907  H  HG22 . THR A 1 82 ? 143.198 -3.648  1.736   1.00 0.00 ? 82  THR A HG22 4  
ATOM   9908  H  HG23 . THR A 1 82 ? 143.950 -4.761  2.880   1.00 0.00 ? 82  THR A HG23 4  
ATOM   9909  N  N    . VAL A 1 83 ? 143.456 -6.545  4.720   1.00 0.00 ? 83  VAL A N    4  
ATOM   9910  C  CA   . VAL A 1 83 ? 144.489 -7.372  5.325   1.00 0.00 ? 83  VAL A CA   4  
ATOM   9911  C  C    . VAL A 1 83 ? 143.859 -8.355  6.309   1.00 0.00 ? 83  VAL A C    4  
ATOM   9912  O  O    . VAL A 1 83 ? 144.244 -9.522  6.377   1.00 0.00 ? 83  VAL A O    4  
ATOM   9913  C  CB   . VAL A 1 83 ? 145.493 -6.485  6.058   1.00 0.00 ? 83  VAL A CB   4  
ATOM   9914  C  CG1  . VAL A 1 83 ? 146.522 -7.356  6.778   1.00 0.00 ? 83  VAL A CG1  4  
ATOM   9915  C  CG2  . VAL A 1 83 ? 146.192 -5.570  5.052   1.00 0.00 ? 83  VAL A CG2  4  
ATOM   9916  H  H    . VAL A 1 83 ? 143.445 -5.581  4.896   1.00 0.00 ? 83  VAL A H    4  
ATOM   9917  H  HA   . VAL A 1 83 ? 145.002 -7.923  4.552   1.00 0.00 ? 83  VAL A HA   4  
ATOM   9918  H  HB   . VAL A 1 83 ? 144.970 -5.882  6.783   1.00 0.00 ? 83  VAL A HB   4  
ATOM   9919  H  HG11 . VAL A 1 83 ? 146.881 -8.120  6.104   1.00 0.00 ? 83  VAL A HG11 4  
ATOM   9920  H  HG12 . VAL A 1 83 ? 146.063 -7.820  7.637   1.00 0.00 ? 83  VAL A HG12 4  
ATOM   9921  H  HG13 . VAL A 1 83 ? 147.350 -6.742  7.100   1.00 0.00 ? 83  VAL A HG13 4  
ATOM   9922  H  HG21 . VAL A 1 83 ? 146.305 -6.088  4.112   1.00 0.00 ? 83  VAL A HG21 4  
ATOM   9923  H  HG22 . VAL A 1 83 ? 147.164 -5.294  5.431   1.00 0.00 ? 83  VAL A HG22 4  
ATOM   9924  H  HG23 . VAL A 1 83 ? 145.595 -4.682  4.904   1.00 0.00 ? 83  VAL A HG23 4  
ATOM   9925  N  N    . ALA A 1 84 ? 142.887 -7.859  7.071   1.00 0.00 ? 84  ALA A N    4  
ATOM   9926  C  CA   . ALA A 1 84 ? 142.191 -8.677  8.060   1.00 0.00 ? 84  ALA A CA   4  
ATOM   9927  C  C    . ALA A 1 84 ? 141.418 -9.812  7.400   1.00 0.00 ? 84  ALA A C    4  
ATOM   9928  O  O    . ALA A 1 84 ? 141.248 -10.881 7.986   1.00 0.00 ? 84  ALA A O    4  
ATOM   9929  C  CB   . ALA A 1 84 ? 141.226 -7.806  8.866   1.00 0.00 ? 84  ALA A CB   4  
ATOM   9930  H  H    . ALA A 1 84 ? 142.631 -6.919  6.965   1.00 0.00 ? 84  ALA A H    4  
ATOM   9931  H  HA   . ALA A 1 84 ? 142.920 -9.099  8.736   1.00 0.00 ? 84  ALA A HA   4  
ATOM   9932  H  HB1  . ALA A 1 84 ? 141.711 -6.877  9.126   1.00 0.00 ? 84  ALA A HB1  4  
ATOM   9933  H  HB2  . ALA A 1 84 ? 140.937 -8.327  9.767   1.00 0.00 ? 84  ALA A HB2  4  
ATOM   9934  H  HB3  . ALA A 1 84 ? 140.347 -7.600  8.273   1.00 0.00 ? 84  ALA A HB3  4  
ATOM   9935  N  N    . CYS A 1 85 ? 140.935 -9.571  6.185   1.00 0.00 ? 85  CYS A N    4  
ATOM   9936  C  CA   . CYS A 1 85 ? 140.163 -10.582 5.472   1.00 0.00 ? 85  CYS A CA   4  
ATOM   9937  C  C    . CYS A 1 85 ? 140.944 -11.890 5.371   1.00 0.00 ? 85  CYS A C    4  
ATOM   9938  O  O    . CYS A 1 85 ? 140.364 -12.974 5.442   1.00 0.00 ? 85  CYS A O    4  
ATOM   9939  C  CB   . CYS A 1 85 ? 139.816 -10.081 4.070   1.00 0.00 ? 85  CYS A CB   4  
ATOM   9940  S  SG   . CYS A 1 85 ? 138.775 -8.606  4.197   1.00 0.00 ? 85  CYS A SG   4  
ATOM   9941  H  H    . CYS A 1 85 ? 141.087 -8.695  5.769   1.00 0.00 ? 85  CYS A H    4  
ATOM   9942  H  HA   . CYS A 1 85 ? 139.246 -10.765 6.010   1.00 0.00 ? 85  CYS A HA   4  
ATOM   9943  H  HB2  . CYS A 1 85 ? 140.725 -9.835  3.540   1.00 0.00 ? 85  CYS A HB2  4  
ATOM   9944  H  HB3  . CYS A 1 85 ? 139.284 -10.852 3.533   1.00 0.00 ? 85  CYS A HB3  4  
ATOM   9945  H  HG   . CYS A 1 85 ? 139.302 -7.848  3.934   1.00 0.00 ? 85  CYS A HG   4  
ATOM   9946  N  N    . ASN A 1 86 ? 142.258 -11.783 5.211   1.00 0.00 ? 86  ASN A N    4  
ATOM   9947  C  CA   . ASN A 1 86 ? 143.100 -12.970 5.111   1.00 0.00 ? 86  ASN A CA   4  
ATOM   9948  C  C    . ASN A 1 86 ? 142.918 -13.867 6.332   1.00 0.00 ? 86  ASN A C    4  
ATOM   9949  O  O    . ASN A 1 86 ? 142.981 -15.101 6.223   1.00 0.00 ? 86  ASN A O    4  
ATOM   9950  C  CB   . ASN A 1 86 ? 144.568 -12.563 4.981   1.00 0.00 ? 86  ASN A CB   4  
ATOM   9951  C  CG   . ASN A 1 86 ? 144.767 -11.767 3.697   1.00 0.00 ? 86  ASN A CG   4  
ATOM   9952  O  OD1  . ASN A 1 86 ? 145.449 -10.742 3.700   1.00 0.00 ? 86  ASN A OD1  4  
ATOM   9953  N  ND2  . ASN A 1 86 ? 144.205 -12.181 2.594   1.00 0.00 ? 86  ASN A ND2  4  
ATOM   9954  H  H    . ASN A 1 86 ? 142.668 -10.895 5.166   1.00 0.00 ? 86  ASN A H    4  
ATOM   9955  H  HA   . ASN A 1 86 ? 142.815 -13.524 4.229   1.00 0.00 ? 86  ASN A HA   4  
ATOM   9956  H  HB2  . ASN A 1 86 ? 144.848 -11.956 5.829   1.00 0.00 ? 86  ASN A HB2  4  
ATOM   9957  H  HB3  . ASN A 1 86 ? 145.185 -13.448 4.953   1.00 0.00 ? 86  ASN A HB3  4  
ATOM   9958  H  HD21 . ASN A 1 86 ? 143.663 -12.997 2.598   1.00 0.00 ? 86  ASN A HD21 4  
ATOM   9959  H  HD22 . ASN A 1 86 ? 144.326 -11.678 1.763   1.00 0.00 ? 86  ASN A HD22 4  
ATOM   9960  N  N    . ASN A 1 87 ? 142.688 -13.239 7.492   1.00 0.00 ? 87  ASN A N    4  
ATOM   9961  C  CA   . ASN A 1 87 ? 142.499 -13.991 8.727   1.00 0.00 ? 87  ASN A CA   4  
ATOM   9962  C  C    . ASN A 1 87 ? 141.408 -15.029 8.519   1.00 0.00 ? 87  ASN A C    4  
ATOM   9963  O  O    . ASN A 1 87 ? 141.510 -16.165 8.964   1.00 0.00 ? 87  ASN A O    4  
ATOM   9964  C  CB   . ASN A 1 87 ? 142.092 -13.037 9.854   1.00 0.00 ? 87  ASN A CB   4  
ATOM   9965  C  CG   . ASN A 1 87 ? 142.193 -13.743 11.203  1.00 0.00 ? 87  ASN A CG   4  
ATOM   9966  O  OD1  . ASN A 1 87 ? 142.894 -14.746 11.330  1.00 0.00 ? 87  ASN A OD1  4  
ATOM   9967  N  ND2  . ASN A 1 87 ? 141.531 -13.274 12.225  1.00 0.00 ? 87  ASN A ND2  4  
ATOM   9968  H  H    . ASN A 1 87 ? 142.646 -12.261 7.510   1.00 0.00 ? 87  ASN A H    4  
ATOM   9969  H  HA   . ASN A 1 87 ? 143.422 -14.480 8.996   1.00 0.00 ? 87  ASN A HA   4  
ATOM   9970  H  HB2  . ASN A 1 87 ? 142.746 -12.178 9.849   1.00 0.00 ? 87  ASN A HB2  4  
ATOM   9971  H  HB3  . ASN A 1 87 ? 141.074 -12.713 9.698   1.00 0.00 ? 87  ASN A HB3  4  
ATOM   9972  H  HD21 . ASN A 1 87 ? 140.972 -12.475 12.122  1.00 0.00 ? 87  ASN A HD21 4  
ATOM   9973  H  HD22 . ASN A 1 87 ? 141.590 -13.721 13.094  1.00 0.00 ? 87  ASN A HD22 4  
ATOM   9974  N  N    . PHE A 1 88 ? 140.372 -14.637 7.805   1.00 0.00 ? 88  PHE A N    4  
ATOM   9975  C  CA   . PHE A 1 88 ? 139.297 -15.558 7.493   1.00 0.00 ? 88  PHE A CA   4  
ATOM   9976  C  C    . PHE A 1 88 ? 139.810 -16.662 6.567   1.00 0.00 ? 88  PHE A C    4  
ATOM   9977  O  O    . PHE A 1 88 ? 139.429 -17.827 6.682   1.00 0.00 ? 88  PHE A O    4  
ATOM   9978  C  CB   . PHE A 1 88 ? 138.144 -14.812 6.819   1.00 0.00 ? 88  PHE A CB   4  
ATOM   9979  C  CG   . PHE A 1 88 ? 136.984 -15.756 6.613   1.00 0.00 ? 88  PHE A CG   4  
ATOM   9980  C  CD1  . PHE A 1 88 ? 136.063 -15.968 7.646   1.00 0.00 ? 88  PHE A CD1  4  
ATOM   9981  C  CD2  . PHE A 1 88 ? 136.829 -16.419 5.390   1.00 0.00 ? 88  PHE A CD2  4  
ATOM   9982  C  CE1  . PHE A 1 88 ? 134.987 -16.843 7.457   1.00 0.00 ? 88  PHE A CE1  4  
ATOM   9983  C  CE2  . PHE A 1 88 ? 135.752 -17.295 5.200   1.00 0.00 ? 88  PHE A CE2  4  
ATOM   9984  C  CZ   . PHE A 1 88 ? 134.832 -17.506 6.234   1.00 0.00 ? 88  PHE A CZ   4  
ATOM   9985  H  H    . PHE A 1 88 ? 140.345 -13.725 7.449   1.00 0.00 ? 88  PHE A H    4  
ATOM   9986  H  HA   . PHE A 1 88 ? 138.937 -16.004 8.409   1.00 0.00 ? 88  PHE A HA   4  
ATOM   9987  H  HB2  . PHE A 1 88 ? 137.833 -13.989 7.444   1.00 0.00 ? 88  PHE A HB2  4  
ATOM   9988  H  HB3  . PHE A 1 88 ? 138.472 -14.433 5.862   1.00 0.00 ? 88  PHE A HB3  4  
ATOM   9989  H  HD1  . PHE A 1 88 ? 136.183 -15.456 8.590   1.00 0.00 ? 88  PHE A HD1  4  
ATOM   9990  H  HD2  . PHE A 1 88 ? 137.539 -16.256 4.593   1.00 0.00 ? 88  PHE A HD2  4  
ATOM   9991  H  HE1  . PHE A 1 88 ? 134.276 -17.006 8.253   1.00 0.00 ? 88  PHE A HE1  4  
ATOM   9992  H  HE2  . PHE A 1 88 ? 135.632 -17.806 4.257   1.00 0.00 ? 88  PHE A HE2  4  
ATOM   9993  H  HZ   . PHE A 1 88 ? 134.001 -18.182 6.087   1.00 0.00 ? 88  PHE A HZ   4  
ATOM   9994  N  N    . PHE A 1 89 ? 140.627 -16.243 5.597   1.00 0.00 ? 89  PHE A N    4  
ATOM   9995  C  CA   . PHE A 1 89 ? 141.154 -17.139 4.567   1.00 0.00 ? 89  PHE A CA   4  
ATOM   9996  C  C    . PHE A 1 89 ? 141.987 -18.307 5.094   1.00 0.00 ? 89  PHE A C    4  
ATOM   9997  O  O    . PHE A 1 89 ? 141.758 -19.449 4.699   1.00 0.00 ? 89  PHE A O    4  
ATOM   9998  C  CB   . PHE A 1 89 ? 142.045 -16.328 3.633   1.00 0.00 ? 89  PHE A CB   4  
ATOM   9999  C  CG   . PHE A 1 89 ? 142.446 -17.176 2.449   1.00 0.00 ? 89  PHE A CG   4  
ATOM   10000 C  CD1  . PHE A 1 89 ? 141.600 -17.272 1.339   1.00 0.00 ? 89  PHE A CD1  4  
ATOM   10001 C  CD2  . PHE A 1 89 ? 143.664 -17.865 2.464   1.00 0.00 ? 89  PHE A CD2  4  
ATOM   10002 C  CE1  . PHE A 1 89 ? 141.972 -18.058 0.242   1.00 0.00 ? 89  PHE A CE1  4  
ATOM   10003 C  CE2  . PHE A 1 89 ? 144.036 -18.651 1.366   1.00 0.00 ? 89  PHE A CE2  4  
ATOM   10004 C  CZ   . PHE A 1 89 ? 143.190 -18.747 0.256   1.00 0.00 ? 89  PHE A CZ   4  
ATOM   10005 H  H    . PHE A 1 89 ? 140.839 -15.287 5.544   1.00 0.00 ? 89  PHE A H    4  
ATOM   10006 H  HA   . PHE A 1 89 ? 140.333 -17.530 3.991   1.00 0.00 ? 89  PHE A HA   4  
ATOM   10007 H  HB2  . PHE A 1 89 ? 141.517 -15.455 3.305   1.00 0.00 ? 89  PHE A HB2  4  
ATOM   10008 H  HB3  . PHE A 1 89 ? 142.933 -16.025 4.163   1.00 0.00 ? 89  PHE A HB3  4  
ATOM   10009 H  HD1  . PHE A 1 89 ? 140.660 -16.740 1.328   1.00 0.00 ? 89  PHE A HD1  4  
ATOM   10010 H  HD2  . PHE A 1 89 ? 144.316 -17.791 3.321   1.00 0.00 ? 89  PHE A HD2  4  
ATOM   10011 H  HE1  . PHE A 1 89 ? 141.319 -18.132 -0.616  1.00 0.00 ? 89  PHE A HE1  4  
ATOM   10012 H  HE2  . PHE A 1 89 ? 144.976 -19.184 1.377   1.00 0.00 ? 89  PHE A HE2  4  
ATOM   10013 H  HZ   . PHE A 1 89 ? 143.477 -19.354 -0.591  1.00 0.00 ? 89  PHE A HZ   4  
ATOM   10014 N  N    . TRP A 1 90 ? 142.973 -18.041 5.949   1.00 0.00 ? 90  TRP A N    4  
ATOM   10015 C  CA   . TRP A 1 90 ? 143.811 -19.153 6.431   1.00 0.00 ? 90  TRP A CA   4  
ATOM   10016 C  C    . TRP A 1 90 ? 142.991 -20.159 7.234   1.00 0.00 ? 90  TRP A C    4  
ATOM   10017 O  O    . TRP A 1 90 ? 143.261 -21.359 7.196   1.00 0.00 ? 90  TRP A O    4  
ATOM   10018 C  CB   . TRP A 1 90 ? 145.002 -18.656 7.253   1.00 0.00 ? 90  TRP A CB   4  
ATOM   10019 C  CG   . TRP A 1 90 ? 144.522 -18.124 8.548   1.00 0.00 ? 90  TRP A CG   4  
ATOM   10020 C  CD1  . TRP A 1 90 ? 143.807 -17.004 8.674   1.00 0.00 ? 90  TRP A CD1  4  
ATOM   10021 C  CD2  . TRP A 1 90 ? 144.726 -18.645 9.893   1.00 0.00 ? 90  TRP A CD2  4  
ATOM   10022 N  NE1  . TRP A 1 90 ? 143.528 -16.795 10.013  1.00 0.00 ? 90  TRP A NE1  4  
ATOM   10023 C  CE2  . TRP A 1 90 ? 144.081 -17.780 10.807  1.00 0.00 ? 90  TRP A CE2  4  
ATOM   10024 C  CE3  . TRP A 1 90 ? 145.394 -19.773 10.404  1.00 0.00 ? 90  TRP A CE3  4  
ATOM   10025 C  CZ2  . TRP A 1 90 ? 144.098 -18.022 12.181  1.00 0.00 ? 90  TRP A CZ2  4  
ATOM   10026 C  CZ3  . TRP A 1 90 ? 145.414 -20.020 11.787  1.00 0.00 ? 90  TRP A CZ3  4  
ATOM   10027 C  CH2  . TRP A 1 90 ? 144.768 -19.147 12.673  1.00 0.00 ? 90  TRP A CH2  4  
ATOM   10028 H  H    . TRP A 1 90 ? 143.155 -17.103 6.229   1.00 0.00 ? 90  TRP A H    4  
ATOM   10029 H  HA   . TRP A 1 90 ? 144.199 -19.668 5.563   1.00 0.00 ? 90  TRP A HA   4  
ATOM   10030 H  HB2  . TRP A 1 90 ? 145.682 -19.475 7.430   1.00 0.00 ? 90  TRP A HB2  4  
ATOM   10031 H  HB3  . TRP A 1 90 ? 145.513 -17.874 6.709   1.00 0.00 ? 90  TRP A HB3  4  
ATOM   10032 H  HD1  . TRP A 1 90 ? 143.483 -16.383 7.854   1.00 0.00 ? 90  TRP A HD1  4  
ATOM   10033 H  HE1  . TRP A 1 90 ? 143.012 -16.045 10.372  1.00 0.00 ? 90  TRP A HE1  4  
ATOM   10034 H  HE3  . TRP A 1 90 ? 145.895 -20.451 9.730   1.00 0.00 ? 90  TRP A HE3  4  
ATOM   10035 H  HZ2  . TRP A 1 90 ? 143.598 -17.346 12.859  1.00 0.00 ? 90  TRP A HZ2  4  
ATOM   10036 H  HZ3  . TRP A 1 90 ? 145.931 -20.887 12.169  1.00 0.00 ? 90  TRP A HZ3  4  
ATOM   10037 H  HH2  . TRP A 1 90 ? 144.786 -19.342 13.735  1.00 0.00 ? 90  TRP A HH2  4  
ATOM   10038 N  N    . GLU A 1 91 ? 141.987 -19.669 7.954   1.00 0.00 ? 91  GLU A N    4  
ATOM   10039 C  CA   . GLU A 1 91 ? 141.138 -20.550 8.751   1.00 0.00 ? 91  GLU A CA   4  
ATOM   10040 C  C    . GLU A 1 91 ? 140.410 -21.549 7.858   1.00 0.00 ? 91  GLU A C    4  
ATOM   10041 O  O    . GLU A 1 91 ? 140.152 -22.683 8.263   1.00 0.00 ? 91  GLU A O    4  
ATOM   10042 C  CB   . GLU A 1 91 ? 140.120 -19.726 9.542   1.00 0.00 ? 91  GLU A CB   4  
ATOM   10043 C  CG   . GLU A 1 91 ? 140.854 -18.858 10.564  1.00 0.00 ? 91  GLU A CG   4  
ATOM   10044 C  CD   . GLU A 1 91 ? 139.849 -18.074 11.401  1.00 0.00 ? 91  GLU A CD   4  
ATOM   10045 O  OE1  . GLU A 1 91 ? 138.677 -18.098 11.060  1.00 0.00 ? 91  GLU A OE1  4  
ATOM   10046 O  OE2  . GLU A 1 91 ? 140.264 -17.460 12.371  1.00 0.00 ? 91  GLU A OE2  4  
ATOM   10047 H  H    . GLU A 1 91 ? 141.811 -18.704 7.945   1.00 0.00 ? 91  GLU A H    4  
ATOM   10048 H  HA   . GLU A 1 91 ? 141.759 -21.093 9.447   1.00 0.00 ? 91  GLU A HA   4  
ATOM   10049 H  HB2  . GLU A 1 91 ? 139.563 -19.095 8.865   1.00 0.00 ? 91  GLU A HB2  4  
ATOM   10050 H  HB3  . GLU A 1 91 ? 139.442 -20.390 10.056  1.00 0.00 ? 91  GLU A HB3  4  
ATOM   10051 H  HG2  . GLU A 1 91 ? 141.443 -19.490 11.213  1.00 0.00 ? 91  GLU A HG2  4  
ATOM   10052 H  HG3  . GLU A 1 91 ? 141.505 -18.170 10.049  1.00 0.00 ? 91  GLU A HG3  4  
ATOM   10053 N  N    . ASN A 1 92 ? 140.083 -21.122 6.643   1.00 0.00 ? 92  ASN A N    4  
ATOM   10054 C  CA   . ASN A 1 92 ? 139.384 -21.990 5.702   1.00 0.00 ? 92  ASN A CA   4  
ATOM   10055 C  C    . ASN A 1 92 ? 140.159 -23.285 5.489   1.00 0.00 ? 92  ASN A C    4  
ATOM   10056 O  O    . ASN A 1 92 ? 139.570 -24.350 5.300   1.00 0.00 ? 92  ASN A O    4  
ATOM   10057 C  CB   . ASN A 1 92 ? 139.207 -21.274 4.362   1.00 0.00 ? 92  ASN A CB   4  
ATOM   10058 C  CG   . ASN A 1 92 ? 138.305 -20.057 4.537   1.00 0.00 ? 92  ASN A CG   4  
ATOM   10059 O  OD1  . ASN A 1 92 ? 138.015 -19.353 3.569   1.00 0.00 ? 92  ASN A OD1  4  
ATOM   10060 N  ND2  . ASN A 1 92 ? 137.839 -19.765 5.720   1.00 0.00 ? 92  ASN A ND2  4  
ATOM   10061 H  H    . ASN A 1 92 ? 140.314 -20.209 6.375   1.00 0.00 ? 92  ASN A H    4  
ATOM   10062 H  HA   . ASN A 1 92 ? 138.410 -22.227 6.101   1.00 0.00 ? 92  ASN A HA   4  
ATOM   10063 H  HB2  . ASN A 1 92 ? 140.172 -20.955 3.996   1.00 0.00 ? 92  ASN A HB2  4  
ATOM   10064 H  HB3  . ASN A 1 92 ? 138.759 -21.951 3.650   1.00 0.00 ? 92  ASN A HB3  4  
ATOM   10065 H  HD21 . ASN A 1 92 ? 138.070 -20.326 6.490   1.00 0.00 ? 92  ASN A HD21 4  
ATOM   10066 H  HD22 . ASN A 1 92 ? 137.258 -18.984 5.841   1.00 0.00 ? 92  ASN A HD22 4  
ATOM   10067 N  N    . SER A 1 93 ? 141.484 -23.188 5.520   1.00 0.00 ? 93  SER A N    4  
ATOM   10068 C  CA   . SER A 1 93 ? 142.332 -24.360 5.330   1.00 0.00 ? 93  SER A CA   4  
ATOM   10069 C  C    . SER A 1 93 ? 142.524 -25.103 6.647   1.00 0.00 ? 93  SER A C    4  
ATOM   10070 O  O    . SER A 1 93 ? 143.009 -26.222 6.609   1.00 0.00 ? 93  SER A O    4  
ATOM   10071 C  CB   . SER A 1 93 ? 143.693 -23.937 4.778   1.00 0.00 ? 93  SER A CB   4  
ATOM   10072 O  OG   . SER A 1 93 ? 144.311 -25.050 4.148   1.00 0.00 ? 93  SER A OG   4  
ATOM   10073 O  OXT  . SER A 1 93 ? 142.185 -24.543 7.676   1.00 0.00 ? 93  SER A OXT  4  
ATOM   10074 H  H    . SER A 1 93 ? 141.900 -22.315 5.675   1.00 0.00 ? 93  SER A H    4  
ATOM   10075 H  HA   . SER A 1 93 ? 141.859 -25.022 4.620   1.00 0.00 ? 93  SER A HA   4  
ATOM   10076 H  HB2  . SER A 1 93 ? 143.561 -23.149 4.055   1.00 0.00 ? 93  SER A HB2  4  
ATOM   10077 H  HB3  . SER A 1 93 ? 144.313 -23.578 5.589   1.00 0.00 ? 93  SER A HB3  4  
ATOM   10078 H  HG   . SER A 1 93 ? 144.322 -25.778 4.774   1.00 0.00 ? 93  SER A HG   4  
ATOM   10079 N  N    . GLY B 1 1  ? 133.508 -11.225 -9.113  1.00 0.00 ? 1   GLY B N    4  
ATOM   10080 C  CA   . GLY B 1 1  ? 132.431 -10.264 -8.912  1.00 0.00 ? 1   GLY B CA   4  
ATOM   10081 C  C    . GLY B 1 1  ? 132.895 -8.848  -9.237  1.00 0.00 ? 1   GLY B C    4  
ATOM   10082 O  O    . GLY B 1 1  ? 133.442 -8.596  -10.310 1.00 0.00 ? 1   GLY B O    4  
ATOM   10083 H  H1   . GLY B 1 1  ? 133.749 -11.508 -10.019 1.00 0.00 ? 1   GLY B H1   4  
ATOM   10084 H  HA2  . GLY B 1 1  ? 131.601 -10.523 -9.554  1.00 0.00 ? 1   GLY B HA2  4  
ATOM   10085 H  HA3  . GLY B 1 1  ? 132.108 -10.301 -7.882  1.00 0.00 ? 1   GLY B HA3  4  
ATOM   10086 N  N    . SER B 1 2  ? 132.674 -7.929  -8.303  1.00 0.00 ? 2   SER B N    4  
ATOM   10087 C  CA   . SER B 1 2  ? 133.075 -6.541  -8.502  1.00 0.00 ? 2   SER B CA   4  
ATOM   10088 C  C    . SER B 1 2  ? 134.587 -6.432  -8.639  1.00 0.00 ? 2   SER B C    4  
ATOM   10089 O  O    . SER B 1 2  ? 135.327 -7.304  -8.182  1.00 0.00 ? 2   SER B O    4  
ATOM   10090 C  CB   . SER B 1 2  ? 132.610 -5.684  -7.333  1.00 0.00 ? 2   SER B CB   4  
ATOM   10091 O  OG   . SER B 1 2  ? 131.198 -5.789  -7.204  1.00 0.00 ? 2   SER B OG   4  
ATOM   10092 H  H    . SER B 1 2  ? 132.234 -8.187  -7.467  1.00 0.00 ? 2   SER B H    4  
ATOM   10093 H  HA   . SER B 1 2  ? 132.616 -6.171  -9.407  1.00 0.00 ? 2   SER B HA   4  
ATOM   10094 H  HB2  . SER B 1 2  ? 133.076 -6.026  -6.423  1.00 0.00 ? 2   SER B HB2  4  
ATOM   10095 H  HB3  . SER B 1 2  ? 132.891 -4.655  -7.514  1.00 0.00 ? 2   SER B HB3  4  
ATOM   10096 H  HG   . SER B 1 2  ? 130.834 -5.978  -8.071  1.00 0.00 ? 2   SER B HG   4  
ATOM   10097 N  N    . GLU B 1 3  ? 135.041 -5.361  -9.281  1.00 0.00 ? 3   GLU B N    4  
ATOM   10098 C  CA   . GLU B 1 3  ? 136.470 -5.159  -9.484  1.00 0.00 ? 3   GLU B CA   4  
ATOM   10099 C  C    . GLU B 1 3  ? 137.207 -5.037  -8.151  1.00 0.00 ? 3   GLU B C    4  
ATOM   10100 O  O    . GLU B 1 3  ? 138.350 -5.475  -8.032  1.00 0.00 ? 3   GLU B O    4  
ATOM   10101 C  CB   . GLU B 1 3  ? 136.704 -3.884  -10.299 1.00 0.00 ? 3   GLU B CB   4  
ATOM   10102 C  CG   . GLU B 1 3  ? 136.084 -4.035  -11.688 1.00 0.00 ? 3   GLU B CG   4  
ATOM   10103 C  CD   . GLU B 1 3  ? 136.388 -2.801  -12.531 1.00 0.00 ? 3   GLU B CD   4  
ATOM   10104 O  OE1  . GLU B 1 3  ? 136.897 -1.841  -11.977 1.00 0.00 ? 3   GLU B OE1  4  
ATOM   10105 O  OE2  . GLU B 1 3  ? 136.107 -2.834  -13.717 1.00 0.00 ? 3   GLU B OE2  4  
ATOM   10106 H  H    . GLU B 1 3  ? 134.406 -4.704  -9.633  1.00 0.00 ? 3   GLU B H    4  
ATOM   10107 H  HA   . GLU B 1 3  ? 136.869 -5.998  -10.032 1.00 0.00 ? 3   GLU B HA   4  
ATOM   10108 H  HB2  . GLU B 1 3  ? 136.248 -3.046  -9.793  1.00 0.00 ? 3   GLU B HB2  4  
ATOM   10109 H  HB3  . GLU B 1 3  ? 137.764 -3.710  -10.397 1.00 0.00 ? 3   GLU B HB3  4  
ATOM   10110 H  HG2  . GLU B 1 3  ? 136.490 -4.912  -12.171 1.00 0.00 ? 3   GLU B HG2  4  
ATOM   10111 H  HG3  . GLU B 1 3  ? 135.013 -4.141  -11.589 1.00 0.00 ? 3   GLU B HG3  4  
ATOM   10112 N  N    . LEU B 1 4  ? 136.561 -4.431  -7.155  1.00 0.00 ? 4   LEU B N    4  
ATOM   10113 C  CA   . LEU B 1 4  ? 137.199 -4.257  -5.851  1.00 0.00 ? 4   LEU B CA   4  
ATOM   10114 C  C    . LEU B 1 4  ? 137.590 -5.597  -5.238  1.00 0.00 ? 4   LEU B C    4  
ATOM   10115 O  O    . LEU B 1 4  ? 138.666 -5.720  -4.642  1.00 0.00 ? 4   LEU B O    4  
ATOM   10116 C  CB   . LEU B 1 4  ? 136.255 -3.518  -4.899  1.00 0.00 ? 4   LEU B CB   4  
ATOM   10117 C  CG   . LEU B 1 4  ? 136.953 -3.261  -3.554  1.00 0.00 ? 4   LEU B CG   4  
ATOM   10118 C  CD1  . LEU B 1 4  ? 138.069 -2.226  -3.734  1.00 0.00 ? 4   LEU B CD1  4  
ATOM   10119 C  CD2  . LEU B 1 4  ? 135.929 -2.731  -2.547  1.00 0.00 ? 4   LEU B CD2  4  
ATOM   10120 H  H    . LEU B 1 4  ? 135.654 -4.089  -7.302  1.00 0.00 ? 4   LEU B H    4  
ATOM   10121 H  HA   . LEU B 1 4  ? 138.090 -3.664  -5.979  1.00 0.00 ? 4   LEU B HA   4  
ATOM   10122 H  HB2  . LEU B 1 4  ? 135.966 -2.580  -5.341  1.00 0.00 ? 4   LEU B HB2  4  
ATOM   10123 H  HB3  . LEU B 1 4  ? 135.377 -4.119  -4.734  1.00 0.00 ? 4   LEU B HB3  4  
ATOM   10124 H  HG   . LEU B 1 4  ? 137.376 -4.181  -3.182  1.00 0.00 ? 4   LEU B HG   4  
ATOM   10125 H  HD11 . LEU B 1 4  ? 138.207 -1.678  -2.814  1.00 0.00 ? 4   LEU B HD11 4  
ATOM   10126 H  HD12 . LEU B 1 4  ? 137.808 -1.540  -4.526  1.00 0.00 ? 4   LEU B HD12 4  
ATOM   10127 H  HD13 . LEU B 1 4  ? 138.985 -2.737  -3.987  1.00 0.00 ? 4   LEU B HD13 4  
ATOM   10128 H  HD21 . LEU B 1 4  ? 135.664 -1.715  -2.803  1.00 0.00 ? 4   LEU B HD21 4  
ATOM   10129 H  HD22 . LEU B 1 4  ? 136.356 -2.752  -1.555  1.00 0.00 ? 4   LEU B HD22 4  
ATOM   10130 H  HD23 . LEU B 1 4  ? 135.048 -3.351  -2.571  1.00 0.00 ? 4   LEU B HD23 4  
ATOM   10131 N  N    . GLU B 1 5  ? 136.733 -6.606  -5.382  1.00 0.00 ? 5   GLU B N    4  
ATOM   10132 C  CA   . GLU B 1 5  ? 137.059 -7.906  -4.821  1.00 0.00 ? 5   GLU B CA   4  
ATOM   10133 C  C    . GLU B 1 5  ? 138.350 -8.394  -5.447  1.00 0.00 ? 5   GLU B C    4  
ATOM   10134 O  O    . GLU B 1 5  ? 139.233 -8.919  -4.769  1.00 0.00 ? 5   GLU B O    4  
ATOM   10135 C  CB   . GLU B 1 5  ? 135.935 -8.904  -5.103  1.00 0.00 ? 5   GLU B CB   4  
ATOM   10136 C  CG   . GLU B 1 5  ? 136.230 -10.223 -4.387  1.00 0.00 ? 5   GLU B CG   4  
ATOM   10137 C  CD   . GLU B 1 5  ? 135.168 -11.258 -4.742  1.00 0.00 ? 5   GLU B CD   4  
ATOM   10138 O  OE1  . GLU B 1 5  ? 134.289 -10.933 -5.521  1.00 0.00 ? 5   GLU B OE1  4  
ATOM   10139 O  OE2  . GLU B 1 5  ? 135.251 -12.361 -4.227  1.00 0.00 ? 5   GLU B OE2  4  
ATOM   10140 H  H    . GLU B 1 5  ? 135.890 -6.474  -5.865  1.00 0.00 ? 5   GLU B H    4  
ATOM   10141 H  HA   . GLU B 1 5  ? 137.192 -7.810  -3.756  1.00 0.00 ? 5   GLU B HA   4  
ATOM   10142 H  HB2  . GLU B 1 5  ? 134.998 -8.500  -4.745  1.00 0.00 ? 5   GLU B HB2  4  
ATOM   10143 H  HB3  . GLU B 1 5  ? 135.867 -9.080  -6.166  1.00 0.00 ? 5   GLU B HB3  4  
ATOM   10144 H  HG2  . GLU B 1 5  ? 137.202 -10.586 -4.692  1.00 0.00 ? 5   GLU B HG2  4  
ATOM   10145 H  HG3  . GLU B 1 5  ? 136.228 -10.059 -3.319  1.00 0.00 ? 5   GLU B HG3  4  
ATOM   10146 N  N    . THR B 1 6  ? 138.464 -8.163  -6.747  1.00 0.00 ? 6   THR B N    4  
ATOM   10147 C  CA   . THR B 1 6  ? 139.664 -8.522  -7.476  1.00 0.00 ? 6   THR B CA   4  
ATOM   10148 C  C    . THR B 1 6  ? 140.837 -7.683  -6.990  1.00 0.00 ? 6   THR B C    4  
ATOM   10149 O  O    . THR B 1 6  ? 141.970 -8.153  -6.930  1.00 0.00 ? 6   THR B O    4  
ATOM   10150 C  CB   . THR B 1 6  ? 139.455 -8.297  -8.975  1.00 0.00 ? 6   THR B CB   4  
ATOM   10151 O  OG1  . THR B 1 6  ? 138.302 -9.010  -9.403  1.00 0.00 ? 6   THR B OG1  4  
ATOM   10152 C  CG2  . THR B 1 6  ? 140.679 -8.794  -9.743  1.00 0.00 ? 6   THR B CG2  4  
ATOM   10153 H  H    . THR B 1 6  ? 137.736 -7.706  -7.218  1.00 0.00 ? 6   THR B H    4  
ATOM   10154 H  HA   . THR B 1 6  ? 139.881 -9.566  -7.306  1.00 0.00 ? 6   THR B HA   4  
ATOM   10155 H  HB   . THR B 1 6  ? 139.318 -7.244  -9.166  1.00 0.00 ? 6   THR B HB   4  
ATOM   10156 H  HG1  . THR B 1 6  ? 138.228 -9.802  -8.866  1.00 0.00 ? 6   THR B HG1  4  
ATOM   10157 H  HG21 . THR B 1 6  ? 140.463 -8.798  -10.802 1.00 0.00 ? 6   THR B HG21 4  
ATOM   10158 H  HG22 . THR B 1 6  ? 140.923 -9.796  -9.423  1.00 0.00 ? 6   THR B HG22 4  
ATOM   10159 H  HG23 . THR B 1 6  ? 141.516 -8.140  -9.549  1.00 0.00 ? 6   THR B HG23 4  
ATOM   10160 N  N    . ALA B 1 7  ? 140.550 -6.415  -6.691  1.00 0.00 ? 7   ALA B N    4  
ATOM   10161 C  CA   . ALA B 1 7  ? 141.582 -5.480  -6.259  1.00 0.00 ? 7   ALA B CA   4  
ATOM   10162 C  C    . ALA B 1 7  ? 142.232 -5.881  -4.930  1.00 0.00 ? 7   ALA B C    4  
ATOM   10163 O  O    . ALA B 1 7  ? 143.463 -5.872  -4.819  1.00 0.00 ? 7   ALA B O    4  
ATOM   10164 C  CB   . ALA B 1 7  ? 140.967 -4.079  -6.130  1.00 0.00 ? 7   ALA B CB   4  
ATOM   10165 H  H    . ALA B 1 7  ? 139.629 -6.097  -6.794  1.00 0.00 ? 7   ALA B H    4  
ATOM   10166 H  HA   . ALA B 1 7  ? 142.348 -5.442  -7.017  1.00 0.00 ? 7   ALA B HA   4  
ATOM   10167 H  HB1  . ALA B 1 7  ? 140.243 -4.075  -5.328  1.00 0.00 ? 7   ALA B HB1  4  
ATOM   10168 H  HB2  . ALA B 1 7  ? 140.474 -3.812  -7.056  1.00 0.00 ? 7   ALA B HB2  4  
ATOM   10169 H  HB3  . ALA B 1 7  ? 141.743 -3.361  -5.918  1.00 0.00 ? 7   ALA B HB3  4  
ATOM   10170 N  N    . MET B 1 8  ? 141.433 -6.243  -3.920  1.00 0.00 ? 8   MET B N    4  
ATOM   10171 C  CA   . MET B 1 8  ? 142.037 -6.621  -2.644  1.00 0.00 ? 8   MET B CA   4  
ATOM   10172 C  C    . MET B 1 8  ? 142.982 -7.783  -2.867  1.00 0.00 ? 8   MET B C    4  
ATOM   10173 O  O    . MET B 1 8  ? 144.085 -7.825  -2.321  1.00 0.00 ? 8   MET B O    4  
ATOM   10174 C  CB   . MET B 1 8  ? 140.979 -7.076  -1.635  1.00 0.00 ? 8   MET B CB   4  
ATOM   10175 C  CG   . MET B 1 8  ? 140.035 -5.931  -1.277  1.00 0.00 ? 8   MET B CG   4  
ATOM   10176 S  SD   . MET B 1 8  ? 138.980 -6.452  0.104   1.00 0.00 ? 8   MET B SD   4  
ATOM   10177 C  CE   . MET B 1 8  ? 138.290 -7.945  -0.656  1.00 0.00 ? 8   MET B CE   4  
ATOM   10178 H  H    . MET B 1 8  ? 140.462 -6.242  -4.031  1.00 0.00 ? 8   MET B H    4  
ATOM   10179 H  HA   . MET B 1 8  ? 142.583 -5.783  -2.240  1.00 0.00 ? 8   MET B HA   4  
ATOM   10180 H  HB2  . MET B 1 8  ? 140.407 -7.885  -2.065  1.00 0.00 ? 8   MET B HB2  4  
ATOM   10181 H  HB3  . MET B 1 8  ? 141.470 -7.426  -0.738  1.00 0.00 ? 8   MET B HB3  4  
ATOM   10182 H  HG2  . MET B 1 8  ? 140.611 -5.064  -0.988  1.00 0.00 ? 8   MET B HG2  4  
ATOM   10183 H  HG3  . MET B 1 8  ? 139.419 -5.688  -2.130  1.00 0.00 ? 8   MET B HG3  4  
ATOM   10184 H  HE1  . MET B 1 8  ? 138.979 -8.769  -0.519  1.00 0.00 ? 8   MET B HE1  4  
ATOM   10185 H  HE2  . MET B 1 8  ? 138.143 -7.779  -1.709  1.00 0.00 ? 8   MET B HE2  4  
ATOM   10186 H  HE3  . MET B 1 8  ? 137.340 -8.183  -0.190  1.00 0.00 ? 8   MET B HE3  4  
ATOM   10187 N  N    . GLU B 1 9  ? 142.546 -8.714  -3.703  1.00 0.00 ? 9   GLU B N    4  
ATOM   10188 C  CA   . GLU B 1 9  ? 143.360 -9.864  -4.032  1.00 0.00 ? 9   GLU B CA   4  
ATOM   10189 C  C    . GLU B 1 9  ? 144.576 -9.452  -4.842  1.00 0.00 ? 9   GLU B C    4  
ATOM   10190 O  O    . GLU B 1 9  ? 145.647 -10.027 -4.697  1.00 0.00 ? 9   GLU B O    4  
ATOM   10191 C  CB   . GLU B 1 9  ? 142.525 -10.888 -4.797  1.00 0.00 ? 9   GLU B CB   4  
ATOM   10192 C  CG   . GLU B 1 9  ? 141.465 -11.467 -3.864  1.00 0.00 ? 9   GLU B CG   4  
ATOM   10193 C  CD   . GLU B 1 9  ? 140.653 -12.532 -4.591  1.00 0.00 ? 9   GLU B CD   4  
ATOM   10194 O  OE1  . GLU B 1 9  ? 140.820 -12.659 -5.792  1.00 0.00 ? 9   GLU B OE1  4  
ATOM   10195 O  OE2  . GLU B 1 9  ? 139.875 -13.205 -3.935  1.00 0.00 ? 9   GLU B OE2  4  
ATOM   10196 H  H    . GLU B 1 9  ? 141.666 -8.611  -4.121  1.00 0.00 ? 9   GLU B H    4  
ATOM   10197 H  HA   . GLU B 1 9  ? 143.699 -10.319 -3.113  1.00 0.00 ? 9   GLU B HA   4  
ATOM   10198 H  HB2  . GLU B 1 9  ? 142.038 -10.401 -5.629  1.00 0.00 ? 9   GLU B HB2  4  
ATOM   10199 H  HB3  . GLU B 1 9  ? 143.159 -11.680 -5.158  1.00 0.00 ? 9   GLU B HB3  4  
ATOM   10200 H  HG2  . GLU B 1 9  ? 141.954 -11.910 -3.008  1.00 0.00 ? 9   GLU B HG2  4  
ATOM   10201 H  HG3  . GLU B 1 9  ? 140.807 -10.676 -3.533  1.00 0.00 ? 9   GLU B HG3  4  
ATOM   10202 N  N    . THR B 1 10 ? 144.401 -8.457  -5.707  1.00 0.00 ? 10  THR B N    4  
ATOM   10203 C  CA   . THR B 1 10 ? 145.504 -7.992  -6.536  1.00 0.00 ? 10  THR B CA   4  
ATOM   10204 C  C    . THR B 1 10 ? 146.639 -7.445  -5.681  1.00 0.00 ? 10  THR B C    4  
ATOM   10205 O  O    . THR B 1 10 ? 147.810 -7.731  -5.934  1.00 0.00 ? 10  THR B O    4  
ATOM   10206 C  CB   . THR B 1 10 ? 145.013 -6.897  -7.486  1.00 0.00 ? 10  THR B CB   4  
ATOM   10207 O  OG1  . THR B 1 10 ? 143.906 -7.384  -8.232  1.00 0.00 ? 10  THR B OG1  4  
ATOM   10208 C  CG2  . THR B 1 10 ? 146.141 -6.502  -8.439  1.00 0.00 ? 10  THR B CG2  4  
ATOM   10209 H  H    . THR B 1 10 ? 143.521 -8.035  -5.790  1.00 0.00 ? 10  THR B H    4  
ATOM   10210 H  HA   . THR B 1 10 ? 145.874 -8.815  -7.123  1.00 0.00 ? 10  THR B HA   4  
ATOM   10211 H  HB   . THR B 1 10 ? 144.710 -6.033  -6.915  1.00 0.00 ? 10  THR B HB   4  
ATOM   10212 H  HG1  . THR B 1 10 ? 144.224 -7.642  -9.101  1.00 0.00 ? 10  THR B HG1  4  
ATOM   10213 H  HG21 . THR B 1 10 ? 145.774 -5.773  -9.148  1.00 0.00 ? 10  THR B HG21 4  
ATOM   10214 H  HG22 . THR B 1 10 ? 146.487 -7.376  -8.970  1.00 0.00 ? 10  THR B HG22 4  
ATOM   10215 H  HG23 . THR B 1 10 ? 146.957 -6.076  -7.875  1.00 0.00 ? 10  THR B HG23 4  
ATOM   10216 N  N    . LEU B 1 11 ? 146.293 -6.657  -4.667  1.00 0.00 ? 11  LEU B N    4  
ATOM   10217 C  CA   . LEU B 1 11 ? 147.319 -6.082  -3.799  1.00 0.00 ? 11  LEU B CA   4  
ATOM   10218 C  C    . LEU B 1 11 ? 148.113 -7.178  -3.084  1.00 0.00 ? 11  LEU B C    4  
ATOM   10219 O  O    . LEU B 1 11 ? 149.354 -7.166  -3.047  1.00 0.00 ? 11  LEU B O    4  
ATOM   10220 C  CB   . LEU B 1 11 ? 146.622 -5.208  -2.754  1.00 0.00 ? 11  LEU B CB   4  
ATOM   10221 C  CG   . LEU B 1 11 ? 145.810 -4.119  -3.461  1.00 0.00 ? 11  LEU B CG   4  
ATOM   10222 C  CD1  . LEU B 1 11 ? 145.003 -3.320  -2.433  1.00 0.00 ? 11  LEU B CD1  4  
ATOM   10223 C  CD2  . LEU B 1 11 ? 146.762 -3.181  -4.206  1.00 0.00 ? 11  LEU B CD2  4  
ATOM   10224 H  H    . LEU B 1 11 ? 145.337 -6.453  -4.508  1.00 0.00 ? 11  LEU B H    4  
ATOM   10225 H  HA   . LEU B 1 11 ? 147.990 -5.471  -4.383  1.00 0.00 ? 11  LEU B HA   4  
ATOM   10226 H  HB2  . LEU B 1 11 ? 145.962 -5.820  -2.155  1.00 0.00 ? 11  LEU B HB2  4  
ATOM   10227 H  HB3  . LEU B 1 11 ? 147.362 -4.746  -2.117  1.00 0.00 ? 11  LEU B HB3  4  
ATOM   10228 H  HG   . LEU B 1 11 ? 145.139 -4.576  -4.164  1.00 0.00 ? 11  LEU B HG   4  
ATOM   10229 H  HD11 . LEU B 1 11 ? 144.860 -2.310  -2.788  1.00 0.00 ? 11  LEU B HD11 4  
ATOM   10230 H  HD12 . LEU B 1 11 ? 145.530 -3.300  -1.491  1.00 0.00 ? 11  LEU B HD12 4  
ATOM   10231 H  HD13 . LEU B 1 11 ? 144.035 -3.791  -2.296  1.00 0.00 ? 11  LEU B HD13 4  
ATOM   10232 H  HD21 . LEU B 1 11 ? 146.299 -2.212  -4.317  1.00 0.00 ? 11  LEU B HD21 4  
ATOM   10233 H  HD22 . LEU B 1 11 ? 146.976 -3.590  -5.182  1.00 0.00 ? 11  LEU B HD22 4  
ATOM   10234 H  HD23 . LEU B 1 11 ? 147.681 -3.079  -3.648  1.00 0.00 ? 11  LEU B HD23 4  
ATOM   10235 N  N    . ILE B 1 12 ? 147.383 -8.141  -2.536  1.00 0.00 ? 12  ILE B N    4  
ATOM   10236 C  CA   . ILE B 1 12 ? 148.010 -9.247  -1.839  1.00 0.00 ? 12  ILE B CA   4  
ATOM   10237 C  C    . ILE B 1 12 ? 148.824 -10.100 -2.799  1.00 0.00 ? 12  ILE B C    4  
ATOM   10238 O  O    . ILE B 1 12 ? 149.947 -10.509 -2.490  1.00 0.00 ? 12  ILE B O    4  
ATOM   10239 C  CB   . ILE B 1 12 ? 146.936 -10.077 -1.141  1.00 0.00 ? 12  ILE B CB   4  
ATOM   10240 C  CG1  . ILE B 1 12 ? 146.181 -9.168  -0.164  1.00 0.00 ? 12  ILE B CG1  4  
ATOM   10241 C  CG2  . ILE B 1 12 ? 147.587 -11.226 -0.375  1.00 0.00 ? 12  ILE B CG2  4  
ATOM   10242 C  CD1  . ILE B 1 12 ? 145.022 -9.927  0.487   1.00 0.00 ? 12  ILE B CD1  4  
ATOM   10243 H  H    . ILE B 1 12 ? 146.407 -8.108  -2.612  1.00 0.00 ? 12  ILE B H    4  
ATOM   10244 H  HA   . ILE B 1 12 ? 148.675 -8.847  -1.087  1.00 0.00 ? 12  ILE B HA   4  
ATOM   10245 H  HB   . ILE B 1 12 ? 146.248 -10.472 -1.875  1.00 0.00 ? 12  ILE B HB   4  
ATOM   10246 H  HG12 . ILE B 1 12 ? 146.861 -8.829  0.604   1.00 0.00 ? 12  ILE B HG12 4  
ATOM   10247 H  HG13 . ILE B 1 12 ? 145.791 -8.315  -0.698  1.00 0.00 ? 12  ILE B HG13 4  
ATOM   10248 H  HG21 . ILE B 1 12 ? 148.382 -10.839 0.245   1.00 0.00 ? 12  ILE B HG21 4  
ATOM   10249 H  HG22 . ILE B 1 12 ? 147.992 -11.941 -1.076  1.00 0.00 ? 12  ILE B HG22 4  
ATOM   10250 H  HG23 . ILE B 1 12 ? 146.848 -11.710 0.246   1.00 0.00 ? 12  ILE B HG23 4  
ATOM   10251 H  HD11 . ILE B 1 12 ? 144.723 -10.752 -0.144  1.00 0.00 ? 12  ILE B HD11 4  
ATOM   10252 H  HD12 . ILE B 1 12 ? 144.185 -9.256  0.622   1.00 0.00 ? 12  ILE B HD12 4  
ATOM   10253 H  HD13 . ILE B 1 12 ? 145.338 -10.302 1.448   1.00 0.00 ? 12  ILE B HD13 4  
ATOM   10254 N  N    . ASN B 1 13 ? 148.256 -10.350 -3.974  1.00 0.00 ? 13  ASN B N    4  
ATOM   10255 C  CA   . ASN B 1 13 ? 148.945 -11.139 -4.977  1.00 0.00 ? 13  ASN B CA   4  
ATOM   10256 C  C    . ASN B 1 13 ? 150.257 -10.459 -5.327  1.00 0.00 ? 13  ASN B C    4  
ATOM   10257 O  O    . ASN B 1 13 ? 151.281 -11.114 -5.520  1.00 0.00 ? 13  ASN B O    4  
ATOM   10258 C  CB   . ASN B 1 13 ? 148.084 -11.262 -6.238  1.00 0.00 ? 13  ASN B CB   4  
ATOM   10259 C  CG   . ASN B 1 13 ? 146.786 -12.012 -5.935  1.00 0.00 ? 13  ASN B CG   4  
ATOM   10260 O  OD1  . ASN B 1 13 ? 146.006 -12.286 -6.847  1.00 0.00 ? 13  ASN B OD1  4  
ATOM   10261 N  ND2  . ASN B 1 13 ? 146.487 -12.333 -4.705  1.00 0.00 ? 13  ASN B ND2  4  
ATOM   10262 H  H    . ASN B 1 13 ? 147.366 -9.989  -4.168  1.00 0.00 ? 13  ASN B H    4  
ATOM   10263 H  HA   . ASN B 1 13 ? 149.144 -12.124 -4.584  1.00 0.00 ? 13  ASN B HA   4  
ATOM   10264 H  HB2  . ASN B 1 13 ? 147.847 -10.274 -6.604  1.00 0.00 ? 13  ASN B HB2  4  
ATOM   10265 H  HB3  . ASN B 1 13 ? 148.636 -11.799 -6.994  1.00 0.00 ? 13  ASN B HB3  4  
ATOM   10266 H  HD21 . ASN B 1 13 ? 147.090 -12.093 -3.973  1.00 0.00 ? 13  ASN B HD21 4  
ATOM   10267 H  HD22 . ASN B 1 13 ? 145.656 -12.817 -4.515  1.00 0.00 ? 13  ASN B HD22 4  
ATOM   10268 N  N    . VAL B 1 14 ? 150.216 -9.128  -5.386  1.00 0.00 ? 14  VAL B N    4  
ATOM   10269 C  CA   . VAL B 1 14 ? 151.409 -8.357  -5.689  1.00 0.00 ? 14  VAL B CA   4  
ATOM   10270 C  C    . VAL B 1 14 ? 152.424 -8.547  -4.573  1.00 0.00 ? 14  VAL B C    4  
ATOM   10271 O  O    . VAL B 1 14 ? 153.617 -8.722  -4.818  1.00 0.00 ? 14  VAL B O    4  
ATOM   10272 C  CB   . VAL B 1 14 ? 151.054 -6.873  -5.797  1.00 0.00 ? 14  VAL B CB   4  
ATOM   10273 C  CG1  . VAL B 1 14 ? 152.318 -6.054  -6.047  1.00 0.00 ? 14  VAL B CG1  4  
ATOM   10274 C  CG2  . VAL B 1 14 ? 150.046 -6.648  -6.943  1.00 0.00 ? 14  VAL B CG2  4  
ATOM   10275 H  H    . VAL B 1 14 ? 149.370 -8.661  -5.208  1.00 0.00 ? 14  VAL B H    4  
ATOM   10276 H  HA   . VAL B 1 14 ? 151.830 -8.693  -6.626  1.00 0.00 ? 14  VAL B HA   4  
ATOM   10277 H  HB   . VAL B 1 14 ? 150.620 -6.553  -4.865  1.00 0.00 ? 14  VAL B HB   4  
ATOM   10278 H  HG11 . VAL B 1 14 ? 152.047 -5.017  -6.184  1.00 0.00 ? 14  VAL B HG11 4  
ATOM   10279 H  HG12 . VAL B 1 14 ? 152.811 -6.418  -6.935  1.00 0.00 ? 14  VAL B HG12 4  
ATOM   10280 H  HG13 . VAL B 1 14 ? 152.980 -6.144  -5.200  1.00 0.00 ? 14  VAL B HG13 4  
ATOM   10281 H  HG21 . VAL B 1 14 ? 149.232 -6.032  -6.589  1.00 0.00 ? 14  VAL B HG21 4  
ATOM   10282 H  HG22 . VAL B 1 14 ? 149.653 -7.598  -7.280  1.00 0.00 ? 14  VAL B HG22 4  
ATOM   10283 H  HG23 . VAL B 1 14 ? 150.534 -6.154  -7.770  1.00 0.00 ? 14  VAL B HG23 4  
ATOM   10284 N  N    . PHE B 1 15 ? 151.928 -8.505  -3.332  1.00 0.00 ? 15  PHE B N    4  
ATOM   10285 C  CA   . PHE B 1 15 ? 152.800 -8.671  -2.172  1.00 0.00 ? 15  PHE B CA   4  
ATOM   10286 C  C    . PHE B 1 15 ? 153.538 -10.008 -2.171  1.00 0.00 ? 15  PHE B C    4  
ATOM   10287 O  O    . PHE B 1 15 ? 154.758 -10.044 -2.009  1.00 0.00 ? 15  PHE B O    4  
ATOM   10288 C  CB   . PHE B 1 15 ? 151.962 -8.559  -0.901  1.00 0.00 ? 15  PHE B CB   4  
ATOM   10289 C  CG   . PHE B 1 15 ? 152.859 -8.710  0.295   1.00 0.00 ? 15  PHE B CG   4  
ATOM   10290 C  CD1  . PHE B 1 15 ? 153.669 -7.652  0.702   1.00 0.00 ? 15  PHE B CD1  4  
ATOM   10291 C  CD2  . PHE B 1 15 ? 152.870 -9.917  1.004   1.00 0.00 ? 15  PHE B CD2  4  
ATOM   10292 C  CE1  . PHE B 1 15 ? 154.495 -7.799  1.819   1.00 0.00 ? 15  PHE B CE1  4  
ATOM   10293 C  CE2  . PHE B 1 15 ? 153.694 -10.064 2.121   1.00 0.00 ? 15  PHE B CE2  4  
ATOM   10294 C  CZ   . PHE B 1 15 ? 154.509 -9.004  2.530   1.00 0.00 ? 15  PHE B CZ   4  
ATOM   10295 H  H    . PHE B 1 15 ? 150.957 -8.349  -3.199  1.00 0.00 ? 15  PHE B H    4  
ATOM   10296 H  HA   . PHE B 1 15 ? 153.530 -7.874  -2.166  1.00 0.00 ? 15  PHE B HA   4  
ATOM   10297 H  HB2  . PHE B 1 15 ? 151.478 -7.593  -0.872  1.00 0.00 ? 15  PHE B HB2  4  
ATOM   10298 H  HB3  . PHE B 1 15 ? 151.214 -9.338  -0.892  1.00 0.00 ? 15  PHE B HB3  4  
ATOM   10299 H  HD1  . PHE B 1 15 ? 153.660 -6.721  0.155   1.00 0.00 ? 15  PHE B HD1  4  
ATOM   10300 H  HD2  . PHE B 1 15 ? 152.239 -10.734 0.686   1.00 0.00 ? 15  PHE B HD2  4  
ATOM   10301 H  HE1  . PHE B 1 15 ? 155.120 -6.983  2.131   1.00 0.00 ? 15  PHE B HE1  4  
ATOM   10302 H  HE2  . PHE B 1 15 ? 153.700 -10.995 2.668   1.00 0.00 ? 15  PHE B HE2  4  
ATOM   10303 H  HZ   . PHE B 1 15 ? 155.149 -9.115  3.393   1.00 0.00 ? 15  PHE B HZ   4  
ATOM   10304 N  N    . HIS B 1 16 ? 152.809 -11.101 -2.363  1.00 0.00 ? 16  HIS B N    4  
ATOM   10305 C  CA   . HIS B 1 16 ? 153.442 -12.416 -2.389  1.00 0.00 ? 16  HIS B CA   4  
ATOM   10306 C  C    . HIS B 1 16 ? 154.483 -12.521 -3.497  1.00 0.00 ? 16  HIS B C    4  
ATOM   10307 O  O    . HIS B 1 16 ? 155.523 -13.158 -3.331  1.00 0.00 ? 16  HIS B O    4  
ATOM   10308 C  CB   . HIS B 1 16 ? 152.397 -13.521 -2.554  1.00 0.00 ? 16  HIS B CB   4  
ATOM   10309 C  CG   . HIS B 1 16 ? 151.613 -13.668 -1.278  1.00 0.00 ? 16  HIS B CG   4  
ATOM   10310 N  ND1  . HIS B 1 16 ? 150.431 -12.985 -1.040  1.00 0.00 ? 16  HIS B ND1  4  
ATOM   10311 C  CD2  . HIS B 1 16 ? 151.839 -14.428 -0.157  1.00 0.00 ? 16  HIS B CD2  4  
ATOM   10312 C  CE1  . HIS B 1 16 ? 149.995 -13.348 0.183   1.00 0.00 ? 16  HIS B CE1  4  
ATOM   10313 N  NE2  . HIS B 1 16 ? 150.817 -14.225 0.762   1.00 0.00 ? 16  HIS B NE2  4  
ATOM   10314 H  H    . HIS B 1 16 ? 151.838 -11.022 -2.497  1.00 0.00 ? 16  HIS B H    4  
ATOM   10315 H  HA   . HIS B 1 16 ? 153.943 -12.566 -1.444  1.00 0.00 ? 16  HIS B HA   4  
ATOM   10316 H  HB2  . HIS B 1 16 ? 151.726 -13.264 -3.361  1.00 0.00 ? 16  HIS B HB2  4  
ATOM   10317 H  HB3  . HIS B 1 16 ? 152.892 -14.453 -2.781  1.00 0.00 ? 16  HIS B HB3  4  
ATOM   10318 H  HD1  . HIS B 1 16 ? 149.992 -12.354 -1.649  1.00 0.00 ? 16  HIS B HD1  4  
ATOM   10319 H  HD2  . HIS B 1 16 ? 152.684 -15.086 -0.012  1.00 0.00 ? 16  HIS B HD2  4  
ATOM   10320 H  HE1  . HIS B 1 16 ? 149.092 -12.977 0.640   1.00 0.00 ? 16  HIS B HE1  4  
ATOM   10321 H  HE2  . HIS B 1 16 ? 150.721 -14.637 1.645   1.00 0.00 ? 16  HIS B HE2  4  
ATOM   10322 N  N    . ALA B 1 17 ? 154.173 -11.924 -4.639  1.00 0.00 ? 17  ALA B N    4  
ATOM   10323 C  CA   . ALA B 1 17 ? 155.061 -11.988 -5.792  1.00 0.00 ? 17  ALA B CA   4  
ATOM   10324 C  C    . ALA B 1 17 ? 156.422 -11.330 -5.546  1.00 0.00 ? 17  ALA B C    4  
ATOM   10325 O  O    . ALA B 1 17 ? 157.443 -11.832 -6.015  1.00 0.00 ? 17  ALA B O    4  
ATOM   10326 C  CB   . ALA B 1 17 ? 154.379 -11.301 -6.979  1.00 0.00 ? 17  ALA B CB   4  
ATOM   10327 H  H    . ALA B 1 17 ? 153.316 -11.457 -4.720  1.00 0.00 ? 17  ALA B H    4  
ATOM   10328 H  HA   . ALA B 1 17 ? 155.221 -13.024 -6.048  1.00 0.00 ? 17  ALA B HA   4  
ATOM   10329 H  HB1  . ALA B 1 17 ? 153.832 -10.435 -6.628  1.00 0.00 ? 17  ALA B HB1  4  
ATOM   10330 H  HB2  . ALA B 1 17 ? 153.695 -11.991 -7.450  1.00 0.00 ? 17  ALA B HB2  4  
ATOM   10331 H  HB3  . ALA B 1 17 ? 155.125 -10.990 -7.696  1.00 0.00 ? 17  ALA B HB3  4  
ATOM   10332 N  N    . HIS B 1 18 ? 156.441 -10.194 -4.853  1.00 0.00 ? 18  HIS B N    4  
ATOM   10333 C  CA   . HIS B 1 18 ? 157.708 -9.488  -4.619  1.00 0.00 ? 18  HIS B CA   4  
ATOM   10334 C  C    . HIS B 1 18 ? 158.294 -9.701  -3.224  1.00 0.00 ? 18  HIS B C    4  
ATOM   10335 O  O    . HIS B 1 18 ? 159.487 -9.965  -3.086  1.00 0.00 ? 18  HIS B O    4  
ATOM   10336 C  CB   . HIS B 1 18 ? 157.490 -7.997  -4.835  1.00 0.00 ? 18  HIS B CB   4  
ATOM   10337 C  CG   . HIS B 1 18 ? 156.989 -7.766  -6.234  1.00 0.00 ? 18  HIS B CG   4  
ATOM   10338 N  ND1  . HIS B 1 18 ? 157.796 -7.947  -7.348  1.00 0.00 ? 18  HIS B ND1  4  
ATOM   10339 C  CD2  . HIS B 1 18 ? 155.767 -7.368  -6.718  1.00 0.00 ? 18  HIS B CD2  4  
ATOM   10340 C  CE1  . HIS B 1 18 ? 157.056 -7.661  -8.435  1.00 0.00 ? 18  HIS B CE1  4  
ATOM   10341 N  NE2  . HIS B 1 18 ? 155.813 -7.302  -8.107  1.00 0.00 ? 18  HIS B NE2  4  
ATOM   10342 H  H    . HIS B 1 18 ? 155.603 -9.811  -4.522  1.00 0.00 ? 18  HIS B H    4  
ATOM   10343 H  HA   . HIS B 1 18 ? 158.428 -9.826  -5.347  1.00 0.00 ? 18  HIS B HA   4  
ATOM   10344 H  HB2  . HIS B 1 18 ? 156.761 -7.644  -4.127  1.00 0.00 ? 18  HIS B HB2  4  
ATOM   10345 H  HB3  . HIS B 1 18 ? 158.420 -7.469  -4.689  1.00 0.00 ? 18  HIS B HB3  4  
ATOM   10346 H  HD1  . HIS B 1 18 ? 158.734 -8.232  -7.343  1.00 0.00 ? 18  HIS B HD1  4  
ATOM   10347 H  HD2  . HIS B 1 18 ? 154.903 -7.141  -6.112  1.00 0.00 ? 18  HIS B HD2  4  
ATOM   10348 H  HE1  . HIS B 1 18 ? 157.425 -7.715  -9.449  1.00 0.00 ? 18  HIS B HE1  4  
ATOM   10349 H  HE2  . HIS B 1 18 ? 155.087 -7.048  -8.715  1.00 0.00 ? 18  HIS B HE2  4  
ATOM   10350 N  N    . SER B 1 19 ? 157.471 -9.545  -2.192  1.00 0.00 ? 19  SER B N    4  
ATOM   10351 C  CA   . SER B 1 19 ? 157.965 -9.682  -0.824  1.00 0.00 ? 19  SER B CA   4  
ATOM   10352 C  C    . SER B 1 19 ? 158.585 -11.056 -0.588  1.00 0.00 ? 19  SER B C    4  
ATOM   10353 O  O    . SER B 1 19 ? 159.552 -11.192 0.163   1.00 0.00 ? 19  SER B O    4  
ATOM   10354 C  CB   . SER B 1 19 ? 156.835 -9.436  0.176   1.00 0.00 ? 19  SER B CB   4  
ATOM   10355 O  OG   . SER B 1 19 ? 156.254 -8.164  -0.076  1.00 0.00 ? 19  SER B OG   4  
ATOM   10356 H  H    . SER B 1 19 ? 156.533 -9.303  -2.349  1.00 0.00 ? 19  SER B H    4  
ATOM   10357 H  HA   . SER B 1 19 ? 158.723 -8.935  -0.667  1.00 0.00 ? 19  SER B HA   4  
ATOM   10358 H  HB2  . SER B 1 19 ? 156.083 -10.194 0.070   1.00 0.00 ? 19  SER B HB2  4  
ATOM   10359 H  HB3  . SER B 1 19 ? 157.232 -9.468  1.182   1.00 0.00 ? 19  SER B HB3  4  
ATOM   10360 H  HG   . SER B 1 19 ? 156.963 -7.517  -0.118  1.00 0.00 ? 19  SER B HG   4  
ATOM   10361 N  N    . GLY B 1 20 ? 158.016 -12.066 -1.226  1.00 0.00 ? 20  GLY B N    4  
ATOM   10362 C  CA   . GLY B 1 20 ? 158.505 -13.433 -1.087  1.00 0.00 ? 20  GLY B CA   4  
ATOM   10363 C  C    . GLY B 1 20 ? 159.975 -13.577 -1.483  1.00 0.00 ? 20  GLY B C    4  
ATOM   10364 O  O    . GLY B 1 20 ? 160.672 -14.459 -0.982  1.00 0.00 ? 20  GLY B O    4  
ATOM   10365 H  H    . GLY B 1 20 ? 157.245 -11.891 -1.805  1.00 0.00 ? 20  GLY B H    4  
ATOM   10366 H  HA2  . GLY B 1 20 ? 158.390 -13.740 -0.060  1.00 0.00 ? 20  GLY B HA2  4  
ATOM   10367 H  HA3  . GLY B 1 20 ? 157.910 -14.081 -1.714  1.00 0.00 ? 20  GLY B HA3  4  
ATOM   10368 N  N    . LYS B 1 21 ? 160.430 -12.748 -2.418  1.00 0.00 ? 21  LYS B N    4  
ATOM   10369 C  CA   . LYS B 1 21 ? 161.805 -12.847 -2.908  1.00 0.00 ? 21  LYS B CA   4  
ATOM   10370 C  C    . LYS B 1 21 ? 162.854 -12.707 -1.801  1.00 0.00 ? 21  LYS B C    4  
ATOM   10371 O  O    . LYS B 1 21 ? 163.873 -13.397 -1.833  1.00 0.00 ? 21  LYS B O    4  
ATOM   10372 C  CB   . LYS B 1 21 ? 162.059 -11.762 -3.956  1.00 0.00 ? 21  LYS B CB   4  
ATOM   10373 C  CG   . LYS B 1 21 ? 161.128 -11.968 -5.152  1.00 0.00 ? 21  LYS B CG   4  
ATOM   10374 C  CD   . LYS B 1 21 ? 161.551 -11.035 -6.291  1.00 0.00 ? 21  LYS B CD   4  
ATOM   10375 C  CE   . LYS B 1 21 ? 161.384 -9.572  -5.862  1.00 0.00 ? 21  LYS B CE   4  
ATOM   10376 N  NZ   . LYS B 1 21 ? 160.911 -8.766  -7.022  1.00 0.00 ? 21  LYS B NZ   4  
ATOM   10377 H  H    . LYS B 1 21 ? 159.823 -12.088 -2.815  1.00 0.00 ? 21  LYS B H    4  
ATOM   10378 H  HA   . LYS B 1 21 ? 161.933 -13.808 -3.381  1.00 0.00 ? 21  LYS B HA   4  
ATOM   10379 H  HB2  . LYS B 1 21 ? 161.873 -10.791 -3.519  1.00 0.00 ? 21  LYS B HB2  4  
ATOM   10380 H  HB3  . LYS B 1 21 ? 163.084 -11.816 -4.288  1.00 0.00 ? 21  LYS B HB3  4  
ATOM   10381 H  HG2  . LYS B 1 21 ? 161.191 -12.995 -5.484  1.00 0.00 ? 21  LYS B HG2  4  
ATOM   10382 H  HG3  . LYS B 1 21 ? 160.114 -11.743 -4.862  1.00 0.00 ? 21  LYS B HG3  4  
ATOM   10383 H  HD2  . LYS B 1 21 ? 162.586 -11.220 -6.541  1.00 0.00 ? 21  LYS B HD2  4  
ATOM   10384 H  HD3  . LYS B 1 21 ? 160.934 -11.226 -7.158  1.00 0.00 ? 21  LYS B HD3  4  
ATOM   10385 H  HE2  . LYS B 1 21 ? 160.663 -9.505  -5.060  1.00 0.00 ? 21  LYS B HE2  4  
ATOM   10386 H  HE3  . LYS B 1 21 ? 162.334 -9.187  -5.521  1.00 0.00 ? 21  LYS B HE3  4  
ATOM   10387 H  HZ1  . LYS B 1 21 ? 159.908 -8.526  -6.892  1.00 0.00 ? 21  LYS B HZ1  4  
ATOM   10388 H  HZ2  . LYS B 1 21 ? 161.025 -9.318  -7.897  1.00 0.00 ? 21  LYS B HZ2  4  
ATOM   10389 H  HZ3  . LYS B 1 21 ? 161.469 -7.892  -7.088  1.00 0.00 ? 21  LYS B HZ3  4  
ATOM   10390 N  N    . GLU B 1 22 ? 162.628 -11.819 -0.831  1.00 0.00 ? 22  GLU B N    4  
ATOM   10391 C  CA   . GLU B 1 22 ? 163.608 -11.633 0.248   1.00 0.00 ? 22  GLU B CA   4  
ATOM   10392 C  C    . GLU B 1 22 ? 162.974 -11.750 1.632   1.00 0.00 ? 22  GLU B C    4  
ATOM   10393 O  O    . GLU B 1 22 ? 161.803 -11.425 1.831   1.00 0.00 ? 22  GLU B O    4  
ATOM   10394 C  CB   . GLU B 1 22 ? 164.285 -10.265 0.109   1.00 0.00 ? 22  GLU B CB   4  
ATOM   10395 C  CG   . GLU B 1 22 ? 165.021 -10.189 -1.232  1.00 0.00 ? 22  GLU B CG   4  
ATOM   10396 C  CD   . GLU B 1 22 ? 166.123 -11.244 -1.292  1.00 0.00 ? 22  GLU B CD   4  
ATOM   10397 O  OE1  . GLU B 1 22 ? 166.506 -11.735 -0.242  1.00 0.00 ? 22  GLU B OE1  4  
ATOM   10398 O  OE2  . GLU B 1 22 ? 166.576 -11.537 -2.385  1.00 0.00 ? 22  GLU B OE2  4  
ATOM   10399 H  H    . GLU B 1 22 ? 161.810 -11.280 -0.844  1.00 0.00 ? 22  GLU B H    4  
ATOM   10400 H  HA   . GLU B 1 22 ? 164.368 -12.395 0.163   1.00 0.00 ? 22  GLU B HA   4  
ATOM   10401 H  HB2  . GLU B 1 22 ? 163.540 -9.486  0.153   1.00 0.00 ? 22  GLU B HB2  4  
ATOM   10402 H  HB3  . GLU B 1 22 ? 164.993 -10.131 0.912   1.00 0.00 ? 22  GLU B HB3  4  
ATOM   10403 H  HG2  . GLU B 1 22 ? 164.320 -10.360 -2.035  1.00 0.00 ? 22  GLU B HG2  4  
ATOM   10404 H  HG3  . GLU B 1 22 ? 165.461 -9.210  -1.343  1.00 0.00 ? 22  GLU B HG3  4  
ATOM   10405 N  N    . GLY B 1 23 ? 163.773 -12.200 2.593   1.00 0.00 ? 23  GLY B N    4  
ATOM   10406 C  CA   . GLY B 1 23 ? 163.303 -12.333 3.963   1.00 0.00 ? 23  GLY B CA   4  
ATOM   10407 C  C    . GLY B 1 23 ? 162.087 -13.241 4.038   1.00 0.00 ? 23  GLY B C    4  
ATOM   10408 O  O    . GLY B 1 23 ? 161.829 -14.034 3.132   1.00 0.00 ? 23  GLY B O    4  
ATOM   10409 H  H    . GLY B 1 23 ? 164.701 -12.430 2.378   1.00 0.00 ? 23  GLY B H    4  
ATOM   10410 H  HA2  . GLY B 1 23 ? 164.094 -12.748 4.571   1.00 0.00 ? 23  GLY B HA2  4  
ATOM   10411 H  HA3  . GLY B 1 23 ? 163.038 -11.358 4.342   1.00 0.00 ? 23  GLY B HA3  4  
ATOM   10412 N  N    . ASP B 1 24 ? 161.329 -13.100 5.118   1.00 0.00 ? 24  ASP B N    4  
ATOM   10413 C  CA   . ASP B 1 24 ? 160.125 -13.892 5.301   1.00 0.00 ? 24  ASP B CA   4  
ATOM   10414 C  C    . ASP B 1 24 ? 159.026 -13.411 4.358   1.00 0.00 ? 24  ASP B C    4  
ATOM   10415 O  O    . ASP B 1 24 ? 158.871 -12.206 4.125   1.00 0.00 ? 24  ASP B O    4  
ATOM   10416 C  CB   . ASP B 1 24 ? 159.642 -13.788 6.748   1.00 0.00 ? 24  ASP B CB   4  
ATOM   10417 C  CG   . ASP B 1 24 ? 160.656 -14.438 7.685   1.00 0.00 ? 24  ASP B CG   4  
ATOM   10418 O  OD1  . ASP B 1 24 ? 161.525 -15.136 7.191   1.00 0.00 ? 24  ASP B OD1  4  
ATOM   10419 O  OD2  . ASP B 1 24 ? 160.547 -14.229 8.882   1.00 0.00 ? 24  ASP B OD2  4  
ATOM   10420 H  H    . ASP B 1 24 ? 161.579 -12.440 5.798   1.00 0.00 ? 24  ASP B H    4  
ATOM   10421 H  HA   . ASP B 1 24 ? 160.348 -14.926 5.082   1.00 0.00 ? 24  ASP B HA   4  
ATOM   10422 H  HB2  . ASP B 1 24 ? 159.527 -12.748 7.014   1.00 0.00 ? 24  ASP B HB2  4  
ATOM   10423 H  HB3  . ASP B 1 24 ? 158.692 -14.291 6.847   1.00 0.00 ? 24  ASP B HB3  4  
ATOM   10424 N  N    . LYS B 1 25 ? 158.265 -14.357 3.820   1.00 0.00 ? 25  LYS B N    4  
ATOM   10425 C  CA   . LYS B 1 25 ? 157.174 -14.017 2.917   1.00 0.00 ? 25  LYS B CA   4  
ATOM   10426 C  C    . LYS B 1 25 ? 156.164 -13.131 3.626   1.00 0.00 ? 25  LYS B C    4  
ATOM   10427 O  O    . LYS B 1 25 ? 155.574 -12.226 3.040   1.00 0.00 ? 25  LYS B O    4  
ATOM   10428 C  CB   . LYS B 1 25 ? 156.427 -15.296 2.514   1.00 0.00 ? 25  LYS B CB   4  
ATOM   10429 C  CG   . LYS B 1 25 ? 157.333 -16.224 1.715   1.00 0.00 ? 25  LYS B CG   4  
ATOM   10430 C  CD   . LYS B 1 25 ? 156.534 -17.447 1.256   1.00 0.00 ? 25  LYS B CD   4  
ATOM   10431 C  CE   . LYS B 1 25 ? 157.470 -18.435 0.559   1.00 0.00 ? 25  LYS B CE   4  
ATOM   10432 N  NZ   . LYS B 1 25 ? 157.943 -17.849 -0.727  1.00 0.00 ? 25  LYS B NZ   4  
ATOM   10433 H  H    . LYS B 1 25 ? 158.433 -15.296 4.041   1.00 0.00 ? 25  LYS B H    4  
ATOM   10434 H  HA   . LYS B 1 25 ? 157.552 -13.524 2.038   1.00 0.00 ? 25  LYS B HA   4  
ATOM   10435 H  HB2  . LYS B 1 25 ? 156.092 -15.807 3.404   1.00 0.00 ? 25  LYS B HB2  4  
ATOM   10436 H  HB3  . LYS B 1 25 ? 155.570 -15.032 1.912   1.00 0.00 ? 25  LYS B HB3  4  
ATOM   10437 H  HG2  . LYS B 1 25 ? 157.694 -15.700 0.856   1.00 0.00 ? 25  LYS B HG2  4  
ATOM   10438 H  HG3  . LYS B 1 25 ? 158.162 -16.543 2.327   1.00 0.00 ? 25  LYS B HG3  4  
ATOM   10439 H  HD2  . LYS B 1 25 ? 156.081 -17.922 2.115   1.00 0.00 ? 25  LYS B HD2  4  
ATOM   10440 H  HD3  . LYS B 1 25 ? 155.764 -17.135 0.568   1.00 0.00 ? 25  LYS B HD3  4  
ATOM   10441 H  HE2  . LYS B 1 25 ? 158.318 -18.638 1.196   1.00 0.00 ? 25  LYS B HE2  4  
ATOM   10442 H  HE3  . LYS B 1 25 ? 156.939 -19.355 0.361   1.00 0.00 ? 25  LYS B HE3  4  
ATOM   10443 H  HZ1  . LYS B 1 25 ? 158.126 -18.611 -1.409  1.00 0.00 ? 25  LYS B HZ1  4  
ATOM   10444 H  HZ2  . LYS B 1 25 ? 158.821 -17.314 -0.560  1.00 0.00 ? 25  LYS B HZ2  4  
ATOM   10445 H  HZ3  . LYS B 1 25 ? 157.215 -17.212 -1.107  1.00 0.00 ? 25  LYS B HZ3  4  
ATOM   10446 N  N    . TYR B 1 26 ? 155.934 -13.475 4.881   1.00 0.00 ? 26  TYR B N    4  
ATOM   10447 C  CA   . TYR B 1 26 ? 154.943 -12.809 5.709   1.00 0.00 ? 26  TYR B CA   4  
ATOM   10448 C  C    . TYR B 1 26 ? 155.396 -11.423 6.161   1.00 0.00 ? 26  TYR B C    4  
ATOM   10449 O  O    . TYR B 1 26 ? 154.575 -10.606 6.581   1.00 0.00 ? 26  TYR B O    4  
ATOM   10450 C  CB   . TYR B 1 26 ? 154.654 -13.708 6.909   1.00 0.00 ? 26  TYR B CB   4  
ATOM   10451 C  CG   . TYR B 1 26 ? 154.199 -15.096 6.443   1.00 0.00 ? 26  TYR B CG   4  
ATOM   10452 C  CD1  . TYR B 1 26 ? 154.103 -15.438 5.066   1.00 0.00 ? 26  TYR B CD1  4  
ATOM   10453 C  CD2  . TYR B 1 26 ? 153.923 -16.074 7.408   1.00 0.00 ? 26  TYR B CD2  4  
ATOM   10454 C  CE1  . TYR B 1 26 ? 153.739 -16.730 4.686   1.00 0.00 ? 26  TYR B CE1  4  
ATOM   10455 C  CE2  . TYR B 1 26 ? 153.547 -17.367 7.017   1.00 0.00 ? 26  TYR B CE2  4  
ATOM   10456 C  CZ   . TYR B 1 26 ? 153.457 -17.695 5.658   1.00 0.00 ? 26  TYR B CZ   4  
ATOM   10457 O  OH   . TYR B 1 26 ? 153.097 -18.972 5.279   1.00 0.00 ? 26  TYR B OH   4  
ATOM   10458 H  H    . TYR B 1 26 ? 156.412 -14.247 5.251   1.00 0.00 ? 26  TYR B H    4  
ATOM   10459 H  HA   . TYR B 1 26 ? 154.032 -12.695 5.143   1.00 0.00 ? 26  TYR B HA   4  
ATOM   10460 H  HB2  . TYR B 1 26 ? 155.550 -13.807 7.503   1.00 0.00 ? 26  TYR B HB2  4  
ATOM   10461 H  HB3  . TYR B 1 26 ? 153.876 -13.262 7.509   1.00 0.00 ? 26  TYR B HB3  4  
ATOM   10462 H  HD1  . TYR B 1 26 ? 154.291 -14.717 4.297   1.00 0.00 ? 26  TYR B HD1  4  
ATOM   10463 H  HD2  . TYR B 1 26 ? 153.991 -15.829 8.457   1.00 0.00 ? 26  TYR B HD2  4  
ATOM   10464 H  HE1  . TYR B 1 26 ? 153.684 -16.981 3.632   1.00 0.00 ? 26  TYR B HE1  4  
ATOM   10465 H  HE2  . TYR B 1 26 ? 153.329 -18.114 7.766   1.00 0.00 ? 26  TYR B HE2  4  
ATOM   10466 H  HH   . TYR B 1 26 ? 153.837 -19.361 4.808   1.00 0.00 ? 26  TYR B HH   4  
ATOM   10467 N  N    . LYS B 1 27 ? 156.700 -11.161 6.103   1.00 0.00 ? 27  LYS B N    4  
ATOM   10468 C  CA   . LYS B 1 27 ? 157.227 -9.869  6.543   1.00 0.00 ? 27  LYS B CA   4  
ATOM   10469 C  C    . LYS B 1 27 ? 157.786 -9.091  5.354   1.00 0.00 ? 27  LYS B C    4  
ATOM   10470 O  O    . LYS B 1 27 ? 158.405 -9.666  4.454   1.00 0.00 ? 27  LYS B O    4  
ATOM   10471 C  CB   . LYS B 1 27 ? 158.330 -10.091 7.585   1.00 0.00 ? 27  LYS B CB   4  
ATOM   10472 C  CG   . LYS B 1 27 ? 158.697 -8.771  8.281   1.00 0.00 ? 27  LYS B CG   4  
ATOM   10473 C  CD   . LYS B 1 27 ? 157.636 -8.423  9.336   1.00 0.00 ? 27  LYS B CD   4  
ATOM   10474 C  CE   . LYS B 1 27 ? 158.092 -7.210  10.146  1.00 0.00 ? 27  LYS B CE   4  
ATOM   10475 N  NZ   . LYS B 1 27 ? 159.221 -7.604  11.035  1.00 0.00 ? 27  LYS B NZ   4  
ATOM   10476 H  H    . LYS B 1 27 ? 157.317 -11.851 5.779   1.00 0.00 ? 27  LYS B H    4  
ATOM   10477 H  HA   . LYS B 1 27 ? 156.430 -9.297  6.988   1.00 0.00 ? 27  LYS B HA   4  
ATOM   10478 H  HB2  . LYS B 1 27 ? 157.985 -10.798 8.324   1.00 0.00 ? 27  LYS B HB2  4  
ATOM   10479 H  HB3  . LYS B 1 27 ? 159.207 -10.488 7.095   1.00 0.00 ? 27  LYS B HB3  4  
ATOM   10480 H  HG2  . LYS B 1 27 ? 159.660 -8.873  8.759   1.00 0.00 ? 27  LYS B HG2  4  
ATOM   10481 H  HG3  . LYS B 1 27 ? 158.743 -7.980  7.547   1.00 0.00 ? 27  LYS B HG3  4  
ATOM   10482 H  HD2  . LYS B 1 27 ? 156.700 -8.191  8.854   1.00 0.00 ? 27  LYS B HD2  4  
ATOM   10483 H  HD3  . LYS B 1 27 ? 157.500 -9.263  10.000  1.00 0.00 ? 27  LYS B HD3  4  
ATOM   10484 H  HE2  . LYS B 1 27 ? 158.414 -6.429  9.475   1.00 0.00 ? 27  LYS B HE2  4  
ATOM   10485 H  HE3  . LYS B 1 27 ? 157.270 -6.849  10.748  1.00 0.00 ? 27  LYS B HE3  4  
ATOM   10486 H  HZ1  . LYS B 1 27 ? 158.880 -7.688  12.013  1.00 0.00 ? 27  LYS B HZ1  4  
ATOM   10487 H  HZ2  . LYS B 1 27 ? 159.968 -6.881  10.987  1.00 0.00 ? 27  LYS B HZ2  4  
ATOM   10488 H  HZ3  . LYS B 1 27 ? 159.604 -8.519  10.724  1.00 0.00 ? 27  LYS B HZ3  4  
ATOM   10489 N  N    . LEU B 1 28 ? 157.542 -7.781  5.345   1.00 0.00 ? 28  LEU B N    4  
ATOM   10490 C  CA   . LEU B 1 28 ? 158.001 -6.939  4.247   1.00 0.00 ? 28  LEU B CA   4  
ATOM   10491 C  C    . LEU B 1 28 ? 159.319 -6.266  4.662   1.00 0.00 ? 28  LEU B C    4  
ATOM   10492 O  O    . LEU B 1 28 ? 159.417 -5.704  5.752   1.00 0.00 ? 28  LEU B O    4  
ATOM   10493 C  CB   . LEU B 1 28 ? 156.931 -5.868  3.964   1.00 0.00 ? 28  LEU B CB   4  
ATOM   10494 C  CG   . LEU B 1 28 ? 157.074 -5.317  2.531   1.00 0.00 ? 28  LEU B CG   4  
ATOM   10495 C  CD1  . LEU B 1 28 ? 155.810 -4.540  2.112   1.00 0.00 ? 28  LEU B CD1  4  
ATOM   10496 C  CD2  . LEU B 1 28 ? 158.287 -4.405  2.431   1.00 0.00 ? 28  LEU B CD2  4  
ATOM   10497 H  H    . LEU B 1 28 ? 157.030 -7.380  6.079   1.00 0.00 ? 28  LEU B H    4  
ATOM   10498 H  HA   . LEU B 1 28 ? 158.158 -7.541  3.367   1.00 0.00 ? 28  LEU B HA   4  
ATOM   10499 H  HB2  . LEU B 1 28 ? 155.954 -6.308  4.090   1.00 0.00 ? 28  LEU B HB2  4  
ATOM   10500 H  HB3  . LEU B 1 28 ? 157.045 -5.058  4.669   1.00 0.00 ? 28  LEU B HB3  4  
ATOM   10501 H  HG   . LEU B 1 28 ? 157.204 -6.147  1.850   1.00 0.00 ? 28  LEU B HG   4  
ATOM   10502 H  HD11 . LEU B 1 28 ? 155.994 -3.475  2.176   1.00 0.00 ? 28  LEU B HD11 4  
ATOM   10503 H  HD12 . LEU B 1 28 ? 154.985 -4.798  2.759   1.00 0.00 ? 28  LEU B HD12 4  
ATOM   10504 H  HD13 . LEU B 1 28 ? 155.558 -4.796  1.093   1.00 0.00 ? 28  LEU B HD13 4  
ATOM   10505 H  HD21 . LEU B 1 28 ? 159.169 -5.007  2.371   1.00 0.00 ? 28  LEU B HD21 4  
ATOM   10506 H  HD22 . LEU B 1 28 ? 158.338 -3.767  3.301   1.00 0.00 ? 28  LEU B HD22 4  
ATOM   10507 H  HD23 . LEU B 1 28 ? 158.202 -3.802  1.541   1.00 0.00 ? 28  LEU B HD23 4  
ATOM   10508 N  N    . SER B 1 29 ? 160.334 -6.338  3.804   1.00 0.00 ? 29  SER B N    4  
ATOM   10509 C  CA   . SER B 1 29 ? 161.640 -5.743  4.111   1.00 0.00 ? 29  SER B CA   4  
ATOM   10510 C  C    . SER B 1 29 ? 161.826 -4.409  3.389   1.00 0.00 ? 29  SER B C    4  
ATOM   10511 O  O    . SER B 1 29 ? 161.247 -4.179  2.331   1.00 0.00 ? 29  SER B O    4  
ATOM   10512 C  CB   . SER B 1 29 ? 162.757 -6.709  3.726   1.00 0.00 ? 29  SER B CB   4  
ATOM   10513 O  OG   . SER B 1 29 ? 164.011 -6.143  4.083   1.00 0.00 ? 29  SER B OG   4  
ATOM   10514 H  H    . SER B 1 29 ? 160.209 -6.808  2.953   1.00 0.00 ? 29  SER B H    4  
ATOM   10515 H  HA   . SER B 1 29 ? 161.695 -5.564  5.174   1.00 0.00 ? 29  SER B HA   4  
ATOM   10516 H  HB2  . SER B 1 29 ? 162.625 -7.637  4.257   1.00 0.00 ? 29  SER B HB2  4  
ATOM   10517 H  HB3  . SER B 1 29 ? 162.721 -6.895  2.661   1.00 0.00 ? 29  SER B HB3  4  
ATOM   10518 H  HG   . SER B 1 29 ? 164.696 -6.606  3.594   1.00 0.00 ? 29  SER B HG   4  
ATOM   10519 N  N    . LYS B 1 30 ? 162.620 -3.517  3.980   1.00 0.00 ? 30  LYS B N    4  
ATOM   10520 C  CA   . LYS B 1 30 ? 162.832 -2.202  3.386   1.00 0.00 ? 30  LYS B CA   4  
ATOM   10521 C  C    . LYS B 1 30 ? 163.294 -2.327  1.941   1.00 0.00 ? 30  LYS B C    4  
ATOM   10522 O  O    . LYS B 1 30 ? 162.832 -1.579  1.079   1.00 0.00 ? 30  LYS B O    4  
ATOM   10523 C  CB   . LYS B 1 30 ? 163.891 -1.433  4.180   1.00 0.00 ? 30  LYS B CB   4  
ATOM   10524 C  CG   . LYS B 1 30 ? 164.022 -0.015  3.620   1.00 0.00 ? 30  LYS B CG   4  
ATOM   10525 C  CD   . LYS B 1 30 ? 165.139 0.728   4.357   1.00 0.00 ? 30  LYS B CD   4  
ATOM   10526 C  CE   . LYS B 1 30 ? 165.164 2.192   3.912   1.00 0.00 ? 30  LYS B CE   4  
ATOM   10527 N  NZ   . LYS B 1 30 ? 165.781 3.027   4.981   1.00 0.00 ? 30  LYS B NZ   4  
ATOM   10528 H  H    . LYS B 1 30 ? 163.045 -3.737  4.833   1.00 0.00 ? 30  LYS B H    4  
ATOM   10529 H  HA   . LYS B 1 30 ? 161.907 -1.648  3.414   1.00 0.00 ? 30  LYS B HA   4  
ATOM   10530 H  HB2  . LYS B 1 30 ? 163.598 -1.387  5.219   1.00 0.00 ? 30  LYS B HB2  4  
ATOM   10531 H  HB3  . LYS B 1 30 ? 164.841 -1.940  4.096   1.00 0.00 ? 30  LYS B HB3  4  
ATOM   10532 H  HG2  . LYS B 1 30 ? 164.257 -0.063  2.566   1.00 0.00 ? 30  LYS B HG2  4  
ATOM   10533 H  HG3  . LYS B 1 30 ? 163.091 0.513   3.757   1.00 0.00 ? 30  LYS B HG3  4  
ATOM   10534 H  HD2  . LYS B 1 30 ? 164.964 0.678   5.421   1.00 0.00 ? 30  LYS B HD2  4  
ATOM   10535 H  HD3  . LYS B 1 30 ? 166.089 0.270   4.127   1.00 0.00 ? 30  LYS B HD3  4  
ATOM   10536 H  HE2  . LYS B 1 30 ? 165.744 2.283   3.005   1.00 0.00 ? 30  LYS B HE2  4  
ATOM   10537 H  HE3  . LYS B 1 30 ? 164.155 2.531   3.729   1.00 0.00 ? 30  LYS B HE3  4  
ATOM   10538 H  HZ1  . LYS B 1 30 ? 166.816 2.994   4.893   1.00 0.00 ? 30  LYS B HZ1  4  
ATOM   10539 H  HZ2  . LYS B 1 30 ? 165.500 2.658   5.914   1.00 0.00 ? 30  LYS B HZ2  4  
ATOM   10540 H  HZ3  . LYS B 1 30 ? 165.459 4.009   4.886   1.00 0.00 ? 30  LYS B HZ3  4  
ATOM   10541 N  N    . LYS B 1 31 ? 164.171 -3.282  1.653   1.00 0.00 ? 31  LYS B N    4  
ATOM   10542 C  CA   . LYS B 1 31 ? 164.604 -3.456  0.273   1.00 0.00 ? 31  LYS B CA   4  
ATOM   10543 C  C    . LYS B 1 31 ? 163.415 -3.748  -0.612  1.00 0.00 ? 31  LYS B C    4  
ATOM   10544 O  O    . LYS B 1 31 ? 163.250 -3.170  -1.695  1.00 0.00 ? 31  LYS B O    4  
ATOM   10545 C  CB   . LYS B 1 31 ? 165.498 -4.683  0.149   1.00 0.00 ? 31  LYS B CB   4  
ATOM   10546 C  CG   . LYS B 1 31 ? 165.925 -4.843  -1.315  1.00 0.00 ? 31  LYS B CG   4  
ATOM   10547 C  CD   . LYS B 1 31 ? 166.545 -6.211  -1.508  1.00 0.00 ? 31  LYS B CD   4  
ATOM   10548 C  CE   . LYS B 1 31 ? 166.835 -6.401  -2.990  1.00 0.00 ? 31  LYS B CE   4  
ATOM   10549 N  NZ   . LYS B 1 31 ? 167.518 -7.710  -3.203  1.00 0.00 ? 31  LYS B NZ   4  
ATOM   10550 H  H    . LYS B 1 31 ? 164.502 -3.879  2.355   1.00 0.00 ? 31  LYS B H    4  
ATOM   10551 H  HA   . LYS B 1 31 ? 165.130 -2.582  -0.073  1.00 0.00 ? 31  LYS B HA   4  
ATOM   10552 H  HB2  . LYS B 1 31 ? 166.374 -4.556  0.770   1.00 0.00 ? 31  LYS B HB2  4  
ATOM   10553 H  HB3  . LYS B 1 31 ? 164.955 -5.561  0.462   1.00 0.00 ? 31  LYS B HB3  4  
ATOM   10554 H  HG2  . LYS B 1 31 ? 165.077 -4.750  -1.974  1.00 0.00 ? 31  LYS B HG2  4  
ATOM   10555 H  HG3  . LYS B 1 31 ? 166.653 -4.086  -1.562  1.00 0.00 ? 31  LYS B HG3  4  
ATOM   10556 H  HD2  . LYS B 1 31 ? 167.458 -6.288  -0.934  1.00 0.00 ? 31  LYS B HD2  4  
ATOM   10557 H  HD3  . LYS B 1 31 ? 165.835 -6.961  -1.185  1.00 0.00 ? 31  LYS B HD3  4  
ATOM   10558 H  HE2  . LYS B 1 31 ? 165.894 -6.388  -3.532  1.00 0.00 ? 31  LYS B HE2  4  
ATOM   10559 H  HE3  . LYS B 1 31 ? 167.466 -5.600  -3.342  1.00 0.00 ? 31  LYS B HE3  4  
ATOM   10560 H  HZ1  . LYS B 1 31 ? 166.819 -8.478  -3.155  1.00 0.00 ? 31  LYS B HZ1  4  
ATOM   10561 H  HZ2  . LYS B 1 31 ? 168.238 -7.849  -2.465  1.00 0.00 ? 31  LYS B HZ2  4  
ATOM   10562 H  HZ3  . LYS B 1 31 ? 167.972 -7.717  -4.138  1.00 0.00 ? 31  LYS B HZ3  4  
ATOM   10563 N  N    . GLU B 1 32 ? 162.607 -4.687  -0.156  1.00 0.00 ? 32  GLU B N    4  
ATOM   10564 C  CA   . GLU B 1 32 ? 161.468 -5.094  -0.929  1.00 0.00 ? 32  GLU B CA   4  
ATOM   10565 C  C    . GLU B 1 32 ? 160.532 -3.911  -1.110  1.00 0.00 ? 32  GLU B C    4  
ATOM   10566 O  O    . GLU B 1 32 ? 159.928 -3.734  -2.166  1.00 0.00 ? 32  GLU B O    4  
ATOM   10567 C  CB   . GLU B 1 32 ? 160.731 -6.220  -0.199  1.00 0.00 ? 32  GLU B CB   4  
ATOM   10568 C  CG   . GLU B 1 32 ? 161.616 -7.467  -0.130  1.00 0.00 ? 32  GLU B CG   4  
ATOM   10569 C  CD   . GLU B 1 32 ? 160.874 -8.601  0.578   1.00 0.00 ? 32  GLU B CD   4  
ATOM   10570 O  OE1  . GLU B 1 32 ? 159.870 -8.330  1.217   1.00 0.00 ? 32  GLU B OE1  4  
ATOM   10571 O  OE2  . GLU B 1 32 ? 161.306 -9.729  0.454   1.00 0.00 ? 32  GLU B OE2  4  
ATOM   10572 H  H    . GLU B 1 32 ? 162.803 -5.131  0.696   1.00 0.00 ? 32  GLU B H    4  
ATOM   10573 H  HA   . GLU B 1 32 ? 161.826 -5.458  -1.892  1.00 0.00 ? 32  GLU B HA   4  
ATOM   10574 H  HB2  . GLU B 1 32 ? 160.492 -5.896  0.801   1.00 0.00 ? 32  GLU B HB2  4  
ATOM   10575 H  HB3  . GLU B 1 32 ? 159.821 -6.457  -0.728  1.00 0.00 ? 32  GLU B HB3  4  
ATOM   10576 H  HG2  . GLU B 1 32 ? 161.873 -7.779  -1.132  1.00 0.00 ? 32  GLU B HG2  4  
ATOM   10577 H  HG3  . GLU B 1 32 ? 162.519 -7.235  0.416   1.00 0.00 ? 32  GLU B HG3  4  
ATOM   10578 N  N    . LEU B 1 33 ? 160.431 -3.099  -0.060  1.00 0.00 ? 33  LEU B N    4  
ATOM   10579 C  CA   . LEU B 1 33 ? 159.581 -1.919  -0.096  1.00 0.00 ? 33  LEU B CA   4  
ATOM   10580 C  C    . LEU B 1 33 ? 160.045 -0.944  -1.163  1.00 0.00 ? 33  LEU B C    4  
ATOM   10581 O  O    . LEU B 1 33 ? 159.250 -0.433  -1.961  1.00 0.00 ? 33  LEU B O    4  
ATOM   10582 C  CB   . LEU B 1 33 ? 159.650 -1.237  1.266   1.00 0.00 ? 33  LEU B CB   4  
ATOM   10583 C  CG   . LEU B 1 33 ? 158.751 -0.012  1.273   1.00 0.00 ? 33  LEU B CG   4  
ATOM   10584 C  CD1  . LEU B 1 33 ? 157.299 -0.450  1.150   1.00 0.00 ? 33  LEU B CD1  4  
ATOM   10585 C  CD2  . LEU B 1 33 ? 158.963 0.740   2.583   1.00 0.00 ? 33  LEU B CD2  4  
ATOM   10586 H  H    . LEU B 1 33 ? 160.946 -3.294  0.750   1.00 0.00 ? 33  LEU B H    4  
ATOM   10587 H  HA   . LEU B 1 33 ? 158.563 -2.215  -0.295  1.00 0.00 ? 33  LEU B HA   4  
ATOM   10588 H  HB2  . LEU B 1 33 ? 159.332 -1.925  2.032   1.00 0.00 ? 33  LEU B HB2  4  
ATOM   10589 H  HB3  . LEU B 1 33 ? 160.666 -0.935  1.459   1.00 0.00 ? 33  LEU B HB3  4  
ATOM   10590 H  HG   . LEU B 1 33 ? 158.999 0.631   0.447   1.00 0.00 ? 33  LEU B HG   4  
ATOM   10591 H  HD11 . LEU B 1 33 ? 156.665 0.302   1.586   1.00 0.00 ? 33  LEU B HD11 4  
ATOM   10592 H  HD12 . LEU B 1 33 ? 157.156 -1.389  1.665   1.00 0.00 ? 33  LEU B HD12 4  
ATOM   10593 H  HD13 . LEU B 1 33 ? 157.053 -0.570  0.105   1.00 0.00 ? 33  LEU B HD13 4  
ATOM   10594 H  HD21 . LEU B 1 33 ? 158.219 1.515   2.679   1.00 0.00 ? 33  LEU B HD21 4  
ATOM   10595 H  HD22 . LEU B 1 33 ? 159.948 1.182   2.582   1.00 0.00 ? 33  LEU B HD22 4  
ATOM   10596 H  HD23 . LEU B 1 33 ? 158.879 0.051   3.409   1.00 0.00 ? 33  LEU B HD23 4  
ATOM   10597 N  N    . LYS B 1 34 ? 161.351 -0.729  -1.193  1.00 0.00 ? 34  LYS B N    4  
ATOM   10598 C  CA   . LYS B 1 34 ? 161.947 0.142   -2.181  1.00 0.00 ? 34  LYS B CA   4  
ATOM   10599 C  C    . LYS B 1 34 ? 161.665 -0.368  -3.564  1.00 0.00 ? 34  LYS B C    4  
ATOM   10600 O  O    . LYS B 1 34 ? 161.351 0.386   -4.486  1.00 0.00 ? 34  LYS B O    4  
ATOM   10601 C  CB   . LYS B 1 34 ? 163.458 0.226   -1.910  1.00 0.00 ? 34  LYS B CB   4  
ATOM   10602 C  CG   . LYS B 1 34 ? 164.197 0.862   -3.091  1.00 0.00 ? 34  LYS B CG   4  
ATOM   10603 C  CD   . LYS B 1 34 ? 163.618 2.229   -3.390  1.00 0.00 ? 34  LYS B CD   4  
ATOM   10604 C  CE   . LYS B 1 34 ? 164.515 2.983   -4.382  1.00 0.00 ? 34  LYS B CE   4  
ATOM   10605 N  NZ   . LYS B 1 34 ? 163.663 3.745   -5.337  1.00 0.00 ? 34  LYS B NZ   4  
ATOM   10606 H  H    . LYS B 1 34 ? 161.928 -1.192  -0.551  1.00 0.00 ? 34  LYS B H    4  
ATOM   10607 H  HA   . LYS B 1 34 ? 161.523 1.130   -2.079  1.00 0.00 ? 34  LYS B HA   4  
ATOM   10608 H  HB2  . LYS B 1 34 ? 163.623 0.830   -1.027  1.00 0.00 ? 34  LYS B HB2  4  
ATOM   10609 H  HB3  . LYS B 1 34 ? 163.846 -0.768  -1.739  1.00 0.00 ? 34  LYS B HB3  4  
ATOM   10610 H  HG2  . LYS B 1 34 ? 165.243 0.963   -2.844  1.00 0.00 ? 34  LYS B HG2  4  
ATOM   10611 H  HG3  . LYS B 1 34 ? 164.095 0.231   -3.962  1.00 0.00 ? 34  LYS B HG3  4  
ATOM   10612 H  HD2  . LYS B 1 34 ? 162.651 2.077   -3.833  1.00 0.00 ? 34  LYS B HD2  4  
ATOM   10613 H  HD3  . LYS B 1 34 ? 163.521 2.797   -2.478  1.00 0.00 ? 34  LYS B HD3  4  
ATOM   10614 H  HE2  . LYS B 1 34 ? 165.148 3.672   -3.842  1.00 0.00 ? 34  LYS B HE2  4  
ATOM   10615 H  HE3  . LYS B 1 34 ? 165.129 2.283   -4.929  1.00 0.00 ? 34  LYS B HE3  4  
ATOM   10616 H  HZ1  . LYS B 1 34 ? 163.346 3.114   -6.099  1.00 0.00 ? 34  LYS B HZ1  4  
ATOM   10617 H  HZ2  . LYS B 1 34 ? 164.214 4.530   -5.742  1.00 0.00 ? 34  LYS B HZ2  4  
ATOM   10618 H  HZ3  . LYS B 1 34 ? 162.834 4.125   -4.837  1.00 0.00 ? 34  LYS B HZ3  4  
ATOM   10619 N  N    . GLU B 1 35 ? 161.774 -1.658  -3.696  1.00 0.00 ? 35  GLU B N    4  
ATOM   10620 C  CA   . GLU B 1 35 ? 161.535 -2.281  -4.974  1.00 0.00 ? 35  GLU B CA   4  
ATOM   10621 C  C    . GLU B 1 35 ? 160.068 -2.223  -5.383  1.00 0.00 ? 35  GLU B C    4  
ATOM   10622 O  O    . GLU B 1 35 ? 159.771 -1.987  -6.551  1.00 0.00 ? 35  GLU B O    4  
ATOM   10623 C  CB   . GLU B 1 35 ? 162.074 -3.693  -4.900  1.00 0.00 ? 35  GLU B CB   4  
ATOM   10624 C  CG   . GLU B 1 35 ? 163.590 -3.572  -4.722  1.00 0.00 ? 35  GLU B CG   4  
ATOM   10625 C  CD   . GLU B 1 35 ? 164.231 -3.017  -5.990  1.00 0.00 ? 35  GLU B CD   4  
ATOM   10626 O  OE1  . GLU B 1 35 ? 163.575 -3.035  -7.019  1.00 0.00 ? 35  GLU B OE1  4  
ATOM   10627 O  OE2  . GLU B 1 35 ? 165.368 -2.582  -5.915  1.00 0.00 ? 35  GLU B OE2  4  
ATOM   10628 H  H    . GLU B 1 35 ? 162.014 -2.209  -2.907  1.00 0.00 ? 35  GLU B H    4  
ATOM   10629 H  HA   . GLU B 1 35 ? 162.103 -1.743  -5.717  1.00 0.00 ? 35  GLU B HA   4  
ATOM   10630 H  HB2  . GLU B 1 35 ? 161.638 -4.210  -4.055  1.00 0.00 ? 35  GLU B HB2  4  
ATOM   10631 H  HB3  . GLU B 1 35 ? 161.856 -4.223  -5.813  1.00 0.00 ? 35  GLU B HB3  4  
ATOM   10632 H  HG2  . GLU B 1 35 ? 163.781 -2.865  -3.910  1.00 0.00 ? 35  GLU B HG2  4  
ATOM   10633 H  HG3  . GLU B 1 35 ? 164.015 -4.535  -4.485  1.00 0.00 ? 35  GLU B HG3  4  
ATOM   10634 N  N    . LEU B 1 36 ? 159.146 -2.407  -4.434  1.00 0.00 ? 36  LEU B N    4  
ATOM   10635 C  CA   . LEU B 1 36 ? 157.732 -2.332  -4.787  1.00 0.00 ? 36  LEU B CA   4  
ATOM   10636 C  C    . LEU B 1 36 ? 157.319 -0.935  -5.203  1.00 0.00 ? 36  LEU B C    4  
ATOM   10637 O  O    . LEU B 1 36 ? 156.697 -0.760  -6.245  1.00 0.00 ? 36  LEU B O    4  
ATOM   10638 C  CB   . LEU B 1 36 ? 156.845 -2.751  -3.607  1.00 0.00 ? 36  LEU B CB   4  
ATOM   10639 C  CG   . LEU B 1 36 ? 156.955 -4.255  -3.352  1.00 0.00 ? 36  LEU B CG   4  
ATOM   10640 C  CD1  . LEU B 1 36 ? 156.208 -4.601  -2.058  1.00 0.00 ? 36  LEU B CD1  4  
ATOM   10641 C  CD2  . LEU B 1 36 ? 156.306 -5.017  -4.531  1.00 0.00 ? 36  LEU B CD2  4  
ATOM   10642 H  H    . LEU B 1 36 ? 159.417 -2.572  -3.506  1.00 0.00 ? 36  LEU B H    4  
ATOM   10643 H  HA   . LEU B 1 36 ? 157.548 -3.004  -5.609  1.00 0.00 ? 36  LEU B HA   4  
ATOM   10644 H  HB2  . LEU B 1 36 ? 157.160 -2.216  -2.724  1.00 0.00 ? 36  LEU B HB2  4  
ATOM   10645 H  HB3  . LEU B 1 36 ? 155.818 -2.499  -3.826  1.00 0.00 ? 36  LEU B HB3  4  
ATOM   10646 H  HG   . LEU B 1 36 ? 157.994 -4.535  -3.261  1.00 0.00 ? 36  LEU B HG   4  
ATOM   10647 H  HD11 . LEU B 1 36 ? 156.562 -5.549  -1.680  1.00 0.00 ? 36  LEU B HD11 4  
ATOM   10648 H  HD12 . LEU B 1 36 ? 155.148 -4.670  -2.260  1.00 0.00 ? 36  LEU B HD12 4  
ATOM   10649 H  HD13 . LEU B 1 36 ? 156.383 -3.831  -1.321  1.00 0.00 ? 36  LEU B HD13 4  
ATOM   10650 H  HD21 . LEU B 1 36 ? 155.776 -4.329  -5.175  1.00 0.00 ? 36  LEU B HD21 4  
ATOM   10651 H  HD22 . LEU B 1 36 ? 155.605 -5.751  -4.157  1.00 0.00 ? 36  LEU B HD22 4  
ATOM   10652 H  HD23 . LEU B 1 36 ? 157.076 -5.511  -5.099  1.00 0.00 ? 36  LEU B HD23 4  
ATOM   10653 N  N    . LEU B 1 37 ? 157.657 0.062   -4.396  1.00 0.00 ? 37  LEU B N    4  
ATOM   10654 C  CA   . LEU B 1 37 ? 157.268 1.419   -4.742  1.00 0.00 ? 37  LEU B CA   4  
ATOM   10655 C  C    . LEU B 1 37 ? 158.013 1.912   -5.972  1.00 0.00 ? 37  LEU B C    4  
ATOM   10656 O  O    . LEU B 1 37 ? 157.429 2.547   -6.855  1.00 0.00 ? 37  LEU B O    4  
ATOM   10657 C  CB   . LEU B 1 37 ? 157.557 2.356   -3.564  1.00 0.00 ? 37  LEU B CB   4  
ATOM   10658 C  CG   . LEU B 1 37 ? 156.813 1.871   -2.315  1.00 0.00 ? 37  LEU B CG   4  
ATOM   10659 C  CD1  . LEU B 1 37 ? 157.016 2.876   -1.179  1.00 0.00 ? 37  LEU B CD1  4  
ATOM   10660 C  CD2  . LEU B 1 37 ? 155.316 1.744   -2.617  1.00 0.00 ? 37  LEU B CD2  4  
ATOM   10661 H  H    . LEU B 1 37 ? 158.156 -0.116  -3.566  1.00 0.00 ? 37  LEU B H    4  
ATOM   10662 H  HA   . LEU B 1 37 ? 156.210 1.438   -4.949  1.00 0.00 ? 37  LEU B HA   4  
ATOM   10663 H  HB2  . LEU B 1 37 ? 158.619 2.366   -3.368  1.00 0.00 ? 37  LEU B HB2  4  
ATOM   10664 H  HB3  . LEU B 1 37 ? 157.228 3.353   -3.812  1.00 0.00 ? 37  LEU B HB3  4  
ATOM   10665 H  HG   . LEU B 1 37 ? 157.203 0.909   -2.016  1.00 0.00 ? 37  LEU B HG   4  
ATOM   10666 H  HD11 . LEU B 1 37 ? 156.286 3.668   -1.262  1.00 0.00 ? 37  LEU B HD11 4  
ATOM   10667 H  HD12 . LEU B 1 37 ? 158.010 3.295   -1.243  1.00 0.00 ? 37  LEU B HD12 4  
ATOM   10668 H  HD13 . LEU B 1 37 ? 156.897 2.375   -0.230  1.00 0.00 ? 37  LEU B HD13 4  
ATOM   10669 H  HD21 . LEU B 1 37 ? 155.117 0.775   -3.051  1.00 0.00 ? 37  LEU B HD21 4  
ATOM   10670 H  HD22 . LEU B 1 37 ? 155.022 2.516   -3.312  1.00 0.00 ? 37  LEU B HD22 4  
ATOM   10671 H  HD23 . LEU B 1 37 ? 154.752 1.850   -1.703  1.00 0.00 ? 37  LEU B HD23 4  
ATOM   10672 N  N    . GLN B 1 38 ? 159.307 1.620   -6.013  1.00 0.00 ? 38  GLN B N    4  
ATOM   10673 C  CA   . GLN B 1 38 ? 160.138 2.054   -7.123  1.00 0.00 ? 38  GLN B CA   4  
ATOM   10674 C  C    . GLN B 1 38 ? 159.747 1.435   -8.450  1.00 0.00 ? 38  GLN B C    4  
ATOM   10675 O  O    . GLN B 1 38 ? 159.728 2.120   -9.473  1.00 0.00 ? 38  GLN B O    4  
ATOM   10676 C  CB   . GLN B 1 38 ? 161.598 1.736   -6.809  1.00 0.00 ? 38  GLN B CB   4  
ATOM   10677 C  CG   . GLN B 1 38 ? 162.498 2.282   -7.911  1.00 0.00 ? 38  GLN B CG   4  
ATOM   10678 C  CD   . GLN B 1 38 ? 163.954 1.936   -7.620  1.00 0.00 ? 38  GLN B CD   4  
ATOM   10679 O  OE1  . GLN B 1 38 ? 164.321 0.760   -7.594  1.00 0.00 ? 38  GLN B OE1  4  
ATOM   10680 N  NE2  . GLN B 1 38 ? 164.811 2.894   -7.399  1.00 0.00 ? 38  GLN B NE2  4  
ATOM   10681 H  H    . GLN B 1 38 ? 159.714 1.118   -5.275  1.00 0.00 ? 38  GLN B H    4  
ATOM   10682 H  HA   . GLN B 1 38 ? 160.041 3.119   -7.214  1.00 0.00 ? 38  GLN B HA   4  
ATOM   10683 H  HB2  . GLN B 1 38 ? 161.864 2.195   -5.875  1.00 0.00 ? 38  GLN B HB2  4  
ATOM   10684 H  HB3  . GLN B 1 38 ? 161.728 0.667   -6.736  1.00 0.00 ? 38  GLN B HB3  4  
ATOM   10685 H  HG2  . GLN B 1 38 ? 162.212 1.837   -8.843  1.00 0.00 ? 38  GLN B HG2  4  
ATOM   10686 H  HG3  . GLN B 1 38 ? 162.385 3.351   -7.975  1.00 0.00 ? 38  GLN B HG3  4  
ATOM   10687 H  HE21 . GLN B 1 38 ? 164.517 3.829   -7.421  1.00 0.00 ? 38  GLN B HE21 4  
ATOM   10688 H  HE22 . GLN B 1 38 ? 165.749 2.680   -7.212  1.00 0.00 ? 38  GLN B HE22 4  
ATOM   10689 N  N    . THR B 1 39 ? 159.458 0.144   -8.455  1.00 0.00 ? 39  THR B N    4  
ATOM   10690 C  CA   . THR B 1 39 ? 159.101 -0.506  -9.703  1.00 0.00 ? 39  THR B CA   4  
ATOM   10691 C  C    . THR B 1 39 ? 157.622 -0.338  -10.040 1.00 0.00 ? 39  THR B C    4  
ATOM   10692 O  O    . THR B 1 39 ? 157.274 -0.034  -11.180 1.00 0.00 ? 39  THR B O    4  
ATOM   10693 C  CB   . THR B 1 39 ? 159.473 -1.995  -9.652  1.00 0.00 ? 39  THR B CB   4  
ATOM   10694 O  OG1  . THR B 1 39 ? 159.651 -2.478  -10.976 1.00 0.00 ? 39  THR B OG1  4  
ATOM   10695 C  CG2  . THR B 1 39 ? 158.369 -2.798  -8.962  1.00 0.00 ? 39  THR B CG2  4  
ATOM   10696 H  H    . THR B 1 39 ? 159.501 -0.375  -7.623  1.00 0.00 ? 39  THR B H    4  
ATOM   10697 H  HA   . THR B 1 39 ? 159.680 -0.045  -10.492 1.00 0.00 ? 39  THR B HA   4  
ATOM   10698 H  HB   . THR B 1 39 ? 160.394 -2.114  -9.102  1.00 0.00 ? 39  THR B HB   4  
ATOM   10699 H  HG1  . THR B 1 39 ? 159.570 -1.734  -11.577 1.00 0.00 ? 39  THR B HG1  4  
ATOM   10700 H  HG21 . THR B 1 39 ? 158.719 -3.802  -8.774  1.00 0.00 ? 39  THR B HG21 4  
ATOM   10701 H  HG22 . THR B 1 39 ? 157.497 -2.834  -9.597  1.00 0.00 ? 39  THR B HG22 4  
ATOM   10702 H  HG23 . THR B 1 39 ? 158.117 -2.327  -8.029  1.00 0.00 ? 39  THR B HG23 4  
ATOM   10703 N  N    . GLU B 1 40 ? 156.749 -0.565  -9.059  1.00 0.00 ? 40  GLU B N    4  
ATOM   10704 C  CA   . GLU B 1 40 ? 155.315 -0.457  -9.319  1.00 0.00 ? 40  GLU B CA   4  
ATOM   10705 C  C    . GLU B 1 40 ? 154.872 0.994   -9.460  1.00 0.00 ? 40  GLU B C    4  
ATOM   10706 O  O    . GLU B 1 40 ? 153.967 1.300   -10.237 1.00 0.00 ? 40  GLU B O    4  
ATOM   10707 C  CB   . GLU B 1 40 ? 154.522 -1.123  -8.194  1.00 0.00 ? 40  GLU B CB   4  
ATOM   10708 C  CG   . GLU B 1 40 ? 154.883 -2.610  -8.143  1.00 0.00 ? 40  GLU B CG   4  
ATOM   10709 C  CD   . GLU B 1 40 ? 154.057 -3.330  -7.086  1.00 0.00 ? 40  GLU B CD   4  
ATOM   10710 O  OE1  . GLU B 1 40 ? 153.382 -2.660  -6.327  1.00 0.00 ? 40  GLU B OE1  4  
ATOM   10711 O  OE2  . GLU B 1 40 ? 154.119 -4.546  -7.048  1.00 0.00 ? 40  GLU B OE2  4  
ATOM   10712 H  H    . GLU B 1 40 ? 157.069 -0.817  -8.166  1.00 0.00 ? 40  GLU B H    4  
ATOM   10713 H  HA   . GLU B 1 40 ? 155.095 -0.974  -10.240 1.00 0.00 ? 40  GLU B HA   4  
ATOM   10714 H  HB2  . GLU B 1 40 ? 154.752 -0.652  -7.254  1.00 0.00 ? 40  GLU B HB2  4  
ATOM   10715 H  HB3  . GLU B 1 40 ? 153.470 -1.020  -8.395  1.00 0.00 ? 40  GLU B HB3  4  
ATOM   10716 H  HG2  . GLU B 1 40 ? 154.699 -3.055  -9.103  1.00 0.00 ? 40  GLU B HG2  4  
ATOM   10717 H  HG3  . GLU B 1 40 ? 155.926 -2.712  -7.900  1.00 0.00 ? 40  GLU B HG3  4  
ATOM   10718 N  N    . LEU B 1 41 ? 155.508 1.890   -8.706  1.00 0.00 ? 41  LEU B N    4  
ATOM   10719 C  CA   . LEU B 1 41 ? 155.158 3.306   -8.762  1.00 0.00 ? 41  LEU B CA   4  
ATOM   10720 C  C    . LEU B 1 41 ? 156.371 4.149   -9.131  1.00 0.00 ? 41  LEU B C    4  
ATOM   10721 O  O    . LEU B 1 41 ? 156.692 5.123   -8.447  1.00 0.00 ? 41  LEU B O    4  
ATOM   10722 C  CB   . LEU B 1 41 ? 154.591 3.763   -7.417  1.00 0.00 ? 41  LEU B CB   4  
ATOM   10723 C  CG   . LEU B 1 41 ? 153.126 3.316   -7.283  1.00 0.00 ? 41  LEU B CG   4  
ATOM   10724 C  CD1  . LEU B 1 41 ? 153.043 1.796   -7.068  1.00 0.00 ? 41  LEU B CD1  4  
ATOM   10725 C  CD2  . LEU B 1 41 ? 152.488 4.035   -6.089  1.00 0.00 ? 41  LEU B CD2  4  
ATOM   10726 H  H    . LEU B 1 41 ? 156.225 1.597   -8.098  1.00 0.00 ? 41  LEU B H    4  
ATOM   10727 H  HA   . LEU B 1 41 ? 154.403 3.452   -9.521  1.00 0.00 ? 41  LEU B HA   4  
ATOM   10728 H  HB2  . LEU B 1 41 ? 155.176 3.336   -6.616  1.00 0.00 ? 41  LEU B HB2  4  
ATOM   10729 H  HB3  . LEU B 1 41 ? 154.642 4.837   -7.363  1.00 0.00 ? 41  LEU B HB3  4  
ATOM   10730 H  HG   . LEU B 1 41 ? 152.587 3.578   -8.182  1.00 0.00 ? 41  LEU B HG   4  
ATOM   10731 H  HD11 . LEU B 1 41 ? 153.983 1.426   -6.682  1.00 0.00 ? 41  LEU B HD11 4  
ATOM   10732 H  HD12 . LEU B 1 41 ? 152.827 1.313   -8.008  1.00 0.00 ? 41  LEU B HD12 4  
ATOM   10733 H  HD13 . LEU B 1 41 ? 152.254 1.571   -6.366  1.00 0.00 ? 41  LEU B HD13 4  
ATOM   10734 H  HD21 . LEU B 1 41 ? 151.557 3.551   -5.833  1.00 0.00 ? 41  LEU B HD21 4  
ATOM   10735 H  HD22 . LEU B 1 41 ? 152.297 5.065   -6.346  1.00 0.00 ? 41  LEU B HD22 4  
ATOM   10736 H  HD23 . LEU B 1 41 ? 153.159 3.991   -5.244  1.00 0.00 ? 41  LEU B HD23 4  
ATOM   10737 N  N    . SER B 1 42 ? 157.035 3.776   -10.216 1.00 0.00 ? 42  SER B N    4  
ATOM   10738 C  CA   . SER B 1 42 ? 158.211 4.506   -10.659 1.00 0.00 ? 42  SER B CA   4  
ATOM   10739 C  C    . SER B 1 42 ? 157.850 5.960   -10.914 1.00 0.00 ? 42  SER B C    4  
ATOM   10740 O  O    . SER B 1 42 ? 158.703 6.842   -10.842 1.00 0.00 ? 42  SER B O    4  
ATOM   10741 C  CB   . SER B 1 42 ? 158.767 3.881   -11.938 1.00 0.00 ? 42  SER B CB   4  
ATOM   10742 O  OG   . SER B 1 42 ? 157.847 4.090   -13.001 1.00 0.00 ? 42  SER B OG   4  
ATOM   10743 H  H    . SER B 1 42 ? 156.730 2.996   -10.725 1.00 0.00 ? 42  SER B H    4  
ATOM   10744 H  HA   . SER B 1 42 ? 158.966 4.461   -9.888  1.00 0.00 ? 42  SER B HA   4  
ATOM   10745 H  HB2  . SER B 1 42 ? 159.708 4.342   -12.188 1.00 0.00 ? 42  SER B HB2  4  
ATOM   10746 H  HB3  . SER B 1 42 ? 158.919 2.820   -11.783 1.00 0.00 ? 42  SER B HB3  4  
ATOM   10747 H  HG   . SER B 1 42 ? 157.182 4.714   -12.699 1.00 0.00 ? 42  SER B HG   4  
ATOM   10748 N  N    . GLY B 1 43 ? 156.580 6.200   -11.217 1.00 0.00 ? 43  GLY B N    4  
ATOM   10749 C  CA   . GLY B 1 43 ? 156.108 7.551   -11.483 1.00 0.00 ? 43  GLY B CA   4  
ATOM   10750 C  C    . GLY B 1 43 ? 155.664 8.257   -10.199 1.00 0.00 ? 43  GLY B C    4  
ATOM   10751 O  O    . GLY B 1 43 ? 156.300 9.214   -9.756  1.00 0.00 ? 43  GLY B O    4  
ATOM   10752 H  H    . GLY B 1 43 ? 155.947 5.453   -11.260 1.00 0.00 ? 43  GLY B H    4  
ATOM   10753 H  HA2  . GLY B 1 43 ? 156.907 8.119   -11.939 1.00 0.00 ? 43  GLY B HA2  4  
ATOM   10754 H  HA3  . GLY B 1 43 ? 155.273 7.506   -12.165 1.00 0.00 ? 43  GLY B HA3  4  
ATOM   10755 N  N    . PHE B 1 44 ? 154.553 7.798   -9.624  1.00 0.00 ? 44  PHE B N    4  
ATOM   10756 C  CA   . PHE B 1 44 ? 154.014 8.417   -8.412  1.00 0.00 ? 44  PHE B CA   4  
ATOM   10757 C  C    . PHE B 1 44 ? 155.023 8.413   -7.256  1.00 0.00 ? 44  PHE B C    4  
ATOM   10758 O  O    . PHE B 1 44 ? 155.172 9.412   -6.551  1.00 0.00 ? 44  PHE B O    4  
ATOM   10759 C  CB   . PHE B 1 44 ? 152.758 7.660   -7.978  1.00 0.00 ? 44  PHE B CB   4  
ATOM   10760 C  CG   . PHE B 1 44 ? 151.682 7.840   -9.021  1.00 0.00 ? 44  PHE B CG   4  
ATOM   10761 C  CD1  . PHE B 1 44 ? 150.867 8.979   -8.999  1.00 0.00 ? 44  PHE B CD1  4  
ATOM   10762 C  CD2  . PHE B 1 44 ? 151.500 6.870   -10.014 1.00 0.00 ? 44  PHE B CD2  4  
ATOM   10763 C  CE1  . PHE B 1 44 ? 149.871 9.147   -9.969  1.00 0.00 ? 44  PHE B CE1  4  
ATOM   10764 C  CE2  . PHE B 1 44 ? 150.504 7.037   -10.984 1.00 0.00 ? 44  PHE B CE2  4  
ATOM   10765 C  CZ   . PHE B 1 44 ? 149.690 8.175   -10.961 1.00 0.00 ? 44  PHE B CZ   4  
ATOM   10766 H  H    . PHE B 1 44 ? 154.075 7.047   -10.033 1.00 0.00 ? 44  PHE B H    4  
ATOM   10767 H  HA   . PHE B 1 44 ? 153.733 9.431   -8.633  1.00 0.00 ? 44  PHE B HA   4  
ATOM   10768 H  HB2  . PHE B 1 44 ? 152.988 6.610   -7.877  1.00 0.00 ? 44  PHE B HB2  4  
ATOM   10769 H  HB3  . PHE B 1 44 ? 152.411 8.047   -7.033  1.00 0.00 ? 44  PHE B HB3  4  
ATOM   10770 H  HD1  . PHE B 1 44 ? 151.008 9.728   -8.233  1.00 0.00 ? 44  PHE B HD1  4  
ATOM   10771 H  HD2  . PHE B 1 44 ? 152.128 5.991   -10.032 1.00 0.00 ? 44  PHE B HD2  4  
ATOM   10772 H  HE1  . PHE B 1 44 ? 149.242 10.024  -9.951  1.00 0.00 ? 44  PHE B HE1  4  
ATOM   10773 H  HE2  . PHE B 1 44 ? 150.364 6.288   -11.750 1.00 0.00 ? 44  PHE B HE2  4  
ATOM   10774 H  HZ   . PHE B 1 44 ? 148.921 8.305   -11.709 1.00 0.00 ? 44  PHE B HZ   4  
ATOM   10775 N  N    . LEU B 1 45 ? 155.709 7.290   -7.069  1.00 0.00 ? 45  LEU B N    4  
ATOM   10776 C  CA   . LEU B 1 45 ? 156.701 7.159   -5.998  1.00 0.00 ? 45  LEU B CA   4  
ATOM   10777 C  C    . LEU B 1 45 ? 158.105 7.525   -6.462  1.00 0.00 ? 45  LEU B C    4  
ATOM   10778 O  O    . LEU B 1 45 ? 159.037 7.479   -5.664  1.00 0.00 ? 45  LEU B O    4  
ATOM   10779 C  CB   . LEU B 1 45 ? 156.694 5.749   -5.391  1.00 0.00 ? 45  LEU B CB   4  
ATOM   10780 C  CG   . LEU B 1 45 ? 155.509 5.542   -4.412  1.00 0.00 ? 45  LEU B CG   4  
ATOM   10781 C  CD1  . LEU B 1 45 ? 155.956 5.906   -2.994  1.00 0.00 ? 45  LEU B CD1  4  
ATOM   10782 C  CD2  . LEU B 1 45 ? 154.283 6.401   -4.772  1.00 0.00 ? 45  LEU B CD2  4  
ATOM   10783 H  H    . LEU B 1 45 ? 155.550 6.523   -7.665  1.00 0.00 ? 45  LEU B H    4  
ATOM   10784 H  HA   . LEU B 1 45 ? 156.439 7.855   -5.219  1.00 0.00 ? 45  LEU B HA   4  
ATOM   10785 H  HB2  . LEU B 1 45 ? 156.621 5.027   -6.186  1.00 0.00 ? 45  LEU B HB2  4  
ATOM   10786 H  HB3  . LEU B 1 45 ? 157.623 5.592   -4.862  1.00 0.00 ? 45  LEU B HB3  4  
ATOM   10787 H  HG   . LEU B 1 45 ? 155.229 4.498   -4.428  1.00 0.00 ? 45  LEU B HG   4  
ATOM   10788 H  HD11 . LEU B 1 45 ? 156.832 5.332   -2.734  1.00 0.00 ? 45  LEU B HD11 4  
ATOM   10789 H  HD12 . LEU B 1 45 ? 155.161 5.684   -2.298  1.00 0.00 ? 45  LEU B HD12 4  
ATOM   10790 H  HD13 . LEU B 1 45 ? 156.190 6.959   -2.950  1.00 0.00 ? 45  LEU B HD13 4  
ATOM   10791 H  HD21 . LEU B 1 45 ? 153.420 6.018   -4.247  1.00 0.00 ? 45  LEU B HD21 4  
ATOM   10792 H  HD22 . LEU B 1 45 ? 154.097 6.358   -5.827  1.00 0.00 ? 45  LEU B HD22 4  
ATOM   10793 H  HD23 . LEU B 1 45 ? 154.447 7.423   -4.472  1.00 0.00 ? 45  LEU B HD23 4  
ATOM   10794 N  N    . ASP B 1 46 ? 158.251 7.841   -7.752  1.00 0.00 ? 46  ASP B N    4  
ATOM   10795 C  CA   . ASP B 1 46 ? 159.561 8.166   -8.337  1.00 0.00 ? 46  ASP B CA   4  
ATOM   10796 C  C    . ASP B 1 46 ? 160.588 8.591   -7.282  1.00 0.00 ? 46  ASP B C    4  
ATOM   10797 O  O    . ASP B 1 46 ? 160.909 9.769   -7.130  1.00 0.00 ? 46  ASP B O    4  
ATOM   10798 C  CB   . ASP B 1 46 ? 159.394 9.293   -9.365  1.00 0.00 ? 46  ASP B CB   4  
ATOM   10799 C  CG   . ASP B 1 46 ? 158.872 10.559  -8.686  1.00 0.00 ? 46  ASP B CG   4  
ATOM   10800 O  OD1  . ASP B 1 46 ? 158.839 10.591  -7.468  1.00 0.00 ? 46  ASP B OD1  4  
ATOM   10801 O  OD2  . ASP B 1 46 ? 158.489 11.471  -9.401  1.00 0.00 ? 46  ASP B OD2  4  
ATOM   10802 H  H    . ASP B 1 46 ? 157.463 7.826   -8.335  1.00 0.00 ? 46  ASP B H    4  
ATOM   10803 H  HA   . ASP B 1 46 ? 159.935 7.294   -8.849  1.00 0.00 ? 46  ASP B HA   4  
ATOM   10804 H  HB2  . ASP B 1 46 ? 160.347 9.501   -9.824  1.00 0.00 ? 46  ASP B HB2  4  
ATOM   10805 H  HB3  . ASP B 1 46 ? 158.692 8.985   -10.123 1.00 0.00 ? 46  ASP B HB3  4  
ATOM   10806 N  N    . ALA B 1 47 ? 161.104 7.591   -6.568  1.00 0.00 ? 47  ALA B N    4  
ATOM   10807 C  CA   . ALA B 1 47 ? 162.102 7.808   -5.526  1.00 0.00 ? 47  ALA B CA   4  
ATOM   10808 C  C    . ALA B 1 47 ? 163.389 8.382   -6.107  1.00 0.00 ? 47  ALA B C    4  
ATOM   10809 O  O    . ALA B 1 47 ? 164.141 9.065   -5.415  1.00 0.00 ? 47  ALA B O    4  
ATOM   10810 C  CB   . ALA B 1 47 ? 162.402 6.487   -4.815  1.00 0.00 ? 47  ALA B CB   4  
ATOM   10811 H  H    . ALA B 1 47 ? 160.808 6.676   -6.753  1.00 0.00 ? 47  ALA B H    4  
ATOM   10812 H  HA   . ALA B 1 47 ? 161.706 8.505   -4.803  1.00 0.00 ? 47  ALA B HA   4  
ATOM   10813 H  HB1  . ALA B 1 47 ? 161.678 6.327   -4.031  1.00 0.00 ? 47  ALA B HB1  4  
ATOM   10814 H  HB2  . ALA B 1 47 ? 163.394 6.521   -4.387  1.00 0.00 ? 47  ALA B HB2  4  
ATOM   10815 H  HB3  . ALA B 1 47 ? 162.345 5.677   -5.527  1.00 0.00 ? 47  ALA B HB3  4  
ATOM   10816 N  N    . GLN B 1 48 ? 163.648 8.086   -7.375  1.00 0.00 ? 48  GLN B N    4  
ATOM   10817 C  CA   . GLN B 1 48 ? 164.862 8.566   -8.018  1.00 0.00 ? 48  GLN B CA   4  
ATOM   10818 C  C    . GLN B 1 48 ? 164.995 10.075  -7.844  1.00 0.00 ? 48  GLN B C    4  
ATOM   10819 O  O    . GLN B 1 48 ? 166.096 10.588  -7.652  1.00 0.00 ? 48  GLN B O    4  
ATOM   10820 C  CB   . GLN B 1 48 ? 164.838 8.223   -9.509  1.00 0.00 ? 48  GLN B CB   4  
ATOM   10821 C  CG   . GLN B 1 48 ? 166.198 8.550   -10.129 1.00 0.00 ? 48  GLN B CG   4  
ATOM   10822 C  CD   . GLN B 1 48 ? 166.146 8.346   -11.640 1.00 0.00 ? 48  GLN B CD   4  
ATOM   10823 O  OE1  . GLN B 1 48 ? 165.337 8.972   -12.324 1.00 0.00 ? 48  GLN B OE1  4  
ATOM   10824 N  NE2  . GLN B 1 48 ? 166.965 7.500   -12.203 1.00 0.00 ? 48  GLN B NE2  4  
ATOM   10825 H  H    . GLN B 1 48 ? 163.021 7.525   -7.879  1.00 0.00 ? 48  GLN B H    4  
ATOM   10826 H  HA   . GLN B 1 48 ? 165.715 8.086   -7.563  1.00 0.00 ? 48  GLN B HA   4  
ATOM   10827 H  HB2  . GLN B 1 48 ? 164.629 7.170   -9.633  1.00 0.00 ? 48  GLN B HB2  4  
ATOM   10828 H  HB3  . GLN B 1 48 ? 164.072 8.803   -10.001 1.00 0.00 ? 48  GLN B HB3  4  
ATOM   10829 H  HG2  . GLN B 1 48 ? 166.452 9.577   -9.915  1.00 0.00 ? 48  GLN B HG2  4  
ATOM   10830 H  HG3  . GLN B 1 48 ? 166.950 7.900   -9.707  1.00 0.00 ? 48  GLN B HG3  4  
ATOM   10831 H  HE21 . GLN B 1 48 ? 167.608 7.003   -11.656 1.00 0.00 ? 48  GLN B HE21 4  
ATOM   10832 H  HE22 . GLN B 1 48 ? 166.937 7.363   -13.173 1.00 0.00 ? 48  GLN B HE22 4  
ATOM   10833 N  N    . LYS B 1 49 ? 163.871 10.780  -7.902  1.00 0.00 ? 49  LYS B N    4  
ATOM   10834 C  CA   . LYS B 1 49 ? 163.896 12.228  -7.735  1.00 0.00 ? 49  LYS B CA   4  
ATOM   10835 C  C    . LYS B 1 49 ? 164.495 12.541  -6.378  1.00 0.00 ? 49  LYS B C    4  
ATOM   10836 O  O    . LYS B 1 49 ? 165.255 13.494  -6.212  1.00 0.00 ? 49  LYS B O    4  
ATOM   10837 C  CB   . LYS B 1 49 ? 162.469 12.773  -7.768  1.00 0.00 ? 49  LYS B CB   4  
ATOM   10838 C  CG   . LYS B 1 49 ? 161.760 12.309  -9.039  1.00 0.00 ? 49  LYS B CG   4  
ATOM   10839 C  CD   . LYS B 1 49 ? 162.442 12.868  -10.285 1.00 0.00 ? 49  LYS B CD   4  
ATOM   10840 C  CE   . LYS B 1 49 ? 161.602 12.485  -11.492 1.00 0.00 ? 49  LYS B CE   4  
ATOM   10841 N  NZ   . LYS B 1 49 ? 162.057 13.249  -12.688 1.00 0.00 ? 49  LYS B NZ   4  
ATOM   10842 H  H    . LYS B 1 49 ? 163.016 10.323  -8.050  1.00 0.00 ? 49  LYS B H    4  
ATOM   10843 H  HA   . LYS B 1 49 ? 164.490 12.687  -8.506  1.00 0.00 ? 49  LYS B HA   4  
ATOM   10844 H  HB2  . LYS B 1 49 ? 161.929 12.413  -6.905  1.00 0.00 ? 49  LYS B HB2  4  
ATOM   10845 H  HB3  . LYS B 1 49 ? 162.498 13.852  -7.749  1.00 0.00 ? 49  LYS B HB3  4  
ATOM   10846 H  HG2  . LYS B 1 49 ? 161.775 11.230  -9.081  1.00 0.00 ? 49  LYS B HG2  4  
ATOM   10847 H  HG3  . LYS B 1 49 ? 160.734 12.647  -9.015  1.00 0.00 ? 49  LYS B HG3  4  
ATOM   10848 H  HD2  . LYS B 1 49 ? 162.514 13.944  -10.214 1.00 0.00 ? 49  LYS B HD2  4  
ATOM   10849 H  HD3  . LYS B 1 49 ? 163.424 12.440  -10.393 1.00 0.00 ? 49  LYS B HD3  4  
ATOM   10850 H  HE2  . LYS B 1 49 ? 161.712 11.426  -11.672 1.00 0.00 ? 49  LYS B HE2  4  
ATOM   10851 H  HE3  . LYS B 1 49 ? 160.567 12.708  -11.288 1.00 0.00 ? 49  LYS B HE3  4  
ATOM   10852 H  HZ1  . LYS B 1 49 ? 162.584 14.092  -12.382 1.00 0.00 ? 49  LYS B HZ1  4  
ATOM   10853 H  HZ2  . LYS B 1 49 ? 161.230 13.541  -13.247 1.00 0.00 ? 49  LYS B HZ2  4  
ATOM   10854 H  HZ3  . LYS B 1 49 ? 162.675 12.649  -13.269 1.00 0.00 ? 49  LYS B HZ3  4  
ATOM   10855 N  N    . ASP B 1 50 ? 164.138 11.702  -5.417  1.00 0.00 ? 50  ASP B N    4  
ATOM   10856 C  CA   . ASP B 1 50 ? 164.625 11.842  -4.044  1.00 0.00 ? 50  ASP B CA   4  
ATOM   10857 C  C    . ASP B 1 50 ? 164.881 10.471  -3.420  1.00 0.00 ? 50  ASP B C    4  
ATOM   10858 O  O    . ASP B 1 50 ? 163.992 9.892   -2.796  1.00 0.00 ? 50  ASP B O    4  
ATOM   10859 C  CB   . ASP B 1 50 ? 163.594 12.592  -3.194  1.00 0.00 ? 50  ASP B CB   4  
ATOM   10860 C  CG   . ASP B 1 50 ? 163.467 14.040  -3.657  1.00 0.00 ? 50  ASP B CG   4  
ATOM   10861 O  OD1  . ASP B 1 50 ? 164.335 14.489  -4.386  1.00 0.00 ? 50  ASP B OD1  4  
ATOM   10862 O  OD2  . ASP B 1 50 ? 162.509 14.684  -3.265  1.00 0.00 ? 50  ASP B OD2  4  
ATOM   10863 H  H    . ASP B 1 50 ? 163.530 10.962  -5.643  1.00 0.00 ? 50  ASP B H    4  
ATOM   10864 H  HA   . ASP B 1 50 ? 165.546 12.404  -4.053  1.00 0.00 ? 50  ASP B HA   4  
ATOM   10865 H  HB2  . ASP B 1 50 ? 162.634 12.105  -3.286  1.00 0.00 ? 50  ASP B HB2  4  
ATOM   10866 H  HB3  . ASP B 1 50 ? 163.905 12.575  -2.160  1.00 0.00 ? 50  ASP B HB3  4  
ATOM   10867 N  N    . VAL B 1 51 ? 166.096 9.957   -3.583  1.00 0.00 ? 51  VAL B N    4  
ATOM   10868 C  CA   . VAL B 1 51 ? 166.442 8.655   -3.017  1.00 0.00 ? 51  VAL B CA   4  
ATOM   10869 C  C    . VAL B 1 51 ? 166.312 8.683   -1.496  1.00 0.00 ? 51  VAL B C    4  
ATOM   10870 O  O    . VAL B 1 51 ? 165.843 7.725   -0.882  1.00 0.00 ? 51  VAL B O    4  
ATOM   10871 C  CB   . VAL B 1 51 ? 167.873 8.280   -3.403  1.00 0.00 ? 51  VAL B CB   4  
ATOM   10872 C  CG1  . VAL B 1 51 ? 168.286 7.008   -2.662  1.00 0.00 ? 51  VAL B CG1  4  
ATOM   10873 C  CG2  . VAL B 1 51 ? 167.946 8.036   -4.911  1.00 0.00 ? 51  VAL B CG2  4  
ATOM   10874 H  H    . VAL B 1 51 ? 166.771 10.460  -4.085  1.00 0.00 ? 51  VAL B H    4  
ATOM   10875 H  HA   . VAL B 1 51 ? 165.767 7.911   -3.413  1.00 0.00 ? 51  VAL B HA   4  
ATOM   10876 H  HB   . VAL B 1 51 ? 168.541 9.086   -3.134  1.00 0.00 ? 51  VAL B HB   4  
ATOM   10877 H  HG11 . VAL B 1 51 ? 168.523 7.248   -1.636  1.00 0.00 ? 51  VAL B HG11 4  
ATOM   10878 H  HG12 . VAL B 1 51 ? 169.154 6.578   -3.140  1.00 0.00 ? 51  VAL B HG12 4  
ATOM   10879 H  HG13 . VAL B 1 51 ? 167.473 6.297   -2.685  1.00 0.00 ? 51  VAL B HG13 4  
ATOM   10880 H  HG21 . VAL B 1 51 ? 167.549 7.058   -5.138  1.00 0.00 ? 51  VAL B HG21 4  
ATOM   10881 H  HG22 . VAL B 1 51 ? 168.975 8.092   -5.237  1.00 0.00 ? 51  VAL B HG22 4  
ATOM   10882 H  HG23 . VAL B 1 51 ? 167.366 8.789   -5.426  1.00 0.00 ? 51  VAL B HG23 4  
ATOM   10883 N  N    . ASP B 1 52 ? 166.729 9.795   -0.904  1.00 0.00 ? 52  ASP B N    4  
ATOM   10884 C  CA   . ASP B 1 52 ? 166.664 9.968   0.544   1.00 0.00 ? 52  ASP B CA   4  
ATOM   10885 C  C    . ASP B 1 52 ? 165.240 9.770   1.056   1.00 0.00 ? 52  ASP B C    4  
ATOM   10886 O  O    . ASP B 1 52 ? 165.030 9.303   2.175   1.00 0.00 ? 52  ASP B O    4  
ATOM   10887 C  CB   . ASP B 1 52 ? 167.152 11.368  0.923   1.00 0.00 ? 52  ASP B CB   4  
ATOM   10888 C  CG   . ASP B 1 52 ? 167.297 11.478  2.437   1.00 0.00 ? 52  ASP B CG   4  
ATOM   10889 O  OD1  . ASP B 1 52 ? 167.120 10.471  3.104   1.00 0.00 ? 52  ASP B OD1  4  
ATOM   10890 O  OD2  . ASP B 1 52 ? 167.583 12.566  2.908   1.00 0.00 ? 52  ASP B OD2  4  
ATOM   10891 H  H    . ASP B 1 52 ? 167.090 10.521  -1.454  1.00 0.00 ? 52  ASP B H    4  
ATOM   10892 H  HA   . ASP B 1 52 ? 167.308 9.239   1.012   1.00 0.00 ? 52  ASP B HA   4  
ATOM   10893 H  HB2  . ASP B 1 52 ? 168.109 11.552  0.457   1.00 0.00 ? 52  ASP B HB2  4  
ATOM   10894 H  HB3  . ASP B 1 52 ? 166.439 12.102  0.579   1.00 0.00 ? 52  ASP B HB3  4  
ATOM   10895 N  N    . ALA B 1 53 ? 164.269 10.159  0.239   1.00 0.00 ? 53  ALA B N    4  
ATOM   10896 C  CA   . ALA B 1 53 ? 162.864 10.057  0.621   1.00 0.00 ? 53  ALA B CA   4  
ATOM   10897 C  C    . ALA B 1 53 ? 162.466 8.622   0.965   1.00 0.00 ? 53  ALA B C    4  
ATOM   10898 O  O    . ALA B 1 53 ? 161.567 8.407   1.778   1.00 0.00 ? 53  ALA B O    4  
ATOM   10899 C  CB   . ALA B 1 53 ? 161.981 10.569  -0.517  1.00 0.00 ? 53  ALA B CB   4  
ATOM   10900 H  H    . ALA B 1 53 ? 164.501 10.545  -0.631  1.00 0.00 ? 53  ALA B H    4  
ATOM   10901 H  HA   . ALA B 1 53 ? 162.696 10.678  1.488   1.00 0.00 ? 53  ALA B HA   4  
ATOM   10902 H  HB1  . ALA B 1 53 ? 162.308 11.555  -0.811  1.00 0.00 ? 53  ALA B HB1  4  
ATOM   10903 H  HB2  . ALA B 1 53 ? 160.954 10.614  -0.185  1.00 0.00 ? 53  ALA B HB2  4  
ATOM   10904 H  HB3  . ALA B 1 53 ? 162.057 9.899   -1.361  1.00 0.00 ? 53  ALA B HB3  4  
ATOM   10905 N  N    . VAL B 1 54 ? 163.118 7.637   0.351   1.00 0.00 ? 54  VAL B N    4  
ATOM   10906 C  CA   . VAL B 1 54 ? 162.773 6.248   0.638   1.00 0.00 ? 54  VAL B CA   4  
ATOM   10907 C  C    . VAL B 1 54 ? 162.905 5.970   2.130   1.00 0.00 ? 54  VAL B C    4  
ATOM   10908 O  O    . VAL B 1 54 ? 162.023 5.355   2.740   1.00 0.00 ? 54  VAL B O    4  
ATOM   10909 C  CB   . VAL B 1 54 ? 163.705 5.309   -0.130  1.00 0.00 ? 54  VAL B CB   4  
ATOM   10910 C  CG1  . VAL B 1 54 ? 163.502 3.873   0.363   1.00 0.00 ? 54  VAL B CG1  4  
ATOM   10911 C  CG2  . VAL B 1 54 ? 163.384 5.385   -1.624  1.00 0.00 ? 54  VAL B CG2  4  
ATOM   10912 H  H    . VAL B 1 54 ? 163.827 7.844   -0.294  1.00 0.00 ? 54  VAL B H    4  
ATOM   10913 H  HA   . VAL B 1 54 ? 161.756 6.058   0.329   1.00 0.00 ? 54  VAL B HA   4  
ATOM   10914 H  HB   . VAL B 1 54 ? 164.731 5.605   0.037   1.00 0.00 ? 54  VAL B HB   4  
ATOM   10915 H  HG11 . VAL B 1 54 ? 164.016 3.191   -0.297  1.00 0.00 ? 54  VAL B HG11 4  
ATOM   10916 H  HG12 . VAL B 1 54 ? 162.448 3.640   0.372   1.00 0.00 ? 54  VAL B HG12 4  
ATOM   10917 H  HG13 . VAL B 1 54 ? 163.901 3.773   1.362   1.00 0.00 ? 54  VAL B HG13 4  
ATOM   10918 H  HG21 . VAL B 1 54 ? 163.174 6.408   -1.895  1.00 0.00 ? 54  VAL B HG21 4  
ATOM   10919 H  HG22 . VAL B 1 54 ? 162.523 4.771   -1.839  1.00 0.00 ? 54  VAL B HG22 4  
ATOM   10920 H  HG23 . VAL B 1 54 ? 164.232 5.029   -2.192  1.00 0.00 ? 54  VAL B HG23 4  
ATOM   10921 N  N    . ASP B 1 55 ? 163.995 6.442   2.726   1.00 0.00 ? 55  ASP B N    4  
ATOM   10922 C  CA   . ASP B 1 55 ? 164.192 6.242   4.152   1.00 0.00 ? 55  ASP B CA   4  
ATOM   10923 C  C    . ASP B 1 55 ? 163.071 6.913   4.932   1.00 0.00 ? 55  ASP B C    4  
ATOM   10924 O  O    . ASP B 1 55 ? 162.541 6.357   5.892   1.00 0.00 ? 55  ASP B O    4  
ATOM   10925 C  CB   . ASP B 1 55 ? 165.539 6.824   4.582   1.00 0.00 ? 55  ASP B CB   4  
ATOM   10926 C  CG   . ASP B 1 55 ? 166.677 6.028   3.953   1.00 0.00 ? 55  ASP B CG   4  
ATOM   10927 O  OD1  . ASP B 1 55 ? 166.407 4.958   3.431   1.00 0.00 ? 55  ASP B OD1  4  
ATOM   10928 O  OD2  . ASP B 1 55 ? 167.802 6.497   4.003   1.00 0.00 ? 55  ASP B OD2  4  
ATOM   10929 H  H    . ASP B 1 55 ? 164.661 6.939   2.206   1.00 0.00 ? 55  ASP B H    4  
ATOM   10930 H  HA   . ASP B 1 55 ? 164.185 5.183   4.363   1.00 0.00 ? 55  ASP B HA   4  
ATOM   10931 H  HB2  . ASP B 1 55 ? 165.603 7.855   4.262   1.00 0.00 ? 55  ASP B HB2  4  
ATOM   10932 H  HB3  . ASP B 1 55 ? 165.622 6.777   5.658   1.00 0.00 ? 55  ASP B HB3  4  
ATOM   10933 N  N    . LYS B 1 56 ? 162.687 8.106   4.502   1.00 0.00 ? 56  LYS B N    4  
ATOM   10934 C  CA   . LYS B 1 56 ? 161.615 8.806   5.180   1.00 0.00 ? 56  LYS B CA   4  
ATOM   10935 C  C    . LYS B 1 56 ? 160.344 7.977   5.131   1.00 0.00 ? 56  LYS B C    4  
ATOM   10936 O  O    . LYS B 1 56 ? 159.587 7.923   6.100   1.00 0.00 ? 56  LYS B O    4  
ATOM   10937 C  CB   . LYS B 1 56 ? 161.372 10.165  4.519   1.00 0.00 ? 56  LYS B CB   4  
ATOM   10938 C  CG   . LYS B 1 56 ? 162.643 10.991  4.553   1.00 0.00 ? 56  LYS B CG   4  
ATOM   10939 C  CD   . LYS B 1 56 ? 163.007 11.277  6.018   1.00 0.00 ? 56  LYS B CD   4  
ATOM   10940 C  CE   . LYS B 1 56 ? 163.559 12.684  6.122   1.00 0.00 ? 56  LYS B CE   4  
ATOM   10941 N  NZ   . LYS B 1 56 ? 164.809 12.798  5.318   1.00 0.00 ? 56  LYS B NZ   4  
ATOM   10942 H  H    . LYS B 1 56 ? 163.121 8.509   3.721   1.00 0.00 ? 56  LYS B H    4  
ATOM   10943 H  HA   . LYS B 1 56 ? 161.894 8.963   6.211   1.00 0.00 ? 56  LYS B HA   4  
ATOM   10944 H  HB2  . LYS B 1 56 ? 161.059 10.024  3.497   1.00 0.00 ? 56  LYS B HB2  4  
ATOM   10945 H  HB3  . LYS B 1 56 ? 160.609 10.707  5.062   1.00 0.00 ? 56  LYS B HB3  4  
ATOM   10946 H  HG2  . LYS B 1 56 ? 163.444 10.436  4.082   1.00 0.00 ? 56  LYS B HG2  4  
ATOM   10947 H  HG3  . LYS B 1 56 ? 162.483 11.917  4.024   1.00 0.00 ? 56  LYS B HG3  4  
ATOM   10948 H  HD2  . LYS B 1 56 ? 162.132 11.192  6.648   1.00 0.00 ? 56  LYS B HD2  4  
ATOM   10949 H  HD3  . LYS B 1 56 ? 163.757 10.575  6.348   1.00 0.00 ? 56  LYS B HD3  4  
ATOM   10950 H  HE2  . LYS B 1 56 ? 162.812 13.362  5.737   1.00 0.00 ? 56  LYS B HE2  4  
ATOM   10951 H  HE3  . LYS B 1 56 ? 163.761 12.917  7.154   1.00 0.00 ? 56  LYS B HE3  4  
ATOM   10952 H  HZ1  . LYS B 1 56 ? 164.880 11.989  4.670   1.00 0.00 ? 56  LYS B HZ1  4  
ATOM   10953 H  HZ2  . LYS B 1 56 ? 165.631 12.805  5.957   1.00 0.00 ? 56  LYS B HZ2  4  
ATOM   10954 H  HZ3  . LYS B 1 56 ? 164.789 13.680  4.768   1.00 0.00 ? 56  LYS B HZ3  4  
ATOM   10955 N  N    . VAL B 1 57 ? 160.114 7.332   3.992   1.00 0.00 ? 57  VAL B N    4  
ATOM   10956 C  CA   . VAL B 1 57 ? 158.924 6.512   3.835   1.00 0.00 ? 57  VAL B CA   4  
ATOM   10957 C  C    . VAL B 1 57 ? 158.948 5.291   4.738   1.00 0.00 ? 57  VAL B C    4  
ATOM   10958 O  O    . VAL B 1 57 ? 157.944 4.961   5.369   1.00 0.00 ? 57  VAL B O    4  
ATOM   10959 C  CB   . VAL B 1 57 ? 158.775 6.076   2.379   1.00 0.00 ? 57  VAL B CB   4  
ATOM   10960 C  CG1  . VAL B 1 57 ? 157.616 5.084   2.259   1.00 0.00 ? 57  VAL B CG1  4  
ATOM   10961 C  CG2  . VAL B 1 57 ? 158.487 7.301   1.507   1.00 0.00 ? 57  VAL B CG2  4  
ATOM   10962 H  H    . VAL B 1 57 ? 160.751 7.413   3.250   1.00 0.00 ? 57  VAL B H    4  
ATOM   10963 H  HA   . VAL B 1 57 ? 158.077 7.101   4.107   1.00 0.00 ? 57  VAL B HA   4  
ATOM   10964 H  HB   . VAL B 1 57 ? 159.689 5.603   2.048   1.00 0.00 ? 57  VAL B HB   4  
ATOM   10965 H  HG11 . VAL B 1 57 ? 156.806 5.397   2.899   1.00 0.00 ? 57  VAL B HG11 4  
ATOM   10966 H  HG12 . VAL B 1 57 ? 157.951 4.101   2.558   1.00 0.00 ? 57  VAL B HG12 4  
ATOM   10967 H  HG13 . VAL B 1 57 ? 157.275 5.051   1.234   1.00 0.00 ? 57  VAL B HG13 4  
ATOM   10968 H  HG21 . VAL B 1 57 ? 159.148 8.108   1.792   1.00 0.00 ? 57  VAL B HG21 4  
ATOM   10969 H  HG22 . VAL B 1 57 ? 157.462 7.610   1.648   1.00 0.00 ? 57  VAL B HG22 4  
ATOM   10970 H  HG23 . VAL B 1 57 ? 158.650 7.051   0.470   1.00 0.00 ? 57  VAL B HG23 4  
ATOM   10971 N  N    . MET B 1 58 ? 160.086 4.614   4.797   1.00 0.00 ? 58  MET B N    4  
ATOM   10972 C  CA   . MET B 1 58 ? 160.180 3.429   5.634   1.00 0.00 ? 58  MET B CA   4  
ATOM   10973 C  C    . MET B 1 58 ? 160.033 3.772   7.121   1.00 0.00 ? 58  MET B C    4  
ATOM   10974 O  O    . MET B 1 58 ? 159.416 3.015   7.871   1.00 0.00 ? 58  MET B O    4  
ATOM   10975 C  CB   . MET B 1 58 ? 161.496 2.687   5.358   1.00 0.00 ? 58  MET B CB   4  
ATOM   10976 C  CG   . MET B 1 58 ? 162.581 3.166   6.315   1.00 0.00 ? 58  MET B CG   4  
ATOM   10977 S  SD   . MET B 1 58 ? 162.383 2.355   7.926   1.00 0.00 ? 58  MET B SD   4  
ATOM   10978 C  CE   . MET B 1 58 ? 163.272 0.826   7.546   1.00 0.00 ? 58  MET B CE   4  
ATOM   10979 H  H    . MET B 1 58 ? 160.863 4.910   4.269   1.00 0.00 ? 58  MET B H    4  
ATOM   10980 H  HA   . MET B 1 58 ? 159.366 2.771   5.368   1.00 0.00 ? 58  MET B HA   4  
ATOM   10981 H  HB2  . MET B 1 58 ? 161.341 1.627   5.491   1.00 0.00 ? 58  MET B HB2  4  
ATOM   10982 H  HB3  . MET B 1 58 ? 161.807 2.877   4.341   1.00 0.00 ? 58  MET B HB3  4  
ATOM   10983 H  HG2  . MET B 1 58 ? 163.553 2.932   5.906   1.00 0.00 ? 58  MET B HG2  4  
ATOM   10984 H  HG3  . MET B 1 58 ? 162.485 4.232   6.432   1.00 0.00 ? 58  MET B HG3  4  
ATOM   10985 H  HE1  . MET B 1 58 ? 163.009 0.069   8.273   1.00 0.00 ? 58  MET B HE1  4  
ATOM   10986 H  HE2  . MET B 1 58 ? 164.334 1.006   7.587   1.00 0.00 ? 58  MET B HE2  4  
ATOM   10987 H  HE3  . MET B 1 58 ? 163.002 0.489   6.555   1.00 0.00 ? 58  MET B HE3  4  
ATOM   10988 N  N    . LYS B 1 59 ? 160.604 4.900   7.554   1.00 0.00 ? 59  LYS B N    4  
ATOM   10989 C  CA   . LYS B 1 59 ? 160.504 5.269   8.966   1.00 0.00 ? 59  LYS B CA   4  
ATOM   10990 C  C    . LYS B 1 59 ? 159.055 5.422   9.407   1.00 0.00 ? 59  LYS B C    4  
ATOM   10991 O  O    . LYS B 1 59 ? 158.703 5.038   10.523  1.00 0.00 ? 59  LYS B O    4  
ATOM   10992 C  CB   . LYS B 1 59 ? 161.269 6.565   9.251   1.00 0.00 ? 59  LYS B CB   4  
ATOM   10993 C  CG   . LYS B 1 59 ? 162.771 6.330   9.069   1.00 0.00 ? 59  LYS B CG   4  
ATOM   10994 C  CD   . LYS B 1 59 ? 163.535 7.598   9.453   1.00 0.00 ? 59  LYS B CD   4  
ATOM   10995 C  CE   . LYS B 1 59 ? 165.024 7.406   9.161   1.00 0.00 ? 59  LYS B CE   4  
ATOM   10996 N  NZ   . LYS B 1 59 ? 165.746 8.689   9.395   1.00 0.00 ? 59  LYS B NZ   4  
ATOM   10997 H  H    . LYS B 1 59 ? 161.101 5.478   6.925   1.00 0.00 ? 59  LYS B H    4  
ATOM   10998 H  HA   . LYS B 1 59 ? 160.952 4.480   9.551   1.00 0.00 ? 59  LYS B HA   4  
ATOM   10999 H  HB2  . LYS B 1 59 ? 160.939 7.334   8.567   1.00 0.00 ? 59  LYS B HB2  4  
ATOM   11000 H  HB3  . LYS B 1 59 ? 161.077 6.879   10.266  1.00 0.00 ? 59  LYS B HB3  4  
ATOM   11001 H  HG2  . LYS B 1 59 ? 163.084 5.516   9.705   1.00 0.00 ? 59  LYS B HG2  4  
ATOM   11002 H  HG3  . LYS B 1 59 ? 162.979 6.083   8.044   1.00 0.00 ? 59  LYS B HG3  4  
ATOM   11003 H  HD2  . LYS B 1 59 ? 163.159 8.433   8.879   1.00 0.00 ? 59  LYS B HD2  4  
ATOM   11004 H  HD3  . LYS B 1 59 ? 163.399 7.795   10.506  1.00 0.00 ? 59  LYS B HD3  4  
ATOM   11005 H  HE2  . LYS B 1 59 ? 165.424 6.643   9.814   1.00 0.00 ? 59  LYS B HE2  4  
ATOM   11006 H  HE3  . LYS B 1 59 ? 165.153 7.103   8.132   1.00 0.00 ? 59  LYS B HE3  4  
ATOM   11007 H  HZ1  . LYS B 1 59 ? 165.383 9.414   8.746   1.00 0.00 ? 59  LYS B HZ1  4  
ATOM   11008 H  HZ2  . LYS B 1 59 ? 166.764 8.549   9.228   1.00 0.00 ? 59  LYS B HZ2  4  
ATOM   11009 H  HZ3  . LYS B 1 59 ? 165.595 8.997   10.376  1.00 0.00 ? 59  LYS B HZ3  4  
ATOM   11010 N  N    . GLU B 1 60 ? 158.207 5.972   8.543   1.00 0.00 ? 60  GLU B N    4  
ATOM   11011 C  CA   . GLU B 1 60 ? 156.806 6.135   8.909   1.00 0.00 ? 60  GLU B CA   4  
ATOM   11012 C  C    . GLU B 1 60 ? 156.164 4.771   9.120   1.00 0.00 ? 60  GLU B C    4  
ATOM   11013 O  O    . GLU B 1 60 ? 155.364 4.581   10.037  1.00 0.00 ? 60  GLU B O    4  
ATOM   11014 C  CB   . GLU B 1 60 ? 156.060 6.891   7.808   1.00 0.00 ? 60  GLU B CB   4  
ATOM   11015 C  CG   . GLU B 1 60 ? 156.619 8.310   7.695   1.00 0.00 ? 60  GLU B CG   4  
ATOM   11016 C  CD   . GLU B 1 60 ? 155.839 9.095   6.645   1.00 0.00 ? 60  GLU B CD   4  
ATOM   11017 O  OE1  . GLU B 1 60 ? 155.042 8.486   5.951   1.00 0.00 ? 60  GLU B OE1  4  
ATOM   11018 O  OE2  . GLU B 1 60 ? 156.048 10.293  6.553   1.00 0.00 ? 60  GLU B OE2  4  
ATOM   11019 H  H    . GLU B 1 60 ? 158.522 6.261   7.661   1.00 0.00 ? 60  GLU B H    4  
ATOM   11020 H  HA   . GLU B 1 60 ? 156.745 6.699   9.827   1.00 0.00 ? 60  GLU B HA   4  
ATOM   11021 H  HB2  . GLU B 1 60 ? 156.189 6.376   6.867   1.00 0.00 ? 60  GLU B HB2  4  
ATOM   11022 H  HB3  . GLU B 1 60 ? 155.010 6.937   8.053   1.00 0.00 ? 60  GLU B HB3  4  
ATOM   11023 H  HG2  . GLU B 1 60 ? 156.534 8.806   8.650   1.00 0.00 ? 60  GLU B HG2  4  
ATOM   11024 H  HG3  . GLU B 1 60 ? 157.658 8.264   7.405   1.00 0.00 ? 60  GLU B HG3  4  
ATOM   11025 N  N    . LEU B 1 61 ? 156.544 3.816   8.277   1.00 0.00 ? 61  LEU B N    4  
ATOM   11026 C  CA   . LEU B 1 61 ? 156.029 2.458   8.386   1.00 0.00 ? 61  LEU B CA   4  
ATOM   11027 C  C    . LEU B 1 61 ? 156.545 1.794   9.654   1.00 0.00 ? 61  LEU B C    4  
ATOM   11028 O  O    . LEU B 1 61 ? 155.855 0.992   10.283  1.00 0.00 ? 61  LEU B O    4  
ATOM   11029 C  CB   . LEU B 1 61 ? 156.472 1.635   7.176   1.00 0.00 ? 61  LEU B CB   4  
ATOM   11030 C  CG   . LEU B 1 61 ? 155.982 2.293   5.885   1.00 0.00 ? 61  LEU B CG   4  
ATOM   11031 C  CD1  . LEU B 1 61 ? 156.358 1.409   4.696   1.00 0.00 ? 61  LEU B CD1  4  
ATOM   11032 C  CD2  . LEU B 1 61 ? 154.459 2.449   5.935   1.00 0.00 ? 61  LEU B CD2  4  
ATOM   11033 H  H    . LEU B 1 61 ? 157.200 4.026   7.580   1.00 0.00 ? 61  LEU B H    4  
ATOM   11034 H  HA   . LEU B 1 61 ? 154.951 2.488   8.417   1.00 0.00 ? 61  LEU B HA   4  
ATOM   11035 H  HB2  . LEU B 1 61 ? 157.551 1.574   7.159   1.00 0.00 ? 61  LEU B HB2  4  
ATOM   11036 H  HB3  . LEU B 1 61 ? 156.058 0.641   7.248   1.00 0.00 ? 61  LEU B HB3  4  
ATOM   11037 H  HG   . LEU B 1 61 ? 156.444 3.263   5.775   1.00 0.00 ? 61  LEU B HG   4  
ATOM   11038 H  HD11 . LEU B 1 61 ? 155.745 0.521   4.704   1.00 0.00 ? 61  LEU B HD11 4  
ATOM   11039 H  HD12 . LEU B 1 61 ? 157.397 1.130   4.772   1.00 0.00 ? 61  LEU B HD12 4  
ATOM   11040 H  HD13 . LEU B 1 61 ? 156.195 1.952   3.777   1.00 0.00 ? 61  LEU B HD13 4  
ATOM   11041 H  HD21 . LEU B 1 61 ? 154.029 1.616   6.470   1.00 0.00 ? 61  LEU B HD21 4  
ATOM   11042 H  HD22 . LEU B 1 61 ? 154.066 2.471   4.929   1.00 0.00 ? 61  LEU B HD22 4  
ATOM   11043 H  HD23 . LEU B 1 61 ? 154.211 3.368   6.440   1.00 0.00 ? 61  LEU B HD23 4  
ATOM   11044 N  N    . ASP B 1 62 ? 157.787 2.120   9.998   1.00 0.00 ? 62  ASP B N    4  
ATOM   11045 C  CA   . ASP B 1 62 ? 158.438 1.544   11.169  1.00 0.00 ? 62  ASP B CA   4  
ATOM   11046 C  C    . ASP B 1 62 ? 158.366 2.440   12.389  1.00 0.00 ? 62  ASP B C    4  
ATOM   11047 O  O    . ASP B 1 62 ? 159.273 2.441   13.222  1.00 0.00 ? 62  ASP B O    4  
ATOM   11048 C  CB   . ASP B 1 62 ? 159.881 1.181   10.842  1.00 0.00 ? 62  ASP B CB   4  
ATOM   11049 C  CG   . ASP B 1 62 ? 159.875 -0.003  9.887   1.00 0.00 ? 62  ASP B CG   4  
ATOM   11050 O  OD1  . ASP B 1 62 ? 158.821 -0.614  9.751   1.00 0.00 ? 62  ASP B OD1  4  
ATOM   11051 O  OD2  . ASP B 1 62 ? 160.911 -0.283  9.306   1.00 0.00 ? 62  ASP B OD2  4  
ATOM   11052 H  H    . ASP B 1 62 ? 158.288 2.750   9.438   1.00 0.00 ? 62  ASP B H    4  
ATOM   11053 H  HA   . ASP B 1 62 ? 157.921 0.629   11.416  1.00 0.00 ? 62  ASP B HA   4  
ATOM   11054 H  HB2  . ASP B 1 62 ? 160.371 2.025   10.375  1.00 0.00 ? 62  ASP B HB2  4  
ATOM   11055 H  HB3  . ASP B 1 62 ? 160.403 0.911   11.747  1.00 0.00 ? 62  ASP B HB3  4  
ATOM   11056 N  N    . GLU B 1 63 ? 157.264 3.154   12.531  1.00 0.00 ? 63  GLU B N    4  
ATOM   11057 C  CA   . GLU B 1 63 ? 157.084 3.983   13.705  1.00 0.00 ? 63  GLU B CA   4  
ATOM   11058 C  C    . GLU B 1 63 ? 157.368 3.171   14.934  1.00 0.00 ? 63  GLU B C    4  
ATOM   11059 O  O    . GLU B 1 63 ? 157.791 3.693   15.965  1.00 0.00 ? 63  GLU B O    4  
ATOM   11060 C  CB   . GLU B 1 63 ? 155.650 4.504   13.775  1.00 0.00 ? 63  GLU B CB   4  
ATOM   11061 C  CG   . GLU B 1 63 ? 155.464 5.277   15.083  1.00 0.00 ? 63  GLU B CG   4  
ATOM   11062 C  CD   . GLU B 1 63 ? 154.044 5.821   15.180  1.00 0.00 ? 63  GLU B CD   4  
ATOM   11063 O  OE1  . GLU B 1 63 ? 153.262 5.543   14.286  1.00 0.00 ? 63  GLU B OE1  4  
ATOM   11064 O  OE2  . GLU B 1 63 ? 153.758 6.508   16.146  1.00 0.00 ? 63  GLU B OE2  4  
ATOM   11065 H  H    . GLU B 1 63 ? 156.548 3.087   11.865  1.00 0.00 ? 63  GLU B H    4  
ATOM   11066 H  HA   . GLU B 1 63 ? 157.765 4.819   13.663  1.00 0.00 ? 63  GLU B HA   4  
ATOM   11067 H  HB2  . GLU B 1 63 ? 155.463 5.160   12.936  1.00 0.00 ? 63  GLU B HB2  4  
ATOM   11068 H  HB3  . GLU B 1 63 ? 154.961 3.675   13.747  1.00 0.00 ? 63  GLU B HB3  4  
ATOM   11069 H  HG2  . GLU B 1 63 ? 155.624 4.601   15.913  1.00 0.00 ? 63  GLU B HG2  4  
ATOM   11070 H  HG3  . GLU B 1 63 ? 156.175 6.065   15.144  1.00 0.00 ? 63  GLU B HG3  4  
ATOM   11071 N  N    . ASN B 1 64 ? 157.096 1.898   14.823  1.00 0.00 ? 64  ASN B N    4  
ATOM   11072 C  CA   . ASN B 1 64 ? 157.283 1.012   15.935  1.00 0.00 ? 64  ASN B CA   4  
ATOM   11073 C  C    . ASN B 1 64 ? 158.702 1.158   16.469  1.00 0.00 ? 64  ASN B C    4  
ATOM   11074 O  O    . ASN B 1 64 ? 158.954 1.004   17.664  1.00 0.00 ? 64  ASN B O    4  
ATOM   11075 C  CB   . ASN B 1 64 ? 157.127 -0.431  15.460  1.00 0.00 ? 64  ASN B CB   4  
ATOM   11076 C  CG   . ASN B 1 64 ? 155.888 -0.591  14.594  1.00 0.00 ? 64  ASN B CG   4  
ATOM   11077 O  OD1  . ASN B 1 64 ? 156.000 -1.064  13.454  1.00 0.00 ? 64  ASN B OD1  4  
ATOM   11078 N  ND2  . ASN B 1 64 ? 154.721 -0.229  15.052  1.00 0.00 ? 64  ASN B ND2  4  
ATOM   11079 H  H    . ASN B 1 64 ? 156.736 1.550   13.981  1.00 0.00 ? 64  ASN B H    4  
ATOM   11080 H  HA   . ASN B 1 64 ? 156.562 1.250   16.699  1.00 0.00 ? 64  ASN B HA   4  
ATOM   11081 H  HB2  . ASN B 1 64 ? 157.998 -0.711  14.887  1.00 0.00 ? 64  ASN B HB2  4  
ATOM   11082 H  HB3  . ASN B 1 64 ? 157.045 -1.078  16.320  1.00 0.00 ? 64  ASN B HB3  4  
ATOM   11083 H  HD21 . ASN B 1 64 ? 154.643 0.143   15.954  1.00 0.00 ? 64  ASN B HD21 4  
ATOM   11084 H  HD22 . ASN B 1 64 ? 153.922 -0.332  14.493  1.00 0.00 ? 64  ASN B HD22 4  
ATOM   11085 N  N    . GLY B 1 65 ? 159.630 1.408   15.550  1.00 0.00 ? 65  GLY B N    4  
ATOM   11086 C  CA   . GLY B 1 65 ? 161.038 1.524   15.898  1.00 0.00 ? 65  GLY B CA   4  
ATOM   11087 C  C    . GLY B 1 65 ? 161.704 0.170   15.696  1.00 0.00 ? 65  GLY B C    4  
ATOM   11088 O  O    . GLY B 1 65 ? 162.883 -0.017  15.995  1.00 0.00 ? 65  GLY B O    4  
ATOM   11089 H  H    . GLY B 1 65 ? 159.362 1.486   14.610  1.00 0.00 ? 65  GLY B H    4  
ATOM   11090 H  HA2  . GLY B 1 65 ? 161.508 2.262   15.264  1.00 0.00 ? 65  GLY B HA2  4  
ATOM   11091 H  HA3  . GLY B 1 65 ? 161.133 1.818   16.933  1.00 0.00 ? 65  GLY B HA3  4  
ATOM   11092 N  N    . ASP B 1 66 ? 160.913 -0.770  15.183  1.00 0.00 ? 66  ASP B N    4  
ATOM   11093 C  CA   . ASP B 1 66 ? 161.383 -2.126  14.927  1.00 0.00 ? 66  ASP B CA   4  
ATOM   11094 C  C    . ASP B 1 66 ? 162.527 -2.159  13.910  1.00 0.00 ? 66  ASP B C    4  
ATOM   11095 O  O    . ASP B 1 66 ? 163.444 -2.972  14.026  1.00 0.00 ? 66  ASP B O    4  
ATOM   11096 C  CB   . ASP B 1 66 ? 160.197 -2.982  14.442  1.00 0.00 ? 66  ASP B CB   4  
ATOM   11097 C  CG   . ASP B 1 66 ? 159.633 -2.454  13.114  1.00 0.00 ? 66  ASP B CG   4  
ATOM   11098 O  OD1  . ASP B 1 66 ? 160.294 -1.656  12.481  1.00 0.00 ? 66  ASP B OD1  4  
ATOM   11099 O  OD2  . ASP B 1 66 ? 158.531 -2.847  12.759  1.00 0.00 ? 66  ASP B OD2  4  
ATOM   11100 H  H    . ASP B 1 66 ? 159.983 -0.544  14.973  1.00 0.00 ? 66  ASP B H    4  
ATOM   11101 H  HA   . ASP B 1 66 ? 161.742 -2.543  15.856  1.00 0.00 ? 66  ASP B HA   4  
ATOM   11102 H  HB2  . ASP B 1 66 ? 160.529 -4.000  14.305  1.00 0.00 ? 66  ASP B HB2  4  
ATOM   11103 H  HB3  . ASP B 1 66 ? 159.419 -2.962  15.191  1.00 0.00 ? 66  ASP B HB3  4  
ATOM   11104 N  N    . GLY B 1 67 ? 162.468 -1.280  12.919  1.00 0.00 ? 67  GLY B N    4  
ATOM   11105 C  CA   . GLY B 1 67 ? 163.500 -1.222  11.890  1.00 0.00 ? 67  GLY B CA   4  
ATOM   11106 C  C    . GLY B 1 67 ? 163.110 -2.104  10.709  1.00 0.00 ? 67  GLY B C    4  
ATOM   11107 O  O    . GLY B 1 67 ? 163.771 -2.107  9.670   1.00 0.00 ? 67  GLY B O    4  
ATOM   11108 H  H    . GLY B 1 67 ? 161.713 -0.658  12.875  1.00 0.00 ? 67  GLY B H    4  
ATOM   11109 H  HA2  . GLY B 1 67 ? 163.614 -0.201  11.555  1.00 0.00 ? 67  GLY B HA2  4  
ATOM   11110 H  HA3  . GLY B 1 67 ? 164.435 -1.572  12.300  1.00 0.00 ? 67  GLY B HA3  4  
ATOM   11111 N  N    . GLU B 1 68 ? 162.020 -2.847  10.885  1.00 0.00 ? 68  GLU B N    4  
ATOM   11112 C  CA   . GLU B 1 68 ? 161.512 -3.739  9.846   1.00 0.00 ? 68  GLU B CA   4  
ATOM   11113 C  C    . GLU B 1 68 ? 160.107 -3.287  9.458   1.00 0.00 ? 68  GLU B C    4  
ATOM   11114 O  O    . GLU B 1 68 ? 159.378 -2.735  10.292  1.00 0.00 ? 68  GLU B O    4  
ATOM   11115 C  CB   . GLU B 1 68 ? 161.473 -5.180  10.355  1.00 0.00 ? 68  GLU B CB   4  
ATOM   11116 C  CG   . GLU B 1 68 ? 161.217 -6.134  9.183   1.00 0.00 ? 68  GLU B CG   4  
ATOM   11117 C  CD   . GLU B 1 68 ? 162.458 -6.207  8.300   1.00 0.00 ? 68  GLU B CD   4  
ATOM   11118 O  OE1  . GLU B 1 68 ? 163.535 -5.931  8.802   1.00 0.00 ? 68  GLU B OE1  4  
ATOM   11119 O  OE2  . GLU B 1 68 ? 162.314 -6.546  7.138   1.00 0.00 ? 68  GLU B OE2  4  
ATOM   11120 H  H    . GLU B 1 68 ? 161.539 -2.790  11.738  1.00 0.00 ? 68  GLU B H    4  
ATOM   11121 H  HA   . GLU B 1 68 ? 162.156 -3.684  8.980   1.00 0.00 ? 68  GLU B HA   4  
ATOM   11122 H  HB2  . GLU B 1 68 ? 162.418 -5.425  10.818  1.00 0.00 ? 68  GLU B HB2  4  
ATOM   11123 H  HB3  . GLU B 1 68 ? 160.680 -5.283  11.079  1.00 0.00 ? 68  GLU B HB3  4  
ATOM   11124 H  HG2  . GLU B 1 68 ? 160.986 -7.118  9.561   1.00 0.00 ? 68  GLU B HG2  4  
ATOM   11125 H  HG3  . GLU B 1 68 ? 160.389 -5.770  8.593   1.00 0.00 ? 68  GLU B HG3  4  
ATOM   11126 N  N    . VAL B 1 69 ? 159.720 -3.493  8.201   1.00 0.00 ? 69  VAL B N    4  
ATOM   11127 C  CA   . VAL B 1 69 ? 158.396 -3.056  7.771   1.00 0.00 ? 69  VAL B CA   4  
ATOM   11128 C  C    . VAL B 1 69 ? 157.403 -4.210  7.718   1.00 0.00 ? 69  VAL B C    4  
ATOM   11129 O  O    . VAL B 1 69 ? 157.652 -5.253  7.115   1.00 0.00 ? 69  VAL B O    4  
ATOM   11130 C  CB   . VAL B 1 69 ? 158.498 -2.423  6.384   1.00 0.00 ? 69  VAL B CB   4  
ATOM   11131 C  CG1  . VAL B 1 69 ? 157.124 -1.900  5.960   1.00 0.00 ? 69  VAL B CG1  4  
ATOM   11132 C  CG2  . VAL B 1 69 ? 159.495 -1.263  6.427   1.00 0.00 ? 69  VAL B CG2  4  
ATOM   11133 H  H    . VAL B 1 69 ? 160.327 -3.922  7.563   1.00 0.00 ? 69  VAL B H    4  
ATOM   11134 H  HA   . VAL B 1 69 ? 158.026 -2.310  8.459   1.00 0.00 ? 69  VAL B HA   4  
ATOM   11135 H  HB   . VAL B 1 69 ? 158.835 -3.165  5.675   1.00 0.00 ? 69  VAL B HB   4  
ATOM   11136 H  HG11 . VAL B 1 69 ? 157.250 -1.103  5.243   1.00 0.00 ? 69  VAL B HG11 4  
ATOM   11137 H  HG12 . VAL B 1 69 ? 156.596 -1.529  6.825   1.00 0.00 ? 69  VAL B HG12 4  
ATOM   11138 H  HG13 . VAL B 1 69 ? 156.558 -2.702  5.509   1.00 0.00 ? 69  VAL B HG13 4  
ATOM   11139 H  HG21 . VAL B 1 69 ? 160.498 -1.654  6.511   1.00 0.00 ? 69  VAL B HG21 4  
ATOM   11140 H  HG22 . VAL B 1 69 ? 159.281 -0.636  7.279   1.00 0.00 ? 69  VAL B HG22 4  
ATOM   11141 H  HG23 . VAL B 1 69 ? 159.410 -0.681  5.522   1.00 0.00 ? 69  VAL B HG23 4  
ATOM   11142 N  N    . ASP B 1 70 ? 156.260 -3.981  8.352   1.00 0.00 ? 70  ASP B N    4  
ATOM   11143 C  CA   . ASP B 1 70 ? 155.177 -4.952  8.393   1.00 0.00 ? 70  ASP B CA   4  
ATOM   11144 C  C    . ASP B 1 70 ? 154.163 -4.661  7.293   1.00 0.00 ? 70  ASP B C    4  
ATOM   11145 O  O    . ASP B 1 70 ? 153.711 -3.523  7.144   1.00 0.00 ? 70  ASP B O    4  
ATOM   11146 C  CB   . ASP B 1 70 ? 154.496 -4.921  9.760   1.00 0.00 ? 70  ASP B CB   4  
ATOM   11147 C  CG   . ASP B 1 70 ? 153.448 -6.025  9.846   1.00 0.00 ? 70  ASP B CG   4  
ATOM   11148 O  OD1  . ASP B 1 70 ? 153.361 -6.807  8.914   1.00 0.00 ? 70  ASP B OD1  4  
ATOM   11149 O  OD2  . ASP B 1 70 ? 152.746 -6.070  10.843  1.00 0.00 ? 70  ASP B OD2  4  
ATOM   11150 H  H    . ASP B 1 70 ? 156.135 -3.117  8.795   1.00 0.00 ? 70  ASP B H    4  
ATOM   11151 H  HA   . ASP B 1 70 ? 155.589 -5.938  8.235   1.00 0.00 ? 70  ASP B HA   4  
ATOM   11152 H  HB2  . ASP B 1 70 ? 155.237 -5.069  10.532  1.00 0.00 ? 70  ASP B HB2  4  
ATOM   11153 H  HB3  . ASP B 1 70 ? 154.024 -3.966  9.898   1.00 0.00 ? 70  ASP B HB3  4  
ATOM   11154 N  N    . PHE B 1 71 ? 153.806 -5.676  6.519   1.00 0.00 ? 71  PHE B N    4  
ATOM   11155 C  CA   . PHE B 1 71 ? 152.846 -5.470  5.445   1.00 0.00 ? 71  PHE B CA   4  
ATOM   11156 C  C    . PHE B 1 71 ? 151.582 -4.792  5.953   1.00 0.00 ? 71  PHE B C    4  
ATOM   11157 O  O    . PHE B 1 71 ? 151.046 -3.907  5.287   1.00 0.00 ? 71  PHE B O    4  
ATOM   11158 C  CB   . PHE B 1 71 ? 152.477 -6.803  4.796   1.00 0.00 ? 71  PHE B CB   4  
ATOM   11159 C  CG   . PHE B 1 71 ? 151.490 -6.553  3.680   1.00 0.00 ? 71  PHE B CG   4  
ATOM   11160 C  CD1  . PHE B 1 71 ? 151.927 -6.057  2.447   1.00 0.00 ? 71  PHE B CD1  4  
ATOM   11161 C  CD2  . PHE B 1 71 ? 150.132 -6.834  3.881   1.00 0.00 ? 71  PHE B CD2  4  
ATOM   11162 C  CE1  . PHE B 1 71 ? 151.004 -5.838  1.416   1.00 0.00 ? 71  PHE B CE1  4  
ATOM   11163 C  CE2  . PHE B 1 71 ? 149.210 -6.615  2.852   1.00 0.00 ? 71  PHE B CE2  4  
ATOM   11164 C  CZ   . PHE B 1 71 ? 149.646 -6.117  1.618   1.00 0.00 ? 71  PHE B CZ   4  
ATOM   11165 H  H    . PHE B 1 71 ? 154.191 -6.564  6.668   1.00 0.00 ? 71  PHE B H    4  
ATOM   11166 H  HA   . PHE B 1 71 ? 153.299 -4.841  4.694   1.00 0.00 ? 71  PHE B HA   4  
ATOM   11167 H  HB2  . PHE B 1 71 ? 153.366 -7.268  4.397   1.00 0.00 ? 71  PHE B HB2  4  
ATOM   11168 H  HB3  . PHE B 1 71 ? 152.029 -7.452  5.534   1.00 0.00 ? 71  PHE B HB3  4  
ATOM   11169 H  HD1  . PHE B 1 71 ? 152.971 -5.833  2.295   1.00 0.00 ? 71  PHE B HD1  4  
ATOM   11170 H  HD2  . PHE B 1 71 ? 149.798 -7.219  4.833   1.00 0.00 ? 71  PHE B HD2  4  
ATOM   11171 H  HE1  . PHE B 1 71 ? 151.341 -5.456  0.463   1.00 0.00 ? 71  PHE B HE1  4  
ATOM   11172 H  HE2  . PHE B 1 71 ? 148.160 -6.832  3.011   1.00 0.00 ? 71  PHE B HE2  4  
ATOM   11173 H  HZ   . PHE B 1 71 ? 148.935 -5.948  0.822   1.00 0.00 ? 71  PHE B HZ   4  
ATOM   11174 N  N    . GLN B 1 72 ? 151.103 -5.187  7.126   1.00 0.00 ? 72  GLN B N    4  
ATOM   11175 C  CA   . GLN B 1 72 ? 149.901 -4.562  7.655   1.00 0.00 ? 72  GLN B CA   4  
ATOM   11176 C  C    . GLN B 1 72 ? 150.107 -3.052  7.752   1.00 0.00 ? 72  GLN B C    4  
ATOM   11177 O  O    . GLN B 1 72 ? 149.221 -2.272  7.404   1.00 0.00 ? 72  GLN B O    4  
ATOM   11178 C  CB   . GLN B 1 72 ? 149.577 -5.131  9.038   1.00 0.00 ? 72  GLN B CB   4  
ATOM   11179 C  CG   . GLN B 1 72 ? 148.215 -4.611  9.499   1.00 0.00 ? 72  GLN B CG   4  
ATOM   11180 C  CD   . GLN B 1 72 ? 147.868 -5.199  10.862  1.00 0.00 ? 72  GLN B CD   4  
ATOM   11181 O  OE1  . GLN B 1 72 ? 148.572 -6.080  11.357  1.00 0.00 ? 72  GLN B OE1  4  
ATOM   11182 N  NE2  . GLN B 1 72 ? 146.818 -4.764  11.503  1.00 0.00 ? 72  GLN B NE2  4  
ATOM   11183 H  H    . GLN B 1 72 ? 151.557 -5.891  7.634   1.00 0.00 ? 72  GLN B H    4  
ATOM   11184 H  HA   . GLN B 1 72 ? 149.076 -4.763  6.989   1.00 0.00 ? 72  GLN B HA   4  
ATOM   11185 H  HB2  . GLN B 1 72 ? 149.553 -6.209  8.986   1.00 0.00 ? 72  GLN B HB2  4  
ATOM   11186 H  HB3  . GLN B 1 72 ? 150.336 -4.821  9.741   1.00 0.00 ? 72  GLN B HB3  4  
ATOM   11187 H  HG2  . GLN B 1 72 ? 148.249 -3.533  9.572   1.00 0.00 ? 72  GLN B HG2  4  
ATOM   11188 H  HG3  . GLN B 1 72 ? 147.459 -4.898  8.783   1.00 0.00 ? 72  GLN B HG3  4  
ATOM   11189 H  HE21 . GLN B 1 72 ? 146.258 -4.062  11.108  1.00 0.00 ? 72  GLN B HE21 4  
ATOM   11190 H  HE22 . GLN B 1 72 ? 146.588 -5.138  12.379  1.00 0.00 ? 72  GLN B HE22 4  
ATOM   11191 N  N    . GLU B 1 73 ? 151.297 -2.647  8.196   1.00 0.00 ? 73  GLU B N    4  
ATOM   11192 C  CA   . GLU B 1 73 ? 151.618 -1.226  8.297   1.00 0.00 ? 73  GLU B CA   4  
ATOM   11193 C  C    . GLU B 1 73 ? 151.691 -0.593  6.908   1.00 0.00 ? 73  GLU B C    4  
ATOM   11194 O  O    . GLU B 1 73 ? 151.247 0.536   6.702   1.00 0.00 ? 73  GLU B O    4  
ATOM   11195 C  CB   . GLU B 1 73 ? 152.955 -1.063  9.031   1.00 0.00 ? 73  GLU B CB   4  
ATOM   11196 C  CG   . GLU B 1 73 ? 152.777 -1.510  10.485  1.00 0.00 ? 73  GLU B CG   4  
ATOM   11197 C  CD   . GLU B 1 73 ? 154.084 -1.375  11.274  1.00 0.00 ? 73  GLU B CD   4  
ATOM   11198 O  OE1  . GLU B 1 73 ? 155.129 -1.167  10.665  1.00 0.00 ? 73  GLU B OE1  4  
ATOM   11199 O  OE2  . GLU B 1 73 ? 154.016 -1.487  12.485  1.00 0.00 ? 73  GLU B OE2  4  
ATOM   11200 H  H    . GLU B 1 73 ? 151.974 -3.312  8.438   1.00 0.00 ? 73  GLU B H    4  
ATOM   11201 H  HA   . GLU B 1 73 ? 150.846 -0.732  8.867   1.00 0.00 ? 73  GLU B HA   4  
ATOM   11202 H  HB2  . GLU B 1 73 ? 153.708 -1.674  8.553   1.00 0.00 ? 73  GLU B HB2  4  
ATOM   11203 H  HB3  . GLU B 1 73 ? 153.258 -0.027  9.008   1.00 0.00 ? 73  GLU B HB3  4  
ATOM   11204 H  HG2  . GLU B 1 73 ? 152.023 -0.891  10.950  1.00 0.00 ? 73  GLU B HG2  4  
ATOM   11205 H  HG3  . GLU B 1 73 ? 152.448 -2.536  10.507  1.00 0.00 ? 73  GLU B HG3  4  
ATOM   11206 N  N    . TYR B 1 74 ? 152.247 -1.342  5.958   1.00 0.00 ? 74  TYR B N    4  
ATOM   11207 C  CA   . TYR B 1 74 ? 152.371 -0.870  4.579   1.00 0.00 ? 74  TYR B CA   4  
ATOM   11208 C  C    . TYR B 1 74 ? 151.027 -0.619  3.905   1.00 0.00 ? 74  TYR B C    4  
ATOM   11209 O  O    . TYR B 1 74 ? 150.862 0.362   3.174   1.00 0.00 ? 74  TYR B O    4  
ATOM   11210 C  CB   . TYR B 1 74 ? 153.171 -1.880  3.757   1.00 0.00 ? 74  TYR B CB   4  
ATOM   11211 C  CG   . TYR B 1 74 ? 153.254 -1.410  2.325   1.00 0.00 ? 74  TYR B CG   4  
ATOM   11212 C  CD1  . TYR B 1 74 ? 154.124 -0.377  1.965   1.00 0.00 ? 74  TYR B CD1  4  
ATOM   11213 C  CD2  . TYR B 1 74 ? 152.461 -2.029  1.350   1.00 0.00 ? 74  TYR B CD2  4  
ATOM   11214 C  CE1  . TYR B 1 74 ? 154.200 0.041   0.629   1.00 0.00 ? 74  TYR B CE1  4  
ATOM   11215 C  CE2  . TYR B 1 74 ? 152.536 -1.612  0.018   1.00 0.00 ? 74  TYR B CE2  4  
ATOM   11216 C  CZ   . TYR B 1 74 ? 153.405 -0.577  -0.344  1.00 0.00 ? 74  TYR B CZ   4  
ATOM   11217 O  OH   . TYR B 1 74 ? 153.479 -0.166  -1.659  1.00 0.00 ? 74  TYR B OH   4  
ATOM   11218 H  H    . TYR B 1 74 ? 152.576 -2.240  6.189   1.00 0.00 ? 74  TYR B H    4  
ATOM   11219 H  HA   . TYR B 1 74 ? 152.920 0.059   4.589   1.00 0.00 ? 74  TYR B HA   4  
ATOM   11220 H  HB2  . TYR B 1 74 ? 154.167 -1.969  4.166   1.00 0.00 ? 74  TYR B HB2  4  
ATOM   11221 H  HB3  . TYR B 1 74 ? 152.679 -2.840  3.791   1.00 0.00 ? 74  TYR B HB3  4  
ATOM   11222 H  HD1  . TYR B 1 74 ? 154.732 0.100   2.717   1.00 0.00 ? 74  TYR B HD1  4  
ATOM   11223 H  HD2  . TYR B 1 74 ? 151.790 -2.827  1.629   1.00 0.00 ? 74  TYR B HD2  4  
ATOM   11224 H  HE1  . TYR B 1 74 ? 154.868 0.839   0.348   1.00 0.00 ? 74  TYR B HE1  4  
ATOM   11225 H  HE2  . TYR B 1 74 ? 151.923 -2.089  -0.733  1.00 0.00 ? 74  TYR B HE2  4  
ATOM   11226 H  HH   . TYR B 1 74 ? 152.852 -0.686  -2.168  1.00 0.00 ? 74  TYR B HH   4  
ATOM   11227 N  N    . VAL B 1 75 ? 150.080 -1.519  4.121   1.00 0.00 ? 75  VAL B N    4  
ATOM   11228 C  CA   . VAL B 1 75 ? 148.778 -1.388  3.485   1.00 0.00 ? 75  VAL B CA   4  
ATOM   11229 C  C    . VAL B 1 75 ? 148.100 -0.081  3.876   1.00 0.00 ? 75  VAL B C    4  
ATOM   11230 O  O    . VAL B 1 75 ? 147.516 0.596   3.029