data_2LPZ
# 
_entry.id   2LPZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.348 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2LPZ         pdb_00002lpz 10.2210/pdb2lpz/pdb 
RCSB  RCSB102687   ?            ?                   
BMRB  18276        ?            ?                   
WWPDB D_1000102687 ?            ?                   
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          18276 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LPZ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-21 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Loquet, A.'      1  
'Sgourakis, N.G.' 2  
'Gupta, R.'       3  
'Giller, K.'      4  
'Riedel, D.'      5  
'Goosmann, C.'    6  
'Griesinger, C.'  7  
'Kolbe, M.G.'     8  
'Baker, D.'       9  
'Becker, S.'      10 
'Lange, A.'       11 
# 
_citation.id                        primary 
_citation.title                     'Atomic model of the type III secretion system needle.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            486 
_citation.page_first                276 
_citation.page_last                 279 
_citation.year                      2012 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22699623 
_citation.pdbx_database_id_DOI      10.1038/nature11079 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Loquet, A.'      1  ? 
primary 'Sgourakis, N.G.' 2  ? 
primary 'Gupta, R.'       3  ? 
primary 'Giller, K.'      4  ? 
primary 'Riedel, D.'      5  ? 
primary 'Goosmann, C.'    6  ? 
primary 'Griesinger, C.'  7  ? 
primary 'Kolbe, M.'       8  ? 
primary 'Baker, D.'       9  ? 
primary 'Becker, S.'      10 ? 
primary 'Lange, A.'       11 ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Protein prgI' 
_entity.formula_weight             8864.868 
_entity.pdbx_number_of_molecules   29 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR 
_entity_poly.pdbx_seq_one_letter_code_can   MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR 
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  ALA n 
1 3  THR n 
1 4  PRO n 
1 5  TRP n 
1 6  SER n 
1 7  GLY n 
1 8  TYR n 
1 9  LEU n 
1 10 ASP n 
1 11 ASP n 
1 12 VAL n 
1 13 SER n 
1 14 ALA n 
1 15 LYS n 
1 16 PHE n 
1 17 ASP n 
1 18 THR n 
1 19 GLY n 
1 20 VAL n 
1 21 ASP n 
1 22 ASN n 
1 23 LEU n 
1 24 GLN n 
1 25 THR n 
1 26 GLN n 
1 27 VAL n 
1 28 THR n 
1 29 GLU n 
1 30 ALA n 
1 31 LEU n 
1 32 ASP n 
1 33 LYS n 
1 34 LEU n 
1 35 ALA n 
1 36 ALA n 
1 37 LYS n 
1 38 PRO n 
1 39 SER n 
1 40 ASP n 
1 41 PRO n 
1 42 ALA n 
1 43 LEU n 
1 44 LEU n 
1 45 ALA n 
1 46 ALA n 
1 47 TYR n 
1 48 GLN n 
1 49 SER n 
1 50 LYS n 
1 51 LEU n 
1 52 SER n 
1 53 GLU n 
1 54 TYR n 
1 55 ASN n 
1 56 LEU n 
1 57 TYR n 
1 58 ARG n 
1 59 ASN n 
1 60 ALA n 
1 61 GLN n 
1 62 SER n 
1 63 ASN n 
1 64 THR n 
1 65 VAL n 
1 66 LYS n 
1 67 VAL n 
1 68 PHE n 
1 69 LYS n 
1 70 ASP n 
1 71 ILE n 
1 72 ASP n 
1 73 ALA n 
1 74 ALA n 
1 75 ILE n 
1 76 ILE n 
1 77 GLN n 
1 78 ASN n 
1 79 PHE n 
1 80 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'prgI, STM2873' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Salmonella enterica subsp. enterica serovar Typhimurium' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     90371 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              DE3 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET16b 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PRGI_SALTY 
_struct_ref.pdbx_db_accession          P41784 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MATPWSGYLDDVSAKFDTGVDNLQTQVTEALDKLAAKPSDPALLAAYQSKLSEYNLYRNAQSNTVKVFKDIDAAIIQNFR

;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2LPZ A 1 ? 80 ? P41784 1 ? 80 ? 1 80 
2  1 2LPZ B 1 ? 80 ? P41784 1 ? 80 ? 1 80 
3  1 2LPZ C 1 ? 80 ? P41784 1 ? 80 ? 1 80 
4  1 2LPZ D 1 ? 80 ? P41784 1 ? 80 ? 1 80 
5  1 2LPZ E 1 ? 80 ? P41784 1 ? 80 ? 1 80 
6  1 2LPZ F 1 ? 80 ? P41784 1 ? 80 ? 1 80 
7  1 2LPZ G 1 ? 80 ? P41784 1 ? 80 ? 1 80 
8  1 2LPZ H 1 ? 80 ? P41784 1 ? 80 ? 1 80 
9  1 2LPZ I 1 ? 80 ? P41784 1 ? 80 ? 1 80 
10 1 2LPZ J 1 ? 80 ? P41784 1 ? 80 ? 1 80 
11 1 2LPZ K 1 ? 80 ? P41784 1 ? 80 ? 1 80 
12 1 2LPZ L 1 ? 80 ? P41784 1 ? 80 ? 1 80 
13 1 2LPZ M 1 ? 80 ? P41784 1 ? 80 ? 1 80 
14 1 2LPZ N 1 ? 80 ? P41784 1 ? 80 ? 1 80 
15 1 2LPZ O 1 ? 80 ? P41784 1 ? 80 ? 1 80 
16 1 2LPZ P 1 ? 80 ? P41784 1 ? 80 ? 1 80 
17 1 2LPZ Q 1 ? 80 ? P41784 1 ? 80 ? 1 80 
18 1 2LPZ R 1 ? 80 ? P41784 1 ? 80 ? 1 80 
19 1 2LPZ S 1 ? 80 ? P41784 1 ? 80 ? 1 80 
20 1 2LPZ T 1 ? 80 ? P41784 1 ? 80 ? 1 80 
21 1 2LPZ U 1 ? 80 ? P41784 1 ? 80 ? 1 80 
22 1 2LPZ V 1 ? 80 ? P41784 1 ? 80 ? 1 80 
23 1 2LPZ W 1 ? 80 ? P41784 1 ? 80 ? 1 80 
24 1 2LPZ X 1 ? 80 ? P41784 1 ? 80 ? 1 80 
25 1 2LPZ Y 1 ? 80 ? P41784 1 ? 80 ? 1 80 
26 1 2LPZ Z 1 ? 80 ? P41784 1 ? 80 ? 1 80 
27 1 2LPZ a 1 ? 80 ? P41784 1 ? 80 ? 1 80 
28 1 2LPZ b 1 ? 80 ? P41784 1 ? 80 ? 1 80 
29 1 2LPZ c 1 ? 80 ? P41784 1 ? 80 ? 1 80 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '15N-13C PAIN-CP' 
1 2 1 PDSD              
1 3 2 '15N-13C PAIN-CP' 
1 4 2 PDSD              
1 5 3 '15N-13C PAIN-CP' 
1 6 3 PDSD              
1 7 4 '15N-13C PAIN-CP' 
1 8 4 PDSD              
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         0 
_pdbx_nmr_exptl_sample_conditions.pH                     7.5 
_pdbx_nmr_exptl_sample_conditions.pressure               ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units         ? 
_pdbx_nmr_exptl_sample_conditions.temperature            278 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
_pdbx_nmr_exptl_sample_conditions.label                  ? 
_pdbx_nmr_exptl_sample_conditions.pH_units               ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   ? 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
'0.1 mM [U-100% 13C; U-100% 15N] PrgI protein, 90% H2O/10% D2O'                           1 '90% H2O/10% D2O' sample_1 solution ? 
'0.1 mM [100% 1-13C glucose; U-100% 15N] PrgI protein, 90% H2O/10% D2O'                   2 '90% H2O/10% D2O' sample_2 solution ? 
'0.1 mM [100% 2-13C glucose; U-100% 15N] PrgI protein, 90% H2O/10% D2O'                   3 '90% H2O/10% D2O' sample_3 solution ? 
'0.1 mM [50% 1-13C glucose; 50% 2-13C glucose; U-100% 15N] PrgI protein, 90% H2O/10% D2O' 4 '90% H2O/10% D2O' sample_4 solution ? 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker AVANCE 1 'Bruker Avance' 
850 Bruker AVANCE 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LPZ 
_pdbx_nmr_refine.method             'Monte Carlo and gradient-based optimization' 
_pdbx_nmr_refine.details            
'Monte-Carlo and gradient-based refinement in torsion angle space of the rigid body, backbone and sidechain degrees of freedom' 
_pdbx_nmr_refine.software_ordinal   3 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'target function' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            1000000 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LPZ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LPZ 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Leaver-Fay, A. et al.' 'structure calculations' Rosetta 3.4 1 
CCPN                    'data analysis'          CcpNmr  ?   2 
'Leaver-Fay, A. et al.' refinement               Rosetta 3.4 3 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    'Atomic model of the Type III Secretion System Needle' 
_exptl.entry_id                   2LPZ 
_exptl.method                     'SOLID-STATE NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LPZ 
_struct.title                     'Atomic model of the Type-III Secretion System Needle' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LPZ 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
_struct_keywords.text            'type three secretion system, filament, needle, helical assembly, TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 1 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A  7  ? VAL A  20 ? GLY A 7  VAL A 20 1 ? 14 
HELX_P HELX_P2  2  VAL A  20 ? LYS A  37 ? VAL A 20 LYS A 37 1 ? 18 
HELX_P HELX_P3  3  ASP A  40 ? GLN A  77 ? ASP A 40 GLN A 77 1 ? 38 
HELX_P HELX_P4  4  GLY B  7  ? VAL B  20 ? GLY B 7  VAL B 20 1 ? 14 
HELX_P HELX_P5  5  VAL B  20 ? LYS B  37 ? VAL B 20 LYS B 37 1 ? 18 
HELX_P HELX_P6  6  ASP B  40 ? GLN B  77 ? ASP B 40 GLN B 77 1 ? 38 
HELX_P HELX_P7  7  GLY C  7  ? VAL C  20 ? GLY C 7  VAL C 20 1 ? 14 
HELX_P HELX_P8  8  VAL C  20 ? LYS C  37 ? VAL C 20 LYS C 37 1 ? 18 
HELX_P HELX_P9  9  ASP C  40 ? GLN C  77 ? ASP C 40 GLN C 77 1 ? 38 
HELX_P HELX_P10 10 GLY D  7  ? VAL D  20 ? GLY D 7  VAL D 20 1 ? 14 
HELX_P HELX_P11 11 VAL D  20 ? LYS D  37 ? VAL D 20 LYS D 37 1 ? 18 
HELX_P HELX_P12 12 ASP D  40 ? GLN D  77 ? ASP D 40 GLN D 77 1 ? 38 
HELX_P HELX_P13 13 GLY E  7  ? VAL E  20 ? GLY E 7  VAL E 20 1 ? 14 
HELX_P HELX_P14 14 VAL E  20 ? LYS E  37 ? VAL E 20 LYS E 37 1 ? 18 
HELX_P HELX_P15 15 ASP E  40 ? GLN E  77 ? ASP E 40 GLN E 77 1 ? 38 
HELX_P HELX_P16 16 GLY F  7  ? VAL F  20 ? GLY F 7  VAL F 20 1 ? 14 
HELX_P HELX_P17 17 VAL F  20 ? LYS F  37 ? VAL F 20 LYS F 37 1 ? 18 
HELX_P HELX_P18 18 ASP F  40 ? GLN F  77 ? ASP F 40 GLN F 77 1 ? 38 
HELX_P HELX_P19 19 GLY G  7  ? VAL G  20 ? GLY G 7  VAL G 20 1 ? 14 
HELX_P HELX_P20 20 VAL G  20 ? LYS G  37 ? VAL G 20 LYS G 37 1 ? 18 
HELX_P HELX_P21 21 ASP G  40 ? GLN G  77 ? ASP G 40 GLN G 77 1 ? 38 
HELX_P HELX_P22 22 GLY H  7  ? VAL H  20 ? GLY H 7  VAL H 20 1 ? 14 
HELX_P HELX_P23 23 VAL H  20 ? LYS H  37 ? VAL H 20 LYS H 37 1 ? 18 
HELX_P HELX_P24 24 ASP H  40 ? GLN H  77 ? ASP H 40 GLN H 77 1 ? 38 
HELX_P HELX_P25 25 GLY I  7  ? VAL I  20 ? GLY I 7  VAL I 20 1 ? 14 
HELX_P HELX_P26 26 VAL I  20 ? LYS I  37 ? VAL I 20 LYS I 37 1 ? 18 
HELX_P HELX_P27 27 ASP I  40 ? GLN I  77 ? ASP I 40 GLN I 77 1 ? 38 
HELX_P HELX_P28 28 GLY J  7  ? VAL J  20 ? GLY J 7  VAL J 20 1 ? 14 
HELX_P HELX_P29 29 VAL J  20 ? LYS J  37 ? VAL J 20 LYS J 37 1 ? 18 
HELX_P HELX_P30 30 ASP J  40 ? GLN J  77 ? ASP J 40 GLN J 77 1 ? 38 
HELX_P HELX_P31 31 GLY K  7  ? VAL K  20 ? GLY K 7  VAL K 20 1 ? 14 
HELX_P HELX_P32 32 VAL K  20 ? LYS K  37 ? VAL K 20 LYS K 37 1 ? 18 
HELX_P HELX_P33 33 ASP K  40 ? GLN K  77 ? ASP K 40 GLN K 77 1 ? 38 
HELX_P HELX_P34 34 GLY L  7  ? VAL L  20 ? GLY L 7  VAL L 20 1 ? 14 
HELX_P HELX_P35 35 VAL L  20 ? LYS L  37 ? VAL L 20 LYS L 37 1 ? 18 
HELX_P HELX_P36 36 ASP L  40 ? GLN L  77 ? ASP L 40 GLN L 77 1 ? 38 
HELX_P HELX_P37 37 GLY M  7  ? VAL M  20 ? GLY M 7  VAL M 20 1 ? 14 
HELX_P HELX_P38 38 VAL M  20 ? LYS M  37 ? VAL M 20 LYS M 37 1 ? 18 
HELX_P HELX_P39 39 ASP M  40 ? GLN M  77 ? ASP M 40 GLN M 77 1 ? 38 
HELX_P HELX_P40 40 GLY N  7  ? VAL N  20 ? GLY N 7  VAL N 20 1 ? 14 
HELX_P HELX_P41 41 VAL N  20 ? LYS N  37 ? VAL N 20 LYS N 37 1 ? 18 
HELX_P HELX_P42 42 ASP N  40 ? GLN N  77 ? ASP N 40 GLN N 77 1 ? 38 
HELX_P HELX_P43 43 GLY O  7  ? VAL O  20 ? GLY O 7  VAL O 20 1 ? 14 
HELX_P HELX_P44 44 VAL O  20 ? LYS O  37 ? VAL O 20 LYS O 37 1 ? 18 
HELX_P HELX_P45 45 ASP O  40 ? GLN O  77 ? ASP O 40 GLN O 77 1 ? 38 
HELX_P HELX_P46 46 GLY P  7  ? VAL P  20 ? GLY P 7  VAL P 20 1 ? 14 
HELX_P HELX_P47 47 VAL P  20 ? LYS P  37 ? VAL P 20 LYS P 37 1 ? 18 
HELX_P HELX_P48 48 ASP P  40 ? GLN P  77 ? ASP P 40 GLN P 77 1 ? 38 
HELX_P HELX_P49 49 GLY Q  7  ? VAL Q  20 ? GLY Q 7  VAL Q 20 1 ? 14 
HELX_P HELX_P50 50 VAL Q  20 ? LYS Q  37 ? VAL Q 20 LYS Q 37 1 ? 18 
HELX_P HELX_P51 51 ASP Q  40 ? GLN Q  77 ? ASP Q 40 GLN Q 77 1 ? 38 
HELX_P HELX_P52 52 GLY R  7  ? VAL R  20 ? GLY R 7  VAL R 20 1 ? 14 
HELX_P HELX_P53 53 VAL R  20 ? LYS R  37 ? VAL R 20 LYS R 37 1 ? 18 
HELX_P HELX_P54 54 ASP R  40 ? GLN R  77 ? ASP R 40 GLN R 77 1 ? 38 
HELX_P HELX_P55 55 GLY S  7  ? VAL S  20 ? GLY S 7  VAL S 20 1 ? 14 
HELX_P HELX_P56 56 VAL S  20 ? LYS S  37 ? VAL S 20 LYS S 37 1 ? 18 
HELX_P HELX_P57 57 ASP S  40 ? GLN S  77 ? ASP S 40 GLN S 77 1 ? 38 
HELX_P HELX_P58 58 GLY T  7  ? VAL T  20 ? GLY T 7  VAL T 20 1 ? 14 
HELX_P HELX_P59 59 VAL T  20 ? LYS T  37 ? VAL T 20 LYS T 37 1 ? 18 
HELX_P HELX_P60 60 ASP T  40 ? GLN T  77 ? ASP T 40 GLN T 77 1 ? 38 
HELX_P HELX_P61 61 GLY U  7  ? VAL U  20 ? GLY U 7  VAL U 20 1 ? 14 
HELX_P HELX_P62 62 VAL U  20 ? LYS U  37 ? VAL U 20 LYS U 37 1 ? 18 
HELX_P HELX_P63 63 ASP U  40 ? GLN U  77 ? ASP U 40 GLN U 77 1 ? 38 
HELX_P HELX_P64 64 GLY V  7  ? VAL V  20 ? GLY V 7  VAL V 20 1 ? 14 
HELX_P HELX_P65 65 VAL V  20 ? LYS V  37 ? VAL V 20 LYS V 37 1 ? 18 
HELX_P HELX_P66 66 ASP V  40 ? GLN V  77 ? ASP V 40 GLN V 77 1 ? 38 
HELX_P HELX_P67 67 GLY W  7  ? VAL W  20 ? GLY W 7  VAL W 20 1 ? 14 
HELX_P HELX_P68 68 VAL W  20 ? LYS W  37 ? VAL W 20 LYS W 37 1 ? 18 
HELX_P HELX_P69 69 ASP W  40 ? GLN W  77 ? ASP W 40 GLN W 77 1 ? 38 
HELX_P HELX_P70 70 GLY X  7  ? VAL X  20 ? GLY X 7  VAL X 20 1 ? 14 
HELX_P HELX_P71 71 VAL X  20 ? LYS X  37 ? VAL X 20 LYS X 37 1 ? 18 
HELX_P HELX_P72 72 ASP X  40 ? GLN X  77 ? ASP X 40 GLN X 77 1 ? 38 
HELX_P HELX_P73 73 GLY Y  7  ? VAL Y  20 ? GLY Y 7  VAL Y 20 1 ? 14 
HELX_P HELX_P74 74 VAL Y  20 ? LYS Y  37 ? VAL Y 20 LYS Y 37 1 ? 18 
HELX_P HELX_P75 75 ASP Y  40 ? GLN Y  77 ? ASP Y 40 GLN Y 77 1 ? 38 
HELX_P HELX_P76 76 GLY Z  7  ? VAL Z  20 ? GLY Z 7  VAL Z 20 1 ? 14 
HELX_P HELX_P77 77 VAL Z  20 ? LYS Z  37 ? VAL Z 20 LYS Z 37 1 ? 18 
HELX_P HELX_P78 78 ASP Z  40 ? GLN Z  77 ? ASP Z 40 GLN Z 77 1 ? 38 
HELX_P HELX_P79 79 GLY AA 7  ? VAL AA 20 ? GLY a 7  VAL a 20 1 ? 14 
HELX_P HELX_P80 80 VAL AA 20 ? LYS AA 37 ? VAL a 20 LYS a 37 1 ? 18 
HELX_P HELX_P81 81 ASP AA 40 ? GLN AA 77 ? ASP a 40 GLN a 77 1 ? 38 
HELX_P HELX_P82 82 GLY BA 7  ? VAL BA 20 ? GLY b 7  VAL b 20 1 ? 14 
HELX_P HELX_P83 83 VAL BA 20 ? LYS BA 37 ? VAL b 20 LYS b 37 1 ? 18 
HELX_P HELX_P84 84 ASP BA 40 ? GLN BA 77 ? ASP b 40 GLN b 77 1 ? 38 
HELX_P HELX_P85 85 GLY CA 7  ? VAL CA 20 ? GLY c 7  VAL c 20 1 ? 14 
HELX_P HELX_P86 86 VAL CA 20 ? LYS CA 37 ? VAL c 20 LYS c 37 1 ? 18 
HELX_P HELX_P87 87 ASP CA 40 ? GLN CA 77 ? ASP c 40 GLN c 77 1 ? 38 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2LPZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1      N N    . MET A  1 1  ? -31.741 33.785  -278.733 1.00 0.00 ?  1  MET A N    1  
ATOM 2      C CA   . MET A  1 1  ? -32.155 32.906  -279.820 1.00 0.00 ?  1  MET A CA   1  
ATOM 3      C C    . MET A  1 1  ? -30.988 32.067  -280.325 1.00 0.00 ?  1  MET A C    1  
ATOM 4      O O    . MET A  1 1  ? -31.175 30.946  -280.798 1.00 0.00 ?  1  MET A O    1  
ATOM 5      C CB   . MET A  1 1  ? -32.752 33.724  -280.963 1.00 0.00 ?  1  MET A CB   1  
ATOM 6      C CG   . MET A  1 1  ? -34.024 34.477  -280.602 1.00 0.00 ?  1  MET A CG   1  
ATOM 7      S SD   . MET A  1 1  ? -35.332 33.386  -280.008 1.00 0.00 ?  1  MET A SD   1  
ATOM 8      C CE   . MET A  1 1  ? -35.747 32.507  -281.511 1.00 0.00 ?  1  MET A CE   1  
ATOM 9      H H1   . MET A  1 1  ? -31.834 34.776  -278.830 1.00 0.00 ?  1  MET A H1   1  
ATOM 10     H H2   . MET A  1 1  ? -32.172 33.706  -277.834 1.00 0.00 ?  1  MET A H2   1  
ATOM 11     H H3   . MET A  1 1  ? -30.792 33.778  -278.418 1.00 0.00 ?  1  MET A H3   1  
ATOM 12     H HA   . MET A  1 1  ? -32.909 32.204  -279.464 1.00 0.00 ?  1  MET A HA   1  
ATOM 13     H HB2  . MET A  1 1  ? -31.987 34.433  -281.278 1.00 0.00 ?  1  MET A HB2  1  
ATOM 14     H HB3  . MET A  1 1  ? -32.961 33.028  -281.777 1.00 0.00 ?  1  MET A HB3  1  
ATOM 15     H HG2  . MET A  1 1  ? -33.781 35.201  -279.824 1.00 0.00 ?  1  MET A HG2  1  
ATOM 16     H HG3  . MET A  1 1  ? -34.372 35.002  -281.491 1.00 0.00 ?  1  MET A HG3  1  
ATOM 17     H HE1  . MET A  1 1  ? -34.868 31.974  -281.876 1.00 0.00 ?  1  MET A HE1  1  
ATOM 18     H HE2  . MET A  1 1  ? -36.545 31.792  -281.307 1.00 0.00 ?  1  MET A HE2  1  
ATOM 19     H HE3  . MET A  1 1  ? -36.081 33.217  -282.269 1.00 0.00 ?  1  MET A HE3  1  
ATOM 20     N N    . ALA A  1 2  ? -29.783 32.617  -280.222 1.00 0.00 ?  2  ALA A N    1  
ATOM 21     C CA   . ALA A  1 2  ? -28.584 31.927  -280.682 1.00 0.00 ?  2  ALA A CA   1  
ATOM 22     C C    . ALA A  1 2  ? -28.184 30.817  -279.718 1.00 0.00 ?  2  ALA A C    1  
ATOM 23     O O    . ALA A  1 2  ? -28.350 30.945  -278.505 1.00 0.00 ?  2  ALA A O    1  
ATOM 24     C CB   . ALA A  1 2  ? -27.440 32.914  -280.862 1.00 0.00 ?  2  ALA A CB   1  
ATOM 25     H H    . ALA A  1 2  ? -29.695 33.538  -279.816 1.00 0.00 ?  2  ALA A H    1  
ATOM 26     H HA   . ALA A  1 2  ? -28.796 31.461  -281.644 1.00 0.00 ?  2  ALA A HA   1  
ATOM 27     H HB1  . ALA A  1 2  ? -27.226 33.400  -279.911 1.00 0.00 ?  2  ALA A HB1  1  
ATOM 28     H HB2  . ALA A  1 2  ? -26.552 32.382  -281.205 1.00 0.00 ?  2  ALA A HB2  1  
ATOM 29     H HB3  . ALA A  1 2  ? -27.720 33.666  -281.600 1.00 0.00 ?  2  ALA A HB3  1  
ATOM 30     N N    . THR A  1 3  ? -27.656 29.727  -280.265 1.00 0.00 ?  3  THR A N    1  
ATOM 31     C CA   . THR A  1 3  ? -27.219 28.597  -279.454 1.00 0.00 ?  3  THR A CA   1  
ATOM 32     C C    . THR A  1 3  ? -25.805 28.169  -279.822 1.00 0.00 ?  3  THR A C    1  
ATOM 33     O O    . THR A  1 3  ? -25.522 27.854  -280.978 1.00 0.00 ?  3  THR A O    1  
ATOM 34     C CB   . THR A  1 3  ? -28.166 27.392  -279.607 1.00 0.00 ?  3  THR A CB   1  
ATOM 35     O OG1  . THR A  1 3  ? -29.493 27.770  -279.218 1.00 0.00 ?  3  THR A OG1  1  
ATOM 36     C CG2  . THR A  1 3  ? -27.698 26.233  -278.740 1.00 0.00 ?  3  THR A CG2  1  
ATOM 37     H H    . THR A  1 3  ? -27.555 29.680  -281.269 1.00 0.00 ?  3  THR A H    1  
ATOM 38     H HA   . THR A  1 3  ? -27.190 28.887  -278.403 1.00 0.00 ?  3  THR A HA   1  
ATOM 39     H HB   . THR A  1 3  ? -28.178 27.081  -280.652 1.00 0.00 ?  3  THR A HB   1  
ATOM 40     H HG1  . THR A  1 3  ? -30.081 27.017  -279.315 1.00 0.00 ?  3  THR A HG1  1  
ATOM 41     H HG21 . THR A  1 3  ? -28.379 25.391  -278.862 1.00 0.00 ?  3  THR A HG21 1  
ATOM 42     H HG22 . THR A  1 3  ? -26.694 25.936  -279.041 1.00 0.00 ?  3  THR A HG22 1  
ATOM 43     H HG23 . THR A  1 3  ? -27.687 26.543  -277.695 1.00 0.00 ?  3  THR A HG23 1  
ATOM 44     N N    . PRO A  1 4  ? -24.919 28.159  -278.832 1.00 0.00 ?  4  PRO A N    1  
ATOM 45     C CA   . PRO A  1 4  ? -23.541 27.731  -279.041 1.00 0.00 ?  4  PRO A CA   1  
ATOM 46     C C    . PRO A  1 4  ? -23.484 26.334  -279.647 1.00 0.00 ?  4  PRO A C    1  
ATOM 47     O O    . PRO A  1 4  ? -24.295 25.470  -279.316 1.00 0.00 ?  4  PRO A O    1  
ATOM 48     C CB   . PRO A  1 4  ? -22.918 27.778  -277.642 1.00 0.00 ?  4  PRO A CB   1  
ATOM 49     C CG   . PRO A  1 4  ? -23.738 28.779  -276.903 1.00 0.00 ?  4  PRO A CG   1  
ATOM 50     C CD   . PRO A  1 4  ? -25.141 28.605  -277.421 1.00 0.00 ?  4  PRO A CD   1  
ATOM 51     H HA   . PRO A  1 4  ? -22.999 28.371  -279.753 1.00 0.00 ?  4  PRO A HA   1  
ATOM 52     H HB2  . PRO A  1 4  ? -22.953 26.793  -277.152 1.00 0.00 ?  4  PRO A HB2  1  
ATOM 53     H HB3  . PRO A  1 4  ? -21.861 28.080  -277.682 1.00 0.00 ?  4  PRO A HB3  1  
ATOM 54     H HG2  . PRO A  1 4  ? -23.693 28.606  -275.818 1.00 0.00 ?  4  PRO A HG2  1  
ATOM 55     H HG3  . PRO A  1 4  ? -23.375 29.801  -277.082 1.00 0.00 ?  4  PRO A HG3  1  
ATOM 56     H HD2  . PRO A  1 4  ? -25.706 27.854  -276.849 1.00 0.00 ?  4  PRO A HD2  1  
ATOM 57     H HD3  . PRO A  1 4  ? -25.718 29.540  -277.381 1.00 0.00 ?  4  PRO A HD3  1  
ATOM 58     N N    . TRP A  1 5  ? -22.521 26.120  -280.538 1.00 0.00 ?  5  TRP A N    1  
ATOM 59     C CA   . TRP A  1 5  ? -22.363 24.831  -281.200 1.00 0.00 ?  5  TRP A CA   1  
ATOM 60     C C    . TRP A  1 5  ? -21.989 23.742  -280.203 1.00 0.00 ?  5  TRP A C    1  
ATOM 61     O O    . TRP A  1 5  ? -21.197 23.970  -279.288 1.00 0.00 ?  5  TRP A O    1  
ATOM 62     C CB   . TRP A  1 5  ? -21.304 24.923  -282.300 1.00 0.00 ?  5  TRP A CB   1  
ATOM 63     C CG   . TRP A  1 5  ? -21.026 23.613  -282.974 1.00 0.00 ?  5  TRP A CG   1  
ATOM 64     C CD1  . TRP A  1 5  ? -21.654 23.114  -284.076 1.00 0.00 ?  5  TRP A CD1  1  
ATOM 65     C CD2  . TRP A  1 5  ? -20.049 22.637  -282.591 1.00 0.00 ?  5  TRP A CD2  1  
ATOM 66     N NE1  . TRP A  1 5  ? -21.131 21.888  -284.403 1.00 0.00 ?  5  TRP A NE1  1  
ATOM 67     C CE2  . TRP A  1 5  ? -20.142 21.573  -283.506 1.00 0.00 ?  5  TRP A CE2  1  
ATOM 68     C CE3  . TRP A  1 5  ? -19.104 22.561  -281.561 1.00 0.00 ?  5  TRP A CE3  1  
ATOM 69     C CZ2  . TRP A  1 5  ? -19.333 20.451  -283.425 1.00 0.00 ?  5  TRP A CZ2  1  
ATOM 70     C CZ3  . TRP A  1 5  ? -18.292 21.436  -281.480 1.00 0.00 ?  5  TRP A CZ3  1  
ATOM 71     C CH2  . TRP A  1 5  ? -18.403 20.412  -282.386 1.00 0.00 ?  5  TRP A CH2  1  
ATOM 72     H H    . TRP A  1 5  ? -21.883 26.870  -280.762 1.00 0.00 ?  5  TRP A H    1  
ATOM 73     H HA   . TRP A  1 5  ? -23.308 24.529  -281.652 1.00 0.00 ?  5  TRP A HA   1  
ATOM 74     H HB2  . TRP A  1 5  ? -21.627 25.612  -283.079 1.00 0.00 ?  5  TRP A HB2  1  
ATOM 75     H HB3  . TRP A  1 5  ? -20.357 25.265  -281.882 1.00 0.00 ?  5  TRP A HB3  1  
ATOM 76     H HD1  . TRP A  1 5  ? -22.438 23.728  -284.515 1.00 0.00 ?  5  TRP A HD1  1  
ATOM 77     H HE1  . TRP A  1 5  ? -21.426 21.311  -285.178 1.00 0.00 ?  5  TRP A HE1  1  
ATOM 78     H HE3  . TRP A  1 5  ? -18.972 23.347  -280.817 1.00 0.00 ?  5  TRP A HE3  1  
ATOM 79     H HZ2  . TRP A  1 5  ? -19.454 19.660  -284.165 1.00 0.00 ?  5  TRP A HZ2  1  
ATOM 80     H HZ3  . TRP A  1 5  ? -17.560 21.390  -280.673 1.00 0.00 ?  5  TRP A HZ3  1  
ATOM 81     H HH2  . TRP A  1 5  ? -17.746 19.547  -282.288 1.00 0.00 ?  5  TRP A HH2  1  
ATOM 82     N N    . SER A  1 6  ? -22.562 22.557  -280.386 1.00 0.00 ?  6  SER A N    1  
ATOM 83     C CA   . SER A  1 6  ? -22.213 21.403  -279.567 1.00 0.00 ?  6  SER A CA   1  
ATOM 84     C C    . SER A  1 6  ? -22.167 20.129  -280.401 1.00 0.00 ?  6  SER A C    1  
ATOM 85     O O    . SER A  1 6  ? -23.132 19.789  -281.085 1.00 0.00 ?  6  SER A O    1  
ATOM 86     C CB   . SER A  1 6  ? -23.201 21.252  -278.427 1.00 0.00 ?  6  SER A CB   1  
ATOM 87     O OG   . SER A  1 6  ? -22.947 20.110  -277.657 1.00 0.00 ?  6  SER A OG   1  
ATOM 88     H H    . SER A  1 6  ? -23.258 22.454  -281.111 1.00 0.00 ?  6  SER A H    1  
ATOM 89     H HA   . SER A  1 6  ? -21.274 21.525  -279.024 1.00 0.00 ?  6  SER A HA   1  
ATOM 90     H HB2  . SER A  1 6  ? -23.133 22.133  -277.789 1.00 0.00 ?  6  SER A HB2  1  
ATOM 91     H HB3  . SER A  1 6  ? -24.206 21.183  -278.843 1.00 0.00 ?  6  SER A HB3  1  
ATOM 92     H HG   . SER A  1 6  ? -23.631 19.457  -277.819 1.00 0.00 ?  6  SER A HG   1  
ATOM 93     N N    . GLY A  1 7  ? -21.040 19.428  -280.340 1.00 0.00 ?  7  GLY A N    1  
ATOM 94     C CA   . GLY A  1 7  ? -20.870 18.185  -281.084 1.00 0.00 ?  7  GLY A CA   1  
ATOM 95     C C    . GLY A  1 7  ? -21.516 17.014  -280.355 1.00 0.00 ?  7  GLY A C    1  
ATOM 96     O O    . GLY A  1 7  ? -22.128 17.188  -279.300 1.00 0.00 ?  7  GLY A O    1  
ATOM 97     H H    . GLY A  1 7  ? -20.282 19.765  -279.765 1.00 0.00 ?  7  GLY A H    1  
ATOM 98     H HA2  . GLY A  1 7  ? -21.332 18.291  -282.065 1.00 0.00 ?  7  GLY A HA2  1  
ATOM 99     H HA3  . GLY A  1 7  ? -19.806 17.985  -281.204 1.00 0.00 ?  7  GLY A HA3  1  
ATOM 100    N N    . TYR A  1 8  ? -21.377 15.821  -280.922 1.00 0.00 ?  8  TYR A N    1  
ATOM 101    C CA   . TYR A  1 8  ? -21.935 14.616  -280.319 1.00 0.00 ?  8  TYR A CA   1  
ATOM 102    C C    . TYR A  1 8  ? -21.273 14.313  -278.981 1.00 0.00 ?  8  TYR A C    1  
ATOM 103    O O    . TYR A  1 8  ? -21.952 14.062  -277.985 1.00 0.00 ?  8  TYR A O    1  
ATOM 104    C CB   . TYR A  1 8  ? -21.779 13.423  -281.265 1.00 0.00 ?  8  TYR A CB   1  
ATOM 105    C CG   . TYR A  1 8  ? -22.302 12.121  -280.700 1.00 0.00 ?  8  TYR A CG   1  
ATOM 106    C CD1  . TYR A  1 8  ? -23.628 11.752  -280.871 1.00 0.00 ?  8  TYR A CD1  1  
ATOM 107    C CD2  . TYR A  1 8  ? -21.467 11.264  -279.999 1.00 0.00 ?  8  TYR A CD2  1  
ATOM 108    C CE1  . TYR A  1 8  ? -24.112 10.564  -280.357 1.00 0.00 ?  8  TYR A CE1  1  
ATOM 109    C CE2  . TYR A  1 8  ? -21.939 10.073  -279.481 1.00 0.00 ?  8  TYR A CE2  1  
ATOM 110    C CZ   . TYR A  1 8  ? -23.263 9.727   -279.662 1.00 0.00 ?  8  TYR A CZ   1  
ATOM 111    O OH   . TYR A  1 8  ? -23.737 8.541   -279.149 1.00 0.00 ?  8  TYR A OH   1  
ATOM 112    H H    . TYR A  1 8  ? -20.873 15.747  -281.794 1.00 0.00 ?  8  TYR A H    1  
ATOM 113    H HA   . TYR A  1 8  ? -22.996 14.762  -280.115 1.00 0.00 ?  8  TYR A HA   1  
ATOM 114    H HB2  . TYR A  1 8  ? -22.319 13.665  -282.181 1.00 0.00 ?  8  TYR A HB2  1  
ATOM 115    H HB3  . TYR A  1 8  ? -20.716 13.323  -281.484 1.00 0.00 ?  8  TYR A HB3  1  
ATOM 116    H HD1  . TYR A  1 8  ? -24.293 12.418  -281.421 1.00 0.00 ?  8  TYR A HD1  1  
ATOM 117    H HD2  . TYR A  1 8  ? -20.423 11.543  -279.859 1.00 0.00 ?  8  TYR A HD2  1  
ATOM 118    H HE1  . TYR A  1 8  ? -25.156 10.287  -280.499 1.00 0.00 ?  8  TYR A HE1  1  
ATOM 119    H HE2  . TYR A  1 8  ? -21.267 9.413   -278.932 1.00 0.00 ?  8  TYR A HE2  1  
ATOM 120    H HH   . TYR A  1 8  ? -24.669 8.400   -279.333 1.00 0.00 ?  8  TYR A HH   1  
ATOM 121    N N    . LEU A  1 9  ? -19.945 14.337  -278.965 1.00 0.00 ?  9  LEU A N    1  
ATOM 122    C CA   . LEU A  1 9  ? -19.188 14.058  -277.750 1.00 0.00 ?  9  LEU A CA   1  
ATOM 123    C C    . LEU A  1 9  ? -19.442 15.118  -276.687 1.00 0.00 ?  9  LEU A C    1  
ATOM 124    O O    . LEU A  1 9  ? -19.465 14.821  -275.493 1.00 0.00 ?  9  LEU A O    1  
ATOM 125    C CB   . LEU A  1 9  ? -17.690 13.968  -278.068 1.00 0.00 ?  9  LEU A CB   1  
ATOM 126    C CG   . LEU A  1 9  ? -17.274 12.762  -278.919 1.00 0.00 ?  9  LEU A CG   1  
ATOM 127    C CD1  . LEU A  1 9  ? -15.798 12.861  -279.279 1.00 0.00 ?  9  LEU A CD1  1  
ATOM 128    C CD2  . LEU A  1 9  ? -17.558 11.477  -278.154 1.00 0.00 ?  9  LEU A CD2  1  
ATOM 129    H H    . LEU A  1 9  ? -19.446 14.555  -279.816 1.00 0.00 ?  9  LEU A H    1  
ATOM 130    H HA   . LEU A  1 9  ? -19.517 13.110  -277.326 1.00 0.00 ?  9  LEU A HA   1  
ATOM 131    H HB2  . LEU A  1 9  ? -17.576 14.887  -278.641 1.00 0.00 ?  9  LEU A HB2  1  
ATOM 132    H HB3  . LEU A  1 9  ? -17.082 14.025  -277.165 1.00 0.00 ?  9  LEU A HB3  1  
ATOM 133    H HG   . LEU A  1 9  ? -17.901 12.764  -279.812 1.00 0.00 ?  9  LEU A HG   1  
ATOM 134    H HD11 . LEU A  1 9  ? -15.512 12.000  -279.883 1.00 0.00 ?  9  LEU A HD11 1  
ATOM 135    H HD12 . LEU A  1 9  ? -15.622 13.775  -279.845 1.00 0.00 ?  9  LEU A HD12 1  
ATOM 136    H HD13 . LEU A  1 9  ? -15.202 12.877  -278.367 1.00 0.00 ?  9  LEU A HD13 1  
ATOM 137    H HD21 . LEU A  1 9  ? -18.624 11.414  -277.932 1.00 0.00 ?  9  LEU A HD21 1  
ATOM 138    H HD22 . LEU A  1 9  ? -17.263 10.621  -278.761 1.00 0.00 ?  9  LEU A HD22 1  
ATOM 139    H HD23 . LEU A  1 9  ? -16.993 11.476  -277.222 1.00 0.00 ?  9  LEU A HD23 1  
ATOM 140    N N    . ASP A  1 10 ? -19.633 16.357  -277.128 1.00 0.00 ?  10 ASP A N    1  
ATOM 141    C CA   . ASP A  1 10 ? -20.142 17.410  -276.257 1.00 0.00 ?  10 ASP A CA   1  
ATOM 142    C C    . ASP A  1 10 ? -21.478 17.017  -275.639 1.00 0.00 ?  10 ASP A C    1  
ATOM 143    O O    . ASP A  1 10 ? -21.694 17.193  -274.440 1.00 0.00 ?  10 ASP A O    1  
ATOM 144    C CB   . ASP A  1 10 ? -20.286 18.723  -277.031 1.00 0.00 ?  10 ASP A CB   1  
ATOM 145    C CG   . ASP A  1 10 ? -18.965 19.376  -277.413 1.00 0.00 ?  10 ASP A CG   1  
ATOM 146    O OD1  . ASP A  1 10 ? -17.958 19.007  -276.856 1.00 0.00 ?  10 ASP A OD1  1  
ATOM 147    O OD2  . ASP A  1 10 ? -18.947 20.122  -278.363 1.00 0.00 -1 10 ASP A OD2  1  
ATOM 148    H H    . ASP A  1 10 ? -19.420 16.575  -278.091 1.00 0.00 ?  10 ASP A H    1  
ATOM 149    H HA   . ASP A  1 10 ? -19.452 17.569  -275.428 1.00 0.00 ?  10 ASP A HA   1  
ATOM 150    H HB2  . ASP A  1 10 ? -20.918 18.639  -277.915 1.00 0.00 ?  10 ASP A HB2  1  
ATOM 151    H HB3  . ASP A  1 10 ? -20.789 19.334  -276.280 1.00 0.00 ?  10 ASP A HB3  1  
ATOM 152    N N    . ASP A  1 11 ? -22.372 16.485  -276.466 1.00 0.00 ?  11 ASP A N    1  
ATOM 153    C CA   . ASP A  1 11 ? -23.683 16.050  -275.999 1.00 0.00 ?  11 ASP A CA   1  
ATOM 154    C C    . ASP A  1 11 ? -23.562 14.888  -275.021 1.00 0.00 ?  11 ASP A C    1  
ATOM 155    O O    . ASP A  1 11 ? -24.316 14.798  -274.053 1.00 0.00 ?  11 ASP A O    1  
ATOM 156    C CB   . ASP A  1 11 ? -24.568 15.652  -277.182 1.00 0.00 ?  11 ASP A CB   1  
ATOM 157    C CG   . ASP A  1 11 ? -25.024 16.818  -278.048 1.00 0.00 ?  11 ASP A CG   1  
ATOM 158    O OD1  . ASP A  1 11 ? -24.856 17.941  -277.634 1.00 0.00 ?  11 ASP A OD1  1  
ATOM 159    O OD2  . ASP A  1 11 ? -25.389 16.588  -279.175 1.00 0.00 -1 11 ASP A OD2  1  
ATOM 160    H H    . ASP A  1 11 ? -22.137 16.378  -277.442 1.00 0.00 ?  11 ASP A H    1  
ATOM 161    H HA   . ASP A  1 11 ? -24.169 16.862  -275.457 1.00 0.00 ?  11 ASP A HA   1  
ATOM 162    H HB2  . ASP A  1 11 ? -24.128 14.881  -277.814 1.00 0.00 ?  11 ASP A HB2  1  
ATOM 163    H HB3  . ASP A  1 11 ? -25.426 15.239  -276.649 1.00 0.00 ?  11 ASP A HB3  1  
ATOM 164    N N    . VAL A  1 12 ? -22.608 14.000  -275.280 1.00 0.00 ?  12 VAL A N    1  
ATOM 165    C CA   . VAL A  1 12 ? -22.343 12.878  -274.388 1.00 0.00 ?  12 VAL A CA   1  
ATOM 166    C C    . VAL A  1 12 ? -21.921 13.361  -273.006 1.00 0.00 ?  12 VAL A C    1  
ATOM 167    O O    . VAL A  1 12 ? -22.397 12.856  -271.989 1.00 0.00 ?  12 VAL A O    1  
ATOM 168    C CB   . VAL A  1 12 ? -21.250 11.952  -274.954 1.00 0.00 ?  12 VAL A CB   1  
ATOM 169    C CG1  . VAL A  1 12 ? -20.815 10.940  -273.905 1.00 0.00 ?  12 VAL A CG1  1  
ATOM 170    C CG2  . VAL A  1 12 ? -21.748 11.241  -276.203 1.00 0.00 ?  12 VAL A CG2  1  
ATOM 171    H H    . VAL A  1 12 ? -22.052 14.106  -276.117 1.00 0.00 ?  12 VAL A H    1  
ATOM 172    H HA   . VAL A  1 12 ? -23.244 12.288  -274.215 1.00 0.00 ?  12 VAL A HA   1  
ATOM 173    H HB   . VAL A  1 12 ? -20.394 12.556  -275.253 1.00 0.00 ?  12 VAL A HB   1  
ATOM 174    H HG11 . VAL A  1 12 ? -20.042 10.293  -274.322 1.00 0.00 ?  12 VAL A HG11 1  
ATOM 175    H HG12 . VAL A  1 12 ? -20.418 11.464  -273.035 1.00 0.00 ?  12 VAL A HG12 1  
ATOM 176    H HG13 . VAL A  1 12 ? -21.670 10.334  -273.606 1.00 0.00 ?  12 VAL A HG13 1  
ATOM 177    H HG21 . VAL A  1 12 ? -22.014 11.979  -276.960 1.00 0.00 ?  12 VAL A HG21 1  
ATOM 178    H HG22 . VAL A  1 12 ? -20.964 10.592  -276.590 1.00 0.00 ?  12 VAL A HG22 1  
ATOM 179    H HG23 . VAL A  1 12 ? -22.626 10.644  -275.955 1.00 0.00 ?  12 VAL A HG23 1  
ATOM 180    N N    . SER A  1 13 ? -21.024 14.341  -272.976 1.00 0.00 ?  13 SER A N    1  
ATOM 181    C CA   . SER A  1 13 ? -20.605 14.957  -271.723 1.00 0.00 ?  13 SER A CA   1  
ATOM 182    C C    . SER A  1 13 ? -21.788 15.578  -270.991 1.00 0.00 ?  13 SER A C    1  
ATOM 183    O O    . SER A  1 13 ? -21.924 15.433  -269.776 1.00 0.00 ?  13 SER A O    1  
ATOM 184    C CB   . SER A  1 13 ? -19.539 16.002  -271.986 1.00 0.00 ?  13 SER A CB   1  
ATOM 185    O OG   . SER A  1 13 ? -19.151 16.666  -270.814 1.00 0.00 ?  13 SER A OG   1  
ATOM 186    H H    . SER A  1 13 ? -20.623 14.667  -273.843 1.00 0.00 ?  13 SER A H    1  
ATOM 187    H HA   . SER A  1 13 ? -20.076 14.271  -271.059 1.00 0.00 ?  13 SER A HA   1  
ATOM 188    H HB2  . SER A  1 13 ? -18.668 15.510  -272.420 1.00 0.00 ?  13 SER A HB2  1  
ATOM 189    H HB3  . SER A  1 13 ? -19.932 16.732  -272.693 1.00 0.00 ?  13 SER A HB3  1  
ATOM 190    H HG   . SER A  1 13 ? -18.772 17.518  -271.041 1.00 0.00 ?  13 SER A HG   1  
ATOM 191    N N    . ALA A  1 14 ? -22.642 16.270  -271.738 1.00 0.00 ?  14 ALA A N    1  
ATOM 192    C CA   . ALA A  1 14 ? -23.832 16.889  -271.167 1.00 0.00 ?  14 ALA A CA   1  
ATOM 193    C C    . ALA A  1 14 ? -24.801 15.838  -270.641 1.00 0.00 ?  14 ALA A C    1  
ATOM 194    O O    . ALA A  1 14 ? -25.415 16.018  -269.589 1.00 0.00 ?  14 ALA A O    1  
ATOM 195    C CB   . ALA A  1 14 ? -24.515 17.775  -272.199 1.00 0.00 ?  14 ALA A CB   1  
ATOM 196    H H    . ALA A  1 14 ? -22.461 16.369  -272.727 1.00 0.00 ?  14 ALA A H    1  
ATOM 197    H HA   . ALA A  1 14 ? -23.532 17.508  -270.321 1.00 0.00 ?  14 ALA A HA   1  
ATOM 198    H HB1  . ALA A  1 14 ? -24.807 17.174  -273.058 1.00 0.00 ?  14 ALA A HB1  1  
ATOM 199    H HB2  . ALA A  1 14 ? -25.401 18.230  -271.756 1.00 0.00 ?  14 ALA A HB2  1  
ATOM 200    H HB3  . ALA A  1 14 ? -23.827 18.558  -272.519 1.00 0.00 ?  14 ALA A HB3  1  
ATOM 201    N N    . LYS A  1 15 ? -24.933 14.741  -271.378 1.00 0.00 ?  15 LYS A N    1  
ATOM 202    C CA   . LYS A  1 15 ? -25.853 13.673  -271.004 1.00 0.00 ?  15 LYS A CA   1  
ATOM 203    C C    . LYS A  1 15 ? -25.464 13.054  -269.667 1.00 0.00 ?  15 LYS A C    1  
ATOM 204    O O    . LYS A  1 15 ? -26.321 12.773  -268.830 1.00 0.00 ?  15 LYS A O    1  
ATOM 205    C CB   . LYS A  1 15 ? -25.893 12.596  -272.090 1.00 0.00 ?  15 LYS A CB   1  
ATOM 206    C CG   . LYS A  1 15 ? -26.716 12.970  -273.315 1.00 0.00 ?  15 LYS A CG   1  
ATOM 207    C CD   . LYS A  1 15 ? -26.571 11.931  -274.417 1.00 0.00 ?  15 LYS A CD   1  
ATOM 208    C CE   . LYS A  1 15 ? -27.296 12.361  -275.684 1.00 0.00 ?  15 LYS A CE   1  
ATOM 209    N NZ   . LYS A  1 15 ? -28.773 12.372  -275.503 1.00 0.00 1  15 LYS A NZ   1  
ATOM 210    H H    . LYS A  1 15 ? -24.383 14.644  -272.219 1.00 0.00 ?  15 LYS A H    1  
ATOM 211    H HA   . LYS A  1 15 ? -26.857 14.078  -270.878 1.00 0.00 ?  15 LYS A HA   1  
ATOM 212    H HB2  . LYS A  1 15 ? -24.863 12.405  -272.389 1.00 0.00 ?  15 LYS A HB2  1  
ATOM 213    H HB3  . LYS A  1 15 ? -26.311 11.698  -271.634 1.00 0.00 ?  15 LYS A HB3  1  
ATOM 214    H HG2  . LYS A  1 15 ? -27.763 13.044  -273.020 1.00 0.00 ?  15 LYS A HG2  1  
ATOM 215    H HG3  . LYS A  1 15 ? -26.373 13.938  -273.680 1.00 0.00 ?  15 LYS A HG3  1  
ATOM 216    H HD2  . LYS A  1 15 ? -25.510 11.800  -274.633 1.00 0.00 ?  15 LYS A HD2  1  
ATOM 217    H HD3  . LYS A  1 15 ? -26.988 10.989  -274.063 1.00 0.00 ?  15 LYS A HD3  1  
ATOM 218    H HE2  . LYS A  1 15 ? -26.957 13.361  -275.950 1.00 0.00 ?  15 LYS A HE2  1  
ATOM 219    H HE3  . LYS A  1 15 ? -27.034 11.666  -276.481 1.00 0.00 ?  15 LYS A HE3  1  
ATOM 220    H HZ1  . LYS A  1 15 ? -29.017 13.017  -274.765 1.00 0.00 ?  15 LYS A HZ1  1  
ATOM 221    H HZ2  . LYS A  1 15 ? -29.216 12.661  -276.364 1.00 0.00 ?  15 LYS A HZ2  1  
ATOM 222    H HZ3  . LYS A  1 15 ? -29.089 11.444  -275.257 1.00 0.00 ?  15 LYS A HZ3  1  
ATOM 223    N N    . PHE A  1 16 ? -24.166 12.844  -269.474 1.00 0.00 ?  16 PHE A N    1  
ATOM 224    C CA   . PHE A  1 16 ? -23.650 12.357  -268.200 1.00 0.00 ?  16 PHE A CA   1  
ATOM 225    C C    . PHE A  1 16 ? -23.874 13.376  -267.090 1.00 0.00 ?  16 PHE A C    1  
ATOM 226    O O    . PHE A  1 16 ? -24.387 13.042  -266.022 1.00 0.00 ?  16 PHE A O    1  
ATOM 227    C CB   . PHE A  1 16 ? -22.162 12.025  -268.317 1.00 0.00 ?  16 PHE A CB   1  
ATOM 228    C CG   . PHE A  1 16 ? -21.554 11.509  -267.044 1.00 0.00 ?  16 PHE A CG   1  
ATOM 229    C CD1  . PHE A  1 16 ? -21.598 10.157  -266.736 1.00 0.00 ?  16 PHE A CD1  1  
ATOM 230    C CD2  . PHE A  1 16 ? -20.937 12.373  -266.153 1.00 0.00 ?  16 PHE A CD2  1  
ATOM 231    C CE1  . PHE A  1 16 ? -21.039 9.681   -265.565 1.00 0.00 ?  16 PHE A CE1  1  
ATOM 232    C CE2  . PHE A  1 16 ? -20.376 11.900  -264.982 1.00 0.00 ?  16 PHE A CE2  1  
ATOM 233    C CZ   . PHE A  1 16 ? -20.428 10.552  -264.688 1.00 0.00 ?  16 PHE A CZ   1  
ATOM 234    H H    . PHE A  1 16 ? -23.520 13.026  -270.228 1.00 0.00 ?  16 PHE A H    1  
ATOM 235    H HA   . PHE A  1 16 ? -24.187 11.454  -267.904 1.00 0.00 ?  16 PHE A HA   1  
ATOM 236    H HB2  . PHE A  1 16 ? -22.008 11.254  -269.071 1.00 0.00 ?  16 PHE A HB2  1  
ATOM 237    H HB3  . PHE A  1 16 ? -21.600 12.917  -268.591 1.00 0.00 ?  16 PHE A HB3  1  
ATOM 238    H HD1  . PHE A  1 16 ? -22.080 9.468   -267.430 1.00 0.00 ?  16 PHE A HD1  1  
ATOM 239    H HD2  . PHE A  1 16 ? -20.896 13.438  -266.385 1.00 0.00 ?  16 PHE A HD2  1  
ATOM 240    H HE1  . PHE A  1 16 ? -21.081 8.617   -265.335 1.00 0.00 ?  16 PHE A HE1  1  
ATOM 241    H HE2  . PHE A  1 16 ? -19.893 12.590  -264.290 1.00 0.00 ?  16 PHE A HE2  1  
ATOM 242    H HZ   . PHE A  1 16 ? -19.988 10.178  -263.765 1.00 0.00 ?  16 PHE A HZ   1  
ATOM 243    N N    . ASP A  1 17 ? -23.485 14.620  -267.348 1.00 0.00 ?  17 ASP A N    1  
ATOM 244    C CA   . ASP A  1 17 ? -23.561 15.671  -266.341 1.00 0.00 ?  17 ASP A CA   1  
ATOM 245    C C    . ASP A  1 17 ? -25.004 15.938  -265.932 1.00 0.00 ?  17 ASP A C    1  
ATOM 246    O O    . ASP A  1 17 ? -25.274 16.334  -264.798 1.00 0.00 ?  17 ASP A O    1  
ATOM 247    C CB   . ASP A  1 17 ? -22.915 16.959  -266.859 1.00 0.00 ?  17 ASP A CB   1  
ATOM 248    C CG   . ASP A  1 17 ? -21.393 16.930  -266.890 1.00 0.00 ?  17 ASP A CG   1  
ATOM 249    O OD1  . ASP A  1 17 ? -20.823 16.046  -266.296 1.00 0.00 ?  17 ASP A OD1  1  
ATOM 250    O OD2  . ASP A  1 17 ? -20.819 17.693  -267.630 1.00 0.00 -1 17 ASP A OD2  1  
ATOM 251    H H    . ASP A  1 17 ? -23.127 14.843  -268.266 1.00 0.00 ?  17 ASP A H    1  
ATOM 252    H HA   . ASP A  1 17 ? -23.036 15.357  -265.439 1.00 0.00 ?  17 ASP A HA   1  
ATOM 253    H HB2  . ASP A  1 17 ? -23.292 17.272  -267.833 1.00 0.00 ?  17 ASP A HB2  1  
ATOM 254    H HB3  . ASP A  1 17 ? -23.250 17.662  -266.096 1.00 0.00 ?  17 ASP A HB3  1  
ATOM 255    N N    . THR A  1 18 ? -25.927 15.720  -266.861 1.00 0.00 ?  18 THR A N    1  
ATOM 256    C CA   . THR A  1 18 ? -27.345 15.939  -266.600 1.00 0.00 ?  18 THR A CA   1  
ATOM 257    C C    . THR A  1 18 ? -27.779 15.254  -265.310 1.00 0.00 ?  18 THR A C    1  
ATOM 258    O O    . THR A  1 18 ? -28.514 15.829  -264.507 1.00 0.00 ?  18 THR A O    1  
ATOM 259    C CB   . THR A  1 18 ? -28.219 15.428  -267.760 1.00 0.00 ?  18 THR A CB   1  
ATOM 260    O OG1  . THR A  1 18 ? -27.925 16.173  -268.948 1.00 0.00 ?  18 THR A OG1  1  
ATOM 261    C CG2  . THR A  1 18 ? -29.695 15.580  -267.423 1.00 0.00 ?  18 THR A CG2  1  
ATOM 262    H H    . THR A  1 18 ? -25.640 15.394  -267.773 1.00 0.00 ?  18 THR A H    1  
ATOM 263    H HA   . THR A  1 18 ? -27.535 17.003  -266.462 1.00 0.00 ?  18 THR A HA   1  
ATOM 264    H HB   . THR A  1 18 ? -27.995 14.376  -267.936 1.00 0.00 ?  18 THR A HB   1  
ATOM 265    H HG1  . THR A  1 18 ? -28.470 15.852  -269.670 1.00 0.00 ?  18 THR A HG1  1  
ATOM 266    H HG21 . THR A  1 18 ? -30.296 15.213  -268.254 1.00 0.00 ?  18 THR A HG21 1  
ATOM 267    H HG22 . THR A  1 18 ? -29.924 15.005  -266.526 1.00 0.00 ?  18 THR A HG22 1  
ATOM 268    H HG23 . THR A  1 18 ? -29.920 16.631  -267.247 1.00 0.00 ?  18 THR A HG23 1  
ATOM 269    N N    . GLY A  1 19 ? -27.320 14.022  -265.117 1.00 0.00 ?  19 GLY A N    1  
ATOM 270    C CA   . GLY A  1 19 ? -27.782 13.197  -264.007 1.00 0.00 ?  19 GLY A CA   1  
ATOM 271    C C    . GLY A  1 19 ? -27.007 13.506  -262.732 1.00 0.00 ?  19 GLY A C    1  
ATOM 272    O O    . GLY A  1 19 ? -27.407 13.106  -261.639 1.00 0.00 ?  19 GLY A O    1  
ATOM 273    H H    . GLY A  1 19 ? -26.634 13.647  -265.756 1.00 0.00 ?  19 GLY A H    1  
ATOM 274    H HA2  . GLY A  1 19 ? -28.841 13.392  -263.835 1.00 0.00 ?  19 GLY A HA2  1  
ATOM 275    H HA3  . GLY A  1 19 ? -27.644 12.147  -264.261 1.00 0.00 ?  19 GLY A HA3  1  
ATOM 276    N N    . VAL A  1 20 ? -25.896 14.219  -262.879 1.00 0.00 ?  20 VAL A N    1  
ATOM 277    C CA   . VAL A  1 20 ? -25.044 14.554  -261.744 1.00 0.00 ?  20 VAL A CA   1  
ATOM 278    C C    . VAL A  1 20 ? -24.698 16.037  -261.734 1.00 0.00 ?  20 VAL A C    1  
ATOM 279    O O    . VAL A  1 20 ? -23.666 16.440  -261.197 1.00 0.00 ?  20 VAL A O    1  
ATOM 280    C CB   . VAL A  1 20 ? -23.741 13.732  -261.753 1.00 0.00 ?  20 VAL A CB   1  
ATOM 281    C CG1  . VAL A  1 20 ? -24.029 12.273  -261.431 1.00 0.00 ?  20 VAL A CG1  1  
ATOM 282    C CG2  . VAL A  1 20 ? -23.046 13.851  -263.101 1.00 0.00 ?  20 VAL A CG2  1  
ATOM 283    H H    . VAL A  1 20 ? -25.634 14.537  -263.801 1.00 0.00 ?  20 VAL A H    1  
ATOM 284    H HA   . VAL A  1 20 ? -25.558 14.380  -260.798 1.00 0.00 ?  20 VAL A HA   1  
ATOM 285    H HB   . VAL A  1 20 ? -23.060 14.141  -261.007 1.00 0.00 ?  20 VAL A HB   1  
ATOM 286    H HG11 . VAL A  1 20 ? -23.097 11.708  -261.442 1.00 0.00 ?  20 VAL A HG11 1  
ATOM 287    H HG12 . VAL A  1 20 ? -24.485 12.202  -260.444 1.00 0.00 ?  20 VAL A HG12 1  
ATOM 288    H HG13 . VAL A  1 20 ? -24.710 11.864  -262.177 1.00 0.00 ?  20 VAL A HG13 1  
ATOM 289    H HG21 . VAL A  1 20 ? -22.806 14.897  -263.295 1.00 0.00 ?  20 VAL A HG21 1  
ATOM 290    H HG22 . VAL A  1 20 ? -22.127 13.266  -263.089 1.00 0.00 ?  20 VAL A HG22 1  
ATOM 291    H HG23 . VAL A  1 20 ? -23.705 13.478  -263.884 1.00 0.00 ?  20 VAL A HG23 1  
ATOM 292    N N    . ASP A  1 21 ? -25.566 16.846  -262.331 1.00 0.00 ?  21 ASP A N    1  
ATOM 293    C CA   . ASP A  1 21 ? -25.396 18.294  -262.320 1.00 0.00 ?  21 ASP A CA   1  
ATOM 294    C C    . ASP A  1 21 ? -25.355 18.834  -260.896 1.00 0.00 ?  21 ASP A C    1  
ATOM 295    O O    . ASP A  1 21 ? -24.617 19.774  -260.600 1.00 0.00 ?  21 ASP A O    1  
ATOM 296    C CB   . ASP A  1 21 ? -26.520 18.972  -263.107 1.00 0.00 ?  21 ASP A CB   1  
ATOM 297    C CG   . ASP A  1 21 ? -26.335 20.471  -263.304 1.00 0.00 ?  21 ASP A CG   1  
ATOM 298    O OD1  . ASP A  1 21 ? -25.369 20.855  -263.920 1.00 0.00 ?  21 ASP A OD1  1  
ATOM 299    O OD2  . ASP A  1 21 ? -27.234 21.208  -262.977 1.00 0.00 -1 21 ASP A OD2  1  
ATOM 300    H H    . ASP A  1 21 ? -26.365 16.448  -262.804 1.00 0.00 ?  21 ASP A H    1  
ATOM 301    H HA   . ASP A  1 21 ? -24.442 18.557  -262.779 1.00 0.00 ?  21 ASP A HA   1  
ATOM 302    H HB2  . ASP A  1 21 ? -26.721 18.502  -264.070 1.00 0.00 ?  21 ASP A HB2  1  
ATOM 303    H HB3  . ASP A  1 21 ? -27.359 18.796  -262.433 1.00 0.00 ?  21 ASP A HB3  1  
ATOM 304    N N    . ASN A  1 22 ? -26.151 18.234  -260.018 1.00 0.00 ?  22 ASN A N    1  
ATOM 305    C CA   . ASN A  1 22 ? -26.233 18.676  -258.631 1.00 0.00 ?  22 ASN A CA   1  
ATOM 306    C C    . ASN A  1 22 ? -25.056 18.156  -257.817 1.00 0.00 ?  22 ASN A C    1  
ATOM 307    O O    . ASN A  1 22 ? -24.649 18.772  -256.832 1.00 0.00 ?  22 ASN A O    1  
ATOM 308    C CB   . ASN A  1 22 ? -27.542 18.253  -257.991 1.00 0.00 ?  22 ASN A CB   1  
ATOM 309    C CG   . ASN A  1 22 ? -28.740 18.998  -258.512 1.00 0.00 ?  22 ASN A CG   1  
ATOM 310    O OD1  . ASN A  1 22 ? -28.622 20.106  -259.049 1.00 0.00 ?  22 ASN A OD1  1  
ATOM 311    N ND2  . ASN A  1 22 ? -29.899 18.435  -258.283 1.00 0.00 ?  22 ASN A ND2  1  
ATOM 312    H H    . ASN A  1 22 ? -26.714 17.452  -260.320 1.00 0.00 ?  22 ASN A H    1  
ATOM 313    H HA   . ASN A  1 22 ? -26.183 19.765  -258.587 1.00 0.00 ?  22 ASN A HA   1  
ATOM 314    H HB2  . ASN A  1 22 ? -27.796 17.198  -257.884 1.00 0.00 ?  22 ASN A HB2  1  
ATOM 315    H HB3  . ASN A  1 22 ? -27.271 18.661  -257.017 1.00 0.00 ?  22 ASN A HB3  1  
ATOM 316    H HD21 . ASN A  1 22 ? -29.944 17.566  -257.791 1.00 0.00 ?  22 ASN A HD21 1  
ATOM 317    H HD22 . ASN A  1 22 ? -30.739 18.874  -258.602 1.00 0.00 ?  22 ASN A HD22 1  
ATOM 318    N N    . LEU A  1 23 ? -24.512 17.017  -258.234 1.00 0.00 ?  23 LEU A N    1  
ATOM 319    C CA   . LEU A  1 23 ? -23.406 16.390  -257.520 1.00 0.00 ?  23 LEU A CA   1  
ATOM 320    C C    . LEU A  1 23 ? -22.271 17.379  -257.285 1.00 0.00 ?  23 LEU A C    1  
ATOM 321    O O    . LEU A  1 23 ? -21.771 17.511  -256.168 1.00 0.00 ?  23 LEU A O    1  
ATOM 322    C CB   . LEU A  1 23 ? -22.898 15.169  -258.297 1.00 0.00 ?  23 LEU A CB   1  
ATOM 323    C CG   . LEU A  1 23 ? -21.562 14.595  -257.809 1.00 0.00 ?  23 LEU A CG   1  
ATOM 324    C CD1  . LEU A  1 23 ? -21.661 14.219  -256.337 1.00 0.00 ?  23 LEU A CD1  1  
ATOM 325    C CD2  . LEU A  1 23 ? -21.191 13.383  -258.651 1.00 0.00 ?  23 LEU A CD2  1  
ATOM 326    H H    . LEU A  1 23 ? -24.874 16.575  -259.066 1.00 0.00 ?  23 LEU A H    1  
ATOM 327    H HA   . LEU A  1 23 ? -23.743 16.067  -256.535 1.00 0.00 ?  23 LEU A HA   1  
ATOM 328    H HB2  . LEU A  1 23 ? -23.706 14.472  -258.079 1.00 0.00 ?  23 LEU A HB2  1  
ATOM 329    H HB3  . LEU A  1 23 ? -22.862 15.360  -259.369 1.00 0.00 ?  23 LEU A HB3  1  
ATOM 330    H HG   . LEU A  1 23 ? -20.802 15.359  -257.973 1.00 0.00 ?  23 LEU A HG   1  
ATOM 331    H HD11 . LEU A  1 23 ? -20.707 13.813  -256.000 1.00 0.00 ?  23 LEU A HD11 1  
ATOM 332    H HD12 . LEU A  1 23 ? -21.903 15.106  -255.751 1.00 0.00 ?  23 LEU A HD12 1  
ATOM 333    H HD13 . LEU A  1 23 ? -22.441 13.471  -256.204 1.00 0.00 ?  23 LEU A HD13 1  
ATOM 334    H HD21 . LEU A  1 23 ? -21.098 13.680  -259.696 1.00 0.00 ?  23 LEU A HD21 1  
ATOM 335    H HD22 . LEU A  1 23 ? -20.241 12.976  -258.304 1.00 0.00 ?  23 LEU A HD22 1  
ATOM 336    H HD23 . LEU A  1 23 ? -21.968 12.623  -258.558 1.00 0.00 ?  23 LEU A HD23 1  
ATOM 337    N N    . GLN A  1 24 ? -21.868 18.072  -258.345 1.00 0.00 ?  24 GLN A N    1  
ATOM 338    C CA   . GLN A  1 24 ? -20.790 19.049  -258.256 1.00 0.00 ?  24 GLN A CA   1  
ATOM 339    C C    . GLN A  1 24 ? -21.102 20.123  -257.222 1.00 0.00 ?  24 GLN A C    1  
ATOM 340    O O    . GLN A  1 24 ? -20.252 20.480  -256.408 1.00 0.00 ?  24 GLN A O    1  
ATOM 341    C CB   . GLN A  1 24 ? -20.544 19.701  -259.620 1.00 0.00 ?  24 GLN A CB   1  
ATOM 342    C CG   . GLN A  1 24 ? -19.397 20.697  -259.636 1.00 0.00 ?  24 GLN A CG   1  
ATOM 343    C CD   . GLN A  1 24 ? -19.184 21.312  -261.006 1.00 0.00 ?  24 GLN A CD   1  
ATOM 344    O OE1  . GLN A  1 24 ? -19.946 21.057  -261.942 1.00 0.00 ?  24 GLN A OE1  1  
ATOM 345    N NE2  . GLN A  1 24 ? -18.141 22.125  -261.133 1.00 0.00 ?  24 GLN A NE2  1  
ATOM 346    H H    . GLN A  1 24 ? -22.321 17.918  -259.234 1.00 0.00 ?  24 GLN A H    1  
ATOM 347    H HA   . GLN A  1 24 ? -19.876 18.555  -257.924 1.00 0.00 ?  24 GLN A HA   1  
ATOM 348    H HB2  . GLN A  1 24 ? -20.340 18.893  -260.323 1.00 0.00 ?  24 GLN A HB2  1  
ATOM 349    H HB3  . GLN A  1 24 ? -21.470 20.201  -259.901 1.00 0.00 ?  24 GLN A HB3  1  
ATOM 350    H HG2  . GLN A  1 24 ? -19.293 21.488  -258.894 1.00 0.00 ?  24 GLN A HG2  1  
ATOM 351    H HG3  . GLN A  1 24 ? -18.625 19.944  -259.472 1.00 0.00 ?  24 GLN A HG3  1  
ATOM 352    H HE21 . GLN A  1 24 ? -17.547 22.303  -260.348 1.00 0.00 ?  24 GLN A HE21 1  
ATOM 353    H HE22 . GLN A  1 24 ? -17.950 22.560  -262.014 1.00 0.00 ?  24 GLN A HE22 1  
ATOM 354    N N    . THR A  1 25 ? -22.328 20.634  -257.260 1.00 0.00 ?  25 THR A N    1  
ATOM 355    C CA   . THR A  1 25 ? -22.747 21.689  -256.345 1.00 0.00 ?  25 THR A CA   1  
ATOM 356    C C    . THR A  1 25 ? -22.764 21.194  -254.905 1.00 0.00 ?  25 THR A C    1  
ATOM 357    O O    . THR A  1 25 ? -22.355 21.907  -253.988 1.00 0.00 ?  25 THR A O    1  
ATOM 358    C CB   . THR A  1 25 ? -24.142 22.231  -256.707 1.00 0.00 ?  25 THR A CB   1  
ATOM 359    O OG1  . THR A  1 25 ? -24.107 22.812  -258.017 1.00 0.00 ?  25 THR A OG1  1  
ATOM 360    C CG2  . THR A  1 25 ? -24.584 23.283  -255.702 1.00 0.00 ?  25 THR A CG2  1  
ATOM 361    H H    . THR A  1 25 ? -22.987 20.283  -257.941 1.00 0.00 ?  25 THR A H    1  
ATOM 362    H HA   . THR A  1 25 ? -22.033 22.512  -256.380 1.00 0.00 ?  25 THR A HA   1  
ATOM 363    H HB   . THR A  1 25 ? -24.854 21.406  -256.705 1.00 0.00 ?  25 THR A HB   1  
ATOM 364    H HG1  . THR A  1 25 ? -23.852 22.143  -258.657 1.00 0.00 ?  25 THR A HG1  1  
ATOM 365    H HG21 . THR A  1 25 ? -25.572 23.654  -255.974 1.00 0.00 ?  25 THR A HG21 1  
ATOM 366    H HG22 . THR A  1 25 ? -24.622 22.841  -254.706 1.00 0.00 ?  25 THR A HG22 1  
ATOM 367    H HG23 . THR A  1 25 ? -23.873 24.108  -255.705 1.00 0.00 ?  25 THR A HG23 1  
ATOM 368    N N    . GLN A  1 26 ? -23.240 19.968  -254.711 1.00 0.00 ?  26 GLN A N    1  
ATOM 369    C CA   . GLN A  1 26 ? -23.367 19.398  -253.376 1.00 0.00 ?  26 GLN A CA   1  
ATOM 370    C C    . GLN A  1 26 ? -22.004 19.220  -252.720 1.00 0.00 ?  26 GLN A C    1  
ATOM 371    O O    . GLN A  1 26 ? -21.812 19.577  -251.557 1.00 0.00 ?  26 GLN A O    1  
ATOM 372    C CB   . GLN A  1 26 ? -24.091 18.050  -253.435 1.00 0.00 ?  26 GLN A CB   1  
ATOM 373    C CG   . GLN A  1 26 ? -25.579 18.155  -253.723 1.00 0.00 ?  26 GLN A CG   1  
ATOM 374    C CD   . GLN A  1 26 ? -26.244 16.796  -253.833 1.00 0.00 ?  26 GLN A CD   1  
ATOM 375    O OE1  . GLN A  1 26 ? -25.594 15.757  -253.686 1.00 0.00 ?  26 GLN A OE1  1  
ATOM 376    N NE2  . GLN A  1 26 ? -27.546 16.795  -254.097 1.00 0.00 ?  26 GLN A NE2  1  
ATOM 377    H H    . GLN A  1 26 ? -23.520 19.418  -255.510 1.00 0.00 ?  26 GLN A H    1  
ATOM 378    H HA   . GLN A  1 26 ? -23.931 20.080  -252.739 1.00 0.00 ?  26 GLN A HA   1  
ATOM 379    H HB2  . GLN A  1 26 ? -23.604 17.466  -254.216 1.00 0.00 ?  26 GLN A HB2  1  
ATOM 380    H HB3  . GLN A  1 26 ? -23.936 17.567  -252.471 1.00 0.00 ?  26 GLN A HB3  1  
ATOM 381    H HG2  . GLN A  1 26 ? -26.244 18.809  -253.159 1.00 0.00 ?  26 GLN A HG2  1  
ATOM 382    H HG3  . GLN A  1 26 ? -25.445 18.556  -254.728 1.00 0.00 ?  26 GLN A HG3  1  
ATOM 383    H HE21 . GLN A  1 26 ? -28.034 17.661  -254.210 1.00 0.00 ?  26 GLN A HE21 1  
ATOM 384    H HE22 . GLN A  1 26 ? -28.039 15.929  -254.181 1.00 0.00 ?  26 GLN A HE22 1  
ATOM 385    N N    . VAL A  1 27 ? -21.059 18.667  -253.472 1.00 0.00 ?  27 VAL A N    1  
ATOM 386    C CA   . VAL A  1 27 ? -19.732 18.373  -252.943 1.00 0.00 ?  27 VAL A CA   1  
ATOM 387    C C    . VAL A  1 27 ? -18.906 19.643  -252.790 1.00 0.00 ?  27 VAL A C    1  
ATOM 388    O O    . VAL A  1 27 ? -18.013 19.717  -251.946 1.00 0.00 ?  27 VAL A O    1  
ATOM 389    C CB   . VAL A  1 27 ? -18.971 17.382  -253.843 1.00 0.00 ?  27 VAL A CB   1  
ATOM 390    C CG1  . VAL A  1 27 ? -18.429 18.090  -255.075 1.00 0.00 ?  27 VAL A CG1  1  
ATOM 391    C CG2  . VAL A  1 27 ? -17.841 16.719  -253.070 1.00 0.00 ?  27 VAL A CG2  1  
ATOM 392    H H    . VAL A  1 27 ? -21.264 18.444  -254.435 1.00 0.00 ?  27 VAL A H    1  
ATOM 393    H HA   . VAL A  1 27 ? -19.791 17.955  -251.937 1.00 0.00 ?  27 VAL A HA   1  
ATOM 394    H HB   . VAL A  1 27 ? -19.652 16.588  -254.151 1.00 0.00 ?  27 VAL A HB   1  
ATOM 395    H HG11 . VAL A  1 27 ? -17.894 17.375  -255.701 1.00 0.00 ?  27 VAL A HG11 1  
ATOM 396    H HG12 . VAL A  1 27 ? -19.255 18.520  -255.641 1.00 0.00 ?  27 VAL A HG12 1  
ATOM 397    H HG13 . VAL A  1 27 ? -17.747 18.883  -254.768 1.00 0.00 ?  27 VAL A HG13 1  
ATOM 398    H HG21 . VAL A  1 27 ? -18.252 16.179  -252.217 1.00 0.00 ?  27 VAL A HG21 1  
ATOM 399    H HG22 . VAL A  1 27 ? -17.315 16.022  -253.721 1.00 0.00 ?  27 VAL A HG22 1  
ATOM 400    H HG23 . VAL A  1 27 ? -17.147 17.482  -252.717 1.00 0.00 ?  27 VAL A HG23 1  
ATOM 401    N N    . THR A  1 28 ? -19.209 20.642  -253.612 1.00 0.00 ?  28 THR A N    1  
ATOM 402    C CA   . THR A  1 28 ? -18.577 21.951  -253.493 1.00 0.00 ?  28 THR A CA   1  
ATOM 403    C C    . THR A  1 28 ? -19.027 22.666  -252.226 1.00 0.00 ?  28 THR A C    1  
ATOM 404    O O    . THR A  1 28 ? -18.212 23.237  -251.501 1.00 0.00 ?  28 THR A O    1  
ATOM 405    C CB   . THR A  1 28 ? -18.887 22.841  -254.711 1.00 0.00 ?  28 THR A CB   1  
ATOM 406    O OG1  . THR A  1 28 ? -18.328 22.252  -255.892 1.00 0.00 ?  28 THR A OG1  1  
ATOM 407    C CG2  . THR A  1 28 ? -18.303 24.232  -254.517 1.00 0.00 ?  28 THR A CG2  1  
ATOM 408    H H    . THR A  1 28 ? -19.894 20.491  -254.339 1.00 0.00 ?  28 THR A H    1  
ATOM 409    H HA   . THR A  1 28 ? -17.496 21.833  -253.413 1.00 0.00 ?  28 THR A HA   1  
ATOM 410    H HB   . THR A  1 28 ? -19.968 22.915  -254.830 1.00 0.00 ?  28 THR A HB   1  
ATOM 411    H HG1  . THR A  1 28 ? -18.546 21.317  -255.916 1.00 0.00 ?  28 THR A HG1  1  
ATOM 412    H HG21 . THR A  1 28 ? -18.533 24.846  -255.388 1.00 0.00 ?  28 THR A HG21 1  
ATOM 413    H HG22 . THR A  1 28 ? -18.735 24.687  -253.626 1.00 0.00 ?  28 THR A HG22 1  
ATOM 414    H HG23 . THR A  1 28 ? -17.223 24.159  -254.400 1.00 0.00 ?  28 THR A HG23 1  
ATOM 415    N N    . GLU A  1 29 ? -20.329 22.632  -251.964 1.00 0.00 ?  29 GLU A N    1  
ATOM 416    C CA   . GLU A  1 29 ? -20.882 23.221  -250.750 1.00 0.00 ?  29 GLU A CA   1  
ATOM 417    C C    . GLU A  1 29 ? -20.439 22.452  -249.513 1.00 0.00 ?  29 GLU A C    1  
ATOM 418    O O    . GLU A  1 29 ? -20.217 23.037  -248.453 1.00 0.00 ?  29 GLU A O    1  
ATOM 419    C CB   . GLU A  1 29 ? -22.410 23.263  -250.824 1.00 0.00 ?  29 GLU A CB   1  
ATOM 420    C CG   . GLU A  1 29 ? -22.965 24.289  -251.801 1.00 0.00 ?  29 GLU A CG   1  
ATOM 421    C CD   . GLU A  1 29 ? -24.462 24.192  -251.904 1.00 0.00 ?  29 GLU A CD   1  
ATOM 422    O OE1  . GLU A  1 29 ? -25.024 23.312  -251.298 1.00 0.00 ?  29 GLU A OE1  1  
ATOM 423    O OE2  . GLU A  1 29 ? -25.054 25.064  -252.497 1.00 0.00 -1 29 GLU A OE2  1  
ATOM 424    H H    . GLU A  1 29 ? -20.952 22.186  -252.622 1.00 0.00 ?  29 GLU A H    1  
ATOM 425    H HA   . GLU A  1 29 ? -20.511 24.240  -250.632 1.00 0.00 ?  29 GLU A HA   1  
ATOM 426    H HB2  . GLU A  1 29 ? -22.742 22.267  -251.116 1.00 0.00 ?  29 GLU A HB2  1  
ATOM 427    H HB3  . GLU A  1 29 ? -22.772 23.486  -249.820 1.00 0.00 ?  29 GLU A HB3  1  
ATOM 428    H HG2  . GLU A  1 29 ? -22.684 25.314  -251.560 1.00 0.00 ?  29 GLU A HG2  1  
ATOM 429    H HG3  . GLU A  1 29 ? -22.517 24.005  -252.752 1.00 0.00 ?  29 GLU A HG3  1  
ATOM 430    N N    . ALA A  1 30 ? -20.310 21.137  -249.654 1.00 0.00 ?  30 ALA A N    1  
ATOM 431    C CA   . ALA A  1 30 ? -19.790 20.298  -248.581 1.00 0.00 ?  30 ALA A CA   1  
ATOM 432    C C    . ALA A  1 30 ? -18.343 20.650  -248.260 1.00 0.00 ?  30 ALA A C    1  
ATOM 433    O O    . ALA A  1 30 ? -17.937 20.647  -247.098 1.00 0.00 ?  30 ALA A O    1  
ATOM 434    C CB   . ALA A  1 30 ? -19.911 18.827  -248.952 1.00 0.00 ?  30 ALA A CB   1  
ATOM 435    H H    . ALA A  1 30 ? -20.581 20.707  -250.527 1.00 0.00 ?  30 ALA A H    1  
ATOM 436    H HA   . ALA A  1 30 ? -20.376 20.479  -247.680 1.00 0.00 ?  30 ALA A HA   1  
ATOM 437    H HB1  . ALA A  1 30 ? -19.343 18.633  -249.860 1.00 0.00 ?  30 ALA A HB1  1  
ATOM 438    H HB2  . ALA A  1 30 ? -19.518 18.215  -248.141 1.00 0.00 ?  30 ALA A HB2  1  
ATOM 439    H HB3  . ALA A  1 30 ? -20.960 18.579  -249.119 1.00 0.00 ?  30 ALA A HB3  1  
ATOM 440    N N    . LEU A  1 31 ? -17.569 20.953  -249.297 1.00 0.00 ?  31 LEU A N    1  
ATOM 441    C CA   . LEU A  1 31 ? -16.204 21.434  -249.119 1.00 0.00 ?  31 LEU A CA   1  
ATOM 442    C C    . LEU A  1 31 ? -16.184 22.790  -248.425 1.00 0.00 ?  31 LEU A C    1  
ATOM 443    O O    . LEU A  1 31 ? -15.396 23.017  -247.507 1.00 0.00 ?  31 LEU A O    1  
ATOM 444    C CB   . LEU A  1 31 ? -15.491 21.518  -250.474 1.00 0.00 ?  31 LEU A CB   1  
ATOM 445    C CG   . LEU A  1 31 ? -14.052 22.049  -250.423 1.00 0.00 ?  31 LEU A CG   1  
ATOM 446    C CD1  . LEU A  1 31 ? -13.195 21.149  -249.544 1.00 0.00 ?  31 LEU A CD1  1  
ATOM 447    C CD2  . LEU A  1 31 ? -13.487 22.122  -251.834 1.00 0.00 ?  31 LEU A CD2  1  
ATOM 448    H H    . LEU A  1 31 ? -17.935 20.846  -250.232 1.00 0.00 ?  31 LEU A H    1  
ATOM 449    H HA   . LEU A  1 31 ? -15.656 20.749  -248.473 1.00 0.00 ?  31 LEU A HA   1  
ATOM 450    H HB2  . LEU A  1 31 ? -15.490 20.462  -250.740 1.00 0.00 ?  31 LEU A HB2  1  
ATOM 451    H HB3  . LEU A  1 31 ? -16.076 22.076  -251.205 1.00 0.00 ?  31 LEU A HB3  1  
ATOM 452    H HG   . LEU A  1 31 ? -14.096 23.064  -250.028 1.00 0.00 ?  31 LEU A HG   1  
ATOM 453    H HD11 . LEU A  1 31 ? -12.175 21.534  -249.514 1.00 0.00 ?  31 LEU A HD11 1  
ATOM 454    H HD12 . LEU A  1 31 ? -13.604 21.129  -248.534 1.00 0.00 ?  31 LEU A HD12 1  
ATOM 455    H HD13 . LEU A  1 31 ? -13.189 20.139  -249.953 1.00 0.00 ?  31 LEU A HD13 1  
ATOM 456    H HD21 . LEU A  1 31 ? -14.099 22.793  -252.437 1.00 0.00 ?  31 LEU A HD21 1  
ATOM 457    H HD22 . LEU A  1 31 ? -12.465 22.500  -251.796 1.00 0.00 ?  31 LEU A HD22 1  
ATOM 458    H HD23 . LEU A  1 31 ? -13.490 21.128  -252.280 1.00 0.00 ?  31 LEU A HD23 1  
ATOM 459    N N    . ASP A  1 32 ? -17.056 23.689  -248.869 1.00 0.00 ?  32 ASP A N    1  
ATOM 460    C CA   . ASP A  1 32 ? -17.126 25.032  -248.305 1.00 0.00 ?  32 ASP A CA   1  
ATOM 461    C C    . ASP A  1 32 ? -17.391 24.987  -246.806 1.00 0.00 ?  32 ASP A C    1  
ATOM 462    O O    . ASP A  1 32 ? -16.765 25.713  -246.033 1.00 0.00 ?  32 ASP A O    1  
ATOM 463    C CB   . ASP A  1 32 ? -18.211 25.852  -249.007 1.00 0.00 ?  32 ASP A CB   1  
ATOM 464    C CG   . ASP A  1 32 ? -17.857 26.282  -250.424 1.00 0.00 ?  32 ASP A CG   1  
ATOM 465    O OD1  . ASP A  1 32 ? -16.712 26.165  -250.791 1.00 0.00 ?  32 ASP A OD1  1  
ATOM 466    O OD2  . ASP A  1 32 ? -18.756 26.574  -251.177 1.00 0.00 -1 32 ASP A OD2  1  
ATOM 467    H H    . ASP A  1 32 ? -17.687 23.435  -249.616 1.00 0.00 ?  32 ASP A H    1  
ATOM 468    H HA   . ASP A  1 32 ? -16.169 25.537  -248.436 1.00 0.00 ?  32 ASP A HA   1  
ATOM 469    H HB2  . ASP A  1 32 ? -19.188 25.369  -249.008 1.00 0.00 ?  32 ASP A HB2  1  
ATOM 470    H HB3  . ASP A  1 32 ? -18.238 26.728  -248.358 1.00 0.00 ?  32 ASP A HB3  1  
ATOM 471    N N    . LYS A  1 33 ? -18.323 24.131  -246.400 1.00 0.00 ?  33 LYS A N    1  
ATOM 472    C CA   . LYS A  1 33 ? -18.656 23.973  -244.990 1.00 0.00 ?  33 LYS A CA   1  
ATOM 473    C C    . LYS A  1 33 ? -17.535 23.272  -244.234 1.00 0.00 ?  33 LYS A C    1  
ATOM 474    O O    . LYS A  1 33 ? -17.146 23.697  -243.146 1.00 0.00 ?  33 LYS A O    1  
ATOM 475    C CB   . LYS A  1 33 ? -19.963 23.194  -244.832 1.00 0.00 ?  33 LYS A CB   1  
ATOM 476    C CG   . LYS A  1 33 ? -21.203 23.944  -245.302 1.00 0.00 ?  33 LYS A CG   1  
ATOM 477    C CD   . LYS A  1 33 ? -22.452 23.086  -245.168 1.00 0.00 ?  33 LYS A CD   1  
ATOM 478    C CE   . LYS A  1 33 ? -23.677 23.801  -245.719 1.00 0.00 ?  33 LYS A CE   1  
ATOM 479    N NZ   . LYS A  1 33 ? -24.900 22.957  -245.634 1.00 0.00 1  33 LYS A NZ   1  
ATOM 480    H H    . LYS A  1 33 ? -18.813 23.576  -247.087 1.00 0.00 ?  33 LYS A H    1  
ATOM 481    H HA   . LYS A  1 33 ? -18.777 24.953  -244.527 1.00 0.00 ?  33 LYS A HA   1  
ATOM 482    H HB2  . LYS A  1 33 ? -19.857 22.273  -245.406 1.00 0.00 ?  33 LYS A HB2  1  
ATOM 483    H HB3  . LYS A  1 33 ? -20.066 22.952  -243.774 1.00 0.00 ?  33 LYS A HB3  1  
ATOM 484    H HG2  . LYS A  1 33 ? -21.313 24.845  -244.696 1.00 0.00 ?  33 LYS A HG2  1  
ATOM 485    H HG3  . LYS A  1 33 ? -21.064 24.224  -246.346 1.00 0.00 ?  33 LYS A HG3  1  
ATOM 486    H HD2  . LYS A  1 33 ? -22.296 22.156  -245.717 1.00 0.00 ?  33 LYS A HD2  1  
ATOM 487    H HD3  . LYS A  1 33 ? -22.608 22.862  -244.113 1.00 0.00 ?  33 LYS A HD3  1  
ATOM 488    H HE2  . LYS A  1 33 ? -23.826 24.715  -245.146 1.00 0.00 ?  33 LYS A HE2  1  
ATOM 489    H HE3  . LYS A  1 33 ? -23.484 24.054  -246.762 1.00 0.00 ?  33 LYS A HE3  1  
ATOM 490    H HZ1  . LYS A  1 33 ? -25.079 22.723  -244.668 1.00 0.00 ?  33 LYS A HZ1  1  
ATOM 491    H HZ2  . LYS A  1 33 ? -25.687 23.466  -246.009 1.00 0.00 ?  33 LYS A HZ2  1  
ATOM 492    H HZ3  . LYS A  1 33 ? -24.762 22.109  -246.166 1.00 0.00 ?  33 LYS A HZ3  1  
ATOM 493    N N    . LEU A  1 34 ? -17.017 22.196  -244.817 1.00 0.00 ?  34 LEU A N    1  
ATOM 494    C CA   . LEU A  1 34 ? -15.953 21.423  -244.190 1.00 0.00 ?  34 LEU A CA   1  
ATOM 495    C C    . LEU A  1 34 ? -14.720 22.282  -243.940 1.00 0.00 ?  34 LEU A C    1  
ATOM 496    O O    . LEU A  1 34 ? -14.020 22.107  -242.943 1.00 0.00 ?  34 LEU A O    1  
ATOM 497    C CB   . LEU A  1 34 ? -15.592 20.213  -245.062 1.00 0.00 ?  34 LEU A CB   1  
ATOM 498    C CG   . LEU A  1 34 ? -14.530 19.276  -244.472 1.00 0.00 ?  34 LEU A CG   1  
ATOM 499    C CD1  . LEU A  1 34 ? -15.030 18.677  -243.165 1.00 0.00 ?  34 LEU A CD1  1  
ATOM 500    C CD2  . LEU A  1 34 ? -14.203 18.182  -245.477 1.00 0.00 ?  34 LEU A CD2  1  
ATOM 501    H H    . LEU A  1 34 ? -17.370 21.907  -245.718 1.00 0.00 ?  34 LEU A H    1  
ATOM 502    H HA   . LEU A  1 34 ? -16.285 21.068  -243.215 1.00 0.00 ?  34 LEU A HA   1  
ATOM 503    H HB2  . LEU A  1 34 ? -16.560 19.715  -245.082 1.00 0.00 ?  34 LEU A HB2  1  
ATOM 504    H HB3  . LEU A  1 34 ? -15.316 20.512  -246.073 1.00 0.00 ?  34 LEU A HB3  1  
ATOM 505    H HG   . LEU A  1 34 ? -13.627 19.868  -244.317 1.00 0.00 ?  34 LEU A HG   1  
ATOM 506    H HD11 . LEU A  1 34 ? -14.270 18.014  -242.753 1.00 0.00 ?  34 LEU A HD11 1  
ATOM 507    H HD12 . LEU A  1 34 ? -15.236 19.477  -242.453 1.00 0.00 ?  34 LEU A HD12 1  
ATOM 508    H HD13 . LEU A  1 34 ? -15.943 18.112  -243.350 1.00 0.00 ?  34 LEU A HD13 1  
ATOM 509    H HD21 . LEU A  1 34 ? -13.821 18.631  -246.394 1.00 0.00 ?  34 LEU A HD21 1  
ATOM 510    H HD22 . LEU A  1 34 ? -13.447 17.517  -245.057 1.00 0.00 ?  34 LEU A HD22 1  
ATOM 511    H HD23 . LEU A  1 34 ? -15.105 17.612  -245.701 1.00 0.00 ?  34 LEU A HD23 1  
ATOM 512    N N    . ALA A  1 35 ? -14.459 23.212  -244.853 1.00 0.00 ?  35 ALA A N    1  
ATOM 513    C CA   . ALA A  1 35 ? -13.342 24.138  -244.706 1.00 0.00 ?  35 ALA A CA   1  
ATOM 514    C C    . ALA A  1 35 ? -13.435 24.910  -243.396 1.00 0.00 ?  35 ALA A C    1  
ATOM 515    O O    . ALA A  1 35 ? -12.420 25.197  -242.761 1.00 0.00 ?  35 ALA A O    1  
ATOM 516    C CB   . ALA A  1 35 ? -13.289 25.096  -245.887 1.00 0.00 ?  35 ALA A CB   1  
ATOM 517    H H    . ALA A  1 35 ? -15.050 23.280  -245.669 1.00 0.00 ?  35 ALA A H    1  
ATOM 518    H HA   . ALA A  1 35 ? -12.415 23.565  -244.681 1.00 0.00 ?  35 ALA A HA   1  
ATOM 519    H HB1  . ALA A  1 35 ? -14.216 25.665  -245.935 1.00 0.00 ?  35 ALA A HB1  1  
ATOM 520    H HB2  . ALA A  1 35 ? -12.449 25.779  -245.762 1.00 0.00 ?  35 ALA A HB2  1  
ATOM 521    H HB3  . ALA A  1 35 ? -13.161 24.530  -246.810 1.00 0.00 ?  35 ALA A HB3  1  
ATOM 522    N N    . ALA A  1 36 ? -14.658 25.243  -242.997 1.00 0.00 ?  36 ALA A N    1  
ATOM 523    C CA   . ALA A  1 36 ? -14.886 25.975  -241.757 1.00 0.00 ?  36 ALA A CA   1  
ATOM 524    C C    . ALA A  1 36 ? -14.648 25.088  -240.541 1.00 0.00 ?  36 ALA A C    1  
ATOM 525    O O    . ALA A  1 36 ? -14.042 25.515  -239.558 1.00 0.00 ?  36 ALA A O    1  
ATOM 526    C CB   . ALA A  1 36 ? -16.295 26.548  -241.732 1.00 0.00 ?  36 ALA A CB   1  
ATOM 527    H H    . ALA A  1 36 ? -15.449 24.981  -243.567 1.00 0.00 ?  36 ALA A H    1  
ATOM 528    H HA   . ALA A  1 36 ? -14.174 26.799  -241.702 1.00 0.00 ?  36 ALA A HA   1  
ATOM 529    H HB1  . ALA A  1 36 ? -17.018 25.737  -241.801 1.00 0.00 ?  36 ALA A HB1  1  
ATOM 530    H HB2  . ALA A  1 36 ? -16.449 27.092  -240.800 1.00 0.00 ?  36 ALA A HB2  1  
ATOM 531    H HB3  . ALA A  1 36 ? -16.427 27.227  -242.574 1.00 0.00 ?  36 ALA A HB3  1  
ATOM 532    N N    . LYS A  1 37 ? -15.128 23.852  -240.614 1.00 0.00 ?  37 LYS A N    1  
ATOM 533    C CA   . LYS A  1 37 ? -14.949 22.895  -239.529 1.00 0.00 ?  37 LYS A CA   1  
ATOM 534    C C    . LYS A  1 37 ? -14.499 21.539  -240.059 1.00 0.00 ?  37 LYS A C    1  
ATOM 535    O O    . LYS A  1 37 ? -15.298 20.610  -240.174 1.00 0.00 ?  37 LYS A O    1  
ATOM 536    C CB   . LYS A  1 37 ? -16.243 22.743  -238.729 1.00 0.00 ?  37 LYS A CB   1  
ATOM 537    C CG   . LYS A  1 37 ? -16.725 24.025  -238.063 1.00 0.00 ?  37 LYS A CG   1  
ATOM 538    C CD   . LYS A  1 37 ? -17.927 23.766  -237.168 1.00 0.00 ?  37 LYS A CD   1  
ATOM 539    C CE   . LYS A  1 37 ? -18.445 25.055  -236.548 1.00 0.00 ?  37 LYS A CE   1  
ATOM 540    N NZ   . LYS A  1 37 ? -19.615 24.815  -235.660 1.00 0.00 1  37 LYS A NZ   1  
ATOM 541    H H    . LYS A  1 37 ? -15.631 23.568  -241.443 1.00 0.00 ?  37 LYS A H    1  
ATOM 542    H HA   . LYS A  1 37 ? -14.163 23.242  -238.857 1.00 0.00 ?  37 LYS A HA   1  
ATOM 543    H HB2  . LYS A  1 37 ? -17.006 22.384  -239.420 1.00 0.00 ?  37 LYS A HB2  1  
ATOM 544    H HB3  . LYS A  1 37 ? -16.061 21.986  -237.966 1.00 0.00 ?  37 LYS A HB3  1  
ATOM 545    H HG2  . LYS A  1 37 ? -15.908 24.434  -237.467 1.00 0.00 ?  37 LYS A HG2  1  
ATOM 546    H HG3  . LYS A  1 37 ? -16.998 24.738  -238.841 1.00 0.00 ?  37 LYS A HG3  1  
ATOM 547    H HD2  . LYS A  1 37 ? -18.715 23.308  -237.767 1.00 0.00 ?  37 LYS A HD2  1  
ATOM 548    H HD3  . LYS A  1 37 ? -17.629 23.078  -236.376 1.00 0.00 ?  37 LYS A HD3  1  
ATOM 549    H HE2  . LYS A  1 37 ? -17.639 25.505  -235.971 1.00 0.00 ?  37 LYS A HE2  1  
ATOM 550    H HE3  . LYS A  1 37 ? -18.734 25.729  -237.354 1.00 0.00 ?  37 LYS A HE3  1  
ATOM 551    H HZ1  . LYS A  1 37 ? -19.348 24.191  -234.913 1.00 0.00 ?  37 LYS A HZ1  1  
ATOM 552    H HZ2  . LYS A  1 37 ? -19.928 25.693  -235.271 1.00 0.00 ?  37 LYS A HZ2  1  
ATOM 553    H HZ3  . LYS A  1 37 ? -20.365 24.398  -236.195 1.00 0.00 ?  37 LYS A HZ3  1  
ATOM 554    N N    . PRO A  1 38 ? -13.214 21.432  -240.382 1.00 0.00 ?  38 PRO A N    1  
ATOM 555    C CA   . PRO A  1 38 ? -12.661 20.198  -240.925 1.00 0.00 ?  38 PRO A CA   1  
ATOM 556    C C    . PRO A  1 38 ? -12.849 19.037  -239.957 1.00 0.00 ?  38 PRO A C    1  
ATOM 557    O O    . PRO A  1 38 ? -12.885 17.876  -240.364 1.00 0.00 ?  38 PRO A O    1  
ATOM 558    C CB   . PRO A  1 38 ? -11.181 20.521  -241.157 1.00 0.00 ?  38 PRO A CB   1  
ATOM 559    C CG   . PRO A  1 38 ? -11.142 22.005  -241.290 1.00 0.00 ?  38 PRO A CG   1  
ATOM 560    C CD   . PRO A  1 38 ? -12.198 22.518  -240.347 1.00 0.00 ?  38 PRO A CD   1  
ATOM 561    H HA   . PRO A  1 38 ? -13.161 19.879  -241.851 1.00 0.00 ?  38 PRO A HA   1  
ATOM 562    H HB2  . PRO A  1 38 ? -10.558 20.179  -240.318 1.00 0.00 ?  38 PRO A HB2  1  
ATOM 563    H HB3  . PRO A  1 38 ? -10.799 20.030  -242.064 1.00 0.00 ?  38 PRO A HB3  1  
ATOM 564    H HG2  . PRO A  1 38 ? -10.150 22.402  -241.026 1.00 0.00 ?  38 PRO A HG2  1  
ATOM 565    H HG3  . PRO A  1 38 ? -11.349 22.318  -242.324 1.00 0.00 ?  38 PRO A HG3  1  
ATOM 566    H HD2  . PRO A  1 38 ? -11.808 22.672  -239.330 1.00 0.00 ?  38 PRO A HD2  1  
ATOM 567    H HD3  . PRO A  1 38 ? -12.620 23.479  -240.679 1.00 0.00 ?  38 PRO A HD3  1  
ATOM 568    N N    . SER A  1 39 ? -12.968 19.357  -238.673 1.00 0.00 ?  39 SER A N    1  
ATOM 569    C CA   . SER A  1 39 ? -12.984 18.341  -237.628 1.00 0.00 ?  39 SER A CA   1  
ATOM 570    C C    . SER A  1 39 ? -14.403 17.865  -237.344 1.00 0.00 ?  39 SER A C    1  
ATOM 571    O O    . SER A  1 39 ? -14.641 17.123  -236.391 1.00 0.00 ?  39 SER A O    1  
ATOM 572    C CB   . SER A  1 39 ? -12.346 18.881  -236.363 1.00 0.00 ?  39 SER A CB   1  
ATOM 573    O OG   . SER A  1 39 ? -13.103 19.912  -235.790 1.00 0.00 ?  39 SER A OG   1  
ATOM 574    H H    . SER A  1 39 ? -13.049 20.330  -238.414 1.00 0.00 ?  39 SER A H    1  
ATOM 575    H HA   . SER A  1 39 ? -12.343 17.485  -237.846 1.00 0.00 ?  39 SER A HA   1  
ATOM 576    H HB2  . SER A  1 39 ? -12.253 18.067  -235.645 1.00 0.00 ?  39 SER A HB2  1  
ATOM 577    H HB3  . SER A  1 39 ? -11.355 19.263  -236.608 1.00 0.00 ?  39 SER A HB3  1  
ATOM 578    H HG   . SER A  1 39 ? -13.187 20.634  -236.418 1.00 0.00 ?  39 SER A HG   1  
ATOM 579    N N    . ASP A  1 40 ? -15.344 18.297  -238.177 1.00 0.00 ?  40 ASP A N    1  
ATOM 580    C CA   . ASP A  1 40 ? -16.732 17.866  -238.056 1.00 0.00 ?  40 ASP A CA   1  
ATOM 581    C C    . ASP A  1 40 ? -16.957 16.533  -238.758 1.00 0.00 ?  40 ASP A C    1  
ATOM 582    O O    . ASP A  1 40 ? -16.838 16.436  -239.980 1.00 0.00 ?  40 ASP A O    1  
ATOM 583    C CB   . ASP A  1 40 ? -17.675 18.927  -238.627 1.00 0.00 ?  40 ASP A CB   1  
ATOM 584    C CG   . ASP A  1 40 ? -19.155 18.619  -238.440 1.00 0.00 ?  40 ASP A CG   1  
ATOM 585    O OD1  . ASP A  1 40 ? -19.465 17.545  -237.981 1.00 0.00 ?  40 ASP A OD1  1  
ATOM 586    O OD2  . ASP A  1 40 ? -19.952 19.510  -238.608 1.00 0.00 -1 40 ASP A OD2  1  
ATOM 587    H H    . ASP A  1 40 ? -15.092 18.941  -238.913 1.00 0.00 ?  40 ASP A H    1  
ATOM 588    H HA   . ASP A  1 40 ? -16.979 17.708  -237.006 1.00 0.00 ?  40 ASP A HA   1  
ATOM 589    H HB2  . ASP A  1 40 ? -17.466 19.934  -238.266 1.00 0.00 ?  40 ASP A HB2  1  
ATOM 590    H HB3  . ASP A  1 40 ? -17.422 18.859  -239.685 1.00 0.00 ?  40 ASP A HB3  1  
ATOM 591    N N    . PRO A  1 41 ? -17.283 15.507  -237.979 1.00 0.00 ?  41 PRO A N    1  
ATOM 592    C CA   . PRO A  1 41 ? -17.526 14.177  -238.525 1.00 0.00 ?  41 PRO A CA   1  
ATOM 593    C C    . PRO A  1 41 ? -18.636 14.204  -239.569 1.00 0.00 ?  41 PRO A C    1  
ATOM 594    O O    . PRO A  1 41 ? -18.583 13.482  -240.564 1.00 0.00 ?  41 PRO A O    1  
ATOM 595    C CB   . PRO A  1 41 ? -17.904 13.334  -237.303 1.00 0.00 ?  41 PRO A CB   1  
ATOM 596    C CG   . PRO A  1 41 ? -17.288 14.052  -236.152 1.00 0.00 ?  41 PRO A CG   1  
ATOM 597    C CD   . PRO A  1 41 ? -17.377 15.514  -236.499 1.00 0.00 ?  41 PRO A CD   1  
ATOM 598    H HA   . PRO A  1 41 ? -16.652 13.767  -239.052 1.00 0.00 ?  41 PRO A HA   1  
ATOM 599    H HB2  . PRO A  1 41 ? -18.995 13.258  -237.188 1.00 0.00 ?  41 PRO A HB2  1  
ATOM 600    H HB3  . PRO A  1 41 ? -17.517 12.308  -237.386 1.00 0.00 ?  41 PRO A HB3  1  
ATOM 601    H HG2  . PRO A  1 41 ? -17.822 13.835  -235.215 1.00 0.00 ?  41 PRO A HG2  1  
ATOM 602    H HG3  . PRO A  1 41 ? -16.242 13.744  -236.004 1.00 0.00 ?  41 PRO A HG3  1  
ATOM 603    H HD2  . PRO A  1 41 ? -18.322 15.965  -236.162 1.00 0.00 ?  41 PRO A HD2  1  
ATOM 604    H HD3  . PRO A  1 41 ? -16.563 16.100  -236.047 1.00 0.00 ?  41 PRO A HD3  1  
ATOM 605    N N    . ALA A  1 42 ? -19.641 15.041  -239.335 1.00 0.00 ?  42 ALA A N    1  
ATOM 606    C CA   . ALA A  1 42 ? -20.789 15.129  -240.229 1.00 0.00 ?  42 ALA A CA   1  
ATOM 607    C C    . ALA A  1 42 ? -20.391 15.702  -241.583 1.00 0.00 ?  42 ALA A C    1  
ATOM 608    O O    . ALA A  1 42 ? -20.822 15.211  -242.626 1.00 0.00 ?  42 ALA A O    1  
ATOM 609    C CB   . ALA A  1 42 ? -21.890 15.968  -239.597 1.00 0.00 ?  42 ALA A CB   1  
ATOM 610    H H    . ALA A  1 42 ? -19.608 15.633  -238.517 1.00 0.00 ?  42 ALA A H    1  
ATOM 611    H HA   . ALA A  1 42 ? -21.174 14.124  -240.402 1.00 0.00 ?  42 ALA A HA   1  
ATOM 612    H HB1  . ALA A  1 42 ? -21.515 16.972  -239.403 1.00 0.00 ?  42 ALA A HB1  1  
ATOM 613    H HB2  . ALA A  1 42 ? -22.740 16.023  -240.277 1.00 0.00 ?  42 ALA A HB2  1  
ATOM 614    H HB3  . ALA A  1 42 ? -22.205 15.510  -238.659 1.00 0.00 ?  42 ALA A HB3  1  
ATOM 615    N N    . LEU A  1 43 ? -19.566 16.743  -241.559 1.00 0.00 ?  43 LEU A N    1  
ATOM 616    C CA   . LEU A  1 43 ? -19.090 17.371  -242.786 1.00 0.00 ?  43 LEU A CA   1  
ATOM 617    C C    . LEU A  1 43 ? -18.084 16.482  -243.506 1.00 0.00 ?  43 LEU A C    1  
ATOM 618    O O    . LEU A  1 43 ? -18.043 16.444  -244.736 1.00 0.00 ?  43 LEU A O    1  
ATOM 619    C CB   . LEU A  1 43 ? -18.467 18.738  -242.475 1.00 0.00 ?  43 LEU A CB   1  
ATOM 620    C CG   . LEU A  1 43 ? -19.444 19.795  -241.945 1.00 0.00 ?  43 LEU A CG   1  
ATOM 621    C CD1  . LEU A  1 43 ? -18.681 21.036  -241.503 1.00 0.00 ?  43 LEU A CD1  1  
ATOM 622    C CD2  . LEU A  1 43 ? -20.456 20.140  -243.027 1.00 0.00 ?  43 LEU A CD2  1  
ATOM 623    H H    . LEU A  1 43 ? -19.260 17.108  -240.669 1.00 0.00 ?  43 LEU A H    1  
ATOM 624    H HA   . LEU A  1 43 ? -19.925 17.511  -243.472 1.00 0.00 ?  43 LEU A HA   1  
ATOM 625    H HB2  . LEU A  1 43 ? -17.775 18.441  -241.689 1.00 0.00 ?  43 LEU A HB2  1  
ATOM 626    H HB3  . LEU A  1 43 ? -17.907 19.129  -243.324 1.00 0.00 ?  43 LEU A HB3  1  
ATOM 627    H HG   . LEU A  1 43 ? -19.987 19.346  -241.112 1.00 0.00 ?  43 LEU A HG   1  
ATOM 628    H HD11 . LEU A  1 43 ? -19.383 21.781  -241.128 1.00 0.00 ?  43 LEU A HD11 1  
ATOM 629    H HD12 . LEU A  1 43 ? -17.979 20.770  -240.712 1.00 0.00 ?  43 LEU A HD12 1  
ATOM 630    H HD13 . LEU A  1 43 ? -18.134 21.448  -242.351 1.00 0.00 ?  43 LEU A HD13 1  
ATOM 631    H HD21 . LEU A  1 43 ? -21.009 19.244  -243.308 1.00 0.00 ?  43 LEU A HD21 1  
ATOM 632    H HD22 . LEU A  1 43 ? -21.150 20.891  -242.649 1.00 0.00 ?  43 LEU A HD22 1  
ATOM 633    H HD23 . LEU A  1 43 ? -19.935 20.534  -243.900 1.00 0.00 ?  43 LEU A HD23 1  
ATOM 634    N N    . LEU A  1 44 ? -17.274 15.767  -242.733 1.00 0.00 ?  44 LEU A N    1  
ATOM 635    C CA   . LEU A  1 44 ? -16.301 14.838  -243.295 1.00 0.00 ?  44 LEU A CA   1  
ATOM 636    C C    . LEU A  1 44 ? -16.991 13.684  -244.011 1.00 0.00 ?  44 LEU A C    1  
ATOM 637    O O    . LEU A  1 44 ? -16.642 13.345  -245.142 1.00 0.00 ?  44 LEU A O    1  
ATOM 638    C CB   . LEU A  1 44 ? -15.378 14.306  -242.192 1.00 0.00 ?  44 LEU A CB   1  
ATOM 639    C CG   . LEU A  1 44 ? -14.314 15.294  -241.699 1.00 0.00 ?  44 LEU A CG   1  
ATOM 640    C CD1  . LEU A  1 44 ? -13.645 14.757  -240.441 1.00 0.00 ?  44 LEU A CD1  1  
ATOM 641    C CD2  . LEU A  1 44 ? -13.287 15.528  -242.797 1.00 0.00 ?  44 LEU A CD2  1  
ATOM 642    H H    . LEU A  1 44 ? -17.334 15.869  -241.730 1.00 0.00 ?  44 LEU A H    1  
ATOM 643    H HA   . LEU A  1 44 ? -15.698 15.350  -244.044 1.00 0.00 ?  44 LEU A HA   1  
ATOM 644    H HB2  . LEU A  1 44 ? -16.117 14.132  -241.411 1.00 0.00 ?  44 LEU A HB2  1  
ATOM 645    H HB3  . LEU A  1 44 ? -14.916 13.359  -242.473 1.00 0.00 ?  44 LEU A HB3  1  
ATOM 646    H HG   . LEU A  1 44 ? -14.817 16.242  -241.506 1.00 0.00 ?  44 LEU A HG   1  
ATOM 647    H HD11 . LEU A  1 44 ? -12.891 15.465  -240.097 1.00 0.00 ?  44 LEU A HD11 1  
ATOM 648    H HD12 . LEU A  1 44 ? -14.394 14.620  -239.661 1.00 0.00 ?  44 LEU A HD12 1  
ATOM 649    H HD13 . LEU A  1 44 ? -13.170 13.801  -240.661 1.00 0.00 ?  44 LEU A HD13 1  
ATOM 650    H HD21 . LEU A  1 44 ? -13.782 15.938  -243.677 1.00 0.00 ?  44 LEU A HD21 1  
ATOM 651    H HD22 . LEU A  1 44 ? -12.532 16.231  -242.445 1.00 0.00 ?  44 LEU A HD22 1  
ATOM 652    H HD23 . LEU A  1 44 ? -12.811 14.582  -243.057 1.00 0.00 ?  44 LEU A HD23 1  
ATOM 653    N N    . ALA A  1 45 ? -17.972 13.084  -243.346 1.00 0.00 ?  45 ALA A N    1  
ATOM 654    C CA   . ALA A  1 45 ? -18.688 11.941  -243.902 1.00 0.00 ?  45 ALA A CA   1  
ATOM 655    C C    . ALA A  1 45 ? -19.477 12.337  -245.144 1.00 0.00 ?  45 ALA A C    1  
ATOM 656    O O    . ALA A  1 45 ? -19.440 11.645  -246.161 1.00 0.00 ?  45 ALA A O    1  
ATOM 657    C CB   . ALA A  1 45 ? -19.610 11.333  -242.856 1.00 0.00 ?  45 ALA A CB   1  
ATOM 658    H H    . ALA A  1 45 ? -18.229 13.427  -242.432 1.00 0.00 ?  45 ALA A H    1  
ATOM 659    H HA   . ALA A  1 45 ? -17.961 11.188  -244.206 1.00 0.00 ?  45 ALA A HA   1  
ATOM 660    H HB1  . ALA A  1 45 ? -20.333 12.079  -242.530 1.00 0.00 ?  45 ALA A HB1  1  
ATOM 661    H HB2  . ALA A  1 45 ? -20.136 10.481  -243.287 1.00 0.00 ?  45 ALA A HB2  1  
ATOM 662    H HB3  . ALA A  1 45 ? -19.021 11.000  -242.001 1.00 0.00 ?  45 ALA A HB3  1  
ATOM 663    N N    . ALA A  1 46 ? -20.191 13.454  -245.054 1.00 0.00 ?  46 ALA A N    1  
ATOM 664    C CA   . ALA A  1 46 ? -21.003 13.936  -246.165 1.00 0.00 ?  46 ALA A CA   1  
ATOM 665    C C    . ALA A  1 46 ? -20.136 14.309  -247.360 1.00 0.00 ?  46 ALA A C    1  
ATOM 666    O O    . ALA A  1 46 ? -20.417 13.912  -248.491 1.00 0.00 ?  46 ALA A O    1  
ATOM 667    C CB   . ALA A  1 46 ? -21.848 15.123  -245.727 1.00 0.00 ?  46 ALA A CB   1  
ATOM 668    H H    . ALA A  1 46 ? -20.170 13.983  -244.194 1.00 0.00 ?  46 ALA A H    1  
ATOM 669    H HA   . ALA A  1 46 ? -21.669 13.134  -246.484 1.00 0.00 ?  46 ALA A HA   1  
ATOM 670    H HB1  . ALA A  1 46 ? -21.197 15.928  -245.390 1.00 0.00 ?  46 ALA A HB1  1  
ATOM 671    H HB2  . ALA A  1 46 ? -22.448 15.471  -246.568 1.00 0.00 ?  46 ALA A HB2  1  
ATOM 672    H HB3  . ALA A  1 46 ? -22.506 14.822  -244.912 1.00 0.00 ?  46 ALA A HB3  1  
ATOM 673    N N    . TYR A  1 47 ? -19.080 15.074  -247.103 1.00 0.00 ?  47 TYR A N    1  
ATOM 674    C CA   . TYR A  1 47 ? -18.195 15.540  -248.164 1.00 0.00 ?  47 TYR A CA   1  
ATOM 675    C C    . TYR A  1 47 ? -17.481 14.375  -248.837 1.00 0.00 ?  47 TYR A C    1  
ATOM 676    O O    . TYR A  1 47 ? -17.452 14.276  -250.064 1.00 0.00 ?  47 TYR A O    1  
ATOM 677    C CB   . TYR A  1 47 ? -17.172 16.534  -247.610 1.00 0.00 ?  47 TYR A CB   1  
ATOM 678    C CG   . TYR A  1 47 ? -16.101 16.928  -248.602 1.00 0.00 ?  47 TYR A CG   1  
ATOM 679    C CD1  . TYR A  1 47 ? -16.427 17.583  -249.781 1.00 0.00 ?  47 TYR A CD1  1  
ATOM 680    C CD2  . TYR A  1 47 ? -14.766 16.646  -248.356 1.00 0.00 ?  47 TYR A CD2  1  
ATOM 681    C CE1  . TYR A  1 47 ? -15.453 17.945  -250.691 1.00 0.00 ?  47 TYR A CE1  1  
ATOM 682    C CE2  . TYR A  1 47 ? -13.783 17.004  -249.259 1.00 0.00 ?  47 TYR A CE2  1  
ATOM 683    C CZ   . TYR A  1 47 ? -14.130 17.654  -250.425 1.00 0.00 ?  47 TYR A CZ   1  
ATOM 684    O OH   . TYR A  1 47 ? -13.155 18.013  -251.327 1.00 0.00 ?  47 TYR A OH   1  
ATOM 685    H H    . TYR A  1 47 ? -18.886 15.339  -246.148 1.00 0.00 ?  47 TYR A H    1  
ATOM 686    H HA   . TYR A  1 47 ? -18.778 16.037  -248.941 1.00 0.00 ?  47 TYR A HA   1  
ATOM 687    H HB2  . TYR A  1 47 ? -17.723 17.422  -247.297 1.00 0.00 ?  47 TYR A HB2  1  
ATOM 688    H HB3  . TYR A  1 47 ? -16.709 16.068  -246.741 1.00 0.00 ?  47 TYR A HB3  1  
ATOM 689    H HD1  . TYR A  1 47 ? -17.474 17.811  -249.984 1.00 0.00 ?  47 TYR A HD1  1  
ATOM 690    H HD2  . TYR A  1 47 ? -14.498 16.132  -247.433 1.00 0.00 ?  47 TYR A HD2  1  
ATOM 691    H HE1  . TYR A  1 47 ? -15.724 18.459  -251.613 1.00 0.00 ?  47 TYR A HE1  1  
ATOM 692    H HE2  . TYR A  1 47 ? -12.739 16.771  -249.048 1.00 0.00 ?  47 TYR A HE2  1  
ATOM 693    H HH   . TYR A  1 47 ? -12.272 17.763  -251.044 1.00 0.00 ?  47 TYR A HH   1  
ATOM 694    N N    . GLN A  1 48 ? -16.904 13.494  -248.027 1.00 0.00 ?  48 GLN A N    1  
ATOM 695    C CA   . GLN A  1 48 ? -16.136 12.367  -248.542 1.00 0.00 ?  48 GLN A CA   1  
ATOM 696    C C    . GLN A  1 48 ? -17.024 11.405  -249.321 1.00 0.00 ?  48 GLN A C    1  
ATOM 697    O O    . GLN A  1 48 ? -16.615 10.859  -250.346 1.00 0.00 ?  48 GLN A O    1  
ATOM 698    C CB   . GLN A  1 48 ? -15.445 11.620  -247.398 1.00 0.00 ?  48 GLN A CB   1  
ATOM 699    C CG   . GLN A  1 48 ? -14.451 10.566  -247.853 1.00 0.00 ?  48 GLN A CG   1  
ATOM 700    C CD   . GLN A  1 48 ? -15.126 9.268   -248.251 1.00 0.00 ?  48 GLN A CD   1  
ATOM 701    O OE1  . GLN A  1 48 ? -16.120 8.857   -247.646 1.00 0.00 ?  48 GLN A OE1  1  
ATOM 702    N NE2  . GLN A  1 48 ? -14.586 8.610   -249.272 1.00 0.00 ?  48 GLN A NE2  1  
ATOM 703    H H    . GLN A  1 48 ? -17.000 13.608  -247.028 1.00 0.00 ?  48 GLN A H    1  
ATOM 704    H HA   . GLN A  1 48 ? -15.382 12.729  -249.242 1.00 0.00 ?  48 GLN A HA   1  
ATOM 705    H HB2  . GLN A  1 48 ? -14.936 12.372  -246.794 1.00 0.00 ?  48 GLN A HB2  1  
ATOM 706    H HB3  . GLN A  1 48 ? -16.232 11.153  -246.807 1.00 0.00 ?  48 GLN A HB3  1  
ATOM 707    H HG2  . GLN A  1 48 ? -13.664 10.771  -248.579 1.00 0.00 ?  48 GLN A HG2  1  
ATOM 708    H HG3  . GLN A  1 48 ? -14.006 10.435  -246.865 1.00 0.00 ?  48 GLN A HG3  1  
ATOM 709    H HE21 . GLN A  1 48 ? -13.779 8.978   -249.733 1.00 0.00 ?  48 GLN A HE21 1  
ATOM 710    H HE22 . GLN A  1 48 ? -14.988 7.747   -249.580 1.00 0.00 ?  48 GLN A HE22 1  
ATOM 711    N N    . SER A  1 49 ? -18.241 11.202  -248.829 1.00 0.00 ?  49 SER A N    1  
ATOM 712    C CA   . SER A  1 49 ? -19.207 10.345  -249.506 1.00 0.00 ?  49 SER A CA   1  
ATOM 713    C C    . SER A  1 49 ? -19.562 10.893  -250.882 1.00 0.00 ?  49 SER A C    1  
ATOM 714    O O    . SER A  1 49 ? -19.635 10.148  -251.858 1.00 0.00 ?  49 SER A O    1  
ATOM 715    C CB   . SER A  1 49 ? -20.456 10.196  -248.658 1.00 0.00 ?  49 SER A CB   1  
ATOM 716    O OG   . SER A  1 49 ? -21.436 9.423   -249.296 1.00 0.00 ?  49 SER A OG   1  
ATOM 717    H H    . SER A  1 49 ? -18.504 11.652  -247.964 1.00 0.00 ?  49 SER A H    1  
ATOM 718    H HA   . SER A  1 49 ? -18.880 9.308   -249.593 1.00 0.00 ?  49 SER A HA   1  
ATOM 719    H HB2  . SER A  1 49 ? -20.183 9.717   -247.718 1.00 0.00 ?  49 SER A HB2  1  
ATOM 720    H HB3  . SER A  1 49 ? -20.861 11.186  -248.456 1.00 0.00 ?  49 SER A HB3  1  
ATOM 721    H HG   . SER A  1 49 ? -21.704 9.856   -250.110 1.00 0.00 ?  49 SER A HG   1  
ATOM 722    N N    . LYS A  1 50 ? -19.782 12.202  -250.952 1.00 0.00 ?  50 LYS A N    1  
ATOM 723    C CA   . LYS A  1 50 ? -20.122 12.855  -252.211 1.00 0.00 ?  50 LYS A CA   1  
ATOM 724    C C    . LYS A  1 50 ? -18.882 13.074  -253.069 1.00 0.00 ?  50 LYS A C    1  
ATOM 725    O O    . LYS A  1 50 ? -18.977 13.215  -254.289 1.00 0.00 ?  50 LYS A O    1  
ATOM 726    C CB   . LYS A  1 50 ? -20.824 14.188  -251.950 1.00 0.00 ?  50 LYS A CB   1  
ATOM 727    C CG   . LYS A  1 50 ? -22.193 14.061  -251.297 1.00 0.00 ?  50 LYS A CG   1  
ATOM 728    C CD   . LYS A  1 50 ? -22.810 15.427  -251.034 1.00 0.00 ?  50 LYS A CD   1  
ATOM 729    C CE   . LYS A  1 50 ? -24.139 15.303  -250.303 1.00 0.00 ?  50 LYS A CE   1  
ATOM 730    N NZ   . LYS A  1 50 ? -25.138 14.530  -251.090 1.00 0.00 1  50 LYS A NZ   1  
ATOM 731    H H    . LYS A  1 50 ? -19.713 12.759  -250.112 1.00 0.00 ?  50 LYS A H    1  
ATOM 732    H HA   . LYS A  1 50 ? -20.791 12.217  -252.789 1.00 0.00 ?  50 LYS A HA   1  
ATOM 733    H HB2  . LYS A  1 50 ? -20.168 14.774  -251.306 1.00 0.00 ?  50 LYS A HB2  1  
ATOM 734    H HB3  . LYS A  1 50 ? -20.927 14.689  -252.913 1.00 0.00 ?  50 LYS A HB3  1  
ATOM 735    H HG2  . LYS A  1 50 ? -22.843 13.490  -251.963 1.00 0.00 ?  50 LYS A HG2  1  
ATOM 736    H HG3  . LYS A  1 50 ? -22.080 13.526  -250.355 1.00 0.00 ?  50 LYS A HG3  1  
ATOM 737    H HD2  . LYS A  1 50 ? -22.115 16.011  -250.430 1.00 0.00 ?  50 LYS A HD2  1  
ATOM 738    H HD3  . LYS A  1 50 ? -22.968 15.927  -251.990 1.00 0.00 ?  50 LYS A HD3  1  
ATOM 739    H HE2  . LYS A  1 50 ? -23.961 14.804  -249.352 1.00 0.00 ?  50 LYS A HE2  1  
ATOM 740    H HE3  . LYS A  1 50 ? -24.521 16.307  -250.119 1.00 0.00 ?  50 LYS A HE3  1  
ATOM 741    H HZ1  . LYS A  1 50 ? -24.784 13.600  -251.261 1.00 0.00 ?  50 LYS A HZ1  1  
ATOM 742    H HZ2  . LYS A  1 50 ? -26.003 14.472  -250.571 1.00 0.00 ?  50 LYS A HZ2  1  
ATOM 743    H HZ3  . LYS A  1 50 ? -25.304 14.994  -251.972 1.00 0.00 ?  50 LYS A HZ3  1  
ATOM 744    N N    . LEU A  1 51 ? -17.720 13.103  -252.426 1.00 0.00 ?  51 LEU A N    1  
ATOM 745    C CA   . LEU A  1 51 ? -16.457 13.279  -253.132 1.00 0.00 ?  51 LEU A CA   1  
ATOM 746    C C    . LEU A  1 51 ? -16.052 12.005  -253.862 1.00 0.00 ?  51 LEU A C    1  
ATOM 747    O O    . LEU A  1 51 ? -15.512 12.057  -254.967 1.00 0.00 ?  51 LEU A O    1  
ATOM 748    C CB   . LEU A  1 51 ? -15.357 13.706  -252.152 1.00 0.00 ?  51 LEU A CB   1  
ATOM 749    C CG   . LEU A  1 51 ? -14.021 14.092  -252.799 1.00 0.00 ?  51 LEU A CG   1  
ATOM 750    C CD1  . LEU A  1 51 ? -14.200 15.329  -253.669 1.00 0.00 ?  51 LEU A CD1  1  
ATOM 751    C CD2  . LEU A  1 51 ? -12.984 14.341  -251.714 1.00 0.00 ?  51 LEU A CD2  1  
ATOM 752    H H    . LEU A  1 51 ? -17.712 13.000  -251.421 1.00 0.00 ?  51 LEU A H    1  
ATOM 753    H HA   . LEU A  1 51 ? -16.570 14.049  -253.894 1.00 0.00 ?  51 LEU A HA   1  
ATOM 754    H HB2  . LEU A  1 51 ? -15.833 14.586  -251.724 1.00 0.00 ?  51 LEU A HB2  1  
ATOM 755    H HB3  . LEU A  1 51 ? -15.201 12.962  -251.372 1.00 0.00 ?  51 LEU A HB3  1  
ATOM 756    H HG   . LEU A  1 51 ? -13.688 13.238  -253.389 1.00 0.00 ?  51 LEU A HG   1  
ATOM 757    H HD11 . LEU A  1 51 ? -13.246 15.595  -254.125 1.00 0.00 ?  51 LEU A HD11 1  
ATOM 758    H HD12 . LEU A  1 51 ? -14.929 15.120  -254.453 1.00 0.00 ?  51 LEU A HD12 1  
ATOM 759    H HD13 . LEU A  1 51 ? -14.553 16.157  -253.056 1.00 0.00 ?  51 LEU A HD13 1  
ATOM 760    H HD21 . LEU A  1 51 ? -12.851 13.436  -251.122 1.00 0.00 ?  51 LEU A HD21 1  
ATOM 761    H HD22 . LEU A  1 51 ? -12.034 14.615  -252.176 1.00 0.00 ?  51 LEU A HD22 1  
ATOM 762    H HD23 . LEU A  1 51 ? -13.321 15.152  -251.068 1.00 0.00 ?  51 LEU A HD23 1  
ATOM 763    N N    . SER A  1 52 ? -16.315 10.862  -253.238 1.00 0.00 ?  52 SER A N    1  
ATOM 764    C CA   . SER A  1 52 ? -16.061 9.571   -253.865 1.00 0.00 ?  52 SER A CA   1  
ATOM 765    C C    . SER A  1 52 ? -16.949 9.366   -255.085 1.00 0.00 ?  52 SER A C    1  
ATOM 766    O O    . SER A  1 52 ? -16.601 8.619   -256.000 1.00 0.00 ?  52 SER A O    1  
ATOM 767    C CB   . SER A  1 52 ? -16.274 8.453   -252.862 1.00 0.00 ?  52 SER A CB   1  
ATOM 768    O OG   . SER A  1 52 ? -17.622 8.317   -252.505 1.00 0.00 ?  52 SER A OG   1  
ATOM 769    H H    . SER A  1 52 ? -16.702 10.889  -252.305 1.00 0.00 ?  52 SER A H    1  
ATOM 770    H HA   . SER A  1 52 ? -15.015 9.420   -254.137 1.00 0.00 ?  52 SER A HA   1  
ATOM 771    H HB2  . SER A  1 52 ? -15.929 7.519   -253.304 1.00 0.00 ?  52 SER A HB2  1  
ATOM 772    H HB3  . SER A  1 52 ? -15.690 8.669   -251.969 1.00 0.00 ?  52 SER A HB3  1  
ATOM 773    H HG   . SER A  1 52 ? -17.714 7.602   -251.871 1.00 0.00 ?  52 SER A HG   1  
ATOM 774    N N    . GLU A  1 53 ? -18.098 10.034  -255.093 1.00 0.00 ?  53 GLU A N    1  
ATOM 775    C CA   . GLU A  1 53 ? -18.939 10.096  -256.282 1.00 0.00 ?  53 GLU A CA   1  
ATOM 776    C C    . GLU A  1 53 ? -18.427 11.139  -257.266 1.00 0.00 ?  53 GLU A C    1  
ATOM 777    O O    . GLU A  1 53 ? -18.458 10.930  -258.479 1.00 0.00 ?  53 GLU A O    1  
ATOM 778    C CB   . GLU A  1 53 ? -20.388 10.403  -255.897 1.00 0.00 ?  53 GLU A CB   1  
ATOM 779    C CG   . GLU A  1 53 ? -21.092 9.279   -255.150 1.00 0.00 ?  53 GLU A CG   1  
ATOM 780    C CD   . GLU A  1 53 ? -22.477 9.686   -254.730 1.00 0.00 ?  53 GLU A CD   1  
ATOM 781    O OE1  . GLU A  1 53 ? -22.799 10.844  -254.853 1.00 0.00 ?  53 GLU A OE1  1  
ATOM 782    O OE2  . GLU A  1 53 ? -23.251 8.822   -254.390 1.00 0.00 -1 53 GLU A OE2  1  
ATOM 783    H H    . GLU A  1 53 ? -18.395 10.511  -254.254 1.00 0.00 ?  53 GLU A H    1  
ATOM 784    H HA   . GLU A  1 53 ? -18.913 9.138   -256.804 1.00 0.00 ?  53 GLU A HA   1  
ATOM 785    H HB2  . GLU A  1 53 ? -20.369 11.296  -255.273 1.00 0.00 ?  53 GLU A HB2  1  
ATOM 786    H HB3  . GLU A  1 53 ? -20.925 10.616  -256.821 1.00 0.00 ?  53 GLU A HB3  1  
ATOM 787    H HG2  . GLU A  1 53 ? -21.144 8.349   -255.716 1.00 0.00 ?  53 GLU A HG2  1  
ATOM 788    H HG3  . GLU A  1 53 ? -20.473 9.131   -254.267 1.00 0.00 ?  53 GLU A HG3  1  
ATOM 789    N N    . TYR A  1 54 ? -17.955 12.263  -256.737 1.00 0.00 ?  54 TYR A N    1  
ATOM 790    C CA   . TYR A  1 54 ? -17.376 13.315  -257.564 1.00 0.00 ?  54 TYR A CA   1  
ATOM 791    C C    . TYR A  1 54 ? -16.128 12.824  -258.286 1.00 0.00 ?  54 TYR A C    1  
ATOM 792    O O    . TYR A  1 54 ? -15.744 13.368  -259.321 1.00 0.00 ?  54 TYR A O    1  
ATOM 793    C CB   . TYR A  1 54 ? -17.042 14.542  -256.713 1.00 0.00 ?  54 TYR A CB   1  
ATOM 794    C CG   . TYR A  1 54 ? -16.541 15.725  -257.512 1.00 0.00 ?  54 TYR A CG   1  
ATOM 795    C CD1  . TYR A  1 54 ? -17.401 16.456  -258.318 1.00 0.00 ?  54 TYR A CD1  1  
ATOM 796    C CD2  . TYR A  1 54 ? -15.209 16.107  -257.457 1.00 0.00 ?  54 TYR A CD2  1  
ATOM 797    C CE1  . TYR A  1 54 ? -16.949 17.537  -259.050 1.00 0.00 ?  54 TYR A CE1  1  
ATOM 798    C CE2  . TYR A  1 54 ? -14.746 17.186  -258.184 1.00 0.00 ?  54 TYR A CE2  1  
ATOM 799    C CZ   . TYR A  1 54 ? -15.619 17.899  -258.980 1.00 0.00 ?  54 TYR A CZ   1  
ATOM 800    O OH   . TYR A  1 54 ? -15.162 18.975  -259.706 1.00 0.00 ?  54 TYR A OH   1  
ATOM 801    H H    . TYR A  1 54 ? -17.998 12.392  -255.737 1.00 0.00 ?  54 TYR A H    1  
ATOM 802    H HA   . TYR A  1 54 ? -18.086 13.611  -258.338 1.00 0.00 ?  54 TYR A HA   1  
ATOM 803    H HB2  . TYR A  1 54 ? -17.952 14.823  -256.181 1.00 0.00 ?  54 TYR A HB2  1  
ATOM 804    H HB3  . TYR A  1 54 ? -16.280 14.239  -255.996 1.00 0.00 ?  54 TYR A HB3  1  
ATOM 805    H HD1  . TYR A  1 54 ? -18.451 16.165  -258.368 1.00 0.00 ?  54 TYR A HD1  1  
ATOM 806    H HD2  . TYR A  1 54 ? -14.524 15.539  -256.827 1.00 0.00 ?  54 TYR A HD2  1  
ATOM 807    H HE1  . TYR A  1 54 ? -17.636 18.102  -259.679 1.00 0.00 ?  54 TYR A HE1  1  
ATOM 808    H HE2  . TYR A  1 54 ? -13.694 17.470  -258.128 1.00 0.00 ?  54 TYR A HE2  1  
ATOM 809    H HH   . TYR A  1 54 ? -14.506 19.494  -259.235 1.00 0.00 ?  54 TYR A HH   1  
ATOM 810    N N    . ASN A  1 55 ? -15.497 11.794  -257.733 1.00 0.00 ?  55 ASN A N    1  
ATOM 811    C CA   . ASN A  1 55 ? -14.384 11.129  -258.400 1.00 0.00 ?  55 ASN A CA   1  
ATOM 812    C C    . ASN A  1 55 ? -14.802 10.587  -259.760 1.00 0.00 ?  55 ASN A C    1  
ATOM 813    O O    . ASN A  1 55 ? -14.041 10.651  -260.725 1.00 0.00 ?  55 ASN A O    1  
ATOM 814    C CB   . ASN A  1 55 ? -13.811 10.014  -257.544 1.00 0.00 ?  55 ASN A CB   1  
ATOM 815    C CG   . ASN A  1 55 ? -13.012 10.503  -256.368 1.00 0.00 ?  55 ASN A CG   1  
ATOM 816    O OD1  . ASN A  1 55 ? -12.560 11.653  -256.334 1.00 0.00 ?  55 ASN A OD1  1  
ATOM 817    N ND2  . ASN A  1 55 ? -12.768 9.611   -255.442 1.00 0.00 ?  55 ASN A ND2  1  
ATOM 818    H H    . ASN A  1 55 ? -15.797 11.463  -256.827 1.00 0.00 ?  55 ASN A H    1  
ATOM 819    H HA   . ASN A  1 55 ? -13.583 11.845  -258.585 1.00 0.00 ?  55 ASN A HA   1  
ATOM 820    H HB2  . ASN A  1 55 ? -14.433 9.175   -257.230 1.00 0.00 ?  55 ASN A HB2  1  
ATOM 821    H HB3  . ASN A  1 55 ? -13.123 9.684   -258.323 1.00 0.00 ?  55 ASN A HB3  1  
ATOM 822    H HD21 . ASN A  1 55 ? -13.107 8.677   -255.545 1.00 0.00 ?  55 ASN A HD21 1  
ATOM 823    H HD22 . ASN A  1 55 ? -12.242 9.866   -254.629 1.00 0.00 ?  55 ASN A HD22 1  
ATOM 824    N N    . LEU A  1 56 ? -16.017 10.052  -259.831 1.00 0.00 ?  56 LEU A N    1  
ATOM 825    C CA   . LEU A  1 56 ? -16.548 9.522   -261.081 1.00 0.00 ?  56 LEU A CA   1  
ATOM 826    C C    . LEU A  1 56 ? -17.149 10.628  -261.938 1.00 0.00 ?  56 LEU A C    1  
ATOM 827    O O    . LEU A  1 56 ? -17.222 10.509  -263.161 1.00 0.00 ?  56 LEU A O    1  
ATOM 828    C CB   . LEU A  1 56 ? -17.598 8.441   -260.794 1.00 0.00 ?  56 LEU A CB   1  
ATOM 829    C CG   . LEU A  1 56 ? -17.071 7.194   -260.071 1.00 0.00 ?  56 LEU A CG   1  
ATOM 830    C CD1  . LEU A  1 56 ? -18.208 6.211   -259.829 1.00 0.00 ?  56 LEU A CD1  1  
ATOM 831    C CD2  . LEU A  1 56 ? -15.971 6.552   -260.903 1.00 0.00 ?  56 LEU A CD2  1  
ATOM 832    H H    . LEU A  1 56 ? -16.586 10.013  -258.998 1.00 0.00 ?  56 LEU A H    1  
ATOM 833    H HA   . LEU A  1 56 ? -15.740 9.083   -261.664 1.00 0.00 ?  56 LEU A HA   1  
ATOM 834    H HB2  . LEU A  1 56 ? -18.256 9.004   -260.134 1.00 0.00 ?  56 LEU A HB2  1  
ATOM 835    H HB3  . LEU A  1 56 ? -18.142 8.157   -261.694 1.00 0.00 ?  56 LEU A HB3  1  
ATOM 836    H HG   . LEU A  1 56 ? -16.628 7.527   -259.132 1.00 0.00 ?  56 LEU A HG   1  
ATOM 837    H HD11 . LEU A  1 56 ? -17.824 5.329   -259.316 1.00 0.00 ?  56 LEU A HD11 1  
ATOM 838    H HD12 . LEU A  1 56 ? -18.973 6.684   -259.213 1.00 0.00 ?  56 LEU A HD12 1  
ATOM 839    H HD13 . LEU A  1 56 ? -18.642 5.915   -260.783 1.00 0.00 ?  56 LEU A HD13 1  
ATOM 840    H HD21 . LEU A  1 56 ? -15.156 7.263   -261.040 1.00 0.00 ?  56 LEU A HD21 1  
ATOM 841    H HD22 . LEU A  1 56 ? -15.596 5.667   -260.388 1.00 0.00 ?  56 LEU A HD22 1  
ATOM 842    H HD23 . LEU A  1 56 ? -16.370 6.265   -261.876 1.00 0.00 ?  56 LEU A HD23 1  
ATOM 843    N N    . TYR A  1 57 ? -17.576 11.706  -261.290 1.00 0.00 ?  57 TYR A N    1  
ATOM 844    C CA   . TYR A  1 57 ? -18.044 12.892  -261.999 1.00 0.00 ?  57 TYR A CA   1  
ATOM 845    C C    . TYR A  1 57 ? -17.057 13.313  -263.079 1.00 0.00 ?  57 TYR A C    1  
ATOM 846    O O    . TYR A  1 57 ? -17.451 13.797  -264.140 1.00 0.00 ?  57 TYR A O    1  
ATOM 847    C CB   . TYR A  1 57 ? -18.274 14.045  -261.019 1.00 0.00 ?  57 TYR A CB   1  
ATOM 848    C CG   . TYR A  1 57 ? -18.838 15.292  -261.663 1.00 0.00 ?  57 TYR A CG   1  
ATOM 849    C CD1  . TYR A  1 57 ? -20.195 15.409  -261.922 1.00 0.00 ?  57 TYR A CD1  1  
ATOM 850    C CD2  . TYR A  1 57 ? -18.010 16.351  -262.007 1.00 0.00 ?  57 TYR A CD2  1  
ATOM 851    C CE1  . TYR A  1 57 ? -20.715 16.546  -262.510 1.00 0.00 ?  57 TYR A CE1  1  
ATOM 852    C CE2  . TYR A  1 57 ? -18.519 17.493  -262.595 1.00 0.00 ?  57 TYR A CE2  1  
ATOM 853    C CZ   . TYR A  1 57 ? -19.873 17.587  -262.845 1.00 0.00 ?  57 TYR A CZ   1  
ATOM 854    O OH   . TYR A  1 57 ? -20.385 18.722  -263.429 1.00 0.00 ?  57 TYR A OH   1  
ATOM 855    H H    . TYR A  1 57 ? -17.578 11.704  -260.280 1.00 0.00 ?  57 TYR A H    1  
ATOM 856    H HA   . TYR A  1 57 ? -18.984 12.673  -262.505 1.00 0.00 ?  57 TYR A HA   1  
ATOM 857    H HB2  . TYR A  1 57 ? -18.964 13.687  -260.255 1.00 0.00 ?  57 TYR A HB2  1  
ATOM 858    H HB3  . TYR A  1 57 ? -17.312 14.275  -260.562 1.00 0.00 ?  57 TYR A HB3  1  
ATOM 859    H HD1  . TYR A  1 57 ? -20.855 14.583  -261.655 1.00 0.00 ?  57 TYR A HD1  1  
ATOM 860    H HD2  . TYR A  1 57 ? -16.942 16.270  -261.807 1.00 0.00 ?  57 TYR A HD2  1  
ATOM 861    H HE1  . TYR A  1 57 ? -21.784 16.623  -262.709 1.00 0.00 ?  57 TYR A HE1  1  
ATOM 862    H HE2  . TYR A  1 57 ? -17.852 18.313  -262.859 1.00 0.00 ?  57 TYR A HE2  1  
ATOM 863    H HH   . TYR A  1 57 ? -20.011 19.530  -263.070 1.00 0.00 ?  57 TYR A HH   1  
ATOM 864    N N    . ARG A  1 58 ? -15.770 13.124  -262.804 1.00 0.00 ?  58 ARG A N    1  
ATOM 865    C CA   . ARG A  1 58 ? -14.725 13.455  -263.765 1.00 0.00 ?  58 ARG A CA   1  
ATOM 866    C C    . ARG A  1 58 ? -14.235 12.211  -264.496 1.00 0.00 ?  58 ARG A C    1  
ATOM 867    O O    . ARG A  1 58 ? -14.097 12.212  -265.719 1.00 0.00 ?  58 ARG A O    1  
ATOM 868    C CB   . ARG A  1 58 ? -13.573 14.213  -263.122 1.00 0.00 ?  58 ARG A CB   1  
ATOM 869    C CG   . ARG A  1 58 ? -13.974 15.482  -262.387 1.00 0.00 ?  58 ARG A CG   1  
ATOM 870    C CD   . ARG A  1 58 ? -14.398 16.595  -263.274 1.00 0.00 ?  58 ARG A CD   1  
ATOM 871    N NE   . ARG A  1 58 ? -14.793 17.807  -262.573 1.00 0.00 ?  58 ARG A NE   1  
ATOM 872    C CZ   . ARG A  1 58 ? -15.235 18.929  -263.174 1.00 0.00 ?  58 ARG A CZ   1  
ATOM 873    N NH1  . ARG A  1 58 ? -15.306 19.012  -264.484 1.00 0.00 1  58 ARG A NH1  1  
ATOM 874    N NH2  . ARG A  1 58 ? -15.574 19.954  -262.412 1.00 0.00 ?  58 ARG A NH2  1  
ATOM 875    H H    . ARG A  1 58 ? -15.510 12.743  -261.906 1.00 0.00 ?  58 ARG A H    1  
ATOM 876    H HA   . ARG A  1 58 ? -15.123 14.126  -264.527 1.00 0.00 ?  58 ARG A HA   1  
ATOM 877    H HB2  . ARG A  1 58 ? -13.093 13.529  -262.424 1.00 0.00 ?  58 ARG A HB2  1  
ATOM 878    H HB3  . ARG A  1 58 ? -12.875 14.466  -263.920 1.00 0.00 ?  58 ARG A HB3  1  
ATOM 879    H HG2  . ARG A  1 58 ? -14.804 15.249  -261.720 1.00 0.00 ?  58 ARG A HG2  1  
ATOM 880    H HG3  . ARG A  1 58 ? -13.121 15.826  -261.800 1.00 0.00 ?  58 ARG A HG3  1  
ATOM 881    H HD2  . ARG A  1 58 ? -13.573 16.855  -263.936 1.00 0.00 ?  58 ARG A HD2  1  
ATOM 882    H HD3  . ARG A  1 58 ? -15.251 16.269  -263.868 1.00 0.00 ?  58 ARG A HD3  1  
ATOM 883    H HE   . ARG A  1 58 ? -14.802 18.004  -261.581 1.00 0.00 ?  58 ARG A HE   1  
ATOM 884    H HH11 . ARG A  1 58 ? -15.027 18.226  -265.054 1.00 0.00 ?  58 ARG A HH11 1  
ATOM 885    H HH12 . ARG A  1 58 ? -15.641 19.862  -264.916 1.00 0.00 ?  58 ARG A HH12 1  
ATOM 886    H HH21 . ARG A  1 58 ? -15.496 19.879  -261.407 1.00 0.00 ?  58 ARG A HH21 1  
ATOM 887    H HH22 . ARG A  1 58 ? -15.908 20.806  -262.836 1.00 0.00 ?  58 ARG A HH22 1  
ATOM 888    N N    . ASN A  1 59 ? -13.974 11.151  -263.739 1.00 0.00 ?  59 ASN A N    1  
ATOM 889    C CA   . ASN A  1 59 ? -13.398 9.934   -264.298 1.00 0.00 ?  59 ASN A CA   1  
ATOM 890    C C    . ASN A  1 59 ? -14.354 9.273   -265.282 1.00 0.00 ?  59 ASN A C    1  
ATOM 891    O O    . ASN A  1 59 ? -14.043 9.130   -266.464 1.00 0.00 ?  59 ASN A O    1  
ATOM 892    C CB   . ASN A  1 59 ? -13.007 8.953   -263.207 1.00 0.00 ?  59 ASN A CB   1  
ATOM 893    C CG   . ASN A  1 59 ? -12.155 7.814   -263.694 1.00 0.00 ?  59 ASN A CG   1  
ATOM 894    O OD1  . ASN A  1 59 ? -12.088 7.533   -264.896 1.00 0.00 ?  59 ASN A OD1  1  
ATOM 895    N ND2  . ASN A  1 59 ? -11.569 7.108   -262.761 1.00 0.00 ?  59 ASN A ND2  1  
ATOM 896    H H    . ASN A  1 59 ? -14.180 11.189  -262.751 1.00 0.00 ?  59 ASN A H    1  
ATOM 897    H HA   . ASN A  1 59 ? -12.495 10.176  -264.860 1.00 0.00 ?  59 ASN A HA   1  
ATOM 898    H HB2  . ASN A  1 59 ? -12.618 9.307   -262.251 1.00 0.00 ?  59 ASN A HB2  1  
ATOM 899    H HB3  . ASN A  1 59 ? -14.028 8.596   -263.074 1.00 0.00 ?  59 ASN A HB3  1  
ATOM 900    H HD21 . ASN A  1 59 ? -11.704 7.341   -261.799 1.00 0.00 ?  59 ASN A HD21 1  
ATOM 901    H HD22 . ASN A  1 59 ? -10.987 6.334   -263.012 1.00 0.00 ?  59 ASN A HD22 1  
ATOM 902    N N    . ALA A  1 60 ? -15.520 8.871   -264.787 1.00 0.00 ?  60 ALA A N    1  
ATOM 903    C CA   . ALA A  1 60 ? -16.498 8.166   -265.607 1.00 0.00 ?  60 ALA A CA   1  
ATOM 904    C C    . ALA A  1 60 ? -16.977 9.035   -266.763 1.00 0.00 ?  60 ALA A C    1  
ATOM 905    O O    . ALA A  1 60 ? -17.245 8.537   -267.856 1.00 0.00 ?  60 ALA A O    1  
ATOM 906    C CB   . ALA A  1 60 ? -17.676 7.715   -264.755 1.00 0.00 ?  60 ALA A CB   1  
ATOM 907    H H    . ALA A  1 60 ? -15.734 9.059   -263.818 1.00 0.00 ?  60 ALA A H    1  
ATOM 908    H HA   . ALA A  1 60 ? -16.023 7.285   -266.038 1.00 0.00 ?  60 ALA A HA   1  
ATOM 909    H HB1  . ALA A  1 60 ? -18.153 8.584   -264.305 1.00 0.00 ?  60 ALA A HB1  1  
ATOM 910    H HB2  . ALA A  1 60 ? -18.397 7.191   -265.382 1.00 0.00 ?  60 ALA A HB2  1  
ATOM 911    H HB3  . ALA A  1 60 ? -17.324 7.046   -263.971 1.00 0.00 ?  60 ALA A HB3  1  
ATOM 912    N N    . GLN A  1 61 ? -17.081 10.336  -266.515 1.00 0.00 ?  61 GLN A N    1  
ATOM 913    C CA   . GLN A  1 61 ? -17.442 11.289  -267.558 1.00 0.00 ?  61 GLN A CA   1  
ATOM 914    C C    . GLN A  1 61 ? -16.502 11.179  -268.752 1.00 0.00 ?  61 GLN A C    1  
ATOM 915    O O    . GLN A  1 61 ? -16.942 10.979  -269.884 1.00 0.00 ?  61 GLN A O    1  
ATOM 916    C CB   . GLN A  1 61 ? -17.417 12.718  -267.010 1.00 0.00 ?  61 GLN A CB   1  
ATOM 917    C CG   . GLN A  1 61 ? -17.806 13.780  -268.025 1.00 0.00 ?  61 GLN A CG   1  
ATOM 918    C CD   . GLN A  1 61 ? -17.707 15.184  -267.460 1.00 0.00 ?  61 GLN A CD   1  
ATOM 919    O OE1  . GLN A  1 61 ? -17.218 15.387  -266.345 1.00 0.00 ?  61 GLN A OE1  1  
ATOM 920    N NE2  . GLN A  1 61 ? -18.175 16.164  -268.225 1.00 0.00 ?  61 GLN A NE2  1  
ATOM 921    H H    . GLN A  1 61 ? -16.907 10.674  -265.579 1.00 0.00 ?  61 GLN A H    1  
ATOM 922    H HA   . GLN A  1 61 ? -18.441 11.063  -267.929 1.00 0.00 ?  61 GLN A HA   1  
ATOM 923    H HB2  . GLN A  1 61 ? -18.107 12.744  -266.166 1.00 0.00 ?  61 GLN A HB2  1  
ATOM 924    H HB3  . GLN A  1 61 ? -16.403 12.902  -266.656 1.00 0.00 ?  61 GLN A HB3  1  
ATOM 925    H HG2  . GLN A  1 61 ? -17.411 13.799  -269.040 1.00 0.00 ?  61 GLN A HG2  1  
ATOM 926    H HG3  . GLN A  1 61 ? -18.858 13.493  -268.052 1.00 0.00 ?  61 GLN A HG3  1  
ATOM 927    H HE21 . GLN A  1 61 ? -18.565 15.955  -269.122 1.00 0.00 ?  61 GLN A HE21 1  
ATOM 928    H HE22 . GLN A  1 61 ? -18.136 17.111  -267.905 1.00 0.00 ?  61 GLN A HE22 1  
ATOM 929    N N    . SER A  1 62 ? -15.206 11.312  -268.492 1.00 0.00 ?  62 SER A N    1  
ATOM 930    C CA   . SER A  1 62 ? -14.207 11.301  -269.554 1.00 0.00 ?  62 SER A CA   1  
ATOM 931    C C    . SER A  1 62 ? -14.078 9.916   -270.175 1.00 0.00 ?  62 SER A C    1  
ATOM 932    O O    . SER A  1 62 ? -13.700 9.779   -271.338 1.00 0.00 ?  62 SER A O    1  
ATOM 933    C CB   . SER A  1 62 ? -12.867 11.764  -269.015 1.00 0.00 ?  62 SER A CB   1  
ATOM 934    O OG   . SER A  1 62 ? -12.291 10.821  -268.154 1.00 0.00 ?  62 SER A OG   1  
ATOM 935    H H    . SER A  1 62 ? -14.905 11.424  -267.535 1.00 0.00 ?  62 SER A H    1  
ATOM 936    H HA   . SER A  1 62 ? -14.394 12.041  -270.333 1.00 0.00 ?  62 SER A HA   1  
ATOM 937    H HB2  . SER A  1 62 ? -12.194 11.934  -269.855 1.00 0.00 ?  62 SER A HB2  1  
ATOM 938    H HB3  . SER A  1 62 ? -13.013 12.698  -268.473 1.00 0.00 ?  62 SER A HB3  1  
ATOM 939    H HG   . SER A  1 62 ? -12.942 10.542  -267.505 1.00 0.00 ?  62 SER A HG   1  
ATOM 940    N N    . ASN A  1 63 ? -14.396 8.890   -269.392 1.00 0.00 ?  63 ASN A N    1  
ATOM 941    C CA   . ASN A  1 63 ? -14.319 7.513   -269.864 1.00 0.00 ?  63 ASN A CA   1  
ATOM 942    C C    . ASN A  1 63 ? -15.349 7.247   -270.954 1.00 0.00 ?  63 ASN A C    1  
ATOM 943    O O    . ASN A  1 63 ? -15.027 6.685   -272.002 1.00 0.00 ?  63 ASN A O    1  
ATOM 944    C CB   . ASN A  1 63 ? -14.493 6.525   -268.725 1.00 0.00 ?  63 ASN A CB   1  
ATOM 945    C CG   . ASN A  1 63 ? -13.305 6.444   -267.807 1.00 0.00 ?  63 ASN A CG   1  
ATOM 946    O OD1  . ASN A  1 63 ? -12.164 6.688   -268.214 1.00 0.00 ?  63 ASN A OD1  1  
ATOM 947    N ND2  . ASN A  1 63 ? -13.557 6.022   -266.594 1.00 0.00 ?  63 ASN A ND2  1  
ATOM 948    H H    . ASN A  1 63 ? -14.698 9.069   -268.445 1.00 0.00 ?  63 ASN A H    1  
ATOM 949    H HA   . ASN A  1 63 ? -13.341 7.329   -270.311 1.00 0.00 ?  63 ASN A HA   1  
ATOM 950    H HB2  . ASN A  1 63 ? -15.407 6.516   -268.129 1.00 0.00 ?  63 ASN A HB2  1  
ATOM 951    H HB3  . ASN A  1 63 ? -14.484 5.661   -269.389 1.00 0.00 ?  63 ASN A HB3  1  
ATOM 952    H HD21 . ASN A  1 63 ? -14.491 5.780   -266.333 1.00 0.00 ?  63 ASN A HD21 1  
ATOM 953    H HD22 . ASN A  1 63 ? -12.814 5.943   -265.929 1.00 0.00 ?  63 ASN A HD22 1  
ATOM 954    N N    . THR A  1 64 ? -16.589 7.652   -270.702 1.00 0.00 ?  64 THR A N    1  
ATOM 955    C CA   . THR A  1 64 ? -17.676 7.424   -271.646 1.00 0.00 ?  64 THR A CA   1  
ATOM 956    C C    . THR A  1 64 ? -17.465 8.213   -272.932 1.00 0.00 ?  64 THR A C    1  
ATOM 957    O O    . THR A  1 64 ? -17.758 7.728   -274.025 1.00 0.00 ?  64 THR A O    1  
ATOM 958    C CB   . THR A  1 64 ? -19.040 7.806   -271.040 1.00 0.00 ?  64 THR A CB   1  
ATOM 959    O OG1  . THR A  1 64 ? -19.015 9.179   -270.628 1.00 0.00 ?  64 THR A OG1  1  
ATOM 960    C CG2  . THR A  1 64 ? -19.356 6.926   -269.841 1.00 0.00 ?  64 THR A CG2  1  
ATOM 961    H H    . THR A  1 64 ? -16.783 8.131   -269.835 1.00 0.00 ?  64 THR A H    1  
ATOM 962    H HA   . THR A  1 64 ? -17.703 6.372   -271.931 1.00 0.00 ?  64 THR A HA   1  
ATOM 963    H HB   . THR A  1 64 ? -19.813 7.677   -271.798 1.00 0.00 ?  64 THR A HB   1  
ATOM 964    H HG1  . THR A  1 64 ? -19.866 9.415   -270.251 1.00 0.00 ?  64 THR A HG1  1  
ATOM 965    H HG21 . THR A  1 64 ? -20.323 7.211   -269.427 1.00 0.00 ?  64 THR A HG21 1  
ATOM 966    H HG22 . THR A  1 64 ? -19.387 5.883   -270.153 1.00 0.00 ?  64 THR A HG22 1  
ATOM 967    H HG23 . THR A  1 64 ? -18.584 7.055   -269.083 1.00 0.00 ?  64 THR A HG23 1  
ATOM 968    N N    . VAL A  1 65 ? -16.953 9.431   -272.795 1.00 0.00 ?  65 VAL A N    1  
ATOM 969    C CA   . VAL A  1 65 ? -16.641 10.265  -273.950 1.00 0.00 ?  65 VAL A CA   1  
ATOM 970    C C    . VAL A  1 65 ? -15.541 9.641   -274.799 1.00 0.00 ?  65 VAL A C    1  
ATOM 971    O O    . VAL A  1 65 ? -15.620 9.635   -276.028 1.00 0.00 ?  65 VAL A O    1  
ATOM 972    C CB   . VAL A  1 65 ? -16.206 11.680  -273.524 1.00 0.00 ?  65 VAL A CB   1  
ATOM 973    C CG1  . VAL A  1 65 ? -15.678 12.458  -274.721 1.00 0.00 ?  65 VAL A CG1  1  
ATOM 974    C CG2  . VAL A  1 65 ? -17.366 12.422  -272.878 1.00 0.00 ?  65 VAL A CG2  1  
ATOM 975    H H    . VAL A  1 65 ? -16.776 9.789   -271.868 1.00 0.00 ?  65 VAL A H    1  
ATOM 976    H HA   . VAL A  1 65 ? -17.497 10.351  -274.620 1.00 0.00 ?  65 VAL A HA   1  
ATOM 977    H HB   . VAL A  1 65 ? -15.423 11.598  -272.770 1.00 0.00 ?  65 VAL A HB   1  
ATOM 978    H HG11 . VAL A  1 65 ? -15.375 13.455  -274.402 1.00 0.00 ?  65 VAL A HG11 1  
ATOM 979    H HG12 . VAL A  1 65 ? -14.819 11.936  -275.143 1.00 0.00 ?  65 VAL A HG12 1  
ATOM 980    H HG13 . VAL A  1 65 ? -16.460 12.541  -275.475 1.00 0.00 ?  65 VAL A HG13 1  
ATOM 981    H HG21 . VAL A  1 65 ? -17.703 11.876  -271.998 1.00 0.00 ?  65 VAL A HG21 1  
ATOM 982    H HG22 . VAL A  1 65 ? -17.042 13.420  -272.583 1.00 0.00 ?  65 VAL A HG22 1  
ATOM 983    H HG23 . VAL A  1 65 ? -18.187 12.503  -273.591 1.00 0.00 ?  65 VAL A HG23 1  
ATOM 984    N N    . LYS A  1 66 ? -14.515 9.116   -274.137 1.00 0.00 ?  66 LYS A N    1  
ATOM 985    C CA   . LYS A  1 66 ? -13.439 8.412   -274.825 1.00 0.00 ?  66 LYS A CA   1  
ATOM 986    C C    . LYS A  1 66 ? -13.983 7.275   -275.680 1.00 0.00 ?  66 LYS A C    1  
ATOM 987    O O    . LYS A  1 66 ? -13.618 7.135   -276.848 1.00 0.00 ?  66 LYS A O    1  
ATOM 988    C CB   . LYS A  1 66 ? -12.423 7.872   -273.817 1.00 0.00 ?  66 LYS A CB   1  
ATOM 989    C CG   . LYS A  1 66 ? -11.283 7.076   -274.439 1.00 0.00 ?  66 LYS A CG   1  
ATOM 990    C CD   . LYS A  1 66 ? -10.350 6.522   -273.373 1.00 0.00 ?  66 LYS A CD   1  
ATOM 991    C CE   . LYS A  1 66 ? -9.267  5.646   -273.986 1.00 0.00 ?  66 LYS A CE   1  
ATOM 992    N NZ   . LYS A  1 66 ? -9.818  4.371   -274.521 1.00 0.00 1  66 LYS A NZ   1  
ATOM 993    H H    . LYS A  1 66 ? -14.480 9.206   -273.132 1.00 0.00 ?  66 LYS A H    1  
ATOM 994    H HA   . LYS A  1 66 ? -12.927 9.094   -275.504 1.00 0.00 ?  66 LYS A HA   1  
ATOM 995    H HB2  . LYS A  1 66 ? -12.016 8.731   -273.283 1.00 0.00 ?  66 LYS A HB2  1  
ATOM 996    H HB3  . LYS A  1 66 ? -12.970 7.237   -273.120 1.00 0.00 ?  66 LYS A HB3  1  
ATOM 997    H HG2  . LYS A  1 66 ? -11.709 6.253   -275.014 1.00 0.00 ?  66 LYS A HG2  1  
ATOM 998    H HG3  . LYS A  1 66 ? -10.725 7.733   -275.105 1.00 0.00 ?  66 LYS A HG3  1  
ATOM 999    H HD2  . LYS A  1 66 ? -9.887  7.358   -272.848 1.00 0.00 ?  66 LYS A HD2  1  
ATOM 1000   H HD3  . LYS A  1 66 ? -10.937 5.933   -272.669 1.00 0.00 ?  66 LYS A HD3  1  
ATOM 1001   H HE2  . LYS A  1 66 ? -8.792  6.203   -274.793 1.00 0.00 ?  66 LYS A HE2  1  
ATOM 1002   H HE3  . LYS A  1 66 ? -8.529  5.426   -273.215 1.00 0.00 ?  66 LYS A HE3  1  
ATOM 1003   H HZ1  . LYS A  1 66 ? -10.502 4.575   -275.236 1.00 0.00 ?  66 LYS A HZ1  1  
ATOM 1004   H HZ2  . LYS A  1 66 ? -9.070  3.821   -274.917 1.00 0.00 ?  66 LYS A HZ2  1  
ATOM 1005   H HZ3  . LYS A  1 66 ? -10.258 3.854   -273.772 1.00 0.00 ?  66 LYS A HZ3  1  
ATOM 1006   N N    . VAL A  1 67 ? -14.858 6.466   -275.093 1.00 0.00 ?  67 VAL A N    1  
ATOM 1007   C CA   . VAL A  1 67 ? -15.394 5.293   -275.774 1.00 0.00 ?  67 VAL A CA   1  
ATOM 1008   C C    . VAL A  1 67 ? -16.207 5.692   -276.999 1.00 0.00 ?  67 VAL A C    1  
ATOM 1009   O O    . VAL A  1 67 ? -16.090 5.079   -278.060 1.00 0.00 ?  67 VAL A O    1  
ATOM 1010   C CB   . VAL A  1 67 ? -16.277 4.449   -274.836 1.00 0.00 ?  67 VAL A CB   1  
ATOM 1011   C CG1  . VAL A  1 67 ? -17.016 3.377   -275.623 1.00 0.00 ?  67 VAL A CG1  1  
ATOM 1012   C CG2  . VAL A  1 67 ? -15.435 3.816   -273.739 1.00 0.00 ?  67 VAL A CG2  1  
ATOM 1013   H H    . VAL A  1 67 ? -15.159 6.668   -274.151 1.00 0.00 ?  67 VAL A H    1  
ATOM 1014   H HA   . VAL A  1 67 ? -14.595 4.661   -276.163 1.00 0.00 ?  67 VAL A HA   1  
ATOM 1015   H HB   . VAL A  1 67 ? -16.998 5.102   -274.346 1.00 0.00 ?  67 VAL A HB   1  
ATOM 1016   H HG11 . VAL A  1 67 ? -17.636 2.790   -274.944 1.00 0.00 ?  67 VAL A HG11 1  
ATOM 1017   H HG12 . VAL A  1 67 ? -17.649 3.849   -276.374 1.00 0.00 ?  67 VAL A HG12 1  
ATOM 1018   H HG13 . VAL A  1 67 ? -16.296 2.723   -276.113 1.00 0.00 ?  67 VAL A HG13 1  
ATOM 1019   H HG21 . VAL A  1 67 ? -14.948 4.599   -273.157 1.00 0.00 ?  67 VAL A HG21 1  
ATOM 1020   H HG22 . VAL A  1 67 ? -16.074 3.224   -273.085 1.00 0.00 ?  67 VAL A HG22 1  
ATOM 1021   H HG23 . VAL A  1 67 ? -14.678 3.173   -274.187 1.00 0.00 ?  67 VAL A HG23 1  
ATOM 1022   N N    . PHE A  1 68 ? -17.033 6.722   -276.845 1.00 0.00 ?  68 PHE A N    1  
ATOM 1023   C CA   . PHE A  1 68 ? -17.829 7.237   -277.953 1.00 0.00 ?  68 PHE A CA   1  
ATOM 1024   C C    . PHE A  1 68 ? -16.944 7.865   -279.022 1.00 0.00 ?  68 PHE A C    1  
ATOM 1025   O O    . PHE A  1 68 ? -17.315 7.920   -280.195 1.00 0.00 ?  68 PHE A O    1  
ATOM 1026   C CB   . PHE A  1 68 ? -18.849 8.259   -277.447 1.00 0.00 ?  68 PHE A CB   1  
ATOM 1027   C CG   . PHE A  1 68 ? -20.091 7.640   -276.871 1.00 0.00 ?  68 PHE A CG   1  
ATOM 1028   C CD1  . PHE A  1 68 ? -20.968 6.930   -277.677 1.00 0.00 ?  68 PHE A CD1  1  
ATOM 1029   C CD2  . PHE A  1 68 ? -20.385 7.767   -275.521 1.00 0.00 ?  68 PHE A CD2  1  
ATOM 1030   C CE1  . PHE A  1 68 ? -22.111 6.362   -277.149 1.00 0.00 ?  68 PHE A CE1  1  
ATOM 1031   C CE2  . PHE A  1 68 ? -21.527 7.199   -274.990 1.00 0.00 ?  68 PHE A CE2  1  
ATOM 1032   C CZ   . PHE A  1 68 ? -22.390 6.496   -275.804 1.00 0.00 ?  68 PHE A CZ   1  
ATOM 1033   H H    . PHE A  1 68 ? -17.110 7.159   -275.938 1.00 0.00 ?  68 PHE A H    1  
ATOM 1034   H HA   . PHE A  1 68 ? -18.365 6.419   -278.435 1.00 0.00 ?  68 PHE A HA   1  
ATOM 1035   H HB2  . PHE A  1 68 ? -18.411 8.869   -276.659 1.00 0.00 ?  68 PHE A HB2  1  
ATOM 1036   H HB3  . PHE A  1 68 ? -19.172 8.901   -278.265 1.00 0.00 ?  68 PHE A HB3  1  
ATOM 1037   H HD1  . PHE A  1 68 ? -20.747 6.823   -278.739 1.00 0.00 ?  68 PHE A HD1  1  
ATOM 1038   H HD2  . PHE A  1 68 ? -19.703 8.324   -274.878 1.00 0.00 ?  68 PHE A HD2  1  
ATOM 1039   H HE1  . PHE A  1 68 ? -22.792 5.806   -277.793 1.00 0.00 ?  68 PHE A HE1  1  
ATOM 1040   H HE2  . PHE A  1 68 ? -21.745 7.306   -273.928 1.00 0.00 ?  68 PHE A HE2  1  
ATOM 1041   H HZ   . PHE A  1 68 ? -23.290 6.047   -275.386 1.00 0.00 ?  68 PHE A HZ   1  
ATOM 1042   N N    . LYS A  1 69 ? -15.773 8.339   -278.610 1.00 0.00 ?  69 LYS A N    1  
ATOM 1043   C CA   . LYS A  1 69 ? -14.770 8.823   -279.550 1.00 0.00 ?  69 LYS A CA   1  
ATOM 1044   C C    . LYS A  1 69 ? -13.993 7.669   -280.170 1.00 0.00 ?  69 LYS A C    1  
ATOM 1045   O O    . LYS A  1 69 ? -13.522 7.762   -281.303 1.00 0.00 ?  69 LYS A O    1  
ATOM 1046   C CB   . LYS A  1 69 ? -13.809 9.791   -278.857 1.00 0.00 ?  69 LYS A CB   1  
ATOM 1047   C CG   . LYS A  1 69 ? -12.920 10.583  -279.807 1.00 0.00 ?  69 LYS A CG   1  
ATOM 1048   C CD   . LYS A  1 69 ? -11.610 9.857   -280.073 1.00 0.00 ?  69 LYS A CD   1  
ATOM 1049   C CE   . LYS A  1 69 ? -10.716 10.654  -281.013 1.00 0.00 ?  69 LYS A CE   1  
ATOM 1050   N NZ   . LYS A  1 69 ? -9.543  9.861   -281.471 1.00 0.00 1  69 LYS A NZ   1  
ATOM 1051   H H    . LYS A  1 69 ? -15.574 8.365   -277.620 1.00 0.00 ?  69 LYS A H    1  
ATOM 1052   H HA   . LYS A  1 69 ? -15.257 9.347   -280.373 1.00 0.00 ?  69 LYS A HA   1  
ATOM 1053   H HB2  . LYS A  1 69 ? -14.417 10.479  -278.270 1.00 0.00 ?  69 LYS A HB2  1  
ATOM 1054   H HB3  . LYS A  1 69 ? -13.185 9.198   -278.188 1.00 0.00 ?  69 LYS A HB3  1  
ATOM 1055   H HG2  . LYS A  1 69 ? -13.456 10.724  -280.746 1.00 0.00 ?  69 LYS A HG2  1  
ATOM 1056   H HG3  . LYS A  1 69 ? -12.713 11.554  -279.358 1.00 0.00 ?  69 LYS A HG3  1  
ATOM 1057   H HD2  . LYS A  1 69 ? -11.096 9.707   -279.123 1.00 0.00 ?  69 LYS A HD2  1  
ATOM 1058   H HD3  . LYS A  1 69 ? -11.834 8.889   -280.521 1.00 0.00 ?  69 LYS A HD3  1  
ATOM 1059   H HE2  . LYS A  1 69 ? -11.309 10.955  -281.875 1.00 0.00 ?  69 LYS A HE2  1  
ATOM 1060   H HE3  . LYS A  1 69 ? -10.369 11.541  -280.484 1.00 0.00 ?  69 LYS A HE3  1  
ATOM 1061   H HZ1  . LYS A  1 69 ? -9.864  9.039   -281.962 1.00 0.00 ?  69 LYS A HZ1  1  
ATOM 1062   H HZ2  . LYS A  1 69 ? -8.977  10.424  -282.090 1.00 0.00 ?  69 LYS A HZ2  1  
ATOM 1063   H HZ3  . LYS A  1 69 ? -8.992  9.582   -280.672 1.00 0.00 ?  69 LYS A HZ3  1  
ATOM 1064   N N    . ASP A  1 70 ? -13.864 6.579   -279.421 1.00 0.00 ?  70 ASP A N    1  
ATOM 1065   C CA   . ASP A  1 70 ? -13.124 5.412   -279.886 1.00 0.00 ?  70 ASP A CA   1  
ATOM 1066   C C    . ASP A  1 70 ? -13.863 4.705   -281.014 1.00 0.00 ?  70 ASP A C    1  
ATOM 1067   O O    . ASP A  1 70 ? -13.247 4.211   -281.958 1.00 0.00 ?  70 ASP A O    1  
ATOM 1068   C CB   . ASP A  1 70 ? -12.874 4.440   -278.730 1.00 0.00 ?  70 ASP A CB   1  
ATOM 1069   C CG   . ASP A  1 70 ? -11.789 4.883   -277.758 1.00 0.00 ?  70 ASP A CG   1  
ATOM 1070   O OD1  . ASP A  1 70 ? -11.071 5.801   -278.079 1.00 0.00 ?  70 ASP A OD1  1  
ATOM 1071   O OD2  . ASP A  1 70 ? -11.787 4.412   -276.647 1.00 0.00 -1 70 ASP A OD2  1  
ATOM 1072   H H    . ASP A  1 70 ? -14.290 6.559   -278.505 1.00 0.00 ?  70 ASP A H    1  
ATOM 1073   H HA   . ASP A  1 70 ? -12.161 5.724   -280.293 1.00 0.00 ?  70 ASP A HA   1  
ATOM 1074   H HB2  . ASP A  1 70 ? -13.776 4.185   -278.175 1.00 0.00 ?  70 ASP A HB2  1  
ATOM 1075   H HB3  . ASP A  1 70 ? -12.529 3.567   -279.286 1.00 0.00 ?  70 ASP A HB3  1  
ATOM 1076   N N    . ILE A  1 71 ? -15.187 4.660   -280.911 1.00 0.00 ?  71 ILE A N    1  
ATOM 1077   C CA   . ILE A  1 71 ? -16.018 4.090   -281.964 1.00 0.00 ?  71 ILE A CA   1  
ATOM 1078   C C    . ILE A  1 71 ? -16.100 5.021   -283.167 1.00 0.00 ?  71 ILE A C    1  
ATOM 1079   O O    . ILE A  1 71 ? -16.392 4.587   -284.281 1.00 0.00 ?  71 ILE A O    1  
ATOM 1080   C CB   . ILE A  1 71 ? -17.442 3.791   -281.460 1.00 0.00 ?  71 ILE A CB   1  
ATOM 1081   C CG1  . ILE A  1 71 ? -18.124 5.079   -280.991 1.00 0.00 ?  71 ILE A CG1  1  
ATOM 1082   C CG2  . ILE A  1 71 ? -17.405 2.765   -280.337 1.00 0.00 ?  71 ILE A CG2  1  
ATOM 1083   C CD1  . ILE A  1 71 ? -19.554 4.884   -280.542 1.00 0.00 ?  71 ILE A CD1  1  
ATOM 1084   H H    . ILE A  1 71 ? -15.628 5.031   -280.082 1.00 0.00 ?  71 ILE A H    1  
ATOM 1085   H HA   . ILE A  1 71 ? -15.572 3.175   -282.353 1.00 0.00 ?  71 ILE A HA   1  
ATOM 1086   H HB   . ILE A  1 71 ? -18.038 3.404   -282.286 1.00 0.00 ?  71 ILE A HB   1  
ATOM 1087   H HG12 . ILE A  1 71 ? -17.534 5.476   -280.165 1.00 0.00 ?  71 ILE A HG12 1  
ATOM 1088   H HG13 . ILE A  1 71 ? -18.097 5.781   -281.824 1.00 0.00 ?  71 ILE A HG13 1  
ATOM 1089   H HG21 . ILE A  1 71 ? -18.419 2.566   -279.992 1.00 0.00 ?  71 ILE A HG21 1  
ATOM 1090   H HG22 . ILE A  1 71 ? -16.958 1.842   -280.703 1.00 0.00 ?  71 ILE A HG22 1  
ATOM 1091   H HG23 . ILE A  1 71 ? -16.810 3.153   -279.510 1.00 0.00 ?  71 ILE A HG23 1  
ATOM 1092   H HD11 . ILE A  1 71 ? -19.583 4.184   -279.709 1.00 0.00 ?  71 ILE A HD11 1  
ATOM 1093   H HD12 . ILE A  1 71 ? -19.970 5.841   -280.225 1.00 0.00 ?  71 ILE A HD12 1  
ATOM 1094   H HD13 . ILE A  1 71 ? -20.145 4.489   -281.369 1.00 0.00 ?  71 ILE A HD13 1  
ATOM 1095   N N    . ASP A  1 72 ? -15.841 6.303   -282.934 1.00 0.00 ?  72 ASP A N    1  
ATOM 1096   C CA   . ASP A  1 72 ? -15.659 7.257   -284.022 1.00 0.00 ?  72 ASP A CA   1  
ATOM 1097   C C    . ASP A  1 72 ? -14.390 6.960   -284.809 1.00 0.00 ?  72 ASP A C    1  
ATOM 1098   O O    . ASP A  1 72 ? -14.403 6.932   -286.040 1.00 0.00 ?  72 ASP A O    1  
ATOM 1099   C CB   . ASP A  1 72 ? -15.617 8.688   -283.479 1.00 0.00 ?  72 ASP A CB   1  
ATOM 1100   C CG   . ASP A  1 72 ? -16.958 9.211   -282.980 1.00 0.00 ?  72 ASP A CG   1  
ATOM 1101   O OD1  . ASP A  1 72 ? -17.961 8.622   -283.306 1.00 0.00 ?  72 ASP A OD1  1  
ATOM 1102   O OD2  . ASP A  1 72 ? -16.959 10.093  -282.155 1.00 0.00 -1 72 ASP A OD2  1  
ATOM 1103   H H    . ASP A  1 72 ? -15.768 6.625   -281.980 1.00 0.00 ?  72 ASP A H    1  
ATOM 1104   H HA   . ASP A  1 72 ? -16.487 7.176   -284.726 1.00 0.00 ?  72 ASP A HA   1  
ATOM 1105   H HB2  . ASP A  1 72 ? -14.860 8.839   -282.710 1.00 0.00 ?  72 ASP A HB2  1  
ATOM 1106   H HB3  . ASP A  1 72 ? -15.331 9.227   -284.383 1.00 0.00 ?  72 ASP A HB3  1  
ATOM 1107   N N    . ALA A  1 73 ? -13.293 6.737   -284.093 1.00 0.00 ?  73 ALA A N    1  
ATOM 1108   C CA   . ALA A  1 73 ? -12.032 6.358   -284.719 1.00 0.00 ?  73 ALA A CA   1  
ATOM 1109   C C    . ALA A  1 73 ? -12.162 5.035   -285.462 1.00 0.00 ?  73 ALA A C    1  
ATOM 1110   O O    . ALA A  1 73 ? -11.602 4.863   -286.545 1.00 0.00 ?  73 ALA A O    1  
ATOM 1111   C CB   . ALA A  1 73 ? -10.926 6.278   -283.677 1.00 0.00 ?  73 ALA A CB   1  
ATOM 1112   H H    . ALA A  1 73 ? -13.334 6.832   -283.088 1.00 0.00 ?  73 ALA A H    1  
ATOM 1113   H HA   . ALA A  1 73 ? -11.764 7.118   -285.453 1.00 0.00 ?  73 ALA A HA   1  
ATOM 1114   H HB1  . ALA A  1 73 ? -11.187 5.533   -282.927 1.00 0.00 ?  73 ALA A HB1  1  
ATOM 1115   H HB2  . ALA A  1 73 ? -9.992  5.994   -284.161 1.00 0.00 ?  73 ALA A HB2  1  
ATOM 1116   H HB3  . ALA A  1 73 ? -10.806 7.250   -283.198 1.00 0.00 ?  73 ALA A HB3  1  
ATOM 1117   N N    . ALA A  1 74 ? -12.903 4.102   -284.875 1.00 0.00 ?  74 ALA A N    1  
ATOM 1118   C CA   . ALA A  1 74 ? -13.109 2.792   -285.481 1.00 0.00 ?  74 ALA A CA   1  
ATOM 1119   C C    . ALA A  1 74 ? -13.761 2.916   -286.852 1.00 0.00 ?  74 ALA A C    1  
ATOM 1120   O O    . ALA A  1 74 ? -13.395 2.209   -287.791 1.00 0.00 ?  74 ALA A O    1  
ATOM 1121   C CB   . ALA A  1 74 ? -13.950 1.912   -284.569 1.00 0.00 ?  74 ALA A CB   1  
ATOM 1122   H H    . ALA A  1 74 ? -13.335 4.305   -283.985 1.00 0.00 ?  74 ALA A H    1  
ATOM 1123   H HA   . ALA A  1 74 ? -12.139 2.317   -285.625 1.00 0.00 ?  74 ALA A HA   1  
ATOM 1124   H HB1  . ALA A  1 74 ? -14.919 2.381   -284.403 1.00 0.00 ?  74 ALA A HB1  1  
ATOM 1125   H HB2  . ALA A  1 74 ? -14.095 0.938   -285.036 1.00 0.00 ?  74 ALA A HB2  1  
ATOM 1126   H HB3  . ALA A  1 74 ? -13.440 1.784   -283.614 1.00 0.00 ?  74 ALA A HB3  1  
ATOM 1127   N N    . ILE A  1 75 ? -14.729 3.820   -286.962 1.00 0.00 ?  75 ILE A N    1  
ATOM 1128   C CA   . ILE A  1 75 ? -15.462 4.010   -288.208 1.00 0.00 ?  75 ILE A CA   1  
ATOM 1129   C C    . ILE A  1 75 ? -14.584 4.655   -289.272 1.00 0.00 ?  75 ILE A C    1  
ATOM 1130   O O    . ILE A  1 75 ? -14.521 4.185   -290.408 1.00 0.00 ?  75 ILE A O    1  
ATOM 1131   C CB   . ILE A  1 75 ? -16.718 4.876   -287.998 1.00 0.00 ?  75 ILE A CB   1  
ATOM 1132   C CG1  . ILE A  1 75 ? -17.733 4.140   -287.120 1.00 0.00 ?  75 ILE A CG1  1  
ATOM 1133   C CG2  . ILE A  1 75 ? -17.338 5.247   -289.336 1.00 0.00 ?  75 ILE A CG2  1  
ATOM 1134   C CD1  . ILE A  1 75 ? -18.851 5.020   -286.609 1.00 0.00 ?  75 ILE A CD1  1  
ATOM 1135   H H    . ILE A  1 75 ? -14.962 4.390   -286.162 1.00 0.00 ?  75 ILE A H    1  
ATOM 1136   H HA   . ILE A  1 75 ? -15.751 3.049   -288.633 1.00 0.00 ?  75 ILE A HA   1  
ATOM 1137   H HB   . ILE A  1 75 ? -16.439 5.782   -287.462 1.00 0.00 ?  75 ILE A HB   1  
ATOM 1138   H HG12 . ILE A  1 75 ? -18.152 3.330   -287.716 1.00 0.00 ?  75 ILE A HG12 1  
ATOM 1139   H HG13 . ILE A  1 75 ? -17.186 3.721   -286.274 1.00 0.00 ?  75 ILE A HG13 1  
ATOM 1140   H HG21 . ILE A  1 75 ? -18.224 5.858   -289.170 1.00 0.00 ?  75 ILE A HG21 1  
ATOM 1141   H HG22 . ILE A  1 75 ? -16.616 5.809   -289.928 1.00 0.00 ?  75 ILE A HG22 1  
ATOM 1142   H HG23 . ILE A  1 75 ? -17.618 4.340   -289.872 1.00 0.00 ?  75 ILE A HG23 1  
ATOM 1143   H HD11 . ILE A  1 75 ? -19.399 5.439   -287.452 1.00 0.00 ?  75 ILE A HD11 1  
ATOM 1144   H HD12 . ILE A  1 75 ? -19.530 4.429   -285.994 1.00 0.00 ?  75 ILE A HD12 1  
ATOM 1145   H HD13 . ILE A  1 75 ? -18.433 5.830   -286.010 1.00 0.00 ?  75 ILE A HD13 1  
ATOM 1146   N N    . ILE A  1 76 ? -13.905 5.734   -288.897 1.00 0.00 ?  76 ILE A N    1  
ATOM 1147   C CA   . ILE A  1 76 ? -13.096 6.496   -289.840 1.00 0.00 ?  76 ILE A CA   1  
ATOM 1148   C C    . ILE A  1 76 ? -11.799 5.767   -290.167 1.00 0.00 ?  76 ILE A C    1  
ATOM 1149   O O    . ILE A  1 76 ? -11.108 6.109   -291.127 1.00 0.00 ?  76 ILE A O    1  
ATOM 1150   C CB   . ILE A  1 76 ? -12.762 7.897   -289.296 1.00 0.00 ?  76 ILE A CB   1  
ATOM 1151   C CG1  . ILE A  1 76 ? -11.880 7.790   -288.049 1.00 0.00 ?  76 ILE A CG1  1  
ATOM 1152   C CG2  . ILE A  1 76 ? -14.038 8.664   -288.984 1.00 0.00 ?  76 ILE A CG2  1  
ATOM 1153   C CD1  . ILE A  1 76 ? -11.369 9.120   -287.547 1.00 0.00 ?  76 ILE A CD1  1  
ATOM 1154   H H    . ILE A  1 76 ? -13.952 6.035   -287.934 1.00 0.00 ?  76 ILE A H    1  
ATOM 1155   H HA   . ILE A  1 76 ? -13.608 6.591   -290.797 1.00 0.00 ?  76 ILE A HA   1  
ATOM 1156   H HB   . ILE A  1 76 ? -12.185 8.441   -290.043 1.00 0.00 ?  76 ILE A HB   1  
ATOM 1157   H HG12 . ILE A  1 76 ? -12.474 7.311   -287.272 1.00 0.00 ?  76 ILE A HG12 1  
ATOM 1158   H HG13 . ILE A  1 76 ? -11.035 7.150   -288.305 1.00 0.00 ?  76 ILE A HG13 1  
ATOM 1159   H HG21 . ILE A  1 76 ? -13.785 9.652   -288.599 1.00 0.00 ?  76 ILE A HG21 1  
ATOM 1160   H HG22 . ILE A  1 76 ? -14.630 8.769   -289.892 1.00 0.00 ?  76 ILE A HG22 1  
ATOM 1161   H HG23 . ILE A  1 76 ? -14.616 8.121   -288.235 1.00 0.00 ?  76 ILE A HG23 1  
ATOM 1162   H HD11 . ILE A  1 76 ? -12.211 9.761   -287.289 1.00 0.00 ?  76 ILE A HD11 1  
ATOM 1163   H HD12 . ILE A  1 76 ? -10.751 8.963   -286.662 1.00 0.00 ?  76 ILE A HD12 1  
ATOM 1164   H HD13 . ILE A  1 76 ? -10.773 9.600   -288.324 1.00 0.00 ?  76 ILE A HD13 1  
ATOM 1165   N N    . GLN A  1 77 ? -11.474 4.759   -289.364 1.00 0.00 ?  77 GLN A N    1  
ATOM 1166   C CA   . GLN A  1 77 ? -10.401 3.829   -289.698 1.00 0.00 ?  77 GLN A CA   1  
ATOM 1167   C C    . GLN A  1 77 ? -10.716 3.061   -290.974 1.00 0.00 ?  77 GLN A C    1  
ATOM 1168   O O    . GLN A  1 77 ? -9.812  2.656   -291.706 1.00 0.00 ?  77 GLN A O    1  
ATOM 1169   C CB   . GLN A  1 77 ? -10.167 2.847   -288.547 1.00 0.00 ?  77 GLN A CB   1  
ATOM 1170   C CG   . GLN A  1 77 ? -8.969  1.934   -288.742 1.00 0.00 ?  77 GLN A CG   1  
ATOM 1171   C CD   . GLN A  1 77 ? -7.663  2.702   -288.821 1.00 0.00 ?  77 GLN A CD   1  
ATOM 1172   O OE1  . GLN A  1 77 ? -7.411  3.610   -288.023 1.00 0.00 ?  77 GLN A OE1  1  
ATOM 1173   N NE2  . GLN A  1 77 ? -6.825  2.346   -289.788 1.00 0.00 ?  77 GLN A NE2  1  
ATOM 1174   H H    . GLN A  1 77 ? -11.983 4.634   -288.501 1.00 0.00 ?  77 GLN A H    1  
ATOM 1175   H HA   . GLN A  1 77 ? -9.483  4.385   -289.888 1.00 0.00 ?  77 GLN A HA   1  
ATOM 1176   H HB2  . GLN A  1 77 ? -10.034 3.444   -287.645 1.00 0.00 ?  77 GLN A HB2  1  
ATOM 1177   H HB3  . GLN A  1 77 ? -11.074 2.249   -288.455 1.00 0.00 ?  77 GLN A HB3  1  
ATOM 1178   H HG2  . GLN A  1 77 ? -8.798  1.046   -288.134 1.00 0.00 ?  77 GLN A HG2  1  
ATOM 1179   H HG3  . GLN A  1 77 ? -9.253  1.632   -289.751 1.00 0.00 ?  77 GLN A HG3  1  
ATOM 1180   H HE21 . GLN A  1 77 ? -7.070  1.606   -290.415 1.00 0.00 ?  77 GLN A HE21 1  
ATOM 1181   H HE22 . GLN A  1 77 ? -5.948  2.817   -289.890 1.00 0.00 ?  77 GLN A HE22 1  
ATOM 1182   N N    . ASN A  1 78 ? -12.003 2.862   -291.238 1.00 0.00 ?  78 ASN A N    1  
ATOM 1183   C CA   . ASN A  1 78 ? -12.441 2.195   -292.458 1.00 0.00 ?  78 ASN A CA   1  
ATOM 1184   C C    . ASN A  1 78 ? -12.995 3.195   -293.464 1.00 0.00 ?  78 ASN A C    1  
ATOM 1185   O O    . ASN A  1 78 ? -13.848 2.858   -294.284 1.00 0.00 ?  78 ASN A O    1  
ATOM 1186   C CB   . ASN A  1 78 ? -13.473 1.121   -292.163 1.00 0.00 ?  78 ASN A CB   1  
ATOM 1187   C CG   . ASN A  1 78 ? -12.937 -0.028  -291.356 1.00 0.00 ?  78 ASN A CG   1  
ATOM 1188   O OD1  . ASN A  1 78 ? -11.759 -0.389  -291.458 1.00 0.00 ?  78 ASN A OD1  1  
ATOM 1189   N ND2  . ASN A  1 78 ? -13.815 -0.656  -290.616 1.00 0.00 ?  78 ASN A ND2  1  
ATOM 1190   H H    . ASN A  1 78 ? -12.695 3.181   -290.575 1.00 0.00 ?  78 ASN A H    1  
ATOM 1191   H HA   . ASN A  1 78 ? -11.591 1.709   -292.940 1.00 0.00 ?  78 ASN A HA   1  
ATOM 1192   H HB2  . ASN A  1 78 ? -14.465 1.386   -291.794 1.00 0.00 ?  78 ASN A HB2  1  
ATOM 1193   H HB3  . ASN A  1 78 ? -13.544 0.814   -293.207 1.00 0.00 ?  78 ASN A HB3  1  
ATOM 1194   H HD21 . ASN A  1 78 ? -14.770 -0.361  -290.614 1.00 0.00 ?  78 ASN A HD21 1  
ATOM 1195   H HD22 . ASN A  1 78 ? -13.529 -1.431  -290.051 1.00 0.00 ?  78 ASN A HD22 1  
ATOM 1196   N N    . PHE A  1 79 ? -12.504 4.428   -293.396 1.00 0.00 ?  79 PHE A N    1  
ATOM 1197   C CA   . PHE A  1 79 ? -13.008 5.501   -294.244 1.00 0.00 ?  79 PHE A CA   1  
ATOM 1198   C C    . PHE A  1 79 ? -12.423 5.416   -295.648 1.00 0.00 ?  79 PHE A C    1  
ATOM 1199   O O    . PHE A  1 79 ? -11.603 6.246   -296.041 1.00 0.00 ?  79 PHE A O    1  
ATOM 1200   C CB   . PHE A  1 79 ? -12.693 6.865   -293.625 1.00 0.00 ?  79 PHE A CB   1  
ATOM 1201   C CG   . PHE A  1 79 ? -13.527 7.987   -294.175 1.00 0.00 ?  79 PHE A CG   1  
ATOM 1202   C CD1  . PHE A  1 79 ? -14.846 8.150   -293.776 1.00 0.00 ?  79 PHE A CD1  1  
ATOM 1203   C CD2  . PHE A  1 79 ? -12.996 8.881   -295.091 1.00 0.00 ?  79 PHE A CD2  1  
ATOM 1204   C CE1  . PHE A  1 79 ? -15.614 9.182   -294.281 1.00 0.00 ?  79 PHE A CE1  1  
ATOM 1205   C CE2  . PHE A  1 79 ? -13.761 9.914   -295.597 1.00 0.00 ?  79 PHE A CE2  1  
ATOM 1206   C CZ   . PHE A  1 79 ? -15.072 10.064  -295.191 1.00 0.00 ?  79 PHE A CZ   1  
ATOM 1207   H H    . PHE A  1 79 ? -11.762 4.627   -292.740 1.00 0.00 ?  79 PHE A H    1  
ATOM 1208   H HA   . PHE A  1 79 ? -14.090 5.410   -294.353 1.00 0.00 ?  79 PHE A HA   1  
ATOM 1209   H HB2  . PHE A  1 79 ? -12.873 6.840   -292.551 1.00 0.00 ?  79 PHE A HB2  1  
ATOM 1210   H HB3  . PHE A  1 79 ? -11.654 7.129   -293.812 1.00 0.00 ?  79 PHE A HB3  1  
ATOM 1211   H HD1  . PHE A  1 79 ? -15.274 7.453   -293.056 1.00 0.00 ?  79 PHE A HD1  1  
ATOM 1212   H HD2  . PHE A  1 79 ? -11.960 8.762   -295.412 1.00 0.00 ?  79 PHE A HD2  1  
ATOM 1213   H HE1  . PHE A  1 79 ? -16.649 9.298   -293.960 1.00 0.00 ?  79 PHE A HE1  1  
ATOM 1214   H HE2  . PHE A  1 79 ? -13.331 10.611  -296.316 1.00 0.00 ?  79 PHE A HE2  1  
ATOM 1215   H HZ   . PHE A  1 79 ? -15.677 10.877  -295.590 1.00 0.00 ?  79 PHE A HZ   1  
ATOM 1216   N N    . ARG A  1 80 ? -12.848 4.406   -296.400 1.00 0.00 ?  80 ARG A N    1  
ATOM 1217   C CA   . ARG A  1 80 ? -12.309 4.164   -297.733 1.00 0.00 ?  80 ARG A CA   1  
ATOM 1218   C C    . ARG A  1 80 ? -12.716 5.269   -298.701 1.00 0.00 ?  80 ARG A C    1  
ATOM 1219   O O    . ARG A  1 80 ? -12.123 6.312   -298.704 1.00 0.00 ?  80 ARG A O    1  
ATOM 1220   C CB   . ARG A  1 80 ? -12.689 2.790   -298.265 1.00 0.00 ?  80 ARG A CB   1  
ATOM 1221   C CG   . ARG A  1 80 ? -12.189 1.621   -297.432 1.00 0.00 ?  80 ARG A CG   1  
ATOM 1222   C CD   . ARG A  1 80 ? -10.711 1.542   -297.312 1.00 0.00 ?  80 ARG A CD   1  
ATOM 1223   N NE   . ARG A  1 80 ? -10.021 1.234   -298.554 1.00 0.00 ?  80 ARG A NE   1  
ATOM 1224   C CZ   . ARG A  1 80 ? -8.688  1.317   -298.731 1.00 0.00 ?  80 ARG A CZ   1  
ATOM 1225   N NH1  . ARG A  1 80 ? -7.902  1.734   -297.763 1.00 0.00 1  80 ARG A NH1  1  
ATOM 1226   N NH2  . ARG A  1 80 ? -8.193  0.992   -299.912 1.00 0.00 ?  80 ARG A NH2  1  
ATOM 1227   O OXT  . ARG A  1 80 ? -13.877 5.480   -298.916 1.00 0.00 -1 80 ARG A OXT  1  
ATOM 1228   H H    . ARG A  1 80 ? -13.563 3.791   -296.039 1.00 0.00 ?  80 ARG A H    1  
ATOM 1229   H HA   . ARG A  1 80 ? -11.219 4.169   -297.697 1.00 0.00 ?  80 ARG A HA   1  
ATOM 1230   H HB2  . ARG A  1 80 ? -13.776 2.758   -298.315 1.00 0.00 ?  80 ARG A HB2  1  
ATOM 1231   H HB3  . ARG A  1 80 ? -12.277 2.715   -299.272 1.00 0.00 ?  80 ARG A HB3  1  
ATOM 1232   H HG2  . ARG A  1 80 ? -12.603 1.709   -296.427 1.00 0.00 ?  80 ARG A HG2  1  
ATOM 1233   H HG3  . ARG A  1 80 ? -12.540 0.695   -297.889 1.00 0.00 ?  80 ARG A HG3  1  
ATOM 1234   H HD2  . ARG A  1 80 ? -10.332 2.501   -296.958 1.00 0.00 ?  80 ARG A HD2  1  
ATOM 1235   H HD3  . ARG A  1 80 ? -10.455 0.764   -296.594 1.00 0.00 ?  80 ARG A HD3  1  
ATOM 1236   H HE   . ARG A  1 80 ? -10.397 0.924   -299.441 1.00 0.00 ?  80 ARG A HE   1  
ATOM 1237   H HH11 . ARG A  1 80 ? -8.298  1.996   -296.871 1.00 0.00 ?  80 ARG A HH11 1  
ATOM 1238   H HH12 . ARG A  1 80 ? -6.905  1.789   -297.915 1.00 0.00 ?  80 ARG A HH12 1  
ATOM 1239   H HH21 . ARG A  1 80 ? -8.814  0.691   -300.651 1.00 0.00 ?  80 ARG A HH21 1  
ATOM 1240   H HH22 . ARG A  1 80 ? -7.198  1.046   -300.071 1.00 0.00 ?  80 ARG A HH22 1  
ATOM 1241   N N    . MET B  1 1  ? -44.093 -13.588 -274.571 1.00 0.00 ?  1  MET B N    1  
ATOM 1242   C CA   . MET B  1 1  ? -43.486 -14.351 -275.655 1.00 0.00 ?  1  MET B CA   1  
ATOM 1243   C C    . MET B  1 1  ? -42.217 -13.676 -276.160 1.00 0.00 ?  1  MET B C    1  
ATOM 1244   O O    . MET B  1 1  ? -41.294 -14.341 -276.630 1.00 0.00 ?  1  MET B O    1  
ATOM 1245   C CB   . MET B  1 1  ? -44.483 -14.525 -276.800 1.00 0.00 ?  1  MET B CB   1  
ATOM 1246   C CG   . MET B  1 1  ? -45.722 -15.332 -276.438 1.00 0.00 ?  1  MET B CG   1  
ATOM 1247   S SD   . MET B  1 1  ? -45.324 -16.987 -275.841 1.00 0.00 ?  1  MET B SD   1  
ATOM 1248   C CE   . MET B  1 1  ? -44.717 -17.752 -277.342 1.00 0.00 ?  1  MET B CE   1  
ATOM 1249   H H1   . MET B  1 1  ? -45.023 -13.233 -274.669 1.00 0.00 ?  1  MET B H1   1  
ATOM 1250   H H2   . MET B  1 1  ? -44.214 -14.008 -273.671 1.00 0.00 ?  1  MET B H2   1  
ATOM 1251   H H3   . MET B  1 1  ? -43.667 -12.740 -274.257 1.00 0.00 ?  1  MET B H3   1  
ATOM 1252   H HA   . MET B  1 1  ? -43.192 -15.337 -275.297 1.00 0.00 ?  1  MET B HA   1  
ATOM 1253   H HB2  . MET B  1 1  ? -44.780 -13.526 -277.117 1.00 0.00 ?  1  MET B HB2  1  
ATOM 1254   H HB3  . MET B  1 1  ? -43.951 -15.022 -277.612 1.00 0.00 ?  1  MET B HB3  1  
ATOM 1255   H HG2  . MET B  1 1  ? -46.264 -14.793 -275.662 1.00 0.00 ?  1  MET B HG2  1  
ATOM 1256   H HG3  . MET B  1 1  ? -46.346 -15.413 -277.328 1.00 0.00 ?  1  MET B HG3  1  
ATOM 1257   H HE1  . MET B  1 1  ? -43.850 -17.199 -277.706 1.00 0.00 ?  1  MET B HE1  1  
ATOM 1258   H HE2  . MET B  1 1  ? -44.430 -18.783 -277.135 1.00 0.00 ?  1  MET B HE2  1  
ATOM 1259   H HE3  . MET B  1 1  ? -45.501 -17.738 -278.100 1.00 0.00 ?  1  MET B HE3  1  
ATOM 1260   N N    . ALA B  1 2  ? -42.177 -12.352 -276.060 1.00 0.00 ?  2  ALA B N    1  
ATOM 1261   C CA   . ALA B  1 2  ? -41.027 -11.583 -276.519 1.00 0.00 ?  2  ALA B CA   1  
ATOM 1262   C C    . ALA B  1 2  ? -39.855 -11.715 -275.554 1.00 0.00 ?  2  ALA B C    1  
ATOM 1263   O O    . ALA B  1 2  ? -40.045 -11.805 -274.341 1.00 0.00 ?  2  ALA B O    1  
ATOM 1264   C CB   . ALA B  1 2  ? -41.405 -10.121 -276.702 1.00 0.00 ?  2  ALA B CB   1  
ATOM 1265   H H    . ALA B  1 2  ? -42.964 -11.865 -275.655 1.00 0.00 ?  2  ALA B H    1  
ATOM 1266   H HA   . ALA B  1 2  ? -40.702 -11.981 -277.481 1.00 0.00 ?  2  ALA B HA   1  
ATOM 1267   H HB1  . ALA B  1 2  ? -41.747 -9.712  -275.753 1.00 0.00 ?  2  ALA B HB1  1  
ATOM 1268   H HB2  . ALA B  1 2  ? -40.535 -9.561  -277.045 1.00 0.00 ?  2  ALA B HB2  1  
ATOM 1269   H HB3  . ALA B  1 2  ? -42.203 -10.041 -277.441 1.00 0.00 ?  2  ALA B HB3  1  
ATOM 1270   N N    . THR B  1 3  ? -38.644 -11.725 -276.100 1.00 0.00 ?  3  THR B N    1  
ATOM 1271   C CA   . THR B  1 3  ? -37.438 -11.832 -275.287 1.00 0.00 ?  3  THR B CA   1  
ATOM 1272   C C    . THR B  1 3  ? -36.428 -10.754 -275.655 1.00 0.00 ?  3  THR B C    1  
ATOM 1273   O O    . THR B  1 3  ? -36.019 -10.642 -276.811 1.00 0.00 ?  3  THR B O    1  
ATOM 1274   C CB   . THR B  1 3  ? -36.777 -13.214 -275.437 1.00 0.00 ?  3  THR B CB   1  
ATOM 1275   O OG1  . THR B  1 3  ? -37.704 -14.236 -275.047 1.00 0.00 ?  3  THR B OG1  1  
ATOM 1276   C CG2  . THR B  1 3  ? -35.532 -13.307 -274.568 1.00 0.00 ?  3  THR B CG2  1  
ATOM 1277   H H    . THR B  1 3  ? -38.556 -11.656 -277.103 1.00 0.00 ?  3  THR B H    1  
ATOM 1278   H HA   . THR B  1 3  ? -37.687 -11.676 -274.236 1.00 0.00 ?  3  THR B HA   1  
ATOM 1279   H HB   . THR B  1 3  ? -36.502 -13.364 -276.480 1.00 0.00 ?  3  THR B HB   1  
ATOM 1280   H HG1  . THR B  1 3  ? -37.289 -15.097 -275.141 1.00 0.00 ?  3  THR B HG1  1  
ATOM 1281   H HG21 . THR B  1 3  ? -35.078 -14.290 -274.687 1.00 0.00 ?  3  THR B HG21 1  
ATOM 1282   H HG22 . THR B  1 3  ? -34.820 -12.538 -274.869 1.00 0.00 ?  3  THR B HG22 1  
ATOM 1283   H HG23 . THR B  1 3  ? -35.806 -13.158 -273.524 1.00 0.00 ?  3  THR B HG23 1  
ATOM 1284   N N    . PRO B  1 4  ? -36.028 -9.962  -274.666 1.00 0.00 ?  4  PRO B N    1  
ATOM 1285   C CA   . PRO B  1 4  ? -35.033 -8.916  -274.876 1.00 0.00 ?  4  PRO B CA   1  
ATOM 1286   C C    . PRO B  1 4  ? -33.756 -9.485  -275.480 1.00 0.00 ?  4  PRO B C    1  
ATOM 1287   O O    . PRO B  1 4  ? -33.340 -10.594 -275.146 1.00 0.00 ?  4  PRO B O    1  
ATOM 1288   C CB   . PRO B  1 4  ? -34.801 -8.334  -273.478 1.00 0.00 ?  4  PRO B CB   1  
ATOM 1289   C CG   . PRO B  1 4  ? -36.063 -8.626  -272.740 1.00 0.00 ?  4  PRO B CG   1  
ATOM 1290   C CD   . PRO B  1 4  ? -36.528 -9.961  -273.256 1.00 0.00 ?  4  PRO B CD   1  
ATOM 1291   H HA   . PRO B  1 4  ? -35.367 -8.149  -275.590 1.00 0.00 ?  4  PRO B HA   1  
ATOM 1292   H HB2  . PRO B  1 4  ? -33.935 -8.801  -272.986 1.00 0.00 ?  4  PRO B HB2  1  
ATOM 1293   H HB3  . PRO B  1 4  ? -34.605 -7.253  -273.520 1.00 0.00 ?  4  PRO B HB3  1  
ATOM 1294   H HG2  . PRO B  1 4  ? -35.890 -8.660  -271.654 1.00 0.00 ?  4  PRO B HG2  1  
ATOM 1295   H HG3  . PRO B  1 4  ? -36.819 -7.847  -272.921 1.00 0.00 ?  4  PRO B HG3  1  
ATOM 1296   H HD2  . PRO B  1 4  ? -36.106 -10.799 -272.682 1.00 0.00 ?  4  PRO B HD2  1  
ATOM 1297   H HD3  . PRO B  1 4  ? -37.622 -10.065 -273.217 1.00 0.00 ?  4  PRO B HD3  1  
ATOM 1298   N N    . TRP B  1 5  ? -33.136 -8.718  -276.371 1.00 0.00 ?  5  TRP B N    1  
ATOM 1299   C CA   . TRP B  1 5  ? -31.910 -9.148  -277.031 1.00 0.00 ?  5  TRP B CA   1  
ATOM 1300   C C    . TRP B  1 5  ? -30.768 -9.293  -276.033 1.00 0.00 ?  5  TRP B C    1  
ATOM 1301   O O    . TRP B  1 5  ? -30.624 -8.481  -275.119 1.00 0.00 ?  5  TRP B O    1  
ATOM 1302   C CB   . TRP B  1 5  ? -31.521 -8.159  -278.132 1.00 0.00 ?  5  TRP B CB   1  
ATOM 1303   C CG   . TRP B  1 5  ? -30.224 -8.491  -278.804 1.00 0.00 ?  5  TRP B CG   1  
ATOM 1304   C CD1  . TRP B  1 5  ? -30.053 -9.277  -279.905 1.00 0.00 ?  5  TRP B CD1  1  
ATOM 1305   C CD2  . TRP B  1 5  ? -28.916 -8.047  -278.421 1.00 0.00 ?  5  TRP B CD2  1  
ATOM 1306   N NE1  . TRP B  1 5  ? -28.721 -9.352  -280.231 1.00 0.00 ?  5  TRP B NE1  1  
ATOM 1307   C CE2  . TRP B  1 5  ? -28.003 -8.603  -279.334 1.00 0.00 ?  5  TRP B CE2  1  
ATOM 1308   C CE3  . TRP B  1 5  ? -28.431 -7.231  -277.391 1.00 0.00 ?  5  TRP B CE3  1  
ATOM 1309   C CZ2  . TRP B  1 5  ? -26.638 -8.374  -279.251 1.00 0.00 ?  5  TRP B CZ2  1  
ATOM 1310   C CZ3  . TRP B  1 5  ? -27.063 -7.001  -277.310 1.00 0.00 ?  5  TRP B CZ3  1  
ATOM 1311   C CH2  . TRP B  1 5  ? -26.192 -7.555  -278.214 1.00 0.00 ?  5  TRP B CH2  1  
ATOM 1312   H H    . TRP B  1 5  ? -33.526 -7.814  -276.597 1.00 0.00 ?  5  TRP B H    1  
ATOM 1313   H HA   . TRP B  1 5  ? -32.057 -10.130 -277.481 1.00 0.00 ?  5  TRP B HA   1  
ATOM 1314   H HB2  . TRP B  1 5  ? -32.282 -8.145  -278.913 1.00 0.00 ?  5  TRP B HB2  1  
ATOM 1315   H HB3  . TRP B  1 5  ? -31.410 -7.158  -277.716 1.00 0.00 ?  5  TRP B HB3  1  
ATOM 1316   H HD1  . TRP B  1 5  ? -30.950 -9.710  -280.344 1.00 0.00 ?  5  TRP B HD1  1  
ATOM 1317   H HE1  . TRP B  1 5  ? -28.333 -9.873  -281.003 1.00 0.00 ?  5  TRP B HE1  1  
ATOM 1318   H HE3  . TRP B  1 5  ? -29.078 -6.764  -276.649 1.00 0.00 ?  5  TRP B HE3  1  
ATOM 1319   H HZ2  . TRP B  1 5  ? -25.982 -8.834  -279.990 1.00 0.00 ?  5  TRP B HZ2  1  
ATOM 1320   H HZ3  . TRP B  1 5  ? -26.698 -6.364  -276.503 1.00 0.00 ?  5  TRP B HZ3  1  
ATOM 1321   H HH2  . TRP B  1 5  ? -25.126 -7.349  -278.114 1.00 0.00 ?  5  TRP B HH2  1  
ATOM 1322   N N    . SER B  1 6  ? -29.960 -10.332 -276.213 1.00 0.00 ?  6  SER B N    1  
ATOM 1323   C CA   . SER B  1 6  ? -28.771 -10.528 -275.392 1.00 0.00 ?  6  SER B CA   1  
ATOM 1324   C C    . SER B  1 6  ? -27.608 -11.052 -276.224 1.00 0.00 ?  6  SER B C    1  
ATOM 1325   O O    . SER B  1 6  ? -27.729 -12.070 -276.906 1.00 0.00 ?  6  SER B O    1  
ATOM 1326   C CB   . SER B  1 6  ? -29.075 -11.479 -274.251 1.00 0.00 ?  6  SER B CB   1  
ATOM 1327   O OG   . SER B  1 6  ? -27.939 -11.755 -273.478 1.00 0.00 ?  6  SER B OG   1  
ATOM 1328   H H    . SER B  1 6  ? -30.174 -11.002 -276.936 1.00 0.00 ?  6  SER B H    1  
ATOM 1329   H HA   . SER B  1 6  ? -28.465 -9.631  -274.851 1.00 0.00 ?  6  SER B HA   1  
ATOM 1330   H HB2  . SER B  1 6  ? -29.836 -11.027 -273.615 1.00 0.00 ?  6  SER B HB2  1  
ATOM 1331   H HB3  . SER B  1 6  ? -29.457 -12.411 -274.666 1.00 0.00 ?  6  SER B HB3  1  
ATOM 1332   H HG   . SER B  1 6  ? -27.656 -12.658 -273.639 1.00 0.00 ?  6  SER B HG   1  
ATOM 1333   N N    . GLY B  1 7  ? -26.480 -10.352 -276.163 1.00 0.00 ?  7  GLY B N    1  
ATOM 1334   C CA   . GLY B  1 7  ? -25.290 -10.751 -276.904 1.00 0.00 ?  7  GLY B CA   1  
ATOM 1335   C C    . GLY B  1 7  ? -24.527 -11.848 -276.172 1.00 0.00 ?  7  GLY B C    1  
ATOM 1336   O O    . GLY B  1 7  ? -24.955 -12.317 -275.118 1.00 0.00 ?  7  GLY B O    1  
ATOM 1337   H H    . GLY B  1 7  ? -26.447 -9.522  -275.589 1.00 0.00 ?  7  GLY B H    1  
ATOM 1338   H HA2  . GLY B  1 7  ? -25.588 -11.120 -277.886 1.00 0.00 ?  7  GLY B HA2  1  
ATOM 1339   H HA3  . GLY B  1 7  ? -24.639 -9.886  -277.025 1.00 0.00 ?  7  GLY B HA3  1  
ATOM 1340   N N    . TYR B  1 8  ? -23.395 -12.253 -276.738 1.00 0.00 ?  8  TYR B N    1  
ATOM 1341   C CA   . TYR B  1 8  ? -22.562 -13.285 -276.132 1.00 0.00 ?  8  TYR B CA   1  
ATOM 1342   C C    . TYR B  1 8  ? -21.998 -12.823 -274.794 1.00 0.00 ?  8  TYR B C    1  
ATOM 1343   O O    . TYR B  1 8  ? -22.075 -13.541 -273.797 1.00 0.00 ?  8  TYR B O    1  
ATOM 1344   C CB   . TYR B  1 8  ? -21.422 -13.675 -277.076 1.00 0.00 ?  8  TYR B CB   1  
ATOM 1345   C CG   . TYR B  1 8  ? -20.487 -14.719 -276.508 1.00 0.00 ?  8  TYR B CG   1  
ATOM 1346   C CD1  . TYR B  1 8  ? -20.743 -16.072 -276.677 1.00 0.00 ?  8  TYR B CD1  1  
ATOM 1347   C CD2  . TYR B  1 8  ? -19.349 -14.349 -275.806 1.00 0.00 ?  8  TYR B CD2  1  
ATOM 1348   C CE1  . TYR B  1 8  ? -19.892 -17.031 -276.160 1.00 0.00 ?  8  TYR B CE1  1  
ATOM 1349   C CE2  . TYR B  1 8  ? -18.491 -15.298 -275.286 1.00 0.00 ?  8  TYR B CE2  1  
ATOM 1350   C CZ   . TYR B  1 8  ? -18.766 -16.639 -275.465 1.00 0.00 ?  8  TYR B CZ   1  
ATOM 1351   O OH   . TYR B  1 8  ? -17.914 -17.588 -274.949 1.00 0.00 ?  8  TYR B OH   1  
ATOM 1352   H H    . TYR B  1 8  ? -23.103 -11.834 -277.610 1.00 0.00 ?  8  TYR B H    1  
ATOM 1353   H HA   . TYR B  1 8  ? -23.162 -14.172 -275.927 1.00 0.00 ?  8  TYR B HA   1  
ATOM 1354   H HB2  . TYR B  1 8  ? -21.876 -14.054 -277.992 1.00 0.00 ?  8  TYR B HB2  1  
ATOM 1355   H HB3  . TYR B  1 8  ? -20.862 -12.767 -277.296 1.00 0.00 ?  8  TYR B HB3  1  
ATOM 1356   H HD1  . TYR B  1 8  ? -21.634 -16.374 -277.227 1.00 0.00 ?  8  TYR B HD1  1  
ATOM 1357   H HD2  . TYR B  1 8  ? -19.138 -13.289 -275.668 1.00 0.00 ?  8  TYR B HD2  1  
ATOM 1358   H HE1  . TYR B  1 8  ? -20.106 -18.090 -276.300 1.00 0.00 ?  8  TYR B HE1  1  
ATOM 1359   H HE2  . TYR B  1 8  ? -17.603 -14.987 -274.736 1.00 0.00 ?  8  TYR B HE2  1  
ATOM 1360   H HH   . TYR B  1 8  ? -18.199 -18.487 -275.131 1.00 0.00 ?  8  TYR B HH   1  
ATOM 1361   N N    . LEU B  1 9  ? -21.432 -11.621 -274.780 1.00 0.00 ?  9  LEU B N    1  
ATOM 1362   C CA   . LEU B  1 9  ? -20.848 -11.065 -273.565 1.00 0.00 ?  9  LEU B CA   1  
ATOM 1363   C C    . LEU B  1 9  ? -21.913 -10.821 -272.503 1.00 0.00 ?  9  LEU B C    1  
ATOM 1364   O O    . LEU B  1 9  ? -21.657 -10.971 -271.309 1.00 0.00 ?  9  LEU B O    1  
ATOM 1365   C CB   . LEU B  1 9  ? -20.104 -9.762  -273.884 1.00 0.00 ?  9  LEU B CB   1  
ATOM 1366   C CG   . LEU B  1 9  ? -18.837 -9.924  -274.734 1.00 0.00 ?  9  LEU B CG   1  
ATOM 1367   C CD1  . LEU B  1 9  ? -18.272 -8.557  -275.095 1.00 0.00 ?  9  LEU B CD1  1  
ATOM 1368   C CD2  . LEU B  1 9  ? -17.812 -10.746 -273.966 1.00 0.00 ?  9  LEU B CD2  1  
ATOM 1369   H H    . LEU B  1 9  ? -21.406 -11.080 -275.631 1.00 0.00 ?  9  LEU B H    1  
ATOM 1370   H HA   . LEU B  1 9  ? -20.144 -11.778 -273.139 1.00 0.00 ?  9  LEU B HA   1  
ATOM 1371   H HB2  . LEU B  1 9  ? -20.877 -9.253  -274.459 1.00 0.00 ?  9  LEU B HB2  1  
ATOM 1372   H HB3  . LEU B  1 9  ? -19.887 -9.190  -272.982 1.00 0.00 ?  9  LEU B HB3  1  
ATOM 1373   H HG   . LEU B  1 9  ? -19.115 -10.487 -275.625 1.00 0.00 ?  9  LEU B HG   1  
ATOM 1374   H HD11 . LEU B  1 9  ? -17.373 -8.683  -275.698 1.00 0.00 ?  9  LEU B HD11 1  
ATOM 1375   H HD12 . LEU B  1 9  ? -19.013 -7.996  -275.663 1.00 0.00 ?  9  LEU B HD12 1  
ATOM 1376   H HD13 . LEU B  1 9  ? -18.024 -8.014  -274.184 1.00 0.00 ?  9  LEU B HD13 1  
ATOM 1377   H HD21 . LEU B  1 9  ? -18.227 -11.729 -273.743 1.00 0.00 ?  9  LEU B HD21 1  
ATOM 1378   H HD22 . LEU B  1 9  ? -16.913 -10.862 -274.571 1.00 0.00 ?  9  LEU B HD22 1  
ATOM 1379   H HD23 . LEU B  1 9  ? -17.561 -10.238 -273.035 1.00 0.00 ?  9  LEU B HD23 1  
ATOM 1380   N N    . ASP B  1 10 ? -23.107 -10.444 -272.946 1.00 0.00 ?  10 ASP B N    1  
ATOM 1381   C CA   . ASP B  1 10 ? -24.278 -10.432 -272.077 1.00 0.00 ?  10 ASP B CA   1  
ATOM 1382   C C    . ASP B  1 10 ? -24.518 -11.803 -271.457 1.00 0.00 ?  10 ASP B C    1  
ATOM 1383   O O    . ASP B  1 10 ? -24.772 -11.917 -270.258 1.00 0.00 ?  10 ASP B O    1  
ATOM 1384   C CB   . ASP B  1 10 ? -25.518 -9.982  -272.853 1.00 0.00 ?  10 ASP B CB   1  
ATOM 1385   C CG   . ASP B  1 10 ? -25.518 -8.509  -273.238 1.00 0.00 ?  10 ASP B CG   1  
ATOM 1386   O OD1  . ASP B  1 10 ? -24.742 -7.769  -272.681 1.00 0.00 ?  10 ASP B OD1  1  
ATOM 1387   O OD2  . ASP B  1 10 ? -26.178 -8.164  -274.189 1.00 0.00 -1 10 ASP B OD2  1  
ATOM 1388   H H    . ASP B  1 10 ? -23.207 -10.159 -273.910 1.00 0.00 ?  10 ASP B H    1  
ATOM 1389   H HA   . ASP B  1 10 ? -24.116 -9.742  -271.249 1.00 0.00 ?  10 ASP B HA   1  
ATOM 1390   H HB2  . ASP B  1 10 ? -25.722 -10.588 -273.736 1.00 0.00 ?  10 ASP B HB2  1  
ATOM 1391   H HB3  . ASP B  1 10 ? -26.289 -10.161 -272.103 1.00 0.00 ?  10 ASP B HB3  1  
ATOM 1392   N N    . ASP B  1 11 ? -24.435 -12.842 -272.281 1.00 0.00 ?  11 ASP B N    1  
ATOM 1393   C CA   . ASP B  1 11 ? -24.626 -14.209 -271.812 1.00 0.00 ?  11 ASP B CA   1  
ATOM 1394   C C    . ASP B  1 11 ? -23.532 -14.613 -270.833 1.00 0.00 ?  11 ASP B C    1  
ATOM 1395   O O    . ASP B  1 11 ? -23.787 -15.328 -269.863 1.00 0.00 ?  11 ASP B O    1  
ATOM 1396   C CB   . ASP B  1 11 ? -24.660 -15.182 -272.994 1.00 0.00 ?  11 ASP B CB   1  
ATOM 1397   C CG   . ASP B  1 11 ? -25.907 -15.075 -273.861 1.00 0.00 ?  11 ASP B CG   1  
ATOM 1398   O OD1  . ASP B  1 11 ? -26.839 -14.427 -273.450 1.00 0.00 ?  11 ASP B OD1  1  
ATOM 1399   O OD2  . ASP B  1 11 ? -25.860 -15.507 -274.988 1.00 0.00 -1 11 ASP B OD2  1  
ATOM 1400   H H    . ASP B  1 11 ? -24.235 -12.681 -273.258 1.00 0.00 ?  11 ASP B H    1  
ATOM 1401   H HA   . ASP B  1 11 ? -25.570 -14.285 -271.272 1.00 0.00 ?  11 ASP B HA   1  
ATOM 1402   H HB2  . ASP B  1 11 ? -23.773 -15.129 -273.625 1.00 0.00 ?  11 ASP B HB2  1  
ATOM 1403   H HB3  . ASP B  1 11 ? -24.670 -16.132 -272.459 1.00 0.00 ?  11 ASP B HB3  1  
ATOM 1404   N N    . VAL B  1 12 ? -22.313 -14.152 -271.091 1.00 0.00 ?  12 VAL B N    1  
ATOM 1405   C CA   . VAL B  1 12 ? -21.191 -14.410 -270.197 1.00 0.00 ?  12 VAL B CA   1  
ATOM 1406   C C    . VAL B  1 12 ? -21.438 -13.815 -268.817 1.00 0.00 ?  12 VAL B C    1  
ATOM 1407   O O    . VAL B  1 12 ? -21.198 -14.464 -267.799 1.00 0.00 ?  12 VAL B O    1  
ATOM 1408   C CB   . VAL B  1 12 ? -19.876 -13.841 -270.762 1.00 0.00 ?  12 VAL B CB   1  
ATOM 1409   C CG1  . VAL B  1 12 ? -18.777 -13.896 -269.712 1.00 0.00 ?  12 VAL B CG1  1  
ATOM 1410   C CG2  . VAL B  1 12 ? -19.458 -14.604 -272.010 1.00 0.00 ?  12 VAL B CG2  1  
ATOM 1411   H H    . VAL B  1 12 ? -22.161 -13.608 -271.929 1.00 0.00 ?  12 VAL B H    1  
ATOM 1412   H HA   . VAL B  1 12 ? -21.061 -15.478 -270.022 1.00 0.00 ?  12 VAL B HA   1  
ATOM 1413   H HB   . VAL B  1 12 ? -20.038 -12.806 -271.064 1.00 0.00 ?  12 VAL B HB   1  
ATOM 1414   H HG11 . VAL B  1 12 ? -17.854 -13.490 -270.129 1.00 0.00 ?  12 VAL B HG11 1  
ATOM 1415   H HG12 . VAL B  1 12 ? -19.072 -13.307 -268.844 1.00 0.00 ?  12 VAL B HG12 1  
ATOM 1416   H HG13 . VAL B  1 12 ? -18.613 -14.931 -269.411 1.00 0.00 ?  12 VAL B HG13 1  
ATOM 1417   H HG21 . VAL B  1 12 ? -20.236 -14.517 -272.768 1.00 0.00 ?  12 VAL B HG21 1  
ATOM 1418   H HG22 . VAL B  1 12 ? -18.528 -14.189 -272.397 1.00 0.00 ?  12 VAL B HG22 1  
ATOM 1419   H HG23 . VAL B  1 12 ? -19.311 -15.655 -271.760 1.00 0.00 ?  12 VAL B HG23 1  
ATOM 1420   N N    . SER B  1 13 ? -21.920 -12.577 -268.789 1.00 0.00 ?  13 SER B N    1  
ATOM 1421   C CA   . SER B  1 13 ? -22.288 -11.926 -267.538 1.00 0.00 ?  13 SER B CA   1  
ATOM 1422   C C    . SER B  1 13 ? -23.370 -12.710 -266.806 1.00 0.00 ?  13 SER B C    1  
ATOM 1423   O O    . SER B  1 13 ? -23.302 -12.895 -265.591 1.00 0.00 ?  13 SER B O    1  
ATOM 1424   C CB   . SER B  1 13 ? -22.753 -10.508 -267.804 1.00 0.00 ?  13 SER B CB   1  
ATOM 1425   O OG   . SER B  1 13 ? -23.178 -9.864  -266.634 1.00 0.00 ?  13 SER B OG   1  
ATOM 1426   H H    . SER B  1 13 ? -22.034 -12.074 -269.658 1.00 0.00 ?  13 SER B H    1  
ATOM 1427   H HA   . SER B  1 13 ? -21.440 -11.754 -266.873 1.00 0.00 ?  13 SER B HA   1  
ATOM 1428   H HB2  . SER B  1 13 ? -21.927 -9.946  -268.238 1.00 0.00 ?  13 SER B HB2  1  
ATOM 1429   H HB3  . SER B  1 13 ? -23.581 -10.538 -268.512 1.00 0.00 ?  13 SER B HB3  1  
ATOM 1430   H HG   . SER B  1 13 ? -23.774 -9.147  -266.862 1.00 0.00 ?  13 SER B HG   1  
ATOM 1431   N N    . ALA B  1 14 ? -24.367 -13.171 -267.553 1.00 0.00 ?  14 ALA B N    1  
ATOM 1432   C CA   . ALA B  1 14 ? -25.450 -13.963 -266.982 1.00 0.00 ?  14 ALA B CA   1  
ATOM 1433   C C    . ALA B  1 14 ? -24.937 -15.296 -266.453 1.00 0.00 ?  14 ALA B C    1  
ATOM 1434   O O    . ALA B  1 14 ? -25.372 -15.766 -265.401 1.00 0.00 ?  14 ALA B O    1  
ATOM 1435   C CB   . ALA B  1 14 ? -26.546 -14.185 -268.014 1.00 0.00 ?  14 ALA B CB   1  
ATOM 1436   H H    . ALA B  1 14 ? -24.376 -12.967 -268.543 1.00 0.00 ?  14 ALA B H    1  
ATOM 1437   H HA   . ALA B  1 14 ? -25.873 -13.419 -266.137 1.00 0.00 ?  14 ALA B HA   1  
ATOM 1438   H HB1  . ALA B  1 14 ? -26.135 -14.714 -268.873 1.00 0.00 ?  14 ALA B HB1  1  
ATOM 1439   H HB2  . ALA B  1 14 ? -27.347 -14.777 -267.572 1.00 0.00 ?  14 ALA B HB2  1  
ATOM 1440   H HB3  . ALA B  1 14 ? -26.943 -13.222 -268.337 1.00 0.00 ?  14 ALA B HB3  1  
ATOM 1441   N N    . LYS B  1 15 ? -24.011 -15.902 -267.188 1.00 0.00 ?  15 LYS B N    1  
ATOM 1442   C CA   . LYS B  1 15 ? -23.461 -17.198 -266.811 1.00 0.00 ?  15 LYS B CA   1  
ATOM 1443   C C    . LYS B  1 15 ? -22.736 -17.121 -265.474 1.00 0.00 ?  15 LYS B C    1  
ATOM 1444   O O    . LYS B  1 15 ? -22.864 -18.013 -264.634 1.00 0.00 ?  15 LYS B O    1  
ATOM 1445   C CB   . LYS B  1 15 ? -22.513 -17.714 -267.894 1.00 0.00 ?  15 LYS B CB   1  
ATOM 1446   C CG   . LYS B  1 15 ? -23.211 -18.288 -269.120 1.00 0.00 ?  15 LYS B CG   1  
ATOM 1447   C CD   . LYS B  1 15 ? -22.214 -18.620 -270.220 1.00 0.00 ?  15 LYS B CD   1  
ATOM 1448   C CE   . LYS B  1 15 ? -22.919 -19.082 -271.487 1.00 0.00 ?  15 LYS B CE   1  
ATOM 1449   N NZ   . LYS B  1 15 ? -23.582 -20.402 -271.304 1.00 0.00 1  15 LYS B NZ   1  
ATOM 1450   H H    . LYS B  1 15 ? -23.679 -15.453 -268.029 1.00 0.00 ?  15 LYS B H    1  
ATOM 1451   H HA   . LYS B  1 15 ? -24.269 -17.920 -266.684 1.00 0.00 ?  15 LYS B HA   1  
ATOM 1452   H HB2  . LYS B  1 15 ? -21.885 -16.874 -268.195 1.00 0.00 ?  15 LYS B HB2  1  
ATOM 1453   H HB3  . LYS B  1 15 ? -21.892 -18.485 -267.437 1.00 0.00 ?  15 LYS B HB3  1  
ATOM 1454   H HG2  . LYS B  1 15 ? -23.741 -19.194 -268.824 1.00 0.00 ?  15 LYS B HG2  1  
ATOM 1455   H HG3  . LYS B  1 15 ? -23.926 -17.553 -269.487 1.00 0.00 ?  15 LYS B HG3  1  
ATOM 1456   H HD2  . LYS B  1 15 ? -21.625 -17.727 -270.437 1.00 0.00 ?  15 LYS B HD2  1  
ATOM 1457   H HD3  . LYS B  1 15 ? -21.554 -19.410 -269.864 1.00 0.00 ?  15 LYS B HD3  1  
ATOM 1458   H HE2  . LYS B  1 15 ? -23.665 -18.335 -271.755 1.00 0.00 ?  15 LYS B HE2  1  
ATOM 1459   H HE3  . LYS B  1 15 ? -22.178 -19.156 -272.282 1.00 0.00 ?  15 LYS B HE3  1  
ATOM 1460   H HZ1  . LYS B  1 15 ? -24.270 -20.333 -270.567 1.00 0.00 ?  15 LYS B HZ1  1  
ATOM 1461   H HZ2  . LYS B  1 15 ? -24.037 -20.672 -272.165 1.00 0.00 ?  15 LYS B HZ2  1  
ATOM 1462   H HZ3  . LYS B  1 15 ? -22.891 -21.095 -271.056 1.00 0.00 ?  15 LYS B HZ3  1  
ATOM 1463   N N    . PHE B  1 16 ? -21.973 -16.050 -265.281 1.00 0.00 ?  16 PHE B N    1  
ATOM 1464   C CA   . PHE B  1 16 ? -21.310 -15.801 -264.007 1.00 0.00 ?  16 PHE B CA   1  
ATOM 1465   C C    . PHE B  1 16 ? -22.323 -15.549 -262.898 1.00 0.00 ?  16 PHE B C    1  
ATOM 1466   O O    . PHE B  1 16 ? -22.253 -16.155 -261.829 1.00 0.00 ?  16 PHE B O    1  
ATOM 1467   C CB   . PHE B  1 16 ? -20.353 -14.614 -264.125 1.00 0.00 ?  16 PHE B CB   1  
ATOM 1468   C CG   . PHE B  1 16 ? -19.622 -14.295 -262.852 1.00 0.00 ?  16 PHE B CG   1  
ATOM 1469   C CD1  . PHE B  1 16 ? -18.430 -14.932 -262.541 1.00 0.00 ?  16 PHE B CD1  1  
ATOM 1470   C CD2  . PHE B  1 16 ? -20.125 -13.357 -261.963 1.00 0.00 ?  16 PHE B CD2  1  
ATOM 1471   C CE1  . PHE B  1 16 ? -17.757 -14.639 -261.370 1.00 0.00 ?  16 PHE B CE1  1  
ATOM 1472   C CE2  . PHE B  1 16 ? -19.454 -13.062 -260.792 1.00 0.00 ?  16 PHE B CE2  1  
ATOM 1473   C CZ   . PHE B  1 16 ? -18.269 -13.704 -260.496 1.00 0.00 ?  16 PHE B CZ   1  
ATOM 1474   H H    . PHE B  1 16 ? -21.850 -15.392 -266.037 1.00 0.00 ?  16 PHE B H    1  
ATOM 1475   H HA   . PHE B  1 16 ? -20.738 -16.681 -263.709 1.00 0.00 ?  16 PHE B HA   1  
ATOM 1476   H HB2  . PHE B  1 16 ? -19.592 -14.818 -264.878 1.00 0.00 ?  16 PHE B HB2  1  
ATOM 1477   H HB3  . PHE B  1 16 ? -20.903 -13.716 -264.402 1.00 0.00 ?  16 PHE B HB3  1  
ATOM 1478   H HD1  . PHE B  1 16 ? -18.025 -15.671 -263.233 1.00 0.00 ?  16 PHE B HD1  1  
ATOM 1479   H HD2  . PHE B  1 16 ? -21.062 -12.850 -262.197 1.00 0.00 ?  16 PHE B HD2  1  
ATOM 1480   H HE1  . PHE B  1 16 ? -16.822 -15.148 -261.138 1.00 0.00 ?  16 PHE B HE1  1  
ATOM 1481   H HE2  . PHE B  1 16 ? -19.860 -12.322 -260.102 1.00 0.00 ?  16 PHE B HE2  1  
ATOM 1482   H HZ   . PHE B  1 16 ? -17.740 -13.474 -259.572 1.00 0.00 ?  16 PHE B HZ   1  
ATOM 1483   N N    . ASP B  1 17 ? -23.266 -14.649 -263.159 1.00 0.00 ?  17 ASP B N    1  
ATOM 1484   C CA   . ASP B  1 17 ? -24.244 -14.251 -262.154 1.00 0.00 ?  17 ASP B CA   1  
ATOM 1485   C C    . ASP B  1 17 ? -25.123 -15.425 -261.744 1.00 0.00 ?  17 ASP B C    1  
ATOM 1486   O O    . ASP B  1 17 ? -25.598 -15.491 -260.610 1.00 0.00 ?  17 ASP B O    1  
ATOM 1487   C CB   . ASP B  1 17 ? -25.112 -13.102 -262.675 1.00 0.00 ?  17 ASP B CB   1  
ATOM 1488   C CG   . ASP B  1 17 ? -24.412 -11.750 -262.708 1.00 0.00 ?  17 ASP B CG   1  
ATOM 1489   O OD1  . ASP B  1 17 ? -23.368 -11.629 -262.113 1.00 0.00 ?  17 ASP B OD1  1  
ATOM 1490   O OD2  . ASP B  1 17 ? -24.842 -10.900 -263.450 1.00 0.00 -1 17 ASP B OD2  1  
ATOM 1491   H H    . ASP B  1 17 ? -23.307 -14.232 -264.078 1.00 0.00 ?  17 ASP B H    1  
ATOM 1492   H HA   . ASP B  1 17 ? -23.731 -13.917 -261.252 1.00 0.00 ?  17 ASP B HA   1  
ATOM 1493   H HB2  . ASP B  1 17 ? -25.558 -13.303 -263.650 1.00 0.00 ?  17 ASP B HB2  1  
ATOM 1494   H HB3  . ASP B  1 17 ? -25.891 -13.090 -261.913 1.00 0.00 ?  17 ASP B HB3  1  
ATOM 1495   N N    . THR B  1 18 ? -25.335 -16.352 -262.672 1.00 0.00 ?  18 THR B N    1  
ATOM 1496   C CA   . THR B  1 18 ? -26.159 -17.526 -262.409 1.00 0.00 ?  18 THR B CA   1  
ATOM 1497   C C    . THR B  1 18 ? -25.738 -18.216 -261.118 1.00 0.00 ?  18 THR B C    1  
ATOM 1498   O O    . THR B  1 18 ? -26.580 -18.618 -260.315 1.00 0.00 ?  18 THR B O    1  
ATOM 1499   C CB   . THR B  1 18 ? -26.086 -18.538 -263.567 1.00 0.00 ?  18 THR B CB   1  
ATOM 1500   O OG1  . THR B  1 18 ? -26.623 -17.946 -264.757 1.00 0.00 ?  18 THR B OG1  1  
ATOM 1501   C CG2  . THR B  1 18 ? -26.876 -19.793 -263.229 1.00 0.00 ?  18 THR B CG2  1  
ATOM 1502   H H    . THR B  1 18 ? -24.914 -16.240 -263.584 1.00 0.00 ?  18 THR B H    1  
ATOM 1503   H HA   . THR B  1 18 ? -27.197 -17.224 -262.273 1.00 0.00 ?  18 THR B HA   1  
ATOM 1504   H HB   . THR B  1 18 ? -25.043 -18.803 -263.742 1.00 0.00 ?  18 THR B HB   1  
ATOM 1505   H HG1  . THR B  1 18 ? -26.576 -18.579 -265.478 1.00 0.00 ?  18 THR B HG1  1  
ATOM 1506   H HG21 . THR B  1 18 ? -26.813 -20.496 -264.059 1.00 0.00 ?  18 THR B HG21 1  
ATOM 1507   H HG22 . THR B  1 18 ? -26.463 -20.251 -262.331 1.00 0.00 ?  18 THR B HG22 1  
ATOM 1508   H HG23 . THR B  1 18 ? -27.919 -19.529 -263.055 1.00 0.00 ?  18 THR B HG23 1  
ATOM 1509   N N    . GLY B  1 19 ? -24.431 -18.349 -260.923 1.00 0.00 ?  19 GLY B N    1  
ATOM 1510   C CA   . GLY B  1 19 ? -23.897 -19.127 -259.811 1.00 0.00 ?  19 GLY B CA   1  
ATOM 1511   C C    . GLY B  1 19 ? -23.832 -18.293 -258.537 1.00 0.00 ?  19 GLY B C    1  
ATOM 1512   O O    . GLY B  1 19 ? -23.652 -18.827 -257.443 1.00 0.00 ?  19 GLY B O    1  
ATOM 1513   H H    . GLY B  1 19 ? -23.790 -17.901 -261.562 1.00 0.00 ?  19 GLY B H    1  
ATOM 1514   H HA2  . GLY B  1 19 ? -24.541 -19.989 -259.638 1.00 0.00 ?  19 GLY B HA2  1  
ATOM 1515   H HA3  . GLY B  1 19 ? -22.894 -19.468 -260.063 1.00 0.00 ?  19 GLY B HA3  1  
ATOM 1516   N N    . VAL B  1 20 ? -23.979 -16.981 -258.687 1.00 0.00 ?  20 VAL B N    1  
ATOM 1517   C CA   . VAL B  1 20 ? -23.904 -16.067 -257.554 1.00 0.00 ?  20 VAL B CA   1  
ATOM 1518   C C    . VAL B  1 20 ? -25.080 -15.100 -257.546 1.00 0.00 ?  20 VAL B C    1  
ATOM 1519   O O    . VAL B  1 20 ? -24.985 -13.995 -257.011 1.00 0.00 ?  20 VAL B O    1  
ATOM 1520   C CB   . VAL B  1 20 ? -22.590 -15.263 -257.563 1.00 0.00 ?  20 VAL B CB   1  
ATOM 1521   C CG1  . VAL B  1 20 ? -21.410 -16.166 -257.238 1.00 0.00 ?  20 VAL B CG1  1  
ATOM 1522   C CG2  . VAL B  1 20 ? -22.388 -14.588 -258.911 1.00 0.00 ?  20 VAL B CG2  1  
ATOM 1523   H H    . VAL B  1 20 ? -24.148 -16.607 -259.610 1.00 0.00 ?  20 VAL B H    1  
ATOM 1524   H HA   . VAL B  1 20 ? -23.977 -16.603 -256.606 1.00 0.00 ?  20 VAL B HA   1  
ATOM 1525   H HB   . VAL B  1 20 ? -22.656 -14.469 -256.818 1.00 0.00 ?  20 VAL B HB   1  
ATOM 1526   H HG11 . VAL B  1 20 ? -20.490 -15.581 -257.248 1.00 0.00 ?  20 VAL B HG11 1  
ATOM 1527   H HG12 . VAL B  1 20 ? -21.549 -16.605 -256.250 1.00 0.00 ?  20 VAL B HG12 1  
ATOM 1528   H HG13 . VAL B  1 20 ? -21.343 -16.959 -257.982 1.00 0.00 ?  20 VAL B HG13 1  
ATOM 1529   H HG21 . VAL B  1 20 ? -23.219 -13.911 -259.108 1.00 0.00 ?  20 VAL B HG21 1  
ATOM 1530   H HG22 . VAL B  1 20 ? -21.456 -14.024 -258.900 1.00 0.00 ?  20 VAL B HG22 1  
ATOM 1531   H HG23 . VAL B  1 20 ? -22.344 -15.347 -259.693 1.00 0.00 ?  20 VAL B HG23 1  
ATOM 1532   N N    . ASP B  1 21 ? -26.190 -15.521 -258.144 1.00 0.00 ?  21 ASP B N    1  
ATOM 1533   C CA   . ASP B  1 21 ? -27.413 -14.727 -258.136 1.00 0.00 ?  21 ASP B CA   1  
ATOM 1534   C C    . ASP B  1 21 ? -27.880 -14.449 -256.713 1.00 0.00 ?  21 ASP B C    1  
ATOM 1535   O O    . ASP B  1 21 ? -28.397 -13.371 -256.419 1.00 0.00 ?  21 ASP B O    1  
ATOM 1536   C CB   . ASP B  1 21 ? -28.518 -15.437 -258.923 1.00 0.00 ?  21 ASP B CB   1  
ATOM 1537   C CG   . ASP B  1 21 ? -29.779 -14.608 -259.123 1.00 0.00 ?  21 ASP B CG   1  
ATOM 1538   O OD1  . ASP B  1 21 ? -29.695 -13.573 -259.740 1.00 0.00 ?  21 ASP B OD1  1  
ATOM 1539   O OD2  . ASP B  1 21 ? -30.839 -15.087 -258.796 1.00 0.00 -1 21 ASP B OD2  1  
ATOM 1540   H H    . ASP B  1 21 ? -26.186 -16.414 -258.615 1.00 0.00 ?  21 ASP B H    1  
ATOM 1541   H HA   . ASP B  1 21 ? -27.226 -13.757 -258.597 1.00 0.00 ?  21 ASP B HA   1  
ATOM 1542   H HB2  . ASP B  1 21 ? -28.184 -15.827 -259.885 1.00 0.00 ?  21 ASP B HB2  1  
ATOM 1543   H HB3  . ASP B  1 21 ? -28.732 -16.266 -258.248 1.00 0.00 ?  21 ASP B HB3  1  
ATOM 1544   N N    . ASN B  1 22 ? -27.696 -15.427 -255.833 1.00 0.00 ?  22 ASN B N    1  
ATOM 1545   C CA   . ASN B  1 22 ? -28.130 -15.303 -254.447 1.00 0.00 ?  22 ASN B CA   1  
ATOM 1546   C C    . ASN B  1 22 ? -27.143 -14.476 -253.633 1.00 0.00 ?  22 ASN B C    1  
ATOM 1547   O O    . ASN B  1 22 ? -27.517 -13.836 -252.650 1.00 0.00 ?  22 ASN B O    1  
ATOM 1548   C CB   . ASN B  1 22 ? -28.331 -16.662 -253.804 1.00 0.00 ?  22 ASN B CB   1  
ATOM 1549   C CG   . ASN B  1 22 ? -29.529 -17.407 -254.325 1.00 0.00 ?  22 ASN B CG   1  
ATOM 1550   O OD1  . ASN B  1 22 ? -30.469 -16.812 -254.864 1.00 0.00 ?  22 ASN B OD1  1  
ATOM 1551   N ND2  . ASN B  1 22 ? -29.537 -18.695 -254.094 1.00 0.00 ?  22 ASN B ND2  1  
ATOM 1552   H H    . ASN B  1 22 ? -27.243 -16.279 -256.133 1.00 0.00 ?  22 ASN B H    1  
ATOM 1553   H HA   . ASN B  1 22 ? -29.084 -14.775 -254.404 1.00 0.00 ?  22 ASN B HA   1  
ATOM 1554   H HB2  . ASN B  1 22 ? -27.497 -17.357 -253.695 1.00 0.00 ?  22 ASN B HB2  1  
ATOM 1555   H HB3  . ASN B  1 22 ? -28.578 -16.237 -252.832 1.00 0.00 ?  22 ASN B HB3  1  
ATOM 1556   H HD21 . ASN B  1 22 ? -28.779 -19.120 -253.600 1.00 0.00 ?  22 ASN B HD21 1  
ATOM 1557   H HD22 . ASN B  1 22 ? -30.303 -19.255 -254.413 1.00 0.00 ?  22 ASN B HD22 1  
ATOM 1558   N N    . LEU B  1 23 ? -25.881 -14.493 -254.048 1.00 0.00 ?  23 LEU B N    1  
ATOM 1559   C CA   . LEU B  1 23 ? -24.830 -13.777 -253.335 1.00 0.00 ?  23 LEU B CA   1  
ATOM 1560   C C    . LEU B  1 23 ? -25.214 -12.322 -253.103 1.00 0.00 ?  23 LEU B C    1  
ATOM 1561   O O    . LEU B  1 23 ? -25.113 -11.813 -251.987 1.00 0.00 ?  23 LEU B O    1  
ATOM 1562   C CB   . LEU B  1 23 ? -23.509 -13.864 -254.110 1.00 0.00 ?  23 LEU B CB   1  
ATOM 1563   C CG   . LEU B  1 23 ? -22.403 -12.919 -253.623 1.00 0.00 ?  23 LEU B CG   1  
ATOM 1564   C CD1  . LEU B  1 23 ? -22.112 -13.171 -252.150 1.00 0.00 ?  23 LEU B CD1  1  
ATOM 1565   C CD2  . LEU B  1 23 ? -21.152 -13.125 -254.463 1.00 0.00 ?  23 LEU B CD2  1  
ATOM 1566   H H    . LEU B  1 23 ? -25.644 -15.015 -254.880 1.00 0.00 ?  23 LEU B H    1  
ATOM 1567   H HA   . LEU B  1 23 ? -24.691 -14.221 -252.349 1.00 0.00 ?  23 LEU B HA   1  
ATOM 1568   H HB2  . LEU B  1 23 ? -23.243 -14.896 -253.890 1.00 0.00 ?  23 LEU B HB2  1  
ATOM 1569   H HB3  . LEU B  1 23 ? -23.663 -13.749 -255.183 1.00 0.00 ?  23 LEU B HB3  1  
ATOM 1570   H HG   . LEU B  1 23 ? -22.752 -11.899 -253.789 1.00 0.00 ?  23 LEU B HG   1  
ATOM 1571   H HD11 . LEU B  1 23 ? -21.326 -12.496 -251.813 1.00 0.00 ?  23 LEU B HD11 1  
ATOM 1572   H HD12 . LEU B  1 23 ? -23.015 -12.996 -251.565 1.00 0.00 ?  23 LEU B HD12 1  
ATOM 1573   H HD13 . LEU B  1 23 ? -21.787 -14.202 -252.015 1.00 0.00 ?  23 LEU B HD13 1  
ATOM 1574   H HD21 . LEU B  1 23 ? -21.376 -12.912 -255.508 1.00 0.00 ?  23 LEU B HD21 1  
ATOM 1575   H HD22 . LEU B  1 23 ? -20.367 -12.452 -254.116 1.00 0.00 ?  23 LEU B HD22 1  
ATOM 1576   H HD23 . LEU B  1 23 ? -20.815 -14.157 -254.367 1.00 0.00 ?  23 LEU B HD23 1  
ATOM 1577   N N    . GLN B  1 24 ? -25.656 -11.656 -254.164 1.00 0.00 ?  24 GLN B N    1  
ATOM 1578   C CA   . GLN B  1 24 ? -26.055 -10.256 -254.079 1.00 0.00 ?  24 GLN B CA   1  
ATOM 1579   C C    . GLN B  1 24 ? -27.158 -10.059 -253.046 1.00 0.00 ?  24 GLN B C    1  
ATOM 1580   O O    . GLN B  1 24 ? -27.103 -9.136  -252.233 1.00 0.00 ?  24 GLN B O    1  
ATOM 1581   C CB   . GLN B  1 24 ? -26.529 -9.749  -255.444 1.00 0.00 ?  24 GLN B CB   1  
ATOM 1582   C CG   . GLN B  1 24 ? -26.915 -8.280  -255.463 1.00 0.00 ?  24 GLN B CG   1  
ATOM 1583   C CD   . GLN B  1 24 ? -27.370 -7.819  -256.834 1.00 0.00 ?  24 GLN B CD   1  
ATOM 1584   O OE1  . GLN B  1 24 ? -27.478 -8.617  -257.769 1.00 0.00 ?  24 GLN B OE1  1  
ATOM 1585   N NE2  . GLN B  1 24 ? -27.637 -6.524  -256.964 1.00 0.00 ?  24 GLN B NE2  1  
ATOM 1586   H H    . GLN B  1 24 ? -25.717 -12.131 -255.053 1.00 0.00 ?  24 GLN B H    1  
ATOM 1587   H HA   . GLN B  1 24 ? -25.209 -9.655  -253.747 1.00 0.00 ?  24 GLN B HA   1  
ATOM 1588   H HB2  . GLN B  1 24 ? -25.714 -9.926  -256.145 1.00 0.00 ?  24 GLN B HB2  1  
ATOM 1589   H HB3  . GLN B  1 24 ? -27.387 -10.359 -255.725 1.00 0.00 ?  24 GLN B HB3  1  
ATOM 1590   H HG2  . GLN B  1 24 ? -27.579 -7.835  -254.722 1.00 0.00 ?  24 GLN B HG2  1  
ATOM 1591   H HG3  . GLN B  1 24 ? -25.898 -7.921  -255.298 1.00 0.00 ?  24 GLN B HG3  1  
ATOM 1592   H HE21 . GLN B  1 24 ? -27.535 -5.911  -256.180 1.00 0.00 ?  24 GLN B HE21 1  
ATOM 1593   H HE22 . GLN B  1 24 ? -27.942 -6.162  -257.845 1.00 0.00 ?  24 GLN B HE22 1  
ATOM 1594   N N    . THR B  1 25 ? -28.159 -10.932 -253.084 1.00 0.00 ?  25 THR B N    1  
ATOM 1595   C CA   . THR B  1 25 ? -29.291 -10.839 -252.170 1.00 0.00 ?  25 THR B CA   1  
ATOM 1596   C C    . THR B  1 25 ? -28.856 -11.071 -250.729 1.00 0.00 ?  25 THR B C    1  
ATOM 1597   O O    . THR B  1 25 ? -29.316 -10.387 -249.814 1.00 0.00 ?  25 THR B O    1  
ATOM 1598   C CB   . THR B  1 25 ? -30.394 -11.850 -252.532 1.00 0.00 ?  25 THR B CB   1  
ATOM 1599   O OG1  . THR B  1 25 ? -30.898 -11.564 -253.843 1.00 0.00 ?  25 THR B OG1  1  
ATOM 1600   C CG2  . THR B  1 25 ? -31.534 -11.778 -251.528 1.00 0.00 ?  25 THR B CG2  1  
ATOM 1601   H H    . THR B  1 25 ? -28.135 -11.679 -253.763 1.00 0.00 ?  25 THR B H    1  
ATOM 1602   H HA   . THR B  1 25 ? -29.713 -9.834  -252.207 1.00 0.00 ?  25 THR B HA   1  
ATOM 1603   H HB   . THR B  1 25 ? -29.970 -12.854 -252.527 1.00 0.00 ?  25 THR B HB   1  
ATOM 1604   H HG1  . THR B  1 25 ? -30.184 -11.633 -254.482 1.00 0.00 ?  25 THR B HG1  1  
ATOM 1605   H HG21 . THR B  1 25 ? -32.303 -12.501 -251.800 1.00 0.00 ?  25 THR B HG21 1  
ATOM 1606   H HG22 . THR B  1 25 ? -31.156 -12.007 -250.532 1.00 0.00 ?  25 THR B HG22 1  
ATOM 1607   H HG23 . THR B  1 25 ? -31.959 -10.776 -251.533 1.00 0.00 ?  25 THR B HG23 1  
ATOM 1608   N N    . GLN B  1 26 ? -27.968 -12.039 -250.533 1.00 0.00 ?  26 GLN B N    1  
ATOM 1609   C CA   . GLN B  1 26 ? -27.515 -12.404 -249.196 1.00 0.00 ?  26 GLN B CA   1  
ATOM 1610   C C    . GLN B  1 26 ? -26.753 -11.259 -248.541 1.00 0.00 ?  26 GLN B C    1  
ATOM 1611   O O    . GLN B  1 26 ? -26.989 -10.927 -247.380 1.00 0.00 ?  26 GLN B O    1  
ATOM 1612   C CB   . GLN B  1 26 ? -26.627 -13.650 -249.252 1.00 0.00 ?  26 GLN B CB   1  
ATOM 1613   C CG   . GLN B  1 26 ? -27.379 -14.938 -249.538 1.00 0.00 ?  26 GLN B CG   1  
ATOM 1614   C CD   . GLN B  1 26 ? -26.455 -16.136 -249.645 1.00 0.00 ?  26 GLN B CD   1  
ATOM 1615   O OE1  . GLN B  1 26 ? -25.236 -16.013 -249.497 1.00 0.00 ?  26 GLN B OE1  1  
ATOM 1616   N NE2  . GLN B  1 26 ? -27.030 -17.304 -249.908 1.00 0.00 ?  26 GLN B NE2  1  
ATOM 1617   H H    . GLN B  1 26 ? -27.598 -12.536 -251.330 1.00 0.00 ?  26 GLN B H    1  
ATOM 1618   H HA   . GLN B  1 26 ? -28.377 -12.606 -248.560 1.00 0.00 ?  26 GLN B HA   1  
ATOM 1619   H HB2  . GLN B  1 26 ? -25.886 -13.473 -250.032 1.00 0.00 ?  26 GLN B HB2  1  
ATOM 1620   H HB3  . GLN B  1 26 ? -26.126 -13.723 -248.287 1.00 0.00 ?  26 GLN B HB3  1  
ATOM 1621   H HG2  . GLN B  1 26 ? -28.260 -15.244 -248.975 1.00 0.00 ?  26 GLN B HG2  1  
ATOM 1622   H HG3  . GLN B  1 26 ? -27.678 -14.642 -250.545 1.00 0.00 ?  26 GLN B HG3  1  
ATOM 1623   H HE21 . GLN B  1 26 ? -28.022 -17.359 -250.022 1.00 0.00 ?  26 GLN B HE21 1  
ATOM 1624   H HE22 . GLN B  1 26 ? -26.471 -18.130 -249.990 1.00 0.00 ?  26 GLN B HE22 1  
ATOM 1625   N N    . VAL B  1 27 ? -25.837 -10.658 -249.293 1.00 0.00 ?  27 VAL B N    1  
ATOM 1626   C CA   . VAL B  1 27 ? -24.987 -9.598  -248.765 1.00 0.00 ?  27 VAL B CA   1  
ATOM 1627   C C    . VAL B  1 27 ? -25.760 -8.294  -248.616 1.00 0.00 ?  27 VAL B C    1  
ATOM 1628   O O    . VAL B  1 27 ? -25.432 -7.459  -247.773 1.00 0.00 ?  27 VAL B O    1  
ATOM 1629   C CB   . VAL B  1 27 ? -23.760 -9.356  -249.664 1.00 0.00 ?  27 VAL B CB   1  
ATOM 1630   C CG1  . VAL B  1 27 ? -24.154 -8.557  -250.898 1.00 0.00 ?  27 VAL B CG1  1  
ATOM 1631   C CG2  . VAL B  1 27 ? -22.666 -8.634  -248.892 1.00 0.00 ?  27 VAL B CG2  1  
ATOM 1632   H H    . VAL B  1 27 ? -25.727 -10.942 -250.256 1.00 0.00 ?  27 VAL B H    1  
ATOM 1633   H HA   . VAL B  1 27 ? -24.639 -9.833  -247.758 1.00 0.00 ?  27 VAL B HA   1  
ATOM 1634   H HB   . VAL B  1 27 ? -23.350 -10.318 -249.970 1.00 0.00 ?  27 VAL B HB   1  
ATOM 1635   H HG11 . VAL B  1 27 ? -23.275 -8.396  -251.523 1.00 0.00 ?  27 VAL B HG11 1  
ATOM 1636   H HG12 . VAL B  1 27 ? -24.904 -9.109  -251.465 1.00 0.00 ?  27 VAL B HG12 1  
ATOM 1637   H HG13 . VAL B  1 27 ? -24.563 -7.594  -250.593 1.00 0.00 ?  27 VAL B HG13 1  
ATOM 1638   H HG21 . VAL B  1 27 ? -22.365 -9.240  -248.037 1.00 0.00 ?  27 VAL B HG21 1  
ATOM 1639   H HG22 . VAL B  1 27 ? -21.807 -8.472  -249.542 1.00 0.00 ?  27 VAL B HG22 1  
ATOM 1640   H HG23 . VAL B  1 27 ? -23.043 -7.673  -248.541 1.00 0.00 ?  27 VAL B HG23 1  
ATOM 1641   N N    . THR B  1 28 ? -26.789 -8.125  -249.440 1.00 0.00 ?  28 THR B N    1  
ATOM 1642   C CA   . THR B  1 28 ? -27.683 -6.979  -249.323 1.00 0.00 ?  28 THR B CA   1  
ATOM 1643   C C    . THR B  1 28 ? -28.525 -7.063  -248.057 1.00 0.00 ?  28 THR B C    1  
ATOM 1644   O O    . THR B  1 28 ? -28.677 -6.078  -247.334 1.00 0.00 ?  28 THR B O    1  
ATOM 1645   C CB   . THR B  1 28 ? -28.617 -6.865  -250.542 1.00 0.00 ?  28 THR B CB   1  
ATOM 1646   O OG1  . THR B  1 28 ? -27.840 -6.626  -251.723 1.00 0.00 ?  28 THR B OG1  1  
ATOM 1647   C CG2  . THR B  1 28 ? -29.606 -5.725  -250.352 1.00 0.00 ?  28 THR B CG2  1  
ATOM 1648   H H    . THR B  1 28 ? -26.956 -8.807  -250.165 1.00 0.00 ?  28 THR B H    1  
ATOM 1649   H HA   . THR B  1 28 ? -27.099 -6.062  -249.244 1.00 0.00 ?  28 THR B HA   1  
ATOM 1650   H HB   . THR B  1 28 ? -29.162 -7.801  -250.660 1.00 0.00 ?  28 THR B HB   1  
ATOM 1651   H HG1  . THR B  1 28 ? -27.098 -7.236  -251.745 1.00 0.00 ?  28 THR B HG1  1  
ATOM 1652   H HG21 . THR B  1 28 ? -30.257 -5.661  -251.223 1.00 0.00 ?  28 THR B HG21 1  
ATOM 1653   H HG22 . THR B  1 28 ? -30.206 -5.909  -249.461 1.00 0.00 ?  28 THR B HG22 1  
ATOM 1654   H HG23 . THR B  1 28 ? -29.062 -4.788  -250.235 1.00 0.00 ?  28 THR B HG23 1  
ATOM 1655   N N    . GLU B  1 29 ? -29.071 -8.245  -247.793 1.00 0.00 ?  29 GLU B N    1  
ATOM 1656   C CA   . GLU B  1 29 ? -29.846 -8.478  -246.580 1.00 0.00 ?  29 GLU B CA   1  
ATOM 1657   C C    . GLU B  1 29 ? -28.961 -8.419  -245.342 1.00 0.00 ?  29 GLU B C    1  
ATOM 1658   O O    . GLU B  1 29 ? -29.389 -7.959  -244.283 1.00 0.00 ?  29 GLU B O    1  
ATOM 1659   C CB   . GLU B  1 29 ? -30.560 -9.830  -246.652 1.00 0.00 ?  29 GLU B CB   1  
ATOM 1660   C CG   . GLU B  1 29 ? -31.724 -9.875  -247.631 1.00 0.00 ?  29 GLU B CG   1  
ATOM 1661   C CD   . GLU B  1 29 ? -32.300 -11.260 -247.732 1.00 0.00 ?  29 GLU B CD   1  
ATOM 1662   O OE1  . GLU B  1 29 ? -31.761 -12.153 -247.124 1.00 0.00 ?  29 GLU B OE1  1  
ATOM 1663   O OE2  . GLU B  1 29 ? -33.343 -11.406 -248.325 1.00 0.00 -1 29 GLU B OE2  1  
ATOM 1664   H H    . GLU B  1 29 ? -28.946 -9.002  -248.450 1.00 0.00 ?  29 GLU B H    1  
ATOM 1665   H HA   . GLU B  1 29 ? -30.595 -7.694  -246.464 1.00 0.00 ?  29 GLU B HA   1  
ATOM 1666   H HB2  . GLU B  1 29 ? -29.813 -10.569 -246.943 1.00 0.00 ?  29 GLU B HB2  1  
ATOM 1667   H HB3  . GLU B  1 29 ? -30.921 -10.053 -245.648 1.00 0.00 ?  29 GLU B HB3  1  
ATOM 1668   H HG2  . GLU B  1 29 ? -32.519 -9.169  -247.392 1.00 0.00 ?  29 GLU B HG2  1  
ATOM 1669   H HG3  . GLU B  1 29 ? -31.270 -9.600  -248.582 1.00 0.00 ?  29 GLU B HG3  1  
ATOM 1670   N N    . ALA B  1 30 ? -27.725 -8.886  -245.481 1.00 0.00 ?  30 ALA B N    1  
ATOM 1671   C CA   . ALA B  1 30 ? -26.744 -8.789  -244.407 1.00 0.00 ?  30 ALA B CA   1  
ATOM 1672   C C    . ALA B  1 30 ? -26.419 -7.335  -244.088 1.00 0.00 ?  30 ALA B C    1  
ATOM 1673   O O    . ALA B  1 30 ? -26.238 -6.970  -242.926 1.00 0.00 ?  30 ALA B O    1  
ATOM 1674   C CB   . ALA B  1 30 ? -25.478 -9.550  -244.775 1.00 0.00 ?  30 ALA B CB   1  
ATOM 1675   H H    . ALA B  1 30 ? -27.458 -9.320  -246.353 1.00 0.00 ?  30 ALA B H    1  
ATOM 1676   H HA   . ALA B  1 30 ? -27.166 -9.233  -243.506 1.00 0.00 ?  30 ALA B HA   1  
ATOM 1677   H HB1  . ALA B  1 30 ? -25.051 -9.128  -245.683 1.00 0.00 ?  30 ALA B HB1  1  
ATOM 1678   H HB2  . ALA B  1 30 ? -24.756 -9.467  -243.963 1.00 0.00 ?  30 ALA B HB2  1  
ATOM 1679   H HB3  . ALA B  1 30 ? -25.719 -10.600 -244.940 1.00 0.00 ?  30 ALA B HB3  1  
ATOM 1680   N N    . LEU B  1 31 ? -26.346 -6.509  -245.126 1.00 0.00 ?  31 LEU B N    1  
ATOM 1681   C CA   . LEU B  1 31 ? -26.174 -5.072  -244.951 1.00 0.00 ?  31 LEU B CA   1  
ATOM 1682   C C    . LEU B  1 31 ? -27.382 -4.453  -244.259 1.00 0.00 ?  31 LEU B C    1  
ATOM 1683   O O    . LEU B  1 31 ? -27.237 -3.644  -243.342 1.00 0.00 ?  31 LEU B O    1  
ATOM 1684   C CB   . LEU B  1 31 ? -25.932 -4.397  -246.307 1.00 0.00 ?  31 LEU B CB   1  
ATOM 1685   C CG   . LEU B  1 31 ? -25.771 -2.873  -246.258 1.00 0.00 ?  31 LEU B CG   1  
ATOM 1686   C CD1  . LEU B  1 31 ? -24.585 -2.500  -245.379 1.00 0.00 ?  31 LEU B CD1  1  
ATOM 1687   C CD2  . LEU B  1 31 ? -25.585 -2.336  -247.670 1.00 0.00 ?  31 LEU B CD2  1  
ATOM 1688   H H    . LEU B  1 31 ? -26.412 -6.886  -246.061 1.00 0.00 ?  31 LEU B H    1  
ATOM 1689   H HA   . LEU B  1 31 ? -25.318 -4.883  -244.304 1.00 0.00 ?  31 LEU B HA   1  
ATOM 1690   H HB2  . LEU B  1 31 ? -24.985 -4.865  -246.570 1.00 0.00 ?  31 LEU B HB2  1  
ATOM 1691   H HB3  . LEU B  1 31 ? -26.691 -4.677  -247.038 1.00 0.00 ?  31 LEU B HB3  1  
ATOM 1692   H HG   . LEU B  1 31 ? -26.701 -2.461  -245.865 1.00 0.00 ?  31 LEU B HG   1  
ATOM 1693   H HD11 . LEU B  1 31 ? -24.479 -1.416  -245.350 1.00 0.00 ?  31 LEU B HD11 1  
ATOM 1694   H HD12 . LEU B  1 31 ? -24.751 -2.874  -244.368 1.00 0.00 ?  31 LEU B HD12 1  
ATOM 1695   H HD13 . LEU B  1 31 ? -23.677 -2.943  -245.786 1.00 0.00 ?  31 LEU B HD13 1  
ATOM 1696   H HD21 . LEU B  1 31 ? -26.456 -2.589  -248.274 1.00 0.00 ?  31 LEU B HD21 1  
ATOM 1697   H HD22 . LEU B  1 31 ? -25.472 -1.252  -247.634 1.00 0.00 ?  31 LEU B HD22 1  
ATOM 1698   H HD23 . LEU B  1 31 ? -24.694 -2.780  -248.114 1.00 0.00 ?  31 LEU B HD23 1  
ATOM 1699   N N    . ASP B  1 32 ? -28.573 -4.837  -244.704 1.00 0.00 ?  32 ASP B N    1  
ATOM 1700   C CA   . ASP B  1 32 ? -29.809 -4.304  -244.143 1.00 0.00 ?  32 ASP B CA   1  
ATOM 1701   C C    . ASP B  1 32 ? -29.888 -4.559  -242.643 1.00 0.00 ?  32 ASP B C    1  
ATOM 1702   O O    . ASP B  1 32 ? -30.263 -3.675  -241.872 1.00 0.00 ?  32 ASP B O    1  
ATOM 1703   C CB   . ASP B  1 32 ? -31.024 -4.915  -244.844 1.00 0.00 ?  32 ASP B CB   1  
ATOM 1704   C CG   . ASP B  1 32 ? -31.251 -4.410  -246.263 1.00 0.00 ?  32 ASP B CG   1  
ATOM 1705   O OD1  . ASP B  1 32 ? -30.639 -3.435  -246.631 1.00 0.00 ?  32 ASP B OD1  1  
ATOM 1706   O OD2  . ASP B  1 32 ? -31.910 -5.088  -247.015 1.00 0.00 -1 32 ASP B OD2  1  
ATOM 1707   H H    . ASP B  1 32 ? -28.625 -5.516  -245.449 1.00 0.00 ?  32 ASP B H    1  
ATOM 1708   H HA   . ASP B  1 32 ? -29.838 -3.222  -244.275 1.00 0.00 ?  32 ASP B HA   1  
ATOM 1709   H HB2  . ASP B  1 32 ? -31.024 -6.005  -244.843 1.00 0.00 ?  32 ASP B HB2  1  
ATOM 1710   H HB3  . ASP B  1 32 ? -31.823 -4.550  -244.197 1.00 0.00 ?  32 ASP B HB3  1  
ATOM 1711   N N    . LYS B  1 33 ? -29.534 -5.773  -242.235 1.00 0.00 ?  33 LYS B N    1  
ATOM 1712   C CA   . LYS B  1 33 ? -29.541 -6.139  -240.824 1.00 0.00 ?  33 LYS B CA   1  
ATOM 1713   C C    . LYS B  1 33 ? -28.417 -5.442  -240.068 1.00 0.00 ?  33 LYS B C    1  
ATOM 1714   O O    . LYS B  1 33 ? -28.628 -4.904  -238.981 1.00 0.00 ?  33 LYS B O    1  
ATOM 1715   C CB   . LYS B  1 33 ? -29.422 -7.655  -240.663 1.00 0.00 ?  33 LYS B CB   1  
ATOM 1716   C CG   . LYS B  1 33 ? -30.642 -8.436  -241.133 1.00 0.00 ?  33 LYS B CG   1  
ATOM 1717   C CD   . LYS B  1 33 ? -30.426 -9.936  -240.996 1.00 0.00 ?  33 LYS B CD   1  
ATOM 1718   C CE   . LYS B  1 33 ? -31.609 -10.718 -241.547 1.00 0.00 ?  33 LYS B CE   1  
ATOM 1719   N NZ   . LYS B  1 33 ? -31.393 -12.188 -241.459 1.00 0.00 1  33 LYS B NZ   1  
ATOM 1720   H H    . LYS B  1 33 ? -29.252 -6.459  -242.920 1.00 0.00 ?  33 LYS B H    1  
ATOM 1721   H HA   . LYS B  1 33 ? -30.474 -5.813  -240.363 1.00 0.00 ?  33 LYS B HA   1  
ATOM 1722   H HB2  . LYS B  1 33 ? -28.548 -7.969  -241.235 1.00 0.00 ?  33 LYS B HB2  1  
ATOM 1723   H HB3  . LYS B  1 33 ? -29.251 -7.853  -239.605 1.00 0.00 ?  33 LYS B HB3  1  
ATOM 1724   H HG2  . LYS B  1 33 ? -31.499 -8.135  -240.529 1.00 0.00 ?  33 LYS B HG2  1  
ATOM 1725   H HG3  . LYS B  1 33 ? -30.830 -8.189  -242.177 1.00 0.00 ?  33 LYS B HG3  1  
ATOM 1726   H HD2  . LYS B  1 33 ? -29.523 -10.208 -241.543 1.00 0.00 ?  33 LYS B HD2  1  
ATOM 1727   H HD3  . LYS B  1 33 ? -30.295 -10.173 -239.940 1.00 0.00 ?  33 LYS B HD3  1  
ATOM 1728   H HE2  . LYS B  1 33 ? -32.495 -10.447 -240.976 1.00 0.00 ?  33 LYS B HE2  1  
ATOM 1729   H HE3  . LYS B  1 33 ? -31.749 -10.435 -242.590 1.00 0.00 ?  33 LYS B HE3  1  
ATOM 1730   H HZ1  . LYS B  1 33 ? -31.264 -12.451 -240.492 1.00 0.00 ?  33 LYS B HZ1  1  
ATOM 1731   H HZ2  . LYS B  1 33 ? -32.198 -12.670 -241.834 1.00 0.00 ?  33 LYS B HZ2  1  
ATOM 1732   H HZ3  . LYS B  1 33 ? -30.572 -12.441 -241.990 1.00 0.00 ?  33 LYS B HZ3  1  
ATOM 1733   N N    . LEU B  1 34 ? -27.223 -5.456  -240.649 1.00 0.00 ?  34 LEU B N    1  
ATOM 1734   C CA   . LEU B  1 34 ? -26.058 -4.843  -240.022 1.00 0.00 ?  34 LEU B CA   1  
ATOM 1735   C C    . LEU B  1 34 ? -26.284 -3.356  -239.775 1.00 0.00 ?  34 LEU B C    1  
ATOM 1736   O O    . LEU B  1 34 ? -25.818 -2.805  -238.778 1.00 0.00 ?  34 LEU B O    1  
ATOM 1737   C CB   . LEU B  1 34 ? -24.813 -5.056  -240.892 1.00 0.00 ?  34 LEU B CB   1  
ATOM 1738   C CG   . LEU B  1 34 ? -23.504 -4.518  -240.302 1.00 0.00 ?  34 LEU B CG   1  
ATOM 1739   C CD1  . LEU B  1 34 ? -23.189 -5.229  -238.993 1.00 0.00 ?  34 LEU B CD1  1  
ATOM 1740   C CD2  . LEU B  1 34 ? -22.376 -4.711  -241.305 1.00 0.00 ?  34 LEU B CD2  1  
ATOM 1741   H H    . LEU B  1 34 ? -27.119 -5.902  -241.549 1.00 0.00 ?  34 LEU B H    1  
ATOM 1742   H HA   . LEU B  1 34 ? -25.889 -5.295  -239.046 1.00 0.00 ?  34 LEU B HA   1  
ATOM 1743   H HB2  . LEU B  1 34 ? -24.795 -6.145  -240.911 1.00 0.00 ?  34 LEU B HB2  1  
ATOM 1744   H HB3  . LEU B  1 34 ? -24.958 -4.678  -241.904 1.00 0.00 ?  34 LEU B HB3  1  
ATOM 1745   H HG   . LEU B  1 34 ? -23.634 -3.446  -240.149 1.00 0.00 ?  34 LEU B HG   1  
ATOM 1746   H HD11 . LEU B  1 34 ? -22.258 -4.840  -238.581 1.00 0.00 ?  34 LEU B HD11 1  
ATOM 1747   H HD12 . LEU B  1 34 ? -23.998 -5.058  -238.282 1.00 0.00 ?  34 LEU B HD12 1  
ATOM 1748   H HD13 . LEU B  1 34 ? -23.086 -6.298  -239.176 1.00 0.00 ?  34 LEU B HD13 1  
ATOM 1749   H HD21 . LEU B  1 34 ? -22.609 -4.171  -242.223 1.00 0.00 ?  34 LEU B HD21 1  
ATOM 1750   H HD22 . LEU B  1 34 ? -21.446 -4.327  -240.884 1.00 0.00 ?  34 LEU B HD22 1  
ATOM 1751   H HD23 . LEU B  1 34 ? -22.264 -5.772  -241.527 1.00 0.00 ?  34 LEU B HD23 1  
ATOM 1752   N N    . ALA B  1 35 ? -27.001 -2.712  -240.690 1.00 0.00 ?  35 ALA B N    1  
ATOM 1753   C CA   . ALA B  1 35 ? -27.336 -1.301  -240.546 1.00 0.00 ?  35 ALA B CA   1  
ATOM 1754   C C    . ALA B  1 35 ? -28.071 -1.040  -239.237 1.00 0.00 ?  35 ALA B C    1  
ATOM 1755   O O    . ALA B  1 35 ? -27.881 -0.002  -238.604 1.00 0.00 ?  35 ALA B O    1  
ATOM 1756   C CB   . ALA B  1 35 ? -28.170 -0.831  -241.729 1.00 0.00 ?  35 ALA B CB   1  
ATOM 1757   H H    . ALA B  1 35 ? -27.322 -3.214  -241.506 1.00 0.00 ?  35 ALA B H    1  
ATOM 1758   H HA   . ALA B  1 35 ? -26.412 -0.723  -240.520 1.00 0.00 ?  35 ALA B HA   1  
ATOM 1759   H HB1  . ALA B  1 35 ? -29.091 -1.410  -241.777 1.00 0.00 ?  35 ALA B HB1  1  
ATOM 1760   H HB2  . ALA B  1 35 ? -28.412 0.225   -241.606 1.00 0.00 ?  35 ALA B HB2  1  
ATOM 1761   H HB3  . ALA B  1 35 ? -27.605 -0.969  -242.651 1.00 0.00 ?  35 ALA B HB3  1  
ATOM 1762   N N    . ALA B  1 36 ? -28.911 -1.988  -238.837 1.00 0.00 ?  36 ALA B N    1  
ATOM 1763   C CA   . ALA B  1 36 ? -29.671 -1.866  -237.598 1.00 0.00 ?  36 ALA B CA   1  
ATOM 1764   C C    . ALA B  1 36 ? -28.772 -2.043  -236.381 1.00 0.00 ?  36 ALA B C    1  
ATOM 1765   O O    . ALA B  1 36 ? -28.888 -1.309  -235.400 1.00 0.00 ?  36 ALA B O    1  
ATOM 1766   C CB   . ALA B  1 36 ? -30.808 -2.876  -237.573 1.00 0.00 ?  36 ALA B CB   1  
ATOM 1767   H H    . ALA B  1 36 ? -29.027 -2.815  -239.406 1.00 0.00 ?  36 ALA B H    1  
ATOM 1768   H HA   . ALA B  1 36 ? -30.095 -0.863  -237.546 1.00 0.00 ?  36 ALA B HA   1  
ATOM 1769   H HB1  . ALA B  1 36 ? -30.402 -3.884  -237.640 1.00 0.00 ?  36 ALA B HB1  1  
ATOM 1770   H HB2  . ALA B  1 36 ? -31.365 -2.772  -236.642 1.00 0.00 ?  36 ALA B HB2  1  
ATOM 1771   H HB3  . ALA B  1 36 ? -31.475 -2.695  -238.416 1.00 0.00 ?  36 ALA B HB3  1  
ATOM 1772   N N    . LYS B  1 37 ? -27.876 -3.022  -236.452 1.00 0.00 ?  37 LYS B N    1  
ATOM 1773   C CA   . LYS B  1 37 ? -26.939 -3.282  -235.365 1.00 0.00 ?  37 LYS B CA   1  
ATOM 1774   C C    . LYS B  1 37 ? -25.524 -3.480  -235.893 1.00 0.00 ?  37 LYS B C    1  
ATOM 1775   O O    . LYS B  1 37 ? -25.045 -4.608  -236.005 1.00 0.00 ?  37 LYS B O    1  
ATOM 1776   C CB   . LYS B  1 37 ? -27.377 -4.509  -234.563 1.00 0.00 ?  37 LYS B CB   1  
ATOM 1777   C CG   . LYS B  1 37 ? -28.741 -4.372  -233.899 1.00 0.00 ?  37 LYS B CG   1  
ATOM 1778   C CD   . LYS B  1 37 ? -29.041 -5.563  -233.002 1.00 0.00 ?  37 LYS B CD   1  
ATOM 1779   C CE   . LYS B  1 37 ? -30.428 -5.456  -232.384 1.00 0.00 ?  37 LYS B CE   1  
ATOM 1780   N NZ   . LYS B  1 37 ? -30.732 -6.610  -231.494 1.00 0.00 1  37 LYS B NZ   1  
ATOM 1781   H H    . LYS B  1 37 ? -27.842 -3.600  -237.279 1.00 0.00 ?  37 LYS B H    1  
ATOM 1782   H HA   . LYS B  1 37 ? -26.903 -2.423  -234.695 1.00 0.00 ?  37 LYS B HA   1  
ATOM 1783   H HB2  . LYS B  1 37 ? -27.392 -5.353  -235.253 1.00 0.00 ?  37 LYS B HB2  1  
ATOM 1784   H HB3  . LYS B  1 37 ? -26.618 -4.679  -233.799 1.00 0.00 ?  37 LYS B HB3  1  
ATOM 1785   H HG2  . LYS B  1 37 ? -28.747 -3.458  -233.305 1.00 0.00 ?  37 LYS B HG2  1  
ATOM 1786   H HG3  . LYS B  1 37 ? -29.500 -4.303  -234.678 1.00 0.00 ?  37 LYS B HG3  1  
ATOM 1787   H HD2  . LYS B  1 37 ? -28.979 -6.473  -233.600 1.00 0.00 ?  37 LYS B HD2  1  
ATOM 1788   H HD3  . LYS B  1 37 ? -28.293 -5.599  -232.210 1.00 0.00 ?  37 LYS B HD3  1  
ATOM 1789   H HE2  . LYS B  1 37 ? -30.475 -4.532  -231.808 1.00 0.00 ?  37 LYS B HE2  1  
ATOM 1790   H HE3  . LYS B  1 37 ? -31.159 -5.417  -233.191 1.00 0.00 ?  37 LYS B HE3  1  
ATOM 1791   H HZ1  . LYS B  1 37 ? -30.054 -6.645  -230.746 1.00 0.00 ?  37 LYS B HZ1  1  
ATOM 1792   H HZ2  . LYS B  1 37 ? -31.658 -6.500  -231.106 1.00 0.00 ?  37 LYS B HZ2  1  
ATOM 1793   H HZ3  . LYS B  1 37 ? -30.689 -7.467  -232.028 1.00 0.00 ?  37 LYS B HZ3  1  
ATOM 1794   N N    . PRO B  1 38 ? -24.859 -2.376  -236.217 1.00 0.00 ?  38 PRO B N    1  
ATOM 1795   C CA   . PRO B  1 38 ? -23.506 -2.427  -236.758 1.00 0.00 ?  38 PRO B CA   1  
ATOM 1796   C C    . PRO B  1 38 ? -22.550 -3.108  -235.788 1.00 0.00 ?  38 PRO B C    1  
ATOM 1797   O O    . PRO B  1 38 ? -21.524 -3.656  -236.193 1.00 0.00 ?  38 PRO B O    1  
ATOM 1798   C CB   . PRO B  1 38 ? -23.141 -0.958  -236.993 1.00 0.00 ?  38 PRO B CB   1  
ATOM 1799   C CG   . PRO B  1 38 ? -24.454 -0.266  -237.128 1.00 0.00 ?  38 PRO B CG   1  
ATOM 1800   C CD   . PRO B  1 38 ? -25.383 -0.984  -236.186 1.00 0.00 ?  38 PRO B CD   1  
ATOM 1801   H HA   . PRO B  1 38 ? -23.441 -3.019  -237.683 1.00 0.00 ?  38 PRO B HA   1  
ATOM 1802   H HB2  . PRO B  1 38 ? -22.559 -0.549  -236.154 1.00 0.00 ?  38 PRO B HB2  1  
ATOM 1803   H HB3  . PRO B  1 38 ? -22.530 -0.834  -237.900 1.00 0.00 ?  38 PRO B HB3  1  
ATOM 1804   H HG2  . PRO B  1 38 ? -24.371 0.799   -236.867 1.00 0.00 ?  38 PRO B HG2  1  
ATOM 1805   H HG3  . PRO B  1 38 ? -24.825 -0.315  -238.163 1.00 0.00 ?  38 PRO B HG3  1  
ATOM 1806   H HD2  . PRO B  1 38 ? -25.350 -0.564  -235.169 1.00 0.00 ?  38 PRO B HD2  1  
ATOM 1807   H HD3  . PRO B  1 38 ? -26.430 -0.938  -236.518 1.00 0.00 ?  38 PRO B HD3  1  
ATOM 1808   N N    . SER B  1 39 ? -22.891 -3.071  -234.504 1.00 0.00 ?  39 SER B N    1  
ATOM 1809   C CA   . SER B  1 39 ? -21.988 -3.534  -233.458 1.00 0.00 ?  39 SER B CA   1  
ATOM 1810   C C    . SER B  1 39 ? -22.190 -5.016  -233.172 1.00 0.00 ?  39 SER B C    1  
ATOM 1811   O O    . SER B  1 39 ? -21.631 -5.556  -232.217 1.00 0.00 ?  39 SER B O    1  
ATOM 1812   C CB   . SER B  1 39 ? -22.192 -2.719  -232.195 1.00 0.00 ?  39 SER B CB   1  
ATOM 1813   O OG   . SER B  1 39 ? -23.451 -2.941  -231.623 1.00 0.00 ?  39 SER B OG   1  
ATOM 1814   H H    . SER B  1 39 ? -23.800 -2.712  -234.247 1.00 0.00 ?  39 SER B H    1  
ATOM 1815   H HA   . SER B  1 39 ? -20.937 -3.338  -233.675 1.00 0.00 ?  39 SER B HA   1  
ATOM 1816   H HB2  . SER B  1 39 ? -21.422 -2.996  -231.475 1.00 0.00 ?  39 SER B HB2  1  
ATOM 1817   H HB3  . SER B  1 39 ? -22.095 -1.663  -232.441 1.00 0.00 ?  39 SER B HB3  1  
ATOM 1818   H HG   . SER B  1 39 ? -24.135 -2.698  -232.252 1.00 0.00 ?  39 SER B HG   1  
ATOM 1819   N N    . ASP B  1 40 ? -22.993 -5.670  -234.004 1.00 0.00 ?  40 ASP B N    1  
ATOM 1820   C CA   . ASP B  1 40 ? -23.221 -7.105  -233.881 1.00 0.00 ?  40 ASP B CA   1  
ATOM 1821   C C    . ASP B  1 40 ? -22.125 -7.898  -234.580 1.00 0.00 ?  40 ASP B C    1  
ATOM 1822   O O    . ASP B  1 40 ? -21.983 -7.836  -235.802 1.00 0.00 ?  40 ASP B O    1  
ATOM 1823   C CB   . ASP B  1 40 ? -24.589 -7.482  -234.453 1.00 0.00 ?  40 ASP B CB   1  
ATOM 1824   C CG   . ASP B  1 40 ? -24.968 -8.945  -234.264 1.00 0.00 ?  40 ASP B CG   1  
ATOM 1825   O OD1  . ASP B  1 40 ? -24.143 -9.697  -233.802 1.00 0.00 ?  40 ASP B OD1  1  
ATOM 1826   O OD2  . ASP B  1 40 ? -26.120 -9.266  -234.432 1.00 0.00 -1 40 ASP B OD2  1  
ATOM 1827   H H    . ASP B  1 40 ? -23.458 -5.160  -234.741 1.00 0.00 ?  40 ASP B H    1  
ATOM 1828   H HA   . ASP B  1 40 ? -23.191 -7.394  -232.830 1.00 0.00 ?  40 ASP B HA   1  
ATOM 1829   H HB2  . ASP B  1 40 ? -25.400 -6.848  -234.093 1.00 0.00 ?  40 ASP B HB2  1  
ATOM 1830   H HB3  . ASP B  1 40 ? -24.415 -7.286  -235.511 1.00 0.00 ?  40 ASP B HB3  1  
ATOM 1831   N N    . PRO B  1 41 ? -21.350 -8.644  -233.799 1.00 0.00 ?  41 PRO B N    1  
ATOM 1832   C CA   . PRO B  1 41 ? -20.265 -9.451  -234.342 1.00 0.00 ?  41 PRO B CA   1  
ATOM 1833   C C    . PRO B  1 41 ? -20.779 -10.436 -235.384 1.00 0.00 ?  41 PRO B C    1  
ATOM 1834   O O    . PRO B  1 41 ? -20.107 -10.710 -236.379 1.00 0.00 ?  41 PRO B O    1  
ATOM 1835   C CB   . PRO B  1 41 ? -19.677 -10.161 -233.118 1.00 0.00 ?  41 PRO B CB   1  
ATOM 1836   C CG   . PRO B  1 41 ? -20.050 -9.288  -231.969 1.00 0.00 ?  41 PRO B CG   1  
ATOM 1837   C CD   . PRO B  1 41 ? -21.400 -8.722  -232.319 1.00 0.00 ?  41 PRO B CD   1  
ATOM 1838   H HA   . PRO B  1 41 ? -19.509 -8.849  -234.869 1.00 0.00 ?  41 PRO B HA   1  
ATOM 1839   H HB2  . PRO B  1 41 ? -20.093 -11.173 -233.002 1.00 0.00 ?  41 PRO B HB2  1  
ATOM 1840   H HB3  . PRO B  1 41 ? -18.586 -10.268 -233.200 1.00 0.00 ?  41 PRO B HB3  1  
ATOM 1841   H HG2  . PRO B  1 41 ? -20.093 -9.862  -231.031 1.00 0.00 ?  41 PRO B HG2  1  
ATOM 1842   H HG3  . PRO B  1 41 ? -19.311 -8.487  -231.822 1.00 0.00 ?  41 PRO B HG3  1  
ATOM 1843   H HD2  . PRO B  1 41 ? -22.223 -9.369  -231.982 1.00 0.00 ?  41 PRO B HD2  1  
ATOM 1844   H HD3  . PRO B  1 41 ? -21.565 -7.732  -231.868 1.00 0.00 ?  41 PRO B HD3  1  
ATOM 1845   N N    . ALA B  1 42 ? -21.975 -10.966 -235.151 1.00 0.00 ?  42 ALA B N    1  
ATOM 1846   C CA   . ALA B  1 42 ? -22.560 -11.959 -236.044 1.00 0.00 ?  42 ALA B CA   1  
ATOM 1847   C C    . ALA B  1 42 ? -22.896 -11.350 -237.399 1.00 0.00 ?  42 ALA B C    1  
ATOM 1848   O O    . ALA B  1 42 ? -22.646 -11.956 -238.442 1.00 0.00 ?  42 ALA B O    1  
ATOM 1849   C CB   . ALA B  1 42 ? -23.801 -12.572 -235.413 1.00 0.00 ?  42 ALA B CB   1  
ATOM 1850   H H    . ALA B  1 42 ? -22.491 -10.673 -234.334 1.00 0.00 ?  42 ALA B H    1  
ATOM 1851   H HA   . ALA B  1 42 ? -21.830 -12.749 -236.215 1.00 0.00 ?  42 ALA B HA   1  
ATOM 1852   H HB1  . ALA B  1 42 ? -24.536 -11.792 -235.221 1.00 0.00 ?  42 ALA B HB1  1  
ATOM 1853   H HB2  . ALA B  1 42 ? -24.226 -13.312 -236.092 1.00 0.00 ?  42 ALA B HB2  1  
ATOM 1854   H HB3  . ALA B  1 42 ? -23.531 -13.056 -234.474 1.00 0.00 ?  42 ALA B HB3  1  
ATOM 1855   N N    . LEU B  1 43 ? -23.464 -10.149 -237.379 1.00 0.00 ?  43 LEU B N    1  
ATOM 1856   C CA   . LEU B  1 43 ? -23.816 -9.447  -238.607 1.00 0.00 ?  43 LEU B CA   1  
ATOM 1857   C C    . LEU B  1 43 ? -22.573 -8.940  -239.327 1.00 0.00 ?  43 LEU B C    1  
ATOM 1858   O O    . LEU B  1 43 ? -22.519 -8.922  -240.557 1.00 0.00 ?  43 LEU B O    1  
ATOM 1859   C CB   . LEU B  1 43 ? -24.766 -8.283  -238.299 1.00 0.00 ?  43 LEU B CB   1  
ATOM 1860   C CG   . LEU B  1 43 ? -26.147 -8.690  -237.770 1.00 0.00 ?  43 LEU B CG   1  
ATOM 1861   C CD1  . LEU B  1 43 ? -26.923 -7.455  -237.331 1.00 0.00 ?  43 LEU B CD1  1  
ATOM 1862   C CD2  . LEU B  1 43 ? -26.904 -9.446  -238.852 1.00 0.00 ?  43 LEU B CD2  1  
ATOM 1863   H H    . LEU B  1 43 ? -23.658 -9.712  -236.489 1.00 0.00 ?  43 LEU B H    1  
ATOM 1864   H HA   . LEU B  1 43 ? -24.311 -10.135 -239.292 1.00 0.00 ?  43 LEU B HA   1  
ATOM 1865   H HB2  . LEU B  1 43 ? -24.195 -7.792  -237.513 1.00 0.00 ?  43 LEU B HB2  1  
ATOM 1866   H HB3  . LEU B  1 43 ? -24.868 -7.609  -239.149 1.00 0.00 ?  43 LEU B HB3  1  
ATOM 1867   H HG   . LEU B  1 43 ? -25.986 -9.374  -236.936 1.00 0.00 ?  43 LEU B HG   1  
ATOM 1868   H HD11 . LEU B  1 43 ? -27.902 -7.754  -236.957 1.00 0.00 ?  43 LEU B HD11 1  
ATOM 1869   H HD12 . LEU B  1 43 ? -26.374 -6.943  -236.541 1.00 0.00 ?  43 LEU B HD12 1  
ATOM 1870   H HD13 . LEU B  1 43 ? -27.049 -6.784  -238.180 1.00 0.00 ?  43 LEU B HD13 1  
ATOM 1871   H HD21 . LEU B  1 43 ? -26.345 -10.340 -239.131 1.00 0.00 ?  43 LEU B HD21 1  
ATOM 1872   H HD22 . LEU B  1 43 ? -27.885 -9.735  -238.474 1.00 0.00 ?  43 LEU B HD22 1  
ATOM 1873   H HD23 . LEU B  1 43 ? -27.025 -8.807  -239.727 1.00 0.00 ?  43 LEU B HD23 1  
ATOM 1874   N N    . LEU B  1 44 ? -21.574 -8.529  -238.553 1.00 0.00 ?  44 LEU B N    1  
ATOM 1875   C CA   . LEU B  1 44 ? -20.309 -8.069  -239.115 1.00 0.00 ?  44 LEU B CA   1  
ATOM 1876   C C    . LEU B  1 44 ? -19.579 -9.199  -239.828 1.00 0.00 ?  44 LEU B C    1  
ATOM 1877   O O    . LEU B  1 44 ? -19.119 -9.039  -240.958 1.00 0.00 ?  44 LEU B O    1  
ATOM 1878   C CB   . LEU B  1 44 ? -19.425 -7.474  -238.012 1.00 0.00 ?  44 LEU B CB   1  
ATOM 1879   C CG   . LEU B  1 44 ? -19.840 -6.081  -237.521 1.00 0.00 ?  44 LEU B CG   1  
ATOM 1880   C CD1  . LEU B  1 44 ? -19.064 -5.718  -236.263 1.00 0.00 ?  44 LEU B CD1  1  
ATOM 1881   C CD2  . LEU B  1 44 ? -19.594 -5.060  -238.621 1.00 0.00 ?  44 LEU B CD2  1  
ATOM 1882   H H    . LEU B  1 44 ? -21.693 -8.535  -237.550 1.00 0.00 ?  44 LEU B H    1  
ATOM 1883   H HA   . LEU B  1 44 ? -20.501 -7.303  -239.865 1.00 0.00 ?  44 LEU B HA   1  
ATOM 1884   H HB2  . LEU B  1 44 ? -19.596 -8.212  -237.230 1.00 0.00 ?  44 LEU B HB2  1  
ATOM 1885   H HB3  . LEU B  1 44 ? -18.371 -7.480  -238.292 1.00 0.00 ?  44 LEU B HB3  1  
ATOM 1886   H HG   . LEU B  1 44 ? -20.913 -6.113  -237.329 1.00 0.00 ?  44 LEU B HG   1  
ATOM 1887   H HD11 . LEU B  1 44 ? -19.366 -4.727  -235.922 1.00 0.00 ?  44 LEU B HD11 1  
ATOM 1888   H HD12 . LEU B  1 44 ? -19.273 -6.449  -235.482 1.00 0.00 ?  44 LEU B HD12 1  
ATOM 1889   H HD13 . LEU B  1 44 ? -17.997 -5.716  -236.482 1.00 0.00 ?  44 LEU B HD13 1  
ATOM 1890   H HD21 . LEU B  1 44 ? -20.180 -5.324  -239.502 1.00 0.00 ?  44 LEU B HD21 1  
ATOM 1891   H HD22 . LEU B  1 44 ? -19.891 -4.071  -238.272 1.00 0.00 ?  44 LEU B HD22 1  
ATOM 1892   H HD23 . LEU B  1 44 ? -18.535 -5.052  -238.880 1.00 0.00 ?  44 LEU B HD23 1  
ATOM 1893   N N    . ALA B  1 45 ? -19.476 -10.344 -239.161 1.00 0.00 ?  45 ALA B N    1  
ATOM 1894   C CA   . ALA B  1 45 ? -18.768 -11.492 -239.714 1.00 0.00 ?  45 ALA B CA   1  
ATOM 1895   C C    . ALA B  1 45 ? -19.471 -12.027 -240.955 1.00 0.00 ?  45 ALA B C    1  
ATOM 1896   O O    . ALA B  1 45 ? -18.833 -12.302 -241.971 1.00 0.00 ?  45 ALA B O    1  
ATOM 1897   C CB   . ALA B  1 45 ? -18.632 -12.586 -238.665 1.00 0.00 ?  45 ALA B CB   1  
ATOM 1898   H H    . ALA B  1 45 ? -19.899 -10.420 -238.247 1.00 0.00 ?  45 ALA B H    1  
ATOM 1899   H HA   . ALA B  1 45 ? -17.770 -11.175 -240.017 1.00 0.00 ?  45 ALA B HA   1  
ATOM 1900   H HB1  . ALA B  1 45 ? -19.621 -12.904 -238.340 1.00 0.00 ?  45 ALA B HB1  1  
ATOM 1901   H HB2  . ALA B  1 45 ? -18.101 -13.436 -239.094 1.00 0.00 ?  45 ALA B HB2  1  
ATOM 1902   H HB3  . ALA B  1 45 ? -18.074 -12.204 -237.810 1.00 0.00 ?  45 ALA B HB3  1  
ATOM 1903   N N    . ALA B  1 46 ? -20.788 -12.172 -240.867 1.00 0.00 ?  46 ALA B N    1  
ATOM 1904   C CA   . ALA B  1 46 ? -21.579 -12.689 -241.977 1.00 0.00 ?  46 ALA B CA   1  
ATOM 1905   C C    . ALA B  1 46 ? -21.528 -11.749 -243.175 1.00 0.00 ?  46 ALA B C    1  
ATOM 1906   O O    . ALA B  1 46 ? -21.295 -12.178 -244.304 1.00 0.00 ?  46 ALA B O    1  
ATOM 1907   C CB   . ALA B  1 46 ? -23.018 -12.920 -241.541 1.00 0.00 ?  46 ALA B CB   1  
ATOM 1908   H H    . ALA B  1 46 ? -21.255 -11.917 -240.008 1.00 0.00 ?  46 ALA B H    1  
ATOM 1909   H HA   . ALA B  1 46 ? -21.154 -13.642 -242.295 1.00 0.00 ?  46 ALA B HA   1  
ATOM 1910   H HB1  . ALA B  1 46 ? -23.452 -11.979 -241.207 1.00 0.00 ?  46 ALA B HB1  1  
ATOM 1911   H HB2  . ALA B  1 46 ? -23.594 -13.306 -242.382 1.00 0.00 ?  46 ALA B HB2  1  
ATOM 1912   H HB3  . ALA B  1 46 ? -23.040 -13.642 -240.725 1.00 0.00 ?  46 ALA B HB3  1  
ATOM 1913   N N    . TYR B  1 47 ? -21.747 -10.463 -242.920 1.00 0.00 ?  47 TYR B N    1  
ATOM 1914   C CA   . TYR B  1 47 ? -21.771 -9.465  -243.983 1.00 0.00 ?  47 TYR B CA   1  
ATOM 1915   C C    . TYR B  1 47 ? -20.410 -9.341  -244.654 1.00 0.00 ?  47 TYR B C    1  
ATOM 1916   O O    . TYR B  1 47 ? -20.307 -9.362  -245.881 1.00 0.00 ?  47 TYR B O    1  
ATOM 1917   C CB   . TYR B  1 47 ? -22.211 -8.107  -243.432 1.00 0.00 ?  47 TYR B CB   1  
ATOM 1918   C CG   . TYR B  1 47 ? -22.089 -6.973  -244.426 1.00 0.00 ?  47 TYR B CG   1  
ATOM 1919   C CD1  . TYR B  1 47 ? -22.819 -6.978  -245.605 1.00 0.00 ?  47 TYR B CD1  1  
ATOM 1920   C CD2  . TYR B  1 47 ? -21.245 -5.901  -244.181 1.00 0.00 ?  47 TYR B CD2  1  
ATOM 1921   C CE1  . TYR B  1 47 ? -22.712 -5.946  -246.517 1.00 0.00 ?  47 TYR B CE1  1  
ATOM 1922   C CE2  . TYR B  1 47 ? -21.129 -4.862  -245.085 1.00 0.00 ?  47 TYR B CE2  1  
ATOM 1923   C CZ   . TYR B  1 47 ? -21.865 -4.888  -246.252 1.00 0.00 ?  47 TYR B CZ   1  
ATOM 1924   O OH   . TYR B  1 47 ? -21.754 -3.856  -247.156 1.00 0.00 ?  47 TYR B OH   1  
ATOM 1925   H H    . TYR B  1 47 ? -21.900 -10.169 -241.966 1.00 0.00 ?  47 TYR B H    1  
ATOM 1926   H HA   . TYR B  1 47 ? -22.474 -9.769  -244.760 1.00 0.00 ?  47 TYR B HA   1  
ATOM 1927   H HB2  . TYR B  1 47 ? -23.251 -8.206  -243.120 1.00 0.00 ?  47 TYR B HB2  1  
ATOM 1928   H HB3  . TYR B  1 47 ? -21.589 -7.896  -242.562 1.00 0.00 ?  47 TYR B HB3  1  
ATOM 1929   H HD1  . TYR B  1 47 ? -23.486 -7.816  -245.807 1.00 0.00 ?  47 TYR B HD1  1  
ATOM 1930   H HD2  . TYR B  1 47 ? -20.666 -5.886  -243.257 1.00 0.00 ?  47 TYR B HD2  1  
ATOM 1931   H HE1  . TYR B  1 47 ? -23.291 -5.963  -247.439 1.00 0.00 ?  47 TYR B HE1  1  
ATOM 1932   H HE2  . TYR B  1 47 ? -20.459 -4.029  -244.875 1.00 0.00 ?  47 TYR B HE2  1  
ATOM 1933   H HH   . TYR B  1 47 ? -21.140 -3.175  -246.873 1.00 0.00 ?  47 TYR B HH   1  
ATOM 1934   N N    . GLN B  1 48 ? -19.365 -9.213  -243.843 1.00 0.00 ?  48 GLN B N    1  
ATOM 1935   C CA   . GLN B  1 48 ? -18.014 -9.024  -244.357 1.00 0.00 ?  48 GLN B CA   1  
ATOM 1936   C C    . GLN B  1 48 ? -17.544 -10.247 -245.134 1.00 0.00 ?  48 GLN B C    1  
ATOM 1937   O O    . GLN B  1 48 ? -16.873 -10.124 -246.158 1.00 0.00 ?  48 GLN B O    1  
ATOM 1938   C CB   . GLN B  1 48 ? -17.041 -8.733  -243.212 1.00 0.00 ?  48 GLN B CB   1  
ATOM 1939   C CG   . GLN B  1 48 ? -15.654 -8.309  -243.666 1.00 0.00 ?  48 GLN B CG   1  
ATOM 1940   C CD   . GLN B  1 48 ? -14.788 -9.490  -244.062 1.00 0.00 ?  48 GLN B CD   1  
ATOM 1941   O OE1  . GLN B  1 48 ? -14.861 -10.562 -243.455 1.00 0.00 ?  48 GLN B OE1  1  
ATOM 1942   N NE2  . GLN B  1 48 ? -13.959 -9.299  -245.082 1.00 0.00 ?  48 GLN B NE2  1  
ATOM 1943   H H    . GLN B  1 48 ? -19.511 -9.247  -242.844 1.00 0.00 ?  48 GLN B H    1  
ATOM 1944   H HA   . GLN B  1 48 ? -18.004 -8.189  -245.058 1.00 0.00 ?  48 GLN B HA   1  
ATOM 1945   H HB2  . GLN B  1 48 ? -17.489 -7.943  -242.610 1.00 0.00 ?  48 GLN B HB2  1  
ATOM 1946   H HB3  . GLN B  1 48 ? -16.970 -9.645  -242.620 1.00 0.00 ?  48 GLN B HB3  1  
ATOM 1947   H HG2  . GLN B  1 48 ? -15.489 -7.514  -244.394 1.00 0.00 ?  48 GLN B HG2  1  
ATOM 1948   H HG3  . GLN B  1 48 ? -15.341 -7.966  -242.680 1.00 0.00 ?  48 GLN B HG3  1  
ATOM 1949   H HE21 . GLN B  1 48 ? -13.930 -8.413  -245.545 1.00 0.00 ?  48 GLN B HE21 1  
ATOM 1950   H HE22 . GLN B  1 48 ? -13.362 -10.042 -245.388 1.00 0.00 ?  48 GLN B HE22 1  
ATOM 1951   N N    . SER B  1 49 ? -17.901 -11.428 -244.640 1.00 0.00 ?  49 SER B N    1  
ATOM 1952   C CA   . SER B  1 49 ? -17.560 -12.675 -245.314 1.00 0.00 ?  49 SER B CA   1  
ATOM 1953   C C    . SER B  1 49 ? -18.207 -12.752 -246.690 1.00 0.00 ?  49 SER B C    1  
ATOM 1954   O O    . SER B  1 49 ? -17.570 -13.150 -247.666 1.00 0.00 ?  49 SER B O    1  
ATOM 1955   C CB   . SER B  1 49 ? -17.980 -13.859 -244.465 1.00 0.00 ?  49 SER B CB   1  
ATOM 1956   O OG   . SER B  1 49 ? -17.720 -15.081 -245.100 1.00 0.00 ?  49 SER B OG   1  
ATOM 1957   H H    . SER B  1 49 ? -18.422 -11.462 -243.776 1.00 0.00 ?  49 SER B H    1  
ATOM 1958   H HA   . SER B  1 49 ? -16.485 -12.840 -245.399 1.00 0.00 ?  49 SER B HA   1  
ATOM 1959   H HB2  . SER B  1 49 ? -17.431 -13.825 -243.524 1.00 0.00 ?  49 SER B HB2  1  
ATOM 1960   H HB3  . SER B  1 49 ? -19.048 -13.783 -244.264 1.00 0.00 ?  49 SER B HB3  1  
ATOM 1961   H HG   . SER B  1 49 ? -18.226 -15.131 -245.914 1.00 0.00 ?  49 SER B HG   1  
ATOM 1962   N N    . LYS B  1 50 ? -19.478 -12.371 -246.763 1.00 0.00 ?  50 LYS B N    1  
ATOM 1963   C CA   . LYS B  1 50 ? -20.212 -12.388 -248.023 1.00 0.00 ?  50 LYS B CA   1  
ATOM 1964   C C    . LYS B  1 50 ? -19.859 -11.182 -248.883 1.00 0.00 ?  50 LYS B C    1  
ATOM 1965   O O    . LYS B  1 50 ? -20.026 -11.206 -250.102 1.00 0.00 ?  50 LYS B O    1  
ATOM 1966   C CB   . LYS B  1 50 ? -21.719 -12.427 -247.764 1.00 0.00 ?  50 LYS B CB   1  
ATOM 1967   C CG   . LYS B  1 50 ? -22.212 -13.710 -247.109 1.00 0.00 ?  50 LYS B CG   1  
ATOM 1968   C CD   . LYS B  1 50 ? -23.710 -13.658 -246.848 1.00 0.00 ?  50 LYS B CD   1  
ATOM 1969   C CE   . LYS B  1 50 ? -24.189 -14.903 -246.115 1.00 0.00 ?  50 LYS B CE   1  
ATOM 1970   N NZ   . LYS B  1 50 ? -23.937 -16.142 -246.899 1.00 0.00 1  50 LYS B NZ   1  
ATOM 1971   H H    . LYS B  1 50 ? -19.947 -12.060 -245.924 1.00 0.00 ?  50 LYS B H    1  
ATOM 1972   H HA   . LYS B  1 50 ? -19.935 -13.272 -248.599 1.00 0.00 ?  50 LYS B HA   1  
ATOM 1973   H HB2  . LYS B  1 50 ? -21.954 -11.578 -247.121 1.00 0.00 ?  50 LYS B HB2  1  
ATOM 1974   H HB3  . LYS B  1 50 ? -22.213 -12.299 -248.727 1.00 0.00 ?  50 LYS B HB3  1  
ATOM 1975   H HG2  . LYS B  1 50 ? -21.987 -14.546 -247.772 1.00 0.00 ?  50 LYS B HG2  1  
ATOM 1976   H HG3  . LYS B  1 50 ? -21.683 -13.843 -246.166 1.00 0.00 ?  50 LYS B HG3  1  
ATOM 1977   H HD2  . LYS B  1 50 ? -23.927 -12.775 -246.246 1.00 0.00 ?  50 LYS B HD2  1  
ATOM 1978   H HD3  . LYS B  1 50 ? -24.227 -13.580 -247.804 1.00 0.00 ?  50 LYS B HD3  1  
ATOM 1979   H HE2  . LYS B  1 50 ? -23.662 -14.963 -245.163 1.00 0.00 ?  50 LYS B HE2  1  
ATOM 1980   H HE3  . LYS B  1 50 ? -25.258 -14.801 -245.932 1.00 0.00 ?  50 LYS B HE3  1  
ATOM 1981   H HZ1  . LYS B  1 50 ? -22.946 -16.237 -247.069 1.00 0.00 ?  50 LYS B HZ1  1  
ATOM 1982   H HZ2  . LYS B  1 50 ? -24.268 -16.943 -246.380 1.00 0.00 ?  50 LYS B HZ2  1  
ATOM 1983   H HZ3  . LYS B  1 50 ? -24.425 -16.088 -247.782 1.00 0.00 ?  50 LYS B HZ3  1  
ATOM 1984   N N    . LEU B  1 51 ? -19.371 -10.126 -248.240 1.00 0.00 ?  51 LEU B N    1  
ATOM 1985   C CA   . LEU B  1 51 ? -18.969 -8.916  -248.949 1.00 0.00 ?  51 LEU B CA   1  
ATOM 1986   C C    . LEU B  1 51 ? -17.647 -9.118  -249.677 1.00 0.00 ?  51 LEU B C    1  
ATOM 1987   O O    . LEU B  1 51 ? -17.453 -8.614  -250.783 1.00 0.00 ?  51 LEU B O    1  
ATOM 1988   C CB   . LEU B  1 51 ? -18.866 -7.739  -247.971 1.00 0.00 ?  51 LEU B CB   1  
ATOM 1989   C CG   . LEU B  1 51 ? -18.620 -6.371  -248.620 1.00 0.00 ?  51 LEU B CG   1  
ATOM 1990   C CD1  . LEU B  1 51 ? -19.807 -5.986  -249.492 1.00 0.00 ?  51 LEU B CD1  1  
ATOM 1991   C CD2  . LEU B  1 51 ? -18.386 -5.329  -247.537 1.00 0.00 ?  51 LEU B CD2  1  
ATOM 1992   H H    . LEU B  1 51 ? -19.276 -10.162 -247.236 1.00 0.00 ?  51 LEU B H    1  
ATOM 1993   H HA   . LEU B  1 51 ? -19.709 -8.678  -249.712 1.00 0.00 ?  51 LEU B HA   1  
ATOM 1994   H HB2  . LEU B  1 51 ? -19.867 -7.775  -247.544 1.00 0.00 ?  51 LEU B HB2  1  
ATOM 1995   H HB3  . LEU B  1 51 ? -18.130 -7.927  -247.189 1.00 0.00 ?  51 LEU B HB3  1  
ATOM 1996   H HG   . LEU B  1 51 ? -17.706 -6.452  -249.209 1.00 0.00 ?  51 LEU B HG   1  
ATOM 1997   H HD11 . LEU B  1 51 ? -19.623 -5.013  -249.949 1.00 0.00 ?  51 LEU B HD11 1  
ATOM 1998   H HD12 . LEU B  1 51 ? -19.942 -6.733  -250.274 1.00 0.00 ?  51 LEU B HD12 1  
ATOM 1999   H HD13 . LEU B  1 51 ? -20.707 -5.934  -248.880 1.00 0.00 ?  51 LEU B HD13 1  
ATOM 2000   H HD21 . LEU B  1 51 ? -17.516 -5.610  -246.943 1.00 0.00 ?  51 LEU B HD21 1  
ATOM 2001   H HD22 . LEU B  1 51 ? -18.210 -4.357  -248.000 1.00 0.00 ?  51 LEU B HD22 1  
ATOM 2002   H HD23 . LEU B  1 51 ? -19.262 -5.271  -246.891 1.00 0.00 ?  51 LEU B HD23 1  
ATOM 2003   N N    . SER B  1 52 ? -16.739 -9.859  -249.050 1.00 0.00 ?  52 SER B N    1  
ATOM 2004   C CA   . SER B  1 52 ? -15.468 -10.204 -249.675 1.00 0.00 ?  52 SER B CA   1  
ATOM 2005   C C    . SER B  1 52 ? -15.676 -11.093 -250.894 1.00 0.00 ?  52 SER B C    1  
ATOM 2006   O O    . SER B  1 52 ? -14.851 -11.114 -251.807 1.00 0.00 ?  52 SER B O    1  
ATOM 2007   C CB   . SER B  1 52 ? -14.561 -10.888 -248.670 1.00 0.00 ?  52 SER B CB   1  
ATOM 2008   O OG   . SER B  1 52 ? -15.037 -12.157 -248.311 1.00 0.00 ?  52 SER B OG   1  
ATOM 2009   H H    . SER B  1 52 ? -16.935 -10.192 -248.117 1.00 0.00 ?  52 SER B H    1  
ATOM 2010   H HA   . SER B  1 52 ? -14.869 -9.334  -249.948 1.00 0.00 ?  52 SER B HA   1  
ATOM 2011   H HB2  . SER B  1 52 ? -13.570 -10.993 -249.111 1.00 0.00 ?  52 SER B HB2  1  
ATOM 2012   H HB3  . SER B  1 52 ? -14.497 -10.268 -247.778 1.00 0.00 ?  52 SER B HB3  1  
ATOM 2013   H HG   . SER B  1 52 ? -14.436 -12.554 -247.676 1.00 0.00 ?  52 SER B HG   1  
ATOM 2014   N N    . GLU B  1 53 ? -16.783 -11.827 -250.902 1.00 0.00 ?  53 GLU B N    1  
ATOM 2015   C CA   . GLU B  1 53 ? -17.210 -12.557 -252.090 1.00 0.00 ?  53 GLU B CA   1  
ATOM 2016   C C    . GLU B  1 53 ? -17.918 -11.637 -253.077 1.00 0.00 ?  53 GLU B C    1  
ATOM 2017   O O    . GLU B  1 53 ? -17.743 -11.760 -254.289 1.00 0.00 ?  53 GLU B O    1  
ATOM 2018   C CB   . GLU B  1 53 ? -18.128 -13.719 -251.704 1.00 0.00 ?  53 GLU B CB   1  
ATOM 2019   C CG   . GLU B  1 53 ? -17.432 -14.847 -250.954 1.00 0.00 ?  53 GLU B CG   1  
ATOM 2020   C CD   . GLU B  1 53 ? -18.411 -15.908 -250.533 1.00 0.00 ?  53 GLU B CD   1  
ATOM 2021   O OE1  . GLU B  1 53 ? -19.591 -15.684 -250.658 1.00 0.00 ?  53 GLU B OE1  1  
ATOM 2022   O OE2  . GLU B  1 53 ? -17.980 -16.984 -250.191 1.00 0.00 -1 53 GLU B OE2  1  
ATOM 2023   H H    . GLU B  1 53 ? -17.344 -11.881 -250.064 1.00 0.00 ?  53 GLU B H    1  
ATOM 2024   H HA   . GLU B  1 53 ? -16.340 -12.958 -252.610 1.00 0.00 ?  53 GLU B HA   1  
ATOM 2025   H HB2  . GLU B  1 53 ? -18.921 -13.306 -251.081 1.00 0.00 ?  53 GLU B HB2  1  
ATOM 2026   H HB3  . GLU B  1 53 ? -18.556 -14.108 -252.628 1.00 0.00 ?  53 GLU B HB3  1  
ATOM 2027   H HG2  . GLU B  1 53 ? -16.621 -15.307 -251.518 1.00 0.00 ?  53 GLU B HG2  1  
ATOM 2028   H HG3  . GLU B  1 53 ? -17.027 -14.356 -250.071 1.00 0.00 ?  53 GLU B HG3  1  
ATOM 2029   N N    . TYR B  1 54 ? -18.717 -10.716 -252.550 1.00 0.00 ?  54 TYR B N    1  
ATOM 2030   C CA   . TYR B  1 54 ? -19.403 -9.732  -253.380 1.00 0.00 ?  54 TYR B CA   1  
ATOM 2031   C C    . TYR B  1 54 ? -18.410 -8.831  -254.102 1.00 0.00 ?  54 TYR B C    1  
ATOM 2032   O O    . TYR B  1 54 ? -18.726 -8.248  -255.139 1.00 0.00 ?  54 TYR B O    1  
ATOM 2033   C CB   . TYR B  1 54 ? -20.357 -8.888  -252.531 1.00 0.00 ?  54 TYR B CB   1  
ATOM 2034   C CG   . TYR B  1 54 ? -21.194 -7.917  -253.333 1.00 0.00 ?  54 TYR B CG   1  
ATOM 2035   C CD1  . TYR B  1 54 ? -22.230 -8.366  -254.139 1.00 0.00 ?  54 TYR B CD1  1  
ATOM 2036   C CD2  . TYR B  1 54 ? -20.947 -6.553  -253.280 1.00 0.00 ?  54 TYR B CD2  1  
ATOM 2037   C CE1  . TYR B  1 54 ? -22.998 -7.483  -254.874 1.00 0.00 ?  54 TYR B CE1  1  
ATOM 2038   C CE2  . TYR B  1 54 ? -21.709 -5.661  -254.010 1.00 0.00 ?  54 TYR B CE2  1  
ATOM 2039   C CZ   . TYR B  1 54 ? -22.734 -6.130  -254.806 1.00 0.00 ?  54 TYR B CZ   1  
ATOM 2040   O OH   . TYR B  1 54 ? -23.496 -5.245  -255.534 1.00 0.00 ?  54 TYR B OH   1  
ATOM 2041   H H    . TYR B  1 54 ? -18.853 -10.696 -251.550 1.00 0.00 ?  54 TYR B H    1  
ATOM 2042   H HA   . TYR B  1 54 ? -19.981 -10.239 -254.153 1.00 0.00 ?  54 TYR B HA   1  
ATOM 2043   H HB2  . TYR B  1 54 ? -21.012 -9.579  -251.998 1.00 0.00 ?  54 TYR B HB2  1  
ATOM 2044   H HB3  . TYR B  1 54 ? -19.748 -8.338  -251.814 1.00 0.00 ?  54 TYR B HB3  1  
ATOM 2045   H HD1  . TYR B  1 54 ? -22.433 -9.436  -254.188 1.00 0.00 ?  54 TYR B HD1  1  
ATOM 2046   H HD2  . TYR B  1 54 ? -20.136 -6.189  -252.650 1.00 0.00 ?  54 TYR B HD2  1  
ATOM 2047   H HE1  . TYR B  1 54 ? -23.808 -7.850  -255.503 1.00 0.00 ?  54 TYR B HE1  1  
ATOM 2048   H HE2  . TYR B  1 54 ? -21.498 -4.593  -253.955 1.00 0.00 ?  54 TYR B HE2  1  
ATOM 2049   H HH   . TYR B  1 54 ? -23.671 -4.426  -255.065 1.00 0.00 ?  54 TYR B HH   1  
ATOM 2050   N N    . ASN B  1 55 ? -17.207 -8.721  -253.547 1.00 0.00 ?  55 ASN B N    1  
ATOM 2051   C CA   . ASN B  1 55 ? -16.117 -8.019  -254.214 1.00 0.00 ?  55 ASN B CA   1  
ATOM 2052   C C    . ASN B  1 55 ? -15.815 -8.636  -255.574 1.00 0.00 ?  55 ASN B C    1  
ATOM 2053   O O    . ASN B  1 55 ? -15.534 -7.927  -256.540 1.00 0.00 ?  55 ASN B O    1  
ATOM 2054   C CB   . ASN B  1 55 ? -14.865 -7.997  -253.358 1.00 0.00 ?  55 ASN B CB   1  
ATOM 2055   C CG   . ASN B  1 55 ? -14.951 -7.063  -252.183 1.00 0.00 ?  55 ASN B CG   1  
ATOM 2056   O OD1  . ASN B  1 55 ? -15.782 -6.148  -252.152 1.00 0.00 ?  55 ASN B OD1  1  
ATOM 2057   N ND2  . ASN B  1 55 ? -14.045 -7.237  -251.255 1.00 0.00 ?  55 ASN B ND2  1  
ATOM 2058   H H    . ASN B  1 55 ? -17.044 -9.135  -252.641 1.00 0.00 ?  55 ASN B H    1  
ATOM 2059   H HA   . ASN B  1 55 ? -16.405 -6.983  -254.402 1.00 0.00 ?  55 ASN B HA   1  
ATOM 2060   H HB2  . ASN B  1 55 ? -14.388 -8.926  -253.042 1.00 0.00 ?  55 ASN B HB2  1  
ATOM 2061   H HB3  . ASN B  1 55 ? -14.263 -7.528  -254.137 1.00 0.00 ?  55 ASN B HB3  1  
ATOM 2062   H HD21 . ASN B  1 55 ? -13.356 -7.954  -251.357 1.00 0.00 ?  55 ASN B HD21 1  
ATOM 2063   H HD22 . ASN B  1 55 ? -14.041 -6.651  -250.444 1.00 0.00 ?  55 ASN B HD22 1  
ATOM 2064   N N    . LEU B  1 56 ? -15.873 -9.962  -255.642 1.00 0.00 ?  56 LEU B N    1  
ATOM 2065   C CA   . LEU B  1 56 ? -15.631 -10.676 -256.890 1.00 0.00 ?  56 LEU B CA   1  
ATOM 2066   C C    . LEU B  1 56 ? -16.888 -10.725 -257.749 1.00 0.00 ?  56 LEU B C    1  
ATOM 2067   O O    . LEU B  1 56 ? -16.812 -10.847 -258.972 1.00 0.00 ?  56 LEU B O    1  
ATOM 2068   C CB   . LEU B  1 56 ? -15.127 -12.095 -256.600 1.00 0.00 ?  56 LEU B CB   1  
ATOM 2069   C CG   . LEU B  1 56 ? -13.777 -12.173 -255.876 1.00 0.00 ?  56 LEU B CG   1  
ATOM 2070   C CD1  . LEU B  1 56 ? -13.399 -13.627 -255.631 1.00 0.00 ?  56 LEU B CD1  1  
ATOM 2071   C CD2  . LEU B  1 56 ? -12.713 -11.472 -256.708 1.00 0.00 ?  56 LEU B CD2  1  
ATOM 2072   H H    . LEU B  1 56 ? -16.091 -10.489 -254.809 1.00 0.00 ?  56 LEU B H    1  
ATOM 2073   H HA   . LEU B  1 56 ? -14.879 -10.146 -257.474 1.00 0.00 ?  56 LEU B HA   1  
ATOM 2074   H HB2  . LEU B  1 56 ? -15.925 -12.435 -255.941 1.00 0.00 ?  56 LEU B HB2  1  
ATOM 2075   H HB3  . LEU B  1 56 ? -15.113 -12.710 -257.499 1.00 0.00 ?  56 LEU B HB3  1  
ATOM 2076   H HG   . LEU B  1 56 ? -13.880 -11.627 -254.938 1.00 0.00 ?  56 LEU B HG   1  
ATOM 2077   H HD11 . LEU B  1 56 ? -12.439 -13.673 -255.116 1.00 0.00 ?  56 LEU B HD11 1  
ATOM 2078   H HD12 . LEU B  1 56 ? -14.162 -14.103 -255.015 1.00 0.00 ?  56 LEU B HD12 1  
ATOM 2079   H HD13 . LEU B  1 56 ? -13.324 -14.149 -256.584 1.00 0.00 ?  56 LEU B HD13 1  
ATOM 2080   H HD21 . LEU B  1 56 ? -12.989 -10.427 -256.847 1.00 0.00 ?  56 LEU B HD21 1  
ATOM 2081   H HD22 . LEU B  1 56 ? -11.754 -11.527 -256.192 1.00 0.00 ?  56 LEU B HD22 1  
ATOM 2082   H HD23 . LEU B  1 56 ? -12.631 -11.959 -257.680 1.00 0.00 ?  56 LEU B HD23 1  
ATOM 2083   N N    . TYR B  1 57 ? -18.045 -10.631 -257.102 1.00 0.00 ?  57 TYR B N    1  
ATOM 2084   C CA   . TYR B  1 57 ? -19.314 -10.527 -257.813 1.00 0.00 ?  57 TYR B CA   1  
ATOM 2085   C C    . TYR B  1 57 ? -19.253 -9.457  -258.895 1.00 0.00 ?  57 TYR B C    1  
ATOM 2086   O O    . TYR B  1 57 ? -19.861 -9.598  -259.956 1.00 0.00 ?  57 TYR B O    1  
ATOM 2087   C CB   . TYR B  1 57 ? -20.451 -10.220 -256.835 1.00 0.00 ?  57 TYR B CB   1  
ATOM 2088   C CG   . TYR B  1 57 ? -21.818 -10.175 -257.480 1.00 0.00 ?  57 TYR B CG   1  
ATOM 2089   C CD1  . TYR B  1 57 ? -22.524 -11.341 -257.739 1.00 0.00 ?  57 TYR B CD1  1  
ATOM 2090   C CD2  . TYR B  1 57 ? -22.401 -8.965  -257.827 1.00 0.00 ?  57 TYR B CD2  1  
ATOM 2091   C CE1  . TYR B  1 57 ? -23.773 -11.305 -258.328 1.00 0.00 ?  57 TYR B CE1  1  
ATOM 2092   C CE2  . TYR B  1 57 ? -23.649 -8.917  -258.417 1.00 0.00 ?  57 TYR B CE2  1  
ATOM 2093   C CZ   . TYR B  1 57 ? -24.333 -10.089 -258.666 1.00 0.00 ?  57 TYR B CZ   1  
ATOM 2094   O OH   . TYR B  1 57 ? -25.577 -10.047 -259.251 1.00 0.00 ?  57 TYR B OH   1  
ATOM 2095   H H    . TYR B  1 57 ? -18.045 -10.631 -256.092 1.00 0.00 ?  57 TYR B H    1  
ATOM 2096   H HA   . TYR B  1 57 ? -19.534 -11.468 -258.318 1.00 0.00 ?  57 TYR B HA   1  
ATOM 2097   H HB2  . TYR B  1 57 ? -20.436 -10.997 -256.069 1.00 0.00 ?  57 TYR B HB2  1  
ATOM 2098   H HB3  . TYR B  1 57 ? -20.232 -9.255  -256.379 1.00 0.00 ?  57 TYR B HB3  1  
ATOM 2099   H HD1  . TYR B  1 57 ? -22.075 -12.297 -257.469 1.00 0.00 ?  57 TYR B HD1  1  
ATOM 2100   H HD2  . TYR B  1 57 ? -21.856 -8.042  -257.629 1.00 0.00 ?  57 TYR B HD2  1  
ATOM 2101   H HE1  . TYR B  1 57 ? -24.315 -12.229 -258.526 1.00 0.00 ?  57 TYR B HE1  1  
ATOM 2102   H HE2  . TYR B  1 57 ? -24.090 -7.955  -258.683 1.00 0.00 ?  57 TYR B HE2  1  
ATOM 2103   H HH   . TYR B  1 57 ? -26.136 -9.353  -258.895 1.00 0.00 ?  57 TYR B HH   1  
ATOM 2104   N N    . ARG B  1 58 ? -18.515 -8.386  -258.621 1.00 0.00 ?  58 ARG B N    1  
ATOM 2105   C CA   . ARG B  1 58 ? -18.348 -7.304  -259.584 1.00 0.00 ?  58 ARG B CA   1  
ATOM 2106   C C    . ARG B  1 58 ? -17.015 -7.417  -260.313 1.00 0.00 ?  58 ARG B C    1  
ATOM 2107   O O    . ARG B  1 58 ? -16.953 -7.295  -261.536 1.00 0.00 ?  58 ARG B O    1  
ATOM 2108   C CB   . ARG B  1 58 ? -18.518 -5.935  -258.944 1.00 0.00 ?  58 ARG B CB   1  
ATOM 2109   C CG   . ARG B  1 58 ? -19.834 -5.731  -258.210 1.00 0.00 ?  58 ARG B CG   1  
ATOM 2110   C CD   . ARG B  1 58 ? -21.020 -5.620  -259.099 1.00 0.00 ?  58 ARG B CD   1  
ATOM 2111   N NE   . ARG B  1 58 ? -22.281 -5.436  -258.400 1.00 0.00 ?  58 ARG B NE   1  
ATOM 2112   C CZ   . ARG B  1 58 ? -23.482 -5.337  -259.003 1.00 0.00 ?  58 ARG B CZ   1  
ATOM 2113   N NH1  . ARG B  1 58 ? -23.587 -5.367  -260.313 1.00 0.00 1  58 ARG B NH1  1  
ATOM 2114   N NH2  . ARG B  1 58 ? -24.552 -5.186  -258.242 1.00 0.00 ?  58 ARG B NH2  1  
ATOM 2115   H H    . ARG B  1 58 ? -18.059 -8.320  -257.723 1.00 0.00 ?  58 ARG B H    1  
ATOM 2116   H HA   . ARG B  1 58 ? -19.125 -7.365  -260.347 1.00 0.00 ?  58 ARG B HA   1  
ATOM 2117   H HB2  . ARG B  1 58 ? -17.693 -5.805  -258.244 1.00 0.00 ?  58 ARG B HB2  1  
ATOM 2118   H HB3  . ARG B  1 58 ? -18.435 -5.198  -259.743 1.00 0.00 ?  58 ARG B HB3  1  
ATOM 2119   H HG2  . ARG B  1 58 ? -19.994 -6.577  -257.542 1.00 0.00 ?  58 ARG B HG2  1  
ATOM 2120   H HG3  . ARG B  1 58 ? -19.766 -4.813  -257.625 1.00 0.00 ?  58 ARG B HG3  1  
ATOM 2121   H HD2  . ARG B  1 58 ? -20.886 -4.766  -259.762 1.00 0.00 ?  58 ARG B HD2  1  
ATOM 2122   H HD3  . ARG B  1 58 ? -21.104 -6.531  -259.691 1.00 0.00 ?  58 ARG B HD3  1  
ATOM 2123   H HE   . ARG B  1 58 ? -22.463 -5.356  -257.408 1.00 0.00 ?  58 ARG B HE   1  
ATOM 2124   H HH11 . ARG B  1 58 ? -22.758 -5.465  -260.881 1.00 0.00 ?  58 ARG B HH11 1  
ATOM 2125   H HH12 . ARG B  1 58 ? -24.496 -5.291  -260.745 1.00 0.00 ?  58 ARG B HH12 1  
ATOM 2126   H HH21 . ARG B  1 58 ? -24.452 -5.148  -257.236 1.00 0.00 ?  58 ARG B HH21 1  
ATOM 2127   H HH22 . ARG B  1 58 ? -25.464 -5.109  -258.667 1.00 0.00 ?  58 ARG B HH22 1  
ATOM 2128   N N    . ASN B  1 59 ? -15.949 -7.651  -259.554 1.00 0.00 ?  59 ASN B N    1  
ATOM 2129   C CA   . ASN B  1 59 ? -14.602 -7.674  -260.111 1.00 0.00 ?  59 ASN B CA   1  
ATOM 2130   C C    . ASN B  1 59 ? -14.432 -8.826  -261.093 1.00 0.00 ?  59 ASN B C    1  
ATOM 2131   O O    . ASN B  1 59 ? -14.165 -8.612  -262.276 1.00 0.00 ?  59 ASN B O    1  
ATOM 2132   C CB   . ASN B  1 59 ? -13.551 -7.756  -259.020 1.00 0.00 ?  59 ASN B CB   1  
ATOM 2133   C CG   . ASN B  1 59 ? -12.152 -7.497  -259.506 1.00 0.00 ?  59 ASN B CG   1  
ATOM 2134   O OD1  . ASN B  1 59 ? -11.869 -7.564  -260.707 1.00 0.00 ?  59 ASN B OD1  1  
ATOM 2135   N ND2  . ASN B  1 59 ? -11.261 -7.283  -258.572 1.00 0.00 ?  59 ASN B ND2  1  
ATOM 2136   H H    . ASN B  1 59 ? -16.076 -7.817  -258.566 1.00 0.00 ?  59 ASN B H    1  
ATOM 2137   H HA   . ASN B  1 59 ? -14.419 -6.758  -260.675 1.00 0.00 ?  59 ASN B HA   1  
ATOM 2138   H HB2  . ASN B  1 59 ? -13.698 -7.249  -258.065 1.00 0.00 ?  59 ASN B HB2  1  
ATOM 2139   H HB3  . ASN B  1 59 ? -13.683 -8.829  -258.885 1.00 0.00 ?  59 ASN B HB3  1  
ATOM 2140   H HD21 . ASN B  1 59 ? -11.531 -7.299  -257.610 1.00 0.00 ?  59 ASN B HD21 1  
ATOM 2141   H HD22 . ASN B  1 59 ? -10.309 -7.104  -258.822 1.00 0.00 ?  59 ASN B HD22 1  
ATOM 2142   N N    . ALA B  1 60 ? -14.588 -10.048 -260.596 1.00 0.00 ?  60 ALA B N    1  
ATOM 2143   C CA   . ALA B  1 60 ? -14.389 -11.239 -261.414 1.00 0.00 ?  60 ALA B CA   1  
ATOM 2144   C C    . ALA B  1 60 ? -15.378 -11.285 -262.571 1.00 0.00 ?  60 ALA B C    1  
ATOM 2145   O O    . ALA B  1 60 ? -15.049 -11.748 -263.663 1.00 0.00 ?  60 ALA B O    1  
ATOM 2146   C CB   . ALA B  1 60 ? -14.507 -12.493 -260.560 1.00 0.00 ?  60 ALA B CB   1  
ATOM 2147   H H    . ALA B  1 60 ? -14.853 -10.155 -259.628 1.00 0.00 ?  60 ALA B H    1  
ATOM 2148   H HA   . ALA B  1 60 ? -13.387 -11.204 -261.844 1.00 0.00 ?  60 ALA B HA   1  
ATOM 2149   H HB1  . ALA B  1 60 ? -15.497 -12.535 -260.111 1.00 0.00 ?  60 ALA B HB1  1  
ATOM 2150   H HB2  . ALA B  1 60 ? -14.355 -13.373 -261.186 1.00 0.00 ?  60 ALA B HB2  1  
ATOM 2151   H HB3  . ALA B  1 60 ? -13.751 -12.472 -259.775 1.00 0.00 ?  60 ALA B HB3  1  
ATOM 2152   N N    . GLN B  1 61 ? -16.591 -10.803 -262.325 1.00 0.00 ?  61 GLN B N    1  
ATOM 2153   C CA   . GLN B  1 61 ? -17.604 -10.706 -263.370 1.00 0.00 ?  61 GLN B CA   1  
ATOM 2154   C C    . GLN B  1 61 ? -17.088 -9.914  -264.564 1.00 0.00 ?  61 GLN B C    1  
ATOM 2155   O O    . GLN B  1 61 ? -17.102 -10.399 -265.696 1.00 0.00 ?  61 GLN B O    1  
ATOM 2156   C CB   . GLN B  1 61 ? -18.875 -10.050 -262.825 1.00 0.00 ?  61 GLN B CB   1  
ATOM 2157   C CG   . GLN B  1 61 ? -19.998 -9.931  -263.841 1.00 0.00 ?  61 GLN B CG   1  
ATOM 2158   C CD   . GLN B  1 61 ? -21.214 -9.219  -263.278 1.00 0.00 ?  61 GLN B CD   1  
ATOM 2159   O OE1  . GLN B  1 61 ? -21.181 -8.689  -262.164 1.00 0.00 ?  61 GLN B OE1  1  
ATOM 2160   N NE2  . GLN B  1 61 ? -22.299 -9.206  -264.045 1.00 0.00 ?  61 GLN B NE2  1  
ATOM 2161   H H    . GLN B  1 61 ? -16.818 -10.495 -261.390 1.00 0.00 ?  61 GLN B H    1  
ATOM 2162   H HA   . GLN B  1 61 ? -17.843 -11.703 -263.739 1.00 0.00 ?  61 GLN B HA   1  
ATOM 2163   H HB2  . GLN B  1 61 ? -19.205 -10.656 -261.980 1.00 0.00 ?  61 GLN B HB2  1  
ATOM 2164   H HB3  . GLN B  1 61 ? -18.592 -9.059  -262.472 1.00 0.00 ?  61 GLN B HB3  1  
ATOM 2165   H HG2  . GLN B  1 61 ? -19.839 -9.570  -264.856 1.00 0.00 ?  61 GLN B HG2  1  
ATOM 2166   H HG3  . GLN B  1 61 ? -20.207 -11.001 -263.866 1.00 0.00 ?  61 GLN B HG3  1  
ATOM 2167   H HE21 . GLN B  1 61 ? -22.283 -9.650  -264.941 1.00 0.00 ?  61 GLN B HE21 1  
ATOM 2168   H HE22 . GLN B  1 61 ? -23.132 -8.752  -263.727 1.00 0.00 ?  61 GLN B HE22 1  
ATOM 2169   N N    . SER B  1 62 ? -16.634 -8.692  -264.307 1.00 0.00 ?  62 SER B N    1  
ATOM 2170   C CA   . SER B  1 62 ? -16.180 -7.804  -265.369 1.00 0.00 ?  62 SER B CA   1  
ATOM 2171   C C    . SER B  1 62 ? -14.881 -8.303  -265.988 1.00 0.00 ?  62 SER B C    1  
ATOM 2172   O O    . SER B  1 62 ? -14.589 -8.026  -267.151 1.00 0.00 ?  62 SER B O    1  
ATOM 2173   C CB   . SER B  1 62 ? -16.003 -6.396  -264.833 1.00 0.00 ?  62 SER B CB   1  
ATOM 2174   O OG   . SER B  1 62 ? -14.904 -6.296  -263.970 1.00 0.00 ?  62 SER B OG   1  
ATOM 2175   H H    . SER B  1 62 ? -16.602 -8.371  -263.349 1.00 0.00 ?  62 SER B H    1  
ATOM 2176   H HA   . SER B  1 62 ? -16.926 -7.646  -266.150 1.00 0.00 ?  62 SER B HA   1  
ATOM 2177   H HB2  . SER B  1 62 ? -15.857 -5.719  -265.674 1.00 0.00 ?  62 SER B HB2  1  
ATOM 2178   H HB3  . SER B  1 62 ? -16.905 -6.113  -264.292 1.00 0.00 ?  62 SER B HB3  1  
ATOM 2179   H HG   . SER B  1 62 ? -14.942 -7.002  -263.321 1.00 0.00 ?  62 SER B HG   1  
ATOM 2180   N N    . ASN B  1 63 ? -14.103 -9.040  -265.202 1.00 0.00 ?  63 ASN B N    1  
ATOM 2181   C CA   . ASN B  1 63 ? -12.833 -9.582  -265.672 1.00 0.00 ?  63 ASN B CA   1  
ATOM 2182   C C    . ASN B  1 63 ? -13.049 -10.625 -266.761 1.00 0.00 ?  63 ASN B C    1  
ATOM 2183   O O    . ASN B  1 63 ? -12.402 -10.587 -267.808 1.00 0.00 ?  63 ASN B O    1  
ATOM 2184   C CB   . ASN B  1 63 ? -12.026 -10.174 -264.531 1.00 0.00 ?  63 ASN B CB   1  
ATOM 2185   C CG   . ASN B  1 63 ? -11.428 -9.143  -263.615 1.00 0.00 ?  63 ASN B CG   1  
ATOM 2186   O OD1  . ASN B  1 63 ? -11.141 -8.011  -264.023 1.00 0.00 ?  63 ASN B OD1  1  
ATOM 2187   N ND2  . ASN B  1 63 ? -11.163 -9.553  -262.401 1.00 0.00 ?  63 ASN B ND2  1  
ATOM 2188   H H    . ASN B  1 63 ? -14.398 -9.230  -264.255 1.00 0.00 ?  63 ASN B H    1  
ATOM 2189   H HA   . ASN B  1 63 ? -12.235 -8.787  -266.120 1.00 0.00 ?  63 ASN B HA   1  
ATOM 2190   H HB2  . ASN B  1 63 ? -12.423 -10.996 -263.935 1.00 0.00 ?  63 ASN B HB2  1  
ATOM 2191   H HB3  . ASN B  1 63 ? -11.246 -10.549 -265.194 1.00 0.00 ?  63 ASN B HB3  1  
ATOM 2192   H HD21 . ASN B  1 63 ? -11.359 -10.497 -262.138 1.00 0.00 ?  63 ASN B HD21 1  
ATOM 2193   H HD22 . ASN B  1 63 ? -10.764 -8.920  -261.736 1.00 0.00 ?  63 ASN B HD22 1  
ATOM 2194   N N    . THR B  1 64 ? -13.962 -11.557 -266.508 1.00 0.00 ?  64 THR B N    1  
ATOM 2195   C CA   . THR B  1 64 ? -14.238 -12.635 -267.451 1.00 0.00 ?  64 THR B CA   1  
ATOM 2196   C C    . THR B  1 64 ? -14.850 -12.098 -268.738 1.00 0.00 ?  64 THR B C    1  
ATOM 2197   O O    . THR B  1 64 ? -14.543 -12.578 -269.829 1.00 0.00 ?  64 THR B O    1  
ATOM 2198   C CB   . THR B  1 64 ? -15.184 -13.687 -266.844 1.00 0.00 ?  64 THR B CB   1  
ATOM 2199   O OG1  . THR B  1 64 ? -16.405 -13.056 -266.435 1.00 0.00 ?  64 THR B OG1  1  
ATOM 2200   C CG2  . THR B  1 64 ? -14.537 -14.358 -265.642 1.00 0.00 ?  64 THR B CG2  1  
ATOM 2201   H H    . THR B  1 64 ? -14.478 -11.517 -265.641 1.00 0.00 ?  64 THR B H    1  
ATOM 2202   H HA   . THR B  1 64 ? -13.306 -13.125 -267.733 1.00 0.00 ?  64 THR B HA   1  
ATOM 2203   H HB   . THR B  1 64 ? -15.410 -14.438 -267.601 1.00 0.00 ?  64 THR B HB   1  
ATOM 2204   H HG1  . THR B  1 64 ? -16.993 -13.714 -266.057 1.00 0.00 ?  64 THR B HG1  1  
ATOM 2205   H HG21 . THR B  1 64 ? -15.221 -15.098 -265.228 1.00 0.00 ?  64 THR B HG21 1  
ATOM 2206   H HG22 . THR B  1 64 ? -13.614 -14.848 -265.953 1.00 0.00 ?  64 THR B HG22 1  
ATOM 2207   H HG23 . THR B  1 64 ? -14.312 -13.607 -264.886 1.00 0.00 ?  64 THR B HG23 1  
ATOM 2208   N N    . VAL B  1 65 ? -15.716 -11.100 -268.604 1.00 0.00 ?  65 VAL B N    1  
ATOM 2209   C CA   . VAL B  1 65 ? -16.324 -10.453 -269.761 1.00 0.00 ?  65 VAL B CA   1  
ATOM 2210   C C    . VAL B  1 65 ? -15.276 -9.745  -270.610 1.00 0.00 ?  65 VAL B C    1  
ATOM 2211   O O    . VAL B  1 65 ? -15.304 -9.820  -271.838 1.00 0.00 ?  65 VAL B O    1  
ATOM 2212   C CB   . VAL B  1 65 ? -17.401 -9.436  -269.338 1.00 0.00 ?  65 VAL B CB   1  
ATOM 2213   C CG1  . VAL B  1 65 ? -17.863 -8.620  -270.536 1.00 0.00 ?  65 VAL B CG1  1  
ATOM 2214   C CG2  . VAL B  1 65 ? -18.581 -10.146 -268.692 1.00 0.00 ?  65 VAL B CG2  1  
ATOM 2215   H H    . VAL B  1 65 ? -15.959 -10.781 -267.677 1.00 0.00 ?  65 VAL B H    1  
ATOM 2216   H HA   . VAL B  1 65 ? -16.779 -11.183 -270.430 1.00 0.00 ?  65 VAL B HA   1  
ATOM 2217   H HB   . VAL B  1 65 ? -16.982 -8.769  -268.584 1.00 0.00 ?  65 VAL B HB   1  
ATOM 2218   H HG11 . VAL B  1 65 ? -18.623 -7.906  -270.220 1.00 0.00 ?  65 VAL B HG11 1  
ATOM 2219   H HG12 . VAL B  1 65 ? -17.014 -8.082  -270.959 1.00 0.00 ?  65 VAL B HG12 1  
ATOM 2220   H HG13 . VAL B  1 65 ? -18.283 -9.286  -271.290 1.00 0.00 ?  65 VAL B HG13 1  
ATOM 2221   H HG21 . VAL B  1 65 ? -18.241 -10.689 -267.810 1.00 0.00 ?  65 VAL B HG21 1  
ATOM 2222   H HG22 . VAL B  1 65 ? -19.331 -9.413  -268.399 1.00 0.00 ?  65 VAL B HG22 1  
ATOM 2223   H HG23 . VAL B  1 65 ? -19.016 -10.847 -269.405 1.00 0.00 ?  65 VAL B HG23 1  
ATOM 2224   N N    . LYS B  1 66 ? -14.352 -9.056  -269.948 1.00 0.00 ?  66 LYS B N    1  
ATOM 2225   C CA   . LYS B  1 66 ? -13.244 -8.404  -270.636 1.00 0.00 ?  66 LYS B CA   1  
ATOM 2226   C C    . LYS B  1 66 ? -12.464 -9.396  -271.489 1.00 0.00 ?  66 LYS B C    1  
ATOM 2227   O O    . LYS B  1 66 ? -12.175 -9.133  -272.656 1.00 0.00 ?  66 LYS B O    1  
ATOM 2228   C CB   . LYS B  1 66 ? -12.311 -7.730  -269.628 1.00 0.00 ?  66 LYS B CB   1  
ATOM 2229   C CG   . LYS B  1 66 ? -11.092 -7.061  -270.250 1.00 0.00 ?  66 LYS B CG   1  
ATOM 2230   C CD   . LYS B  1 66 ? -10.183 -6.468  -269.184 1.00 0.00 ?  66 LYS B CD   1  
ATOM 2231   C CE   . LYS B  1 66 ? -8.917  -5.886  -269.796 1.00 0.00 ?  66 LYS B CE   1  
ATOM 2232   N NZ   . LYS B  1 66 ? -8.018  -6.946  -270.328 1.00 0.00 1  66 LYS B NZ   1  
ATOM 2233   H H    . LYS B  1 66 ? -14.419 -8.983  -268.943 1.00 0.00 ?  66 LYS B H    1  
ATOM 2234   H HA   . LYS B  1 66 ? -13.628 -7.644  -271.317 1.00 0.00 ?  66 LYS B HA   1  
ATOM 2235   H HB2  . LYS B  1 66 ? -12.902 -6.984  -269.096 1.00 0.00 ?  66 LYS B HB2  1  
ATOM 2236   H HB3  . LYS B  1 66 ? -11.985 -8.500  -268.929 1.00 0.00 ?  66 LYS B HB3  1  
ATOM 2237   H HG2  . LYS B  1 66 ? -10.542 -7.808  -270.823 1.00 0.00 ?  66 LYS B HG2  1  
ATOM 2238   H HG3  . LYS B  1 66 ? -11.433 -6.271  -270.918 1.00 0.00 ?  66 LYS B HG3  1  
ATOM 2239   H HD2  . LYS B  1 66 ? -10.729 -5.682  -268.660 1.00 0.00 ?  66 LYS B HD2  1  
ATOM 2240   H HD3  . LYS B  1 66 ? -9.916  -7.254  -268.478 1.00 0.00 ?  66 LYS B HD3  1  
ATOM 2241   H HE2  . LYS B  1 66 ? -9.206  -5.215  -270.605 1.00 0.00 ?  66 LYS B HE2  1  
ATOM 2242   H HE3  . LYS B  1 66 ? -8.394  -5.320  -269.025 1.00 0.00 ?  66 LYS B HE3  1  
ATOM 2243   H HZ1  . LYS B  1 66 ? -8.502  -7.470  -271.043 1.00 0.00 ?  66 LYS B HZ1  1  
ATOM 2244   H HZ2  . LYS B  1 66 ? -7.193  -6.519  -270.724 1.00 0.00 ?  66 LYS B HZ2  1  
ATOM 2245   H HZ3  . LYS B  1 66 ? -7.750  -7.568  -269.578 1.00 0.00 ?  66 LYS B HZ3  1  
ATOM 2246   N N    . VAL B  1 67 ? -12.126 -10.538 -270.899 1.00 0.00 ?  67 VAL B N    1  
ATOM 2247   C CA   . VAL B  1 67 ? -11.312 -11.539 -271.578 1.00 0.00 ?  67 VAL B CA   1  
ATOM 2248   C C    . VAL B  1 67 ? -12.028 -12.094 -272.802 1.00 0.00 ?  67 VAL B C    1  
ATOM 2249   O O    . VAL B  1 67 ? -11.425 -12.262 -273.862 1.00 0.00 ?  67 VAL B O    1  
ATOM 2250   C CB   . VAL B  1 67 ? -10.946 -12.703 -270.637 1.00 0.00 ?  67 VAL B CB   1  
ATOM 2251   C CG1  . VAL B  1 67 ? -10.312 -13.842 -271.421 1.00 0.00 ?  67 VAL B CG1  1  
ATOM 2252   C CG2  . VAL B  1 67 ? -10.008 -12.226 -269.539 1.00 0.00 ?  67 VAL B CG2  1  
ATOM 2253   H H    . VAL B  1 67 ? -12.442 -10.717 -269.957 1.00 0.00 ?  67 VAL B H    1  
ATOM 2254   H HA   . VAL B  1 67 ? -10.390 -11.103 -271.966 1.00 0.00 ?  67 VAL B HA   1  
ATOM 2255   H HB   . VAL B  1 67 ? -11.852 -13.059 -270.147 1.00 0.00 ?  67 VAL B HB   1  
ATOM 2256   H HG11 . VAL B  1 67 ? -10.060 -14.656 -270.740 1.00 0.00 ?  67 VAL B HG11 1  
ATOM 2257   H HG12 . VAL B  1 67 ? -11.014 -14.202 -272.172 1.00 0.00 ?  67 VAL B HG12 1  
ATOM 2258   H HG13 . VAL B  1 67 ? -9.406  -13.486 -271.910 1.00 0.00 ?  67 VAL B HG13 1  
ATOM 2259   H HG21 . VAL B  1 67 ? -10.495 -11.442 -268.959 1.00 0.00 ?  67 VAL B HG21 1  
ATOM 2260   H HG22 . VAL B  1 67 ? -9.761  -13.060 -268.883 1.00 0.00 ?  67 VAL B HG22 1  
ATOM 2261   H HG23 . VAL B  1 67 ? -9.095  -11.833 -269.987 1.00 0.00 ?  67 VAL B HG23 1  
ATOM 2262   N N    . PHE B  1 68 ? -13.317 -12.378 -272.649 1.00 0.00 ?  68 PHE B N    1  
ATOM 2263   C CA   . PHE B  1 68 ? -14.130 -12.866 -273.757 1.00 0.00 ?  68 PHE B CA   1  
ATOM 2264   C C    . PHE B  1 68 ? -14.301 -11.796 -274.828 1.00 0.00 ?  68 PHE B C    1  
ATOM 2265   O O    . PHE B  1 68 ? -14.512 -12.107 -276.000 1.00 0.00 ?  68 PHE B O    1  
ATOM 2266   C CB   . PHE B  1 68 ? -15.498 -13.328 -273.252 1.00 0.00 ?  68 PHE B CB   1  
ATOM 2267   C CG   . PHE B  1 68 ? -15.495 -14.714 -272.673 1.00 0.00 ?  68 PHE B CG   1  
ATOM 2268   C CD1  . PHE B  1 68 ? -15.245 -15.816 -273.476 1.00 0.00 ?  68 PHE B CD1  1  
ATOM 2269   C CD2  . PHE B  1 68 ? -15.740 -14.918 -271.323 1.00 0.00 ?  68 PHE B CD2  1  
ATOM 2270   C CE1  . PHE B  1 68 ? -15.242 -17.092 -272.946 1.00 0.00 ?  68 PHE B CE1  1  
ATOM 2271   C CE2  . PHE B  1 68 ? -15.737 -16.193 -270.790 1.00 0.00 ?  68 PHE B CE2  1  
ATOM 2272   C CZ   . PHE B  1 68 ? -15.488 -17.280 -271.601 1.00 0.00 ?  68 PHE B CZ   1  
ATOM 2273   H H    . PHE B  1 68 ? -13.744 -12.252 -271.743 1.00 0.00 ?  68 PHE B H    1  
ATOM 2274   H HA   . PHE B  1 68 ? -13.633 -13.710 -274.237 1.00 0.00 ?  68 PHE B HA   1  
ATOM 2275   H HB2  . PHE B  1 68 ? -15.852 -12.663 -272.465 1.00 0.00 ?  68 PHE B HB2  1  
ATOM 2276   H HB3  . PHE B  1 68 ? -16.217 -13.334 -274.070 1.00 0.00 ?  68 PHE B HB3  1  
ATOM 2277   H HD1  . PHE B  1 68 ? -15.050 -15.667 -274.539 1.00 0.00 ?  68 PHE B HD1  1  
ATOM 2278   H HD2  . PHE B  1 68 ? -15.938 -14.059 -270.682 1.00 0.00 ?  68 PHE B HD2  1  
ATOM 2279   H HE1  . PHE B  1 68 ? -15.045 -17.950 -273.589 1.00 0.00 ?  68 PHE B HE1  1  
ATOM 2280   H HE2  . PHE B  1 68 ? -15.931 -16.340 -269.728 1.00 0.00 ?  68 PHE B HE2  1  
ATOM 2281   H HZ   . PHE B  1 68 ? -15.484 -18.285 -271.182 1.00 0.00 ?  68 PHE B HZ   1  
ATOM 2282   N N    . LYS B  1 69 ? -14.208 -10.536 -274.418 1.00 0.00 ?  69 LYS B N    1  
ATOM 2283   C CA   . LYS B  1 69 ? -14.196 -9.423  -275.361 1.00 0.00 ?  69 LYS B CA   1  
ATOM 2284   C C    . LYS B  1 69 ? -12.816 -9.240  -275.979 1.00 0.00 ?  69 LYS B C    1  
ATOM 2285   O O    . LYS B  1 69 ? -12.690 -8.777  -277.113 1.00 0.00 ?  69 LYS B O    1  
ATOM 2286   C CB   . LYS B  1 69 ? -14.639 -8.132  -274.670 1.00 0.00 ?  69 LYS B CB   1  
ATOM 2287   C CG   . LYS B  1 69 ? -14.955 -6.986  -275.622 1.00 0.00 ?  69 LYS B CG   1  
ATOM 2288   C CD   . LYS B  1 69 ? -13.724 -6.133  -275.889 1.00 0.00 ?  69 LYS B CD   1  
ATOM 2289   C CE   . LYS B  1 69 ? -14.041 -4.981  -276.831 1.00 0.00 ?  69 LYS B CE   1  
ATOM 2290   N NZ   . LYS B  1 69 ? -12.811 -4.281  -277.289 1.00 0.00 1  69 LYS B NZ   1  
ATOM 2291   H H    . LYS B  1 69 ? -14.144 -10.343 -273.429 1.00 0.00 ?  69 LYS B H    1  
ATOM 2292   H HA   . LYS B  1 69 ? -14.881 -9.630  -276.184 1.00 0.00 ?  69 LYS B HA   1  
ATOM 2293   H HB2  . LYS B  1 69 ? -15.526 -8.372  -274.084 1.00 0.00 ?  69 LYS B HB2  1  
ATOM 2294   H HB3  . LYS B  1 69 ? -13.832 -7.834  -274.000 1.00 0.00 ?  69 LYS B HB3  1  
ATOM 2295   H HG2  . LYS B  1 69 ? -15.317 -7.406  -276.561 1.00 0.00 ?  69 LYS B HG2  1  
ATOM 2296   H HG3  . LYS B  1 69 ? -15.735 -6.370  -275.176 1.00 0.00 ?  69 LYS B HG3  1  
ATOM 2297   H HD2  . LYS B  1 69 ? -13.363 -5.737  -274.939 1.00 0.00 ?  69 LYS B HD2  1  
ATOM 2298   H HD3  . LYS B  1 69 ? -12.954 -6.763  -276.334 1.00 0.00 ?  69 LYS B HD3  1  
ATOM 2299   H HE2  . LYS B  1 69 ? -14.573 -5.381  -277.693 1.00 0.00 ?  69 LYS B HE2  1  
ATOM 2300   H HE3  . LYS B  1 69 ? -14.684 -4.276  -276.304 1.00 0.00 ?  69 LYS B HE3  1  
ATOM 2301   H HZ1  . LYS B  1 69 ? -12.215 -4.933  -277.778 1.00 0.00 ?  69 LYS B HZ1  1  
ATOM 2302   H HZ2  . LYS B  1 69 ? -13.064 -3.525  -277.910 1.00 0.00 ?  69 LYS B HZ2  1  
ATOM 2303   H HZ3  . LYS B  1 69 ? -12.317 -3.909  -276.489 1.00 0.00 ?  69 LYS B HZ3  1  
ATOM 2304   N N    . ASP B  1 70 ? -11.783 -9.605  -275.228 1.00 0.00 ?  70 ASP B N    1  
ATOM 2305   C CA   . ASP B  1 70 ? -10.409 -9.458  -275.691 1.00 0.00 ?  70 ASP B CA   1  
ATOM 2306   C C    . ASP B  1 70 ? -10.100 -10.436 -276.818 1.00 0.00 ?  70 ASP B C    1  
ATOM 2307   O O    . ASP B  1 70 ? -9.383  -10.104 -277.762 1.00 0.00 ?  70 ASP B O    1  
ATOM 2308   C CB   . ASP B  1 70 ? -9.428  -9.663  -274.535 1.00 0.00 ?  70 ASP B CB   1  
ATOM 2309   C CG   . ASP B  1 70 ? -9.346  -8.492  -273.565 1.00 0.00 ?  70 ASP B CG   1  
ATOM 2310   O OD1  . ASP B  1 70 ? -9.850  -7.442  -273.887 1.00 0.00 ?  70 ASP B OD1  1  
ATOM 2311   O OD2  . ASP B  1 70 ? -8.923  -8.696  -272.452 1.00 0.00 -1 70 ASP B OD2  1  
ATOM 2312   H H    . ASP B  1 70 ? -11.955 -9.994  -274.311 1.00 0.00 ?  70 ASP B H    1  
ATOM 2313   H HA   . ASP B  1 70 ? -10.262 -8.458  -276.100 1.00 0.00 ?  70 ASP B HA   1  
ATOM 2314   H HB2  . ASP B  1 70 ? -9.599  -10.584 -273.977 1.00 0.00 ?  70 ASP B HB2  1  
ATOM 2315   H HB3  . ASP B  1 70 ? -8.492  -9.741  -275.089 1.00 0.00 ?  70 ASP B HB3  1  
ATOM 2316   N N    . ILE B  1 71 ? -10.646 -11.643 -276.713 1.00 0.00 ?  71 ILE B N    1  
ATOM 2317   C CA   . ILE B  1 71 ? -10.502 -12.643 -277.764 1.00 0.00 ?  71 ILE B CA   1  
ATOM 2318   C C    . ILE B  1 71 ? -11.372 -12.306 -278.968 1.00 0.00 ?  71 ILE B C    1  
ATOM 2319   O O    . ILE B  1 71 ? -11.111 -12.762 -280.082 1.00 0.00 ?  71 ILE B O    1  
ATOM 2320   C CB   . ILE B  1 71 ? -10.865 -14.051 -277.258 1.00 0.00 ?  71 ILE B CB   1  
ATOM 2321   C CG1  . ILE B  1 71 ? -12.322 -14.091 -276.791 1.00 0.00 ?  71 ILE B CG1  1  
ATOM 2322   C CG2  . ILE B  1 71 ? -9.930  -14.469 -276.134 1.00 0.00 ?  71 ILE B CG2  1  
ATOM 2323   C CD1  . ILE B  1 71 ? -12.781 -15.459 -276.340 1.00 0.00 ?  71 ILE B CD1  1  
ATOM 2324   H H    . ILE B  1 71 ? -11.175 -11.873 -275.884 1.00 0.00 ?  71 ILE B H    1  
ATOM 2325   H HA   . ILE B  1 71 ? -9.484  -12.648 -278.152 1.00 0.00 ?  71 ILE B HA   1  
ATOM 2326   H HB   . ILE B  1 71 ? -10.780 -14.758 -278.083 1.00 0.00 ?  71 ILE B HB   1  
ATOM 2327   H HG12 . ILE B  1 71 ? -12.418 -13.385 -275.966 1.00 0.00 ?  71 ILE B HG12 1  
ATOM 2328   H HG13 . ILE B  1 71 ? -12.939 -13.758 -277.625 1.00 0.00 ?  71 ILE B HG13 1  
ATOM 2329   H HG21 . ILE B  1 71 ? -10.201 -15.466 -275.787 1.00 0.00 ?  71 ILE B HG21 1  
ATOM 2330   H HG22 . ILE B  1 71 ? -8.904  -14.479 -276.498 1.00 0.00 ?  71 ILE B HG22 1  
ATOM 2331   H HG23 . ILE B  1 71 ? -10.015 -13.763 -275.307 1.00 0.00 ?  71 ILE B HG23 1  
ATOM 2332   H HD11 . ILE B  1 71 ? -12.167 -15.793 -275.505 1.00 0.00 ?  71 ILE B HD11 1  
ATOM 2333   H HD12 . ILE B  1 71 ? -13.824 -15.408 -276.024 1.00 0.00 ?  71 ILE B HD12 1  
ATOM 2334   H HD13 . ILE B  1 71 ? -12.688 -16.166 -277.165 1.00 0.00 ?  71 ILE B HD13 1  
ATOM 2335   N N    . ASP B  1 72 ? -12.407 -11.506 -278.739 1.00 0.00 ?  72 ASP B N    1  
ATOM 2336   C CA   . ASP B  1 72 ? -13.181 -10.922 -279.828 1.00 0.00 ?  72 ASP B CA   1  
ATOM 2337   C C    . ASP B  1 72 ? -12.351 -9.917  -280.617 1.00 0.00 ?  72 ASP B C    1  
ATOM 2338   O O    . ASP B  1 72 ? -12.331 -9.943  -281.847 1.00 0.00 ?  72 ASP B O    1  
ATOM 2339   C CB   . ASP B  1 72 ? -14.446 -10.250 -279.288 1.00 0.00 ?  72 ASP B CB   1  
ATOM 2340   C CG   . ASP B  1 72 ? -15.508 -11.220 -278.789 1.00 0.00 ?  72 ASP B CG   1  
ATOM 2341   O OD1  . ASP B  1 72 ? -15.424 -12.381 -279.112 1.00 0.00 ?  72 ASP B OD1  1  
ATOM 2342   O OD2  . ASP B  1 72 ? -16.301 -10.829 -277.965 1.00 0.00 -1 72 ASP B OD2  1  
ATOM 2343   H H    . ASP B  1 72 ? -12.665 -11.296 -277.785 1.00 0.00 ?  72 ASP B H    1  
ATOM 2344   H HA   . ASP B  1 72 ? -13.474 -11.702 -280.532 1.00 0.00 ?  72 ASP B HA   1  
ATOM 2345   H HB2  . ASP B  1 72 ? -14.247 -9.503  -278.520 1.00 0.00 ?  72 ASP B HB2  1  
ATOM 2346   H HB3  . ASP B  1 72 ? -14.801 -9.757  -280.193 1.00 0.00 ?  72 ASP B HB3  1  
ATOM 2347   N N    . ALA B  1 73 ? -11.666 -9.031  -279.901 1.00 0.00 ?  73 ALA B N    1  
ATOM 2348   C CA   . ALA B  1 73 ? -10.768 -8.069  -280.527 1.00 0.00 ?  73 ALA B CA   1  
ATOM 2349   C C    . ALA B  1 73 ? -9.638  -8.773  -281.268 1.00 0.00 ?  73 ALA B C    1  
ATOM 2350   O O    . ALA B  1 73 ? -9.235  -8.349  -282.352 1.00 0.00 ?  73 ALA B O    1  
ATOM 2351   C CB   . ALA B  1 73 ? -10.207 -7.111  -279.486 1.00 0.00 ?  73 ALA B CB   1  
ATOM 2352   H H    . ALA B  1 73 ? -11.771 -9.024  -278.896 1.00 0.00 ?  73 ALA B H    1  
ATOM 2353   H HA   . ALA B  1 73 ? -11.330 -7.494  -281.263 1.00 0.00 ?  73 ALA B HA   1  
ATOM 2354   H HB1  . ALA B  1 73 ? -9.655  -7.673  -278.735 1.00 0.00 ?  73 ALA B HB1  1  
ATOM 2355   H HB2  . ALA B  1 73 ? -9.539  -6.400  -279.971 1.00 0.00 ?  73 ALA B HB2  1  
ATOM 2356   H HB3  . ALA B  1 73 ? -11.026 -6.572  -279.009 1.00 0.00 ?  73 ALA B HB3  1  
ATOM 2357   N N    . ALA B  1 74 ? -9.130  -9.850  -280.678 1.00 0.00 ?  74 ALA B N    1  
ATOM 2358   C CA   . ALA B  1 74 ? -8.046  -10.615 -281.282 1.00 0.00 ?  74 ALA B CA   1  
ATOM 2359   C C    . ALA B  1 74 ? -8.445  -11.147 -282.653 1.00 0.00 ?  74 ALA B C    1  
ATOM 2360   O O    . ALA B  1 74 ? -7.647  -11.134 -283.590 1.00 0.00 ?  74 ALA B O    1  
ATOM 2361   C CB   . ALA B  1 74 ? -7.631  -11.758 -280.367 1.00 0.00 ?  74 ALA B CB   1  
ATOM 2362   H H    . ALA B  1 74 ? -9.505  -10.145 -279.788 1.00 0.00 ?  74 ALA B H    1  
ATOM 2363   H HA   . ALA B  1 74 ? -7.190  -9.955  -281.426 1.00 0.00 ?  74 ALA B HA   1  
ATOM 2364   H HB1  . ALA B  1 74 ? -8.480  -12.418 -280.201 1.00 0.00 ?  74 ALA B HB1  1  
ATOM 2365   H HB2  . ALA B  1 74 ? -6.820  -12.319 -280.833 1.00 0.00 ?  74 ALA B HB2  1  
ATOM 2366   H HB3  . ALA B  1 74 ? -7.291  -11.355 -279.413 1.00 0.00 ?  74 ALA B HB3  1  
ATOM 2367   N N    . ILE B  1 75 ? -9.683  -11.615 -282.763 1.00 0.00 ?  75 ILE B N    1  
ATOM 2368   C CA   . ILE B  1 75 ? -10.177 -12.191 -284.008 1.00 0.00 ?  75 ILE B CA   1  
ATOM 2369   C C    . ILE B  1 75 ? -10.365 -11.119 -285.074 1.00 0.00 ?  75 ILE B C    1  
ATOM 2370   O O    . ILE B  1 75 ? -9.915  -11.274 -286.210 1.00 0.00 ?  75 ILE B O    1  
ATOM 2371   C CB   . ILE B  1 75 ? -11.509 -12.933 -283.799 1.00 0.00 ?  75 ILE B CB   1  
ATOM 2372   C CG1  . ILE B  1 75 ? -11.300 -14.168 -282.918 1.00 0.00 ?  75 ILE B CG1  1  
ATOM 2373   C CG2  . ILE B  1 75 ? -12.115 -13.327 -285.137 1.00 0.00 ?  75 ILE B CG2  1  
ATOM 2374   C CD1  . ILE B  1 75 ? -12.585 -14.779 -282.408 1.00 0.00 ?  75 ILE B CD1  1  
ATOM 2375   H H    . ILE B  1 75 ? -10.299 -11.570 -281.964 1.00 0.00 ?  75 ILE B H    1  
ATOM 2376   H HA   . ILE B  1 75 ? -9.443  -12.876 -284.432 1.00 0.00 ?  75 ILE B HA   1  
ATOM 2377   H HB   . ILE B  1 75 ? -12.199 -12.280 -283.265 1.00 0.00 ?  75 ILE B HB   1  
ATOM 2378   H HG12 . ILE B  1 75 ? -10.759 -14.903 -283.513 1.00 0.00 ?  75 ILE B HG12 1  
ATOM 2379   H HG13 . ILE B  1 75 ? -10.683 -13.861 -282.072 1.00 0.00 ?  75 ILE B HG13 1  
ATOM 2380   H HG21 . ILE B  1 75 ? -13.056 -13.851 -284.971 1.00 0.00 ?  75 ILE B HG21 1  
ATOM 2381   H HG22 . ILE B  1 75 ? -12.299 -12.432 -285.731 1.00 0.00 ?  75 ILE B HG22 1  
ATOM 2382   H HG23 . ILE B  1 75 ? -11.425 -13.981 -285.671 1.00 0.00 ?  75 ILE B HG23 1  
ATOM 2383   H HD11 . ILE B  1 75 ? -13.202 -15.087 -283.251 1.00 0.00 ?  75 ILE B HD11 1  
ATOM 2384   H HD12 . ILE B  1 75 ? -12.356 -15.648 -281.791 1.00 0.00 ?  75 ILE B HD12 1  
ATOM 2385   H HD13 . ILE B  1 75 ? -13.127 -14.044 -281.811 1.00 0.00 ?  75 ILE B HD13 1  
ATOM 2386   N N    . ILE B  1 76 ? -11.033 -10.033 -284.702 1.00 0.00 ?  76 ILE B N    1  
ATOM 2387   C CA   . ILE B  1 76 ? -11.356 -8.971  -285.648 1.00 0.00 ?  76 ILE B CA   1  
ATOM 2388   C C    . ILE B  1 76 ? -10.128 -8.132  -285.975 1.00 0.00 ?  76 ILE B C    1  
ATOM 2389   O O    . ILE B  1 76 ? -10.128 -7.362  -286.936 1.00 0.00 ?  76 ILE B O    1  
ATOM 2390   C CB   . ILE B  1 76 ? -12.466 -8.051  -285.106 1.00 0.00 ?  76 ILE B CB   1  
ATOM 2391   C CG1  . ILE B  1 76 ? -11.980 -7.305  -283.861 1.00 0.00 ?  76 ILE B CG1  1  
ATOM 2392   C CG2  . ILE B  1 76 ? -13.719 -8.855  -284.794 1.00 0.00 ?  76 ILE B CG2  1  
ATOM 2393   C CD1  . ILE B  1 76 ? -12.948 -6.256  -283.361 1.00 0.00 ?  76 ILE B CD1  1  
ATOM 2394   H H    . ILE B  1 76 ? -11.324 -9.940  -283.740 1.00 0.00 ?  76 ILE B H    1  
ATOM 2395   H HA   . ILE B  1 76 ? -11.668 -9.390  -286.604 1.00 0.00 ?  76 ILE B HA   1  
ATOM 2396   H HB   . ILE B  1 76 ? -12.697 -7.294  -285.855 1.00 0.00 ?  76 ILE B HB   1  
ATOM 2397   H HG12 . ILE B  1 76 ? -11.815 -8.048  -283.082 1.00 0.00 ?  76 ILE B HG12 1  
ATOM 2398   H HG13 . ILE B  1 76 ? -11.032 -6.831  -284.116 1.00 0.00 ?  76 ILE B HG13 1  
ATOM 2399   H HG21 . ILE B  1 76 ? -14.492 -8.189  -284.412 1.00 0.00 ?  76 ILE B HG21 1  
ATOM 2400   H HG22 . ILE B  1 76 ? -14.074 -9.341  -285.702 1.00 0.00 ?  76 ILE B HG22 1  
ATOM 2401   H HG23 . ILE B  1 76 ? -13.488 -9.611  -284.044 1.00 0.00 ?  76 ILE B HG23 1  
ATOM 2402   H HD11 . ILE B  1 76 ? -13.895 -6.728  -283.104 1.00 0.00 ?  76 ILE B HD11 1  
ATOM 2403   H HD12 . ILE B  1 76 ? -12.534 -5.771  -282.477 1.00 0.00 ?  76 ILE B HD12 1  
ATOM 2404   H HD13 . ILE B  1 76 ? -13.113 -5.511  -284.140 1.00 0.00 ?  76 ILE B HD13 1  
ATOM 2405   N N    . GLN B  1 77 ? -9.082  -8.285  -285.171 1.00 0.00 ?  77 GLN B N    1  
ATOM 2406   C CA   . GLN B  1 77 ? -7.773  -7.735  -285.503 1.00 0.00 ?  77 GLN B CA   1  
ATOM 2407   C C    . GLN B  1 77 ? -7.221  -8.360  -286.779 1.00 0.00 ?  77 GLN B C    1  
ATOM 2408   O O    . GLN B  1 77 ? -6.457  -7.730  -287.510 1.00 0.00 ?  77 GLN B O    1  
ATOM 2409   C CB   . GLN B  1 77 ? -6.789  -7.959  -284.351 1.00 0.00 ?  77 GLN B CB   1  
ATOM 2410   C CG   . GLN B  1 77 ? -5.440  -7.288  -284.546 1.00 0.00 ?  77 GLN B CG   1  
ATOM 2411   C CD   . GLN B  1 77 ? -5.551  -5.778  -284.628 1.00 0.00 ?  77 GLN B CD   1  
ATOM 2412   O OE1  . GLN B  1 77 ? -6.254  -5.149  -283.832 1.00 0.00 ?  77 GLN B OE1  1  
ATOM 2413   N NE2  . GLN B  1 77 ? -4.859  -5.186  -285.595 1.00 0.00 ?  77 GLN B NE2  1  
ATOM 2414   H H    . GLN B  1 77 ? -9.196  -8.795  -284.307 1.00 0.00 ?  77 GLN B H    1  
ATOM 2415   H HA   . GLN B  1 77 ? -7.864  -6.667  -285.696 1.00 0.00 ?  77 GLN B HA   1  
ATOM 2416   H HB2  . GLN B  1 77 ? -7.267  -7.573  -283.451 1.00 0.00 ?  77 GLN B HB2  1  
ATOM 2417   H HB3  . GLN B  1 77 ? -6.655  -9.036  -284.257 1.00 0.00 ?  77 GLN B HB3  1  
ATOM 2418   H HG2  . GLN B  1 77 ? -4.569  -7.527  -283.937 1.00 0.00 ?  77 GLN B HG2  1  
ATOM 2419   H HG3  . GLN B  1 77 ? -5.294  -7.678  -285.554 1.00 0.00 ?  77 GLN B HG3  1  
ATOM 2420   H HE21 . GLN B  1 77 ? -4.303  -5.734  -286.220 1.00 0.00 ?  77 GLN B HE21 1  
ATOM 2421   H HE22 . GLN B  1 77 ? -4.893  -4.191  -285.699 1.00 0.00 ?  77 GLN B HE22 1  
ATOM 2422   N N    . ASN B  1 78 ? -7.612  -9.603  -287.040 1.00 0.00 ?  78 ASN B N    1  
ATOM 2423   C CA   . ASN B  1 78 ? -7.207  -10.293 -288.258 1.00 0.00 ?  78 ASN B CA   1  
ATOM 2424   C C    . ASN B  1 78 ? -8.348  -10.348 -289.266 1.00 0.00 ?  78 ASN B C    1  
ATOM 2425   O O    . ASN B  1 78 ? -8.422  -11.264 -290.085 1.00 0.00 ?  78 ASN B O    1  
ATOM 2426   C CB   . ASN B  1 78 ? -6.702  -11.693 -287.961 1.00 0.00 ?  78 ASN B CB   1  
ATOM 2427   C CG   . ASN B  1 78 ? -5.434  -11.720 -287.152 1.00 0.00 ?  78 ASN B CG   1  
ATOM 2428   O OD1  . ASN B  1 78 ? -4.589  -10.824 -287.255 1.00 0.00 ?  78 ASN B OD1  1  
ATOM 2429   N ND2  . ASN B  1 78 ? -5.261  -12.784 -286.409 1.00 0.00 ?  78 ASN B ND2  1  
ATOM 2430   H H    . ASN B  1 78 ? -8.206  -10.081 -286.377 1.00 0.00 ?  78 ASN B H    1  
ATOM 2431   H HA   . ASN B  1 78 ? -6.395  -9.747  -288.741 1.00 0.00 ?  78 ASN B HA   1  
ATOM 2432   H HB2  . ASN B  1 78 ? -7.379  -12.464 -287.591 1.00 0.00 ?  78 ASN B HB2  1  
ATOM 2433   H HB3  . ASN B  1 78 ? -6.457  -11.895 -289.004 1.00 0.00 ?  78 ASN B HB3  1  
ATOM 2434   H HD21 . ASN B  1 78 ? -5.949  -13.509 -286.407 1.00 0.00 ?  78 ASN B HD21 1  
ATOM 2435   H HD22 . ASN B  1 78 ? -4.440  -12.869 -285.844 1.00 0.00 ?  78 ASN B HD22 1  
ATOM 2436   N N    . PHE B  1 79 ? -9.236  -9.362  -289.201 1.00 0.00 ?  79 PHE B N    1  
ATOM 2437   C CA   . PHE B  1 79 ? -10.421 -9.341  -290.050 1.00 0.00 ?  79 PHE B CA   1  
ATOM 2438   C C    . PHE B  1 79 ? -10.083 -8.856  -291.454 1.00 0.00 ?  79 PHE B C    1  
ATOM 2439   O O    . PHE B  1 79 ? -10.464 -7.755  -291.850 1.00 0.00 ?  79 PHE B O    1  
ATOM 2440   C CB   . PHE B  1 79 ? -11.504 -8.454  -289.434 1.00 0.00 ?  79 PHE B CB   1  
ATOM 2441   C CG   . PHE B  1 79 ? -12.879 -8.706  -289.985 1.00 0.00 ?  79 PHE B CG   1  
ATOM 2442   C CD1  . PHE B  1 79 ? -13.609 -9.815  -289.585 1.00 0.00 ?  79 PHE B CD1  1  
ATOM 2443   C CD2  . PHE B  1 79 ? -13.445 -7.835  -290.904 1.00 0.00 ?  79 PHE B CD2  1  
ATOM 2444   C CE1  . PHE B  1 79 ? -14.874 -10.048 -290.091 1.00 0.00 ?  79 PHE B CE1  1  
ATOM 2445   C CE2  . PHE B  1 79 ? -14.709 -8.064  -291.410 1.00 0.00 ?  79 PHE B CE2  1  
ATOM 2446   C CZ   . PHE B  1 79 ? -15.424 -9.173  -291.003 1.00 0.00 ?  79 PHE B CZ   1  
ATOM 2447   H H    . PHE B  1 79 ? -9.087  -8.608  -288.546 1.00 0.00 ?  79 PHE B H    1  
ATOM 2448   H HA   . PHE B  1 79 ? -10.817 -10.351 -290.158 1.00 0.00 ?  79 PHE B HA   1  
ATOM 2449   H HB2  . PHE B  1 79 ? -11.563 -8.624  -288.360 1.00 0.00 ?  79 PHE B HB2  1  
ATOM 2450   H HB3  . PHE B  1 79 ? -11.281 -7.405  -289.623 1.00 0.00 ?  79 PHE B HB3  1  
ATOM 2451   H HD1  . PHE B  1 79 ? -13.175 -10.507 -288.863 1.00 0.00 ?  79 PHE B HD1  1  
ATOM 2452   H HD2  . PHE B  1 79 ? -12.879 -6.960  -291.225 1.00 0.00 ?  79 PHE B HD2  1  
ATOM 2453   H HE1  . PHE B  1 79 ? -15.437 -10.924 -289.768 1.00 0.00 ?  79 PHE B HE1  1  
ATOM 2454   H HE2  . PHE B  1 79 ? -15.142 -7.372  -292.131 1.00 0.00 ?  79 PHE B HE2  1  
ATOM 2455   H HZ   . PHE B  1 79 ? -16.421 -9.356  -291.403 1.00 0.00 ?  79 PHE B HZ   1  
ATOM 2456   N N    . ARG B  1 80 ? -9.365  -9.686  -292.204 1.00 0.00 ?  80 ARG B N    1  
ATOM 2457   C CA   . ARG B  1 80 ? -8.908  -9.312  -293.538 1.00 0.00 ?  80 ARG B CA   1  
ATOM 2458   C C    . ARG B  1 80 ? -10.078 -9.190  -294.506 1.00 0.00 ?  80 ARG B C    1  
ATOM 2459   O O    . ARG B  1 80 ? -10.751 -8.197  -294.511 1.00 0.00 ?  80 ARG B O    1  
ATOM 2460   C CB   . ARG B  1 80 ? -7.844  -10.262 -294.067 1.00 0.00 ?  80 ARG B CB   1  
ATOM 2461   C CG   . ARG B  1 80 ? -6.575  -10.330 -293.231 1.00 0.00 ?  80 ARG B CG   1  
ATOM 2462   C CD   . ARG B  1 80 ? -5.850  -9.039  -293.113 1.00 0.00 ?  80 ARG B CD   1  
ATOM 2463   N NE   . ARG B  1 80 ? -5.267  -8.560  -294.356 1.00 0.00 ?  80 ARG B NE   1  
ATOM 2464   C CZ   . ARG B  1 80 ? -4.751  -7.328  -294.534 1.00 0.00 ?  80 ARG B CZ   1  
ATOM 2465   N NH1  . ARG B  1 80 ? -4.778  -6.436  -293.568 1.00 0.00 1  80 ARG B NH1  1  
ATOM 2466   N NH2  . ARG B  1 80 ? -4.239  -7.030  -295.715 1.00 0.00 ?  80 ARG B NH2  1  
ATOM 2467   O OXT  . ARG B  1 80 ? -10.781 -10.138 -294.721 1.00 0.00 -1 80 ARG B OXT  1  
ATOM 2468   H H    . ARG B  1 80 ? -9.130  -10.599 -291.842 1.00 0.00 ?  80 ARG B H    1  
ATOM 2469   H HA   . ARG B  1 80 ? -8.430  -8.333  -293.503 1.00 0.00 ?  80 ARG B HA   1  
ATOM 2470   H HB2  . ARG B  1 80 ? -8.296  -11.252 -294.115 1.00 0.00 ?  80 ARG B HB2  1  
ATOM 2471   H HB3  . ARG B  1 80 ? -7.593  -9.928  -295.073 1.00 0.00 ?  80 ARG B HB3  1  
ATOM 2472   H HG2  . ARG B  1 80 ? -6.839  -10.660 -292.226 1.00 0.00 ?  80 ARG B HG2  1  
ATOM 2473   H HG3  . ARG B  1 80 ? -5.900  -11.055 -293.686 1.00 0.00 ?  80 ARG B HG3  1  
ATOM 2474   H HD2  . ARG B  1 80 ? -6.543  -8.275  -292.762 1.00 0.00 ?  80 ARG B HD2  1  
ATOM 2475   H HD3  . ARG B  1 80 ? -5.039  -9.153  -292.394 1.00 0.00 ?  80 ARG B HD3  1  
ATOM 2476   H HE   . ARG B  1 80 ? -5.155  -9.036  -295.241 1.00 0.00 ?  80 ARG B HE   1  
ATOM 2477   H HH11 . ARG B  1 80 ? -5.189  -6.674  -292.676 1.00 0.00 ?  80 ARG B HH11 1  
ATOM 2478   H HH12 . ARG B  1 80 ? -4.386  -5.518  -293.721 1.00 0.00 ?  80 ARG B HH12 1  
ATOM 2479   H HH21 . ARG B  1 80 ? -4.243  -7.721  -296.453 1.00 0.00 ?  80 ARG B HH21 1  
ATOM 2480   H HH22 . ARG B  1 80 ? -3.847  -6.114  -295.875 1.00 0.00 ?  80 ARG B HH22 1  
ATOM 2481   N N    . MET C  1 1  ? -7.089  -45.630 -270.308 1.00 0.00 ?  1  MET C N    1  
ATOM 2482   C CA   . MET C  1 1  ? -6.135  -45.425 -271.392 1.00 0.00 ?  1  MET C CA   1  
ATOM 2483   C C    . MET C  1 1  ? -6.178  -43.989 -271.899 1.00 0.00 ?  1  MET C C    1  
ATOM 2484   O O    . MET C  1 1  ? -5.172  -43.457 -272.369 1.00 0.00 ?  1  MET C O    1  
ATOM 2485   C CB   . MET C  1 1  ? -6.419  -46.398 -272.534 1.00 0.00 ?  1  MET C CB   1  
ATOM 2486   C CG   . MET C  1 1  ? -6.244  -47.865 -272.170 1.00 0.00 ?  1  MET C CG   1  
ATOM 2487   S SD   . MET C  1 1  ? -4.585  -48.240 -271.570 1.00 0.00 ?  1  MET C SD   1  
ATOM 2488   C CE   . MET C  1 1  ? -3.629  -48.037 -273.071 1.00 0.00 ?  1  MET C CE   1  
ATOM 2489   H H1   . MET C  1 1  ? -7.819  -46.306 -270.405 1.00 0.00 ?  1  MET C H1   1  
ATOM 2490   H H2   . MET C  1 1  ? -6.767  -45.922 -269.407 1.00 0.00 ?  1  MET C H2   1  
ATOM 2491   H H3   . MET C  1 1  ? -7.661  -44.871 -269.996 1.00 0.00 ?  1  MET C H3   1  
ATOM 2492   H HA   . MET C  1 1  ? -5.121  -45.597 -271.032 1.00 0.00 ?  1  MET C HA   1  
ATOM 2493   H HB2  . MET C  1 1  ? -7.445  -46.222 -272.853 1.00 0.00 ?  1  MET C HB2  1  
ATOM 2494   H HB3  . MET C  1 1  ? -5.737  -46.142 -273.346 1.00 0.00 ?  1  MET C HB3  1  
ATOM 2495   H HG2  . MET C  1 1  ? -6.969  -48.112 -271.395 1.00 0.00 ?  1  MET C HG2  1  
ATOM 2496   H HG3  . MET C  1 1  ? -6.446  -48.462 -273.059 1.00 0.00 ?  1  MET C HG3  1  
ATOM 2497   H HE1  . MET C  1 1  ? -3.740  -47.016 -273.437 1.00 0.00 ?  1  MET C HE1  1  
ATOM 2498   H HE2  . MET C  1 1  ? -2.577  -48.236 -272.862 1.00 0.00 ?  1  MET C HE2  1  
ATOM 2499   H HE3  . MET C  1 1  ? -3.988  -48.735 -273.828 1.00 0.00 ?  1  MET C HE3  1  
ATOM 2500   N N    . ALA C  1 2  ? -7.348  -43.367 -271.801 1.00 0.00 ?  2  ALA C N    1  
ATOM 2501   C CA   . ALA C  1 2  ? -7.527  -41.996 -272.263 1.00 0.00 ?  2  ALA C CA   1  
ATOM 2502   C C    . ALA C  1 2  ? -6.892  -41.002 -271.299 1.00 0.00 ?  2  ALA C C    1  
ATOM 2503   O O    . ALA C  1 2  ? -6.896  -41.210 -270.086 1.00 0.00 ?  2  ALA C O    1  
ATOM 2504   C CB   . ALA C  1 2  ? -9.006  -41.688 -272.449 1.00 0.00 ?  2  ALA C CB   1  
ATOM 2505   H H    . ALA C  1 2  ? -8.133  -43.856 -271.396 1.00 0.00 ?  2  ALA C H    1  
ATOM 2506   H HA   . ALA C  1 2  ? -7.025  -41.882 -273.224 1.00 0.00 ?  2  ALA C HA   1  
ATOM 2507   H HB1  . ALA C  1 2  ? -9.524  -41.812 -271.499 1.00 0.00 ?  2  ALA C HB1  1  
ATOM 2508   H HB2  . ALA C  1 2  ? -9.122  -40.661 -272.794 1.00 0.00 ?  2  ALA C HB2  1  
ATOM 2509   H HB3  . ALA C  1 2  ? -9.430  -42.369 -273.187 1.00 0.00 ?  2  ALA C HB3  1  
ATOM 2510   N N    . THR C  1 3  ? -6.345  -39.921 -271.846 1.00 0.00 ?  3  THR C N    1  
ATOM 2511   C CA   . THR C  1 3  ? -5.717  -38.886 -271.034 1.00 0.00 ?  3  THR C CA   1  
ATOM 2512   C C    . THR C  1 3  ? -6.235  -37.503 -271.406 1.00 0.00 ?  3  THR C C    1  
ATOM 2513   O O    . THR C  1 3  ? -6.154  -37.089 -272.562 1.00 0.00 ?  3  THR C O    1  
ATOM 2514   C CB   . THR C  1 3  ? -4.184  -38.905 -271.182 1.00 0.00 ?  3  THR C CB   1  
ATOM 2515   O OG1  . THR C  1 3  ? -3.679  -40.188 -270.790 1.00 0.00 ?  3  THR C OG1  1  
ATOM 2516   C CG2  . THR C  1 3  ? -3.551  -37.828 -270.315 1.00 0.00 ?  3  THR C CG2  1  
ATOM 2517   H H    . THR C  1 3  ? -6.367  -39.814 -272.850 1.00 0.00 ?  3  THR C H    1  
ATOM 2518   H HA   . THR C  1 3  ? -5.968  -39.038 -269.984 1.00 0.00 ?  3  THR C HA   1  
ATOM 2519   H HB   . THR C  1 3  ? -3.927  -38.727 -272.226 1.00 0.00 ?  3  THR C HB   1  
ATOM 2520   H HG1  . THR C  1 3  ? -2.723  -40.197 -270.883 1.00 0.00 ?  3  THR C HG1  1  
ATOM 2521   H HG21 . THR C  1 3  ? -2.468  -37.857 -270.433 1.00 0.00 ?  3  THR C HG21 1  
ATOM 2522   H HG22 . THR C  1 3  ? -3.924  -36.850 -270.619 1.00 0.00 ?  3  THR C HG22 1  
ATOM 2523   H HG23 . THR C  1 3  ? -3.807  -38.006 -269.271 1.00 0.00 ?  3  THR C HG23 1  
ATOM 2524   N N    . PRO C  1 4  ? -6.770  -36.792 -270.419 1.00 0.00 ?  4  PRO C N    1  
ATOM 2525   C CA   . PRO C  1 4  ? -7.267  -35.438 -270.632 1.00 0.00 ?  4  PRO C CA   1  
ATOM 2526   C C    . PRO C  1 4  ? -6.191  -34.545 -271.236 1.00 0.00 ?  4  PRO C C    1  
ATOM 2527   O O    . PRO C  1 4  ? -5.012  -34.663 -270.900 1.00 0.00 ?  4  PRO C O    1  
ATOM 2528   C CB   . PRO C  1 4  ? -7.687  -34.970 -269.235 1.00 0.00 ?  4  PRO C CB   1  
ATOM 2529   C CG   . PRO C  1 4  ? -7.986  -36.229 -268.495 1.00 0.00 ?  4  PRO C CG   1  
ATOM 2530   C CD   . PRO C  1 4  ? -6.993  -37.238 -269.008 1.00 0.00 ?  4  PRO C CD   1  
ATOM 2531   H HA   . PRO C  1 4  ? -8.102  -35.399 -271.346 1.00 0.00 ?  4  PRO C HA   1  
ATOM 2532   H HB2  . PRO C  1 4  ? -6.886  -34.399 -268.743 1.00 0.00 ?  4  PRO C HB2  1  
ATOM 2533   H HB3  . PRO C  1 4  ? -8.570  -34.315 -269.279 1.00 0.00 ?  4  PRO C HB3  1  
ATOM 2534   H HG2  . PRO C  1 4  ? -7.880  -36.087 -267.410 1.00 0.00 ?  4  PRO C HG2  1  
ATOM 2535   H HG3  . PRO C  1 4  ? -9.018  -36.562 -268.677 1.00 0.00 ?  4  PRO C HG3  1  
ATOM 2536   H HD2  . PRO C  1 4  ? -6.056  -37.229 -268.433 1.00 0.00 ?  4  PRO C HD2  1  
ATOM 2537   H HD3  . PRO C  1 4  ? -7.385  -38.265 -268.968 1.00 0.00 ?  4  PRO C HD3  1  
ATOM 2538   N N    . TRP C  1 5  ? -6.603  -33.652 -272.129 1.00 0.00 ?  5  TRP C N    1  
ATOM 2539   C CA   . TRP C  1 5  ? -5.673  -32.744 -272.790 1.00 0.00 ?  5  TRP C CA   1  
ATOM 2540   C C    . TRP C  1 5  ? -5.040  -31.783 -271.792 1.00 0.00 ?  5  TRP C C    1  
ATOM 2541   O O    . TRP C  1 5  ? -5.705  -31.292 -270.880 1.00 0.00 ?  5  TRP C O    1  
ATOM 2542   C CB   . TRP C  1 5  ? -6.387  -31.960 -273.893 1.00 0.00 ?  5  TRP C CB   1  
ATOM 2543   C CG   . TRP C  1 5  ? -5.514  -30.944 -274.566 1.00 0.00 ?  5  TRP C CG   1  
ATOM 2544   C CD1  . TRP C  1 5  ? -4.733  -31.141 -275.665 1.00 0.00 ?  5  TRP C CD1  1  
ATOM 2545   C CD2  . TRP C  1 5  ? -5.334  -29.575 -274.184 1.00 0.00 ?  5  TRP C CD2  1  
ATOM 2546   N NE1  . TRP C  1 5  ? -4.075  -29.981 -275.992 1.00 0.00 ?  5  TRP C NE1  1  
ATOM 2547   C CE2  . TRP C  1 5  ? -4.430  -29.003 -275.097 1.00 0.00 ?  5  TRP C CE2  1  
ATOM 2548   C CE3  . TRP C  1 5  ? -5.852  -28.777 -273.157 1.00 0.00 ?  5  TRP C CE3  1  
ATOM 2549   C CZ2  . TRP C  1 5  ? -4.031  -27.678 -275.017 1.00 0.00 ?  5  TRP C CZ2  1  
ATOM 2550   C CZ3  . TRP C  1 5  ? -5.453  -27.448 -273.077 1.00 0.00 ?  5  TRP C CZ3  1  
ATOM 2551   C CH2  . TRP C  1 5  ? -4.569  -26.914 -273.981 1.00 0.00 ?  5  TRP C CH2  1  
ATOM 2552   H H    . TRP C  1 5  ? -7.586  -33.601 -272.356 1.00 0.00 ?  5  TRP C H    1  
ATOM 2553   H HA   . TRP C  1 5  ? -4.858  -33.311 -273.238 1.00 0.00 ?  5  TRP C HA   1  
ATOM 2554   H HB2  . TRP C  1 5  ? -6.735  -32.637 -274.673 1.00 0.00 ?  5  TRP C HB2  1  
ATOM 2555   H HB3  . TRP C  1 5  ? -7.236  -31.416 -273.478 1.00 0.00 ?  5  TRP C HB3  1  
ATOM 2556   H HD1  . TRP C  1 5  ? -4.741  -32.138 -276.103 1.00 0.00 ?  5  TRP C HD1  1  
ATOM 2557   H HE1  . TRP C  1 5  ? -3.435  -29.865 -276.765 1.00 0.00 ?  5  TRP C HE1  1  
ATOM 2558   H HE3  . TRP C  1 5  ? -6.558  -29.149 -272.415 1.00 0.00 ?  5  TRP C HE3  1  
ATOM 2559   H HZ2  . TRP C  1 5  ? -3.327  -27.295 -275.756 1.00 0.00 ?  5  TRP C HZ2  1  
ATOM 2560   H HZ3  . TRP C  1 5  ? -5.863  -26.837 -272.272 1.00 0.00 ?  5  TRP C HZ3  1  
ATOM 2561   H HH2  . TRP C  1 5  ? -4.282  -25.867 -273.884 1.00 0.00 ?  5  TRP C HH2  1  
ATOM 2562   N N    . SER C  1 6  ? -3.750  -31.518 -271.971 1.00 0.00 ?  6  SER C N    1  
ATOM 2563   C CA   . SER C  1 6  ? -3.048  -30.537 -271.151 1.00 0.00 ?  6  SER C CA   1  
ATOM 2564   C C    . SER C  1 6  ? -2.062  -29.728 -271.984 1.00 0.00 ?  6  SER C C    1  
ATOM 2565   O O    . SER C  1 6  ? -1.203  -30.288 -272.664 1.00 0.00 ?  6  SER C O    1  
ATOM 2566   C CB   . SER C  1 6  ? -2.332  -31.229 -270.008 1.00 0.00 ?  6  SER C CB   1  
ATOM 2567   O OG   . SER C  1 6  ? -1.582  -30.332 -269.237 1.00 0.00 ?  6  SER C OG   1  
ATOM 2568   H H    . SER C  1 6  ? -3.242  -32.008 -272.693 1.00 0.00 ?  6  SER C H    1  
ATOM 2569   H HA   . SER C  1 6  ? -3.718  -29.865 -270.612 1.00 0.00 ?  6  SER C HA   1  
ATOM 2570   H HB2  . SER C  1 6  ? -3.074  -31.710 -269.372 1.00 0.00 ?  6  SER C HB2  1  
ATOM 2571   H HB3  . SER C  1 6  ? -1.665  -31.985 -270.421 1.00 0.00 ?  6  SER C HB3  1  
ATOM 2572   H HG   . SER C  1 6  ? -0.646  -30.478 -269.395 1.00 0.00 ?  6  SER C HG   1  
ATOM 2573   N N    . GLY C  1 7  ? -2.191  -28.407 -271.925 1.00 0.00 ?  7  GLY C N    1  
ATOM 2574   C CA   . GLY C  1 7  ? -1.305  -27.517 -272.667 1.00 0.00 ?  7  GLY C CA   1  
ATOM 2575   C C    . GLY C  1 7  ? 0.015   -27.318 -271.934 1.00 0.00 ?  7  GLY C C    1  
ATOM 2576   O O    . GLY C  1 7  ? 0.245   -27.907 -270.878 1.00 0.00 ?  7  GLY C O    1  
ATOM 2577   H H    . GLY C  1 7  ? -2.921  -28.008 -271.353 1.00 0.00 ?  7  GLY C H    1  
ATOM 2578   H HA2  . GLY C  1 7  ? -1.105  -27.950 -273.648 1.00 0.00 ?  7  GLY C HA2  1  
ATOM 2579   H HA3  . GLY C  1 7  ? -1.793  -26.551 -272.790 1.00 0.00 ?  7  GLY C HA3  1  
ATOM 2580   N N    . TYR C  1 8  ? 0.880   -26.483 -272.500 1.00 0.00 ?  8  TYR C N    1  
ATOM 2581   C CA   . TYR C  1 8  ? 2.173   -26.192 -271.893 1.00 0.00 ?  8  TYR C CA   1  
ATOM 2582   C C    . TYR C  1 8  ? 2.008   -25.480 -270.557 1.00 0.00 ?  8  TYR C C    1  
ATOM 2583   O O    . TYR C  1 8  ? 2.616   -25.864 -269.558 1.00 0.00 ?  8  TYR C O    1  
ATOM 2584   C CB   . TYR C  1 8  ? 3.029   -25.344 -272.837 1.00 0.00 ?  8  TYR C CB   1  
ATOM 2585   C CG   . TYR C  1 8  ? 4.379   -24.967 -272.269 1.00 0.00 ?  8  TYR C CG   1  
ATOM 2586   C CD1  . TYR C  1 8  ? 5.479   -25.796 -272.435 1.00 0.00 ?  8  TYR C CD1  1  
ATOM 2587   C CD2  . TYR C  1 8  ? 4.550   -23.782 -271.569 1.00 0.00 ?  8  TYR C CD2  1  
ATOM 2588   C CE1  . TYR C  1 8  ? 6.714   -25.456 -271.918 1.00 0.00 ?  8  TYR C CE1  1  
ATOM 2589   C CE2  . TYR C  1 8  ? 5.780   -23.432 -271.048 1.00 0.00 ?  8  TYR C CE2  1  
ATOM 2590   C CZ   . TYR C  1 8  ? 6.860   -24.272 -271.224 1.00 0.00 ?  8  TYR C CZ   1  
ATOM 2591   O OH   . TYR C  1 8  ? 8.088   -23.928 -270.708 1.00 0.00 ?  8  TYR C OH   1  
ATOM 2592   H H    . TYR C  1 8  ? 0.635   -26.038 -273.373 1.00 0.00 ?  8  TYR C H    1  
ATOM 2593   H HA   . TYR C  1 8  ? 2.702   -27.123 -271.686 1.00 0.00 ?  8  TYR C HA   1  
ATOM 2594   H HB2  . TYR C  1 8  ? 3.168   -25.921 -273.753 1.00 0.00 ?  8  TYR C HB2  1  
ATOM 2595   H HB3  . TYR C  1 8  ? 2.463   -24.440 -273.060 1.00 0.00 ?  8  TYR C HB3  1  
ATOM 2596   H HD1  . TYR C  1 8  ? 5.356   -26.729 -272.984 1.00 0.00 ?  8  TYR C HD1  1  
ATOM 2597   H HD2  . TYR C  1 8  ? 3.692   -23.123 -271.433 1.00 0.00 ?  8  TYR C HD2  1  
ATOM 2598   H HE1  . TYR C  1 8  ? 7.569   -26.117 -272.055 1.00 0.00 ?  8  TYR C HE1  1  
ATOM 2599   H HE2  . TYR C  1 8  ? 5.894   -22.496 -270.500 1.00 0.00 ?  8  TYR C HE2  1  
ATOM 2600   H HH   . TYR C  1 8  ? 8.768   -24.582 -270.888 1.00 0.00 ?  8  TYR C HH   1  
ATOM 2601   N N    . LEU C  1 9  ? 1.180   -24.440 -270.545 1.00 0.00 ?  9  LEU C N    1  
ATOM 2602   C CA   . LEU C  1 9  ? 0.938   -23.668 -269.332 1.00 0.00 ?  9  LEU C CA   1  
ATOM 2603   C C    . LEU C  1 9  ? 0.247   -24.512 -268.270 1.00 0.00 ?  9  LEU C C    1  
ATOM 2604   O O    . LEU C  1 9  ? 0.494   -24.348 -267.075 1.00 0.00 ?  9  LEU C O    1  
ATOM 2605   C CB   . LEU C  1 9  ? 0.100   -22.424 -269.655 1.00 0.00 ?  9  LEU C CB   1  
ATOM 2606   C CG   . LEU C  1 9  ? 0.808   -21.362 -270.505 1.00 0.00 ?  9  LEU C CG   1  
ATOM 2607   C CD1  . LEU C  1 9  ? -0.167  -20.251 -270.870 1.00 0.00 ?  9  LEU C CD1  1  
ATOM 2608   C CD2  . LEU C  1 9  ? 1.997   -20.805 -269.737 1.00 0.00 ?  9  LEU C CD2  1  
ATOM 2609   H H    . LEU C  1 9  ? 0.707   -24.178 -271.398 1.00 0.00 ?  9  LEU C H    1  
ATOM 2610   H HA   . LEU C  1 9  ? 1.889   -23.351 -268.905 1.00 0.00 ?  9  LEU C HA   1  
ATOM 2611   H HB2  . LEU C  1 9  ? -0.698  -22.893 -270.229 1.00 0.00 ?  9  LEU C HB2  1  
ATOM 2612   H HB3  . LEU C  1 9  ? -0.318  -21.975 -268.754 1.00 0.00 ?  9  LEU C HB3  1  
ATOM 2613   H HG   . LEU C  1 9  ? 1.190   -21.862 -271.396 1.00 0.00 ?  9  LEU C HG   1  
ATOM 2614   H HD11 . LEU C  1 9  ? 0.344   -19.501 -271.474 1.00 0.00 ?  9  LEU C HD11 1  
ATOM 2615   H HD12 . LEU C  1 9  ? -0.999  -20.668 -271.438 1.00 0.00 ?  9  LEU C HD12 1  
ATOM 2616   H HD13 . LEU C  1 9  ? -0.546  -19.786 -269.960 1.00 0.00 ?  9  LEU C HD13 1  
ATOM 2617   H HD21 . LEU C  1 9  ? 2.695   -21.612 -269.511 1.00 0.00 ?  9  LEU C HD21 1  
ATOM 2618   H HD22 . LEU C  1 9  ? 2.500   -20.051 -270.343 1.00 0.00 ?  9  LEU C HD22 1  
ATOM 2619   H HD23 . LEU C  1 9  ? 1.652   -20.354 -268.807 1.00 0.00 ?  9  LEU C HD23 1  
ATOM 2620   N N    . ASP C  1 10 ? -0.619  -25.418 -268.712 1.00 0.00 ?  10 ASP C N    1  
ATOM 2621   C CA   . ASP C  1 10 ? -1.149  -26.460 -267.841 1.00 0.00 ?  10 ASP C CA   1  
ATOM 2622   C C    . ASP C  1 10 ? -0.027  -27.281 -267.219 1.00 0.00 ?  10 ASP C C    1  
ATOM 2623   O O    . ASP C  1 10 ? -0.039  -27.558 -266.020 1.00 0.00 ?  10 ASP C O    1  
ATOM 2624   C CB   . ASP C  1 10 ? -2.101  -27.374 -268.617 1.00 0.00 ?  10 ASP C CB   1  
ATOM 2625   C CG   . ASP C  1 10 ? -3.421  -26.723 -269.005 1.00 0.00 ?  10 ASP C CG   1  
ATOM 2626   O OD1  . ASP C  1 10 ? -3.742  -25.699 -268.450 1.00 0.00 ?  10 ASP C OD1  1  
ATOM 2627   O OD2  . ASP C  1 10 ? -4.021  -27.164 -269.956 1.00 0.00 -1 10 ASP C OD2  1  
ATOM 2628   H H    . ASP C  1 10 ? -0.918  -25.383 -269.676 1.00 0.00 ?  10 ASP C H    1  
ATOM 2629   H HA   . ASP C  1 10 ? -1.697  -26.008 -267.015 1.00 0.00 ?  10 ASP C HA   1  
ATOM 2630   H HB2  . ASP C  1 10 ? -1.647  -27.827 -269.499 1.00 0.00 ?  10 ASP C HB2  1  
ATOM 2631   H HB3  . ASP C  1 10 ? -2.282  -28.143 -267.866 1.00 0.00 ?  10 ASP C HB3  1  
ATOM 2632   N N    . ASP C  1 11 ? 0.943   -27.669 -268.041 1.00 0.00 ?  11 ASP C N    1  
ATOM 2633   C CA   . ASP C  1 11 ? 2.083   -28.444 -267.570 1.00 0.00 ?  11 ASP C CA   1  
ATOM 2634   C C    . ASP C  1 11 ? 2.929   -27.641 -266.590 1.00 0.00 ?  11 ASP C C    1  
ATOM 2635   O O    . ASP C  1 11 ? 3.456   -28.184 -265.619 1.00 0.00 ?  11 ASP C O    1  
ATOM 2636   C CB   . ASP C  1 11 ? 2.942   -28.907 -268.749 1.00 0.00 ?  11 ASP C CB   1  
ATOM 2637   C CG   . ASP C  1 11 ? 2.295   -29.980 -269.615 1.00 0.00 ?  11 ASP C CG   1  
ATOM 2638   O OD1  . ASP C  1 11 ? 1.300   -30.528 -269.204 1.00 0.00 ?  11 ASP C OD1  1  
ATOM 2639   O OD2  . ASP C  1 11 ? 2.705   -30.131 -270.742 1.00 0.00 -1 11 ASP C OD2  1  
ATOM 2640   H H    . ASP C  1 11 ? 0.888   -27.419 -269.019 1.00 0.00 ?  11 ASP C H    1  
ATOM 2641   H HA   . ASP C  1 11 ? 1.733   -29.324 -267.028 1.00 0.00 ?  11 ASP C HA   1  
ATOM 2642   H HB2  . ASP C  1 11 ? 3.288   -28.090 -269.382 1.00 0.00 ?  11 ASP C HB2  1  
ATOM 2643   H HB3  . ASP C  1 11 ? 3.789   -29.336 -268.213 1.00 0.00 ?  11 ASP C HB3  1  
ATOM 2644   N N    . VAL C  1 12 ? 3.055   -26.344 -266.851 1.00 0.00 ?  12 VAL C N    1  
ATOM 2645   C CA   . VAL C  1 12 ? 3.782   -25.450 -265.958 1.00 0.00 ?  12 VAL C CA   1  
ATOM 2646   C C    . VAL C  1 12 ? 3.138   -25.406 -264.578 1.00 0.00 ?  12 VAL C C    1  
ATOM 2647   O O    . VAL C  1 12 ? 3.825   -25.475 -263.559 1.00 0.00 ?  12 VAL C O    1  
ATOM 2648   C CB   . VAL C  1 12 ? 3.855   -24.020 -266.526 1.00 0.00 ?  12 VAL C CB   1  
ATOM 2649   C CG1  . VAL C  1 12 ? 4.390   -23.057 -265.476 1.00 0.00 ?  12 VAL C CG1  1  
ATOM 2650   C CG2  . VAL C  1 12 ? 4.726   -23.985 -267.772 1.00 0.00 ?  12 VAL C CG2  1  
ATOM 2651   H H    . VAL C  1 12 ? 2.636   -25.968 -267.690 1.00 0.00 ?  12 VAL C H    1  
ATOM 2652   H HA   . VAL C  1 12 ? 4.798   -25.806 -265.781 1.00 0.00 ?  12 VAL C HA   1  
ATOM 2653   H HB   . VAL C  1 12 ? 2.855   -23.708 -266.829 1.00 0.00 ?  12 VAL C HB   1  
ATOM 2654   H HG11 . VAL C  1 12 ? 4.435   -22.051 -265.895 1.00 0.00 ?  12 VAL C HG11 1  
ATOM 2655   H HG12 . VAL C  1 12 ? 3.730   -23.060 -264.609 1.00 0.00 ?  12 VAL C HG12 1  
ATOM 2656   H HG13 . VAL C  1 12 ? 5.390   -23.368 -265.174 1.00 0.00 ?  12 VAL C HG13 1  
ATOM 2657   H HG21 . VAL C  1 12 ? 4.304   -24.646 -268.530 1.00 0.00 ?  12 VAL C HG21 1  
ATOM 2658   H HG22 . VAL C  1 12 ? 4.766   -22.968 -268.161 1.00 0.00 ?  12 VAL C HG22 1  
ATOM 2659   H HG23 . VAL C  1 12 ? 5.733   -24.318 -267.521 1.00 0.00 ?  12 VAL C HG23 1  
ATOM 2660   N N    . SER C  1 13 ? 1.814   -25.290 -264.552 1.00 0.00 ?  13 SER C N    1  
ATOM 2661   C CA   . SER C  1 13 ? 1.066   -25.329 -263.302 1.00 0.00 ?  13 SER C CA   1  
ATOM 2662   C C    . SER C  1 13 ? 1.290   -26.645 -262.567 1.00 0.00 ?  13 SER C C    1  
ATOM 2663   O O    . SER C  1 13 ? 1.484   -26.664 -261.352 1.00 0.00 ?  13 SER C O    1  
ATOM 2664   C CB   . SER C  1 13 ? -0.411  -25.119 -263.570 1.00 0.00 ?  13 SER C CB   1  
ATOM 2665   O OG   . SER C  1 13 ? -1.178  -25.213 -262.401 1.00 0.00 ?  13 SER C OG   1  
ATOM 2666   H H    . SER C  1 13 ? 1.314   -25.171 -265.422 1.00 0.00 ?  13 SER C H    1  
ATOM 2667   H HA   . SER C  1 13 ? 1.287   -24.492 -262.638 1.00 0.00 ?  13 SER C HA   1  
ATOM 2668   H HB2  . SER C  1 13 ? -0.548  -24.130 -264.006 1.00 0.00 ?  13 SER C HB2  1  
ATOM 2669   H HB3  . SER C  1 13 ? -0.749  -25.876 -264.277 1.00 0.00 ?  13 SER C HB3  1  
ATOM 2670   H HG   . SER C  1 13 ? -2.084  -25.430 -262.630 1.00 0.00 ?  13 SER C HG   1  
ATOM 2671   N N    . ALA C  1 14 ? 1.262   -27.745 -263.313 1.00 0.00 ?  14 ALA C N    1  
ATOM 2672   C CA   . ALA C  1 14 ? 1.492   -29.065 -262.739 1.00 0.00 ?  14 ALA C CA   1  
ATOM 2673   C C    . ALA C  1 14 ? 2.914   -29.195 -262.208 1.00 0.00 ?  14 ALA C C    1  
ATOM 2674   O O    . ALA C  1 14 ? 3.141   -29.791 -261.155 1.00 0.00 ?  14 ALA C O    1  
ATOM 2675   C CB   . ALA C  1 14 ? 1.207   -30.148 -263.770 1.00 0.00 ?  14 ALA C CB   1  
ATOM 2676   H H    . ALA C  1 14 ? 1.077   -27.664 -264.302 1.00 0.00 ?  14 ALA C H    1  
ATOM 2677   H HA   . ALA C  1 14 ? 0.816   -29.202 -261.895 1.00 0.00 ?  14 ALA C HA   1  
ATOM 2678   H HB1  . ALA C  1 14 ? 1.865   -30.016 -264.627 1.00 0.00 ?  14 ALA C HB1  1  
ATOM 2679   H HB2  . ALA C  1 14 ? 1.384   -31.127 -263.325 1.00 0.00 ?  14 ALA C HB2  1  
ATOM 2680   H HB3  . ALA C  1 14 ? 0.168   -30.078 -264.093 1.00 0.00 ?  14 ALA C HB3  1  
ATOM 2681   N N    . LYS C  1 15 ? 3.868   -28.634 -262.943 1.00 0.00 ?  15 LYS C N    1  
ATOM 2682   C CA   . LYS C  1 15 ? 5.274   -28.714 -262.564 1.00 0.00 ?  15 LYS C CA   1  
ATOM 2683   C C    . LYS C  1 15 ? 5.524   -28.027 -261.227 1.00 0.00 ?  15 LYS C C    1  
ATOM 2684   O O    . LYS C  1 15 ? 6.266   -28.535 -260.387 1.00 0.00 ?  15 LYS C O    1  
ATOM 2685   C CB   . LYS C  1 15 ? 6.157   -28.094 -263.648 1.00 0.00 ?  15 LYS C CB   1  
ATOM 2686   C CG   . LYS C  1 15 ? 6.364   -28.976 -264.871 1.00 0.00 ?  15 LYS C CG   1  
ATOM 2687   C CD   . LYS C  1 15 ? 7.104   -28.231 -265.972 1.00 0.00 ?  15 LYS C CD   1  
ATOM 2688   C CE   . LYS C  1 15 ? 7.208   -29.070 -267.237 1.00 0.00 ?  15 LYS C CE   1  
ATOM 2689   N NZ   . LYS C  1 15 ? 8.097   -30.249 -267.051 1.00 0.00 1  15 LYS C NZ   1  
ATOM 2690   H H    . LYS C  1 15 ? 3.613   -28.139 -263.785 1.00 0.00 ?  15 LYS C H    1  
ATOM 2691   H HA   . LYS C  1 15 ? 5.562   -29.758 -262.435 1.00 0.00 ?  15 LYS C HA   1  
ATOM 2692   H HB2  . LYS C  1 15 ? 5.683   -27.160 -263.950 1.00 0.00 ?  15 LYS C HB2  1  
ATOM 2693   H HB3  . LYS C  1 15 ? 7.122   -27.878 -263.189 1.00 0.00 ?  15 LYS C HB3  1  
ATOM 2694   H HG2  . LYS C  1 15 ? 6.941   -29.852 -264.573 1.00 0.00 ?  15 LYS C HG2  1  
ATOM 2695   H HG3  . LYS C  1 15 ? 5.389   -29.293 -265.239 1.00 0.00 ?  15 LYS C HG3  1  
ATOM 2696   H HD2  . LYS C  1 15 ? 6.564   -27.309 -266.191 1.00 0.00 ?  15 LYS C HD2  1  
ATOM 2697   H HD3  . LYS C  1 15 ? 8.105   -27.988 -265.615 1.00 0.00 ?  15 LYS C HD3  1  
ATOM 2698   H HE2  . LYS C  1 15 ? 6.208   -29.409 -267.506 1.00 0.00 ?  15 LYS C HE2  1  
ATOM 2699   H HE3  . LYS C  1 15 ? 7.603   -28.440 -268.033 1.00 0.00 ?  15 LYS C HE3  1  
ATOM 2700   H HZ1  . LYS C  1 15 ? 7.731   -30.834 -266.314 1.00 0.00 ?  15 LYS C HZ1  1  
ATOM 2701   H HZ2  . LYS C  1 15 ? 8.139   -30.778 -267.911 1.00 0.00 ?  15 LYS C HZ2  1  
ATOM 2702   H HZ3  . LYS C  1 15 ? 9.025   -29.935 -266.803 1.00 0.00 ?  15 LYS C HZ3  1  
ATOM 2703   N N    . PHE C  1 16 ? 4.901   -26.869 -261.038 1.00 0.00 ?  16 PHE C N    1  
ATOM 2704   C CA   . PHE C  1 16 ? 4.970   -26.161 -259.765 1.00 0.00 ?  16 PHE C CA   1  
ATOM 2705   C C    . PHE C  1 16 ? 4.293   -26.956 -258.655 1.00 0.00 ?  16 PHE C C    1  
ATOM 2706   O O    . PHE C  1 16 ? 4.867   -27.160 -257.585 1.00 0.00 ?  16 PHE C O    1  
ATOM 2707   C CB   . PHE C  1 16 ? 4.329   -24.778 -259.887 1.00 0.00 ?  16 PHE C CB   1  
ATOM 2708   C CG   . PHE C  1 16 ? 4.365   -23.979 -258.615 1.00 0.00 ?  16 PHE C CG   1  
ATOM 2709   C CD1  . PHE C  1 16 ? 5.464   -23.192 -258.304 1.00 0.00 ?  16 PHE C CD1  1  
ATOM 2710   C CD2  . PHE C  1 16 ? 3.301   -24.013 -257.727 1.00 0.00 ?  16 PHE C CD2  1  
ATOM 2711   C CE1  . PHE C  1 16 ? 5.498   -22.457 -257.134 1.00 0.00 ?  16 PHE C CE1  1  
ATOM 2712   C CE2  . PHE C  1 16 ? 3.332   -23.279 -256.557 1.00 0.00 ?  16 PHE C CE2  1  
ATOM 2713   C CZ   . PHE C  1 16 ? 4.432   -22.500 -256.261 1.00 0.00 ?  16 PHE C CZ   1  
ATOM 2714   H H    . PHE C  1 16 ? 4.366   -26.468 -261.795 1.00 0.00 ?  16 PHE C H    1  
ATOM 2715   H HA   . PHE C  1 16 ? 6.012   -26.038 -259.466 1.00 0.00 ?  16 PHE C HA   1  
ATOM 2716   H HB2  . PHE C  1 16 ? 4.850   -24.188 -260.640 1.00 0.00 ?  16 PHE C HB2  1  
ATOM 2717   H HB3  . PHE C  1 16 ? 3.281   -24.874 -260.164 1.00 0.00 ?  16 PHE C HB3  1  
ATOM 2718   H HD1  . PHE C  1 16 ? 6.307   -23.157 -258.995 1.00 0.00 ?  16 PHE C HD1  1  
ATOM 2719   H HD2  . PHE C  1 16 ? 2.432   -24.629 -257.961 1.00 0.00 ?  16 PHE C HD2  1  
ATOM 2720   H HE1  . PHE C  1 16 ? 6.368   -21.843 -256.902 1.00 0.00 ?  16 PHE C HE1  1  
ATOM 2721   H HE2  . PHE C  1 16 ? 2.488   -23.314 -255.868 1.00 0.00 ?  16 PHE C HE2  1  
ATOM 2722   H HZ   . PHE C  1 16 ? 4.458   -21.922 -255.338 1.00 0.00 ?  16 PHE C HZ   1  
ATOM 2723   N N    . ASP C  1 17 ? 3.070   -27.404 -258.917 1.00 0.00 ?  17 ASP C N    1  
ATOM 2724   C CA   . ASP C  1 17 ? 2.278   -28.103 -257.912 1.00 0.00 ?  17 ASP C CA   1  
ATOM 2725   C C    . ASP C  1 17 ? 2.942   -29.410 -257.498 1.00 0.00 ?  17 ASP C C    1  
ATOM 2726   O O    . ASP C  1 17 ? 2.789   -29.863 -256.364 1.00 0.00 ?  17 ASP C O    1  
ATOM 2727   C CB   . ASP C  1 17 ? 0.865   -28.373 -258.434 1.00 0.00 ?  17 ASP C CB   1  
ATOM 2728   C CG   . ASP C  1 17 ? -0.038  -27.148 -258.470 1.00 0.00 ?  17 ASP C CG   1  
ATOM 2729   O OD1  . ASP C  1 17 ? 0.316   -26.156 -257.876 1.00 0.00 ?  17 ASP C OD1  1  
ATOM 2730   O OD2  . ASP C  1 17 ? -0.989  -27.157 -259.213 1.00 0.00 -1 17 ASP C OD2  1  
ATOM 2731   H H    . ASP C  1 17 ? 2.679   -27.257 -259.837 1.00 0.00 ?  17 ASP C H    1  
ATOM 2732   H HA   . ASP C  1 17 ? 2.206   -27.493 -257.010 1.00 0.00 ?  17 ASP C HA   1  
ATOM 2733   H HB2  . ASP C  1 17 ? 0.849   -28.864 -259.407 1.00 0.00 ?  17 ASP C HB2  1  
ATOM 2734   H HB3  . ASP C  1 17 ? 0.508   -29.065 -257.671 1.00 0.00 ?  17 ASP C HB3  1  
ATOM 2735   N N    . THR C  1 18 ? 3.680   -30.012 -258.425 1.00 0.00 ?  18 THR C N    1  
ATOM 2736   C CA   . THR C  1 18 ? 4.368   -31.270 -258.159 1.00 0.00 ?  18 THR C CA   1  
ATOM 2737   C C    . THR C  1 18 ? 5.171   -31.196 -256.866 1.00 0.00 ?  18 THR C C    1  
ATOM 2738   O O    . THR C  1 18 ? 5.158   -32.128 -256.062 1.00 0.00 ?  18 THR C O    1  
ATOM 2739   C CB   . THR C  1 18 ? 5.309   -31.655 -259.315 1.00 0.00 ?  18 THR C CB   1  
ATOM 2740   O OG1  . THR C  1 18 ? 4.542   -31.876 -260.505 1.00 0.00 ?  18 THR C OG1  1  
ATOM 2741   C CG2  . THR C  1 18 ? 6.084   -32.919 -258.973 1.00 0.00 ?  18 THR C CG2  1  
ATOM 2742   H H    . THR C  1 18 ? 3.767   -29.587 -259.337 1.00 0.00 ?  18 THR C H    1  
ATOM 2743   H HA   . THR C  1 18 ? 3.637   -32.068 -258.022 1.00 0.00 ?  18 THR C HA   1  
ATOM 2744   H HB   . THR C  1 18 ? 6.008   -30.838 -259.490 1.00 0.00 ?  18 THR C HB   1  
ATOM 2745   H HG1  . THR C  1 18 ? 5.131   -32.115 -261.225 1.00 0.00 ?  18 THR C HG1  1  
ATOM 2746   H HG21 . THR C  1 18 ? 6.743   -33.175 -259.802 1.00 0.00 ?  18 THR C HG21 1  
ATOM 2747   H HG22 . THR C  1 18 ? 6.677   -32.750 -258.075 1.00 0.00 ?  18 THR C HG22 1  
ATOM 2748   H HG23 . THR C  1 18 ? 5.386   -33.736 -258.799 1.00 0.00 ?  18 THR C HG23 1  
ATOM 2749   N N    . GLY C  1 19 ? 5.870   -30.082 -256.673 1.00 0.00 ?  19 GLY C N    1  
ATOM 2750   C CA   . GLY C  1 19 ? 6.801   -29.946 -255.560 1.00 0.00 ?  19 GLY C CA   1  
ATOM 2751   C C    . GLY C  1 19 ? 6.081   -29.516 -254.288 1.00 0.00 ?  19 GLY C C    1  
ATOM 2752   O O    . GLY C  1 19 ? 6.638   -29.589 -253.193 1.00 0.00 ?  19 GLY C O    1  
ATOM 2753   H H    . GLY C  1 19 ? 5.752   -29.310 -257.313 1.00 0.00 ?  19 GLY C H    1  
ATOM 2754   H HA2  . GLY C  1 19 ? 7.290   -30.905 -255.384 1.00 0.00 ?  19 GLY C HA2  1  
ATOM 2755   H HA3  . GLY C  1 19 ? 7.552   -29.198 -255.813 1.00 0.00 ?  19 GLY C HA3  1  
ATOM 2756   N N    . VAL C  1 20 ? 4.840   -29.068 -254.440 1.00 0.00 ?  20 VAL C N    1  
ATOM 2757   C CA   . VAL C  1 20 ? 4.052   -28.594 -253.308 1.00 0.00 ?  20 VAL C CA   1  
ATOM 2758   C C    . VAL C  1 20 ? 2.664   -29.220 -253.302 1.00 0.00 ?  20 VAL C C    1  
ATOM 2759   O O    . VAL C  1 20 ? 1.715   -28.645 -252.768 1.00 0.00 ?  20 VAL C O    1  
ATOM 2760   C CB   . VAL C  1 20 ? 3.913   -27.060 -253.320 1.00 0.00 ?  20 VAL C CB   1  
ATOM 2761   C CG1  . VAL C  1 20 ? 5.245   -26.401 -252.995 1.00 0.00 ?  20 VAL C CG1  1  
ATOM 2762   C CG2  . VAL C  1 20 ? 3.399   -26.582 -254.670 1.00 0.00 ?  20 VAL C CG2  1  
ATOM 2763   H H    . VAL C  1 20 ? 4.431   -29.055 -255.363 1.00 0.00 ?  20 VAL C H    1  
ATOM 2764   H HA   . VAL C  1 20 ? 4.500   -28.895 -252.360 1.00 0.00 ?  20 VAL C HA   1  
ATOM 2765   H HB   . VAL C  1 20 ? 3.171   -26.766 -252.577 1.00 0.00 ?  20 VAL C HB   1  
ATOM 2766   H HG11 . VAL C  1 20 ? 5.127   -25.317 -253.007 1.00 0.00 ?  20 VAL C HG11 1  
ATOM 2767   H HG12 . VAL C  1 20 ? 5.576   -26.718 -252.006 1.00 0.00 ?  20 VAL C HG12 1  
ATOM 2768   H HG13 . VAL C  1 20 ? 5.986   -26.693 -253.738 1.00 0.00 ?  20 VAL C HG13 1  
ATOM 2769   H HG21 . VAL C  1 20 ? 2.424   -27.028 -254.867 1.00 0.00 ?  20 VAL C HG21 1  
ATOM 2770   H HG22 . VAL C  1 20 ? 3.306   -25.496 -254.661 1.00 0.00 ?  20 VAL C HG22 1  
ATOM 2771   H HG23 . VAL C  1 20 ? 4.099   -26.880 -255.451 1.00 0.00 ?  20 VAL C HG23 1  
ATOM 2772   N N    . ASP C  1 21 ? 2.551   -30.403 -253.897 1.00 0.00 ?  21 ASP C N    1  
ATOM 2773   C CA   . ASP C  1 21 ? 1.298   -31.148 -253.890 1.00 0.00 ?  21 ASP C CA   1  
ATOM 2774   C C    . ASP C  1 21 ? 0.840   -31.441 -252.467 1.00 0.00 ?  21 ASP C C    1  
ATOM 2775   O O    . ASP C  1 21 ? -0.356  -31.426 -252.174 1.00 0.00 ?  21 ASP C O    1  
ATOM 2776   C CB   . ASP C  1 21 ? 1.446   -32.454 -254.674 1.00 0.00 ?  21 ASP C CB   1  
ATOM 2777   C CG   . ASP C  1 21 ? 0.144   -33.219 -254.874 1.00 0.00 ?  21 ASP C CG   1  
ATOM 2778   O OD1  . ASP C  1 21 ? -0.746  -32.686 -255.493 1.00 0.00 ?  21 ASP C OD1  1  
ATOM 2779   O OD2  . ASP C  1 21 ? 0.105   -34.380 -254.545 1.00 0.00 -1 21 ASP C OD2  1  
ATOM 2780   H H    . ASP C  1 21 ? 3.355   -30.796 -254.367 1.00 0.00 ?  21 ASP C H    1  
ATOM 2781   H HA   . ASP C  1 21 ? 0.511   -30.551 -254.352 1.00 0.00 ?  21 ASP C HA   1  
ATOM 2782   H HB2  . ASP C  1 21 ? 1.945   -32.330 -255.635 1.00 0.00 ?  21 ASP C HB2  1  
ATOM 2783   H HB3  . ASP C  1 21 ? 2.094   -33.012 -253.997 1.00 0.00 ?  21 ASP C HB3  1  
ATOM 2784   N N    . ASN C  1 22 ? 1.798   -31.707 -251.585 1.00 0.00 ?  22 ASN C N    1  
ATOM 2785   C CA   . ASN C  1 22 ? 1.492   -32.039 -250.199 1.00 0.00 ?  22 ASN C CA   1  
ATOM 2786   C C    . ASN C  1 22 ? 1.187   -30.787 -249.387 1.00 0.00 ?  22 ASN C C    1  
ATOM 2787   O O    . ASN C  1 22 ? 0.447   -30.837 -248.405 1.00 0.00 ?  22 ASN C O    1  
ATOM 2788   C CB   . ASN C  1 22 ? 2.622   -32.820 -249.553 1.00 0.00 ?  22 ASN C CB   1  
ATOM 2789   C CG   . ASN C  1 22 ? 2.760   -34.225 -250.071 1.00 0.00 ?  22 ASN C CG   1  
ATOM 2790   O OD1  . ASN C  1 22 ? 1.811   -34.805 -250.611 1.00 0.00 ?  22 ASN C OD1  1  
ATOM 2791   N ND2  . ASN C  1 22 ? 3.911   -34.802 -249.838 1.00 0.00 ?  22 ASN C ND2  1  
ATOM 2792   H H    . ASN C  1 22 ? 2.762   -31.679 -251.883 1.00 0.00 ?  22 ASN C H    1  
ATOM 2793   H HA   . ASN C  1 22 ? 0.597   -32.661 -250.156 1.00 0.00 ?  22 ASN C HA   1  
ATOM 2794   H HB2  . ASN C  1 22 ? 3.614   -32.380 -249.444 1.00 0.00 ?  22 ASN C HB2  1  
ATOM 2795   H HB3  . ASN C  1 22 ? 2.130   -32.852 -248.581 1.00 0.00 ?  22 ASN C HB3  1  
ATOM 2796   H HD21 . ASN C  1 22 ? 4.627   -34.309 -249.344 1.00 0.00 ?  22 ASN C HD21 1  
ATOM 2797   H HD22 . ASN C  1 22 ? 4.074   -35.737 -250.155 1.00 0.00 ?  22 ASN C HD22 1  
ATOM 2798   N N    . LEU C  1 23 ? 1.761   -29.663 -249.804 1.00 0.00 ?  23 LEU C N    1  
ATOM 2799   C CA   . LEU C  1 23 ? 1.584   -28.403 -249.092 1.00 0.00 ?  23 LEU C CA   1  
ATOM 2800   C C    . LEU C  1 23 ? 0.109   -28.102 -248.863 1.00 0.00 ?  23 LEU C C    1  
ATOM 2801   O O    . LEU C  1 23 ? -0.304  -27.784 -247.748 1.00 0.00 ?  23 LEU C O    1  
ATOM 2802   C CB   . LEU C  1 23 ? 2.248   -27.258 -249.869 1.00 0.00 ?  23 LEU C CB   1  
ATOM 2803   C CG   . LEU C  1 23 ? 1.889   -25.847 -249.385 1.00 0.00 ?  23 LEU C CG   1  
ATOM 2804   C CD1  . LEU C  1 23 ? 2.243   -25.696 -247.912 1.00 0.00 ?  23 LEU C CD1  1  
ATOM 2805   C CD2  . LEU C  1 23 ? 2.629   -24.818 -250.226 1.00 0.00 ?  23 LEU C CD2  1  
ATOM 2806   H H    . LEU C  1 23 ? 2.336   -29.683 -250.634 1.00 0.00 ?  23 LEU C H    1  
ATOM 2807   H HA   . LEU C  1 23 ? 2.042   -28.473 -248.106 1.00 0.00 ?  23 LEU C HA   1  
ATOM 2808   H HB2  . LEU C  1 23 ? 3.291   -27.476 -249.648 1.00 0.00 ?  23 LEU C HB2  1  
ATOM 2809   H HB3  . LEU C  1 23 ? 2.078   -27.347 -250.942 1.00 0.00 ?  23 LEU C HB3  1  
ATOM 2810   H HG   . LEU C  1 23 ? 0.821   -25.709 -249.552 1.00 0.00 ?  23 LEU C HG   1  
ATOM 2811   H HD11 . LEU C  1 23 ? 1.985   -24.691 -247.577 1.00 0.00 ?  23 LEU C HD11 1  
ATOM 2812   H HD12 . LEU C  1 23 ? 1.685   -26.426 -247.326 1.00 0.00 ?  23 LEU C HD12 1  
ATOM 2813   H HD13 . LEU C  1 23 ? 3.311   -25.860 -247.775 1.00 0.00 ?  23 LEU C HD13 1  
ATOM 2814   H HD21 . LEU C  1 23 ? 2.341   -24.926 -251.271 1.00 0.00 ?  23 LEU C HD21 1  
ATOM 2815   H HD22 . LEU C  1 23 ? 2.373   -23.816 -249.881 1.00 0.00 ?  23 LEU C HD22 1  
ATOM 2816   H HD23 . LEU C  1 23 ? 3.704   -24.972 -250.129 1.00 0.00 ?  23 LEU C HD23 1  
ATOM 2817   N N    . GLN C  1 24 ? -0.683  -28.206 -249.925 1.00 0.00 ?  24 GLN C N    1  
ATOM 2818   C CA   . GLN C  1 24 ? -2.115  -27.943 -249.842 1.00 0.00 ?  24 GLN C CA   1  
ATOM 2819   C C    . GLN C  1 24 ? -2.780  -28.843 -248.809 1.00 0.00 ?  24 GLN C C    1  
ATOM 2820   O O    . GLN C  1 24 ? -3.584  -28.384 -247.997 1.00 0.00 ?  24 GLN C O    1  
ATOM 2821   C CB   . GLN C  1 24 ? -2.777  -28.146 -251.207 1.00 0.00 ?  24 GLN C CB   1  
ATOM 2822   C CG   . GLN C  1 24 ? -4.265  -27.842 -251.228 1.00 0.00 ?  24 GLN C CG   1  
ATOM 2823   C CD   . GLN C  1 24 ? -4.879  -28.049 -252.600 1.00 0.00 ?  24 GLN C CD   1  
ATOM 2824   O OE1  . GLN C  1 24 ? -4.209  -28.500 -253.533 1.00 0.00 ?  24 GLN C OE1  1  
ATOM 2825   N NE2  . GLN C  1 24 ? -6.158  -27.715 -252.732 1.00 0.00 ?  24 GLN C NE2  1  
ATOM 2826   H H    . GLN C  1 24 ? -0.283  -28.473 -250.813 1.00 0.00 ?  24 GLN C H    1  
ATOM 2827   H HA   . GLN C  1 24 ? -2.279  -26.918 -249.512 1.00 0.00 ?  24 GLN C HA   1  
ATOM 2828   H HB2  . GLN C  1 24 ? -2.257  -27.495 -251.909 1.00 0.00 ?  24 GLN C HB2  1  
ATOM 2829   H HB3  . GLN C  1 24 ? -2.611  -29.187 -251.486 1.00 0.00 ?  24 GLN C HB3  1  
ATOM 2830   H HG2  . GLN C  1 24 ? -4.959  -28.239 -250.488 1.00 0.00 ?  24 GLN C HG2  1  
ATOM 2831   H HG3  . GLN C  1 24 ? -4.137  -26.771 -251.066 1.00 0.00 ?  24 GLN C HG3  1  
ATOM 2832   H HE21 . GLN C  1 24 ? -6.663  -27.351 -251.949 1.00 0.00 ?  24 GLN C HE21 1  
ATOM 2833   H HE22 . GLN C  1 24 ? -6.617  -27.829 -253.614 1.00 0.00 ?  24 GLN C HE22 1  
ATOM 2834   N N    . THR C  1 25 ? -2.441  -30.127 -248.843 1.00 0.00 ?  25 THR C N    1  
ATOM 2835   C CA   . THR C  1 25 ? -3.027  -31.100 -247.928 1.00 0.00 ?  25 THR C CA   1  
ATOM 2836   C C    . THR C  1 25 ? -2.628  -30.810 -246.487 1.00 0.00 ?  25 THR C C    1  
ATOM 2837   O O    . THR C  1 25 ? -3.446  -30.917 -245.573 1.00 0.00 ?  25 THR C O    1  
ATOM 2838   C CB   . THR C  1 25 ? -2.608  -32.537 -248.287 1.00 0.00 ?  25 THR C CB   1  
ATOM 2839   O OG1  . THR C  1 25 ? -3.086  -32.864 -249.598 1.00 0.00 ?  25 THR C OG1  1  
ATOM 2840   C CG2  . THR C  1 25 ? -3.178  -33.526 -247.282 1.00 0.00 ?  25 THR C CG2  1  
ATOM 2841   H H    . THR C  1 25 ? -1.760  -30.438 -249.521 1.00 0.00 ?  25 THR C H    1  
ATOM 2842   H HA   . THR C  1 25 ? -4.115  -31.033 -247.967 1.00 0.00 ?  25 THR C HA   1  
ATOM 2843   H HB   . THR C  1 25 ? -1.520  -32.601 -248.281 1.00 0.00 ?  25 THR C HB   1  
ATOM 2844   H HG1  . THR C  1 25 ? -2.708  -32.256 -250.238 1.00 0.00 ?  25 THR C HG1  1  
ATOM 2845   H HG21 . THR C  1 25 ? -2.871  -34.536 -247.552 1.00 0.00 ?  25 THR C HG21 1  
ATOM 2846   H HG22 . THR C  1 25 ? -2.806  -33.286 -246.286 1.00 0.00 ?  25 THR C HG22 1  
ATOM 2847   H HG23 . THR C  1 25 ? -4.265  -33.463 -247.288 1.00 0.00 ?  25 THR C HG23 1  
ATOM 2848   N N    . GLN C  1 26 ? -1.367  -30.442 -246.290 1.00 0.00 ?  26 GLN C N    1  
ATOM 2849   C CA   . GLN C  1 26 ? -0.841  -30.194 -244.953 1.00 0.00 ?  26 GLN C CA   1  
ATOM 2850   C C    . GLN C  1 26 ? -1.531  -29.003 -244.302 1.00 0.00 ?  26 GLN C C    1  
ATOM 2851   O O    . GLN C  1 26 ? -1.935  -29.066 -243.140 1.00 0.00 ?  26 GLN C O    1  
ATOM 2852   C CB   . GLN C  1 26 ? 0.670   -29.950 -245.008 1.00 0.00 ?  26 GLN C CB   1  
ATOM 2853   C CG   . GLN C  1 26 ? 1.492   -31.195 -245.291 1.00 0.00 ?  26 GLN C CG   1  
ATOM 2854   C CD   . GLN C  1 26 ? 2.976   -30.898 -245.397 1.00 0.00 ?  26 GLN C CD   1  
ATOM 2855   O OE1  . GLN C  1 26 ? 3.405   -29.750 -245.251 1.00 0.00 ?  26 GLN C OE1  1  
ATOM 2856   N NE2  . GLN C  1 26 ? 3.769   -31.931 -245.657 1.00 0.00 ?  26 GLN C NE2  1  
ATOM 2857   H H    . GLN C  1 26 ? -0.756  -30.331 -247.087 1.00 0.00 ?  26 GLN C H    1  
ATOM 2858   H HA   . GLN C  1 26 ? -1.042  -31.056 -244.316 1.00 0.00 ?  26 GLN C HA   1  
ATOM 2859   H HB2  . GLN C  1 26 ? 0.841   -29.209 -245.790 1.00 0.00 ?  26 GLN C HB2  1  
ATOM 2860   H HB3  . GLN C  1 26 ? 0.956   -29.531 -244.043 1.00 0.00 ?  26 GLN C HB3  1  
ATOM 2861   H HG2  . GLN C  1 26 ? 1.376   -32.120 -244.726 1.00 0.00 ?  26 GLN C HG2  1  
ATOM 2862   H HG3  . GLN C  1 26 ? 1.096   -31.334 -246.298 1.00 0.00 ?  26 GLN C HG3  1  
ATOM 2863   H HE21 . GLN C  1 26 ? 3.379   -32.845 -245.770 1.00 0.00 ?  26 GLN C HE21 1  
ATOM 2864   H HE22 . GLN C  1 26 ? 4.757   -31.796 -245.738 1.00 0.00 ?  26 GLN C HE22 1  
ATOM 2865   N N    . VAL C  1 27 ? -1.663  -27.917 -245.056 1.00 0.00 ?  27 VAL C N    1  
ATOM 2866   C CA   . VAL C  1 27 ? -2.238  -26.685 -244.530 1.00 0.00 ?  27 VAL C CA   1  
ATOM 2867   C C    . VAL C  1 27 ? -3.750  -26.801 -244.383 1.00 0.00 ?  27 VAL C C    1  
ATOM 2868   O O    . VAL C  1 27 ? -4.354  -26.135 -243.542 1.00 0.00 ?  27 VAL C O    1  
ATOM 2869   C CB   . VAL C  1 27 ? -1.911  -25.479 -245.432 1.00 0.00 ?  27 VAL C CB   1  
ATOM 2870   C CG1  . VAL C  1 27 ? -2.800  -25.481 -246.666 1.00 0.00 ?  27 VAL C CG1  1  
ATOM 2871   C CG2  . VAL C  1 27 ? -2.074  -24.178 -244.661 1.00 0.00 ?  27 VAL C CG2  1  
ATOM 2872   H H    . VAL C  1 27 ? -1.358  -27.947 -246.018 1.00 0.00 ?  27 VAL C H    1  
ATOM 2873   H HA   . VAL C  1 27 ? -1.874  -26.475 -243.524 1.00 0.00 ?  27 VAL C HA   1  
ATOM 2874   H HB   . VAL C  1 27 ? -0.866  -25.538 -245.736 1.00 0.00 ?  27 VAL C HB   1  
ATOM 2875   H HG11 . VAL C  1 27 ? -2.555  -24.622 -247.292 1.00 0.00 ?  27 VAL C HG11 1  
ATOM 2876   H HG12 . VAL C  1 27 ? -2.636  -26.399 -247.231 1.00 0.00 ?  27 VAL C HG12 1  
ATOM 2877   H HG13 . VAL C  1 27 ? -3.844  -25.421 -246.363 1.00 0.00 ?  27 VAL C HG13 1  
ATOM 2878   H HG21 . VAL C  1 27 ? -1.399  -24.174 -243.806 1.00 0.00 ?  27 VAL C HG21 1  
ATOM 2879   H HG22 . VAL C  1 27 ? -1.839  -23.337 -245.313 1.00 0.00 ?  27 VAL C HG22 1  
ATOM 2880   H HG23 . VAL C  1 27 ? -3.103  -24.090 -244.312 1.00 0.00 ?  27 VAL C HG23 1  
ATOM 2881   N N    . THR C  1 28 ? -4.356  -27.650 -245.206 1.00 0.00 ?  28 THR C N    1  
ATOM 2882   C CA   . THR C  1 28 ? -5.779  -27.944 -245.091 1.00 0.00 ?  28 THR C CA   1  
ATOM 2883   C C    . THR C  1 28 ? -6.078  -28.734 -243.823 1.00 0.00 ?  28 THR C C    1  
ATOM 2884   O O    . THR C  1 28 ? -7.029  -28.433 -243.102 1.00 0.00 ?  28 THR C O    1  
ATOM 2885   C CB   . THR C  1 28 ? -6.294  -28.733 -246.309 1.00 0.00 ?  28 THR C CB   1  
ATOM 2886   O OG1  . THR C  1 28 ? -6.162  -27.933 -247.490 1.00 0.00 ?  28 THR C OG1  1  
ATOM 2887   C CG2  . THR C  1 28 ? -7.754  -29.115 -246.119 1.00 0.00 ?  28 THR C CG2  1  
ATOM 2888   H H    . THR C  1 28 ? -3.817  -28.103 -245.929 1.00 0.00 ?  28 THR C H    1  
ATOM 2889   H HA   . THR C  1 28 ? -6.343  -27.014 -245.014 1.00 0.00 ?  28 THR C HA   1  
ATOM 2890   H HB   . THR C  1 28 ? -5.695  -29.636 -246.424 1.00 0.00 ?  28 THR C HB   1  
ATOM 2891   H HG1  . THR C  1 28 ? -5.287  -27.537 -247.513 1.00 0.00 ?  28 THR C HG1  1  
ATOM 2892   H HG21 . THR C  1 28 ? -8.099  -29.672 -246.990 1.00 0.00 ?  28 THR C HG21 1  
ATOM 2893   H HG22 . THR C  1 28 ? -7.855  -29.733 -245.227 1.00 0.00 ?  28 THR C HG22 1  
ATOM 2894   H HG23 . THR C  1 28 ? -8.353  -28.212 -246.005 1.00 0.00 ?  28 THR C HG23 1  
ATOM 2895   N N    . GLU C  1 29 ? -5.260  -29.747 -243.557 1.00 0.00 ?  29 GLU C N    1  
ATOM 2896   C CA   . GLU C  1 29 ? -5.395  -30.542 -242.342 1.00 0.00 ?  29 GLU C CA   1  
ATOM 2897   C C    . GLU C  1 29 ? -5.058  -29.720 -241.105 1.00 0.00 ?  29 GLU C C    1  
ATOM 2898   O O    . GLU C  1 29 ? -5.661  -29.898 -240.047 1.00 0.00 ?  29 GLU C O    1  
ATOM 2899   C CB   . GLU C  1 29 ? -4.499  -31.781 -242.411 1.00 0.00 ?  29 GLU C CB   1  
ATOM 2900   C CG   . GLU C  1 29 ? -4.974  -32.847 -243.388 1.00 0.00 ?  29 GLU C CG   1  
ATOM 2901   C CD   . GLU C  1 29 ? -3.987  -33.976 -243.486 1.00 0.00 ?  29 GLU C CD   1  
ATOM 2902   O OE1  . GLU C  1 29 ? -2.948  -33.887 -242.877 1.00 0.00 ?  29 GLU C OE1  1  
ATOM 2903   O OE2  . GLU C  1 29 ? -4.316  -34.977 -244.078 1.00 0.00 -1 29 GLU C OE2  1  
ATOM 2904   H H    . GLU C  1 29 ? -4.525  -29.971 -244.212 1.00 0.00 ?  29 GLU C H    1  
ATOM 2905   H HA   . GLU C  1 29 ? -6.430  -30.866 -242.226 1.00 0.00 ?  29 GLU C HA   1  
ATOM 2906   H HB2  . GLU C  1 29 ? -3.506  -31.439 -242.701 1.00 0.00 ?  29 GLU C HB2  1  
ATOM 2907   H HB3  . GLU C  1 29 ? -4.460  -32.202 -241.406 1.00 0.00 ?  29 GLU C HB3  1  
ATOM 2908   H HG2  . GLU C  1 29 ? -5.959  -33.246 -243.150 1.00 0.00 ?  29 GLU C HG2  1  
ATOM 2909   H HG3  . GLU C  1 29 ? -5.018  -32.319 -244.340 1.00 0.00 ?  29 GLU C HG3  1  
ATOM 2910   N N    . ALA C  1 30 ? -4.092  -28.819 -241.245 1.00 0.00 ?  30 ALA C N    1  
ATOM 2911   C CA   . ALA C  1 30 ? -3.746  -27.894 -240.172 1.00 0.00 ?  30 ALA C CA   1  
ATOM 2912   C C    . ALA C  1 30 ? -4.906  -26.959 -239.856 1.00 0.00 ?  30 ALA C C    1  
ATOM 2913   O O    . ALA C  1 30 ? -5.155  -26.633 -238.695 1.00 0.00 ?  30 ALA C O    1  
ATOM 2914   C CB   . ALA C  1 30 ? -2.503  -27.097 -240.540 1.00 0.00 ?  30 ALA C CB   1  
ATOM 2915   H H    . ALA C  1 30 ? -3.584  -28.774 -242.116 1.00 0.00 ?  30 ALA C H    1  
ATOM 2916   H HA   . ALA C  1 30 ? -3.536  -28.468 -239.269 1.00 0.00 ?  30 ALA C HA   1  
ATOM 2917   H HB1  . ALA C  1 30 ? -2.692  -26.529 -241.450 1.00 0.00 ?  30 ALA C HB1  1  
ATOM 2918   H HB2  . ALA C  1 30 ? -2.259  -26.411 -239.729 1.00 0.00 ?  30 ALA C HB2  1  
ATOM 2919   H HB3  . ALA C  1 30 ? -1.668  -27.778 -240.703 1.00 0.00 ?  30 ALA C HB3  1  
ATOM 2920   N N    . LEU C  1 31 ? -5.614  -26.530 -240.895 1.00 0.00 ?  31 LEU C N    1  
ATOM 2921   C CA   . LEU C  1 31 ? -6.826  -25.739 -240.723 1.00 0.00 ?  31 LEU C CA   1  
ATOM 2922   C C    . LEU C  1 31 ? -7.917  -26.546 -240.031 1.00 0.00 ?  31 LEU C C    1  
ATOM 2923   O O    . LEU C  1 31 ? -8.579  -26.057 -239.116 1.00 0.00 ?  31 LEU C O    1  
ATOM 2924   C CB   . LEU C  1 31 ? -7.322  -25.226 -242.081 1.00 0.00 ?  31 LEU C CB   1  
ATOM 2925   C CG   . LEU C  1 31 ? -8.618  -24.406 -242.035 1.00 0.00 ?  31 LEU C CG   1  
ATOM 2926   C CD1  . LEU C  1 31 ? -8.428  -23.177 -241.157 1.00 0.00 ?  31 LEU C CD1  1  
ATOM 2927   C CD2  . LEU C  1 31 ? -9.016  -24.004 -243.448 1.00 0.00 ?  31 LEU C CD2  1  
ATOM 2928   H H    . LEU C  1 31 ? -5.304  -26.757 -241.829 1.00 0.00 ?  31 LEU C H    1  
ATOM 2929   H HA   . LEU C  1 31 ? -6.617  -24.886 -240.078 1.00 0.00 ?  31 LEU C HA   1  
ATOM 2930   H HB2  . LEU C  1 31 ? -6.483  -24.584 -242.344 1.00 0.00 ?  31 LEU C HB2  1  
ATOM 2931   H HB3  . LEU C  1 31 ? -7.406  -26.031 -242.810 1.00 0.00 ?  31 LEU C HB3  1  
ATOM 2932   H HG   . LEU C  1 31 ? -9.399  -25.057 -241.641 1.00 0.00 ?  31 LEU C HG   1  
ATOM 2933   H HD11 . LEU C  1 31 ? -9.353  -22.601 -241.131 1.00 0.00 ?  31 LEU C HD11 1  
ATOM 2934   H HD12 . LEU C  1 31 ? -8.167  -23.488 -240.146 1.00 0.00 ?  31 LEU C HD12 1  
ATOM 2935   H HD13 . LEU C  1 31 ? -7.629  -22.559 -241.565 1.00 0.00 ?  31 LEU C HD13 1  
ATOM 2936   H HD21 . LEU C  1 31 ? -9.174  -24.899 -244.050 1.00 0.00 ?  31 LEU C HD21 1  
ATOM 2937   H HD22 . LEU C  1 31 ? -9.937  -23.422 -243.414 1.00 0.00 ?  31 LEU C HD22 1  
ATOM 2938   H HD23 . LEU C  1 31 ? -8.222  -23.403 -243.892 1.00 0.00 ?  31 LEU C HD23 1  
ATOM 2939   N N    . ASP C  1 32 ? -8.099  -27.786 -240.474 1.00 0.00 ?  32 ASP C N    1  
ATOM 2940   C CA   . ASP C  1 32 ? -9.125  -28.657 -239.912 1.00 0.00 ?  32 ASP C CA   1  
ATOM 2941   C C    . ASP C  1 32 ? -8.933  -28.838 -238.412 1.00 0.00 ?  32 ASP C C    1  
ATOM 2942   O O    . ASP C  1 32 ? -9.892  -28.781 -237.643 1.00 0.00 ?  32 ASP C O    1  
ATOM 2943   C CB   . ASP C  1 32 ? -9.114  -30.018 -240.612 1.00 0.00 ?  32 ASP C CB   1  
ATOM 2944   C CG   . ASP C  1 32 ? -9.666  -30.001 -242.031 1.00 0.00 ?  32 ASP C CG   1  
ATOM 2945   O OD1  . ASP C  1 32 ? -10.268 -29.021 -242.401 1.00 0.00 ?  32 ASP C OD1  1  
ATOM 2946   O OD2  . ASP C  1 32 ? -9.349  -30.893 -242.781 1.00 0.00 -1 32 ASP C OD2  1  
ATOM 2947   H H    . ASP C  1 32 ? -7.512  -28.134 -241.218 1.00 0.00 ?  32 ASP C H    1  
ATOM 2948   H HA   . ASP C  1 32 ? -10.108 -28.204 -240.047 1.00 0.00 ?  32 ASP C HA   1  
ATOM 2949   H HB2  . ASP C  1 32 ? -8.137  -30.501 -240.609 1.00 0.00 ?  32 ASP C HB2  1  
ATOM 2950   H HB3  . ASP C  1 32 ? -9.795  -30.571 -239.964 1.00 0.00 ?  32 ASP C HB3  1  
ATOM 2951   N N    . LYS C  1 33 ? -7.688  -29.057 -238.002 1.00 0.00 ?  33 LYS C N    1  
ATOM 2952   C CA   . LYS C  1 33 ? -7.365  -29.223 -236.590 1.00 0.00 ?  33 LYS C CA   1  
ATOM 2953   C C    . LYS C  1 33 ? -7.493  -27.905 -235.837 1.00 0.00 ?  33 LYS C C    1  
ATOM 2954   O O    . LYS C  1 33 ? -8.070  -27.854 -234.751 1.00 0.00 ?  33 LYS C O    1  
ATOM 2955   C CB   . LYS C  1 33 ? -5.952  -29.787 -236.427 1.00 0.00 ?  33 LYS C CB   1  
ATOM 2956   C CG   . LYS C  1 33 ? -5.792  -31.227 -236.894 1.00 0.00 ?  33 LYS C CG   1  
ATOM 2957   C CD   . LYS C  1 33 ? -4.352  -31.698 -236.755 1.00 0.00 ?  33 LYS C CD   1  
ATOM 2958   C CE   . LYS C  1 33 ? -4.173  -33.106 -237.303 1.00 0.00 ?  33 LYS C CE   1  
ATOM 2959   N NZ   . LYS C  1 33 ? -2.760  -33.563 -237.212 1.00 0.00 1  33 LYS C NZ   1  
ATOM 2960   H H    . LYS C  1 33 ? -6.947  -29.109 -238.686 1.00 0.00 ?  33 LYS C H    1  
ATOM 2961   H HA   . LYS C  1 33 ? -8.071  -29.914 -236.129 1.00 0.00 ?  33 LYS C HA   1  
ATOM 2962   H HB2  . LYS C  1 33 ? -5.284  -29.144 -237.000 1.00 0.00 ?  33 LYS C HB2  1  
ATOM 2963   H HB3  . LYS C  1 33 ? -5.701  -29.719 -235.368 1.00 0.00 ?  33 LYS C HB3  1  
ATOM 2964   H HG2  . LYS C  1 33 ? -6.442  -31.861 -236.290 1.00 0.00 ?  33 LYS C HG2  1  
ATOM 2965   H HG3  . LYS C  1 33 ? -6.096  -31.289 -237.939 1.00 0.00 ?  33 LYS C HG3  1  
ATOM 2966   H HD2  . LYS C  1 33 ? -3.707  -31.009 -237.302 1.00 0.00 ?  33 LYS C HD2  1  
ATOM 2967   H HD3  . LYS C  1 33 ? -4.083  -31.684 -235.699 1.00 0.00 ?  33 LYS C HD3  1  
ATOM 2968   H HE2  . LYS C  1 33 ? -4.810  -33.779 -236.731 1.00 0.00 ?  33 LYS C HE2  1  
ATOM 2969   H HE3  . LYS C  1 33 ? -4.488  -33.108 -238.347 1.00 0.00 ?  33 LYS C HE3  1  
ATOM 2970   H HZ1  . LYS C  1 33 ? -2.468  -33.562 -236.246 1.00 0.00 ?  33 LYS C HZ1  1  
ATOM 2971   H HZ2  . LYS C  1 33 ? -2.684  -34.498 -237.586 1.00 0.00 ?  33 LYS C HZ2  1  
ATOM 2972   H HZ3  . LYS C  1 33 ? -2.169  -32.939 -237.744 1.00 0.00 ?  33 LYS C HZ3  1  
ATOM 2973   N N    . LEU C  1 34 ? -6.951  -26.841 -236.420 1.00 0.00 ?  34 LEU C N    1  
ATOM 2974   C CA   . LEU C  1 34 ? -6.986  -25.524 -235.795 1.00 0.00 ?  34 LEU C CA   1  
ATOM 2975   C C    . LEU C  1 34 ? -8.419  -25.068 -235.551 1.00 0.00 ?  34 LEU C C    1  
ATOM 2976   O O    . LEU C  1 34 ? -8.708  -24.404 -234.555 1.00 0.00 ?  34 LEU C O    1  
ATOM 2977   C CB   . LEU C  1 34 ? -6.242  -24.504 -236.666 1.00 0.00 ?  34 LEU C CB   1  
ATOM 2978   C CG   . LEU C  1 34 ? -6.146  -23.091 -236.078 1.00 0.00 ?  34 LEU C CG   1  
ATOM 2979   C CD1  . LEU C  1 34 ? -5.371  -23.122 -234.768 1.00 0.00 ?  34 LEU C CD1  1  
ATOM 2980   C CD2  . LEU C  1 34 ? -5.473  -22.167 -237.082 1.00 0.00 ?  34 LEU C CD2  1  
ATOM 2981   H H    . LEU C  1 34 ? -6.504  -26.947 -237.319 1.00 0.00 ?  34 LEU C H    1  
ATOM 2982   H HA   . LEU C  1 34 ? -6.506  -25.571 -234.818 1.00 0.00 ?  34 LEU C HA   1  
ATOM 2983   H HB2  . LEU C  1 34 ? -5.258  -24.970 -236.682 1.00 0.00 ?  34 LEU C HB2  1  
ATOM 2984   H HB3  . LEU C  1 34 ? -6.644  -24.469 -237.678 1.00 0.00 ?  34 LEU C HB3  1  
ATOM 2985   H HG   . LEU C  1 34 ? -7.165  -22.733 -235.927 1.00 0.00 ?  34 LEU C HG   1  
ATOM 2986   H HD11 . LEU C  1 34 ? -5.308  -22.113 -234.358 1.00 0.00 ?  34 LEU C HD11 1  
ATOM 2987   H HD12 . LEU C  1 34 ? -5.883  -23.770 -234.057 1.00 0.00 ?  34 LEU C HD12 1  
ATOM 2988   H HD13 . LEU C  1 34 ? -4.366  -23.502 -234.949 1.00 0.00 ?  34 LEU C HD13 1  
ATOM 2989   H HD21 . LEU C  1 34 ? -6.059  -22.138 -238.001 1.00 0.00 ?  34 LEU C HD21 1  
ATOM 2990   H HD22 . LEU C  1 34 ? -5.406  -21.162 -236.663 1.00 0.00 ?  34 LEU C HD22 1  
ATOM 2991   H HD23 . LEU C  1 34 ? -4.471  -22.537 -237.302 1.00 0.00 ?  34 LEU C HD23 1  
ATOM 2992   N N    . ALA C  1 35 ? -9.313  -25.428 -236.465 1.00 0.00 ?  35 ALA C N    1  
ATOM 2993   C CA   . ALA C  1 35 ? -10.727 -25.103 -236.324 1.00 0.00 ?  35 ALA C CA   1  
ATOM 2994   C C    . ALA C  1 35 ? -11.288 -25.644 -235.015 1.00 0.00 ?  35 ALA C C    1  
ATOM 2995   O O    . ALA C  1 35 ? -12.135 -25.013 -234.383 1.00 0.00 ?  35 ALA C O    1  
ATOM 2996   C CB   . ALA C  1 35 ? -11.516 -25.645 -237.507 1.00 0.00 ?  35 ALA C CB   1  
ATOM 2997   H H    . ALA C  1 35 ? -9.005  -25.940 -237.280 1.00 0.00 ?  35 ALA C H    1  
ATOM 2998   H HA   . ALA C  1 35 ? -10.836 -24.019 -236.300 1.00 0.00 ?  35 ALA C HA   1  
ATOM 2999   H HB1  . ALA C  1 35 ? -11.405 -26.727 -237.553 1.00 0.00 ?  35 ALA C HB1  1  
ATOM 3000   H HB2  . ALA C  1 35 ? -12.570 -25.394 -237.385 1.00 0.00 ?  35 ALA C HB2  1  
ATOM 3001   H HB3  . ALA C  1 35 ? -11.142 -25.201 -238.429 1.00 0.00 ?  35 ALA C HB3  1  
ATOM 3002   N N    . ALA C  1 36 ? -10.810 -26.817 -234.612 1.00 0.00 ?  36 ALA C N    1  
ATOM 3003   C CA   . ALA C  1 36 ? -11.257 -27.441 -233.373 1.00 0.00 ?  36 ALA C CA   1  
ATOM 3004   C C    . ALA C  1 36 ? -10.702 -26.712 -232.157 1.00 0.00 ?  36 ALA C C    1  
ATOM 3005   O O    . ALA C  1 36 ? -11.412 -26.489 -231.176 1.00 0.00 ?  36 ALA C O    1  
ATOM 3006   C CB   . ALA C  1 36 ? -10.855 -28.909 -233.344 1.00 0.00 ?  36 ALA C CB   1  
ATOM 3007   H H    . ALA C  1 36 ? -10.120 -27.288 -235.179 1.00 0.00 ?  36 ALA C H    1  
ATOM 3008   H HA   . ALA C  1 36 ? -12.344 -27.378 -233.321 1.00 0.00 ?  36 ALA C HA   1  
ATOM 3009   H HB1  . ALA C  1 36 ? -9.772  -28.990 -233.410 1.00 0.00 ?  36 ALA C HB1  1  
ATOM 3010   H HB2  . ALA C  1 36 ? -11.197 -29.360 -232.412 1.00 0.00 ?  36 ALA C HB2  1  
ATOM 3011   H HB3  . ALA C  1 36 ? -11.311 -29.428 -234.187 1.00 0.00 ?  36 ALA C HB3  1  
ATOM 3012   N N    . LYS C  1 37 ? -9.428  -26.342 -232.226 1.00 0.00 ?  37 LYS C N    1  
ATOM 3013   C CA   . LYS C  1 37 ? -8.781  -25.615 -231.140 1.00 0.00 ?  37 LYS C CA   1  
ATOM 3014   C C    . LYS C  1 37 ? -7.976  -24.435 -231.669 1.00 0.00 ?  37 LYS C C    1  
ATOM 3015   O O    . LYS C  1 37 ? -6.752  -24.505 -231.779 1.00 0.00 ?  37 LYS C O    1  
ATOM 3016   C CB   . LYS C  1 37 ? -7.876  -26.549 -230.335 1.00 0.00 ?  37 LYS C CB   1  
ATOM 3017   C CG   . LYS C  1 37 ? -8.603  -27.711 -229.670 1.00 0.00 ?  37 LYS C CG   1  
ATOM 3018   C CD   . LYS C  1 37 ? -7.669  -28.506 -228.770 1.00 0.00 ?  37 LYS C CD   1  
ATOM 3019   C CE   . LYS C  1 37 ? -8.380  -29.700 -228.151 1.00 0.00 ?  37 LYS C CE   1  
ATOM 3020   N NZ   . LYS C  1 37 ? -7.481  -30.482 -227.259 1.00 0.00 1  37 LYS C NZ   1  
ATOM 3021   H H    . LYS C  1 37 ? -8.893  -26.569 -233.052 1.00 0.00 ?  37 LYS C H    1  
ATOM 3022   H HA   . LYS C  1 37 ? -9.536  -25.201 -230.471 1.00 0.00 ?  37 LYS C HA   1  
ATOM 3023   H HB2  . LYS C  1 37 ? -7.125  -26.938 -231.023 1.00 0.00 ?  37 LYS C HB2  1  
ATOM 3024   H HB3  . LYS C  1 37 ? -7.388  -25.943 -229.572 1.00 0.00 ?  37 LYS C HB3  1  
ATOM 3025   H HG2  . LYS C  1 37 ? -9.426  -27.310 -229.077 1.00 0.00 ?  37 LYS C HG2  1  
ATOM 3026   H HG3  . LYS C  1 37 ? -9.000  -28.362 -230.448 1.00 0.00 ?  37 LYS C HG3  1  
ATOM 3027   H HD2  . LYS C  1 37 ? -6.825  -28.854 -229.367 1.00 0.00 ?  37 LYS C HD2  1  
ATOM 3028   H HD3  . LYS C  1 37 ? -7.307  -27.849 -227.979 1.00 0.00 ?  37 LYS C HD3  1  
ATOM 3029   H HE2  . LYS C  1 37 ? -9.229  -29.333 -227.577 1.00 0.00 ?  37 LYS C HE2  1  
ATOM 3030   H HE3  . LYS C  1 37 ? -8.737  -30.341 -228.957 1.00 0.00 ?  37 LYS C HE3  1  
ATOM 3031   H HZ1  . LYS C  1 37 ? -7.150  -29.889 -226.511 1.00 0.00 ?  37 LYS C HZ1  1  
ATOM 3032   H HZ2  . LYS C  1 37 ? -7.989  -31.263 -226.870 1.00 0.00 ?  37 LYS C HZ2  1  
ATOM 3033   H HZ3  . LYS C  1 37 ? -6.693  -30.824 -227.791 1.00 0.00 ?  37 LYS C HZ3  1  
ATOM 3034   N N    . PRO C  1 38 ? -8.671  -23.350 -231.995 1.00 0.00 ?  38 PRO C N    1  
ATOM 3035   C CA   . PRO C  1 38 ? -8.026  -22.161 -232.539 1.00 0.00 ?  38 PRO C CA   1  
ATOM 3036   C C    . PRO C  1 38 ? -6.993  -21.603 -231.568 1.00 0.00 ?  38 PRO C C    1  
ATOM 3037   O O    . PRO C  1 38 ? -6.048  -20.927 -231.973 1.00 0.00 ?  38 PRO C O    1  
ATOM 3038   C CB   . PRO C  1 38 ? -9.181  -21.184 -232.776 1.00 0.00 ?  38 PRO C CB   1  
ATOM 3039   C CG   . PRO C  1 38 ? -10.383 -22.055 -232.911 1.00 0.00 ?  38 PRO C CG   1  
ATOM 3040   C CD   . PRO C  1 38 ? -10.151 -23.204 -231.966 1.00 0.00 ?  38 PRO C CD   1  
ATOM 3041   H HA   . PRO C  1 38 ? -7.465  -22.366 -233.463 1.00 0.00 ?  38 PRO C HA   1  
ATOM 3042   H HB2  . PRO C  1 38 ? -9.292  -20.479 -231.939 1.00 0.00 ?  38 PRO C HB2  1  
ATOM 3043   H HB3  . PRO C  1 38 ? -9.021  -20.583 -233.684 1.00 0.00 ?  38 PRO C HB3  1  
ATOM 3044   H HG2  . PRO C  1 38 ? -11.302 -21.508 -232.652 1.00 0.00 ?  38 PRO C HG2  1  
ATOM 3045   H HG3  . PRO C  1 38 ? -10.502 -22.411 -233.945 1.00 0.00 ?  38 PRO C HG3  1  
ATOM 3046   H HD2  . PRO C  1 38 ? -10.514 -22.986 -230.951 1.00 0.00 ?  38 PRO C HD2  1  
ATOM 3047   H HD3  . PRO C  1 38 ? -10.656 -24.123 -232.298 1.00 0.00 ?  38 PRO C HD3  1  
ATOM 3048   N N    . SER C  1 39 ? -7.179  -21.890 -230.284 1.00 0.00 ?  39 SER C N    1  
ATOM 3049   C CA   . SER C  1 39 ? -6.365  -21.284 -229.237 1.00 0.00 ?  39 SER C CA   1  
ATOM 3050   C C    . SER C  1 39 ? -5.126  -22.121 -228.948 1.00 0.00 ?  39 SER C C    1  
ATOM 3051   O O    . SER C  1 39 ? -4.396  -21.857 -227.994 1.00 0.00 ?  39 SER C O    1  
ATOM 3052   C CB   . SER C  1 39 ? -7.187  -21.104 -227.976 1.00 0.00 ?  39 SER C CB   1  
ATOM 3053   O OG   . SER C  1 39 ? -7.547  -22.330 -227.402 1.00 0.00 ?  39 SER C OG   1  
ATOM 3054   H H    . SER C  1 39 ? -7.903  -22.546 -230.027 1.00 0.00 ?  39 SER C H    1  
ATOM 3055   H HA   . SER C  1 39 ? -6.076  -20.255 -229.456 1.00 0.00 ?  39 SER C HA   1  
ATOM 3056   H HB2  . SER C  1 39 ? -6.599  -20.534 -227.256 1.00 0.00 ?  39 SER C HB2  1  
ATOM 3057   H HB3  . SER C  1 39 ? -8.091  -20.549 -228.224 1.00 0.00 ?  39 SER C HB3  1  
ATOM 3058   H HG   . SER C  1 39 ? -8.067  -22.837 -228.031 1.00 0.00 ?  39 SER C HG   1  
ATOM 3059   N N    . ASP C  1 40 ? -4.894  -23.132 -229.779 1.00 0.00 ?  40 ASP C N    1  
ATOM 3060   C CA   . ASP C  1 40 ? -3.709  -23.971 -229.653 1.00 0.00 ?  40 ASP C CA   1  
ATOM 3061   C C    . ASP C  1 40 ? -2.511  -23.340 -230.352 1.00 0.00 ?  40 ASP C C    1  
ATOM 3062   O O    . ASP C  1 40 ? -2.503  -23.189 -231.574 1.00 0.00 ?  40 ASP C O    1  
ATOM 3063   C CB   . ASP C  1 40 ? -3.975  -25.366 -230.222 1.00 0.00 ?  40 ASP C CB   1  
ATOM 3064   C CG   . ASP C  1 40 ? -2.832  -26.353 -230.030 1.00 0.00 ?  40 ASP C CG   1  
ATOM 3065   O OD1  . ASP C  1 40 ? -1.792  -25.946 -229.568 1.00 0.00 ?  40 ASP C OD1  1  
ATOM 3066   O OD2  . ASP C  1 40 ? -3.054  -27.529 -230.197 1.00 0.00 -1 40 ASP C OD2  1  
ATOM 3067   H H    . ASP C  1 40 ? -5.557  -23.324 -230.517 1.00 0.00 ?  40 ASP C H    1  
ATOM 3068   H HA   . ASP C  1 40 ? -3.437  -24.070 -228.601 1.00 0.00 ?  40 ASP C HA   1  
ATOM 3069   H HB2  . ASP C  1 40 ? -4.903  -25.812 -229.863 1.00 0.00 ?  40 ASP C HB2  1  
ATOM 3070   H HB3  . ASP C  1 40 ? -4.073  -25.125 -231.281 1.00 0.00 ?  40 ASP C HB3  1  
ATOM 3071   N N    . PRO C  1 41 ? -1.501  -22.975 -229.570 1.00 0.00 ?  41 PRO C N    1  
ATOM 3072   C CA   . PRO C  1 41 ? -0.296  -22.360 -230.113 1.00 0.00 ?  41 PRO C CA   1  
ATOM 3073   C C    . PRO C  1 41 ? 0.361   -23.259 -231.153 1.00 0.00 ?  41 PRO C C    1  
ATOM 3074   O O    . PRO C  1 41 ? 0.906   -22.779 -232.147 1.00 0.00 ?  41 PRO C O    1  
ATOM 3075   C CB   . PRO C  1 41 ? 0.600   -22.145 -228.889 1.00 0.00 ?  41 PRO C CB   1  
ATOM 3076   C CG   . PRO C  1 41 ? -0.349  -22.091 -227.740 1.00 0.00 ?  41 PRO C CG   1  
ATOM 3077   C CD   . PRO C  1 41 ? -1.454  -23.051 -228.090 1.00 0.00 ?  41 PRO C CD   1  
ATOM 3078   H HA   . PRO C  1 41 ? -0.500  -21.417 -230.642 1.00 0.00 ?  41 PRO C HA   1  
ATOM 3079   H HB2  . PRO C  1 41 ? 1.323   -22.965 -228.769 1.00 0.00 ?  41 PRO C HB2  1  
ATOM 3080   H HB3  . PRO C  1 41 ? 1.179   -21.214 -228.971 1.00 0.00 ?  41 PRO C HB3  1  
ATOM 3081   H HG2  . PRO C  1 41 ? 0.146   -22.382 -226.802 1.00 0.00 ?  41 PRO C HG2  1  
ATOM 3082   H HG3  . PRO C  1 41 ? -0.740  -21.073 -227.596 1.00 0.00 ?  41 PRO C HG3  1  
ATOM 3083   H HD2  . PRO C  1 41 ? -1.239  -24.075 -227.751 1.00 0.00 ?  41 PRO C HD2  1  
ATOM 3084   H HD3  . PRO C  1 41 ? -2.416  -22.760 -227.641 1.00 0.00 ?  41 PRO C HD3  1  
ATOM 3085   N N    . ALA C  1 42 ? 0.307   -24.565 -230.917 1.00 0.00 ?  42 ALA C N    1  
ATOM 3086   C CA   . ALA C  1 42 ? 0.938   -25.531 -231.808 1.00 0.00 ?  42 ALA C CA   1  
ATOM 3087   C C    . ALA C  1 42 ? 0.246   -25.566 -233.164 1.00 0.00 ?  42 ALA C C    1  
ATOM 3088   O O    . ALA C  1 42 ? 0.901   -25.611 -234.205 1.00 0.00 ?  42 ALA C O    1  
ATOM 3089   C CB   . ALA C  1 42 ? 0.939   -26.915 -231.174 1.00 0.00 ?  42 ALA C CB   1  
ATOM 3090   H H    . ALA C  1 42 ? -0.185  -24.898 -230.100 1.00 0.00 ?  42 ALA C H    1  
ATOM 3091   H HA   . ALA C  1 42 ? 1.971   -25.227 -231.978 1.00 0.00 ?  42 ALA C HA   1  
ATOM 3092   H HB1  . ALA C  1 42 ? -0.087  -27.228 -230.983 1.00 0.00 ?  42 ALA C HB1  1  
ATOM 3093   H HB2  . ALA C  1 42 ? 1.414   -27.624 -231.851 1.00 0.00 ?  42 ALA C HB2  1  
ATOM 3094   H HB3  . ALA C  1 42 ? 1.491   -26.885 -230.234 1.00 0.00 ?  42 ALA C HB3  1  
ATOM 3095   N N    . LEU C  1 43 ? -1.082  -25.544 -233.145 1.00 0.00 ?  43 LEU C N    1  
ATOM 3096   C CA   . LEU C  1 43 ? -1.866  -25.550 -234.374 1.00 0.00 ?  43 LEU C CA   1  
ATOM 3097   C C    . LEU C  1 43 ? -1.770  -24.212 -235.096 1.00 0.00 ?  43 LEU C C    1  
ATOM 3098   O O    . LEU C  1 43 ? -1.761  -24.159 -236.326 1.00 0.00 ?  43 LEU C O    1  
ATOM 3099   C CB   . LEU C  1 43 ? -3.331  -25.886 -234.067 1.00 0.00 ?  43 LEU C CB   1  
ATOM 3100   C CG   . LEU C  1 43 ? -3.578  -27.303 -233.536 1.00 0.00 ?  43 LEU C CG   1  
ATOM 3101   C CD1  . LEU C  1 43 ? -5.029  -27.452 -233.099 1.00 0.00 ?  43 LEU C CD1  1  
ATOM 3102   C CD2  . LEU C  1 43 ? -3.234  -28.319 -234.615 1.00 0.00 ?  43 LEU C CD2  1  
ATOM 3103   H H    . LEU C  1 43 ? -1.562  -25.522 -232.256 1.00 0.00 ?  43 LEU C H    1  
ATOM 3104   H HA   . LEU C  1 43 ? -1.468  -26.299 -235.057 1.00 0.00 ?  43 LEU C HA   1  
ATOM 3105   H HB2  . LEU C  1 43 ? -3.520  -25.154 -233.283 1.00 0.00 ?  43 LEU C HB2  1  
ATOM 3106   H HB3  . LEU C  1 43 ? -3.980  -25.680 -234.919 1.00 0.00 ?  43 LEU C HB3  1  
ATOM 3107   H HG   . LEU C  1 43 ? -2.895  -27.460 -232.701 1.00 0.00 ?  43 LEU C HG   1  
ATOM 3108   H HD11 . LEU C  1 43 ? -5.195  -28.461 -232.723 1.00 0.00 ?  43 LEU C HD11 1  
ATOM 3109   H HD12 . LEU C  1 43 ? -5.247  -26.731 -232.310 1.00 0.00 ?  43 LEU C HD12 1  
ATOM 3110   H HD13 . LEU C  1 43 ? -5.686  -27.269 -233.949 1.00 0.00 ?  43 LEU C HD13 1  
ATOM 3111   H HD21 . LEU C  1 43 ? -2.185  -28.214 -234.893 1.00 0.00 ?  43 LEU C HD21 1  
ATOM 3112   H HD22 . LEU C  1 43 ? -3.409  -29.326 -234.236 1.00 0.00 ?  43 LEU C HD22 1  
ATOM 3113   H HD23 . LEU C  1 43 ? -3.860  -28.146 -235.491 1.00 0.00 ?  43 LEU C HD23 1  
ATOM 3114   N N    . LEU C  1 44 ? -1.697  -23.133 -234.324 1.00 0.00 ?  44 LEU C N    1  
ATOM 3115   C CA   . LEU C  1 44 ? -1.549  -21.796 -234.888 1.00 0.00 ?  44 LEU C CA   1  
ATOM 3116   C C    . LEU C  1 44 ? -0.211  -21.644 -235.600 1.00 0.00 ?  44 LEU C C    1  
ATOM 3117   O O    . LEU C  1 44 ? -0.151  -21.162 -236.731 1.00 0.00 ?  44 LEU C O    1  
ATOM 3118   C CB   . LEU C  1 44 ? -1.692  -20.738 -233.787 1.00 0.00 ?  44 LEU C CB   1  
ATOM 3119   C CG   . LEU C  1 44 ? -3.125  -20.493 -233.299 1.00 0.00 ?  44 LEU C CG   1  
ATOM 3120   C CD1  . LEU C  1 44 ? -3.109  -19.634 -232.042 1.00 0.00 ?  44 LEU C CD1  1  
ATOM 3121   C CD2  . LEU C  1 44 ? -3.931  -19.822 -234.401 1.00 0.00 ?  44 LEU C CD2  1  
ATOM 3122   H H    . LEU C  1 44 ? -1.745  -23.241 -233.321 1.00 0.00 ?  44 LEU C H    1  
ATOM 3123   H HA   . LEU C  1 44 ? -2.320  -21.630 -235.640 1.00 0.00 ?  44 LEU C HA   1  
ATOM 3124   H HB2  . LEU C  1 44 ? -1.107  -21.217 -233.004 1.00 0.00 ?  44 LEU C HB2  1  
ATOM 3125   H HB3  . LEU C  1 44 ? -1.220  -19.797 -234.068 1.00 0.00 ?  44 LEU C HB3  1  
ATOM 3126   H HG   . LEU C  1 44 ? -3.573  -21.469 -233.106 1.00 0.00 ?  44 LEU C HG   1  
ATOM 3127   H HD11 . LEU C  1 44 ? -4.131  -19.465 -231.702 1.00 0.00 ?  44 LEU C HD11 1  
ATOM 3128   H HD12 . LEU C  1 44 ? -2.547  -20.144 -231.259 1.00 0.00 ?  44 LEU C HD12 1  
ATOM 3129   H HD13 . LEU C  1 44 ? -2.638  -18.676 -232.262 1.00 0.00 ?  44 LEU C HD13 1  
ATOM 3130   H HD21 . LEU C  1 44 ? -3.953  -20.466 -235.280 1.00 0.00 ?  44 LEU C HD21 1  
ATOM 3131   H HD22 . LEU C  1 44 ? -4.950  -19.649 -234.053 1.00 0.00 ?  44 LEU C HD22 1  
ATOM 3132   H HD23 . LEU C  1 44 ? -3.469  -18.869 -234.661 1.00 0.00 ?  44 LEU C HD23 1  
ATOM 3133   N N    . ALA C  1 45 ? 0.860   -22.057 -234.931 1.00 0.00 ?  45 ALA C N    1  
ATOM 3134   C CA   . ALA C  1 45 ? 2.203   -21.931 -235.483 1.00 0.00 ?  45 ALA C CA   1  
ATOM 3135   C C    . ALA C  1 45 ? 2.373   -22.800 -236.722 1.00 0.00 ?  45 ALA C C    1  
ATOM 3136   O O    . ALA C  1 45 ? 2.904   -22.352 -237.738 1.00 0.00 ?  45 ALA C O    1  
ATOM 3137   C CB   . ALA C  1 45 ? 3.244   -22.291 -234.432 1.00 0.00 ?  45 ALA C CB   1  
ATOM 3138   H H    . ALA C  1 45 ? 0.740   -22.468 -234.016 1.00 0.00 ?  45 ALA C H    1  
ATOM 3139   H HA   . ALA C  1 45 ? 2.361   -20.896 -235.787 1.00 0.00 ?  45 ALA C HA   1  
ATOM 3140   H HB1  . ALA C  1 45 ? 3.090   -23.319 -234.106 1.00 0.00 ?  45 ALA C HB1  1  
ATOM 3141   H HB2  . ALA C  1 45 ? 4.241   -22.192 -234.860 1.00 0.00 ?  45 ALA C HB2  1  
ATOM 3142   H HB3  . ALA C  1 45 ? 3.147   -21.620 -233.578 1.00 0.00 ?  45 ALA C HB3  1  
ATOM 3143   N N    . ALA C  1 46 ? 1.920   -24.046 -236.632 1.00 0.00 ?  46 ALA C N    1  
ATOM 3144   C CA   . ALA C  1 46 ? 2.035   -24.985 -237.741 1.00 0.00 ?  46 ALA C CA   1  
ATOM 3145   C C    . ALA C  1 46 ? 1.216   -24.525 -238.940 1.00 0.00 ?  46 ALA C C    1  
ATOM 3146   O O    . ALA C  1 46 ? 1.705   -24.509 -240.069 1.00 0.00 ?  46 ALA C O    1  
ATOM 3147   C CB   . ALA C  1 46 ? 1.604   -26.377 -237.303 1.00 0.00 ?  46 ALA C CB   1  
ATOM 3148   H H    . ALA C  1 46 ? 1.484   -24.350 -235.773 1.00 0.00 ?  46 ALA C H    1  
ATOM 3149   H HA   . ALA C  1 46 ? 3.078   -25.027 -238.057 1.00 0.00 ?  46 ALA C HA   1  
ATOM 3150   H HB1  . ALA C  1 46 ? 0.568   -26.349 -236.969 1.00 0.00 ?  46 ALA C HB1  1  
ATOM 3151   H HB2  . ALA C  1 46 ? 1.696   -27.067 -238.142 1.00 0.00 ?  46 ALA C HB2  1  
ATOM 3152   H HB3  . ALA C  1 46 ? 2.241   -26.715 -236.485 1.00 0.00 ?  46 ALA C HB3  1  
ATOM 3153   N N    . TYR C  1 47 ? -0.034  -24.152 -238.688 1.00 0.00 ?  47 TYR C N    1  
ATOM 3154   C CA   . TYR C  1 47 ? -0.939  -23.734 -239.752 1.00 0.00 ?  47 TYR C CA   1  
ATOM 3155   C C    . TYR C  1 47 ? -0.446  -22.460 -240.425 1.00 0.00 ?  47 TYR C C    1  
ATOM 3156   O O    . TYR C  1 47 ? -0.381  -22.379 -241.652 1.00 0.00 ?  47 TYR C O    1  
ATOM 3157   C CB   . TYR C  1 47 ? -2.352  -23.526 -239.203 1.00 0.00 ?  47 TYR C CB   1  
ATOM 3158   C CG   . TYR C  1 47 ? -3.313  -22.917 -240.199 1.00 0.00 ?  47 TYR C CG   1  
ATOM 3159   C CD1  . TYR C  1 47 ? -3.631  -23.576 -241.378 1.00 0.00 ?  47 TYR C CD1  1  
ATOM 3160   C CD2  . TYR C  1 47 ? -3.902  -21.684 -239.957 1.00 0.00 ?  47 TYR C CD2  1  
ATOM 3161   C CE1  . TYR C  1 47 ? -4.508  -23.024 -242.291 1.00 0.00 ?  47 TYR C CE1  1  
ATOM 3162   C CE2  . TYR C  1 47 ? -4.780  -21.123 -240.863 1.00 0.00 ?  47 TYR C CE2  1  
ATOM 3163   C CZ   . TYR C  1 47 ? -5.081  -21.796 -242.030 1.00 0.00 ?  47 TYR C CZ   1  
ATOM 3164   O OH   . TYR C  1 47 ? -5.957  -21.241 -242.935 1.00 0.00 ?  47 TYR C OH   1  
ATOM 3165   H H    . TYR C  1 47 ? -0.366  -24.157 -237.734 1.00 0.00 ?  47 TYR C H    1  
ATOM 3166   H HA   . TYR C  1 47 ? -0.977  -24.500 -240.527 1.00 0.00 ?  47 TYR C HA   1  
ATOM 3167   H HB2  . TYR C  1 47 ? -2.724  -24.502 -238.890 1.00 0.00 ?  47 TYR C HB2  1  
ATOM 3168   H HB3  . TYR C  1 47 ? -2.267  -22.873 -238.334 1.00 0.00 ?  47 TYR C HB3  1  
ATOM 3169   H HD1  . TYR C  1 47 ? -3.174  -24.545 -241.578 1.00 0.00 ?  47 TYR C HD1  1  
ATOM 3170   H HD2  . TYR C  1 47 ? -3.659  -21.157 -239.034 1.00 0.00 ?  47 TYR C HD2  1  
ATOM 3171   H HE1  . TYR C  1 47 ? -4.748  -23.553 -243.213 1.00 0.00 ?  47 TYR C HE1  1  
ATOM 3172   H HE2  . TYR C  1 47 ? -5.232  -20.152 -240.655 1.00 0.00 ?  47 TYR C HE2  1  
ATOM 3173   H HH   . TYR C  1 47 ? -6.296  -20.388 -242.655 1.00 0.00 ?  47 TYR C HH   1  
ATOM 3174   N N    . GLN C  1 48 ? -0.100  -21.465 -239.615 1.00 0.00 ?  48 GLN C N    1  
ATOM 3175   C CA   . GLN C  1 48 ? 0.329   -20.171 -240.131 1.00 0.00 ?  48 GLN C CA   1  
ATOM 3176   C C    . GLN C  1 48 ? 1.635   -20.292 -240.906 1.00 0.00 ?  48 GLN C C    1  
ATOM 3177   O O    . GLN C  1 48 ? 1.823   -19.637 -241.931 1.00 0.00 ?  48 GLN C O    1  
ATOM 3178   C CB   . GLN C  1 48 ? 0.498   -19.167 -238.988 1.00 0.00 ?  48 GLN C CB   1  
ATOM 3179   C CG   . GLN C  1 48 ? 0.732   -17.737 -239.444 1.00 0.00 ?  48 GLN C CG   1  
ATOM 3180   C CD   . GLN C  1 48 ? 2.175   -17.484 -239.839 1.00 0.00 ?  48 GLN C CD   1  
ATOM 3181   O OE1  . GLN C  1 48 ? 3.103   -18.023 -239.230 1.00 0.00 ?  48 GLN C OE1  1  
ATOM 3182   N NE2  . GLN C  1 48 ? 2.372   -16.658 -240.860 1.00 0.00 ?  48 GLN C NE2  1  
ATOM 3183   H H    . GLN C  1 48 ? -0.135  -21.609 -238.616 1.00 0.00 ?  48 GLN C H    1  
ATOM 3184   H HA   . GLN C  1 48 ? -0.414  -19.793 -240.834 1.00 0.00 ?  48 GLN C HA   1  
ATOM 3185   H HB2  . GLN C  1 48 ? -0.410  -19.218 -238.387 1.00 0.00 ?  48 GLN C HB2  1  
ATOM 3186   H HB3  . GLN C  1 48 ? 1.346   -19.507 -238.394 1.00 0.00 ?  48 GLN C HB3  1  
ATOM 3187   H HG2  . GLN C  1 48 ? 0.094   -17.238 -240.173 1.00 0.00 ?  48 GLN C HG2  1  
ATOM 3188   H HG3  . GLN C  1 48 ? 0.563   -17.302 -238.458 1.00 0.00 ?  48 GLN C HG3  1  
ATOM 3189   H HE21 . GLN C  1 48 ? 1.591   -16.241 -241.324 1.00 0.00 ?  48 GLN C HE21 1  
ATOM 3190   H HE22 . GLN C  1 48 ? 3.303   -16.452 -241.165 1.00 0.00 ?  48 GLN C HE22 1  
ATOM 3191   N N    . SER C  1 49 ? 2.535   -21.134 -240.410 1.00 0.00 ?  49 SER C N    1  
ATOM 3192   C CA   . SER C  1 49 ? 3.805   -21.381 -241.082 1.00 0.00 ?  49 SER C CA   1  
ATOM 3193   C C    . SER C  1 49 ? 3.590   -21.999 -242.457 1.00 0.00 ?  49 SER C C    1  
ATOM 3194   O O    . SER C  1 49 ? 4.229   -21.605 -243.432 1.00 0.00 ?  49 SER C O    1  
ATOM 3195   C CB   . SER C  1 49 ? 4.680   -22.281 -240.230 1.00 0.00 ?  49 SER C CB   1  
ATOM 3196   O OG   . SER C  1 49 ? 5.891   -22.590 -240.863 1.00 0.00 ?  49 SER C OG   1  
ATOM 3197   H H    . SER C  1 49 ? 2.334   -21.615 -239.545 1.00 0.00 ?  49 SER C H    1  
ATOM 3198   H HA   . SER C  1 49 ? 4.430   -20.491 -241.168 1.00 0.00 ?  49 SER C HA   1  
ATOM 3199   H HB2  . SER C  1 49 ? 4.891   -21.772 -239.290 1.00 0.00 ?  49 SER C HB2  1  
ATOM 3200   H HB3  . SER C  1 49 ? 4.139   -23.204 -240.029 1.00 0.00 ?  49 SER C HB3  1  
ATOM 3201   H HG   . SER C  1 49 ? 5.713   -23.067 -241.677 1.00 0.00 ?  49 SER C HG   1  
ATOM 3202   N N    . LYS C  1 50 ? 2.685   -22.969 -242.529 1.00 0.00 ?  50 LYS C N    1  
ATOM 3203   C CA   . LYS C  1 50 ? 2.377   -23.638 -243.788 1.00 0.00 ?  50 LYS C CA   1  
ATOM 3204   C C    . LYS C  1 50 ? 1.452   -22.789 -244.651 1.00 0.00 ?  50 LYS C C    1  
ATOM 3205   O O    . LYS C  1 50 ? 1.403   -22.951 -245.870 1.00 0.00 ?  50 LYS C O    1  
ATOM 3206   C CB   . LYS C  1 50 ? 1.744   -25.005 -243.528 1.00 0.00 ?  50 LYS C CB   1  
ATOM 3207   C CG   . LYS C  1 50 ? 2.676   -26.015 -242.870 1.00 0.00 ?  50 LYS C CG   1  
ATOM 3208   C CD   . LYS C  1 50 ? 1.966   -27.334 -242.607 1.00 0.00 ?  50 LYS C CD   1  
ATOM 3209   C CE   . LYS C  1 50 ? 2.869   -28.313 -241.871 1.00 0.00 ?  50 LYS C CE   1  
ATOM 3210   N NZ   . LYS C  1 50 ? 4.093   -28.637 -242.654 1.00 0.00 1  50 LYS C NZ   1  
ATOM 3211   H H    . LYS C  1 50 ? 2.198   -23.251 -241.691 1.00 0.00 ?  50 LYS C H    1  
ATOM 3212   H HA   . LYS C  1 50 ? 3.293   -23.782 -244.363 1.00 0.00 ?  50 LYS C HA   1  
ATOM 3213   H HB2  . LYS C  1 50 ? 0.878   -24.840 -242.886 1.00 0.00 ?  50 LYS C HB2  1  
ATOM 3214   H HB3  . LYS C  1 50 ? 1.412   -25.393 -244.491 1.00 0.00 ?  50 LYS C HB3  1  
ATOM 3215   H HG2  . LYS C  1 50 ? 3.526   -26.184 -243.532 1.00 0.00 ?  50 LYS C HG2  1  
ATOM 3216   H HG3  . LYS C  1 50 ? 3.029   -25.597 -241.927 1.00 0.00 ?  50 LYS C HG3  1  
ATOM 3217   H HD2  . LYS C  1 50 ? 1.077   -27.137 -242.006 1.00 0.00 ?  50 LYS C HD2  1  
ATOM 3218   H HD3  . LYS C  1 50 ? 1.668   -27.765 -243.563 1.00 0.00 ?  50 LYS C HD3  1  
ATOM 3219   H HE2  . LYS C  1 50 ? 3.155   -27.866 -240.920 1.00 0.00 ?  50 LYS C HE2  1  
ATOM 3220   H HE3  . LYS C  1 50 ? 2.304   -29.227 -241.687 1.00 0.00 ?  50 LYS C HE3  1  
ATOM 3221   H HZ1  . LYS C  1 50 ? 4.617   -27.791 -242.824 1.00 0.00 ?  50 LYS C HZ1  1  
ATOM 3222   H HZ2  . LYS C  1 50 ? 4.663   -29.288 -242.132 1.00 0.00 ?  50 LYS C HZ2  1  
ATOM 3223   H HZ3  . LYS C  1 50 ? 3.829   -29.053 -243.536 1.00 0.00 ?  50 LYS C HZ3  1  
ATOM 3224   N N    . LEU C  1 51 ? 0.721   -21.882 -244.011 1.00 0.00 ?  51 LEU C N    1  
ATOM 3225   C CA   . LEU C  1 51 ? -0.185  -20.988 -244.722 1.00 0.00 ?  51 LEU C CA   1  
ATOM 3226   C C    . LEU C  1 51 ? 0.583   -19.893 -245.451 1.00 0.00 ?  51 LEU C C    1  
ATOM 3227   O O    . LEU C  1 51 ? 0.218   -19.497 -246.558 1.00 0.00 ?  51 LEU C O    1  
ATOM 3228   C CB   . LEU C  1 51 ? -1.196  -20.372 -243.746 1.00 0.00 ?  51 LEU C CB   1  
ATOM 3229   C CG   . LEU C  1 51 ? -2.312  -19.547 -244.398 1.00 0.00 ?  51 LEU C CG   1  
ATOM 3230   C CD1  . LEU C  1 51 ? -3.183  -20.443 -245.270 1.00 0.00 ?  51 LEU C CD1  1  
ATOM 3231   C CD2  . LEU C  1 51 ? -3.145  -18.874 -243.317 1.00 0.00 ?  51 LEU C CD2  1  
ATOM 3232   H H    . LEU C  1 51 ? 0.795   -21.811 -243.006 1.00 0.00 ?  51 LEU C H    1  
ATOM 3233   H HA   . LEU C  1 51 ? -0.725  -21.547 -245.485 1.00 0.00 ?  51 LEU C HA   1  
ATOM 3234   H HB2  . LEU C  1 51 ? -1.607  -21.285 -243.318 1.00 0.00 ?  51 LEU C HB2  1  
ATOM 3235   H HB3  . LEU C  1 51 ? -0.702  -19.795 -242.965 1.00 0.00 ?  51 LEU C HB3  1  
ATOM 3236   H HG   . LEU C  1 51 ? -1.835  -18.764 -244.988 1.00 0.00 ?  51 LEU C HG   1  
ATOM 3237   H HD11 . LEU C  1 51 ? -3.973  -19.848 -245.728 1.00 0.00 ?  51 LEU C HD11 1  
ATOM 3238   H HD12 . LEU C  1 51 ? -2.571  -20.896 -246.050 1.00 0.00 ?  51 LEU C HD12 1  
ATOM 3239   H HD13 . LEU C  1 51 ? -3.628  -21.225 -244.656 1.00 0.00 ?  51 LEU C HD13 1  
ATOM 3240   H HD21 . LEU C  1 51 ? -2.508  -18.217 -242.724 1.00 0.00 ?  51 LEU C HD21 1  
ATOM 3241   H HD22 . LEU C  1 51 ? -3.938  -18.287 -243.782 1.00 0.00 ?  51 LEU C HD22 1  
ATOM 3242   H HD23 . LEU C  1 51 ? -3.585  -19.633 -242.671 1.00 0.00 ?  51 LEU C HD23 1  
ATOM 3243   N N    . SER C  1 52 ? 1.648   -19.406 -244.824 1.00 0.00 ?  52 SER C N    1  
ATOM 3244   C CA   . SER C  1 52 ? 2.521   -18.419 -245.449 1.00 0.00 ?  52 SER C CA   1  
ATOM 3245   C C    . SER C  1 52 ? 3.228   -19.002 -246.667 1.00 0.00 ?  52 SER C C    1  
ATOM 3246   O O    . SER C  1 52 ? 3.613   -18.273 -247.581 1.00 0.00 ?  52 SER C O    1  
ATOM 3247   C CB   . SER C  1 52 ? 3.535   -17.908 -244.445 1.00 0.00 ?  52 SER C CB   1  
ATOM 3248   O OG   . SER C  1 52 ? 4.461   -18.895 -244.082 1.00 0.00 ?  52 SER C OG   1  
ATOM 3249   H H    . SER C  1 52 ? 1.859   -19.727 -243.890 1.00 0.00 ?  52 SER C H    1  
ATOM 3250   H HA   . SER C  1 52 ? 2.006   -17.498 -245.725 1.00 0.00 ?  52 SER C HA   1  
ATOM 3251   H HB2  . SER C  1 52 ? 4.068   -17.066 -244.886 1.00 0.00 ?  52 SER C HB2  1  
ATOM 3252   H HB3  . SER C  1 52 ? 3.006   -17.574 -243.553 1.00 0.00 ?  52 SER C HB3  1  
ATOM 3253   H HG   . SER C  1 52 ? 5.083   -18.532 -243.447 1.00 0.00 ?  52 SER C HG   1  
ATOM 3254   N N    . GLU C  1 53 ? 3.396   -20.320 -246.672 1.00 0.00 ?  53 GLU C N    1  
ATOM 3255   C CA   . GLU C  1 53 ? 3.862   -21.028 -247.858 1.00 0.00 ?  53 GLU C CA   1  
ATOM 3256   C C    . GLU C  1 53 ? 2.726   -21.257 -248.846 1.00 0.00 ?  53 GLU C C    1  
ATOM 3257   O O    . GLU C  1 53 ? 2.914   -21.157 -250.059 1.00 0.00 ?  53 GLU C O    1  
ATOM 3258   C CB   . GLU C  1 53 ? 4.498   -22.364 -247.469 1.00 0.00 ?  53 GLU C CB   1  
ATOM 3259   C CG   . GLU C  1 53 ? 5.816   -22.239 -246.718 1.00 0.00 ?  53 GLU C CG   1  
ATOM 3260   C CD   . GLU C  1 53 ? 6.333   -23.585 -246.294 1.00 0.00 ?  53 GLU C CD   1  
ATOM 3261   O OE1  . GLU C  1 53 ? 5.610   -24.544 -246.418 1.00 0.00 ?  53 GLU C OE1  1  
ATOM 3262   O OE2  . GLU C  1 53 ? 7.489   -23.674 -245.951 1.00 0.00 -1 53 GLU C OE2  1  
ATOM 3263   H H    . GLU C  1 53 ? 3.195   -20.845 -245.833 1.00 0.00 ?  53 GLU C H    1  
ATOM 3264   H HA   . GLU C  1 53 ? 4.608   -20.426 -248.379 1.00 0.00 ?  53 GLU C HA   1  
ATOM 3265   H HB2  . GLU C  1 53 ? 3.775   -22.891 -246.847 1.00 0.00 ?  53 GLU C HB2  1  
ATOM 3266   H HB3  . GLU C  1 53 ? 4.658   -22.922 -248.392 1.00 0.00 ?  53 GLU C HB3  1  
ATOM 3267   H HG2  . GLU C  1 53 ? 6.588   -21.715 -247.282 1.00 0.00 ?  53 GLU C HG2  1  
ATOM 3268   H HG3  . GLU C  1 53 ? 5.554   -21.656 -245.836 1.00 0.00 ?  53 GLU C HG3  1  
ATOM 3269   N N    . TYR C  1 54 ? 1.545   -21.565 -248.321 1.00 0.00 ?  54 TYR C N    1  
ATOM 3270   C CA   . TYR C  1 54 ? 0.360   -21.746 -249.151 1.00 0.00 ?  54 TYR C CA   1  
ATOM 3271   C C    . TYR C  1 54 ? -0.007  -20.457 -249.876 1.00 0.00 ?  54 TYR C C    1  
ATOM 3272   O O    . TYR C  1 54 ? -0.668  -20.485 -250.914 1.00 0.00 ?  54 TYR C O    1  
ATOM 3273   C CB   . TYR C  1 54 ? -0.820  -22.226 -248.303 1.00 0.00 ?  54 TYR C CB   1  
ATOM 3274   C CG   . TYR C  1 54 ? -2.061  -22.548 -249.106 1.00 0.00 ?  54 TYR C CG   1  
ATOM 3275   C CD1  . TYR C  1 54 ? -2.116  -23.677 -249.910 1.00 0.00 ?  54 TYR C CD1  1  
ATOM 3276   C CD2  . TYR C  1 54 ? -3.174  -21.723 -249.055 1.00 0.00 ?  54 TYR C CD2  1  
ATOM 3277   C CE1  . TYR C  1 54 ? -3.247  -23.976 -250.645 1.00 0.00 ?  54 TYR C CE1  1  
ATOM 3278   C CE2  . TYR C  1 54 ? -4.310  -22.012 -249.786 1.00 0.00 ?  54 TYR C CE2  1  
ATOM 3279   C CZ   . TYR C  1 54 ? -4.343  -23.140 -250.580 1.00 0.00 ?  54 TYR C CZ   1  
ATOM 3280   O OH   . TYR C  1 54 ? -5.473  -23.433 -251.309 1.00 0.00 ?  54 TYR C OH   1  
ATOM 3281   H H    . TYR C  1 54 ? 1.466   -21.676 -247.320 1.00 0.00 ?  54 TYR C H    1  
ATOM 3282   H HA   . TYR C  1 54 ? 0.560   -22.490 -249.922 1.00 0.00 ?  54 TYR C HA   1  
ATOM 3283   H HB2  . TYR C  1 54 ? -0.491  -23.118 -247.768 1.00 0.00 ?  54 TYR C HB2  1  
ATOM 3284   H HB3  . TYR C  1 54 ? -1.045  -21.435 -247.588 1.00 0.00 ?  54 TYR C HB3  1  
ATOM 3285   H HD1  . TYR C  1 54 ? -1.246  -24.333 -249.956 1.00 0.00 ?  54 TYR C HD1  1  
ATOM 3286   H HD2  . TYR C  1 54 ? -3.142  -20.833 -248.426 1.00 0.00 ?  54 TYR C HD2  1  
ATOM 3287   H HE1  . TYR C  1 54 ? -3.276  -24.866 -251.273 1.00 0.00 ?  54 TYR C HE1  1  
ATOM 3288   H HE2  . TYR C  1 54 ? -5.175  -21.350 -249.734 1.00 0.00 ?  54 TYR C HE2  1  
ATOM 3289   H HH   . TYR C  1 54 ? -6.285  -23.226 -250.841 1.00 0.00 ?  54 TYR C HH   1  
ATOM 3290   N N    . ASN C  1 55 ? 0.426   -19.330 -249.323 1.00 0.00 ?  55 ASN C N    1  
ATOM 3291   C CA   . ASN C  1 55 ? 0.280   -18.043 -249.992 1.00 0.00 ?  55 ASN C CA   1  
ATOM 3292   C C    . ASN C  1 55 ? 0.969   -18.047 -251.351 1.00 0.00 ?  55 ASN C C    1  
ATOM 3293   O O    . ASN C  1 55 ? 0.458   -17.483 -252.319 1.00 0.00 ?  55 ASN C O    1  
ATOM 3294   C CB   . ASN C  1 55 ? 0.814   -16.908 -249.137 1.00 0.00 ?  55 ASN C CB   1  
ATOM 3295   C CG   . ASN C  1 55 ? -0.064  -16.570 -247.964 1.00 0.00 ?  55 ASN C CG   1  
ATOM 3296   O OD1  . ASN C  1 55 ? -1.252  -16.910 -247.934 1.00 0.00 ?  55 ASN C OD1  1  
ATOM 3297   N ND2  . ASN C  1 55 ? 0.492   -15.832 -247.037 1.00 0.00 ?  55 ASN C ND2  1  
ATOM 3298   H H    . ASN C  1 55 ? 0.868   -19.365 -248.415 1.00 0.00 ?  55 ASN C H    1  
ATOM 3299   H HA   . ASN C  1 55 ? -0.776  -17.842 -250.182 1.00 0.00 ?  55 ASN C HA   1  
ATOM 3300   H HB2  . ASN C  1 55 ? 1.857   -16.892 -248.820 1.00 0.00 ?  55 ASN C HB2  1  
ATOM 3301   H HB3  . ASN C  1 55 ? 0.660   -16.163 -249.917 1.00 0.00 ?  55 ASN C HB3  1  
ATOM 3302   H HD21 . ASN C  1 55 ? 1.440   -15.533 -247.138 1.00 0.00 ?  55 ASN C HD21 1  
ATOM 3303   H HD22 . ASN C  1 55 ? -0.033  -15.569 -246.227 1.00 0.00 ?  55 ASN C HD22 1  
ATOM 3304   N N    . LEU C  1 56 ? 2.131   -18.687 -251.417 1.00 0.00 ?  56 LEU C N    1  
ATOM 3305   C CA   . LEU C  1 56 ? 2.880   -18.788 -252.664 1.00 0.00 ?  56 LEU C CA   1  
ATOM 3306   C C    . LEU C  1 56 ? 2.369   -19.939 -253.521 1.00 0.00 ?  56 LEU C C    1  
ATOM 3307   O O    . LEU C  1 56 ? 2.513   -19.926 -254.744 1.00 0.00 ?  56 LEU C O    1  
ATOM 3308   C CB   . LEU C  1 56 ? 4.376   -18.964 -252.371 1.00 0.00 ?  56 LEU C CB   1  
ATOM 3309   C CG   . LEU C  1 56 ? 5.042   -17.786 -251.649 1.00 0.00 ?  56 LEU C CG   1  
ATOM 3310   C CD1  . LEU C  1 56 ? 6.513   -18.091 -251.401 1.00 0.00 ?  56 LEU C CD1  1  
ATOM 3311   C CD2  . LEU C  1 56 ? 4.886   -16.523 -252.483 1.00 0.00 ?  56 LEU C CD2  1  
ATOM 3312   H H    . LEU C  1 56 ? 2.506   -19.113 -250.582 1.00 0.00 ?  56 LEU C H    1  
ATOM 3313   H HA   . LEU C  1 56 ? 2.739   -17.880 -253.249 1.00 0.00 ?  56 LEU C HA   1  
ATOM 3314   H HB2  . LEU C  1 56 ? 4.326   -19.828 -251.711 1.00 0.00 ?  56 LEU C HB2  1  
ATOM 3315   H HB3  . LEU C  1 56 ? 4.935   -19.225 -253.270 1.00 0.00 ?  56 LEU C HB3  1  
ATOM 3316   H HG   . LEU C  1 56 ? 4.506   -17.635 -250.712 1.00 0.00 ?  56 LEU C HG   1  
ATOM 3317   H HD11 . LEU C  1 56 ? 6.978   -17.249 -250.888 1.00 0.00 ?  56 LEU C HD11 1  
ATOM 3318   H HD12 . LEU C  1 56 ? 6.601   -18.985 -250.784 1.00 0.00 ?  56 LEU C HD12 1  
ATOM 3319   H HD13 . LEU C  1 56 ? 7.016   -18.256 -252.354 1.00 0.00 ?  56 LEU C HD13 1  
ATOM 3320   H HD21 . LEU C  1 56 ? 3.827   -16.309 -252.624 1.00 0.00 ?  56 LEU C HD21 1  
ATOM 3321   H HD22 . LEU C  1 56 ? 5.360   -15.687 -251.968 1.00 0.00 ?  56 LEU C HD22 1  
ATOM 3322   H HD23 . LEU C  1 56 ? 5.359   -16.667 -253.455 1.00 0.00 ?  56 LEU C HD23 1  
ATOM 3323   N N    . TYR C  1 57 ? 1.771   -20.933 -252.873 1.00 0.00 ?  57 TYR C N    1  
ATOM 3324   C CA   . TYR C  1 57 ? 1.117   -22.026 -253.582 1.00 0.00 ?  57 TYR C CA   1  
ATOM 3325   C C    . TYR C  1 57 ? 0.186   -21.499 -254.667 1.00 0.00 ?  57 TYR C C    1  
ATOM 3326   O O    . TYR C  1 57 ? 0.044   -22.109 -255.727 1.00 0.00 ?  57 TYR C O    1  
ATOM 3327   C CB   . TYR C  1 57 ? 0.338   -22.908 -252.604 1.00 0.00 ?  57 TYR C CB   1  
ATOM 3328   C CG   . TYR C  1 57 ? -0.308  -24.115 -253.248 1.00 0.00 ?  57 TYR C CG   1  
ATOM 3329   C CD1  . TYR C  1 57 ? 0.426   -25.264 -253.504 1.00 0.00 ?  57 TYR C CD1  1  
ATOM 3330   C CD2  . TYR C  1 57 ? -1.650  -24.102 -253.597 1.00 0.00 ?  57 TYR C CD2  1  
ATOM 3331   C CE1  . TYR C  1 57 ? -0.159  -26.369 -254.092 1.00 0.00 ?  57 TYR C CE1  1  
ATOM 3332   C CE2  . TYR C  1 57 ? -2.245  -25.201 -254.185 1.00 0.00 ?  57 TYR C CE2  1  
ATOM 3333   C CZ   . TYR C  1 57 ? -1.496  -26.334 -254.431 1.00 0.00 ?  57 TYR C CZ   1  
ATOM 3334   O OH   . TYR C  1 57 ? -2.084  -27.432 -255.015 1.00 0.00 ?  57 TYR C OH   1  
ATOM 3335   H H    . TYR C  1 57 ? 1.770   -20.931 -251.863 1.00 0.00 ?  57 TYR C H    1  
ATOM 3336   H HA   . TYR C  1 57 ? 1.864   -22.640 -254.086 1.00 0.00 ?  57 TYR C HA   1  
ATOM 3337   H HB2  . TYR C  1 57 ? 1.040   -23.237 -251.837 1.00 0.00 ?  57 TYR C HB2  1  
ATOM 3338   H HB3  . TYR C  1 57 ? -0.431  -22.284 -252.150 1.00 0.00 ?  57 TYR C HB3  1  
ATOM 3339   H HD1  . TYR C  1 57 ? 1.482   -25.285 -253.233 1.00 0.00 ?  57 TYR C HD1  1  
ATOM 3340   H HD2  . TYR C  1 57 ? -2.236  -23.204 -253.400 1.00 0.00 ?  57 TYR C HD2  1  
ATOM 3341   H HE1  . TYR C  1 57 ? 0.430   -27.265 -254.287 1.00 0.00 ?  57 TYR C HE1  1  
ATOM 3342   H HE2  . TYR C  1 57 ? -3.302  -25.171 -254.452 1.00 0.00 ?  57 TYR C HE2  1  
ATOM 3343   H HH   . TYR C  1 57 ? -2.955  -27.625 -254.659 1.00 0.00 ?  57 TYR C HH   1  
ATOM 3344   N N    . ARG C  1 58 ? -0.448  -20.363 -254.396 1.00 0.00 ?  58 ARG C N    1  
ATOM 3345   C CA   . ARG C  1 58 ? -1.342  -19.736 -255.361 1.00 0.00 ?  58 ARG C CA   1  
ATOM 3346   C C    . ARG C  1 58 ? -0.650  -18.592 -256.091 1.00 0.00 ?  58 ARG C C    1  
ATOM 3347   O O    . ARG C  1 58 ? -0.731  -18.485 -257.314 1.00 0.00 ?  58 ARG C O    1  
ATOM 3348   C CB   . ARG C  1 58 ? -2.647  -19.281 -254.723 1.00 0.00 ?  58 ARG C CB   1  
ATOM 3349   C CG   . ARG C  1 58 ? -3.413  -20.370 -253.988 1.00 0.00 ?  58 ARG C CG   1  
ATOM 3350   C CD   . ARG C  1 58 ? -4.036  -21.385 -254.876 1.00 0.00 ?  58 ARG C CD   1  
ATOM 3351   N NE   . ARG C  1 58 ? -4.761  -22.434 -254.176 1.00 0.00 ?  58 ARG C NE   1  
ATOM 3352   C CZ   . ARG C  1 58 ? -5.380  -23.468 -254.777 1.00 0.00 ?  58 ARG C CZ   1  
ATOM 3353   N NH1  . ARG C  1 58 ? -5.399  -23.577 -256.087 1.00 0.00 1  58 ARG C NH1  1  
ATOM 3354   N NH2  . ARG C  1 58 ? -5.990  -24.359 -254.015 1.00 0.00 ?  58 ARG C NH2  1  
ATOM 3355   H H    . ARG C  1 58 ? -0.306  -19.923 -253.498 1.00 0.00 ?  58 ARG C H    1  
ATOM 3356   H HA   . ARG C  1 58 ? -1.631  -20.461 -256.122 1.00 0.00 ?  58 ARG C HA   1  
ATOM 3357   H HB2  . ARG C  1 58 ? -2.398  -18.483 -254.024 1.00 0.00 ?  58 ARG C HB2  1  
ATOM 3358   H HB3  . ARG C  1 58 ? -3.270  -18.882 -255.523 1.00 0.00 ?  58 ARG C HB3  1  
ATOM 3359   H HG2  . ARG C  1 58 ? -2.726  -20.886 -253.318 1.00 0.00 ?  58 ARG C HG2  1  
ATOM 3360   H HG3  . ARG C  1 58 ? -4.206  -19.901 -253.405 1.00 0.00 ?  58 ARG C HG3  1  
ATOM 3361   H HD2  . ARG C  1 58 ? -4.742  -20.889 -255.541 1.00 0.00 ?  58 ARG C HD2  1  
ATOM 3362   H HD3  . ARG C  1 58 ? -3.256  -21.865 -255.466 1.00 0.00 ?  58 ARG C HD3  1  
ATOM 3363   H HE   . ARG C  1 58 ? -4.914  -22.559 -253.184 1.00 0.00 ?  58 ARG C HE   1  
ATOM 3364   H HH11 . ARG C  1 58 ? -4.943  -22.878 -256.657 1.00 0.00 ?  58 ARG C HH11 1  
ATOM 3365   H HH12 . ARG C  1 58 ? -5.869  -24.360 -256.519 1.00 0.00 ?  58 ARG C HH12 1  
ATOM 3366   H HH21 . ARG C  1 58 ? -5.982  -24.250 -253.010 1.00 0.00 ?  58 ARG C HH21 1  
ATOM 3367   H HH22 . ARG C  1 58 ? -6.463  -25.143 -254.440 1.00 0.00 ?  58 ARG C HH22 1  
ATOM 3368   N N    . ASN C  1 59 ? 0.030   -17.739 -255.333 1.00 0.00 ?  59 ASN C N    1  
ATOM 3369   C CA   . ASN C  1 59 ? 0.648   -16.542 -255.892 1.00 0.00 ?  59 ASN C CA   1  
ATOM 3370   C C    . ASN C  1 59 ? 1.757   -16.901 -256.872 1.00 0.00 ?  59 ASN C C    1  
ATOM 3371   O O    . ASN C  1 59 ? 1.685   -16.569 -258.055 1.00 0.00 ?  59 ASN C O    1  
ATOM 3372   C CB   . ASN C  1 59 ? 1.185   -15.634 -254.801 1.00 0.00 ?  59 ASN C CB   1  
ATOM 3373   C CG   . ASN C  1 59 ? 1.573   -14.266 -255.289 1.00 0.00 ?  59 ASN C CG   1  
ATOM 3374   O OD1  . ASN C  1 59 ? 1.760   -14.043 -256.491 1.00 0.00 ?  59 ASN C OD1  1  
ATOM 3375   N ND2  . ASN C  1 59 ? 1.775   -13.370 -254.356 1.00 0.00 ?  59 ASN C ND2  1  
ATOM 3376   H H    . ASN C  1 59 ? 0.122   -17.924 -254.344 1.00 0.00 ?  59 ASN C H    1  
ATOM 3377   H HA   . ASN C  1 59 ? -0.092  -15.973 -256.457 1.00 0.00 ?  59 ASN C HA   1  
ATOM 3378   H HB2  . ASN C  1 59 ? 0.665   -15.539 -253.847 1.00 0.00 ?  59 ASN C HB2  1  
ATOM 3379   H HB3  . ASN C  1 59 ? 2.089   -16.227 -254.664 1.00 0.00 ?  59 ASN C HB3  1  
ATOM 3380   H HD21 . ASN C  1 59 ? 1.669   -13.617 -253.394 1.00 0.00 ?  59 ASN C HD21 1  
ATOM 3381   H HD22 . ASN C  1 59 ? 2.036   -12.437 -254.608 1.00 0.00 ?  59 ASN C HD22 1  
ATOM 3382   N N    . ALA C  1 60 ? 2.783   -17.582 -256.372 1.00 0.00 ?  60 ALA C N    1  
ATOM 3383   C CA   . ALA C  1 60 ? 3.941   -17.931 -257.188 1.00 0.00 ?  60 ALA C CA   1  
ATOM 3384   C C    . ALA C  1 60 ? 3.545   -18.841 -258.344 1.00 0.00 ?  60 ALA C C    1  
ATOM 3385   O O    . ALA C  1 60 ? 4.107   -18.753 -259.435 1.00 0.00 ?  60 ALA C O    1  
ATOM 3386   C CB   . ALA C  1 60 ? 5.012   -18.591 -256.332 1.00 0.00 ?  60 ALA C CB   1  
ATOM 3387   H H    . ALA C  1 60 ? 2.761   -17.864 -255.403 1.00 0.00 ?  60 ALA C H    1  
ATOM 3388   H HA   . ALA C  1 60 ? 4.353   -17.019 -257.619 1.00 0.00 ?  60 ALA C HA   1  
ATOM 3389   H HB1  . ALA C  1 60 ? 4.610   -19.497 -255.881 1.00 0.00 ?  60 ALA C HB1  1  
ATOM 3390   H HB2  . ALA C  1 60 ? 5.869   -18.845 -256.956 1.00 0.00 ?  60 ALA C HB2  1  
ATOM 3391   H HB3  . ALA C  1 60 ? 5.326   -17.903 -255.547 1.00 0.00 ?  60 ALA C HB3  1  
ATOM 3392   N N    . GLN C  1 61 ? 2.575   -19.715 -258.097 1.00 0.00 ?  61 GLN C N    1  
ATOM 3393   C CA   . GLN C  1 61 ? 2.042   -20.581 -259.141 1.00 0.00 ?  61 GLN C CA   1  
ATOM 3394   C C    . GLN C  1 61 ? 1.561   -19.771 -260.338 1.00 0.00 ?  61 GLN C C    1  
ATOM 3395   O O    . GLN C  1 61 ? 1.991   -20.000 -261.468 1.00 0.00 ?  61 GLN C O    1  
ATOM 3396   C CB   . GLN C  1 61 ? 0.890   -21.430 -258.596 1.00 0.00 ?  61 GLN C CB   1  
ATOM 3397   C CG   . GLN C  1 61 ? 0.287   -22.386 -259.611 1.00 0.00 ?  61 GLN C CG   1  
ATOM 3398   C CD   . GLN C  1 61 ? -0.890  -23.160 -259.049 1.00 0.00 ?  61 GLN C CD   1  
ATOM 3399   O OE1  . GLN C  1 61 ? -1.352  -22.894 -257.935 1.00 0.00 ?  61 GLN C OE1  1  
ATOM 3400   N NE2  . GLN C  1 61 ? -1.381  -24.128 -259.814 1.00 0.00 ?  61 GLN C NE2  1  
ATOM 3401   H H    . GLN C  1 61 ? 2.198   -19.780 -257.163 1.00 0.00 ?  61 GLN C H    1  
ATOM 3402   H HA   . GLN C  1 61 ? 2.830   -21.239 -259.508 1.00 0.00 ?  61 GLN C HA   1  
ATOM 3403   H HB2  . GLN C  1 61 ? 1.286   -21.992 -257.750 1.00 0.00 ?  61 GLN C HB2  1  
ATOM 3404   H HB3  . GLN C  1 61 ? 0.126   -20.737 -258.245 1.00 0.00 ?  61 GLN C HB3  1  
ATOM 3405   H HG2  . GLN C  1 61 ? 0.035   -22.086 -260.627 1.00 0.00 ?  61 GLN C HG2  1  
ATOM 3406   H HG3  . GLN C  1 61 ? 1.154   -23.047 -259.634 1.00 0.00 ?  61 GLN C HG3  1  
ATOM 3407   H HE21 . GLN C  1 61 ? -0.975  -24.313 -260.710 1.00 0.00 ?  61 GLN C HE21 1  
ATOM 3408   H HE22 . GLN C  1 61 ? -2.158  -24.674 -259.496 1.00 0.00 ?  61 GLN C HE22 1  
ATOM 3409   N N    . SER C  1 62 ? 0.666   -18.822 -260.083 1.00 0.00 ?  62 SER C N    1  
ATOM 3410   C CA   . SER C  1 62 ? 0.072   -18.023 -261.148 1.00 0.00 ?  62 SER C CA   1  
ATOM 3411   C C    . SER C  1 62 ? 1.095   -17.081 -261.766 1.00 0.00 ?  62 SER C C    1  
ATOM 3412   O O    . SER C  1 62 ? 0.978   -16.699 -262.931 1.00 0.00 ?  62 SER C O    1  
ATOM 3413   C CB   . SER C  1 62 ? -1.113  -17.241 -260.614 1.00 0.00 ?  62 SER C CB   1  
ATOM 3414   O OG   . SER C  1 62 ? -0.717  -16.209 -259.753 1.00 0.00 ?  62 SER C OG   1  
ATOM 3415   H H    . SER C  1 62 ? 0.391   -18.650 -259.126 1.00 0.00 ?  62 SER C H    1  
ATOM 3416   H HA   . SER C  1 62 ? -0.399  -18.624 -261.927 1.00 0.00 ?  62 SER C HA   1  
ATOM 3417   H HB2  . SER C  1 62 ? -1.654  -16.811 -261.456 1.00 0.00 ?  62 SER C HB2  1  
ATOM 3418   H HB3  . SER C  1 62 ? -1.767  -17.923 -260.073 1.00 0.00 ?  62 SER C HB3  1  
ATOM 3419   H HG   . SER C  1 62 ? -0.101  -16.555 -259.102 1.00 0.00 ?  62 SER C HG   1  
ATOM 3420   N N    . ASN C  1 63 ? 2.100   -16.708 -260.981 1.00 0.00 ?  63 ASN C N    1  
ATOM 3421   C CA   . ASN C  1 63 ? 3.148   -15.810 -261.451 1.00 0.00 ?  63 ASN C CA   1  
ATOM 3422   C C    . ASN C  1 63 ? 3.989   -16.468 -262.538 1.00 0.00 ?  63 ASN C C    1  
ATOM 3423   O O    . ASN C  1 63 ? 4.243   -15.873 -263.585 1.00 0.00 ?  63 ASN C O    1  
ATOM 3424   C CB   . ASN C  1 63 ? 4.035   -15.346 -260.310 1.00 0.00 ?  63 ASN C CB   1  
ATOM 3425   C CG   . ASN C  1 63 ? 3.374   -14.352 -259.396 1.00 0.00 ?  63 ASN C CG   1  
ATOM 3426   O OD1  . ASN C  1 63 ? 2.487   -13.595 -259.806 1.00 0.00 ?  63 ASN C OD1  1  
ATOM 3427   N ND2  . ASN C  1 63 ? 3.858   -14.294 -258.181 1.00 0.00 ?  63 ASN C ND2  1  
ATOM 3428   H H    . ASN C  1 63 ? 2.138   -17.055 -260.033 1.00 0.00 ?  63 ASN C H    1  
ATOM 3429   H HA   . ASN C  1 63 ? 2.701   -14.923 -261.901 1.00 0.00 ?  63 ASN C HA   1  
ATOM 3430   H HB2  . ASN C  1 63 ? 4.596   -16.065 -259.711 1.00 0.00 ?  63 ASN C HB2  1  
ATOM 3431   H HB3  . ASN C  1 63 ? 4.718   -14.815 -260.972 1.00 0.00 ?  63 ASN C HB3  1  
ATOM 3432   H HD21 . ASN C  1 63 ? 4.617   -14.887 -257.916 1.00 0.00 ?  63 ASN C HD21 1  
ATOM 3433   H HD22 . ASN C  1 63 ? 3.466   -13.655 -257.518 1.00 0.00 ?  63 ASN C HD22 1  
ATOM 3434   N N    . THR C  1 64 ? 4.420   -17.698 -262.282 1.00 0.00 ?  64 THR C N    1  
ATOM 3435   C CA   . THR C  1 64 ? 5.266   -18.424 -263.222 1.00 0.00 ?  64 THR C CA   1  
ATOM 3436   C C    . THR C  1 64 ? 4.515   -18.738 -264.510 1.00 0.00 ?  64 THR C C    1  
ATOM 3437   O O    . THR C  1 64 ? 5.083   -18.678 -265.601 1.00 0.00 ?  64 THR C O    1  
ATOM 3438   C CB   . THR C  1 64 ? 5.789   -19.738 -262.613 1.00 0.00 ?  64 THR C CB   1  
ATOM 3439   O OG1  . THR C  1 64 ? 4.683   -20.552 -262.203 1.00 0.00 ?  64 THR C OG1  1  
ATOM 3440   C CG2  . THR C  1 64 ? 6.676   -19.452 -261.410 1.00 0.00 ?  64 THR C CG2  1  
ATOM 3441   H H    . THR C  1 64 ? 4.155   -18.142 -261.415 1.00 0.00 ?  64 THR C H    1  
ATOM 3442   H HA   . THR C  1 64 ? 6.118   -17.807 -263.505 1.00 0.00 ?  64 THR C HA   1  
ATOM 3443   H HB   . THR C  1 64 ? 6.364   -20.275 -263.367 1.00 0.00 ?  64 THR C HB   1  
ATOM 3444   H HG1  . THR C  1 64 ? 5.012   -21.371 -261.823 1.00 0.00 ?  64 THR C HG1  1  
ATOM 3445   H HG21 . THR C  1 64 ? 7.037   -20.393 -260.994 1.00 0.00 ?  64 THR C HG21 1  
ATOM 3446   H HG22 . THR C  1 64 ? 7.525   -18.843 -261.721 1.00 0.00 ?  64 THR C HG22 1  
ATOM 3447   H HG23 . THR C  1 64 ? 6.102   -18.917 -260.655 1.00 0.00 ?  64 THR C HG23 1  
ATOM 3448   N N    . VAL C  1 65 ? 3.236   -19.072 -264.377 1.00 0.00 ?  65 VAL C N    1  
ATOM 3449   C CA   . VAL C  1 65 ? 2.388   -19.333 -265.534 1.00 0.00 ?  65 VAL C CA   1  
ATOM 3450   C C    . VAL C  1 65 ? 2.218   -18.082 -266.386 1.00 0.00 ?  65 VAL C C    1  
ATOM 3451   O O    . VAL C  1 65 ? 2.275   -18.143 -267.614 1.00 0.00 ?  65 VAL C O    1  
ATOM 3452   C CB   . VAL C  1 65 ? 0.999   -19.848 -265.112 1.00 0.00 ?  65 VAL C CB   1  
ATOM 3453   C CG1  . VAL C  1 65 ? 0.065   -19.903 -266.311 1.00 0.00 ?  65 VAL C CG1  1  
ATOM 3454   C CG2  . VAL C  1 65 ? 1.113   -21.219 -264.464 1.00 0.00 ?  65 VAL C CG2  1  
ATOM 3455   H H    . VAL C  1 65 ? 2.841   -19.148 -263.450 1.00 0.00 ?  65 VAL C H    1  
ATOM 3456   H HA   . VAL C  1 65 ? 2.843   -20.066 -266.201 1.00 0.00 ?  65 VAL C HA   1  
ATOM 3457   H HB   . VAL C  1 65 ? 0.586   -19.176 -264.360 1.00 0.00 ?  65 VAL C HB   1  
ATOM 3458   H HG11 . VAL C  1 65 ? -0.913  -20.269 -265.995 1.00 0.00 ?  65 VAL C HG11 1  
ATOM 3459   H HG12 . VAL C  1 65 ? -0.042  -18.905 -266.736 1.00 0.00 ?  65 VAL C HG12 1  
ATOM 3460   H HG13 . VAL C  1 65 ? 0.477   -20.576 -267.063 1.00 0.00 ?  65 VAL C HG13 1  
ATOM 3461   H HG21 . VAL C  1 65 ? 1.749   -21.153 -263.581 1.00 0.00 ?  65 VAL C HG21 1  
ATOM 3462   H HG22 . VAL C  1 65 ? 0.123   -21.567 -264.171 1.00 0.00 ?  65 VAL C HG22 1  
ATOM 3463   H HG23 . VAL C  1 65 ? 1.550   -21.921 -265.174 1.00 0.00 ?  65 VAL C HG23 1  
ATOM 3464   N N    . LYS C  1 66 ? 2.009   -16.947 -265.726 1.00 0.00 ?  66 LYS C N    1  
ATOM 3465   C CA   . LYS C  1 66 ? 1.916   -15.666 -266.416 1.00 0.00 ?  66 LYS C CA   1  
ATOM 3466   C C    . LYS C  1 66 ? 3.152   -15.408 -267.268 1.00 0.00 ?  66 LYS C C    1  
ATOM 3467   O O    . LYS C  1 66 ? 3.045   -15.035 -268.436 1.00 0.00 ?  66 LYS C O    1  
ATOM 3468   C CB   . LYS C  1 66 ? 1.723   -14.529 -265.411 1.00 0.00 ?  66 LYS C CB   1  
ATOM 3469   C CG   . LYS C  1 66 ? 1.664   -13.142 -266.035 1.00 0.00 ?  66 LYS C CG   1  
ATOM 3470   C CD   . LYS C  1 66 ? 1.533   -12.062 -264.971 1.00 0.00 ?  66 LYS C CD   1  
ATOM 3471   C CE   . LYS C  1 66 ? 1.572   -10.670 -265.586 1.00 0.00 ?  66 LYS C CE   1  
ATOM 3472   N NZ   . LYS C  1 66 ? 2.921   -10.334 -266.117 1.00 0.00 1  66 LYS C NZ   1  
ATOM 3473   H H    . LYS C  1 66 ? 1.913   -16.973 -264.721 1.00 0.00 ?  66 LYS C H    1  
ATOM 3474   H HA   . LYS C  1 66 ? 1.065   -15.675 -267.098 1.00 0.00 ?  66 LYS C HA   1  
ATOM 3475   H HB2  . LYS C  1 66 ? 0.792   -14.728 -264.879 1.00 0.00 ?  66 LYS C HB2  1  
ATOM 3476   H HB3  . LYS C  1 66 ? 2.558   -14.576 -264.711 1.00 0.00 ?  66 LYS C HB3  1  
ATOM 3477   H HG2  . LYS C  1 66 ? 2.578   -12.980 -266.607 1.00 0.00 ?  66 LYS C HG2  1  
ATOM 3478   H HG3  . LYS C  1 66 ? 0.805   -13.099 -266.704 1.00 0.00 ?  66 LYS C HG3  1  
ATOM 3479   H HD2  . LYS C  1 66 ? 0.586   -12.202 -264.448 1.00 0.00 ?  66 LYS C HD2  1  
ATOM 3480   H HD3  . LYS C  1 66 ? 2.356   -12.169 -264.264 1.00 0.00 ?  66 LYS C HD3  1  
ATOM 3481   H HE2  . LYS C  1 66 ? 0.845   -10.633 -266.395 1.00 0.00 ?  66 LYS C HE2  1  
ATOM 3482   H HE3  . LYS C  1 66 ? 1.296   -9.949  -264.817 1.00 0.00 ?  66 LYS C HE3  1  
ATOM 3483   H HZ1  . LYS C  1 66 ? 3.178   -11.002 -266.830 1.00 0.00 ?  66 LYS C HZ1  1  
ATOM 3484   H HZ2  . LYS C  1 66 ? 2.905   -9.406  -266.514 1.00 0.00 ?  66 LYS C HZ2  1  
ATOM 3485   H HZ3  . LYS C  1 66 ? 3.597   -10.367 -265.366 1.00 0.00 ?  66 LYS C HZ3  1  
ATOM 3486   N N    . VAL C  1 67 ? 4.325   -15.609 -266.677 1.00 0.00 ?  67 VAL C N    1  
ATOM 3487   C CA   . VAL C  1 67 ? 5.583   -15.323 -267.354 1.00 0.00 ?  67 VAL C CA   1  
ATOM 3488   C C    . VAL C  1 67 ? 5.766   -16.213 -268.577 1.00 0.00 ?  67 VAL C C    1  
ATOM 3489   O O    . VAL C  1 67 ? 6.184   -15.749 -269.638 1.00 0.00 ?  67 VAL C O    1  
ATOM 3490   C CB   . VAL C  1 67 ? 6.787   -15.509 -266.412 1.00 0.00 ?  67 VAL C CB   1  
ATOM 3491   C CG1  . VAL C  1 67 ? 8.091   -15.446 -267.194 1.00 0.00 ?  67 VAL C CG1  1  
ATOM 3492   C CG2  . VAL C  1 67 ? 6.774   -14.455 -265.316 1.00 0.00 ?  67 VAL C CG2  1  
ATOM 3493   H H    . VAL C  1 67 ? 4.344   -15.970 -265.733 1.00 0.00 ?  67 VAL C H    1  
ATOM 3494   H HA   . VAL C  1 67 ? 5.601   -14.305 -267.744 1.00 0.00 ?  67 VAL C HA   1  
ATOM 3495   H HB   . VAL C  1 67 ? 6.706   -16.478 -265.920 1.00 0.00 ?  67 VAL C HB   1  
ATOM 3496   H HG11 . VAL C  1 67 ? 8.931   -15.580 -266.513 1.00 0.00 ?  67 VAL C HG11 1  
ATOM 3497   H HG12 . VAL C  1 67 ? 8.104   -16.236 -267.944 1.00 0.00 ?  67 VAL C HG12 1  
ATOM 3498   H HG13 . VAL C  1 67 ? 8.174   -14.477 -267.685 1.00 0.00 ?  67 VAL C HG13 1  
ATOM 3499   H HG21 . VAL C  1 67 ? 5.855   -14.543 -264.737 1.00 0.00 ?  67 VAL C HG21 1  
ATOM 3500   H HG22 . VAL C  1 67 ? 7.631   -14.601 -264.659 1.00 0.00 ?  67 VAL C HG22 1  
ATOM 3501   H HG23 . VAL C  1 67 ? 6.826   -13.463 -265.765 1.00 0.00 ?  67 VAL C HG23 1  
ATOM 3502   N N    . PHE C  1 68 ? 5.449   -17.494 -268.422 1.00 0.00 ?  68 PHE C N    1  
ATOM 3503   C CA   . PHE C  1 68 ? 5.528   -18.442 -269.528 1.00 0.00 ?  68 PHE C CA   1  
ATOM 3504   C C    . PHE C  1 68 ? 4.495   -18.123 -270.601 1.00 0.00 ?  68 PHE C C    1  
ATOM 3505   O O    . PHE C  1 68 ? 4.681   -18.452 -271.772 1.00 0.00 ?  68 PHE C O    1  
ATOM 3506   C CB   . PHE C  1 68 ? 5.336   -19.872 -269.020 1.00 0.00 ?  68 PHE C CB   1  
ATOM 3507   C CG   . PHE C  1 68 ? 6.580   -20.481 -268.439 1.00 0.00 ?  68 PHE C CG   1  
ATOM 3508   C CD1  . PHE C  1 68 ? 7.679   -20.747 -269.241 1.00 0.00 ?  68 PHE C CD1  1  
ATOM 3509   C CD2  . PHE C  1 68 ? 6.653   -20.790 -267.089 1.00 0.00 ?  68 PHE C CD2  1  
ATOM 3510   C CE1  . PHE C  1 68 ? 8.824   -21.308 -268.709 1.00 0.00 ?  68 PHE C CE1  1  
ATOM 3511   C CE2  . PHE C  1 68 ? 7.797   -21.350 -266.553 1.00 0.00 ?  68 PHE C CE2  1  
ATOM 3512   C CZ   . PHE C  1 68 ? 8.882   -21.610 -267.363 1.00 0.00 ?  68 PHE C CZ   1  
ATOM 3513   H H    . PHE C  1 68 ? 5.146   -17.820 -267.516 1.00 0.00 ?  68 PHE C H    1  
ATOM 3514   H HA   . PHE C  1 68 ? 6.505   -18.371 -270.007 1.00 0.00 ?  68 PHE C HA   1  
ATOM 3515   H HB2  . PHE C  1 68 ? 4.582   -19.894 -268.234 1.00 0.00 ?  68 PHE C HB2  1  
ATOM 3516   H HB3  . PHE C  1 68 ? 5.024   -20.521 -269.838 1.00 0.00 ?  68 PHE C HB3  1  
ATOM 3517   H HD1  . PHE C  1 68 ? 7.633   -20.508 -270.304 1.00 0.00 ?  68 PHE C HD1  1  
ATOM 3518   H HD2  . PHE C  1 68 ? 5.794   -20.585 -266.449 1.00 0.00 ?  68 PHE C HD2  1  
ATOM 3519   H HE1  . PHE C  1 68 ? 9.681   -21.512 -269.350 1.00 0.00 ?  68 PHE C HE1  1  
ATOM 3520   H HE2  . PHE C  1 68 ? 7.841   -21.587 -265.491 1.00 0.00 ?  68 PHE C HE2  1  
ATOM 3521   H HZ   . PHE C  1 68 ? 9.785   -22.050 -266.941 1.00 0.00 ?  68 PHE C HZ   1  
ATOM 3522   N N    . LYS C  1 69 ? 3.405   -17.481 -270.194 1.00 0.00 ?  69 LYS C N    1  
ATOM 3523   C CA   . LYS C  1 69 ? 2.414   -16.980 -271.138 1.00 0.00 ?  69 LYS C CA   1  
ATOM 3524   C C    . LYS C  1 69 ? 2.861   -15.662 -271.758 1.00 0.00 ?  69 LYS C C    1  
ATOM 3525   O O    . LYS C  1 69 ? 2.503   -15.347 -272.893 1.00 0.00 ?  69 LYS C O    1  
ATOM 3526   C CB   . LYS C  1 69 ? 1.059   -16.804 -270.449 1.00 0.00 ?  69 LYS C CB   1  
ATOM 3527   C CG   . LYS C  1 69 ? -0.107  -16.582 -271.403 1.00 0.00 ?  69 LYS C CG   1  
ATOM 3528   C CD   . LYS C  1 69 ? -0.327  -15.100 -271.673 1.00 0.00 ?  69 LYS C CD   1  
ATOM 3529   C CE   . LYS C  1 69 ? -1.499  -14.877 -272.617 1.00 0.00 ?  69 LYS C CE   1  
ATOM 3530   N NZ   . LYS C  1 69 ? -1.582  -13.464 -273.077 1.00 0.00 1  69 LYS C NZ   1  
ATOM 3531   H H    . LYS C  1 69 ? 3.260   -17.337 -269.205 1.00 0.00 ?  69 LYS C H    1  
ATOM 3532   H HA   . LYS C  1 69 ? 2.297   -17.686 -271.960 1.00 0.00 ?  69 LYS C HA   1  
ATOM 3533   H HB2  . LYS C  1 69 ? 0.880   -17.705 -269.862 1.00 0.00 ?  69 LYS C HB2  1  
ATOM 3534   H HB3  . LYS C  1 69 ? 1.149   -15.947 -269.781 1.00 0.00 ?  69 LYS C HB3  1  
ATOM 3535   H HG2  . LYS C  1 69 ? 0.110   -17.094 -272.341 1.00 0.00 ?  69 LYS C HG2  1  
ATOM 3536   H HG3  . LYS C  1 69 ? -1.006  -17.007 -270.957 1.00 0.00 ?  69 LYS C HG3  1  
ATOM 3537   H HD2  . LYS C  1 69 ? -0.523  -14.600 -270.724 1.00 0.00 ?  69 LYS C HD2  1  
ATOM 3538   H HD3  . LYS C  1 69 ? 0.580   -14.690 -272.118 1.00 0.00 ?  69 LYS C HD3  1  
ATOM 3539   H HE2  . LYS C  1 69 ? -1.375  -15.532 -273.477 1.00 0.00 ?  69 LYS C HE2  1  
ATOM 3540   H HE3  . LYS C  1 69 ? -2.417  -15.140 -272.090 1.00 0.00 ?  69 LYS C HE3  1  
ATOM 3541   H HZ1  . LYS C  1 69 ? -0.732  -13.220 -273.566 1.00 0.00 ?  69 LYS C HZ1  1  
ATOM 3542   H HZ2  . LYS C  1 69 ? -2.371  -13.358 -273.699 1.00 0.00 ?  69 LYS C HZ2  1  
ATOM 3543   H HZ3  . LYS C  1 69 ? -1.698  -12.855 -272.279 1.00 0.00 ?  69 LYS C HZ3  1  
ATOM 3544   N N    . ASP C  1 70 ? 3.644   -14.896 -271.007 1.00 0.00 ?  70 ASP C N    1  
ATOM 3545   C CA   . ASP C  1 70 ? 4.122   -13.600 -271.473 1.00 0.00 ?  70 ASP C CA   1  
ATOM 3546   C C    . ASP C  1 70 ? 5.137   -13.758 -272.598 1.00 0.00 ?  70 ASP C C    1  
ATOM 3547   O O    . ASP C  1 70 ? 5.158   -12.970 -273.543 1.00 0.00 ?  70 ASP C O    1  
ATOM 3548   C CB   . ASP C  1 70 ? 4.739   -12.808 -270.317 1.00 0.00 ?  70 ASP C CB   1  
ATOM 3549   C CG   . ASP C  1 70 ? 3.724   -12.215 -269.349 1.00 0.00 ?  70 ASP C CG   1  
ATOM 3550   O OD1  . ASP C  1 70 ? 2.560   -12.203 -269.673 1.00 0.00 ?  70 ASP C OD1  1  
ATOM 3551   O OD2  . ASP C  1 70 ? 4.093   -11.925 -268.237 1.00 0.00 -1 70 ASP C OD2  1  
ATOM 3552   H H    . ASP C  1 70 ? 3.916   -15.220 -270.090 1.00 0.00 ?  70 ASP C H    1  
ATOM 3553   H HA   . ASP C  1 70 ? 3.291   -13.026 -271.884 1.00 0.00 ?  70 ASP C HA   1  
ATOM 3554   H HB2  . ASP C  1 70 ? 5.488   -13.369 -269.758 1.00 0.00 ?  70 ASP C HB2  1  
ATOM 3555   H HB3  . ASP C  1 70 ? 5.223   -12.005 -270.872 1.00 0.00 ?  70 ASP C HB3  1  
ATOM 3556   N N    . ILE C  1 71 ? 5.977   -14.782 -272.490 1.00 0.00 ?  71 ILE C N    1  
ATOM 3557   C CA   . ILE C  1 71 ? 6.939   -15.097 -273.540 1.00 0.00 ?  71 ILE C CA   1  
ATOM 3558   C C    . ILE C  1 71 ? 6.253   -15.730 -274.744 1.00 0.00 ?  71 ILE C C    1  
ATOM 3559   O O    . ILE C  1 71 ? 6.779   -15.700 -275.856 1.00 0.00 ?  71 ILE C O    1  
ATOM 3560   C CB   . ILE C  1 71 ? 8.040   -16.045 -273.031 1.00 0.00 ?  71 ILE C CB   1  
ATOM 3561   C CG1  . ILE C  1 71 ? 7.430   -17.368 -272.561 1.00 0.00 ?  71 ILE C CG1  1  
ATOM 3562   C CG2  . ILE C  1 71 ? 8.828   -15.390 -271.906 1.00 0.00 ?  71 ILE C CG2  1  
ATOM 3563   C CD1  . ILE C  1 71 ? 8.453   -18.385 -272.108 1.00 0.00 ?  71 ILE C CD1  1  
ATOM 3564   H H    . ILE C  1 71 ? 5.949   -15.357 -271.660 1.00 0.00 ?  71 ILE C H    1  
ATOM 3565   H HA   . ILE C  1 71 ? 7.395   -14.187 -273.928 1.00 0.00 ?  71 ILE C HA   1  
ATOM 3566   H HB   . ILE C  1 71 ? 8.712   -16.284 -273.854 1.00 0.00 ?  71 ILE C HB   1  
ATOM 3567   H HG12 . ILE C  1 71 ? 6.754   -17.140 -271.738 1.00 0.00 ?  71 ILE C HG12 1  
ATOM 3568   H HG13 . ILE C  1 71 ? 6.860   -17.776 -273.396 1.00 0.00 ?  71 ILE C HG13 1  
ATOM 3569   H HG21 . ILE C  1 71 ? 9.602   -16.074 -271.558 1.00 0.00 ?  71 ILE C HG21 1  
ATOM 3570   H HG22 . ILE C  1 71 ? 9.291   -14.475 -272.272 1.00 0.00 ?  71 ILE C HG22 1  
ATOM 3571   H HG23 . ILE C  1 71 ? 8.156   -15.152 -271.082 1.00 0.00 ?  71 ILE C HG23 1  
ATOM 3572   H HD11 . ILE C  1 71 ? 9.024   -17.980 -271.273 1.00 0.00 ?  71 ILE C HD11 1  
ATOM 3573   H HD12 . ILE C  1 71 ? 7.945   -19.296 -271.791 1.00 0.00 ?  71 ILE C HD12 1  
ATOM 3574   H HD13 . ILE C  1 71 ? 9.129   -18.615 -272.932 1.00 0.00 ?  71 ILE C HD13 1  
ATOM 3575   N N    . ASP C  1 72 ? 5.077   -16.303 -274.514 1.00 0.00 ?  72 ASP C N    1  
ATOM 3576   C CA   . ASP C  1 72 ? 4.212   -16.741 -275.604 1.00 0.00 ?  72 ASP C CA   1  
ATOM 3577   C C    . ASP C  1 72 ? 3.680   -15.553 -276.395 1.00 0.00 ?  72 ASP C C    1  
ATOM 3578   O O    . ASP C  1 72 ? 3.713   -15.549 -277.626 1.00 0.00 ?  72 ASP C O    1  
ATOM 3579   C CB   . ASP C  1 72 ? 3.049   -17.577 -275.064 1.00 0.00 ?  72 ASP C CB   1  
ATOM 3580   C CG   . ASP C  1 72 ? 3.448   -18.958 -274.561 1.00 0.00 ?  72 ASP C CG   1  
ATOM 3581   O OD1  . ASP C  1 72 ? 4.526   -19.397 -274.883 1.00 0.00 ?  72 ASP C OD1  1  
ATOM 3582   O OD2  . ASP C  1 72 ? 2.745   -19.494 -273.738 1.00 0.00 -1 72 ASP C OD2  1  
ATOM 3583   H H    . ASP C  1 72 ? 4.773   -16.440 -273.561 1.00 0.00 ?  72 ASP C H    1  
ATOM 3584   H HA   . ASP C  1 72 ? 4.783   -17.350 -276.306 1.00 0.00 ?  72 ASP C HA   1  
ATOM 3585   H HB2  . ASP C  1 72 ? 2.467   -17.066 -274.297 1.00 0.00 ?  72 ASP C HB2  1  
ATOM 3586   H HB3  . ASP C  1 72 ? 2.450   -17.679 -275.969 1.00 0.00 ?  72 ASP C HB3  1  
ATOM 3587   N N    . ALA C  1 73 ? 3.188   -14.546 -275.681 1.00 0.00 ?  73 ALA C N    1  
ATOM 3588   C CA   . ALA C  1 73 ? 2.724   -13.315 -276.311 1.00 0.00 ?  73 ALA C CA   1  
ATOM 3589   C C    . ALA C  1 73 ? 3.855   -12.615 -277.052 1.00 0.00 ?  73 ALA C C    1  
ATOM 3590   O O    . ALA C  1 73 ? 3.655   -12.068 -278.136 1.00 0.00 ?  73 ALA C O    1  
ATOM 3591   C CB   . ALA C  1 73 ? 2.111   -12.387 -275.272 1.00 0.00 ?  73 ALA C CB   1  
ATOM 3592   H H    . ALA C  1 73 ? 3.134   -14.635 -274.677 1.00 0.00 ?  73 ALA C H    1  
ATOM 3593   H HA   . ALA C  1 73 ? 1.960   -13.566 -277.047 1.00 0.00 ?  73 ALA C HA   1  
ATOM 3594   H HB1  . ALA C  1 73 ? 2.859   -12.139 -274.520 1.00 0.00 ?  73 ALA C HB1  1  
ATOM 3595   H HB2  . ALA C  1 73 ? 1.770   -11.473 -275.759 1.00 0.00 ?  73 ALA C HB2  1  
ATOM 3596   H HB3  . ALA C  1 73 ? 1.265   -12.882 -274.795 1.00 0.00 ?  73 ALA C HB3  1  
ATOM 3597   N N    . ALA C  1 74 ? 5.045   -12.636 -276.460 1.00 0.00 ?  74 ALA C N    1  
ATOM 3598   C CA   . ALA C  1 74 ? 6.212   -12.004 -277.064 1.00 0.00 ?  74 ALA C CA   1  
ATOM 3599   C C    . ALA C  1 74 ? 6.514   -12.599 -278.433 1.00 0.00 ?  74 ALA C C    1  
ATOM 3600   O O    . ALA C  1 74 ? 6.856   -11.879 -279.372 1.00 0.00 ?  74 ALA C O    1  
ATOM 3601   C CB   . ALA C  1 74 ? 7.419   -12.135 -276.147 1.00 0.00 ?  74 ALA C CB   1  
ATOM 3602   H H    . ALA C  1 74 ? 5.143   -13.101 -275.569 1.00 0.00 ?  74 ALA C H    1  
ATOM 3603   H HA   . ALA C  1 74 ? 6.000   -10.944 -277.210 1.00 0.00 ?  74 ALA C HA   1  
ATOM 3604   H HB1  . ALA C  1 74 ? 7.635   -13.189 -275.979 1.00 0.00 ?  74 ALA C HB1  1  
ATOM 3605   H HB2  . ALA C  1 74 ? 8.282   -11.658 -276.613 1.00 0.00 ?  74 ALA C HB2  1  
ATOM 3606   H HB3  . ALA C  1 74 ? 7.207   -11.650 -275.194 1.00 0.00 ?  74 ALA C HB3  1  
ATOM 3607   N N    . ILE C  1 75 ? 6.385   -13.917 -278.541 1.00 0.00 ?  75 ILE C N    1  
ATOM 3608   C CA   . ILE C  1 75 ? 6.685   -14.616 -279.785 1.00 0.00 ?  75 ILE C CA   1  
ATOM 3609   C C    . ILE C  1 75 ? 5.642   -14.313 -280.853 1.00 0.00 ?  75 ILE C C    1  
ATOM 3610   O O    . ILE C  1 75 ? 5.981   -13.979 -281.988 1.00 0.00 ?  75 ILE C O    1  
ATOM 3611   C CB   . ILE C  1 75 ? 6.760   -16.139 -279.573 1.00 0.00 ?  75 ILE C CB   1  
ATOM 3612   C CG1  . ILE C  1 75 ? 7.959   -16.497 -278.690 1.00 0.00 ?  75 ILE C CG1  1  
ATOM 3613   C CG2  . ILE C  1 75 ? 6.846   -16.859 -280.910 1.00 0.00 ?  75 ILE C CG2  1  
ATOM 3614   C CD1  . ILE C  1 75 ? 7.937   -17.919 -278.177 1.00 0.00 ?  75 ILE C CD1  1  
ATOM 3615   H H    . ILE C  1 75 ? 6.072   -14.448 -277.741 1.00 0.00 ?  75 ILE C H    1  
ATOM 3616   H HA   . ILE C  1 75 ? 7.624   -14.263 -280.208 1.00 0.00 ?  75 ILE C HA   1  
ATOM 3617   H HB   . ILE C  1 75 ? 5.869   -16.468 -279.040 1.00 0.00 ?  75 ILE C HB   1  
ATOM 3618   H HG12 . ILE C  1 75 ? 8.858   -16.338 -279.284 1.00 0.00 ?  75 ILE C HG12 1  
ATOM 3619   H HG13 . ILE C  1 75 ? 7.956   -15.807 -277.846 1.00 0.00 ?  75 ILE C HG13 1  
ATOM 3620   H HG21 . ILE C  1 75 ? 6.900   -17.935 -280.741 1.00 0.00 ?  75 ILE C HG21 1  
ATOM 3621   H HG22 . ILE C  1 75 ? 5.964   -16.629 -281.504 1.00 0.00 ?  75 ILE C HG22 1  
ATOM 3622   H HG23 . ILE C  1 75 ? 7.739   -16.532 -281.443 1.00 0.00 ?  75 ILE C HG23 1  
ATOM 3623   H HD11 . ILE C  1 75 ? 7.941   -18.610 -279.019 1.00 0.00 ?  75 ILE C HD11 1  
ATOM 3624   H HD12 . ILE C  1 75 ? 8.818   -18.097 -277.559 1.00 0.00 ?  75 ILE C HD12 1  
ATOM 3625   H HD13 . ILE C  1 75 ? 7.038   -18.078 -277.581 1.00 0.00 ?  75 ILE C HD13 1  
ATOM 3626   N N    . ILE C  1 76 ? 4.371   -14.430 -280.482 1.00 0.00 ?  76 ILE C N    1  
ATOM 3627   C CA   . ILE C  1 76 ? 3.277   -14.252 -281.429 1.00 0.00 ?  76 ILE C CA   1  
ATOM 3628   C C    . ILE C  1 76 ? 3.069   -12.779 -281.759 1.00 0.00 ?  76 ILE C C    1  
ATOM 3629   O O    . ILE C  1 76 ? 2.380   -12.440 -282.722 1.00 0.00 ?  76 ILE C O    1  
ATOM 3630   C CB   . ILE C  1 76 ? 1.960   -14.838 -280.888 1.00 0.00 ?  76 ILE C CB   1  
ATOM 3631   C CG1  . ILE C  1 76 ? 1.505   -14.070 -279.645 1.00 0.00 ?  76 ILE C CG1  1  
ATOM 3632   C CG2  . ILE C  1 76 ? 2.126   -16.317 -280.573 1.00 0.00 ?  76 ILE C CG2  1  
ATOM 3633   C CD1  . ILE C  1 76 ? 0.136   -14.473 -279.146 1.00 0.00 ?  76 ILE C CD1  1  
ATOM 3634   H H    . ILE C  1 76 ? 4.158   -14.648 -279.519 1.00 0.00 ?  76 ILE C H    1  
ATOM 3635   H HA   . ILE C  1 76 ? 3.516   -14.718 -282.384 1.00 0.00 ?  76 ILE C HA   1  
ATOM 3636   H HB   . ILE C  1 76 ? 1.181   -14.711 -281.638 1.00 0.00 ?  76 ILE C HB   1  
ATOM 3637   H HG12 . ILE C  1 76 ? 2.244   -14.249 -278.864 1.00 0.00 ?  76 ILE C HG12 1  
ATOM 3638   H HG13 . ILE C  1 76 ? 1.500   -13.011 -279.902 1.00 0.00 ?  76 ILE C HG13 1  
ATOM 3639   H HG21 . ILE C  1 76 ? 1.187   -16.715 -280.192 1.00 0.00 ?  76 ILE C HG21 1  
ATOM 3640   H HG22 . ILE C  1 76 ? 2.406   -16.852 -281.480 1.00 0.00 ?  76 ILE C HG22 1  
ATOM 3641   H HG23 . ILE C  1 76 ? 2.906   -16.444 -279.822 1.00 0.00 ?  76 ILE C HG23 1  
ATOM 3642   H HD11 . ILE C  1 76 ? 0.139   -15.530 -278.887 1.00 0.00 ?  76 ILE C HD11 1  
ATOM 3643   H HD12 . ILE C  1 76 ? -0.118  -13.885 -278.263 1.00 0.00 ?  76 ILE C HD12 1  
ATOM 3644   H HD13 . ILE C  1 76 ? -0.604  -14.292 -279.926 1.00 0.00 ?  76 ILE C HD13 1  
ATOM 3645   N N    . GLN C  1 77 ? 3.669   -11.907 -280.956 1.00 0.00 ?  77 GLN C N    1  
ATOM 3646   C CA   . GLN C  1 77 ? 3.756   -10.491 -281.291 1.00 0.00 ?  77 GLN C CA   1  
ATOM 3647   C C    . GLN C  1 77 ? 4.562   -10.275 -282.565 1.00 0.00 ?  77 GLN C C    1  
ATOM 3648   O O    . GLN C  1 77 ? 4.335   -9.313  -283.299 1.00 0.00 ?  77 GLN C O    1  
ATOM 3649   C CB   . GLN C  1 77 ? 4.390   -9.706  -280.140 1.00 0.00 ?  77 GLN C CB   1  
ATOM 3650   C CG   . GLN C  1 77 ? 4.386   -8.200  -280.337 1.00 0.00 ?  77 GLN C CG   1  
ATOM 3651   C CD   . GLN C  1 77 ? 2.983   -7.630  -280.422 1.00 0.00 ?  77 GLN C CD   1  
ATOM 3652   O OE1  . GLN C  1 77 ? 2.107   -7.981  -279.626 1.00 0.00 ?  77 GLN C OE1  1  
ATOM 3653   N NE2  . GLN C  1 77 ? 2.760   -6.750  -281.391 1.00 0.00 ?  77 GLN C NE2  1  
ATOM 3654   H H    . GLN C  1 77 ? 4.074   -12.234 -280.091 1.00 0.00 ?  77 GLN C H    1  
ATOM 3655   H HA   . GLN C  1 77 ? 2.757   -10.100 -281.486 1.00 0.00 ?  77 GLN C HA   1  
ATOM 3656   H HB2  . GLN C  1 77 ? 3.832   -9.961  -279.239 1.00 0.00 ?  77 GLN C HB2  1  
ATOM 3657   H HB3  . GLN C  1 77 ? 5.416   -10.062 -280.043 1.00 0.00 ?  77 GLN C HB3  1  
ATOM 3658   H HG2  . GLN C  1 77 ? 4.986   -7.524  -279.728 1.00 0.00 ?  77 GLN C HG2  1  
ATOM 3659   H HG3  . GLN C  1 77 ? 4.802   -8.244  -281.345 1.00 0.00 ?  77 GLN C HG3  1  
ATOM 3660   H HE21 . GLN C  1 77 ? 3.498   -6.496  -282.015 1.00 0.00 ?  77 GLN C HE21 1  
ATOM 3661   H HE22 . GLN C  1 77 ? 1.853   -6.341  -281.496 1.00 0.00 ?  77 GLN C HE22 1  
ATOM 3662   N N    . ASN C  1 78 ? 5.503   -11.177 -282.824 1.00 0.00 ?  78 ASN C N    1  
ATOM 3663   C CA   . ASN C  1 78 ? 6.303   -11.121 -284.042 1.00 0.00 ?  78 ASN C CA   1  
ATOM 3664   C C    . ASN C  1 78 ? 5.848   -12.170 -285.048 1.00 0.00 ?  78 ASN C C    1  
ATOM 3665   O O    . ASN C  1 78 ? 6.638   -12.644 -285.865 1.00 0.00 ?  78 ASN C O    1  
ATOM 3666   C CB   . ASN C  1 78 ? 7.782   -11.287 -283.742 1.00 0.00 ?  78 ASN C CB   1  
ATOM 3667   C CG   . ASN C  1 78 ? 8.366   -10.161 -282.935 1.00 0.00 ?  78 ASN C CG   1  
ATOM 3668   O OD1  . ASN C  1 78 ? 7.936   -9.007  -283.040 1.00 0.00 ?  78 ASN C OD1  1  
ATOM 3669   N ND2  . ASN C  1 78 ? 9.395   -10.476 -282.190 1.00 0.00 ?  78 ASN C ND2  1  
ATOM 3670   H H    . ASN C  1 78 ? 5.669   -11.919 -282.160 1.00 0.00 ?  78 ASN C H    1  
ATOM 3671   H HA   . ASN C  1 78 ? 6.173   -10.152 -284.526 1.00 0.00 ?  78 ASN C HA   1  
ATOM 3672   H HB2  . ASN C  1 78 ? 8.173   -12.235 -283.370 1.00 0.00 ?  78 ASN C HB2  1  
ATOM 3673   H HB3  . ASN C  1 78 ? 8.072   -11.159 -284.785 1.00 0.00 ?  78 ASN C HB3  1  
ATOM 3674   H HD21 . ASN C  1 78 ? 9.742   -11.413 -282.186 1.00 0.00 ?  78 ASN C HD21 1  
ATOM 3675   H HD22 . ASN C  1 78 ? 9.835   -9.777  -281.626 1.00 0.00 ?  78 ASN C HD22 1  
ATOM 3676   N N    . PHE C  1 79 ? 4.571   -12.530 -284.984 1.00 0.00 ?  79 PHE C N    1  
ATOM 3677   C CA   . PHE C  1 79 ? 4.028   -13.584 -285.832 1.00 0.00 ?  79 PHE C CA   1  
ATOM 3678   C C    . PHE C  1 79 ? 3.745   -13.070 -287.237 1.00 0.00 ?  79 PHE C C    1  
ATOM 3679   O O    . PHE C  1 79 ? 2.589   -12.925 -287.634 1.00 0.00 ?  79 PHE C O    1  
ATOM 3680   C CB   . PHE C  1 79 ? 2.753   -14.162 -285.216 1.00 0.00 ?  79 PHE C CB   1  
ATOM 3681   C CG   . PHE C  1 79 ? 2.370   -15.507 -285.765 1.00 0.00 ?  79 PHE C CG   1  
ATOM 3682   C CD1  . PHE C  1 79 ? 3.041   -16.653 -285.362 1.00 0.00 ?  79 PHE C CD1  1  
ATOM 3683   C CD2  . PHE C  1 79 ? 1.340   -15.631 -286.685 1.00 0.00 ?  79 PHE C CD2  1  
ATOM 3684   C CE1  . PHE C  1 79 ? 2.691   -17.891 -285.867 1.00 0.00 ?  79 PHE C CE1  1  
ATOM 3685   C CE2  . PHE C  1 79 ? 0.987   -16.867 -287.189 1.00 0.00 ?  79 PHE C CE2  1  
ATOM 3686   C CZ   . PHE C  1 79 ? 1.663   -17.998 -286.780 1.00 0.00 ?  79 PHE C CZ   1  
ATOM 3687   H H    . PHE C  1 79 ? 3.960   -12.061 -284.330 1.00 0.00 ?  79 PHE C H    1  
ATOM 3688   H HA   . PHE C  1 79 ? 4.759   -14.387 -285.937 1.00 0.00 ?  79 PHE C HA   1  
ATOM 3689   H HB2  . PHE C  1 79 ? 2.878   -14.288 -284.142 1.00 0.00 ?  79 PHE C HB2  1  
ATOM 3690   H HB3  . PHE C  1 79 ? 1.911   -13.498 -285.407 1.00 0.00 ?  79 PHE C HB3  1  
ATOM 3691   H HD1  . PHE C  1 79 ? 3.853   -16.568 -284.639 1.00 0.00 ?  79 PHE C HD1  1  
ATOM 3692   H HD2  . PHE C  1 79 ? 0.806   -14.737 -287.009 1.00 0.00 ?  79 PHE C HD2  1  
ATOM 3693   H HE1  . PHE C  1 79 ? 3.226   -18.782 -285.542 1.00 0.00 ?  79 PHE C HE1  1  
ATOM 3694   H HE2  . PHE C  1 79 ? 0.175   -16.950 -287.912 1.00 0.00 ?  79 PHE C HE2  1  
ATOM 3695   H HZ   . PHE C  1 79 ? 1.387   -18.973 -287.178 1.00 0.00 ?  79 PHE C HZ   1  
ATOM 3696   N N    . ARG C  1 80 ? 4.807   -12.795 -287.987 1.00 0.00 ?  80 ARG C N    1  
ATOM 3697   C CA   . ARG C  1 80 ? 4.676   -12.222 -289.321 1.00 0.00 ?  80 ARG C CA   1  
ATOM 3698   C C    . ARG C  1 80 ? 4.050   -13.218 -290.289 1.00 0.00 ?  80 ARG C C    1  
ATOM 3699   O O    . ARG C  1 80 ? 2.861   -13.382 -290.296 1.00 0.00 ?  80 ARG C O    1  
ATOM 3700   C CB   . ARG C  1 80 ? 6.000   -11.689 -289.849 1.00 0.00 ?  80 ARG C CB   1  
ATOM 3701   C CG   . ARG C  1 80 ? 6.621   -10.580 -289.015 1.00 0.00 ?  80 ARG C CG   1  
ATOM 3702   C CD   . ARG C  1 80 ? 5.785   -9.358  -288.900 1.00 0.00 ?  80 ARG C CD   1  
ATOM 3703   N NE   . ARG C  1 80 ? 5.614   -8.625  -290.144 1.00 0.00 ?  80 ARG C NE   1  
ATOM 3704   C CZ   . ARG C  1 80 ? 4.738   -7.617  -290.325 1.00 0.00 ?  80 ARG C CZ   1  
ATOM 3705   N NH1  . ARG C  1 80 ? 3.926   -7.245  -289.361 1.00 0.00 1  80 ARG C NH1  1  
ATOM 3706   N NH2  . ARG C  1 80 ? 4.699   -7.028  -291.508 1.00 0.00 ?  80 ARG C NH2  1  
ATOM 3707   O OXT  . ARG C  1 80 ? 4.589   -14.269 -290.501 1.00 0.00 -1 80 ARG C OXT  1  
ATOM 3708   H H    . ARG C  1 80 ? 5.729   -12.987 -287.622 1.00 0.00 ?  80 ARG C H    1  
ATOM 3709   H HA   . ARG C  1 80 ? 4.010   -11.359 -289.289 1.00 0.00 ?  80 ARG C HA   1  
ATOM 3710   H HB2  . ARG C  1 80 ? 6.687   -12.532 -289.895 1.00 0.00 ?  80 ARG C HB2  1  
ATOM 3711   H HB3  . ARG C  1 80 ? 5.813   -11.317 -290.857 1.00 0.00 ?  80 ARG C HB3  1  
ATOM 3712   H HG2  . ARG C  1 80 ? 6.800   -10.960 -288.009 1.00 0.00 ?  80 ARG C HG2  1  
ATOM 3713   H HG3  . ARG C  1 80 ? 7.571   -10.296 -289.470 1.00 0.00 ?  80 ARG C HG3  1  
ATOM 3714   H HD2  . ARG C  1 80 ? 4.793   -9.640  -288.549 1.00 0.00 ?  80 ARG C HD2  1  
ATOM 3715   H HD3  . ARG C  1 80 ? 6.245   -8.680  -288.182 1.00 0.00 ?  80 ARG C HD3  1  
ATOM 3716   H HE   . ARG C  1 80 ? 6.092   -8.737  -291.029 1.00 0.00 ?  80 ARG C HE   1  
ATOM 3717   H HH11 . ARG C  1 80 ? 3.956   -7.717  -288.468 1.00 0.00 ?  80 ARG C HH11 1  
ATOM 3718   H HH12 . ARG C  1 80 ? 3.277   -6.488  -289.516 1.00 0.00 ?  80 ARG C HH12 1  
ATOM 3719   H HH21 . ARG C  1 80 ? 5.318   -7.339  -292.244 1.00 0.00 ?  80 ARG C HH21 1  
ATOM 3720   H HH22 . ARG C  1 80 ? 4.052   -6.271  -291.670 1.00 0.00 ?  80 ARG C HH22 1  
ATOM 3721   N N    . MET D  1 1  ? 38.019  -26.627 -266.027 1.00 0.00 ?  1  MET D N    1  
ATOM 3722   C CA   . MET D  1 1  ? 38.259  -25.684 -267.112 1.00 0.00 ?  1  MET D CA   1  
ATOM 3723   C C    . MET D  1 1  ? 36.954  -25.087 -267.622 1.00 0.00 ?  1  MET D C    1  
ATOM 3724   O O    . MET D  1 1  ? 36.922  -23.951 -268.094 1.00 0.00 ?  1  MET D O    1  
ATOM 3725   C CB   . MET D  1 1  ? 39.007  -26.371 -268.253 1.00 0.00 ?  1  MET D CB   1  
ATOM 3726   C CG   . MET D  1 1  ? 40.400  -26.863 -267.886 1.00 0.00 ?  1  MET D CG   1  
ATOM 3727   S SD   . MET D  1 1  ? 41.470  -25.540 -267.287 1.00 0.00 ?  1  MET D SD   1  
ATOM 3728   C CE   . MET D  1 1  ? 41.713  -24.596 -268.789 1.00 0.00 ?  1  MET D CE   1  
ATOM 3729   H H1   . MET D  1 1  ? 38.302  -27.582 -266.122 1.00 0.00 ?  1  MET D H1   1  
ATOM 3730   H H2   . MET D  1 1  ? 38.423  -26.467 -265.126 1.00 0.00 ?  1  MET D H2   1  
ATOM 3731   H H3   . MET D  1 1  ? 37.085  -26.804 -265.715 1.00 0.00 ?  1  MET D H3   1  
ATOM 3732   H HA   . MET D  1 1  ? 38.861  -24.850 -266.753 1.00 0.00 ?  1  MET D HA   1  
ATOM 3733   H HB2  . MET D  1 1  ? 38.396  -27.214 -268.571 1.00 0.00 ?  1  MET D HB2  1  
ATOM 3734   H HB3  . MET D  1 1  ? 39.081  -25.647 -269.066 1.00 0.00 ?  1  MET D HB3  1  
ATOM 3735   H HG2  . MET D  1 1  ? 40.299  -27.620 -267.109 1.00 0.00 ?  1  MET D HG2  1  
ATOM 3736   H HG3  . MET D  1 1  ? 40.847  -27.310 -268.774 1.00 0.00 ?  1  MET D HG3  1  
ATOM 3737   H HE1  . MET D  1 1  ? 40.749  -24.244 -269.157 1.00 0.00 ?  1  MET D HE1  1  
ATOM 3738   H HE2  . MET D  1 1  ? 42.356  -23.740 -268.581 1.00 0.00 ?  1  MET D HE2  1  
ATOM 3739   H HE3  . MET D  1 1  ? 42.181  -25.228 -269.545 1.00 0.00 ?  1  MET D HE3  1  
ATOM 3740   N N    . ALA D  1 2  ? 35.877  -25.860 -267.524 1.00 0.00 ?  2  ALA D N    1  
ATOM 3741   C CA   . ALA D  1 2  ? 34.569  -25.415 -267.988 1.00 0.00 ?  2  ALA D CA   1  
ATOM 3742   C C    . ALA D  1 2  ? 33.958  -24.403 -267.027 1.00 0.00 ?  2  ALA D C    1  
ATOM 3743   O O    . ALA D  1 2  ? 34.141  -24.497 -265.813 1.00 0.00 ?  2  ALA D O    1  
ATOM 3744   C CB   . ALA D  1 2  ? 33.639  -26.605 -268.173 1.00 0.00 ?  2  ALA D CB   1  
ATOM 3745   H H    . ALA D  1 2  ? 35.968  -26.780 -267.117 1.00 0.00 ?  2  ALA D H    1  
ATOM 3746   H HA   . ALA D  1 2  ? 34.691  -24.916 -268.950 1.00 0.00 ?  2  ALA D HA   1  
ATOM 3747   H HB1  . ALA D  1 2  ? 33.519  -27.123 -267.223 1.00 0.00 ?  2  ALA D HB1  1  
ATOM 3748   H HB2  . ALA D  1 2  ? 32.667  -26.255 -268.520 1.00 0.00 ?  2  ALA D HB2  1  
ATOM 3749   H HB3  . ALA D  1 2  ? 34.062  -27.288 -268.909 1.00 0.00 ?  2  ALA D HB3  1  
ATOM 3750   N N    . THR D  1 3  ? 33.232  -23.436 -267.576 1.00 0.00 ?  3  THR D N    1  
ATOM 3751   C CA   . THR D  1 3  ? 32.581  -22.413 -266.767 1.00 0.00 ?  3  THR D CA   1  
ATOM 3752   C C    . THR D  1 3  ? 31.112  -22.266 -267.141 1.00 0.00 ?  3  THR D C    1  
ATOM 3753   O O    . THR D  1 3  ? 30.778  -22.012 -268.298 1.00 0.00 ?  3  THR D O    1  
ATOM 3754   C CB   . THR D  1 3  ? 33.277  -21.047 -266.917 1.00 0.00 ?  3  THR D CB   1  
ATOM 3755   O OG1  . THR D  1 3  ? 34.650  -21.162 -266.522 1.00 0.00 ?  3  THR D OG1  1  
ATOM 3756   C CG2  . THR D  1 3  ? 32.590  -20.001 -266.052 1.00 0.00 ?  3  THR D CG2  1  
ATOM 3757   H H    . THR D  1 3  ? 33.127  -23.409 -268.580 1.00 0.00 ?  3  THR D H    1  
ATOM 3758   H HA   . THR D  1 3  ? 32.604  -22.703 -265.716 1.00 0.00 ?  3  THR D HA   1  
ATOM 3759   H HB   . THR D  1 3  ? 33.232  -20.739 -267.961 1.00 0.00 ?  3  THR D HB   1  
ATOM 3760   H HG1  . THR D  1 3  ? 35.082  -20.309 -266.617 1.00 0.00 ?  3  THR D HG1  1  
ATOM 3761   H HG21 . THR D  1 3  ? 33.096  -19.043 -266.171 1.00 0.00 ?  3  THR D HG21 1  
ATOM 3762   H HG22 . THR D  1 3  ? 31.549  -19.904 -266.357 1.00 0.00 ?  3  THR D HG22 1  
ATOM 3763   H HG23 . THR D  1 3  ? 32.635  -20.307 -265.007 1.00 0.00 ?  3  THR D HG23 1  
ATOM 3764   N N    . PRO D  1 4  ? 30.236  -22.429 -266.154 1.00 0.00 ?  4  PRO D N    1  
ATOM 3765   C CA   . PRO D  1 4  ? 28.803  -22.275 -266.369 1.00 0.00 ?  4  PRO D CA   1  
ATOM 3766   C C    . PRO D  1 4  ? 28.479  -20.916 -266.976 1.00 0.00 ?  4  PRO D C    1  
ATOM 3767   O O    . PRO D  1 4  ? 29.106  -19.911 -266.641 1.00 0.00 ?  4  PRO D O    1  
ATOM 3768   C CB   . PRO D  1 4  ? 28.195  -22.443 -264.973 1.00 0.00 ?  4  PRO D CB   1  
ATOM 3769   C CG   . PRO D  1 4  ? 29.191  -23.266 -264.230 1.00 0.00 ?  4  PRO D CG   1  
ATOM 3770   C CD   . PRO D  1 4  ? 30.536  -22.824 -264.743 1.00 0.00 ?  4  PRO D CD   1  
ATOM 3771   H HA   . PRO D  1 4  ? 28.398  -23.008 -267.083 1.00 0.00 ?  4  PRO D HA   1  
ATOM 3772   H HB2  . PRO D  1 4  ? 28.037  -21.471 -264.483 1.00 0.00 ?  4  PRO D HB2  1  
ATOM 3773   H HB3  . PRO D  1 4  ? 27.217  -22.944 -265.017 1.00 0.00 ?  4  PRO D HB3  1  
ATOM 3774   H HG2  . PRO D  1 4  ? 29.109  -23.106 -263.145 1.00 0.00 ?  4  PRO D HG2  1  
ATOM 3775   H HG3  . PRO D  1 4  ? 29.033  -24.340 -264.410 1.00 0.00 ?  4  PRO D HG3  1  
ATOM 3776   H HD2  . PRO D  1 4  ? 30.942  -21.978 -264.168 1.00 0.00 ?  4  PRO D HD2  1  
ATOM 3777   H HD3  . PRO D  1 4  ? 31.283  -23.630 -264.700 1.00 0.00 ?  4  PRO D HD3  1  
ATOM 3778   N N    . TRP D  1 5  ? 27.497  -20.892 -267.871 1.00 0.00 ?  5  TRP D N    1  
ATOM 3779   C CA   . TRP D  1 5  ? 27.095  -19.658 -268.534 1.00 0.00 ?  5  TRP D CA   1  
ATOM 3780   C C    . TRP D  1 5  ? 26.512  -18.662 -267.539 1.00 0.00 ?  5  TRP D C    1  
ATOM 3781   O O    . TRP D  1 5  ? 25.776  -19.039 -266.627 1.00 0.00 ?  5  TRP D O    1  
ATOM 3782   C CB   . TRP D  1 5  ? 26.077  -19.952 -269.638 1.00 0.00 ?  5  TRP D CB   1  
ATOM 3783   C CG   . TRP D  1 5  ? 25.554  -18.721 -270.313 1.00 0.00 ?  5  TRP D CG   1  
ATOM 3784   C CD1  . TRP D  1 5  ? 26.077  -18.110 -271.413 1.00 0.00 ?  5  TRP D CD1  1  
ATOM 3785   C CD2  . TRP D  1 5  ? 24.405  -17.953 -269.935 1.00 0.00 ?  5  TRP D CD2  1  
ATOM 3786   N NE1  . TRP D  1 5  ? 25.328  -17.007 -271.743 1.00 0.00 ?  5  TRP D NE1  1  
ATOM 3787   C CE2  . TRP D  1 5  ? 24.293  -16.891 -270.850 1.00 0.00 ?  5  TRP D CE2  1  
ATOM 3788   C CE3  . TRP D  1 5  ? 23.459  -18.062 -268.908 1.00 0.00 ?  5  TRP D CE3  1  
ATOM 3789   C CZ2  . TRP D  1 5  ? 23.282  -15.946 -270.772 1.00 0.00 ?  5  TRP D CZ2  1  
ATOM 3790   C CZ3  . TRP D  1 5  ? 22.444  -17.116 -268.831 1.00 0.00 ?  5  TRP D CZ3  1  
ATOM 3791   C CH2  . TRP D  1 5  ? 22.358  -16.089 -269.737 1.00 0.00 ?  5  TRP D CH2  1  
ATOM 3792   H H    . TRP D  1 5  ? 27.016  -21.751 -268.097 1.00 0.00 ?  5  TRP D H    1  
ATOM 3793   H HA   . TRP D  1 5  ? 27.965  -19.178 -268.982 1.00 0.00 ?  5  TRP D HA   1  
ATOM 3794   H HB2  . TRP D  1 5  ? 26.531  -20.566 -270.416 1.00 0.00 ?  5  TRP D HB2  1  
ATOM 3795   H HB3  . TRP D  1 5  ? 25.213  -20.472 -269.223 1.00 0.00 ?  5  TRP D HB3  1  
ATOM 3796   H HD1  . TRP D  1 5  ? 26.968  -18.559 -271.849 1.00 0.00 ?  5  TRP D HD1  1  
ATOM 3797   H HE1  . TRP D  1 5  ? 25.509  -16.383 -272.516 1.00 0.00 ?  5  TRP D HE1  1  
ATOM 3798   H HE3  . TRP D  1 5  ? 23.479  -18.859 -268.165 1.00 0.00 ?  5  TRP D HE3  1  
ATOM 3799   H HZ2  . TRP D  1 5  ? 23.251  -15.146 -271.512 1.00 0.00 ?  5  TRP D HZ2  1  
ATOM 3800   H HZ3  . TRP D  1 5  ? 21.714  -17.212 -268.027 1.00 0.00 ?  5  TRP D HZ3  1  
ATOM 3801   H HH2  . TRP D  1 5  ? 21.546  -15.367 -269.642 1.00 0.00 ?  5  TRP D HH2  1  
ATOM 3802   N N    . SER D  1 6  ? 26.846  -17.389 -267.720 1.00 0.00 ?  6  SER D N    1  
ATOM 3803   C CA   . SER D  1 6  ? 26.276  -16.324 -266.902 1.00 0.00 ?  6  SER D CA   1  
ATOM 3804   C C    . SER D  1 6  ? 25.988  -15.083 -267.737 1.00 0.00 ?  6  SER D C    1  
ATOM 3805   O O    . SER D  1 6  ? 26.872  -14.562 -268.418 1.00 0.00 ?  6  SER D O    1  
ATOM 3806   C CB   . SER D  1 6  ? 27.213  -15.986 -265.759 1.00 0.00 ?  6  SER D CB   1  
ATOM 3807   O OG   . SER D  1 6  ? 26.739  -14.915 -264.989 1.00 0.00 ?  6  SER D OG   1  
ATOM 3808   H H    . SER D  1 6  ? 27.511  -17.152 -268.442 1.00 0.00 ?  6  SER D H    1  
ATOM 3809   H HA   . SER D  1 6  ? 25.377  -16.626 -266.364 1.00 0.00 ?  6  SER D HA   1  
ATOM 3810   H HB2  . SER D  1 6  ? 27.314  -16.863 -265.121 1.00 0.00 ?  6  SER D HB2  1  
ATOM 3811   H HB3  . SER D  1 6  ? 28.186  -15.723 -266.171 1.00 0.00 ?  6  SER D HB3  1  
ATOM 3812   H HG   . SER D  1 6  ? 27.284  -14.141 -265.149 1.00 0.00 ?  6  SER D HG   1  
ATOM 3813   N N    . GLY D  1 7  ? 24.746  -14.613 -267.681 1.00 0.00 ?  7  GLY D N    1  
ATOM 3814   C CA   . GLY D  1 7  ? 24.342  -13.427 -268.426 1.00 0.00 ?  7  GLY D CA   1  
ATOM 3815   C C    . GLY D  1 7  ? 24.746  -12.153 -267.694 1.00 0.00 ?  7  GLY D C    1  
ATOM 3816   O O    . GLY D  1 7  ? 25.376  -12.206 -266.638 1.00 0.00 ?  7  GLY D O    1  
ATOM 3817   H H    . GLY D  1 7  ? 24.065  -15.091 -267.108 1.00 0.00 ?  7  GLY D H    1  
ATOM 3818   H HA2  . GLY D  1 7  ? 24.820  -13.441 -269.405 1.00 0.00 ?  7  GLY D HA2  1  
ATOM 3819   H HA3  . GLY D  1 7  ? 23.260  -13.436 -268.550 1.00 0.00 ?  7  GLY D HA3  1  
ATOM 3820   N N    . TYR D  1 8  ? 24.381  -11.009 -268.263 1.00 0.00 ?  8  TYR D N    1  
ATOM 3821   C CA   . TYR D  1 8  ? 24.693  -9.720  -267.658 1.00 0.00 ?  8  TYR D CA   1  
ATOM 3822   C C    . TYR D  1 8  ? 23.979  -9.551  -266.323 1.00 0.00 ?  8  TYR D C    1  
ATOM 3823   O O    . TYR D  1 8  ? 24.592  -9.174  -265.324 1.00 0.00 ?  8  TYR D O    1  
ATOM 3824   C CB   . TYR D  1 8  ? 24.312  -8.579  -268.604 1.00 0.00 ?  8  TYR D CB   1  
ATOM 3825   C CG   . TYR D  1 8  ? 24.571  -7.200  -268.038 1.00 0.00 ?  8  TYR D CG   1  
ATOM 3826   C CD1  . TYR D  1 8  ? 25.801  -6.581  -268.204 1.00 0.00 ?  8  TYR D CD1  1  
ATOM 3827   C CD2  . TYR D  1 8  ? 23.583  -6.521  -267.341 1.00 0.00 ?  8  TYR D CD2  1  
ATOM 3828   C CE1  . TYR D  1 8  ? 26.043  -5.322  -267.688 1.00 0.00 ?  8  TYR D CE1  1  
ATOM 3829   C CE2  . TYR D  1 8  ? 23.813  -5.262  -266.821 1.00 0.00 ?  8  TYR D CE2  1  
ATOM 3830   C CZ   . TYR D  1 8  ? 25.045  -4.666  -266.997 1.00 0.00 ?  8  TYR D CZ   1  
ATOM 3831   O OH   . TYR D  1 8  ? 25.280  -3.411  -266.483 1.00 0.00 ?  8  TYR D OH   1  
ATOM 3832   H H    . TYR D  1 8  ? 23.875  -11.034 -269.136 1.00 0.00 ?  8  TYR D H    1  
ATOM 3833   H HA   . TYR D  1 8  ? 25.761  -9.657  -267.450 1.00 0.00 ?  8  TYR D HA   1  
ATOM 3834   H HB2  . TYR D  1 8  ? 24.892  -8.711  -269.519 1.00 0.00 ?  8  TYR D HB2  1  
ATOM 3835   H HB3  . TYR D  1 8  ? 23.251  -8.686  -268.828 1.00 0.00 ?  8  TYR D HB3  1  
ATOM 3836   H HD1  . TYR D  1 8  ? 26.585  -7.106  -268.751 1.00 0.00 ?  8  TYR D HD1  1  
ATOM 3837   H HD2  . TYR D  1 8  ? 22.612  -6.998  -267.205 1.00 0.00 ?  8  TYR D HD2  1  
ATOM 3838   H HE1  . TYR D  1 8  ? 27.015  -4.848  -267.826 1.00 0.00 ?  8  TYR D HE1  1  
ATOM 3839   H HE2  . TYR D  1 8  ? 23.024  -4.745  -266.275 1.00 0.00 ?  8  TYR D HE2  1  
ATOM 3840   H HH   . TYR D  1 8  ? 26.167  -3.092  -266.662 1.00 0.00 ?  8  TYR D HH   1  
ATOM 3841   N N    . LEU D  1 9  ? 22.681  -9.832  -266.312 1.00 0.00 ?  9  LEU D N    1  
ATOM 3842   C CA   . LEU D  1 9  ? 21.880  -9.705  -265.100 1.00 0.00 ?  9  LEU D CA   1  
ATOM 3843   C C    . LEU D  1 9  ? 22.330  -10.696 -264.035 1.00 0.00 ?  9  LEU D C    1  
ATOM 3844   O O    . LEU D  1 9  ? 22.290  -10.401 -262.841 1.00 0.00 ?  9  LEU D O    1  
ATOM 3845   C CB   . LEU D  1 9  ? 20.394  -9.907  -265.424 1.00 0.00 ?  9  LEU D CB   1  
ATOM 3846   C CG   . LEU D  1 9  ? 19.755  -8.803  -266.277 1.00 0.00 ?  9  LEU D CG   1  
ATOM 3847   C CD1  . LEU D  1 9  ? 18.328  -9.186  -266.642 1.00 0.00 ?  9  LEU D CD1  1  
ATOM 3848   C CD2  . LEU D  1 9  ? 19.782  -7.489  -265.511 1.00 0.00 ?  9  LEU D CD2  1  
ATOM 3849   H H    . LEU D  1 9  ? 22.237  -10.142 -267.165 1.00 0.00 ?  9  LEU D H    1  
ATOM 3850   H HA   . LEU D  1 9  ? 22.016  -8.711  -264.675 1.00 0.00 ?  9  LEU D HA   1  
ATOM 3851   H HB2  . LEU D  1 9  ? 20.461  -10.830 -265.997 1.00 0.00 ?  9  LEU D HB2  1  
ATOM 3852   H HB3  . LEU D  1 9  ? 19.805  -10.080 -264.523 1.00 0.00 ?  9  LEU D HB3  1  
ATOM 3853   H HG   . LEU D  1 9  ? 20.374  -8.684  -267.167 1.00 0.00 ?  9  LEU D HG   1  
ATOM 3854   H HD11 . LEU D  1 9  ? 17.883  -8.397  -267.248 1.00 0.00 ?  9  LEU D HD11 1  
ATOM 3855   H HD12 . LEU D  1 9  ? 18.334  -10.117 -267.209 1.00 0.00 ?  9  LEU D HD12 1  
ATOM 3856   H HD13 . LEU D  1 9  ? 17.743  -9.318  -265.733 1.00 0.00 ?  9  LEU D HD13 1  
ATOM 3857   H HD21 . LEU D  1 9  ? 20.814  -7.220  -265.285 1.00 0.00 ?  9  LEU D HD21 1  
ATOM 3858   H HD22 . LEU D  1 9  ? 19.329  -6.705  -266.119 1.00 0.00 ?  9  LEU D HD22 1  
ATOM 3859   H HD23 . LEU D  1 9  ? 19.223  -7.597  -264.582 1.00 0.00 ?  9  LEU D HD23 1  
ATOM 3860   N N    . ASP D  1 10 ? 22.759  -11.875 -264.475 1.00 0.00 ?  10 ASP D N    1  
ATOM 3861   C CA   . ASP D  1 10 ? 23.458  -12.810 -263.602 1.00 0.00 ?  10 ASP D CA   1  
ATOM 3862   C C    . ASP D  1 10 ? 24.690  -12.166 -262.979 1.00 0.00 ?  10 ASP D C    1  
ATOM 3863   O O    . ASP D  1 10 ? 24.931  -12.297 -261.779 1.00 0.00 ?  10 ASP D O    1  
ATOM 3864   C CB   . ASP D  1 10 ? 23.857  -14.069 -264.375 1.00 0.00 ?  10 ASP D CB   1  
ATOM 3865   C CG   . ASP D  1 10 ? 22.689  -14.966 -264.762 1.00 0.00 ?  10 ASP D CG   1  
ATOM 3866   O OD1  . ASP D  1 10 ? 21.628  -14.799 -264.209 1.00 0.00 ?  10 ASP D OD1  1  
ATOM 3867   O OD2  . ASP D  1 10 ? 22.819  -15.701 -265.712 1.00 0.00 -1 10 ASP D OD2  1  
ATOM 3868   H H    . ASP D  1 10 ? 22.596  -12.129 -265.439 1.00 0.00 ?  10 ASP D H    1  
ATOM 3869   H HA   . ASP D  1 10 ? 22.808  -13.100 -262.776 1.00 0.00 ?  10 ASP D HA   1  
ATOM 3870   H HB2  . ASP D  1 10 ? 24.464  -13.864 -265.256 1.00 0.00 ?  10 ASP D HB2  1  
ATOM 3871   H HB3  . ASP D  1 10 ? 24.465  -14.571 -263.622 1.00 0.00 ?  10 ASP D HB3  1  
ATOM 3872   N N    . ASP D  1 11 ? 25.467  -11.470 -263.802 1.00 0.00 ?  11 ASP D N    1  
ATOM 3873   C CA   . ASP D  1 11 ? 26.667  -10.790 -263.330 1.00 0.00 ?  11 ASP D CA   1  
ATOM 3874   C C    . ASP D  1 11 ? 26.320  -9.674  -262.353 1.00 0.00 ?  11 ASP D C    1  
ATOM 3875   O O    . ASP D  1 11 ? 27.039  -9.440  -261.382 1.00 0.00 ?  11 ASP D O    1  
ATOM 3876   C CB   . ASP D  1 11 ? 27.464  -10.227 -264.510 1.00 0.00 ?  11 ASP D CB   1  
ATOM 3877   C CG   . ASP D  1 11 ? 28.140  -11.283 -265.373 1.00 0.00 ?  11 ASP D CG   1  
ATOM 3878   O OD1  . ASP D  1 11 ? 28.191  -12.417 -264.960 1.00 0.00 ?  11 ASP D OD1  1  
ATOM 3879   O OD2  . ASP D  1 11 ? 28.459  -10.985 -266.500 1.00 0.00 -1 11 ASP D OD2  1  
ATOM 3880   H H    . ASP D  1 11 ? 25.220  -11.411 -264.780 1.00 0.00 ?  11 ASP D H    1  
ATOM 3881   H HA   . ASP D  1 11 ? 27.300  -11.492 -262.786 1.00 0.00 ?  11 ASP D HA   1  
ATOM 3882   H HB2  . ASP D  1 11 ? 26.885  -9.556  -265.144 1.00 0.00 ?  11 ASP D HB2  1  
ATOM 3883   H HB3  . ASP D  1 11 ? 28.223  -9.656  -263.973 1.00 0.00 ?  11 ASP D HB3  1  
ATOM 3884   N N    . VAL D  1 12 ? 25.213  -8.987  -262.616 1.00 0.00 ?  12 VAL D N    1  
ATOM 3885   C CA   . VAL D  1 12 ? 24.733  -7.938  -261.726 1.00 0.00 ?  12 VAL D CA   1  
ATOM 3886   C C    . VAL D  1 12 ? 24.406  -8.494  -260.345 1.00 0.00 ?  12 VAL D C    1  
ATOM 3887   O O    . VAL D  1 12 ? 24.772  -7.907  -259.327 1.00 0.00 ?  12 VAL D O    1  
ATOM 3888   C CB   . VAL D  1 12 ? 23.483  -7.241  -262.296 1.00 0.00 ?  12 VAL D CB   1  
ATOM 3889   C CG1  . VAL D  1 12 ? 22.856  -6.332  -261.249 1.00 0.00 ?  12 VAL D CG1  1  
ATOM 3890   C CG2  . VAL D  1 12 ? 23.839  -6.447  -263.544 1.00 0.00 ?  12 VAL D CG2  1  
ATOM 3891   H H    . VAL D  1 12 ? 24.692  -9.198  -263.455 1.00 0.00 ?  12 VAL D H    1  
ATOM 3892   H HA   . VAL D  1 12 ? 25.501  -7.185  -261.549 1.00 0.00 ?  12 VAL D HA   1  
ATOM 3893   H HB   . VAL D  1 12 ? 22.762  -7.999  -262.599 1.00 0.00 ?  12 VAL D HB   1  
ATOM 3894   H HG11 . VAL D  1 12 ? 21.974  -5.848  -261.669 1.00 0.00 ?  12 VAL D HG11 1  
ATOM 3895   H HG12 . VAL D  1 12 ? 22.565  -6.924  -260.381 1.00 0.00 ?  12 VAL D HG12 1  
ATOM 3896   H HG13 . VAL D  1 12 ? 23.577  -5.573  -260.947 1.00 0.00 ?  12 VAL D HG13 1  
ATOM 3897   H HG21 . VAL D  1 12 ? 24.246  -7.119  -264.300 1.00 0.00 ?  12 VAL D HG21 1  
ATOM 3898   H HG22 . VAL D  1 12 ? 22.945  -5.961  -263.934 1.00 0.00 ?  12 VAL D HG22 1  
ATOM 3899   H HG23 . VAL D  1 12 ? 24.583  -5.690  -263.293 1.00 0.00 ?  12 VAL D HG23 1  
ATOM 3900   N N    . SER D  1 13 ? 23.716  -9.629  -260.318 1.00 0.00 ?  13 SER D N    1  
ATOM 3901   C CA   . SER D  1 13 ? 23.419  -10.315 -259.067 1.00 0.00 ?  13 SER D CA   1  
ATOM 3902   C C    . SER D  1 13 ? 24.697  -10.696 -258.330 1.00 0.00 ?  13 SER D C    1  
ATOM 3903   O O    . SER D  1 13 ? 24.798  -10.528 -257.115 1.00 0.00 ?  13 SER D O    1  
ATOM 3904   C CB   . SER D  1 13 ? 22.577  -11.547 -259.334 1.00 0.00 ?  13 SER D CB   1  
ATOM 3905   O OG   . SER D  1 13 ? 22.320  -12.274 -258.164 1.00 0.00 ?  13 SER D OG   1  
ATOM 3906   H H    . SER D  1 13 ? 23.389  -10.027 -261.187 1.00 0.00 ?  13 SER D H    1  
ATOM 3907   H HA   . SER D  1 13 ? 22.765  -9.745  -258.405 1.00 0.00 ?  13 SER D HA   1  
ATOM 3908   H HB2  . SER D  1 13 ? 21.629  -11.233 -259.771 1.00 0.00 ?  13 SER D HB2  1  
ATOM 3909   H HB3  . SER D  1 13 ? 23.107  -12.186 -260.039 1.00 0.00 ?  13 SER D HB3  1  
ATOM 3910   H HG   . SER D  1 13 ? 22.114  -13.183 -258.391 1.00 0.00 ?  13 SER D HG   1  
ATOM 3911   N N    . ALA D  1 14 ? 25.672  -11.209 -259.074 1.00 0.00 ?  14 ALA D N    1  
ATOM 3912   C CA   . ALA D  1 14 ? 26.957  -11.586 -258.498 1.00 0.00 ?  14 ALA D CA   1  
ATOM 3913   C C    . ALA D  1 14 ? 27.702  -10.368 -257.968 1.00 0.00 ?  14 ALA D C    1  
ATOM 3914   O O    . ALA D  1 14 ? 28.335  -10.426 -256.914 1.00 0.00 ?  14 ALA D O    1  
ATOM 3915   C CB   . ALA D  1 14 ? 27.803  -12.323 -259.526 1.00 0.00 ?  14 ALA D CB   1  
ATOM 3916   H H    . ALA D  1 14 ? 25.518  -11.341 -260.063 1.00 0.00 ?  14 ALA D H    1  
ATOM 3917   H HA   . ALA D  1 14 ? 26.779  -12.251 -257.652 1.00 0.00 ?  14 ALA D HA   1  
ATOM 3918   H HB1  . ALA D  1 14 ? 27.976  -11.676 -260.385 1.00 0.00 ?  14 ALA D HB1  1  
ATOM 3919   H HB2  . ALA D  1 14 ? 28.759  -12.597 -259.080 1.00 0.00 ?  14 ALA D HB2  1  
ATOM 3920   H HB3  . ALA D  1 14 ? 27.281  -13.224 -259.849 1.00 0.00 ?  14 ALA D HB3  1  
ATOM 3921   N N    . LYS D  1 15 ? 27.622  -9.265  -258.705 1.00 0.00 ?  15 LYS D N    1  
ATOM 3922   C CA   . LYS D  1 15 ? 28.316  -8.040  -258.327 1.00 0.00 ?  15 LYS D CA   1  
ATOM 3923   C C    . LYS D  1 15 ? 27.809  -7.508  -256.992 1.00 0.00 ?  15 LYS D C    1  
ATOM 3924   O O    . LYS D  1 15 ? 28.592  -7.067  -256.151 1.00 0.00 ?  15 LYS D O    1  
ATOM 3925   C CB   . LYS D  1 15 ? 28.152  -6.975  -259.413 1.00 0.00 ?  15 LYS D CB   1  
ATOM 3926   C CG   . LYS D  1 15 ? 29.036  -7.182  -260.636 1.00 0.00 ?  15 LYS D CG   1  
ATOM 3927   C CD   . LYS D  1 15 ? 28.697  -6.190  -261.738 1.00 0.00 ?  15 LYS D CD   1  
ATOM 3928   C CE   . LYS D  1 15 ? 29.497  -6.471  -263.002 1.00 0.00 ?  15 LYS D CE   1  
ATOM 3929   N NZ   . LYS D  1 15 ? 30.948  -6.195  -262.815 1.00 0.00 1  15 LYS D NZ   1  
ATOM 3930   H H    . LYS D  1 15 ? 27.067  -9.276  -259.548 1.00 0.00 ?  15 LYS D H    1  
ATOM 3931   H HA   . LYS D  1 15 ? 29.379  -8.243  -258.197 1.00 0.00 ?  15 LYS D HA   1  
ATOM 3932   H HB2  . LYS D  1 15 ? 27.105  -6.987  -259.717 1.00 0.00 ?  15 LYS D HB2  1  
ATOM 3933   H HB3  . LYS D  1 15 ? 28.385  -6.013  -258.956 1.00 0.00 ?  15 LYS D HB3  1  
ATOM 3934   H HG2  . LYS D  1 15 ? 30.077  -7.052  -260.336 1.00 0.00 ?  15 LYS D HG2  1  
ATOM 3935   H HG3  . LYS D  1 15 ? 28.889  -8.198  -261.002 1.00 0.00 ?  15 LYS D HG3  1  
ATOM 3936   H HD2  . LYS D  1 15 ? 27.631  -6.267  -261.958 1.00 0.00 ?  15 LYS D HD2  1  
ATOM 3937   H HD3  . LYS D  1 15 ? 28.922  -5.185  -261.383 1.00 0.00 ?  15 LYS D HD3  1  
ATOM 3938   H HE2  . LYS D  1 15 ? 29.359  -7.518  -263.269 1.00 0.00 ?  15 LYS D HE2  1  
ATOM 3939   H HE3  . LYS D  1 15 ? 29.108  -5.839  -263.800 1.00 0.00 ?  15 LYS D HE3  1  
ATOM 3940   H HZ1  . LYS D  1 15 ? 31.309  -6.781  -262.076 1.00 0.00 ?  15 LYS D HZ1  1  
ATOM 3941   H HZ2  . LYS D  1 15 ? 31.441  -6.393  -263.674 1.00 0.00 ?  15 LYS D HZ2  1  
ATOM 3942   H HZ3  . LYS D  1 15 ? 31.077  -5.224  -262.568 1.00 0.00 ?  15 LYS D HZ3  1  
ATOM 3943   N N    . PHE D  1 16 ? 26.495  -7.554  -256.804 1.00 0.00 ?  16 PHE D N    1  
ATOM 3944   C CA   . PHE D  1 16 ? 25.890  -7.176  -255.532 1.00 0.00 ?  16 PHE D CA   1  
ATOM 3945   C C    . PHE D  1 16 ? 26.301  -8.133  -254.421 1.00 0.00 ?  16 PHE D C    1  
ATOM 3946   O O    . PHE D  1 16 ? 26.737  -7.707  -253.351 1.00 0.00 ?  16 PHE D O    1  
ATOM 3947   C CB   . PHE D  1 16 ? 24.365  -7.139  -255.656 1.00 0.00 ?  16 PHE D CB   1  
ATOM 3948   C CG   . PHE D  1 16 ? 23.663  -6.751  -254.386 1.00 0.00 ?  16 PHE D CG   1  
ATOM 3949   C CD1  . PHE D  1 16 ? 23.444  -5.416  -254.078 1.00 0.00 ?  16 PHE D CD1  1  
ATOM 3950   C CD2  . PHE D  1 16 ? 23.222  -7.719  -253.496 1.00 0.00 ?  16 PHE D CD2  1  
ATOM 3951   C CE1  . PHE D  1 16 ? 22.799  -5.058  -252.909 1.00 0.00 ?  16 PHE D CE1  1  
ATOM 3952   C CE2  . PHE D  1 16 ? 22.576  -7.364  -252.328 1.00 0.00 ?  16 PHE D CE2  1  
ATOM 3953   C CZ   . PHE D  1 16 ? 22.364  -6.032  -252.035 1.00 0.00 ?  16 PHE D CZ   1  
ATOM 3954   H H    . PHE D  1 16 ? 25.899  -7.857  -257.561 1.00 0.00 ?  16 PHE D H    1  
ATOM 3955   H HA   . PHE D  1 16 ? 26.239  -6.187  -255.235 1.00 0.00 ?  16 PHE D HA   1  
ATOM 3956   H HB2  . PHE D  1 16 ? 24.068  -6.412  -256.411 1.00 0.00 ?  16 PHE D HB2  1  
ATOM 3957   H HB3  . PHE D  1 16 ? 23.988  -8.122  -255.932 1.00 0.00 ?  16 PHE D HB3  1  
ATOM 3958   H HD1  . PHE D  1 16 ? 23.787  -4.647  -254.770 1.00 0.00 ?  16 PHE D HD1  1  
ATOM 3959   H HD2  . PHE D  1 16 ? 23.390  -8.771  -253.728 1.00 0.00 ?  16 PHE D HD2  1  
ATOM 3960   H HE1  . PHE D  1 16 ? 22.633  -4.006  -252.679 1.00 0.00 ?  16 PHE D HE1  1  
ATOM 3961   H HE2  . PHE D  1 16 ? 22.233  -8.134  -251.638 1.00 0.00 ?  16 PHE D HE2  1  
ATOM 3962   H HZ   . PHE D  1 16 ? 21.856  -5.750  -251.113 1.00 0.00 ?  16 PHE D HZ   1  
ATOM 3963   N N    . ASP D  1 17 ? 26.162  -9.429  -254.681 1.00 0.00 ?  17 ASP D N    1  
ATOM 3964   C CA   . ASP D  1 17 ? 26.436  -10.446 -253.673 1.00 0.00 ?  17 ASP D CA   1  
ATOM 3965   C C    . ASP D  1 17 ? 27.902  -10.429 -253.258 1.00 0.00 ?  17 ASP D C    1  
ATOM 3966   O O    . ASP D  1 17 ? 28.239  -10.765 -252.123 1.00 0.00 ?  17 ASP D O    1  
ATOM 3967   C CB   . ASP D  1 17 ? 26.054  -11.834 -254.193 1.00 0.00 ?  17 ASP D CB   1  
ATOM 3968   C CG   . ASP D  1 17 ? 24.555  -12.101 -254.230 1.00 0.00 ?  17 ASP D CG   1  
ATOM 3969   O OD1  . ASP D  1 17 ? 23.822  -11.344 -253.639 1.00 0.00 ?  17 ASP D OD1  1  
ATOM 3970   O OD2  . ASP D  1 17 ? 24.143  -12.960 -254.972 1.00 0.00 -1 17 ASP D OD2  1  
ATOM 3971   H H    . ASP D  1 17 ? 25.857  -9.716  -255.600 1.00 0.00 ?  17 ASP D H    1  
ATOM 3972   H HA   . ASP D  1 17 ? 25.857  -10.240 -252.773 1.00 0.00 ?  17 ASP D HA   1  
ATOM 3973   H HB2  . ASP D  1 17 ? 26.488  -12.068 -255.166 1.00 0.00 ?  17 ASP D HB2  1  
ATOM 3974   H HB3  . ASP D  1 17 ? 26.515  -12.459 -253.428 1.00 0.00 ?  17 ASP D HB3  1  
ATOM 3975   N N    . THR D  1 18 ? 28.769  -10.035 -254.184 1.00 0.00 ?  18 THR D N    1  
ATOM 3976   C CA   . THR D  1 18 ? 30.201  -9.975  -253.916 1.00 0.00 ?  18 THR D CA   1  
ATOM 3977   C C    . THR D  1 18 ? 30.489  -9.220  -252.625 1.00 0.00 ?  18 THR D C    1  
ATOM 3978   O O    . THR D  1 18 ? 31.318  -9.642  -251.819 1.00 0.00 ?  18 THR D O    1  
ATOM 3979   C CB   . THR D  1 18 ? 30.965  -9.304  -255.073 1.00 0.00 ?  18 THR D CB   1  
ATOM 3980   O OG1  . THR D  1 18 ? 30.825  -10.092 -256.262 1.00 0.00 ?  18 THR D OG1  1  
ATOM 3981   C CG2  . THR D  1 18 ? 32.440  -9.168  -254.730 1.00 0.00 ?  18 THR D CG2  1  
ATOM 3982   H H    . THR D  1 18 ? 28.428  -9.771  -255.097 1.00 0.00 ?  18 THR D H    1  
ATOM 3983   H HA   . THR D  1 18 ? 30.593  -10.983 -253.778 1.00 0.00 ?  18 THR D HA   1  
ATOM 3984   H HB   . THR D  1 18 ? 30.541  -8.316  -255.251 1.00 0.00 ?  18 THR D HB   1  
ATOM 3985   H HG1  . THR D  1 18 ? 31.301  -9.671  -256.982 1.00 0.00 ?  18 THR D HG1  1  
ATOM 3986   H HG21 . THR D  1 18 ? 32.963  -8.691  -255.559 1.00 0.00 ?  18 THR D HG21 1  
ATOM 3987   H HG22 . THR D  1 18 ? 32.550  -8.560  -253.832 1.00 0.00 ?  18 THR D HG22 1  
ATOM 3988   H HG23 . THR D  1 18 ? 32.864  -10.156 -254.553 1.00 0.00 ?  18 THR D HG23 1  
ATOM 3989   N N    . GLY D  1 19 ? 29.800  -8.100  -252.434 1.00 0.00 ?  19 GLY D N    1  
ATOM 3990   C CA   . GLY D  1 19 ? 30.089  -7.203  -251.323 1.00 0.00 ?  19 GLY D CA   1  
ATOM 3991   C C    . GLY D  1 19 ? 29.383  -7.656  -250.051 1.00 0.00 ?  19 GLY D C    1  
ATOM 3992   O O    . GLY D  1 19 ? 29.694  -7.187  -248.956 1.00 0.00 ?  19 GLY D O    1  
ATOM 3993   H H    . GLY D  1 19 ? 29.056  -7.865  -253.076 1.00 0.00 ?  19 GLY D H    1  
ATOM 3994   H HA2  . GLY D  1 19 ? 31.165  -7.189  -251.146 1.00 0.00 ?  19 GLY D HA2  1  
ATOM 3995   H HA3  . GLY D  1 19 ? 29.751  -6.199  -251.578 1.00 0.00 ?  19 GLY D HA3  1  
ATOM 3996   N N    . VAL D  1 20 ? 28.432  -8.571  -250.202 1.00 0.00 ?  20 VAL D N    1  
ATOM 3997   C CA   . VAL D  1 20 ? 27.657  -9.065  -249.070 1.00 0.00 ?  20 VAL D CA   1  
ATOM 3998   C C    . VAL D  1 20 ? 27.604  -10.587 -249.061 1.00 0.00 ?  20 VAL D C    1  
ATOM 3999   O O    . VAL D  1 20 ? 26.667  -11.182 -248.528 1.00 0.00 ?  20 VAL D O    1  
ATOM 4000   C CB   . VAL D  1 20 ? 26.219  -8.511  -249.085 1.00 0.00 ?  20 VAL D CB   1  
ATOM 4001   C CG1  . VAL D  1 20 ? 26.218  -7.024  -248.762 1.00 0.00 ?  20 VAL D CG1  1  
ATOM 4002   C CG2  . VAL D  1 20 ? 25.565  -8.762  -250.435 1.00 0.00 ?  20 VAL D CG2  1  
ATOM 4003   H H    . VAL D  1 20 ? 28.240  -8.933  -251.125 1.00 0.00 ?  20 VAL D H    1  
ATOM 4004   H HA   . VAL D  1 20 ? 28.123  -8.795  -248.122 1.00 0.00 ?  20 VAL D HA   1  
ATOM 4005   H HB   . VAL D  1 20 ? 25.627  -9.045  -248.342 1.00 0.00 ?  20 VAL D HB   1  
ATOM 4006   H HG11 . VAL D  1 20 ? 25.194  -6.650  -248.777 1.00 0.00 ?  20 VAL D HG11 1  
ATOM 4007   H HG12 . VAL D  1 20 ? 26.648  -6.866  -247.773 1.00 0.00 ?  20 VAL D HG12 1  
ATOM 4008   H HG13 . VAL D  1 20 ? 26.809  -6.490  -249.506 1.00 0.00 ?  20 VAL D HG13 1  
ATOM 4009   H HG21 . VAL D  1 20 ? 25.534  -9.834  -250.631 1.00 0.00 ?  20 VAL D HG21 1  
ATOM 4010   H HG22 . VAL D  1 20 ? 24.550  -8.365  -250.428 1.00 0.00 ?  20 VAL D HG22 1  
ATOM 4011   H HG23 . VAL D  1 20 ? 26.143  -8.267  -251.216 1.00 0.00 ?  20 VAL D HG23 1  
ATOM 4012   N N    . ASP D  1 21 ? 28.615  -11.212 -249.654 1.00 0.00 ?  21 ASP D N    1  
ATOM 4013   C CA   . ASP D  1 21 ? 28.728  -12.666 -249.644 1.00 0.00 ?  21 ASP D CA   1  
ATOM 4014   C C    . ASP D  1 21 ? 28.787  -13.204 -248.220 1.00 0.00 ?  21 ASP D C    1  
ATOM 4015   O O    . ASP D  1 21 ? 28.244  -14.269 -247.926 1.00 0.00 ?  21 ASP D O    1  
ATOM 4016   C CB   . ASP D  1 21 ? 29.966  -13.113 -250.426 1.00 0.00 ?  21 ASP D CB   1  
ATOM 4017   C CG   . ASP D  1 21 ? 30.075  -14.619 -250.623 1.00 0.00 ?  21 ASP D CG   1  
ATOM 4018   O OD1  . ASP D  1 21 ? 29.204  -15.182 -251.243 1.00 0.00 ?  21 ASP D OD1  1  
ATOM 4019   O OD2  . ASP D  1 21 ? 31.099  -15.168 -250.293 1.00 0.00 -1 21 ASP D OD2  1  
ATOM 4020   H H    . ASP D  1 21 ? 29.323  -10.667 -250.124 1.00 0.00 ?  21 ASP D H    1  
ATOM 4021   H HA   . ASP D  1 21 ? 27.845  -13.108 -250.107 1.00 0.00 ?  21 ASP D HA   1  
ATOM 4022   H HB2  . ASP D  1 21 ? 30.076  -12.613 -251.388 1.00 0.00 ?  21 ASP D HB2  1  
ATOM 4023   H HB3  . ASP D  1 21 ? 30.752  -12.778 -249.749 1.00 0.00 ?  21 ASP D HB3  1  
ATOM 4024   N N    . ASN D  1 22 ? 29.448  -12.462 -247.339 1.00 0.00 ?  22 ASN D N    1  
ATOM 4025   C CA   . ASN D  1 22 ? 29.609  -12.880 -245.952 1.00 0.00 ?  22 ASN D CA   1  
ATOM 4026   C C    . ASN D  1 22 ? 28.350  -12.598 -245.142 1.00 0.00 ?  22 ASN D C    1  
ATOM 4027   O O    . ASN D  1 22 ? 28.066  -13.282 -244.159 1.00 0.00 ?  22 ASN D O    1  
ATOM 4028   C CB   . ASN D  1 22 ? 30.809  -12.212 -245.306 1.00 0.00 ?  22 ASN D CB   1  
ATOM 4029   C CG   . ASN D  1 22 ? 32.130  -12.711 -245.822 1.00 0.00 ?  22 ASN D CG   1  
ATOM 4030   O OD1  . ASN D  1 22 ? 32.231  -13.820 -246.359 1.00 0.00 ?  22 ASN D OD1  1  
ATOM 4031   N ND2  . ASN D  1 22 ? 33.157  -11.934 -245.589 1.00 0.00 ?  22 ASN D ND2  1  
ATOM 4032   H H    . ASN D  1 22 ? 29.851  -11.585 -247.638 1.00 0.00 ?  22 ASN D H    1  
ATOM 4033   H HA   . ASN D  1 22 ? 29.770  -13.958 -245.907 1.00 0.00 ?  22 ASN D HA   1  
ATOM 4034   H HB2  . ASN D  1 22 ? 30.853  -11.127 -245.199 1.00 0.00 ?  22 ASN D HB2  1  
ATOM 4035   H HB3  . ASN D  1 22 ? 30.618  -12.665 -244.333 1.00 0.00 ?  22 ASN D HB3  1  
ATOM 4036   H HD21 . ASN D  1 22 ? 33.031  -11.073 -245.097 1.00 0.00 ?  22 ASN D HD21 1  
ATOM 4037   H HD22 . ASN D  1 22 ? 34.068  -12.202 -245.904 1.00 0.00 ?  22 ASN D HD22 1  
ATOM 4038   N N    . LEU D  1 23 ? 27.597  -11.586 -245.561 1.00 0.00 ?  23 LEU D N    1  
ATOM 4039   C CA   . LEU D  1 23 ? 26.388  -11.186 -244.852 1.00 0.00 ?  23 LEU D CA   1  
ATOM 4040   C C    . LEU D  1 23 ? 25.465  -12.375 -244.622 1.00 0.00 ?  23 LEU D C    1  
ATOM 4041   O O    . LEU D  1 23 ? 24.996  -12.602 -243.507 1.00 0.00 ?  23 LEU D O    1  
ATOM 4042   C CB   . LEU D  1 23 ? 25.656  -10.086 -245.632 1.00 0.00 ?  23 LEU D CB   1  
ATOM 4043   C CG   . LEU D  1 23 ? 24.232  -9.781  -245.150 1.00 0.00 ?  23 LEU D CG   1  
ATOM 4044   C CD1  . LEU D  1 23 ? 24.251  -9.394  -243.677 1.00 0.00 ?  23 LEU D CD1  1  
ATOM 4045   C CD2  . LEU D  1 23 ? 23.637  -8.663  -245.994 1.00 0.00 ?  23 LEU D CD2  1  
ATOM 4046   H H    . LEU D  1 23 ? 27.870  -11.081 -246.393 1.00 0.00 ?  23 LEU D H    1  
ATOM 4047   H HA   . LEU D  1 23 ? 26.652  -10.804 -243.867 1.00 0.00 ?  23 LEU D HA   1  
ATOM 4048   H HB2  . LEU D  1 23 ? 26.313  -9.246  -245.411 1.00 0.00 ?  23 LEU D HB2  1  
ATOM 4049   H HB3  . LEU D  1 23 ? 25.662  -10.279 -246.704 1.00 0.00 ?  23 LEU D HB3  1  
ATOM 4050   H HG   . LEU D  1 23 ? 23.635  -10.678 -245.316 1.00 0.00 ?  23 LEU D HG   1  
ATOM 4051   H HD11 . LEU D  1 23 ? 23.235  -9.180  -243.344 1.00 0.00 ?  23 LEU D HD11 1  
ATOM 4052   H HD12 . LEU D  1 23 ? 24.658  -10.217 -243.090 1.00 0.00 ?  23 LEU D HD12 1  
ATOM 4053   H HD13 . LEU D  1 23 ? 24.871  -8.509  -243.542 1.00 0.00 ?  23 LEU D HD13 1  
ATOM 4054   H HD21 . LEU D  1 23 ? 23.608  -8.972  -247.039 1.00 0.00 ?  23 LEU D HD21 1  
ATOM 4055   H HD22 . LEU D  1 23 ? 22.625  -8.449  -245.651 1.00 0.00 ?  23 LEU D HD22 1  
ATOM 4056   H HD23 . LEU D  1 23 ? 24.252  -7.768  -245.897 1.00 0.00 ?  23 LEU D HD23 1  
ATOM 4057   N N    . GLN D  1 24 ? 25.208  -13.133 -245.683 1.00 0.00 ?  24 GLN D N    1  
ATOM 4058   C CA   . GLN D  1 24 ? 24.339  -14.300 -245.599 1.00 0.00 ?  24 GLN D CA   1  
ATOM 4059   C C    . GLN D  1 24 ? 24.850  -15.294 -244.563 1.00 0.00 ?  24 GLN D C    1  
ATOM 4060   O O    . GLN D  1 24 ? 24.081  -15.810 -243.752 1.00 0.00 ?  24 GLN D O    1  
ATOM 4061   C CB   . GLN D  1 24 ? 24.229  -14.987 -246.963 1.00 0.00 ?  24 GLN D CB   1  
ATOM 4062   C CG   . GLN D  1 24 ? 23.298  -16.186 -246.983 1.00 0.00 ?  24 GLN D CG   1  
ATOM 4063   C CD   . GLN D  1 24 ? 23.213  -16.830 -248.354 1.00 0.00 ?  24 GLN D CD   1  
ATOM 4064   O OE1  . GLN D  1 24 ? 23.915  -16.432 -249.287 1.00 0.00 ?  24 GLN D OE1  1  
ATOM 4065   N NE2  . GLN D  1 24 ? 22.348  -17.830 -248.484 1.00 0.00 ?  24 GLN D NE2  1  
ATOM 4066   H H    . GLN D  1 24 ? 25.626  -12.894 -246.571 1.00 0.00 ?  24 GLN D H    1  
ATOM 4067   H HA   . GLN D  1 24 ? 23.346  -13.993 -245.270 1.00 0.00 ?  24 GLN D HA   1  
ATOM 4068   H HB2  . GLN D  1 24 ? 23.876  -14.233 -247.667 1.00 0.00 ?  24 GLN D HB2  1  
ATOM 4069   H HB3  . GLN D  1 24 ? 25.236  -15.298 -247.240 1.00 0.00 ?  24 GLN D HB3  1  
ATOM 4070   H HG2  . GLN D  1 24 ? 23.346  -16.983 -246.241 1.00 0.00 ?  24 GLN D HG2  1  
ATOM 4071   H HG3  . GLN D  1 24 ? 22.394  -15.597 -246.823 1.00 0.00 ?  24 GLN D HG3  1  
ATOM 4072   H HE21 . GLN D  1 24 ? 21.797  -18.120 -247.702 1.00 0.00 ?  24 GLN D HE21 1  
ATOM 4073   H HE22 . GLN D  1 24 ? 22.248  -18.293 -249.366 1.00 0.00 ?  24 GLN D HE22 1  
ATOM 4074   N N    . THR D  1 25 ? 26.152  -15.558 -244.596 1.00 0.00 ?  25 THR D N    1  
ATOM 4075   C CA   . THR D  1 25 ? 26.763  -16.512 -243.678 1.00 0.00 ?  25 THR D CA   1  
ATOM 4076   C C    . THR D  1 25 ? 26.678  -16.024 -242.238 1.00 0.00 ?  25 THR D C    1  
ATOM 4077   O O    . THR D  1 25 ? 26.412  -16.803 -241.323 1.00 0.00 ?  25 THR D O    1  
ATOM 4078   C CB   . THR D  1 25 ? 28.238  -16.773 -244.035 1.00 0.00 ?  25 THR D CB   1  
ATOM 4079   O OG1  . THR D  1 25 ? 28.321  -17.350 -245.345 1.00 0.00 ?  25 THR D OG1  1  
ATOM 4080   C CG2  . THR D  1 25 ? 28.871  -17.721 -243.027 1.00 0.00 ?  25 THR D CG2  1  
ATOM 4081   H H    . THR D  1 25 ? 26.733  -15.086 -245.274 1.00 0.00 ?  25 THR D H    1  
ATOM 4082   H HA   . THR D  1 25 ? 26.222  -17.458 -243.716 1.00 0.00 ?  25 THR D HA   1  
ATOM 4083   H HB   . THR D  1 25 ? 28.777  -15.826 -244.030 1.00 0.00 ?  25 THR D HB   1  
ATOM 4084   H HG1  . THR D  1 25 ? 27.944  -16.742 -245.986 1.00 0.00 ?  25 THR D HG1  1  
ATOM 4085   H HG21 . THR D  1 25 ? 29.913  -17.893 -243.296 1.00 0.00 ?  25 THR D HG21 1  
ATOM 4086   H HG22 . THR D  1 25 ? 28.820  -17.280 -242.032 1.00 0.00 ?  25 THR D HG22 1  
ATOM 4087   H HG23 . THR D  1 25 ? 28.333  -18.668 -243.033 1.00 0.00 ?  25 THR D HG23 1  
ATOM 4088   N N    . GLN D  1 26 ? 26.907  -14.729 -242.043 1.00 0.00 ?  26 GLN D N    1  
ATOM 4089   C CA   . GLN D  1 26 ? 26.916  -14.146 -240.707 1.00 0.00 ?  26 GLN D CA   1  
ATOM 4090   C C    . GLN D  1 26 ? 25.541  -14.236 -240.057 1.00 0.00 ?  26 GLN D C    1  
ATOM 4091   O O    . GLN D  1 26 ? 25.418  -14.624 -238.895 1.00 0.00 ?  26 GLN D O    1  
ATOM 4092   C CB   . GLN D  1 26 ? 27.365  -12.683 -240.764 1.00 0.00 ?  26 GLN D CB   1  
ATOM 4093   C CG   . GLN D  1 26 ? 28.847  -12.498 -241.046 1.00 0.00 ?  26 GLN D CG   1  
ATOM 4094   C CD   . GLN D  1 26 ? 29.237  -11.036 -241.154 1.00 0.00 ?  26 GLN D CD   1  
ATOM 4095   O OE1  . GLN D  1 26 ? 28.397  -10.143 -241.010 1.00 0.00 ?  26 GLN D OE1  1  
ATOM 4096   N NE2  . GLN D  1 26 ? 30.515  -10.783 -241.413 1.00 0.00 ?  26 GLN D NE2  1  
ATOM 4097   H H    . GLN D  1 26 ? 27.078  -14.134 -242.841 1.00 0.00 ?  26 GLN D H    1  
ATOM 4098   H HA   . GLN D  1 26 ? 27.598  -14.707 -240.069 1.00 0.00 ?  26 GLN D HA   1  
ATOM 4099   H HB2  . GLN D  1 26 ? 26.778  -12.204 -241.547 1.00 0.00 ?  26 GLN D HB2  1  
ATOM 4100   H HB3  . GLN D  1 26 ? 27.116  -12.239 -239.801 1.00 0.00 ?  26 GLN D HB3  1  
ATOM 4101   H HG2  . GLN D  1 26 ? 29.624  -13.010 -240.479 1.00 0.00 ?  26 GLN D HG2  1  
ATOM 4102   H HG3  . GLN D  1 26 ? 28.796  -12.916 -242.052 1.00 0.00 ?  26 GLN D HG3  1  
ATOM 4103   H HE21 . GLN D  1 26 ? 31.162  -11.537 -241.524 1.00 0.00 ?  26 GLN D HE21 1  
ATOM 4104   H HE22 . GLN D  1 26 ? 30.831  -9.837  -241.495 1.00 0.00 ?  26 GLN D HE22 1  
ATOM 4105   N N    . VAL D  1 27 ? 24.510  -13.875 -240.813 1.00 0.00 ?  27 VAL D N    1  
ATOM 4106   C CA   . VAL D  1 27 ? 23.150  -13.844 -240.289 1.00 0.00 ?  27 VAL D CA   1  
ATOM 4107   C C    . VAL D  1 27 ? 22.584  -15.251 -240.140 1.00 0.00 ?  27 VAL D C    1  
ATOM 4108   O O    . VAL D  1 27 ? 21.719  -15.496 -239.299 1.00 0.00 ?  27 VAL D O    1  
ATOM 4109   C CB   . VAL D  1 27 ? 22.215  -13.019 -241.193 1.00 0.00 ?  27 VAL D CB   1  
ATOM 4110   C CG1  . VAL D  1 27 ? 21.824  -13.819 -242.427 1.00 0.00 ?  27 VAL D CG1  1  
ATOM 4111   C CG2  . VAL D  1 27 ? 20.975  -12.588 -240.425 1.00 0.00 ?  27 VAL D CG2  1  
ATOM 4112   H H    . VAL D  1 27 ? 24.672  -13.617 -241.776 1.00 0.00 ?  27 VAL D H    1  
ATOM 4113   H HA   . VAL D  1 27 ? 23.122  -13.423 -239.283 1.00 0.00 ?  27 VAL D HA   1  
ATOM 4114   H HB   . VAL D  1 27 ? 22.730  -12.108 -241.498 1.00 0.00 ?  27 VAL D HB   1  
ATOM 4115   H HG11 . VAL D  1 27 ? 21.164  -13.220 -243.055 1.00 0.00 ?  27 VAL D HG11 1  
ATOM 4116   H HG12 . VAL D  1 27 ? 22.720  -14.080 -242.990 1.00 0.00 ?  27 VAL D HG12 1  
ATOM 4117   H HG13 . VAL D  1 27 ? 21.308  -14.728 -242.122 1.00 0.00 ?  27 VAL D HG13 1  
ATOM 4118   H HG21 . VAL D  1 27 ? 21.269  -11.979 -239.570 1.00 0.00 ?  27 VAL D HG21 1  
ATOM 4119   H HG22 . VAL D  1 27 ? 20.326  -12.005 -241.078 1.00 0.00 ?  27 VAL D HG22 1  
ATOM 4120   H HG23 . VAL D  1 27 ? 20.440  -13.471 -240.075 1.00 0.00 ?  27 VAL D HG23 1  
ATOM 4121   N N    . THR D  1 28 ? 23.078  -16.172 -240.960 1.00 0.00 ?  28 THR D N    1  
ATOM 4122   C CA   . THR D  1 28 ? 22.711  -17.578 -240.843 1.00 0.00 ?  28 THR D CA   1  
ATOM 4123   C C    . THR D  1 28 ? 23.286  -18.193 -239.574 1.00 0.00 ?  28 THR D C    1  
ATOM 4124   O O    . THR D  1 28 ? 22.595  -18.911 -238.852 1.00 0.00 ?  28 THR D O    1  
ATOM 4125   C CB   . THR D  1 28 ? 23.193  -18.391 -242.059 1.00 0.00 ?  28 THR D CB   1  
ATOM 4126   O OG1  . THR D  1 28 ? 22.535  -17.920 -243.243 1.00 0.00 ?  28 THR D OG1  1  
ATOM 4127   C CG2  . THR D  1 28 ? 22.888  -19.868 -241.868 1.00 0.00 ?  28 THR D CG2  1  
ATOM 4128   H H    . THR D  1 28 ? 23.724  -15.890 -241.684 1.00 0.00 ?  28 THR D H    1  
ATOM 4129   H HA   . THR D  1 28 ? 21.628  -17.671 -240.768 1.00 0.00 ?  28 THR D HA   1  
ATOM 4130   H HB   . THR D  1 28 ? 24.268  -18.254 -242.174 1.00 0.00 ?  28 THR D HB   1  
ATOM 4131   H HG1  . THR D  1 28 ? 22.568  -16.961 -243.267 1.00 0.00 ?  28 THR D HG1  1  
ATOM 4132   H HG21 . THR D  1 28 ? 23.236  -20.426 -242.737 1.00 0.00 ?  28 THR D HG21 1  
ATOM 4133   H HG22 . THR D  1 28 ? 23.397  -20.231 -240.975 1.00 0.00 ?  28 THR D HG22 1  
ATOM 4134   H HG23 . THR D  1 28 ? 21.814  -20.006 -241.754 1.00 0.00 ?  28 THR D HG23 1  
ATOM 4135   N N    . GLU D  1 29 ? 24.556  -17.907 -239.307 1.00 0.00 ?  29 GLU D N    1  
ATOM 4136   C CA   . GLU D  1 29 ? 25.208  -18.379 -238.091 1.00 0.00 ?  29 GLU D CA   1  
ATOM 4137   C C    . GLU D  1 29 ? 24.619  -17.711 -236.855 1.00 0.00 ?  29 GLU D C    1  
ATOM 4138   O O    . GLU D  1 29 ? 24.510  -18.328 -235.796 1.00 0.00 ?  29 GLU D O    1  
ATOM 4139   C CB   . GLU D  1 29 ? 26.716  -18.124 -238.158 1.00 0.00 ?  29 GLU D CB   1  
ATOM 4140   C CG   . GLU D  1 29 ? 27.462  -19.023 -239.133 1.00 0.00 ?  29 GLU D CG   1  
ATOM 4141   C CD   . GLU D  1 29 ? 28.912  -18.638 -239.230 1.00 0.00 ?  29 GLU D CD   1  
ATOM 4142   O OE1  . GLU D  1 29 ? 29.291  -17.666 -238.622 1.00 0.00 ?  29 GLU D OE1  1  
ATOM 4143   O OE2  . GLU D  1 29 ? 29.665  -19.378 -239.820 1.00 0.00 -1 29 GLU D OE2  1  
ATOM 4144   H H    . GLU D  1 29 ? 25.084  -17.349 -239.963 1.00 0.00 ?  29 GLU D H    1  
ATOM 4145   H HA   . GLU D  1 29 ? 25.041  -19.450 -237.973 1.00 0.00 ?  29 GLU D HA   1  
ATOM 4146   H HB2  . GLU D  1 29 ? 26.850  -17.082 -238.450 1.00 0.00 ?  29 GLU D HB2  1  
ATOM 4147   H HB3  . GLU D  1 29 ? 27.109  -18.274 -237.152 1.00 0.00 ?  29 GLU D HB3  1  
ATOM 4148   H HG2  . GLU D  1 29 ? 27.384  -20.083 -238.893 1.00 0.00 ?  29 GLU D HG2  1  
ATOM 4149   H HG3  . GLU D  1 29 ? 26.971  -18.831 -240.086 1.00 0.00 ?  29 GLU D HG3  1  
ATOM 4150   N N    . ALA D  1 30 ? 24.239  -16.445 -236.998 1.00 0.00 ?  30 ALA D N    1  
ATOM 4151   C CA   . ALA D  1 30 ? 23.561  -15.724 -235.927 1.00 0.00 ?  30 ALA D CA   1  
ATOM 4152   C C    . ALA D  1 30 ? 22.209  -16.349 -235.611 1.00 0.00 ?  30 ALA D C    1  
ATOM 4153   O O    . ALA D  1 30 ? 21.805  -16.426 -234.451 1.00 0.00 ?  30 ALA D O    1  
ATOM 4154   C CB   . ALA D  1 30 ? 23.397  -14.257 -236.298 1.00 0.00 ?  30 ALA D CB   1  
ATOM 4155   H H    . ALA D  1 30 ? 24.425  -15.971 -237.870 1.00 0.00 ?  30 ALA D H    1  
ATOM 4156   H HA   . ALA D  1 30 ? 24.168  -15.788 -235.024 1.00 0.00 ?  30 ALA D HA   1  
ATOM 4157   H HB1  . ALA D  1 30 ? 22.806  -14.176 -237.208 1.00 0.00 ?  30 ALA D HB1  1  
ATOM 4158   H HB2  . ALA D  1 30 ? 22.890  -13.733 -235.488 1.00 0.00 ?  30 ALA D HB2  1  
ATOM 4159   H HB3  . ALA D  1 30 ? 24.378  -13.811 -236.460 1.00 0.00 ?  30 ALA D HB3  1  
ATOM 4160   N N    . LEU D  1 31 ? 21.512  -16.796 -236.651 1.00 0.00 ?  31 LEU D N    1  
ATOM 4161   C CA   . LEU D  1 31 ? 20.266  -17.533 -236.479 1.00 0.00 ?  31 LEU D CA   1  
ATOM 4162   C C    . LEU D  1 31 ? 20.506  -18.867 -235.784 1.00 0.00 ?  31 LEU D C    1  
ATOM 4163   O O    . LEU D  1 31 ? 19.773  -19.242 -234.869 1.00 0.00 ?  31 LEU D O    1  
ATOM 4164   C CB   . LEU D  1 31 ? 19.588  -17.752 -237.837 1.00 0.00 ?  31 LEU D CB   1  
ATOM 4165   C CG   . LEU D  1 31 ? 18.279  -18.552 -237.791 1.00 0.00 ?  31 LEU D CG   1  
ATOM 4166   C CD1  . LEU D  1 31 ? 17.260  -17.835 -236.916 1.00 0.00 ?  31 LEU D CD1  1  
ATOM 4167   C CD2  . LEU D  1 31 ? 17.744  -18.733 -239.204 1.00 0.00 ?  31 LEU D CD2  1  
ATOM 4168   H H    . LEU D  1 31 ? 21.855  -16.620 -237.585 1.00 0.00 ?  31 LEU D H    1  
ATOM 4169   H HA   . LEU D  1 31 ? 19.593  -16.966 -235.835 1.00 0.00 ?  31 LEU D HA   1  
ATOM 4170   H HB2  . LEU D  1 31 ? 19.384  -16.716 -238.102 1.00 0.00 ?  31 LEU D HB2  1  
ATOM 4171   H HB3  . LEU D  1 31 ? 20.273  -18.186 -238.565 1.00 0.00 ?  31 LEU D HB3  1  
ATOM 4172   H HG   . LEU D  1 31 ? 18.517  -19.540 -237.396 1.00 0.00 ?  31 LEU D HG   1  
ATOM 4173   H HD11 . LEU D  1 31 ? 16.334  -18.410 -236.890 1.00 0.00 ?  31 LEU D HD11 1  
ATOM 4174   H HD12 . LEU D  1 31 ? 17.654  -17.737 -235.904 1.00 0.00 ?  31 LEU D HD12 1  
ATOM 4175   H HD13 . LEU D  1 31 ? 17.060  -16.846 -237.326 1.00 0.00 ?  31 LEU D HD13 1  
ATOM 4176   H HD21 . LEU D  1 31 ? 18.477  -19.271 -239.805 1.00 0.00 ?  31 LEU D HD21 1  
ATOM 4177   H HD22 . LEU D  1 31 ? 16.815  -19.302 -239.170 1.00 0.00 ?  31 LEU D HD22 1  
ATOM 4178   H HD23 . LEU D  1 31 ? 17.557  -17.756 -239.651 1.00 0.00 ?  31 LEU D HD23 1  
ATOM 4179   N N    . ASP D  1 32 ? 21.538  -19.580 -236.224 1.00 0.00 ?  32 ASP D N    1  
ATOM 4180   C CA   . ASP D  1 32 ? 21.864  -20.884 -235.660 1.00 0.00 ?  32 ASP D CA   1  
ATOM 4181   C C    . ASP D  1 32 ? 22.109  -20.790 -234.160 1.00 0.00 ?  32 ASP D C    1  
ATOM 4182   O O    . ASP D  1 32 ? 21.633  -21.623 -233.389 1.00 0.00 ?  32 ASP D O    1  
ATOM 4183   C CB   . ASP D  1 32 ? 23.090  -21.479 -236.357 1.00 0.00 ?  32 ASP D CB   1  
ATOM 4184   C CG   . ASP D  1 32 ? 22.832  -21.968 -237.776 1.00 0.00 ?  32 ASP D CG   1  
ATOM 4185   O OD1  . ASP D  1 32 ? 21.687  -22.075 -238.147 1.00 0.00 ?  32 ASP D OD1  1  
ATOM 4186   O OD2  . ASP D  1 32 ? 23.773  -22.080 -238.525 1.00 0.00 -1 32 ASP D OD2  1  
ATOM 4187   H H    . ASP D  1 32 ? 22.110  -19.209 -236.969 1.00 0.00 ?  32 ASP D H    1  
ATOM 4188   H HA   . ASP D  1 32 ? 21.023  -21.565 -235.794 1.00 0.00 ?  32 ASP D HA   1  
ATOM 4189   H HB2  . ASP D  1 32 ? 23.955  -20.815 -236.354 1.00 0.00 ?  32 ASP D HB2  1  
ATOM 4190   H HB3  . ASP D  1 32 ? 23.284  -22.333 -235.708 1.00 0.00 ?  32 ASP D HB3  1  
ATOM 4191   N N    . LYS D  1 33 ? 22.856  -19.769 -233.751 1.00 0.00 ?  33 LYS D N    1  
ATOM 4192   C CA   . LYS D  1 33 ? 23.147  -19.550 -232.339 1.00 0.00 ?  33 LYS D CA   1  
ATOM 4193   C C    . LYS D  1 33 ? 21.908  -19.081 -231.588 1.00 0.00 ?  33 LYS D C    1  
ATOM 4194   O O    . LYS D  1 33 ? 21.605  -19.573 -230.501 1.00 0.00 ?  33 LYS D O    1  
ATOM 4195   C CB   . LYS D  1 33 ? 24.277  -18.533 -232.176 1.00 0.00 ?  33 LYS D CB   1  
ATOM 4196   C CG   . LYS D  1 33 ? 25.641  -19.029 -232.641 1.00 0.00 ?  33 LYS D CG   1  
ATOM 4197   C CD   . LYS D  1 33 ? 26.700  -17.945 -232.502 1.00 0.00 ?  33 LYS D CD   1  
ATOM 4198   C CE   . LYS D  1 33 ? 28.042  -18.409 -233.049 1.00 0.00 ?  33 LYS D CE   1  
ATOM 4199   N NZ   . LYS D  1 33 ? 29.078  -17.344 -232.958 1.00 0.00 1  33 LYS D NZ   1  
ATOM 4200   H H    . LYS D  1 33 ? 23.232  -19.129 -234.436 1.00 0.00 ?  33 LYS D H    1  
ATOM 4201   H HA   . LYS D  1 33 ? 23.454  -20.489 -231.876 1.00 0.00 ?  33 LYS D HA   1  
ATOM 4202   H HB2  . LYS D  1 33 ? 23.997  -17.650 -232.751 1.00 0.00 ?  33 LYS D HB2  1  
ATOM 4203   H HB3  . LYS D  1 33 ? 24.327  -18.276 -231.118 1.00 0.00 ?  33 LYS D HB3  1  
ATOM 4204   H HG2  . LYS D  1 33 ? 25.921  -19.891 -232.035 1.00 0.00 ?  33 LYS D HG2  1  
ATOM 4205   H HG3  . LYS D  1 33 ? 25.563  -19.329 -233.685 1.00 0.00 ?  33 LYS D HG3  1  
ATOM 4206   H HD2  . LYS D  1 33 ? 26.368  -17.063 -233.052 1.00 0.00 ?  33 LYS D HD2  1  
ATOM 4207   H HD3  . LYS D  1 33 ? 26.805  -17.695 -231.447 1.00 0.00 ?  33 LYS D HD3  1  
ATOM 4208   H HE2  . LYS D  1 33 ? 28.363  -19.277 -232.475 1.00 0.00 ?  33 LYS D HE2  1  
ATOM 4209   H HE3  . LYS D  1 33 ? 27.906  -18.694 -234.092 1.00 0.00 ?  33 LYS D HE3  1  
ATOM 4210   H HZ1  . LYS D  1 33 ? 29.205  -17.080 -231.992 1.00 0.00 ?  33 LYS D HZ1  1  
ATOM 4211   H HZ2  . LYS D  1 33 ? 29.950  -17.691 -233.330 1.00 0.00 ?  33 LYS D HZ2  1  
ATOM 4212   H HZ3  . LYS D  1 33 ? 28.781  -16.539 -233.491 1.00 0.00 ?  33 LYS D HZ3  1  
ATOM 4213   N N    . LEU D  1 34 ? 21.194  -18.125 -232.173 1.00 0.00 ?  34 LEU D N    1  
ATOM 4214   C CA   . LEU D  1 34 ? 19.997  -17.572 -231.551 1.00 0.00 ?  34 LEU D CA   1  
ATOM 4215   C C    . LEU D  1 34 ? 18.953  -18.654 -231.306 1.00 0.00 ?  34 LEU D C    1  
ATOM 4216   O O    . LEU D  1 34 ? 18.229  -18.618 -230.311 1.00 0.00 ?  34 LEU D O    1  
ATOM 4217   C CB   . LEU D  1 34 ? 19.413  -16.455 -232.424 1.00 0.00 ?  34 LEU D CB   1  
ATOM 4218   C CG   . LEU D  1 34 ? 18.187  -15.742 -231.839 1.00 0.00 ?  34 LEU D CG   1  
ATOM 4219   C CD1  . LEU D  1 34 ? 18.557  -15.058 -230.530 1.00 0.00 ?  34 LEU D CD1  1  
ATOM 4220   C CD2  . LEU D  1 34 ? 17.658  -14.731 -232.846 1.00 0.00 ?  34 LEU D CD2  1  
ATOM 4221   H H    . LEU D  1 34 ? 21.488  -17.772 -233.073 1.00 0.00 ?  34 LEU D H    1  
ATOM 4222   H HA   . LEU D  1 34 ? 20.250  -17.161 -230.574 1.00 0.00 ?  34 LEU D HA   1  
ATOM 4223   H HB2  . LEU D  1 34 ? 20.266  -15.779 -232.441 1.00 0.00 ?  34 LEU D HB2  1  
ATOM 4224   H HB3  . LEU D  1 34 ? 19.204  -16.802 -233.437 1.00 0.00 ?  34 LEU D HB3  1  
ATOM 4225   H HG   . LEU D  1 34 ? 17.415  -16.497 -231.688 1.00 0.00 ?  34 LEU D HG   1  
ATOM 4226   H HD11 . LEU D  1 34 ? 17.680  -14.555 -230.122 1.00 0.00 ?  34 LEU D HD11 1  
ATOM 4227   H HD12 . LEU D  1 34 ? 18.910  -15.803 -229.817 1.00 0.00 ?  34 LEU D HD12 1  
ATOM 4228   H HD13 . LEU D  1 34 ? 19.343  -14.326 -230.712 1.00 0.00 ?  34 LEU D HD13 1  
ATOM 4229   H HD21 . LEU D  1 34 ? 17.374  -15.245 -233.764 1.00 0.00 ?  34 LEU D HD21 1  
ATOM 4230   H HD22 . LEU D  1 34 ? 16.787  -14.225 -232.429 1.00 0.00 ?  34 LEU D HD22 1  
ATOM 4231   H HD23 . LEU D  1 34 ? 18.433  -13.997 -233.066 1.00 0.00 ?  34 LEU D HD23 1  
ATOM 4232   N N    . ALA D  1 35 ? 18.881  -19.617 -232.219 1.00 0.00 ?  35 ALA D N    1  
ATOM 4233   C CA   . ALA D  1 35 ? 17.964  -20.741 -232.076 1.00 0.00 ?  35 ALA D CA   1  
ATOM 4234   C C    . ALA D  1 35 ? 18.199  -21.481 -230.766 1.00 0.00 ?  35 ALA D C    1  
ATOM 4235   O O    . ALA D  1 35 ? 17.257  -21.960 -230.135 1.00 0.00 ?  35 ALA D O    1  
ATOM 4236   C CB   . ALA D  1 35 ? 18.102  -21.691 -233.257 1.00 0.00 ?  35 ALA D CB   1  
ATOM 4237   H H    . ALA D  1 35 ? 19.477  -19.569 -233.033 1.00 0.00 ?  35 ALA D H    1  
ATOM 4238   H HA   . ALA D  1 35 ? 16.943  -20.359 -232.055 1.00 0.00 ?  35 ALA D HA   1  
ATOM 4239   H HB1  . ALA D  1 35 ? 19.122  -22.070 -233.302 1.00 0.00 ?  35 ALA D HB1  1  
ATOM 4240   H HB2  . ALA D  1 35 ? 17.410  -22.524 -233.135 1.00 0.00 ?  35 ALA D HB2  1  
ATOM 4241   H HB3  . ALA D  1 35 ? 17.871  -21.160 -234.181 1.00 0.00 ?  35 ALA D HB3  1  
ATOM 4242   N N    . ALA D  1 36 ? 19.462  -21.571 -230.361 1.00 0.00 ?  36 ALA D N    1  
ATOM 4243   C CA   . ALA D  1 36 ? 19.822  -22.246 -229.120 1.00 0.00 ?  36 ALA D CA   1  
ATOM 4244   C C    . ALA D  1 36 ? 19.413  -21.423 -227.906 1.00 0.00 ?  36 ALA D C    1  
ATOM 4245   O O    . ALA D  1 36 ? 18.897  -21.960 -226.926 1.00 0.00 ?  36 ALA D O    1  
ATOM 4246   C CB   . ALA D  1 36 ? 21.316  -22.535 -229.089 1.00 0.00 ?  36 ALA D CB   1  
ATOM 4247   H H    . ALA D  1 36 ? 20.190  -21.161 -230.928 1.00 0.00 ?  36 ALA D H    1  
ATOM 4248   H HA   . ALA D  1 36 ? 19.284  -23.193 -229.068 1.00 0.00 ?  36 ALA D HA   1  
ATOM 4249   H HB1  . ALA D  1 36 ? 21.869  -21.600 -229.157 1.00 0.00 ?  36 ALA D HB1  1  
ATOM 4250   H HB2  . ALA D  1 36 ? 21.569  -23.040 -228.157 1.00 0.00 ?  36 ALA D HB2  1  
ATOM 4251   H HB3  . ALA D  1 36 ? 21.581  -23.176 -229.931 1.00 0.00 ?  36 ALA D HB3  1  
ATOM 4252   N N    . LYS D  1 37 ? 19.645  -20.117 -227.978 1.00 0.00 ?  37 LYS D N    1  
ATOM 4253   C CA   . LYS D  1 37 ? 19.279  -19.213 -226.894 1.00 0.00 ?  37 LYS D CA   1  
ATOM 4254   C C    . LYS D  1 37 ? 18.577  -17.970 -227.426 1.00 0.00 ?  37 LYS D C    1  
ATOM 4255   O O    . LYS D  1 37 ? 19.182  -16.904 -227.537 1.00 0.00 ?  37 LYS D O    1  
ATOM 4256   C CB   . LYS D  1 37 ? 20.516  -18.814 -226.088 1.00 0.00 ?  37 LYS D CB   1  
ATOM 4257   C CG   . LYS D  1 37 ? 21.235  -19.979 -225.420 1.00 0.00 ?  37 LYS D CG   1  
ATOM 4258   C CD   . LYS D  1 37 ? 22.360  -19.492 -224.520 1.00 0.00 ?  37 LYS D CD   1  
ATOM 4259   C CE   . LYS D  1 37 ? 23.115  -20.657 -223.897 1.00 0.00 ?  37 LYS D CE   1  
ATOM 4260   N NZ   . LYS D  1 37 ? 24.213  -20.195 -223.005 1.00 0.00 1  37 LYS D NZ   1  
ATOM 4261   H H    . LYS D  1 37 ? 20.086  -19.740 -228.804 1.00 0.00 ?  37 LYS D H    1  
ATOM 4262   H HA   . LYS D  1 37 ? 18.572  -19.706 -226.225 1.00 0.00 ?  37 LYS D HA   1  
ATOM 4263   H HB2  . LYS D  1 37 ? 21.198  -18.314 -226.777 1.00 0.00 ?  37 LYS D HB2  1  
ATOM 4264   H HB3  . LYS D  1 37 ? 20.187  -18.107 -225.326 1.00 0.00 ?  37 LYS D HB3  1  
ATOM 4265   H HG2  . LYS D  1 37 ? 20.510  -20.538 -224.827 1.00 0.00 ?  37 LYS D HG2  1  
ATOM 4266   H HG3  . LYS D  1 37 ? 21.644  -20.624 -226.197 1.00 0.00 ?  37 LYS D HG3  1  
ATOM 4267   H HD2  . LYS D  1 37 ? 23.047  -18.890 -225.117 1.00 0.00 ?  37 LYS D HD2  1  
ATOM 4268   H HD3  . LYS D  1 37 ? 21.931  -18.875 -223.730 1.00 0.00 ?  37 LYS D HD3  1  
ATOM 4269   H HE2  . LYS D  1 37 ? 22.409  -21.255 -223.324 1.00 0.00 ?  37 LYS D HE2  1  
ATOM 4270   H HE3  . LYS D  1 37 ? 23.533  -21.262 -224.702 1.00 0.00 ?  37 LYS D HE3  1  
ATOM 4271   H HZ1  . LYS D  1 37 ? 23.827  -19.635 -222.259 1.00 0.00 ?  37 LYS D HZ1  1  
ATOM 4272   H HZ2  . LYS D  1 37 ? 24.689  -20.996 -222.614 1.00 0.00 ?  37 LYS D HZ2  1  
ATOM 4273   H HZ3  . LYS D  1 37 ? 24.870  -19.641 -223.537 1.00 0.00 ?  37 LYS D HZ3  1  
ATOM 4274   N N    . PRO D  1 38 ? 17.297  -18.114 -227.754 1.00 0.00 ?  38 PRO D N    1  
ATOM 4275   C CA   . PRO D  1 38 ? 16.518  -17.010 -228.300 1.00 0.00 ?  38 PRO D CA   1  
ATOM 4276   C C    . PRO D  1 38 ? 16.473  -15.835 -227.331 1.00 0.00 ?  38 PRO D C    1  
ATOM 4277   O O    . PRO D  1 38 ? 16.286  -14.688 -227.739 1.00 0.00 ?  38 PRO D O    1  
ATOM 4278   C CB   . PRO D  1 38 ? 15.130  -17.613 -228.538 1.00 0.00 ?  38 PRO D CB   1  
ATOM 4279   C CG   . PRO D  1 38 ? 15.379  -19.077 -228.670 1.00 0.00 ?  38 PRO D CG   1  
ATOM 4280   C CD   . PRO D  1 38 ? 16.510  -19.376 -227.723 1.00 0.00 ?  38 PRO D CD   1  
ATOM 4281   H HA   . PRO D  1 38 ? 16.950  -16.599 -229.224 1.00 0.00 ?  38 PRO D HA   1  
ATOM 4282   H HB2  . PRO D  1 38 ? 14.448  -17.399 -227.701 1.00 0.00 ?  38 PRO D HB2  1  
ATOM 4283   H HB3  . PRO D  1 38 ? 14.663  -17.205 -229.446 1.00 0.00 ?  38 PRO D HB3  1  
ATOM 4284   H HG2  . PRO D  1 38 ? 14.482  -19.658 -228.410 1.00 0.00 ?  38 PRO D HG2  1  
ATOM 4285   H HG3  . PRO D  1 38 ? 15.647  -19.343 -229.703 1.00 0.00 ?  38 PRO D HG3  1  
ATOM 4286   H HD2  . PRO D  1 38 ? 16.154  -19.603 -226.707 1.00 0.00 ?  38 PRO D HD2  1  
ATOM 4287   H HD3  . PRO D  1 38 ? 17.112  -20.236 -228.052 1.00 0.00 ?  38 PRO D HD3  1  
ATOM 4288   N N    . SER D  1 39 ? 16.647  -16.127 -226.046 1.00 0.00 ?  39 SER D N    1  
ATOM 4289   C CA   . SER D  1 39 ? 16.462  -15.126 -225.002 1.00 0.00 ?  39 SER D CA   1  
ATOM 4290   C C    . SER D  1 39 ? 17.761  -14.385 -224.713 1.00 0.00 ?  39 SER D C    1  
ATOM 4291   O O    . SER D  1 39 ? 17.846  -13.612 -223.759 1.00 0.00 ?  39 SER D O    1  
ATOM 4292   C CB   . SER D  1 39 ? 15.935  -15.781 -223.740 1.00 0.00 ?  39 SER D CB   1  
ATOM 4293   O OG   . SER D  1 39 ? 16.875  -16.646 -223.163 1.00 0.00 ?  39 SER D OG   1  
ATOM 4294   H H    . SER D  1 39 ? 16.914  -17.065 -225.787 1.00 0.00 ?  39 SER D H    1  
ATOM 4295   H HA   . SER D  1 39 ? 15.668  -14.411 -225.222 1.00 0.00 ?  39 SER D HA   1  
ATOM 4296   H HB2  . SER D  1 39 ? 15.684  -15.001 -223.022 1.00 0.00 ?  39 SER D HB2  1  
ATOM 4297   H HB3  . SER D  1 39 ? 15.038  -16.347 -223.988 1.00 0.00 ?  39 SER D HB3  1  
ATOM 4298   H HG   . SER D  1 39 ? 17.100  -17.337 -223.790 1.00 0.00 ?  39 SER D HG   1  
ATOM 4299   N N    . ASP D  1 40 ? 18.771  -14.627 -225.541 1.00 0.00 ?  40 ASP D N    1  
ATOM 4300   C CA   . ASP D  1 40 ? 20.048  -13.934 -225.415 1.00 0.00 ?  40 ASP D CA   1  
ATOM 4301   C C    . ASP D  1 40 ? 20.014  -12.583 -226.117 1.00 0.00 ?  40 ASP D C    1  
ATOM 4302   O O    . ASP D  1 40 ? 19.883  -12.510 -227.339 1.00 0.00 ?  40 ASP D O    1  
ATOM 4303   C CB   . ASP D  1 40 ? 21.182  -14.792 -225.982 1.00 0.00 ?  40 ASP D CB   1  
ATOM 4304   C CG   . ASP D  1 40 ? 22.573  -14.204 -225.789 1.00 0.00 ?  40 ASP D CG   1  
ATOM 4305   O OD1  . ASP D  1 40 ? 22.667  -13.090 -225.329 1.00 0.00 ?  40 ASP D OD1  1  
ATOM 4306   O OD2  . ASP D  1 40 ? 23.529  -14.924 -225.954 1.00 0.00 -1 40 ASP D OD2  1  
ATOM 4307   H H    . ASP D  1 40 ? 18.651  -15.307 -226.278 1.00 0.00 ?  40 ASP D H    1  
ATOM 4308   H HA   . ASP D  1 40 ? 20.256  -13.733 -224.364 1.00 0.00 ?  40 ASP D HA   1  
ATOM 4309   H HB2  . ASP D  1 40 ? 21.170  -15.821 -225.621 1.00 0.00 ?  40 ASP D HB2  1  
ATOM 4310   H HB3  . ASP D  1 40 ? 20.924  -14.775 -227.041 1.00 0.00 ?  40 ASP D HB3  1  
ATOM 4311   N N    . PRO D  1 41 ? 20.132  -11.514 -225.337 1.00 0.00 ?  41 PRO D N    1  
ATOM 4312   C CA   . PRO D  1 41 ? 20.115  -10.162 -225.882 1.00 0.00 ?  41 PRO D CA   1  
ATOM 4313   C C    . PRO D  1 41 ? 21.213  -9.973  -226.921 1.00 0.00 ?  41 PRO D C    1  
ATOM 4314   O O    . PRO D  1 41 ? 21.025  -9.274  -227.917 1.00 0.00 ?  41 PRO D O    1  
ATOM 4315   C CB   . PRO D  1 41 ? 20.318  -9.262  -224.659 1.00 0.00 ?  41 PRO D CB   1  
ATOM 4316   C CG   . PRO D  1 41 ? 19.848  -10.086 -223.510 1.00 0.00 ?  41 PRO D CG   1  
ATOM 4317   C CD   . PRO D  1 41 ? 20.220  -11.503 -223.856 1.00 0.00 ?  41 PRO D CD   1  
ATOM 4318   H HA   . PRO D  1 41 ? 19.180  -9.929  -226.412 1.00 0.00 ?  41 PRO D HA   1  
ATOM 4319   H HB2  . PRO D  1 41 ? 21.373  -8.976  -224.539 1.00 0.00 ?  41 PRO D HB2  1  
ATOM 4320   H HB3  . PRO D  1 41 ? 19.739  -8.330  -224.744 1.00 0.00 ?  41 PRO D HB3  1  
ATOM 4321   H HG2  . PRO D  1 41 ? 20.326  -9.770  -222.571 1.00 0.00 ?  41 PRO D HG2  1  
ATOM 4322   H HG3  . PRO D  1 41 ? 18.761  -9.986  -223.366 1.00 0.00 ?  41 PRO D HG3  1  
ATOM 4323   H HD2  . PRO D  1 41 ? 21.233  -11.763 -223.515 1.00 0.00 ?  41 PRO D HD2  1  
ATOM 4324   H HD3  . PRO D  1 41 ? 19.533  -12.236 -223.407 1.00 0.00 ?  41 PRO D HD3  1  
ATOM 4325   N N    . ALA D  1 42 ? 22.360  -10.600 -226.683 1.00 0.00 ?  42 ALA D N    1  
ATOM 4326   C CA   . ALA D  1 42 ? 23.507  -10.462 -227.572 1.00 0.00 ?  42 ALA D CA   1  
ATOM 4327   C C    . ALA D  1 42 ? 23.233  -11.101 -228.928 1.00 0.00 ?  42 ALA D C    1  
ATOM 4328   O O    . ALA D  1 42 ? 23.565  -10.536 -229.970 1.00 0.00 ?  42 ALA D O    1  
ATOM 4329   C CB   . ALA D  1 42 ? 24.747  -11.074 -226.936 1.00 0.00 ?  42 ALA D CB   1  
ATOM 4330   H H    . ALA D  1 42 ? 22.439  -11.187 -225.865 1.00 0.00 ?  42 ALA D H    1  
ATOM 4331   H HA   . ALA D  1 42 ? 23.691  -9.402  -227.744 1.00 0.00 ?  42 ALA D HA   1  
ATOM 4332   H HB1  . ALA D  1 42 ? 24.573  -12.131 -226.743 1.00 0.00 ?  42 ALA D HB1  1  
ATOM 4333   H HB2  . ALA D  1 42 ? 25.594  -10.963 -227.613 1.00 0.00 ?  42 ALA D HB2  1  
ATOM 4334   H HB3  . ALA D  1 42 ? 24.964  -10.564 -225.997 1.00 0.00 ?  42 ALA D HB3  1  
ATOM 4335   N N    . LEU D  1 43 ? 22.625  -12.282 -228.907 1.00 0.00 ?  43 LEU D N    1  
ATOM 4336   C CA   . LEU D  1 43 ? 22.285  -12.990 -230.136 1.00 0.00 ?  43 LEU D CA   1  
ATOM 4337   C C    . LEU D  1 43 ? 21.129  -12.312 -230.860 1.00 0.00 ?  43 LEU D C    1  
ATOM 4338   O O    . LEU D  1 43 ? 21.086  -12.283 -232.090 1.00 0.00 ?  43 LEU D O    1  
ATOM 4339   C CB   . LEU D  1 43 ? 21.937  -14.452 -229.826 1.00 0.00 ?  43 LEU D CB   1  
ATOM 4340   C CG   . LEU D  1 43 ? 23.098  -15.300 -229.292 1.00 0.00 ?  43 LEU D CG   1  
ATOM 4341   C CD1  . LEU D  1 43 ? 22.588  -16.666 -228.853 1.00 0.00 ?  43 LEU D CD1  1  
ATOM 4342   C CD2  . LEU D  1 43 ? 24.162  -15.443 -230.370 1.00 0.00 ?  43 LEU D CD2  1  
ATOM 4343   H H    . LEU D  1 43 ? 22.392  -12.701 -228.018 1.00 0.00 ?  43 LEU D H    1  
ATOM 4344   H HA   . LEU D  1 43 ? 23.134  -12.966 -230.818 1.00 0.00 ?  43 LEU D HA   1  
ATOM 4345   H HB2  . LEU D  1 43 ? 21.197  -14.296 -229.043 1.00 0.00 ?  43 LEU D HB2  1  
ATOM 4346   H HB3  . LEU D  1 43 ? 21.467  -14.944 -230.678 1.00 0.00 ?  43 LEU D HB3  1  
ATOM 4347   H HG   . LEU D  1 43 ? 23.540  -14.755 -228.458 1.00 0.00 ?  43 LEU D HG   1  
ATOM 4348   H HD11 . LEU D  1 43 ? 23.420  -17.261 -228.475 1.00 0.00 ?  43 LEU D HD11 1  
ATOM 4349   H HD12 . LEU D  1 43 ? 21.845  -16.541 -228.065 1.00 0.00 ?  43 LEU D HD12 1  
ATOM 4350   H HD13 . LEU D  1 43 ? 22.135  -17.175 -229.703 1.00 0.00 ?  43 LEU D HD13 1  
ATOM 4351   H HD21 . LEU D  1 43 ? 24.533  -14.456 -230.649 1.00 0.00 ?  43 LEU D HD21 1  
ATOM 4352   H HD22 . LEU D  1 43 ? 24.987  -16.045 -229.989 1.00 0.00 ?  43 LEU D HD22 1  
ATOM 4353   H HD23 . LEU D  1 43 ? 23.731  -15.929 -231.246 1.00 0.00 ?  43 LEU D HD23 1  
ATOM 4354   N N    . LEU D  1 44 ? 20.193  -11.768 -230.090 1.00 0.00 ?  44 LEU D N    1  
ATOM 4355   C CA   . LEU D  1 44 ? 19.060  -11.045 -230.657 1.00 0.00 ?  44 LEU D CA   1  
ATOM 4356   C C    . LEU D  1 44 ? 19.517  -9.779  -231.370 1.00 0.00 ?  44 LEU D C    1  
ATOM 4357   O O    . LEU D  1 44 ? 19.113  -9.513  -232.502 1.00 0.00 ?  44 LEU D O    1  
ATOM 4358   C CB   . LEU D  1 44 ? 18.047  -10.703 -229.557 1.00 0.00 ?  44 LEU D CB   1  
ATOM 4359   C CG   . LEU D  1 44 ? 17.192  -11.879 -229.068 1.00 0.00 ?  44 LEU D CG   1  
ATOM 4360   C CD1  . LEU D  1 44 ? 16.427  -11.481 -227.813 1.00 0.00 ?  44 LEU D CD1  1  
ATOM 4361   C CD2  . LEU D  1 44 ? 16.235  -12.306 -230.171 1.00 0.00 ?  44 LEU D CD2  1  
ATOM 4362   H H    . LEU D  1 44 ? 20.267  -11.858 -229.087 1.00 0.00 ?  44 LEU D H    1  
ATOM 4363   H HA   . LEU D  1 44 ? 18.571  -11.664 -231.408 1.00 0.00 ?  44 LEU D HA   1  
ATOM 4364   H HB2  . LEU D  1 44 ? 18.735  -10.389 -228.774 1.00 0.00 ?  44 LEU D HB2  1  
ATOM 4365   H HB3  . LEU D  1 44 ? 17.412  -9.863  -229.841 1.00 0.00 ?  44 LEU D HB3  1  
ATOM 4366   H HG   . LEU D  1 44 ? 17.869  -12.711 -228.873 1.00 0.00 ?  44 LEU D HG   1  
ATOM 4367   H HD11 . LEU D  1 44 ? 15.824  -12.322 -227.472 1.00 0.00 ?  44 LEU D HD11 1  
ATOM 4368   H HD12 . LEU D  1 44 ? 17.132  -11.202 -227.030 1.00 0.00 ?  44 LEU D HD12 1  
ATOM 4369   H HD13 . LEU D  1 44 ? 15.778  -10.636 -228.036 1.00 0.00 ?  44 LEU D HD13 1  
ATOM 4370   H HD21 . LEU D  1 44 ? 16.804  -12.612 -231.049 1.00 0.00 ?  44 LEU D HD21 1  
ATOM 4371   H HD22 . LEU D  1 44 ? 15.629  -13.142 -229.822 1.00 0.00 ?  44 LEU D HD22 1  
ATOM 4372   H HD23 . LEU D  1 44 ? 15.585  -11.470 -230.433 1.00 0.00 ?  44 LEU D HD23 1  
ATOM 4373   N N    . ALA D  1 45 ? 20.360  -9.000  -230.702 1.00 0.00 ?  45 ALA D N    1  
ATOM 4374   C CA   . ALA D  1 45 ? 20.843  -7.741  -231.255 1.00 0.00 ?  45 ALA D CA   1  
ATOM 4375   C C    . ALA D  1 45 ? 21.699  -7.975  -232.493 1.00 0.00 ?  45 ALA D C    1  
ATOM 4376   O O    . ALA D  1 45 ? 21.533  -7.303  -233.511 1.00 0.00 ?  45 ALA D O    1  
ATOM 4377   C CB   . ALA D  1 45 ? 21.626  -6.966  -230.205 1.00 0.00 ?  45 ALA D CB   1  
ATOM 4378   H H    . ALA D  1 45 ? 20.675  -9.288  -229.786 1.00 0.00 ?  45 ALA D H    1  
ATOM 4379   H HA   . ALA D  1 45 ? 19.986  -7.142  -231.562 1.00 0.00 ?  45 ALA D HA   1  
ATOM 4380   H HB1  . ALA D  1 45 ? 22.478  -7.558  -229.877 1.00 0.00 ?  45 ALA D HB1  1  
ATOM 4381   H HB2  . ALA D  1 45 ? 21.979  -6.028  -230.634 1.00 0.00 ?  45 ALA D HB2  1  
ATOM 4382   H HB3  . ALA D  1 45 ? 20.980  -6.754  -229.353 1.00 0.00 ?  45 ALA D HB3  1  
ATOM 4383   N N    . ALA D  1 46 ? 22.615  -8.933  -232.400 1.00 0.00 ?  46 ALA D N    1  
ATOM 4384   C CA   . ALA D  1 46 ? 23.510  -9.248  -233.508 1.00 0.00 ?  46 ALA D CA   1  
ATOM 4385   C C    . ALA D  1 46 ? 22.736  -9.781  -234.707 1.00 0.00 ?  46 ALA D C    1  
ATOM 4386   O O    . ALA D  1 46 ? 22.940  -9.337  -235.836 1.00 0.00 ?  46 ALA D O    1  
ATOM 4387   C CB   . ALA D  1 46 ? 24.567  -10.250 -233.067 1.00 0.00 ?  46 ALA D CB   1  
ATOM 4388   H H    . ALA D  1 46 ? 22.694  -9.457  -231.540 1.00 0.00 ?  46 ALA D H    1  
ATOM 4389   H HA   . ALA D  1 46 ? 24.009  -8.332  -233.825 1.00 0.00 ?  46 ALA D HA   1  
ATOM 4390   H HB1  . ALA D  1 46 ? 24.083  -11.166 -232.732 1.00 0.00 ?  46 ALA D HB1  1  
ATOM 4391   H HB2  . ALA D  1 46 ? 25.227  -10.474 -233.905 1.00 0.00 ?  46 ALA D HB2  1  
ATOM 4392   H HB3  . ALA D  1 46 ? 25.151  -9.827  -232.249 1.00 0.00 ?  46 ALA D HB3  1  
ATOM 4393   N N    . TYR D  1 47 ? 21.848  -10.736 -234.454 1.00 0.00 ?  47 TYR D N    1  
ATOM 4394   C CA   . TYR D  1 47 ? 21.074  -11.364 -235.518 1.00 0.00 ?  47 TYR D CA   1  
ATOM 4395   C C    . TYR D  1 47 ? 20.150  -10.360 -236.194 1.00 0.00 ?  47 TYR D C    1  
ATOM 4396   O O    . TYR D  1 47 ? 20.108  -10.268 -237.421 1.00 0.00 ?  47 TYR D O    1  
ATOM 4397   C CB   . TYR D  1 47 ? 20.261  -12.538 -234.968 1.00 0.00 ?  47 TYR D CB   1  
ATOM 4398   C CG   . TYR D  1 47 ? 19.290  -13.132 -235.964 1.00 0.00 ?  47 TYR D CG   1  
ATOM 4399   C CD1  . TYR D  1 47 ? 19.742  -13.711 -237.141 1.00 0.00 ?  47 TYR D CD1  1  
ATOM 4400   C CD2  . TYR D  1 47 ? 17.924  -13.114 -235.724 1.00 0.00 ?  47 TYR D CD2  1  
ATOM 4401   C CE1  . TYR D  1 47 ? 18.860  -14.255 -238.055 1.00 0.00 ?  47 TYR D CE1  1  
ATOM 4402   C CE2  . TYR D  1 47 ? 17.033  -13.655 -236.630 1.00 0.00 ?  47 TYR D CE2  1  
ATOM 4403   C CZ   . TYR D  1 47 ? 17.504  -14.225 -237.795 1.00 0.00 ?  47 TYR D CZ   1  
ATOM 4404   O OH   . TYR D  1 47 ? 16.621  -14.766 -238.700 1.00 0.00 ?  47 TYR D OH   1  
ATOM 4405   H H    . TYR D  1 47 ? 21.704  -11.035 -233.499 1.00 0.00 ?  47 TYR D H    1  
ATOM 4406   H HA   . TYR D  1 47 ? 21.745  -11.739 -236.292 1.00 0.00 ?  47 TYR D HA   1  
ATOM 4407   H HB2  . TYR D  1 47 ? 20.971  -13.303 -234.652 1.00 0.00 ?  47 TYR D HB2  1  
ATOM 4408   H HB3  . TYR D  1 47 ? 19.712  -12.171 -234.100 1.00 0.00 ?  47 TYR D HB3  1  
ATOM 4409   H HD1  . TYR D  1 47 ? 20.814  -13.731 -237.339 1.00 0.00 ?  47 TYR D HD1  1  
ATOM 4410   H HD2  . TYR D  1 47 ? 17.558  -12.662 -234.802 1.00 0.00 ?  47 TYR D HD2  1  
ATOM 4411   H HE1  . TYR D  1 47 ? 19.229  -14.706 -238.975 1.00 0.00 ?  47 TYR D HE1  1  
ATOM 4412   H HE2  . TYR D  1 47 ? 15.963  -13.629 -236.423 1.00 0.00 ?  47 TYR D HE2  1  
ATOM 4413   H HH   . TYR D  1 47 ? 15.705  -14.692 -238.421 1.00 0.00 ?  47 TYR D HH   1  
ATOM 4414   N N    . GLN D  1 48 ? 19.410  -9.607  -235.386 1.00 0.00 ?  48 GLN D N    1  
ATOM 4415   C CA   . GLN D  1 48 ? 18.440  -8.651  -235.905 1.00 0.00 ?  48 GLN D CA   1  
ATOM 4416   C C    . GLN D  1 48 ? 19.128  -7.535  -236.681 1.00 0.00 ?  48 GLN D C    1  
ATOM 4417   O O    . GLN D  1 48 ? 18.626  -7.078  -237.708 1.00 0.00 ?  48 GLN D O    1  
ATOM 4418   C CB   . GLN D  1 48 ? 17.614  -8.052  -234.764 1.00 0.00 ?  48 GLN D CB   1  
ATOM 4419   C CG   . GLN D  1 48 ? 16.436  -7.210  -235.223 1.00 0.00 ?  48 GLN D CG   1  
ATOM 4420   C CD   . GLN D  1 48 ? 16.848  -5.806  -235.619 1.00 0.00 ?  48 GLN D CD   1  
ATOM 4421   O OE1  . GLN D  1 48 ? 17.742  -5.211  -235.010 1.00 0.00 ?  48 GLN D OE1  1  
ATOM 4422   N NE2  . GLN D  1 48 ? 16.196  -5.265  -236.642 1.00 0.00 ?  48 GLN D NE2  1  
ATOM 4423   H H    . GLN D  1 48 ? 19.523  -9.701  -234.387 1.00 0.00 ?  48 GLN D H    1  
ATOM 4424   H HA   . GLN D  1 48 ? 17.774  -9.151  -236.608 1.00 0.00 ?  48 GLN D HA   1  
ATOM 4425   H HB2  . GLN D  1 48 ? 17.257  -8.888  -234.161 1.00 0.00 ?  48 GLN D HB2  1  
ATOM 4426   H HB3  . GLN D  1 48 ? 18.293  -7.441  -234.170 1.00 0.00 ?  48 GLN D HB3  1  
ATOM 4427   H HG2  . GLN D  1 48 ? 15.707  -7.563  -235.952 1.00 0.00 ?  48 GLN D HG2  1  
ATOM 4428   H HG3  . GLN D  1 48 ? 15.970  -7.168  -234.238 1.00 0.00 ?  48 GLN D HG3  1  
ATOM 4429   H HE21 . GLN D  1 48 ? 15.477  -5.781  -237.106 1.00 0.00 ?  48 GLN D HE21 1  
ATOM 4430   H HE22 . GLN D  1 48 ? 16.424  -4.340  -236.949 1.00 0.00 ?  48 GLN D HE22 1  
ATOM 4431   N N    . SER D  1 49 ? 20.281  -7.099  -236.184 1.00 0.00 ?  49 SER D N    1  
ATOM 4432   C CA   . SER D  1 49 ? 21.066  -6.071  -236.857 1.00 0.00 ?  49 SER D CA   1  
ATOM 4433   C C    . SER D  1 49 ? 21.526  -6.540  -238.231 1.00 0.00 ?  49 SER D C    1  
ATOM 4434   O O    . SER D  1 49 ? 21.457  -5.794  -239.208 1.00 0.00 ?  49 SER D O    1  
ATOM 4435   C CB   . SER D  1 49 ? 22.259  -5.684  -236.005 1.00 0.00 ?  49 SER D CB   1  
ATOM 4436   O OG   . SER D  1 49 ? 23.073  -4.736  -236.639 1.00 0.00 ?  49 SER D OG   1  
ATOM 4437   H H    . SER D  1 49 ? 20.623  -7.491  -235.318 1.00 0.00 ?  49 SER D H    1  
ATOM 4438   H HA   . SER D  1 49 ? 20.544  -5.117  -236.946 1.00 0.00 ?  49 SER D HA   1  
ATOM 4439   H HB2  . SER D  1 49 ? 21.895  -5.267  -235.066 1.00 0.00 ?  49 SER D HB2  1  
ATOM 4440   H HB3  . SER D  1 49 ? 22.847  -6.577  -235.801 1.00 0.00 ?  49 SER D HB3  1  
ATOM 4441   H HG   . SER D  1 49 ? 23.423  -5.108  -237.451 1.00 0.00 ?  49 SER D HG   1  
ATOM 4442   N N    . LYS D  1 50 ? 21.996  -7.781  -238.301 1.00 0.00 ?  50 LYS D N    1  
ATOM 4443   C CA   . LYS D  1 50 ? 22.460  -8.355  -239.558 1.00 0.00 ?  50 LYS D CA   1  
ATOM 4444   C C    . LYS D  1 50 ? 21.290  -8.810  -240.421 1.00 0.00 ?  50 LYS D C    1  
ATOM 4445   O O    . LYS D  1 50 ? 21.415  -8.929  -241.640 1.00 0.00 ?  50 LYS D O    1  
ATOM 4446   C CB   . LYS D  1 50 ? 23.406  -9.528  -239.294 1.00 0.00 ?  50 LYS D CB   1  
ATOM 4447   C CG   . LYS D  1 50 ? 24.723  -9.138  -238.635 1.00 0.00 ?  50 LYS D CG   1  
ATOM 4448   C CD   . LYS D  1 50 ? 25.591  -10.359 -238.370 1.00 0.00 ?  50 LYS D CD   1  
ATOM 4449   C CE   . LYS D  1 50 ? 26.868  -9.981  -237.633 1.00 0.00 ?  50 LYS D CE   1  
ATOM 4450   N NZ   . LYS D  1 50 ? 27.701  -9.028  -238.416 1.00 0.00 1  50 LYS D NZ   1  
ATOM 4451   H H    . LYS D  1 50 ? 22.032  -8.341  -237.461 1.00 0.00 ?  50 LYS D H    1  
ATOM 4452   H HA   . LYS D  1 50 ? 22.995  -7.600  -240.133 1.00 0.00 ?  50 LYS D HA   1  
ATOM 4453   H HB2  . LYS D  1 50 ? 22.873  -10.230 -238.652 1.00 0.00 ?  50 LYS D HB2  1  
ATOM 4454   H HB3  . LYS D  1 50 ? 23.608  -9.999  -240.256 1.00 0.00 ?  50 LYS D HB3  1  
ATOM 4455   H HG2  . LYS D  1 50 ? 25.252  -8.452  -239.298 1.00 0.00 ?  50 LYS D HG2  1  
ATOM 4456   H HG3  . LYS D  1 50 ? 24.504  -8.636  -237.694 1.00 0.00 ?  50 LYS D HG3  1  
ATOM 4457   H HD2  . LYS D  1 50 ? 25.020  -11.067 -237.768 1.00 0.00 ?  50 LYS D HD2  1  
ATOM 4458   H HD3  . LYS D  1 50 ? 25.846  -10.818 -239.325 1.00 0.00 ?  50 LYS D HD3  1  
ATOM 4459   H HE2  . LYS D  1 50 ? 26.592  -9.525  -236.683 1.00 0.00 ?  50 LYS D HE2  1  
ATOM 4460   H HE3  . LYS D  1 50 ? 27.437  -10.892 -237.447 1.00 0.00 ?  50 LYS D HE3  1  
ATOM 4461   H HZ1  . LYS D  1 50 ? 27.175  -8.184  -238.588 1.00 0.00 ?  50 LYS D HZ1  1  
ATOM 4462   H HZ2  . LYS D  1 50 ? 28.536  -8.804  -237.894 1.00 0.00 ?  50 LYS D HZ2  1  
ATOM 4463   H HZ3  . LYS D  1 50 ? 27.958  -9.451  -239.297 1.00 0.00 ?  50 LYS D HZ3  1  
ATOM 4464   N N    . LEU D  1 51 ? 20.153  -9.064  -239.782 1.00 0.00 ?  51 LEU D N    1  
ATOM 4465   C CA   . LEU D  1 51 ? 18.951  -9.481  -240.494 1.00 0.00 ?  51 LEU D CA   1  
ATOM 4466   C C    . LEU D  1 51 ? 18.310  -8.309  -241.226 1.00 0.00 ?  51 LEU D C    1  
ATOM 4467   O O    . LEU D  1 51 ? 17.794  -8.464  -242.333 1.00 0.00 ?  51 LEU D O    1  
ATOM 4468   C CB   . LEU D  1 51 ? 17.950  -10.113 -239.518 1.00 0.00 ?  51 LEU D CB   1  
ATOM 4469   C CG   . LEU D  1 51 ? 16.717  -10.751 -240.170 1.00 0.00 ?  51 LEU D CG   1  
ATOM 4470   C CD1  . LEU D  1 51 ? 17.135  -11.929 -241.039 1.00 0.00 ?  51 LEU D CD1  1  
ATOM 4471   C CD2  . LEU D  1 51 ? 15.743  -11.197 -239.089 1.00 0.00 ?  51 LEU D CD2  1  
ATOM 4472   H H    . LEU D  1 51 ? 20.121  -8.965  -238.777 1.00 0.00 ?  51 LEU D H    1  
ATOM 4473   H HA   . LEU D  1 51 ? 19.214  -10.215 -241.255 1.00 0.00 ?  51 LEU D HA   1  
ATOM 4474   H HB2  . LEU D  1 51 ? 18.586  -10.885 -239.088 1.00 0.00 ?  51 LEU D HB2  1  
ATOM 4475   H HB3  . LEU D  1 51 ? 17.650  -9.414  -238.738 1.00 0.00 ?  51 LEU D HB3  1  
ATOM 4476   H HG   . LEU D  1 51 ? 16.227  -9.977  -240.762 1.00 0.00 ?  51 LEU D HG   1  
ATOM 4477   H HD11 . LEU D  1 51 ? 16.253  -12.375 -241.498 1.00 0.00 ?  51 LEU D HD11 1  
ATOM 4478   H HD12 . LEU D  1 51 ? 17.813  -11.583 -241.819 1.00 0.00 ?  51 LEU D HD12 1  
ATOM 4479   H HD13 . LEU D  1 51 ? 17.639  -12.673 -240.424 1.00 0.00 ?  51 LEU D HD13 1  
ATOM 4480   H HD21 . LEU D  1 51 ? 15.435  -10.334 -238.498 1.00 0.00 ?  51 LEU D HD21 1  
ATOM 4481   H HD22 . LEU D  1 51 ? 14.867  -11.649 -239.554 1.00 0.00 ?  51 LEU D HD22 1  
ATOM 4482   H HD23 . LEU D  1 51 ? 16.228  -11.927 -238.441 1.00 0.00 ?  51 LEU D HD23 1  
ATOM 4483   N N    . SER D  1 52 ? 18.344  -7.137  -240.601 1.00 0.00 ?  52 SER D N    1  
ATOM 4484   C CA   . SER D  1 52 ? 17.847  -5.919  -241.229 1.00 0.00 ?  52 SER D CA   1  
ATOM 4485   C C    . SER D  1 52 ? 18.683  -5.546  -242.446 1.00 0.00 ?  52 SER D C    1  
ATOM 4486   O O    . SER D  1 52 ? 18.201  -4.880  -243.362 1.00 0.00 ?  52 SER D O    1  
ATOM 4487   C CB   . SER D  1 52 ? 17.836  -4.782  -240.226 1.00 0.00 ?  52 SER D CB   1  
ATOM 4488   O OG   . SER D  1 52 ? 19.130  -4.388  -239.863 1.00 0.00 ?  52 SER D OG   1  
ATOM 4489   H H    . SER D  1 52 ? 18.725  -7.089  -239.666 1.00 0.00 ?  52 SER D H    1  
ATOM 4490   H HA   . SER D  1 52 ? 16.793  -5.974  -241.506 1.00 0.00 ?  52 SER D HA   1  
ATOM 4491   H HB2  . SER D  1 52 ? 17.318  -3.932  -240.669 1.00 0.00 ?  52 SER D HB2  1  
ATOM 4492   H HB3  . SER D  1 52 ? 17.301  -5.107  -239.335 1.00 0.00 ?  52 SER D HB3  1  
ATOM 4493   H HG   . SER D  1 52 ? 19.079  -3.668  -239.229 1.00 0.00 ?  52 SER D HG   1  
ATOM 4494   N N    . GLU D  1 53 ? 19.940  -5.979  -242.449 1.00 0.00 ?  53 GLU D N    1  
ATOM 4495   C CA   . GLU D  1 53 ? 20.782  -5.876  -243.634 1.00 0.00 ?  53 GLU D CA   1  
ATOM 4496   C C    . GLU D  1 53 ? 20.485  -6.998  -244.621 1.00 0.00 ?  53 GLU D C    1  
ATOM 4497   O O    . GLU D  1 53 ? 20.481  -6.787  -245.833 1.00 0.00 ?  53 GLU D O    1  
ATOM 4498   C CB   . GLU D  1 53 ? 22.262  -5.897  -243.244 1.00 0.00 ?  53 GLU D CB   1  
ATOM 4499   C CG   . GLU D  1 53 ? 22.732  -4.658  -242.494 1.00 0.00 ?  53 GLU D CG   1  
ATOM 4500   C CD   . GLU D  1 53 ? 24.167  -4.790  -242.068 1.00 0.00 ?  53 GLU D CD   1  
ATOM 4501   O OE1  . GLU D  1 53 ? 24.707  -5.863  -242.190 1.00 0.00 ?  53 GLU D OE1  1  
ATOM 4502   O OE2  . GLU D  1 53 ? 24.758  -3.792  -241.726 1.00 0.00 -1 53 GLU D OE2  1  
ATOM 4503   H H    . GLU D  1 53 ? 20.321  -6.390  -241.609 1.00 0.00 ?  53 GLU D H    1  
ATOM 4504   H HA   . GLU D  1 53 ? 20.573  -4.941  -244.157 1.00 0.00 ?  53 GLU D HA   1  
ATOM 4505   H HB2  . GLU D  1 53 ? 22.413  -6.777  -242.619 1.00 0.00 ?  53 GLU D HB2  1  
ATOM 4506   H HB3  . GLU D  1 53 ? 22.834  -6.002  -244.166 1.00 0.00 ?  53 GLU D HB3  1  
ATOM 4507   H HG2  . GLU D  1 53 ? 22.605  -3.735  -243.060 1.00 0.00 ?  53 GLU D HG2  1  
ATOM 4508   H HG3  . GLU D  1 53 ? 22.092  -4.634  -241.613 1.00 0.00 ?  53 GLU D HG3  1  
ATOM 4509   N N    . TYR D  1 54 ? 20.238  -8.192  -244.093 1.00 0.00 ?  54 TYR D N    1  
ATOM 4510   C CA   . TYR D  1 54 ? 19.877  -9.336  -244.922 1.00 0.00 ?  54 TYR D CA   1  
ATOM 4511   C C    . TYR D  1 54 ? 18.560  -9.096  -245.649 1.00 0.00 ?  54 TYR D C    1  
ATOM 4512   O O    . TYR D  1 54 ? 18.293  -9.703  -246.686 1.00 0.00 ?  54 TYR D O    1  
ATOM 4513   C CB   . TYR D  1 54 ? 19.784  -10.605 -244.072 1.00 0.00 ?  54 TYR D CB   1  
ATOM 4514   C CG   . TYR D  1 54 ? 19.524  -11.862 -244.872 1.00 0.00 ?  54 TYR D CG   1  
ATOM 4515   C CD1  . TYR D  1 54 ? 20.513  -12.413 -245.674 1.00 0.00 ?  54 TYR D CD1  1  
ATOM 4516   C CD2  . TYR D  1 54 ? 18.291  -12.495 -244.822 1.00 0.00 ?  54 TYR D CD2  1  
ATOM 4517   C CE1  . TYR D  1 54 ? 20.281  -13.560 -246.408 1.00 0.00 ?  54 TYR D CE1  1  
ATOM 4518   C CE2  . TYR D  1 54 ? 18.048  -13.643 -245.551 1.00 0.00 ?  54 TYR D CE2  1  
ATOM 4519   C CZ   . TYR D  1 54 ? 19.046  -14.173 -246.343 1.00 0.00 ?  54 TYR D CZ   1  
ATOM 4520   O OH   . TYR D  1 54 ? 18.810  -15.317 -247.070 1.00 0.00 ?  54 TYR D OH   1  
ATOM 4521   H H    . TYR D  1 54 ? 20.301  -8.311  -243.092 1.00 0.00 ?  54 TYR D H    1  
ATOM 4522   H HA   . TYR D  1 54 ? 20.634  -9.488  -245.692 1.00 0.00 ?  54 TYR D HA   1  
ATOM 4523   H HB2  . TYR D  1 54 ? 20.729  -10.705 -243.535 1.00 0.00 ?  54 TYR D HB2  1  
ATOM 4524   H HB3  . TYR D  1 54 ? 18.975  -10.456 -243.358 1.00 0.00 ?  54 TYR D HB3  1  
ATOM 4525   H HD1  . TYR D  1 54 ? 21.486  -11.924 -245.721 1.00 0.00 ?  54 TYR D HD1  1  
ATOM 4526   H HD2  . TYR D  1 54 ? 17.507  -12.071 -244.195 1.00 0.00 ?  54 TYR D HD2  1  
ATOM 4527   H HE1  . TYR D  1 54 ? 21.067  -13.982 -247.034 1.00 0.00 ?  54 TYR D HE1  1  
ATOM 4528   H HE2  . TYR D  1 54 ? 17.072  -14.125 -245.499 1.00 0.00 ?  54 TYR D HE2  1  
ATOM 4529   H HH   . TYR D  1 54 ? 18.264  -15.953 -246.602 1.00 0.00 ?  54 TYR D HH   1  
ATOM 4530   N N    . ASN D  1 55 ? 17.740  -8.208  -245.098 1.00 0.00 ?  55 ASN D N    1  
ATOM 4531   C CA   . ASN D  1 55 ? 16.522  -7.770  -245.770 1.00 0.00 ?  55 ASN D CA   1  
ATOM 4532   C C    . ASN D  1 55 ? 16.832  -7.157  -247.129 1.00 0.00 ?  55 ASN D C    1  
ATOM 4533   O O    . ASN D  1 55 ? 16.102  -7.367  -248.097 1.00 0.00 ?  55 ASN D O    1  
ATOM 4534   C CB   . ASN D  1 55 ? 15.740  -6.788  -244.917 1.00 0.00 ?  55 ASN D CB   1  
ATOM 4535   C CG   . ASN D  1 55 ? 15.047  -7.423  -243.744 1.00 0.00 ?  55 ASN D CG   1  
ATOM 4536   O OD1  . ASN D  1 55 ? 14.825  -8.639  -243.712 1.00 0.00 ?  55 ASN D OD1  1  
ATOM 4537   N ND2  . ASN D  1 55 ? 14.631  -6.596  -242.819 1.00 0.00 ?  55 ASN D ND2  1  
ATOM 4538   H H    . ASN D  1 55 ? 17.966  -7.825  -244.191 1.00 0.00 ?  55 ASN D H    1  
ATOM 4539   H HA   . ASN D  1 55 ? 15.875  -8.628  -245.958 1.00 0.00 ?  55 ASN D HA   1  
ATOM 4540   H HB2  . ASN D  1 55 ? 16.187  -5.844  -244.601 1.00 0.00 ?  55 ASN D HB2  1  
ATOM 4541   H HB3  . ASN D  1 55 ? 15.004  -6.597  -245.699 1.00 0.00 ?  55 ASN D HB3  1  
ATOM 4542   H HD21 . ASN D  1 55 ? 14.782  -5.613  -242.922 1.00 0.00 ?  55 ASN D HD21 1  
ATOM 4543   H HD22 . ASN D  1 55 ? 14.161  -6.948  -242.009 1.00 0.00 ?  55 ASN D HD22 1  
ATOM 4544   N N    . LEU D  1 56 ? 17.921  -6.398  -247.195 1.00 0.00 ?  56 LEU D N    1  
ATOM 4545   C CA   . LEU D  1 56 ? 18.345  -5.773  -248.443 1.00 0.00 ?  56 LEU D CA   1  
ATOM 4546   C C    . LEU D  1 56 ? 19.151  -6.743  -249.298 1.00 0.00 ?  56 LEU D C    1  
ATOM 4547   O O    . LEU D  1 56 ? 19.205  -6.610  -250.520 1.00 0.00 ?  56 LEU D O    1  
ATOM 4548   C CB   . LEU D  1 56 ? 19.164  -4.510  -248.152 1.00 0.00 ?  56 LEU D CB   1  
ATOM 4549   C CG   . LEU D  1 56 ? 18.402  -3.389  -247.432 1.00 0.00 ?  56 LEU D CG   1  
ATOM 4550   C CD1  . LEU D  1 56 ? 19.326  -2.205  -247.186 1.00 0.00 ?  56 LEU D CD1  1  
ATOM 4551   C CD2  . LEU D  1 56 ? 17.202  -2.972  -248.268 1.00 0.00 ?  56 LEU D CD2  1  
ATOM 4552   H H    . LEU D  1 56 ? 18.468  -6.249  -246.360 1.00 0.00 ?  56 LEU D H    1  
ATOM 4553   H HA   . LEU D  1 56 ? 17.469  -5.499  -249.030 1.00 0.00 ?  56 LEU D HA   1  
ATOM 4554   H HB2  . LEU D  1 56 ? 19.916  -4.935  -247.490 1.00 0.00 ?  56 LEU D HB2  1  
ATOM 4555   H HB3  . LEU D  1 56 ? 19.646  -4.126  -249.050 1.00 0.00 ?  56 LEU D HB3  1  
ATOM 4556   H HG   . LEU D  1 56 ? 18.028  -3.802  -246.495 1.00 0.00 ?  56 LEU D HG   1  
ATOM 4557   H HD11 . LEU D  1 56 ? 18.777  -1.414  -246.674 1.00 0.00 ?  56 LEU D HD11 1  
ATOM 4558   H HD12 . LEU D  1 56 ? 20.166  -2.521  -246.566 1.00 0.00 ?  56 LEU D HD12 1  
ATOM 4559   H HD13 . LEU D  1 56 ? 19.699  -1.829  -248.138 1.00 0.00 ?  56 LEU D HD13 1  
ATOM 4560   H HD21 . LEU D  1 56 ? 16.540  -3.827  -248.409 1.00 0.00 ?  56 LEU D HD21 1  
ATOM 4561   H HD22 . LEU D  1 56 ? 16.661  -2.176  -247.755 1.00 0.00 ?  56 LEU D HD22 1  
ATOM 4562   H HD23 . LEU D  1 56 ? 17.542  -2.613  -249.240 1.00 0.00 ?  56 LEU D HD23 1  
ATOM 4563   N N    . TYR D  1 57 ? 19.777  -7.717  -248.647 1.00 0.00 ?  57 TYR D N    1  
ATOM 4564   C CA   . TYR D  1 57 ? 20.468  -8.789  -249.354 1.00 0.00 ?  57 TYR D CA   1  
ATOM 4565   C C    . TYR D  1 57 ? 19.585  -9.393  -250.438 1.00 0.00 ?  57 TYR D C    1  
ATOM 4566   O O    . TYR D  1 57 ? 20.071  -9.792  -251.497 1.00 0.00 ?  57 TYR D O    1  
ATOM 4567   C CB   . TYR D  1 57 ? 20.913  -9.877  -248.373 1.00 0.00 ?  57 TYR D CB   1  
ATOM 4568   C CG   . TYR D  1 57 ? 21.710  -10.991 -249.014 1.00 0.00 ?  57 TYR D CG   1  
ATOM 4569   C CD1  . TYR D  1 57 ? 23.066  -10.843 -249.268 1.00 0.00 ?  57 TYR D CD1  1  
ATOM 4570   C CD2  . TYR D  1 57 ? 21.105  -12.190 -249.361 1.00 0.00 ?  57 TYR D CD2  1  
ATOM 4571   C CE1  . TYR D  1 57 ? 23.799  -11.857 -249.853 1.00 0.00 ?  57 TYR D CE1  1  
ATOM 4572   C CE2  . TYR D  1 57 ? 21.828  -13.211 -249.946 1.00 0.00 ?  57 TYR D CE2  1  
ATOM 4573   C CZ   . TYR D  1 57 ? 23.175  -13.041 -250.191 1.00 0.00 ?  57 TYR D CZ   1  
ATOM 4574   O OH   . TYR D  1 57 ? 23.900  -14.056 -250.773 1.00 0.00 ?  57 TYR D OH   1  
ATOM 4575   H H    . TYR D  1 57 ? 19.774  -7.716  -247.637 1.00 0.00 ?  57 TYR D H    1  
ATOM 4576   H HA   . TYR D  1 57 ? 21.350  -8.393  -249.857 1.00 0.00 ?  57 TYR D HA   1  
ATOM 4577   H HB2  . TYR D  1 57 ? 21.518  -9.392  -247.606 1.00 0.00 ?  57 TYR D HB2  1  
ATOM 4578   H HB3  . TYR D  1 57 ? 20.012  -10.289 -247.919 1.00 0.00 ?  57 TYR D HB3  1  
ATOM 4579   H HD1  . TYR D  1 57 ? 23.552  -9.905  -248.999 1.00 0.00 ?  57 TYR D HD1  1  
ATOM 4580   H HD2  . TYR D  1 57 ? 20.040  -12.318 -249.165 1.00 0.00 ?  57 TYR D HD2  1  
ATOM 4581   H HE1  . TYR D  1 57 ? 24.863  -11.726 -250.048 1.00 0.00 ?  57 TYR D HE1  1  
ATOM 4582   H HE2  . TYR D  1 57 ? 21.333  -14.146 -250.213 1.00 0.00 ?  57 TYR D HE2  1  
ATOM 4583   H HH   . TYR D  1 57 ? 23.688  -14.921 -250.415 1.00 0.00 ?  57 TYR D HH   1  
ATOM 4584   N N    . ARG D  1 58 ? 18.286  -9.458  -250.168 1.00 0.00 ?  58 ARG D N    1  
ATOM 4585   C CA   . ARG D  1 58 ? 17.328  -9.984  -251.133 1.00 0.00 ?  58 ARG D CA   1  
ATOM 4586   C C    . ARG D  1 58 ? 16.610  -8.858  -251.866 1.00 0.00 ?  58 ARG D C    1  
ATOM 4587   O O    . ARG D  1 58 ? 16.479  -8.886  -253.090 1.00 0.00 ?  58 ARG D O    1  
ATOM 4588   C CB   . ARG D  1 58 ? 16.342  -10.951 -250.495 1.00 0.00 ?  58 ARG D CB   1  
ATOM 4589   C CG   . ARG D  1 58 ? 16.978  -12.119 -249.758 1.00 0.00 ?  58 ARG D CG   1  
ATOM 4590   C CD   . ARG D  1 58 ? 17.614  -13.129 -250.642 1.00 0.00 ?  58 ARG D CD   1  
ATOM 4591   N NE   . ARG D  1 58 ? 18.232  -14.241 -249.940 1.00 0.00 ?  58 ARG D NE   1  
ATOM 4592   C CZ   . ARG D  1 58 ? 18.886  -15.256 -250.539 1.00 0.00 ?  58 ARG D CZ   1  
ATOM 4593   N NH1  . ARG D  1 58 ? 18.977  -15.323 -251.849 1.00 0.00 1  58 ARG D NH1  1  
ATOM 4594   N NH2  . ARG D  1 58 ? 19.414  -16.196 -249.775 1.00 0.00 ?  58 ARG D NH2  1  
ATOM 4595   H H    . ARG D  1 58 ? 17.953  -9.134  -249.271 1.00 0.00 ?  58 ARG D H    1  
ATOM 4596   H HA   . ARG D  1 58 ? 17.851  -10.565 -251.893 1.00 0.00 ?  58 ARG D HA   1  
ATOM 4597   H HB2  . ARG D  1 58 ? 15.736  -10.374 -249.798 1.00 0.00 ?  58 ARG D HB2  1  
ATOM 4598   H HB3  . ARG D  1 58 ? 15.709  -11.335 -251.295 1.00 0.00 ?  58 ARG D HB3  1  
ATOM 4599   H HG2  . ARG D  1 58 ? 17.745  -11.730 -249.087 1.00 0.00 ?  58 ARG D HG2  1  
ATOM 4600   H HG3  . ARG D  1 58 ? 16.206  -12.622 -249.174 1.00 0.00 ?  58 ARG D HG3  1  
ATOM 4601   H HD2  . ARG D  1 58 ? 16.857  -13.543 -251.308 1.00 0.00 ?  58 ARG D HD2  1  
ATOM 4602   H HD3  . ARG D  1 58 ? 18.390  -12.643 -251.233 1.00 0.00 ?  58 ARG D HD3  1  
ATOM 4603   H HE   . ARG D  1 58 ? 18.276  -14.433 -248.948 1.00 0.00 ?  58 ARG D HE   1  
ATOM 4604   H HH11 . ARG D  1 58 ? 18.553  -14.606 -252.419 1.00 0.00 ?  58 ARG D HH11 1  
ATOM 4605   H HH12 . ARG D  1 58 ? 19.472  -16.092 -252.278 1.00 0.00 ?  58 ARG D HH12 1  
ATOM 4606   H HH21 . ARG D  1 58 ? 19.319  -16.138 -248.770 1.00 0.00 ?  58 ARG D HH21 1  
ATOM 4607   H HH22 . ARG D  1 58 ? 19.908  -16.967 -250.197 1.00 0.00 ?  58 ARG D HH22 1  
ATOM 4608   N N    . ASN D  1 59 ? 16.145  -7.869  -251.111 1.00 0.00 ?  59 ASN D N    1  
ATOM 4609   C CA   . ASN D  1 59 ? 15.346  -6.786  -251.672 1.00 0.00 ?  59 ASN D CA   1  
ATOM 4610   C C    . ASN D  1 59 ? 16.160  -5.952  -252.653 1.00 0.00 ?  59 ASN D C    1  
ATOM 4611   O O    . ASN D  1 59 ? 15.832  -5.872  -253.836 1.00 0.00 ?  59 ASN D O    1  
ATOM 4612   C CB   . ASN D  1 59 ? 14.768  -5.901  -250.584 1.00 0.00 ?  59 ASN D CB   1  
ATOM 4613   C CG   . ASN D  1 59 ? 13.714  -4.948  -251.075 1.00 0.00 ?  59 ASN D CG   1  
ATOM 4614   O OD1  . ASN D  1 59 ? 13.598  -4.684  -252.277 1.00 0.00 ?  59 ASN D OD1  1  
ATOM 4615   N ND2  . ASN D  1 59 ? 12.999  -4.369  -250.144 1.00 0.00 ?  59 ASN D ND2  1  
ATOM 4616   H H    . ASN D  1 59 ? 16.350  -7.867  -250.122 1.00 0.00 ?  59 ASN D H    1  
ATOM 4617   H HA   . ASN D  1 59 ? 14.509  -7.199  -252.238 1.00 0.00 ?  59 ASN D HA   1  
ATOM 4618   H HB2  . ASN D  1 59 ? 14.452  -6.324  -249.629 1.00 0.00 ?  59 ASN D HB2  1  
ATOM 4619   H HB3  . ASN D  1 59 ? 15.701  -5.353  -250.446 1.00 0.00 ?  59 ASN D HB3  1  
ATOM 4620   H HD21 . ASN D  1 59 ? 13.173  -4.572  -249.181 1.00 0.00 ?  59 ASN D HD21 1  
ATOM 4621   H HD22 . ASN D  1 59 ? 12.279  -3.723  -250.398 1.00 0.00 ?  59 ASN D HD22 1  
ATOM 4622   N N    . ALA D  1 60 ? 17.224  -5.333  -252.153 1.00 0.00 ?  60 ALA D N    1  
ATOM 4623   C CA   . ALA D  1 60 ? 18.051  -4.451  -252.969 1.00 0.00 ?  60 ALA D CA   1  
ATOM 4624   C C    . ALA D  1 60 ? 18.693  -5.211  -254.123 1.00 0.00 ?  60 ALA D C    1  
ATOM 4625   O O    . ALA D  1 60 ? 18.864  -4.670  -255.216 1.00 0.00 ?  60 ALA D O    1  
ATOM 4626   C CB   . ALA D  1 60 ? 19.116  -3.781  -252.114 1.00 0.00 ?  60 ALA D CB   1  
ATOM 4627   H H    . ALA D  1 60 ? 17.467  -5.476  -251.183 1.00 0.00 ?  60 ALA D H    1  
ATOM 4628   H HA   . ALA D  1 60 ? 17.416  -3.678  -253.402 1.00 0.00 ?  60 ALA D HA   1  
ATOM 4629   H HB1  . ALA D  1 60 ? 19.750  -4.542  -251.661 1.00 0.00 ?  60 ALA D HB1  1  
ATOM 4630   H HB2  . ALA D  1 60 ? 19.724  -3.127  -252.738 1.00 0.00 ?  60 ALA D HB2  1  
ATOM 4631   H HB3  . ALA D  1 60 ? 18.637  -3.193  -251.330 1.00 0.00 ?  60 ALA D HB3  1  
ATOM 4632   N N    . GLN D  1 61 ? 19.047  -6.467  -253.874 1.00 0.00 ?  61 GLN D N    1  
ATOM 4633   C CA   . GLN D  1 61 ? 19.589  -7.331  -254.916 1.00 0.00 ?  61 GLN D CA   1  
ATOM 4634   C C    . GLN D  1 61 ? 18.651  -7.405  -256.114 1.00 0.00 ?  61 GLN D C    1  
ATOM 4635   O O    . GLN D  1 61 ? 19.048  -7.123  -257.244 1.00 0.00 ?  61 GLN D O    1  
ATOM 4636   C CB   . GLN D  1 61 ? 19.840  -8.738  -254.368 1.00 0.00 ?  61 GLN D CB   1  
ATOM 4637   C CG   . GLN D  1 61 ? 20.431  -9.704  -255.380 1.00 0.00 ?  61 GLN D CG   1  
ATOM 4638   C CD   . GLN D  1 61 ? 20.603  -11.102 -254.815 1.00 0.00 ?  61 GLN D CD   1  
ATOM 4639   O OE1  . GLN D  1 61 ? 20.158  -11.395 -253.702 1.00 0.00 ?  61 GLN D OE1  1  
ATOM 4640   N NE2  . GLN D  1 61 ? 21.255  -11.971 -255.579 1.00 0.00 ?  61 GLN D NE2  1  
ATOM 4641   H H    . GLN D  1 61 ? 18.937  -6.833  -252.939 1.00 0.00 ?  61 GLN D H    1  
ATOM 4642   H HA   . GLN D  1 61 ? 20.527  -6.916  -255.283 1.00 0.00 ?  61 GLN D HA   1  
ATOM 4643   H HB2  . GLN D  1 61 ? 20.518  -8.631  -253.521 1.00 0.00 ?  61 GLN D HB2  1  
ATOM 4644   H HB3  . GLN D  1 61 ? 18.879  -9.115  -254.017 1.00 0.00 ?  61 GLN D HB3  1  
ATOM 4645   H HG2  . GLN D  1 61 ? 20.051  -9.799  -256.397 1.00 0.00 ?  61 GLN D HG2  1  
ATOM 4646   H HG3  . GLN D  1 61 ? 21.407  -9.219  -255.403 1.00 0.00 ?  61 GLN D HG3  1  
ATOM 4647   H HE21 . GLN D  1 61 ? 21.601  -11.691 -256.474 1.00 0.00 ?  61 GLN D HE21 1  
ATOM 4648   H HE22 . GLN D  1 61 ? 21.399  -12.909 -255.259 1.00 0.00 ?  61 GLN D HE22 1  
ATOM 4649   N N    . SER D  1 62 ? 17.404  -7.787  -255.859 1.00 0.00 ?  62 SER D N    1  
ATOM 4650   C CA   . SER D  1 62 ? 16.425  -7.969  -256.925 1.00 0.00 ?  62 SER D CA   1  
ATOM 4651   C C    . SER D  1 62 ? 16.034  -6.634  -257.547 1.00 0.00 ?  62 SER D C    1  
ATOM 4652   O O    . SER D  1 62 ? 15.641  -6.573  -258.712 1.00 0.00 ?  62 SER D O    1  
ATOM 4653   C CB   . SER D  1 62 ? 15.199  -8.683  -256.391 1.00 0.00 ?  62 SER D CB   1  
ATOM 4654   O OG   . SER D  1 62 ? 14.448  -7.869  -255.533 1.00 0.00 ?  62 SER D OG   1  
ATOM 4655   H H    . SER D  1 62 ? 17.126  -7.955  -254.903 1.00 0.00 ?  62 SER D H    1  
ATOM 4656   H HA   . SER D  1 62 ? 16.756  -8.658  -257.703 1.00 0.00 ?  62 SER D HA   1  
ATOM 4657   H HB2  . SER D  1 62 ? 14.575  -8.980  -257.234 1.00 0.00 ?  62 SER D HB2  1  
ATOM 4658   H HB3  . SER D  1 62 ? 15.520  -9.571  -255.848 1.00 0.00 ?  62 SER D HB3  1  
ATOM 4659   H HG   . SER D  1 62 ? 15.029  -7.470  -254.881 1.00 0.00 ?  62 SER D HG   1  
ATOM 4660   N N    . ASN D  1 63 ? 16.144  -5.567  -256.763 1.00 0.00 ?  63 ASN D N    1  
ATOM 4661   C CA   . ASN D  1 63 ? 15.804  -4.231  -257.236 1.00 0.00 ?  63 ASN D CA   1  
ATOM 4662   C C    . ASN D  1 63 ? 16.766  -3.769  -258.322 1.00 0.00 ?  63 ASN D C    1  
ATOM 4663   O O    . ASN D  1 63 ? 16.346  -3.281  -259.371 1.00 0.00 ?  63 ASN D O    1  
ATOM 4664   C CB   . ASN D  1 63 ? 15.779  -3.228  -256.096 1.00 0.00 ?  63 ASN D CB   1  
ATOM 4665   C CG   . ASN D  1 63 ? 14.594  -3.379  -255.183 1.00 0.00 ?  63 ASN D CG   1  
ATOM 4666   O OD1  . ASN D  1 63 ? 13.523  -3.840  -255.594 1.00 0.00 ?  63 ASN D OD1  1  
ATOM 4667   N ND2  . ASN D  1 63 ? 14.754  -2.917  -253.969 1.00 0.00 ?  63 ASN D ND2  1  
ATOM 4668   H H    . ASN D  1 63 ? 16.471  -5.685  -255.814 1.00 0.00 ?  63 ASN D H    1  
ATOM 4669   H HA   . ASN D  1 63 ? 14.810  -4.239  -257.687 1.00 0.00 ?  63 ASN D HA   1  
ATOM 4670   H HB2  . ASN D  1 63 ? 16.671  -3.042  -255.497 1.00 0.00 ?  63 ASN D HB2  1  
ATOM 4671   H HB3  . ASN D  1 63 ? 15.605  -2.381  -256.761 1.00 0.00 ?  63 ASN D HB3  1  
ATOM 4672   H HD21 . ASN D  1 63 ? 15.622  -2.498  -253.704 1.00 0.00 ?  63 ASN D HD21 1  
ATOM 4673   H HD22 . ASN D  1 63 ? 14.007  -2.984  -253.307 1.00 0.00 ?  63 ASN D HD22 1  
ATOM 4674   N N    . THR D  1 64 ? 18.060  -3.927  -258.065 1.00 0.00 ?  64 THR D N    1  
ATOM 4675   C CA   . THR D  1 64 ? 19.087  -3.492  -259.004 1.00 0.00 ?  64 THR D CA   1  
ATOM 4676   C C    . THR D  1 64 ? 19.037  -4.306  -260.291 1.00 0.00 ?  64 THR D C    1  
ATOM 4677   O O    . THR D  1 64 ? 19.236  -3.773  -261.382 1.00 0.00 ?  64 THR D O    1  
ATOM 4678   C CB   . THR D  1 64 ? 20.496  -3.603  -258.393 1.00 0.00 ?  64 THR D CB   1  
ATOM 4679   O OG1  . THR D  1 64 ? 20.736  -4.955  -257.981 1.00 0.00 ?  64 THR D OG1  1  
ATOM 4680   C CG2  . THR D  1 64 ? 20.631  -2.679  -257.192 1.00 0.00 ?  64 THR D CG2  1  
ATOM 4681   H H    . THR D  1 64 ? 18.340  -4.360  -257.196 1.00 0.00 ?  64 THR D H    1  
ATOM 4682   H HA   . THR D  1 64 ? 18.911  -2.455  -259.289 1.00 0.00 ?  64 THR D HA   1  
ATOM 4683   H HB   . THR D  1 64 ? 21.232  -3.327  -259.148 1.00 0.00 ?  64 THR D HB   1  
ATOM 4684   H HG1  . THR D  1 64 ? 21.615  -5.022  -257.600 1.00 0.00 ?  64 THR D HG1  1  
ATOM 4685   H HG21 . THR D  1 64 ? 21.633  -2.772  -256.774 1.00 0.00 ?  64 THR D HG21 1  
ATOM 4686   H HG22 . THR D  1 64 ? 20.461  -1.649  -257.505 1.00 0.00 ?  64 THR D HG22 1  
ATOM 4687   H HG23 . THR D  1 64 ? 19.896  -2.956  -256.437 1.00 0.00 ?  64 THR D HG23 1  
ATOM 4688   N N    . VAL D  1 65 ? 18.771  -5.601  -260.156 1.00 0.00 ?  65 VAL D N    1  
ATOM 4689   C CA   . VAL D  1 65 ? 18.630  -6.479  -261.311 1.00 0.00 ?  65 VAL D CA   1  
ATOM 4690   C C    . VAL D  1 65 ? 17.434  -6.079  -262.165 1.00 0.00 ?  65 VAL D C    1  
ATOM 4691   O O    . VAL D  1 65 ? 17.515  -6.057  -263.393 1.00 0.00 ?  65 VAL D O    1  
ATOM 4692   C CB   . VAL D  1 65 ? 18.476  -7.952  -260.887 1.00 0.00 ?  65 VAL D CB   1  
ATOM 4693   C CG1  . VAL D  1 65 ? 18.114  -8.816  -262.085 1.00 0.00 ?  65 VAL D CG1  1  
ATOM 4694   C CG2  . VAL D  1 65 ? 19.756  -8.455  -260.236 1.00 0.00 ?  65 VAL D CG2  1  
ATOM 4695   H H    . VAL D  1 65 ? 18.662  -5.987  -259.229 1.00 0.00 ?  65 VAL D H    1  
ATOM 4696   H HA   . VAL D  1 65 ? 19.490  -6.397  -261.978 1.00 0.00 ?  65 VAL D HA   1  
ATOM 4697   H HB   . VAL D  1 65 ? 17.690  -8.023  -260.136 1.00 0.00 ?  65 VAL D HB   1  
ATOM 4698   H HG11 . VAL D  1 65 ? 18.008  -9.854  -261.767 1.00 0.00 ?  65 VAL D HG11 1  
ATOM 4699   H HG12 . VAL D  1 65 ? 17.172  -8.471  -262.511 1.00 0.00 ?  65 VAL D HG12 1  
ATOM 4700   H HG13 . VAL D  1 65 ? 18.900  -8.746  -262.836 1.00 0.00 ?  65 VAL D HG13 1  
ATOM 4701   H HG21 . VAL D  1 65 ? 19.977  -7.854  -259.354 1.00 0.00 ?  65 VAL D HG21 1  
ATOM 4702   H HG22 . VAL D  1 65 ? 19.629  -9.497  -259.942 1.00 0.00 ?  65 VAL D HG22 1  
ATOM 4703   H HG23 . VAL D  1 65 ? 20.579  -8.376  -260.946 1.00 0.00 ?  65 VAL D HG23 1  
ATOM 4704   N N    . LYS D  1 66 ? 16.324  -5.763  -261.508 1.00 0.00 ?  66 LYS D N    1  
ATOM 4705   C CA   . LYS D  1 66 ? 15.134  -5.281  -262.200 1.00 0.00 ?  66 LYS D CA   1  
ATOM 4706   C C    . LYS D  1 66 ? 15.451  -4.060  -263.053 1.00 0.00 ?  66 LYS D C    1  
ATOM 4707   O O    . LYS D  1 66 ? 15.070  -3.992  -264.222 1.00 0.00 ?  66 LYS D O    1  
ATOM 4708   C CB   . LYS D  1 66 ? 14.029  -4.948  -261.196 1.00 0.00 ?  66 LYS D CB   1  
ATOM 4709   C CG   . LYS D  1 66 ? 12.759  -4.388  -261.823 1.00 0.00 ?  66 LYS D CG   1  
ATOM 4710   C CD   . LYS D  1 66 ? 11.731  -4.025  -260.761 1.00 0.00 ?  66 LYS D CD   1  
ATOM 4711   C CE   . LYS D  1 66 ? 10.502  -3.375  -261.378 1.00 0.00 ?  66 LYS D CE   1  
ATOM 4712   N NZ   . LYS D  1 66 ? 10.798  -2.018  -261.911 1.00 0.00 1  66 LYS D NZ   1  
ATOM 4713   H H    . LYS D  1 66 ? 16.303  -5.859  -260.502 1.00 0.00 ?  66 LYS D H    1  
ATOM 4714   H HA   . LYS D  1 66 ? 14.767  -6.049  -262.881 1.00 0.00 ?  66 LYS D HA   1  
ATOM 4715   H HB2  . LYS D  1 66 ? 13.794  -5.870  -260.663 1.00 0.00 ?  66 LYS D HB2  1  
ATOM 4716   H HB3  . LYS D  1 66 ? 14.439  -4.220  -260.497 1.00 0.00 ?  66 LYS D HB3  1  
ATOM 4717   H HG2  . LYS D  1 66 ? 13.019  -3.498  -262.397 1.00 0.00 ?  66 LYS D HG2  1  
ATOM 4718   H HG3  . LYS D  1 66 ? 12.341  -5.140  -262.491 1.00 0.00 ?  66 LYS D HG3  1  
ATOM 4719   H HD2  . LYS D  1 66 ? 11.437  -4.936  -260.237 1.00 0.00 ?  66 LYS D HD2  1  
ATOM 4720   H HD3  . LYS D  1 66 ? 12.191  -3.334  -260.055 1.00 0.00 ?  66 LYS D HD3  1  
ATOM 4721   H HE2  . LYS D  1 66 ? 10.147  -4.013  -262.187 1.00 0.00 ?  66 LYS D HE2  1  
ATOM 4722   H HE3  . LYS D  1 66 ? 9.732   -3.303  -260.610 1.00 0.00 ?  66 LYS D HE3  1  
ATOM 4723   H HZ1  . LYS D  1 66 ? 11.511  -2.085  -262.624 1.00 0.00 ?  66 LYS D HZ1  1  
ATOM 4724   H HZ2  . LYS D  1 66 ? 9.959   -1.622  -262.310 1.00 0.00 ?  66 LYS D HZ2  1  
ATOM 4725   H HZ3  . LYS D  1 66 ? 11.126  -1.425  -261.161 1.00 0.00 ?  66 LYS D HZ3  1  
ATOM 4726   N N    . VAL D  1 67 ? 16.150  -3.096  -262.463 1.00 0.00 ?  67 VAL D N    1  
ATOM 4727   C CA   . VAL D  1 67 ? 16.452  -1.842  -263.143 1.00 0.00 ?  67 VAL D CA   1  
ATOM 4728   C C    . VAL D  1 67 ? 17.332  -2.075  -264.364 1.00 0.00 ?  67 VAL D C    1  
ATOM 4729   O O    . VAL D  1 67 ? 17.102  -1.496  -265.426 1.00 0.00 ?  67 VAL D O    1  
ATOM 4730   C CB   . VAL D  1 67 ? 17.150  -0.843  -262.201 1.00 0.00 ?  67 VAL D CB   1  
ATOM 4731   C CG1  . VAL D  1 67 ? 17.672  0.352   -262.985 1.00 0.00 ?  67 VAL D CG1  1  
ATOM 4732   C CG2  . VAL D  1 67 ? 16.198  -0.386  -261.107 1.00 0.00 ?  67 VAL D CG2  1  
ATOM 4733   H H    . VAL D  1 67 ? 16.481  -3.236  -261.519 1.00 0.00 ?  67 VAL D H    1  
ATOM 4734   H HA   . VAL D  1 67 ? 15.547  -1.376  -263.535 1.00 0.00 ?  67 VAL D HA   1  
ATOM 4735   H HB   . VAL D  1 67 ? 17.983  -1.344  -261.707 1.00 0.00 ?  67 VAL D HB   1  
ATOM 4736   H HG11 . VAL D  1 67 ? 18.163  1.048   -262.304 1.00 0.00 ?  67 VAL D HG11 1  
ATOM 4737   H HG12 . VAL D  1 67 ? 18.387  0.012   -263.734 1.00 0.00 ?  67 VAL D HG12 1  
ATOM 4738   H HG13 . VAL D  1 67 ? 16.840  0.855   -263.478 1.00 0.00 ?  67 VAL D HG13 1  
ATOM 4739   H HG21 . VAL D  1 67 ? 15.869  -1.249  -260.527 1.00 0.00 ?  67 VAL D HG21 1  
ATOM 4740   H HG22 . VAL D  1 67 ? 16.708  0.319   -260.451 1.00 0.00 ?  67 VAL D HG22 1  
ATOM 4741   H HG23 . VAL D  1 67 ? 15.332  0.099   -261.559 1.00 0.00 ?  67 VAL D HG23 1  
ATOM 4742   N N    . PHE D  1 68 ? 18.340  -2.925  -264.206 1.00 0.00 ?  68 PHE D N    1  
ATOM 4743   C CA   . PHE D  1 68 ? 19.226  -3.276  -265.310 1.00 0.00 ?  68 PHE D CA   1  
ATOM 4744   C C    . PHE D  1 68 ? 18.484  -4.064  -266.383 1.00 0.00 ?  68 PHE D C    1  
ATOM 4745   O O    . PHE D  1 68 ? 18.863  -4.044  -267.554 1.00 0.00 ?  68 PHE D O    1  
ATOM 4746   C CB   . PHE D  1 68 ? 20.423  -4.081  -264.800 1.00 0.00 ?  68 PHE D CB   1  
ATOM 4747   C CG   . PHE D  1 68 ? 21.519  -3.234  -264.219 1.00 0.00 ?  68 PHE D CG   1  
ATOM 4748   C CD1  . PHE D  1 68 ? 22.245  -2.367  -265.022 1.00 0.00 ?  68 PHE D CD1  1  
ATOM 4749   C CD2  . PHE D  1 68 ? 21.826  -3.303  -262.868 1.00 0.00 ?  68 PHE D CD2  1  
ATOM 4750   C CE1  . PHE D  1 68 ? 23.254  -1.588  -264.490 1.00 0.00 ?  68 PHE D CE1  1  
ATOM 4751   C CE2  . PHE D  1 68 ? 22.835  -2.524  -262.333 1.00 0.00 ?  68 PHE D CE2  1  
ATOM 4752   C CZ   . PHE D  1 68 ? 23.549  -1.667  -263.143 1.00 0.00 ?  68 PHE D CZ   1  
ATOM 4753   H H    . PHE D  1 68 ? 18.497  -3.340  -263.299 1.00 0.00 ?  68 PHE D H    1  
ATOM 4754   H HA   . PHE D  1 68 ? 19.595  -2.369  -265.791 1.00 0.00 ?  68 PHE D HA   1  
ATOM 4755   H HB2  . PHE D  1 68 ? 20.107  -4.765  -264.013 1.00 0.00 ?  68 PHE D HB2  1  
ATOM 4756   H HB3  . PHE D  1 68 ? 20.867  -4.649  -265.616 1.00 0.00 ?  68 PHE D HB3  1  
ATOM 4757   H HD1  . PHE D  1 68 ? 22.012  -2.305  -266.085 1.00 0.00 ?  68 PHE D HD1  1  
ATOM 4758   H HD2  . PHE D  1 68 ? 21.262  -3.981  -262.228 1.00 0.00 ?  68 PHE D HD2  1  
ATOM 4759   H HE1  . PHE D  1 68 ? 23.818  -0.911  -265.131 1.00 0.00 ?  68 PHE D HE1  1  
ATOM 4760   H HE2  . PHE D  1 68 ? 23.065  -2.588  -261.270 1.00 0.00 ?  68 PHE D HE2  1  
ATOM 4761   H HZ   . PHE D  1 68 ? 24.343  -1.052  -262.722 1.00 0.00 ?  68 PHE D HZ   1  
ATOM 4762   N N    . LYS D  1 69 ? 17.425  -4.756  -265.976 1.00 0.00 ?  69 LYS D N    1  
ATOM 4763   C CA   . LYS D  1 69 ? 16.538  -5.424  -266.920 1.00 0.00 ?  69 LYS D CA   1  
ATOM 4764   C C    . LYS D  1 69 ? 15.555  -4.441  -267.543 1.00 0.00 ?  69 LYS D C    1  
ATOM 4765   O O    . LYS D  1 69 ? 15.115  -4.624  -268.678 1.00 0.00 ?  69 LYS D O    1  
ATOM 4766   C CB   . LYS D  1 69 ? 15.780  -6.560  -266.230 1.00 0.00 ?  69 LYS D CB   1  
ATOM 4767   C CG   . LYS D  1 69 ? 15.065  -7.509  -267.183 1.00 0.00 ?  69 LYS D CG   1  
ATOM 4768   C CD   . LYS D  1 69 ? 13.640  -7.051  -267.455 1.00 0.00 ?  69 LYS D CD   1  
ATOM 4769   C CE   . LYS D  1 69 ? 12.922  -8.005  -268.398 1.00 0.00 ?  69 LYS D CE   1  
ATOM 4770   N NZ   . LYS D  1 69 ? 11.619  -7.454  -268.861 1.00 0.00 1  69 LYS D NZ   1  
ATOM 4771   H H    . LYS D  1 69 ? 17.230  -4.820  -264.987 1.00 0.00 ?  69 LYS D H    1  
ATOM 4772   H HA   . LYS D  1 69 ? 17.121  -5.844  -267.741 1.00 0.00 ?  69 LYS D HA   1  
ATOM 4773   H HB2  . LYS D  1 69 ? 16.508  -7.118  -265.640 1.00 0.00 ?  69 LYS D HB2  1  
ATOM 4774   H HB3  . LYS D  1 69 ? 15.050  -6.099  -265.563 1.00 0.00 ?  69 LYS D HB3  1  
ATOM 4775   H HG2  . LYS D  1 69 ? 15.622  -7.543  -268.120 1.00 0.00 ?  69 LYS D HG2  1  
ATOM 4776   H HG3  . LYS D  1 69 ? 15.049  -8.502  -266.735 1.00 0.00 ?  69 LYS D HG3  1  
ATOM 4777   H HD2  . LYS D  1 69 ? 13.103  -7.003  -266.507 1.00 0.00 ?  69 LYS D HD2  1  
ATOM 4778   H HD3  . LYS D  1 69 ? 13.674  -6.057  -267.902 1.00 0.00 ?  69 LYS D HD3  1  
ATOM 4779   H HE2  . LYS D  1 69 ? 13.565  -8.185  -269.258 1.00 0.00 ?  69 LYS D HE2  1  
ATOM 4780   H HE3  . LYS D  1 69 ? 12.751  -8.943  -267.870 1.00 0.00 ?  69 LYS D HE3  1  
ATOM 4781   H HZ1  . LYS D  1 69 ? 11.777  -6.585  -269.351 1.00 0.00 ?  69 LYS D HZ1  1  
ATOM 4782   H HZ2  . LYS D  1 69 ? 11.176  -8.115  -269.482 1.00 0.00 ?  69 LYS D HZ2  1  
ATOM 4783   H HZ3  . LYS D  1 69 ? 11.021  -7.287  -268.064 1.00 0.00 ?  69 LYS D HZ3  1  
ATOM 4784   N N    . ASP D  1 70 ? 15.215  -3.398  -266.794 1.00 0.00 ?  70 ASP D N    1  
ATOM 4785   C CA   . ASP D  1 70 ? 14.264  -2.397  -267.263 1.00 0.00 ?  70 ASP D CA   1  
ATOM 4786   C C    . ASP D  1 70 ? 14.857  -1.559  -268.389 1.00 0.00 ?  70 ASP D C    1  
ATOM 4787   O O    . ASP D  1 70 ? 14.160  -1.193  -269.335 1.00 0.00 ?  70 ASP D O    1  
ATOM 4788   C CB   . ASP D  1 70 ? 13.826  -1.491  -266.109 1.00 0.00 ?  70 ASP D CB   1  
ATOM 4789   C CG   . ASP D  1 70 ? 12.844  -2.137  -265.141 1.00 0.00 ?  70 ASP D CG   1  
ATOM 4790   O OD1  . ASP D  1 70 ? 12.318  -3.176  -265.464 1.00 0.00 ?  70 ASP D OD1  1  
ATOM 4791   O OD2  . ASP D  1 70 ? 12.745  -1.675  -264.029 1.00 0.00 -1 70 ASP D OD2  1  
ATOM 4792   H H    . ASP D  1 70 ? 15.625  -3.296  -265.877 1.00 0.00 ?  70 ASP D H    1  
ATOM 4793   H HA   . ASP D  1 70 ? 13.382  -2.888  -267.674 1.00 0.00 ?  70 ASP D HA   1  
ATOM 4794   H HB2  . ASP D  1 70 ? 14.660  -1.066  -265.549 1.00 0.00 ?  70 ASP D HB2  1  
ATOM 4795   H HB3  . ASP D  1 70 ? 13.321  -0.702  -266.666 1.00 0.00 ?  70 ASP D HB3  1  
ATOM 4796   N N    . ILE D  1 71 ? 16.146  -1.259  -268.280 1.00 0.00 ?  71 ILE D N    1  
ATOM 4797   C CA   . ILE D  1 71 ? 16.856  -0.537  -269.330 1.00 0.00 ?  71 ILE D CA   1  
ATOM 4798   C C    . ILE D  1 71 ? 17.122  -1.435  -270.532 1.00 0.00 ?  71 ILE D C    1  
ATOM 4799   O O    . ILE D  1 71 ? 17.328  -0.952  -271.645 1.00 0.00 ?  71 ILE D O    1  
ATOM 4800   C CB   . ILE D  1 71 ? 18.193  0.031   -268.820 1.00 0.00 ?  71 ILE D CB   1  
ATOM 4801   C CG1  . ILE D  1 71 ? 19.109  -1.101  -268.348 1.00 0.00 ?  71 ILE D CG1  1  
ATOM 4802   C CG2  . ILE D  1 71 ? 17.953  1.030   -267.698 1.00 0.00 ?  71 ILE D CG2  1  
ATOM 4803   C CD1  . ILE D  1 71 ? 20.473  -0.633  -267.893 1.00 0.00 ?  71 ILE D CD1  1  
ATOM 4804   H H    . ILE D  1 71 ? 16.648  -1.537  -267.449 1.00 0.00 ?  71 ILE D H    1  
ATOM 4805   H HA   . ILE D  1 71 ? 16.243  0.274   -269.721 1.00 0.00 ?  71 ILE D HA   1  
ATOM 4806   H HB   . ILE D  1 71 ? 18.705  0.527   -269.644 1.00 0.00 ?  71 ILE D HB   1  
ATOM 4807   H HG12 . ILE D  1 71 ? 18.605  -1.604  -267.524 1.00 0.00 ?  71 ILE D HG12 1  
ATOM 4808   H HG13 . ILE D  1 71 ? 19.223  -1.794  -269.181 1.00 0.00 ?  71 ILE D HG13 1  
ATOM 4809   H HG21 . ILE D  1 71 ? 18.908  1.421   -267.349 1.00 0.00 ?  71 ILE D HG21 1  
ATOM 4810   H HG22 . ILE D  1 71 ? 17.338  1.850   -268.066 1.00 0.00 ?  71 ILE D HG22 1  
ATOM 4811   H HG23 . ILE D  1 71 ? 17.441  0.534   -266.873 1.00 0.00 ?  71 ILE D HG23 1  
ATOM 4812   H HD11 . ILE D  1 71 ? 20.362  0.059   -267.060 1.00 0.00 ?  71 ILE D HD11 1  
ATOM 4813   H HD12 . ILE D  1 71 ? 21.065  -1.491  -267.574 1.00 0.00 ?  71 ILE D HD12 1  
ATOM 4814   H HD13 . ILE D  1 71 ? 20.980  -0.130  -268.718 1.00 0.00 ?  71 ILE D HD13 1  
ATOM 4815   N N    . ASP D  1 72 ? 17.114  -2.743  -270.300 1.00 0.00 ?  72 ASP D N    1  
ATOM 4816   C CA   . ASP D  1 72 ? 17.125  -3.714  -271.388 1.00 0.00 ?  72 ASP D CA   1  
ATOM 4817   C C    . ASP D  1 72 ? 15.825  -3.667  -272.181 1.00 0.00 ?  72 ASP D C    1  
ATOM 4818   O O    . ASP D  1 72 ? 15.838  -3.637  -273.411 1.00 0.00 ?  72 ASP D O    1  
ATOM 4819   C CB   . ASP D  1 72 ? 17.359  -5.125  -270.845 1.00 0.00 ?  72 ASP D CB   1  
ATOM 4820   C CG   . ASP D  1 72 ? 18.773  -5.379  -270.341 1.00 0.00 ?  72 ASP D CG   1  
ATOM 4821   O OD1  . ASP D  1 72 ? 19.645  -4.607  -270.663 1.00 0.00 ?  72 ASP D OD1  1  
ATOM 4822   O OD2  . ASP D  1 72 ? 18.942  -6.244  -269.515 1.00 0.00 -1 72 ASP D OD2  1  
ATOM 4823   H H    . ASP D  1 72 ? 17.101  -3.074  -269.346 1.00 0.00 ?  72 ASP D H    1  
ATOM 4824   H HA   . ASP D  1 72 ? 17.925  -3.473  -272.089 1.00 0.00 ?  72 ASP D HA   1  
ATOM 4825   H HB2  . ASP D  1 72 ? 16.642  -5.420  -270.079 1.00 0.00 ?  72 ASP D HB2  1  
ATOM 4826   H HB3  . ASP D  1 72 ? 17.187  -5.709  -271.750 1.00 0.00 ?  72 ASP D HB3  1  
ATOM 4827   N N    . ALA D  1 73 ? 14.704  -3.661  -271.468 1.00 0.00 ?  73 ALA D N    1  
ATOM 4828   C CA   . ALA D  1 73 ? 13.396  -3.533  -272.100 1.00 0.00 ?  73 ALA D CA   1  
ATOM 4829   C C    . ALA D  1 73 ? 13.270  -2.210  -272.843 1.00 0.00 ?  73 ALA D C    1  
ATOM 4830   O O    . ALA D  1 73 ? 12.692  -2.149  -273.929 1.00 0.00 ?  73 ALA D O    1  
ATOM 4831   C CB   . ALA D  1 73 ? 12.291  -3.669  -271.062 1.00 0.00 ?  73 ALA D CB   1  
ATOM 4832   H H    . ALA D  1 73 ? 14.759  -3.747  -270.464 1.00 0.00 ?  73 ALA D H    1  
ATOM 4833   H HA   . ALA D  1 73 ? 13.283  -4.331  -272.835 1.00 0.00 ?  73 ALA D HA   1  
ATOM 4834   H HB1  . ALA D  1 73 ? 12.399  -2.888  -270.312 1.00 0.00 ?  73 ALA D HB1  1  
ATOM 4835   H HB2  . ALA D  1 73 ? 11.321  -3.572  -271.550 1.00 0.00 ?  73 ALA D HB2  1  
ATOM 4836   H HB3  . ALA D  1 73 ? 12.359  -4.646  -270.583 1.00 0.00 ?  73 ALA D HB3  1  
ATOM 4837   N N    . ALA D  1 74 ? 13.814  -1.151  -272.253 1.00 0.00 ?  74 ALA D N    1  
ATOM 4838   C CA   . ALA D  1 74 ? 13.765  0.174   -272.859 1.00 0.00 ?  74 ALA D CA   1  
ATOM 4839   C C    . ALA D  1 74 ? 14.434  0.179   -274.228 1.00 0.00 ?  74 ALA D C    1  
ATOM 4840   O O    . ALA D  1 74 ? 13.941  0.803   -275.168 1.00 0.00 ?  74 ALA D O    1  
ATOM 4841   C CB   . ALA D  1 74 ? 14.416  1.200   -271.943 1.00 0.00 ?  74 ALA D CB   1  
ATOM 4842   H H    . ALA D  1 74 ? 14.274  -1.267  -271.361 1.00 0.00 ?  74 ALA D H    1  
ATOM 4843   H HA   . ALA D  1 74 ? 12.721  0.452   -273.007 1.00 0.00 ?  74 ALA D HA   1  
ATOM 4844   H HB1  . ALA D  1 74 ? 15.456  0.927   -271.774 1.00 0.00 ?  74 ALA D HB1  1  
ATOM 4845   H HB2  . ALA D  1 74 ? 14.370  2.184   -272.411 1.00 0.00 ?  74 ALA D HB2  1  
ATOM 4846   H HB3  . ALA D  1 74 ? 13.886  1.226   -270.991 1.00 0.00 ?  74 ALA D HB3  1  
ATOM 4847   N N    . ILE D  1 75 ? 15.559  -0.520  -274.333 1.00 0.00 ?  75 ILE D N    1  
ATOM 4848   C CA   . ILE D  1 75 ? 16.320  -0.564  -275.576 1.00 0.00 ?  75 ILE D CA   1  
ATOM 4849   C C    . ILE D  1 75 ? 15.587  -1.366  -276.643 1.00 0.00 ?  75 ILE D C    1  
ATOM 4850   O O    . ILE D  1 75 ? 15.440  -0.917  -277.780 1.00 0.00 ?  75 ILE D O    1  
ATOM 4851   C CB   . ILE D  1 75 ? 17.719  -1.170  -275.361 1.00 0.00 ?  75 ILE D CB   1  
ATOM 4852   C CG1  . ILE D  1 75 ? 18.569  -0.252  -274.478 1.00 0.00 ?  75 ILE D CG1  1  
ATOM 4853   C CG2  . ILE D  1 75 ? 18.404  -1.414  -276.696 1.00 0.00 ?  75 ILE D CG2  1  
ATOM 4854   C CD1  . ILE D  1 75 ? 19.834  -0.900  -273.963 1.00 0.00 ?  75 ILE D CD1  1  
ATOM 4855   H H    . ILE D  1 75 ? 15.895  -1.035  -273.532 1.00 0.00 ?  75 ILE D H    1  
ATOM 4856   H HA   . ILE D  1 75 ? 16.419  0.435   -276.000 1.00 0.00 ?  75 ILE D HA   1  
ATOM 4857   H HB   . ILE D  1 75 ? 17.618  -2.114  -274.826 1.00 0.00 ?  75 ILE D HB   1  
ATOM 4858   H HG12 . ILE D  1 75 ? 18.825  0.624   -275.074 1.00 0.00 ?  75 ILE D HG12 1  
ATOM 4859   H HG13 . ILE D  1 75 ? 17.948  0.053   -273.636 1.00 0.00 ?  75 ILE D HG13 1  
ATOM 4860   H HG21 . ILE D  1 75 ? 19.391  -1.842  -276.526 1.00 0.00 ?  75 ILE D HG21 1  
ATOM 4861   H HG22 . ILE D  1 75 ? 17.807  -2.104  -277.291 1.00 0.00 ?  75 ILE D HG22 1  
ATOM 4862   H HG23 . ILE D  1 75 ? 18.506  -0.469  -277.231 1.00 0.00 ?  75 ILE D HG23 1  
ATOM 4863   H HD11 . ILE D  1 75 ? 20.456  -1.204  -274.804 1.00 0.00 ?  75 ILE D HD11 1  
ATOM 4864   H HD12 . ILE D  1 75 ? 20.382  -0.188  -273.346 1.00 0.00 ?  75 ILE D HD12 1  
ATOM 4865   H HD13 . ILE D  1 75 ? 19.578  -1.776  -273.366 1.00 0.00 ?  75 ILE D HD13 1  
ATOM 4866   N N    . ILE D  1 76 ? 15.129  -2.557  -276.271 1.00 0.00 ?  76 ILE D N    1  
ATOM 4867   C CA   . ILE D  1 76 ? 14.486  -3.461  -277.217 1.00 0.00 ?  76 ILE D CA   1  
ATOM 4868   C C    . ILE D  1 76 ? 13.074  -2.996  -277.550 1.00 0.00 ?  76 ILE D C    1  
ATOM 4869   O O    . ILE D  1 76 ? 12.466  -3.465  -278.512 1.00 0.00 ?  76 ILE D O    1  
ATOM 4870   C CB   . ILE D  1 76 ? 14.428  -4.900  -276.673 1.00 0.00 ?  76 ILE D CB   1  
ATOM 4871   C CG1  . ILE D  1 76 ? 13.537  -4.966  -275.431 1.00 0.00 ?  76 ILE D CG1  1  
ATOM 4872   C CG2  . ILE D  1 76 ? 15.827  -5.405  -276.356 1.00 0.00 ?  76 ILE D CG2  1  
ATOM 4873   C CD1  . ILE D  1 76 ? 13.291  -6.371  -274.929 1.00 0.00 ?  76 ILE D CD1  1  
ATOM 4874   H H    . ILE D  1 76 ? 15.229  -2.843  -275.307 1.00 0.00 ?  76 ILE D H    1  
ATOM 4875   H HA   . ILE D  1 76 ? 15.011  -3.454  -278.171 1.00 0.00 ?  76 ILE D HA   1  
ATOM 4876   H HB   . ILE D  1 76 ? 13.970  -5.544  -277.423 1.00 0.00 ?  76 ILE D HB   1  
ATOM 4877   H HG12 . ILE D  1 76 ? 14.023  -4.382  -274.651 1.00 0.00 ?  76 ILE D HG12 1  
ATOM 4878   H HG13 . ILE D  1 76 ? 12.585  -4.502  -275.690 1.00 0.00 ?  76 ILE D HG13 1  
ATOM 4879   H HG21 . ILE D  1 76 ? 15.768  -6.424  -275.972 1.00 0.00 ?  76 ILE D HG21 1  
ATOM 4880   H HG22 . ILE D  1 76 ? 16.432  -5.394  -277.262 1.00 0.00 ?  76 ILE D HG22 1  
ATOM 4881   H HG23 . ILE D  1 76 ? 16.286  -4.761  -275.605 1.00 0.00 ?  76 ILE D HG23 1  
ATOM 4882   H HD11 . ILE D  1 76 ? 14.240  -6.836  -274.669 1.00 0.00 ?  76 ILE D HD11 1  
ATOM 4883   H HD12 . ILE D  1 76 ? 12.651  -6.337  -274.047 1.00 0.00 ?  76 ILE D HD12 1  
ATOM 4884   H HD13 . ILE D  1 76 ? 12.802  -6.956  -275.709 1.00 0.00 ?  76 ILE D HD13 1  
ATOM 4885   N N    . GLN D  1 77 ? 12.557  -2.071  -276.748 1.00 0.00 ?  77 GLN D N    1  
ATOM 4886   C CA   . GLN D  1 77 ? 11.326  -1.366  -277.086 1.00 0.00 ?  77 GLN D CA   1  
ATOM 4887   C C    . GLN D  1 77 ? 11.490  -0.551  -278.362 1.00 0.00 ?  77 GLN D C    1  
ATOM 4888   O O    . GLN D  1 77 ? 10.528  -0.329  -279.097 1.00 0.00 ?  77 GLN D O    1  
ATOM 4889   C CB   . GLN D  1 77 ? 10.901  -0.448  -275.937 1.00 0.00 ?  77 GLN D CB   1  
ATOM 4890   C CG   . GLN D  1 77 ? 9.549   0.215   -276.137 1.00 0.00 ?  77 GLN D CG   1  
ATOM 4891   C CD   . GLN D  1 77 ? 8.418   -0.791  -276.221 1.00 0.00 ?  77 GLN D CD   1  
ATOM 4892   O OE1  . GLN D  1 77 ? 8.343   -1.730  -275.424 1.00 0.00 ?  77 GLN D OE1  1  
ATOM 4893   N NE2  . GLN D  1 77 ? 7.531   -0.603  -277.192 1.00 0.00 ?  77 GLN D NE2  1  
ATOM 4894   H H    . GLN D  1 77 ? 13.028  -1.850  -275.883 1.00 0.00 ?  77 GLN D H    1  
ATOM 4895   H HA   . GLN D  1 77 ? 10.533  -2.089  -277.280 1.00 0.00 ?  77 GLN D HA   1  
ATOM 4896   H HB2  . GLN D  1 77 ? 10.882  -1.060  -275.035 1.00 0.00 ?  77 GLN D HB2  1  
ATOM 4897   H HB3  . GLN D  1 77 ? 11.674  0.314   -275.841 1.00 0.00 ?  77 GLN D HB3  1  
ATOM 4898   H HG2  . GLN D  1 77 ? 9.208   1.053   -275.530 1.00 0.00 ?  77 GLN D HG2  1  
ATOM 4899   H HG3  . GLN D  1 77 ? 9.774   0.567   -277.145 1.00 0.00 ?  77 GLN D HG3  1  
ATOM 4900   H HE21 . GLN D  1 77 ? 7.630   0.170   -277.818 1.00 0.00 ?  77 GLN D HE21 1  
ATOM 4901   H HE22 . GLN D  1 77 ? 6.762   -1.236  -277.297 1.00 0.00 ?  77 GLN D HE22 1  
ATOM 4902   N N    . ASN D  1 78 ? 12.716  -0.106  -278.620 1.00 0.00 ?  78 ASN D N    1  
ATOM 4903   C CA   . ASN D  1 78 ? 13.021  0.634   -279.838 1.00 0.00 ?  78 ASN D CA   1  
ATOM 4904   C C    . ASN D  1 78 ? 13.762  -0.240  -280.842 1.00 0.00 ?  78 ASN D C    1  
ATOM 4905   O O    . ASN D  1 78 ? 14.537  0.257   -281.659 1.00 0.00 ?  78 ASN D O    1  
ATOM 4906   C CB   . ASN D  1 78 ? 13.825  1.887   -279.540 1.00 0.00 ?  78 ASN D CB   1  
ATOM 4907   C CG   . ASN D  1 78 ? 13.073  2.910   -278.736 1.00 0.00 ?  78 ASN D CG   1  
ATOM 4908   O OD1  . ASN D  1 78 ? 11.848  3.036   -278.843 1.00 0.00 ?  78 ASN D OD1  1  
ATOM 4909   N ND2  . ASN D  1 78 ? 13.810  3.696   -277.992 1.00 0.00 ?  78 ASN D ND2  1  
ATOM 4910   H H    . ASN D  1 78 ? 13.454  -0.285  -277.955 1.00 0.00 ?  78 ASN D H    1  
ATOM 4911   H HA   . ASN D  1 78 ? 12.096  0.946   -280.324 1.00 0.00 ?  78 ASN D HA   1  
ATOM 4912   H HB2  . ASN D  1 78 ? 14.847  1.818   -279.167 1.00 0.00 ?  78 ASN D HB2  1  
ATOM 4913   H HB3  . ASN D  1 78 ? 13.839  2.202   -280.584 1.00 0.00 ?  78 ASN D HB3  1  
ATOM 4914   H HD21 . ASN D  1 78 ? 14.804  3.591   -277.986 1.00 0.00 ?  78 ASN D HD21 1  
ATOM 4915   H HD22 . ASN D  1 78 ? 13.377  4.400   -277.429 1.00 0.00 ?  78 ASN D HD22 1  
ATOM 4916   N N    . PHE D  1 79 ? 13.519  -1.545  -280.776 1.00 0.00 ?  79 PHE D N    1  
ATOM 4917   C CA   . PHE D  1 79 ? 14.225  -2.500  -281.622 1.00 0.00 ?  79 PHE D CA   1  
ATOM 4918   C C    . PHE D  1 79 ? 13.640  -2.528  -283.028 1.00 0.00 ?  79 PHE D C    1  
ATOM 4919   O O    . PHE D  1 79 ? 12.998  -3.501  -283.424 1.00 0.00 ?  79 PHE D O    1  
ATOM 4920   C CB   . PHE D  1 79 ? 14.178  -3.898  -281.004 1.00 0.00 ?  79 PHE D CB   1  
ATOM 4921   C CG   . PHE D  1 79 ? 15.216  -4.837  -281.549 1.00 0.00 ?  79 PHE D CG   1  
ATOM 4922   C CD1  . PHE D  1 79 ? 16.539  -4.742  -281.145 1.00 0.00 ?  79 PHE D CD1  1  
ATOM 4923   C CD2  . PHE D  1 79 ? 14.871  -5.817  -282.468 1.00 0.00 ?  79 PHE D CD2  1  
ATOM 4924   C CE1  . PHE D  1 79 ? 17.495  -5.606  -281.647 1.00 0.00 ?  79 PHE D CE1  1  
ATOM 4925   C CE2  . PHE D  1 79 ? 15.824  -6.683  -282.970 1.00 0.00 ?  79 PHE D CE2  1  
ATOM 4926   C CZ   . PHE D  1 79 ? 17.137  -6.576  -282.559 1.00 0.00 ?  79 PHE D CZ   1  
ATOM 4927   H H    . PHE D  1 79 ? 12.827  -1.884  -280.123 1.00 0.00 ?  79 PHE D H    1  
ATOM 4928   H HA   . PHE D  1 79 ? 15.269  -2.200  -281.726 1.00 0.00 ?  79 PHE D HA   1  
ATOM 4929   H HB2  . PHE D  1 79 ? 14.345  -3.839  -279.929 1.00 0.00 ?  79 PHE D HB2  1  
ATOM 4930   H HB3  . PHE D  1 79 ? 13.210  -4.359  -281.195 1.00 0.00 ?  79 PHE D HB3  1  
ATOM 4931   H HD1  . PHE D  1 79 ? 16.822  -3.976  -280.423 1.00 0.00 ?  79 PHE D HD1  1  
ATOM 4932   H HD2  . PHE D  1 79 ? 13.833  -5.901  -282.793 1.00 0.00 ?  79 PHE D HD2  1  
ATOM 4933   H HE1  . PHE D  1 79 ? 18.531  -5.519  -281.321 1.00 0.00 ?  79 PHE D HE1  1  
ATOM 4934   H HE2  . PHE D  1 79 ? 15.539  -7.449  -283.691 1.00 0.00 ?  79 PHE D HE2  1  
ATOM 4935   H HZ   . PHE D  1 79 ? 17.890  -7.256  -282.955 1.00 0.00 ?  79 PHE D HZ   1  
ATOM 4936   N N    . ARG D  1 80 ? 13.865  -1.455  -283.779 1.00 0.00 ?  80 ARG D N    1  
ATOM 4937   C CA   . ARG D  1 80 ? 13.294  -1.322  -285.114 1.00 0.00 ?  80 ARG D CA   1  
ATOM 4938   C C    . ARG D  1 80 ? 13.911  -2.326  -286.079 1.00 0.00 ?  80 ARG D C    1  
ATOM 4939   O O    . ARG D  1 80 ? 13.532  -3.465  -286.083 1.00 0.00 ?  80 ARG D O    1  
ATOM 4940   C CB   . ARG D  1 80 ? 13.403  0.100   -285.645 1.00 0.00 ?  80 ARG D CB   1  
ATOM 4941   C CG   . ARG D  1 80 ? 12.683  1.150   -284.813 1.00 0.00 ?  80 ARG D CG   1  
ATOM 4942   C CD   . ARG D  1 80 ? 11.217  0.941   -284.700 1.00 0.00 ?  80 ARG D CD   1  
ATOM 4943   N NE   . ARG D  1 80 ? 10.486  1.111   -285.945 1.00 0.00 ?  80 ARG D NE   1  
ATOM 4944   C CZ   . ARG D  1 80 ? 9.195   0.771   -286.127 1.00 0.00 ?  80 ARG D CZ   1  
ATOM 4945   N NH1  . ARG D  1 80 ? 8.500   0.209   -285.162 1.00 0.00 1  80 ARG D NH1  1  
ATOM 4946   N NH2  . ARG D  1 80 ? 8.651   0.995   -287.310 1.00 0.00 ?  80 ARG D NH2  1  
ATOM 4947   O OXT  . ARG D  1 80 ? 15.092  -2.308  -286.290 1.00 0.00 -1 80 ARG D OXT  1  
ATOM 4948   H H    . ARG D  1 80 ? 14.445  -0.713  -283.415 1.00 0.00 ?  80 ARG D H    1  
ATOM 4949   H HA   . ARG D  1 80 ? 12.226  -1.537  -285.082 1.00 0.00 ?  80 ARG D HA   1  
ATOM 4950   H HB2  . ARG D  1 80 ? 14.464  0.343   -285.690 1.00 0.00 ?  80 ARG D HB2  1  
ATOM 4951   H HB3  . ARG D  1 80 ? 12.989  0.095   -286.653 1.00 0.00 ?  80 ARG D HB3  1  
ATOM 4952   H HG2  . ARG D  1 80 ? 13.102  1.143   -283.807 1.00 0.00 ?  80 ARG D HG2  1  
ATOM 4953   H HG3  . ARG D  1 80 ? 12.850  2.127   -285.269 1.00 0.00 ?  80 ARG D HG3  1  
ATOM 4954   H HD2  . ARG D  1 80 ? 11.030  -0.073  -284.347 1.00 0.00 ?  80 ARG D HD2  1  
ATOM 4955   H HD3  . ARG D  1 80 ? 10.812  1.655   -283.983 1.00 0.00 ?  80 ARG D HD3  1  
ATOM 4956   H HE   . ARG D  1 80 ? 10.798  1.488   -286.830 1.00 0.00 ?  80 ARG D HE   1  
ATOM 4957   H HH11 . ARG D  1 80 ? 8.936   0.029   -284.269 1.00 0.00 ?  80 ARG D HH11 1  
ATOM 4958   H HH12 . ARG D  1 80 ? 7.534   -0.038  -285.318 1.00 0.00 ?  80 ARG D HH12 1  
ATOM 4959   H HH21 . ARG D  1 80 ? 9.204   1.411   -288.047 1.00 0.00 ?  80 ARG D HH21 1  
ATOM 4960   H HH22 . ARG D  1 80 ? 7.686   0.749   -287.473 1.00 0.00 ?  80 ARG D HH22 1  
ATOM 4961   N N    . MET E  1 1  ? 40.946  22.239  -261.830 1.00 0.00 ?  1  MET E N    1  
ATOM 4962   C CA   . MET E  1 1  ? 40.207  22.870  -262.917 1.00 0.00 ?  1  MET E CA   1  
ATOM 4963   C C    . MET E  1 1  ? 39.095  21.963  -263.427 1.00 0.00 ?  1  MET E C    1  
ATOM 4964   O O    . MET E  1 1  ? 38.063  22.437  -263.901 1.00 0.00 ?  1  MET E O    1  
ATOM 4965   C CB   . MET E  1 1  ? 41.156  23.235  -264.057 1.00 0.00 ?  1  MET E CB   1  
ATOM 4966   C CG   . MET E  1 1  ? 42.214  24.267  -263.691 1.00 0.00 ?  1  MET E CG   1  
ATOM 4967   S SD   . MET E  1 1  ? 41.500  25.813  -263.096 1.00 0.00 ?  1  MET E SD   1  
ATOM 4968   C CE   . MET E  1 1  ? 40.763  26.446  -264.600 1.00 0.00 ?  1  MET E CE   1  
ATOM 4969   H H1   . MET E  1 1  ? 41.927  22.071  -261.924 1.00 0.00 ?  1  MET E H1   1  
ATOM 4970   H H2   . MET E  1 1  ? 40.980  22.674  -260.930 1.00 0.00 ?  1  MET E H2   1  
ATOM 4971   H H3   . MET E  1 1  ? 40.691  21.324  -261.517 1.00 0.00 ?  1  MET E H3   1  
ATOM 4972   H HA   . MET E  1 1  ? 39.726  23.781  -262.560 1.00 0.00 ?  1  MET E HA   1  
ATOM 4973   H HB2  . MET E  1 1  ? 41.641  22.313  -264.373 1.00 0.00 ?  1  MET E HB2  1  
ATOM 4974   H HB3  . MET E  1 1  ? 40.541  23.620  -264.872 1.00 0.00 ?  1  MET E HB3  1  
ATOM 4975   H HG2  . MET E  1 1  ? 42.847  23.842  -262.913 1.00 0.00 ?  1  MET E HG2  1  
ATOM 4976   H HG3  . MET E  1 1  ? 42.813  24.468  -264.579 1.00 0.00 ?  1  MET E HG3  1  
ATOM 4977   H HE1  . MET E  1 1  ? 40.021  25.737  -264.967 1.00 0.00 ?  1  MET E HE1  1  
ATOM 4978   H HE2  . MET E  1 1  ? 40.280  27.402  -264.395 1.00 0.00 ?  1  MET E HE2  1  
ATOM 4979   H HE3  . MET E  1 1  ? 41.538  26.585  -265.355 1.00 0.00 ?  1  MET E HE3  1  
ATOM 4980   N N    . ALA E  1 2  ? 39.312  20.656  -263.326 1.00 0.00 ?  2  ALA E N    1  
ATOM 4981   C CA   . ALA E  1 2  ? 38.334  19.679  -263.790 1.00 0.00 ?  2  ALA E CA   1  
ATOM 4982   C C    . ALA E  1 2  ? 37.155  19.581  -262.829 1.00 0.00 ?  2  ALA E C    1  
ATOM 4983   O O    . ALA E  1 2  ? 37.319  19.706  -261.616 1.00 0.00 ?  2  ALA E O    1  
ATOM 4984   C CB   . ALA E  1 2  ? 38.989  18.318  -263.971 1.00 0.00 ?  2  ALA E CB   1  
ATOM 4985   H H    . ALA E  1 2  ? 40.176  20.331  -262.918 1.00 0.00 ?  2  ALA E H    1  
ATOM 4986   H HA   . ALA E  1 2  ? 37.941  20.007  -264.753 1.00 0.00 ?  2  ALA E HA   1  
ATOM 4987   H HB1  . ALA E  1 2  ? 39.400  17.983  -263.020 1.00 0.00 ?  2  ALA E HB1  1  
ATOM 4988   H HB2  . ALA E  1 2  ? 38.245  17.601  -264.317 1.00 0.00 ?  2  ALA E HB2  1  
ATOM 4989   H HB3  . ALA E  1 2  ? 39.790  18.394  -264.707 1.00 0.00 ?  2  ALA E HB3  1  
ATOM 4990   N N    . THR E  1 3  ? 35.967  19.357  -263.380 1.00 0.00 ?  3  THR E N    1  
ATOM 4991   C CA   . THR E  1 3  ? 34.760  19.228  -262.572 1.00 0.00 ?  3  THR E CA   1  
ATOM 4992   C C    . THR E  1 3  ? 33.979  17.975  -262.944 1.00 0.00 ?  3  THR E C    1  
ATOM 4993   O O    . THR E  1 3  ? 33.604  17.786  -264.101 1.00 0.00 ?  3  THR E O    1  
ATOM 4994   C CB   . THR E  1 3  ? 33.844  20.456  -262.725 1.00 0.00 ?  3  THR E CB   1  
ATOM 4995   O OG1  . THR E  1 3  ? 34.554  21.638  -262.332 1.00 0.00 ?  3  THR E OG1  1  
ATOM 4996   C CG2  . THR E  1 3  ? 32.601  20.305  -261.861 1.00 0.00 ?  3  THR E CG2  1  
ATOM 4997   H H    . THR E  1 3  ? 35.898  19.273  -264.384 1.00 0.00 ?  3  THR E H    1  
ATOM 4998   H HA   . THR E  1 3  ? 35.030  19.122  -261.521 1.00 0.00 ?  3  THR E HA   1  
ATOM 4999   H HB   . THR E  1 3  ? 33.550  20.551  -263.770 1.00 0.00 ?  3  THR E HB   1  
ATOM 5000   H HG1  . THR E  1 3  ? 33.981  22.402  -262.428 1.00 0.00 ?  3  THR E HG1  1  
ATOM 5001   H HG21 . THR E  1 3  ? 31.966  21.182  -261.983 1.00 0.00 ?  3  THR E HG21 1  
ATOM 5002   H HG22 . THR E  1 3  ? 32.053  19.414  -262.165 1.00 0.00 ?  3  THR E HG22 1  
ATOM 5003   H HG23 . THR E  1 3  ? 32.895  20.212  -260.816 1.00 0.00 ?  3  THR E HG23 1  
ATOM 5004   N N    . PRO E  1 4  ? 33.736  17.120  -261.956 1.00 0.00 ?  4  PRO E N    1  
ATOM 5005   C CA   . PRO E  1 4  ? 32.964  15.902  -262.170 1.00 0.00 ?  4  PRO E CA   1  
ATOM 5006   C C    . PRO E  1 4  ? 31.603  16.212  -262.779 1.00 0.00 ?  4  PRO E C    1  
ATOM 5007   O O    . PRO E  1 4  ? 30.978  17.220  -262.447 1.00 0.00 ?  4  PRO E O    1  
ATOM 5008   C CB   . PRO E  1 4  ? 32.843  15.285  -260.773 1.00 0.00 ?  4  PRO E CB   1  
ATOM 5009   C CG   . PRO E  1 4  ? 34.022  15.815  -260.030 1.00 0.00 ?  4  PRO E CG   1  
ATOM 5010   C CD   . PRO E  1 4  ? 34.221  17.216  -260.545 1.00 0.00 ?  4  PRO E CD   1  
ATOM 5011   H HA   . PRO E  1 4  ? 33.443  15.214  -262.882 1.00 0.00 ?  4  PRO E HA   1  
ATOM 5012   H HB2  . PRO E  1 4  ? 31.901  15.575  -260.285 1.00 0.00 ?  4  PRO E HB2  1  
ATOM 5013   H HB3  . PRO E  1 4  ? 32.860  14.186  -260.815 1.00 0.00 ?  4  PRO E HB3  1  
ATOM 5014   H HG2  . PRO E  1 4  ? 33.841  15.814  -258.945 1.00 0.00 ?  4  PRO E HG2  1  
ATOM 5015   H HG3  . PRO E  1 4  ? 34.914  15.197  -260.208 1.00 0.00 ?  4  PRO E HG3  1  
ATOM 5016   H HD2  . PRO E  1 4  ? 33.642  17.955  -259.972 1.00 0.00 ?  4  PRO E HD2  1  
ATOM 5017   H HD3  . PRO E  1 4  ? 35.274  17.529  -260.501 1.00 0.00 ?  4  PRO E HD3  1  
ATOM 5018   N N    . TRP E  1 5  ? 31.147  15.340  -263.673 1.00 0.00 ?  5  TRP E N    1  
ATOM 5019   C CA   . TRP E  1 5  ? 29.863  15.525  -264.338 1.00 0.00 ?  5  TRP E CA   1  
ATOM 5020   C C    . TRP E  1 5  ? 28.711  15.446  -263.344 1.00 0.00 ?  5  TRP E C    1  
ATOM 5021   O O    . TRP E  1 5  ? 28.723  14.620  -262.431 1.00 0.00 ?  5  TRP E O    1  
ATOM 5022   C CB   . TRP E  1 5  ? 29.678  14.480  -265.440 1.00 0.00 ?  5  TRP E CB   1  
ATOM 5023   C CG   . TRP E  1 5  ? 28.343  14.555  -266.117 1.00 0.00 ?  5  TRP E CG   1  
ATOM 5024   C CD1  . TRP E  1 5  ? 28.028  15.293  -267.218 1.00 0.00 ?  5  TRP E CD1  1  
ATOM 5025   C CD2  . TRP E  1 5  ? 27.145  13.866  -265.739 1.00 0.00 ?  5  TRP E CD2  1  
ATOM 5026   N NE1  . TRP E  1 5  ? 26.708  15.109  -267.550 1.00 0.00 ?  5  TRP E NE1  1  
ATOM 5027   C CE2  . TRP E  1 5  ? 26.145  14.234  -266.656 1.00 0.00 ?  5  TRP E CE2  1  
ATOM 5028   C CE3  . TRP E  1 5  ? 26.823  12.971  -264.711 1.00 0.00 ?  5  TRP E CE3  1  
ATOM 5029   C CZ2  . TRP E  1 5  ? 24.850  13.746  -266.579 1.00 0.00 ?  5  TRP E CZ2  1  
ATOM 5030   C CZ3  . TRP E  1 5  ? 25.525  12.480  -264.635 1.00 0.00 ?  5  TRP E CZ3  1  
ATOM 5031   C CH2  . TRP E  1 5  ? 24.567  12.856  -265.542 1.00 0.00 ?  5  TRP E CH2  1  
ATOM 5032   H H    . TRP E  1 5  ? 31.705  14.529  -263.897 1.00 0.00 ?  5  TRP E H    1  
ATOM 5033   H HA   . TRP E  1 5  ? 29.819  16.517  -264.787 1.00 0.00 ?  5  TRP E HA   1  
ATOM 5034   H HB2  . TRP E  1 5  ? 30.430  14.614  -266.217 1.00 0.00 ?  5  TRP E HB2  1  
ATOM 5035   H HB3  . TRP E  1 5  ? 29.761  13.477  -265.024 1.00 0.00 ?  5  TRP E HB3  1  
ATOM 5036   H HD1  . TRP E  1 5  ? 28.826  15.892  -267.655 1.00 0.00 ?  5  TRP E HD1  1  
ATOM 5037   H HE1  . TRP E  1 5  ? 26.230  15.546  -268.324 1.00 0.00 ?  5  TRP E HE1  1  
ATOM 5038   H HE3  . TRP E  1 5  ? 27.545  12.637  -263.966 1.00 0.00 ?  5  TRP E HE3  1  
ATOM 5039   H HZ2  . TRP E  1 5  ? 24.120  14.071  -267.320 1.00 0.00 ?  5  TRP E HZ2  1  
ATOM 5040   H HZ3  . TRP E  1 5  ? 25.287  11.784  -263.830 1.00 0.00 ?  5  TRP E HZ3  1  
ATOM 5041   H HH2  . TRP E  1 5  ? 23.561  12.447  -265.447 1.00 0.00 ?  5  TRP E HH2  1  
ATOM 5042   N N    . SER E  1 6  ? 27.717  16.308  -263.527 1.00 0.00 ?  6  SER E N    1  
ATOM 5043   C CA   . SER E  1 6  ? 26.510  16.270  -262.711 1.00 0.00 ?  6  SER E CA   1  
ATOM 5044   C C    . SER E  1 6  ? 25.270  16.560  -263.548 1.00 0.00 ?  6  SER E C    1  
ATOM 5045   O O    . SER E  1 6  ? 25.195  17.582  -264.231 1.00 0.00 ?  6  SER E O    1  
ATOM 5046   C CB   . SER E  1 6  ? 26.620  17.262  -261.570 1.00 0.00 ?  6  SER E CB   1  
ATOM 5047   O OG   . SER E  1 6  ? 25.449  17.312  -260.802 1.00 0.00 ?  6  SER E OG   1  
ATOM 5048   H H    . SER E  1 6  ? 27.801  17.008  -264.250 1.00 0.00 ?  6  SER E H    1  
ATOM 5049   H HA   . SER E  1 6  ? 26.381  15.331  -262.171 1.00 0.00 ?  6  SER E HA   1  
ATOM 5050   H HB2  . SER E  1 6  ? 27.451  16.965  -260.930 1.00 0.00 ?  6  SER E HB2  1  
ATOM 5051   H HB3  . SER E  1 6  ? 26.816  18.250  -261.983 1.00 0.00 ?  6  SER E HB3  1  
ATOM 5052   H HG   . SER E  1 6  ? 24.996  18.144  -260.963 1.00 0.00 ?  6  SER E HG   1  
ATOM 5053   N N    . GLY E  1 7  ? 24.300  15.654  -263.492 1.00 0.00 ?  7  GLY E N    1  
ATOM 5054   C CA   . GLY E  1 7  ? 23.057  15.816  -264.238 1.00 0.00 ?  7  GLY E CA   1  
ATOM 5055   C C    . GLY E  1 7  ? 22.094  16.743  -263.509 1.00 0.00 ?  7  GLY E C    1  
ATOM 5056   O O    . GLY E  1 7  ? 22.418  17.286  -262.453 1.00 0.00 ?  7  GLY E O    1  
ATOM 5057   H H    . GLY E  1 7  ? 24.425  14.833  -262.917 1.00 0.00 ?  7  GLY E H    1  
ATOM 5058   H HA2  . GLY E  1 7  ? 23.282  16.236  -265.218 1.00 0.00 ?  7  GLY E HA2  1  
ATOM 5059   H HA3  . GLY E  1 7  ? 22.587  14.841  -264.361 1.00 0.00 ?  7  GLY E HA3  1  
ATOM 5060   N N    . TYR E  1 8  ? 20.907  16.922  -264.080 1.00 0.00 ?  8  TYR E N    1  
ATOM 5061   C CA   . TYR E  1 8  ? 19.888  17.773  -263.478 1.00 0.00 ?  8  TYR E CA   1  
ATOM 5062   C C    . TYR E  1 8  ? 19.419  17.210  -262.142 1.00 0.00 ?  8  TYR E C    1  
ATOM 5063   O O    . TYR E  1 8  ? 19.351  17.929  -261.144 1.00 0.00 ?  8  TYR E O    1  
ATOM 5064   C CB   . TYR E  1 8  ? 18.697  17.935  -264.426 1.00 0.00 ?  8  TYR E CB   1  
ATOM 5065   C CG   . TYR E  1 8  ? 17.575  18.779  -263.862 1.00 0.00 ?  8  TYR E CG   1  
ATOM 5066   C CD1  . TYR E  1 8  ? 17.565  20.155  -264.030 1.00 0.00 ?  8  TYR E CD1  1  
ATOM 5067   C CD2  . TYR E  1 8  ? 16.528  18.195  -263.165 1.00 0.00 ?  8  TYR E CD2  1  
ATOM 5068   C CE1  . TYR E  1 8  ? 16.543  20.931  -263.517 1.00 0.00 ?  8  TYR E CE1  1  
ATOM 5069   C CE2  . TYR E  1 8  ? 15.500  18.959  -262.648 1.00 0.00 ?  8  TYR E CE2  1  
ATOM 5070   C CZ   . TYR E  1 8  ? 15.511  20.328  -262.826 1.00 0.00 ?  8  TYR E CZ   1  
ATOM 5071   O OH   . TYR E  1 8  ? 14.490  21.094  -262.315 1.00 0.00 ?  8  TYR E OH   1  
ATOM 5072   H H    . TYR E  1 8  ? 20.705  16.455  -264.953 1.00 0.00 ?  8  TYR E H    1  
ATOM 5073   H HA   . TYR E  1 8  ? 20.304  18.759  -263.270 1.00 0.00 ?  8  TYR E HA   1  
ATOM 5074   H HB2  . TYR E  1 8  ? 19.074  18.395  -265.340 1.00 0.00 ?  8  TYR E HB2  1  
ATOM 5075   H HB3  . TYR E  1 8  ? 18.324  16.936  -264.648 1.00 0.00 ?  8  TYR E HB3  1  
ATOM 5076   H HD1  . TYR E  1 8  ? 18.383  20.625  -264.577 1.00 0.00 ?  8  TYR E HD1  1  
ATOM 5077   H HD2  . TYR E  1 8  ? 16.526  17.113  -263.027 1.00 0.00 ?  8  TYR E HD2  1  
ATOM 5078   H HE1  . TYR E  1 8  ? 16.548  22.011  -263.657 1.00 0.00 ?  8  TYR E HE1  1  
ATOM 5079   H HE2  . TYR E  1 8  ? 14.687  18.482  -262.102 1.00 0.00 ?  8  TYR E HE2  1  
ATOM 5080   H HH   . TYR E  1 8  ? 14.596  22.031  -262.496 1.00 0.00 ?  8  TYR E HH   1  
ATOM 5081   N N    . LEU E  1 9  ? 19.096  15.922  -262.129 1.00 0.00 ?  9  LEU E N    1  
ATOM 5082   C CA   . LEU E  1 9  ? 18.626  15.262  -260.917 1.00 0.00 ?  9  LEU E CA   1  
ATOM 5083   C C    . LEU E  1 9  ? 19.713  15.228  -259.851 1.00 0.00 ?  9  LEU E C    1  
ATOM 5084   O O    . LEU E  1 9  ? 19.429  15.325  -258.657 1.00 0.00 ?  9  LEU E O    1  
ATOM 5085   C CB   . LEU E  1 9  ? 18.150  13.839  -261.238 1.00 0.00 ?  9  LEU E CB   1  
ATOM 5086   C CG   . LEU E  1 9  ? 16.879  13.754  -262.093 1.00 0.00 ?  9  LEU E CG   1  
ATOM 5087   C CD1  . LEU E  1 9  ? 16.590  12.304  -262.456 1.00 0.00 ?  9  LEU E CD1  1  
ATOM 5088   C CD2  . LEU E  1 9  ? 15.711  14.361  -261.330 1.00 0.00 ?  9  LEU E CD2  1  
ATOM 5089   H H    . LEU E  1 9  ? 19.179  15.385  -262.981 1.00 0.00 ?  9  LEU E H    1  
ATOM 5090   H HA   . LEU E  1 9  ? 17.795  15.825  -260.493 1.00 0.00 ?  9  LEU E HA   1  
ATOM 5091   H HB2  . LEU E  1 9  ? 19.008  13.490  -261.810 1.00 0.00 ?  9  LEU E HB2  1  
ATOM 5092   H HB3  . LEU E  1 9  ? 18.044  13.236  -260.337 1.00 0.00 ?  9  LEU E HB3  1  
ATOM 5093   H HG   . LEU E  1 9  ? 17.046  14.360  -262.984 1.00 0.00 ?  9  LEU E HG   1  
ATOM 5094   H HD11 . LEU E  1 9  ? 15.686  12.253  -263.063 1.00 0.00 ?  9  LEU E HD11 1  
ATOM 5095   H HD12 . LEU E  1 9  ? 17.429  11.897  -263.021 1.00 0.00 ?  9  LEU E HD12 1  
ATOM 5096   H HD13 . LEU E  1 9  ? 16.449  11.722  -261.546 1.00 0.00 ?  9  LEU E HD13 1  
ATOM 5097   H HD21 . LEU E  1 9  ? 15.926  15.406  -261.105 1.00 0.00 ?  9  LEU E HD21 1  
ATOM 5098   H HD22 . LEU E  1 9  ? 14.808  14.301  -261.939 1.00 0.00 ?  9  LEU E HD22 1  
ATOM 5099   H HD23 . LEU E  1 9  ? 15.559  13.814  -260.399 1.00 0.00 ?  9  LEU E HD23 1  
ATOM 5100   N N    . ASP E  1 10 ? 20.960  15.090  -260.288 1.00 0.00 ?  10 ASP E N    1  
ATOM 5101   C CA   . ASP E  1 10 ? 22.107  15.305  -259.414 1.00 0.00 ?  10 ASP E CA   1  
ATOM 5102   C C    . ASP E  1 10 ? 22.075  16.696  -258.794 1.00 0.00 ?  10 ASP E C    1  
ATOM 5103   O O    . ASP E  1 10 ? 22.298  16.856  -257.594 1.00 0.00 ?  10 ASP E O    1  
ATOM 5104   C CB   . ASP E  1 10 ? 23.414  15.104  -260.185 1.00 0.00 ?  10 ASP E CB   1  
ATOM 5105   C CG   . ASP E  1 10 ? 23.701  13.658  -260.570 1.00 0.00 ?  10 ASP E CG   1  
ATOM 5106   O OD1  . ASP E  1 10 ? 23.081  12.782  -260.016 1.00 0.00 ?  10 ASP E OD1  1  
ATOM 5107   O OD2  . ASP E  1 10 ? 24.419  13.449  -261.519 1.00 0.00 -1 10 ASP E OD2  1  
ATOM 5108   H H    . ASP E  1 10 ? 21.117  14.830  -261.252 1.00 0.00 ?  10 ASP E H    1  
ATOM 5109   H HA   . ASP E  1 10 ? 22.078  14.596  -258.587 1.00 0.00 ?  10 ASP E HA   1  
ATOM 5110   H HB2  . ASP E  1 10 ? 23.500  15.738  -261.068 1.00 0.00 ?  10 ASP E HB2  1  
ATOM 5111   H HB3  . ASP E  1 10 ? 24.133  15.428  -259.432 1.00 0.00 ?  10 ASP E HB3  1  
ATOM 5112   N N    . ASP E  1 11 ? 21.796  17.699  -259.619 1.00 0.00 ?  11 ASP E N    1  
ATOM 5113   C CA   . ASP E  1 11 ? 21.717  19.078  -259.150 1.00 0.00 ?  11 ASP E CA   1  
ATOM 5114   C C    . ASP E  1 11 ? 20.561  19.262  -258.174 1.00 0.00 ?  11 ASP E C    1  
ATOM 5115   O O    . ASP E  1 11 ? 20.668  20.012  -257.204 1.00 0.00 ?  11 ASP E O    1  
ATOM 5116   C CB   . ASP E  1 11 ? 21.566  20.039  -260.331 1.00 0.00 ?  11 ASP E CB   1  
ATOM 5117   C CG   . ASP E  1 11 ? 22.813  20.176  -261.194 1.00 0.00 ?  11 ASP E CG   1  
ATOM 5118   O OD1  . ASP E  1 11 ? 23.852  19.720  -260.778 1.00 0.00 ?  11 ASP E OD1  1  
ATOM 5119   O OD2  . ASP E  1 11 ? 22.688  20.591  -262.321 1.00 0.00 -1 11 ASP E OD2  1  
ATOM 5120   H H    . ASP E  1 11 ? 21.634  17.503  -260.597 1.00 0.00 ?  11 ASP E H    1  
ATOM 5121   H HA   . ASP E  1 11 ? 22.626  19.335  -258.605 1.00 0.00 ?  11 ASP E HA   1  
ATOM 5122   H HB2  . ASP E  1 11 ? 20.708  19.815  -260.966 1.00 0.00 ?  11 ASP E HB2  1  
ATOM 5123   H HB3  . ASP E  1 11 ? 21.390  20.973  -259.797 1.00 0.00 ?  11 ASP E HB3  1  
ATOM 5124   N N    . VAL E  1 12 ? 19.456  18.573  -258.438 1.00 0.00 ?  12 VAL E N    1  
ATOM 5125   C CA   . VAL E  1 12 ? 18.301  18.608  -257.548 1.00 0.00 ?  12 VAL E CA   1  
ATOM 5126   C C    . VAL E  1 12 ? 18.653  18.072  -256.167 1.00 0.00 ?  12 VAL E C    1  
ATOM 5127   O O    . VAL E  1 12 ? 18.287  18.661  -255.150 1.00 0.00 ?  12 VAL E O    1  
ATOM 5128   C CB   . VAL E  1 12 ? 17.123  17.796  -258.119 1.00 0.00 ?  12 VAL E CB   1  
ATOM 5129   C CG1  . VAL E  1 12 ? 16.030  17.637  -257.073 1.00 0.00 ?  12 VAL E CG1  1  
ATOM 5130   C CG2  . VAL E  1 12 ? 16.570  18.464  -259.368 1.00 0.00 ?  12 VAL E CG2  1  
ATOM 5131   H H    . VAL E  1 12 ? 19.414  18.010  -259.276 1.00 0.00 ?  12 VAL E H    1  
ATOM 5132   H HA   . VAL E  1 12 ? 17.966  19.631  -257.374 1.00 0.00 ?  12 VAL E HA   1  
ATOM 5133   H HB   . VAL E  1 12 ? 17.484  16.812  -258.419 1.00 0.00 ?  12 VAL E HB   1  
ATOM 5134   H HG11 . VAL E  1 12 ? 15.205  17.060  -257.493 1.00 0.00 ?  12 VAL E HG11 1  
ATOM 5135   H HG12 . VAL E  1 12 ? 16.431  17.116  -256.204 1.00 0.00 ?  12 VAL E HG12 1  
ATOM 5136   H HG13 . VAL E  1 12 ? 15.668  18.620  -256.773 1.00 0.00 ?  12 VAL E HG13 1  
ATOM 5137   H HG21 . VAL E  1 12 ? 17.354  18.529  -260.123 1.00 0.00 ?  12 VAL E HG21 1  
ATOM 5138   H HG22 . VAL E  1 12 ? 15.740  17.877  -259.758 1.00 0.00 ?  12 VAL E HG22 1  
ATOM 5139   H HG23 . VAL E  1 12 ? 16.221  19.466  -259.119 1.00 0.00 ?  12 VAL E HG23 1  
ATOM 5140   N N    . SER E  1 13 ? 19.365  16.951  -256.137 1.00 0.00 ?  13 SER E N    1  
ATOM 5141   C CA   . SER E  1 13 ? 19.848  16.383  -254.884 1.00 0.00 ?  13 SER E CA   1  
ATOM 5142   C C    . SER E  1 13 ? 20.754  17.361  -254.148 1.00 0.00 ?  13 SER E C    1  
ATOM 5143   O O    . SER E  1 13 ? 20.647  17.528  -252.933 1.00 0.00 ?  13 SER E O    1  
ATOM 5144   C CB   . SER E  1 13 ? 20.580  15.081  -255.148 1.00 0.00 ?  13 SER E CB   1  
ATOM 5145   O OG   . SER E  1 13 ? 21.116  14.532  -253.976 1.00 0.00 ?  13 SER E OG   1  
ATOM 5146   H H    . SER E  1 13 ? 19.578  16.480  -257.005 1.00 0.00 ?  13 SER E H    1  
ATOM 5147   H HA   . SER E  1 13 ? 19.047  16.050  -254.222 1.00 0.00 ?  13 SER E HA   1  
ATOM 5148   H HB2  . SER E  1 13 ? 19.879  14.370  -255.585 1.00 0.00 ?  13 SER E HB2  1  
ATOM 5149   H HB3  . SER E  1 13 ? 21.388  15.272  -255.852 1.00 0.00 ?  13 SER E HB3  1  
ATOM 5150   H HG   . SER E  1 13 ? 21.841  13.944  -254.201 1.00 0.00 ?  13 SER E HG   1  
ATOM 5151   N N    . ALA E  1 14 ? 21.647  18.007  -254.891 1.00 0.00 ?  14 ALA E N    1  
ATOM 5152   C CA   . ALA E  1 14 ? 22.553  18.993  -254.316 1.00 0.00 ?  14 ALA E CA   1  
ATOM 5153   C C    . ALA E  1 14 ? 21.790  20.202  -253.789 1.00 0.00 ?  14 ALA E C    1  
ATOM 5154   O O    . ALA E  1 14 ? 22.121  20.746  -252.736 1.00 0.00 ?  14 ALA E O    1  
ATOM 5155   C CB   . ALA E  1 14 ? 23.589  19.423  -255.344 1.00 0.00 ?  14 ALA E CB   1  
ATOM 5156   H H    . ALA E  1 14 ? 21.698  17.809  -255.880 1.00 0.00 ?  14 ALA E H    1  
ATOM 5157   H HA   . ALA E  1 14 ? 23.070  18.541  -253.470 1.00 0.00 ?  14 ALA E HA   1  
ATOM 5158   H HB1  . ALA E  1 14 ? 23.087  19.864  -256.204 1.00 0.00 ?  14 ALA E HB1  1  
ATOM 5159   H HB2  . ALA E  1 14 ? 24.258  20.160  -254.899 1.00 0.00 ?  14 ALA E HB2  1  
ATOM 5160   H HB3  . ALA E  1 14 ? 24.167  18.556  -255.665 1.00 0.00 ?  14 ALA E HB3  1  
ATOM 5161   N N    . LYS E  1 15 ? 20.767  20.617  -254.528 1.00 0.00 ?  15 LYS E N    1  
ATOM 5162   C CA   . LYS E  1 15 ? 19.974  21.782  -254.154 1.00 0.00 ?  15 LYS E CA   1  
ATOM 5163   C C    . LYS E  1 15 ? 19.272  21.565  -252.819 1.00 0.00 ?  15 LYS E C    1  
ATOM 5164   O O    . LYS E  1 15 ? 19.222  22.464  -251.980 1.00 0.00 ?  15 LYS E O    1  
ATOM 5165   C CB   . LYS E  1 15 ? 18.949  22.105  -255.241 1.00 0.00 ?  15 LYS E CB   1  
ATOM 5166   C CG   . LYS E  1 15 ? 19.527  22.804  -256.464 1.00 0.00 ?  15 LYS E CG   1  
ATOM 5167   C CD   . LYS E  1 15 ? 18.489  22.936  -257.569 1.00 0.00 ?  15 LYS E CD   1  
ATOM 5168   C CE   . LYS E  1 15 ? 19.097  23.527  -258.832 1.00 0.00 ?  15 LYS E CE   1  
ATOM 5169   N NZ   . LYS E  1 15 ? 19.491  24.950  -258.648 1.00 0.00 1  15 LYS E NZ   1  
ATOM 5170   H H    . LYS E  1 15 ? 20.532  20.112  -255.371 1.00 0.00 ?  15 LYS E H    1  
ATOM 5171   H HA   . LYS E  1 15 ? 20.627  22.646  -254.024 1.00 0.00 ?  15 LYS E HA   1  
ATOM 5172   H HB2  . LYS E  1 15 ? 18.496  21.160  -255.544 1.00 0.00 ?  15 LYS E HB2  1  
ATOM 5173   H HB3  . LYS E  1 15 ? 18.189  22.741  -254.787 1.00 0.00 ?  15 LYS E HB3  1  
ATOM 5174   H HG2  . LYS E  1 15 ? 19.871  23.795  -256.167 1.00 0.00 ?  15 LYS E HG2  1  
ATOM 5175   H HG3  . LYS E  1 15 ? 20.373  22.221  -256.829 1.00 0.00 ?  15 LYS E HG3  1  
ATOM 5176   H HD2  . LYS E  1 15 ? 18.086  21.947  -257.787 1.00 0.00 ?  15 LYS E HD2  1  
ATOM 5177   H HD3  . LYS E  1 15 ? 17.687  23.584  -257.215 1.00 0.00 ?  15 LYS E HD3  1  
ATOM 5178   H HE2  . LYS E  1 15 ? 19.974  22.939  -259.097 1.00 0.00 ?  15 LYS E HE2  1  
ATOM 5179   H HE3  . LYS E  1 15 ? 18.358  23.457  -259.631 1.00 0.00 ?  15 LYS E HE3  1  
ATOM 5180   H HZ1  . LYS E  1 15 ? 20.176  25.016  -257.908 1.00 0.00 ?  15 LYS E HZ1  1  
ATOM 5181   H HZ2  . LYS E  1 15 ? 19.888  25.304  -259.507 1.00 0.00 ?  15 LYS E HZ2  1  
ATOM 5182   H HZ3  . LYS E  1 15 ? 18.677  25.497  -258.403 1.00 0.00 ?  15 LYS E HZ3  1  
ATOM 5183   N N    . PHE E  1 16 ? 18.731  20.367  -252.629 1.00 0.00 ?  16 PHE E N    1  
ATOM 5184   C CA   . PHE E  1 16 ? 18.123  19.994  -251.358 1.00 0.00 ?  16 PHE E CA   1  
ATOM 5185   C C    . PHE E  1 16 ? 19.162  19.941  -250.245 1.00 0.00 ?  16 PHE E C    1  
ATOM 5186   O O    . PHE E  1 16 ? 18.971  20.522  -249.177 1.00 0.00 ?  16 PHE E O    1  
ATOM 5187   C CB   . PHE E  1 16 ? 17.415  18.643  -251.480 1.00 0.00 ?  16 PHE E CB   1  
ATOM 5188   C CG   . PHE E  1 16 ? 16.755  18.188  -250.210 1.00 0.00 ?  16 PHE E CG   1  
ATOM 5189   C CD1  . PHE E  1 16 ? 15.461  18.583  -249.904 1.00 0.00 ?  16 PHE E CD1  1  
ATOM 5190   C CD2  . PHE E  1 16 ? 17.426  17.366  -249.318 1.00 0.00 ?  16 PHE E CD2  1  
ATOM 5191   C CE1  . PHE E  1 16 ? 14.852  18.165  -248.735 1.00 0.00 ?  16 PHE E CE1  1  
ATOM 5192   C CE2  . PHE E  1 16 ? 16.820  16.945  -248.150 1.00 0.00 ?  16 PHE E CE2  1  
ATOM 5193   C CZ   . PHE E  1 16 ? 15.532  17.346  -247.858 1.00 0.00 ?  16 PHE E CZ   1  
ATOM 5194   H H    . PHE E  1 16 ? 18.740  19.697  -253.386 1.00 0.00 ?  16 PHE E H    1  
ATOM 5195   H HA   . PHE E  1 16 ? 17.390  20.746  -251.063 1.00 0.00 ?  16 PHE E HA   1  
ATOM 5196   H HB2  . PHE E  1 16 ? 16.632  18.697  -252.236 1.00 0.00 ?  16 PHE E HB2  1  
ATOM 5197   H HB3  . PHE E  1 16 ? 18.130  17.869  -251.754 1.00 0.00 ?  16 PHE E HB3  1  
ATOM 5198   H HD1  . PHE E  1 16 ? 14.923  19.229  -250.597 1.00 0.00 ?  16 PHE E HD1  1  
ATOM 5199   H HD2  . PHE E  1 16 ? 18.444  17.049  -249.548 1.00 0.00 ?  16 PHE E HD2  1  
ATOM 5200   H HE1  . PHE E  1 16 ? 13.835  18.482  -248.507 1.00 0.00 ?  16 PHE E HE1  1  
ATOM 5201   H HE2  . PHE E  1 16 ? 17.359  16.298  -247.458 1.00 0.00 ?  16 PHE E HE2  1  
ATOM 5202   H HZ   . PHE E  1 16 ? 15.054  17.017  -246.937 1.00 0.00 ?  16 PHE E HZ   1  
ATOM 5203   N N    . ASP E  1 17 ? 20.262  19.242  -250.502 1.00 0.00 ?  17 ASP E N    1  
ATOM 5204   C CA   . ASP E  1 17 ? 21.295  19.040  -249.493 1.00 0.00 ?  17 ASP E CA   1  
ATOM 5205   C C    . ASP E  1 17 ? 21.928  20.362  -249.079 1.00 0.00 ?  17 ASP E C    1  
ATOM 5206   O O    . ASP E  1 17 ? 22.377  20.518  -247.944 1.00 0.00 ?  17 ASP E O    1  
ATOM 5207   C CB   . ASP E  1 17 ? 22.370  18.081  -250.011 1.00 0.00 ?  17 ASP E CB   1  
ATOM 5208   C CG   . ASP E  1 17 ? 21.946  16.619  -250.045 1.00 0.00 ?  17 ASP E CG   1  
ATOM 5209   O OD1  . ASP E  1 17 ? 20.943  16.298  -249.454 1.00 0.00 ?  17 ASP E OD1  1  
ATOM 5210   O OD2  . ASP E  1 17 ? 22.535  15.868  -250.785 1.00 0.00 -1 17 ASP E OD2  1  
ATOM 5211   H H    . ASP E  1 17 ? 20.386  18.840  -251.421 1.00 0.00 ?  17 ASP E H    1  
ATOM 5212   H HA   . ASP E  1 17 ? 20.852  18.613  -248.593 1.00 0.00 ?  17 ASP E HA   1  
ATOM 5213   H HB2  . ASP E  1 17 ? 22.774  18.365  -250.983 1.00 0.00 ?  17 ASP E HB2  1  
ATOM 5214   H HB3  . ASP E  1 17 ? 23.134  18.220  -249.245 1.00 0.00 ?  17 ASP E HB3  1  
ATOM 5215   N N    . THR E  1 18 ? 21.960  21.313  -250.007 1.00 0.00 ?  18 THR E N    1  
ATOM 5216   C CA   . THR E  1 18 ? 22.540  22.624  -249.741 1.00 0.00 ?  18 THR E CA   1  
ATOM 5217   C C    . THR E  1 18 ? 21.989  23.219  -248.452 1.00 0.00 ?  18 THR E C    1  
ATOM 5218   O O    . THR E  1 18 ? 22.734  23.776  -247.646 1.00 0.00 ?  18 THR E O    1  
ATOM 5219   C CB   . THR E  1 18 ? 22.277  23.603  -250.900 1.00 0.00 ?  18 THR E CB   1  
ATOM 5220   O OG1  . THR E  1 18 ? 22.923  23.127  -252.088 1.00 0.00 ?  18 THR E OG1  1  
ATOM 5221   C CG2  . THR E  1 18 ? 22.808  24.987  -250.559 1.00 0.00 ?  18 THR E CG2  1  
ATOM 5222   H H    . THR E  1 18 ? 21.573  21.122  -250.920 1.00 0.00 ?  18 THR E H    1  
ATOM 5223   H HA   . THR E  1 18 ? 23.617  22.529  -249.601 1.00 0.00 ?  18 THR E HA   1  
ATOM 5224   H HB   . THR E  1 18 ? 21.204  23.661  -251.079 1.00 0.00 ?  18 THR E HB   1  
ATOM 5225   H HG1  . THR E  1 18 ? 22.757  23.739  -252.809 1.00 0.00 ?  18 THR E HG1  1  
ATOM 5226   H HG21 . THR E  1 18 ? 22.613  25.665  -251.390 1.00 0.00 ?  18 THR E HG21 1  
ATOM 5227   H HG22 . THR E  1 18 ? 22.311  25.357  -249.663 1.00 0.00 ?  18 THR E HG22 1  
ATOM 5228   H HG23 . THR E  1 18 ? 23.881  24.930  -250.381 1.00 0.00 ?  18 THR E HG23 1  
ATOM 5229   N N    . GLY E  1 19 ? 20.679  23.096  -248.263 1.00 0.00 ?  19 GLY E N    1  
ATOM 5230   C CA   . GLY E  1 19 ? 20.001  23.755  -247.153 1.00 0.00 ?  19 GLY E CA   1  
ATOM 5231   C C    . GLY E  1 19 ? 20.093  22.924  -245.879 1.00 0.00 ?  19 GLY E C    1  
ATOM 5232   O O    . GLY E  1 19 ? 19.809  23.412  -244.786 1.00 0.00 ?  19 GLY E O    1  
ATOM 5233   H H    . GLY E  1 19 ? 20.140  22.533  -248.904 1.00 0.00 ?  19 GLY E H    1  
ATOM 5234   H HA2  . GLY E  1 19 ? 20.465  24.726  -246.977 1.00 0.00 ?  19 GLY E HA2  1  
ATOM 5235   H HA3  . GLY E  1 19 ? 18.952  23.896  -247.409 1.00 0.00 ?  19 GLY E HA3  1  
ATOM 5236   N N    . VAL E  1 20 ? 20.493  21.665  -246.028 1.00 0.00 ?  20 VAL E N    1  
ATOM 5237   C CA   . VAL E  1 20 ? 20.591  20.754  -244.894 1.00 0.00 ?  20 VAL E CA   1  
ATOM 5238   C C    . VAL E  1 20 ? 21.933  20.033  -244.882 1.00 0.00 ?  20 VAL E C    1  
ATOM 5239   O O    . VAL E  1 20 ? 22.051  18.930  -244.347 1.00 0.00 ?  20 VAL E O    1  
ATOM 5240   C CB   . VAL E  1 20 ? 19.458  19.710  -244.909 1.00 0.00 ?  20 VAL E CB   1  
ATOM 5241   C CG1  . VAL E  1 20 ? 18.124  20.368  -244.589 1.00 0.00 ?  20 VAL E CG1  1  
ATOM 5242   C CG2  . VAL E  1 20 ? 19.395  19.010  -246.257 1.00 0.00 ?  20 VAL E CG2  1  
ATOM 5243   H H    . VAL E  1 20 ? 20.734  21.332  -246.950 1.00 0.00 ?  20 VAL E H    1  
ATOM 5244   H HA   . VAL E  1 20 ? 20.555  21.293  -243.947 1.00 0.00 ?  20 VAL E HA   1  
ATOM 5245   H HB   . VAL E  1 20 ? 19.674  18.944  -244.164 1.00 0.00 ?  20 VAL E HB   1  
ATOM 5246   H HG11 . VAL E  1 20 ? 17.335  19.615  -244.602 1.00 0.00 ?  20 VAL E HG11 1  
ATOM 5247   H HG12 . VAL E  1 20 ? 18.171  20.825  -243.600 1.00 0.00 ?  20 VAL E HG12 1  
ATOM 5248   H HG13 . VAL E  1 20 ? 17.908  21.133  -245.333 1.00 0.00 ?  20 VAL E HG13 1  
ATOM 5249   H HG21 . VAL E  1 20 ? 20.343  18.507  -246.451 1.00 0.00 ?  20 VAL E HG21 1  
ATOM 5250   H HG22 . VAL E  1 20 ? 18.590  18.276  -246.250 1.00 0.00 ?  20 VAL E HG22 1  
ATOM 5251   H HG23 . VAL E  1 20 ? 19.209  19.746  -247.040 1.00 0.00 ?  20 VAL E HG23 1  
ATOM 5252   N N    . ASP E  1 21 ? 22.942  20.661  -245.475 1.00 0.00 ?  21 ASP E N    1  
ATOM 5253   C CA   . ASP E  1 21 ? 24.295  20.119  -245.463 1.00 0.00 ?  21 ASP E CA   1  
ATOM 5254   C C    . ASP E  1 21 ? 24.802  19.936  -244.038 1.00 0.00 ?  21 ASP E C    1  
ATOM 5255   O O    . ASP E  1 21 ? 25.516  18.978  -243.741 1.00 0.00 ?  21 ASP E O    1  
ATOM 5256   C CB   . ASP E  1 21 ? 25.245  21.029  -246.245 1.00 0.00 ?  21 ASP E CB   1  
ATOM 5257   C CG   . ASP E  1 21 ? 26.644  20.460  -246.440 1.00 0.00 ?  21 ASP E CG   1  
ATOM 5258   O OD1  . ASP E  1 21 ? 26.764  19.429  -247.057 1.00 0.00 ?  21 ASP E OD1  1  
ATOM 5259   O OD2  . ASP E  1 21 ? 27.589  21.136  -246.109 1.00 0.00 -1 21 ASP E OD2  1  
ATOM 5260   H H    . ASP E  1 21 ? 22.767  21.537  -245.947 1.00 0.00 ?  21 ASP E H    1  
ATOM 5261   H HA   . ASP E  1 21 ? 24.302  19.131  -245.924 1.00 0.00 ?  21 ASP E HA   1  
ATOM 5262   H HB2  . ASP E  1 21 ? 24.846  21.348  -247.208 1.00 0.00 ?  21 ASP E HB2  1  
ATOM 5263   H HB3  . ASP E  1 21 ? 25.292  21.884  -245.569 1.00 0.00 ?  21 ASP E HB3  1  
ATOM 5264   N N    . ASN E  1 22 ? 24.428  20.859  -243.159 1.00 0.00 ?  22 ASN E N    1  
ATOM 5265   C CA   . ASN E  1 22 ? 24.873  20.821  -241.771 1.00 0.00 ?  22 ASN E CA   1  
ATOM 5266   C C    . ASN E  1 22 ? 24.061  19.818  -240.961 1.00 0.00 ?  22 ASN E C    1  
ATOM 5267   O O    . ASN E  1 22 ? 24.548  19.263  -239.976 1.00 0.00 ?  22 ASN E O    1  
ATOM 5268   C CB   . ASN E  1 22 ? 24.804  22.194  -241.128 1.00 0.00 ?  22 ASN E CB   1  
ATOM 5269   C CG   . ASN E  1 22 ? 25.837  23.156  -241.644 1.00 0.00 ?  22 ASN E CG   1  
ATOM 5270   O OD1  . ASN E  1 22 ? 26.877  22.755  -242.179 1.00 0.00 ?  22 ASN E OD1  1  
ATOM 5271   N ND2  . ASN E  1 22 ? 25.595  24.422  -241.414 1.00 0.00 ?  22 ASN E ND2  1  
ATOM 5272   H H    . ASN E  1 22 ? 23.820  21.608  -243.460 1.00 0.00 ?  22 ASN E H    1  
ATOM 5273   H HA   . ASN E  1 22 ? 25.911  20.488  -241.724 1.00 0.00 ?  22 ASN E HA   1  
ATOM 5274   H HB2  . ASN E  1 22 ? 23.851  22.714  -241.022 1.00 0.00 ?  22 ASN E HB2  1  
ATOM 5275   H HB3  . ASN E  1 22 ? 25.125  21.823  -240.154 1.00 0.00 ?  22 ASN E HB3  1  
ATOM 5276   H HD21 . ASN E  1 22 ? 24.767  24.691  -240.923 1.00 0.00 ?  22 ASN E HD21 1  
ATOM 5277   H HD22 . ASN E  1 22 ? 26.239  25.119  -241.729 1.00 0.00 ?  22 ASN E HD22 1  
ATOM 5278   N N    . LEU E  1 23 ? 22.822  19.591  -241.381 1.00 0.00 ?  23 LEU E N    1  
ATOM 5279   C CA   . LEU E  1 23 ? 21.926  18.685  -240.671 1.00 0.00 ?  23 LEU E CA   1  
ATOM 5280   C C    . LEU E  1 23 ? 22.584  17.331  -240.437 1.00 0.00 ?  23 LEU E C    1  
ATOM 5281   O O    . LEU E  1 23 ? 22.578  16.812  -239.321 1.00 0.00 ?  23 LEU E O    1  
ATOM 5282   C CB   . LEU E  1 23 ? 20.617  18.514  -241.452 1.00 0.00 ?  23 LEU E CB   1  
ATOM 5283   C CG   . LEU E  1 23 ? 19.713  17.373  -240.969 1.00 0.00 ?  23 LEU E CG   1  
ATOM 5284   C CD1  . LEU E  1 23 ? 19.373  17.564  -239.497 1.00 0.00 ?  23 LEU E CD1  1  
ATOM 5285   C CD2  . LEU E  1 23 ? 18.448  17.333  -241.814 1.00 0.00 ?  23 LEU E CD2  1  
ATOM 5286   H H    . LEU E  1 23 ? 22.491  20.057  -242.213 1.00 0.00 ?  23 LEU E H    1  
ATOM 5287   H HA   . LEU E  1 23 ? 21.700  19.092  -239.686 1.00 0.00 ?  23 LEU E HA   1  
ATOM 5288   H HB2  . LEU E  1 23 ? 20.154  19.475  -241.233 1.00 0.00 ?  23 LEU E HB2  1  
ATOM 5289   H HB3  . LEU E  1 23 ? 20.794  18.432  -242.524 1.00 0.00 ?  23 LEU E HB3  1  
ATOM 5290   H HG   . LEU E  1 23 ? 20.253  16.440  -241.133 1.00 0.00 ?  23 LEU E HG   1  
ATOM 5291   H HD11 . LEU E  1 23 ? 18.731  16.748  -239.163 1.00 0.00 ?  23 LEU E HD11 1  
ATOM 5292   H HD12 . LEU E  1 23 ? 20.290  17.566  -238.909 1.00 0.00 ?  23 LEU E HD12 1  
ATOM 5293   H HD13 . LEU E  1 23 ? 18.853  18.512  -239.364 1.00 0.00 ?  23 LEU E HD13 1  
ATOM 5294   H HD21 . LEU E  1 23 ? 18.713  17.168  -242.858 1.00 0.00 ?  23 LEU E HD21 1  
ATOM 5295   H HD22 . LEU E  1 23 ? 17.807  16.521  -241.470 1.00 0.00 ?  23 LEU E HD22 1  
ATOM 5296   H HD23 . LEU E  1 23 ? 17.917  18.281  -241.720 1.00 0.00 ?  23 LEU E HD23 1  
ATOM 5297   N N    . GLN E  1 24 ? 23.151  16.763  -241.497 1.00 0.00 ?  24 GLN E N    1  
ATOM 5298   C CA   . GLN E  1 24 ? 23.813  15.467  -241.409 1.00 0.00 ?  24 GLN E CA   1  
ATOM 5299   C C    . GLN E  1 24 ? 24.929  15.487  -240.372 1.00 0.00 ?  24 GLN E C    1  
ATOM 5300   O O    . GLN E  1 24 ? 25.050  14.571  -239.559 1.00 0.00 ?  24 GLN E O    1  
ATOM 5301   C CB   . GLN E  1 24 ? 24.381  15.063  -242.772 1.00 0.00 ?  24 GLN E CB   1  
ATOM 5302   C CG   . GLN E  1 24 ? 25.044  13.696  -242.789 1.00 0.00 ?  24 GLN E CG   1  
ATOM 5303   C CD   . GLN E  1 24 ? 25.586  13.333  -244.158 1.00 0.00 ?  24 GLN E CD   1  
ATOM 5304   O OE1  . GLN E  1 24 ? 25.541  14.137  -245.093 1.00 0.00 ?  24 GLN E OE1  1  
ATOM 5305   N NE2  . GLN E  1 24 ? 26.099  12.114  -244.286 1.00 0.00 ?  24 GLN E NE2  1  
ATOM 5306   H H    . GLN E  1 24 ? 23.122  17.242  -242.386 1.00 0.00 ?  24 GLN E H    1  
ATOM 5307   H HA   . GLN E  1 24 ? 23.098  14.714  -241.080 1.00 0.00 ?  24 GLN E HA   1  
ATOM 5308   H HB2  . GLN E  1 24 ? 23.550  15.079  -243.477 1.00 0.00 ?  24 GLN E HB2  1  
ATOM 5309   H HB3  . GLN E  1 24 ? 25.107  15.827  -243.050 1.00 0.00 ?  24 GLN E HB3  1  
ATOM 5310   H HG2  . GLN E  1 24 ? 25.779  13.388  -242.046 1.00 0.00 ?  24 GLN E HG2  1  
ATOM 5311   H HG3  . GLN E  1 24 ? 24.116  13.147  -242.629 1.00 0.00 ?  24 GLN E HG3  1  
ATOM 5312   H HE21 . GLN E  1 24 ? 26.115  11.493  -243.503 1.00 0.00 ?  24 GLN E HE21 1  
ATOM 5313   H HE22 . GLN E  1 24 ? 26.472  11.818  -245.167 1.00 0.00 ?  24 GLN E HE22 1  
ATOM 5314   N N    . THR E  1 25 ? 25.742  16.538  -240.406 1.00 0.00 ?  25 THR E N    1  
ATOM 5315   C CA   . THR E  1 25 ? 26.867  16.665  -239.488 1.00 0.00 ?  25 THR E CA   1  
ATOM 5316   C C    . THR E  1 25 ? 26.390  16.808  -238.048 1.00 0.00 ?  25 THR E C    1  
ATOM 5317   O O    . THR E  1 25 ? 26.969  16.226  -237.131 1.00 0.00 ?  25 THR E O    1  
ATOM 5318   C CB   . THR E  1 25 ? 27.755  17.871  -239.846 1.00 0.00 ?  25 THR E CB   1  
ATOM 5319   O OG1  . THR E  1 25 ? 28.310  17.688  -241.154 1.00 0.00 ?  25 THR E OG1  1  
ATOM 5320   C CG2  . THR E  1 25 ? 28.883  18.021  -238.837 1.00 0.00 ?  25 THR E CG2  1  
ATOM 5321   H H    . THR E  1 25 ? 25.576  17.266  -241.086 1.00 0.00 ?  25 THR E H    1  
ATOM 5322   H HA   . THR E  1 25 ? 27.476  15.761  -239.523 1.00 0.00 ?  25 THR E HA   1  
ATOM 5323   H HB   . THR E  1 25 ? 27.144  18.774  -239.843 1.00 0.00 ?  25 THR E HB   1  
ATOM 5324   H HG1  . THR E  1 25 ? 27.599  17.618  -241.796 1.00 0.00 ?  25 THR E HG1  1  
ATOM 5325   H HG21 . THR E  1 25 ? 29.499  18.879  -239.106 1.00 0.00 ?  25 THR E HG21 1  
ATOM 5326   H HG22 . THR E  1 25 ? 28.464  18.172  -237.842 1.00 0.00 ?  25 THR E HG22 1  
ATOM 5327   H HG23 . THR E  1 25 ? 29.495  17.120  -238.840 1.00 0.00 ?  25 THR E HG23 1  
ATOM 5328   N N    . GLN E  1 26 ? 25.330  17.586  -237.856 1.00 0.00 ?  26 GLN E N    1  
ATOM 5329   C CA   . GLN E  1 26 ? 24.809  17.855  -236.521 1.00 0.00 ?  26 GLN E CA   1  
ATOM 5330   C C    . GLN E  1 26 ? 24.281  16.584  -235.869 1.00 0.00 ?  26 GLN E C    1  
ATOM 5331   O O    . GLN E  1 26 ? 24.573  16.303  -234.707 1.00 0.00 ?  26 GLN E O    1  
ATOM 5332   C CB   . GLN E  1 26 ? 23.697  18.906  -236.581 1.00 0.00 ?  26 GLN E CB   1  
ATOM 5333   C CG   . GLN E  1 26 ? 24.187  20.315  -236.865 1.00 0.00 ?  26 GLN E CG   1  
ATOM 5334   C CD   . GLN E  1 26 ? 23.049  21.312  -236.976 1.00 0.00 ?  26 GLN E CD   1  
ATOM 5335   O OE1  . GLN E  1 26 ? 21.876  20.955  -236.833 1.00 0.00 ?  26 GLN E OE1  1  
ATOM 5336   N NE2  . GLN E  1 26 ? 23.388  22.569  -237.236 1.00 0.00 ?  26 GLN E NE2  1  
ATOM 5337   H H    . GLN E  1 26 ? 24.874  18.002  -238.655 1.00 0.00 ?  26 GLN E H    1  
ATOM 5338   H HA   . GLN E  1 26 ? 25.614  18.220  -235.882 1.00 0.00 ?  26 GLN E HA   1  
ATOM 5339   H HB2  . GLN E  1 26 ? 23.008  18.590  -237.365 1.00 0.00 ?  26 GLN E HB2  1  
ATOM 5340   H HB3  . GLN E  1 26 ? 23.188  18.880  -235.618 1.00 0.00 ?  26 GLN E HB3  1  
ATOM 5341   H HG2  . GLN E  1 26 ? 24.990  20.786  -236.298 1.00 0.00 ?  26 GLN E HG2  1  
ATOM 5342   H HG3  . GLN E  1 26 ? 24.541  20.083  -237.870 1.00 0.00 ?  26 GLN E HG3  1  
ATOM 5343   H HE21 . GLN E  1 26 ? 24.351  22.815  -237.347 1.00 0.00 ?  26 GLN E HE21 1  
ATOM 5344   H HE22 . GLN E  1 26 ? 22.680  23.272  -237.321 1.00 0.00 ?  26 GLN E HE22 1  
ATOM 5345   N N    . VAL E  1 27 ? 23.502  15.817  -236.625 1.00 0.00 ?  27 VAL E N    1  
ATOM 5346   C CA   . VAL E  1 27 ? 22.871  14.613  -236.099 1.00 0.00 ?  27 VAL E CA   1  
ATOM 5347   C C    . VAL E  1 27 ? 23.882  13.483  -235.947 1.00 0.00 ?  27 VAL E C    1  
ATOM 5348   O O    . VAL E  1 27 ? 23.718  12.600  -235.105 1.00 0.00 ?  27 VAL E O    1  
ATOM 5349   C CB   . VAL E  1 27 ? 21.718  14.138  -237.004 1.00 0.00 ?  27 VAL E CB   1  
ATOM 5350   C CG1  . VAL E  1 27 ? 22.264  13.432  -238.236 1.00 0.00 ?  27 VAL E CG1  1  
ATOM 5351   C CG2  . VAL E  1 27 ? 20.782  13.218  -236.235 1.00 0.00 ?  27 VAL E CG2  1  
ATOM 5352   H H    . VAL E  1 27 ? 23.343  16.076  -237.588 1.00 0.00 ?  27 VAL E H    1  
ATOM 5353   H HA   . VAL E  1 27 ? 22.480  14.776  -235.094 1.00 0.00 ?  27 VAL E HA   1  
ATOM 5354   H HB   . VAL E  1 27 ? 21.130  15.003  -237.311 1.00 0.00 ?  27 VAL E HB   1  
ATOM 5355   H HG11 . VAL E  1 27 ? 21.435  13.103  -238.864 1.00 0.00 ?  27 VAL E HG11 1  
ATOM 5356   H HG12 . VAL E  1 27 ? 22.895  14.118  -238.799 1.00 0.00 ?  27 VAL E HG12 1  
ATOM 5357   H HG13 . VAL E  1 27 ? 22.851  12.566  -237.929 1.00 0.00 ?  27 VAL E HG13 1  
ATOM 5358   H HG21 . VAL E  1 27 ? 20.365  13.753  -235.382 1.00 0.00 ?  27 VAL E HG21 1  
ATOM 5359   H HG22 . VAL E  1 27 ? 19.973  12.893  -236.889 1.00 0.00 ?  27 VAL E HG22 1  
ATOM 5360   H HG23 . VAL E  1 27 ? 21.336  12.348  -235.883 1.00 0.00 ?  27 VAL E HG23 1  
ATOM 5361   N N    . THR E  1 28 ? 24.927  13.517  -236.766 1.00 0.00 ?  28 THR E N    1  
ATOM 5362   C CA   . THR E  1 28 ? 26.026  12.565  -236.646 1.00 0.00 ?  28 THR E CA   1  
ATOM 5363   C C    . THR E  1 28 ? 26.830  12.811  -235.377 1.00 0.00 ?  28 THR E C    1  
ATOM 5364   O O    . THR E  1 28 ? 27.167  11.874  -234.653 1.00 0.00 ?  28 THR E O    1  
ATOM 5365   C CB   . THR E  1 28 ? 26.969  12.635  -237.861 1.00 0.00 ?  28 THR E CB   1  
ATOM 5366   O OG1  . THR E  1 28 ? 26.257  12.251  -239.045 1.00 0.00 ?  28 THR E OG1  1  
ATOM 5367   C CG2  . THR E  1 28 ? 28.159  11.708  -237.667 1.00 0.00 ?  28 THR E CG2  1  
ATOM 5368   H H    . THR E  1 28 ? 24.962  14.219  -237.491 1.00 0.00 ?  28 THR E H    1  
ATOM 5369   H HA   . THR E  1 28 ? 25.630  11.552  -236.569 1.00 0.00 ?  28 THR E HA   1  
ATOM 5370   H HB   . THR E  1 28 ? 27.323  13.660  -237.977 1.00 0.00 ?  28 THR E HB   1  
ATOM 5371   H HG1  . THR E  1 28 ? 25.412  12.706  -239.071 1.00 0.00 ?  28 THR E HG1  1  
ATOM 5372   H HG21 . THR E  1 28 ? 28.814  11.772  -238.535 1.00 0.00 ?  28 THR E HG21 1  
ATOM 5373   H HG22 . THR E  1 28 ? 28.709  12.005  -236.774 1.00 0.00 ?  28 THR E HG22 1  
ATOM 5374   H HG23 . THR E  1 28 ? 27.806  10.684  -237.552 1.00 0.00 ?  28 THR E HG23 1  
ATOM 5375   N N    . GLU E  1 29 ? 27.136  14.076  -235.111 1.00 0.00 ?  29 GLU E N    1  
ATOM 5376   C CA   . GLU E  1 29 ? 27.846  14.454  -233.895 1.00 0.00 ?  29 GLU E CA   1  
ATOM 5377   C C    . GLU E  1 29 ? 26.985  14.224  -232.660 1.00 0.00 ?  29 GLU E C    1  
ATOM 5378   O O    . GLU E  1 29 ? 27.489  13.855  -231.599 1.00 0.00 ?  29 GLU E O    1  
ATOM 5379   C CB   . GLU E  1 29 ? 28.285  15.919  -233.964 1.00 0.00 ?  29 GLU E CB   1  
ATOM 5380   C CG   . GLU E  1 29 ? 29.423  16.189  -234.939 1.00 0.00 ?  29 GLU E CG   1  
ATOM 5381   C CD   . GLU E  1 29 ? 29.720  17.659  -235.038 1.00 0.00 ?  29 GLU E CD   1  
ATOM 5382   O OE1  . GLU E  1 29 ? 29.015  18.430  -234.432 1.00 0.00 ?  29 GLU E OE1  1  
ATOM 5383   O OE2  . GLU E  1 29 ? 30.717  18.005  -235.627 1.00 0.00 -1 29 GLU E OE2  1  
ATOM 5384   H H    . GLU E  1 29 ? 26.870  14.795  -235.769 1.00 0.00 ?  29 GLU E H    1  
ATOM 5385   H HA   . GLU E  1 29 ? 28.732  13.830  -233.775 1.00 0.00 ?  29 GLU E HA   1  
ATOM 5386   H HB2  . GLU E  1 29 ? 27.411  16.500  -234.258 1.00 0.00 ?  29 GLU E HB2  1  
ATOM 5387   H HB3  . GLU E  1 29 ? 28.592  16.207  -232.959 1.00 0.00 ?  29 GLU E HB3  1  
ATOM 5388   H HG2  . GLU E  1 29 ? 30.338  15.650  -234.696 1.00 0.00 ?  29 GLU E HG2  1  
ATOM 5389   H HG3  . GLU E  1 29 ? 29.034  15.832  -235.891 1.00 0.00 ?  29 GLU E HG3  1  
ATOM 5390   N N    . ALA E  1 30 ? 25.682  14.443  -232.804 1.00 0.00 ?  30 ALA E N    1  
ATOM 5391   C CA   . ALA E  1 30 ? 24.734  14.157  -231.734 1.00 0.00 ?  30 ALA E CA   1  
ATOM 5392   C C    . ALA E  1 30 ? 24.695  12.668  -231.416 1.00 0.00 ?  30 ALA E C    1  
ATOM 5393   O O    . ALA E  1 30 ? 24.584  12.274  -230.255 1.00 0.00 ?  30 ALA E O    1  
ATOM 5394   C CB   . ALA E  1 30 ? 23.347  14.659  -232.108 1.00 0.00 ?  30 ALA E CB   1  
ATOM 5395   H H    . ALA E  1 30 ? 25.340  14.818  -233.678 1.00 0.00 ?  30 ALA E H    1  
ATOM 5396   H HA   . ALA E  1 30 ? 25.059  14.674  -230.831 1.00 0.00 ?  30 ALA E HA   1  
ATOM 5397   H HB1  . ALA E  1 30 ? 23.013  14.162  -233.018 1.00 0.00 ?  30 ALA E HB1  1  
ATOM 5398   H HB2  . ALA E  1 30 ? 22.651  14.437  -231.298 1.00 0.00 ?  30 ALA E HB2  1  
ATOM 5399   H HB3  . ALA E  1 30 ? 23.381  15.736  -232.272 1.00 0.00 ?  30 ALA E HB3  1  
ATOM 5400   N N    . LEU E  1 31 ? 24.789  11.844  -232.454 1.00 0.00 ?  31 LEU E N    1  
ATOM 5401   C CA   . LEU E  1 31 ? 24.897  10.400  -232.279 1.00 0.00 ?  31 LEU E CA   1  
ATOM 5402   C C    . LEU E  1 31 ? 26.199  10.027  -231.582 1.00 0.00 ?  31 LEU E C    1  
ATOM 5403   O O    . LEU E  1 31 ? 26.210  9.205   -230.666 1.00 0.00 ?  31 LEU E O    1  
ATOM 5404   C CB   . LEU E  1 31 ? 24.796  9.693   -233.636 1.00 0.00 ?  31 LEU E CB   1  
ATOM 5405   C CG   . LEU E  1 31 ? 24.933  8.166   -233.588 1.00 0.00 ?  31 LEU E CG   1  
ATOM 5406   C CD1  . LEU E  1 31 ? 23.838  7.570   -232.712 1.00 0.00 ?  31 LEU E CD1  1  
ATOM 5407   C CD2  . LEU E  1 31 ? 24.860  7.603   -234.999 1.00 0.00 ?  31 LEU E CD2  1  
ATOM 5408   H H    . LEU E  1 31 ? 24.784  12.227  -233.389 1.00 0.00 ?  31 LEU E H    1  
ATOM 5409   H HA   . LEU E  1 31 ? 24.091  10.049  -231.636 1.00 0.00 ?  31 LEU E HA   1  
ATOM 5410   H HB2  . LEU E  1 31 ? 23.777  9.968   -233.903 1.00 0.00 ?  31 LEU E HB2  1  
ATOM 5411   H HB3  . LEU E  1 31 ? 25.489  10.114  -234.364 1.00 0.00 ?  31 LEU E HB3  1  
ATOM 5412   H HG   . LEU E  1 31 ? 25.923  7.942   -233.190 1.00 0.00 ?  31 LEU E HG   1  
ATOM 5413   H HD11 . LEU E  1 31 ? 23.944  6.486   -232.684 1.00 0.00 ?  31 LEU E HD11 1  
ATOM 5414   H HD12 . LEU E  1 31 ? 23.924  7.969   -231.701 1.00 0.00 ?  31 LEU E HD12 1  
ATOM 5415   H HD13 . LEU E  1 31 ? 22.863  7.829   -233.124 1.00 0.00 ?  31 LEU E HD13 1  
ATOM 5416   H HD21 . LEU E  1 31 ? 25.668  8.021   -235.600 1.00 0.00 ?  31 LEU E HD21 1  
ATOM 5417   H HD22 . LEU E  1 31 ? 24.959  6.518   -234.964 1.00 0.00 ?  31 LEU E HD22 1  
ATOM 5418   H HD23 . LEU E  1 31 ? 23.902  7.867   -235.448 1.00 0.00 ?  31 LEU E HD23 1  
ATOM 5419   N N    . ASP E  1 32 ? 27.296  10.635  -232.022 1.00 0.00 ?  32 ASP E N    1  
ATOM 5420   C CA   . ASP E  1 32 ? 28.609  10.351  -231.456 1.00 0.00 ?  32 ASP E CA   1  
ATOM 5421   C C    . ASP E  1 32 ? 28.631  10.616  -229.956 1.00 0.00 ?  32 ASP E C    1  
ATOM 5422   O O    . ASP E  1 32 ? 29.166  9.821   -229.184 1.00 0.00 ?  32 ASP E O    1  
ATOM 5423   C CB   . ASP E  1 32 ? 29.686  11.186  -232.153 1.00 0.00 ?  32 ASP E CB   1  
ATOM 5424   C CG   . ASP E  1 32 ? 30.012  10.735  -233.571 1.00 0.00 ?  32 ASP E CG   1  
ATOM 5425   O OD1  . ASP E  1 32 ? 29.601  9.660   -233.941 1.00 0.00 ?  32 ASP E OD1  1  
ATOM 5426   O OD2  . ASP E  1 32 ? 30.530  11.528  -234.320 1.00 0.00 -1 32 ASP E OD2  1  
ATOM 5427   H H    . ASP E  1 32 ? 27.217  11.311  -232.768 1.00 0.00 ?  32 ASP E H    1  
ATOM 5428   H HA   . ASP E  1 32 ? 28.847  9.295   -231.588 1.00 0.00 ?  32 ASP E HA   1  
ATOM 5429   H HB2  . ASP E  1 32 ? 29.474  12.256  -232.153 1.00 0.00 ?  32 ASP E HB2  1  
ATOM 5430   H HB3  . ASP E  1 32 ? 30.537  10.983  -231.503 1.00 0.00 ?  32 ASP E HB3  1  
ATOM 5431   N N    . LYS E  1 33 ? 28.046  11.738  -229.550 1.00 0.00 ?  33 LYS E N    1  
ATOM 5432   C CA   . LYS E  1 33 ? 27.977  12.098  -228.139 1.00 0.00 ?  33 LYS E CA   1  
ATOM 5433   C C    . LYS E  1 33 ? 27.006  11.196  -227.387 1.00 0.00 ?  33 LYS E C    1  
ATOM 5434   O O    . LYS E  1 33 ? 27.313  10.708  -226.299 1.00 0.00 ?  33 LYS E O    1  
ATOM 5435   C CB   . LYS E  1 33 ? 27.566  13.562  -227.979 1.00 0.00 ?  33 LYS E CB   1  
ATOM 5436   C CG   . LYS E  1 33 ? 28.614  14.564  -228.444 1.00 0.00 ?  33 LYS E CG   1  
ATOM 5437   C CD   . LYS E  1 33 ? 28.111  15.994  -228.309 1.00 0.00 ?  33 LYS E CD   1  
ATOM 5438   C CE   . LYS E  1 33 ? 29.122  16.991  -228.856 1.00 0.00 ?  33 LYS E CE   1  
ATOM 5439   N NZ   . LYS E  1 33 ? 28.625  18.391  -228.769 1.00 0.00 1  33 LYS E NZ   1  
ATOM 5440   H H    . LYS E  1 33 ? 27.640  12.357  -230.236 1.00 0.00 ?  33 LYS E H    1  
ATOM 5441   H HA   . LYS E  1 33 ? 28.954  11.958  -227.674 1.00 0.00 ?  33 LYS E HA   1  
ATOM 5442   H HB2  . LYS E  1 33 ? 26.650  13.701  -228.555 1.00 0.00 ?  33 LYS E HB2  1  
ATOM 5443   H HB3  . LYS E  1 33 ? 27.356  13.722  -226.922 1.00 0.00 ?  33 LYS E HB3  1  
ATOM 5444   H HG2  . LYS E  1 33 ? 29.510  14.435  -227.837 1.00 0.00 ?  33 LYS E HG2  1  
ATOM 5445   H HG3  . LYS E  1 33 ? 28.850  14.359  -229.488 1.00 0.00 ?  33 LYS E HG3  1  
ATOM 5446   H HD2  . LYS E  1 33 ? 27.174  16.086  -228.860 1.00 0.00 ?  33 LYS E HD2  1  
ATOM 5447   H HD3  . LYS E  1 33 ? 27.932  16.201  -227.254 1.00 0.00 ?  33 LYS E HD3  1  
ATOM 5448   H HE2  . LYS E  1 33 ? 30.042  16.896  -228.281 1.00 0.00 ?  33 LYS E HE2  1  
ATOM 5449   H HE3  . LYS E  1 33 ? 29.319  16.741  -229.898 1.00 0.00 ?  33 LYS E HE3  1  
ATOM 5450   H HZ1  . LYS E  1 33 ? 28.444  18.624  -227.803 1.00 0.00 ?  33 LYS E HZ1  1  
ATOM 5451   H HZ2  . LYS E  1 33 ? 29.323  19.020  -229.141 1.00 0.00 ?  33 LYS E HZ2  1  
ATOM 5452   H HZ3  . LYS E  1 33 ? 27.772  18.481  -229.303 1.00 0.00 ?  33 LYS E HZ3  1  
ATOM 5453   N N    . LEU E  1 34 ? 25.834  10.978  -227.974 1.00 0.00 ?  34 LEU E N    1  
ATOM 5454   C CA   . LEU E  1 34 ? 24.808  10.151  -227.351 1.00 0.00 ?  34 LEU E CA   1  
ATOM 5455   C C    . LEU E  1 34 ? 25.316  8.736   -227.103 1.00 0.00 ?  34 LEU E C    1  
ATOM 5456   O O    . LEU E  1 34 ? 24.962  8.105   -226.107 1.00 0.00 ?  34 LEU E O    1  
ATOM 5457   C CB   . LEU E  1 34 ? 23.549  10.120  -228.226 1.00 0.00 ?  34 LEU E CB   1  
ATOM 5458   C CG   . LEU E  1 34 ? 22.366  9.338   -227.641 1.00 0.00 ?  34 LEU E CG   1  
ATOM 5459   C CD1  . LEU E  1 34 ? 21.915  9.974   -226.333 1.00 0.00 ?  34 LEU E CD1  1  
ATOM 5460   C CD2  . LEU E  1 34 ? 21.226  9.309   -228.648 1.00 0.00 ?  34 LEU E CD2  1  
ATOM 5461   H H    . LEU E  1 34 ? 25.649  11.396  -228.874 1.00 0.00 ?  34 LEU E H    1  
ATOM 5462   H HA   . LEU E  1 34 ? 24.550  10.562  -226.375 1.00 0.00 ?  34 LEU E HA   1  
ATOM 5463   H HB2  . LEU E  1 34 ? 23.320  11.184  -228.245 1.00 0.00 ?  34 LEU E HB2  1  
ATOM 5464   H HB3  . LEU E  1 34 ? 23.768  9.778   -229.237 1.00 0.00 ?  34 LEU E HB3  1  
ATOM 5465   H HG   . LEU E  1 34 ? 22.701  8.311   -227.487 1.00 0.00 ?  34 LEU E HG   1  
ATOM 5466   H HD11 . LEU E  1 34 ? 21.075  9.412   -225.925 1.00 0.00 ?  34 LEU E HD11 1  
ATOM 5467   H HD12 . LEU E  1 34 ? 22.739  9.963   -225.620 1.00 0.00 ?  34 LEU E HD12 1  
ATOM 5468   H HD13 . LEU E  1 34 ? 21.607  11.003  -226.517 1.00 0.00 ?  34 LEU E HD13 1  
ATOM 5469   H HD21 . LEU E  1 34 ? 21.563  8.825   -229.565 1.00 0.00 ?  34 LEU E HD21 1  
ATOM 5470   H HD22 . LEU E  1 34 ? 20.387  8.752   -228.231 1.00 0.00 ?  34 LEU E HD22 1  
ATOM 5471   H HD23 . LEU E  1 34 ? 20.912  10.329  -228.871 1.00 0.00 ?  34 LEU E HD23 1  
ATOM 5472   N N    . ALA E  1 35 ? 26.148  8.244   -228.014 1.00 0.00 ?  35 ALA E N    1  
ATOM 5473   C CA   . ALA E  1 35 ? 26.750  6.924   -227.868 1.00 0.00 ?  35 ALA E CA   1  
ATOM 5474   C C    . ALA E  1 35 ? 27.516  6.809   -226.557 1.00 0.00 ?  35 ALA E C    1  
ATOM 5475   O O    . ALA E  1 35 ? 27.528  5.754   -225.924 1.00 0.00 ?  35 ALA E O    1  
ATOM 5476   C CB   . ALA E  1 35 ? 27.664  6.625   -229.048 1.00 0.00 ?  35 ALA E CB   1  
ATOM 5477   H H    . ALA E  1 35 ? 26.370  8.798   -228.829 1.00 0.00 ?  35 ALA E H    1  
ATOM 5478   H HA   . ALA E  1 35 ? 25.955  6.178   -227.846 1.00 0.00 ?  35 ALA E HA   1  
ATOM 5479   H HB1  . ALA E  1 35 ? 28.455  7.371   -229.093 1.00 0.00 ?  35 ALA E HB1  1  
ATOM 5480   H HB2  . ALA E  1 35 ? 28.105  5.636   -228.923 1.00 0.00 ?  35 ALA E HB2  1  
ATOM 5481   H HB3  . ALA E  1 35 ? 27.087  6.651   -229.972 1.00 0.00 ?  35 ALA E HB3  1  
ATOM 5482   N N    . ALA E  1 36 ? 28.155  7.902   -226.154 1.00 0.00 ?  36 ALA E N    1  
ATOM 5483   C CA   . ALA E  1 36 ? 28.919  7.929   -224.912 1.00 0.00 ?  36 ALA E CA   1  
ATOM 5484   C C    . ALA E  1 36 ? 27.998  7.928   -223.699 1.00 0.00 ?  36 ALA E C    1  
ATOM 5485   O O    . ALA E  1 36 ? 28.250  7.230   -222.716 1.00 0.00 ?  36 ALA E O    1  
ATOM 5486   C CB   . ALA E  1 36 ? 29.839  9.140   -224.882 1.00 0.00 ?  36 ALA E CB   1  
ATOM 5487   H H    . ALA E  1 36 ? 28.111  8.736   -226.722 1.00 0.00 ?  36 ALA E H    1  
ATOM 5488   H HA   . ALA E  1 36 ? 29.529  7.027   -224.857 1.00 0.00 ?  36 ALA E HA   1  
ATOM 5489   H HB1  . ALA E  1 36 ? 29.245  10.050  -224.951 1.00 0.00 ?  36 ALA E HB1  1  
ATOM 5490   H HB2  . ALA E  1 36 ? 30.402  9.145   -223.948 1.00 0.00 ?  36 ALA E HB2  1  
ATOM 5491   H HB3  . ALA E  1 36 ? 30.532  9.093   -225.722 1.00 0.00 ?  36 ALA E HB3  1  
ATOM 5492   N N    . LYS E  1 37 ? 26.929  8.715   -223.773 1.00 0.00 ?  37 LYS E N    1  
ATOM 5493   C CA   . LYS E  1 37 ? 25.956  8.789   -222.690 1.00 0.00 ?  37 LYS E CA   1  
ATOM 5494   C C    . LYS E  1 37 ? 24.531  8.709   -223.224 1.00 0.00 ?  37 LYS E C    1  
ATOM 5495   O O    . LYS E  1 37 ? 23.843  9.723   -223.338 1.00 0.00 ?  37 LYS E O    1  
ATOM 5496   C CB   . LYS E  1 37 ? 26.145  10.076  -221.886 1.00 0.00 ?  37 LYS E CB   1  
ATOM 5497   C CG   . LYS E  1 37 ? 27.507  10.206  -221.217 1.00 0.00 ?  37 LYS E CG   1  
ATOM 5498   C CD   . LYS E  1 37 ? 27.567  11.432  -220.319 1.00 0.00 ?  37 LYS E CD   1  
ATOM 5499   C CE   . LYS E  1 37 ? 28.946  11.595  -219.695 1.00 0.00 ?  37 LYS E CE   1  
ATOM 5500   N NZ   . LYS E  1 37 ? 29.017  12.785  -218.805 1.00 0.00 1  37 LYS E NZ   1  
ATOM 5501   H H    . LYS E  1 37 ? 26.788  9.276   -224.600 1.00 0.00 ?  37 LYS E H    1  
ATOM 5502   H HA   . LYS E  1 37 ? 26.084  7.938   -222.019 1.00 0.00 ?  37 LYS E HA   1  
ATOM 5503   H HB2  . LYS E  1 37 ? 25.999  10.908  -222.577 1.00 0.00 ?  37 LYS E HB2  1  
ATOM 5504   H HB3  . LYS E  1 37 ? 25.364  10.096  -221.126 1.00 0.00 ?  37 LYS E HB3  1  
ATOM 5505   H HG2  . LYS E  1 37 ? 27.687  9.310   -220.623 1.00 0.00 ?  37 LYS E HG2  1  
ATOM 5506   H HG3  . LYS E  1 37 ? 28.268  10.285  -221.993 1.00 0.00 ?  37 LYS E HG3  1  
ATOM 5507   H HD2  . LYS E  1 37 ? 27.332  12.313  -220.918 1.00 0.00 ?  37 LYS E HD2  1  
ATOM 5508   H HD3  . LYS E  1 37 ? 26.823  11.322  -219.530 1.00 0.00 ?  37 LYS E HD3  1  
ATOM 5509   H HE2  . LYS E  1 37 ? 29.168  10.698  -219.119 1.00 0.00 ?  37 LYS E HE2  1  
ATOM 5510   H HE3  . LYS E  1 37 ? 29.674  11.700  -220.499 1.00 0.00 ?  37 LYS E HE3  1  
ATOM 5511   H HZ1  . LYS E  1 37 ? 28.343  12.689  -218.059 1.00 0.00 ?  37 LYS E HZ1  1  
ATOM 5512   H HZ2  . LYS E  1 37 ? 29.945  12.858  -218.413 1.00 0.00 ?  37 LYS E HZ2  1  
ATOM 5513   H HZ3  . LYS E  1 37 ? 28.811  13.618  -219.339 1.00 0.00 ?  37 LYS E HZ3  1  
ATOM 5514   N N    . PRO E  1 38 ? 24.094  7.497   -223.550 1.00 0.00 ?  38 PRO E N    1  
ATOM 5515   C CA   . PRO E  1 38 ? 22.759  7.286   -224.097 1.00 0.00 ?  38 PRO E CA   1  
ATOM 5516   C C    . PRO E  1 38 ? 21.685  7.768   -223.130 1.00 0.00 ?  38 PRO E C    1  
ATOM 5517   O O    . PRO E  1 38 ? 20.575  8.107   -223.540 1.00 0.00 ?  38 PRO E O    1  
ATOM 5518   C CB   . PRO E  1 38 ? 22.686  5.774   -224.332 1.00 0.00 ?  38 PRO E CB   1  
ATOM 5519   C CG   . PRO E  1 38 ? 24.109  5.349   -224.462 1.00 0.00 ?  38 PRO E CG   1  
ATOM 5520   C CD   . PRO E  1 38 ? 24.877  6.233   -223.516 1.00 0.00 ?  38 PRO E CD   1  
ATOM 5521   H HA   . PRO E  1 38 ? 22.584  7.854   -225.022 1.00 0.00 ?  38 PRO E HA   1  
ATOM 5522   H HB2  . PRO E  1 38 ? 22.192  5.259   -223.495 1.00 0.00 ?  38 PRO E HB2  1  
ATOM 5523   H HB3  . PRO E  1 38 ? 22.115  5.534   -225.241 1.00 0.00 ?  38 PRO E HB3  1  
ATOM 5524   H HG2  . PRO E  1 38 ? 24.233  4.288   -224.200 1.00 0.00 ?  38 PRO E HG2  1  
ATOM 5525   H HG3  . PRO E  1 38 ? 24.468  5.469   -225.495 1.00 0.00 ?  38 PRO E HG3  1  
ATOM 5526   H HD2  . PRO E  1 38 ? 24.922  5.814   -222.500 1.00 0.00 ?  38 PRO E HD2  1  
ATOM 5527   H HD3  . PRO E  1 38 ? 25.915  6.390   -223.844 1.00 0.00 ?  38 PRO E HD3  1  
ATOM 5528   N N    . SER E  1 39 ? 22.022  7.797   -221.845 1.00 0.00 ?  39 SER E N    1  
ATOM 5529   C CA   . SER E  1 39 ? 21.042  8.075   -220.802 1.00 0.00 ?  39 SER E CA   1  
ATOM 5530   C C    . SER E  1 39 ? 20.953  9.569   -220.516 1.00 0.00 ?  39 SER E C    1  
ATOM 5531   O O    . SER E  1 39 ? 20.296  9.990   -219.564 1.00 0.00 ?  39 SER E O    1  
ATOM 5532   C CB   . SER E  1 39 ? 21.395  7.316   -219.539 1.00 0.00 ?  39 SER E CB   1  
ATOM 5533   O OG   . SER E  1 39 ? 22.585  7.777   -218.962 1.00 0.00 ?  39 SER E OG   1  
ATOM 5534   H H    . SER E  1 39 ? 22.982  7.621   -221.585 1.00 0.00 ?  39 SER E H    1  
ATOM 5535   H HA   . SER E  1 39 ? 20.050  7.680   -221.023 1.00 0.00 ?  39 SER E HA   1  
ATOM 5536   H HB2  . SER E  1 39 ? 20.583  7.437   -218.822 1.00 0.00 ?  39 SER E HB2  1  
ATOM 5537   H HB3  . SER E  1 39 ? 21.505  6.260   -219.785 1.00 0.00 ?  39 SER E HB3  1  
ATOM 5538   H HG   . SER E  1 39 ? 23.306  7.671   -219.588 1.00 0.00 ?  39 SER E HG   1  
ATOM 5539   N N    . ASP E  1 40 ? 21.617  10.366  -221.346 1.00 0.00 ?  40 ASP E N    1  
ATOM 5540   C CA   . ASP E  1 40 ? 21.562  11.818  -221.222 1.00 0.00 ?  40 ASP E CA   1  
ATOM 5541   C C    . ASP E  1 40 ? 20.336  12.384  -221.926 1.00 0.00 ?  40 ASP E C    1  
ATOM 5542   O O    . ASP E  1 40 ? 20.214  12.297  -223.148 1.00 0.00 ?  40 ASP E O    1  
ATOM 5543   C CB   . ASP E  1 40 ? 22.834  12.454  -221.788 1.00 0.00 ?  40 ASP E CB   1  
ATOM 5544   C CG   . ASP E  1 40 ? 22.921  13.962  -221.598 1.00 0.00 ?  40 ASP E CG   1  
ATOM 5545   O OD1  . ASP E  1 40 ? 21.964  14.540  -221.140 1.00 0.00 ?  40 ASP E OD1  1  
ATOM 5546   O OD2  . ASP E  1 40 ? 23.990  14.500  -221.763 1.00 0.00 -1 40 ASP E OD2  1  
ATOM 5547   H H    . ASP E  1 40 ? 22.175  9.956   -222.081 1.00 0.00 ?  40 ASP E H    1  
ATOM 5548   H HA   . ASP E  1 40 ? 21.472  12.096  -220.171 1.00 0.00 ?  40 ASP E HA   1  
ATOM 5549   H HB2  . ASP E  1 40 ? 23.751  11.988  -221.426 1.00 0.00 ?  40 ASP E HB2  1  
ATOM 5550   H HB3  . ASP E  1 40 ? 22.705  12.228  -222.847 1.00 0.00 ?  40 ASP E HB3  1  
ATOM 5551   N N    . PRO E  1 41 ? 19.428  12.965  -221.148 1.00 0.00 ?  41 PRO E N    1  
ATOM 5552   C CA   . PRO E  1 41 ? 18.209  13.547  -221.696 1.00 0.00 ?  41 PRO E CA   1  
ATOM 5553   C C    . PRO E  1 41 ? 18.527  14.614  -222.736 1.00 0.00 ?  41 PRO E C    1  
ATOM 5554   O O    . PRO E  1 41 ? 17.818  14.753  -223.733 1.00 0.00 ?  41 PRO E O    1  
ATOM 5555   C CB   . PRO E  1 41 ? 17.491  14.130  -220.475 1.00 0.00 ?  41 PRO E CB   1  
ATOM 5556   C CG   . PRO E  1 41 ? 18.020  13.345  -219.323 1.00 0.00 ?  41 PRO E CG   1  
ATOM 5557   C CD   . PRO E  1 41 ? 19.456  13.051  -219.668 1.00 0.00 ?  41 PRO E CD   1  
ATOM 5558   H HA   . PRO E  1 41 ? 17.587  12.811  -222.226 1.00 0.00 ?  41 PRO E HA   1  
ATOM 5559   H HB2  . PRO E  1 41 ? 17.702  15.203  -220.356 1.00 0.00 ?  41 PRO E HB2  1  
ATOM 5560   H HB3  . PRO E  1 41 ? 16.399  14.023  -220.560 1.00 0.00 ?  41 PRO E HB3  1  
ATOM 5561   H HG2  . PRO E  1 41 ? 17.948  13.916  -218.386 1.00 0.00 ?  41 PRO E HG2  1  
ATOM 5562   H HG3  . PRO E  1 41 ? 17.450  12.416  -219.179 1.00 0.00 ?  41 PRO E HG3  1  
ATOM 5563   H HD2  . PRO E  1 41 ? 20.137  13.845  -219.328 1.00 0.00 ?  41 PRO E HD2  1  
ATOM 5564   H HD3  . PRO E  1 41 ? 19.808  12.112  -219.216 1.00 0.00 ?  41 PRO E HD3  1  
ATOM 5565   N N    . ALA E  1 42 ? 19.597  15.365  -222.498 1.00 0.00 ?  42 ALA E N    1  
ATOM 5566   C CA   . ALA E  1 42 ? 19.983  16.453  -223.389 1.00 0.00 ?  42 ALA E CA   1  
ATOM 5567   C C    . ALA E  1 42 ? 20.435  15.922  -224.743 1.00 0.00 ?  42 ALA E C    1  
ATOM 5568   O O    . ALA E  1 42 ? 20.077  16.468  -225.786 1.00 0.00 ?  42 ALA E O    1  
ATOM 5569   C CB   . ALA E  1 42 ? 21.079  17.295  -222.753 1.00 0.00 ?  42 ALA E CB   1  
ATOM 5570   H H    . ALA E  1 42 ? 20.157  15.178  -221.679 1.00 0.00 ?  42 ALA E H    1  
ATOM 5571   H HA   . ALA E  1 42 ? 19.113  17.087  -223.563 1.00 0.00 ?  42 ALA E HA   1  
ATOM 5572   H HB1  . ALA E  1 42 ? 21.950  16.672  -222.558 1.00 0.00 ?  42 ALA E HB1  1  
ATOM 5573   H HB2  . ALA E  1 42 ? 21.355  18.103  -223.431 1.00 0.00 ?  42 ALA E HB2  1  
ATOM 5574   H HB3  . ALA E  1 42 ? 20.716  17.717  -221.815 1.00 0.00 ?  42 ALA E HB3  1  
ATOM 5575   N N    . LEU E  1 43 ? 21.225  14.854  -224.720 1.00 0.00 ?  43 LEU E N    1  
ATOM 5576   C CA   . LEU E  1 43 ? 21.711  14.233  -225.947 1.00 0.00 ?  43 LEU E CA   1  
ATOM 5577   C C    . LEU E  1 43 ? 20.592  13.496  -226.671 1.00 0.00 ?  43 LEU E C    1  
ATOM 5578   O O    . LEU E  1 43 ? 20.549  13.468  -227.901 1.00 0.00 ?  43 LEU E O    1  
ATOM 5579   C CB   . LEU E  1 43 ? 22.867  13.275  -225.634 1.00 0.00 ?  43 LEU E CB   1  
ATOM 5580   C CG   . LEU E  1 43 ? 24.141  13.942  -225.100 1.00 0.00 ?  43 LEU E CG   1  
ATOM 5581   C CD1  . LEU E  1 43 ? 25.140  12.880  -224.658 1.00 0.00 ?  43 LEU E CD1  1  
ATOM 5582   C CD2  . LEU E  1 43 ? 24.741  14.830  -226.179 1.00 0.00 ?  43 LEU E CD2  1  
ATOM 5583   H H    . LEU E  1 43 ? 21.496  14.462  -223.830 1.00 0.00 ?  43 LEU E H    1  
ATOM 5584   H HA   . LEU E  1 43 ? 22.066  15.004  -226.630 1.00 0.00 ?  43 LEU E HA   1  
ATOM 5585   H HB2  . LEU E  1 43 ? 22.399  12.682  -224.850 1.00 0.00 ?  43 LEU E HB2  1  
ATOM 5586   H HB3  . LEU E  1 43 ? 23.101  12.634  -226.484 1.00 0.00 ?  43 LEU E HB3  1  
ATOM 5587   H HG   . LEU E  1 43 ? 23.847  14.581  -224.267 1.00 0.00 ?  43 LEU E HG   1  
ATOM 5588   H HD11 . LEU E  1 43 ? 26.041  13.363  -224.280 1.00 0.00 ?  43 LEU E HD11 1  
ATOM 5589   H HD12 . LEU E  1 43 ? 24.698  12.271  -223.869 1.00 0.00 ?  43 LEU E HD12 1  
ATOM 5590   H HD13 . LEU E  1 43 ? 25.396  12.247  -225.506 1.00 0.00 ?  43 LEU E HD13 1  
ATOM 5591   H HD21 . LEU E  1 43 ? 24.021  15.599  -226.460 1.00 0.00 ?  43 LEU E HD21 1  
ATOM 5592   H HD22 . LEU E  1 43 ? 25.646  15.304  -225.797 1.00 0.00 ?  43 LEU E HD22 1  
ATOM 5593   H HD23 . LEU E  1 43 ? 24.987  14.227  -227.053 1.00 0.00 ?  43 LEU E HD23 1  
ATOM 5594   N N    . LEU E  1 44 ? 19.689  12.898  -225.901 1.00 0.00 ?  44 LEU E N    1  
ATOM 5595   C CA   . LEU E  1 44 ? 18.540  12.202  -226.468 1.00 0.00 ?  44 LEU E CA   1  
ATOM 5596   C C    . LEU E  1 44 ? 17.607  13.170  -227.184 1.00 0.00 ?  44 LEU E C    1  
ATOM 5597   O O    . LEU E  1 44 ? 17.191  12.924  -228.316 1.00 0.00 ?  44 LEU E O    1  
ATOM 5598   C CB   . LEU E  1 44 ? 17.783  11.447  -225.368 1.00 0.00 ?  44 LEU E CB   1  
ATOM 5599   C CG   . LEU E  1 44 ? 18.458  10.161  -224.875 1.00 0.00 ?  44 LEU E CG   1  
ATOM 5600   C CD1  . LEU E  1 44 ? 17.762  9.653   -223.620 1.00 0.00 ?  44 LEU E CD1  1  
ATOM 5601   C CD2  . LEU E  1 44 ? 18.419  9.112   -225.976 1.00 0.00 ?  44 LEU E CD2  1  
ATOM 5602   H H    . LEU E  1 44 ? 19.801  12.927  -224.898 1.00 0.00 ?  44 LEU E H    1  
ATOM 5603   H HA   . LEU E  1 44 ? 18.879  11.488  -227.217 1.00 0.00 ?  44 LEU E HA   1  
ATOM 5604   H HB2  . LEU E  1 44 ? 17.805  12.204  -224.586 1.00 0.00 ?  44 LEU E HB2  1  
ATOM 5605   H HB3  . LEU E  1 44 ? 16.749  11.249  -225.652 1.00 0.00 ?  44 LEU E HB3  1  
ATOM 5606   H HG   . LEU E  1 44 ? 19.504  10.399  -224.679 1.00 0.00 ?  44 LEU E HG   1  
ATOM 5607   H HD11 . LEU E  1 44 ? 18.248  8.740   -223.278 1.00 0.00 ?  44 LEU E HD11 1  
ATOM 5608   H HD12 . LEU E  1 44 ? 17.823  10.411  -222.838 1.00 0.00 ?  44 LEU E HD12 1  
ATOM 5609   H HD13 . LEU E  1 44 ? 16.716  9.445   -223.844 1.00 0.00 ?  44 LEU E HD13 1  
ATOM 5610   H HD21 . LEU E  1 44 ? 18.946  9.484   -226.854 1.00 0.00 ?  44 LEU E HD21 1  
ATOM 5611   H HD22 . LEU E  1 44 ? 18.900  8.198   -225.625 1.00 0.00 ?  44 LEU E HD22 1  
ATOM 5612   H HD23 . LEU E  1 44 ? 17.382  8.899   -226.239 1.00 0.00 ?  44 LEU E HD23 1  
ATOM 5613   N N    . ALA E  1 45 ? 17.282  14.273  -226.518 1.00 0.00 ?  45 ALA E N    1  
ATOM 5614   C CA   . ALA E  1 45 ? 16.367  15.263  -227.074 1.00 0.00 ?  45 ALA E CA   1  
ATOM 5615   C C    . ALA E  1 45 ? 16.958  15.924  -228.313 1.00 0.00 ?  45 ALA E C    1  
ATOM 5616   O O    . ALA E  1 45 ? 16.282  16.071  -229.332 1.00 0.00 ?  45 ALA E O    1  
ATOM 5617   C CB   . ALA E  1 45 ? 16.017  16.309  -226.026 1.00 0.00 ?  45 ALA E CB   1  
ATOM 5618   H H    . ALA E  1 45 ? 17.679  14.430  -225.602 1.00 0.00 ?  45 ALA E H    1  
ATOM 5619   H HA   . ALA E  1 45 ? 15.451  14.758  -227.381 1.00 0.00 ?  45 ALA E HA   1  
ATOM 5620   H HB1  . ALA E  1 45 ? 16.925  16.812  -225.698 1.00 0.00 ?  45 ALA E HB1  1  
ATOM 5621   H HB2  . ALA E  1 45 ? 15.334  17.040  -226.458 1.00 0.00 ?  45 ALA E HB2  1  
ATOM 5622   H HB3  . ALA E  1 45 ? 15.540  15.826  -225.174 1.00 0.00 ?  45 ALA E HB3  1  
ATOM 5623   N N    . ALA E  1 46 ? 18.222  16.321  -228.219 1.00 0.00 ?  46 ALA E N    1  
ATOM 5624   C CA   . ALA E  1 46 ? 18.902  16.982  -229.327 1.00 0.00 ?  46 ALA E CA   1  
ATOM 5625   C C    . ALA E  1 46 ? 19.039  16.050  -230.524 1.00 0.00 ?  46 ALA E C    1  
ATOM 5626   O O    . ALA E  1 46 ? 18.732  16.427  -231.655 1.00 0.00 ?  46 ALA E O    1  
ATOM 5627   C CB   . ALA E  1 46 ? 20.267  17.487  -228.885 1.00 0.00 ?  46 ALA E CB   1  
ATOM 5628   H H    . ALA E  1 46 ? 18.725  16.161  -227.358 1.00 0.00 ?  46 ALA E H    1  
ATOM 5629   H HA   . ALA E  1 46 ? 18.302  17.835  -229.646 1.00 0.00 ?  46 ALA E HA   1  
ATOM 5630   H HB1  . ALA E  1 46 ? 20.874  16.648  -228.548 1.00 0.00 ?  46 ALA E HB1  1  
ATOM 5631   H HB2  . ALA E  1 46 ? 20.761  17.978  -229.724 1.00 0.00 ?  46 ALA E HB2  1  
ATOM 5632   H HB3  . ALA E  1 46 ? 20.146  18.199  -228.069 1.00 0.00 ?  46 ALA E HB3  1  
ATOM 5633   N N    . TYR E  1 47 ? 19.501  14.831  -230.268 1.00 0.00 ?  47 TYR E N    1  
ATOM 5634   C CA   . TYR E  1 47 ? 19.723  13.858  -231.331 1.00 0.00 ?  47 TYR E CA   1  
ATOM 5635   C C    . TYR E  1 47 ? 18.414  13.473  -232.007 1.00 0.00 ?  47 TYR E C    1  
ATOM 5636   O O    . TYR E  1 47 ? 18.315  13.473  -233.234 1.00 0.00 ?  47 TYR E O    1  
ATOM 5637   C CB   . TYR E  1 47 ? 20.415  12.610  -230.777 1.00 0.00 ?  47 TYR E CB   1  
ATOM 5638   C CG   . TYR E  1 47 ? 20.519  11.475  -231.771 1.00 0.00 ?  47 TYR E CG   1  
ATOM 5639   C CD1  . TYR E  1 47 ? 21.239  11.621  -232.948 1.00 0.00 ?  47 TYR E CD1  1  
ATOM 5640   C CD2  . TYR E  1 47 ? 19.897  10.259  -231.529 1.00 0.00 ?  47 TYR E CD2  1  
ATOM 5641   C CE1  . TYR E  1 47 ? 21.337  10.588  -233.859 1.00 0.00 ?  47 TYR E CE1  1  
ATOM 5642   C CE2  . TYR E  1 47 ? 19.989  9.218   -232.433 1.00 0.00 ?  47 TYR E CE2  1  
ATOM 5643   C CZ   . TYR E  1 47 ? 20.710  9.387   -233.598 1.00 0.00 ?  47 TYR E CZ   1  
ATOM 5644   O OH   . TYR E  1 47 ? 20.805  8.353   -234.501 1.00 0.00 ?  47 TYR E OH   1  
ATOM 5645   H H    . TYR E  1 47 ? 19.704  14.572  -229.313 1.00 0.00 ?  47 TYR E H    1  
ATOM 5646   H HA   . TYR E  1 47 ? 20.357  14.292  -232.104 1.00 0.00 ?  47 TYR E HA   1  
ATOM 5647   H HB2  . TYR E  1 47 ? 21.415  12.909  -230.461 1.00 0.00 ?  47 TYR E HB2  1  
ATOM 5648   H HB3  . TYR E  1 47 ? 19.842  12.282  -229.910 1.00 0.00 ?  47 TYR E HB3  1  
ATOM 5649   H HD1  . TYR E  1 47 ? 21.732  12.573  -233.147 1.00 0.00 ?  47 TYR E HD1  1  
ATOM 5650   H HD2  . TYR E  1 47 ? 19.329  10.132  -230.608 1.00 0.00 ?  47 TYR E HD2  1  
ATOM 5651   H HE1  . TYR E  1 47 ? 21.906  10.717  -234.780 1.00 0.00 ?  47 TYR E HE1  1  
ATOM 5652   H HE2  . TYR E  1 47 ? 19.492  8.270   -232.226 1.00 0.00 ?  47 TYR E HE2  1  
ATOM 5653   H HH   . TYR E  1 47 ? 20.333  7.565   -234.221 1.00 0.00 ?  47 TYR E HH   1  
ATOM 5654   N N    . GLN E  1 48 ? 17.411  13.144  -231.200 1.00 0.00 ?  48 GLN E N    1  
ATOM 5655   C CA   . GLN E  1 48 ? 16.124  12.697  -231.720 1.00 0.00 ?  48 GLN E CA   1  
ATOM 5656   C C    . GLN E  1 48 ? 15.429  13.806  -232.498 1.00 0.00 ?  48 GLN E C    1  
ATOM 5657   O O    . GLN E  1 48 ? 14.798  13.556  -233.525 1.00 0.00 ?  48 GLN E O    1  
ATOM 5658   C CB   . GLN E  1 48 ? 15.221  12.223  -230.579 1.00 0.00 ?  48 GLN E CB   1  
ATOM 5659   C CG   . GLN E  1 48 ? 13.945  11.538  -231.038 1.00 0.00 ?  48 GLN E CG   1  
ATOM 5660   C CD   . GLN E  1 48 ? 12.868  12.529  -231.438 1.00 0.00 ?  48 GLN E CD   1  
ATOM 5661   O OE1  . GLN E  1 48 ? 12.730  13.595  -230.831 1.00 0.00 ?  48 GLN E OE1  1  
ATOM 5662   N NE2  . GLN E  1 48 ? 12.095  12.182  -232.460 1.00 0.00 ?  48 GLN E NE2  1  
ATOM 5663   H H    . GLN E  1 48 ? 17.544  13.205  -230.201 1.00 0.00 ?  48 GLN E H    1  
ATOM 5664   H HA   . GLN E  1 48 ? 16.279  11.876  -232.421 1.00 0.00 ?  48 GLN E HA   1  
ATOM 5665   H HB2  . GLN E  1 48 ? 15.812  11.534  -229.974 1.00 0.00 ?  48 GLN E HB2  1  
ATOM 5666   H HB3  . GLN E  1 48 ? 14.973  13.103  -229.986 1.00 0.00 ?  48 GLN E HB3  1  
ATOM 5667   H HG2  . GLN E  1 48 ? 13.939  10.727  -231.766 1.00 0.00 ?  48 GLN E HG2  1  
ATOM 5668   H HG3  . GLN E  1 48 ? 13.699  11.141  -230.052 1.00 0.00 ?  48 GLN E HG3  1  
ATOM 5669   H HE21 . GLN E  1 48 ? 12.241  11.307  -232.923 1.00 0.00 ?  48 GLN E HE21 1  
ATOM 5670   H HE22 . GLN E  1 48 ? 11.367  12.796  -232.769 1.00 0.00 ?  48 GLN E HE22 1  
ATOM 5671   N N    . SER E  1 49 ? 15.549  15.034  -232.004 1.00 0.00 ?  49 SER E N    1  
ATOM 5672   C CA   . SER E  1 49 ? 14.975  16.191  -232.679 1.00 0.00 ?  49 SER E CA   1  
ATOM 5673   C C    . SER E  1 49 ? 15.601  16.394  -234.053 1.00 0.00 ?  49 SER E C    1  
ATOM 5674   O O    . SER E  1 49 ? 14.902  16.660  -235.031 1.00 0.00 ?  49 SER E O    1  
ATOM 5675   C CB   . SER E  1 49 ? 15.154  17.434  -231.829 1.00 0.00 ?  49 SER E CB   1  
ATOM 5676   O OG   . SER E  1 49 ? 14.666  18.583  -232.466 1.00 0.00 ?  49 SER E OG   1  
ATOM 5677   H H    . SER E  1 49 ? 16.050  15.168  -231.137 1.00 0.00 ?  49 SER E H    1  
ATOM 5678   H HA   . SER E  1 49 ? 13.889  16.146  -232.769 1.00 0.00 ?  49 SER E HA   1  
ATOM 5679   H HB2  . SER E  1 49 ? 14.619  17.294  -230.890 1.00 0.00 ?  49 SER E HB2  1  
ATOM 5680   H HB3  . SER E  1 49 ? 16.216  17.567  -231.624 1.00 0.00 ?  49 SER E HB3  1  
ATOM 5681   H HG   . SER E  1 49 ? 15.155  18.731  -233.278 1.00 0.00 ?  49 SER E HG   1  
ATOM 5682   N N    . LYS E  1 50 ? 16.922  16.265  -234.121 1.00 0.00 ?  50 LYS E N    1  
ATOM 5683   C CA   . LYS E  1 50 ? 17.643  16.425  -235.377 1.00 0.00 ?  50 LYS E CA   1  
ATOM 5684   C C    . LYS E  1 50 ? 17.534  15.173  -236.238 1.00 0.00 ?  50 LYS E C    1  
ATOM 5685   O O    . LYS E  1 50 ? 17.698  15.231  -237.457 1.00 0.00 ?  50 LYS E O    1  
ATOM 5686   C CB   . LYS E  1 50 ? 19.113  16.755  -235.112 1.00 0.00 ?  50 LYS E CB   1  
ATOM 5687   C CG   . LYS E  1 50 ? 19.346  18.109  -234.456 1.00 0.00 ?  50 LYS E CG   1  
ATOM 5688   C CD   . LYS E  1 50 ? 20.825  18.348  -234.189 1.00 0.00 ?  50 LYS E CD   1  
ATOM 5689   C CE   . LYS E  1 50 ? 21.050  19.661  -233.454 1.00 0.00 ?  50 LYS E CE   1  
ATOM 5690   N NZ   . LYS E  1 50 ? 20.566  20.829  -234.240 1.00 0.00 1  50 LYS E NZ   1  
ATOM 5691   H H    . LYS E  1 50 ? 17.439  16.051  -233.280 1.00 0.00 ?  50 LYS E H    1  
ATOM 5692   H HA   . LYS E  1 50 ? 17.203  17.239  -235.955 1.00 0.00 ?  50 LYS E HA   1  
ATOM 5693   H HB2  . LYS E  1 50 ? 19.506  15.967  -234.468 1.00 0.00 ?  50 LYS E HB2  1  
ATOM 5694   H HB3  . LYS E  1 50 ? 19.626  16.726  -236.074 1.00 0.00 ?  50 LYS E HB3  1  
ATOM 5695   H HG2  . LYS E  1 50 ? 18.966  18.886  -235.121 1.00 0.00 ?  50 LYS E HG2  1  
ATOM 5696   H HG3  . LYS E  1 50 ? 18.797  18.137  -233.515 1.00 0.00 ?  50 LYS E HG3  1  
ATOM 5697   H HD2  . LYS E  1 50 ? 21.206  17.523  -233.586 1.00 0.00 ?  50 LYS E HD2  1  
ATOM 5698   H HD3  . LYS E  1 50 ? 21.351  18.372  -235.143 1.00 0.00 ?  50 LYS E HD3  1  
ATOM 5699   H HE2  . LYS E  1 50 ? 20.519  19.618  -232.505 1.00 0.00 ?  50 LYS E HE2  1  
ATOM 5700   H HE3  . LYS E  1 50 ? 22.118  19.769  -233.267 1.00 0.00 ?  50 LYS E HE3  1  
ATOM 5701   H HZ1  . LYS E  1 50 ? 19.576  20.731  -234.413 1.00 0.00 ?  50 LYS E HZ1  1  
ATOM 5702   H HZ2  . LYS E  1 50 ? 20.734  21.678  -233.719 1.00 0.00 ?  50 LYS E HZ2  1  
ATOM 5703   H HZ3  . LYS E  1 50 ? 21.060  20.871  -235.121 1.00 0.00 ?  50 LYS E HZ3  1  
ATOM 5704   N N    . LEU E  1 51 ? 17.257  14.043  -235.598 1.00 0.00 ?  51 LEU E N    1  
ATOM 5705   C CA   . LEU E  1 51 ? 17.100  12.779  -236.307 1.00 0.00 ?  51 LEU E CA   1  
ATOM 5706   C C    . LEU E  1 51 ? 15.767  12.721  -237.041 1.00 0.00 ?  51 LEU E C    1  
ATOM 5707   O O    . LEU E  1 51 ? 15.678  12.189  -238.147 1.00 0.00 ?  51 LEU E O    1  
ATOM 5708   C CB   . LEU E  1 51 ? 17.223  11.603  -235.330 1.00 0.00 ?  51 LEU E CB   1  
ATOM 5709   C CG   . LEU E  1 51 ? 17.249  10.214  -235.979 1.00 0.00 ?  51 LEU E CG   1  
ATOM 5710   C CD1  . LEU E  1 51 ? 18.492  10.066  -236.846 1.00 0.00 ?  51 LEU E CD1  1  
ATOM 5711   C CD2  . LEU E  1 51 ? 17.217  9.146   -234.896 1.00 0.00 ?  51 LEU E CD2  1  
ATOM 5712   H H    . LEU E  1 51 ? 17.153  14.060  -234.593 1.00 0.00 ?  51 LEU E H    1  
ATOM 5713   H HA   . LEU E  1 51 ? 17.875  12.688  -237.068 1.00 0.00 ?  51 LEU E HA   1  
ATOM 5714   H HB2  . LEU E  1 51 ? 18.196  11.833  -234.898 1.00 0.00 ?  51 LEU E HB2  1  
ATOM 5715   H HB3  . LEU E  1 51 ? 16.462  11.645  -234.551 1.00 0.00 ?  51 LEU E HB3  1  
ATOM 5716   H HG   . LEU E  1 51 ? 16.339  10.116  -236.571 1.00 0.00 ?  51 LEU E HG   1  
ATOM 5717   H HD11 . LEU E  1 51 ? 18.502  9.077   -237.303 1.00 0.00 ?  51 LEU E HD11 1  
ATOM 5718   H HD12 . LEU E  1 51 ? 18.483  10.826  -237.628 1.00 0.00 ?  51 LEU E HD12 1  
ATOM 5719   H HD13 . LEU E  1 51 ? 19.382  10.190  -236.230 1.00 0.00 ?  51 LEU E HD13 1  
ATOM 5720   H HD21 . LEU E  1 51 ? 16.307  9.252   -234.306 1.00 0.00 ?  51 LEU E HD21 1  
ATOM 5721   H HD22 . LEU E  1 51 ? 17.235  8.158   -235.360 1.00 0.00 ?  51 LEU E HD22 1  
ATOM 5722   H HD23 . LEU E  1 51 ? 18.085  9.258   -234.247 1.00 0.00 ?  51 LEU E HD23 1  
ATOM 5723   N N    . SER E  1 52 ? 14.730  13.272  -236.418 1.00 0.00 ?  52 SER E N    1  
ATOM 5724   C CA   . SER E  1 52 ? 13.418  13.364  -237.048 1.00 0.00 ?  52 SER E CA   1  
ATOM 5725   C C    . SER E  1 52 ? 13.455  14.278  -238.266 1.00 0.00 ?  52 SER E C    1  
ATOM 5726   O O    . SER E  1 52 ? 12.646  14.139  -239.183 1.00 0.00 ?  52 SER E O    1  
ATOM 5727   C CB   . SER E  1 52 ? 12.393  13.860  -236.047 1.00 0.00 ?  52 SER E CB   1  
ATOM 5728   O OG   . SER E  1 52 ? 12.612  15.196  -235.686 1.00 0.00 ?  52 SER E OG   1  
ATOM 5729   H H    . SER E  1 52 ? 14.854  13.636  -235.484 1.00 0.00 ?  52 SER E H    1  
ATOM 5730   H HA   . SER E  1 52 ? 13.001  12.395  -237.323 1.00 0.00 ?  52 SER E HA   1  
ATOM 5731   H HB2  . SER E  1 52 ? 11.402  13.771  -236.492 1.00 0.00 ?  52 SER E HB2  1  
ATOM 5732   H HB3  . SER E  1 52 ? 12.446  13.238  -235.155 1.00 0.00 ?  52 SER E HB3  1  
ATOM 5733   H HG   . SER E  1 52 ? 11.944  15.470  -235.053 1.00 0.00 ?  52 SER E HG   1  
ATOM 5734   N N    . GLU E  1 53 ? 14.400  15.212  -238.270 1.00 0.00 ?  53 GLU E N    1  
ATOM 5735   C CA   . GLU E  1 53 ? 14.682  16.011  -239.457 1.00 0.00 ?  53 GLU E CA   1  
ATOM 5736   C C    . GLU E  1 53 ? 15.558  15.246  -240.440 1.00 0.00 ?  53 GLU E C    1  
ATOM 5737   O O    . GLU E  1 53 ? 15.368  15.334  -241.654 1.00 0.00 ?  53 GLU E O    1  
ATOM 5738   C CB   . GLU E  1 53 ? 15.355  17.329  -239.068 1.00 0.00 ?  53 GLU E CB   1  
ATOM 5739   C CG   . GLU E  1 53 ? 14.452  18.300  -238.321 1.00 0.00 ?  53 GLU E CG   1  
ATOM 5740   C CD   . GLU E  1 53 ? 15.205  19.530  -237.896 1.00 0.00 ?  53 GLU E CD   1  
ATOM 5741   O OE1  . GLU E  1 53 ? 16.406  19.539  -238.016 1.00 0.00 ?  53 GLU E OE1  1  
ATOM 5742   O OE2  . GLU E  1 53 ? 14.572  20.502  -237.556 1.00 0.00 -1 53 GLU E OE2  1  
ATOM 5743   H H    . GLU E  1 53 ? 14.936  15.373  -237.430 1.00 0.00 ?  53 GLU E H    1  
ATOM 5744   H HA   . GLU E  1 53 ? 13.752  16.237  -239.980 1.00 0.00 ?  53 GLU E HA   1  
ATOM 5745   H HB2  . GLU E  1 53 ? 16.211  17.077  -238.442 1.00 0.00 ?  53 GLU E HB2  1  
ATOM 5746   H HB3  . GLU E  1 53 ? 15.704  17.794  -239.990 1.00 0.00 ?  53 GLU E HB3  1  
ATOM 5747   H HG2  . GLU E  1 53 ? 13.569  18.594  -238.888 1.00 0.00 ?  53 GLU E HG2  1  
ATOM 5748   H HG3  . GLU E  1 53 ? 14.146  17.739  -237.439 1.00 0.00 ?  53 GLU E HG3  1  
ATOM 5749   N N    . TYR E  1 54 ? 16.519  14.497  -239.910 1.00 0.00 ?  54 TYR E N    1  
ATOM 5750   C CA   . TYR E  1 54 ? 17.386  13.666  -240.737 1.00 0.00 ?  54 TYR E CA   1  
ATOM 5751   C C    . TYR E  1 54 ? 16.588  12.589  -241.463 1.00 0.00 ?  54 TYR E C    1  
ATOM 5752   O O    . TYR E  1 54 ? 17.015  12.079  -242.498 1.00 0.00 ?  54 TYR E O    1  
ATOM 5753   C CB   . TYR E  1 54 ? 18.481  13.022  -239.884 1.00 0.00 ?  54 TYR E CB   1  
ATOM 5754   C CG   . TYR E  1 54 ? 19.494  12.231  -240.682 1.00 0.00 ?  54 TYR E CG   1  
ATOM 5755   C CD1  . TYR E  1 54 ? 20.427  12.872  -241.484 1.00 0.00 ?  54 TYR E CD1  1  
ATOM 5756   C CD2  . TYR E  1 54 ? 19.516  10.845  -240.630 1.00 0.00 ?  54 TYR E CD2  1  
ATOM 5757   C CE1  . TYR E  1 54 ? 21.354  12.155  -242.216 1.00 0.00 ?  54 TYR E CE1  1  
ATOM 5758   C CE2  . TYR E  1 54 ? 20.438  10.118  -241.356 1.00 0.00 ?  54 TYR E CE2  1  
ATOM 5759   C CZ   . TYR E  1 54 ? 21.356  10.777  -242.148 1.00 0.00 ?  54 TYR E CZ   1  
ATOM 5760   O OH   . TYR E  1 54 ? 22.278  10.057  -242.873 1.00 0.00 ?  54 TYR E OH   1  
ATOM 5761   H H    . TYR E  1 54 ? 16.652  14.503  -238.909 1.00 0.00 ?  54 TYR E H    1  
ATOM 5762   H HA   . TYR E  1 54 ? 17.858  14.275  -241.508 1.00 0.00 ?  54 TYR E HA   1  
ATOM 5763   H HB2  . TYR E  1 54 ? 18.988  13.826  -239.349 1.00 0.00 ?  54 TYR E HB2  1  
ATOM 5764   H HB3  . TYR E  1 54 ? 17.988  12.363  -239.170 1.00 0.00 ?  54 TYR E HB3  1  
ATOM 5765   H HD1  . TYR E  1 54 ? 20.419  13.961  -241.533 1.00 0.00 ?  54 TYR E HD1  1  
ATOM 5766   H HD2  . TYR E  1 54 ? 18.788  10.331  -240.002 1.00 0.00 ?  54 TYR E HD2  1  
ATOM 5767   H HE1  . TYR E  1 54 ? 22.080  12.672  -242.842 1.00 0.00 ?  54 TYR E HE1  1  
ATOM 5768   H HE2  . TYR E  1 54 ? 20.438  9.029   -241.302 1.00 0.00 ?  54 TYR E HE2  1  
ATOM 5769   H HH   . TYR E  1 54 ? 22.607  9.287   -242.403 1.00 0.00 ?  54 TYR E HH   1  
ATOM 5770   N N    . ASN E  1 55 ? 15.428  12.248  -240.913 1.00 0.00 ?  55 ASN E N    1  
ATOM 5771   C CA   . ASN E  1 55 ? 14.497  11.349  -241.584 1.00 0.00 ?  55 ASN E CA   1  
ATOM 5772   C C    . ASN E  1 55 ? 14.086  11.896  -242.945 1.00 0.00 ?  55 ASN E C    1  
ATOM 5773   O O    . ASN E  1 55 ? 13.952  11.146  -243.912 1.00 0.00 ?  55 ASN E O    1  
ATOM 5774   C CB   . ASN E  1 55 ? 13.269  11.084  -240.732 1.00 0.00 ?  55 ASN E CB   1  
ATOM 5775   C CG   . ASN E  1 55 ? 13.530  10.183  -239.557 1.00 0.00 ?  55 ASN E CG   1  
ATOM 5776   O OD1  . ASN E  1 55 ? 14.522  9.447   -239.522 1.00 0.00 ?  55 ASN E OD1  1  
ATOM 5777   N ND2  . ASN E  1 55 ? 12.603  10.178  -238.633 1.00 0.00 ?  55 ASN E ND2  1  
ATOM 5778   H H    . ASN E  1 55 ? 15.184  12.622  -240.007 1.00 0.00 ?  55 ASN E H    1  
ATOM 5779   H HA   . ASN E  1 55 ? 14.980  10.388  -241.770 1.00 0.00 ?  55 ASN E HA   1  
ATOM 5780   H HB2  . ASN E  1 55 ? 12.620  11.903  -240.418 1.00 0.00 ?  55 ASN E HB2  1  
ATOM 5781   H HB3  . ASN E  1 55 ? 12.773  10.508  -241.513 1.00 0.00 ?  55 ASN E HB3  1  
ATOM 5782   H HD21 . ASN E  1 55 ? 11.790  10.749  -238.738 1.00 0.00 ?  55 ASN E HD21 1  
ATOM 5783   H HD22 . ASN E  1 55 ? 12.710  9.602   -237.822 1.00 0.00 ?  55 ASN E HD22 1  
ATOM 5784   N N    . LEU E  1 56 ? 13.887  13.208  -243.014 1.00 0.00 ?  56 LEU E N    1  
ATOM 5785   C CA   . LEU E  1 56 ? 13.517  13.862  -244.263 1.00 0.00 ?  56 LEU E CA   1  
ATOM 5786   C C    . LEU E  1 56 ? 14.744  14.155  -245.117 1.00 0.00 ?  56 LEU E C    1  
ATOM 5787   O O    . LEU E  1 56 ? 14.650  14.260  -246.340 1.00 0.00 ?  56 LEU E O    1  
ATOM 5788   C CB   . LEU E  1 56 ? 12.746  15.157  -243.975 1.00 0.00 ?  56 LEU E CB   1  
ATOM 5789   C CG   . LEU E  1 56 ? 11.403  14.971  -243.256 1.00 0.00 ?  56 LEU E CG   1  
ATOM 5790   C CD1  . LEU E  1 56 ? 10.750  16.325  -243.013 1.00 0.00 ?  56 LEU E CD1  1  
ATOM 5791   C CD2  . LEU E  1 56 ? 10.498  14.078  -244.092 1.00 0.00 ?  56 LEU E CD2  1  
ATOM 5792   H H    . LEU E  1 56 ? 13.995  13.767  -242.179 1.00 0.00 ?  56 LEU E H    1  
ATOM 5793   H HA   . LEU E  1 56 ? 12.883  13.197  -244.849 1.00 0.00 ?  56 LEU E HA   1  
ATOM 5794   H HB2  . LEU E  1 56 ? 13.460  15.644  -243.313 1.00 0.00 ?  56 LEU E HB2  1  
ATOM 5795   H HB3  . LEU E  1 56 ? 12.616  15.758  -244.875 1.00 0.00 ?  56 LEU E HB3  1  
ATOM 5796   H HG   . LEU E  1 56 ? 11.607  14.455  -242.318 1.00 0.00 ?  56 LEU E HG   1  
ATOM 5797   H HD11 . LEU E  1 56 ? 9.797   16.183  -242.503 1.00 0.00 ?  56 LEU E HD11 1  
ATOM 5798   H HD12 . LEU E  1 56 ? 11.404  16.939  -242.394 1.00 0.00 ?  56 LEU E HD12 1  
ATOM 5799   H HD13 . LEU E  1 56 ? 10.579  16.823  -243.967 1.00 0.00 ?  56 LEU E HD13 1  
ATOM 5800   H HD21 . LEU E  1 56 ? 10.973  13.106  -244.230 1.00 0.00 ?  56 LEU E HD21 1  
ATOM 5801   H HD22 . LEU E  1 56 ? 9.545   13.946  -243.580 1.00 0.00 ?  56 LEU E HD22 1  
ATOM 5802   H HD23 . LEU E  1 56 ? 10.328  14.540  -245.065 1.00 0.00 ?  56 LEU E HD23 1  
ATOM 5803   N N    . TYR E  1 57 ? 15.894  14.286  -244.465 1.00 0.00 ?  57 TYR E N    1  
ATOM 5804   C CA   . TYR E  1 57 ? 17.162  14.429  -245.170 1.00 0.00 ?  57 TYR E CA   1  
ATOM 5805   C C    . TYR E  1 57 ? 17.314  13.368  -246.253 1.00 0.00 ?  57 TYR E C    1  
ATOM 5806   O O    . TYR E  1 57 ? 17.887  13.625  -247.311 1.00 0.00 ?  57 TYR E O    1  
ATOM 5807   C CB   . TYR E  1 57 ? 18.333  14.349  -244.188 1.00 0.00 ?  57 TYR E CB   1  
ATOM 5808   C CG   . TYR E  1 57 ? 19.686  14.569  -244.828 1.00 0.00 ?  57 TYR E CG   1  
ATOM 5809   C CD1  . TYR E  1 57 ? 20.153  15.850  -245.084 1.00 0.00 ?  57 TYR E CD1  1  
ATOM 5810   C CD2  . TYR E  1 57 ? 20.493  13.495  -245.172 1.00 0.00 ?  57 TYR E CD2  1  
ATOM 5811   C CE1  . TYR E  1 57 ? 21.388  16.057  -245.668 1.00 0.00 ?  57 TYR E CE1  1  
ATOM 5812   C CE2  . TYR E  1 57 ? 21.729  13.690  -245.756 1.00 0.00 ?  57 TYR E CE2  1  
ATOM 5813   C CZ   . TYR E  1 57 ? 22.174  14.973  -246.003 1.00 0.00 ?  57 TYR E CZ   1  
ATOM 5814   O OH   . TYR E  1 57 ? 23.405  15.172  -246.584 1.00 0.00 ?  57 TYR E OH   1  
ATOM 5815   H H    . TYR E  1 57 ? 15.890  14.286  -243.455 1.00 0.00 ?  57 TYR E H    1  
ATOM 5816   H HA   . TYR E  1 57 ? 17.197  15.395  -245.675 1.00 0.00 ?  57 TYR E HA   1  
ATOM 5817   H HB2  . TYR E  1 57 ? 18.165  15.107  -243.422 1.00 0.00 ?  57 TYR E HB2  1  
ATOM 5818   H HB3  . TYR E  1 57 ? 18.303  13.359  -243.732 1.00 0.00 ?  57 TYR E HB3  1  
ATOM 5819   H HD1  . TYR E  1 57 ? 19.527  16.701  -244.816 1.00 0.00 ?  57 TYR E HD1  1  
ATOM 5820   H HD2  . TYR E  1 57 ? 20.136  12.484  -244.975 1.00 0.00 ?  57 TYR E HD2  1  
ATOM 5821   H HE1  . TYR E  1 57 ? 21.742  17.069  -245.864 1.00 0.00 ?  57 TYR E HE1  1  
ATOM 5822   H HE2  . TYR E  1 57 ? 22.349  12.832  -246.021 1.00 0.00 ?  57 TYR E HE2  1  
ATOM 5823   H HH   . TYR E  1 57 ? 24.087  14.600  -246.224 1.00 0.00 ?  57 TYR E HH   1  
ATOM 5824   N N    . ARG E  1 58 ? 16.796  12.175  -245.981 1.00 0.00 ?  58 ARG E N    1  
ATOM 5825   C CA   . ARG E  1 58 ? 16.845  11.082  -246.944 1.00 0.00 ?  58 ARG E CA   1  
ATOM 5826   C C    . ARG E  1 58 ? 15.519  10.935  -247.678 1.00 0.00 ?  58 ARG E C    1  
ATOM 5827   O O    . ARG E  1 58 ? 15.487  10.803  -248.902 1.00 0.00 ?  58 ARG E O    1  
ATOM 5828   C CB   . ARG E  1 58 ? 17.275  9.771   -246.303 1.00 0.00 ?  58 ARG E CB   1  
ATOM 5829   C CG   . ARG E  1 58 ? 18.603  9.825   -245.564 1.00 0.00 ?  58 ARG E CG   1  
ATOM 5830   C CD   . ARG E  1 58 ? 19.791  9.947   -246.448 1.00 0.00 ?  58 ARG E CD   1  
ATOM 5831   N NE   . ARG E  1 58 ? 21.061  10.010  -245.744 1.00 0.00 ?  58 ARG E NE   1  
ATOM 5832   C CZ   . ARG E  1 58 ? 22.261  10.146  -246.342 1.00 0.00 ?  58 ARG E CZ   1  
ATOM 5833   N NH1  . ARG E  1 58 ? 22.364  10.196  -247.652 1.00 0.00 1  58 ARG E NH1  1  
ATOM 5834   N NH2  . ARG E  1 58 ? 23.337  10.204  -245.576 1.00 0.00 ?  58 ARG E NH2  1  
ATOM 5835   H H    . ARG E  1 58 ? 16.357  12.022  -245.084 1.00 0.00 ?  58 ARG E H    1  
ATOM 5836   H HA   . ARG E  1 58 ? 17.599  11.293  -247.704 1.00 0.00 ?  58 ARG E HA   1  
ATOM 5837   H HB2  . ARG E  1 58 ? 16.488  9.484   -245.607 1.00 0.00 ?  58 ARG E HB2  1  
ATOM 5838   H HB3  . ARG E  1 58 ? 17.340  9.032   -247.102 1.00 0.00 ?  58 ARG E HB3  1  
ATOM 5839   H HG2  . ARG E  1 58 ? 18.593  10.686  -244.895 1.00 0.00 ?  58 ARG E HG2  1  
ATOM 5840   H HG3  . ARG E  1 58 ? 18.711  8.912   -244.979 1.00 0.00 ?  58 ARG E HG3  1  
ATOM 5841   H HD2  . ARG E  1 58 ? 19.828  9.084   -247.112 1.00 0.00 ?  58 ARG E HD2  1  
ATOM 5842   H HD3  . ARG E  1 58 ? 19.699  10.857  -247.040 1.00 0.00 ?  58 ARG E HD3  1  
ATOM 5843   H HE   . ARG E  1 58 ? 21.251  9.966   -244.752 1.00 0.00 ?  58 ARG E HE   1  
ATOM 5844   H HH11 . ARG E  1 58 ? 21.533  10.132  -248.223 1.00 0.00 ?  58 ARG E HH11 1  
ATOM 5845   H HH12 . ARG E  1 58 ? 23.272  10.298  -248.080 1.00 0.00 ?  58 ARG E HH12 1  
ATOM 5846   H HH21 . ARG E  1 58 ? 23.242  10.147  -244.572 1.00 0.00 ?  58 ARG E HH21 1  
ATOM 5847   H HH22 . ARG E  1 58 ? 24.248  10.306  -245.998 1.00 0.00 ?  58 ARG E HH22 1  
ATOM 5848   N N    . ASN E  1 59 ? 14.425  10.957  -246.924 1.00 0.00 ?  59 ASN E N    1  
ATOM 5849   C CA   . ASN E  1 59 ? 13.101  10.719  -247.487 1.00 0.00 ?  59 ASN E CA   1  
ATOM 5850   C C    . ASN E  1 59 ? 12.715  11.817  -248.470 1.00 0.00 ?  59 ASN E C    1  
ATOM 5851   O O    . ASN E  1 59 ? 12.499  11.556  -249.653 1.00 0.00 ?  59 ASN E O    1  
ATOM 5852   C CB   . ASN E  1 59 ? 12.050  10.595  -246.399 1.00 0.00 ?  59 ASN E CB   1  
ATOM 5853   C CG   . ASN E  1 59 ? 10.729  10.071  -246.891 1.00 0.00 ?  59 ASN E CG   1  
ATOM 5854   O OD1  . ASN E  1 59 ? 10.443  10.082  -248.094 1.00 0.00 ?  59 ASN E OD1  1  
ATOM 5855   N ND2  . ASN E  1 59 ? 9.892   9.688   -245.961 1.00 0.00 ?  59 ASN E ND2  1  
ATOM 5856   H H    . ASN E  1 59 ? 14.513  11.144  -245.936 1.00 0.00 ?  59 ASN E H    1  
ATOM 5857   H HA   . ASN E  1 59 ? 13.101  9.785   -248.051 1.00 0.00 ?  59 ASN E HA   1  
ATOM 5858   H HB2  . ASN E  1 59 ? 12.288  10.126  -245.444 1.00 0.00 ?  59 ASN E HB2  1  
ATOM 5859   H HB3  . ASN E  1 59 ? 11.971  11.674  -246.264 1.00 0.00 ?  59 ASN E HB3  1  
ATOM 5860   H HD21 . ASN E  1 59 ? 10.150  9.755   -244.997 1.00 0.00 ?  59 ASN E HD21 1  
ATOM 5861   H HD22 . ASN E  1 59 ? 8.994   9.328   -246.215 1.00 0.00 ?  59 ASN E HD22 1  
ATOM 5862   N N    . ALA E  1 60 ? 12.630  13.046  -247.973 1.00 0.00 ?  60 ALA E N    1  
ATOM 5863   C CA   . ALA E  1 60 ? 12.206  14.176  -248.791 1.00 0.00 ?  60 ALA E CA   1  
ATOM 5864   C C    . ALA E  1 60 ? 13.173  14.414  -249.944 1.00 0.00 ?  60 ALA E C    1  
ATOM 5865   O O    . ALA E  1 60 ? 12.765  14.805  -251.038 1.00 0.00 ?  60 ALA E O    1  
ATOM 5866   C CB   . ALA E  1 60 ? 12.076  15.429  -247.938 1.00 0.00 ?  60 ALA E CB   1  
ATOM 5867   H H    . ALA E  1 60 ? 12.864  13.202  -247.003 1.00 0.00 ?  60 ALA E H    1  
ATOM 5868   H HA   . ALA E  1 60 ? 11.233  13.948  -249.225 1.00 0.00 ?  60 ALA E HA   1  
ATOM 5869   H HB1  . ALA E  1 60 ? 13.038  15.662  -247.484 1.00 0.00 ?  60 ALA E HB1  1  
ATOM 5870   H HB2  . ALA E  1 60 ? 11.759  16.263  -248.564 1.00 0.00 ?  60 ALA E HB2  1  
ATOM 5871   H HB3  . ALA E  1 60 ? 11.336  15.262  -247.155 1.00 0.00 ?  60 ALA E HB3  1  
ATOM 5872   N N    . GLN E  1 61 ? 14.455  14.175  -249.694 1.00 0.00 ?  61 GLN E N    1  
ATOM 5873   C CA   . GLN E  1 61 ? 15.472  14.277  -250.734 1.00 0.00 ?  61 GLN E CA   1  
ATOM 5874   C C    . GLN E  1 61 ? 15.124  13.400  -251.931 1.00 0.00 ?  61 GLN E C    1  
ATOM 5875   O O    . GLN E  1 61 ? 15.048  13.880  -253.062 1.00 0.00 ?  61 GLN E O    1  
ATOM 5876   C CB   . GLN E  1 61 ? 16.844  13.880  -250.184 1.00 0.00 ?  61 GLN E CB   1  
ATOM 5877   C CG   . GLN E  1 61 ? 17.973  13.980  -251.195 1.00 0.00 ?  61 GLN E CG   1  
ATOM 5878   C CD   . GLN E  1 61 ? 19.301  13.517  -250.628 1.00 0.00 ?  61 GLN E CD   1  
ATOM 5879   O OE1  . GLN E  1 61 ? 19.367  12.990  -249.514 1.00 0.00 ?  61 GLN E OE1  1  
ATOM 5880   N NE2  . GLN E  1 61 ? 20.371  13.715  -251.390 1.00 0.00 ?  61 GLN E NE2  1  
ATOM 5881   H H    . GLN E  1 61 ? 14.734  13.917  -248.758 1.00 0.00 ?  61 GLN E H    1  
ATOM 5882   H HA   . GLN E  1 61 ? 15.515  15.302  -251.103 1.00 0.00 ?  61 GLN E HA   1  
ATOM 5883   H HB2  . GLN E  1 61 ? 17.046  14.537  -249.338 1.00 0.00 ?  61 GLN E HB2  1  
ATOM 5884   H HB3  . GLN E  1 61 ? 16.756  12.852  -249.832 1.00 0.00 ?  61 GLN E HB3  1  
ATOM 5885   H HG2  . GLN E  1 61 ? 17.891  13.596  -252.211 1.00 0.00 ?  61 GLN E HG2  1  
ATOM 5886   H HG3  . GLN E  1 61 ? 17.970  15.071  -251.220 1.00 0.00 ?  61 GLN E HG3  1  
ATOM 5887   H HE21 . GLN E  1 61 ? 20.273  14.148  -252.287 1.00 0.00 ?  61 GLN E HE21 1  
ATOM 5888   H HE22 . GLN E  1 61 ? 21.275  13.430  -251.069 1.00 0.00 ?  61 GLN E HE22 1  
ATOM 5889   N N    . SER E  1 62 ? 14.914  12.114  -251.674 1.00 0.00 ?  62 SER E N    1  
ATOM 5890   C CA   . SER E  1 62 ? 14.645  11.154  -252.739 1.00 0.00 ?  62 SER E CA   1  
ATOM 5891   C C    . SER E  1 62 ? 13.276  11.393  -253.362 1.00 0.00 ?  62 SER E C    1  
ATOM 5892   O O    . SER E  1 62 ? 13.048  11.066  -254.527 1.00 0.00 ?  62 SER E O    1  
ATOM 5893   C CB   . SER E  1 62 ? 14.742  9.739   -252.202 1.00 0.00 ?  62 SER E CB   1  
ATOM 5894   O OG   . SER E  1 62 ? 13.679  9.428   -251.344 1.00 0.00 ?  62 SER E OG   1  
ATOM 5895   H H    . SER E  1 62 ? 14.941  11.792  -250.717 1.00 0.00 ?  62 SER E H    1  
ATOM 5896   H HA   . SER E  1 62 ? 15.410  11.144  -253.516 1.00 0.00 ?  62 SER E HA   1  
ATOM 5897   H HB2  . SER E  1 62 ? 14.733  9.047   -253.044 1.00 0.00 ?  62 SER E HB2  1  
ATOM 5898   H HB3  . SER E  1 62 ? 15.679  9.635   -251.658 1.00 0.00 ?  62 SER E HB3  1  
ATOM 5899   H HG   . SER E  1 62 ? 13.577  10.127  -250.695 1.00 0.00 ?  62 SER E HG   1  
ATOM 5900   N N    . ASN E  1 63 ? 12.367  11.965  -252.580 1.00 0.00 ?  63 ASN E N    1  
ATOM 5901   C CA   . ASN E  1 63 ? 11.018  12.251  -253.055 1.00 0.00 ?  63 ASN E CA   1  
ATOM 5902   C C    . ASN E  1 63 ? 11.032  13.317  -254.144 1.00 0.00 ?  63 ASN E C    1  
ATOM 5903   O O    . ASN E  1 63 ? 10.409  13.155  -255.193 1.00 0.00 ?  63 ASN E O    1  
ATOM 5904   C CB   . ASN E  1 63 ? 10.107  12.675  -251.918 1.00 0.00 ?  63 ASN E CB   1  
ATOM 5905   C CG   . ASN E  1 63 ? 9.716   11.547  -251.004 1.00 0.00 ?  63 ASN E CG   1  
ATOM 5906   O OD1  . ASN E  1 63 ? 9.656   10.382  -251.412 1.00 0.00 ?  63 ASN E OD1  1  
ATOM 5907   N ND2  . ASN E  1 63 ? 9.372   11.897  -249.791 1.00 0.00 ?  63 ASN E ND2  1  
ATOM 5908   H H    . ASN E  1 63 ? 12.616  12.208  -251.632 1.00 0.00 ?  63 ASN E H    1  
ATOM 5909   H HA   . ASN E  1 63 ? 10.587  11.356  -253.505 1.00 0.00 ?  63 ASN E HA   1  
ATOM 5910   H HB2  . ASN E  1 63 ? 10.335  13.558  -251.320 1.00 0.00 ?  63 ASN E HB2  1  
ATOM 5911   H HB3  . ASN E  1 63 ? 9.272   12.892  -252.584 1.00 0.00 ?  63 ASN E HB3  1  
ATOM 5912   H HD21 . ASN E  1 63 ? 9.381   12.862  -249.527 1.00 0.00 ?  63 ASN E HD21 1  
ATOM 5913   H HD22 . ASN E  1 63 ? 9.101   11.199  -249.127 1.00 0.00 ?  63 ASN E HD22 1  
ATOM 5914   N N    . THR E  1 64 ? 11.747  14.408  -253.888 1.00 0.00 ?  64 THR E N    1  
ATOM 5915   C CA   . THR E  1 64 ? 11.812  15.519  -254.829 1.00 0.00 ?  64 THR E CA   1  
ATOM 5916   C C    . THR E  1 64 ? 12.521  15.112  -256.114 1.00 0.00 ?  64 THR E C    1  
ATOM 5917   O O    . THR E  1 64 ? 12.133  15.524  -257.207 1.00 0.00 ?  64 THR E O    1  
ATOM 5918   C CB   . THR E  1 64 ? 12.535  16.734  -254.219 1.00 0.00 ?  64 THR E CB   1  
ATOM 5919   O OG1  . THR E  1 64 ? 13.852  16.352  -253.805 1.00 0.00 ?  64 THR E OG1  1  
ATOM 5920   C CG2  . THR E  1 64 ? 11.765  17.267  -253.020 1.00 0.00 ?  64 THR E CG2  1  
ATOM 5921   H H    . THR E  1 64 ? 12.257  14.468  -253.019 1.00 0.00 ?  64 THR E H    1  
ATOM 5922   H HA   . THR E  1 64 ? 10.804  15.820  -255.115 1.00 0.00 ?  64 THR E HA   1  
ATOM 5923   H HB   . THR E  1 64 ? 12.614  17.516  -254.975 1.00 0.00 ?  64 THR E HB   1  
ATOM 5924   H HG1  . THR E  1 64 ? 14.301  17.111  -253.425 1.00 0.00 ?  64 THR E HG1  1  
ATOM 5925   H HG21 . THR E  1 64 ? 12.291  18.125  -252.603 1.00 0.00 ?  64 THR E HG21 1  
ATOM 5926   H HG22 . THR E  1 64 ? 10.766  17.569  -253.335 1.00 0.00 ?  64 THR E HG22 1  
ATOM 5927   H HG23 . THR E  1 64 ? 11.686  16.486  -252.264 1.00 0.00 ?  64 THR E HG23 1  
ATOM 5928   N N    . VAL E  1 65 ? 13.564  14.300  -255.976 1.00 0.00 ?  65 VAL E N    1  
ATOM 5929   C CA   . VAL E  1 65 ? 14.291  13.783  -257.130 1.00 0.00 ?  65 VAL E CA   1  
ATOM 5930   C C    . VAL E  1 65 ? 13.403  12.886  -257.983 1.00 0.00 ?  65 VAL E C    1  
ATOM 5931   O O    . VAL E  1 65 ? 13.421  12.966  -259.212 1.00 0.00 ?  65 VAL E O    1  
ATOM 5932   C CB   . VAL E  1 65 ? 15.542  12.994  -256.703 1.00 0.00 ?  65 VAL E CB   1  
ATOM 5933   C CG1  . VAL E  1 65 ? 16.158  12.284  -257.899 1.00 0.00 ?  65 VAL E CG1  1  
ATOM 5934   C CG2  . VAL E  1 65 ? 16.560  13.919  -256.053 1.00 0.00 ?  65 VAL E CG2  1  
ATOM 5935   H H    . VAL E  1 65 ? 13.861  14.033  -255.048 1.00 0.00 ?  65 VAL E H    1  
ATOM 5936   H HA   . VAL E  1 65 ? 14.599  14.589  -257.798 1.00 0.00 ?  65 VAL E HA   1  
ATOM 5937   H HB   . VAL E  1 65 ? 15.257  12.258  -255.951 1.00 0.00 ?  65 VAL E HB   1  
ATOM 5938   H HG11 . VAL E  1 65 ? 17.042  11.731  -257.579 1.00 0.00 ?  65 VAL E HG11 1  
ATOM 5939   H HG12 . VAL E  1 65 ? 15.432  11.592  -258.325 1.00 0.00 ?  65 VAL E HG12 1  
ATOM 5940   H HG13 . VAL E  1 65 ? 16.444  13.019  -258.651 1.00 0.00 ?  65 VAL E HG13 1  
ATOM 5941   H HG21 . VAL E  1 65 ? 16.117  14.385  -255.172 1.00 0.00 ?  65 VAL E HG21 1  
ATOM 5942   H HG22 . VAL E  1 65 ? 17.437  13.345  -255.756 1.00 0.00 ?  65 VAL E HG22 1  
ATOM 5943   H HG23 . VAL E  1 65 ? 16.854  14.692  -256.763 1.00 0.00 ?  65 VAL E HG23 1  
ATOM 5944   N N    . LYS E  1 66 ? 12.627  12.031  -257.325 1.00 0.00 ?  66 LYS E N    1  
ATOM 5945   C CA   . LYS E  1 66 ? 11.669  11.177  -258.017 1.00 0.00 ?  66 LYS E CA   1  
ATOM 5946   C C    . LYS E  1 66 ? 10.716  12.000  -258.873 1.00 0.00 ?  66 LYS E C    1  
ATOM 5947   O O    . LYS E  1 66 ? 10.488  11.687  -260.042 1.00 0.00 ?  66 LYS E O    1  
ATOM 5948   C CB   . LYS E  1 66 ? 10.881  10.335  -257.013 1.00 0.00 ?  66 LYS E CB   1  
ATOM 5949   C CG   . LYS E  1 66 ? 9.817   9.443   -257.639 1.00 0.00 ?  66 LYS E CG   1  
ATOM 5950   C CD   . LYS E  1 66 ? 9.036   8.684   -256.577 1.00 0.00 ?  66 LYS E CD   1  
ATOM 5951   C CE   . LYS E  1 66 ? 7.909   7.869   -257.194 1.00 0.00 ?  66 LYS E CE   1  
ATOM 5952   N NZ   . LYS E  1 66 ? 6.824   8.734   -257.730 1.00 0.00 1  66 LYS E NZ   1  
ATOM 5953   H H    . LYS E  1 66 ? 12.703  11.972  -256.320 1.00 0.00 ?  66 LYS E H    1  
ATOM 5954   H HA   . LYS E  1 66 ? 12.196  10.506  -258.696 1.00 0.00 ?  66 LYS E HA   1  
ATOM 5955   H HB2  . LYS E  1 66 ? 11.602  9.717   -256.478 1.00 0.00 ?  66 LYS E HB2  1  
ATOM 5956   H HB3  . LYS E  1 66 ? 10.408  11.027  -256.316 1.00 0.00 ?  66 LYS E HB3  1  
ATOM 5957   H HG2  . LYS E  1 66 ? 9.134   10.070  -258.215 1.00 0.00 ?  66 LYS E HG2  1  
ATOM 5958   H HG3  . LYS E  1 66 ? 10.307  8.734   -258.306 1.00 0.00 ?  66 LYS E HG3  1  
ATOM 5959   H HD2  . LYS E  1 66 ? 9.721   8.018   -256.051 1.00 0.00 ?  66 LYS E HD2  1  
ATOM 5960   H HD3  . LYS E  1 66 ? 8.618   9.404   -255.872 1.00 0.00 ?  66 LYS E HD3  1  
ATOM 5961   H HE2  . LYS E  1 66 ? 8.325   7.267   -258.001 1.00 0.00 ?  66 LYS E HE2  1  
ATOM 5962   H HE3  . LYS E  1 66 ? 7.502   7.212   -256.425 1.00 0.00 ?  66 LYS E HE3  1  
ATOM 5963   H HZ1  . LYS E  1 66 ? 7.200   9.343   -258.443 1.00 0.00 ?  66 LYS E HZ1  1  
ATOM 5964   H HZ2  . LYS E  1 66 ? 6.098   8.156   -258.129 1.00 0.00 ?  66 LYS E HZ2  1  
ATOM 5965   H HZ3  . LYS E  1 66 ? 6.437   9.292   -256.981 1.00 0.00 ?  66 LYS E HZ3  1  
ATOM 5966   N N    . VAL E  1 67 ? 10.161  13.055  -258.285 1.00 0.00 ?  67 VAL E N    1  
ATOM 5967   C CA   . VAL E  1 67 ? 9.170   13.879  -258.967 1.00 0.00 ?  67 VAL E CA   1  
ATOM 5968   C C    . VAL E  1 67 ? 9.770   14.563  -260.189 1.00 0.00 ?  67 VAL E C    1  
ATOM 5969   O O    . VAL E  1 67 ? 9.151   14.612  -261.252 1.00 0.00 ?  67 VAL E O    1  
ATOM 5970   C CB   . VAL E  1 67 ? 8.583   14.950  -258.029 1.00 0.00 ?  67 VAL E CB   1  
ATOM 5971   C CG1  . VAL E  1 67 ? 7.743   15.945  -258.815 1.00 0.00 ?  67 VAL E CG1  1  
ATOM 5972   C CG2  . VAL E  1 67 ? 7.750   14.300  -256.934 1.00 0.00 ?  67 VAL E CG2  1  
ATOM 5973   H H    . VAL E  1 67 ? 10.432  13.291  -257.342 1.00 0.00 ?  67 VAL E H    1  
ATOM 5974   H HA   . VAL E  1 67 ? 8.352   13.274  -259.359 1.00 0.00 ?  67 VAL E HA   1  
ATOM 5975   H HB   . VAL E  1 67 ? 9.400   15.475  -257.535 1.00 0.00 ?  67 VAL E HB   1  
ATOM 5976   H HG11 . VAL E  1 67 ? 7.336   16.694  -258.136 1.00 0.00 ?  67 VAL E HG11 1  
ATOM 5977   H HG12 . VAL E  1 67 ? 8.365   16.434  -259.564 1.00 0.00 ?  67 VAL E HG12 1  
ATOM 5978   H HG13 . VAL E  1 67 ? 6.924   15.421  -259.308 1.00 0.00 ?  67 VAL E HG13 1  
ATOM 5979   H HG21 . VAL E  1 67 ? 8.377   13.624  -256.352 1.00 0.00 ?  67 VAL E HG21 1  
ATOM 5980   H HG22 . VAL E  1 67 ? 7.343   15.070  -256.280 1.00 0.00 ?  67 VAL E HG22 1  
ATOM 5981   H HG23 . VAL E  1 67 ? 6.932   13.738  -257.386 1.00 0.00 ?  67 VAL E HG23 1  
ATOM 5982   N N    . PHE E  1 68 ? 10.979  15.091  -260.031 1.00 0.00 ?  68 PHE E N    1  
ATOM 5983   C CA   . PHE E  1 68 ? 11.687  15.728  -261.136 1.00 0.00 ?  68 PHE E CA   1  
ATOM 5984   C C    . PHE E  1 68 ? 12.066  14.712  -262.206 1.00 0.00 ?  68 PHE E C    1  
ATOM 5985   O O    . PHE E  1 68 ? 12.218  15.058  -263.377 1.00 0.00 ?  68 PHE E O    1  
ATOM 5986   C CB   . PHE E  1 68 ? 12.938  16.446  -260.625 1.00 0.00 ?  68 PHE E CB   1  
ATOM 5987   C CG   . PHE E  1 68 ? 12.663  17.805  -260.047 1.00 0.00 ?  68 PHE E CG   1  
ATOM 5988   C CD1  . PHE E  1 68 ? 12.208  18.838  -260.852 1.00 0.00 ?  68 PHE E CD1  1  
ATOM 5989   C CD2  . PHE E  1 68 ? 12.859  18.052  -258.697 1.00 0.00 ?  68 PHE E CD2  1  
ATOM 5990   C CE1  . PHE E  1 68 ? 11.956  20.089  -260.322 1.00 0.00 ?  68 PHE E CE1  1  
ATOM 5991   C CE2  . PHE E  1 68 ? 12.607  19.302  -258.164 1.00 0.00 ?  68 PHE E CE2  1  
ATOM 5992   C CZ   . PHE E  1 68 ? 12.156  20.320  -258.976 1.00 0.00 ?  68 PHE E CZ   1  
ATOM 5993   H H    . PHE E  1 68 ? 11.419  15.050  -259.123 1.00 0.00 ?  68 PHE E H    1  
ATOM 5994   H HA   . PHE E  1 68 ? 11.038  16.460  -261.618 1.00 0.00 ?  68 PHE E HA   1  
ATOM 5995   H HB2  . PHE E  1 68 ? 13.411  15.861  -259.837 1.00 0.00 ?  68 PHE E HB2  1  
ATOM 5996   H HB3  . PHE E  1 68 ? 13.645  16.591  -261.441 1.00 0.00 ?  68 PHE E HB3  1  
ATOM 5997   H HD1  . PHE E  1 68 ? 12.050  18.655  -261.915 1.00 0.00 ?  68 PHE E HD1  1  
ATOM 5998   H HD2  . PHE E  1 68 ? 13.217  17.247  -258.054 1.00 0.00 ?  68 PHE E HD2  1  
ATOM 5999   H HE1  . PHE E  1 68 ? 11.599  20.892  -260.966 1.00 0.00 ?  68 PHE E HE1  1  
ATOM 6000   H HE2  . PHE E  1 68 ? 12.765  19.483  -257.101 1.00 0.00 ?  68 PHE E HE2  1  
ATOM 6001   H HZ   . PHE E  1 68 ? 11.955  21.305  -258.557 1.00 0.00 ?  68 PHE E HZ   1  
ATOM 6002   N N    . LYS E  1 69 ? 12.217  13.457  -261.796 1.00 0.00 ?  69 LYS E N    1  
ATOM 6003   C CA   . LYS E  1 69 ? 12.425  12.364  -262.738 1.00 0.00 ?  69 LYS E CA   1  
ATOM 6004   C C    . LYS E  1 69 ? 11.109  11.917  -263.362 1.00 0.00 ?  69 LYS E C    1  
ATOM 6005   O O    . LYS E  1 69 ? 11.080  11.439  -264.496 1.00 0.00 ?  69 LYS E O    1  
ATOM 6006   C CB   . LYS E  1 69 ? 13.107  11.183  -262.046 1.00 0.00 ?  69 LYS E CB   1  
ATOM 6007   C CG   . LYS E  1 69 ? 13.642  10.120  -262.996 1.00 0.00 ?  69 LYS E CG   1  
ATOM 6008   C CD   . LYS E  1 69 ? 12.601  9.045   -263.267 1.00 0.00 ?  69 LYS E CD   1  
ATOM 6009   C CE   . LYS E  1 69 ? 13.139  7.976   -264.208 1.00 0.00 ?  69 LYS E CE   1  
ATOM 6010   N NZ   . LYS E  1 69 ? 12.069  7.051   -264.670 1.00 0.00 1  69 LYS E NZ   1  
ATOM 6011   H H    . LYS E  1 69 ? 12.188  13.256  -260.807 1.00 0.00 ?  69 LYS E H    1  
ATOM 6012   H HA   . LYS E  1 69 ? 13.060  12.699  -263.559 1.00 0.00 ?  69 LYS E HA   1  
ATOM 6013   H HB2  . LYS E  1 69 ? 13.929  11.589  -261.456 1.00 0.00 ?  69 LYS E HB2  1  
ATOM 6014   H HB3  . LYS E  1 69 ? 12.370  10.734  -261.379 1.00 0.00 ?  69 LYS E HB3  1  
ATOM 6015   H HG2  . LYS E  1 69 ? 13.920  10.602  -263.934 1.00 0.00 ?  69 LYS E HG2  1  
ATOM 6016   H HG3  . LYS E  1 69 ? 14.525  9.666   -262.546 1.00 0.00 ?  69 LYS E HG3  1  
ATOM 6017   H HD2  . LYS E  1 69 ? 12.320  8.586   -262.318 1.00 0.00 ?  69 LYS E HD2  1  
ATOM 6018   H HD3  . LYS E  1 69 ? 11.726  9.514   -263.716 1.00 0.00 ?  69 LYS E HD3  1  
ATOM 6019   H HE2  . LYS E  1 69 ? 13.587  8.472   -265.068 1.00 0.00 ?  69 LYS E HE2  1  
ATOM 6020   H HE3  . LYS E  1 69 ? 13.904  7.409   -263.678 1.00 0.00 ?  69 LYS E HE3  1  
ATOM 6021   H HZ1  . LYS E  1 69 ? 11.360  7.576   -265.162 1.00 0.00 ?  69 LYS E HZ1  1  
ATOM 6022   H HZ2  . LYS E  1 69 ? 12.467  6.360   -265.290 1.00 0.00 ?  69 LYS E HZ2  1  
ATOM 6023   H HZ3  . LYS E  1 69 ? 11.654  6.590   -263.873 1.00 0.00 ?  69 LYS E HZ3  1  
ATOM 6024   N N    . ASP E  1 70 ? 10.022  12.075  -262.615 1.00 0.00 ?  70 ASP E N    1  
ATOM 6025   C CA   . ASP E  1 70 ? 8.704   11.665  -263.084 1.00 0.00 ?  70 ASP E CA   1  
ATOM 6026   C C    . ASP E  1 70 ? 8.216   12.565  -264.212 1.00 0.00 ?  70 ASP E C    1  
ATOM 6027   O O    . ASP E  1 70 ? 7.581   12.101  -265.159 1.00 0.00 ?  70 ASP E O    1  
ATOM 6028   C CB   . ASP E  1 70 ? 7.697   11.675  -261.931 1.00 0.00 ?  70 ASP E CB   1  
ATOM 6029   C CG   . ASP E  1 70 ? 7.840   10.510  -260.961 1.00 0.00 ?  70 ASP E CG   1  
ATOM 6030   O OD1  . ASP E  1 70 ? 8.539   9.578   -261.282 1.00 0.00 ?  70 ASP E OD1  1  
ATOM 6031   O OD2  . ASP E  1 70 ? 7.381   10.628  -259.851 1.00 0.00 -1 70 ASP E OD2  1  
ATOM 6032   H H    . ASP E  1 70 ? 10.111  12.489  -261.698 1.00 0.00 ?  70 ASP E H    1  
ATOM 6033   H HA   . ASP E  1 70 ? 8.755   10.655  -263.493 1.00 0.00 ?  70 ASP E HA   1  
ATOM 6034   H HB2  . ASP E  1 70 ? 7.684   12.612  -261.374 1.00 0.00 ?  70 ASP E HB2  1  
ATOM 6035   H HB3  . ASP E  1 70 ? 6.766   11.570  -262.489 1.00 0.00 ?  70 ASP E HB3  1  
ATOM 6036   N N    . ILE E  1 71 ? 8.518   13.855  -264.106 1.00 0.00 ?  71 ILE E N    1  
ATOM 6037   C CA   . ILE E  1 71 ? 8.187   14.808  -265.158 1.00 0.00 ?  71 ILE E CA   1  
ATOM 6038   C C    . ILE E  1 71 ? 9.110   14.647  -266.358 1.00 0.00 ?  71 ILE E C    1  
ATOM 6039   O O    . ILE E  1 71 ? 8.770   15.044  -267.473 1.00 0.00 ?  71 ILE E O    1  
ATOM 6040   C CB   . ILE E  1 71 ? 8.268   16.260  -264.650 1.00 0.00 ?  71 ILE E CB   1  
ATOM 6041   C CG1  . ILE E  1 71 ? 9.688   16.581  -264.177 1.00 0.00 ?  71 ILE E CG1  1  
ATOM 6042   C CG2  . ILE E  1 71 ? 7.266   16.489  -263.530 1.00 0.00 ?  71 ILE E CG2  1  
ATOM 6043   C CD1  . ILE E  1 71 ? 9.872   18.012  -263.725 1.00 0.00 ?  71 ILE E CD1  1  
ATOM 6044   H H    . ILE E  1 71 ? 8.989   14.183  -263.275 1.00 0.00 ?  71 ILE E H    1  
ATOM 6045   H HA   . ILE E  1 71 ? 7.188   14.617  -265.549 1.00 0.00 ?  71 ILE E HA   1  
ATOM 6046   H HB   . ILE E  1 71 ? 8.052   16.937  -265.476 1.00 0.00 ?  71 ILE E HB   1  
ATOM 6047   H HG12 . ILE E  1 71 ? 9.915   15.907  -263.352 1.00 0.00 ?  71 ILE E HG12 1  
ATOM 6048   H HG13 . ILE E  1 71 ? 10.361  16.374  -265.009 1.00 0.00 ?  71 ILE E HG13 1  
ATOM 6049   H HG21 . ILE E  1 71 ? 7.337   17.519  -263.183 1.00 0.00 ?  71 ILE E HG21 1  
ATOM 6050   H HG22 . ILE E  1 71 ? 6.258   16.299  -263.899 1.00 0.00 ?  71 ILE E HG22 1  
ATOM 6051   H HG23 . ILE E  1 71 ? 7.483   15.812  -262.703 1.00 0.00 ?  71 ILE E HG23 1  
ATOM 6052   H HD11 . ILE E  1 71 ? 9.201   18.220  -262.893 1.00 0.00 ?  71 ILE E HD11 1  
ATOM 6053   H HD12 . ILE E  1 71 ? 10.903  18.163  -263.405 1.00 0.00 ?  71 ILE E HD12 1  
ATOM 6054   H HD13 . ILE E  1 71 ? 9.646   18.687  -264.551 1.00 0.00 ?  71 ILE E HD13 1  
ATOM 6055   N N    . ASP E  1 72 ? 10.280  14.062  -266.124 1.00 0.00 ?  72 ASP E N    1  
ATOM 6056   C CA   . ASP E  1 72 ? 11.156  13.640  -267.210 1.00 0.00 ?  72 ASP E CA   1  
ATOM 6057   C C    . ASP E  1 72 ? 10.540  12.493  -268.002 1.00 0.00 ?  72 ASP E C    1  
ATOM 6058   O O    . ASP E  1 72 ? 10.520  12.516  -269.232 1.00 0.00 ?  72 ASP E O    1  
ATOM 6059   C CB   . ASP E  1 72 ? 12.525  13.226  -266.665 1.00 0.00 ?  72 ASP E CB   1  
ATOM 6060   C CG   . ASP E  1 72 ? 13.378  14.382  -266.161 1.00 0.00 ?  72 ASP E CG   1  
ATOM 6061   O OD1  . ASP E  1 72 ? 13.072  15.505  -266.486 1.00 0.00 ?  72 ASP E OD1  1  
ATOM 6062   O OD2  . ASP E  1 72 ? 14.228  14.152  -265.335 1.00 0.00 -1 72 ASP E OD2  1  
ATOM 6063   H H    . ASP E  1 72 ? 10.569  13.905  -265.169 1.00 0.00 ?  72 ASP E H    1  
ATOM 6064   H HA   . ASP E  1 72 ? 11.296  14.462  -267.913 1.00 0.00 ?  72 ASP E HA   1  
ATOM 6065   H HB2  . ASP E  1 72 ? 12.471  12.453  -265.897 1.00 0.00 ?  72 ASP E HB2  1  
ATOM 6066   H HB3  . ASP E  1 72 ? 12.974  12.811  -267.568 1.00 0.00 ?  72 ASP E HB3  1  
ATOM 6067   N N    . ALA E  1 73 ? 10.037  11.492  -267.288 1.00 0.00 ?  73 ALA E N    1  
ATOM 6068   C CA   . ALA E  1 73 ? 9.344   10.374  -267.918 1.00 0.00 ?  73 ALA E CA   1  
ATOM 6069   C C    . ALA E  1 73 ? 8.103   10.846  -268.664 1.00 0.00 ?  73 ALA E C    1  
ATOM 6070   O O    . ALA E  1 73 ? 7.794   10.353  -269.749 1.00 0.00 ?  73 ALA E O    1  
ATOM 6071   C CB   . ALA E  1 73 ? 8.976   9.325   -266.879 1.00 0.00 ?  73 ALA E CB   1  
ATOM 6072   H H    . ALA E  1 73 ? 10.137  11.504  -266.283 1.00 0.00 ?  73 ALA E H    1  
ATOM 6073   H HA   . ALA E  1 73 ? 10.010  9.919   -268.651 1.00 0.00 ?  73 ALA E HA   1  
ATOM 6074   H HB1  . ALA E  1 73 ? 8.323   9.769   -266.130 1.00 0.00 ?  73 ALA E HB1  1  
ATOM 6075   H HB2  . ALA E  1 73 ? 8.460   8.498   -267.366 1.00 0.00 ?  73 ALA E HB2  1  
ATOM 6076   H HB3  . ALA E  1 73 ? 9.882   8.955   -266.399 1.00 0.00 ?  73 ALA E HB3  1  
ATOM 6077   N N    . ALA E  1 74 ? 7.394   11.804  -268.076 1.00 0.00 ?  74 ALA E N    1  
ATOM 6078   C CA   . ALA E  1 74 ? 6.184   12.345  -268.685 1.00 0.00 ?  74 ALA E CA   1  
ATOM 6079   C C    . ALA E  1 74 ? 6.478   12.944  -270.054 1.00 0.00 ?  74 ALA E C    1  
ATOM 6080   O O    . ALA E  1 74 ? 5.702   12.777  -270.995 1.00 0.00 ?  74 ALA E O    1  
ATOM 6081   C CB   . ALA E  1 74 ? 5.552   13.385  -267.772 1.00 0.00 ?  74 ALA E CB   1  
ATOM 6082   H H    . ALA E  1 74 ? 7.700   12.166  -267.185 1.00 0.00 ?  74 ALA E H    1  
ATOM 6083   H HA   . ALA E  1 74 ? 5.473   11.532  -268.832 1.00 0.00 ?  74 ALA E HA   1  
ATOM 6084   H HB1  . ALA E  1 74 ? 6.257   14.197  -267.602 1.00 0.00 ?  74 ALA E HB1  1  
ATOM 6085   H HB2  . ALA E  1 74 ? 4.650   13.779  -268.241 1.00 0.00 ?  74 ALA E HB2  1  
ATOM 6086   H HB3  . ALA E  1 74 ? 5.293   12.923  -266.819 1.00 0.00 ?  74 ALA E HB3  1  
ATOM 6087   N N    . ILE E  1 75 ? 7.603   13.643  -270.159 1.00 0.00 ?  75 ILE E N    1  
ATOM 6088   C CA   . ILE E  1 75 ? 7.980   14.305  -271.403 1.00 0.00 ?  75 ILE E CA   1  
ATOM 6089   C C    . ILE E  1 75 ? 8.377   13.290  -272.468 1.00 0.00 ?  75 ILE E C    1  
ATOM 6090   O O    . ILE E  1 75 ? 7.910   13.355  -273.605 1.00 0.00 ?  75 ILE E O    1  
ATOM 6091   C CB   . ILE E  1 75 ? 9.143   15.291  -271.188 1.00 0.00 ?  75 ILE E CB   1  
ATOM 6092   C CG1  . ILE E  1 75 ? 8.695   16.461  -270.309 1.00 0.00 ?  75 ILE E CG1  1  
ATOM 6093   C CG2  . ILE E  1 75 ? 9.666   15.795  -272.524 1.00 0.00 ?  75 ILE E CG2  1  
ATOM 6094   C CD1  . ILE E  1 75 ? 9.835   17.309  -269.794 1.00 0.00 ?  75 ILE E CD1  1  
ATOM 6095   H H    . ILE E  1 75 ? 8.212   13.719  -269.358 1.00 0.00 ?  75 ILE E H    1  
ATOM 6096   H HA   . ILE E  1 75 ? 7.129   14.835  -271.829 1.00 0.00 ?  75 ILE E HA   1  
ATOM 6097   H HB   . ILE E  1 75 ? 9.944   14.784  -270.652 1.00 0.00 ?  75 ILE E HB   1  
ATOM 6098   H HG12 . ILE E  1 75 ? 8.024   17.078  -270.906 1.00 0.00 ?  75 ILE E HG12 1  
ATOM 6099   H HG13 . ILE E  1 75 ? 8.146   16.041  -269.465 1.00 0.00 ?  75 ILE E HG13 1  
ATOM 6100   H HG21 . ILE E  1 75 ? 10.487  16.491  -272.354 1.00 0.00 ?  75 ILE E HG21 1  
ATOM 6101   H HG22 . ILE E  1 75 ? 10.022  14.953  -273.117 1.00 0.00 ?  75 ILE E HG22 1  
ATOM 6102   H HG23 . ILE E  1 75 ? 8.865   16.303  -273.061 1.00 0.00 ?  75 ILE E HG23 1  
ATOM 6103   H HD11 . ILE E  1 75 ? 10.384  17.731  -270.634 1.00 0.00 ?  75 ILE E HD11 1  
ATOM 6104   H HD12 . ILE E  1 75 ? 9.440   18.118  -269.178 1.00 0.00 ?  75 ILE E HD12 1  
ATOM 6105   H HD13 . ILE E  1 75 ? 10.507  16.693  -269.194 1.00 0.00 ?  75 ILE E HD13 1  
ATOM 6106   N N    . ILE E  1 76 ? 9.241   12.353  -272.093 1.00 0.00 ?  76 ILE E N    1  
ATOM 6107   C CA   . ILE E  1 76 ? 9.768   11.375  -273.037 1.00 0.00 ?  76 ILE E CA   1  
ATOM 6108   C C    . ILE E  1 76 ? 8.726   10.314  -273.369 1.00 0.00 ?  76 ILE E C    1  
ATOM 6109   O O    . ILE E  1 76 ? 8.879   9.559   -274.329 1.00 0.00 ?  76 ILE E O    1  
ATOM 6110   C CB   . ILE E  1 76 ? 11.032  10.687  -272.490 1.00 0.00 ?  76 ILE E CB   1  
ATOM 6111   C CG1  . ILE E  1 76 ? 10.695  9.860   -271.247 1.00 0.00 ?  76 ILE E CG1  1  
ATOM 6112   C CG2  . ILE E  1 76 ? 12.104  11.718  -272.174 1.00 0.00 ?  76 ILE E CG2  1  
ATOM 6113   C CD1  . ILE E  1 76 ? 11.845  9.019   -270.742 1.00 0.00 ?  76 ILE E CD1  1  
ATOM 6114   H H    . ILE E  1 76 ? 9.541   12.318  -271.129 1.00 0.00 ?  76 ILE E H    1  
ATOM 6115   H HA   . ILE E  1 76 ? 9.996   11.847  -273.992 1.00 0.00 ?  76 ILE E HA   1  
ATOM 6116   H HB   . ILE E  1 76 ? 11.408  9.989   -273.238 1.00 0.00 ?  76 ILE E HB   1  
ATOM 6117   H HG12 . ILE E  1 76 ? 10.386  10.557  -270.468 1.00 0.00 ?  76 ILE E HG12 1  
ATOM 6118   H HG13 . ILE E  1 76 ? 9.858   9.212   -271.506 1.00 0.00 ?  76 ILE E HG13 1  
ATOM 6119   H HG21 . ILE E  1 76 ? 12.991  11.215  -271.788 1.00 0.00 ?  76 ILE E HG21 1  
ATOM 6120   H HG22 . ILE E  1 76 ? 12.363  12.264  -273.080 1.00 0.00 ?  76 ILE E HG22 1  
ATOM 6121   H HG23 . ILE E  1 76 ? 11.729  12.415  -271.425 1.00 0.00 ?  76 ILE E HG23 1  
ATOM 6122   H HD11 . ILE E  1 76 ? 12.683  9.665   -270.482 1.00 0.00 ?  76 ILE E HD11 1  
ATOM 6123   H HD12 . ILE E  1 76 ? 11.530  8.462   -269.860 1.00 0.00 ?  76 ILE E HD12 1  
ATOM 6124   H HD13 . ILE E  1 76 ? 12.155  8.320   -271.520 1.00 0.00 ?  76 ILE E HD13 1  
ATOM 6125   N N    . GLN E  1 77 ? 7.667   10.261  -272.568 1.00 0.00 ?  77 GLN E N    1  
ATOM 6126   C CA   . GLN E  1 77 ? 6.491   9.469   -272.906 1.00 0.00 ?  77 GLN E CA   1  
ATOM 6127   C C    . GLN E  1 77 ? 5.834   9.975   -274.184 1.00 0.00 ?  77 GLN E C    1  
ATOM 6128   O O    . GLN E  1 77 ? 5.209   9.209   -274.918 1.00 0.00 ?  77 GLN E O    1  
ATOM 6129   C CB   . GLN E  1 77 ? 5.478   9.497   -271.758 1.00 0.00 ?  77 GLN E CB   1  
ATOM 6130   C CG   . GLN E  1 77 ? 4.285   8.578   -271.958 1.00 0.00 ?  77 GLN E CG   1  
ATOM 6131   C CD   . GLN E  1 77 ? 4.686   7.117   -272.039 1.00 0.00 ?  77 GLN E CD   1  
ATOM 6132   O OE1  . GLN E  1 77 ? 5.495   6.636   -271.240 1.00 0.00 ?  77 GLN E OE1  1  
ATOM 6133   N NE2  . GLN E  1 77 ? 4.126   6.403   -273.009 1.00 0.00 ?  77 GLN E NE2  1  
ATOM 6134   H H    . GLN E  1 77 ? 7.677   10.783  -271.704 1.00 0.00 ?  77 GLN E H    1  
ATOM 6135   H HA   . GLN E  1 77 ? 6.788   8.438   -273.098 1.00 0.00 ?  77 GLN E HA   1  
ATOM 6136   H HB2  . GLN E  1 77 ? 6.017   9.210   -270.855 1.00 0.00 ?  77 GLN E HB2  1  
ATOM 6137   H HB3  . GLN E  1 77 ? 5.137   10.527  -271.665 1.00 0.00 ?  77 GLN E HB3  1  
ATOM 6138   H HG2  . GLN E  1 77 ? 3.382   8.643   -271.352 1.00 0.00 ?  77 GLN E HG2  1  
ATOM 6139   H HG3  . GLN E  1 77 ? 4.070   8.933   -272.967 1.00 0.00 ?  77 GLN E HG3  1  
ATOM 6140   H HE21 . GLN E  1 77 ? 3.477   6.834   -273.636 1.00 0.00 ?  77 GLN E HE21 1  
ATOM 6141   H HE22 . GLN E  1 77 ? 4.353   5.434   -273.112 1.00 0.00 ?  77 GLN E HE22 1  
ATOM 6142   N N    . ASN E  1 78 ? 5.978   11.270  -274.444 1.00 0.00 ?  78 ASN E N    1  
ATOM 6143   C CA   . ASN E  1 78 ? 5.451   11.870  -275.664 1.00 0.00 ?  78 ASN E CA   1  
ATOM 6144   C C    . ASN E  1 78 ? 6.564   12.145  -276.667 1.00 0.00 ?  78 ASN E C    1  
ATOM 6145   O O    . ASN E  1 78 ? 6.463   13.059  -277.486 1.00 0.00 ?  78 ASN E O    1  
ATOM 6146   C CB   . ASN E  1 78 ? 4.683   13.145  -275.369 1.00 0.00 ?  78 ASN E CB   1  
ATOM 6147   C CG   . ASN E  1 78 ? 3.432   12.926  -274.565 1.00 0.00 ?  78 ASN E CG   1  
ATOM 6148   O OD1  . ASN E  1 78 ? 2.776   11.883  -274.671 1.00 0.00 ?  78 ASN E OD1  1  
ATOM 6149   N ND2  . ASN E  1 78 ? 3.053   13.935  -273.824 1.00 0.00 ?  78 ASN E ND2  1  
ATOM 6150   H H    . ASN E  1 78 ? 6.465   11.854  -273.779 1.00 0.00 ?  78 ASN E H    1  
ATOM 6151   H HA   . ASN E  1 78 ? 4.762   11.177  -276.149 1.00 0.00 ?  78 ASN E HA   1  
ATOM 6152   H HB2  . ASN E  1 78 ? 5.196   14.032  -274.997 1.00 0.00 ?  78 ASN E HB2  1  
ATOM 6153   H HB3  . ASN E  1 78 ? 4.408   13.296  -276.413 1.00 0.00 ?  78 ASN E HB3  1  
ATOM 6154   H HD21 . ASN E  1 78 ? 3.586   14.780  -273.819 1.00 0.00 ?  78 ASN E HD21 1  
ATOM 6155   H HD22 . ASN E  1 78 ? 2.228   13.860  -273.262 1.00 0.00 ?  78 ASN E HD22 1  
ATOM 6156   N N    . PHE E  1 79 ? 7.626   11.350  -276.598 1.00 0.00 ?  79 PHE E N    1  
ATOM 6157   C CA   . PHE E  1 79 ? 8.796   11.559  -277.443 1.00 0.00 ?  79 PHE E CA   1  
ATOM 6158   C C    . PHE E  1 79 ? 8.564   11.019  -278.848 1.00 0.00 ?  79 PHE E C    1  
ATOM 6159   O O    . PHE E  1 79 ? 9.153   10.012  -279.242 1.00 0.00 ?  79 PHE E O    1  
ATOM 6160   C CB   . PHE E  1 79 ? 10.028  10.898  -276.822 1.00 0.00 ?  79 PHE E CB   1  
ATOM 6161   C CG   . PHE E  1 79 ? 11.330  11.412  -277.367 1.00 0.00 ?  79 PHE E CG   1  
ATOM 6162   C CD1  . PHE E  1 79 ? 11.830  12.641  -276.965 1.00 0.00 ?  79 PHE E CD1  1  
ATOM 6163   C CD2  . PHE E  1 79 ? 12.057  10.667  -278.284 1.00 0.00 ?  79 PHE E CD2  1  
ATOM 6164   C CE1  . PHE E  1 79 ? 13.028  13.115  -277.466 1.00 0.00 ?  79 PHE E CE1  1  
ATOM 6165   C CE2  . PHE E  1 79 ? 13.256  11.137  -278.785 1.00 0.00 ?  79 PHE E CE2  1  
ATOM 6166   C CZ   . PHE E  1 79 ? 13.741  12.363  -278.376 1.00 0.00 ?  79 PHE E CZ   1  
ATOM 6167   H H    . PHE E  1 79 ? 7.623   10.581  -275.944 1.00 0.00 ?  79 PHE E H    1  
ATOM 6168   H HA   . PHE E  1 79 ? 8.990   12.627  -277.549 1.00 0.00 ?  79 PHE E HA   1  
ATOM 6169   H HB2  . PHE E  1 79 ? 10.048  11.076  -275.748 1.00 0.00 ?  79 PHE E HB2  1  
ATOM 6170   H HB3  . PHE E  1 79 ? 10.013  9.826   -277.011 1.00 0.00 ?  79 PHE E HB3  1  
ATOM 6171   H HD1  . PHE E  1 79 ? 11.267  13.235  -276.245 1.00 0.00 ?  79 PHE E HD1  1  
ATOM 6172   H HD2  . PHE E  1 79 ? 11.674  9.699   -278.607 1.00 0.00 ?  79 PHE E HD2  1  
ATOM 6173   H HE1  . PHE E  1 79 ? 13.409  14.083  -277.141 1.00 0.00 ?  79 PHE E HE1  1  
ATOM 6174   H HE2  . PHE E  1 79 ? 13.818  10.542  -279.504 1.00 0.00 ?  79 PHE E HE2  1  
ATOM 6175   H HZ   . PHE E  1 79 ? 14.684  12.736  -278.772 1.00 0.00 ?  79 PHE E HZ   1  
ATOM 6176   N N    . ARG E  1 80 ? 7.702   11.694  -279.601 1.00 0.00 ?  80 ARG E N    1  
ATOM 6177   C CA   . ARG E  1 80 ? 7.332   11.239  -280.936 1.00 0.00 ?  80 ARG E CA   1  
ATOM 6178   C C    . ARG E  1 80 ? 8.506   11.346  -281.900 1.00 0.00 ?  80 ARG E C    1  
ATOM 6179   O O    . ARG E  1 80 ? 9.359   10.502  -281.902 1.00 0.00 ?  80 ARG E O    1  
ATOM 6180   C CB   . ARG E  1 80 ? 6.105   11.965  -281.470 1.00 0.00 ?  80 ARG E CB   1  
ATOM 6181   C CG   . ARG E  1 80 ? 4.844   11.786  -280.640 1.00 0.00 ?  80 ARG E CG   1  
ATOM 6182   C CD   . ARG E  1 80 ? 4.382   10.379  -280.524 1.00 0.00 ?  80 ARG E CD   1  
ATOM 6183   N NE   . ARG E  1 80 ? 3.908   9.796   -281.769 1.00 0.00 ?  80 ARG E NE   1  
ATOM 6184   C CZ   . ARG E  1 80 ? 3.641   8.488   -281.948 1.00 0.00 ?  80 ARG E CZ   1  
ATOM 6185   N NH1  . ARG E  1 80 ? 3.836   7.618   -280.982 1.00 0.00 1  80 ARG E NH1  1  
ATOM 6186   N NH2  . ARG E  1 80 ? 3.201   8.097   -283.132 1.00 0.00 ?  80 ARG E NH2  1  
ATOM 6187   O OXT  . ARG E  1 80 ? 9.014   12.413  -282.112 1.00 0.00 -1 80 ARG E OXT  1  
ATOM 6188   H H    . ARG E  1 80 ? 7.293   12.543  -279.240 1.00 0.00 ?  80 ARG E H    1  
ATOM 6189   H HA   . ARG E  1 80 ? 7.052   10.186  -280.903 1.00 0.00 ?  80 ARG E HA   1  
ATOM 6190   H HB2  . ARG E  1 80 ? 6.357   13.024  -281.516 1.00 0.00 ?  80 ARG E HB2  1  
ATOM 6191   H HB3  . ARG E  1 80 ? 5.927   11.590  -282.478 1.00 0.00 ?  80 ARG E HB3  1  
ATOM 6192   H HG2  . ARG E  1 80 ? 5.035   12.160  -279.634 1.00 0.00 ?  80 ARG E HG2  1  
ATOM 6193   H HG3  . ARG E  1 80 ? 4.043   12.367  -281.098 1.00 0.00 ?  80 ARG E HG3  1  
ATOM 6194   H HD2  . ARG E  1 80 ? 5.208   9.763   -280.169 1.00 0.00 ?  80 ARG E HD2  1  
ATOM 6195   H HD3  . ARG E  1 80 ? 3.562   10.333  -279.808 1.00 0.00 ?  80 ARG E HD3  1  
ATOM 6196   H HE   . ARG E  1 80 ? 3.709   10.242  -282.655 1.00 0.00 ?  80 ARG E HE   1  
ATOM 6197   H HH11 . ARG E  1 80 ? 4.190   7.930   -280.089 1.00 0.00 ?  80 ARG E HH11 1  
ATOM 6198   H HH12 . ARG E  1 80 ? 3.630   6.642   -281.136 1.00 0.00 ?  80 ARG E HH12 1  
ATOM 6199   H HH21 . ARG E  1 80 ? 3.074   8.776   -283.869 1.00 0.00 ?  80 ARG E HH21 1  
ATOM 6200   H HH22 . ARG E  1 80 ? 2.994   7.122   -283.293 1.00 0.00 ?  80 ARG E HH22 1  
ATOM 6201   N N    . MET F  1 1  ? -1.580  46.506  -257.726 1.00 0.00 ?  1  MET F N    1  
ATOM 6202   C CA   . MET F  1 1  ? -2.471  46.121  -258.813 1.00 0.00 ?  1  MET F CA   1  
ATOM 6203   C C    . MET F  1 1  ? -2.150  44.721  -259.320 1.00 0.00 ?  1  MET F C    1  
ATOM 6204   O O    . MET F  1 1  ? -3.031  44.004  -259.794 1.00 0.00 ?  1  MET F O    1  
ATOM 6205   C CB   . MET F  1 1  ? -2.377  47.131  -259.955 1.00 0.00 ?  1  MET F CB   1  
ATOM 6206   C CG   . MET F  1 1  ? -2.834  48.537  -259.592 1.00 0.00 ?  1  MET F CG   1  
ATOM 6207   S SD   . MET F  1 1  ? -4.537  48.583  -258.999 1.00 0.00 ?  1  MET F SD   1  
ATOM 6208   C CE   . MET F  1 1  ? -5.429  48.199  -260.503 1.00 0.00 ?  1  MET F CE   1  
ATOM 6209   H H1   . MET F  1 1  ? -0.994  47.311  -257.820 1.00 0.00 ?  1  MET F H1   1  
ATOM 6210   H H2   . MET F  1 1  ? -1.956  46.730  -256.826 1.00 0.00 ?  1  MET F H2   1  
ATOM 6211   H H3   . MET F  1 1  ? -0.872  45.873  -257.411 1.00 0.00 ?  1  MET F H3   1  
ATOM 6212   H HA   . MET F  1 1  ? -3.501  46.093  -258.457 1.00 0.00 ?  1  MET F HA   1  
ATOM 6213   H HB2  . MET F  1 1  ? -1.335  47.158  -260.270 1.00 0.00 ?  1  MET F HB2  1  
ATOM 6214   H HB3  . MET F  1 1  ? -2.994  46.748  -260.770 1.00 0.00 ?  1  MET F HB3  1  
ATOM 6215   H HG2  . MET F  1 1  ? -2.174  48.918  -258.814 1.00 0.00 ?  1  MET F HG2  1  
ATOM 6216   H HG3  . MET F  1 1  ? -2.748  49.162  -260.481 1.00 0.00 ?  1  MET F HG3  1  
ATOM 6217   H HE1  . MET F  1 1  ? -5.121  47.219  -260.868 1.00 0.00 ?  1  MET F HE1  1  
ATOM 6218   H HE2  . MET F  1 1  ? -6.500  48.190  -260.299 1.00 0.00 ?  1  MET F HE2  1  
ATOM 6219   H HE3  . MET F  1 1  ? -5.210  48.954  -261.259 1.00 0.00 ?  1  MET F HE3  1  
ATOM 6220   N N    . ALA F  1 2  ? -0.882  44.337  -259.217 1.00 0.00 ?  2  ALA F N    1  
ATOM 6221   C CA   . ALA F  1 2  ? -0.439  43.027  -259.678 1.00 0.00 ?  2  ALA F CA   1  
ATOM 6222   C C    . ALA F  1 2  ? -0.873  41.928  -258.716 1.00 0.00 ?  2  ALA F C    1  
ATOM 6223   O O    . ALA F  1 2  ? -0.914  42.133  -257.503 1.00 0.00 ?  2  ALA F O    1  
ATOM 6224   C CB   . ALA F  1 2  ? 1.073   43.011  -259.857 1.00 0.00 ?  2  ALA F CB   1  
ATOM 6225   H H    . ALA F  1 2  ? -0.208  44.969  -258.809 1.00 0.00 ?  2  ALA F H    1  
ATOM 6226   H HA   . ALA F  1 2  ? -0.905  42.819  -260.641 1.00 0.00 ?  2  ALA F HA   1  
ATOM 6227   H HB1  . ALA F  1 2  ? 1.554   43.233  -258.906 1.00 0.00 ?  2  ALA F HB1  1  
ATOM 6228   H HB2  . ALA F  1 2  ? 1.387   42.026  -260.202 1.00 0.00 ?  2  ALA F HB2  1  
ATOM 6229   H HB3  . ALA F  1 2  ? 1.360   43.762  -260.594 1.00 0.00 ?  2  ALA F HB3  1  
ATOM 6230   N N    . THR F  1 3  ? -1.197  40.762  -259.265 1.00 0.00 ?  3  THR F N    1  
ATOM 6231   C CA   . THR F  1 3  ? -1.617  39.625  -258.455 1.00 0.00 ?  3  THR F CA   1  
ATOM 6232   C C    . THR F  1 3  ? -0.839  38.369  -258.824 1.00 0.00 ?  3  THR F C    1  
ATOM 6233   O O    . THR F  1 3  ? -0.834  37.947  -259.981 1.00 0.00 ?  3  THR F O    1  
ATOM 6234   C CB   . THR F  1 3  ? -3.124  39.347  -258.610 1.00 0.00 ?  3  THR F CB   1  
ATOM 6235   O OG1  . THR F  1 3  ? -3.869  40.507  -258.219 1.00 0.00 ?  3  THR F OG1  1  
ATOM 6236   C CG2  . THR F  1 3  ? -3.540  38.167  -257.744 1.00 0.00 ?  3  THR F CG2  1  
ATOM 6237   H H    . THR F  1 3  ? -1.152  40.662  -260.269 1.00 0.00 ?  3  THR F H    1  
ATOM 6238   H HA   . THR F  1 3  ? -1.404  39.822  -257.404 1.00 0.00 ?  3  THR F HA   1  
ATOM 6239   H HB   . THR F  1 3  ? -3.338  39.123  -259.654 1.00 0.00 ?  3  THR F HB   1  
ATOM 6240   H HG1  . THR F  1 3  ? -4.808  40.331  -258.317 1.00 0.00 ?  3  THR F HG1  1  
ATOM 6241   H HG21 . THR F  1 3  ? -4.607  37.986  -257.867 1.00 0.00 ?  3  THR F HG21 1  
ATOM 6242   H HG22 . THR F  1 3  ? -2.983  37.280  -258.046 1.00 0.00 ?  3  THR F HG22 1  
ATOM 6243   H HG23 . THR F  1 3  ? -3.327  38.391  -256.699 1.00 0.00 ?  3  THR F HG23 1  
ATOM 6244   N N    . PRO F  1 4  ? -0.181  37.774  -257.835 1.00 0.00 ?  4  PRO F N    1  
ATOM 6245   C CA   . PRO F  1 4  ? 0.570   36.542  -258.046 1.00 0.00 ?  4  PRO F CA   1  
ATOM 6246   C C    . PRO F  1 4  ? -0.311  35.458  -258.654 1.00 0.00 ?  4  PRO F C    1  
ATOM 6247   O O    . PRO F  1 4  ? -1.491  35.345  -258.323 1.00 0.00 ?  4  PRO F O    1  
ATOM 6248   C CB   . PRO F  1 4  ? 1.068   36.163  -256.647 1.00 0.00 ?  4  PRO F CB   1  
ATOM 6249   C CG   . PRO F  1 4  ? 1.113   37.456  -255.906 1.00 0.00 ?  4  PRO F CG   1  
ATOM 6250   C CD   . PRO F  1 4  ? -0.054  38.254  -256.424 1.00 0.00 ?  4  PRO F CD   1  
ATOM 6251   H HA   . PRO F  1 4  ? 1.400   36.666  -258.757 1.00 0.00 ?  4  PRO F HA   1  
ATOM 6252   H HB2  . PRO F  1 4  ? 0.390   35.448  -256.158 1.00 0.00 ?  4  PRO F HB2  1  
ATOM 6253   H HB3  . PRO F  1 4  ? 2.061   35.692  -256.687 1.00 0.00 ?  4  PRO F HB3  1  
ATOM 6254   H HG2  . PRO F  1 4  ? 1.033   37.296  -254.821 1.00 0.00 ?  4  PRO F HG2  1  
ATOM 6255   H HG3  . PRO F  1 4  ? 2.062   37.983  -256.084 1.00 0.00 ?  4  PRO F HG3  1  
ATOM 6256   H HD2  . PRO F  1 4  ? -0.974  38.064  -255.852 1.00 0.00 ?  4  PRO F HD2  1  
ATOM 6257   H HD3  . PRO F  1 4  ? 0.132   39.337  -256.382 1.00 0.00 ?  4  PRO F HD3  1  
ATOM 6258   N N    . TRP F  1 5  ? 0.270   34.662  -259.545 1.00 0.00 ?  5  TRP F N    1  
ATOM 6259   C CA   . TRP F  1 5  ? -0.463  33.591  -260.209 1.00 0.00 ?  5  TRP F CA   1  
ATOM 6260   C C    . TRP F  1 5  ? -0.903  32.525  -259.214 1.00 0.00 ?  5  TRP F C    1  
ATOM 6261   O O    . TRP F  1 5  ? -0.159  32.172  -258.299 1.00 0.00 ?  5  TRP F O    1  
ATOM 6262   C CB   . TRP F  1 5  ? 0.393   32.961  -261.309 1.00 0.00 ?  5  TRP F CB   1  
ATOM 6263   C CG   . TRP F  1 5  ? -0.264  31.796  -261.985 1.00 0.00 ?  5  TRP F CG   1  
ATOM 6264   C CD1  . TRP F  1 5  ? -1.064  31.838  -263.087 1.00 0.00 ?  5  TRP F CD1  1  
ATOM 6265   C CD2  . TRP F  1 5  ? -0.177  30.417  -261.604 1.00 0.00 ?  5  TRP F CD2  1  
ATOM 6266   N NE1  . TRP F  1 5  ? -1.483  30.573  -263.417 1.00 0.00 ?  5  TRP F NE1  1  
ATOM 6267   C CE2  . TRP F  1 5  ? -0.949  29.682  -262.520 1.00 0.00 ?  5  TRP F CE2  1  
ATOM 6268   C CE3  . TRP F  1 5  ? 0.482   29.734  -260.574 1.00 0.00 ?  5  TRP F CE3  1  
ATOM 6269   C CZ2  . TRP F  1 5  ? -1.084  28.304  -262.441 1.00 0.00 ?  5  TRP F CZ2  1  
ATOM 6270   C CZ3  . TRP F  1 5  ? 0.347   28.353  -260.496 1.00 0.00 ?  5  TRP F CZ3  1  
ATOM 6271   C CH2  . TRP F  1 5  ? -0.413  27.659  -261.403 1.00 0.00 ?  5  TRP F CH2  1  
ATOM 6272   H H    . TRP F  1 5  ? 1.245   34.803  -259.768 1.00 0.00 ?  5  TRP F H    1  
ATOM 6273   H HA   . TRP F  1 5  ? -1.371  33.990  -260.661 1.00 0.00 ?  5  TRP F HA   1  
ATOM 6274   H HB2  . TRP F  1 5  ? 0.607   33.693  -262.088 1.00 0.00 ?  5  TRP F HB2  1  
ATOM 6275   H HB3  . TRP F  1 5  ? 1.329   32.592  -260.891 1.00 0.00 ?  5  TRP F HB3  1  
ATOM 6276   H HD1  . TRP F  1 5  ? -1.247  32.817  -263.526 1.00 0.00 ?  5  TRP F HD1  1  
ATOM 6277   H HE1  . TRP F  1 5  ? -2.085  30.336  -264.192 1.00 0.00 ?  5  TRP F HE1  1  
ATOM 6278   H HE3  . TRP F  1 5  ? 1.100   30.235  -259.830 1.00 0.00 ?  5  TRP F HE3  1  
ATOM 6279   H HZ2  . TRP F  1 5  ? -1.698  27.792  -263.183 1.00 0.00 ?  5  TRP F HZ2  1  
ATOM 6280   H HZ3  . TRP F  1 5  ? 0.865   27.833  -259.689 1.00 0.00 ?  5  TRP F HZ3  1  
ATOM 6281   H HH2  . TRP F  1 5  ? -0.492  26.575  -261.306 1.00 0.00 ?  5  TRP F HH2  1  
ATOM 6282   N N    . SER F  1 6  ? -2.116  32.016  -259.398 1.00 0.00 ?  6  SER F N    1  
ATOM 6283   C CA   . SER F  1 6  ? -2.617  30.917  -258.581 1.00 0.00 ?  6  SER F CA   1  
ATOM 6284   C C    . SER F  1 6  ? -3.425  29.933  -259.417 1.00 0.00 ?  6  SER F C    1  
ATOM 6285   O O    . SER F  1 6  ? -4.374  30.316  -260.101 1.00 0.00 ?  6  SER F O    1  
ATOM 6286   C CB   . SER F  1 6  ? -3.459  31.457  -257.441 1.00 0.00 ?  6  SER F CB   1  
ATOM 6287   O OG   . SER F  1 6  ? -4.024  30.431  -256.671 1.00 0.00 ?  6  SER F OG   1  
ATOM 6288   H H    . SER F  1 6  ? -2.706  32.399  -260.122 1.00 0.00 ?  6  SER F H    1  
ATOM 6289   H HA   . SER F  1 6  ? -1.833  30.387  -258.038 1.00 0.00 ?  6  SER F HA   1  
ATOM 6290   H HB2  . SER F  1 6  ? -2.826  32.072  -256.801 1.00 0.00 ?  6  SER F HB2  1  
ATOM 6291   H HB3  . SER F  1 6  ? -4.258  32.069  -257.856 1.00 0.00 ?  6  SER F HB3  1  
ATOM 6292   H HG   . SER F  1 6  ? -4.969  30.393  -256.834 1.00 0.00 ?  6  SER F HG   1  
ATOM 6293   N N    . GLY F  1 7  ? -3.043  28.661  -259.357 1.00 0.00 ?  7  GLY F N    1  
ATOM 6294   C CA   . GLY F  1 7  ? -3.737  27.618  -260.102 1.00 0.00 ?  7  GLY F CA   1  
ATOM 6295   C C    . GLY F  1 7  ? -4.996  27.166  -259.374 1.00 0.00 ?  7  GLY F C    1  
ATOM 6296   O O    . GLY F  1 7  ? -5.340  27.699  -258.320 1.00 0.00 ?  7  GLY F O    1  
ATOM 6297   H H    . GLY F  1 7  ? -2.252  28.412  -258.781 1.00 0.00 ?  7  GLY F H    1  
ATOM 6298   H HA2  . GLY F  1 7  ? -4.013  28.004  -261.084 1.00 0.00 ?  7  GLY F HA2  1  
ATOM 6299   H HA3  . GLY F  1 7  ? -3.071  26.764  -260.223 1.00 0.00 ?  7  GLY F HA3  1  
ATOM 6300   N N    . TYR F  1 8  ? -5.681  26.179  -259.944 1.00 0.00 ?  8  TYR F N    1  
ATOM 6301   C CA   . TYR F  1 8  ? -6.896  25.643  -259.342 1.00 0.00 ?  8  TYR F CA   1  
ATOM 6302   C C    . TYR F  1 8  ? -6.601  24.976  -258.005 1.00 0.00 ?  8  TYR F C    1  
ATOM 6303   O O    . TYR F  1 8  ? -7.276  25.235  -257.009 1.00 0.00 ?  8  TYR F O    1  
ATOM 6304   C CB   . TYR F  1 8  ? -7.567  24.646  -260.289 1.00 0.00 ?  8  TYR F CB   1  
ATOM 6305   C CG   . TYR F  1 8  ? -8.821  24.015  -259.726 1.00 0.00 ?  8  TYR F CG   1  
ATOM 6306   C CD1  . TYR F  1 8  ? -10.060 24.615  -259.897 1.00 0.00 ?  8  TYR F CD1  1  
ATOM 6307   C CD2  . TYR F  1 8  ? -8.762  22.818  -259.027 1.00 0.00 ?  8  TYR F CD2  1  
ATOM 6308   C CE1  . TYR F  1 8  ? -11.208 24.042  -259.384 1.00 0.00 ?  8  TYR F CE1  1  
ATOM 6309   C CE2  . TYR F  1 8  ? -9.903  22.236  -258.510 1.00 0.00 ?  8  TYR F CE2  1  
ATOM 6310   C CZ   . TYR F  1 8  ? -11.125 22.852  -258.691 1.00 0.00 ?  8  TYR F CZ   1  
ATOM 6311   O OH   . TYR F  1 8  ? -12.265 22.276  -258.179 1.00 0.00 ?  8  TYR F OH   1  
ATOM 6312   H H    . TYR F  1 8  ? -5.351  25.791  -260.816 1.00 0.00 ?  8  TYR F H    1  
ATOM 6313   H HA   . TYR F  1 8  ? -7.596  26.454  -259.137 1.00 0.00 ?  8  TYR F HA   1  
ATOM 6314   H HB2  . TYR F  1 8  ? -7.812  25.186  -261.205 1.00 0.00 ?  8  TYR F HB2  1  
ATOM 6315   H HB3  . TYR F  1 8  ? -6.836  23.869  -260.509 1.00 0.00 ?  8  TYR F HB3  1  
ATOM 6316   H HD1  . TYR F  1 8  ? -10.118 25.555  -260.446 1.00 0.00 ?  8  TYR F HD1  1  
ATOM 6317   H HD2  . TYR F  1 8  ? -7.793  22.338  -258.887 1.00 0.00 ?  8  TYR F HD2  1  
ATOM 6318   H HE1  . TYR F  1 8  ? -12.175 24.525  -259.526 1.00 0.00 ?  8  TYR F HE1  1  
ATOM 6319   H HE2  . TYR F  1 8  ? -9.835  21.296  -257.962 1.00 0.00 ?  8  TYR F HE2  1  
ATOM 6320   H HH   . TYR F  1 8  ? -13.058 22.786  -258.362 1.00 0.00 ?  8  TYR F HH   1  
ATOM 6321   N N    . LEU F  1 9  ? -5.588  24.116  -257.989 1.00 0.00 ?  9  LEU F N    1  
ATOM 6322   C CA   . LEU F  1 9  ? -5.206  23.405  -256.775 1.00 0.00 ?  9  LEU F CA   1  
ATOM 6323   C C    . LEU F  1 9  ? -4.696  24.367  -255.710 1.00 0.00 ?  9  LEU F C    1  
ATOM 6324   O O    . LEU F  1 9  ? -4.910  24.157  -254.516 1.00 0.00 ?  9  LEU F O    1  
ATOM 6325   C CB   . LEU F  1 9  ? -4.141  22.348  -257.094 1.00 0.00 ?  9  LEU F CB   1  
ATOM 6326   C CG   . LEU F  1 9  ? -4.626  21.169  -257.947 1.00 0.00 ?  9  LEU F CG   1  
ATOM 6327   C CD1  . LEU F  1 9  ? -3.453  20.267  -258.307 1.00 0.00 ?  9  LEU F CD1  1  
ATOM 6328   C CD2  . LEU F  1 9  ? -5.689  20.392  -257.183 1.00 0.00 ?  9  LEU F CD2  1  
ATOM 6329   H H    . LEU F  1 9  ? -5.069  23.951  -258.840 1.00 0.00 ?  9  LEU F H    1  
ATOM 6330   H HA   . LEU F  1 9  ? -6.079  22.910  -256.352 1.00 0.00 ?  9  LEU F HA   1  
ATOM 6331   H HB2  . LEU F  1 9  ? -3.447  22.962  -257.665 1.00 0.00 ?  9  LEU F HB2  1  
ATOM 6332   H HB3  . LEU F  1 9  ? -3.648  21.987  -256.191 1.00 0.00 ?  9  LEU F HB3  1  
ATOM 6333   H HG   . LEU F  1 9  ? -5.094  21.585  -258.839 1.00 0.00 ?  9  LEU F HG   1  
ATOM 6334   H HD11 . LEU F  1 9  ? -3.807  19.433  -258.913 1.00 0.00 ?  9  LEU F HD11 1  
ATOM 6335   H HD12 . LEU F  1 9  ? -2.716  20.838  -258.872 1.00 0.00 ?  9  LEU F HD12 1  
ATOM 6336   H HD13 . LEU F  1 9  ? -2.995  19.885  -257.395 1.00 0.00 ?  9  LEU F HD13 1  
ATOM 6337   H HD21 . LEU F  1 9  ? -6.530  21.048  -256.961 1.00 0.00 ?  9  LEU F HD21 1  
ATOM 6338   H HD22 . LEU F  1 9  ? -6.033  19.555  -257.791 1.00 0.00 ?  9  LEU F HD22 1  
ATOM 6339   H HD23 . LEU F  1 9  ? -5.266  20.015  -256.252 1.00 0.00 ?  9  LEU F HD23 1  
ATOM 6340   N N    . ASP F  1 10 ? -4.019  25.423  -256.149 1.00 0.00 ?  10 ASP F N    1  
ATOM 6341   C CA   . ASP F  1 10 ? -3.705  26.548  -255.277 1.00 0.00 ?  10 ASP F CA   1  
ATOM 6342   C C    . ASP F  1 10 ? -4.967  27.136  -254.659 1.00 0.00 ?  10 ASP F C    1  
ATOM 6343   O O    . ASP F  1 10 ? -5.014  27.409  -253.460 1.00 0.00 ?  10 ASP F O    1  
ATOM 6344   C CB   . ASP F  1 10 ? -2.945  27.630  -256.049 1.00 0.00 ?  10 ASP F CB   1  
ATOM 6345   C CG   . ASP F  1 10 ? -1.521  27.247  -256.431 1.00 0.00 ?  10 ASP F CG   1  
ATOM 6346   O OD1  . ASP F  1 10 ? -1.011  26.303  -255.875 1.00 0.00 ?  10 ASP F OD1  1  
ATOM 6347   O OD2  . ASP F  1 10 ? -1.015  27.796  -257.380 1.00 0.00 -1 10 ASP F OD2  1  
ATOM 6348   H H    . ASP F  1 10 ? -3.715  25.447  -257.112 1.00 0.00 ?  10 ASP F H    1  
ATOM 6349   H HA   . ASP F  1 10 ? -3.083  26.210  -254.448 1.00 0.00 ?  10 ASP F HA   1  
ATOM 6350   H HB2  . ASP F  1 10 ? -3.474  27.986  -256.933 1.00 0.00 ?  10 ASP F HB2  1  
ATOM 6351   H HB3  . ASP F  1 10 ? -2.919  28.419  -255.297 1.00 0.00 ?  10 ASP F HB3  1  
ATOM 6352   N N    . ASP F  1 11 ? -5.990  27.329  -255.486 1.00 0.00 ?  11 ASP F N    1  
ATOM 6353   C CA   . ASP F  1 11 ? -7.261  27.869  -255.019 1.00 0.00 ?  11 ASP F CA   1  
ATOM 6354   C C    . ASP F  1 11 ? -7.939  26.916  -254.043 1.00 0.00 ?  11 ASP F C    1  
ATOM 6355   O O    . ASP F  1 11 ? -8.565  27.346  -253.074 1.00 0.00 ?  11 ASP F O    1  
ATOM 6356   C CB   . ASP F  1 11 ? -8.188  28.157  -256.202 1.00 0.00 ?  11 ASP F CB   1  
ATOM 6357   C CG   . ASP F  1 11 ? -7.758  29.335  -257.066 1.00 0.00 ?  11 ASP F CG   1  
ATOM 6358   O OD1  . ASP F  1 11 ? -6.890  30.065  -256.651 1.00 0.00 ?  11 ASP F OD1  1  
ATOM 6359   O OD2  . ASP F  1 11 ? -8.184  29.405  -258.194 1.00 0.00 -1 11 ASP F OD2  1  
ATOM 6360   H H    . ASP F  1 11 ? -5.884  27.095  -256.462 1.00 0.00 ?  11 ASP F H    1  
ATOM 6361   H HA   . ASP F  1 11 ? -7.090  28.799  -254.476 1.00 0.00 ?  11 ASP F HA   1  
ATOM 6362   H HB2  . ASP F  1 11 ? -8.367  27.288  -256.836 1.00 0.00 ?  11 ASP F HB2  1  
ATOM 6363   H HB3  . ASP F  1 11 ? -9.104  28.414  -255.669 1.00 0.00 ?  11 ASP F HB3  1  
ATOM 6364   N N    . VAL F  1 12 ? -7.810  25.619  -254.303 1.00 0.00 ?  12 VAL F N    1  
ATOM 6365   C CA   . VAL F  1 12 ? -8.354  24.601  -253.413 1.00 0.00 ?  12 VAL F CA   1  
ATOM 6366   C C    . VAL F  1 12 ? -7.719  24.682  -252.031 1.00 0.00 ?  12 VAL F C    1  
ATOM 6367   O O    . VAL F  1 12 ? -8.410  24.617  -251.014 1.00 0.00 ?  12 VAL F O    1  
ATOM 6368   C CB   . VAL F  1 12 ? -8.146  23.184  -253.980 1.00 0.00 ?  12 VAL F CB   1  
ATOM 6369   C CG1  . VAL F  1 12 ? -8.489  22.136  -252.933 1.00 0.00 ?  12 VAL F CG1  1  
ATOM 6370   C CG2  . VAL F  1 12 ? -8.989  22.982  -255.230 1.00 0.00 ?  12 VAL F CG2  1  
ATOM 6371   H H    . VAL F  1 12 ? -7.323  25.332  -255.140 1.00 0.00 ?  12 VAL F H    1  
ATOM 6372   H HA   . VAL F  1 12 ? -9.420  24.754  -253.240 1.00 0.00 ?  12 VAL F HA   1  
ATOM 6373   H HB   . VAL F  1 12 ? -7.104  23.072  -254.279 1.00 0.00 ?  12 VAL F HB   1  
ATOM 6374   H HG11 . VAL F  1 12 ? -8.336  21.140  -253.351 1.00 0.00 ?  12 VAL F HG11 1  
ATOM 6375   H HG12 . VAL F  1 12 ? -7.846  22.266  -252.063 1.00 0.00 ?  12 VAL F HG12 1  
ATOM 6376   H HG13 . VAL F  1 12 ? -9.532  22.247  -252.634 1.00 0.00 ?  12 VAL F HG13 1  
ATOM 6377   H HG21 . VAL F  1 12 ? -8.700  23.712  -255.986 1.00 0.00 ?  12 VAL F HG21 1  
ATOM 6378   H HG22 . VAL F  1 12 ? -8.830  21.977  -255.619 1.00 0.00 ?  12 VAL F HG22 1  
ATOM 6379   H HG23 . VAL F  1 12 ? -10.043 23.114  -254.983 1.00 0.00 ?  12 VAL F HG23 1  
ATOM 6380   N N    . SER F  1 13 ? -6.398  24.824  -251.999 1.00 0.00 ?  13 SER F N    1  
ATOM 6381   C CA   . SER F  1 13 ? -5.677  25.008  -250.746 1.00 0.00 ?  13 SER F CA   1  
ATOM 6382   C C    . SER F  1 13 ? -6.154  26.255  -250.013 1.00 0.00 ?  13 SER F C    1  
ATOM 6383   O O    . SER F  1 13 ? -6.353  26.235  -248.798 1.00 0.00 ?  13 SER F O    1  
ATOM 6384   C CB   . SER F  1 13 ? -4.186  25.088  -251.008 1.00 0.00 ?  13 SER F CB   1  
ATOM 6385   O OG   . SER F  1 13 ? -3.457  25.327  -249.836 1.00 0.00 ?  13 SER F OG   1  
ATOM 6386   H H    . SER F  1 13 ? -5.881  24.805  -252.866 1.00 0.00 ?  13 SER F H    1  
ATOM 6387   H HA   . SER F  1 13 ? -5.734  24.143  -250.083 1.00 0.00 ?  13 SER F HA   1  
ATOM 6388   H HB2  . SER F  1 13 ? -3.858  24.144  -251.443 1.00 0.00 ?  13 SER F HB2  1  
ATOM 6389   H HB3  . SER F  1 13 ? -3.998  25.896  -251.714 1.00 0.00 ?  13 SER F HB3  1  
ATOM 6390   H HG   . SER F  1 13 ? -2.608  25.717  -250.061 1.00 0.00 ?  13 SER F HG   1  
ATOM 6391   N N    . ALA F  1 14 ? -6.337  27.340  -250.758 1.00 0.00 ?  14 ALA F N    1  
ATOM 6392   C CA   . ALA F  1 14 ? -6.820  28.590  -250.186 1.00 0.00 ?  14 ALA F CA   1  
ATOM 6393   C C    . ALA F  1 14 ? -8.243  28.442  -249.660 1.00 0.00 ?  14 ALA F C    1  
ATOM 6394   O O    . ALA F  1 14 ? -8.585  28.981  -248.608 1.00 0.00 ?  14 ALA F O    1  
ATOM 6395   C CB   . ALA F  1 14 ? -6.746  29.708  -251.216 1.00 0.00 ?  14 ALA F CB   1  
ATOM 6396   H H    . ALA F  1 14 ? -6.135  27.297  -251.747 1.00 0.00 ?  14 ALA F H    1  
ATOM 6397   H HA   . ALA F  1 14 ? -6.187  28.855  -249.339 1.00 0.00 ?  14 ALA F HA   1  
ATOM 6398   H HB1  . ALA F  1 14 ? -7.362  29.451  -252.076 1.00 0.00 ?  14 ALA F HB1  1  
ATOM 6399   H HB2  . ALA F  1 14 ? -7.111  30.634  -250.772 1.00 0.00 ?  14 ALA F HB2  1  
ATOM 6400   H HB3  . ALA F  1 14 ? -5.713  29.841  -251.535 1.00 0.00 ?  14 ALA F HB3  1  
ATOM 6401   N N    . LYS F  1 15 ? -9.067  27.707  -250.399 1.00 0.00 ?  15 LYS F N    1  
ATOM 6402   C CA   . LYS F  1 15 ? -10.463 27.513  -250.026 1.00 0.00 ?  15 LYS F CA   1  
ATOM 6403   C C    . LYS F  1 15 ? -10.581 26.790  -248.690 1.00 0.00 ?  15 LYS F C    1  
ATOM 6404   O O    . LYS F  1 15 ? -11.410 27.145  -247.852 1.00 0.00 ?  15 LYS F O    1  
ATOM 6405   C CB   . LYS F  1 15 ? -11.205 26.734  -251.113 1.00 0.00 ?  15 LYS F CB   1  
ATOM 6406   C CG   . LYS F  1 15 ? -11.574 27.560  -252.338 1.00 0.00 ?  15 LYS F CG   1  
ATOM 6407   C CD   . LYS F  1 15 ? -12.152 26.686  -253.441 1.00 0.00 ?  15 LYS F CD   1  
ATOM 6408   C CE   . LYS F  1 15 ? -12.411 27.490  -254.707 1.00 0.00 ?  15 LYS F CE   1  
ATOM 6409   N NZ   . LYS F  1 15 ? -13.513 28.474  -254.525 1.00 0.00 1  15 LYS F NZ   1  
ATOM 6410   H H    . LYS F  1 15 ? -8.718  27.271  -251.241 1.00 0.00 ?  15 LYS F H    1  
ATOM 6411   H HA   . LYS F  1 15 ? -10.949 28.481  -249.899 1.00 0.00 ?  15 LYS F HA   1  
ATOM 6412   H HB2  . LYS F  1 15 ? -10.558 25.910  -251.413 1.00 0.00 ?  15 LYS F HB2  1  
ATOM 6413   H HB3  . LYS F  1 15 ? -12.112 26.335  -250.658 1.00 0.00 ?  15 LYS F HB3  1  
ATOM 6414   H HG2  . LYS F  1 15 ? -12.312 28.307  -252.042 1.00 0.00 ?  15 LYS F HG2  1  
ATOM 6415   H HG3  . LYS F  1 15 ? -10.677 28.060  -252.702 1.00 0.00 ?  15 LYS F HG3  1  
ATOM 6416   H HD2  . LYS F  1 15 ? -11.443 25.886  -253.657 1.00 0.00 ?  15 LYS F HD2  1  
ATOM 6417   H HD3  . LYS F  1 15 ? -13.088 26.254  -253.088 1.00 0.00 ?  15 LYS F HD3  1  
ATOM 6418   H HE2  . LYS F  1 15 ? -11.495 28.016  -254.971 1.00 0.00 ?  15 LYS F HE2  1  
ATOM 6419   H HE3  . LYS F  1 15 ? -12.674 26.796  -255.505 1.00 0.00 ?  15 LYS F HE3  1  
ATOM 6420   H HZ1  . LYS F  1 15 ? -13.270 29.119  -253.786 1.00 0.00 ?  15 LYS F HZ1  1  
ATOM 6421   H HZ2  . LYS F  1 15 ? -13.653 28.985  -255.385 1.00 0.00 ?  15 LYS F HZ2  1  
ATOM 6422   H HZ3  . LYS F  1 15 ? -14.363 27.987  -254.280 1.00 0.00 ?  15 LYS F HZ3  1  
ATOM 6423   N N    . PHE F  1 16 ? -9.747  25.774  -248.498 1.00 0.00 ?  16 PHE F N    1  
ATOM 6424   C CA   . PHE F  1 16 ? -9.682  25.066  -247.224 1.00 0.00 ?  16 PHE F CA   1  
ATOM 6425   C C    . PHE F  1 16 ? -9.177  25.977  -246.113 1.00 0.00 ?  16 PHE F C    1  
ATOM 6426   O O    . PHE F  1 16 ? -9.783  26.065  -245.045 1.00 0.00 ?  16 PHE F O    1  
ATOM 6427   C CB   . PHE F  1 16 ? -8.785  23.833  -247.343 1.00 0.00 ?  16 PHE F CB   1  
ATOM 6428   C CG   . PHE F  1 16 ? -8.671  23.042  -246.072 1.00 0.00 ?  16 PHE F CG   1  
ATOM 6429   C CD1  . PHE F  1 16 ? -9.598  22.057  -245.765 1.00 0.00 ?  16 PHE F CD1  1  
ATOM 6430   C CD2  . PHE F  1 16 ? -7.637  23.281  -245.179 1.00 0.00 ?  16 PHE F CD2  1  
ATOM 6431   C CE1  . PHE F  1 16 ? -9.493  21.328  -244.595 1.00 0.00 ?  16 PHE F CE1  1  
ATOM 6432   C CE2  . PHE F  1 16 ? -7.529  22.554  -244.010 1.00 0.00 ?  16 PHE F CE2  1  
ATOM 6433   C CZ   . PHE F  1 16 ? -8.459  21.577  -243.717 1.00 0.00 ?  16 PHE F CZ   1  
ATOM 6434   H H    . PHE F  1 16 ? -9.141  25.485  -249.252 1.00 0.00 ?  16 PHE F H    1  
ATOM 6435   H HA   . PHE F  1 16 ? -10.682 24.743  -246.930 1.00 0.00 ?  16 PHE F HA   1  
ATOM 6436   H HB2  . PHE F  1 16 ? -9.179  23.154  -248.099 1.00 0.00 ?  16 PHE F HB2  1  
ATOM 6437   H HB3  . PHE F  1 16 ? -7.774  24.131  -247.617 1.00 0.00 ?  16 PHE F HB3  1  
ATOM 6438   H HD1  . PHE F  1 16 ? -10.415 21.860  -246.459 1.00 0.00 ?  16 PHE F HD1  1  
ATOM 6439   H HD2  . PHE F  1 16 ? -6.902  24.054  -245.410 1.00 0.00 ?  16 PHE F HD2  1  
ATOM 6440   H HE1  . PHE F  1 16 ? -10.229 20.557  -244.366 1.00 0.00 ?  16 PHE F HE1  1  
ATOM 6441   H HE2  . PHE F  1 16 ? -6.711  22.752  -243.317 1.00 0.00 ?  16 PHE F HE2  1  
ATOM 6442   H HZ   . PHE F  1 16 ? -8.377  21.004  -242.795 1.00 0.00 ?  16 PHE F HZ   1  
ATOM 6443   N N    . ASP F  1 17 ? -8.062  26.653  -246.370 1.00 0.00 ?  17 ASP F N    1  
ATOM 6444   C CA   . ASP F  1 17 ? -7.425  27.491  -245.361 1.00 0.00 ?  17 ASP F CA   1  
ATOM 6445   C C    . ASP F  1 17 ? -8.331  28.645  -244.951 1.00 0.00 ?  17 ASP F C    1  
ATOM 6446   O O    . ASP F  1 17 ? -8.273  29.119  -243.816 1.00 0.00 ?  17 ASP F O    1  
ATOM 6447   C CB   . ASP F  1 17 ? -6.089  28.030  -245.878 1.00 0.00 ?  17 ASP F CB   1  
ATOM 6448   C CG   . ASP F  1 17 ? -4.966  27.003  -245.910 1.00 0.00 ?  17 ASP F CG   1  
ATOM 6449   O OD1  . ASP F  1 17 ? -5.123  25.962  -245.318 1.00 0.00 ?  17 ASP F OD1  1  
ATOM 6450   O OD2  . ASP F  1 17 ? -4.031  27.197  -246.649 1.00 0.00 -1 17 ASP F OD2  1  
ATOM 6451   H H    . ASP F  1 17 ? -7.646  26.585  -247.288 1.00 0.00 ?  17 ASP F H    1  
ATOM 6452   H HA   . ASP F  1 17 ? -7.239  26.907  -244.460 1.00 0.00 ?  17 ASP F HA   1  
ATOM 6453   H HB2  . ASP F  1 17 ? -6.164  28.516  -246.852 1.00 0.00 ?  17 ASP F HB2  1  
ATOM 6454   H HB3  . ASP F  1 17 ? -5.875  28.778  -245.114 1.00 0.00 ?  17 ASP F HB3  1  
ATOM 6455   N N    . THR F  1 18 ? -9.168  29.093  -245.881 1.00 0.00 ?  18 THR F N    1  
ATOM 6456   C CA   . THR F  1 18 ? -10.087 30.194  -245.618 1.00 0.00 ?  18 THR F CA   1  
ATOM 6457   C C    . THR F  1 18 ? -10.866 29.965  -244.329 1.00 0.00 ?  18 THR F C    1  
ATOM 6458   O O    . THR F  1 18 ? -11.037 30.882  -243.525 1.00 0.00 ?  18 THR F O    1  
ATOM 6459   C CB   . THR F  1 18 ? -11.080 30.390  -246.778 1.00 0.00 ?  18 THR F CB   1  
ATOM 6460   O OG1  . THR F  1 18 ? -10.366 30.756  -247.966 1.00 0.00 ?  18 THR F OG1  1  
ATOM 6461   C CG2  . THR F  1 18 ? -12.086 31.480  -246.440 1.00 0.00 ?  18 THR F CG2  1  
ATOM 6462   H H    . THR F  1 18 ? -9.167  28.660  -246.793 1.00 0.00 ?  18 THR F H    1  
ATOM 6463   H HA   . THR F  1 18 ? -9.525  31.118  -245.479 1.00 0.00 ?  18 THR F HA   1  
ATOM 6464   H HB   . THR F  1 18 ? -11.607 29.453  -246.956 1.00 0.00 ?  18 THR F HB   1  
ATOM 6465   H HG1  . THR F  1 18 ? -10.987 30.877  -248.688 1.00 0.00 ?  18 THR F HG1  1  
ATOM 6466   H HG21 . THR F  1 18 ? -12.780 31.603  -247.272 1.00 0.00 ?  18 THR F HG21 1  
ATOM 6467   H HG22 . THR F  1 18 ? -12.639 31.198  -245.544 1.00 0.00 ?  18 THR F HG22 1  
ATOM 6468   H HG23 . THR F  1 18 ? -11.561 32.417  -246.263 1.00 0.00 ?  18 THR F HG23 1  
ATOM 6469   N N    . GLY F  1 19 ? -11.336 28.737  -244.138 1.00 0.00 ?  19 GLY F N    1  
ATOM 6470   C CA   . GLY F  1 19 ? -12.228 28.423  -243.028 1.00 0.00 ?  19 GLY F CA   1  
ATOM 6471   C C    . GLY F  1 19 ? -11.444 28.140  -241.754 1.00 0.00 ?  19 GLY F C    1  
ATOM 6472   O O    . GLY F  1 19 ? -12.009 28.103  -240.661 1.00 0.00 ?  19 GLY F O    1  
ATOM 6473   H H    . GLY F  1 19 ? -11.069 28.003  -244.778 1.00 0.00 ?  19 GLY F H    1  
ATOM 6474   H HA2  . GLY F  1 19 ? -12.894 29.269  -242.855 1.00 0.00 ?  19 GLY F HA2  1  
ATOM 6475   H HA3  . GLY F  1 19 ? -12.819 27.544  -243.284 1.00 0.00 ?  19 GLY F HA3  1  
ATOM 6476   N N    . VAL F  1 20 ? -10.138 27.941  -241.900 1.00 0.00 ?  20 VAL F N    1  
ATOM 6477   C CA   . VAL F  1 20 ? -9.279  27.627  -240.765 1.00 0.00 ?  20 VAL F CA   1  
ATOM 6478   C C    . VAL F  1 20 ? -8.038  28.511  -240.753 1.00 0.00 ?  20 VAL F C    1  
ATOM 6479   O O    . VAL F  1 20 ? -6.998  28.130  -240.216 1.00 0.00 ?  20 VAL F O    1  
ATOM 6480   C CB   . VAL F  1 20 ? -8.844  26.149  -240.776 1.00 0.00 ?  20 VAL F CB   1  
ATOM 6481   C CG1  . VAL F  1 20 ? -10.025 25.245  -240.456 1.00 0.00 ?  20 VAL F CG1  1  
ATOM 6482   C CG2  . VAL F  1 20 ? -8.243  25.781  -242.124 1.00 0.00 ?  20 VAL F CG2  1  
ATOM 6483   H H    . VAL F  1 20 ? -9.731  28.008  -242.822 1.00 0.00 ?  20 VAL F H    1  
ATOM 6484   H HA   . VAL F  1 20 ? -9.780  27.835  -239.819 1.00 0.00 ?  20 VAL F HA   1  
ATOM 6485   H HB   . VAL F  1 20 ? -8.063  26.005  -240.030 1.00 0.00 ?  20 VAL F HB   1  
ATOM 6486   H HG11 . VAL F  1 20 ? -9.700  24.204  -240.468 1.00 0.00 ?  20 VAL F HG11 1  
ATOM 6487   H HG12 . VAL F  1 20 ? -10.415 25.491  -239.469 1.00 0.00 ?  20 VAL F HG12 1  
ATOM 6488   H HG13 . VAL F  1 20 ? -10.806 25.388  -241.202 1.00 0.00 ?  20 VAL F HG13 1  
ATOM 6489   H HG21 . VAL F  1 20 ? -7.372  26.407  -242.317 1.00 0.00 ?  20 VAL F HG21 1  
ATOM 6490   H HG22 . VAL F  1 20 ? -7.941  24.734  -242.114 1.00 0.00 ?  20 VAL F HG22 1  
ATOM 6491   H HG23 . VAL F  1 20 ? -8.984  25.938  -242.907 1.00 0.00 ?  20 VAL F HG23 1  
ATOM 6492   N N    . ASP F  1 21 ? -8.154  29.693  -241.349 1.00 0.00 ?  21 ASP F N    1  
ATOM 6493   C CA   . ASP F  1 21 ? -7.069  30.667  -241.336 1.00 0.00 ?  21 ASP F CA   1  
ATOM 6494   C C    . ASP F  1 21 ? -6.682  31.042  -239.912 1.00 0.00 ?  21 ASP F C    1  
ATOM 6495   O O    . ASP F  1 21 ? -5.507  31.259  -239.614 1.00 0.00 ?  21 ASP F O    1  
ATOM 6496   C CB   . ASP F  1 21 ? -7.464  31.920  -242.122 1.00 0.00 ?  21 ASP F CB   1  
ATOM 6497   C CG   . ASP F  1 21 ? -6.334  32.922  -242.317 1.00 0.00 ?  21 ASP F CG   1  
ATOM 6498   O OD1  . ASP F  1 21 ? -5.355  32.572  -242.932 1.00 0.00 ?  21 ASP F OD1  1  
ATOM 6499   O OD2  . ASP F  1 21 ? -6.522  34.069  -241.988 1.00 0.00 -1 21 ASP F OD2  1  
ATOM 6500   H H    . ASP F  1 21 ? -9.016  29.923  -241.822 1.00 0.00 ?  21 ASP F H    1  
ATOM 6501   H HA   . ASP F  1 21 ? -6.180  30.234  -241.796 1.00 0.00 ?  21 ASP F HA   1  
ATOM 6502   H HB2  . ASP F  1 21 ? -7.925  31.702  -243.085 1.00 0.00 ?  21 ASP F HB2  1  
ATOM 6503   H HB3  . ASP F  1 21 ? -8.210  32.341  -241.447 1.00 0.00 ?  21 ASP F HB3  1  
ATOM 6504   N N    . ASN F  1 22 ? -7.677  31.118  -239.034 1.00 0.00 ?  22 ASN F N    1  
ATOM 6505   C CA   . ASN F  1 22 ? -7.447  31.502  -237.647 1.00 0.00 ?  22 ASN F CA   1  
ATOM 6506   C C    . ASN F  1 22 ? -6.908  30.332  -236.833 1.00 0.00 ?  22 ASN F C    1  
ATOM 6507   O O    . ASN F  1 22 ? -6.196  30.524  -235.848 1.00 0.00 ?  22 ASN F O    1  
ATOM 6508   C CB   . ASN F  1 22 ? -8.709  32.049  -237.006 1.00 0.00 ?  22 ASN F CB   1  
ATOM 6509   C CG   . ASN F  1 22 ? -9.114  33.401  -237.525 1.00 0.00 ?  22 ASN F CG   1  
ATOM 6510   O OD1  . ASN F  1 22 ? -8.293  34.154  -238.061 1.00 0.00 ?  22 ASN F OD1  1  
ATOM 6511   N ND2  . ASN F  1 22 ? -10.356 33.744  -237.297 1.00 0.00 ?  22 ASN F ND2  1  
ATOM 6512   H H    . ASN F  1 22 ? -8.616  30.904  -239.336 1.00 0.00 ?  22 ASN F H    1  
ATOM 6513   H HA   . ASN F  1 22 ? -6.689  32.285  -237.600 1.00 0.00 ?  22 ASN F HA   1  
ATOM 6514   H HB2  . ASN F  1 22 ? -9.597  31.425  -236.900 1.00 0.00 ?  22 ASN F HB2  1  
ATOM 6515   H HB3  . ASN F  1 22 ? -8.236  32.175  -236.032 1.00 0.00 ?  22 ASN F HB3  1  
ATOM 6516   H HD21 . ASN F  1 22 ? -10.965 33.121  -236.806 1.00 0.00 ?  22 ASN F HD21 1  
ATOM 6517   H HD22 . ASN F  1 22 ? -10.696 34.630  -237.614 1.00 0.00 ?  22 ASN F HD22 1  
ATOM 6518   N N    . LEU F  1 23 ? -7.252  29.119  -237.252 1.00 0.00 ?  23 LEU F N    1  
ATOM 6519   C CA   . LEU F  1 23 ? -6.837  27.916  -236.540 1.00 0.00 ?  23 LEU F CA   1  
ATOM 6520   C C    . LEU F  1 23 ? -5.332  27.907  -236.304 1.00 0.00 ?  23 LEU F C    1  
ATOM 6521   O O    . LEU F  1 23 ? -4.871  27.674  -235.187 1.00 0.00 ?  23 LEU F O    1  
ATOM 6522   C CB   . LEU F  1 23 ? -7.263  26.665  -237.318 1.00 0.00 ?  23 LEU F CB   1  
ATOM 6523   C CG   . LEU F  1 23 ? -6.641  25.350  -236.832 1.00 0.00 ?  23 LEU F CG   1  
ATOM 6524   C CD1  . LEU F  1 23 ? -6.964  25.132  -235.361 1.00 0.00 ?  23 LEU F CD1  1  
ATOM 6525   C CD2  . LEU F  1 23 ? -7.164  24.197  -237.676 1.00 0.00 ?  23 LEU F CD2  1  
ATOM 6526   H H    . LEU F  1 23 ? -7.816  29.027  -238.085 1.00 0.00 ?  23 LEU F H    1  
ATOM 6527   H HA   . LEU F  1 23 ? -7.304  27.895  -235.555 1.00 0.00 ?  23 LEU F HA   1  
ATOM 6528   H HB2  . LEU F  1 23 ? -8.330  26.676  -237.101 1.00 0.00 ?  23 LEU F HB2  1  
ATOM 6529   H HB3  . LEU F  1 23 ? -7.110  26.785  -238.391 1.00 0.00 ?  23 LEU F HB3  1  
ATOM 6530   H HG   . LEU F  1 23 ? -5.565  25.421  -236.996 1.00 0.00 ?  23 LEU F HG   1  
ATOM 6531   H HD11 . LEU F  1 23 ? -6.518  24.196  -235.024 1.00 0.00 ?  23 LEU F HD11 1  
ATOM 6532   H HD12 . LEU F  1 23 ? -6.560  25.957  -234.773 1.00 0.00 ?  23 LEU F HD12 1  
ATOM 6533   H HD13 . LEU F  1 23 ? -8.044  25.086  -235.229 1.00 0.00 ?  23 LEU F HD13 1  
ATOM 6534   H HD21 . LEU F  1 23 ? -6.897  24.360  -238.721 1.00 0.00 ?  23 LEU F HD21 1  
ATOM 6535   H HD22 . LEU F  1 23 ? -6.720  23.263  -237.330 1.00 0.00 ?  23 LEU F HD22 1  
ATOM 6536   H HD23 . LEU F  1 23 ? -8.249  24.140  -237.583 1.00 0.00 ?  23 LEU F HD23 1  
ATOM 6537   N N    . GLN F  1 24 ? -4.571  28.162  -237.363 1.00 0.00 ?  24 GLN F N    1  
ATOM 6538   C CA   . GLN F  1 24 ? -3.116  28.182  -237.274 1.00 0.00 ?  24 GLN F CA   1  
ATOM 6539   C C    . GLN F  1 24 ? -2.642  29.193  -236.238 1.00 0.00 ?  24 GLN F C    1  
ATOM 6540   O O    . GLN F  1 24 ? -1.767  28.898  -235.424 1.00 0.00 ?  24 GLN F O    1  
ATOM 6541   C CB   . GLN F  1 24 ? -2.500  28.510  -238.637 1.00 0.00 ?  24 GLN F CB   1  
ATOM 6542   C CG   . GLN F  1 24 ? -0.981  28.499  -238.652 1.00 0.00 ?  24 GLN F CG   1  
ATOM 6543   C CD   . GLN F  1 24 ? -0.414  28.822  -240.021 1.00 0.00 ?  24 GLN F CD   1  
ATOM 6544   O OE1  . GLN F  1 24 ? -1.155  29.136  -240.957 1.00 0.00 ?  24 GLN F OE1  1  
ATOM 6545   N NE2  . GLN F  1 24 ? 0.906   28.742  -240.148 1.00 0.00 ?  24 GLN F NE2  1  
ATOM 6546   H H    . GLN F  1 24 ? -5.012  28.347  -238.253 1.00 0.00 ?  24 GLN F H    1  
ATOM 6547   H HA   . GLN F  1 24 ? -2.758  27.207  -236.943 1.00 0.00 ?  24 GLN F HA   1  
ATOM 6548   H HB2  . GLN F  1 24 ? -2.882  27.770  -239.341 1.00 0.00 ?  24 GLN F HB2  1  
ATOM 6549   H HB3  . GLN F  1 24 ? -2.864  29.498  -238.917 1.00 0.00 ?  24 GLN F HB3  1  
ATOM 6550   H HG2  . GLN F  1 24 ? -0.380  29.023  -237.909 1.00 0.00 ?  24 GLN F HG2  1  
ATOM 6551   H HG3  . GLN F  1 24 ? -0.901  27.424  -238.490 1.00 0.00 ?  24 GLN F HG3  1  
ATOM 6552   H HE21 . GLN F  1 24 ? 1.469   28.482  -239.363 1.00 0.00 ?  24 GLN F HE21 1  
ATOM 6553   H HE22 . GLN F  1 24 ? 1.338   28.944  -241.028 1.00 0.00 ?  24 GLN F HE22 1  
ATOM 6554   N N    . THR F  1 25 ? -3.223  30.387  -236.275 1.00 0.00 ?  25 THR F N    1  
ATOM 6555   C CA   . THR F  1 25 ? -2.840  31.454  -235.358 1.00 0.00 ?  25 THR F CA   1  
ATOM 6556   C C    . THR F  1 25 ? -3.181  31.092  -233.918 1.00 0.00 ?  25 THR F C    1  
ATOM 6557   O O    . THR F  1 25 ? -2.404  31.355  -233.001 1.00 0.00 ?  25 THR F O    1  
ATOM 6558   C CB   . THR F  1 25 ? -3.529  32.784  -235.719 1.00 0.00 ?  25 THR F CB   1  
ATOM 6559   O OG1  . THR F  1 25 ? -3.117  33.198  -237.028 1.00 0.00 ?  25 THR F OG1  1  
ATOM 6560   C CG2  . THR F  1 25 ? -3.164  33.863  -234.712 1.00 0.00 ?  25 THR F CG2  1  
ATOM 6561   H H    . THR F  1 25 ? -3.949  30.560  -236.955 1.00 0.00 ?  25 THR F H    1  
ATOM 6562   H HA   . THR F  1 25 ? -1.760  31.600  -235.392 1.00 0.00 ?  25 THR F HA   1  
ATOM 6563   H HB   . THR F  1 25 ? -4.608  32.635  -235.717 1.00 0.00 ?  25 THR F HB   1  
ATOM 6564   H HG1  . THR F  1 25 ? -3.368  32.528  -237.669 1.00 0.00 ?  25 THR F HG1  1  
ATOM 6565   H HG21 . THR F  1 25 ? -3.661  34.795  -234.983 1.00 0.00 ?  25 THR F HG21 1  
ATOM 6566   H HG22 . THR F  1 25 ? -3.487  33.556  -233.717 1.00 0.00 ?  25 THR F HG22 1  
ATOM 6567   H HG23 . THR F  1 25 ? -2.085  34.013  -234.714 1.00 0.00 ?  25 THR F HG23 1  
ATOM 6568   N N    . GLN F  1 26 ? -4.348  30.487  -233.726 1.00 0.00 ?  26 GLN F N    1  
ATOM 6569   C CA   . GLN F  1 26 ? -4.822  30.141  -232.391 1.00 0.00 ?  26 GLN F CA   1  
ATOM 6570   C C    . GLN F  1 26 ? -3.917  29.106  -231.737 1.00 0.00 ?  26 GLN F C    1  
ATOM 6571   O O    . GLN F  1 26 ? -3.537  29.245  -230.574 1.00 0.00 ?  26 GLN F O    1  
ATOM 6572   C CB   . GLN F  1 26 ? -6.256  29.609  -232.452 1.00 0.00 ?  26 GLN F CB   1  
ATOM 6573   C CG   . GLN F  1 26 ? -7.303  30.672  -232.739 1.00 0.00 ?  26 GLN F CG   1  
ATOM 6574   C CD   . GLN F  1 26 ? -8.700  30.092  -232.851 1.00 0.00 ?  26 GLN F CD   1  
ATOM 6575   O OE1  . GLN F  1 26 ? -8.900  28.883  -232.706 1.00 0.00 ?  26 GLN F OE1  1  
ATOM 6576   N NE2  . GLN F  1 26 ? -9.677  30.953  -233.114 1.00 0.00 ?  26 GLN F NE2  1  
ATOM 6577   H H    . GLN F  1 26 ? -4.922  30.260  -234.526 1.00 0.00 ?  26 GLN F H    1  
ATOM 6578   H HA   . GLN F  1 26 ? -4.793  31.025  -231.754 1.00 0.00 ?  26 GLN F HA   1  
ATOM 6579   H HB2  . GLN F  1 26 ? -6.277  28.850  -233.234 1.00 0.00 ?  26 GLN F HB2  1  
ATOM 6580   H HB3  . GLN F  1 26 ? -6.460  29.143  -231.489 1.00 0.00 ?  26 GLN F HB3  1  
ATOM 6581   H HG2  . GLN F  1 26 ? -7.370  31.601  -232.174 1.00 0.00 ?  26 GLN F HG2  1  
ATOM 6582   H HG3  . GLN F  1 26 ? -6.937  30.885  -233.744 1.00 0.00 ?  26 GLN F HG3  1  
ATOM 6583   H HE21 . GLN F  1 26 ? -9.471  31.925  -233.226 1.00 0.00 ?  26 GLN F HE21 1  
ATOM 6584   H HE22 . GLN F  1 26 ? -10.620 30.629  -233.199 1.00 0.00 ?  26 GLN F HE22 1  
ATOM 6585   N N    . VAL F  1 27 ? -3.573  28.067  -232.490 1.00 0.00 ?  27 VAL F N    1  
ATOM 6586   C CA   . VAL F  1 27 ? -2.773  26.968  -231.962 1.00 0.00 ?  27 VAL F CA   1  
ATOM 6587   C C    . VAL F  1 27 ? -1.313  27.375  -231.808 1.00 0.00 ?  27 VAL F C    1  
ATOM 6588   O O    . VAL F  1 27 ? -0.595  26.839  -230.964 1.00 0.00 ?  27 VAL F O    1  
ATOM 6589   C CB   . VAL F  1 27 ? -2.857  25.723  -232.864 1.00 0.00 ?  27 VAL F CB   1  
ATOM 6590   C CG1  . VAL F  1 27 ? -1.980  25.897  -234.095 1.00 0.00 ?  27 VAL F CG1  1  
ATOM 6591   C CG2  . VAL F  1 27 ? -2.447  24.478  -232.092 1.00 0.00 ?  27 VAL F CG2  1  
ATOM 6592   H H    . VAL F  1 27 ? -3.874  28.037  -233.454 1.00 0.00 ?  27 VAL F H    1  
ATOM 6593   H HA   . VAL F  1 27 ? -3.093  26.692  -230.956 1.00 0.00 ?  27 VAL F HA   1  
ATOM 6594   H HB   . VAL F  1 27 ? -3.892  25.578  -233.172 1.00 0.00 ?  27 VAL F HB   1  
ATOM 6595   H HG11 . VAL F  1 27 ? -2.052  25.008  -234.722 1.00 0.00 ?  27 VAL F HG11 1  
ATOM 6596   H HG12 . VAL F  1 27 ? -2.316  26.767  -234.661 1.00 0.00 ?  27 VAL F HG12 1  
ATOM 6597   H HG13 . VAL F  1 27 ? -0.945  26.041  -233.787 1.00 0.00 ?  27 VAL F HG13 1  
ATOM 6598   H HG21 . VAL F  1 27 ? -3.113  24.342  -231.240 1.00 0.00 ?  27 VAL F HG21 1  
ATOM 6599   H HG22 . VAL F  1 27 ? -2.513  23.607  -232.745 1.00 0.00 ?  27 VAL F HG22 1  
ATOM 6600   H HG23 . VAL F  1 27 ? -1.422  24.590  -231.739 1.00 0.00 ?  27 VAL F HG23 1  
ATOM 6601   N N    . THR F  1 28 ? -0.879  28.326  -232.629 1.00 0.00 ?  28 THR F N    1  
ATOM 6602   C CA   . THR F  1 28 ? 0.460   28.890  -232.508 1.00 0.00 ?  28 THR F CA   1  
ATOM 6603   C C    . THR F  1 28 ? 0.595   29.722  -231.240 1.00 0.00 ?  28 THR F C    1  
ATOM 6604   O O    . THR F  1 28 ? 1.583   29.611  -230.515 1.00 0.00 ?  28 THR F O    1  
ATOM 6605   C CB   . THR F  1 28 ? 0.816   29.764  -233.724 1.00 0.00 ?  28 THR F CB   1  
ATOM 6606   O OG1  . THR F  1 28 ? 0.847   28.954  -234.906 1.00 0.00 ?  28 THR F OG1  1  
ATOM 6607   C CG2  . THR F  1 28 ? 2.174   30.421  -233.529 1.00 0.00 ?  28 THR F CG2  1  
ATOM 6608   H H    . THR F  1 28 ? -1.493  28.666  -233.355 1.00 0.00 ?  28 THR F H    1  
ATOM 6609   H HA   . THR F  1 28 ? 1.193   28.086  -232.429 1.00 0.00 ?  28 THR F HA   1  
ATOM 6610   H HB   . THR F  1 28 ? 0.055   30.535  -233.842 1.00 0.00 ?  28 THR F HB   1  
ATOM 6611   H HG1  . THR F  1 28 ? 0.065   28.397  -234.932 1.00 0.00 ?  28 THR F HG1  1  
ATOM 6612   H HG21 . THR F  1 28 ? 2.408   31.035  -234.399 1.00 0.00 ?  28 THR F HG21 1  
ATOM 6613   H HG22 . THR F  1 28 ? 2.150   31.047  -232.637 1.00 0.00 ?  28 THR F HG22 1  
ATOM 6614   H HG23 . THR F  1 28 ? 2.936   29.652  -233.412 1.00 0.00 ?  28 THR F HG23 1  
ATOM 6615   N N    . GLU F  1 29 ? -0.405  30.557  -230.977 1.00 0.00 ?  29 GLU F N    1  
ATOM 6616   C CA   . GLU F  1 29 ? -0.431  31.363  -229.762 1.00 0.00 ?  29 GLU F CA   1  
ATOM 6617   C C    . GLU F  1 29 ? -0.607  30.491  -228.526 1.00 0.00 ?  29 GLU F C    1  
ATOM 6618   O O    . GLU F  1 29 ? -0.055  30.782  -227.465 1.00 0.00 ?  29 GLU F O    1  
ATOM 6619   C CB   . GLU F  1 29 ? -1.550  32.405  -229.835 1.00 0.00 ?  29 GLU F CB   1  
ATOM 6620   C CG   . GLU F  1 29 ? -1.287  33.543  -230.811 1.00 0.00 ?  29 GLU F CG   1  
ATOM 6621   C CD   . GLU F  1 29 ? -2.474  34.460  -230.913 1.00 0.00 ?  29 GLU F CD   1  
ATOM 6622   O OE1  . GLU F  1 29 ? -3.478  34.171  -230.308 1.00 0.00 ?  29 GLU F OE1  1  
ATOM 6623   O OE2  . GLU F  1 29 ? -2.342  35.506  -231.504 1.00 0.00 -1 29 GLU F OE2  1  
ATOM 6624   H H    . GLU F  1 29 ? -1.167  30.635  -231.636 1.00 0.00 ?  29 GLU F H    1  
ATOM 6625   H HA   . GLU F  1 29 ? 0.521   31.882  -229.642 1.00 0.00 ?  29 GLU F HA   1  
ATOM 6626   H HB2  . GLU F  1 29 ? -2.457  31.878  -230.129 1.00 0.00 ?  29 GLU F HB2  1  
ATOM 6627   H HB3  . GLU F  1 29 ? -1.673  32.810  -228.830 1.00 0.00 ?  29 GLU F HB3  1  
ATOM 6628   H HG2  . GLU F  1 29 ? -0.399  34.126  -230.568 1.00 0.00 ?  29 GLU F HG2  1  
ATOM 6629   H HG3  . GLU F  1 29 ? -1.138  33.035  -231.762 1.00 0.00 ?  29 GLU F HG3  1  
ATOM 6630   N N    . ALA F  1 30 ? -1.381  29.420  -228.669 1.00 0.00 ?  30 ALA F N    1  
ATOM 6631   C CA   . ALA F  1 30 ? -1.545  28.445  -227.598 1.00 0.00 ?  30 ALA F CA   1  
ATOM 6632   C C    . ALA F  1 30 ? -0.227  27.752  -227.277 1.00 0.00 ?  30 ALA F C    1  
ATOM 6633   O O    . ALA F  1 30 ? 0.075   27.480  -226.115 1.00 0.00 ?  30 ALA F O    1  
ATOM 6634   C CB   . ALA F  1 30 ? -2.608  27.422  -227.970 1.00 0.00 ?  30 ALA F CB   1  
ATOM 6635   H H    . ALA F  1 30 ? -1.867  29.278  -229.543 1.00 0.00 ?  30 ALA F H    1  
ATOM 6636   H HA   . ALA F  1 30 ? -1.865  28.967  -226.696 1.00 0.00 ?  30 ALA F HA   1  
ATOM 6637   H HB1  . ALA F  1 30 ? -2.310  26.902  -228.879 1.00 0.00 ?  30 ALA F HB1  1  
ATOM 6638   H HB2  . ALA F  1 30 ? -2.719  26.702  -227.160 1.00 0.00 ?  30 ALA F HB2  1  
ATOM 6639   H HB3  . ALA F  1 30 ? -3.559  27.929  -228.137 1.00 0.00 ?  30 ALA F HB3  1  
ATOM 6640   N N    . LEU F  1 31 ? 0.554   27.468  -228.313 1.00 0.00 ?  31 LEU F N    1  
ATOM 6641   C CA   . LEU F  1 31 ? 1.897   26.927  -228.136 1.00 0.00 ?  31 LEU F CA   1  
ATOM 6642   C C    . LEU F  1 31 ? 2.807   27.931  -227.440 1.00 0.00 ?  31 LEU F C    1  
ATOM 6643   O O    . LEU F  1 31 ? 3.548   27.578  -226.522 1.00 0.00 ?  31 LEU F O    1  
ATOM 6644   C CB   . LEU F  1 31 ? 2.488   26.520  -229.491 1.00 0.00 ?  31 LEU F CB   1  
ATOM 6645   C CG   . LEU F  1 31 ? 3.918   25.968  -229.440 1.00 0.00 ?  31 LEU F CG   1  
ATOM 6646   C CD1  . LEU F  1 31 ? 3.966   24.724  -228.563 1.00 0.00 ?  31 LEU F CD1  1  
ATOM 6647   C CD2  . LEU F  1 31 ? 4.391   25.651  -230.851 1.00 0.00 ?  31 LEU F CD2  1  
ATOM 6648   H H    . LEU F  1 31 ? 0.210   27.632  -229.248 1.00 0.00 ?  31 LEU F H    1  
ATOM 6649   H HA   . LEU F  1 31 ? 1.854   26.050  -227.491 1.00 0.00 ?  31 LEU F HA   1  
ATOM 6650   H HB2  . LEU F  1 31 ? 1.790   25.728  -229.758 1.00 0.00 ?  31 LEU F HB2  1  
ATOM 6651   H HB3  . LEU F  1 31 ? 2.418   27.327  -230.221 1.00 0.00 ?  31 LEU F HB3  1  
ATOM 6652   H HG   . LEU F  1 31 ? 4.556   26.757  -229.044 1.00 0.00 ?  31 LEU F HG   1  
ATOM 6653   H HD11 . LEU F  1 31 ? 4.985   24.339  -228.532 1.00 0.00 ?  31 LEU F HD11 1  
ATOM 6654   H HD12 . LEU F  1 31 ? 3.645   24.979  -227.553 1.00 0.00 ?  31 LEU F HD12 1  
ATOM 6655   H HD13 . LEU F  1 31 ? 3.303   23.963  -228.973 1.00 0.00 ?  31 LEU F HD13 1  
ATOM 6656   H HD21 . LEU F  1 31 ? 4.376   26.559  -231.453 1.00 0.00 ?  31 LEU F HD21 1  
ATOM 6657   H HD22 . LEU F  1 31 ? 5.408   25.259  -230.813 1.00 0.00 ?  31 LEU F HD22 1  
ATOM 6658   H HD23 . LEU F  1 31 ? 3.731   24.907  -231.298 1.00 0.00 ?  31 LEU F HD23 1  
ATOM 6659   N N    . ASP F  1 32 ? 2.748   29.182  -227.882 1.00 0.00 ?  32 ASP F N    1  
ATOM 6660   C CA   . ASP F  1 32 ? 3.583   30.235  -227.317 1.00 0.00 ?  32 ASP F CA   1  
ATOM 6661   C C    . ASP F  1 32 ? 3.354   30.375  -225.817 1.00 0.00 ?  32 ASP F C    1  
ATOM 6662   O O    . ASP F  1 32 ? 4.303   30.504  -225.044 1.00 0.00 ?  32 ASP F O    1  
ATOM 6663   C CB   . ASP F  1 32 ? 3.312   31.569  -228.017 1.00 0.00 ?  32 ASP F CB   1  
ATOM 6664   C CG   . ASP F  1 32 ? 3.862   31.659  -229.434 1.00 0.00 ?  32 ASP F CG   1  
ATOM 6665   O OD1  . ASP F  1 32 ? 4.645   30.815  -229.801 1.00 0.00 ?  32 ASP F OD1  1  
ATOM 6666   O OD2  . ASP F  1 32 ? 3.382   32.473  -230.185 1.00 0.00 -1 32 ASP F OD2  1  
ATOM 6667   H H    . ASP F  1 32 ? 2.107   29.410  -228.629 1.00 0.00 ?  32 ASP F H    1  
ATOM 6668   H HA   . ASP F  1 32 ? 4.636   29.981  -227.447 1.00 0.00 ?  32 ASP F HA   1  
ATOM 6669   H HB2  . ASP F  1 32 ? 2.259   31.853  -228.018 1.00 0.00 ?  32 ASP F HB2  1  
ATOM 6670   H HB3  . ASP F  1 32 ? 3.870   32.243  -227.367 1.00 0.00 ?  32 ASP F HB3  1  
ATOM 6671   N N    . LYS F  1 33 ? 2.089   30.348  -225.412 1.00 0.00 ?  33 LYS F N    1  
ATOM 6672   C CA   . LYS F  1 33 ? 1.733   30.448  -224.002 1.00 0.00 ?  33 LYS F CA   1  
ATOM 6673   C C    . LYS F  1 33 ? 2.111   29.180  -223.248 1.00 0.00 ?  33 LYS F C    1  
ATOM 6674   O O    . LYS F  1 33 ? 2.683   29.240  -222.159 1.00 0.00 ?  33 LYS F O    1  
ATOM 6675   C CB   . LYS F  1 33 ? 0.238   30.727  -223.845 1.00 0.00 ?  33 LYS F CB   1  
ATOM 6676   C CG   . LYS F  1 33 ? -0.196  32.110  -224.313 1.00 0.00 ?  33 LYS F CG   1  
ATOM 6677   C CD   . LYS F  1 33 ? -1.701  32.292  -224.179 1.00 0.00 ?  33 LYS F CD   1  
ATOM 6678   C CE   . LYS F  1 33 ? -2.147  33.639  -224.729 1.00 0.00 ?  33 LYS F CE   1  
ATOM 6679   N NZ   . LYS F  1 33 ? -3.622  33.814  -224.644 1.00 0.00 1  33 LYS F NZ   1  
ATOM 6680   H H    . LYS F  1 33 ? 1.354   30.256  -226.099 1.00 0.00 ?  33 LYS F H    1  
ATOM 6681   H HA   . LYS F  1 33 ? 2.290   31.263  -223.538 1.00 0.00 ?  33 LYS F HA   1  
ATOM 6682   H HB2  . LYS F  1 33 ? -0.291  29.967  -224.420 1.00 0.00 ?  33 LYS F HB2  1  
ATOM 6683   H HB3  . LYS F  1 33 ? 0.000   30.612  -222.787 1.00 0.00 ?  33 LYS F HB3  1  
ATOM 6684   H HG2  . LYS F  1 33 ? 0.316   32.858  -223.706 1.00 0.00 ?  33 LYS F HG2  1  
ATOM 6685   H HG3  . LYS F  1 33 ? 0.094   32.229  -225.356 1.00 0.00 ?  33 LYS F HG3  1  
ATOM 6686   H HD2  . LYS F  1 33 ? -2.198  31.492  -224.729 1.00 0.00 ?  33 LYS F HD2  1  
ATOM 6687   H HD3  . LYS F  1 33 ? -1.967  32.226  -223.124 1.00 0.00 ?  33 LYS F HD3  1  
ATOM 6688   H HE2  . LYS F  1 33 ? -1.655  34.423  -224.155 1.00 0.00 ?  33 LYS F HE2  1  
ATOM 6689   H HE3  . LYS F  1 33 ? -1.834  33.703  -225.771 1.00 0.00 ?  33 LYS F HE3  1  
ATOM 6690   H HZ1  . LYS F  1 33 ? -3.912  33.756  -223.678 1.00 0.00 ?  33 LYS F HZ1  1  
ATOM 6691   H HZ2  . LYS F  1 33 ? -3.876  34.718  -225.018 1.00 0.00 ?  33 LYS F HZ2  1  
ATOM 6692   H HZ3  . LYS F  1 33 ? -4.079  33.088  -225.177 1.00 0.00 ?  33 LYS F HZ3  1  
ATOM 6693   N N    . LEU F  1 34 ? 1.788   28.031  -223.832 1.00 0.00 ?  34 LEU F N    1  
ATOM 6694   C CA   . LEU F  1 34 ? 2.075   26.746  -223.207 1.00 0.00 ?  34 LEU F CA   1  
ATOM 6695   C C    . LEU F  1 34 ? 3.568   26.575  -222.957 1.00 0.00 ?  34 LEU F C    1  
ATOM 6696   O O    . LEU F  1 34 ? 3.976   25.980  -221.960 1.00 0.00 ?  34 LEU F O    1  
ATOM 6697   C CB   . LEU F  1 34 ? 1.546   25.601  -224.081 1.00 0.00 ?  34 LEU F CB   1  
ATOM 6698   C CG   . LEU F  1 34 ? 1.724   24.195  -223.493 1.00 0.00 ?  34 LEU F CG   1  
ATOM 6699   C CD1  . LEU F  1 34 ? 0.951   24.075  -222.186 1.00 0.00 ?  34 LEU F CD1  1  
ATOM 6700   C CD2  . LEU F  1 34 ? 1.246   23.159  -224.499 1.00 0.00 ?  34 LEU F CD2  1  
ATOM 6701   H H    . LEU F  1 34 ? 1.333   28.049  -224.733 1.00 0.00 ?  34 LEU F H    1  
ATOM 6702   H HA   . LEU F  1 34 ? 1.591   26.698  -222.232 1.00 0.00 ?  34 LEU F HA   1  
ATOM 6703   H HB2  . LEU F  1 34 ? 0.491   25.867  -224.101 1.00 0.00 ?  34 LEU F HB2  1  
ATOM 6704   H HB3  . LEU F  1 34 ? 1.952   25.645  -225.091 1.00 0.00 ?  34 LEU F HB3  1  
ATOM 6705   H HG   . LEU F  1 34 ? 2.792   24.042  -223.337 1.00 0.00 ?  34 LEU F HG   1  
ATOM 6706   H HD11 . LEU F  1 34 ? 1.083   23.074  -221.776 1.00 0.00 ?  34 LEU F HD11 1  
ATOM 6707   H HD12 . LEU F  1 34 ? 1.326   24.810  -221.473 1.00 0.00 ?  34 LEU F HD12 1  
ATOM 6708   H HD13 . LEU F  1 34 ? -0.107  24.254  -222.371 1.00 0.00 ?  34 LEU F HD13 1  
ATOM 6709   H HD21 . LEU F  1 34 ? 1.830   23.245  -225.415 1.00 0.00 ?  34 LEU F HD21 1  
ATOM 6710   H HD22 . LEU F  1 34 ? 1.373   22.160  -224.080 1.00 0.00 ?  34 LEU F HD22 1  
ATOM 6711   H HD23 . LEU F  1 34 ? 0.192   23.328  -224.723 1.00 0.00 ?  34 LEU F HD23 1  
ATOM 6712   N N    . ALA F  1 35 ? 4.379   27.102  -223.868 1.00 0.00 ?  35 ALA F N    1  
ATOM 6713   C CA   . ALA F  1 35 ? 5.829   27.057  -223.721 1.00 0.00 ?  35 ALA F CA   1  
ATOM 6714   C C    . ALA F  1 35 ? 6.269   27.696  -222.410 1.00 0.00 ?  35 ALA F C    1  
ATOM 6715   O O    . ALA F  1 35 ? 7.220   27.240  -221.775 1.00 0.00 ?  35 ALA F O    1  
ATOM 6716   C CB   . ALA F  1 35 ? 6.503   27.742  -224.900 1.00 0.00 ?  35 ALA F CB   1  
ATOM 6717   H H    . ALA F  1 35 ? 3.981   27.545  -224.684 1.00 0.00 ?  35 ALA F H    1  
ATOM 6718   H HA   . ALA F  1 35 ? 6.146   26.015  -223.697 1.00 0.00 ?  35 ALA F HA   1  
ATOM 6719   H HB1  . ALA F  1 35 ? 6.184   28.782  -224.948 1.00 0.00 ?  35 ALA F HB1  1  
ATOM 6720   H HB2  . ALA F  1 35 ? 7.585   27.700  -224.775 1.00 0.00 ?  35 ALA F HB2  1  
ATOM 6721   H HB3  . ALA F  1 35 ? 6.225   27.234  -225.824 1.00 0.00 ?  35 ALA F HB3  1  
ATOM 6722   N N    . ALA F  1 36 ? 5.572   28.754  -222.009 1.00 0.00 ?  36 ALA F N    1  
ATOM 6723   C CA   . ALA F  1 36 ? 5.884   29.452  -220.768 1.00 0.00 ?  36 ALA F CA   1  
ATOM 6724   C C    . ALA F  1 36 ? 5.476   28.628  -219.554 1.00 0.00 ?  36 ALA F C    1  
ATOM 6725   O O    . ALA F  1 36 ? 6.212   28.547  -218.571 1.00 0.00 ?  36 ALA F O    1  
ATOM 6726   C CB   . ALA F  1 36 ? 5.206   30.814  -220.742 1.00 0.00 ?  36 ALA F CB   1  
ATOM 6727   H H    . ALA F  1 36 ? 4.805   29.082  -222.579 1.00 0.00 ?  36 ALA F H    1  
ATOM 6728   H HA   . ALA F  1 36 ? 6.963   29.600  -220.713 1.00 0.00 ?  36 ALA F HA   1  
ATOM 6729   H HB1  . ALA F  1 36 ? 4.127   30.684  -220.812 1.00 0.00 ?  36 ALA F HB1  1  
ATOM 6730   H HB2  . ALA F  1 36 ? 5.450   31.323  -219.809 1.00 0.00 ?  36 ALA F HB2  1  
ATOM 6731   H HB3  . ALA F  1 36 ? 5.556   31.412  -221.583 1.00 0.00 ?  36 ALA F HB3  1  
ATOM 6732   N N    . LYS F  1 37 ? 4.298   28.019  -219.628 1.00 0.00 ?  37 LYS F N    1  
ATOM 6733   C CA   . LYS F  1 37 ? 3.799   27.180  -218.545 1.00 0.00 ?  37 LYS F CA   1  
ATOM 6734   C C    . LYS F  1 37 ? 3.241   25.866  -219.077 1.00 0.00 ?  37 LYS F C    1  
ATOM 6735   O O    . LYS F  1 37 ? 2.027   25.698  -219.192 1.00 0.00 ?  37 LYS F O    1  
ATOM 6736   C CB   . LYS F  1 37 ? 2.728   27.921  -217.744 1.00 0.00 ?  37 LYS F CB   1  
ATOM 6737   C CG   . LYS F  1 37 ? 3.213   29.201  -217.076 1.00 0.00 ?  37 LYS F CG   1  
ATOM 6738   C CD   . LYS F  1 37 ? 2.140   29.800  -216.180 1.00 0.00 ?  37 LYS F CD   1  
ATOM 6739   C CE   . LYS F  1 37 ? 2.603   31.109  -215.558 1.00 0.00 ?  37 LYS F CE   1  
ATOM 6740   N NZ   . LYS F  1 37 ? 1.566   31.701  -214.671 1.00 0.00 1  37 LYS F NZ   1  
ATOM 6741   H H    . LYS F  1 37 ? 3.733   28.139  -220.457 1.00 0.00 ?  37 LYS F H    1  
ATOM 6742   H HA   . LYS F  1 37 ? 4.618   26.920  -217.873 1.00 0.00 ?  37 LYS F HA   1  
ATOM 6743   H HB2  . LYS F  1 37 ? 1.918   28.157  -218.435 1.00 0.00 ?  37 LYS F HB2  1  
ATOM 6744   H HB3  . LYS F  1 37 ? 2.363   27.231  -216.982 1.00 0.00 ?  37 LYS F HB3  1  
ATOM 6745   H HG2  . LYS F  1 37 ? 4.096   28.967  -216.480 1.00 0.00 ?  37 LYS F HG2  1  
ATOM 6746   H HG3  . LYS F  1 37 ? 3.480   29.917  -217.853 1.00 0.00 ?  37 LYS F HG3  1  
ATOM 6747   H HD2  . LYS F  1 37 ? 1.246   29.978  -216.780 1.00 0.00 ?  37 LYS F HD2  1  
ATOM 6748   H HD3  . LYS F  1 37 ? 1.908   29.085  -215.390 1.00 0.00 ?  37 LYS F HD3  1  
ATOM 6749   H HE2  . LYS F  1 37 ? 3.506   30.912  -214.981 1.00 0.00 ?  37 LYS F HE2  1  
ATOM 6750   H HE3  . LYS F  1 37 ? 2.833   31.807  -216.364 1.00 0.00 ?  37 LYS F HE3  1  
ATOM 6751   H HZ1  . LYS F  1 37 ? 1.354   31.055  -213.924 1.00 0.00 ?  37 LYS F HZ1  1  
ATOM 6752   H HZ2  . LYS F  1 37 ? 1.912   32.566  -214.280 1.00 0.00 ?  37 LYS F HZ2  1  
ATOM 6753   H HZ3  . LYS F  1 37 ? 0.729   31.885  -215.206 1.00 0.00 ?  37 LYS F HZ3  1  
ATOM 6754   N N    . PRO F  1 38 ? 4.134   24.937  -219.400 1.00 0.00 ?  38 PRO F N    1  
ATOM 6755   C CA   . PRO F  1 38 ? 3.733   23.646  -219.945 1.00 0.00 ?  38 PRO F CA   1  
ATOM 6756   C C    . PRO F  1 38 ? 2.824   22.898  -218.979 1.00 0.00 ?  38 PRO F C    1  
ATOM 6757   O O    . PRO F  1 38 ? 2.030   22.052  -219.388 1.00 0.00 ?  38 PRO F O    1  
ATOM 6758   C CB   . PRO F  1 38 ? 5.057   22.911  -220.178 1.00 0.00 ?  38 PRO F CB   1  
ATOM 6759   C CG   . PRO F  1 38 ? 6.068   23.998  -220.309 1.00 0.00 ?  38 PRO F CG   1  
ATOM 6760   C CD   . PRO F  1 38 ? 5.615   25.080  -219.365 1.00 0.00 ?  38 PRO F CD   1  
ATOM 6761   H HA   . PRO F  1 38 ? 3.147   23.739  -220.872 1.00 0.00 ?  38 PRO F HA   1  
ATOM 6762   H HB2  . PRO F  1 38 ? 5.299   22.241  -219.340 1.00 0.00 ?  38 PRO F HB2  1  
ATOM 6763   H HB3  . PRO F  1 38 ? 5.020   22.291  -221.086 1.00 0.00 ?  38 PRO F HB3  1  
ATOM 6764   H HG2  . PRO F  1 38 ? 7.074   23.640  -220.045 1.00 0.00 ?  38 PRO F HG2  1  
ATOM 6765   H HG3  . PRO F  1 38 ? 6.120   24.371  -221.342 1.00 0.00 ?  38 PRO F HG3  1  
ATOM 6766   H HD2  . PRO F  1 38 ? 6.008   24.937  -218.348 1.00 0.00 ?  38 PRO F HD2  1  
ATOM 6767   H HD3  . PRO F  1 38 ? 5.933   26.080  -219.695 1.00 0.00 ?  38 PRO F HD3  1  
ATOM 6768   N N    . SER F  1 39 ? 2.946   23.215  -217.694 1.00 0.00 ?  39 SER F N    1  
ATOM 6769   C CA   . SER F  1 39 ? 2.261   22.462  -216.651 1.00 0.00 ?  39 SER F CA   1  
ATOM 6770   C C    . SER F  1 39 ? 0.882   23.043  -216.367 1.00 0.00 ?  39 SER F C    1  
ATOM 6771   O O    . SER F  1 39 ? 0.213   22.642  -215.415 1.00 0.00 ?  39 SER F O    1  
ATOM 6772   C CB   . SER F  1 39 ? 3.097   22.444  -215.386 1.00 0.00 ?  39 SER F CB   1  
ATOM 6773   O OG   . SER F  1 39 ? 3.210   23.717  -214.811 1.00 0.00 ?  39 SER F OG   1  
ATOM 6774   H H    . SER F  1 39 ? 3.529   23.998  -217.434 1.00 0.00 ?  39 SER F H    1  
ATOM 6775   H HA   . SER F  1 39 ? 2.177   21.397  -216.870 1.00 0.00 ?  39 SER F HA   1  
ATOM 6776   H HB2  . SER F  1 39 ? 2.628   21.771  -214.668 1.00 0.00 ?  39 SER F HB2  1  
ATOM 6777   H HB3  . SER F  1 39 ? 4.093   22.076  -215.630 1.00 0.00 ?  39 SER F HB3  1  
ATOM 6778   H HG   . SER F  1 39 ? 3.625   24.315  -215.438 1.00 0.00 ?  39 SER F HG   1  
ATOM 6779   N N    . ASP F  1 40 ? 0.462   23.991  -217.199 1.00 0.00 ?  40 ASP F N    1  
ATOM 6780   C CA   . ASP F  1 40 ? -0.864  24.584  -217.077 1.00 0.00 ?  40 ASP F CA   1  
ATOM 6781   C C    . ASP F  1 40 ? -1.914  23.734  -217.781 1.00 0.00 ?  40 ASP F C    1  
ATOM 6782   O O    . ASP F  1 40 ? -1.888  23.584  -219.003 1.00 0.00 ?  40 ASP F O    1  
ATOM 6783   C CB   . ASP F  1 40 ? -0.870  26.005  -217.646 1.00 0.00 ?  40 ASP F CB   1  
ATOM 6784   C CG   . ASP F  1 40 ? -2.184  26.752  -217.459 1.00 0.00 ?  40 ASP F CG   1  
ATOM 6785   O OD1  . ASP F  1 40 ? -3.127  26.150  -217.001 1.00 0.00 ?  40 ASP F OD1  1  
ATOM 6786   O OD2  . ASP F  1 40 ? -2.193  27.948  -217.626 1.00 0.00 -1 40 ASP F OD2  1  
ATOM 6787   H H    . ASP F  1 40 ? 1.078   24.308  -217.934 1.00 0.00 ?  40 ASP F H    1  
ATOM 6788   H HA   . ASP F  1 40 ? -1.154  24.628  -216.027 1.00 0.00 ?  40 ASP F HA   1  
ATOM 6789   H HB2  . ASP F  1 40 ? -0.048  26.622  -217.284 1.00 0.00 ?  40 ASP F HB2  1  
ATOM 6790   H HB3  . ASP F  1 40 ? -0.724  25.788  -218.705 1.00 0.00 ?  40 ASP F HB3  1  
ATOM 6791   N N    . PRO F  1 41 ? -2.837  23.179  -217.003 1.00 0.00 ?  41 PRO F N    1  
ATOM 6792   C CA   . PRO F  1 41 ? -3.899  22.343  -217.551 1.00 0.00 ?  41 PRO F CA   1  
ATOM 6793   C C    . PRO F  1 41 ? -4.713  23.098  -218.594 1.00 0.00 ?  41 PRO F C    1  
ATOM 6794   O O    . PRO F  1 41 ? -5.150  22.522  -219.590 1.00 0.00 ?  41 PRO F O    1  
ATOM 6795   C CB   . PRO F  1 41 ? -4.740  21.958  -216.330 1.00 0.00 ?  41 PRO F CB   1  
ATOM 6796   C CG   . PRO F  1 41 ? -3.804  22.088  -215.178 1.00 0.00 ?  41 PRO F CG   1  
ATOM 6797   C CD   . PRO F  1 41 ? -2.904  23.244  -215.523 1.00 0.00 ?  41 PRO F CD   1  
ATOM 6798   H HA   . PRO F  1 41 ? -3.513  21.458  -218.079 1.00 0.00 ?  41 PRO F HA   1  
ATOM 6799   H HB2  . PRO F  1 41 ? -5.609  22.623  -216.214 1.00 0.00 ?  41 PRO F HB2  1  
ATOM 6800   H HB3  . PRO F  1 41 ? -5.128  20.932  -216.414 1.00 0.00 ?  41 PRO F HB3  1  
ATOM 6801   H HG2  . PRO F  1 41 ? -4.349  22.277  -214.241 1.00 0.00 ?  41 PRO F HG2  1  
ATOM 6802   H HG3  . PRO F  1 41 ? -3.223  21.165  -215.031 1.00 0.00 ?  41 PRO F HG3  1  
ATOM 6803   H HD2  . PRO F  1 41 ? -3.315  24.207  -215.185 1.00 0.00 ?  41 PRO F HD2  1  
ATOM 6804   H HD3  . PRO F  1 41 ? -1.906  23.145  -215.070 1.00 0.00 ?  41 PRO F HD3  1  
ATOM 6805   N N    . ALA F  1 42 ? -4.913  24.390  -218.358 1.00 0.00 ?  42 ALA F N    1  
ATOM 6806   C CA   . ALA F  1 42 ? -5.717  25.216  -219.251 1.00 0.00 ?  42 ALA F CA   1  
ATOM 6807   C C    . ALA F  1 42 ? -5.038  25.384  -220.605 1.00 0.00 ?  42 ALA F C    1  
ATOM 6808   O O    . ALA F  1 42 ? -5.686  25.303  -221.649 1.00 0.00 ?  42 ALA F O    1  
ATOM 6809   C CB   . ALA F  1 42 ? -5.987  26.573  -218.618 1.00 0.00 ?  42 ALA F CB   1  
ATOM 6810   H H    . ALA F  1 42 ? -4.498  24.811  -217.539 1.00 0.00 ?  42 ALA F H    1  
ATOM 6811   H HA   . ALA F  1 42 ? -6.670  24.717  -219.426 1.00 0.00 ?  42 ALA F HA   1  
ATOM 6812   H HB1  . ALA F  1 42 ? -5.043  27.078  -218.423 1.00 0.00 ?  42 ALA F HB1  1  
ATOM 6813   H HB2  . ALA F  1 42 ? -6.588  27.177  -219.298 1.00 0.00 ?  42 ALA F HB2  1  
ATOM 6814   H HB3  . ALA F  1 42 ? -6.527  26.436  -217.681 1.00 0.00 ?  42 ALA F HB3  1  
ATOM 6815   N N    . LEU F  1 43 ? -3.731  25.620  -220.581 1.00 0.00 ?  43 LEU F N    1  
ATOM 6816   C CA   . LEU F  1 43 ? -2.958  25.779  -221.807 1.00 0.00 ?  43 LEU F CA   1  
ATOM 6817   C C    . LEU F  1 43 ? -2.791  24.448  -222.529 1.00 0.00 ?  43 LEU F C    1  
ATOM 6818   O O    . LEU F  1 43 ? -2.785  24.394  -223.759 1.00 0.00 ?  43 LEU F O    1  
ATOM 6819   C CB   . LEU F  1 43 ? -1.587  26.392  -221.494 1.00 0.00 ?  43 LEU F CB   1  
ATOM 6820   C CG   . LEU F  1 43 ? -1.622  27.830  -220.962 1.00 0.00 ?  43 LEU F CG   1  
ATOM 6821   C CD1  . LEU F  1 43 ? -0.229  28.256  -220.519 1.00 0.00 ?  43 LEU F CD1  1  
ATOM 6822   C CD2  . LEU F  1 43 ? -2.152  28.760  -222.043 1.00 0.00 ?  43 LEU F CD2  1  
ATOM 6823   H H    . LEU F  1 43 ? -3.260  25.691  -219.690 1.00 0.00 ?  43 LEU F H    1  
ATOM 6824   H HA   . LEU F  1 43 ? -3.491  26.437  -222.492 1.00 0.00 ?  43 LEU F HA   1  
ATOM 6825   H HB2  . LEU F  1 43 ? -1.264  25.710  -220.708 1.00 0.00 ?  43 LEU F HB2  1  
ATOM 6826   H HB3  . LEU F  1 43 ? -0.908  26.316  -222.343 1.00 0.00 ?  43 LEU F HB3  1  
ATOM 6827   H HG   . LEU F  1 43 ? -2.326  27.851  -220.130 1.00 0.00 ?  43 LEU F HG   1  
ATOM 6828   H HD11 . LEU F  1 43 ? -0.263  29.279  -220.143 1.00 0.00 ?  43 LEU F HD11 1  
ATOM 6829   H HD12 . LEU F  1 43 ? 0.121   27.592  -219.729 1.00 0.00 ?  43 LEU F HD12 1  
ATOM 6830   H HD13 . LEU F  1 43 ? 0.454   28.205  -221.367 1.00 0.00 ?  43 LEU F HD13 1  
ATOM 6831   H HD21 . LEU F  1 43 ? -3.159  28.454  -222.325 1.00 0.00 ?  43 LEU F HD21 1  
ATOM 6832   H HD22 . LEU F  1 43 ? -2.176  29.782  -221.664 1.00 0.00 ?  43 LEU F HD22 1  
ATOM 6833   H HD23 . LEU F  1 43 ? -1.501  28.712  -222.917 1.00 0.00 ?  43 LEU F HD23 1  
ATOM 6834   N N    . LEU F  1 44 ? -2.657  23.374  -221.757 1.00 0.00 ?  44 LEU F N    1  
ATOM 6835   C CA   . LEU F  1 44 ? -2.540  22.035  -222.321 1.00 0.00 ?  44 LEU F CA   1  
ATOM 6836   C C    . LEU F  1 44 ? -3.821  21.626  -223.038 1.00 0.00 ?  44 LEU F C    1  
ATOM 6837   O O    . LEU F  1 44 ? -3.782  21.142  -224.169 1.00 0.00 ?  44 LEU F O    1  
ATOM 6838   C CB   . LEU F  1 44 ? -2.200  21.024  -221.219 1.00 0.00 ?  44 LEU F CB   1  
ATOM 6839   C CG   . LEU F  1 44 ? -0.748  21.061  -220.724 1.00 0.00 ?  44 LEU F CG   1  
ATOM 6840   C CD1  . LEU F  1 44 ? -0.603  20.214  -219.468 1.00 0.00 ?  44 LEU F CD1  1  
ATOM 6841   C CD2  . LEU F  1 44 ? 0.177   20.559  -221.823 1.00 0.00 ?  44 LEU F CD2  1  
ATOM 6842   H H    . LEU F  1 44 ? -2.634  23.490  -220.754 1.00 0.00 ?  44 LEU F H    1  
ATOM 6843   H HA   . LEU F  1 44 ? -1.749  22.021  -223.069 1.00 0.00 ?  44 LEU F HA   1  
ATOM 6844   H HB2  . LEU F  1 44 ? -2.870  21.380  -220.438 1.00 0.00 ?  44 LEU F HB2  1  
ATOM 6845   H HB3  . LEU F  1 44 ? -2.480  20.009  -221.502 1.00 0.00 ?  44 LEU F HB3  1  
ATOM 6846   H HG   . LEU F  1 44 ? -0.499  22.105  -220.530 1.00 0.00 ?  44 LEU F HG   1  
ATOM 6847   H HD11 . LEU F  1 44 ? 0.431   20.247  -219.124 1.00 0.00 ?  44 LEU F HD11 1  
ATOM 6848   H HD12 . LEU F  1 44 ? -1.256  20.605  -218.687 1.00 0.00 ?  44 LEU F HD12 1  
ATOM 6849   H HD13 . LEU F  1 44 ? -0.878  19.184  -219.690 1.00 0.00 ?  44 LEU F HD13 1  
ATOM 6850   H HD21 . LEU F  1 44 ? 0.077   21.195  -222.703 1.00 0.00 ?  44 LEU F HD21 1  
ATOM 6851   H HD22 . LEU F  1 44 ? 1.208   20.587  -221.471 1.00 0.00 ?  44 LEU F HD22 1  
ATOM 6852   H HD23 . LEU F  1 44 ? -0.091  19.535  -222.085 1.00 0.00 ?  44 LEU F HD23 1  
ATOM 6853   N N    . ALA F  1 45 ? -4.954  21.824  -222.373 1.00 0.00 ?  45 ALA F N    1  
ATOM 6854   C CA   . ALA F  1 45 ? -6.246  21.441  -222.930 1.00 0.00 ?  45 ALA F CA   1  
ATOM 6855   C C    . ALA F  1 45 ? -6.576  22.261  -224.171 1.00 0.00 ?  45 ALA F C    1  
ATOM 6856   O O    . ALA F  1 45 ? -7.005  21.719  -225.189 1.00 0.00 ?  45 ALA F O    1  
ATOM 6857   C CB   . ALA F  1 45 ? -7.340  21.592  -221.884 1.00 0.00 ?  45 ALA F CB   1  
ATOM 6858   H H    . ALA F  1 45 ? -4.920  22.250  -221.458 1.00 0.00 ?  45 ALA F H    1  
ATOM 6859   H HA   . ALA F  1 45 ? -6.199  20.395  -223.235 1.00 0.00 ?  45 ALA F HA   1  
ATOM 6860   H HB1  . ALA F  1 45 ? -7.390  22.630  -221.557 1.00 0.00 ?  45 ALA F HB1  1  
ATOM 6861   H HB2  . ALA F  1 45 ? -8.298  21.302  -222.316 1.00 0.00 ?  45 ALA F HB2  1  
ATOM 6862   H HB3  . ALA F  1 45 ? -7.119  20.952  -221.030 1.00 0.00 ?  45 ALA F HB3  1  
ATOM 6863   N N    . ALA F  1 46 ? -6.372  23.571  -224.079 1.00 0.00 ?  46 ALA F N    1  
ATOM 6864   C CA   . ALA F  1 46 ? -6.663  24.470  -225.189 1.00 0.00 ?  46 ALA F CA   1  
ATOM 6865   C C    . ALA F  1 46 ? -5.765  24.179  -226.384 1.00 0.00 ?  46 ALA F C    1  
ATOM 6866   O O    . ALA F  1 46 ? -6.238  24.068  -227.516 1.00 0.00 ?  46 ALA F O    1  
ATOM 6867   C CB   . ALA F  1 46 ? -6.512  25.920  -224.750 1.00 0.00 ?  46 ALA F CB   1  
ATOM 6868   H H    . ALA F  1 46 ? -6.007  23.953  -223.219 1.00 0.00 ?  46 ALA F H    1  
ATOM 6869   H HA   . ALA F  1 46 ? -7.693  24.310  -225.509 1.00 0.00 ?  46 ALA F HA   1  
ATOM 6870   H HB1  . ALA F  1 46 ? -5.491  26.092  -224.412 1.00 0.00 ?  46 ALA F HB1  1  
ATOM 6871   H HB2  . ALA F  1 46 ? -6.732  26.578  -225.590 1.00 0.00 ?  46 ALA F HB2  1  
ATOM 6872   H HB3  . ALA F  1 46 ? -7.205  26.127  -223.934 1.00 0.00 ?  46 ALA F HB3  1  
ATOM 6873   N N    . TYR F  1 47 ? -4.468  24.054  -226.127 1.00 0.00 ?  47 TYR F N    1  
ATOM 6874   C CA   . TYR F  1 47 ? -3.495  23.820  -227.188 1.00 0.00 ?  47 TYR F CA   1  
ATOM 6875   C C    . TYR F  1 47 ? -3.729  22.475  -227.862 1.00 0.00 ?  47 TYR F C    1  
ATOM 6876   O O    . TYR F  1 47 ? -3.772  22.384  -229.089 1.00 0.00 ?  47 TYR F O    1  
ATOM 6877   C CB   . TYR F  1 47 ? -2.071  23.889  -226.633 1.00 0.00 ?  47 TYR F CB   1  
ATOM 6878   C CG   . TYR F  1 47 ? -1.006  23.478  -227.625 1.00 0.00 ?  47 TYR F CG   1  
ATOM 6879   C CD1  . TYR F  1 47 ? -0.817  24.187  -228.803 1.00 0.00 ?  47 TYR F CD1  1  
ATOM 6880   C CD2  . TYR F  1 47 ? -0.191  22.383  -227.380 1.00 0.00 ?  47 TYR F CD2  1  
ATOM 6881   C CE1  . TYR F  1 47 ? 0.154   23.815  -229.713 1.00 0.00 ?  47 TYR F CE1  1  
ATOM 6882   C CE2  . TYR F  1 47 ? 0.784   22.002  -228.283 1.00 0.00 ?  47 TYR F CE2  1  
ATOM 6883   C CZ   . TYR F  1 47 ? 0.953   22.722  -229.448 1.00 0.00 ?  47 TYR F CZ   1  
ATOM 6884   O OH   . TYR F  1 47 ? 1.923   22.348  -230.350 1.00 0.00 ?  47 TYR F OH   1  
ATOM 6885   H H    . TYR F  1 47 ? -4.147  24.123  -225.172 1.00 0.00 ?  47 TYR F H    1  
ATOM 6886   H HA   . TYR F  1 47 ? -3.603  24.579  -227.963 1.00 0.00 ?  47 TYR F HA   1  
ATOM 6887   H HB2  . TYR F  1 47 ? -1.896  24.919  -226.318 1.00 0.00 ?  47 TYR F HB2  1  
ATOM 6888   H HB3  . TYR F  1 47 ? -2.031  23.232  -225.765 1.00 0.00 ?  47 TYR F HB3  1  
ATOM 6889   H HD1  . TYR F  1 47 ? -1.452  25.050  -229.005 1.00 0.00 ?  47 TYR F HD1  1  
ATOM 6890   H HD2  . TYR F  1 47 ? -0.330  21.819  -226.458 1.00 0.00 ?  47 TYR F HD2  1  
ATOM 6891   H HE1  . TYR F  1 47 ? 0.291   24.381  -230.634 1.00 0.00 ?  47 TYR F HE1  1  
ATOM 6892   H HE2  . TYR F  1 47 ? 1.414   21.138  -228.072 1.00 0.00 ?  47 TYR F HE2  1  
ATOM 6893   H HH   . TYR F  1 47 ? 2.420   21.576  -230.068 1.00 0.00 ?  47 TYR F HH   1  
ATOM 6894   N N    . GLN F  1 48 ? -3.879  21.431  -227.054 1.00 0.00 ?  48 GLN F N    1  
ATOM 6895   C CA   . GLN F  1 48 ? -4.047  20.079  -227.571 1.00 0.00 ?  48 GLN F CA   1  
ATOM 6896   C C    . GLN F  1 48 ? -5.349  19.945  -228.351 1.00 0.00 ?  48 GLN F C    1  
ATOM 6897   O O    . GLN F  1 48 ? -5.403  19.267  -229.377 1.00 0.00 ?  48 GLN F O    1  
ATOM 6898   C CB   . GLN F  1 48 ? -4.023  19.060  -226.428 1.00 0.00 ?  48 GLN F CB   1  
ATOM 6899   C CG   . GLN F  1 48 ? -3.974  17.613  -226.885 1.00 0.00 ?  48 GLN F CG   1  
ATOM 6900   C CD   . GLN F  1 48 ? -5.339  17.085  -227.285 1.00 0.00 ?  48 GLN F CD   1  
ATOM 6901   O OE1  . GLN F  1 48 ? -6.357  17.434  -226.680 1.00 0.00 ?  48 GLN F OE1  1  
ATOM 6902   N NE2  . GLN F  1 48 ? -5.369  16.237  -228.306 1.00 0.00 ?  48 GLN F NE2  1  
ATOM 6903   H H    . GLN F  1 48 ? -3.876  21.579  -226.054 1.00 0.00 ?  48 GLN F H    1  
ATOM 6904   H HA   . GLN F  1 48 ? -3.243  19.853  -228.270 1.00 0.00 ?  48 GLN F HA   1  
ATOM 6905   H HB2  . GLN F  1 48 ? -3.145  19.287  -225.823 1.00 0.00 ?  48 GLN F HB2  1  
ATOM 6906   H HB3  . GLN F  1 48 ? -4.924  19.229  -225.837 1.00 0.00 ?  48 GLN F HB3  1  
ATOM 6907   H HG2  . GLN F  1 48 ? -3.248  17.248  -227.611 1.00 0.00 ?  48 GLN F HG2  1  
ATOM 6908   H HG3  . GLN F  1 48 ? -3.728  17.219  -225.898 1.00 0.00 ?  48 GLN F HG3  1  
ATOM 6909   H HE21 . GLN F  1 48 ? -4.519  15.979  -228.768 1.00 0.00 ?  48 GLN F HE21 1  
ATOM 6910   H HE22 . GLN F  1 48 ? -6.241  15.855  -228.615 1.00 0.00 ?  48 GLN F HE22 1  
ATOM 6911   N N    . SER F  1 49 ? -6.397  20.597  -227.858 1.00 0.00 ?  49 SER F N    1  
ATOM 6912   C CA   . SER F  1 49 ? -7.688  20.594  -228.536 1.00 0.00 ?  49 SER F CA   1  
ATOM 6913   C C    . SER F  1 49 ? -7.591  21.242  -229.911 1.00 0.00 ?  49 SER F C    1  
ATOM 6914   O O    . SER F  1 49 ? -8.138  20.732  -230.888 1.00 0.00 ?  49 SER F O    1  
ATOM 6915   C CB   . SER F  1 49 ? -8.724  21.306  -227.688 1.00 0.00 ?  49 SER F CB   1  
ATOM 6916   O OG   . SER F  1 49 ? -9.970  21.375  -228.326 1.00 0.00 ?  49 SER F OG   1  
ATOM 6917   H H    . SER F  1 49 ? -6.297  21.107  -226.993 1.00 0.00 ?  49 SER F H    1  
ATOM 6918   H HA   . SER F  1 49 ? -8.128  19.599  -228.624 1.00 0.00 ?  49 SER F HA   1  
ATOM 6919   H HB2  . SER F  1 49 ? -8.837  20.766  -226.748 1.00 0.00 ?  49 SER F HB2  1  
ATOM 6920   H HB3  . SER F  1 49 ? -8.373  22.317  -227.484 1.00 0.00 ?  49 SER F HB3  1  
ATOM 6921   H HG   . SER F  1 49 ? -9.885  21.878  -229.139 1.00 0.00 ?  49 SER F HG   1  
ATOM 6922   N N    . LYS F  1 50 ? -6.891  22.369  -229.979 1.00 0.00 ?  50 LYS F N    1  
ATOM 6923   C CA   . LYS F  1 50 ? -6.713  23.085  -231.237 1.00 0.00 ?  50 LYS F CA   1  
ATOM 6924   C C    . LYS F  1 50 ? -5.638  22.431  -232.096 1.00 0.00 ?  50 LYS F C    1  
ATOM 6925   O O    . LYS F  1 50 ? -5.616  22.601  -233.315 1.00 0.00 ?  50 LYS F O    1  
ATOM 6926   C CB   . LYS F  1 50 ? -6.359  24.549  -230.974 1.00 0.00 ?  50 LYS F CB   1  
ATOM 6927   C CG   . LYS F  1 50 ? -7.471  25.359  -230.321 1.00 0.00 ?  50 LYS F CG   1  
ATOM 6928   C CD   . LYS F  1 50 ? -7.031  26.791  -230.056 1.00 0.00 ?  50 LYS F CD   1  
ATOM 6929   C CE   . LYS F  1 50 ? -8.109  27.576  -229.324 1.00 0.00 ?  50 LYS F CE   1  
ATOM 6930   N NZ   . LYS F  1 50 ? -9.369  27.657  -230.111 1.00 0.00 1  50 LYS F NZ   1  
ATOM 6931   H H    . LYS F  1 50 ? -6.471  22.740  -229.139 1.00 0.00 ?  50 LYS F H    1  
ATOM 6932   H HA   . LYS F  1 50 ? -7.637  23.049  -231.816 1.00 0.00 ?  50 LYS F HA   1  
ATOM 6933   H HB2  . LYS F  1 50 ? -5.479  24.554  -230.329 1.00 0.00 ?  50 LYS F HB2  1  
ATOM 6934   H HB3  . LYS F  1 50 ? -6.104  24.995  -231.936 1.00 0.00 ?  50 LYS F HB3  1  
ATOM 6935   H HG2  . LYS F  1 50 ? -8.335  25.361  -230.986 1.00 0.00 ?  50 LYS F HG2  1  
ATOM 6936   H HG3  . LYS F  1 50 ? -7.740  24.881  -229.379 1.00 0.00 ?  50 LYS F HG3  1  
ATOM 6937   H HD2  . LYS F  1 50 ? -6.123  26.769  -229.451 1.00 0.00 ?  50 LYS F HD2  1  
ATOM 6938   H HD3  . LYS F  1 50 ? -6.818  27.271  -231.011 1.00 0.00 ?  50 LYS F HD3  1  
ATOM 6939   H HE2  . LYS F  1 50 ? -8.307  27.081  -228.374 1.00 0.00 ?  50 LYS F HE2  1  
ATOM 6940   H HE3  . LYS F  1 50 ? -7.733  28.581  -229.138 1.00 0.00 ?  50 LYS F HE3  1  
ATOM 6941   H HZ1  . LYS F  1 50 ? -9.719  26.726  -230.283 1.00 0.00 ?  50 LYS F HZ1  1  
ATOM 6942   H HZ2  . LYS F  1 50 ? -10.057 28.185  -229.592 1.00 0.00 ?  50 LYS F HZ2  1  
ATOM 6943   H HZ3  . LYS F  1 50 ? -9.187  28.117  -230.993 1.00 0.00 ?  50 LYS F HZ3  1  
ATOM 6944   N N    . LEU F  1 51 ? -4.748  21.684  -231.453 1.00 0.00 ?  51 LEU F N    1  
ATOM 6945   C CA   . LEU F  1 51 ? -3.683  20.982  -232.160 1.00 0.00 ?  51 LEU F CA   1  
ATOM 6946   C C    . LEU F  1 51 ? -4.221  19.759  -232.892 1.00 0.00 ?  51 LEU F C    1  
ATOM 6947   O O    . LEU F  1 51 ? -3.782  19.442  -233.997 1.00 0.00 ?  51 LEU F O    1  
ATOM 6948   C CB   . LEU F  1 51 ? -2.576  20.573  -231.180 1.00 0.00 ?  51 LEU F CB   1  
ATOM 6949   C CG   . LEU F  1 51 ? -1.318  19.980  -231.827 1.00 0.00 ?  51 LEU F CG   1  
ATOM 6950   C CD1  . LEU F  1 51 ? -0.634  21.028  -232.695 1.00 0.00 ?  51 LEU F CD1  1  
ATOM 6951   C CD2  . LEU F  1 51 ? -0.376  19.480  -230.742 1.00 0.00 ?  51 LEU F CD2  1  
ATOM 6952   H H    . LEU F  1 51 ? -4.810  21.599  -230.448 1.00 0.00 ?  51 LEU F H    1  
ATOM 6953   H HA   . LEU F  1 51 ? -3.258  21.635  -232.921 1.00 0.00 ?  51 LEU F HA   1  
ATOM 6954   H HB2  . LEU F  1 51 ? -2.351  21.548  -230.750 1.00 0.00 ?  51 LEU F HB2  1  
ATOM 6955   H HB3  . LEU F  1 51 ? -2.952  19.911  -230.400 1.00 0.00 ?  51 LEU F HB3  1  
ATOM 6956   H HG   . LEU F  1 51 ? -1.633  19.120  -232.418 1.00 0.00 ?  51 LEU F HG   1  
ATOM 6957   H HD11 . LEU F  1 51 ? 0.258   20.598  -233.151 1.00 0.00 ?  51 LEU F HD11 1  
ATOM 6958   H HD12 . LEU F  1 51 ? -1.319  21.354  -233.478 1.00 0.00 ?  51 LEU F HD12 1  
ATOM 6959   H HD13 . LEU F  1 51 ? -0.352  21.882  -232.080 1.00 0.00 ?  51 LEU F HD13 1  
ATOM 6960   H HD21 . LEU F  1 51 ? -0.875  18.713  -230.151 1.00 0.00 ?  51 LEU F HD21 1  
ATOM 6961   H HD22 . LEU F  1 51 ? 0.518   19.058  -231.204 1.00 0.00 ?  51 LEU F HD22 1  
ATOM 6962   H HD23 . LEU F  1 51 ? -0.093  20.310  -230.094 1.00 0.00 ?  51 LEU F HD23 1  
ATOM 6963   N N    . SER F  1 52 ? -5.175  19.075  -232.269 1.00 0.00 ?  52 SER F N    1  
ATOM 6964   C CA   . SER F  1 52 ? -5.837  17.938  -232.897 1.00 0.00 ?  52 SER F CA   1  
ATOM 6965   C C    . SER F  1 52 ? -6.639  18.374  -234.117 1.00 0.00 ?  52 SER F C    1  
ATOM 6966   O O    . SER F  1 52 ? -6.871  17.585  -235.033 1.00 0.00 ?  52 SER F O    1  
ATOM 6967   C CB   . SER F  1 52 ? -6.737  17.240  -231.896 1.00 0.00 ?  52 SER F CB   1  
ATOM 6968   O OG   . SER F  1 52 ? -7.838  18.029  -231.538 1.00 0.00 ?  52 SER F OG   1  
ATOM 6969   H H    . SER F  1 52 ? -5.447  19.349  -231.336 1.00 0.00 ?  52 SER F H    1  
ATOM 6970   H HA   . SER F  1 52 ? -5.152  17.135  -233.171 1.00 0.00 ?  52 SER F HA   1  
ATOM 6971   H HB2  . SER F  1 52 ? -7.096  16.311  -232.340 1.00 0.00 ?  52 SER F HB2  1  
ATOM 6972   H HB3  . SER F  1 52 ? -6.157  17.014  -231.003 1.00 0.00 ?  52 SER F HB3  1  
ATOM 6973   H HG   . SER F  1 52 ? -8.381  17.552  -230.905 1.00 0.00 ?  52 SER F HG   1  
ATOM 6974   N N    . GLU F  1 53 ? -7.059  19.634  -234.124 1.00 0.00 ?  53 GLU F N    1  
ATOM 6975   C CA   . GLU F  1 53 ? -7.649  20.239  -235.312 1.00 0.00 ?  53 GLU F CA   1  
ATOM 6976   C C    . GLU F  1 53 ? -6.574  20.684  -236.296 1.00 0.00 ?  53 GLU F C    1  
ATOM 6977   O O    . GLU F  1 53 ? -6.735  20.550  -237.509 1.00 0.00 ?  53 GLU F O    1  
ATOM 6978   C CB   . GLU F  1 53 ? -8.533  21.427  -234.926 1.00 0.00 ?  53 GLU F CB   1  
ATOM 6979   C CG   . GLU F  1 53 ? -9.805  21.048  -234.181 1.00 0.00 ?  53 GLU F CG   1  
ATOM 6980   C CD   . GLU F  1 53 ? -10.574 22.268  -233.759 1.00 0.00 ?  53 GLU F CD   1  
ATOM 6981   O OE1  . GLU F  1 53 ? -10.050 23.350  -233.880 1.00 0.00 ?  53 GLU F OE1  1  
ATOM 6982   O OE2  . GLU F  1 53 ? -11.727 22.132  -233.420 1.00 0.00 -1 53 GLU F OE2  1  
ATOM 6983   H H    . GLU F  1 53 ? -6.967  20.188  -233.285 1.00 0.00 ?  53 GLU F H    1  
ATOM 6984   H HA   . GLU F  1 53 ? -8.262  19.504  -235.835 1.00 0.00 ?  53 GLU F HA   1  
ATOM 6985   H HB2  . GLU F  1 53 ? -7.928  22.084  -234.301 1.00 0.00 ?  53 GLU F HB2  1  
ATOM 6986   H HB3  . GLU F  1 53 ? -8.794  21.943  -235.850 1.00 0.00 ?  53 GLU F HB3  1  
ATOM 6987   H HG2  . GLU F  1 53 ? -10.458 20.385  -234.747 1.00 0.00 ?  53 GLU F HG2  1  
ATOM 6988   H HG3  . GLU F  1 53 ? -9.438  20.527  -233.297 1.00 0.00 ?  53 GLU F HG3  1  
ATOM 6989   N N    . TYR F  1 54 ? -5.477  21.215  -235.765 1.00 0.00 ?  54 TYR F N    1  
ATOM 6990   C CA   . TYR F  1 54 ? -4.347  21.622  -236.591 1.00 0.00 ?  54 TYR F CA   1  
ATOM 6991   C C    . TYR F  1 54 ? -3.734  20.430  -237.314 1.00 0.00 ?  54 TYR F C    1  
ATOM 6992   O O    . TYR F  1 54 ? -3.086  20.585  -238.349 1.00 0.00 ?  54 TYR F O    1  
ATOM 6993   C CB   . TYR F  1 54 ? -3.286  22.321  -235.739 1.00 0.00 ?  54 TYR F CB   1  
ATOM 6994   C CG   . TYR F  1 54 ? -2.127  22.878  -236.536 1.00 0.00 ?  54 TYR F CG   1  
ATOM 6995   C CD1  . TYR F  1 54 ? -2.288  23.997  -237.341 1.00 0.00 ?  54 TYR F CD1  1  
ATOM 6996   C CD2  . TYR F  1 54 ? -0.875  22.284  -236.481 1.00 0.00 ?  54 TYR F CD2  1  
ATOM 6997   C CE1  . TYR F  1 54 ? -1.234  24.509  -238.072 1.00 0.00 ?  54 TYR F CE1  1  
ATOM 6998   C CE2  . TYR F  1 54 ? 0.186   22.788  -237.207 1.00 0.00 ?  54 TYR F CE2  1  
ATOM 6999   C CZ   . TYR F  1 54 ? 0.003   23.901  -238.002 1.00 0.00 ?  54 TYR F CZ   1  
ATOM 7000   O OH   . TYR F  1 54 ? 1.057   24.408  -238.726 1.00 0.00 ?  54 TYR F OH   1  
ATOM 7001   H H    . TYR F  1 54 ? -5.425  21.338  -234.764 1.00 0.00 ?  54 TYR F H    1  
ATOM 7002   H HA   . TYR F  1 54 ? -4.684  22.314  -237.364 1.00 0.00 ?  54 TYR F HA   1  
ATOM 7003   H HB2  . TYR F  1 54 ? -3.783  23.133  -235.205 1.00 0.00 ?  54 TYR F HB2  1  
ATOM 7004   H HB3  . TYR F  1 54 ? -2.915  21.589  -235.022 1.00 0.00 ?  54 TYR F HB3  1  
ATOM 7005   H HD1  . TYR F  1 54 ? -3.269  24.472  -237.391 1.00 0.00 ?  54 TYR F HD1  1  
ATOM 7006   H HD2  . TYR F  1 54 ? -0.737  21.405  -235.852 1.00 0.00 ?  54 TYR F HD2  1  
ATOM 7007   H HE1  . TYR F  1 54 ? -1.375  25.389  -238.700 1.00 0.00 ?  54 TYR F HE1  1  
ATOM 7008   H HE2  . TYR F  1 54 ? 1.163   22.306  -237.151 1.00 0.00 ?  54 TYR F HE2  1  
ATOM 7009   H HH   . TYR F  1 54 ? 1.893   24.362  -238.255 1.00 0.00 ?  54 TYR F HH   1  
ATOM 7010   N N    . ASN F  1 55 ? -3.943  19.239  -236.763 1.00 0.00 ?  55 ASN F N    1  
ATOM 7011   C CA   . ASN F  1 55 ? -3.547  18.005  -237.431 1.00 0.00 ?  55 ASN F CA   1  
ATOM 7012   C C    . ASN F  1 55 ? -4.219  17.877  -238.792 1.00 0.00 ?  55 ASN F C    1  
ATOM 7013   O O    . ASN F  1 55 ? -3.604  17.423  -239.758 1.00 0.00 ?  55 ASN F O    1  
ATOM 7014   C CB   . ASN F  1 55 ? -3.855  16.788  -236.578 1.00 0.00 ?  55 ASN F CB   1  
ATOM 7015   C CG   . ASN F  1 55 ? -2.933  16.626  -235.401 1.00 0.00 ?  55 ASN F CG   1  
ATOM 7016   O OD1  . ASN F  1 55 ? -1.833  17.189  -235.366 1.00 0.00 ?  55 ASN F OD1  1  
ATOM 7017   N ND2  . ASN F  1 55 ? -3.340  15.794  -234.476 1.00 0.00 ?  55 ASN F ND2  1  
ATOM 7018   H H    . ASN F  1 55 ? -4.387  19.187  -235.857 1.00 0.00 ?  55 ASN F H    1  
ATOM 7019   H HA   . ASN F  1 55 ? -2.472  18.013  -237.616 1.00 0.00 ?  55 ASN F HA   1  
ATOM 7020   H HB2  . ASN F  1 55 ? -4.877  16.570  -236.264 1.00 0.00 ?  55 ASN F HB2  1  
ATOM 7021   H HB3  . ASN F  1 55 ? -3.557  16.087  -237.357 1.00 0.00 ?  55 ASN F HB3  1  
ATOM 7022   H HD21 . ASN F  1 55 ? -4.212  15.317  -234.581 1.00 0.00 ?  55 ASN F HD21 1  
ATOM 7023   H HD22 . ASN F  1 55 ? -2.777  15.637  -233.664 1.00 0.00 ?  55 ASN F HD22 1  
ATOM 7024   N N    . LEU F  1 56 ? -5.483  18.279  -238.863 1.00 0.00 ?  56 LEU F N    1  
ATOM 7025   C CA   . LEU F  1 56 ? -6.232  18.234  -240.113 1.00 0.00 ?  56 LEU F CA   1  
ATOM 7026   C C    . LEU F  1 56 ? -5.950  19.462  -240.969 1.00 0.00 ?  56 LEU F C    1  
ATOM 7027   O O    . LEU F  1 56 ? -6.084  19.423  -242.192 1.00 0.00 ?  56 LEU F O    1  
ATOM 7028   C CB   . LEU F  1 56 ? -7.735  18.117  -239.827 1.00 0.00 ?  56 LEU F CB   1  
ATOM 7029   C CG   . LEU F  1 56 ? -8.163  16.832  -239.107 1.00 0.00 ?  56 LEU F CG   1  
ATOM 7030   C CD1  . LEU F  1 56 ? -9.667  16.846  -238.865 1.00 0.00 ?  56 LEU F CD1  1  
ATOM 7031   C CD2  . LEU F  1 56 ? -7.762  15.624  -239.940 1.00 0.00 ?  56 LEU F CD2  1  
ATOM 7032   H H    . LEU F  1 56 ? -5.937  18.625  -238.030 1.00 0.00 ?  56 LEU F H    1  
ATOM 7033   H HA   . LEU F  1 56 ? -5.916  17.371  -240.698 1.00 0.00 ?  56 LEU F HA   1  
ATOM 7034   H HB2  . LEU F  1 56 ? -7.856  18.974  -239.166 1.00 0.00 ?  56 LEU F HB2  1  
ATOM 7035   H HB3  . LEU F  1 56 ? -8.330  18.265  -240.728 1.00 0.00 ?  56 LEU F HB3  1  
ATOM 7036   H HG   . LEU F  1 56 ? -7.612  16.787  -238.167 1.00 0.00 ?  56 LEU F HG   1  
ATOM 7037   H HD11 . LEU F  1 56 ? -9.962  15.930  -238.353 1.00 0.00 ?  56 LEU F HD11 1  
ATOM 7038   H HD12 . LEU F  1 56 ? -9.928  17.705  -238.248 1.00 0.00 ?  56 LEU F HD12 1  
ATOM 7039   H HD13 . LEU F  1 56 ? -10.188 16.911  -239.820 1.00 0.00 ?  56 LEU F HD13 1  
ATOM 7040   H HD21 . LEU F  1 56 ? -6.681  15.618  -240.076 1.00 0.00 ?  56 LEU F HD21 1  
ATOM 7041   H HD22 . LEU F  1 56 ? -8.067  14.711  -239.426 1.00 0.00 ?  56 LEU F HD22 1  
ATOM 7042   H HD23 . LEU F  1 56 ? -8.251  15.674  -240.913 1.00 0.00 ?  56 LEU F HD23 1  
ATOM 7043   N N    . TYR F  1 57 ? -5.559  20.553  -240.319 1.00 0.00 ?  57 TYR F N    1  
ATOM 7044   C CA   . TYR F  1 57 ? -5.126  21.752  -241.026 1.00 0.00 ?  57 TYR F CA   1  
ATOM 7045   C C    . TYR F  1 57 ? -4.106  21.417  -242.106 1.00 0.00 ?  57 TYR F C    1  
ATOM 7046   O O    . TYR F  1 57 ? -4.081  22.043  -243.166 1.00 0.00 ?  57 TYR F O    1  
ATOM 7047   C CB   . TYR F  1 57 ? -4.536  22.768  -240.045 1.00 0.00 ?  57 TYR F CB   1  
ATOM 7048   C CG   . TYR F  1 57 ? -4.134  24.078  -240.686 1.00 0.00 ?  57 TYR F CG   1  
ATOM 7049   C CD1  . TYR F  1 57 ? -5.075  25.063  -240.945 1.00 0.00 ?  57 TYR F CD1  1  
ATOM 7050   C CD2  . TYR F  1 57 ? -2.813  24.325  -241.029 1.00 0.00 ?  57 TYR F CD2  1  
ATOM 7051   C CE1  . TYR F  1 57 ? -4.714  26.261  -241.531 1.00 0.00 ?  57 TYR F CE1  1  
ATOM 7052   C CE2  . TYR F  1 57 ? -2.440  25.519  -241.615 1.00 0.00 ?  57 TYR F CE2  1  
ATOM 7053   C CZ   . TYR F  1 57 ? -3.393  26.485  -241.865 1.00 0.00 ?  57 TYR F CZ   1  
ATOM 7054   O OH   . TYR F  1 57 ? -3.027  27.676  -242.447 1.00 0.00 ?  57 TYR F OH   1  
ATOM 7055   H H    . TYR F  1 57 ? -5.562  20.551  -239.309 1.00 0.00 ?  57 TYR F H    1  
ATOM 7056   H HA   . TYR F  1 57 ? -5.976  22.211  -241.532 1.00 0.00 ?  57 TYR F HA   1  
ATOM 7057   H HB2  . TYR F  1 57 ? -5.291  22.955  -239.280 1.00 0.00 ?  57 TYR F HB2  1  
ATOM 7058   H HB3  . TYR F  1 57 ? -3.663  22.304  -239.587 1.00 0.00 ?  57 TYR F HB3  1  
ATOM 7059   H HD1  . TYR F  1 57 ? -6.116  24.879  -240.679 1.00 0.00 ?  57 TYR F HD1  1  
ATOM 7060   H HD2  . TYR F  1 57 ? -2.065  23.558  -240.830 1.00 0.00 ?  57 TYR F HD2  1  
ATOM 7061   H HE1  . TYR F  1 57 ? -5.464  27.026  -241.729 1.00 0.00 ?  57 TYR F HE1  1  
ATOM 7062   H HE2  . TYR F  1 57 ? -1.396  25.694  -241.879 1.00 0.00 ?  57 TYR F HE2  1  
ATOM 7063   H HH   . TYR F  1 57 ? -2.211  28.035  -242.088 1.00 0.00 ?  57 TYR F HH   1  
ATOM 7064   N N    . ARG F  1 58 ? -3.266  20.425  -241.832 1.00 0.00 ?  58 ARG F N    1  
ATOM 7065   C CA   . ARG F  1 58 ? -2.262  19.983  -242.793 1.00 0.00 ?  58 ARG F CA   1  
ATOM 7066   C C    . ARG F  1 58 ? -2.717  18.727  -243.526 1.00 0.00 ?  58 ARG F C    1  
ATOM 7067   O O    . ARG F  1 58 ? -2.612  18.638  -244.749 1.00 0.00 ?  58 ARG F O    1  
ATOM 7068   C CB   . ARG F  1 58 ? -0.897  19.789  -242.150 1.00 0.00 ?  58 ARG F CB   1  
ATOM 7069   C CG   . ARG F  1 58 ? -0.359  21.005  -241.413 1.00 0.00 ?  58 ARG F CG   1  
ATOM 7070   C CD   . ARG F  1 58 ? 0.059   22.122  -242.298 1.00 0.00 ?  58 ARG F CD   1  
ATOM 7071   N NE   . ARG F  1 58 ? 0.564   23.291  -241.596 1.00 0.00 ?  58 ARG F NE   1  
ATOM 7072   C CZ   . ARG F  1 58 ? 0.974   24.426  -242.195 1.00 0.00 ?  58 ARG F CZ   1  
ATOM 7073   N NH1  . ARG F  1 58 ? 0.976   24.537  -243.505 1.00 0.00 1  58 ARG F NH1  1  
ATOM 7074   N NH2  . ARG F  1 58 ? 1.397   25.418  -241.431 1.00 0.00 ?  58 ARG F NH2  1  
ATOM 7075   H H    . ARG F  1 58 ? -3.323  19.965  -240.935 1.00 0.00 ?  58 ARG F H    1  
ATOM 7076   H HA   . ARG F  1 58 ? -2.117  20.750  -243.554 1.00 0.00 ?  58 ARG F HA   1  
ATOM 7077   H HB2  . ARG F  1 58 ? -0.989  18.958  -241.452 1.00 0.00 ?  58 ARG F HB2  1  
ATOM 7078   H HB3  . ARG F  1 58 ? -0.205  19.518  -242.948 1.00 0.00 ?  58 ARG F HB3  1  
ATOM 7079   H HG2  . ARG F  1 58 ? -1.136  21.378  -240.745 1.00 0.00 ?  58 ARG F HG2  1  
ATOM 7080   H HG3  . ARG F  1 58 ? 0.507   20.698  -240.826 1.00 0.00 ?  58 ARG F HG3  1  
ATOM 7081   H HD2  . ARG F  1 58 ? 0.850   21.772  -242.960 1.00 0.00 ?  58 ARG F HD2  1  
ATOM 7082   H HD3  . ARG F  1 58 ? -0.797  22.442  -242.892 1.00 0.00 ?  58 ARG F HD3  1  
ATOM 7083   H HE   . ARG F  1 58 ? 0.686   23.444  -240.603 1.00 0.00 ?  58 ARG F HE   1  
ATOM 7084   H HH11 . ARG F  1 58 ? 0.666   23.763  -244.076 1.00 0.00 ?  58 ARG F HH11 1  
ATOM 7085   H HH12 . ARG F  1 58 ? 1.287   25.396  -243.935 1.00 0.00 ?  58 ARG F HH12 1  
ATOM 7086   H HH21 . ARG F  1 58 ? 1.405   25.309  -240.426 1.00 0.00 ?  58 ARG F HH21 1  
ATOM 7087   H HH22 . ARG F  1 58 ? 1.710   26.279  -241.854 1.00 0.00 ?  58 ARG F HH22 1  
ATOM 7088   N N    . ASN F  1 59 ? -3.222  17.758  -242.770 1.00 0.00 ?  59 ASN F N    1  
ATOM 7089   C CA   . ASN F  1 59 ? -3.594  16.464  -243.331 1.00 0.00 ?  59 ASN F CA   1  
ATOM 7090   C C    . ASN F  1 59 ? -4.748  16.602  -244.316 1.00 0.00 ?  59 ASN F C    1  
ATOM 7091   O O    . ASN F  1 59 ? -4.609  16.291  -245.498 1.00 0.00 ?  59 ASN F O    1  
ATOM 7092   C CB   . ASN F  1 59 ? -3.950  15.469  -242.242 1.00 0.00 ?  59 ASN F CB   1  
ATOM 7093   C CG   . ASN F  1 59 ? -4.064  14.052  -242.731 1.00 0.00 ?  59 ASN F CG   1  
ATOM 7094   O OD1  . ASN F  1 59 ? -4.199  13.797  -243.934 1.00 0.00 ?  59 ASN F OD1  1  
ATOM 7095   N ND2  . ASN F  1 59 ? -4.092  13.133  -241.800 1.00 0.00 ?  59 ASN F ND2  1  
ATOM 7096   H H    . ASN F  1 59 ? -3.352  17.921  -241.782 1.00 0.00 ?  59 ASN F H    1  
ATOM 7097   H HA   . ASN F  1 59 ? -2.756  16.050  -243.894 1.00 0.00 ?  59 ASN F HA   1  
ATOM 7098   H HB2  . ASN F  1 59 ? -3.425  15.476  -241.286 1.00 0.00 ?  59 ASN F HB2  1  
ATOM 7099   H HB3  . ASN F  1 59 ? -4.952  15.876  -242.109 1.00 0.00 ?  59 ASN F HB3  1  
ATOM 7100   H HD21 . ASN F  1 59 ? -4.039  13.396  -240.837 1.00 0.00 ?  59 ASN F HD21 1  
ATOM 7101   H HD22 . ASN F  1 59 ? -4.166  12.168  -242.052 1.00 0.00 ?  59 ASN F HD22 1  
ATOM 7102   N N    . ALA F  1 60 ? -5.889  17.071  -243.821 1.00 0.00 ?  60 ALA F N    1  
ATOM 7103   C CA   . ALA F  1 60 ? -7.089  17.190  -244.641 1.00 0.00 ?  60 ALA F CA   1  
ATOM 7104   C C    . ALA F  1 60 ? -6.872  18.160  -245.796 1.00 0.00 ?  60 ALA F C    1  
ATOM 7105   O O    . ALA F  1 60 ? -7.402  17.965  -246.889 1.00 0.00 ?  60 ALA F O    1  
ATOM 7106   C CB   . ALA F  1 60 ? -8.271  17.629  -243.790 1.00 0.00 ?  60 ALA F CB   1  
ATOM 7107   H H    . ALA F  1 60 ? -5.926  17.352  -242.851 1.00 0.00 ?  60 ALA F H    1  
ATOM 7108   H HA   . ALA F  1 60 ? -7.315  16.215  -245.073 1.00 0.00 ?  60 ALA F HA   1  
ATOM 7109   H HB1  . ALA F  1 60 ? -8.054  18.596  -243.338 1.00 0.00 ?  60 ALA F HB1  1  
ATOM 7110   H HB2  . ALA F  1 60 ? -9.158  17.713  -244.417 1.00 0.00 ?  60 ALA F HB2  1  
ATOM 7111   H HB3  . ALA F  1 60 ? -8.449  16.893  -243.006 1.00 0.00 ?  60 ALA F HB3  1  
ATOM 7112   N N    . GLN F  1 61 ? -6.091  19.205  -245.546 1.00 0.00 ?  61 GLN F N    1  
ATOM 7113   C CA   . GLN F  1 61 ? -5.731  20.159  -246.588 1.00 0.00 ?  61 GLN F CA   1  
ATOM 7114   C C    . GLN F  1 61 ? -5.098  19.457  -247.782 1.00 0.00 ?  61 GLN F C    1  
ATOM 7115   O O    . GLN F  1 61 ? -5.560  19.599  -248.914 1.00 0.00 ?  61 GLN F O    1  
ATOM 7116   C CB   . GLN F  1 61 ? -4.768  21.214  -246.038 1.00 0.00 ?  61 GLN F CB   1  
ATOM 7117   C CG   . GLN F  1 61 ? -4.357  22.270  -247.051 1.00 0.00 ?  61 GLN F CG   1  
ATOM 7118   C CD   . GLN F  1 61 ? -3.354  23.257  -246.484 1.00 0.00 ?  61 GLN F CD   1  
ATOM 7119   O OE1  . GLN F  1 61 ? -2.854  23.084  -245.369 1.00 0.00 ?  61 GLN F OE1  1  
ATOM 7120   N NE2  . GLN F  1 61 ? -3.057  24.302  -247.248 1.00 0.00 ?  61 GLN F NE2  1  
ATOM 7121   H H    . GLN F  1 61 ? -5.737  19.341  -244.610 1.00 0.00 ?  61 GLN F H    1  
ATOM 7122   H HA   . GLN F  1 61 ? -6.630  20.651  -246.958 1.00 0.00 ?  61 GLN F HA   1  
ATOM 7123   H HB2  . GLN F  1 61 ? -5.268  21.688  -245.194 1.00 0.00 ?  61 GLN F HB2  1  
ATOM 7124   H HB3  . GLN F  1 61 ? -3.886  20.682  -245.684 1.00 0.00 ?  61 GLN F HB3  1  
ATOM 7125   H HG2  . GLN F  1 61 ? -4.047  22.024  -248.066 1.00 0.00 ?  61 GLN F HG2  1  
ATOM 7126   H HG3  . GLN F  1 61 ? -5.336  22.750  -247.078 1.00 0.00 ?  61 GLN F HG3  1  
ATOM 7127   H HE21 . GLN F  1 61 ? -3.488  24.404  -248.145 1.00 0.00 ?  61 GLN F HE21 1  
ATOM 7128   H HE22 . GLN F  1 61 ? -2.402  24.987  -246.927 1.00 0.00 ?  61 GLN F HE22 1  
ATOM 7129   N N    . SER F  1 62 ? -4.037  18.700  -247.523 1.00 0.00 ?  62 SER F N    1  
ATOM 7130   C CA   . SER F  1 62 ? -3.295  18.032  -248.585 1.00 0.00 ?  62 SER F CA   1  
ATOM 7131   C C    . SER F  1 62 ? -4.114  16.909  -249.208 1.00 0.00 ?  62 SER F C    1  
ATOM 7132   O O    . SER F  1 62 ? -3.920  16.557  -250.372 1.00 0.00 ?  62 SER F O    1  
ATOM 7133   C CB   . SER F  1 62 ? -1.984  17.493  -248.047 1.00 0.00 ?  62 SER F CB   1  
ATOM 7134   O OG   . SER F  1 62 ? -2.176  16.404  -247.187 1.00 0.00 ?  62 SER F OG   1  
ATOM 7135   H H    . SER F  1 62 ? -3.738  18.583  -246.565 1.00 0.00 ?  62 SER F H    1  
ATOM 7136   H HA   . SER F  1 62 ? -2.946  18.712  -249.363 1.00 0.00 ?  62 SER F HA   1  
ATOM 7137   H HB2  . SER F  1 62 ? -1.366  17.177  -248.887 1.00 0.00 ?  62 SER F HB2  1  
ATOM 7138   H HB3  . SER F  1 62 ? -1.476  18.289  -247.503 1.00 0.00 ?  62 SER F HB3  1  
ATOM 7139   H HG   . SER F  1 62 ? -2.849  16.623  -246.538 1.00 0.00 ?  62 SER F HG   1  
ATOM 7140   N N    . ASN F  1 63 ? -5.031  16.348  -248.426 1.00 0.00 ?  63 ASN F N    1  
ATOM 7141   C CA   . ASN F  1 63 ? -5.884  15.265  -248.900 1.00 0.00 ?  63 ASN F CA   1  
ATOM 7142   C C    . ASN F  1 63 ? -6.832  15.747  -249.991 1.00 0.00 ?  63 ASN F C    1  
ATOM 7143   O O    . ASN F  1 63 ? -6.961  15.115  -251.039 1.00 0.00 ?  63 ASN F O    1  
ATOM 7144   C CB   . ASN F  1 63 ? -6.668  14.637  -247.763 1.00 0.00 ?  63 ASN F CB   1  
ATOM 7145   C CG   . ASN F  1 63 ? -5.831  13.789  -246.846 1.00 0.00 ?  63 ASN F CG   1  
ATOM 7146   O OD1  . ASN F  1 63 ? -4.812  13.219  -247.252 1.00 0.00 ?  63 ASN F OD1  1  
ATOM 7147   N ND2  . ASN F  1 63 ? -6.299  13.638  -245.633 1.00 0.00 ?  63 ASN F ND2  1  
ATOM 7148   H H    . ASN F  1 63 ? -5.139  16.681  -247.479 1.00 0.00 ?  63 ASN F H    1  
ATOM 7149   H HA   . ASN F  1 63 ? -5.271  14.481  -249.348 1.00 0.00 ?  63 ASN F HA   1  
ATOM 7150   H HB2  . ASN F  1 63 ? -7.360  15.234  -247.166 1.00 0.00 ?  63 ASN F HB2  1  
ATOM 7151   H HB3  . ASN F  1 63 ? -7.232  13.984  -248.428 1.00 0.00 ?  63 ASN F HB3  1  
ATOM 7152   H HD21 . ASN F  1 63 ? -7.160  14.073  -245.371 1.00 0.00 ?  63 ASN F HD21 1  
ATOM 7153   H HD22 . ASN F  1 63 ? -5.794  13.087  -244.968 1.00 0.00 ?  63 ASN F HD22 1  
ATOM 7154   N N    . THR F  1 64 ? -7.494  16.871  -249.737 1.00 0.00 ?  64 THR F N    1  
ATOM 7155   C CA   . THR F  1 64 ? -8.460  17.420  -250.681 1.00 0.00 ?  64 THR F CA   1  
ATOM 7156   C C    . THR F  1 64 ? -7.779  17.874  -251.966 1.00 0.00 ?  64 THR F C    1  
ATOM 7157   O O    . THR F  1 64 ? -8.320  17.705  -253.059 1.00 0.00 ?  64 THR F O    1  
ATOM 7158   C CB   . THR F  1 64 ? -9.231  18.607  -250.074 1.00 0.00 ?  64 THR F CB   1  
ATOM 7159   O OG1  . THR F  1 64 ? -8.304  19.620  -249.660 1.00 0.00 ?  64 THR F OG1  1  
ATOM 7160   C CG2  . THR F  1 64 ? -10.050 18.154  -248.875 1.00 0.00 ?  64 THR F CG2  1  
ATOM 7161   H H    . THR F  1 64 ? -7.323  17.357  -248.869 1.00 0.00 ?  64 THR F H    1  
ATOM 7162   H HA   . THR F  1 64 ? -9.176  16.649  -250.967 1.00 0.00 ?  64 THR F HA   1  
ATOM 7163   H HB   . THR F  1 64 ? -9.895  19.023  -250.831 1.00 0.00 ?  64 THR F HB   1  
ATOM 7164   H HG1  . THR F  1 64 ? -8.787  20.359  -249.282 1.00 0.00 ?  64 THR F HG1  1  
ATOM 7165   H HG21 . THR F  1 64 ? -10.588 19.007  -248.460 1.00 0.00 ?  64 THR F HG21 1  
ATOM 7166   H HG22 . THR F  1 64 ? -10.763 17.392  -249.189 1.00 0.00 ?  64 THR F HG22 1  
ATOM 7167   H HG23 . THR F  1 64 ? -9.386  17.740  -248.117 1.00 0.00 ?  64 THR F HG23 1  
ATOM 7168   N N    . VAL F  1 65 ? -6.590  18.449  -251.828 1.00 0.00 ?  65 VAL F N    1  
ATOM 7169   C CA   . VAL F  1 65 ? -5.804  18.870  -252.981 1.00 0.00 ?  65 VAL F CA   1  
ATOM 7170   C C    . VAL F  1 65 ? -5.391  17.676  -253.832 1.00 0.00 ?  65 VAL F C    1  
ATOM 7171   O O    . VAL F  1 65 ? -5.454  17.725  -255.060 1.00 0.00 ?  65 VAL F O    1  
ATOM 7172   C CB   . VAL F  1 65 ? -4.542  19.644  -252.554 1.00 0.00 ?  65 VAL F CB   1  
ATOM 7173   C CG1  . VAL F  1 65 ? -3.632  19.879  -253.750 1.00 0.00 ?  65 VAL F CG1  1  
ATOM 7174   C CG2  . VAL F  1 65 ? -4.922  20.967  -251.907 1.00 0.00 ?  65 VAL F CG2  1  
ATOM 7175   H H    . VAL F  1 65 ? -6.221  18.599  -250.900 1.00 0.00 ?  65 VAL F H    1  
ATOM 7176   H HA   . VAL F  1 65 ? -6.389  19.501  -253.651 1.00 0.00 ?  65 VAL F HA   1  
ATOM 7177   H HB   . VAL F  1 65 ? -4.010  19.064  -251.800 1.00 0.00 ?  65 VAL F HB   1  
ATOM 7178   H HG11 . VAL F  1 65 ? -2.745  20.427  -253.429 1.00 0.00 ?  65 VAL F HG11 1  
ATOM 7179   H HG12 . VAL F  1 65 ? -3.332  18.921  -254.173 1.00 0.00 ?  65 VAL F HG12 1  
ATOM 7180   H HG13 . VAL F  1 65 ? -4.163  20.460  -254.503 1.00 0.00 ?  65 VAL F HG13 1  
ATOM 7181   H HG21 . VAL F  1 65 ? -5.537  20.778  -251.026 1.00 0.00 ?  65 VAL F HG21 1  
ATOM 7182   H HG22 . VAL F  1 65 ? -4.019  21.500  -251.610 1.00 0.00 ?  65 VAL F HG22 1  
ATOM 7183   H HG23 . VAL F  1 65 ? -5.484  21.571  -252.619 1.00 0.00 ?  65 VAL F HG23 1  
ATOM 7184   N N    . LYS F  1 66 ? -4.969  16.603  -253.171 1.00 0.00 ?  66 LYS F N    1  
ATOM 7185   C CA   . LYS F  1 66 ? -4.627  15.364  -253.860 1.00 0.00 ?  66 LYS F CA   1  
ATOM 7186   C C    . LYS F  1 66 ? -5.786  14.872  -254.717 1.00 0.00 ?  66 LYS F C    1  
ATOM 7187   O O    . LYS F  1 66 ? -5.604  14.527  -255.885 1.00 0.00 ?  66 LYS F O    1  
ATOM 7188   C CB   . LYS F  1 66 ? -4.222  14.286  -252.854 1.00 0.00 ?  66 LYS F CB   1  
ATOM 7189   C CG   . LYS F  1 66 ? -3.892  12.936  -253.477 1.00 0.00 ?  66 LYS F CG   1  
ATOM 7190   C CD   . LYS F  1 66 ? -3.559  11.901  -252.413 1.00 0.00 ?  66 LYS F CD   1  
ATOM 7191   C CE   . LYS F  1 66 ? -3.326  10.529  -253.027 1.00 0.00 ?  66 LYS F CE   1  
ATOM 7192   N NZ   . LYS F  1 66 ? -4.582  9.938   -253.563 1.00 0.00 1  66 LYS F NZ   1  
ATOM 7193   H H    . LYS F  1 66 ? -4.883  16.646  -252.166 1.00 0.00 ?  66 LYS F H    1  
ATOM 7194   H HA   . LYS F  1 66 ? -3.791  15.538  -254.539 1.00 0.00 ?  66 LYS F HA   1  
ATOM 7195   H HB2  . LYS F  1 66 ? -3.349  14.661  -252.318 1.00 0.00 ?  66 LYS F HB2  1  
ATOM 7196   H HB3  . LYS F  1 66 ? -5.052  14.170  -252.157 1.00 0.00 ?  66 LYS F HB3  1  
ATOM 7197   H HG2  . LYS F  1 66 ? -4.756  12.601  -254.053 1.00 0.00 ?  66 LYS F HG2  1  
ATOM 7198   H HG3  . LYS F  1 66 ? -3.039  13.061  -254.143 1.00 0.00 ?  66 LYS F HG3  1  
ATOM 7199   H HD2  . LYS F  1 66 ? -2.659  12.222  -251.886 1.00 0.00 ?  66 LYS F HD2  1  
ATOM 7200   H HD3  . LYS F  1 66 ? -4.390  11.847  -251.709 1.00 0.00 ?  66 LYS F HD3  1  
ATOM 7201   H HE2  . LYS F  1 66 ? -2.601  10.634  -253.834 1.00 0.00 ?  66 LYS F HE2  1  
ATOM 7202   H HE3  . LYS F  1 66 ? -2.918  9.875   -252.257 1.00 0.00 ?  66 LYS F HE3  1  
ATOM 7203   H HZ1  . LYS F  1 66 ? -4.960  10.544  -254.278 1.00 0.00 ?  66 LYS F HZ1  1  
ATOM 7204   H HZ2  . LYS F  1 66 ? -4.384  9.031   -253.961 1.00 0.00 ?  66 LYS F HZ2  1  
ATOM 7205   H HZ3  . LYS F  1 66 ? -5.254  9.840   -252.815 1.00 0.00 ?  66 LYS F HZ3  1  
ATOM 7206   N N    . VAL F  1 67 ? -6.978  14.842  -254.131 1.00 0.00 ?  67 VAL F N    1  
ATOM 7207   C CA   . VAL F  1 67 ? -8.155  14.318  -254.813 1.00 0.00 ?  67 VAL F CA   1  
ATOM 7208   C C    . VAL F  1 67 ? -8.501  15.156  -256.037 1.00 0.00 ?  67 VAL F C    1  
ATOM 7209   O O    . VAL F  1 67 ? -8.817  14.621  -257.099 1.00 0.00 ?  67 VAL F O    1  
ATOM 7210   C CB   . VAL F  1 67 ? -9.376  14.267  -253.876 1.00 0.00 ?  67 VAL F CB   1  
ATOM 7211   C CG1  . VAL F  1 67 ? -10.639 13.953  -254.663 1.00 0.00 ?  67 VAL F CG1  1  
ATOM 7212   C CG2  . VAL F  1 67 ? -9.163  13.234  -252.779 1.00 0.00 ?  67 VAL F CG2  1  
ATOM 7213   H H    . VAL F  1 67 ? -7.071  15.192  -253.188 1.00 0.00 ?  67 VAL F H    1  
ATOM 7214   H HA   . VAL F  1 67 ? -7.973  13.316  -255.203 1.00 0.00 ?  67 VAL F HA   1  
ATOM 7215   H HB   . VAL F  1 67 ? -9.485  15.233  -253.384 1.00 0.00 ?  67 VAL F HB   1  
ATOM 7216   H HG11 . VAL F  1 67 ? -11.492 13.921  -253.985 1.00 0.00 ?  67 VAL F HG11 1  
ATOM 7217   H HG12 . VAL F  1 67 ? -10.802 14.726  -255.414 1.00 0.00 ?  67 VAL F HG12 1  
ATOM 7218   H HG13 . VAL F  1 67 ? -10.531 12.986  -255.154 1.00 0.00 ?  67 VAL F HG13 1  
ATOM 7219   H HG21 . VAL F  1 67 ? -8.280  13.499  -252.196 1.00 0.00 ?  67 VAL F HG21 1  
ATOM 7220   H HG22 . VAL F  1 67 ? -10.034 13.212  -252.126 1.00 0.00 ?  67 VAL F HG22 1  
ATOM 7221   H HG23 . VAL F  1 67 ? -9.020  12.251  -253.229 1.00 0.00 ?  67 VAL F HG23 1  
ATOM 7222   N N    . PHE F  1 68 ? -8.439  16.475  -255.881 1.00 0.00 ?  68 PHE F N    1  
ATOM 7223   C CA   . PHE F  1 68 ? -8.695  17.389  -256.987 1.00 0.00 ?  68 PHE F CA   1  
ATOM 7224   C C    . PHE F  1 68 ? -7.616  17.277  -258.056 1.00 0.00 ?  68 PHE F C    1  
ATOM 7225   O O    . PHE F  1 68 ? -7.857  17.564  -259.229 1.00 0.00 ?  68 PHE F O    1  
ATOM 7226   C CB   . PHE F  1 68 ? -8.786  18.829  -256.480 1.00 0.00 ?  68 PHE F CB   1  
ATOM 7227   C CG   . PHE F  1 68 ? -10.127 19.186  -255.904 1.00 0.00 ?  68 PHE F CG   1  
ATOM 7228   C CD1  . PHE F  1 68 ? -11.254 19.234  -256.710 1.00 0.00 ?  68 PHE F CD1  1  
ATOM 7229   C CD2  . PHE F  1 68 ? -10.263 19.474  -254.554 1.00 0.00 ?  68 PHE F CD2  1  
ATOM 7230   C CE1  . PHE F  1 68 ? -12.487 19.563  -256.183 1.00 0.00 ?  68 PHE F CE1  1  
ATOM 7231   C CE2  . PHE F  1 68 ? -11.497 19.802  -254.023 1.00 0.00 ?  68 PHE F CE2  1  
ATOM 7232   C CZ   . PHE F  1 68 ? -12.608 19.846  -254.837 1.00 0.00 ?  68 PHE F CZ   1  
ATOM 7233   H H    . PHE F  1 68 ? -8.209  16.853  -254.974 1.00 0.00 ?  68 PHE F H    1  
ATOM 7234   H HA   . PHE F  1 68 ? -9.638  17.130  -257.471 1.00 0.00 ?  68 PHE F HA   1  
ATOM 7235   H HB2  . PHE F  1 68 ? -8.053  18.996  -255.691 1.00 0.00 ?  68 PHE F HB2  1  
ATOM 7236   H HB3  . PHE F  1 68 ? -8.603  19.526  -257.297 1.00 0.00 ?  68 PHE F HB3  1  
ATOM 7237   H HD1  . PHE F  1 68 ? -11.158 19.009  -257.773 1.00 0.00 ?  68 PHE F HD1  1  
ATOM 7238   H HD2  . PHE F  1 68 ? -9.384  19.439  -253.910 1.00 0.00 ?  68 PHE F HD2  1  
ATOM 7239   H HE1  . PHE F  1 68 ? -13.365 19.597  -256.827 1.00 0.00 ?  68 PHE F HE1  1  
ATOM 7240   H HE2  . PHE F  1 68 ? -11.590 20.025  -252.961 1.00 0.00 ?  68 PHE F HE2  1  
ATOM 7241   H HZ   . PHE F  1 68 ? -13.581 20.104  -254.419 1.00 0.00 ?  68 PHE F HZ   1  
ATOM 7242   N N    . LYS F  1 69 ? -6.424  16.858  -257.645 1.00 0.00 ?  69 LYS F N    1  
ATOM 7243   C CA   . LYS F  1 69 ? -5.350  16.559  -258.585 1.00 0.00 ?  69 LYS F CA   1  
ATOM 7244   C C    . LYS F  1 69 ? -5.531  15.180  -259.206 1.00 0.00 ?  69 LYS F C    1  
ATOM 7245   O O    . LYS F  1 69 ? -5.115  14.940  -260.340 1.00 0.00 ?  69 LYS F O    1  
ATOM 7246   C CB   . LYS F  1 69 ? -3.990  16.648  -257.891 1.00 0.00 ?  69 LYS F CB   1  
ATOM 7247   C CG   . LYS F  1 69 ? -2.799  16.656  -258.840 1.00 0.00 ?  69 LYS F CG   1  
ATOM 7248   C CD   . LYS F  1 69 ? -2.296  15.246  -259.108 1.00 0.00 ?  69 LYS F CD   1  
ATOM 7249   C CE   . LYS F  1 69 ? -1.098  15.254  -260.047 1.00 0.00 ?  69 LYS F CE   1  
ATOM 7250   N NZ   . LYS F  1 69 ? -0.742  13.884  -260.507 1.00 0.00 1  69 LYS F NZ   1  
ATOM 7251   H H    . LYS F  1 69 ? -6.257  16.744  -256.655 1.00 0.00 ?  69 LYS F H    1  
ATOM 7252   H HA   . LYS F  1 69 ? -5.369  17.275  -259.407 1.00 0.00 ?  69 LYS F HA   1  
ATOM 7253   H HB2  . LYS F  1 69 ? -3.992  17.566  -257.302 1.00 0.00 ?  69 LYS F HB2  1  
ATOM 7254   H HB3  . LYS F  1 69 ? -3.915  15.790  -257.222 1.00 0.00 ?  69 LYS F HB3  1  
ATOM 7255   H HG2  . LYS F  1 69 ? -3.108  17.118  -259.779 1.00 0.00 ?  69 LYS F HG2  1  
ATOM 7256   H HG3  . LYS F  1 69 ? -2.002  17.248  -258.390 1.00 0.00 ?  69 LYS F HG3  1  
ATOM 7257   H HD2  . LYS F  1 69 ? -2.010  14.792  -258.158 1.00 0.00 ?  69 LYS F HD2  1  
ATOM 7258   H HD3  . LYS F  1 69 ? -3.104  14.668  -259.557 1.00 0.00 ?  69 LYS F HD3  1  
ATOM 7259   H HE2  . LYS F  1 69 ? -1.344  15.873  -260.908 1.00 0.00 ?  69 LYS F HE2  1  
ATOM 7260   H HE3  . LYS F  1 69 ? -0.252  15.690  -259.517 1.00 0.00 ?  69 LYS F HE3  1  
ATOM 7261   H HZ1  . LYS F  1 69 ? -1.526  13.480  -260.999 1.00 0.00 ?  69 LYS F HZ1  1  
ATOM 7262   H HZ2  . LYS F  1 69 ? 0.055   13.934  -261.125 1.00 0.00 ?  69 LYS F HZ2  1  
ATOM 7263   H HZ3  . LYS F  1 69 ? -0.514  13.309  -259.708 1.00 0.00 ?  69 LYS F HZ3  1  
ATOM 7264   N N    . ASP F  1 70 ? -6.155  14.276  -258.458 1.00 0.00 ?  70 ASP F N    1  
ATOM 7265   C CA   . ASP F  1 70 ? -6.371  12.912  -258.925 1.00 0.00 ?  70 ASP F CA   1  
ATOM 7266   C C    . ASP F  1 70 ? -7.392  12.871  -260.055 1.00 0.00 ?  70 ASP F C    1  
ATOM 7267   O O    . ASP F  1 70 ? -7.257  12.094  -261.000 1.00 0.00 ?  70 ASP F O    1  
ATOM 7268   C CB   . ASP F  1 70 ? -6.827  12.016  -257.771 1.00 0.00 ?  70 ASP F CB   1  
ATOM 7269   C CG   . ASP F  1 70 ? -5.720  11.630  -256.799 1.00 0.00 ?  70 ASP F CG   1  
ATOM 7270   O OD1  . ASP F  1 70 ? -4.575  11.843  -257.119 1.00 0.00 ?  70 ASP F OD1  1  
ATOM 7271   O OD2  . ASP F  1 70 ? -6.031  11.273  -255.688 1.00 0.00 -1 70 ASP F OD2  1  
ATOM 7272   H H    . ASP F  1 70 ? -6.488  14.541  -257.542 1.00 0.00 ?  70 ASP F H    1  
ATOM 7273   H HA   . ASP F  1 70 ? -5.443  12.510  -259.332 1.00 0.00 ?  70 ASP F HA   1  
ATOM 7274   H HB2  . ASP F  1 70 ? -7.673  12.420  -257.216 1.00 0.00 ?  70 ASP F HB2  1  
ATOM 7275   H HB3  . ASP F  1 70 ? -7.145  11.134  -258.328 1.00 0.00 ?  70 ASP F HB3  1  
ATOM 7276   N N    . ILE F  1 71 ? -8.415  13.713  -259.951 1.00 0.00 ?  71 ILE F N    1  
ATOM 7277   C CA   . ILE F  1 71 ? -9.416  13.836  -261.004 1.00 0.00 ?  71 ILE F CA   1  
ATOM 7278   C C    . ILE F  1 71 ? -8.861  14.591  -262.205 1.00 0.00 ?  71 ILE F C    1  
ATOM 7279   O O    . ILE F  1 71 ? -9.366  14.460  -263.320 1.00 0.00 ?  71 ILE F O    1  
ATOM 7280   C CB   . ILE F  1 71 ? -10.682 14.553  -260.499 1.00 0.00 ?  71 ILE F CB   1  
ATOM 7281   C CG1  . ILE F  1 71 ? -10.342 15.969  -260.028 1.00 0.00 ?  71 ILE F CG1  1  
ATOM 7282   C CG2  . ILE F  1 71 ? -11.332 13.757  -259.378 1.00 0.00 ?  71 ILE F CG2  1  
ATOM 7283   C CD1  . ILE F  1 71 ? -11.544 16.768  -259.579 1.00 0.00 ?  71 ILE F CD1  1  
ATOM 7284   H H    . ILE F  1 71 ? -8.502  14.282  -259.121 1.00 0.00 ?  71 ILE F H    1  
ATOM 7285   H HA   . ILE F  1 71 ? -9.686  12.856  -261.394 1.00 0.00 ?  71 ILE F HA   1  
ATOM 7286   H HB   . ILE F  1 71 ? -11.384 14.657  -261.326 1.00 0.00 ?  71 ILE F HB   1  
ATOM 7287   H HG12 . ILE F  1 71 ? -9.638  15.876  -259.202 1.00 0.00 ?  71 ILE F HG12 1  
ATOM 7288   H HG13 . ILE F  1 71 ? -9.857  16.480  -260.861 1.00 0.00 ?  71 ILE F HG13 1  
ATOM 7289   H HG21 . ILE F  1 71 ? -12.225 14.278  -259.033 1.00 0.00 ?  71 ILE F HG21 1  
ATOM 7290   H HG22 . ILE F  1 71 ? -11.608 12.770  -259.746 1.00 0.00 ?  71 ILE F HG22 1  
ATOM 7291   H HG23 . ILE F  1 71 ? -10.630 13.653  -258.551 1.00 0.00 ?  71 ILE F HG23 1  
ATOM 7292   H HD11 . ILE F  1 71 ? -12.029 16.260  -258.746 1.00 0.00 ?  71 ILE F HD11 1  
ATOM 7293   H HD12 . ILE F  1 71 ? -11.224 17.760  -259.260 1.00 0.00 ?  71 ILE F HD12 1  
ATOM 7294   H HD13 . ILE F  1 71 ? -12.249 16.863  -260.406 1.00 0.00 ?  71 ILE F HD13 1  
ATOM 7295   N N    . ASP F  1 72 ? -7.819  15.381  -261.971 1.00 0.00 ?  72 ASP F N    1  
ATOM 7296   C CA   . ASP F  1 72 ? -7.051  15.978  -263.058 1.00 0.00 ?  72 ASP F CA   1  
ATOM 7297   C C    . ASP F  1 72 ? -6.295  14.916  -263.846 1.00 0.00 ?  72 ASP F C    1  
ATOM 7298   O O    . ASP F  1 72 ? -6.323  14.906  -265.077 1.00 0.00 ?  72 ASP F O    1  
ATOM 7299   C CB   . ASP F  1 72 ? -6.074  17.023  -262.513 1.00 0.00 ?  72 ASP F CB   1  
ATOM 7300   C CG   . ASP F  1 72 ? -6.735  18.301  -262.013 1.00 0.00 ?  72 ASP F CG   1  
ATOM 7301   O OD1  . ASP F  1 72 ? -7.876  18.523  -262.339 1.00 0.00 ?  72 ASP F OD1  1  
ATOM 7302   O OD2  . ASP F  1 72 ? -6.152  18.962  -261.187 1.00 0.00 -1 72 ASP F OD2  1  
ATOM 7303   H H    . ASP F  1 72 ? -7.551  15.573  -261.017 1.00 0.00 ?  72 ASP F H    1  
ATOM 7304   H HA   . ASP F  1 72 ? -7.726  16.466  -263.762 1.00 0.00 ?  72 ASP F HA   1  
ATOM 7305   H HB2  . ASP F  1 72 ? -5.407  16.634  -261.744 1.00 0.00 ?  72 ASP F HB2  1  
ATOM 7306   H HB3  . ASP F  1 72 ? -5.503  17.240  -263.416 1.00 0.00 ?  72 ASP F HB3  1  
ATOM 7307   N N    . ALA F  1 73 ? -5.620  14.023  -263.130 1.00 0.00 ?  73 ALA F N    1  
ATOM 7308   C CA   . ALA F  1 73 ? -4.924  12.906  -263.758 1.00 0.00 ?  73 ALA F CA   1  
ATOM 7309   C C    . ALA F  1 73 ? -5.896  12.000  -264.503 1.00 0.00 ?  73 ALA F C    1  
ATOM 7310   O O    . ALA F  1 73 ? -5.590  11.503  -265.586 1.00 0.00 ?  73 ALA F O    1  
ATOM 7311   C CB   . ALA F  1 73 ? -4.148  12.113  -262.716 1.00 0.00 ?  73 ALA F CB   1  
ATOM 7312   H H    . ALA F  1 73 ? -5.589  14.121  -262.126 1.00 0.00 ?  73 ALA F H    1  
ATOM 7313   H HA   . ALA F  1 73 ? -4.220  13.300  -264.491 1.00 0.00 ?  73 ALA F HA   1  
ATOM 7314   H HB1  . ALA F  1 73 ? -4.836  11.725  -261.967 1.00 0.00 ?  73 ALA F HB1  1  
ATOM 7315   H HB2  . ALA F  1 73 ? -3.634  11.283  -263.201 1.00 0.00 ?  73 ALA F HB2  1  
ATOM 7316   H HB3  . ALA F  1 73 ? -3.416  12.762  -262.236 1.00 0.00 ?  73 ALA F HB3  1  
ATOM 7317   N N    . ALA F  1 74 ? -7.069  11.790  -263.916 1.00 0.00 ?  74 ALA F N    1  
ATOM 7318   C CA   . ALA F  1 74 ? -8.089  10.944  -264.524 1.00 0.00 ?  74 ALA F CA   1  
ATOM 7319   C C    . ALA F  1 74 ? -8.496  11.470  -265.895 1.00 0.00 ?  74 ALA F C    1  
ATOM 7320   O O    . ALA F  1 74 ? -8.688  10.698  -266.835 1.00 0.00 ?  74 ALA F O    1  
ATOM 7321   C CB   . ALA F  1 74 ? -9.303  10.839  -263.612 1.00 0.00 ?  74 ALA F CB   1  
ATOM 7322   H H    . ALA F  1 74 ? -7.260  12.227  -263.026 1.00 0.00 ?  74 ALA F H    1  
ATOM 7323   H HA   . ALA F  1 74 ? -7.675  9.946   -264.669 1.00 0.00 ?  74 ALA F HA   1  
ATOM 7324   H HB1  . ALA F  1 74 ? -9.720  11.831  -263.445 1.00 0.00 ?  74 ALA F HB1  1  
ATOM 7325   H HB2  . ALA F  1 74 ? -10.055 10.204  -264.081 1.00 0.00 ?  74 ALA F HB2  1  
ATOM 7326   H HB3  . ALA F  1 74 ? -9.005  10.404  -262.658 1.00 0.00 ?  74 ALA F HB3  1  
ATOM 7327   N N    . ILE F  1 75 ? -8.624  12.788  -266.003 1.00 0.00 ?  75 ILE F N    1  
ATOM 7328   C CA   . ILE F  1 75 ? -9.049  13.417  -267.248 1.00 0.00 ?  75 ILE F CA   1  
ATOM 7329   C C    . ILE F  1 75 ? -7.962  13.321  -268.312 1.00 0.00 ?  75 ILE F C    1  
ATOM 7330   O O    . ILE F  1 75 ? -8.226  12.929  -269.448 1.00 0.00 ?  75 ILE F O    1  
ATOM 7331   C CB   . ILE F  1 75 ? -9.418  14.896  -267.036 1.00 0.00 ?  75 ILE F CB   1  
ATOM 7332   C CG1  . ILE F  1 75 ? -10.667 15.014  -266.158 1.00 0.00 ?  75 ILE F CG1  1  
ATOM 7333   C CG2  . ILE F  1 75 ? -9.637  15.587  -268.374 1.00 0.00 ?  75 ILE F CG2  1  
ATOM 7334   C CD1  . ILE F  1 75 ? -10.923 16.413  -265.646 1.00 0.00 ?  75 ILE F CD1  1  
ATOM 7335   H H    . ILE F  1 75 ? -8.423  13.369  -265.202 1.00 0.00 ?  75 ILE F H    1  
ATOM 7336   H HA   . ILE F  1 75 ? -9.900  12.888  -267.675 1.00 0.00 ?  75 ILE F HA   1  
ATOM 7337   H HB   . ILE F  1 75 ? -8.609  15.391  -266.500 1.00 0.00 ?  75 ILE F HB   1  
ATOM 7338   H HG12 . ILE F  1 75 ? -11.516 14.685  -266.756 1.00 0.00 ?  75 ILE F HG12 1  
ATOM 7339   H HG13 . ILE F  1 75 ? -10.534 14.338  -265.314 1.00 0.00 ?  75 ILE F HG13 1  
ATOM 7340   H HG21 . ILE F  1 75 ? -9.898  16.631  -268.206 1.00 0.00 ?  75 ILE F HG21 1  
ATOM 7341   H HG22 . ILE F  1 75 ? -8.724  15.532  -268.965 1.00 0.00 ?  75 ILE F HG22 1  
ATOM 7342   H HG23 . ILE F  1 75 ? -10.447 15.092  -268.911 1.00 0.00 ?  75 ILE F HG23 1  
ATOM 7343   H HD11 . ILE F  1 75 ? -11.057 17.091  -266.488 1.00 0.00 ?  75 ILE F HD11 1  
ATOM 7344   H HD12 . ILE F  1 75 ? -11.824 16.418  -265.032 1.00 0.00 ?  75 ILE F HD12 1  
ATOM 7345   H HD13 . ILE F  1 75 ? -10.074 16.744  -265.047 1.00 0.00 ?  75 ILE F HD13 1  
ATOM 7346   N N    . ILE F  1 76 ? -6.740  13.682  -267.936 1.00 0.00 ?  76 ILE F N    1  
ATOM 7347   C CA   . ILE F  1 76 ? -5.628  13.720  -268.878 1.00 0.00 ?  76 ILE F CA   1  
ATOM 7348   C C    . ILE F  1 76 ? -5.138  12.316  -269.207 1.00 0.00 ?  76 ILE F C    1  
ATOM 7349   O O    . ILE F  1 76 ? -4.392  12.117  -270.167 1.00 0.00 ?  76 ILE F O    1  
ATOM 7350   C CB   . ILE F  1 76 ? -4.452  14.550  -268.332 1.00 0.00 ?  76 ILE F CB   1  
ATOM 7351   C CG1  . ILE F  1 76 ? -3.862  13.884  -267.087 1.00 0.00 ?  76 ILE F CG1  1  
ATOM 7352   C CG2  . ILE F  1 76 ? -4.903  15.968  -268.019 1.00 0.00 ?  76 ILE F CG2  1  
ATOM 7353   C CD1  . ILE F  1 76 ? -2.599  14.544  -266.582 1.00 0.00 ?  76 ILE F CD1  1  
ATOM 7354   H H    . ILE F  1 76 ? -6.577  13.937  -266.972 1.00 0.00 ?  76 ILE F H    1  
ATOM 7355   H HA   . ILE F  1 76 ? -5.949  14.131  -269.834 1.00 0.00 ?  76 ILE F HA   1  
ATOM 7356   H HB   . ILE F  1 76 ? -3.659  14.577  -269.079 1.00 0.00 ?  76 ILE F HB   1  
ATOM 7357   H HG12 . ILE F  1 76 ? -4.624  13.916  -266.309 1.00 0.00 ?  76 ILE F HG12 1  
ATOM 7358   H HG13 . ILE F  1 76 ? -3.651  12.846  -267.344 1.00 0.00 ?  76 ILE F HG13 1  
ATOM 7359   H HG21 . ILE F  1 76 ? -4.060  16.541  -267.633 1.00 0.00 ?  76 ILE F HG21 1  
ATOM 7360   H HG22 . ILE F  1 76 ? -5.277  16.440  -268.926 1.00 0.00 ?  76 ILE F HG22 1  
ATOM 7361   H HG23 . ILE F  1 76 ? -5.695  15.942  -267.270 1.00 0.00 ?  76 ILE F HG23 1  
ATOM 7362   H HD11 . ILE F  1 76 ? -2.807  15.581  -266.324 1.00 0.00 ?  76 ILE F HD11 1  
ATOM 7363   H HD12 . ILE F  1 76 ? -2.240  14.016  -265.698 1.00 0.00 ?  76 ILE F HD12 1  
ATOM 7364   H HD13 . ILE F  1 76 ? -1.834  14.510  -267.359 1.00 0.00 ?  76 ILE F HD13 1  
ATOM 7365   N N    . GLN F  1 77 ? -5.560  11.344  -268.406 1.00 0.00 ?  77 GLN F N    1  
ATOM 7366   C CA   . GLN F  1 77 ? -5.370  9.938   -268.741 1.00 0.00 ?  77 GLN F CA   1  
ATOM 7367   C C    . GLN F  1 77 ? -6.114  9.570   -270.019 1.00 0.00 ?  77 GLN F C    1  
ATOM 7368   O O    . GLN F  1 77 ? -5.702  8.670   -270.751 1.00 0.00 ?  77 GLN F O    1  
ATOM 7369   C CB   . GLN F  1 77 ? -5.845  9.044   -267.592 1.00 0.00 ?  77 GLN F CB   1  
ATOM 7370   C CG   . GLN F  1 77 ? -5.549  7.567   -267.789 1.00 0.00 ?  77 GLN F CG   1  
ATOM 7371   C CD   . GLN F  1 77 ? -4.061  7.280   -267.867 1.00 0.00 ?  77 GLN F CD   1  
ATOM 7372   O OE1  . GLN F  1 77 ? -3.273  7.793   -267.069 1.00 0.00 ?  77 GLN F OE1  1  
ATOM 7373   N NE2  . GLN F  1 77 ? -3.668  6.460   -268.835 1.00 0.00 ?  77 GLN F NE2  1  
ATOM 7374   H H    . GLN F  1 77 ? -6.025  11.585  -267.542 1.00 0.00 ?  77 GLN F H    1  
ATOM 7375   H HA   . GLN F  1 77 ? -4.314  9.747   -268.931 1.00 0.00 ?  77 GLN F HA   1  
ATOM 7376   H HB2  . GLN F  1 77 ? -5.350  9.402   -266.689 1.00 0.00 ?  77 GLN F HB2  1  
ATOM 7377   H HB3  . GLN F  1 77 ? -6.920  9.195   -267.500 1.00 0.00 ?  77 GLN F HB3  1  
ATOM 7378   H HG2  . GLN F  1 77 ? -6.008  6.787   -267.182 1.00 0.00 ?  77 GLN F HG2  1  
ATOM 7379   H HG3  . GLN F  1 77 ? -5.961  7.530   -268.798 1.00 0.00 ?  77 GLN F HG3  1  
ATOM 7380   H HE21 . GLN F  1 77 ? -4.341  6.068   -269.463 1.00 0.00 ?  77 GLN F HE21 1  
ATOM 7381   H HE22 . GLN F  1 77 ? -2.698  6.234   -268.937 1.00 0.00 ?  77 GLN F HE22 1  
ATOM 7382   N N    . ASN F  1 78 ? -7.211  10.272  -270.281 1.00 0.00 ?  78 ASN F N    1  
ATOM 7383   C CA   . ASN F  1 78 ? -7.980  10.064  -271.502 1.00 0.00 ?  78 ASN F CA   1  
ATOM 7384   C C    . ASN F  1 78 ? -7.733  11.181  -272.507 1.00 0.00 ?  78 ASN F C    1  
ATOM 7385   O O    . ASN F  1 78 ? -8.596  11.494  -273.327 1.00 0.00 ?  78 ASN F O    1  
ATOM 7386   C CB   . ASN F  1 78 ? -9.464  9.940   -271.209 1.00 0.00 ?  78 ASN F CB   1  
ATOM 7387   C CG   . ASN F  1 78 ? -9.822  8.722   -270.403 1.00 0.00 ?  78 ASN F CG   1  
ATOM 7388   O OD1  . ASN F  1 78 ? -9.177  7.673   -270.506 1.00 0.00 ?  78 ASN F OD1  1  
ATOM 7389   N ND2  . ASN F  1 78 ? -10.896 8.831   -269.663 1.00 0.00 ?  78 ASN F ND2  1  
ATOM 7390   H H    . ASN F  1 78 ? -7.520  10.969  -269.618 1.00 0.00 ?  78 ASN F H    1  
ATOM 7391   H HA   . ASN F  1 78 ? -7.663  9.138   -271.985 1.00 0.00 ?  78 ASN F HA   1  
ATOM 7392   H HB2  . ASN F  1 78 ? -10.033 10.794  -270.838 1.00 0.00 ?  78 ASN F HB2  1  
ATOM 7393   H HB3  . ASN F  1 78 ? -9.720  9.758   -272.253 1.00 0.00 ?  78 ASN F HB3  1  
ATOM 7394   H HD21 . ASN F  1 78 ? -11.418 9.683   -269.660 1.00 0.00 ?  78 ASN F HD21 1  
ATOM 7395   H HD22 . ASN F  1 78 ? -11.194 8.060   -269.100 1.00 0.00 ?  78 ASN F HD22 1  
ATOM 7396   N N    . PHE F  1 79 ? -6.550  11.782  -272.437 1.00 0.00 ?  79 PHE F N    1  
ATOM 7397   C CA   . PHE F  1 79 ? -6.218  12.922  -273.284 1.00 0.00 ?  79 PHE F CA   1  
ATOM 7398   C C    . PHE F  1 79 ? -5.835  12.472  -274.688 1.00 0.00 ?  79 PHE F C    1  
ATOM 7399   O O    . PHE F  1 79 ? -4.671  12.554  -275.080 1.00 0.00 ?  79 PHE F O    1  
ATOM 7400   C CB   . PHE F  1 79 ? -5.081  13.735  -272.663 1.00 0.00 ?  79 PHE F CB   1  
ATOM 7401   C CG   . PHE F  1 79 ? -4.965  15.129  -273.211 1.00 0.00 ?  79 PHE F CG   1  
ATOM 7402   C CD1  . PHE F  1 79 ? -5.846  16.123  -272.811 1.00 0.00 ?  79 PHE F CD1  1  
ATOM 7403   C CD2  . PHE F  1 79 ? -3.974  15.450  -274.127 1.00 0.00 ?  79 PHE F CD2  1  
ATOM 7404   C CE1  . PHE F  1 79 ? -5.740  17.406  -273.315 1.00 0.00 ?  79 PHE F CE1  1  
ATOM 7405   C CE2  . PHE F  1 79 ? -3.865  16.732  -274.630 1.00 0.00 ?  79 PHE F CE2  1  
ATOM 7406   C CZ   . PHE F  1 79 ? -4.749  17.710  -274.224 1.00 0.00 ?  79 PHE F CZ   1  
ATOM 7407   H H    . PHE F  1 79 ? -5.862  11.440  -271.782 1.00 0.00 ?  79 PHE F H    1  
ATOM 7408   H HA   . PHE F  1 79 ? -7.090  13.568  -273.392 1.00 0.00 ?  79 PHE F HA   1  
ATOM 7409   H HB2  . PHE F  1 79 ? -5.233  13.834  -271.589 1.00 0.00 ?  79 PHE F HB2  1  
ATOM 7410   H HB3  . PHE F  1 79 ? -4.126  13.247  -272.850 1.00 0.00 ?  79 PHE F HB3  1  
ATOM 7411   H HD1  . PHE F  1 79 ? -6.629  15.882  -272.091 1.00 0.00 ?  79 PHE F HD1  1  
ATOM 7412   H HD2  . PHE F  1 79 ? -3.276  14.677  -274.448 1.00 0.00 ?  79 PHE F HD2  1  
ATOM 7413   H HE1  . PHE F  1 79 ? -6.439  18.176  -272.992 1.00 0.00 ?  79 PHE F HE1  1  
ATOM 7414   H HE2  . PHE F  1 79 ? -3.081  16.971  -275.349 1.00 0.00 ?  79 PHE F HE2  1  
ATOM 7415   H HZ   . PHE F  1 79 ? -4.665  18.721  -274.621 1.00 0.00 ?  79 PHE F HZ   1  
ATOM 7416   N N    . ARG F  1 80 ? -6.821  11.997  -275.441 1.00 0.00 ?  80 ARG F N    1  
ATOM 7417   C CA   . ARG F  1 80 ? -6.576  11.461  -276.775 1.00 0.00 ?  80 ARG F CA   1  
ATOM 7418   C C    . ARG F  1 80 ? -6.151  12.560  -277.741 1.00 0.00 ?  80 ARG F C    1  
ATOM 7419   O O    . ARG F  1 80 ? -5.017  12.951  -277.743 1.00 0.00 ?  80 ARG F O    1  
ATOM 7420   C CB   . ARG F  1 80 ? -7.769  10.682  -277.309 1.00 0.00 ?  80 ARG F CB   1  
ATOM 7421   C CG   . ARG F  1 80 ? -8.168  9.473   -276.477 1.00 0.00 ?  80 ARG F CG   1  
ATOM 7422   C CD   . ARG F  1 80 ? -7.111  8.436   -276.358 1.00 0.00 ?  80 ARG F CD   1  
ATOM 7423   N NE   . ARG F  1 80 ? -6.797  7.751   -277.601 1.00 0.00 ?  80 ARG F NE   1  
ATOM 7424   C CZ   . ARG F  1 80 ? -5.741  6.932   -277.778 1.00 0.00 ?  80 ARG F CZ   1  
ATOM 7425   N NH1  . ARG F  1 80 ? -4.877  6.723   -276.810 1.00 0.00 1  80 ARG F NH1  1  
ATOM 7426   N NH2  . ARG F  1 80 ? -5.584  6.362   -278.960 1.00 0.00 ?  80 ARG F NH2  1  
ATOM 7427   O OXT  . ARG F  1 80 ? -6.882  13.487  -277.955 1.00 0.00 -1 80 ARG F OXT  1  
ATOM 7428   H H    . ARG F  1 80 ? -7.764  12.007  -275.081 1.00 0.00 ?  80 ARG F H    1  
ATOM 7429   H HA   . ARG F  1 80 ? -5.755  10.744  -276.740 1.00 0.00 ?  80 ARG F HA   1  
ATOM 7430   H HB2  . ARG F  1 80 ? -8.607  11.377  -277.357 1.00 0.00 ?  80 ARG F HB2  1  
ATOM 7431   H HB3  . ARG F  1 80 ? -7.510  10.354  -278.315 1.00 0.00 ?  80 ARG F HB3  1  
ATOM 7432   H HG2  . ARG F  1 80 ? -8.420  9.812   -275.472 1.00 0.00 ?  80 ARG F HG2  1  
ATOM 7433   H HG3  . ARG F  1 80 ? -9.043  9.011   -276.935 1.00 0.00 ?  80 ARG F HG3  1  
ATOM 7434   H HD2  . ARG F  1 80 ? -6.193  8.905   -276.003 1.00 0.00 ?  80 ARG F HD2  1  
ATOM 7435   H HD3  . ARG F  1 80 ? -7.434  7.682   -275.641 1.00 0.00 ?  80 ARG F HD3  1  
ATOM 7436   H HE   . ARG F  1 80 ? -7.283  7.769   -278.488 1.00 0.00 ?  80 ARG F HE   1  
ATOM 7437   H HH11 . ARG F  1 80 ? -5.001  7.181   -275.918 1.00 0.00 ?  80 ARG F HH11 1  
ATOM 7438   H HH12 . ARG F  1 80 ? -4.092  6.106   -276.963 1.00 0.00 ?  80 ARG F HH12 1  
ATOM 7439   H HH21 . ARG F  1 80 ? -6.249  6.548   -279.699 1.00 0.00 ?  80 ARG F HH21 1  
ATOM 7440   H HH22 . ARG F  1 80 ? -4.802  5.745   -279.120 1.00 0.00 ?  80 ARG F HH22 1  
ATOM 7441   N N    . MET G  1 1  ? -42.170 19.126  -253.619 1.00 0.00 ?  1  MET G N    1  
ATOM 7442   C CA   . MET G  1 1  ? -42.219 18.154  -254.705 1.00 0.00 ?  1  MET G CA   1  
ATOM 7443   C C    . MET G  1 1  ? -40.820 17.822  -255.210 1.00 0.00 ?  1  MET G C    1  
ATOM 7444   O O    . MET G  1 1  ? -40.567 16.713  -255.681 1.00 0.00 ?  1  MET G O    1  
ATOM 7445   C CB   . MET G  1 1  ? -43.081 18.684  -255.849 1.00 0.00 ?  1  MET G CB   1  
ATOM 7446   C CG   . MET G  1 1  ? -44.545 18.897  -255.488 1.00 0.00 ?  1  MET G CG   1  
ATOM 7447   S SD   . MET G  1 1  ? -45.340 17.391  -254.893 1.00 0.00 ?  1  MET G SD   1  
ATOM 7448   C CE   . MET G  1 1  ? -45.390 16.419  -256.396 1.00 0.00 ?  1  MET G CE   1  
ATOM 7449   H H1   . MET G  1 1  ? -42.633 20.007  -253.716 1.00 0.00 ?  1  MET G H1   1  
ATOM 7450   H H2   . MET G  1 1  ? -42.539 18.890  -252.720 1.00 0.00 ?  1  MET G H2   1  
ATOM 7451   H H3   . MET G  1 1  ? -41.290 19.480  -253.304 1.00 0.00 ?  1  MET G H3   1  
ATOM 7452   H HA   . MET G  1 1  ? -42.650 17.219  -254.348 1.00 0.00 ?  1  MET G HA   1  
ATOM 7453   H HB2  . MET G  1 1  ? -42.643 19.629  -256.165 1.00 0.00 ?  1  MET G HB2  1  
ATOM 7454   H HB3  . MET G  1 1  ? -43.010 17.960  -256.662 1.00 0.00 ?  1  MET G HB3  1  
ATOM 7455   H HG2  . MET G  1 1  ? -44.595 19.659  -254.711 1.00 0.00 ?  1  MET G HG2  1  
ATOM 7456   H HG3  . MET G  1 1  ? -45.066 19.249  -256.378 1.00 0.00 ?  1  MET G HG3  1  
ATOM 7457   H HE1  . MET G  1 1  ? -44.374 16.260  -256.760 1.00 0.00 ?  1  MET G HE1  1  
ATOM 7458   H HE2  . MET G  1 1  ? -45.856 15.455  -256.191 1.00 0.00 ?  1  MET G HE2  1  
ATOM 7459   H HE3  . MET G  1 1  ? -45.968 16.949  -257.153 1.00 0.00 ?  1  MET G HE3  1  
ATOM 7460   N N    . ALA G  1 2  ? -39.915 18.789  -255.108 1.00 0.00 ?  2  ALA G N    1  
ATOM 7461   C CA   . ALA G  1 2  ? -38.543 18.605  -255.567 1.00 0.00 ?  2  ALA G CA   1  
ATOM 7462   C C    . ALA G  1 2  ? -37.752 17.731  -254.602 1.00 0.00 ?  2  ALA G C    1  
ATOM 7463   O O    . ALA G  1 2  ? -37.955 17.787  -253.389 1.00 0.00 ?  2  ALA G O    1  
ATOM 7464   C CB   . ALA G  1 2  ? -37.860 19.953  -255.748 1.00 0.00 ?  2  ALA G CB   1  
ATOM 7465   H H    . ALA G  1 2  ? -40.183 19.674  -254.702 1.00 0.00 ?  2  ALA G H    1  
ATOM 7466   H HA   . ALA G  1 2  ? -38.562 18.093  -256.529 1.00 0.00 ?  2  ALA G HA   1  
ATOM 7467   H HB1  . ALA G  1 2  ? -37.847 20.484  -254.797 1.00 0.00 ?  2  ALA G HB1  1  
ATOM 7468   H HB2  . ALA G  1 2  ? -36.837 19.798  -256.091 1.00 0.00 ?  2  ALA G HB2  1  
ATOM 7469   H HB3  . ALA G  1 2  ? -38.405 20.541  -256.486 1.00 0.00 ?  2  ALA G HB3  1  
ATOM 7470   N N    . THR G  1 3  ? -36.849 16.923  -255.148 1.00 0.00 ?  3  THR G N    1  
ATOM 7471   C CA   . THR G  1 3  ? -36.016 16.044  -254.336 1.00 0.00 ?  3  THR G CA   1  
ATOM 7472   C C    . THR G  1 3  ? -34.545 16.186  -254.704 1.00 0.00 ?  3  THR G C    1  
ATOM 7473   O O    . THR G  1 3  ? -34.164 16.001  -255.860 1.00 0.00 ?  3  THR G O    1  
ATOM 7474   C CB   . THR G  1 3  ? -36.434 14.570  -254.488 1.00 0.00 ?  3  THR G CB   1  
ATOM 7475   O OG1  . THR G  1 3  ? -37.805 14.416  -254.100 1.00 0.00 ?  3  THR G OG1  1  
ATOM 7476   C CG2  . THR G  1 3  ? -35.561 13.676  -253.620 1.00 0.00 ?  3  THR G CG2  1  
ATOM 7477   H H    . THR G  1 3  ? -36.738 16.917  -256.152 1.00 0.00 ?  3  THR G H    1  
ATOM 7478   H HA   . THR G  1 3  ? -36.100 16.324  -253.286 1.00 0.00 ?  3  THR G HA   1  
ATOM 7479   H HB   . THR G  1 3  ? -36.326 14.277  -255.533 1.00 0.00 ?  3  THR G HB   1  
ATOM 7480   H HG1  . THR G  1 3  ? -38.063 13.496  -254.196 1.00 0.00 ?  3  THR G HG1  1  
ATOM 7481   H HG21 . THR G  1 3  ? -35.871 12.639  -253.742 1.00 0.00 ?  3  THR G HG21 1  
ATOM 7482   H HG22 . THR G  1 3  ? -34.519 13.783  -253.921 1.00 0.00 ?  3  THR G HG22 1  
ATOM 7483   H HG23 . THR G  1 3  ? -35.669 13.968  -252.576 1.00 0.00 ?  3  THR G HG23 1  
ATOM 7484   N N    . PRO G  1 4  ? -33.722 16.514  -253.714 1.00 0.00 ?  4  PRO G N    1  
ATOM 7485   C CA   . PRO G  1 4  ? -32.284 16.641  -253.923 1.00 0.00 ?  4  PRO G CA   1  
ATOM 7486   C C    . PRO G  1 4  ? -31.701 15.371  -254.529 1.00 0.00 ?  4  PRO G C    1  
ATOM 7487   O O    . PRO G  1 4  ? -32.123 14.263  -254.196 1.00 0.00 ?  4  PRO G O    1  
ATOM 7488   C CB   . PRO G  1 4  ? -31.726 16.923  -252.525 1.00 0.00 ?  4  PRO G CB   1  
ATOM 7489   C CG   . PRO G  1 4  ? -32.866 17.537  -251.786 1.00 0.00 ?  4  PRO G CG   1  
ATOM 7490   C CD   . PRO G  1 4  ? -34.097 16.843  -252.304 1.00 0.00 ?  4  PRO G CD   1  
ATOM 7491   H HA   . PRO G  1 4  ? -32.027 17.439  -254.636 1.00 0.00 ?  4  PRO G HA   1  
ATOM 7492   H HB2  . PRO G  1 4  ? -31.385 15.999  -252.034 1.00 0.00 ?  4  PRO G HB2  1  
ATOM 7493   H HB3  . PRO G  1 4  ? -30.863 17.604  -252.565 1.00 0.00 ?  4  PRO G HB3  1  
ATOM 7494   H HG2  . PRO G  1 4  ? -32.759 17.396  -250.701 1.00 0.00 ?  4  PRO G HG2  1  
ATOM 7495   H HG3  . PRO G  1 4  ? -32.918 18.621  -251.966 1.00 0.00 ?  4  PRO G HG3  1  
ATOM 7496   H HD2  . PRO G  1 4  ? -34.335 15.935  -251.731 1.00 0.00 ?  4  PRO G HD2  1  
ATOM 7497   H HD3  . PRO G  1 4  ? -34.986 17.489  -252.265 1.00 0.00 ?  4  PRO G HD3  1  
ATOM 7498   N N    . TRP G  1 5  ? -30.729 15.538  -255.419 1.00 0.00 ?  5  TRP G N    1  
ATOM 7499   C CA   . TRP G  1 5  ? -30.093 14.405  -256.080 1.00 0.00 ?  5  TRP G CA   1  
ATOM 7500   C C    . TRP G  1 5  ? -29.333 13.540  -255.083 1.00 0.00 ?  5  TRP G C    1  
ATOM 7501   O O    . TRP G  1 5  ? -28.688 14.053  -254.168 1.00 0.00 ?  5  TRP G O    1  
ATOM 7502   C CB   . TRP G  1 5  ? -29.147 14.891  -257.180 1.00 0.00 ?  5  TRP G CB   1  
ATOM 7503   C CG   . TRP G  1 5  ? -28.393 13.785  -257.853 1.00 0.00 ?  5  TRP G CG   1  
ATOM 7504   C CD1  . TRP G  1 5  ? -28.784 13.085  -258.955 1.00 0.00 ?  5  TRP G CD1  1  
ATOM 7505   C CD2  . TRP G  1 5  ? -27.119 13.254  -257.470 1.00 0.00 ?  5  TRP G CD2  1  
ATOM 7506   N NE1  . TRP G  1 5  ? -27.834 12.148  -259.282 1.00 0.00 ?  5  TRP G NE1  1  
ATOM 7507   C CE2  . TRP G  1 5  ? -26.800 12.234  -258.384 1.00 0.00 ?  5  TRP G CE2  1  
ATOM 7508   C CE3  . TRP G  1 5  ? -26.216 13.544  -256.440 1.00 0.00 ?  5  TRP G CE3  1  
ATOM 7509   C CZ2  . TRP G  1 5  ? -25.625 11.503  -258.302 1.00 0.00 ?  5  TRP G CZ2  1  
ATOM 7510   C CZ3  . TRP G  1 5  ? -25.037 12.812  -256.359 1.00 0.00 ?  5  TRP G CZ3  1  
ATOM 7511   C CH2  . TRP G  1 5  ? -24.750 11.821  -257.264 1.00 0.00 ?  5  TRP G CH2  1  
ATOM 7512   H H    . TRP G  1 5  ? -30.423 16.474  -255.644 1.00 0.00 ?  5  TRP G H    1  
ATOM 7513   H HA   . TRP G  1 5  ? -30.852 13.766  -256.532 1.00 0.00 ?  5  TRP G HA   1  
ATOM 7514   H HB2  . TRP G  1 5  ? -29.709 15.406  -257.960 1.00 0.00 ?  5  TRP G HB2  1  
ATOM 7515   H HB3  . TRP G  1 5  ? -28.402 15.568  -256.762 1.00 0.00 ?  5  TRP G HB3  1  
ATOM 7516   H HD1  . TRP G  1 5  ? -29.743 13.353  -259.395 1.00 0.00 ?  5  TRP G HD1  1  
ATOM 7517   H HE1  . TRP G  1 5  ? -27.887 11.502  -260.055 1.00 0.00 ?  5  TRP G HE1  1  
ATOM 7518   H HE3  . TRP G  1 5  ? -26.392 14.321  -255.697 1.00 0.00 ?  5  TRP G HE3  1  
ATOM 7519   H HZ2  . TRP G  1 5  ? -25.437 10.725  -259.042 1.00 0.00 ?  5  TRP G HZ2  1  
ATOM 7520   H HZ3  . TRP G  1 5  ? -24.343 13.047  -255.551 1.00 0.00 ?  5  TRP G HZ3  1  
ATOM 7521   H HH2  . TRP G  1 5  ? -23.814 11.271  -257.165 1.00 0.00 ?  5  TRP G HH2  1  
ATOM 7522   N N    . SER G  1 6  ? -29.413 12.227  -255.264 1.00 0.00 ?  6  SER G N    1  
ATOM 7523   C CA   . SER G  1 6  ? -28.651 11.292  -254.445 1.00 0.00 ?  6  SER G CA   1  
ATOM 7524   C C    . SER G  1 6  ? -28.125 10.131  -255.278 1.00 0.00 ?  6  SER G C    1  
ATOM 7525   O O    . SER G  1 6  ? -28.888 9.449   -255.962 1.00 0.00 ?  6  SER G O    1  
ATOM 7526   C CB   . SER G  1 6  ? -29.509 10.778  -253.305 1.00 0.00 ?  6  SER G CB   1  
ATOM 7527   O OG   . SER G  1 6  ? -28.840 9.819   -252.533 1.00 0.00 ?  6  SER G OG   1  
ATOM 7528   H H    . SER G  1 6  ? -30.017 11.866  -255.989 1.00 0.00 ?  6  SER G H    1  
ATOM 7529   H HA   . SER G  1 6  ? -27.829 11.762  -253.902 1.00 0.00 ?  6  SER G HA   1  
ATOM 7530   H HB2  . SER G  1 6  ? -29.781 11.619  -252.667 1.00 0.00 ?  6  SER G HB2  1  
ATOM 7531   H HB3  . SER G  1 6  ? -30.411 10.332  -253.720 1.00 0.00 ?  6  SER G HB3  1  
ATOM 7532   H HG   . SER G  1 6  ? -29.224 8.954   -252.695 1.00 0.00 ?  6  SER G HG   1  
ATOM 7533   N N    . GLY G  1 7  ? -26.816 9.911   -255.217 1.00 0.00 ?  7  GLY G N    1  
ATOM 7534   C CA   . GLY G  1 7  ? -26.186 8.825   -255.959 1.00 0.00 ?  7  GLY G CA   1  
ATOM 7535   C C    . GLY G  1 7  ? -26.339 7.497   -255.229 1.00 0.00 ?  7  GLY G C    1  
ATOM 7536   O O    . GLY G  1 7  ? -26.971 7.426   -254.175 1.00 0.00 ?  7  GLY G O    1  
ATOM 7537   H H    . GLY G  1 7  ? -26.242 10.511  -254.641 1.00 0.00 ?  7  GLY G H    1  
ATOM 7538   H HA2  . GLY G  1 7  ? -26.654 8.747   -256.941 1.00 0.00 ?  7  GLY G HA2  1  
ATOM 7539   H HA3  . GLY G  1 7  ? -25.126 9.044   -256.079 1.00 0.00 ?  7  GLY G HA3  1  
ATOM 7540   N N    . TYR G  1 8  ? -25.757 6.446   -255.796 1.00 0.00 ?  8  TYR G N    1  
ATOM 7541   C CA   . TYR G  1 8  ? -25.816 5.120   -255.192 1.00 0.00 ?  8  TYR G CA   1  
ATOM 7542   C C    . TYR G  1 8  ? -25.088 5.092   -253.854 1.00 0.00 ?  8  TYR G C    1  
ATOM 7543   O O    . TYR G  1 8  ? -25.620 4.602   -252.857 1.00 0.00 ?  8  TYR G O    1  
ATOM 7544   C CB   . TYR G  1 8  ? -25.217 4.075   -256.136 1.00 0.00 ?  8  TYR G CB   1  
ATOM 7545   C CG   . TYR G  1 8  ? -25.207 2.672   -255.571 1.00 0.00 ?  8  TYR G CG   1  
ATOM 7546   C CD1  . TYR G  1 8  ? -26.293 1.826   -255.741 1.00 0.00 ?  8  TYR G CD1  1  
ATOM 7547   C CD2  . TYR G  1 8  ? -24.109 2.197   -254.869 1.00 0.00 ?  8  TYR G CD2  1  
ATOM 7548   C CE1  . TYR G  1 8  ? -26.289 0.544   -255.226 1.00 0.00 ?  8  TYR G CE1  1  
ATOM 7549   C CE2  . TYR G  1 8  ? -24.093 0.916   -254.350 1.00 0.00 ?  8  TYR G CE2  1  
ATOM 7550   C CZ   . TYR G  1 8  ? -25.185 0.093   -254.531 1.00 0.00 ?  8  TYR G CZ   1  
ATOM 7551   O OH   . TYR G  1 8  ? -25.174 -1.183  -254.017 1.00 0.00 ?  8  TYR G OH   1  
ATOM 7552   H H    . TYR G  1 8  ? -25.262 6.568   -256.667 1.00 0.00 ?  8  TYR G H    1  
ATOM 7553   H HA   . TYR G  1 8  ? -26.852 4.851   -254.988 1.00 0.00 ?  8  TYR G HA   1  
ATOM 7554   H HB2  . TYR G  1 8  ? -25.809 4.092   -257.053 1.00 0.00 ?  8  TYR G HB2  1  
ATOM 7555   H HB3  . TYR G  1 8  ? -24.197 4.386   -256.356 1.00 0.00 ?  8  TYR G HB3  1  
ATOM 7556   H HD1  . TYR G  1 8  ? -27.161 2.190   -256.292 1.00 0.00 ?  8  TYR G HD1  1  
ATOM 7557   H HD2  . TYR G  1 8  ? -23.249 2.852   -254.729 1.00 0.00 ?  8  TYR G HD2  1  
ATOM 7558   H HE1  . TYR G  1 8  ? -27.150 -0.109  -255.368 1.00 0.00 ?  8  TYR G HE1  1  
ATOM 7559   H HE2  . TYR G  1 8  ? -23.221 0.562   -253.800 1.00 0.00 ?  8  TYR G HE2  1  
ATOM 7560   H HH   . TYR G  1 8  ? -25.983 -1.669  -254.200 1.00 0.00 ?  8  TYR G HH   1  
ATOM 7561   N N    . LEU G  1 9  ? -23.869 5.619   -253.838 1.00 0.00 ?  9  LEU G N    1  
ATOM 7562   C CA   . LEU G  1 9  ? -23.063 5.649   -252.623 1.00 0.00 ?  9  LEU G CA   1  
ATOM 7563   C C    . LEU G  1 9  ? -23.701 6.534   -251.560 1.00 0.00 ?  9  LEU G C    1  
ATOM 7564   O O    . LEU G  1 9  ? -23.609 6.251   -250.366 1.00 0.00 ?  9  LEU G O    1  
ATOM 7565   C CB   . LEU G  1 9  ? -21.643 6.135   -252.940 1.00 0.00 ?  9  LEU G CB   1  
ATOM 7566   C CG   . LEU G  1 9  ? -20.800 5.176   -253.791 1.00 0.00 ?  9  LEU G CG   1  
ATOM 7567   C CD1  . LEU G  1 9  ? -19.472 5.829   -254.151 1.00 0.00 ?  9  LEU G CD1  1  
ATOM 7568   C CD2  . LEU G  1 9  ? -20.575 3.881   -253.025 1.00 0.00 ?  9  LEU G CD2  1  
ATOM 7569   H H    . LEU G  1 9  ? -23.490 6.009   -254.689 1.00 0.00 ?  9  LEU G H    1  
ATOM 7570   H HA   . LEU G  1 9  ? -23.007 4.647   -252.198 1.00 0.00 ?  9  LEU G HA   1  
ATOM 7571   H HB2  . LEU G  1 9  ? -21.886 7.028   -253.514 1.00 0.00 ?  9  LEU G HB2  1  
ATOM 7572   H HB3  . LEU G  1 9  ? -21.103 6.419   -252.038 1.00 0.00 ?  9  LEU G HB3  1  
ATOM 7573   H HG   . LEU G  1 9  ? -21.380 4.940   -254.683 1.00 0.00 ?  9  LEU G HG   1  
ATOM 7574   H HD11 . LEU G  1 9  ? -18.880 5.141   -254.754 1.00 0.00 ?  9  LEU G HD11 1  
ATOM 7575   H HD12 . LEU G  1 9  ? -19.657 6.741   -254.718 1.00 0.00 ?  9  LEU G HD12 1  
ATOM 7576   H HD13 . LEU G  1 9  ? -18.927 6.071   -253.239 1.00 0.00 ?  9  LEU G HD13 1  
ATOM 7577   H HD21 . LEU G  1 9  ? -21.536 3.418   -252.802 1.00 0.00 ?  9  LEU G HD21 1  
ATOM 7578   H HD22 . LEU G  1 9  ? -19.976 3.201   -253.631 1.00 0.00 ?  9  LEU G HD22 1  
ATOM 7579   H HD23 . LEU G  1 9  ? -20.051 4.095   -252.093 1.00 0.00 ?  9  LEU G HD23 1  
ATOM 7580   N N    . ASP G  1 10 ? -24.348 7.607   -252.002 1.00 0.00 ?  10 ASP G N    1  
ATOM 7581   C CA   . ASP G  1 10 ? -25.219 8.389   -251.132 1.00 0.00 ?  10 ASP G CA   1  
ATOM 7582   C C    . ASP G  1 10 ? -26.305 7.518   -250.514 1.00 0.00 ?  10 ASP G C    1  
ATOM 7583   O O    . ASP G  1 10 ? -26.572 7.599   -249.315 1.00 0.00 ?  10 ASP G O    1  
ATOM 7584   C CB   . ASP G  1 10 ? -25.851 9.548   -251.906 1.00 0.00 ?  10 ASP G CB   1  
ATOM 7585   C CG   . ASP G  1 10 ? -24.877 10.654  -252.290 1.00 0.00 ?  10 ASP G CG   1  
ATOM 7586   O OD1  . ASP G  1 10 ? -23.806 10.695  -251.732 1.00 0.00 ?  10 ASP G OD1  1  
ATOM 7587   O OD2  . ASP G  1 10 ? -25.144 11.349  -253.240 1.00 0.00 -1 10 ASP G OD2  1  
ATOM 7588   H H    . ASP G  1 10 ? -24.234 7.889   -252.965 1.00 0.00 ?  10 ASP G H    1  
ATOM 7589   H HA   . ASP G  1 10 ? -24.641 8.799   -250.303 1.00 0.00 ?  10 ASP G HA   1  
ATOM 7590   H HB2  . ASP G  1 10 ? -26.404 9.229   -252.790 1.00 0.00 ?  10 ASP G HB2  1  
ATOM 7591   H HB3  . ASP G  1 10 ? -26.548 9.922   -251.156 1.00 0.00 ?  10 ASP G HB3  1  
ATOM 7592   N N    . ASP G  1 11 ? -26.930 6.685   -251.339 1.00 0.00 ?  11 ASP G N    1  
ATOM 7593   C CA   . ASP G  1 11 ? -27.978 5.785   -250.872 1.00 0.00 ?  11 ASP G CA   1  
ATOM 7594   C C    . ASP G  1 11 ? -27.424 4.757   -249.893 1.00 0.00 ?  11 ASP G C    1  
ATOM 7595   O O    . ASP G  1 11 ? -28.088 4.388   -248.925 1.00 0.00 ?  11 ASP G O    1  
ATOM 7596   C CB   . ASP G  1 11 ? -28.645 5.079   -252.055 1.00 0.00 ?  11 ASP G CB   1  
ATOM 7597   C CG   . ASP G  1 11 ? -29.510 5.985   -252.921 1.00 0.00 ?  11 ASP G CG   1  
ATOM 7598   O OD1  . ASP G  1 11 ? -29.781 7.087   -252.508 1.00 0.00 ?  11 ASP G OD1  1  
ATOM 7599   O OD2  . ASP G  1 11 ? -29.760 5.632   -254.049 1.00 0.00 -1 11 ASP G OD2  1  
ATOM 7600   H H    . ASP G  1 11 ? -26.672 6.675   -252.316 1.00 0.00 ?  11 ASP G H    1  
ATOM 7601   H HA   . ASP G  1 11 ? -28.736 6.351   -250.331 1.00 0.00 ?  11 ASP G HA   1  
ATOM 7602   H HB2  . ASP G  1 11 ? -27.944 4.533   -252.687 1.00 0.00 ?  11 ASP G HB2  1  
ATOM 7603   H HB3  . ASP G  1 11 ? -29.281 4.372   -251.521 1.00 0.00 ?  11 ASP G HB3  1  
ATOM 7604   N N    . VAL G  1 12 ? -26.205 4.298   -250.152 1.00 0.00 ?  12 VAL G N    1  
ATOM 7605   C CA   . VAL G  1 12 ? -25.533 3.361   -249.259 1.00 0.00 ?  12 VAL G CA   1  
ATOM 7606   C C    . VAL G  1 12 ? -25.326 3.969   -247.878 1.00 0.00 ?  12 VAL G C    1  
ATOM 7607   O O    . VAL G  1 12 ? -25.575 3.322   -246.860 1.00 0.00 ?  12 VAL G O    1  
ATOM 7608   C CB   . VAL G  1 12 ? -24.171 2.919   -249.824 1.00 0.00 ?  12 VAL G CB   1  
ATOM 7609   C CG1  . VAL G  1 12 ? -23.383 2.149   -248.774 1.00 0.00 ?  12 VAL G CG1  1  
ATOM 7610   C CG2  . VAL G  1 12 ? -24.361 2.072   -251.073 1.00 0.00 ?  12 VAL G CG2  1  
ATOM 7611   H H    . VAL G  1 12 ? -25.730 4.606   -250.989 1.00 0.00 ?  12 VAL G H    1  
ATOM 7612   H HA   . VAL G  1 12 ? -26.142 2.473   -249.085 1.00 0.00 ?  12 VAL G HA   1  
ATOM 7613   H HB   . VAL G  1 12 ? -23.608 3.804   -250.124 1.00 0.00 ?  12 VAL G HB   1  
ATOM 7614   H HG11 . VAL G  1 12 ? -22.422 1.845   -249.191 1.00 0.00 ?  12 VAL G HG11 1  
ATOM 7615   H HG12 . VAL G  1 12 ? -23.216 2.786   -247.906 1.00 0.00 ?  12 VAL G HG12 1  
ATOM 7616   H HG13 . VAL G  1 12 ? -23.944 1.265   -248.475 1.00 0.00 ?  12 VAL G HG13 1  
ATOM 7617   H HG21 . VAL G  1 12 ? -24.887 2.653   -251.831 1.00 0.00 ?  12 VAL G HG21 1  
ATOM 7618   H HG22 . VAL G  1 12 ? -23.388 1.769   -251.459 1.00 0.00 ?  12 VAL G HG22 1  
ATOM 7619   H HG23 . VAL G  1 12 ? -24.945 1.186   -250.825 1.00 0.00 ?  12 VAL G HG23 1  
ATOM 7620   N N    . SER G  1 13 ? -24.869 5.216   -247.848 1.00 0.00 ?  13 SER G N    1  
ATOM 7621   C CA   . SER G  1 13 ? -24.716 5.947   -246.595 1.00 0.00 ?  13 SER G CA   1  
ATOM 7622   C C    . SER G  1 13 ? -26.046 6.072   -245.864 1.00 0.00 ?  13 SER G C    1  
ATOM 7623   O O    . SER G  1 13 ? -26.118 5.888   -244.649 1.00 0.00 ?  13 SER G O    1  
ATOM 7624   C CB   . SER G  1 13 ? -24.127 7.319   -246.860 1.00 0.00 ?  13 SER G CB   1  
ATOM 7625   O OG   . SER G  1 13 ? -24.020 8.081   -245.689 1.00 0.00 ?  13 SER G OG   1  
ATOM 7626   H H    . SER G  1 13 ? -24.622 5.670   -248.716 1.00 0.00 ?  13 SER G H    1  
ATOM 7627   H HA   . SER G  1 13 ? -23.967 5.514   -245.931 1.00 0.00 ?  13 SER G HA   1  
ATOM 7628   H HB2  . SER G  1 13 ? -23.135 7.194   -247.293 1.00 0.00 ?  13 SER G HB2  1  
ATOM 7629   H HB3  . SER G  1 13 ? -24.768 7.843   -247.567 1.00 0.00 ?  13 SER G HB3  1  
ATOM 7630   H HG   . SER G  1 13 ? -23.994 9.013   -245.916 1.00 0.00 ?  13 SER G HG   1  
ATOM 7631   N N    . ALA G  1 14 ? -27.099 6.387   -246.612 1.00 0.00 ?  14 ALA G N    1  
ATOM 7632   C CA   . ALA G  1 14 ? -28.435 6.508   -246.041 1.00 0.00 ?  14 ALA G CA   1  
ATOM 7633   C C    . ALA G  1 14 ? -28.932 5.168   -245.514 1.00 0.00 ?  14 ALA G C    1  
ATOM 7634   O O    . ALA G  1 14 ? -29.569 5.102   -244.462 1.00 0.00 ?  14 ALA G O    1  
ATOM 7635   C CB   . ALA G  1 14 ? -29.403 7.068   -247.073 1.00 0.00 ?  14 ALA G CB   1  
ATOM 7636   H H    . ALA G  1 14 ? -26.970 6.547   -247.601 1.00 0.00 ?  14 ALA G H    1  
ATOM 7637   H HA   . ALA G  1 14 ? -28.393 7.195   -245.195 1.00 0.00 ?  14 ALA G HA   1  
ATOM 7638   H HB1  . ALA G  1 14 ? -29.445 6.400   -247.932 1.00 0.00 ?  14 ALA G HB1  1  
ATOM 7639   H HB2  . ALA G  1 14 ? -30.396 7.152   -246.631 1.00 0.00 ?  14 ALA G HB2  1  
ATOM 7640   H HB3  . ALA G  1 14 ? -29.065 8.053   -247.394 1.00 0.00 ?  14 ALA G HB3  1  
ATOM 7641   N N    . LYS G  1 15 ? -28.637 4.102   -246.250 1.00 0.00 ?  15 LYS G N    1  
ATOM 7642   C CA   . LYS G  1 15 ? -29.082 2.766   -245.875 1.00 0.00 ?  15 LYS G CA   1  
ATOM 7643   C C    . LYS G  1 15 ? -28.487 2.342   -244.538 1.00 0.00 ?  15 LYS G C    1  
ATOM 7644   O O    . LYS G  1 15 ? -29.174 1.757   -243.700 1.00 0.00 ?  15 LYS G O    1  
ATOM 7645   C CB   . LYS G  1 15 ? -28.711 1.753   -246.960 1.00 0.00 ?  15 LYS G CB   1  
ATOM 7646   C CG   . LYS G  1 15 ? -29.614 1.786   -248.186 1.00 0.00 ?  15 LYS G CG   1  
ATOM 7647   C CD   . LYS G  1 15 ? -29.084 0.879   -249.287 1.00 0.00 ?  15 LYS G CD   1  
ATOM 7648   C CE   . LYS G  1 15 ? -29.919 1.000   -250.554 1.00 0.00 ?  15 LYS G CE   1  
ATOM 7649   N NZ   . LYS G  1 15 ? -31.289 0.449   -250.373 1.00 0.00 1  15 LYS G NZ   1  
ATOM 7650   H H    . LYS G  1 15 ? -28.091 4.221   -247.091 1.00 0.00 ?  15 LYS G H    1  
ATOM 7651   H HA   . LYS G  1 15 ? -30.165 2.759   -245.749 1.00 0.00 ?  15 LYS G HA   1  
ATOM 7652   H HB2  . LYS G  1 15 ? -27.685 1.968   -247.259 1.00 0.00 ?  15 LYS G HB2  1  
ATOM 7653   H HB3  . LYS G  1 15 ? -28.755 0.764   -246.504 1.00 0.00 ?  15 LYS G HB3  1  
ATOM 7654   H HG2  . LYS G  1 15 ? -30.610 1.456   -247.891 1.00 0.00 ?  15 LYS G HG2  1  
ATOM 7655   H HG3  . LYS G  1 15 ? -29.664 2.811   -248.552 1.00 0.00 ?  15 LYS G HG3  1  
ATOM 7656   H HD2  . LYS G  1 15 ? -28.052 1.160   -249.502 1.00 0.00 ?  15 LYS G HD2  1  
ATOM 7657   H HD3  . LYS G  1 15 ? -29.112 -0.151  -248.932 1.00 0.00 ?  15 LYS G HD3  1  
ATOM 7658   H HE2  . LYS G  1 15 ? -29.984 2.054   -250.820 1.00 0.00 ?  15 LYS G HE2  1  
ATOM 7659   H HE3  . LYS G  1 15 ? -29.411 0.456   -251.350 1.00 0.00 ?  15 LYS G HE3  1  
ATOM 7660   H HZ1  . LYS G  1 15 ? -31.760 0.953   -249.635 1.00 0.00 ?  15 LYS G HZ1  1  
ATOM 7661   H HZ2  . LYS G  1 15 ? -31.808 0.548   -251.233 1.00 0.00 ?  15 LYS G HZ2  1  
ATOM 7662   H HZ3  . LYS G  1 15 ? -31.229 -0.529  -250.126 1.00 0.00 ?  15 LYS G HZ3  1  
ATOM 7663   N N    . PHE G  1 16 ? -27.207 2.641   -244.344 1.00 0.00 ?  16 PHE G N    1  
ATOM 7664   C CA   . PHE G  1 16 ? -26.546 2.387   -243.070 1.00 0.00 ?  16 PHE G CA   1  
ATOM 7665   C C    . PHE G  1 16 ? -27.140 3.246   -241.961 1.00 0.00 ?  16 PHE G C    1  
ATOM 7666   O O    . PHE G  1 16 ? -27.488 2.743   -240.893 1.00 0.00 ?  16 PHE G O    1  
ATOM 7667   C CB   . PHE G  1 16 ? -25.042 2.646   -243.188 1.00 0.00 ?  16 PHE G CB   1  
ATOM 7668   C CG   . PHE G  1 16 ? -24.284 2.400   -241.915 1.00 0.00 ?  16 PHE G CG   1  
ATOM 7669   C CD1  . PHE G  1 16 ? -23.811 1.134   -241.605 1.00 0.00 ?  16 PHE G CD1  1  
ATOM 7670   C CD2  . PHE G  1 16 ? -24.042 3.435   -241.024 1.00 0.00 ?  16 PHE G CD2  1  
ATOM 7671   C CE1  . PHE G  1 16 ? -23.114 0.907   -240.434 1.00 0.00 ?  16 PHE G CE1  1  
ATOM 7672   C CE2  . PHE G  1 16 ? -23.344 3.212   -239.853 1.00 0.00 ?  16 PHE G CE2  1  
ATOM 7673   C CZ   . PHE G  1 16 ? -22.879 1.945   -239.558 1.00 0.00 ?  16 PHE G CZ   1  
ATOM 7674   H H    . PHE G  1 16 ? -26.679 3.054   -245.099 1.00 0.00 ?  16 PHE G H    1  
ATOM 7675   H HA   . PHE G  1 16 ? -26.699 1.349   -242.774 1.00 0.00 ?  16 PHE G HA   1  
ATOM 7676   H HB2  . PHE G  1 16 ? -24.607 1.991   -243.941 1.00 0.00 ?  16 PHE G HB2  1  
ATOM 7677   H HB3  . PHE G  1 16 ? -24.862 3.684   -243.463 1.00 0.00 ?  16 PHE G HB3  1  
ATOM 7678   H HD1  . PHE G  1 16 ? -23.996 0.313   -242.298 1.00 0.00 ?  16 PHE G HD1  1  
ATOM 7679   H HD2  . PHE G  1 16 ? -24.409 4.435   -241.257 1.00 0.00 ?  16 PHE G HD2  1  
ATOM 7680   H HE1  . PHE G  1 16 ? -22.748 -0.093  -240.203 1.00 0.00 ?  16 PHE G HE1  1  
ATOM 7681   H HE2  . PHE G  1 16 ? -23.160 4.034   -239.162 1.00 0.00 ?  16 PHE G HE2  1  
ATOM 7682   H HZ   . PHE G  1 16 ? -22.330 1.767   -238.634 1.00 0.00 ?  16 PHE G HZ   1  
ATOM 7683   N N    . ASP G  1 17 ? -27.252 4.544   -242.220 1.00 0.00 ?  17 ASP G N    1  
ATOM 7684   C CA   . ASP G  1 17 ? -27.723 5.489   -241.214 1.00 0.00 ?  17 ASP G CA   1  
ATOM 7685   C C    . ASP G  1 17 ? -29.159 5.187   -240.805 1.00 0.00 ?  17 ASP G C    1  
ATOM 7686   O O    . ASP G  1 17 ? -29.560 5.451   -239.671 1.00 0.00 ?  17 ASP G O    1  
ATOM 7687   C CB   . ASP G  1 17 ? -27.614 6.924   -241.733 1.00 0.00 ?  17 ASP G CB   1  
ATOM 7688   C CG   . ASP G  1 17 ? -26.195 7.476   -241.764 1.00 0.00 ?  17 ASP G CG   1  
ATOM 7689   O OD1  . ASP G  1 17 ? -25.332 6.876   -241.170 1.00 0.00 ?  17 ASP G OD1  1  
ATOM 7690   O OD2  . ASP G  1 17 ? -25.955 8.400   -242.505 1.00 0.00 -1 17 ASP G OD2  1  
ATOM 7691   H H    . ASP G  1 17 ? -27.006 4.886   -243.138 1.00 0.00 ?  17 ASP G H    1  
ATOM 7692   H HA   . ASP G  1 17 ? -27.118 5.398   -240.311 1.00 0.00 ?  17 ASP G HA   1  
ATOM 7693   H HB2  . ASP G  1 17 ? -28.082 7.070   -242.707 1.00 0.00 ?  17 ASP G HB2  1  
ATOM 7694   H HB3  . ASP G  1 17 ? -28.191 7.448   -240.970 1.00 0.00 ?  17 ASP G HB3  1  
ATOM 7695   N N    . THR G  1 18 ? -29.930 4.634   -241.734 1.00 0.00 ?  18 THR G N    1  
ATOM 7696   C CA   . THR G  1 18 ? -31.324 4.298   -241.472 1.00 0.00 ?  18 THR G CA   1  
ATOM 7697   C C    . THR G  1 18 ? -31.466 3.500   -240.182 1.00 0.00 ?  18 THR G C    1  
ATOM 7698   O O    . THR G  1 18 ? -32.364 3.754   -239.380 1.00 0.00 ?  18 THR G O    1  
ATOM 7699   C CB   . THR G  1 18 ? -31.939 3.492   -242.632 1.00 0.00 ?  18 THR G CB   1  
ATOM 7700   O OG1  . THR G  1 18 ? -31.949 4.292   -243.821 1.00 0.00 ?  18 THR G OG1  1  
ATOM 7701   C CG2  . THR G  1 18 ? -33.361 3.072   -242.295 1.00 0.00 ?  18 THR G CG2  1  
ATOM 7702   H H    . THR G  1 18 ? -29.540 4.441   -242.646 1.00 0.00 ?  18 THR G H    1  
ATOM 7703   H HA   . THR G  1 18 ? -31.904 5.211   -241.336 1.00 0.00 ?  18 THR G HA   1  
ATOM 7704   H HB   . THR G  1 18 ? -31.331 2.604   -242.808 1.00 0.00 ?  18 THR G HB   1  
ATOM 7705   H HG1  . THR G  1 18 ? -32.332 3.788   -244.542 1.00 0.00 ?  18 THR G HG1  1  
ATOM 7706   H HG21 . THR G  1 18 ? -33.779 2.504   -243.126 1.00 0.00 ?  18 THR G HG21 1  
ATOM 7707   H HG22 . THR G  1 18 ? -33.355 2.454   -241.397 1.00 0.00 ?  18 THR G HG22 1  
ATOM 7708   H HG23 . THR G  1 18 ? -33.969 3.959   -242.120 1.00 0.00 ?  18 THR G HG23 1  
ATOM 7709   N N    . GLY G  1 19 ? -30.573 2.535   -239.988 1.00 0.00 ?  19 GLY G N    1  
ATOM 7710   C CA   . GLY G  1 19 ? -30.687 1.598   -238.877 1.00 0.00 ?  19 GLY G CA   1  
ATOM 7711   C C    . GLY G  1 19 ? -30.088 2.179   -237.603 1.00 0.00 ?  19 GLY G C    1  
ATOM 7712   O O    . GLY G  1 19 ? -30.306 1.658   -236.509 1.00 0.00 ?  19 GLY G O    1  
ATOM 7713   H H    . GLY G  1 19 ? -29.796 2.449   -240.627 1.00 0.00 ?  19 GLY G H    1  
ATOM 7714   H HA2  . GLY G  1 19 ? -31.741 1.376   -238.705 1.00 0.00 ?  19 GLY G HA2  1  
ATOM 7715   H HA3  . GLY G  1 19 ? -30.161 0.679   -239.131 1.00 0.00 ?  19 GLY G HA3  1  
ATOM 7716   N N    . VAL G  1 20 ? -29.331 3.261   -237.751 1.00 0.00 ?  20 VAL G N    1  
ATOM 7717   C CA   . VAL G  1 20 ? -28.671 3.895   -236.616 1.00 0.00 ?  20 VAL G CA   1  
ATOM 7718   C C    . VAL G  1 20 ? -28.914 5.398   -236.607 1.00 0.00 ?  20 VAL G C    1  
ATOM 7719   O O    . VAL G  1 20 ? -28.112 6.163   -236.070 1.00 0.00 ?  20 VAL G O    1  
ATOM 7720   C CB   . VAL G  1 20 ? -27.153 3.630   -236.625 1.00 0.00 ?  20 VAL G CB   1  
ATOM 7721   C CG1  . VAL G  1 20 ? -26.865 2.171   -236.301 1.00 0.00 ?  20 VAL G CG1  1  
ATOM 7722   C CG2  . VAL G  1 20 ? -26.555 4.004   -237.972 1.00 0.00 ?  20 VAL G CG2  1  
ATOM 7723   H H    . VAL G  1 20 ? -29.210 3.654   -238.673 1.00 0.00 ?  20 VAL G H    1  
ATOM 7724   H HA   . VAL G  1 20 ? -29.080 3.539   -235.670 1.00 0.00 ?  20 VAL G HA   1  
ATOM 7725   H HB   . VAL G  1 20 ? -26.678 4.268   -235.879 1.00 0.00 ?  20 VAL G HB   1  
ATOM 7726   H HG11 . VAL G  1 20 ? -25.788 2.002   -236.312 1.00 0.00 ?  20 VAL G HG11 1  
ATOM 7727   H HG12 . VAL G  1 20 ? -27.260 1.933   -235.314 1.00 0.00 ?  20 VAL G HG12 1  
ATOM 7728   H HG13 . VAL G  1 20 ? -27.339 1.533   -237.047 1.00 0.00 ?  20 VAL G HG13 1  
ATOM 7729   H HG21 . VAL G  1 20 ? -26.731 5.062   -238.168 1.00 0.00 ?  20 VAL G HG21 1  
ATOM 7730   H HG22 . VAL G  1 20 ? -25.483 3.811   -237.961 1.00 0.00 ?  20 VAL G HG22 1  
ATOM 7731   H HG23 . VAL G  1 20 ? -27.023 3.407   -238.755 1.00 0.00 ?  20 VAL G HG23 1  
ATOM 7732   N N    . ASP G  1 21 ? -30.024 5.817   -237.204 1.00 0.00 ?  21 ASP G N    1  
ATOM 7733   C CA   . ASP G  1 21 ? -30.417 7.221   -237.195 1.00 0.00 ?  21 ASP G CA   1  
ATOM 7734   C C    . ASP G  1 21 ? -30.584 7.737   -235.772 1.00 0.00 ?  21 ASP G C    1  
ATOM 7735   O O    . ASP G  1 21 ? -30.259 8.886   -235.476 1.00 0.00 ?  21 ASP G O    1  
ATOM 7736   C CB   . ASP G  1 21 ? -31.715 7.420   -237.982 1.00 0.00 ?  21 ASP G CB   1  
ATOM 7737   C CG   . ASP G  1 21 ? -32.113 8.876   -238.180 1.00 0.00 ?  21 ASP G CG   1  
ATOM 7738   O OD1  . ASP G  1 21 ? -31.365 9.598   -238.796 1.00 0.00 ?  21 ASP G OD1  1  
ATOM 7739   O OD2  . ASP G  1 21 ? -33.225 9.217   -237.854 1.00 0.00 -1 21 ASP G OD2  1  
ATOM 7740   H H    . ASP G  1 21 ? -30.612 5.145   -237.677 1.00 0.00 ?  21 ASP G H    1  
ATOM 7741   H HA   . ASP G  1 21 ? -29.635 7.826   -237.654 1.00 0.00 ?  21 ASP G HA   1  
ATOM 7742   H HB2  . ASP G  1 21 ? -31.722 6.908   -238.945 1.00 0.00 ?  21 ASP G HB2  1  
ATOM 7743   H HB3  . ASP G  1 21 ? -32.424 6.938   -237.308 1.00 0.00 ?  21 ASP G HB3  1  
ATOM 7744   N N    . ASN G  1 22 ? -31.093 6.880   -234.893 1.00 0.00 ?  22 ASN G N    1  
ATOM 7745   C CA   . ASN G  1 22 ? -31.337 7.258   -233.506 1.00 0.00 ?  22 ASN G CA   1  
ATOM 7746   C C    . ASN G  1 22 ? -30.051 7.225   -232.692 1.00 0.00 ?  22 ASN G C    1  
ATOM 7747   O O    . ASN G  1 22 ? -29.909 7.950   -231.707 1.00 0.00 ?  22 ASN G O    1  
ATOM 7748   C CB   . ASN G  1 22 ? -32.388 6.370   -232.865 1.00 0.00 ?  22 ASN G CB   1  
ATOM 7749   C CG   . ASN G  1 22 ? -33.778 6.604   -233.387 1.00 0.00 ?  22 ASN G CG   1  
ATOM 7750   O OD1  . ASN G  1 22 ? -34.090 7.673   -233.924 1.00 0.00 ?  22 ASN G OD1  1  
ATOM 7751   N ND2  . ASN G  1 22 ? -34.636 5.643   -233.157 1.00 0.00 ?  22 ASN G ND2  1  
ATOM 7752   H H    . ASN G  1 22 ? -31.317 5.942   -235.194 1.00 0.00 ?  22 ASN G H    1  
ATOM 7753   H HA   . ASN G  1 22 ? -31.704 8.285   -233.462 1.00 0.00 ?  22 ASN G HA   1  
ATOM 7754   H HB2  . ASN G  1 22 ? -32.222 5.297   -232.758 1.00 0.00 ?  22 ASN G HB2  1  
ATOM 7755   H HB3  . ASN G  1 22 ? -32.292 6.852   -231.892 1.00 0.00 ?  22 ASN G HB3  1  
ATOM 7756   H HD21 . ASN G  1 22 ? -34.348 4.822   -232.664 1.00 0.00 ?  22 ASN G HD21 1  
ATOM 7757   H HD22 . ASN G  1 22 ? -35.581 5.730   -233.476 1.00 0.00 ?  22 ASN G HD22 1  
ATOM 7758   N N    . LEU G  1 23 ? -29.115 6.378   -233.108 1.00 0.00 ?  23 LEU G N    1  
ATOM 7759   C CA   . LEU G  1 23 ? -27.854 6.219   -232.393 1.00 0.00 ?  23 LEU G CA   1  
ATOM 7760   C C    . LEU G  1 23 ? -27.180 7.565   -232.160 1.00 0.00 ?  23 LEU G C    1  
ATOM 7761   O O    . LEU G  1 23 ? -26.767 7.878   -231.043 1.00 0.00 ?  23 LEU G O    1  
ATOM 7762   C CB   . LEU G  1 23 ? -26.920 5.282   -233.170 1.00 0.00 ?  23 LEU G CB   1  
ATOM 7763   C CG   . LEU G  1 23 ? -25.466 5.259   -232.682 1.00 0.00 ?  23 LEU G CG   1  
ATOM 7764   C CD1  . LEU G  1 23 ? -25.415 4.875   -231.209 1.00 0.00 ?  23 LEU G CD1  1  
ATOM 7765   C CD2  . LEU G  1 23 ? -24.662 4.278   -233.523 1.00 0.00 ?  23 LEU G CD2  1  
ATOM 7766   H H    . LEU G  1 23 ? -29.282 5.831   -233.940 1.00 0.00 ?  23 LEU G H    1  
ATOM 7767   H HA   . LEU G  1 23 ? -28.043 5.793   -231.409 1.00 0.00 ?  23 LEU G HA   1  
ATOM 7768   H HB2  . LEU G  1 23 ? -27.402 4.331   -232.951 1.00 0.00 ?  23 LEU G HB2  1  
ATOM 7769   H HB3  . LEU G  1 23 ? -26.958 5.471   -234.242 1.00 0.00 ?  23 LEU G HB3  1  
ATOM 7770   H HG   . LEU G  1 23 ? -25.053 6.255   -232.846 1.00 0.00 ?  23 LEU G HG   1  
ATOM 7771   H HD11 . LEU G  1 23 ? -24.378 4.862   -230.872 1.00 0.00 ?  23 LEU G HD11 1  
ATOM 7772   H HD12 . LEU G  1 23 ? -25.976 5.603   -230.624 1.00 0.00 ?  23 LEU G HD12 1  
ATOM 7773   H HD13 . LEU G  1 23 ? -25.852 3.887   -231.076 1.00 0.00 ?  23 LEU G HD13 1  
ATOM 7774   H HD21 . LEU G  1 23 ? -24.689 4.587   -234.568 1.00 0.00 ?  23 LEU G HD21 1  
ATOM 7775   H HD22 . LEU G  1 23 ? -23.629 4.263   -233.176 1.00 0.00 ?  23 LEU G HD22 1  
ATOM 7776   H HD23 . LEU G  1 23 ? -25.092 3.280   -233.429 1.00 0.00 ?  23 LEU G HD23 1  
ATOM 7777   N N    . GLN G  1 24 ? -27.070 8.358   -233.220 1.00 0.00 ?  24 GLN G N    1  
ATOM 7778   C CA   . GLN G  1 24 ? -26.444 9.672   -233.132 1.00 0.00 ?  24 GLN G CA   1  
ATOM 7779   C C    . GLN G  1 24 ? -27.142 10.547  -232.099 1.00 0.00 ?  24 GLN G C    1  
ATOM 7780   O O    . GLN G  1 24 ? -26.491 11.202  -231.285 1.00 0.00 ?  24 GLN G O    1  
ATOM 7781   C CB   . GLN G  1 24 ? -26.464 10.367  -234.496 1.00 0.00 ?  24 GLN G CB   1  
ATOM 7782   C CG   . GLN G  1 24 ? -25.782 11.725  -234.513 1.00 0.00 ?  24 GLN G CG   1  
ATOM 7783   C CD   . GLN G  1 24 ? -25.818 12.374  -235.884 1.00 0.00 ?  24 GLN G CD   1  
ATOM 7784   O OE1  . GLN G  1 24 ? -26.426 11.847  -236.820 1.00 0.00 ?  24 GLN G OE1  1  
ATOM 7785   N NE2  . GLN G  1 24 ? -25.163 13.522  -236.011 1.00 0.00 ?  24 GLN G NE2  1  
ATOM 7786   H H    . GLN G  1 24 ? -27.430 8.043   -234.109 1.00 0.00 ?  24 GLN G H    1  
ATOM 7787   H HA   . GLN G  1 24 ? -25.412 9.563   -232.800 1.00 0.00 ?  24 GLN G HA   1  
ATOM 7788   H HB2  . GLN G  1 24 ? -25.969 9.697   -235.199 1.00 0.00 ?  24 GLN G HB2  1  
ATOM 7789   H HB3  . GLN G  1 24 ? -27.511 10.478  -234.778 1.00 0.00 ?  24 GLN G HB3  1  
ATOM 7790   H HG2  . GLN G  1 24 ? -25.986 12.497  -233.772 1.00 0.00 ?  24 GLN G HG2  1  
ATOM 7791   H HG3  . GLN G  1 24 ? -24.782 11.321  -234.349 1.00 0.00 ?  24 GLN G HG3  1  
ATOM 7792   H HE21 . GLN G  1 24 ? -24.681 13.913  -235.227 1.00 0.00 ?  24 GLN G HE21 1  
ATOM 7793   H HE22 . GLN G  1 24 ? -25.151 13.996  -236.893 1.00 0.00 ?  24 GLN G HE22 1  
ATOM 7794   N N    . THR G  1 25 ? -28.470 10.554  -232.137 1.00 0.00 ?  25 THR G N    1  
ATOM 7795   C CA   . THR G  1 25 ? -29.258 11.372  -231.223 1.00 0.00 ?  25 THR G CA   1  
ATOM 7796   C C    . THR G  1 25 ? -29.086 10.908  -229.782 1.00 0.00 ?  25 THR G C    1  
ATOM 7797   O O    . THR G  1 25 ? -28.979 11.724  -228.866 1.00 0.00 ?  25 THR G O    1  
ATOM 7798   C CB   . THR G  1 25 ? -30.754 11.342  -231.585 1.00 0.00 ?  25 THR G CB   1  
ATOM 7799   O OG1  . THR G  1 25 ? -30.942 11.893  -232.896 1.00 0.00 ?  25 THR G OG1  1  
ATOM 7800   C CG2  . THR G  1 25 ? -31.563 12.149  -230.580 1.00 0.00 ?  25 THR G CG2  1  
ATOM 7801   H H    . THR G  1 25 ? -28.945 9.979   -232.817 1.00 0.00 ?  25 THR G H    1  
ATOM 7802   H HA   . THR G  1 25 ? -28.910 12.405  -231.258 1.00 0.00 ?  25 THR G HA   1  
ATOM 7803   H HB   . THR G  1 25 ? -31.100 10.309  -231.582 1.00 0.00 ?  25 THR G HB   1  
ATOM 7804   H HG1  . THR G  1 25 ? -30.452 11.370  -233.535 1.00 0.00 ?  25 THR G HG1  1  
ATOM 7805   H HG21 . THR G  1 25 ? -32.617 12.116  -230.853 1.00 0.00 ?  25 THR G HG21 1  
ATOM 7806   H HG22 . THR G  1 25 ? -31.431 11.726  -229.585 1.00 0.00 ?  25 THR G HG22 1  
ATOM 7807   H HG23 . THR G  1 25 ? -31.219 13.182  -230.584 1.00 0.00 ?  25 THR G HG23 1  
ATOM 7808   N N    . GLN G  1 26 ? -29.060 9.594   -229.588 1.00 0.00 ?  26 GLN G N    1  
ATOM 7809   C CA   . GLN G  1 26 ? -28.962 9.019   -228.252 1.00 0.00 ?  26 GLN G CA   1  
ATOM 7810   C C    . GLN G  1 26 ? -27.633 9.374   -227.596 1.00 0.00 ?  26 GLN G C    1  
ATOM 7811   O O    . GLN G  1 26 ? -27.592 9.777   -226.434 1.00 0.00 ?  26 GLN G O    1  
ATOM 7812   C CB   . GLN G  1 26 ? -29.119 7.497   -228.310 1.00 0.00 ?  26 GLN G CB   1  
ATOM 7813   C CG   . GLN G  1 26 ? -30.535 7.029   -228.598 1.00 0.00 ?  26 GLN G CG   1  
ATOM 7814   C CD   . GLN G  1 26 ? -30.634 5.519   -228.707 1.00 0.00 ?  26 GLN G CD   1  
ATOM 7815   O OE1  . GLN G  1 26 ? -29.638 4.805   -228.559 1.00 0.00 ?  26 GLN G OE1  1  
ATOM 7816   N NE2  . GLN G  1 26 ? -31.838 5.023   -228.970 1.00 0.00 ?  26 GLN G NE2  1  
ATOM 7817   H H    . GLN G  1 26 ? -29.110 8.978   -230.386 1.00 0.00 ?  26 GLN G H    1  
ATOM 7818   H HA   . GLN G  1 26 ? -29.742 9.437   -227.616 1.00 0.00 ?  26 GLN G HA   1  
ATOM 7819   H HB2  . GLN G  1 26 ? -28.447 7.141   -229.090 1.00 0.00 ?  26 GLN G HB2  1  
ATOM 7820   H HB3  . GLN G  1 26 ? -28.792 7.110   -227.345 1.00 0.00 ?  26 GLN G HB3  1  
ATOM 7821   H HG2  . GLN G  1 26 ? -31.399 7.381   -228.034 1.00 0.00 ?  26 GLN G HG2  1  
ATOM 7822   H HG3  . GLN G  1 26 ? -30.563 7.450   -229.603 1.00 0.00 ?  26 GLN G HG3  1  
ATOM 7823   H HE21 . GLN G  1 26 ? -32.618 5.638   -229.084 1.00 0.00 ?  26 GLN G HE21 1  
ATOM 7824   H HE22 . GLN G  1 26 ? -31.965 4.034   -229.054 1.00 0.00 ?  26 GLN G HE22 1  
ATOM 7825   N N    . VAL G  1 27 ? -26.548 9.220   -228.348 1.00 0.00 ?  27 VAL G N    1  
ATOM 7826   C CA   . VAL G  1 27 ? -25.210 9.452   -227.818 1.00 0.00 ?  27 VAL G CA   1  
ATOM 7827   C C    . VAL G  1 27 ? -24.928 10.942  -227.667 1.00 0.00 ?  27 VAL G C    1  
ATOM 7828   O O    . VAL G  1 27 ? -24.130 11.350  -226.823 1.00 0.00 ?  27 VAL G O    1  
ATOM 7829   C CB   . VAL G  1 27 ? -24.129 8.824   -228.718 1.00 0.00 ?  27 VAL G CB   1  
ATOM 7830   C CG1  . VAL G  1 27 ? -23.896 9.685   -229.951 1.00 0.00 ?  27 VAL G CG1  1  
ATOM 7831   C CG2  . VAL G  1 27 ? -22.832 8.641   -227.945 1.00 0.00 ?  27 VAL G CG2  1  
ATOM 7832   H H    . VAL G  1 27 ? -26.654 8.935   -229.311 1.00 0.00 ?  27 VAL G H    1  
ATOM 7833   H HA   . VAL G  1 27 ? -25.105 9.044   -226.812 1.00 0.00 ?  27 VAL G HA   1  
ATOM 7834   H HB   . VAL G  1 27 ? -24.458 7.831   -229.025 1.00 0.00 ?  27 VAL G HB   1  
ATOM 7835   H HG11 . VAL G  1 27 ? -23.130 9.226   -230.576 1.00 0.00 ?  27 VAL G HG11 1  
ATOM 7836   H HG12 . VAL G  1 27 ? -24.824 9.768   -230.517 1.00 0.00 ?  27 VAL G HG12 1  
ATOM 7837   H HG13 . VAL G  1 27 ? -23.567 10.678  -229.644 1.00 0.00 ?  27 VAL G HG13 1  
ATOM 7838   H HG21 . VAL G  1 27 ? -23.007 7.986   -227.091 1.00 0.00 ?  27 VAL G HG21 1  
ATOM 7839   H HG22 . VAL G  1 27 ? -22.080 8.196   -228.595 1.00 0.00 ?  27 VAL G HG22 1  
ATOM 7840   H HG23 . VAL G  1 27 ? -22.480 9.611   -227.593 1.00 0.00 ?  27 VAL G HG23 1  
ATOM 7841   N N    . THR G  1 28 ? -25.588 11.750  -228.490 1.00 0.00 ?  28 THR G N    1  
ATOM 7842   C CA   . THR G  1 28 ? -25.501 13.201  -228.372 1.00 0.00 ?  28 THR G CA   1  
ATOM 7843   C C    . THR G  1 28 ? -26.189 13.692  -227.105 1.00 0.00 ?  28 THR G C    1  
ATOM 7844   O O    . THR G  1 28 ? -25.652 14.531  -226.381 1.00 0.00 ?  28 THR G O    1  
ATOM 7845   C CB   . THR G  1 28 ? -26.126 13.905  -229.590 1.00 0.00 ?  28 THR G CB   1  
ATOM 7846   O OG1  . THR G  1 28 ? -25.384 13.572  -230.771 1.00 0.00 ?  28 THR G OG1  1  
ATOM 7847   C CG2  . THR G  1 28 ? -26.114 15.414  -229.398 1.00 0.00 ?  28 THR G CG2  1  
ATOM 7848   H H    . THR G  1 28 ? -26.164 11.349  -229.216 1.00 0.00 ?  28 THR G H    1  
ATOM 7849   H HA   . THR G  1 28 ? -24.456 13.502  -228.292 1.00 0.00 ?  28 THR G HA   1  
ATOM 7850   H HB   . THR G  1 28 ? -27.154 13.563  -229.709 1.00 0.00 ?  28 THR G HB   1  
ATOM 7851   H HG1  . THR G  1 28 ? -25.231 12.624  -230.794 1.00 0.00 ?  28 THR G HG1  1  
ATOM 7852   H HG21 . THR G  1 28 ? -26.560 15.894  -230.268 1.00 0.00 ?  28 THR G HG21 1  
ATOM 7853   H HG22 . THR G  1 28 ? -26.687 15.671  -228.507 1.00 0.00 ?  28 THR G HG22 1  
ATOM 7854   H HG23 . THR G  1 28 ? -25.087 15.757  -229.280 1.00 0.00 ?  28 THR G HG23 1  
ATOM 7855   N N    . GLU G  1 29 ? -27.381 13.166  -226.843 1.00 0.00 ?  29 GLU G N    1  
ATOM 7856   C CA   . GLU G  1 29 ? -28.116 13.502  -225.630 1.00 0.00 ?  29 GLU G CA   1  
ATOM 7857   C C    . GLU G  1 29 ? -27.414 12.960  -224.392 1.00 0.00 ?  29 GLU G C    1  
ATOM 7858   O O    . GLU G  1 29 ? -27.431 13.586  -223.332 1.00 0.00 ?  29 GLU G O    1  
ATOM 7859   C CB   . GLU G  1 29 ? -29.546 12.960  -225.703 1.00 0.00 ?  29 GLU G CB   1  
ATOM 7860   C CG   . GLU G  1 29 ? -30.449 13.698  -226.681 1.00 0.00 ?  29 GLU G CG   1  
ATOM 7861   C CD   . GLU G  1 29 ? -31.796 13.039  -226.784 1.00 0.00 ?  29 GLU G CD   1  
ATOM 7862   O OE1  . GLU G  1 29 ? -31.982 12.012  -226.177 1.00 0.00 ?  29 GLU G OE1  1  
ATOM 7863   O OE2  . GLU G  1 29 ? -32.675 13.620  -227.377 1.00 0.00 -1 29 GLU G OE2  1  
ATOM 7864   H H    . GLU G  1 29 ? -27.787 12.517  -227.501 1.00 0.00 ?  29 GLU G H    1  
ATOM 7865   H HA   . GLU G  1 29 ? -28.160 14.585  -225.512 1.00 0.00 ?  29 GLU G HA   1  
ATOM 7866   H HB2  . GLU G  1 29 ? -29.474 11.912  -225.995 1.00 0.00 ?  29 GLU G HB2  1  
ATOM 7867   H HB3  . GLU G  1 29 ? -29.965 13.030  -224.699 1.00 0.00 ?  29 GLU G HB3  1  
ATOM 7868   H HG2  . GLU G  1 29 ? -30.578 14.753  -226.441 1.00 0.00 ?  29 GLU G HG2  1  
ATOM 7869   H HG3  . GLU G  1 29 ? -29.926 13.605  -227.632 1.00 0.00 ?  29 GLU G HG3  1  
ATOM 7870   N N    . ALA G  1 30 ? -26.796 11.792  -224.532 1.00 0.00 ?  30 ALA G N    1  
ATOM 7871   C CA   . ALA G  1 30 ? -25.995 11.215  -223.458 1.00 0.00 ?  30 ALA G CA   1  
ATOM 7872   C C    . ALA G  1 30 ? -24.791 12.090  -223.138 1.00 0.00 ?  30 ALA G C    1  
ATOM 7873   O O    . ALA G  1 30 ? -24.414 12.243  -221.976 1.00 0.00 ?  30 ALA G O    1  
ATOM 7874   C CB   . ALA G  1 30 ? -25.549 9.808   -223.828 1.00 0.00 ?  30 ALA G CB   1  
ATOM 7875   H H    . ALA G  1 30 ? -26.882 11.291  -225.405 1.00 0.00 ?  30 ALA G H    1  
ATOM 7876   H HA   . ALA G  1 30 ? -26.606 11.160  -222.557 1.00 0.00 ?  30 ALA G HA   1  
ATOM 7877   H HB1  . ALA G  1 30 ? -24.949 9.844   -224.736 1.00 0.00 ?  30 ALA G HB1  1  
ATOM 7878   H HB2  . ALA G  1 30 ? -24.953 9.391   -223.016 1.00 0.00 ?  30 ALA G HB2  1  
ATOM 7879   H HB3  . ALA G  1 30 ? -26.424 9.180   -223.994 1.00 0.00 ?  30 ALA G HB3  1  
ATOM 7880   N N    . LEU G  1 31 ? -24.189 12.664  -224.174 1.00 0.00 ?  31 LEU G N    1  
ATOM 7881   C CA   . LEU G  1 31 ? -23.110 13.628  -223.997 1.00 0.00 ?  31 LEU G CA   1  
ATOM 7882   C C    . LEU G  1 31 ? -23.607 14.890  -223.304 1.00 0.00 ?  31 LEU G C    1  
ATOM 7883   O O    . LEU G  1 31 ? -22.965 15.400  -222.387 1.00 0.00 ?  31 LEU G O    1  
ATOM 7884   C CB   . LEU G  1 31 ? -22.482 13.975  -225.353 1.00 0.00 ?  31 LEU G CB   1  
ATOM 7885   C CG   . LEU G  1 31 ? -21.353 15.013  -225.302 1.00 0.00 ?  31 LEU G CG   1  
ATOM 7886   C CD1  . LEU G  1 31 ? -20.218 14.507  -224.423 1.00 0.00 ?  31 LEU G CD1  1  
ATOM 7887   C CD2  . LEU G  1 31 ? -20.858 15.295  -226.713 1.00 0.00 ?  31 LEU G CD2  1  
ATOM 7888   H H    . LEU G  1 31 ? -24.488 12.426  -225.110 1.00 0.00 ?  31 LEU G H    1  
ATOM 7889   H HA   . LEU G  1 31 ? -22.343 13.202  -223.351 1.00 0.00 ?  31 LEU G HA   1  
ATOM 7890   H HB2  . LEU G  1 31 ? -22.080 12.999  -225.617 1.00 0.00 ?  31 LEU G HB2  1  
ATOM 7891   H HB3  . LEU G  1 31 ? -23.236 14.268  -226.084 1.00 0.00 ?  31 LEU G HB3  1  
ATOM 7892   H HG   . LEU G  1 31 ? -21.779 15.936  -224.908 1.00 0.00 ?  31 LEU G HG   1  
ATOM 7893   H HD11 . LEU G  1 31 ? -19.421 15.250  -224.393 1.00 0.00 ?  31 LEU G HD11 1  
ATOM 7894   H HD12 . LEU G  1 31 ? -20.590 14.334  -223.413 1.00 0.00 ?  31 LEU G HD12 1  
ATOM 7895   H HD13 . LEU G  1 31 ? -19.829 13.575  -224.831 1.00 0.00 ?  31 LEU G HD13 1  
ATOM 7896   H HD21 . LEU G  1 31 ? -21.679 15.682  -227.317 1.00 0.00 ?  31 LEU G HD21 1  
ATOM 7897   H HD22 . LEU G  1 31 ? -20.056 16.033  -226.676 1.00 0.00 ?  31 LEU G HD22 1  
ATOM 7898   H HD23 . LEU G  1 31 ? -20.483 14.373  -227.158 1.00 0.00 ?  31 LEU G HD23 1  
ATOM 7899   N N    . ASP G  1 32 ? -24.755 15.390  -223.749 1.00 0.00 ?  32 ASP G N    1  
ATOM 7900   C CA   . ASP G  1 32 ? -25.330 16.606  -223.186 1.00 0.00 ?  32 ASP G CA   1  
ATOM 7901   C C    . ASP G  1 32 ? -25.559 16.465  -221.687 1.00 0.00 ?  32 ASP G C    1  
ATOM 7902   O O    . ASP G  1 32 ? -25.256 17.375  -220.915 1.00 0.00 ?  32 ASP G O    1  
ATOM 7903   C CB   . ASP G  1 32 ? -26.646 16.952  -223.888 1.00 0.00 ?  32 ASP G CB   1  
ATOM 7904   C CG   . ASP G  1 32 ? -26.481 17.483  -225.306 1.00 0.00 ?  32 ASP G CG   1  
ATOM 7905   O OD1  . ASP G  1 32 ? -25.377 17.810  -225.673 1.00 0.00 ?  32 ASP G OD1  1  
ATOM 7906   O OD2  . ASP G  1 32 ? -27.423 17.411  -226.059 1.00 0.00 -1 32 ASP G OD2  1  
ATOM 7907   H H    . ASP G  1 32 ? -25.242 14.915  -224.495 1.00 0.00 ?  32 ASP G H    1  
ATOM 7908   H HA   . ASP G  1 32 ? -24.637 17.437  -223.317 1.00 0.00 ?  32 ASP G HA   1  
ATOM 7909   H HB2  . ASP G  1 32 ? -27.366 16.134  -223.889 1.00 0.00 ?  32 ASP G HB2  1  
ATOM 7910   H HB3  . ASP G  1 32 ? -27.004 17.753  -223.240 1.00 0.00 ?  32 ASP G HB3  1  
ATOM 7911   N N    . LYS G  1 33 ? -26.095 15.319  -221.281 1.00 0.00 ?  33 LYS G N    1  
ATOM 7912   C CA   . LYS G  1 33 ? -26.344 15.048  -219.870 1.00 0.00 ?  33 LYS G CA   1  
ATOM 7913   C C    . LYS G  1 33 ? -25.040 14.826  -219.114 1.00 0.00 ?  33 LYS G C    1  
ATOM 7914   O O    . LYS G  1 33 ? -24.843 15.368  -218.026 1.00 0.00 ?  33 LYS G O    1  
ATOM 7915   C CB   . LYS G  1 33 ? -27.257 13.831  -219.712 1.00 0.00 ?  33 LYS G CB   1  
ATOM 7916   C CG   . LYS G  1 33 ? -28.688 14.053  -220.182 1.00 0.00 ?  33 LYS G CG   1  
ATOM 7917   C CD   . LYS G  1 33 ? -29.518 12.785  -220.047 1.00 0.00 ?  33 LYS G CD   1  
ATOM 7918   C CE   . LYS G  1 33 ? -30.923 12.980  -220.599 1.00 0.00 ?  33 LYS G CE   1  
ATOM 7919   N NZ   . LYS G  1 33 ? -31.733 11.735  -220.512 1.00 0.00 1  33 LYS G NZ   1  
ATOM 7920   H H    . LYS G  1 33 ? -26.337 14.619  -221.967 1.00 0.00 ?  33 LYS G H    1  
ATOM 7921   H HA   . LYS G  1 33 ? -26.829 15.909  -219.408 1.00 0.00 ?  33 LYS G HA   1  
ATOM 7922   H HB2  . LYS G  1 33 ? -26.809 13.019  -220.285 1.00 0.00 ?  33 LYS G HB2  1  
ATOM 7923   H HB3  . LYS G  1 33 ? -27.260 13.569  -218.653 1.00 0.00 ?  33 LYS G HB3  1  
ATOM 7924   H HG2  . LYS G  1 33 ? -29.133 14.844  -219.577 1.00 0.00 ?  33 LYS G HG2  1  
ATOM 7925   H HG3  . LYS G  1 33 ? -28.666 14.364  -221.226 1.00 0.00 ?  33 LYS G HG3  1  
ATOM 7926   H HD2  . LYS G  1 33 ? -29.020 11.984  -220.595 1.00 0.00 ?  33 LYS G HD2  1  
ATOM 7927   H HD3  . LYS G  1 33 ? -29.577 12.519  -218.992 1.00 0.00 ?  33 LYS G HD3  1  
ATOM 7928   H HE2  . LYS G  1 33 ? -31.408 13.769  -220.026 1.00 0.00 ?  33 LYS G HE2  1  
ATOM 7929   H HE3  . LYS G  1 33 ? -30.840 13.287  -221.641 1.00 0.00 ?  33 LYS G HE3  1  
ATOM 7930   H HZ1  . LYS G  1 33 ? -31.810 11.450  -219.546 1.00 0.00 ?  33 LYS G HZ1  1  
ATOM 7931   H HZ2  . LYS G  1 33 ? -32.655 11.906  -220.888 1.00 0.00 ?  33 LYS G HZ2  1  
ATOM 7932   H HZ3  . LYS G  1 33 ? -31.283 11.003  -221.044 1.00 0.00 ?  33 LYS G HZ3  1  
ATOM 7933   N N    . LEU G  1 34 ? -24.153 14.027  -219.696 1.00 0.00 ?  34 LEU G N    1  
ATOM 7934   C CA   . LEU G  1 34 ? -22.874 13.716  -219.068 1.00 0.00 ?  34 LEU G CA   1  
ATOM 7935   C C    . LEU G  1 34 ? -22.061 14.980  -218.820 1.00 0.00 ?  34 LEU G C    1  
ATOM 7936   O O    . LEU G  1 34 ? -21.347 15.084  -217.822 1.00 0.00 ?  34 LEU G O    1  
ATOM 7937   C CB   . LEU G  1 34 ? -22.081 12.734  -219.939 1.00 0.00 ?  34 LEU G CB   1  
ATOM 7938   C CG   . LEU G  1 34 ? -20.743 12.272  -219.349 1.00 0.00 ?  34 LEU G CG   1  
ATOM 7939   C CD1  . LEU G  1 34 ? -20.978 11.528  -218.041 1.00 0.00 ?  34 LEU G CD1  1  
ATOM 7940   C CD2  . LEU G  1 34 ? -20.024 11.383  -220.353 1.00 0.00 ?  34 LEU G CD2  1  
ATOM 7941   H H    . LEU G  1 34 ? -24.369 13.625  -220.597 1.00 0.00 ?  34 LEU G H    1  
ATOM 7942   H HA   . LEU G  1 34 ? -23.047 13.263  -218.093 1.00 0.00 ?  34 LEU G HA   1  
ATOM 7943   H HB2  . LEU G  1 34 ? -22.787 11.905  -219.959 1.00 0.00 ?  34 LEU G HB2  1  
ATOM 7944   H HB3  . LEU G  1 34 ? -21.939 13.115  -220.951 1.00 0.00 ?  34 LEU G HB3  1  
ATOM 7945   H HG   . LEU G  1 34 ? -20.132 13.162  -219.195 1.00 0.00 ?  34 LEU G HG   1  
ATOM 7946   H HD11 . LEU G  1 34 ? -20.022 11.204  -217.629 1.00 0.00 ?  34 LEU G HD11 1  
ATOM 7947   H HD12 . LEU G  1 34 ? -21.472 12.190  -217.330 1.00 0.00 ?  34 LEU G HD12 1  
ATOM 7948   H HD13 . LEU G  1 34 ? -21.607 10.658  -218.226 1.00 0.00 ?  34 LEU G HD13 1  
ATOM 7949   H HD21 . LEU G  1 34 ? -19.841 11.943  -221.270 1.00 0.00 ?  34 LEU G HD21 1  
ATOM 7950   H HD22 . LEU G  1 34 ? -19.073 11.055  -219.932 1.00 0.00 ?  34 LEU G HD22 1  
ATOM 7951   H HD23 . LEU G  1 34 ? -20.641 10.512  -220.576 1.00 0.00 ?  34 LEU G HD23 1  
ATOM 7952   N N    . ALA G  1 35 ? -22.173 15.939  -219.733 1.00 0.00 ?  35 ALA G N    1  
ATOM 7953   C CA   . ALA G  1 35 ? -21.491 17.219  -219.587 1.00 0.00 ?  35 ALA G CA   1  
ATOM 7954   C C    . ALA G  1 35 ? -21.870 17.899  -218.278 1.00 0.00 ?  35 ALA G C    1  
ATOM 7955   O O    . ALA G  1 35 ? -21.041 18.551  -217.643 1.00 0.00 ?  35 ALA G O    1  
ATOM 7956   C CB   . ALA G  1 35 ? -21.806 18.125  -220.769 1.00 0.00 ?  35 ALA G CB   1  
ATOM 7957   H H    . ALA G  1 35 ? -22.745 15.776  -220.549 1.00 0.00 ?  35 ALA G H    1  
ATOM 7958   H HA   . ALA G  1 35 ? -20.416 17.042  -219.561 1.00 0.00 ?  35 ALA G HA   1  
ATOM 7959   H HB1  . ALA G  1 35 ? -22.879 18.299  -220.817 1.00 0.00 ?  35 ALA G HB1  1  
ATOM 7960   H HB2  . ALA G  1 35 ? -21.289 19.077  -220.644 1.00 0.00 ?  35 ALA G HB2  1  
ATOM 7961   H HB3  . ALA G  1 35 ? -21.472 17.649  -221.691 1.00 0.00 ?  35 ALA G HB3  1  
ATOM 7962   N N    . ALA G  1 36 ? -23.128 17.743  -217.878 1.00 0.00 ?  36 ALA G N    1  
ATOM 7963   C CA   . ALA G  1 36 ? -23.617 18.335  -216.639 1.00 0.00 ?  36 ALA G CA   1  
ATOM 7964   C C    . ALA G  1 36 ? -23.061 17.606  -215.423 1.00 0.00 ?  36 ALA G C    1  
ATOM 7965   O O    . ALA G  1 36 ? -22.663 18.232  -214.440 1.00 0.00 ?  36 ALA G O    1  
ATOM 7966   C CB   . ALA G  1 36 ? -25.139 18.329  -216.614 1.00 0.00 ?  36 ALA G CB   1  
ATOM 7967   H H    . ALA G  1 36 ? -23.761 17.200  -218.448 1.00 0.00 ?  36 ALA G H    1  
ATOM 7968   H HA   . ALA G  1 36 ? -23.273 19.368  -216.585 1.00 0.00 ?  36 ALA G HA   1  
ATOM 7969   H HB1  . ALA G  1 36 ? -25.500 17.304  -216.683 1.00 0.00 ?  36 ALA G HB1  1  
ATOM 7970   H HB2  . ALA G  1 36 ? -25.488 18.775  -215.682 1.00 0.00 ?  36 ALA G HB2  1  
ATOM 7971   H HB3  . ALA G  1 36 ? -25.519 18.907  -217.457 1.00 0.00 ?  36 ALA G HB3  1  
ATOM 7972   N N    . LYS G  1 37 ? -23.035 16.279  -215.495 1.00 0.00 ?  37 LYS G N    1  
ATOM 7973   C CA   . LYS G  1 37 ? -22.506 15.463  -214.409 1.00 0.00 ?  37 LYS G CA   1  
ATOM 7974   C C    . LYS G  1 37 ? -21.574 14.380  -214.938 1.00 0.00 ?  37 LYS G C    1  
ATOM 7975   O O    . LYS G  1 37 ? -21.961 13.217  -215.052 1.00 0.00 ?  37 LYS G O    1  
ATOM 7976   C CB   . LYS G  1 37 ? -23.645 14.832  -213.608 1.00 0.00 ?  37 LYS G CB   1  
ATOM 7977   C CG   . LYS G  1 37 ? -24.579 15.835  -212.944 1.00 0.00 ?  37 LYS G CG   1  
ATOM 7978   C CD   . LYS G  1 37 ? -25.592 15.139  -212.048 1.00 0.00 ?  37 LYS G CD   1  
ATOM 7979   C CE   . LYS G  1 37 ? -26.561 16.135  -211.429 1.00 0.00 ?  37 LYS G CE   1  
ATOM 7980   N NZ   . LYS G  1 37 ? -27.553 15.469  -210.541 1.00 0.00 1  37 LYS G NZ   1  
ATOM 7981   H H    . LYS G  1 37 ? -23.392 15.825  -216.323 1.00 0.00 ?  37 LYS G H    1  
ATOM 7982   H HA   . LYS G  1 37 ? -21.911 16.083  -213.738 1.00 0.00 ?  37 LYS G HA   1  
ATOM 7983   H HB2  . LYS G  1 37 ? -24.215 14.209  -214.299 1.00 0.00 ?  37 LYS G HB2  1  
ATOM 7984   H HB3  . LYS G  1 37 ? -23.189 14.201  -212.845 1.00 0.00 ?  37 LYS G HB3  1  
ATOM 7985   H HG2  . LYS G  1 37 ? -23.979 16.524  -212.348 1.00 0.00 ?  37 LYS G HG2  1  
ATOM 7986   H HG3  . LYS G  1 37 ? -25.102 16.390  -213.722 1.00 0.00 ?  37 LYS G HG3  1  
ATOM 7987   H HD2  . LYS G  1 37 ? -26.147 14.416  -212.647 1.00 0.00 ?  37 LYS G HD2  1  
ATOM 7988   H HD3  . LYS G  1 37 ? -25.055 14.617  -211.256 1.00 0.00 ?  37 LYS G HD3  1  
ATOM 7989   H HE2  . LYS G  1 37 ? -25.986 16.858  -210.852 1.00 0.00 ?  37 LYS G HE2  1  
ATOM 7990   H HE3  . LYS G  1 37 ? -27.084 16.649  -212.235 1.00 0.00 ?  37 LYS G HE3  1  
ATOM 7991   H HZ1  . LYS G  1 37 ? -27.068 14.994  -209.793 1.00 0.00 ?  37 LYS G HZ1  1  
ATOM 7992   H HZ2  . LYS G  1 37 ? -28.175 16.163  -210.152 1.00 0.00 ?  37 LYS G HZ2  1  
ATOM 7993   H HZ3  . LYS G  1 37 ? -28.087 14.799  -211.075 1.00 0.00 ?  37 LYS G HZ3  1  
ATOM 7994   N N    . PRO G  1 38 ? -20.345 14.769  -215.261 1.00 0.00 ?  38 PRO G N    1  
ATOM 7995   C CA   . PRO G  1 38 ? -19.364 13.837  -215.803 1.00 0.00 ?  38 PRO G CA   1  
ATOM 7996   C C    . PRO G  1 38 ? -19.097 12.692  -214.834 1.00 0.00 ?  38 PRO G C    1  
ATOM 7997   O O    . PRO G  1 38 ? -18.690 11.604  -215.241 1.00 0.00 ?  38 PRO G O    1  
ATOM 7998   C CB   . PRO G  1 38 ? -18.119 14.698  -216.036 1.00 0.00 ?  38 PRO G CB   1  
ATOM 7999   C CG   . PRO G  1 38 ? -18.646 16.086  -216.170 1.00 0.00 ?  38 PRO G CG   1  
ATOM 8000   C CD   . PRO G  1 38 ? -19.818 16.160  -215.227 1.00 0.00 ?  38 PRO G CD   1  
ATOM 8001   H HA   . PRO G  1 38 ? -19.706 13.351  -216.729 1.00 0.00 ?  38 PRO G HA   1  
ATOM 8002   H HB2  . PRO G  1 38 ? -17.412 14.619  -215.197 1.00 0.00 ?  38 PRO G HB2  1  
ATOM 8003   H HB3  . PRO G  1 38 ? -17.578 14.388  -216.943 1.00 0.00 ?  38 PRO G HB3  1  
ATOM 8004   H HG2  . PRO G  1 38 ? -17.880 16.829  -215.907 1.00 0.00 ?  38 PRO G HG2  1  
ATOM 8005   H HG3  . PRO G  1 38 ? -18.956 16.295  -217.204 1.00 0.00 ?  38 PRO G HG3  1  
ATOM 8006   H HD2  . PRO G  1 38 ? -19.516 16.451  -214.210 1.00 0.00 ?  38 PRO G HD2  1  
ATOM 8007   H HD3  . PRO G  1 38 ? -20.573 16.887  -215.559 1.00 0.00 ?  38 PRO G HD3  1  
ATOM 8008   N N    . SER G  1 39 ? -19.329 12.945  -213.550 1.00 0.00 ?  39 SER G N    1  
ATOM 8009   C CA   . SER G  1 39 ? -18.958 11.999  -212.505 1.00 0.00 ?  39 SER G CA   1  
ATOM 8010   C C    . SER G  1 39 ? -20.090 11.020  -212.220 1.00 0.00 ?  39 SER G C    1  
ATOM 8011   O O    . SER G  1 39 ? -20.028 10.244  -211.267 1.00 0.00 ?  39 SER G O    1  
ATOM 8012   C CB   . SER G  1 39 ? -18.573 12.742  -211.241 1.00 0.00 ?  39 SER G CB   1  
ATOM 8013   O OG   . SER G  1 39 ? -19.665 13.408  -210.668 1.00 0.00 ?  39 SER G OG   1  
ATOM 8014   H H    . SER G  1 39 ? -19.774 13.814  -213.292 1.00 0.00 ?  39 SER G H    1  
ATOM 8015   H HA   . SER G  1 39 ? -18.040 11.451  -212.722 1.00 0.00 ?  39 SER G HA   1  
ATOM 8016   H HB2  . SER G  1 39 ? -18.179 12.025  -210.521 1.00 0.00 ?  39 SER G HB2  1  
ATOM 8017   H HB3  . SER G  1 39 ? -17.802 13.471  -211.485 1.00 0.00 ?  39 SER G HB3  1  
ATOM 8018   H HG   . SER G  1 39 ? -20.017 14.044  -211.296 1.00 0.00 ?  39 SER G HG   1  
ATOM 8019   N N    . ASP G  1 40 ? -21.125 11.061  -213.053 1.00 0.00 ?  40 ASP G N    1  
ATOM 8020   C CA   . ASP G  1 40 ? -22.244 10.135  -212.932 1.00 0.00 ?  40 ASP G CA   1  
ATOM 8021   C C    . ASP G  1 40 ? -21.946 8.816   -213.633 1.00 0.00 ?  40 ASP G C    1  
ATOM 8022   O O    . ASP G  1 40 ? -21.798 8.771   -214.854 1.00 0.00 ?  40 ASP G O    1  
ATOM 8023   C CB   . ASP G  1 40 ? -23.520 10.757  -213.504 1.00 0.00 ?  40 ASP G CB   1  
ATOM 8024   C CG   . ASP G  1 40 ? -24.772 9.910   -213.316 1.00 0.00 ?  40 ASP G CG   1  
ATOM 8025   O OD1  . ASP G  1 40 ? -24.650 8.800   -212.856 1.00 0.00 ?  40 ASP G OD1  1  
ATOM 8026   O OD2  . ASP G  1 40 ? -25.848 10.432  -213.485 1.00 0.00 -1 40 ASP G OD2  1  
ATOM 8027   H H    . ASP G  1 40 ? -21.136 11.753  -213.790 1.00 0.00 ?  40 ASP G H    1  
ATOM 8028   H HA   . ASP G  1 40 ? -22.413 9.896   -211.881 1.00 0.00 ?  40 ASP G HA   1  
ATOM 8029   H HB2  . ASP G  1 40 ? -23.709 11.769  -213.143 1.00 0.00 ?  40 ASP G HB2  1  
ATOM 8030   H HB3  . ASP G  1 40 ? -23.259 10.791  -214.562 1.00 0.00 ?  40 ASP G HB3  1  
ATOM 8031   N N    . PRO G  1 41 ? -21.858 7.744   -212.853 1.00 0.00 ?  41 PRO G N    1  
ATOM 8032   C CA   . PRO G  1 41 ? -21.577 6.421   -213.398 1.00 0.00 ?  41 PRO G CA   1  
ATOM 8033   C C    . PRO G  1 41 ? -22.614 6.023   -214.441 1.00 0.00 ?  41 PRO G C    1  
ATOM 8034   O O    . PRO G  1 41 ? -22.290 5.375   -215.436 1.00 0.00 ?  41 PRO G O    1  
ATOM 8035   C CB   . PRO G  1 41 ? -21.607 5.498   -212.175 1.00 0.00 ?  41 PRO G CB   1  
ATOM 8036   C CG   . PRO G  1 41 ? -21.310 6.398   -211.024 1.00 0.00 ?  41 PRO G CG   1  
ATOM 8037   C CD   . PRO G  1 41 ? -21.948 7.716   -211.373 1.00 0.00 ?  41 PRO G CD   1  
ATOM 8038   H HA   . PRO G  1 41 ? -20.613 6.374   -213.924 1.00 0.00 ?  41 PRO G HA   1  
ATOM 8039   H HB2  . PRO G  1 41 ? -22.587 5.014   -212.060 1.00 0.00 ?  41 PRO G HB2  1  
ATOM 8040   H HB3  . PRO G  1 41 ? -20.858 4.696   -212.257 1.00 0.00 ?  41 PRO G HB3  1  
ATOM 8041   H HG2  . PRO G  1 41 ? -21.722 5.994   -210.088 1.00 0.00 ?  41 PRO G HG2  1  
ATOM 8042   H HG3  . PRO G  1 41 ? -20.225 6.510   -210.877 1.00 0.00 ?  41 PRO G HG3  1  
ATOM 8043   H HD2  . PRO G  1 41 ? -22.993 7.774   -211.036 1.00 0.00 ?  41 PRO G HD2  1  
ATOM 8044   H HD3  . PRO G  1 41 ? -21.418 8.567   -210.921 1.00 0.00 ?  41 PRO G HD3  1  
ATOM 8045   N N    . ALA G  1 42 ? -23.861 6.416   -214.208 1.00 0.00 ?  42 ALA G N    1  
ATOM 8046   C CA   . ALA G  1 42 ? -24.957 6.060   -215.102 1.00 0.00 ?  42 ALA G CA   1  
ATOM 8047   C C    . ALA G  1 42 ? -24.806 6.740   -216.456 1.00 0.00 ?  42 ALA G C    1  
ATOM 8048   O O    . ALA G  1 42 ? -25.018 6.122   -217.499 1.00 0.00 ?  42 ALA G O    1  
ATOM 8049   C CB   . ALA G  1 42 ? -26.294 6.419   -214.471 1.00 0.00 ?  42 ALA G CB   1  
ATOM 8050   H H    . ALA G  1 42 ? -24.056 6.976   -213.390 1.00 0.00 ?  42 ALA G H    1  
ATOM 8051   H HA   . ALA G  1 42 ? -24.931 4.984   -215.274 1.00 0.00 ?  42 ALA G HA   1  
ATOM 8052   H HB1  . ALA G  1 42 ? -26.329 7.490   -214.278 1.00 0.00 ?  42 ALA G HB1  1  
ATOM 8053   H HB2  . ALA G  1 42 ? -27.101 6.146   -215.151 1.00 0.00 ?  42 ALA G HB2  1  
ATOM 8054   H HB3  . ALA G  1 42 ? -26.411 5.876   -213.532 1.00 0.00 ?  42 ALA G HB3  1  
ATOM 8055   N N    . LEU G  1 43 ? -24.438 8.017   -216.434 1.00 0.00 ?  43 LEU G N    1  
ATOM 8056   C CA   . LEU G  1 43 ? -24.237 8.778   -217.661 1.00 0.00 ?  43 LEU G CA   1  
ATOM 8057   C C    . LEU G  1 43 ? -22.969 8.337   -218.381 1.00 0.00 ?  43 LEU G C    1  
ATOM 8058   O O    . LEU G  1 43 ? -22.916 8.317   -219.610 1.00 0.00 ?  43 LEU G O    1  
ATOM 8059   C CB   . LEU G  1 43 ? -24.180 10.279  -217.351 1.00 0.00 ?  43 LEU G CB   1  
ATOM 8060   C CG   . LEU G  1 43 ? -25.486 10.886  -216.822 1.00 0.00 ?  43 LEU G CG   1  
ATOM 8061   C CD1  . LEU G  1 43 ? -25.251 12.324  -216.381 1.00 0.00 ?  43 LEU G CD1  1  
ATOM 8062   C CD2  . LEU G  1 43 ? -26.553 10.820  -217.904 1.00 0.00 ?  43 LEU G CD2  1  
ATOM 8063   H H    . LEU G  1 43 ? -24.295 8.472   -215.544 1.00 0.00 ?  43 LEU G H    1  
ATOM 8064   H HA   . LEU G  1 43 ? -25.062 8.590   -218.347 1.00 0.00 ?  43 LEU G HA   1  
ATOM 8065   H HB2  . LEU G  1 43 ? -23.427 10.268  -216.564 1.00 0.00 ?  43 LEU G HB2  1  
ATOM 8066   H HB3  . LEU G  1 43 ? -23.810 10.853  -218.200 1.00 0.00 ?  43 LEU G HB3  1  
ATOM 8067   H HG   . LEU G  1 43 ? -25.817 10.265  -215.989 1.00 0.00 ?  43 LEU G HG   1  
ATOM 8068   H HD11 . LEU G  1 43 ? -26.184 12.747  -216.007 1.00 0.00 ?  43 LEU G HD11 1  
ATOM 8069   H HD12 . LEU G  1 43 ? -24.501 12.345  -215.590 1.00 0.00 ?  43 LEU G HD12 1  
ATOM 8070   H HD13 . LEU G  1 43 ? -24.902 12.912  -217.229 1.00 0.00 ?  43 LEU G HD13 1  
ATOM 8071   H HD21 . LEU G  1 43 ? -26.724 9.781   -218.184 1.00 0.00 ?  43 LEU G HD21 1  
ATOM 8072   H HD22 . LEU G  1 43 ? -27.480 11.251  -217.526 1.00 0.00 ?  43 LEU G HD22 1  
ATOM 8073   H HD23 . LEU G  1 43 ? -26.220 11.381  -218.778 1.00 0.00 ?  43 LEU G HD23 1  
ATOM 8074   N N    . LEU G  1 44 ? -21.948 7.984   -217.607 1.00 0.00 ?  44 LEU G N    1  
ATOM 8075   C CA   . LEU G  1 44 ? -20.695 7.494   -218.169 1.00 0.00 ?  44 LEU G CA   1  
ATOM 8076   C C    . LEU G  1 44 ? -20.894 6.164   -218.884 1.00 0.00 ?  44 LEU G C    1  
ATOM 8077   O O    . LEU G  1 44 ? -20.442 5.982   -220.014 1.00 0.00 ?  44 LEU G O    1  
ATOM 8078   C CB   . LEU G  1 44 ? -19.638 7.354   -217.065 1.00 0.00 ?  44 LEU G CB   1  
ATOM 8079   C CG   . LEU G  1 44 ? -19.030 8.673   -216.573 1.00 0.00 ?  44 LEU G CG   1  
ATOM 8080   C CD1  . LEU G  1 44 ? -18.207 8.430   -215.314 1.00 0.00 ?  44 LEU G CD1  1  
ATOM 8081   C CD2  . LEU G  1 44 ? -18.169 9.277   -217.672 1.00 0.00 ?  44 LEU G CD2  1  
ATOM 8082   H H    . LEU G  1 44 ? -22.042 8.057   -216.604 1.00 0.00 ?  44 LEU G H    1  
ATOM 8083   H HA   . LEU G  1 44 ? -20.331 8.196   -218.918 1.00 0.00 ?  44 LEU G HA   1  
ATOM 8084   H HB2  . LEU G  1 44 ? -20.256 6.912   -216.284 1.00 0.00 ?  44 LEU G HB2  1  
ATOM 8085   H HB3  . LEU G  1 44 ? -18.852 6.653   -217.346 1.00 0.00 ?  44 LEU G HB3  1  
ATOM 8086   H HG   . LEU G  1 44 ? -19.855 9.358   -216.380 1.00 0.00 ?  44 LEU G HG   1  
ATOM 8087   H HD11 . LEU G  1 44 ? -17.779 9.373   -214.972 1.00 0.00 ?  44 LEU G HD11 1  
ATOM 8088   H HD12 . LEU G  1 44 ? -18.848 8.019   -214.534 1.00 0.00 ?  44 LEU G HD12 1  
ATOM 8089   H HD13 . LEU G  1 44 ? -17.405 7.727   -215.534 1.00 0.00 ?  44 LEU G HD13 1  
ATOM 8090   H HD21 . LEU G  1 44 ? -18.783 9.468   -218.552 1.00 0.00 ?  44 LEU G HD21 1  
ATOM 8091   H HD22 . LEU G  1 44 ? -17.737 10.215  -217.320 1.00 0.00 ?  44 LEU G HD22 1  
ATOM 8092   H HD23 . LEU G  1 44 ? -17.369 8.584   -217.931 1.00 0.00 ?  44 LEU G HD23 1  
ATOM 8093   N N    . ALA G  1 45 ? -21.574 5.236   -218.218 1.00 0.00 ?  45 ALA G N    1  
ATOM 8094   C CA   . ALA G  1 45 ? -21.801 3.907   -218.773 1.00 0.00 ?  45 ALA G CA   1  
ATOM 8095   C C    . ALA G  1 45 ? -22.681 3.972   -220.015 1.00 0.00 ?  45 ALA G C    1  
ATOM 8096   O O    . ALA G  1 45 ? -22.384 3.345   -221.032 1.00 0.00 ?  45 ALA G O    1  
ATOM 8097   C CB   . ALA G  1 45 ? -22.423 2.995   -217.726 1.00 0.00 ?  45 ALA G CB   1  
ATOM 8098   H H    . ALA G  1 45 ? -21.942 5.457   -217.304 1.00 0.00 ?  45 ALA G H    1  
ATOM 8099   H HA   . ALA G  1 45 ? -20.843 3.486   -219.076 1.00 0.00 ?  45 ALA G HA   1  
ATOM 8100   H HB1  . ALA G  1 45 ? -23.376 3.411   -217.401 1.00 0.00 ?  45 ALA G HB1  1  
ATOM 8101   H HB2  . ALA G  1 45 ? -22.586 2.007   -218.156 1.00 0.00 ?  45 ALA G HB2  1  
ATOM 8102   H HB3  . ALA G  1 45 ? -21.752 2.912   -216.871 1.00 0.00 ?  45 ALA G HB3  1  
ATOM 8103   N N    . ALA G  1 46 ? -23.766 4.735   -219.926 1.00 0.00 ?  46 ALA G N    1  
ATOM 8104   C CA   . ALA G  1 46 ? -24.700 4.870   -221.037 1.00 0.00 ?  46 ALA G CA   1  
ATOM 8105   C C    . ALA G  1 46 ? -24.040 5.544   -222.233 1.00 0.00 ?  46 ALA G C    1  
ATOM 8106   O O    . ALA G  1 46 ? -24.149 5.069   -223.363 1.00 0.00 ?  46 ALA G O    1  
ATOM 8107   C CB   . ALA G  1 46 ? -25.933 5.648   -220.600 1.00 0.00 ?  46 ALA G CB   1  
ATOM 8108   H H    . ALA G  1 46 ? -23.948 5.233   -219.066 1.00 0.00 ?  46 ALA G H    1  
ATOM 8109   H HA   . ALA G  1 46 ? -25.012 3.876   -221.355 1.00 0.00 ?  46 ALA G HA   1  
ATOM 8110   H HB1  . ALA G  1 46 ? -25.637 6.641   -220.264 1.00 0.00 ?  46 ALA G HB1  1  
ATOM 8111   H HB2  . ALA G  1 46 ? -26.620 5.741   -221.441 1.00 0.00 ?  46 ALA G HB2  1  
ATOM 8112   H HB3  . ALA G  1 46 ? -26.427 5.120   -219.784 1.00 0.00 ?  46 ALA G HB3  1  
ATOM 8113   N N    . TYR G  1 47 ? -23.354 6.653   -221.977 1.00 0.00 ?  47 TYR G N    1  
ATOM 8114   C CA   . TYR G  1 47 ? -22.713 7.419   -223.038 1.00 0.00 ?  47 TYR G CA   1  
ATOM 8115   C C    . TYR G  1 47 ? -21.609 6.613   -223.710 1.00 0.00 ?  47 TYR G C    1  
ATOM 8116   O O    . TYR G  1 47 ? -21.545 6.532   -224.936 1.00 0.00 ?  47 TYR G O    1  
ATOM 8117   C CB   . TYR G  1 47 ? -22.144 8.728   -222.485 1.00 0.00 ?  47 TYR G CB   1  
ATOM 8118   C CG   . TYR G  1 47 ? -21.303 9.499   -223.477 1.00 0.00 ?  47 TYR G CG   1  
ATOM 8119   C CD1  . TYR G  1 47 ? -21.853 9.980   -224.656 1.00 0.00 ?  47 TYR G CD1  1  
ATOM 8120   C CD2  . TYR G  1 47 ? -19.960 9.746   -223.231 1.00 0.00 ?  47 TYR G CD2  1  
ATOM 8121   C CE1  . TYR G  1 47 ? -21.090 10.685  -225.567 1.00 0.00 ?  47 TYR G CE1  1  
ATOM 8122   C CE2  . TYR G  1 47 ? -19.187 10.450  -224.134 1.00 0.00 ?  47 TYR G CE2  1  
ATOM 8123   C CZ   . TYR G  1 47 ? -19.755 10.918  -225.301 1.00 0.00 ?  47 TYR G CZ   1  
ATOM 8124   O OH   . TYR G  1 47 ? -18.990 11.620  -226.203 1.00 0.00 ?  47 TYR G OH   1  
ATOM 8125   H H    . TYR G  1 47 ? -23.275 6.973   -221.022 1.00 0.00 ?  47 TYR G H    1  
ATOM 8126   H HA   . TYR G  1 47 ? -23.440 7.657   -223.814 1.00 0.00 ?  47 TYR G HA   1  
ATOM 8127   H HB2  . TYR G  1 47 ? -22.991 9.341   -222.172 1.00 0.00 ?  47 TYR G HB2  1  
ATOM 8128   H HB3  . TYR G  1 47 ? -21.539 8.474   -221.615 1.00 0.00 ?  47 TYR G HB3  1  
ATOM 8129   H HD1  . TYR G  1 47 ? -22.908 9.793   -224.859 1.00 0.00 ?  47 TYR G HD1  1  
ATOM 8130   H HD2  . TYR G  1 47 ? -19.517 9.373   -222.308 1.00 0.00 ?  47 TYR G HD2  1  
ATOM 8131   H HE1  . TYR G  1 47 ? -21.535 11.057  -226.489 1.00 0.00 ?  47 TYR G HE1  1  
ATOM 8132   H HE2  . TYR G  1 47 ? -18.133 10.632  -223.923 1.00 0.00 ?  47 TYR G HE2  1  
ATOM 8133   H HH   . TYR G  1 47 ? -18.078 11.725  -225.920 1.00 0.00 ?  47 TYR G HH   1  
ATOM 8134   N N    . GLN G  1 48 ? -20.740 6.018   -222.899 1.00 0.00 ?  48 GLN G N    1  
ATOM 8135   C CA   . GLN G  1 48 ? -19.602 5.267   -223.414 1.00 0.00 ?  48 GLN G CA   1  
ATOM 8136   C C    . GLN G  1 48 ? -20.057 4.040   -224.192 1.00 0.00 ?  48 GLN G C    1  
ATOM 8137   O O    . GLN G  1 48 ? -19.472 3.689   -225.216 1.00 0.00 ?  48 GLN G O    1  
ATOM 8138   C CB   . GLN G  1 48 ? -18.679 4.840   -222.269 1.00 0.00 ?  48 GLN G CB   1  
ATOM 8139   C CG   . GLN G  1 48 ? -17.359 4.242   -222.723 1.00 0.00 ?  48 GLN G CG   1  
ATOM 8140   C CD   . GLN G  1 48 ? -17.490 2.784   -223.121 1.00 0.00 ?  48 GLN G CD   1  
ATOM 8141   O OE1  . GLN G  1 48 ? -18.254 2.027   -222.515 1.00 0.00 ?  48 GLN G OE1  1  
ATOM 8142   N NE2  . GLN G  1 48 ? -16.741 2.380   -224.140 1.00 0.00 ?  48 GLN G NE2  1  
ATOM 8143   H H    . GLN G  1 48 ? -20.873 6.087   -221.900 1.00 0.00 ?  48 GLN G H    1  
ATOM 8144   H HA   . GLN G  1 48 ? -19.042 5.888   -224.114 1.00 0.00 ?  48 GLN G HA   1  
ATOM 8145   H HB2  . GLN G  1 48 ? -18.494 5.729   -221.665 1.00 0.00 ?  48 GLN G HB2  1  
ATOM 8146   H HB3  . GLN G  1 48 ? -19.230 4.109   -221.677 1.00 0.00 ?  48 GLN G HB3  1  
ATOM 8147   H HG2  . GLN G  1 48 ? -16.709 4.730   -223.449 1.00 0.00 ?  48 GLN G HG2  1  
ATOM 8148   H HG3  . GLN G  1 48 ? -16.898 4.290   -221.736 1.00 0.00 ?  48 GLN G HG3  1  
ATOM 8149   H HE21 . GLN G  1 48 ? -16.133 3.027   -224.602 1.00 0.00 ?  48 GLN G HE21 1  
ATOM 8150   H HE22 . GLN G  1 48 ? -16.784 1.429   -224.448 1.00 0.00 ?  48 GLN G HE22 1  
ATOM 8151   N N    . SER G  1 49 ? -21.106 3.389   -223.699 1.00 0.00 ?  49 SER G N    1  
ATOM 8152   C CA   . SER G  1 49 ? -21.674 2.229   -224.375 1.00 0.00 ?  49 SER G CA   1  
ATOM 8153   C C    . SER G  1 49 ? -22.211 2.600   -225.751 1.00 0.00 ?  49 SER G C    1  
ATOM 8154   O O    . SER G  1 49 ? -21.994 1.882   -226.727 1.00 0.00 ?  49 SER G O    1  
ATOM 8155   C CB   . SER G  1 49 ? -22.773 1.617   -223.528 1.00 0.00 ?  49 SER G CB   1  
ATOM 8156   O OG   . SER G  1 49 ? -23.385 0.530   -224.164 1.00 0.00 ?  49 SER G OG   1  
ATOM 8157   H H    . SER G  1 49 ? -21.520 3.707   -222.835 1.00 0.00 ?  49 SER G H    1  
ATOM 8158   H HA   . SER G  1 49 ? -20.977 1.394   -224.462 1.00 0.00 ?  49 SER G HA   1  
ATOM 8159   H HB2  . SER G  1 49 ? -22.339 1.279   -222.587 1.00 0.00 ?  49 SER G HB2  1  
ATOM 8160   H HB3  . SER G  1 49 ? -23.524 2.379   -223.326 1.00 0.00 ?  49 SER G HB3  1  
ATOM 8161   H HG   . SER G  1 49 ? -23.798 0.827   -224.979 1.00 0.00 ?  49 SER G HG   1  
ATOM 8162   N N    . LYS G  1 50 ? -22.911 3.727   -225.823 1.00 0.00 ?  50 LYS G N    1  
ATOM 8163   C CA   . LYS G  1 50 ? -23.473 4.201   -227.082 1.00 0.00 ?  50 LYS G CA   1  
ATOM 8164   C C    . LYS G  1 50 ? -22.410 4.874   -227.941 1.00 0.00 ?  50 LYS G C    1  
ATOM 8165   O O    . LYS G  1 50 ? -22.551 4.967   -229.160 1.00 0.00 ?  50 LYS G O    1  
ATOM 8166   C CB   . LYS G  1 50 ? -24.629 5.168   -226.823 1.00 0.00 ?  50 LYS G CB   1  
ATOM 8167   C CG   . LYS G  1 50 ? -25.848 4.530   -226.169 1.00 0.00 ?  50 LYS G CG   1  
ATOM 8168   C CD   . LYS G  1 50 ? -26.938 5.559   -225.907 1.00 0.00 ?  50 LYS G CD   1  
ATOM 8169   C CE   . LYS G  1 50 ? -28.120 4.941   -225.176 1.00 0.00 ?  50 LYS G CE   1  
ATOM 8170   N NZ   . LYS G  1 50 ? -28.750 3.846   -225.962 1.00 0.00 1  50 LYS G NZ   1  
ATOM 8171   H H    . LYS G  1 50 ? -23.059 4.269   -224.984 1.00 0.00 ?  50 LYS G H    1  
ATOM 8172   H HA   . LYS G  1 50 ? -23.850 3.356   -227.660 1.00 0.00 ?  50 LYS G HA   1  
ATOM 8173   H HB2  . LYS G  1 50 ? -24.245 5.960   -226.179 1.00 0.00 ?  50 LYS G HB2  1  
ATOM 8174   H HB3  . LYS G  1 50 ? -24.915 5.591   -227.786 1.00 0.00 ?  50 LYS G HB3  1  
ATOM 8175   H HG2  . LYS G  1 50 ? -26.232 3.755   -226.834 1.00 0.00 ?  50 LYS G HG2  1  
ATOM 8176   H HG3  . LYS G  1 50 ? -25.540 4.079   -225.227 1.00 0.00 ?  50 LYS G HG3  1  
ATOM 8177   H HD2  . LYS G  1 50 ? -26.517 6.365   -225.304 1.00 0.00 ?  50 LYS G HD2  1  
ATOM 8178   H HD3  . LYS G  1 50 ? -27.273 5.961   -226.863 1.00 0.00 ?  50 LYS G HD3  1  
ATOM 8179   H HE2  . LYS G  1 50 ? -27.765 4.547   -224.225 1.00 0.00 ?  50 LYS G HE2  1  
ATOM 8180   H HE3  . LYS G  1 50 ? -28.855 5.724   -224.992 1.00 0.00 ?  50 LYS G HE3  1  
ATOM 8181   H HZ1  . LYS G  1 50 ? -28.070 3.119   -226.132 1.00 0.00 ?  50 LYS G HZ1  1  
ATOM 8182   H HZ2  . LYS G  1 50 ? -29.528 3.464   -225.443 1.00 0.00 ?  50 LYS G HZ2  1  
ATOM 8183   H HZ3  . LYS G  1 50 ? -29.080 4.211   -226.844 1.00 0.00 ?  50 LYS G HZ3  1  
ATOM 8184   N N    . LEU G  1 51 ? -21.346 5.343   -227.298 1.00 0.00 ?  51 LEU G N    1  
ATOM 8185   C CA   . LEU G  1 51 ? -20.245 5.985   -228.004 1.00 0.00 ?  51 LEU G CA   1  
ATOM 8186   C C    . LEU G  1 51 ? -19.386 4.960   -228.734 1.00 0.00 ?  51 LEU G C    1  
ATOM 8187   O O    . LEU G  1 51 ? -18.906 5.212   -229.839 1.00 0.00 ?  51 LEU G O    1  
ATOM 8188   C CB   . LEU G  1 51 ? -19.390 6.799   -227.025 1.00 0.00 ?  51 LEU G CB   1  
ATOM 8189   C CG   . LEU G  1 51 ? -18.300 7.663   -227.672 1.00 0.00 ?  51 LEU G CG   1  
ATOM 8190   C CD1  . LEU G  1 51 ? -18.936 8.738   -228.543 1.00 0.00 ?  51 LEU G CD1  1  
ATOM 8191   C CD2  . LEU G  1 51 ? -17.436 8.289   -226.588 1.00 0.00 ?  51 LEU G CD2  1  
ATOM 8192   H H    . LEU G  1 51 ? -21.300 5.251   -226.293 1.00 0.00 ?  51 LEU G H    1  
ATOM 8193   H HA   . LEU G  1 51 ? -20.642 6.654   -228.767 1.00 0.00 ?  51 LEU G HA   1  
ATOM 8194   H HB2  . LEU G  1 51 ? -20.165 7.433   -226.597 1.00 0.00 ?  51 LEU G HB2  1  
ATOM 8195   H HB3  . LEU G  1 51 ? -18.962 6.170   -226.244 1.00 0.00 ?  51 LEU G HB3  1  
ATOM 8196   H HG   . LEU G  1 51 ? -17.667 6.999   -228.262 1.00 0.00 ?  51 LEU G HG   1  
ATOM 8197   H HD11 . LEU G  1 51 ? -18.155 9.347   -228.999 1.00 0.00 ?  51 LEU G HD11 1  
ATOM 8198   H HD12 . LEU G  1 51 ? -19.531 8.268   -229.326 1.00 0.00 ?  51 LEU G HD12 1  
ATOM 8199   H HD13 . LEU G  1 51 ? -19.577 9.371   -227.930 1.00 0.00 ?  51 LEU G HD13 1  
ATOM 8200   H HD21 . LEU G  1 51 ? -16.969 7.502   -225.995 1.00 0.00 ?  51 LEU G HD21 1  
ATOM 8201   H HD22 . LEU G  1 51 ? -16.661 8.902   -227.050 1.00 0.00 ?  51 LEU G HD22 1  
ATOM 8202   H HD23 . LEU G  1 51 ? -18.056 8.911   -225.942 1.00 0.00 ?  51 LEU G HD23 1  
ATOM 8203   N N    . SER G  1 52 ? -19.195 3.803   -228.108 1.00 0.00 ?  52 SER G N    1  
ATOM 8204   C CA   . SER G  1 52 ? -18.469 2.705   -228.734 1.00 0.00 ?  52 SER G CA   1  
ATOM 8205   C C    . SER G  1 52 ? -19.213 2.177   -229.954 1.00 0.00 ?  52 SER G C    1  
ATOM 8206   O O    . SER G  1 52 ? -18.607 1.617   -230.868 1.00 0.00 ?  52 SER G O    1  
ATOM 8207   C CB   . SER G  1 52 ? -18.242 1.591   -227.731 1.00 0.00 ?  52 SER G CB   1  
ATOM 8208   O OG   . SER G  1 52 ? -19.437 0.953   -227.373 1.00 0.00 ?  52 SER G OG   1  
ATOM 8209   H H    . SER G  1 52 ? -19.563 3.682   -227.175 1.00 0.00 ?  52 SER G H    1  
ATOM 8210   H HA   . SER G  1 52 ? -17.444 2.963   -229.007 1.00 0.00 ?  52 SER G HA   1  
ATOM 8211   H HB2  . SER G  1 52 ? -17.567 0.857   -228.172 1.00 0.00 ?  52 SER G HB2  1  
ATOM 8212   H HB3  . SER G  1 52 ? -17.784 2.013   -226.838 1.00 0.00 ?  52 SER G HB3  1  
ATOM 8213   H HG   . SER G  1 52 ? -19.250 0.257   -226.738 1.00 0.00 ?  52 SER G HG   1  
ATOM 8214   N N    . GLU G  1 53 ? -20.529 2.359   -229.963 1.00 0.00 ?  53 GLU G N    1  
ATOM 8215   C CA   . GLU G  1 53 ? -21.331 2.095   -231.151 1.00 0.00 ?  53 GLU G CA   1  
ATOM 8216   C C    . GLU G  1 53 ? -21.253 3.254   -232.137 1.00 0.00 ?  53 GLU G C    1  
ATOM 8217   O O    . GLU G  1 53 ? -21.202 3.048   -233.349 1.00 0.00 ?  53 GLU G O    1  
ATOM 8218   C CB   . GLU G  1 53 ? -22.788 1.829   -230.767 1.00 0.00 ?  53 GLU G CB   1  
ATOM 8219   C CG   . GLU G  1 53 ? -23.012 0.522   -230.019 1.00 0.00 ?  53 GLU G CG   1  
ATOM 8220   C CD   . GLU G  1 53 ? -24.448 0.373   -229.598 1.00 0.00 ?  53 GLU G CD   1  
ATOM 8221   O OE1  . GLU G  1 53 ? -25.185 1.321   -229.722 1.00 0.00 ?  53 GLU G OE1  1  
ATOM 8222   O OE2  . GLU G  1 53 ? -24.836 -0.720  -229.258 1.00 0.00 -1 53 GLU G OE2  1  
ATOM 8223   H H    . GLU G  1 53 ? -20.985 2.688   -229.124 1.00 0.00 ?  53 GLU G H    1  
ATOM 8224   H HA   . GLU G  1 53 ? -20.943 1.219   -231.672 1.00 0.00 ?  53 GLU G HA   1  
ATOM 8225   H HB2  . GLU G  1 53 ? -23.110 2.663   -230.143 1.00 0.00 ?  53 GLU G HB2  1  
ATOM 8226   H HB3  . GLU G  1 53 ? -23.366 1.822   -231.691 1.00 0.00 ?  53 GLU G HB3  1  
ATOM 8227   H HG2  . GLU G  1 53 ? -22.707 -0.358  -230.583 1.00 0.00 ?  53 GLU G HG2  1  
ATOM 8228   H HG3  . GLU G  1 53 ? -22.383 0.622   -229.135 1.00 0.00 ?  53 GLU G HG3  1  
ATOM 8229   N N    . TYR G  1 54 ? -21.244 4.473   -231.609 1.00 0.00 ?  54 TYR G N    1  
ATOM 8230   C CA   . TYR G  1 54 ? -21.108 5.666   -232.436 1.00 0.00 ?  54 TYR G CA   1  
ATOM 8231   C C    . TYR G  1 54 ? -19.766 5.686   -233.158 1.00 0.00 ?  54 TYR G C    1  
ATOM 8232   O O    . TYR G  1 54 ? -19.617 6.334   -234.194 1.00 0.00 ?  54 TYR G O    1  
ATOM 8233   C CB   . TYR G  1 54 ? -21.265 6.928   -231.586 1.00 0.00 ?  54 TYR G CB   1  
ATOM 8234   C CG   . TYR G  1 54 ? -21.251 8.212   -232.386 1.00 0.00 ?  54 TYR G CG   1  
ATOM 8235   C CD1  . TYR G  1 54 ? -22.325 8.561   -233.192 1.00 0.00 ?  54 TYR G CD1  1  
ATOM 8236   C CD2  . TYR G  1 54 ? -20.164 9.072   -232.331 1.00 0.00 ?  54 TYR G CD2  1  
ATOM 8237   C CE1  . TYR G  1 54 ? -22.317 9.732   -233.926 1.00 0.00 ?  54 TYR G CE1  1  
ATOM 8238   C CE2  . TYR G  1 54 ? -20.145 10.245  -233.060 1.00 0.00 ?  54 TYR G CE2  1  
ATOM 8239   C CZ   . TYR G  1 54 ? -21.224 10.573  -233.856 1.00 0.00 ?  54 TYR G CZ   1  
ATOM 8240   O OH   . TYR G  1 54 ? -21.210 11.741  -234.583 1.00 0.00 ?  54 TYR G OH   1  
ATOM 8241   H H    . TYR G  1 54 ? -21.333 4.577   -230.608 1.00 0.00 ?  54 TYR G H    1  
ATOM 8242   H HA   . TYR G  1 54 ? -21.876 5.669   -233.210 1.00 0.00 ?  54 TYR G HA   1  
ATOM 8243   H HB2  . TYR G  1 54 ? -22.214 6.843   -231.054 1.00 0.00 ?  54 TYR G HB2  1  
ATOM 8244   H HB3  . TYR G  1 54 ? -20.445 6.938   -230.869 1.00 0.00 ?  54 TYR G HB3  1  
ATOM 8245   H HD1  . TYR G  1 54 ? -23.184 7.893   -233.242 1.00 0.00 ?  54 TYR G HD1  1  
ATOM 8246   H HD2  . TYR G  1 54 ? -19.315 8.807   -231.701 1.00 0.00 ?  54 TYR G HD2  1  
ATOM 8247   H HE1  . TYR G  1 54 ? -23.167 9.994   -234.555 1.00 0.00 ?  54 TYR G HE1  1  
ATOM 8248   H HE2  . TYR G  1 54 ? -19.281 10.908  -233.004 1.00 0.00 ?  54 TYR G HE2  1  
ATOM 8249   H HH   . TYR G  1 54 ? -20.800 12.471  -234.112 1.00 0.00 ?  54 TYR G HH   1  
ATOM 8250   N N    . ASN G  1 55 ? -18.792 4.973   -232.604 1.00 0.00 ?  55 ASN G N    1  
ATOM 8251   C CA   . ASN G  1 55 ? -17.509 4.780   -233.270 1.00 0.00 ?  55 ASN G CA   1  
ATOM 8252   C C    . ASN G  1 55 ? -17.690 4.118   -234.631 1.00 0.00 ?  55 ASN G C    1  
ATOM 8253   O O    . ASN G  1 55 ? -17.010 4.467   -235.596 1.00 0.00 ?  55 ASN G O    1  
ATOM 8254   C CB   . ASN G  1 55 ? -16.556 3.967   -232.414 1.00 0.00 ?  55 ASN G CB   1  
ATOM 8255   C CG   . ASN G  1 55 ? -16.003 4.724   -231.239 1.00 0.00 ?  55 ASN G CG   1  
ATOM 8256   O OD1  . ASN G  1 55 ? -16.021 5.959   -231.206 1.00 0.00 ?  55 ASN G OD1  1  
ATOM 8257   N ND2  . ASN G  1 55 ? -15.438 3.993   -230.311 1.00 0.00 ?  55 ASN G ND2  1  
ATOM 8258   H H    . ASN G  1 55 ? -18.943 4.553   -231.697 1.00 0.00 ?  55 ASN G H    1  
ATOM 8259   H HA   . ASN G  1 55 ? -17.040 5.747   -233.457 1.00 0.00 ?  55 ASN G HA   1  
ATOM 8260   H HB2  . ASN G  1 55 ? -16.812 2.955   -232.100 1.00 0.00 ?  55 ASN G HB2  1  
ATOM 8261   H HB3  . ASN G  1 55 ? -15.794 3.923   -233.193 1.00 0.00 ?  55 ASN G HB3  1  
ATOM 8262   H HD21 . ASN G  1 55 ? -15.397 2.999   -230.414 1.00 0.00 ?  55 ASN G HD21 1  
ATOM 8263   H HD22 . ASN G  1 55 ? -15.049 4.429   -229.500 1.00 0.00 ?  55 ASN G HD22 1  
ATOM 8264   N N    . LEU G  1 56 ? -18.610 3.163   -234.701 1.00 0.00 ?  56 LEU G N    1  
ATOM 8265   C CA   . LEU G  1 56 ? -18.900 2.469   -235.950 1.00 0.00 ?  56 LEU G CA   1  
ATOM 8266   C C    . LEU G  1 56 ? -19.876 3.264   -236.808 1.00 0.00 ?  56 LEU G C    1  
ATOM 8267   O O    . LEU G  1 56 ? -19.898 3.124   -238.031 1.00 0.00 ?  56 LEU G O    1  
ATOM 8268   C CB   . LEU G  1 56 ? -19.460 1.070   -235.662 1.00 0.00 ?  56 LEU G CB   1  
ATOM 8269   C CG   . LEU G  1 56 ? -18.499 0.118   -234.939 1.00 0.00 ?  56 LEU G CG   1  
ATOM 8270   C CD1  . LEU G  1 56 ? -19.177 -1.223  -234.696 1.00 0.00 ?  56 LEU G CD1  1  
ATOM 8271   C CD2  . LEU G  1 56 ? -17.237 -0.058  -235.770 1.00 0.00 ?  56 LEU G CD2  1  
ATOM 8272   H H    . LEU G  1 56 ? -19.122 2.910   -233.868 1.00 0.00 ?  56 LEU G H    1  
ATOM 8273   H HA   . LEU G  1 56 ? -17.985 2.370   -236.533 1.00 0.00 ?  56 LEU G HA   1  
ATOM 8274   H HB2  . LEU G  1 56 ? -20.284 1.342   -235.003 1.00 0.00 ?  56 LEU G HB2  1  
ATOM 8275   H HB3  . LEU G  1 56 ? -19.856 0.600   -236.562 1.00 0.00 ?  56 LEU G HB3  1  
ATOM 8276   H HG   . LEU G  1 56 ? -18.216 0.595   -234.000 1.00 0.00 ?  56 LEU G HG   1  
ATOM 8277   H HD11 . LEU G  1 56 ? -18.487 -1.892  -234.182 1.00 0.00 ?  56 LEU G HD11 1  
ATOM 8278   H HD12 . LEU G  1 56 ? -20.065 -1.076  -234.080 1.00 0.00 ?  56 LEU G HD12 1  
ATOM 8279   H HD13 . LEU G  1 56 ? -19.466 -1.663  -235.650 1.00 0.00 ?  56 LEU G HD13 1  
ATOM 8280   H HD21 . LEU G  1 56 ? -16.753 0.909   -235.908 1.00 0.00 ?  56 LEU G HD21 1  
ATOM 8281   H HD22 . LEU G  1 56 ? -16.554 -0.735  -235.255 1.00 0.00 ?  56 LEU G HD22 1  
ATOM 8282   H HD23 . LEU G  1 56 ? -17.497 -0.476  -236.743 1.00 0.00 ?  56 LEU G HD23 1  
ATOM 8283   N N    . TYR G  1 57 ? -20.681 4.099   -236.161 1.00 0.00 ?  57 TYR G N    1  
ATOM 8284   C CA   . TYR G  1 57 ? -21.564 5.017   -236.870 1.00 0.00 ?  57 TYR G CA   1  
ATOM 8285   C C    . TYR G  1 57 ? -20.810 5.781   -237.951 1.00 0.00 ?  57 TYR G C    1  
ATOM 8286   O O    . TYR G  1 57 ? -21.360 6.078   -239.012 1.00 0.00 ?  57 TYR G O    1  
ATOM 8287   C CB   . TYR G  1 57 ? -22.215 5.997   -235.892 1.00 0.00 ?  57 TYR G CB   1  
ATOM 8288   C CG   . TYR G  1 57 ? -23.210 6.936   -236.536 1.00 0.00 ?  57 TYR G CG   1  
ATOM 8289   C CD1  . TYR G  1 57 ? -24.510 6.528   -236.796 1.00 0.00 ?  57 TYR G CD1  1  
ATOM 8290   C CD2  . TYR G  1 57 ? -22.847 8.230   -236.881 1.00 0.00 ?  57 TYR G CD2  1  
ATOM 8291   C CE1  . TYR G  1 57 ? -25.424 7.382   -237.384 1.00 0.00 ?  57 TYR G CE1  1  
ATOM 8292   C CE2  . TYR G  1 57 ? -23.752 9.092   -237.470 1.00 0.00 ?  57 TYR G CE2  1  
ATOM 8293   C CZ   . TYR G  1 57 ? -25.040 8.664   -237.720 1.00 0.00 ?  57 TYR G CZ   1  
ATOM 8294   O OH   . TYR G  1 57 ? -25.945 9.520   -238.305 1.00 0.00 ?  57 TYR G OH   1  
ATOM 8295   H H    . TYR G  1 57 ? -20.682 4.097   -235.151 1.00 0.00 ?  57 TYR G H    1  
ATOM 8296   H HA   . TYR G  1 57 ? -22.351 4.457   -237.377 1.00 0.00 ?  57 TYR G HA   1  
ATOM 8297   H HB2  . TYR G  1 57 ? -22.718 5.404   -235.127 1.00 0.00 ?  57 TYR G HB2  1  
ATOM 8298   H HB3  . TYR G  1 57 ? -21.413 6.576   -235.434 1.00 0.00 ?  57 TYR G HB3  1  
ATOM 8299   H HD1  . TYR G  1 57 ? -24.807 5.514   -236.528 1.00 0.00 ?  57 TYR G HD1  1  
ATOM 8300   H HD2  . TYR G  1 57 ? -21.828 8.561   -236.681 1.00 0.00 ?  57 TYR G HD2  1  
ATOM 8301   H HE1  . TYR G  1 57 ? -26.441 7.047   -237.583 1.00 0.00 ?  57 TYR G HE1  1  
ATOM 8302   H HE2  . TYR G  1 57 ? -23.446 10.105  -237.735 1.00 0.00 ?  57 TYR G HE2  1  
ATOM 8303   H HH   . TYR G  1 57 ? -25.906 10.410  -237.947 1.00 0.00 ?  57 TYR G HH   1  
ATOM 8304   N N    . ARG G  1 58 ? -19.549 6.096   -237.676 1.00 0.00 ?  58 ARG G N    1  
ATOM 8305   C CA   . ARG G  1 58 ? -18.708 6.798   -238.638 1.00 0.00 ?  58 ARG G CA   1  
ATOM 8306   C C    . ARG G  1 58 ? -17.782 5.833   -239.367 1.00 0.00 ?  58 ARG G C    1  
ATOM 8307   O O    . ARG G  1 58 ? -17.654 5.886   -240.591 1.00 0.00 ?  58 ARG G O    1  
ATOM 8308   C CB   . ARG G  1 58 ? -17.930 7.937   -237.995 1.00 0.00 ?  58 ARG G CB   1  
ATOM 8309   C CG   . ARG G  1 58 ? -18.783 8.960   -237.261 1.00 0.00 ?  58 ARG G CG   1  
ATOM 8310   C CD   . ARG G  1 58 ? -19.599 9.827   -238.149 1.00 0.00 ?  58 ARG G CD   1  
ATOM 8311   N NE   . ARG G  1 58 ? -20.424 10.799  -237.449 1.00 0.00 ?  58 ARG G NE   1  
ATOM 8312   C CZ   . ARG G  1 58 ? -21.260 11.668  -238.051 1.00 0.00 ?  58 ARG G CZ   1  
ATOM 8313   N NH1  . ARG G  1 58 ? -21.357 11.717  -239.361 1.00 0.00 1  58 ARG G NH1  1  
ATOM 8314   N NH2  . ARG G  1 58 ? -21.963 12.488  -237.289 1.00 0.00 ?  58 ARG G NH2  1  
ATOM 8315   H H    . ARG G  1 58 ? -19.164 5.842   -236.778 1.00 0.00 ?  58 ARG G H    1  
ATOM 8316   H HA   . ARG G  1 58 ? -19.330 7.267   -239.400 1.00 0.00 ?  58 ARG G HA   1  
ATOM 8317   H HB2  . ARG G  1 58 ? -17.226 7.488   -237.296 1.00 0.00 ?  58 ARG G HB2  1  
ATOM 8318   H HB3  . ARG G  1 58 ? -17.381 8.436   -238.794 1.00 0.00 ?  58 ARG G HB3  1  
ATOM 8319   H HG2  . ARG G  1 58 ? -19.463 8.429   -236.593 1.00 0.00 ?  58 ARG G HG2  1  
ATOM 8320   H HG3  . ARG G  1 58 ? -18.125 9.602   -236.675 1.00 0.00 ?  58 ARG G HG3  1  
ATOM 8321   H HD2  . ARG G  1 58 ? -18.934 10.381  -238.811 1.00 0.00 ?  58 ARG G HD2  1  
ATOM 8322   H HD3  . ARG G  1 58 ? -20.264 9.201   -238.742 1.00 0.00 ?  58 ARG G HD3  1  
ATOM 8323   H HE   . ARG G  1 58 ? -20.508 10.978  -236.457 1.00 0.00 ?  58 ARG G HE   1  
ATOM 8324   H HH11 . ARG G  1 58 ? -20.799 11.095  -239.930 1.00 0.00 ?  58 ARG G HH11 1  
ATOM 8325   H HH12 . ARG G  1 58 ? -21.989 12.375  -239.793 1.00 0.00 ?  58 ARG G HH12 1  
ATOM 8326   H HH21 . ARG G  1 58 ? -21.862 12.449  -236.284 1.00 0.00 ?  58 ARG G HH21 1  
ATOM 8327   H HH22 . ARG G  1 58 ? -22.595 13.149  -237.714 1.00 0.00 ?  58 ARG G HH22 1  
ATOM 8328   N N    . ASN G  1 59 ? -17.137 4.952   -238.610 1.00 0.00 ?  59 ASN G N    1  
ATOM 8329   C CA   . ASN G  1 59 ? -16.142 4.045   -239.168 1.00 0.00 ?  59 ASN G CA   1  
ATOM 8330   C C    . ASN G  1 59 ? -16.775 3.069   -240.151 1.00 0.00 ?  59 ASN G C    1  
ATOM 8331   O O    . ASN G  1 59 ? -16.433 3.055   -241.333 1.00 0.00 ?  59 ASN G O    1  
ATOM 8332   C CB   . ASN G  1 59 ? -15.408 3.287   -238.076 1.00 0.00 ?  59 ASN G CB   1  
ATOM 8333   C CG   . ASN G  1 59 ? -14.187 2.557   -238.563 1.00 0.00 ?  59 ASN G CG   1  
ATOM 8334   O OD1  . ASN G  1 59 ? -14.018 2.321   -239.765 1.00 0.00 ?  59 ASN G OD1  1  
ATOM 8335   N ND2  . ASN G  1 59 ? -13.377 2.127   -237.629 1.00 0.00 ?  59 ASN G ND2  1  
ATOM 8336   H H    . ASN G  1 59 ? -17.343 4.910   -237.622 1.00 0.00 ?  59 ASN G H    1  
ATOM 8337   H HA   . ASN G  1 59 ? -15.399 4.612   -239.730 1.00 0.00 ?  59 ASN G HA   1  
ATOM 8338   H HB2  . ASN G  1 59 ? -15.183 3.763   -237.121 1.00 0.00 ?  59 ASN G HB2  1  
ATOM 8339   H HB3  . ASN G  1 59 ? -16.217 2.569   -237.943 1.00 0.00 ?  59 ASN G HB3  1  
ATOM 8340   H HD21 . ASN G  1 59 ? -13.591 2.292   -236.667 1.00 0.00 ?  59 ASN G HD21 1  
ATOM 8341   H HD22 . ASN G  1 59 ? -12.544 1.632   -237.880 1.00 0.00 ?  59 ASN G HD22 1  
ATOM 8342   N N    . ALA G  1 60 ? -17.701 2.255   -239.656 1.00 0.00 ?  60 ALA G N    1  
ATOM 8343   C CA   . ALA G  1 60 ? -18.338 1.231   -240.475 1.00 0.00 ?  60 ALA G CA   1  
ATOM 8344   C C    . ALA G  1 60 ? -19.110 1.852   -241.632 1.00 0.00 ?  60 ALA G C    1  
ATOM 8345   O O    . ALA G  1 60 ? -19.169 1.289   -242.725 1.00 0.00 ?  60 ALA G O    1  
ATOM 8346   C CB   . ALA G  1 60 ? -19.256 0.367   -239.623 1.00 0.00 ?  60 ALA G CB   1  
ATOM 8347   H H    . ALA G  1 60 ? -17.971 2.348   -238.687 1.00 0.00 ?  60 ALA G H    1  
ATOM 8348   H HA   . ALA G  1 60 ? -17.563 0.596   -240.905 1.00 0.00 ?  60 ALA G HA   1  
ATOM 8349   H HB1  . ALA G  1 60 ? -20.028 0.990   -239.173 1.00 0.00 ?  60 ALA G HB1  1  
ATOM 8350   H HB2  . ALA G  1 60 ? -19.724 -0.393  -240.250 1.00 0.00 ?  60 ALA G HB2  1  
ATOM 8351   H HB3  . ALA G  1 60 ? -18.676 -0.118  -238.838 1.00 0.00 ?  60 ALA G HB3  1  
ATOM 8352   N N    . GLN G  1 61 ? -19.702 3.016   -241.384 1.00 0.00 ?  61 GLN G N    1  
ATOM 8353   C CA   . GLN G  1 61 ? -20.397 3.759   -242.428 1.00 0.00 ?  61 GLN G CA   1  
ATOM 8354   C C    . GLN G  1 61 ? -19.486 4.014   -243.622 1.00 0.00 ?  61 GLN G C    1  
ATOM 8355   O O    . GLN G  1 61 ? -19.816 3.661   -244.754 1.00 0.00 ?  61 GLN G O    1  
ATOM 8356   C CB   . GLN G  1 61 ? -20.918 5.091   -241.882 1.00 0.00 ?  61 GLN G CB   1  
ATOM 8357   C CG   . GLN G  1 61 ? -21.681 5.925   -242.897 1.00 0.00 ?  61 GLN G CG   1  
ATOM 8358   C CD   . GLN G  1 61 ? -22.122 7.262   -242.333 1.00 0.00 ?  61 GLN G CD   1  
ATOM 8359   O OE1  . GLN G  1 61 ? -21.747 7.635   -241.218 1.00 0.00 ?  61 GLN G OE1  1  
ATOM 8360   N NE2  . GLN G  1 61 ? -22.927 7.989   -243.099 1.00 0.00 ?  61 GLN G NE2  1  
ATOM 8361   H H    . GLN G  1 61 ? -19.669 3.395   -240.449 1.00 0.00 ?  61 GLN G H    1  
ATOM 8362   H HA   . GLN G  1 61 ? -21.236 3.170   -242.799 1.00 0.00 ?  61 GLN G HA   1  
ATOM 8363   H HB2  . GLN G  1 61 ? -21.565 4.853   -241.038 1.00 0.00 ?  61 GLN G HB2  1  
ATOM 8364   H HB3  . GLN G  1 61 ? -20.049 5.647   -241.528 1.00 0.00 ?  61 GLN G HB3  1  
ATOM 8365   H HG2  . GLN G  1 61 ? -21.322 6.092   -243.912 1.00 0.00 ?  61 GLN G HG2  1  
ATOM 8366   H HG3  . GLN G  1 61 ? -22.544 5.259   -242.924 1.00 0.00 ?  61 GLN G HG3  1  
ATOM 8367   H HE21 . GLN G  1 61 ? -23.208 7.647   -243.996 1.00 0.00 ?  61 GLN G HE21 1  
ATOM 8368   H HE22 . GLN G  1 61 ? -23.252 8.881   -242.780 1.00 0.00 ?  61 GLN G HE22 1  
ATOM 8369   N N    . SER G  1 62 ? -18.337 4.630   -243.363 1.00 0.00 ?  62 SER G N    1  
ATOM 8370   C CA   . SER G  1 62 ? -17.409 4.998   -244.425 1.00 0.00 ?  62 SER G CA   1  
ATOM 8371   C C    . SER G  1 62 ? -16.764 3.765   -245.045 1.00 0.00 ?  62 SER G C    1  
ATOM 8372   O O    . SER G  1 62 ? -16.362 3.781   -246.208 1.00 0.00 ?  62 SER G O    1  
ATOM 8373   C CB   . SER G  1 62 ? -16.346 5.936   -243.887 1.00 0.00 ?  62 SER G CB   1  
ATOM 8374   O OG   . SER G  1 62 ? -15.455 5.283   -243.025 1.00 0.00 ?  62 SER G OG   1  
ATOM 8375   H H    . SER G  1 62 ? -18.102 4.849   -242.406 1.00 0.00 ?  62 SER G H    1  
ATOM 8376   H HA   . SER G  1 62 ? -17.863 5.611   -245.205 1.00 0.00 ?  62 SER G HA   1  
ATOM 8377   H HB2  . SER G  1 62 ? -15.788 6.349   -244.727 1.00 0.00 ?  62 SER G HB2  1  
ATOM 8378   H HB3  . SER G  1 62 ? -16.835 6.744   -243.345 1.00 0.00 ?  62 SER G HB3  1  
ATOM 8379   H HG   . SER G  1 62 ? -15.951 4.778   -242.376 1.00 0.00 ?  62 SER G HG   1  
ATOM 8380   N N    . ASN G  1 63 ? -16.668 2.696   -244.261 1.00 0.00 ?  63 ASN G N    1  
ATOM 8381   C CA   . ASN G  1 63 ? -16.073 1.451   -244.732 1.00 0.00 ?  63 ASN G CA   1  
ATOM 8382   C C    . ASN G  1 63 ? -16.924 0.813   -245.822 1.00 0.00 ?  63 ASN G C    1  
ATOM 8383   O O    . ASN G  1 63 ? -16.413 0.415   -246.869 1.00 0.00 ?  63 ASN G O    1  
ATOM 8384   C CB   . ASN G  1 63 ? -15.859 0.472   -243.592 1.00 0.00 ?  63 ASN G CB   1  
ATOM 8385   C CG   . ASN G  1 63 ? -14.730 0.849   -242.675 1.00 0.00 ?  63 ASN G CG   1  
ATOM 8386   O OD1  . ASN G  1 63 ? -13.766 1.509   -243.081 1.00 0.00 ?  63 ASN G OD1  1  
ATOM 8387   N ND2  . ASN G  1 63 ? -14.802 0.365   -241.461 1.00 0.00 ?  63 ASN G ND2  1  
ATOM 8388   H H    . ASN G  1 63 ? -17.015 2.748   -243.314 1.00 0.00 ?  63 ASN G H    1  
ATOM 8389   H HA   . ASN G  1 63 ? -15.099 1.653   -245.179 1.00 0.00 ?  63 ASN G HA   1  
ATOM 8390   H HB2  . ASN G  1 63 ? -16.701 0.117   -242.996 1.00 0.00 ?  63 ASN G HB2  1  
ATOM 8391   H HB3  . ASN G  1 63 ? -15.522 -0.324  -244.256 1.00 0.00 ?  63 ASN G HB3  1  
ATOM 8392   H HD21 . ASN G  1 63 ? -15.574 -0.214  -241.199 1.00 0.00 ?  63 ASN G HD21 1  
ATOM 8393   H HD22 . ASN G  1 63 ? -14.085 0.574   -240.796 1.00 0.00 ?  63 ASN G HD22 1  
ATOM 8394   N N    . THR G  1 64 ? -18.225 0.717   -245.570 1.00 0.00 ?  64 THR G N    1  
ATOM 8395   C CA   . THR G  1 64 ? -19.145 0.092   -246.514 1.00 0.00 ?  64 THR G CA   1  
ATOM 8396   C C    . THR G  1 64 ? -19.248 0.901   -247.800 1.00 0.00 ?  64 THR G C    1  
ATOM 8397   O O    . THR G  1 64 ? -19.336 0.340   -248.892 1.00 0.00 ?  64 THR G O    1  
ATOM 8398   C CB   . THR G  1 64 ? -20.551 -0.072  -245.908 1.00 0.00 ?  64 THR G CB   1  
ATOM 8399   O OG1  . THR G  1 64 ? -21.050 1.207   -245.497 1.00 0.00 ?  64 THR G OG1  1  
ATOM 8400   C CG2  . THR G  1 64 ? -20.509 -1.005  -244.708 1.00 0.00 ?  64 THR G CG2  1  
ATOM 8401   H H    . THR G  1 64 ? -18.587 1.087   -244.703 1.00 0.00 ?  64 THR G H    1  
ATOM 8402   H HA   . THR G  1 64 ? -18.770 -0.892  -246.797 1.00 0.00 ?  64 THR G HA   1  
ATOM 8403   H HB   . THR G  1 64 ? -21.217 -0.486  -246.665 1.00 0.00 ?  64 THR G HB   1  
ATOM 8404   H HG1  . THR G  1 64 ? -21.926 1.102   -245.120 1.00 0.00 ?  64 THR G HG1  1  
ATOM 8405   H HG21 . THR G  1 64 ? -21.512 -1.109  -244.294 1.00 0.00 ?  64 THR G HG21 1  
ATOM 8406   H HG22 . THR G  1 64 ? -20.141 -1.983  -245.020 1.00 0.00 ?  64 THR G HG22 1  
ATOM 8407   H HG23 . THR G  1 64 ? -19.845 -0.592  -243.950 1.00 0.00 ?  64 THR G HG23 1  
ATOM 8408   N N    . VAL G  1 65 ? -19.238 2.223   -247.664 1.00 0.00 ?  65 VAL G N    1  
ATOM 8409   C CA   . VAL G  1 65 ? -19.266 3.112   -248.820 1.00 0.00 ?  65 VAL G CA   1  
ATOM 8410   C C    . VAL G  1 65 ? -18.011 2.951   -249.669 1.00 0.00 ?  65 VAL G C    1  
ATOM 8411   O O    . VAL G  1 65 ? -18.082 2.915   -250.897 1.00 0.00 ?  65 VAL G O    1  
ATOM 8412   C CB   . VAL G  1 65 ? -19.402 4.586   -248.395 1.00 0.00 ?  65 VAL G CB   1  
ATOM 8413   C CG1  . VAL G  1 65 ? -19.208 5.505   -249.592 1.00 0.00 ?  65 VAL G CG1  1  
ATOM 8414   C CG2  . VAL G  1 65 ? -20.757 4.832   -247.750 1.00 0.00 ?  65 VAL G CG2  1  
ATOM 8415   H H    . VAL G  1 65 ? -19.210 2.622   -246.737 1.00 0.00 ?  65 VAL G H    1  
ATOM 8416   H HA   . VAL G  1 65 ? -20.090 2.865   -249.490 1.00 0.00 ?  65 VAL G HA   1  
ATOM 8417   H HB   . VAL G  1 65 ? -18.647 4.808   -247.641 1.00 0.00 ?  65 VAL G HB   1  
ATOM 8418   H HG11 . VAL G  1 65 ? -19.307 6.543   -249.274 1.00 0.00 ?  65 VAL G HG11 1  
ATOM 8419   H HG12 . VAL G  1 65 ? -18.216 5.348   -250.015 1.00 0.00 ?  65 VAL G HG12 1  
ATOM 8420   H HG13 . VAL G  1 65 ? -19.964 5.284   -250.346 1.00 0.00 ?  65 VAL G HG13 1  
ATOM 8421   H HG21 . VAL G  1 65 ? -20.861 4.199   -246.868 1.00 0.00 ?  65 VAL G HG21 1  
ATOM 8422   H HG22 . VAL G  1 65 ? -20.836 5.878   -247.455 1.00 0.00 ?  65 VAL G HG22 1  
ATOM 8423   H HG23 . VAL G  1 65 ? -21.547 4.595   -248.463 1.00 0.00 ?  65 VAL G HG23 1  
ATOM 8424   N N    . LYS G  1 66 ? -16.863 2.856   -249.006 1.00 0.00 ?  66 LYS G N    1  
ATOM 8425   C CA   . LYS G  1 66 ? -15.600 2.613   -249.694 1.00 0.00 ?  66 LYS G CA   1  
ATOM 8426   C C    . LYS G  1 66 ? -15.671 1.355   -250.548 1.00 0.00 ?  66 LYS G C    1  
ATOM 8427   O O    . LYS G  1 66 ? -15.280 1.362   -251.715 1.00 0.00 ?  66 LYS G O    1  
ATOM 8428   C CB   . LYS G  1 66 ? -14.455 2.501   -248.686 1.00 0.00 ?  66 LYS G CB   1  
ATOM 8429   C CG   . LYS G  1 66 ? -13.098 2.198   -249.307 1.00 0.00 ?  66 LYS G CG   1  
ATOM 8430   C CD   . LYS G  1 66 ? -12.024 2.040   -248.241 1.00 0.00 ?  66 LYS G CD   1  
ATOM 8431   C CE   . LYS G  1 66 ? -10.690 1.641   -248.853 1.00 0.00 ?  66 LYS G CE   1  
ATOM 8432   N NZ   . LYS G  1 66 ? -10.716 0.252   -249.387 1.00 0.00 1  66 LYS G NZ   1  
ATOM 8433   H H    . LYS G  1 66 ? -16.866 2.954   -248.001 1.00 0.00 ?  66 LYS G H    1  
ATOM 8434   H HA   . LYS G  1 66 ? -15.386 3.439   -250.373 1.00 0.00 ?  66 LYS G HA   1  
ATOM 8435   H HB2  . LYS G  1 66 ? -14.406 3.450   -248.152 1.00 0.00 ?  66 LYS G HB2  1  
ATOM 8436   H HB3  . LYS G  1 66 ? -14.720 1.706   -247.988 1.00 0.00 ?  66 LYS G HB3  1  
ATOM 8437   H HG2  . LYS G  1 66 ? -13.179 1.274   -249.881 1.00 0.00 ?  66 LYS G HG2  1  
ATOM 8438   H HG3  . LYS G  1 66 ? -12.832 3.017   -249.974 1.00 0.00 ?  66 LYS G HG3  1  
ATOM 8439   H HD2  . LYS G  1 66 ? -11.914 2.990   -247.716 1.00 0.00 ?  66 LYS G HD2  1  
ATOM 8440   H HD3  . LYS G  1 66 ? -12.344 1.273   -247.537 1.00 0.00 ?  66 LYS G HD3  1  
ATOM 8441   H HE2  . LYS G  1 66 ? -10.462 2.336   -249.660 1.00 0.00 ?  66 LYS G HE2  1  
ATOM 8442   H HE3  . LYS G  1 66 ? -9.924  1.719   -248.082 1.00 0.00 ?  66 LYS G HE3  1  
ATOM 8443   H HZ1  . LYS G  1 66 ? -11.425 0.180   -250.102 1.00 0.00 ?  66 LYS G HZ1  1  
ATOM 8444   H HZ2  . LYS G  1 66 ? -9.814  0.027   -249.783 1.00 0.00 ?  66 LYS G HZ2  1  
ATOM 8445   H HZ3  . LYS G  1 66 ? -10.926 -0.393  -248.638 1.00 0.00 ?  66 LYS G HZ3  1  
ATOM 8446   N N    . VAL G  1 67 ? -16.173 0.274   -249.960 1.00 0.00 ?  67 VAL G N    1  
ATOM 8447   C CA   . VAL G  1 67 ? -16.223 -1.015  -250.641 1.00 0.00 ?  67 VAL G CA   1  
ATOM 8448   C C    . VAL G  1 67 ? -17.127 -0.956  -251.865 1.00 0.00 ?  67 VAL G C    1  
ATOM 8449   O O    . VAL G  1 67 ? -16.785 -1.479  -252.926 1.00 0.00 ?  67 VAL G O    1  
ATOM 8450   C CB   . VAL G  1 67 ? -16.719 -2.131  -249.702 1.00 0.00 ?  67 VAL G CB   1  
ATOM 8451   C CG1  . VAL G  1 67 ? -16.996 -3.404  -250.487 1.00 0.00 ?  67 VAL G CG1  1  
ATOM 8452   C CG2  . VAL G  1 67 ? -15.700 -2.395  -248.604 1.00 0.00 ?  67 VAL G CG2  1  
ATOM 8453   H H    . VAL G  1 67 ? -16.529 0.347   -249.018 1.00 0.00 ?  67 VAL G H    1  
ATOM 8454   H HA   . VAL G  1 67 ? -15.244 -1.297  -251.029 1.00 0.00 ?  67 VAL G HA   1  
ATOM 8455   H HB   . VAL G  1 67 ? -17.634 -1.800  -249.211 1.00 0.00 ?  67 VAL G HB   1  
ATOM 8456   H HG11 . VAL G  1 67 ? -17.345 -4.182  -249.808 1.00 0.00 ?  67 VAL G HG11 1  
ATOM 8457   H HG12 . VAL G  1 67 ? -17.760 -3.209  -251.239 1.00 0.00 ?  67 VAL G HG12 1  
ATOM 8458   H HG13 . VAL G  1 67 ? -16.080 -3.736  -250.977 1.00 0.00 ?  67 VAL G HG13 1  
ATOM 8459   H HG21 . VAL G  1 67 ? -15.547 -1.485  -248.022 1.00 0.00 ?  67 VAL G HG21 1  
ATOM 8460   H HG22 . VAL G  1 67 ? -16.067 -3.185  -247.949 1.00 0.00 ?  67 VAL G HG22 1  
ATOM 8461   H HG23 . VAL G  1 67 ? -14.755 -2.703  -249.052 1.00 0.00 ?  67 VAL G HG23 1  
ATOM 8462   N N    . PHE G  1 68 ? -18.281 -0.317  -251.713 1.00 0.00 ?  68 PHE G N    1  
ATOM 8463   C CA   . PHE G  1 68 ? -19.214 -0.144  -252.820 1.00 0.00 ?  68 PHE G CA   1  
ATOM 8464   C C    . PHE G  1 68 ? -18.634 0.773   -253.890 1.00 0.00 ?  68 PHE G C    1  
ATOM 8465   O O    . PHE G  1 68 ? -18.997 0.681   -255.062 1.00 0.00 ?  68 PHE G O    1  
ATOM 8466   C CB   . PHE G  1 68 ? -20.546 0.414   -252.315 1.00 0.00 ?  68 PHE G CB   1  
ATOM 8467   C CG   . PHE G  1 68 ? -21.460 -0.630  -251.738 1.00 0.00 ?  68 PHE G CG   1  
ATOM 8468   C CD1  . PHE G  1 68 ? -22.001 -1.621  -252.543 1.00 0.00 ?  68 PHE G CD1  1  
ATOM 8469   C CD2  . PHE G  1 68 ? -21.780 -0.623  -250.389 1.00 0.00 ?  68 PHE G CD2  1  
ATOM 8470   C CE1  . PHE G  1 68 ? -22.842 -2.580  -252.015 1.00 0.00 ?  68 PHE G CE1  1  
ATOM 8471   C CE2  . PHE G  1 68 ? -22.620 -1.582  -249.857 1.00 0.00 ?  68 PHE G CE2  1  
ATOM 8472   C CZ   . PHE G  1 68 ? -23.152 -2.561  -250.670 1.00 0.00 ?  68 PHE G CZ   1  
ATOM 8473   H H    . PHE G  1 68 ? -18.519 0.059   -250.806 1.00 0.00 ?  68 PHE G H    1  
ATOM 8474   H HA   . PHE G  1 68 ? -19.399 -1.105  -253.302 1.00 0.00 ?  68 PHE G HA   1  
ATOM 8475   H HB2  . PHE G  1 68 ? -20.372 1.145   -251.527 1.00 0.00 ?  68 PHE G HB2  1  
ATOM 8476   H HB3  . PHE G  1 68 ? -21.089 0.885   -253.133 1.00 0.00 ?  68 PHE G HB3  1  
ATOM 8477   H HD1  . PHE G  1 68 ? -21.756 -1.636  -253.606 1.00 0.00 ?  68 PHE G HD1  1  
ATOM 8478   H HD2  . PHE G  1 68 ? -21.360 0.152   -249.746 1.00 0.00 ?  68 PHE G HD2  1  
ATOM 8479   H HE1  . PHE G  1 68 ? -23.261 -3.353  -252.659 1.00 0.00 ?  68 PHE G HE1  1  
ATOM 8480   H HE2  . PHE G  1 68 ? -22.863 -1.565  -248.795 1.00 0.00 ?  68 PHE G HE2  1  
ATOM 8481   H HZ   . PHE G  1 68 ? -23.814 -3.318  -250.251 1.00 0.00 ?  68 PHE G HZ   1  
ATOM 8482   N N    . LYS G  1 69 ? -17.731 1.656   -253.479 1.00 0.00 ?  69 LYS G N    1  
ATOM 8483   C CA   . LYS G  1 69 ? -16.986 2.485   -254.419 1.00 0.00 ?  69 LYS G CA   1  
ATOM 8484   C C    . LYS G  1 69 ? -15.829 1.711   -255.038 1.00 0.00 ?  69 LYS G C    1  
ATOM 8485   O O    . LYS G  1 69 ? -15.429 1.976   -256.172 1.00 0.00 ?  69 LYS G O    1  
ATOM 8486   C CB   . LYS G  1 69 ? -16.465 3.745   -253.727 1.00 0.00 ?  69 LYS G CB   1  
ATOM 8487   C CG   . LYS G  1 69 ? -15.944 4.815   -254.677 1.00 0.00 ?  69 LYS G CG   1  
ATOM 8488   C CD   . LYS G  1 69 ? -14.456 4.642   -254.944 1.00 0.00 ?  69 LYS G CD   1  
ATOM 8489   C CE   . LYS G  1 69 ? -13.932 5.717   -255.884 1.00 0.00 ?  69 LYS G CE   1  
ATOM 8490   N NZ   . LYS G  1 69 ? -12.546 5.429   -256.342 1.00 0.00 1  69 LYS G NZ   1  
ATOM 8491   H H    . LYS G  1 69 ? -17.556 1.757   -252.489 1.00 0.00 ?  69 LYS G H    1  
ATOM 8492   H HA   . LYS G  1 69 ? -17.636 2.784   -255.243 1.00 0.00 ?  69 LYS G HA   1  
ATOM 8493   H HB2  . LYS G  1 69 ? -17.290 4.151   -253.140 1.00 0.00 ?  69 LYS G HB2  1  
ATOM 8494   H HB3  . LYS G  1 69 ? -15.663 3.434   -253.057 1.00 0.00 ?  69 LYS G HB3  1  
ATOM 8495   H HG2  . LYS G  1 69 ? -16.493 4.741   -255.617 1.00 0.00 ?  69 LYS G HG2  1  
ATOM 8496   H HG3  . LYS G  1 69 ? -16.122 5.792   -254.230 1.00 0.00 ?  69 LYS G HG3  1  
ATOM 8497   H HD2  . LYS G  1 69 ? -13.924 4.698   -253.993 1.00 0.00 ?  69 LYS G HD2  1  
ATOM 8498   H HD3  . LYS G  1 69 ? -14.295 3.660   -255.390 1.00 0.00 ?  69 LYS G HD3  1  
ATOM 8499   H HE2  . LYS G  1 69 ? -14.595 5.770   -256.746 1.00 0.00 ?  69 LYS G HE2  1  
ATOM 8500   H HE3  . LYS G  1 69 ? -13.949 6.670   -255.355 1.00 0.00 ?  69 LYS G HE3  1  
ATOM 8501   H HZ1  . LYS G  1 69 ? -12.530 4.547   -256.832 1.00 0.00 ?  69 LYS G HZ1  1  
ATOM 8502   H HZ2  . LYS G  1 69 ? -12.237 6.165   -256.961 1.00 0.00 ?  69 LYS G HZ2  1  
ATOM 8503   H HZ3  . LYS G  1 69 ? -11.930 5.381   -255.542 1.00 0.00 ?  69 LYS G HZ3  1  
ATOM 8504   N N    . ASP G  1 70 ? -15.296 0.753   -254.288 1.00 0.00 ?  70 ASP G N    1  
ATOM 8505   C CA   . ASP G  1 70 ? -14.168 -0.045  -254.752 1.00 0.00 ?  70 ASP G CA   1  
ATOM 8506   C C    . ASP G  1 70 ? -14.582 -0.981  -255.880 1.00 0.00 ?  70 ASP G C    1  
ATOM 8507   O O    . ASP G  1 70 ? -13.825 -1.205  -256.824 1.00 0.00 ?  70 ASP G O    1  
ATOM 8508   C CB   . ASP G  1 70 ? -13.567 -0.849  -253.596 1.00 0.00 ?  70 ASP G CB   1  
ATOM 8509   C CG   . ASP G  1 70 ? -12.732 -0.026  -252.625 1.00 0.00 ?  70 ASP G CG   1  
ATOM 8510   O OD1  . ASP G  1 70 ? -12.416 1.095   -252.946 1.00 0.00 ?  70 ASP G OD1  1  
ATOM 8511   O OD2  . ASP G  1 70 ? -12.551 -0.460  -251.513 1.00 0.00 -1 70 ASP G OD2  1  
ATOM 8512   H H    . ASP G  1 70 ? -15.682 0.573   -253.372 1.00 0.00 ?  70 ASP G H    1  
ATOM 8513   H HA   . ASP G  1 70 ? -13.396 0.608   -255.160 1.00 0.00 ?  70 ASP G HA   1  
ATOM 8514   H HB2  . ASP G  1 70 ? -14.305 -1.428  -253.040 1.00 0.00 ?  70 ASP G HB2  1  
ATOM 8515   H HB3  . ASP G  1 70 ? -12.917 -1.525  -254.151 1.00 0.00 ?  70 ASP G HB3  1  
ATOM 8516   N N    . ILE G  1 71 ? -15.790 -1.526  -255.777 1.00 0.00 ?  71 ILE G N    1  
ATOM 8517   C CA   . ILE G  1 71 ? -16.342 -2.370  -256.829 1.00 0.00 ?  71 ILE G CA   1  
ATOM 8518   C C    . ILE G  1 71 ? -16.772 -1.541  -258.033 1.00 0.00 ?  71 ILE G C    1  
ATOM 8519   O O    . ILE G  1 71 ? -16.877 -2.054  -259.147 1.00 0.00 ?  71 ILE G O    1  
ATOM 8520   C CB   . ILE G  1 71 ? -17.546 -3.187  -256.325 1.00 0.00 ?  71 ILE G CB   1  
ATOM 8521   C CG1  . ILE G  1 71 ? -18.666 -2.254  -255.856 1.00 0.00 ?  71 ILE G CG1  1  
ATOM 8522   C CG2  . ILE G  1 71 ? -17.122 -4.121  -255.201 1.00 0.00 ?  71 ILE G CG2  1  
ATOM 8523   C CD1  . ILE G  1 71 ? -19.915 -2.978  -255.407 1.00 0.00 ?  71 ILE G CD1  1  
ATOM 8524   H H    . ILE G  1 71 ? -16.340 -1.350  -254.948 1.00 0.00 ?  71 ILE G H    1  
ATOM 8525   H HA   . ILE G  1 71 ? -15.582 -3.047  -257.217 1.00 0.00 ?  71 ILE G HA   1  
ATOM 8526   H HB   . ILE G  1 71 ? -17.949 -3.772  -257.151 1.00 0.00 ?  71 ILE G HB   1  
ATOM 8527   H HG12 . ILE G  1 71 ? -18.272 -1.663  -255.031 1.00 0.00 ?  71 ILE G HG12 1  
ATOM 8528   H HG13 . ILE G  1 71 ? -18.908 -1.595  -256.691 1.00 0.00 ?  71 ILE G HG13 1  
ATOM 8529   H HG21 . ILE G  1 71 ? -17.984 -4.690  -254.856 1.00 0.00 ?  71 ILE G HG21 1  
ATOM 8530   H HG22 . ILE G  1 71 ? -16.358 -4.806  -255.566 1.00 0.00 ?  71 ILE G HG22 1  
ATOM 8531   H HG23 . ILE G  1 71 ? -16.719 -3.536  -254.374 1.00 0.00 ?  71 ILE G HG23 1  
ATOM 8532   H HD11 . ILE G  1 71 ? -19.675 -3.636  -254.573 1.00 0.00 ?  71 ILE G HD11 1  
ATOM 8533   H HD12 . ILE G  1 71 ? -20.663 -2.251  -255.091 1.00 0.00 ?  71 ILE G HD12 1  
ATOM 8534   H HD13 . ILE G  1 71 ? -20.311 -3.569  -256.234 1.00 0.00 ?  71 ILE G HD13 1  
ATOM 8535   N N    . ASP G  1 72 ? -17.019 -0.256  -257.801 1.00 0.00 ?  72 ASP G N    1  
ATOM 8536   C CA   . ASP G  1 72 ? -17.213 0.695   -258.889 1.00 0.00 ?  72 ASP G CA   1  
ATOM 8537   C C    . ASP G  1 72 ? -15.926 0.901   -259.677 1.00 0.00 ?  72 ASP G C    1  
ATOM 8538   O O    . ASP G  1 72 ? -15.928 0.870   -260.908 1.00 0.00 ?  72 ASP G O    1  
ATOM 8539   C CB   . ASP G  1 72 ? -17.719 2.034   -258.348 1.00 0.00 ?  72 ASP G CB   1  
ATOM 8540   C CG   . ASP G  1 72 ? -19.157 2.009   -257.849 1.00 0.00 ?  72 ASP G CG   1  
ATOM 8541   O OD1  . ASP G  1 72 ? -19.862 1.083   -258.174 1.00 0.00 ?  72 ASP G OD1  1  
ATOM 8542   O OD2  . ASP G  1 72 ? -19.493 2.825   -257.025 1.00 0.00 -1 72 ASP G OD2  1  
ATOM 8543   H H    . ASP G  1 72 ? -17.074 0.070   -256.847 1.00 0.00 ?  72 ASP G H    1  
ATOM 8544   H HA   . ASP G  1 72 ? -17.948 0.305   -259.594 1.00 0.00 ?  72 ASP G HA   1  
ATOM 8545   H HB2  . ASP G  1 72 ? -17.075 2.462   -257.579 1.00 0.00 ?  72 ASP G HB2  1  
ATOM 8546   H HB3  . ASP G  1 72 ? -17.659 2.641   -259.252 1.00 0.00 ?  72 ASP G HB3  1  
ATOM 8547   N N    . ALA G  1 73 ? -14.827 1.112   -258.960 1.00 0.00 ?  73 ALA G N    1  
ATOM 8548   C CA   . ALA G  1 73 ? -13.517 1.240   -259.586 1.00 0.00 ?  73 ALA G CA   1  
ATOM 8549   C C    . ALA G  1 73 ? -13.134 -0.033  -260.329 1.00 0.00 ?  73 ALA G C    1  
ATOM 8550   O O    . ALA G  1 73 ? -12.551 0.019   -261.412 1.00 0.00 ?  73 ALA G O    1  
ATOM 8551   C CB   . ALA G  1 73 ? -12.463 1.587   -258.544 1.00 0.00 ?  73 ALA G CB   1  
ATOM 8552   H H    . ALA G  1 73 ? -14.902 1.185   -257.956 1.00 0.00 ?  73 ALA G H    1  
ATOM 8553   H HA   . ALA G  1 73 ? -13.557 2.045   -260.321 1.00 0.00 ?  73 ALA G HA   1  
ATOM 8554   H HB1  . ALA G  1 73 ? -12.421 0.800   -257.794 1.00 0.00 ?  73 ALA G HB1  1  
ATOM 8555   H HB2  . ALA G  1 73 ? -11.491 1.680   -259.028 1.00 0.00 ?  73 ALA G HB2  1  
ATOM 8556   H HB3  . ALA G  1 73 ? -12.721 2.532   -258.066 1.00 0.00 ?  73 ALA G HB3  1  
ATOM 8557   N N    . ALA G  1 74 ? -13.465 -1.177  -259.740 1.00 0.00 ?  74 ALA G N    1  
ATOM 8558   C CA   . ALA G  1 74 ? -13.158 -2.468  -260.346 1.00 0.00 ?  74 ALA G CA   1  
ATOM 8559   C C    . ALA G  1 74 ? -13.808 -2.601  -261.717 1.00 0.00 ?  74 ALA G C    1  
ATOM 8560   O O    . ALA G  1 74 ? -13.200 -3.118  -262.655 1.00 0.00 ?  74 ALA G O    1  
ATOM 8561   C CB   . ALA G  1 74 ? -13.601 -3.601  -259.432 1.00 0.00 ?  74 ALA G CB   1  
ATOM 8562   H H    . ALA G  1 74 ? -13.942 -1.153  -258.850 1.00 0.00 ?  74 ALA G H    1  
ATOM 8563   H HA   . ALA G  1 74 ? -12.079 -2.538  -260.489 1.00 0.00 ?  74 ALA G HA   1  
ATOM 8564   H HB1  . ALA G  1 74 ? -14.676 -3.535  -259.267 1.00 0.00 ?  74 ALA G HB1  1  
ATOM 8565   H HB2  . ALA G  1 74 ? -13.365 -4.557  -259.899 1.00 0.00 ?  74 ALA G HB2  1  
ATOM 8566   H HB3  . ALA G  1 74 ? -13.081 -3.525  -258.478 1.00 0.00 ?  74 ALA G HB3  1  
ATOM 8567   N N    . ILE G  1 75 ? -15.046 -2.133  -261.827 1.00 0.00 ?  75 ILE G N    1  
ATOM 8568   C CA   . ILE G  1 75 ? -15.797 -2.238  -263.073 1.00 0.00 ?  75 ILE G CA   1  
ATOM 8569   C C    . ILE G  1 75 ? -15.229 -1.308  -264.137 1.00 0.00 ?  75 ILE G C    1  
ATOM 8570   O O    . ILE G  1 75 ? -14.992 -1.720  -265.273 1.00 0.00 ?  75 ILE G O    1  
ATOM 8571   C CB   . ILE G  1 75 ? -17.287 -1.914  -262.864 1.00 0.00 ?  75 ILE G CB   1  
ATOM 8572   C CG1  . ILE G  1 75 ? -17.947 -2.980  -261.985 1.00 0.00 ?  75 ILE G CG1  1  
ATOM 8573   C CG2  . ILE G  1 75 ? -18.001 -1.807  -264.202 1.00 0.00 ?  75 ILE G CG2  1  
ATOM 8574   C CD1  . ILE G  1 75 ? -19.315 -2.589  -261.475 1.00 0.00 ?  75 ILE G CD1  1  
ATOM 8575   H H    . ILE G  1 75 ? -15.479 -1.694  -261.027 1.00 0.00 ?  75 ILE G H    1  
ATOM 8576   H HA   . ILE G  1 75 ? -15.699 -3.236  -263.498 1.00 0.00 ?  75 ILE G HA   1  
ATOM 8577   H HB   . ILE G  1 75 ? -17.373 -0.968  -262.329 1.00 0.00 ?  75 ILE G HB   1  
ATOM 8578   H HG12 . ILE G  1 75 ? -18.026 -3.888  -262.581 1.00 0.00 ?  75 ILE G HG12 1  
ATOM 8579   H HG13 . ILE G  1 75 ? -17.282 -3.159  -261.139 1.00 0.00 ?  75 ILE G HG13 1  
ATOM 8580   H HG21 . ILE G  1 75 ? -19.054 -1.578  -264.036 1.00 0.00 ?  75 ILE G HG21 1  
ATOM 8581   H HG22 . ILE G  1 75 ? -17.547 -1.013  -264.794 1.00 0.00 ?  75 ILE G HG22 1  
ATOM 8582   H HG23 . ILE G  1 75 ? -17.916 -2.753  -264.737 1.00 0.00 ?  75 ILE G HG23 1  
ATOM 8583   H HD11 . ILE G  1 75 ? -19.981 -2.411  -262.318 1.00 0.00 ?  75 ILE G HD11 1  
ATOM 8584   H HD12 . ILE G  1 75 ? -19.718 -3.394  -260.859 1.00 0.00 ?  75 ILE G HD12 1  
ATOM 8585   H HD13 . ILE G  1 75 ? -19.236 -1.681  -260.876 1.00 0.00 ?  75 ILE G HD13 1  
ATOM 8586   N N    . ILE G  1 76 ? -15.012 -0.051  -263.764 1.00 0.00 ?  76 ILE G N    1  
ATOM 8587   C CA   . ILE G  1 76 ? -14.552 0.960   -264.707 1.00 0.00 ?  76 ILE G CA   1  
ATOM 8588   C C    . ILE G  1 76 ? -13.075 0.778   -265.034 1.00 0.00 ?  76 ILE G C    1  
ATOM 8589   O O    . ILE G  1 76 ? -12.566 1.357   -265.994 1.00 0.00 ?  76 ILE G O    1  
ATOM 8590   C CB   . ILE G  1 76 ? -14.776 2.383   -264.164 1.00 0.00 ?  76 ILE G CB   1  
ATOM 8591   C CG1  . ILE G  1 76 ? -13.919 2.620   -262.918 1.00 0.00 ?  76 ILE G CG1  1  
ATOM 8592   C CG2  . ILE G  1 76 ? -16.248 2.608   -263.853 1.00 0.00 ?  76 ILE G CG2  1  
ATOM 8593   C CD1  . ILE G  1 76 ? -13.952 4.046   -262.416 1.00 0.00 ?  76 ILE G CD1  1  
ATOM 8594   H H    . ILE G  1 76 ? -15.169 0.210   -262.801 1.00 0.00 ?  76 ILE G H    1  
ATOM 8595   H HA   . ILE G  1 76 ? -15.062 0.853   -265.664 1.00 0.00 ?  76 ILE G HA   1  
ATOM 8596   H HB   . ILE G  1 76 ? -14.449 3.105   -264.912 1.00 0.00 ?  76 ILE G HB   1  
ATOM 8597   H HG12 . ILE G  1 76 ? -14.287 1.952   -262.140 1.00 0.00 ?  76 ILE G HG12 1  
ATOM 8598   H HG13 . ILE G  1 76 ? -12.894 2.349   -263.173 1.00 0.00 ?  76 ILE G HG13 1  
ATOM 8599   H HG21 . ILE G  1 76 ? -16.388 3.618   -263.469 1.00 0.00 ?  76 ILE G HG21 1  
ATOM 8600   H HG22 . ILE G  1 76 ? -16.835 2.480   -264.761 1.00 0.00 ?  76 ILE G HG22 1  
ATOM 8601   H HG23 . ILE G  1 76 ? -16.576 1.887   -263.104 1.00 0.00 ?  76 ILE G HG23 1  
ATOM 8602   H HD11 . ILE G  1 76 ? -14.975 4.318   -262.159 1.00 0.00 ?  76 ILE G HD11 1  
ATOM 8603   H HD12 . ILE G  1 76 ? -13.321 4.136   -261.532 1.00 0.00 ?  76 ILE G HD12 1  
ATOM 8604   H HD13 . ILE G  1 76 ? -13.583 4.715   -263.194 1.00 0.00 ?  76 ILE G HD13 1  
ATOM 8605   N N    . GLN G  1 77 ? -12.392 -0.030  -264.231 1.00 0.00 ?  77 GLN G N    1  
ATOM 8606   C CA   . GLN G  1 77 ? -11.046 -0.482  -264.563 1.00 0.00 ?  77 GLN G CA   1  
ATOM 8607   C C    . GLN G  1 77 ? -11.045 -1.314  -265.840 1.00 0.00 ?  77 GLN G C    1  
ATOM 8608   O O    . GLN G  1 77 ? -10.055 -1.345  -266.571 1.00 0.00 ?  77 GLN G O    1  
ATOM 8609   C CB   . GLN G  1 77 ? -10.457 -1.302  -263.412 1.00 0.00 ?  77 GLN G CB   1  
ATOM 8610   C CG   . GLN G  1 77 ? -9.001  -1.690  -263.607 1.00 0.00 ?  77 GLN G CG   1  
ATOM 8611   C CD   . GLN G  1 77 ? -8.085  -0.484  -263.687 1.00 0.00 ?  77 GLN G CD   1  
ATOM 8612   O OE1  . GLN G  1 77 ? -8.197  0.452   -262.889 1.00 0.00 ?  77 GLN G OE1  1  
ATOM 8613   N NE2  . GLN G  1 77 ? -7.175  -0.496  -264.653 1.00 0.00 ?  77 GLN G NE2  1  
ATOM 8614   H H    . GLN G  1 77 ? -12.815 -0.338  -263.367 1.00 0.00 ?  77 GLN G H    1  
ATOM 8615   H HA   . GLN G  1 77 ? -10.408 0.380   -264.755 1.00 0.00 ?  77 GLN G HA   1  
ATOM 8616   H HB2  . GLN G  1 77 ? -10.560 -0.698  -262.511 1.00 0.00 ?  77 GLN G HB2  1  
ATOM 8617   H HB3  . GLN G  1 77 ? -11.068 -2.199  -263.319 1.00 0.00 ?  77 GLN G HB3  1  
ATOM 8618   H HG2  . GLN G  1 77 ? -8.506  -2.447  -262.998 1.00 0.00 ?  77 GLN G HG2  1  
ATOM 8619   H HG3  . GLN G  1 77 ? -9.149  -2.078  -264.615 1.00 0.00 ?  77 GLN G HG3  1  
ATOM 8620   H HE21 . GLN G  1 77 ? -7.120  -1.274  -265.280 1.00 0.00 ?  77 GLN G HE21 1  
ATOM 8621   H HE22 . GLN G  1 77 ? -6.543  0.273   -264.756 1.00 0.00 ?  77 GLN G HE22 1  
ATOM 8622   N N    . ASN G  1 78 ? -12.160 -1.987  -266.102 1.00 0.00 ?  78 ASN G N    1  
ATOM 8623   C CA   . ASN G  1 78 ? -12.312 -2.772  -267.322 1.00 0.00 ?  78 ASN G CA   1  
ATOM 8624   C C    . ASN G  1 78 ? -13.204 -2.057  -268.329 1.00 0.00 ?  78 ASN G C    1  
ATOM 8625   O O    . ASN G  1 78 ? -13.865 -2.694  -269.149 1.00 0.00 ?  78 ASN G O    1  
ATOM 8626   C CB   . ASN G  1 78 ? -12.858 -4.157  -267.027 1.00 0.00 ?  78 ASN G CB   1  
ATOM 8627   C CG   . ASN G  1 78 ? -11.926 -5.016  -266.218 1.00 0.00 ?  78 ASN G CG   1  
ATOM 8628   O OD1  . ASN G  1 78 ? -10.699 -4.902  -266.321 1.00 0.00 ?  78 ASN G OD1  1  
ATOM 8629   N ND2  . ASN G  1 78 ? -12.499 -5.929  -265.477 1.00 0.00 ?  78 ASN G ND2  1  
ATOM 8630   H H    . ASN G  1 78 ? -12.922 -1.955  -265.440 1.00 0.00 ?  78 ASN G H    1  
ATOM 8631   H HA   . ASN G  1 78 ? -11.341 -2.898  -267.804 1.00 0.00 ?  78 ASN G HA   1  
ATOM 8632   H HB2  . ASN G  1 78 ? -13.876 -4.288  -266.657 1.00 0.00 ?  78 ASN G HB2  1  
ATOM 8633   H HB3  . ASN G  1 78 ? -12.807 -4.468  -268.070 1.00 0.00 ?  78 ASN G HB3  1  
ATOM 8634   H HD21 . ASN G  1 78 ? -13.495 -6.019  -265.476 1.00 0.00 ?  78 ASN G HD21 1  
ATOM 8635   H HD22 . ASN G  1 78 ? -11.941 -6.537  -264.912 1.00 0.00 ?  78 ASN G HD22 1  
ATOM 8636   N N    . PHE G  1 79 ? -13.218 -0.730  -268.262 1.00 0.00 ?  79 PHE G N    1  
ATOM 8637   C CA   . PHE G  1 79 ? -14.092 0.070   -269.111 1.00 0.00 ?  79 PHE G CA   1  
ATOM 8638   C C    . PHE G  1 79 ? -13.518 0.212   -270.515 1.00 0.00 ?  79 PHE G C    1  
ATOM 8639   O O    . PHE G  1 79 ? -13.076 1.291   -270.908 1.00 0.00 ?  79 PHE G O    1  
ATOM 8640   C CB   . PHE G  1 79 ? -14.319 1.451   -268.493 1.00 0.00 ?  79 PHE G CB   1  
ATOM 8641   C CG   . PHE G  1 79 ? -15.517 2.172   -269.043 1.00 0.00 ?  79 PHE G CG   1  
ATOM 8642   C CD1  . PHE G  1 79 ? -16.798 1.822   -268.645 1.00 0.00 ?  79 PHE G CD1  1  
ATOM 8643   C CD2  . PHE G  1 79 ? -15.365 3.200   -269.961 1.00 0.00 ?  79 PHE G CD2  1  
ATOM 8644   C CE1  . PHE G  1 79 ? -17.901 2.484   -269.150 1.00 0.00 ?  79 PHE G CE1  1  
ATOM 8645   C CE2  . PHE G  1 79 ? -16.465 3.865   -270.467 1.00 0.00 ?  79 PHE G CE2  1  
ATOM 8646   C CZ   . PHE G  1 79 ? -17.735 3.506   -270.061 1.00 0.00 ?  79 PHE G CZ   1  
ATOM 8647   H H    . PHE G  1 79 ? -12.608 -0.264  -267.606 1.00 0.00 ?  79 PHE G H    1  
ATOM 8648   H HA   . PHE G  1 79 ? -15.058 -0.426  -269.220 1.00 0.00 ?  79 PHE G HA   1  
ATOM 8649   H HB2  . PHE G  1 79 ? -14.476 1.360   -267.419 1.00 0.00 ?  79 PHE G HB2  1  
ATOM 8650   H HB3  . PHE G  1 79 ? -13.458 2.091   -268.680 1.00 0.00 ?  79 PHE G HB3  1  
ATOM 8651   H HD1  . PHE G  1 79 ? -16.930 1.015   -267.923 1.00 0.00 ?  79 PHE G HD1  1  
ATOM 8652   H HD2  . PHE G  1 79 ? -14.362 3.484   -270.282 1.00 0.00 ?  79 PHE G HD2  1  
ATOM 8653   H HE1  . PHE G  1 79 ? -18.902 2.199   -268.829 1.00 0.00 ?  79 PHE G HE1  1  
ATOM 8654   H HE2  . PHE G  1 79 ? -16.332 4.672   -271.187 1.00 0.00 ?  79 PHE G HE2  1  
ATOM 8655   H HZ   . PHE G  1 79 ? -18.603 4.027   -270.461 1.00 0.00 ?  79 PHE G HZ   1  
ATOM 8656   N N    . ARG G  1 80 ? -13.528 -0.884  -271.266 1.00 0.00 ?  80 ARG G N    1  
ATOM 8657   C CA   . ARG G  1 80 ? -12.937 -0.904  -272.599 1.00 0.00 ?  80 ARG G CA   1  
ATOM 8658   C C    . ARG G  1 80 ? -13.733 -0.038  -273.567 1.00 0.00 ?  80 ARG G C    1  
ATOM 8659   O O    . ARG G  1 80 ? -13.582 1.152   -273.571 1.00 0.00 ?  80 ARG G O    1  
ATOM 8660   C CB   . ARG G  1 80 ? -12.766 -2.319  -273.130 1.00 0.00 ?  80 ARG G CB   1  
ATOM 8661   C CG   . ARG G  1 80 ? -11.860 -3.210  -272.295 1.00 0.00 ?  80 ARG G CG   1  
ATOM 8662   C CD   . ARG G  1 80 ? -10.462 -2.721  -272.176 1.00 0.00 ?  80 ARG G CD   1  
ATOM 8663   N NE   . ARG G  1 80 ? -9.707  -2.746  -273.418 1.00 0.00 ?  80 ARG G NE   1  
ATOM 8664   C CZ   . ARG G  1 80 ? -8.506  -2.162  -273.595 1.00 0.00 ?  80 ARG G CZ   1  
ATOM 8665   N NH1  . ARG G  1 80 ? -7.937  -1.477  -272.627 1.00 0.00 1  80 ARG G NH1  1  
ATOM 8666   N NH2  . ARG G  1 80 ? -7.924  -2.276  -274.776 1.00 0.00 ?  80 ARG G NH2  1  
ATOM 8667   O OXT  . ARG G  1 80 ? -14.887 -0.283  -273.782 1.00 0.00 -1 80 ARG G OXT  1  
ATOM 8668   H H    . ARG G  1 80 ? -13.955 -1.724  -270.905 1.00 0.00 ?  80 ARG G H    1  
ATOM 8669   H HA   . ARG G  1 80 ? -11.931 -0.485  -272.563 1.00 0.00 ?  80 ARG G HA   1  
ATOM 8670   H HB2  . ARG G  1 80 ? -13.760 -2.763  -273.179 1.00 0.00 ?  80 ARG G HB2  1  
ATOM 8671   H HB3  . ARG G  1 80 ? -12.356 -2.234  -274.136 1.00 0.00 ?  80 ARG G HB3  1  
ATOM 8672   H HG2  . ARG G  1 80 ? -12.276 -3.285  -271.291 1.00 0.00 ?  80 ARG G HG2  1  
ATOM 8673   H HG3  . ARG G  1 80 ? -11.832 -4.200  -272.752 1.00 0.00 ?  80 ARG G HG3  1  
ATOM 8674   H HD2  . ARG G  1 80 ? -10.477 -1.691  -271.823 1.00 0.00 ?  80 ARG G HD2  1  
ATOM 8675   H HD3  . ARG G  1 80 ? -9.930  -3.344  -271.458 1.00 0.00 ?  80 ARG G HD3  1  
ATOM 8676   H HE   . ARG G  1 80 ? -9.937  -3.176  -274.304 1.00 0.00 ?  80 ARG G HE   1  
ATOM 8677   H HH11 . ARG G  1 80 ? -8.403  -1.385  -271.736 1.00 0.00 ?  80 ARG G HH11 1  
ATOM 8678   H HH12 . ARG G  1 80 ? -7.036  -1.047  -272.780 1.00 0.00 ?  80 ARG G HH12 1  
ATOM 8679   H HH21 . ARG G  1 80 ? -8.383  -2.791  -275.514 1.00 0.00 ?  80 ARG G HH21 1  
ATOM 8680   H HH22 . ARG G  1 80 ? -7.024  -1.848  -274.935 1.00 0.00 ?  80 ARG G HH22 1  
ATOM 8681   N N    . MET H  1 1  ? -35.595 -29.385 -249.418 1.00 0.00 ?  1  MET H N    1  
ATOM 8682   C CA   . MET H  1 1  ? -34.744 -29.860 -250.502 1.00 0.00 ?  1  MET H CA   1  
ATOM 8683   C C    . MET H  1 1  ? -33.826 -28.754 -251.008 1.00 0.00 ?  1  MET H C    1  
ATOM 8684   O O    . MET H  1 1  ? -32.720 -29.019 -251.478 1.00 0.00 ?  1  MET H O    1  
ATOM 8685   C CB   . MET H  1 1  ? -35.599 -30.401 -251.646 1.00 0.00 ?  1  MET H CB   1  
ATOM 8686   C CG   . MET H  1 1  ? -36.439 -31.618 -251.284 1.00 0.00 ?  1  MET H CG   1  
ATOM 8687   S SD   . MET H  1 1  ? -35.442 -32.997 -250.686 1.00 0.00 ?  1  MET H SD   1  
ATOM 8688   C CE   . MET H  1 1  ? -34.590 -33.475 -252.186 1.00 0.00 ?  1  MET H CE   1  
ATOM 8689   H H1   . MET H  1 1  ? -36.590 -29.409 -249.516 1.00 0.00 ?  1  MET H H1   1  
ATOM 8690   H H2   . MET H  1 1  ? -35.547 -29.818 -248.518 1.00 0.00 ?  1  MET H H2   1  
ATOM 8691   H H3   . MET H  1 1  ? -35.523 -28.438 -249.105 1.00 0.00 ?  1  MET H H3   1  
ATOM 8692   H HA   . MET H  1 1  ? -34.097 -30.660 -250.143 1.00 0.00 ?  1  MET H HA   1  
ATOM 8693   H HB2  . MET H  1 1  ? -36.253 -29.590 -251.964 1.00 0.00 ?  1  MET H HB2  1  
ATOM 8694   H HB3  . MET H  1 1  ? -34.918 -30.659 -252.458 1.00 0.00 ?  1  MET H HB3  1  
ATOM 8695   H HG2  . MET H  1 1  ? -37.146 -31.325 -250.509 1.00 0.00 ?  1  MET H HG2  1  
ATOM 8696   H HG3  . MET H  1 1  ? -36.984 -31.931 -252.174 1.00 0.00 ?  1  MET H HG3  1  
ATOM 8697   H HE1  . MET H  1 1  ? -33.998 -32.635 -252.551 1.00 0.00 ?  1  MET H HE1  1  
ATOM 8698   H HE2  . MET H  1 1  ? -33.932 -34.319 -251.979 1.00 0.00 ?  1  MET H HE2  1  
ATOM 8699   H HE3  . MET H  1 1  ? -35.320 -33.760 -252.944 1.00 0.00 ?  1  MET H HE3  1  
ATOM 8700   N N    . ALA H  1 2  ? -34.292 -27.514 -250.909 1.00 0.00 ?  2  ALA H N    1  
ATOM 8701   C CA   . ALA H  1 2  ? -33.520 -26.366 -251.369 1.00 0.00 ?  2  ALA H CA   1  
ATOM 8702   C C    . ALA H  1 2  ? -32.387 -26.042 -250.404 1.00 0.00 ?  2  ALA H C    1  
ATOM 8703   O O    . ALA H  1 2  ? -32.528 -26.197 -249.191 1.00 0.00 ?  2  ALA H O    1  
ATOM 8704   C CB   . ALA H  1 2  ? -34.426 -25.157 -251.553 1.00 0.00 ?  2  ALA H CB   1  
ATOM 8705   H H    . ALA H  1 2  ? -35.205 -27.362 -250.504 1.00 0.00 ?  2  ALA H H    1  
ATOM 8706   H HA   . ALA H  1 2  ? -33.068 -26.612 -252.330 1.00 0.00 ?  2  ALA H HA   1  
ATOM 8707   H HB1  . ALA H  1 2  ? -34.898 -24.909 -250.604 1.00 0.00 ?  2  ALA H HB1  1  
ATOM 8708   H HB2  . ALA H  1 2  ? -33.834 -24.309 -251.897 1.00 0.00 ?  2  ALA H HB2  1  
ATOM 8709   H HB3  . ALA H  1 2  ? -35.194 -25.387 -252.292 1.00 0.00 ?  2  ALA H HB3  1  
ATOM 8710   N N    . THR H  1 3  ? -31.262 -25.591 -250.949 1.00 0.00 ?  3  THR H N    1  
ATOM 8711   C CA   . THR H  1 3  ? -30.107 -25.232 -250.136 1.00 0.00 ?  3  THR H CA   1  
ATOM 8712   C C    . THR H  1 3  ? -29.581 -23.851 -250.506 1.00 0.00 ?  3  THR H C    1  
ATOM 8713   O O    . THR H  1 3  ? -29.246 -23.593 -251.662 1.00 0.00 ?  3  THR H O    1  
ATOM 8714   C CB   . THR H  1 3  ? -28.969 -26.259 -250.285 1.00 0.00 ?  3  THR H CB   1  
ATOM 8715   O OG1  . THR H  1 3  ? -29.439 -27.556 -249.895 1.00 0.00 ?  3  THR H OG1  1  
ATOM 8716   C CG2  . THR H  1 3  ? -27.783 -25.871 -249.417 1.00 0.00 ?  3  THR H CG2  1  
ATOM 8717   H H    . THR H  1 3  ? -31.207 -25.496 -251.953 1.00 0.00 ?  3  THR H H    1  
ATOM 8718   H HA   . THR H  1 3  ? -30.396 -25.181 -249.086 1.00 0.00 ?  3  THR H HA   1  
ATOM 8719   H HB   . THR H  1 3  ? -28.658 -26.294 -251.329 1.00 0.00 ?  3  THR H HB   1  
ATOM 8720   H HG1  . THR H  1 3  ? -28.728 -28.195 -249.989 1.00 0.00 ?  3  THR H HG1  1  
ATOM 8721   H HG21 . THR H  1 3  ? -26.989 -26.608 -249.536 1.00 0.00 ?  3  THR H HG21 1  
ATOM 8722   H HG22 . THR H  1 3  ? -27.416 -24.890 -249.719 1.00 0.00 ?  3  THR H HG22 1  
ATOM 8723   H HG23 . THR H  1 3  ? -28.093 -25.837 -248.373 1.00 0.00 ?  3  THR H HG23 1  
ATOM 8724   N N    . PRO H  1 4  ? -29.513 -22.965 -249.518 1.00 0.00 ?  4  PRO H N    1  
ATOM 8725   C CA   . PRO H  1 4  ? -28.990 -21.621 -249.729 1.00 0.00 ?  4  PRO H CA   1  
ATOM 8726   C C    . PRO H  1 4  ? -27.592 -21.661 -250.332 1.00 0.00 ?  4  PRO H C    1  
ATOM 8727   O O    . PRO H  1 4  ? -26.786 -22.529 -249.997 1.00 0.00 ?  4  PRO H O    1  
ATOM 8728   C CB   . PRO H  1 4  ? -28.997 -20.993 -248.331 1.00 0.00 ?  4  PRO H CB   1  
ATOM 8729   C CG   . PRO H  1 4  ? -30.053 -21.741 -247.593 1.00 0.00 ?  4  PRO H CG   1  
ATOM 8730   C CD   . PRO H  1 4  ? -29.975 -23.154 -248.108 1.00 0.00 ?  4  PRO H CD   1  
ATOM 8731   H HA   . PRO H  1 4  ? -29.591 -21.038 -250.443 1.00 0.00 ?  4  PRO H HA   1  
ATOM 8732   H HB2  . PRO H  1 4  ? -28.018 -21.095 -247.839 1.00 0.00 ?  4  PRO H HB2  1  
ATOM 8733   H HB3  . PRO H  1 4  ? -29.226 -19.918 -248.373 1.00 0.00 ?  4  PRO H HB3  1  
ATOM 8734   H HG2  . PRO H  1 4  ? -29.880 -21.706 -246.507 1.00 0.00 ?  4  PRO H HG2  1  
ATOM 8735   H HG3  . PRO H  1 4  ? -31.048 -21.309 -247.775 1.00 0.00 ?  4  PRO H HG3  1  
ATOM 8736   H HD2  . PRO H  1 4  ? -29.267 -23.768 -247.533 1.00 0.00 ?  4  PRO H HD2  1  
ATOM 8737   H HD3  . PRO H  1 4  ? -30.949 -23.665 -248.069 1.00 0.00 ?  4  PRO H HD3  1  
ATOM 8738   N N    . TRP H  1 5  ? -27.311 -20.718 -251.224 1.00 0.00 ?  5  TRP H N    1  
ATOM 8739   C CA   . TRP H  1 5  ? -26.012 -20.650 -251.884 1.00 0.00 ?  5  TRP H CA   1  
ATOM 8740   C C    . TRP H  1 5  ? -24.902 -20.349 -250.886 1.00 0.00 ?  5  TRP H C    1  
ATOM 8741   O O    . TRP H  1 5  ? -25.077 -19.542 -249.973 1.00 0.00 ?  5  TRP H O    1  
ATOM 8742   C CB   . TRP H  1 5  ? -26.029 -19.588 -252.986 1.00 0.00 ?  5  TRP H CB   1  
ATOM 8743   C CG   . TRP H  1 5  ? -24.702 -19.403 -253.658 1.00 0.00 ?  5  TRP H CG   1  
ATOM 8744   C CD1  . TRP H  1 5  ? -24.245 -20.066 -254.757 1.00 0.00 ?  5  TRP H CD1  1  
ATOM 8745   C CD2  . TRP H  1 5  ? -23.662 -18.495 -253.275 1.00 0.00 ?  5  TRP H CD2  1  
ATOM 8746   N NE1  . TRP H  1 5  ? -22.985 -19.629 -255.084 1.00 0.00 ?  5  TRP H NE1  1  
ATOM 8747   C CE2  . TRP H  1 5  ? -22.605 -18.662 -254.187 1.00 0.00 ?  5  TRP H CE2  1  
ATOM 8748   C CE3  . TRP H  1 5  ? -23.523 -17.555 -252.246 1.00 0.00 ?  5  TRP H CE3  1  
ATOM 8749   C CZ2  . TRP H  1 5  ? -21.430 -17.932 -254.106 1.00 0.00 ?  5  TRP H CZ2  1  
ATOM 8750   C CZ3  . TRP H  1 5  ? -22.345 -16.822 -252.165 1.00 0.00 ?  5  TRP H CZ3  1  
ATOM 8751   C CH2  . TRP H  1 5  ? -21.329 -17.005 -253.068 1.00 0.00 ?  5  TRP H CH2  1  
ATOM 8752   H H    . TRP H  1 5  ? -28.014 -20.029 -251.451 1.00 0.00 ?  5  TRP H H    1  
ATOM 8753   H HA   . TRP H  1 5  ? -25.775 -21.614 -252.333 1.00 0.00 ?  5  TRP H HA   1  
ATOM 8754   H HB2  . TRP H  1 5  ? -26.738 -19.865 -253.766 1.00 0.00 ?  5  TRP H HB2  1  
ATOM 8755   H HB3  . TRP H  1 5  ? -26.306 -18.620 -252.570 1.00 0.00 ?  5  TRP H HB3  1  
ATOM 8756   H HD1  . TRP H  1 5  ? -24.910 -20.807 -255.197 1.00 0.00 ?  5  TRP H HD1  1  
ATOM 8757   H HE1  . TRP H  1 5  ? -22.428 -19.965 -255.856 1.00 0.00 ?  5  TRP H HE1  1  
ATOM 8758   H HE3  . TRP H  1 5  ? -24.299 -17.368 -251.504 1.00 0.00 ?  5  TRP H HE3  1  
ATOM 8759   H HZ2  . TRP H  1 5  ? -20.648 -18.109 -254.844 1.00 0.00 ?  5  TRP H HZ2  1  
ATOM 8760   H HZ3  . TRP H  1 5  ? -22.250 -16.094 -251.359 1.00 0.00 ?  5  TRP H HZ3  1  
ATOM 8761   H HH2  . TRP H  1 5  ? -20.421 -16.409 -252.969 1.00 0.00 ?  5  TRP H HH2  1  
ATOM 8762   N N    . SER H  1 6  ? -23.759 -21.003 -251.065 1.00 0.00 ?  6  SER H N    1  
ATOM 8763   C CA   . SER H  1 6  ? -22.585 -20.732 -250.244 1.00 0.00 ?  6  SER H CA   1  
ATOM 8764   C C    . SER H  1 6  ? -21.309 -20.776 -251.076 1.00 0.00 ?  6  SER H C    1  
ATOM 8765   O O    . SER H  1 6  ? -21.035 -21.764 -251.757 1.00 0.00 ?  6  SER H O    1  
ATOM 8766   C CB   . SER H  1 6  ? -22.505 -21.727 -249.102 1.00 0.00 ?  6  SER H CB   1  
ATOM 8767   O OG   . SER H  1 6  ? -21.350 -21.550 -248.330 1.00 0.00 ?  6  SER H OG   1  
ATOM 8768   H H    . SER H  1 6  ? -23.702 -21.706 -251.788 1.00 0.00 ?  6  SER H H    1  
ATOM 8769   H HA   . SER H  1 6  ? -22.643 -19.786 -249.704 1.00 0.00 ?  6  SER H HA   1  
ATOM 8770   H HB2  . SER H  1 6  ? -23.380 -21.597 -248.466 1.00 0.00 ?  6  SER H HB2  1  
ATOM 8771   H HB3  . SER H  1 6  ? -22.504 -22.734 -249.516 1.00 0.00 ?  6  SER H HB3  1  
ATOM 8772   H HG   . SER H  1 6  ? -20.744 -22.278 -248.489 1.00 0.00 ?  6  SER H HG   1  
ATOM 8773   N N    . GLY H  1 7  ? -20.532 -19.700 -251.016 1.00 0.00 ?  7  GLY H N    1  
ATOM 8774   C CA   . GLY H  1 7  ? -19.280 -19.617 -251.757 1.00 0.00 ?  7  GLY H CA   1  
ATOM 8775   C C    . GLY H  1 7  ? -18.157 -20.341 -251.024 1.00 0.00 ?  7  GLY H C    1  
ATOM 8776   O O    . GLY H  1 7  ? -18.375 -20.937 -249.969 1.00 0.00 ?  7  GLY H O    1  
ATOM 8777   H H    . GLY H  1 7  ? -20.817 -18.919 -250.442 1.00 0.00 ?  7  GLY H H    1  
ATOM 8778   H HA2  . GLY H  1 7  ? -19.415 -20.072 -252.738 1.00 0.00 ?  7  GLY H HA2  1  
ATOM 8779   H HA3  . GLY H  1 7  ? -19.006 -18.569 -251.879 1.00 0.00 ?  7  GLY H HA3  1  
ATOM 8780   N N    . TYR H  1 8  ? -16.956 -20.286 -251.589 1.00 0.00 ?  8  TYR H N    1  
ATOM 8781   C CA   . TYR H  1 8  ? -15.794 -20.924 -250.983 1.00 0.00 ?  8  TYR H CA   1  
ATOM 8782   C C    . TYR H  1 8  ? -15.448 -20.282 -249.646 1.00 0.00 ?  8  TYR H C    1  
ATOM 8783   O O    . TYR H  1 8  ? -15.246 -20.973 -248.648 1.00 0.00 ?  8  TYR H O    1  
ATOM 8784   C CB   . TYR H  1 8  ? -14.591 -20.852 -251.926 1.00 0.00 ?  8  TYR H CB   1  
ATOM 8785   C CG   . TYR H  1 8  ? -13.329 -21.462 -251.358 1.00 0.00 ?  8  TYR H CG   1  
ATOM 8786   C CD1  . TYR H  1 8  ? -13.052 -22.811 -251.526 1.00 0.00 ?  8  TYR H CD1  1  
ATOM 8787   C CD2  . TYR H  1 8  ? -12.418 -20.687 -250.657 1.00 0.00 ?  8  TYR H CD2  1  
ATOM 8788   C CE1  . TYR H  1 8  ? -11.901 -23.374 -251.009 1.00 0.00 ?  8  TYR H CE1  1  
ATOM 8789   C CE2  . TYR H  1 8  ? -11.263 -21.238 -250.136 1.00 0.00 ?  8  TYR H CE2  1  
ATOM 8790   C CZ   . TYR H  1 8  ? -11.008 -22.583 -250.314 1.00 0.00 ?  8  TYR H CZ   1  
ATOM 8791   O OH   . TYR H  1 8  ? -9.860  -23.137 -249.797 1.00 0.00 ?  8  TYR H OH   1  
ATOM 8792   H H    . TYR H  1 8  ? -16.846 -19.789 -252.462 1.00 0.00 ?  8  TYR H H    1  
ATOM 8793   H HA   . TYR H  1 8  ? -16.012 -21.972 -250.777 1.00 0.00 ?  8  TYR H HA   1  
ATOM 8794   H HB2  . TYR H  1 8  ? -14.867 -21.376 -252.843 1.00 0.00 ?  8  TYR H HB2  1  
ATOM 8795   H HB3  . TYR H  1 8  ? -14.418 -19.799 -252.148 1.00 0.00 ?  8  TYR H HB3  1  
ATOM 8796   H HD1  . TYR H  1 8  ? -13.761 -23.429 -252.076 1.00 0.00 ?  8  TYR H HD1  1  
ATOM 8797   H HD2  . TYR H  1 8  ? -12.625 -19.626 -250.519 1.00 0.00 ?  8  TYR H HD2  1  
ATOM 8798   H HE1  . TYR H  1 8  ? -11.696 -24.435 -251.148 1.00 0.00 ?  8  TYR H HE1  1  
ATOM 8799   H HE2  . TYR H  1 8  ? -10.560 -20.612 -249.586 1.00 0.00 ?  8  TYR H HE2  1  
ATOM 8800   H HH   . TYR H  1 8  ? -9.782  -24.077 -249.979 1.00 0.00 ?  8  TYR H HH   1  
ATOM 8801   N N    . LEU H  1 9  ? -15.381 -18.955 -249.632 1.00 0.00 ?  9  LEU H N    1  
ATOM 8802   C CA   . LEU H  1 9  ? -15.053 -18.217 -248.418 1.00 0.00 ?  9  LEU H CA   1  
ATOM 8803   C C    . LEU H  1 9  ? -16.130 -18.395 -247.356 1.00 0.00 ?  9  LEU H C    1  
ATOM 8804   O O    . LEU H  1 9  ? -15.837 -18.436 -246.161 1.00 0.00 ?  9  LEU H O    1  
ATOM 8805   C CB   . LEU H  1 9  ? -14.860 -16.729 -248.738 1.00 0.00 ?  9  LEU H CB   1  
ATOM 8806   C CG   . LEU H  1 9  ? -13.626 -16.399 -249.588 1.00 0.00 ?  9  LEU H CG   1  
ATOM 8807   C CD1  . LEU H  1 9  ? -13.622 -14.920 -249.950 1.00 0.00 ?  9  LEU H CD1  1  
ATOM 8808   C CD2  . LEU H  1 9  ? -12.366 -16.769 -248.820 1.00 0.00 ?  9  LEU H CD2  1  
ATOM 8809   H H    . LEU H  1 9  ? -15.563 -18.444 -250.484 1.00 0.00 ?  9  LEU H H    1  
ATOM 8810   H HA   . LEU H  1 9  ? -14.130 -18.609 -247.991 1.00 0.00 ?  9  LEU H HA   1  
ATOM 8811   H HB2  . LEU H  1 9  ? -15.767 -16.552 -249.313 1.00 0.00 ?  9  LEU H HB2  1  
ATOM 8812   H HB3  . LEU H  1 9  ? -14.876 -16.117 -247.837 1.00 0.00 ?  9  LEU H HB3  1  
ATOM 8813   H HG   . LEU H  1 9  ? -13.669 -17.025 -250.479 1.00 0.00 ?  9  LEU H HG   1  
ATOM 8814   H HD11 . LEU H  1 9  ? -12.743 -14.695 -250.553 1.00 0.00 ?  9  LEU H HD11 1  
ATOM 8815   H HD12 . LEU H  1 9  ? -14.521 -14.682 -250.519 1.00 0.00 ?  9  LEU H HD12 1  
ATOM 8816   H HD13 . LEU H  1 9  ? -13.600 -14.322 -249.040 1.00 0.00 ?  9  LEU H HD13 1  
ATOM 8817   H HD21 . LEU H  1 9  ? -12.376 -17.835 -248.595 1.00 0.00 ?  9  LEU H HD21 1  
ATOM 8818   H HD22 . LEU H  1 9  ? -11.489 -16.534 -249.425 1.00 0.00 ?  9  LEU H HD22 1  
ATOM 8819   H HD23 . LEU H  1 9  ? -12.327 -16.203 -247.889 1.00 0.00 ?  9  LEU H HD23 1  
ATOM 8820   N N    . ASP H  1 10 ? -17.378 -18.501 -247.799 1.00 0.00 ?  10 ASP H N    1  
ATOM 8821   C CA   . ASP H  1 10 ? -18.466 -18.934 -246.930 1.00 0.00 ?  10 ASP H CA   1  
ATOM 8822   C C    . ASP H  1 10 ? -18.167 -20.293 -246.309 1.00 0.00 ?  10 ASP H C    1  
ATOM 8823   O O    . ASP H  1 10 ? -18.359 -20.494 -245.110 1.00 0.00 ?  10 ASP H O    1  
ATOM 8824   C CB   . ASP H  1 10 ? -19.784 -18.989 -247.706 1.00 0.00 ?  10 ASP H CB   1  
ATOM 8825   C CG   . ASP H  1 10 ? -20.344 -17.627 -248.092 1.00 0.00 ?  10 ASP H CG   1  
ATOM 8826   O OD1  . ASP H  1 10 ? -19.907 -16.647 -247.536 1.00 0.00 ?  10 ASP H OD1  1  
ATOM 8827   O OD2  . ASP H  1 10 ? -21.085 -17.560 -249.044 1.00 0.00 -1 10 ASP H OD2  1  
ATOM 8828   H H    . ASP H  1 10 ? -17.579 -18.276 -248.763 1.00 0.00 ?  10 ASP H H    1  
ATOM 8829   H HA   . ASP H  1 10 ? -18.578 -18.233 -246.102 1.00 0.00 ?  10 ASP H HA   1  
ATOM 8830   H HB2  . ASP H  1 10 ? -19.742 -19.628 -248.589 1.00 0.00 ?  10 ASP H HB2  1  
ATOM 8831   H HB3  . ASP H  1 10 ? -20.429 -19.447 -246.956 1.00 0.00 ?  10 ASP H HB3  1  
ATOM 8832   N N    . ASP H  1 11 ? -17.695 -21.223 -247.132 1.00 0.00 ?  11 ASP H N    1  
ATOM 8833   C CA   . ASP H  1 11 ? -17.353 -22.560 -246.662 1.00 0.00 ?  11 ASP H CA   1  
ATOM 8834   C C    . ASP H  1 11 ? -16.187 -22.517 -245.682 1.00 0.00 ?  11 ASP H C    1  
ATOM 8835   O O    . ASP H  1 11 ? -16.151 -23.274 -244.712 1.00 0.00 ?  11 ASP H O    1  
ATOM 8836   C CB   . ASP H  1 11 ? -17.014 -23.473 -247.843 1.00 0.00 ?  11 ASP H CB   1  
ATOM 8837   C CG   . ASP H  1 11 ? -18.208 -23.849 -248.710 1.00 0.00 ?  11 ASP H CG   1  
ATOM 8838   O OD1  . ASP H  1 11 ? -19.317 -23.603 -248.299 1.00 0.00 ?  11 ASP H OD1  1  
ATOM 8839   O OD2  . ASP H  1 11 ? -18.000 -24.232 -249.837 1.00 0.00 -1 11 ASP H OD2  1  
ATOM 8840   H H    . ASP H  1 11 ? -17.571 -20.998 -248.109 1.00 0.00 ?  11 ASP H H    1  
ATOM 8841   H HA   . ASP H  1 11 ? -18.197 -22.989 -246.121 1.00 0.00 ?  11 ASP H HA   1  
ATOM 8842   H HB2  . ASP H  1 11 ? -16.213 -23.088 -248.475 1.00 0.00 ?  11 ASP H HB2  1  
ATOM 8843   H HB3  . ASP H  1 11 ? -16.662 -24.356 -247.307 1.00 0.00 ?  11 ASP H HB3  1  
ATOM 8844   N N    . VAL H  1 12 ? -15.235 -21.627 -245.941 1.00 0.00 ?  12 VAL H N    1  
ATOM 8845   C CA   . VAL H  1 12 ? -14.099 -21.438 -245.047 1.00 0.00 ?  12 VAL H CA   1  
ATOM 8846   C C    . VAL H  1 12 ? -14.554 -20.981 -243.667 1.00 0.00 ?  12 VAL H C    1  
ATOM 8847   O O    . VAL H  1 12 ? -14.085 -21.489 -242.649 1.00 0.00 ?  12 VAL H O    1  
ATOM 8848   C CB   . VAL H  1 12 ? -13.099 -20.413 -245.613 1.00 0.00 ?  12 VAL H CB   1  
ATOM 8849   C CG1  . VAL H  1 12 ? -12.061 -20.046 -244.563 1.00 0.00 ?  12 VAL H CG1  1  
ATOM 8850   C CG2  . VAL H  1 12 ? -12.422 -20.961 -246.860 1.00 0.00 ?  12 VAL H CG2  1  
ATOM 8851   H H    . VAL H  1 12 ? -15.300 -21.067 -246.779 1.00 0.00 ?  12 VAL H H    1  
ATOM 8852   H HA   . VAL H  1 12 ? -13.573 -22.377 -244.871 1.00 0.00 ?  12 VAL H HA   1  
ATOM 8853   H HB   . VAL H  1 12 ? -13.642 -19.518 -245.916 1.00 0.00 ?  12 VAL H HB   1  
ATOM 8854   H HG11 . VAL H  1 12 ? -11.362 -19.320 -244.980 1.00 0.00 ?  12 VAL H HG11 1  
ATOM 8855   H HG12 . VAL H  1 12 ? -12.559 -19.613 -243.696 1.00 0.00 ?  12 VAL H HG12 1  
ATOM 8856   H HG13 . VAL H  1 12 ? -11.517 -20.941 -244.261 1.00 0.00 ?  12 VAL H HG13 1  
ATOM 8857   H HG21 . VAL H  1 12 ? -13.175 -21.177 -247.618 1.00 0.00 ?  12 VAL H HG21 1  
ATOM 8858   H HG22 . VAL H  1 12 ? -11.719 -20.224 -247.247 1.00 0.00 ?  12 VAL H HG22 1  
ATOM 8859   H HG23 . VAL H  1 12 ? -11.887 -21.877 -246.610 1.00 0.00 ?  12 VAL H HG23 1  
ATOM 8860   N N    . SER H  1 13 ? -15.470 -20.019 -243.641 1.00 0.00 ?  13 SER H N    1  
ATOM 8861   C CA   . SER H  1 13 ? -16.059 -19.556 -242.390 1.00 0.00 ?  13 SER H CA   1  
ATOM 8862   C C    . SER H  1 13 ? -16.761 -20.692 -241.657 1.00 0.00 ?  13 SER H C    1  
ATOM 8863   O O    . SER H  1 13 ? -16.629 -20.836 -240.442 1.00 0.00 ?  13 SER H O    1  
ATOM 8864   C CB   . SER H  1 13 ? -17.028 -18.421 -242.657 1.00 0.00 ?  13 SER H CB   1  
ATOM 8865   O OG   . SER H  1 13 ? -17.665 -17.986 -241.488 1.00 0.00 ?  13 SER H OG   1  
ATOM 8866   H H    . SER H  1 13 ? -15.767 -19.598 -244.509 1.00 0.00 ?  13 SER H H    1  
ATOM 8867   H HA   . SER H  1 13 ? -15.340 -19.075 -241.725 1.00 0.00 ?  13 SER H HA   1  
ATOM 8868   H HB2  . SER H  1 13 ? -16.476 -17.587 -243.091 1.00 0.00 ?  13 SER H HB2  1  
ATOM 8869   H HB3  . SER H  1 13 ? -17.781 -18.764 -243.365 1.00 0.00 ?  13 SER H HB3  1  
ATOM 8870   H HG   . SER H  1 13 ? -18.489 -17.550 -241.716 1.00 0.00 ?  13 SER H HG   1  
ATOM 8871   N N    . ALA H  1 14 ? -17.509 -21.498 -242.404 1.00 0.00 ?  14 ALA H N    1  
ATOM 8872   C CA   . ALA H  1 14 ? -18.209 -22.641 -241.832 1.00 0.00 ?  14 ALA H CA   1  
ATOM 8873   C C    . ALA H  1 14 ? -17.229 -23.679 -241.302 1.00 0.00 ?  14 ALA H C    1  
ATOM 8874   O O    . ALA H  1 14 ? -17.452 -24.278 -240.250 1.00 0.00 ?  14 ALA H O    1  
ATOM 8875   C CB   . ALA H  1 14 ? -19.138 -23.264 -242.864 1.00 0.00 ?  14 ALA H CB   1  
ATOM 8876   H H    . ALA H  1 14 ? -17.594 -21.313 -243.393 1.00 0.00 ?  14 ALA H H    1  
ATOM 8877   H HA   . ALA H  1 14 ? -18.807 -22.298 -240.988 1.00 0.00 ?  14 ALA H HA   1  
ATOM 8878   H HB1  . ALA H  1 14 ? -18.557 -23.598 -243.722 1.00 0.00 ?  14 ALA H HB1  1  
ATOM 8879   H HB2  . ALA H  1 14 ? -19.654 -24.116 -242.421 1.00 0.00 ?  14 ALA H HB2  1  
ATOM 8880   H HB3  . ALA H  1 14 ? -19.871 -22.524 -243.187 1.00 0.00 ?  14 ALA H HB3  1  
ATOM 8881   N N    . LYS H  1 15 ? -16.141 -23.888 -242.036 1.00 0.00 ?  15 LYS H N    1  
ATOM 8882   C CA   . LYS H  1 15 ? -15.140 -24.878 -241.658 1.00 0.00 ?  15 LYS H CA   1  
ATOM 8883   C C    . LYS H  1 15 ? -14.498 -24.530 -240.321 1.00 0.00 ?  15 LYS H C    1  
ATOM 8884   O O    . LYS H  1 15 ? -14.279 -25.403 -239.481 1.00 0.00 ?  15 LYS H O    1  
ATOM 8885   C CB   . LYS H  1 15 ? -14.067 -24.995 -242.742 1.00 0.00 ?  15 LYS H CB   1  
ATOM 8886   C CG   . LYS H  1 15 ? -14.494 -25.793 -243.967 1.00 0.00 ?  15 LYS H CG   1  
ATOM 8887   C CD   . LYS H  1 15 ? -13.446 -25.721 -245.067 1.00 0.00 ?  15 LYS H CD   1  
ATOM 8888   C CE   . LYS H  1 15 ? -13.922 -26.418 -246.333 1.00 0.00 ?  15 LYS H CE   1  
ATOM 8889   N NZ   . LYS H  1 15 ? -14.034 -27.891 -246.149 1.00 0.00 1  15 LYS H NZ   1  
ATOM 8890   H H    . LYS H  1 15 ? -16.005 -23.347 -242.878 1.00 0.00 ?  15 LYS H H    1  
ATOM 8891   H HA   . LYS H  1 15 ? -15.614 -25.852 -241.531 1.00 0.00 ?  15 LYS H HA   1  
ATOM 8892   H HB2  . LYS H  1 15 ? -13.805 -23.980 -243.043 1.00 0.00 ?  15 LYS H HB2  1  
ATOM 8893   H HB3  . LYS H  1 15 ? -13.200 -25.472 -242.284 1.00 0.00 ?  15 LYS H HB3  1  
ATOM 8894   H HG2  . LYS H  1 15 ? -14.640 -26.832 -243.670 1.00 0.00 ?  15 LYS H HG2  1  
ATOM 8895   H HG3  . LYS H  1 15 ? -15.435 -25.385 -244.335 1.00 0.00 ?  15 LYS H HG3  1  
ATOM 8896   H HD2  . LYS H  1 15 ? -13.241 -24.672 -245.284 1.00 0.00 ?  15 LYS H HD2  1  
ATOM 8897   H HD3  . LYS H  1 15 ? -12.535 -26.202 -244.710 1.00 0.00 ?  15 LYS H HD3  1  
ATOM 8898   H HE2  . LYS H  1 15 ? -14.896 -26.011 -246.602 1.00 0.00 ?  15 LYS H HE2  1  
ATOM 8899   H HE3  . LYS H  1 15 ? -13.208 -26.205 -247.129 1.00 0.00 ?  15 LYS H HE3  1  
ATOM 8900   H HZ1  . LYS H  1 15 ? -14.696 -28.088 -245.413 1.00 0.00 ?  15 LYS H HZ1  1  
ATOM 8901   H HZ2  . LYS H  1 15 ? -14.352 -28.314 -247.010 1.00 0.00 ?  15 LYS H HZ2  1  
ATOM 8902   H HZ3  . LYS H  1 15 ? -13.131 -28.269 -245.901 1.00 0.00 ?  15 LYS H HZ3  1  
ATOM 8903   N N    . PHE H  1 16 ? -14.200 -23.250 -240.130 1.00 0.00 ?  16 PHE H N    1  
ATOM 8904   C CA   . PHE H  1 16 ? -13.681 -22.766 -238.856 1.00 0.00 ?  16 PHE H CA   1  
ATOM 8905   C C    . PHE H  1 16 ? -14.715 -22.917 -237.747 1.00 0.00 ?  16 PHE H C    1  
ATOM 8906   O O    . PHE H  1 16 ? -14.420 -23.450 -236.678 1.00 0.00 ?  16 PHE H O    1  
ATOM 8907   C CB   . PHE H  1 16 ? -13.247 -21.304 -238.975 1.00 0.00 ?  16 PHE H CB   1  
ATOM 8908   C CG   . PHE H  1 16 ? -12.693 -20.730 -237.703 1.00 0.00 ?  16 PHE H CG   1  
ATOM 8909   C CD1  . PHE H  1 16 ? -11.348 -20.867 -237.391 1.00 0.00 ?  16 PHE H CD1  1  
ATOM 8910   C CD2  . PHE H  1 16 ? -13.514 -20.054 -236.814 1.00 0.00 ?  16 PHE H CD2  1  
ATOM 8911   C CE1  . PHE H  1 16 ? -10.837 -20.339 -236.220 1.00 0.00 ?  16 PHE H CE1  1  
ATOM 8912   C CE2  . PHE H  1 16 ? -13.006 -19.524 -235.644 1.00 0.00 ?  16 PHE H CE2  1  
ATOM 8913   C CZ   . PHE H  1 16 ? -11.666 -19.668 -235.347 1.00 0.00 ?  16 PHE H CZ   1  
ATOM 8914   H H    . PHE H  1 16 ? -14.336 -22.594 -240.886 1.00 0.00 ?  16 PHE H H    1  
ATOM 8915   H HA   . PHE H  1 16 ? -12.818 -23.363 -238.557 1.00 0.00 ?  16 PHE H HA   1  
ATOM 8916   H HB2  . PHE H  1 16 ? -12.466 -21.205 -239.728 1.00 0.00 ?  16 PHE H HB2  1  
ATOM 8917   H HB3  . PHE H  1 16 ? -14.098 -20.683 -239.252 1.00 0.00 ?  16 PHE H HB3  1  
ATOM 8918   H HD1  . PHE H  1 16 ? -10.693 -21.397 -238.083 1.00 0.00 ?  16 PHE H HD1  1  
ATOM 8919   H HD2  . PHE H  1 16 ? -14.574 -19.941 -237.048 1.00 0.00 ?  16 PHE H HD2  1  
ATOM 8920   H HE1  . PHE H  1 16 ? -9.779  -20.454 -235.988 1.00 0.00 ?  16 PHE H HE1  1  
ATOM 8921   H HE2  . PHE H  1 16 ? -13.663 -18.994 -234.954 1.00 0.00 ?  16 PHE H HE2  1  
ATOM 8922   H HZ   . PHE H  1 16 ? -11.264 -19.253 -234.423 1.00 0.00 ?  16 PHE H HZ   1  
ATOM 8923   N N    . ASP H  1 17 ? -15.929 -22.443 -238.009 1.00 0.00 ?  17 ASP H N    1  
ATOM 8924   C CA   . ASP H  1 17 ? -16.985 -22.445 -237.004 1.00 0.00 ?  17 ASP H CA   1  
ATOM 8925   C C    . ASP H  1 17 ? -17.351 -23.866 -236.592 1.00 0.00 ?  17 ASP H C    1  
ATOM 8926   O O    . ASP H  1 17 ? -17.767 -24.106 -235.459 1.00 0.00 ?  17 ASP H O    1  
ATOM 8927   C CB   . ASP H  1 17 ? -18.224 -21.713 -237.526 1.00 0.00 ?  17 ASP H CB   1  
ATOM 8928   C CG   . ASP H  1 17 ? -18.091 -20.197 -237.559 1.00 0.00 ?  17 ASP H CG   1  
ATOM 8929   O OD1  . ASP H  1 17 ? -17.171 -19.687 -236.965 1.00 0.00 ?  17 ASP H OD1  1  
ATOM 8930   O OD2  . ASP H  1 17 ? -18.811 -19.574 -238.302 1.00 0.00 -1 17 ASP H OD2  1  
ATOM 8931   H H    . ASP H  1 17 ? -16.125 -22.073 -238.928 1.00 0.00 ?  17 ASP H H    1  
ATOM 8932   H HA   . ASP H  1 17 ? -16.637 -21.941 -236.102 1.00 0.00 ?  17 ASP H HA   1  
ATOM 8933   H HB2  . ASP H  1 17 ? -18.561 -22.069 -238.500 1.00 0.00 ?  17 ASP H HB2  1  
ATOM 8934   H HB3  . ASP H  1 17 ? -18.950 -21.997 -236.763 1.00 0.00 ?  17 ASP H HB3  1  
ATOM 8935   N N    . THR H  1 18 ? -17.195 -24.804 -237.520 1.00 0.00 ?  18 THR H N    1  
ATOM 8936   C CA   . THR H  1 18 ? -17.512 -26.202 -237.256 1.00 0.00 ?  18 THR H CA   1  
ATOM 8937   C C    . THR H  1 18 ? -16.861 -26.680 -235.964 1.00 0.00 ?  18 THR H C    1  
ATOM 8938   O O    . THR H  1 18 ? -17.487 -27.372 -235.161 1.00 0.00 ?  18 THR H O    1  
ATOM 8939   C CB   . THR H  1 18 ? -17.060 -27.112 -238.413 1.00 0.00 ?  18 THR H CB   1  
ATOM 8940   O OG1  . THR H  1 18 ? -17.781 -26.769 -239.604 1.00 0.00 ?  18 THR H OG1  1  
ATOM 8941   C CG2  . THR H  1 18 ? -17.314 -28.573 -238.074 1.00 0.00 ?  18 THR H CG2  1  
ATOM 8942   H H    . THR H  1 18 ? -16.849 -24.541 -238.432 1.00 0.00 ?  18 THR H H    1  
ATOM 8943   H HA   . THR H  1 18 ? -18.587 -26.318 -237.120 1.00 0.00 ?  18 THR H HA   1  
ATOM 8944   H HB   . THR H  1 18 ? -15.995 -26.961 -238.588 1.00 0.00 ?  18 THR H HB   1  
ATOM 8945   H HG1  . THR H  1 18 ? -17.497 -27.337 -240.324 1.00 0.00 ?  18 THR H HG1  1  
ATOM 8946   H HG21 . THR H  1 18 ? -16.988 -29.200 -238.904 1.00 0.00 ?  18 THR H HG21 1  
ATOM 8947   H HG22 . THR H  1 18 ? -16.758 -28.839 -237.176 1.00 0.00 ?  18 THR H HG22 1  
ATOM 8948   H HG23 . THR H  1 18 ? -18.378 -28.725 -237.900 1.00 0.00 ?  18 THR H HG23 1  
ATOM 8949   N N    . GLY H  1 19 ? -15.600 -26.307 -235.770 1.00 0.00 ?  19 GLY H N    1  
ATOM 8950   C CA   . GLY H  1 19 ? -14.812 -26.822 -234.657 1.00 0.00 ?  19 GLY H CA   1  
ATOM 8951   C C    . GLY H  1 19 ? -15.069 -26.025 -233.384 1.00 0.00 ?  19 GLY H C    1  
ATOM 8952   O O    . GLY H  1 19 ? -14.700 -26.450 -232.289 1.00 0.00 ?  19 GLY H O    1  
ATOM 8953   H H    . GLY H  1 19 ? -15.178 -25.649 -236.409 1.00 0.00 ?  19 GLY H H    1  
ATOM 8954   H HA2  . GLY H  1 19 ? -15.080 -27.864 -234.483 1.00 0.00 ?  19 GLY H HA2  1  
ATOM 8955   H HA3  . GLY H  1 19 ? -13.754 -26.757 -234.909 1.00 0.00 ?  19 GLY H HA3  1  
ATOM 8956   N N    . VAL H  1 20 ? -15.703 -24.868 -233.535 1.00 0.00 ?  20 VAL H N    1  
ATOM 8957   C CA   . VAL H  1 20 ? -15.981 -23.993 -232.402 1.00 0.00 ?  20 VAL H CA   1  
ATOM 8958   C C    . VAL H  1 20 ? -17.437 -23.545 -232.395 1.00 0.00 ?  20 VAL H C    1  
ATOM 8959   O O    . VAL H  1 20 ? -17.769 -22.487 -231.861 1.00 0.00 ?  20 VAL H O    1  
ATOM 8960   C CB   . VAL H  1 20 ? -15.072 -22.749 -232.412 1.00 0.00 ?  20 VAL H CB   1  
ATOM 8961   C CG1  . VAL H  1 20 ? -13.637 -23.136 -232.086 1.00 0.00 ?  20 VAL H CG1  1  
ATOM 8962   C CG2  . VAL H  1 20 ? -15.140 -22.050 -233.761 1.00 0.00 ?  20 VAL H CG2  1  
ATOM 8963   H H    . VAL H  1 20 ? -16.001 -24.586 -234.458 1.00 0.00 ?  20 VAL H H    1  
ATOM 8964   H HA   . VAL H  1 20 ? -15.845 -24.516 -231.455 1.00 0.00 ?  20 VAL H HA   1  
ATOM 8965   H HB   . VAL H  1 20 ? -15.434 -22.040 -231.668 1.00 0.00 ?  20 VAL H HB   1  
ATOM 8966   H HG11 . VAL H  1 20 ? -13.008 -22.246 -232.097 1.00 0.00 ?  20 VAL H HG11 1  
ATOM 8967   H HG12 . VAL H  1 20 ? -13.599 -23.594 -231.098 1.00 0.00 ?  20 VAL H HG12 1  
ATOM 8968   H HG13 . VAL H  1 20 ? -13.273 -23.845 -232.830 1.00 0.00 ?  20 VAL H HG13 1  
ATOM 8969   H HG21 . VAL H  1 20 ? -16.167 -21.739 -233.958 1.00 0.00 ?  20 VAL H HG21 1  
ATOM 8970   H HG22 . VAL H  1 20 ? -14.493 -21.174 -233.750 1.00 0.00 ?  20 VAL H HG22 1  
ATOM 8971   H HG23 . VAL H  1 20 ? -14.811 -22.735 -234.542 1.00 0.00 ?  20 VAL H HG23 1  
ATOM 8972   N N    . ASP H  1 21 ? -18.303 -24.357 -232.992 1.00 0.00 ?  21 ASP H N    1  
ATOM 8973   C CA   . ASP H  1 21 ? -19.736 -24.087 -232.985 1.00 0.00 ?  21 ASP H CA   1  
ATOM 8974   C C    . ASP H  1 21 ? -20.274 -24.006 -231.563 1.00 0.00 ?  21 ASP H C    1  
ATOM 8975   O O    . ASP H  1 21 ? -21.161 -23.205 -231.269 1.00 0.00 ?  21 ASP H O    1  
ATOM 8976   C CB   . ASP H  1 21 ? -20.488 -25.164 -233.771 1.00 0.00 ?  21 ASP H CB   1  
ATOM 8977   C CG   . ASP H  1 21 ? -21.970 -24.877 -233.972 1.00 0.00 ?  21 ASP H CG   1  
ATOM 8978   O OD1  . ASP H  1 21 ? -22.285 -23.888 -234.590 1.00 0.00 ?  21 ASP H OD1  1  
ATOM 8979   O OD2  . ASP H  1 21 ? -22.768 -25.722 -233.645 1.00 0.00 -1 21 ASP H OD2  1  
ATOM 8980   H H    . ASP H  1 21 ? -17.960 -25.182 -233.463 1.00 0.00 ?  21 ASP H H    1  
ATOM 8981   H HA   . ASP H  1 21 ? -19.932 -23.119 -233.447 1.00 0.00 ?  21 ASP H HA   1  
ATOM 8982   H HB2  . ASP H  1 21 ? -20.031 -25.399 -234.733 1.00 0.00 ?  21 ASP H HB2  1  
ATOM 8983   H HB3  . ASP H  1 21 ? -20.371 -26.012 -233.095 1.00 0.00 ?  21 ASP H HB3  1  
ATOM 8984   N N    . ASN H  1 22 ? -19.732 -24.840 -230.682 1.00 0.00 ?  22 ASN H N    1  
ATOM 8985   C CA   . ASN H  1 22 ? -20.181 -24.889 -229.296 1.00 0.00 ?  22 ASN H CA   1  
ATOM 8986   C C    . ASN H  1 22 ? -19.583 -23.749 -228.482 1.00 0.00 ?  22 ASN H C    1  
ATOM 8987   O O    . ASN H  1 22 ? -20.172 -23.299 -227.500 1.00 0.00 ?  22 ASN H O    1  
ATOM 8988   C CB   . ASN H  1 22 ? -19.851 -26.223 -228.652 1.00 0.00 ?  22 ASN H CB   1  
ATOM 8989   C CG   . ASN H  1 22 ? -20.675 -27.367 -229.172 1.00 0.00 ?  22 ASN H CG   1  
ATOM 8990   O OD1  . ASN H  1 22 ? -21.771 -27.174 -229.711 1.00 0.00 ?  22 ASN H OD1  1  
ATOM 8991   N ND2  . ASN H  1 22 ? -20.194 -28.562 -228.940 1.00 0.00 ?  22 ASN H ND2  1  
ATOM 8992   H H    . ASN H  1 22 ? -18.990 -25.457 -230.980 1.00 0.00 ?  22 ASN H H    1  
ATOM 8993   H HA   . ASN H  1 22 ? -21.264 -24.764 -229.253 1.00 0.00 ?  22 ASN H HA   1  
ATOM 8994   H HB2  . ASN H  1 22 ? -18.815 -26.549 -228.542 1.00 0.00 ?  22 ASN H HB2  1  
ATOM 8995   H HB3  . ASN H  1 22 ? -20.241 -25.922 -227.679 1.00 0.00 ?  22 ASN H HB3  1  
ATOM 8996   H HD21 . ASN H  1 22 ? -19.331 -28.666 -228.446 1.00 0.00 ?  22 ASN H HD21 1  
ATOM 8997   H HD22 . ASN H  1 22 ? -20.689 -29.371 -229.258 1.00 0.00 ?  22 ASN H HD22 1  
ATOM 8998   N N    . LEU H  1 23 ? -18.409 -23.285 -228.898 1.00 0.00 ?  23 LEU H N    1  
ATOM 8999   C CA   . LEU H  1 23 ? -17.709 -22.224 -228.185 1.00 0.00 ?  23 LEU H CA   1  
ATOM 9000   C C    . LEU H  1 23 ? -18.617 -21.023 -227.954 1.00 0.00 ?  23 LEU H C    1  
ATOM 9001   O O    . LEU H  1 23 ? -18.716 -20.513 -226.838 1.00 0.00 ?  23 LEU H O    1  
ATOM 9002   C CB   . LEU H  1 23 ? -16.454 -21.802 -228.960 1.00 0.00 ?  23 LEU H CB   1  
ATOM 9003   C CG   . LEU H  1 23 ? -15.790 -20.508 -228.474 1.00 0.00 ?  23 LEU H CG   1  
ATOM 9004   C CD1  . LEU H  1 23 ? -15.425 -20.629 -227.001 1.00 0.00 ?  23 LEU H CD1  1  
ATOM 9005   C CD2  . LEU H  1 23 ? -14.554 -20.223 -229.314 1.00 0.00 ?  23 LEU H CD2  1  
ATOM 9006   H H    . LEU H  1 23 ? -17.991 -23.679 -229.729 1.00 0.00 ?  23 LEU H H    1  
ATOM 9007   H HA   . LEU H  1 23 ? -17.411 -22.580 -227.199 1.00 0.00 ?  23 LEU H HA   1  
ATOM 9008   H HB2  . LEU H  1 23 ? -15.815 -22.656 -228.740 1.00 0.00 ?  23 LEU H HB2  1  
ATOM 9009   H HB3  . LEU H  1 23 ? -16.639 -21.755 -230.033 1.00 0.00 ?  23 LEU H HB3  1  
ATOM 9010   H HG   . LEU H  1 23 ? -16.500 -19.697 -228.641 1.00 0.00 ?  23 LEU H HG   1  
ATOM 9011   H HD11 . LEU H  1 23 ? -14.954 -19.706 -226.664 1.00 0.00 ?  23 LEU H HD11 1  
ATOM 9012   H HD12 . LEU H  1 23 ? -16.327 -20.809 -226.416 1.00 0.00 ?  23 LEU H HD12 1  
ATOM 9013   H HD13 . LEU H  1 23 ? -14.732 -21.459 -226.865 1.00 0.00 ?  23 LEU H HD13 1  
ATOM 9014   H HD21 . LEU H  1 23 ? -14.841 -20.112 -230.360 1.00 0.00 ?  23 LEU H HD21 1  
ATOM 9015   H HD22 . LEU H  1 23 ? -14.083 -19.303 -228.968 1.00 0.00 ?  23 LEU H HD22 1  
ATOM 9016   H HD23 . LEU H  1 23 ? -13.850 -21.050 -229.217 1.00 0.00 ?  23 LEU H HD23 1  
ATOM 9017   N N    . GLN H  1 24 ? -19.279 -20.575 -229.016 1.00 0.00 ?  24 GLN H N    1  
ATOM 9018   C CA   . GLN H  1 24 ? -20.179 -19.432 -228.931 1.00 0.00 ?  24 GLN H CA   1  
ATOM 9019   C C    . GLN H  1 24 ? -21.274 -19.668 -227.899 1.00 0.00 ?  24 GLN H C    1  
ATOM 9020   O O    . GLN H  1 24 ? -21.574 -18.793 -227.087 1.00 0.00 ?  24 GLN H O    1  
ATOM 9021   C CB   . GLN H  1 24 ? -20.810 -19.144 -230.297 1.00 0.00 ?  24 GLN H CB   1  
ATOM 9022   C CG   . GLN H  1 24 ? -21.725 -17.932 -230.317 1.00 0.00 ?  24 GLN H CG   1  
ATOM 9023   C CD   . GLN H  1 24 ? -22.322 -17.680 -231.688 1.00 0.00 ?  24 GLN H CD   1  
ATOM 9024   O OE1  . GLN H  1 24 ? -22.117 -18.460 -232.623 1.00 0.00 ?  24 GLN H OE1  1  
ATOM 9025   N NE2  . GLN H  1 24 ? -23.061 -16.584 -231.819 1.00 0.00 ?  24 GLN H NE2  1  
ATOM 9026   H H    . GLN H  1 24 ? -19.155 -21.039 -229.904 1.00 0.00 ?  24 GLN H H    1  
ATOM 9027   H HA   . GLN H  1 24 ? -19.625 -18.554 -228.600 1.00 0.00 ?  24 GLN H HA   1  
ATOM 9028   H HB2  . GLN H  1 24 ? -19.989 -18.999 -230.998 1.00 0.00 ?  24 GLN H HB2  1  
ATOM 9029   H HB3  . GLN H  1 24 ? -21.373 -20.035 -230.577 1.00 0.00 ?  24 GLN H HB3  1  
ATOM 9030   H HG2  . GLN H  1 24 ? -22.509 -17.772 -229.577 1.00 0.00 ?  24 GLN H HG2  1  
ATOM 9031   H HG3  . GLN H  1 24 ? -20.921 -17.214 -230.153 1.00 0.00 ?  24 GLN H HG3  1  
ATOM 9032   H HE21 . GLN H  1 24 ? -23.199 -15.977 -231.036 1.00 0.00 ?  24 GLN H HE21 1  
ATOM 9033   H HE22 . GLN H  1 24 ? -23.480 -16.365 -232.701 1.00 0.00 ?  24 GLN H HE22 1  
ATOM 9034   N N    . THR H  1 25 ? -21.869 -20.856 -227.936 1.00 0.00 ?  25 THR H N    1  
ATOM 9035   C CA   . THR H  1 25 ? -22.952 -21.199 -227.022 1.00 0.00 ?  25 THR H CA   1  
ATOM 9036   C C    . THR H  1 25 ? -22.462 -21.248 -225.581 1.00 0.00 ?  25 THR H C    1  
ATOM 9037   O O    . THR H  1 25 ? -23.146 -20.789 -224.666 1.00 0.00 ?  25 THR H O    1  
ATOM 9038   C CB   . THR H  1 25 ? -23.587 -22.555 -227.383 1.00 0.00 ?  25 THR H CB   1  
ATOM 9039   O OG1  . THR H  1 25 ? -24.162 -22.482 -228.694 1.00 0.00 ?  25 THR H OG1  1  
ATOM 9040   C CG2  . THR H  1 25 ? -24.670 -22.921 -226.378 1.00 0.00 ?  25 THR H CG2  1  
ATOM 9041   H H    . THR H  1 25 ? -21.562 -21.539 -228.614 1.00 0.00 ?  25 THR H H    1  
ATOM 9042   H HA   . THR H  1 25 ? -23.724 -20.431 -227.059 1.00 0.00 ?  25 THR H HA   1  
ATOM 9043   H HB   . THR H  1 25 ? -22.813 -23.322 -227.377 1.00 0.00 ?  25 THR H HB   1  
ATOM 9044   H HG1  . THR H  1 25 ? -23.476 -22.275 -229.333 1.00 0.00 ?  25 THR H HG1  1  
ATOM 9045   H HG21 . THR H  1 25 ? -25.107 -23.881 -226.650 1.00 0.00 ?  25 THR H HG21 1  
ATOM 9046   H HG22 . THR H  1 25 ? -24.233 -22.988 -225.382 1.00 0.00 ?  25 THR H HG22 1  
ATOM 9047   H HG23 . THR H  1 25 ? -25.444 -22.155 -226.384 1.00 0.00 ?  25 THR H HG23 1  
ATOM 9048   N N    . GLN H  1 26 ? -21.272 -21.806 -225.384 1.00 0.00 ?  26 GLN H N    1  
ATOM 9049   C CA   . GLN H  1 26 ? -20.714 -21.970 -224.047 1.00 0.00 ?  26 GLN H CA   1  
ATOM 9050   C C    . GLN H  1 26 ? -20.445 -20.621 -223.393 1.00 0.00 ?  26 GLN H C    1  
ATOM 9051   O O    . GLN H  1 26 ? -20.790 -20.402 -222.232 1.00 0.00 ?  26 GLN H O    1  
ATOM 9052   C CB   . GLN H  1 26 ? -19.419 -22.785 -224.102 1.00 0.00 ?  26 GLN H CB   1  
ATOM 9053   C CG   . GLN H  1 26 ? -19.626 -24.263 -224.387 1.00 0.00 ?  26 GLN H CG   1  
ATOM 9054   C CD   . GLN H  1 26 ? -18.316 -25.020 -224.493 1.00 0.00 ?  26 GLN H CD   1  
ATOM 9055   O OE1  . GLN H  1 26 ? -17.235 -24.443 -224.346 1.00 0.00 ?  26 GLN H OE1  1  
ATOM 9056   N NE2  . GLN H  1 26 ? -18.404 -26.319 -224.755 1.00 0.00 ?  26 GLN H NE2  1  
ATOM 9057   H H    . GLN H  1 26 ? -20.740 -22.125 -226.181 1.00 0.00 ?  26 GLN H H    1  
ATOM 9058   H HA   . GLN H  1 26 ? -21.435 -22.484 -223.411 1.00 0.00 ?  26 GLN H HA   1  
ATOM 9059   H HB2  . GLN H  1 26 ? -18.801 -22.341 -224.883 1.00 0.00 ?  26 GLN H HB2  1  
ATOM 9060   H HB3  . GLN H  1 26 ? -18.928 -22.662 -223.137 1.00 0.00 ?  26 GLN H HB3  1  
ATOM 9061   H HG2  . GLN H  1 26 ? -20.325 -24.880 -223.824 1.00 0.00 ?  26 GLN H HG2  1  
ATOM 9062   H HG3  . GLN H  1 26 ? -20.015 -24.103 -225.394 1.00 0.00 ?  26 GLN H HG3  1  
ATOM 9063   H HE21 . GLN H  1 26 ? -19.301 -26.747 -224.869 1.00 0.00 ?  26 GLN H HE21 1  
ATOM 9064   H HE22 . GLN H  1 26 ? -17.573 -26.871 -224.837 1.00 0.00 ?  26 GLN H HE22 1  
ATOM 9065   N N    . VAL H  1 27 ? -19.826 -19.717 -224.146 1.00 0.00 ?  27 VAL H N    1  
ATOM 9066   C CA   . VAL H  1 27 ? -19.442 -18.413 -223.618 1.00 0.00 ?  27 VAL H CA   1  
ATOM 9067   C C    . VAL H  1 27 ? -20.653 -17.501 -223.470 1.00 0.00 ?  27 VAL H C    1  
ATOM 9068   O O    . VAL H  1 27 ? -20.667 -16.604 -222.628 1.00 0.00 ?  27 VAL H O    1  
ATOM 9069   C CB   . VAL H  1 27 ? -18.400 -17.724 -224.518 1.00 0.00 ?  27 VAL H CB   1  
ATOM 9070   C CG1  . VAL H  1 27 ? -19.067 -17.136 -225.753 1.00 0.00 ?  27 VAL H CG1  1  
ATOM 9071   C CG2  . VAL H  1 27 ? -17.662 -16.641 -223.746 1.00 0.00 ?  27 VAL H CG2  1  
ATOM 9072   H H    . VAL H  1 27 ? -19.616 -19.940 -225.108 1.00 0.00 ?  27 VAL H H    1  
ATOM 9073   H HA   . VAL H  1 27 ? -19.031 -18.498 -222.612 1.00 0.00 ?  27 VAL H HA   1  
ATOM 9074   H HB   . VAL H  1 27 ? -17.654 -18.459 -224.823 1.00 0.00 ?  27 VAL H HB   1  
ATOM 9075   H HG11 . VAL H  1 27 ? -18.315 -16.653 -226.378 1.00 0.00 ?  27 VAL H HG11 1  
ATOM 9076   H HG12 . VAL H  1 27 ? -19.551 -17.932 -226.318 1.00 0.00 ?  27 VAL H HG12 1  
ATOM 9077   H HG13 . VAL H  1 27 ? -19.811 -16.401 -225.448 1.00 0.00 ?  27 VAL H HG13 1  
ATOM 9078   H HG21 . VAL H  1 27 ? -17.153 -17.086 -222.891 1.00 0.00 ?  27 VAL H HG21 1  
ATOM 9079   H HG22 . VAL H  1 27 ? -16.929 -16.165 -224.396 1.00 0.00 ?  27 VAL H HG22 1  
ATOM 9080   H HG23 . VAL H  1 27 ? -18.376 -15.895 -223.396 1.00 0.00 ?  27 VAL H HG23 1  
ATOM 9081   N N    . THR H  1 28 ? -21.669 -17.736 -224.294 1.00 0.00 ?  28 THR H N    1  
ATOM 9082   C CA   . THR H  1 28 ? -22.931 -17.016 -224.178 1.00 0.00 ?  28 THR H CA   1  
ATOM 9083   C C    . THR H  1 28 ? -23.679 -17.413 -222.912 1.00 0.00 ?  28 THR H C    1  
ATOM 9084   O O    . THR H  1 28 ? -24.193 -16.559 -222.190 1.00 0.00 ?  28 THR H O    1  
ATOM 9085   C CB   . THR H  1 28 ? -23.839 -17.266 -225.397 1.00 0.00 ?  28 THR H CB   1  
ATOM 9086   O OG1  . THR H  1 28 ? -23.210 -16.751 -226.578 1.00 0.00 ?  28 THR H OG1  1  
ATOM 9087   C CG2  . THR H  1 28 ? -25.186 -16.587 -225.208 1.00 0.00 ?  28 THR H CG2  1  
ATOM 9088   H H    . THR H  1 28 ? -21.564 -18.432 -225.018 1.00 0.00 ?  28 THR H H    1  
ATOM 9089   H HA   . THR H  1 28 ? -22.739 -15.945 -224.100 1.00 0.00 ?  28 THR H HA   1  
ATOM 9090   H HB   . THR H  1 28 ? -23.987 -18.340 -225.514 1.00 0.00 ?  28 THR H HB   1  
ATOM 9091   H HG1  . THR H  1 28 ? -22.292 -17.033 -226.600 1.00 0.00 ?  28 THR H HG1  1  
ATOM 9092   H HG21 . THR H  1 28 ? -25.813 -16.776 -226.079 1.00 0.00 ?  28 THR H HG21 1  
ATOM 9093   H HG22 . THR H  1 28 ? -25.672 -16.986 -224.317 1.00 0.00 ?  28 THR H HG22 1  
ATOM 9094   H HG23 . THR H  1 28 ? -25.039 -15.514 -225.092 1.00 0.00 ?  28 THR H HG23 1  
ATOM 9095   N N    . GLU H  1 29 ? -23.734 -18.714 -222.647 1.00 0.00 ?  29 GLU H N    1  
ATOM 9096   C CA   . GLU H  1 29 ? -24.363 -19.223 -221.434 1.00 0.00 ?  29 GLU H CA   1  
ATOM 9097   C C    . GLU H  1 29 ? -23.567 -18.830 -220.196 1.00 0.00 ?  29 GLU H C    1  
ATOM 9098   O O    . GLU H  1 29 ? -24.137 -18.567 -219.137 1.00 0.00 ?  29 GLU H O    1  
ATOM 9099   C CB   . GLU H  1 29 ? -24.509 -20.744 -221.504 1.00 0.00 ?  29 GLU H CB   1  
ATOM 9100   C CG   . GLU H  1 29 ? -25.569 -21.229 -222.483 1.00 0.00 ?  29 GLU H CG   1  
ATOM 9101   C CD   . GLU H  1 29 ? -25.576 -22.729 -222.583 1.00 0.00 ?  29 GLU H CD   1  
ATOM 9102   O OE1  . GLU H  1 29 ? -24.738 -23.350 -221.974 1.00 0.00 ?  29 GLU H OE1  1  
ATOM 9103   O OE2  . GLU H  1 29 ? -26.484 -23.261 -223.176 1.00 0.00 -1 29 GLU H OE2  1  
ATOM 9104   H H    . GLU H  1 29 ? -23.331 -19.367 -223.304 1.00 0.00 ?  29 GLU H H    1  
ATOM 9105   H HA   . GLU H  1 29 ? -25.353 -18.782 -221.318 1.00 0.00 ?  29 GLU H HA   1  
ATOM 9106   H HB2  . GLU H  1 29 ? -23.538 -21.145 -221.794 1.00 0.00 ?  29 GLU H HB2  1  
ATOM 9107   H HB3  . GLU H  1 29 ? -24.759 -21.087 -220.500 1.00 0.00 ?  29 GLU H HB3  1  
ATOM 9108   H HG2  . GLU H  1 29 ? -26.573 -20.878 -222.245 1.00 0.00 ?  29 GLU H HG2  1  
ATOM 9109   H HG3  . GLU H  1 29 ? -25.253 -20.803 -223.434 1.00 0.00 ?  29 GLU H HG3  1  
ATOM 9110   N N    . ALA H  1 30 ? -22.246 -18.793 -220.334 1.00 0.00 ?  30 ALA H N    1  
ATOM 9111   C CA   . ALA H  1 30 ? -21.376 -18.329 -219.261 1.00 0.00 ?  30 ALA H CA   1  
ATOM 9112   C C    . ALA H  1 30 ? -21.628 -16.861 -218.943 1.00 0.00 ?  30 ALA H C    1  
ATOM 9113   O O    . ALA H  1 30 ? -21.599 -16.454 -217.782 1.00 0.00 ?  30 ALA H O    1  
ATOM 9114   C CB   . ALA H  1 30 ? -19.916 -18.553 -219.628 1.00 0.00 ?  30 ALA H CB   1  
ATOM 9115   H H    . ALA H  1 30 ? -21.834 -19.094 -221.206 1.00 0.00 ?  30 ALA H H    1  
ATOM 9116   H HA   . ALA H  1 30 ? -21.598 -18.900 -218.359 1.00 0.00 ?  30 ALA H HA   1  
ATOM 9117   H HB1  . ALA H  1 30 ? -19.681 -18.001 -220.537 1.00 0.00 ?  30 ALA H HB1  1  
ATOM 9118   H HB2  . ALA H  1 30 ? -19.279 -18.201 -218.816 1.00 0.00 ?  30 ALA H HB2  1  
ATOM 9119   H HB3  . ALA H  1 30 ? -19.740 -19.616 -219.793 1.00 0.00 ?  30 ALA H HB3  1  
ATOM 9120   N N    . LEU H  1 31 ? -21.874 -16.070 -219.981 1.00 0.00 ?  31 LEU H N    1  
ATOM 9121   C CA   . LEU H  1 31 ? -22.261 -14.675 -219.807 1.00 0.00 ?  31 LEU H CA   1  
ATOM 9122   C C    . LEU H  1 31 ? -23.614 -14.561 -219.116 1.00 0.00 ?  31 LEU H C    1  
ATOM 9123   O O    . LEU H  1 31 ? -23.788 -13.757 -218.200 1.00 0.00 ?  31 LEU H O    1  
ATOM 9124   C CB   . LEU H  1 31 ? -22.293 -13.961 -221.164 1.00 0.00 ?  31 LEU H CB   1  
ATOM 9125   C CG   . LEU H  1 31 ? -22.724 -12.489 -221.117 1.00 0.00 ?  31 LEU H CG   1  
ATOM 9126   C CD1  . LEU H  1 31 ? -21.769 -11.693 -220.237 1.00 0.00 ?  31 LEU H CD1  1  
ATOM 9127   C CD2  . LEU H  1 31 ? -22.755 -11.923 -222.529 1.00 0.00 ?  31 LEU H CD2  1  
ATOM 9128   H H    . LEU H  1 31 ? -21.792 -16.445 -220.916 1.00 0.00 ?  31 LEU H H    1  
ATOM 9129   H HA   . LEU H  1 31 ? -21.541 -14.175 -219.161 1.00 0.00 ?  31 LEU H HA   1  
ATOM 9130   H HB2  . LEU H  1 31 ? -21.239 -14.033 -221.427 1.00 0.00 ?  31 LEU H HB2  1  
ATOM 9131   H HB3  . LEU H  1 31 ? -22.889 -14.508 -221.895 1.00 0.00 ?  31 LEU H HB3  1  
ATOM 9132   H HG   . LEU H  1 31 ? -23.740 -12.461 -220.724 1.00 0.00 ?  31 LEU H HG   1  
ATOM 9133   H HD11 . LEU H  1 31 ? -22.082 -10.650 -220.210 1.00 0.00 ?  31 LEU H HD11 1  
ATOM 9134   H HD12 . LEU H  1 31 ? -21.779 -12.101 -219.227 1.00 0.00 ?  31 LEU H HD12 1  
ATOM 9135   H HD13 . LEU H  1 31 ? -20.760 -11.758 -220.645 1.00 0.00 ?  31 LEU H HD13 1  
ATOM 9136   H HD21 . LEU H  1 31 ? -23.465 -12.488 -223.132 1.00 0.00 ?  31 LEU H HD21 1  
ATOM 9137   H HD22 . LEU H  1 31 ? -23.062 -10.877 -222.493 1.00 0.00 ?  31 LEU H HD22 1  
ATOM 9138   H HD23 . LEU H  1 31 ? -21.763 -11.995 -222.973 1.00 0.00 ?  31 LEU H HD23 1  
ATOM 9139   N N    . ASP H  1 32 ? -24.570 -15.370 -219.560 1.00 0.00 ?  32 ASP H N    1  
ATOM 9140   C CA   . ASP H  1 32 ? -25.915 -15.346 -218.999 1.00 0.00 ?  32 ASP H CA   1  
ATOM 9141   C C    . ASP H  1 32 ? -25.892 -15.611 -217.499 1.00 0.00 ?  32 ASP H C    1  
ATOM 9142   O O    . ASP H  1 32 ? -26.574 -14.935 -216.729 1.00 0.00 ?  32 ASP H O    1  
ATOM 9143   C CB   . ASP H  1 32 ? -26.807 -16.373 -219.701 1.00 0.00 ?  32 ASP H CB   1  
ATOM 9144   C CG   . ASP H  1 32 ? -27.209 -15.993 -221.120 1.00 0.00 ?  32 ASP H CG   1  
ATOM 9145   O OD1  . ASP H  1 32 ? -27.013 -14.859 -221.488 1.00 0.00 ?  32 ASP H OD1  1  
ATOM 9146   O OD2  . ASP H  1 32 ? -27.560 -16.871 -221.871 1.00 0.00 -1 32 ASP H OD2  1  
ATOM 9147   H H    . ASP H  1 32 ? -24.359 -16.018 -220.305 1.00 0.00 ?  32 ASP H H    1  
ATOM 9148   H HA   . ASP H  1 32 ? -26.353 -14.356 -219.133 1.00 0.00 ?  32 ASP H HA   1  
ATOM 9149   H HB2  . ASP H  1 32 ? -26.393 -17.382 -219.699 1.00 0.00 ?  32 ASP H HB2  1  
ATOM 9150   H HB3  . ASP H  1 32 ? -27.684 -16.339 -219.054 1.00 0.00 ?  32 ASP H HB3  1  
ATOM 9151   N N    . LYS H  1 33 ? -25.103 -16.598 -217.090 1.00 0.00 ?  33 LYS H N    1  
ATOM 9152   C CA   . LYS H  1 33 ? -24.971 -16.939 -215.679 1.00 0.00 ?  33 LYS H CA   1  
ATOM 9153   C C    . LYS H  1 33 ? -24.196 -15.866 -214.924 1.00 0.00 ?  33 LYS H C    1  
ATOM 9154   O O    . LYS H  1 33 ? -24.595 -15.448 -213.837 1.00 0.00 ?  33 LYS H O    1  
ATOM 9155   C CB   . LYS H  1 33 ? -24.284 -18.296 -215.517 1.00 0.00 ?  33 LYS H CB   1  
ATOM 9156   C CG   . LYS H  1 33 ? -25.116 -19.482 -215.986 1.00 0.00 ?  33 LYS H CG   1  
ATOM 9157   C CD   . LYS H  1 33 ? -24.347 -20.787 -215.848 1.00 0.00 ?  33 LYS H CD   1  
ATOM 9158   C CE   . LYS H  1 33 ? -25.143 -21.961 -216.399 1.00 0.00 ?  33 LYS H CE   1  
ATOM 9159   N NZ   . LYS H  1 33 ? -24.385 -23.238 -216.309 1.00 0.00 1  33 LYS H NZ   1  
ATOM 9160   H H    . LYS H  1 33 ? -24.581 -17.126 -217.775 1.00 0.00 ?  33 LYS H H    1  
ATOM 9161   H HA   . LYS H  1 33 ? -25.958 -16.991 -215.218 1.00 0.00 ?  33 LYS H HA   1  
ATOM 9162   H HB2  . LYS H  1 33 ? -23.357 -18.255 -216.089 1.00 0.00 ?  33 LYS H HB2  1  
ATOM 9163   H HB3  . LYS H  1 33 ? -24.051 -18.413 -214.459 1.00 0.00 ?  33 LYS H HB3  1  
ATOM 9164   H HG2  . LYS H  1 33 ? -26.023 -19.529 -215.383 1.00 0.00 ?  33 LYS H HG2  1  
ATOM 9165   H HG3  . LYS H  1 33 ? -25.384 -19.326 -217.031 1.00 0.00 ?  33 LYS H HG3  1  
ATOM 9166   H HD2  . LYS H  1 33 ? -23.407 -20.696 -216.395 1.00 0.00 ?  33 LYS H HD2  1  
ATOM 9167   H HD3  . LYS H  1 33 ? -24.136 -20.956 -214.793 1.00 0.00 ?  33 LYS H HD3  1  
ATOM 9168   H HE2  . LYS H  1 33 ? -26.066 -22.046 -215.828 1.00 0.00 ?  33 LYS H HE2  1  
ATOM 9169   H HE3  . LYS H  1 33 ? -25.380 -21.753 -217.442 1.00 0.00 ?  33 LYS H HE3  1  
ATOM 9170   H HZ1  . LYS H  1 33 ? -24.166 -23.432 -215.343 1.00 0.00 ?  33 LYS H HZ1  1  
ATOM 9171   H HZ2  . LYS H  1 33 ? -24.947 -23.990 -216.684 1.00 0.00 ?  33 LYS H HZ2  1  
ATOM 9172   H HZ3  . LYS H  1 33 ? -23.529 -23.161 -216.840 1.00 0.00 ?  33 LYS H HZ3  1  
ATOM 9173   N N    . LEU H  1 34 ? -23.086 -15.425 -215.506 1.00 0.00 ?  34 LEU H N    1  
ATOM 9174   C CA   . LEU H  1 34 ? -22.242 -14.415 -214.879 1.00 0.00 ?  34 LEU H CA   1  
ATOM 9175   C C    . LEU H  1 34 ? -23.015 -13.126 -214.633 1.00 0.00 ?  34 LEU H C    1  
ATOM 9176   O O    . LEU H  1 34 ? -22.794 -12.438 -213.637 1.00 0.00 ?  34 LEU H O    1  
ATOM 9177   C CB   . LEU H  1 34 ? -21.009 -14.141 -215.749 1.00 0.00 ?  34 LEU H CB   1  
ATOM 9178   C CG   . LEU H  1 34 ? -20.002 -13.144 -215.159 1.00 0.00 ?  34 LEU H CG   1  
ATOM 9179   C CD1  . LEU H  1 34 ? -19.442 -13.682 -213.850 1.00 0.00 ?  34 LEU H CD1  1  
ATOM 9180   C CD2  . LEU H  1 34 ? -18.886 -12.895 -216.162 1.00 0.00 ?  34 LEU H CD2  1  
ATOM 9181   H H    . LEU H  1 34 ? -22.820 -15.799 -216.405 1.00 0.00 ?  34 LEU H H    1  
ATOM 9182   H HA   . LEU H  1 34 ? -21.913 -14.769 -213.902 1.00 0.00 ?  34 LEU H HA   1  
ATOM 9183   H HB2  . LEU H  1 34 ? -20.578 -15.141 -215.767 1.00 0.00 ?  34 LEU H HB2  1  
ATOM 9184   H HB3  . LEU H  1 34 ? -21.286 -13.847 -216.761 1.00 0.00 ?  34 LEU H HB3  1  
ATOM 9185   H HG   . LEU H  1 34 ? -20.530 -12.202 -215.007 1.00 0.00 ?  34 LEU H HG   1  
ATOM 9186   H HD11 . LEU H  1 34 ? -18.728 -12.968 -213.438 1.00 0.00 ?  34 LEU H HD11 1  
ATOM 9187   H HD12 . LEU H  1 34 ? -20.255 -13.831 -213.139 1.00 0.00 ?  34 LEU H HD12 1  
ATOM 9188   H HD13 . LEU H  1 34 ? -18.940 -14.632 -214.032 1.00 0.00 ?  34 LEU H HD13 1  
ATOM 9189   H HD21 . LEU H  1 34 ? -19.306 -12.485 -217.081 1.00 0.00 ?  34 LEU H HD21 1  
ATOM 9190   H HD22 . LEU H  1 34 ? -18.172 -12.186 -215.742 1.00 0.00 ?  34 LEU H HD22 1  
ATOM 9191   H HD23 . LEU H  1 34 ? -18.378 -13.835 -216.383 1.00 0.00 ?  34 LEU H HD23 1  
ATOM 9192   N N    . ALA H  1 35 ? -23.923 -12.804 -215.548 1.00 0.00 ?  35 ALA H N    1  
ATOM 9193   C CA   . ALA H  1 35 ? -24.770 -11.625 -215.405 1.00 0.00 ?  35 ALA H CA   1  
ATOM 9194   C C    . ALA H  1 35 ? -25.549 -11.662 -214.097 1.00 0.00 ?  35 ALA H C    1  
ATOM 9195   O O    . ALA H  1 35 ? -25.767 -10.629 -213.464 1.00 0.00 ?  35 ALA H O    1  
ATOM 9196   C CB   . ALA H  1 35 ? -25.720 -11.509 -216.588 1.00 0.00 ?  35 ALA H CB   1  
ATOM 9197   H H    . ALA H  1 35 ? -24.030 -13.390 -216.363 1.00 0.00 ?  35 ALA H H    1  
ATOM 9198   H HA   . ALA H  1 35 ? -24.135 -10.740 -215.380 1.00 0.00 ?  35 ALA H HA   1  
ATOM 9199   H HB1  . ALA H  1 35 ? -26.351 -12.394 -216.636 1.00 0.00 ?  35 ALA H HB1  1  
ATOM 9200   H HB2  . ALA H  1 35 ? -26.344 -10.624 -216.466 1.00 0.00 ?  35 ALA H HB2  1  
ATOM 9201   H HB3  . ALA H  1 35 ? -25.144 -11.422 -217.510 1.00 0.00 ?  35 ALA H HB3  1  
ATOM 9202   N N    . ALA H  1 36 ? -25.966 -12.858 -213.696 1.00 0.00 ?  36 ALA H N    1  
ATOM 9203   C CA   . ALA H  1 36 ? -26.715 -13.033 -212.457 1.00 0.00 ?  36 ALA H CA   1  
ATOM 9204   C C    . ALA H  1 36 ? -25.816 -12.854 -211.240 1.00 0.00 ?  36 ALA H C    1  
ATOM 9205   O O    . ALA H  1 36 ? -26.202 -12.219 -210.259 1.00 0.00 ?  36 ALA H O    1  
ATOM 9206   C CB   . ALA H  1 36 ? -27.383 -14.400 -212.430 1.00 0.00 ?  36 ALA H CB   1  
ATOM 9207   H H    . ALA H  1 36 ? -25.759 -13.667 -214.264 1.00 0.00 ?  36 ALA H H    1  
ATOM 9208   H HA   . ALA H  1 36 ? -27.488 -12.266 -212.405 1.00 0.00 ?  36 ALA H HA   1  
ATOM 9209   H HB1  . ALA H  1 36 ? -26.624 -15.177 -212.497 1.00 0.00 ?  36 ALA H HB1  1  
ATOM 9210   H HB2  . ALA H  1 36 ? -27.938 -14.514 -211.499 1.00 0.00 ?  36 ALA H HB2  1  
ATOM 9211   H HB3  . ALA H  1 36 ? -28.068 -14.486 -213.274 1.00 0.00 ?  36 ALA H HB3  1  
ATOM 9212   N N    . LYS H  1 37 ? -24.615 -13.419 -211.310 1.00 0.00 ?  37 LYS H N    1  
ATOM 9213   C CA   . LYS H  1 37 ? -23.650 -13.303 -210.223 1.00 0.00 ?  37 LYS H CA   1  
ATOM 9214   C C    . LYS H  1 37 ? -22.266 -12.949 -210.751 1.00 0.00 ?  37 LYS H C    1  
ATOM 9215   O O    . LYS H  1 37 ? -21.394 -13.810 -210.862 1.00 0.00 ?  37 LYS H O    1  
ATOM 9216   C CB   . LYS H  1 37 ? -23.589 -14.603 -209.420 1.00 0.00 ?  37 LYS H CB   1  
ATOM 9217   C CG   . LYS H  1 37 ? -24.903 -14.995 -208.756 1.00 0.00 ?  37 LYS H CG   1  
ATOM 9218   C CD   . LYS H  1 37 ? -24.729 -16.210 -207.858 1.00 0.00 ?  37 LYS H CD   1  
ATOM 9219   C CE   . LYS H  1 37 ? -26.052 -16.637 -207.239 1.00 0.00 ?  37 LYS H CE   1  
ATOM 9220   N NZ   . LYS H  1 37 ? -25.895 -17.819 -206.349 1.00 0.00 1  37 LYS H NZ   1  
ATOM 9221   H H    . LYS H  1 37 ? -24.365 -13.942 -212.137 1.00 0.00 ?  37 LYS H H    1  
ATOM 9222   H HA   . LYS H  1 37 ? -23.944 -12.494 -209.553 1.00 0.00 ?  37 LYS H HA   1  
ATOM 9223   H HB2  . LYS H  1 37 ? -23.283 -15.391 -210.109 1.00 0.00 ?  37 LYS H HB2  1  
ATOM 9224   H HB3  . LYS H  1 37 ? -22.823 -14.472 -208.656 1.00 0.00 ?  37 LYS H HB3  1  
ATOM 9225   H HG2  . LYS H  1 37 ? -25.256 -14.151 -208.162 1.00 0.00 ?  37 LYS H HG2  1  
ATOM 9226   H HG3  . LYS H  1 37 ? -25.631 -15.220 -209.535 1.00 0.00 ?  37 LYS H HG3  1  
ATOM 9227   H HD2  . LYS H  1 37 ? -24.325 -17.029 -208.455 1.00 0.00 ?  37 LYS H HD2  1  
ATOM 9228   H HD3  . LYS H  1 37 ? -24.023 -15.958 -207.066 1.00 0.00 ?  37 LYS H HD3  1  
ATOM 9229   H HE2  . LYS H  1 37 ? -26.446 -15.800 -206.665 1.00 0.00 ?  37 LYS H HE2  1  
ATOM 9230   H HE3  . LYS H  1 37 ? -26.743 -16.880 -208.046 1.00 0.00 ?  37 LYS H HE3  1  
ATOM 9231   H HZ1  . LYS H  1 37 ? -25.255 -17.594 -205.601 1.00 0.00 ?  37 LYS H HZ1  1  
ATOM 9232   H HZ2  . LYS H  1 37 ? -26.793 -18.070 -205.961 1.00 0.00 ?  37 LYS H HZ2  1  
ATOM 9233   H HZ3  . LYS H  1 37 ? -25.529 -18.596 -206.882 1.00 0.00 ?  37 LYS H HZ3  1  
ATOM 9234   N N    . PRO H  1 38 ? -22.070 -11.675 -211.076 1.00 0.00 ?  38 PRO H N    1  
ATOM 9235   C CA   . PRO H  1 38 ? -20.800 -11.209 -211.618 1.00 0.00 ?  38 PRO H CA   1  
ATOM 9236   C C    . PRO H  1 38 ? -19.656 -11.475 -210.647 1.00 0.00 ?  38 PRO H C    1  
ATOM 9237   O O    . PRO H  1 38 ? -18.500 -11.592 -211.052 1.00 0.00 ?  38 PRO H O    1  
ATOM 9238   C CB   . PRO H  1 38 ? -21.020 -9.712  -211.853 1.00 0.00 ?  38 PRO H CB   1  
ATOM 9239   C CG   . PRO H  1 38 ? -22.498 -9.570  -211.989 1.00 0.00 ?  38 PRO H CG   1  
ATOM 9240   C CD   . PRO H  1 38 ? -23.084 -10.587 -211.046 1.00 0.00 ?  38 PRO H CD   1  
ATOM 9241   H HA   . PRO H  1 38 ? -20.514 -11.732 -212.542 1.00 0.00 ?  38 PRO H HA   1  
ATOM 9242   H HB2  . PRO H  1 38 ? -20.638 -9.111  -211.015 1.00 0.00 ?  38 PRO H HB2  1  
ATOM 9243   H HB3  . PRO H  1 38 ? -20.502 -9.366  -212.760 1.00 0.00 ?  38 PRO H HB3  1  
ATOM 9244   H HG2  . PRO H  1 38 ? -22.826 -8.553  -211.728 1.00 0.00 ?  38 PRO H HG2  1  
ATOM 9245   H HG3  . PRO H  1 38 ? -22.822 -9.757  -213.023 1.00 0.00 ?  38 PRO H HG3  1  
ATOM 9246   H HD2  . PRO H  1 38 ? -23.213 -10.185 -210.030 1.00 0.00 ?  38 PRO H HD2  1  
ATOM 9247   H HD3  . PRO H  1 38 ? -24.070 -10.942 -211.378 1.00 0.00 ?  38 PRO H HD3  1  
ATOM 9248   N N    . SER H  1 39 ? -19.987 -11.569 -209.363 1.00 0.00 ?  39 SER H N    1  
ATOM 9249   C CA   . SER H  1 39 ? -18.975 -11.653 -208.316 1.00 0.00 ?  39 SER H CA   1  
ATOM 9250   C C    . SER H  1 39 ? -18.599 -13.101 -208.029 1.00 0.00 ?  39 SER H C    1  
ATOM 9251   O O    . SER H  1 39 ? -17.877 -13.387 -207.074 1.00 0.00 ?  39 SER H O    1  
ATOM 9252   C CB   . SER H  1 39 ? -19.473 -10.976 -207.054 1.00 0.00 ?  39 SER H CB   1  
ATOM 9253   O OG   . SER H  1 39 ? -20.554 -11.660 -206.482 1.00 0.00 ?  39 SER H OG   1  
ATOM 9254   H H    . SER H  1 39 ? -20.963 -11.582 -209.106 1.00 0.00 ?  39 SER H H    1  
ATOM 9255   H HA   . SER H  1 39 ? -18.078 -11.072 -208.533 1.00 0.00 ?  39 SER H HA   1  
ATOM 9256   H HB2  . SER H  1 39 ? -18.656 -10.939 -206.334 1.00 0.00 ?  39 SER H HB2  1  
ATOM 9257   H HB3  . SER H  1 39 ? -19.785 -9.962  -207.301 1.00 0.00 ?  39 SER H HB3  1  
ATOM 9258   H HG   . SER H  1 39 ? -21.279 -11.695 -207.111 1.00 0.00 ?  39 SER H HG   1  
ATOM 9259   N N    . ASP H  1 40 ? -19.094 -14.011 -208.861 1.00 0.00 ?  40 ASP H N    1  
ATOM 9260   C CA   . ASP H  1 40 ? -18.759 -15.425 -208.736 1.00 0.00 ?  40 ASP H CA   1  
ATOM 9261   C C    . ASP H  1 40 ? -17.443 -15.743 -209.435 1.00 0.00 ?  40 ASP H C    1  
ATOM 9262   O O    . ASP H  1 40 ? -17.336 -15.633 -210.657 1.00 0.00 ?  40 ASP H O    1  
ATOM 9263   C CB   . ASP H  1 40 ? -19.881 -16.295 -209.308 1.00 0.00 ?  40 ASP H CB   1  
ATOM 9264   C CG   . ASP H  1 40 ? -19.676 -17.792 -209.118 1.00 0.00 ?  40 ASP H CG   1  
ATOM 9265   O OD1  . ASP H  1 40 ? -18.627 -18.174 -208.656 1.00 0.00 ?  40 ASP H OD1  1  
ATOM 9266   O OD2  . ASP H  1 40 ? -20.620 -18.526 -209.286 1.00 0.00 -1 40 ASP H OD2  1  
ATOM 9267   H H    . ASP H  1 40 ? -19.717 -13.717 -209.598 1.00 0.00 ?  40 ASP H H    1  
ATOM 9268   H HA   . ASP H  1 40 ? -18.621 -15.681 -207.685 1.00 0.00 ?  40 ASP H HA   1  
ATOM 9269   H HB2  . ASP H  1 40 ? -20.872 -16.016 -208.949 1.00 0.00 ?  40 ASP H HB2  1  
ATOM 9270   H HB3  . ASP H  1 40 ? -19.794 -16.048 -210.366 1.00 0.00 ?  40 ASP H HB3  1  
ATOM 9271   N N    . PRO H  1 41 ? -16.444 -16.138 -208.654 1.00 0.00 ?  41 PRO H N    1  
ATOM 9272   C CA   . PRO H  1 41 ? -15.133 -16.472 -209.197 1.00 0.00 ?  41 PRO H CA   1  
ATOM 9273   C C    . PRO H  1 41 ? -15.234 -17.579 -210.238 1.00 0.00 ?  41 PRO H C    1  
ATOM 9274   O O    . PRO H  1 41 ? -14.508 -17.578 -211.232 1.00 0.00 ?  41 PRO H O    1  
ATOM 9275   C CB   . PRO H  1 41 ? -14.320 -16.905 -207.972 1.00 0.00 ?  41 PRO H CB   1  
ATOM 9276   C CG   . PRO H  1 41 ? -14.996 -16.238 -206.823 1.00 0.00 ?  41 PRO H CG   1  
ATOM 9277   C CD   . PRO H  1 41 ? -16.460 -16.228 -207.173 1.00 0.00 ?  41 PRO H CD   1  
ATOM 9278   H HA   . PRO H  1 41 ? -14.662 -15.629 -209.724 1.00 0.00 ?  41 PRO H HA   1  
ATOM 9279   H HB2  . PRO H  1 41 ? -14.320 -17.999 -207.854 1.00 0.00 ?  41 PRO H HB2  1  
ATOM 9280   H HB3  . PRO H  1 41 ? -13.269 -16.589 -208.054 1.00 0.00 ?  41 PRO H HB3  1  
ATOM 9281   H HG2  . PRO H  1 41 ? -14.818 -16.785 -205.885 1.00 0.00 ?  41 PRO H HG2  1  
ATOM 9282   H HG3  . PRO H  1 41 ? -14.617 -15.216 -206.677 1.00 0.00 ?  41 PRO H HG3  1  
ATOM 9283   H HD2  . PRO H  1 41 ? -16.975 -17.139 -206.836 1.00 0.00 ?  41 PRO H HD2  1  
ATOM 9284   H HD3  . PRO H  1 41 ? -16.989 -15.374 -206.723 1.00 0.00 ?  41 PRO H HD3  1  
ATOM 9285   N N    . ALA H  1 42 ? -16.139 -18.524 -210.004 1.00 0.00 ?  42 ALA H N    1  
ATOM 9286   C CA   . ALA H  1 42 ? -16.303 -19.665 -210.896 1.00 0.00 ?  42 ALA H CA   1  
ATOM 9287   C C    . ALA H  1 42 ? -16.845 -19.231 -212.252 1.00 0.00 ?  42 ALA H C    1  
ATOM 9288   O O    . ALA H  1 42 ? -16.383 -19.697 -213.293 1.00 0.00 ?  42 ALA H O    1  
ATOM 9289   C CB   . ALA H  1 42 ? -17.218 -20.704 -210.264 1.00 0.00 ?  42 ALA H CB   1  
ATOM 9290   H H    . ALA H  1 42 ? -16.728 -18.449 -209.187 1.00 0.00 ?  42 ALA H H    1  
ATOM 9291   H HA   . ALA H  1 42 ? -15.327 -20.119 -211.066 1.00 0.00 ?  42 ALA H HA   1  
ATOM 9292   H HB1  . ALA H  1 42 ? -18.194 -20.261 -210.073 1.00 0.00 ?  42 ALA H HB1  1  
ATOM 9293   H HB2  . ALA H  1 42 ? -17.330 -21.550 -210.943 1.00 0.00 ?  42 ALA H HB2  1  
ATOM 9294   H HB3  . ALA H  1 42 ? -16.784 -21.048 -209.325 1.00 0.00 ?  42 ALA H HB3  1  
ATOM 9295   N N    . LEU H  1 43 ? -17.827 -18.337 -212.232 1.00 0.00 ?  43 LEU H N    1  
ATOM 9296   C CA   . LEU H  1 43 ? -18.418 -17.821 -213.461 1.00 0.00 ?  43 LEU H CA   1  
ATOM 9297   C C    . LEU H  1 43 ? -17.461 -16.881 -214.181 1.00 0.00 ?  43 LEU H C    1  
ATOM 9298   O O    . LEU H  1 43 ? -17.418 -16.845 -215.411 1.00 0.00 ?  43 LEU H O    1  
ATOM 9299   C CB   . LEU H  1 43 ? -19.739 -17.105 -213.153 1.00 0.00 ?  43 LEU H CB   1  
ATOM 9300   C CG   . LEU H  1 43 ? -20.862 -18.006 -212.624 1.00 0.00 ?  43 LEU H CG   1  
ATOM 9301   C CD1  . LEU H  1 43 ? -22.049 -17.158 -212.186 1.00 0.00 ?  43 LEU H CD1  1  
ATOM 9302   C CD2  . LEU H  1 43 ? -21.275 -18.994 -213.705 1.00 0.00 ?  43 LEU H CD2  1  
ATOM 9303   H H    . LEU H  1 43 ? -18.172 -18.005 -211.343 1.00 0.00 ?  43 LEU H H    1  
ATOM 9304   H HA   . LEU H  1 43 ? -18.614 -18.646 -214.145 1.00 0.00 ?  43 LEU H HA   1  
ATOM 9305   H HB2  . LEU H  1 43 ? -19.398 -16.433 -212.368 1.00 0.00 ?  43 LEU H HB2  1  
ATOM 9306   H HB3  . LEU H  1 43 ? -20.090 -16.521 -214.004 1.00 0.00 ?  43 LEU H HB3  1  
ATOM 9307   H HG   . LEU H  1 43 ? -20.454 -18.577 -211.789 1.00 0.00 ?  43 LEU H HG   1  
ATOM 9308   H HD11 . LEU H  1 43 ? -22.841 -17.807 -211.812 1.00 0.00 ?  43 LEU H HD11 1  
ATOM 9309   H HD12 . LEU H  1 43 ? -21.737 -16.475 -211.396 1.00 0.00 ?  43 LEU H HD12 1  
ATOM 9310   H HD13 . LEU H  1 43 ? -22.420 -16.586 -213.036 1.00 0.00 ?  43 LEU H HD13 1  
ATOM 9311   H HD21 . LEU H  1 43 ? -20.418 -19.608 -213.983 1.00 0.00 ?  43 LEU H HD21 1  
ATOM 9312   H HD22 . LEU H  1 43 ? -22.072 -19.634 -213.327 1.00 0.00 ?  43 LEU H HD22 1  
ATOM 9313   H HD23 . LEU H  1 43 ? -21.630 -18.449 -214.580 1.00 0.00 ?  43 LEU H HD23 1  
ATOM 9314   N N    . LEU H  1 44 ? -16.693 -16.120 -213.408 1.00 0.00 ?  44 LEU H N    1  
ATOM 9315   C CA   . LEU H  1 44 ? -15.698 -15.214 -213.970 1.00 0.00 ?  44 LEU H CA   1  
ATOM 9316   C C    . LEU H  1 44 ? -14.593 -15.983 -214.682 1.00 0.00 ?  44 LEU H C    1  
ATOM 9317   O O    . LEU H  1 44 ? -14.228 -15.660 -215.813 1.00 0.00 ?  44 LEU H O    1  
ATOM 9318   C CB   . LEU H  1 44 ? -15.106 -14.327 -212.867 1.00 0.00 ?  44 LEU H CB   1  
ATOM 9319   C CG   . LEU H  1 44 ? -16.020 -13.197 -212.378 1.00 0.00 ?  44 LEU H CG   1  
ATOM 9320   C CD1  . LEU H  1 44 ? -15.440 -12.564 -211.120 1.00 0.00 ?  44 LEU H CD1  1  
ATOM 9321   C CD2  . LEU H  1 44 ? -16.180 -12.159 -213.479 1.00 0.00 ?  44 LEU H CD2  1  
ATOM 9322   H H    . LEU H  1 44 ? -16.801 -16.171 -212.405 1.00 0.00 ?  44 LEU H H    1  
ATOM 9323   H HA   . LEU H  1 44 ? -16.166 -14.579 -214.721 1.00 0.00 ?  44 LEU H HA   1  
ATOM 9324   H HB2  . LEU H  1 44 ? -14.985 -15.075 -212.085 1.00 0.00 ?  44 LEU H HB2  1  
ATOM 9325   H HB3  . LEU H  1 44 ? -14.130 -13.933 -213.148 1.00 0.00 ?  44 LEU H HB3  1  
ATOM 9326   H HG   . LEU H  1 44 ? -17.001 -13.633 -212.186 1.00 0.00 ?  44 LEU H HG   1  
ATOM 9327   H HD11 . LEU H  1 44 ? -16.096 -11.763 -210.780 1.00 0.00 ?  44 LEU H HD11 1  
ATOM 9328   H HD12 . LEU H  1 44 ? -15.356 -13.319 -210.339 1.00 0.00 ?  44 LEU H HD12 1  
ATOM 9329   H HD13 . LEU H  1 44 ? -14.454 -12.157 -211.340 1.00 0.00 ?  44 LEU H HD13 1  
ATOM 9330   H HD21 . LEU H  1 44 ? -16.622 -12.627 -214.359 1.00 0.00 ?  44 LEU H HD21 1  
ATOM 9331   H HD22 . LEU H  1 44 ? -16.830 -11.356 -213.130 1.00 0.00 ?  44 LEU H HD22 1  
ATOM 9332   H HD23 . LEU H  1 44 ? -15.203 -11.749 -213.738 1.00 0.00 ?  44 LEU H HD23 1  
ATOM 9333   N N    . ALA H  1 45 ? -14.063 -17.002 -214.014 1.00 0.00 ?  45 ALA H N    1  
ATOM 9334   C CA   . ALA H  1 45 ? -12.972 -17.796 -214.567 1.00 0.00 ?  45 ALA H CA   1  
ATOM 9335   C C    . ALA H  1 45 ? -13.418 -18.558 -215.807 1.00 0.00 ?  45 ALA H C    1  
ATOM 9336   O O    . ALA H  1 45 ? -12.723 -18.571 -216.823 1.00 0.00 ?  45 ALA H O    1  
ATOM 9337   C CB   . ALA H  1 45 ? -12.430 -18.755 -213.517 1.00 0.00 ?  45 ALA H CB   1  
ATOM 9338   H H    . ALA H  1 45 ? -14.426 -17.233 -213.100 1.00 0.00 ?  45 ALA H H    1  
ATOM 9339   H HA   . ALA H  1 45 ? -12.169 -17.123 -214.870 1.00 0.00 ?  45 ALA H HA   1  
ATOM 9340   H HB1  . ALA H  1 45 ? -13.225 -19.425 -213.192 1.00 0.00 ?  45 ALA H HB1  1  
ATOM 9341   H HB2  . ALA H  1 45 ? -11.616 -19.340 -213.946 1.00 0.00 ?  45 ALA H HB2  1  
ATOM 9342   H HB3  . ALA H  1 45 ? -12.059 -18.189 -212.663 1.00 0.00 ?  45 ALA H HB3  1  
ATOM 9343   N N    . ALA H  1 46 ? -14.582 -19.193 -215.719 1.00 0.00 ?  46 ALA H N    1  
ATOM 9344   C CA   . ALA H  1 46 ? -15.116 -19.973 -216.829 1.00 0.00 ?  46 ALA H CA   1  
ATOM 9345   C C    . ALA H  1 46 ? -15.426 -19.084 -218.027 1.00 0.00 ?  46 ALA H C    1  
ATOM 9346   O O    . ALA H  1 46 ? -15.048 -19.394 -219.156 1.00 0.00 ?  46 ALA H O    1  
ATOM 9347   C CB   . ALA H  1 46 ? -16.360 -20.733 -216.392 1.00 0.00 ?  46 ALA H CB   1  
ATOM 9348   H H    . ALA H  1 46 ? -15.110 -19.134 -214.860 1.00 0.00 ?  46 ALA H H    1  
ATOM 9349   H HA   . ALA H  1 46 ? -14.362 -20.693 -217.145 1.00 0.00 ?  46 ALA H HA   1  
ATOM 9350   H HB1  . ALA H  1 46 ? -17.119 -20.027 -216.058 1.00 0.00 ?  46 ALA H HB1  1  
ATOM 9351   H HB2  . ALA H  1 46 ? -16.746 -21.310 -217.233 1.00 0.00 ?  46 ALA H HB2  1  
ATOM 9352   H HB3  . ALA H  1 46 ? -16.106 -21.408 -215.575 1.00 0.00 ?  46 ALA H HB3  1  
ATOM 9353   N N    . TYR H  1 47 ? -16.117 -17.978 -217.773 1.00 0.00 ?  47 TYR H N    1  
ATOM 9354   C CA   . TYR H  1 47 ? -16.519 -17.065 -218.837 1.00 0.00 ?  47 TYR H CA   1  
ATOM 9355   C C    . TYR H  1 47 ? -15.307 -16.434 -219.509 1.00 0.00 ?  47 TYR H C    1  
ATOM 9356   O O    . TYR H  1 47 ? -15.204 -16.415 -220.735 1.00 0.00 ?  47 TYR H O    1  
ATOM 9357   C CB   . TYR H  1 47 ? -17.442 -15.975 -218.287 1.00 0.00 ?  47 TYR H CB   1  
ATOM 9358   C CG   . TYR H  1 47 ? -17.760 -14.881 -219.282 1.00 0.00 ?  47 TYR H CG   1  
ATOM 9359   C CD1  . TYR H  1 47 ? -18.434 -15.164 -220.461 1.00 0.00 ?  47 TYR H CD1  1  
ATOM 9360   C CD2  . TYR H  1 47 ? -17.387 -13.568 -219.038 1.00 0.00 ?  47 TYR H CD2  1  
ATOM 9361   C CE1  . TYR H  1 47 ? -18.726 -14.169 -221.373 1.00 0.00 ?  47 TYR H CE1  1  
ATOM 9362   C CE2  . TYR H  1 47 ? -17.674 -12.565 -219.942 1.00 0.00 ?  47 TYR H CE2  1  
ATOM 9363   C CZ   . TYR H  1 47 ? -18.344 -12.869 -221.110 1.00 0.00 ?  47 TYR H CZ   1  
ATOM 9364   O OH   . TYR H  1 47 ? -18.634 -11.873 -222.014 1.00 0.00 ?  47 TYR H OH   1  
ATOM 9365   H H    . TYR H  1 47 ? -16.371 -17.764 -216.819 1.00 0.00 ?  47 TYR H H    1  
ATOM 9366   H HA   . TYR H  1 47 ? -17.054 -17.614 -219.613 1.00 0.00 ?  47 TYR H HA   1  
ATOM 9367   H HB2  . TYR H  1 47 ? -18.367 -16.462 -217.974 1.00 0.00 ?  47 TYR H HB2  1  
ATOM 9368   H HB3  . TYR H  1 47 ? -16.947 -15.543 -217.417 1.00 0.00 ?  47 TYR H HB3  1  
ATOM 9369   H HD1  . TYR H  1 47 ? -18.732 -16.193 -220.662 1.00 0.00 ?  47 TYR H HD1  1  
ATOM 9370   H HD2  . TYR H  1 47 ? -16.857 -13.334 -218.114 1.00 0.00 ?  47 TYR H HD2  1  
ATOM 9371   H HE1  . TYR H  1 47 ? -19.256 -14.406 -222.296 1.00 0.00 ?  47 TYR H HE1  1  
ATOM 9372   H HE2  . TYR H  1 47 ? -17.371 -11.538 -219.733 1.00 0.00 ?  47 TYR H HE2  1  
ATOM 9373   H HH   . TYR H  1 47 ? -18.325 -11.009 -221.732 1.00 0.00 ?  47 TYR H HH   1  
ATOM 9374   N N    . GLN H  1 48 ? -14.390 -15.917 -218.697 1.00 0.00 ?  48 GLN H N    1  
ATOM 9375   C CA   . GLN H  1 48 ? -13.212 -15.229 -219.212 1.00 0.00 ?  48 GLN H CA   1  
ATOM 9376   C C    . GLN H  1 48 ? -12.312 -16.183 -219.988 1.00 0.00 ?  48 GLN H C    1  
ATOM 9377   O O    . GLN H  1 48 ? -11.737 -15.815 -221.012 1.00 0.00 ?  48 GLN H O    1  
ATOM 9378   C CB   . GLN H  1 48 ? -12.422 -14.590 -218.067 1.00 0.00 ?  48 GLN H CB   1  
ATOM 9379   C CG   . GLN H  1 48 ? -11.301 -13.671 -218.522 1.00 0.00 ?  48 GLN H CG   1  
ATOM 9380   C CD   . GLN H  1 48 ? -10.051 -14.435 -218.917 1.00 0.00 ?  48 GLN H CD   1  
ATOM 9381   O OE1  . GLN H  1 48 ? -9.711  -15.454 -218.309 1.00 0.00 ?  48 GLN H OE1  1  
ATOM 9382   N NE2  . GLN H  1 48 ? -9.356  -13.944 -219.937 1.00 0.00 ?  48 GLN H NE2  1  
ATOM 9383   H H    . GLN H  1 48 ? -14.512 -16.004 -217.699 1.00 0.00 ?  48 GLN H H    1  
ATOM 9384   H HA   . GLN H  1 48 ? -13.519 -14.454 -219.914 1.00 0.00 ?  48 GLN H HA   1  
ATOM 9385   H HB2  . GLN H  1 48 ? -13.137 -14.029 -217.466 1.00 0.00 ?  48 GLN H HB2  1  
ATOM 9386   H HB3  . GLN H  1 48 ? -12.011 -15.406 -217.474 1.00 0.00 ?  48 GLN H HB3  1  
ATOM 9387   H HG2  . GLN H  1 48 ? -11.450 -12.874 -219.250 1.00 0.00 ?  48 GLN H HG2  1  
ATOM 9388   H HG3  . GLN H  1 48 ? -11.141 -13.234 -217.535 1.00 0.00 ?  48 GLN H HG3  1  
ATOM 9389   H HE21 . GLN H  1 48 ? -9.666  -13.114 -220.400 1.00 0.00 ?  48 GLN H HE21 1  
ATOM 9390   H HE22 . GLN H  1 48 ? -8.522  -14.405 -220.242 1.00 0.00 ?  48 GLN H HE22 1  
ATOM 9391   N N    . SER H  1 49 ? -12.193 -17.411 -219.493 1.00 0.00 ?  49 SER H N    1  
ATOM 9392   C CA   . SER H  1 49 ? -11.404 -18.435 -220.166 1.00 0.00 ?  49 SER H CA   1  
ATOM 9393   C C    . SER H  1 49 ? -11.973 -18.754 -221.542 1.00 0.00 ?  49 SER H C    1  
ATOM 9394   O O    . SER H  1 49 ? -11.232 -18.879 -222.517 1.00 0.00 ?  49 SER H O    1  
ATOM 9395   C CB   . SER H  1 49 ? -11.343 -19.689 -219.316 1.00 0.00 ?  49 SER H CB   1  
ATOM 9396   O OG   . SER H  1 49 ? -10.638 -20.721 -219.950 1.00 0.00 ?  49 SER H OG   1  
ATOM 9397   H H    . SER H  1 49 ? -12.663 -17.640 -218.628 1.00 0.00 ?  49 SER H H    1  
ATOM 9398   H HA   . SER H  1 49 ? -10.346 -18.180 -220.252 1.00 0.00 ?  49 SER H HA   1  
ATOM 9399   H HB2  . SER H  1 49 ? -10.848 -19.448 -218.375 1.00 0.00 ?  49 SER H HB2  1  
ATOM 9400   H HB3  . SER H  1 49 ? -12.359 -20.025 -219.115 1.00 0.00 ?  49 SER H HB3  1  
ATOM 9401   H HG   . SER H  1 49 ? -11.087 -20.961 -220.765 1.00 0.00 ?  49 SER H HG   1  
ATOM 9402   N N    . LYS H  1 50 ? -13.293 -18.884 -221.615 1.00 0.00 ?  50 LYS H N    1  
ATOM 9403   C CA   . LYS H  1 50 ? -13.966 -19.180 -222.875 1.00 0.00 ?  50 LYS H CA   1  
ATOM 9404   C C    . LYS H  1 50 ? -14.098 -17.930 -223.736 1.00 0.00 ?  50 LYS H C    1  
ATOM 9405   O O    . LYS H  1 50 ? -14.242 -18.017 -224.955 1.00 0.00 ?  50 LYS H O    1  
ATOM 9406   C CB   . LYS H  1 50 ? -15.345 -19.788 -222.615 1.00 0.00 ?  50 LYS H CB   1  
ATOM 9407   C CG   . LYS H  1 50 ? -15.313 -21.162 -221.960 1.00 0.00 ?  50 LYS H CG   1  
ATOM 9408   C CD   . LYS H  1 50 ? -16.719 -21.683 -221.698 1.00 0.00 ?  50 LYS H CD   1  
ATOM 9409   C CE   . LYS H  1 50 ? -16.689 -23.015 -220.964 1.00 0.00 ?  50 LYS H CE   1  
ATOM 9410   N NZ   . LYS H  1 50 ? -15.985 -24.067 -221.748 1.00 0.00 1  50 LYS H NZ   1  
ATOM 9411   H H    . LYS H  1 50 ? -13.846 -18.774 -220.777 1.00 0.00 ?  50 LYS H H    1  
ATOM 9412   H HA   . LYS H  1 50 ? -13.374 -19.892 -223.450 1.00 0.00 ?  50 LYS H HA   1  
ATOM 9413   H HB2  . LYS H  1 50 ? -15.885 -19.092 -221.973 1.00 0.00 ?  50 LYS H HB2  1  
ATOM 9414   H HB3  . LYS H  1 50 ? -15.850 -19.858 -223.579 1.00 0.00 ?  50 LYS H HB3  1  
ATOM 9415   H HG2  . LYS H  1 50 ? -14.788 -21.850 -222.622 1.00 0.00 ?  50 LYS H HG2  1  
ATOM 9416   H HG3  . LYS H  1 50 ? -14.774 -21.083 -221.016 1.00 0.00 ?  50 LYS H HG3  1  
ATOM 9417   H HD2  . LYS H  1 50 ? -17.255 -20.948 -221.097 1.00 0.00 ?  50 LYS H HD2  1  
ATOM 9418   H HD3  . LYS H  1 50 ? -17.226 -21.808 -222.655 1.00 0.00 ?  50 LYS H HD3  1  
ATOM 9419   H HE2  . LYS H  1 50 ? -16.179 -22.870 -220.013 1.00 0.00 ?  50 LYS H HE2  1  
ATOM 9420   H HE3  . LYS H  1 50 ? -17.717 -23.327 -220.781 1.00 0.00 ?  50 LYS H HE3  1  
ATOM 9421   H HZ1  . LYS H  1 50 ? -15.032 -23.778 -221.917 1.00 0.00 ?  50 LYS H HZ1  1  
ATOM 9422   H HZ2  . LYS H  1 50 ? -15.987 -24.932 -221.227 1.00 0.00 ?  50 LYS H HZ2  1  
ATOM 9423   H HZ3  . LYS H  1 50 ? -16.457 -24.203 -222.630 1.00 0.00 ?  50 LYS H HZ3  1  
ATOM 9424   N N    . LEU H  1 51 ? -14.047 -16.768 -223.094 1.00 0.00 ?  51 LEU H N    1  
ATOM 9425   C CA   . LEU H  1 51 ? -14.135 -15.497 -223.804 1.00 0.00 ?  51 LEU H CA   1  
ATOM 9426   C C    . LEU H  1 51 ? -12.835 -15.181 -224.532 1.00 0.00 ?  51 LEU H C    1  
ATOM 9427   O O    . LEU H  1 51 ? -12.847 -14.642 -225.638 1.00 0.00 ?  51 LEU H O    1  
ATOM 9428   C CB   . LEU H  1 51 ? -14.487 -14.368 -222.827 1.00 0.00 ?  51 LEU H CB   1  
ATOM 9429   C CG   . LEU H  1 51 ? -14.779 -13.009 -223.477 1.00 0.00 ?  51 LEU H CG   1  
ATOM 9430   C CD1  . LEU H  1 51 ? -16.024 -13.105 -224.349 1.00 0.00 ?  51 LEU H CD1  1  
ATOM 9431   C CD2  . LEU H  1 51 ? -14.959 -11.955 -222.394 1.00 0.00 ?  51 LEU H CD2  1  
ATOM 9432   H H    . LEU H  1 51 ? -13.946 -16.764 -222.089 1.00 0.00 ?  51 LEU H H    1  
ATOM 9433   H HA   . LEU H  1 51 ? -14.910 -15.558 -224.567 1.00 0.00 ?  51 LEU H HA   1  
ATOM 9434   H HB2  . LEU H  1 51 ? -15.399 -14.781 -222.399 1.00 0.00 ?  51 LEU H HB2  1  
ATOM 9435   H HB3  . LEU H  1 51 ? -13.735 -14.262 -222.045 1.00 0.00 ?  51 LEU H HB3  1  
ATOM 9436   H HG   . LEU H  1 51 ? -13.903 -12.737 -224.065 1.00 0.00 ?  51 LEU H HG   1  
ATOM 9437   H HD11 . LEU H  1 51 ? -16.223 -12.136 -224.807 1.00 0.00 ?  51 LEU H HD11 1  
ATOM 9438   H HD12 . LEU H  1 51 ? -15.864 -13.848 -225.130 1.00 0.00 ?  51 LEU H HD12 1  
ATOM 9439   H HD13 . LEU H  1 51 ? -16.875 -13.398 -223.736 1.00 0.00 ?  51 LEU H HD13 1  
ATOM 9440   H HD21 . LEU H  1 51 ? -14.047 -11.884 -221.800 1.00 0.00 ?  51 LEU H HD21 1  
ATOM 9441   H HD22 . LEU H  1 51 ? -15.165 -10.990 -222.858 1.00 0.00 ?  51 LEU H HD22 1  
ATOM 9442   H HD23 . LEU H  1 51 ? -15.792 -12.235 -221.749 1.00 0.00 ?  51 LEU H HD23 1  
ATOM 9443   N N    . SER H  1 52 ? -11.714 -15.522 -223.905 1.00 0.00 ?  52 SER H N    1  
ATOM 9444   C CA   . SER H  1 52 ? -10.407 -15.358 -224.529 1.00 0.00 ?  52 SER H CA   1  
ATOM 9445   C C    . SER H  1 52 ? -10.261 -16.260 -225.747 1.00 0.00 ?  52 SER H C    1  
ATOM 9446   O O    . SER H  1 52 ? -9.490  -15.967 -226.661 1.00 0.00 ?  52 SER H O    1  
ATOM 9447   C CB   . SER H  1 52 ? -9.308  -15.646 -223.524 1.00 0.00 ?  52 SER H CB   1  
ATOM 9448   O OG   . SER H  1 52 ? -9.266  -16.999 -223.164 1.00 0.00 ?  52 SER H OG   1  
ATOM 9449   H H    . SER H  1 52 ? -11.769 -15.903 -222.971 1.00 0.00 ?  52 SER H H    1  
ATOM 9450   H HA   . SER H  1 52 ? -10.184 -14.326 -224.803 1.00 0.00 ?  52 SER H HA   1  
ATOM 9451   H HB2  . SER H  1 52 ? -8.352  -15.366 -223.965 1.00 0.00 ?  52 SER H HB2  1  
ATOM 9452   H HB3  . SER H  1 52 ? -9.485  -15.046 -222.632 1.00 0.00 ?  52 SER H HB3  1  
ATOM 9453   H HG   . SER H  1 52 ? -8.560  -17.139 -222.528 1.00 0.00 ?  52 SER H HG   1  
ATOM 9454   N N    . GLU H  1 53 ? -11.007 -17.360 -225.755 1.00 0.00 ?  53 GLU H N    1  
ATOM 9455   C CA   . GLU H  1 53 ? -11.124 -18.198 -226.942 1.00 0.00 ?  53 GLU H CA   1  
ATOM 9456   C C    . GLU H  1 53 ? -12.128 -17.617 -227.930 1.00 0.00 ?  53 GLU H C    1  
ATOM 9457   O O    . GLU H  1 53 ? -11.919 -17.665 -229.142 1.00 0.00 ?  53 GLU H O    1  
ATOM 9458   C CB   . GLU H  1 53 ? -11.531 -19.622 -226.555 1.00 0.00 ?  53 GLU H CB   1  
ATOM 9459   C CG   . GLU H  1 53 ? -10.459 -20.400 -225.805 1.00 0.00 ?  53 GLU H CG   1  
ATOM 9460   C CD   . GLU H  1 53 ? -10.962 -21.753 -225.382 1.00 0.00 ?  53 GLU H CD   1  
ATOM 9461   O OE1  . GLU H  1 53 ? -12.138 -21.994 -225.507 1.00 0.00 ?  53 GLU H OE1  1  
ATOM 9462   O OE2  . GLU H  1 53 ? -10.154 -22.584 -225.040 1.00 0.00 -1 53 GLU H OE2  1  
ATOM 9463   H H    . GLU H  1 53 ? -11.505 -17.623 -224.916 1.00 0.00 ?  53 GLU H H    1  
ATOM 9464   H HA   . GLU H  1 53 ? -10.166 -18.239 -227.462 1.00 0.00 ?  53 GLU H HA   1  
ATOM 9465   H HB2  . GLU H  1 53 ? -12.422 -19.540 -225.933 1.00 0.00 ?  53 GLU H HB2  1  
ATOM 9466   H HB3  . GLU H  1 53 ? -11.779 -20.145 -227.479 1.00 0.00 ?  53 GLU H HB3  1  
ATOM 9467   H HG2  . GLU H  1 53 ? -9.534  -20.517 -226.368 1.00 0.00 ?  53 GLU H HG2  1  
ATOM 9468   H HG3  . GLU H  1 53 ? -10.271 -19.791 -224.922 1.00 0.00 ?  53 GLU H HG3  1  
ATOM 9469   N N    . TYR H  1 54 ? -13.217 -17.068 -227.404 1.00 0.00 ?  54 TYR H N    1  
ATOM 9470   C CA   . TYR H  1 54 ? -14.226 -16.420 -228.234 1.00 0.00 ?  54 TYR H CA   1  
ATOM 9471   C C    . TYR H  1 54 ? -13.649 -15.209 -228.957 1.00 0.00 ?  54 TYR H C    1  
ATOM 9472   O O    . TYR H  1 54 ? -14.163 -14.791 -229.994 1.00 0.00 ?  54 TYR H O    1  
ATOM 9473   C CB   . TYR H  1 54 ? -15.429 -16.001 -227.386 1.00 0.00 ?  54 TYR H CB   1  
ATOM 9474   C CG   . TYR H  1 54 ? -16.572 -15.421 -228.188 1.00 0.00 ?  54 TYR H CG   1  
ATOM 9475   C CD1  . TYR H  1 54 ? -17.360 -16.230 -228.994 1.00 0.00 ?  54 TYR H CD1  1  
ATOM 9476   C CD2  . TYR H  1 54 ? -16.862 -14.066 -228.136 1.00 0.00 ?  54 TYR H CD2  1  
ATOM 9477   C CE1  . TYR H  1 54 ? -18.405 -15.706 -229.729 1.00 0.00 ?  54 TYR H CE1  1  
ATOM 9478   C CE2  . TYR H  1 54 ? -17.905 -13.530 -228.867 1.00 0.00 ?  54 TYR H CE2  1  
ATOM 9479   C CZ   . TYR H  1 54 ? -18.675 -14.354 -229.662 1.00 0.00 ?  54 TYR H CZ   1  
ATOM 9480   O OH   . TYR H  1 54 ? -19.716 -13.826 -230.391 1.00 0.00 ?  54 TYR H OH   1  
ATOM 9481   H H    . TYR H  1 54 ? -13.351 -17.101 -226.403 1.00 0.00 ?  54 TYR H H    1  
ATOM 9482   H HA   . TYR H  1 54 ? -14.568 -17.109 -229.006 1.00 0.00 ?  54 TYR H HA   1  
ATOM 9483   H HB2  . TYR H  1 54 ? -15.772 -16.888 -226.852 1.00 0.00 ?  54 TYR H HB2  1  
ATOM 9484   H HB3  . TYR H  1 54 ? -15.075 -15.260 -226.669 1.00 0.00 ?  54 TYR H HB3  1  
ATOM 9485   H HD1  . TYR H  1 54 ? -17.141 -17.297 -229.042 1.00 0.00 ?  54 TYR H HD1  1  
ATOM 9486   H HD2  . TYR H  1 54 ? -16.250 -13.420 -227.506 1.00 0.00 ?  54 TYR H HD2  1  
ATOM 9487   H HE1  . TYR H  1 54 ? -19.016 -16.354 -230.358 1.00 0.00 ?  54 TYR H HE1  1  
ATOM 9488   H HE2  . TYR H  1 54 ? -18.116 -12.462 -228.813 1.00 0.00 ?  54 TYR H HE2  1  
ATOM 9489   H HH   . TYR H  1 54 ? -20.189 -13.134 -229.923 1.00 0.00 ?  54 TYR H HH   1  
ATOM 9490   N N    . ASN H  1 55 ? -12.578 -14.650 -228.403 1.00 0.00 ?  55 ASN H N    1  
ATOM 9491   C CA   . ASN H  1 55 ? -11.837 -13.587 -229.070 1.00 0.00 ?  55 ASN H CA   1  
ATOM 9492   C C    . ASN H  1 55 ? -11.322 -14.044 -230.429 1.00 0.00 ?  55 ASN H C    1  
ATOM 9493   O O    . ASN H  1 55 ? -11.333 -13.282 -231.396 1.00 0.00 ?  55 ASN H O    1  
ATOM 9494   C CB   . ASN H  1 55 ? -10.687 -13.090 -228.214 1.00 0.00 ?  55 ASN H CB   1  
ATOM 9495   C CG   . ASN H  1 55 ? -11.122 -12.258 -227.040 1.00 0.00 ?  55 ASN H CG   1  
ATOM 9496   O OD1  . ASN H  1 55 ? -12.238 -11.727 -227.009 1.00 0.00 ?  55 ASN H OD1  1  
ATOM 9497   N ND2  . ASN H  1 55 ? -10.218 -12.073 -226.112 1.00 0.00 ?  55 ASN H ND2  1  
ATOM 9498   H H    . ASN H  1 55 ? -12.270 -14.970 -227.495 1.00 0.00 ?  55 ASN H H    1  
ATOM 9499   H HA   . ASN H  1 55 ? -12.496 -12.738 -229.259 1.00 0.00 ?  55 ASN H HA   1  
ATOM 9500   H HB2  . ASN H  1 55 ? -9.893  -13.768 -227.897 1.00 0.00 ?  55 ASN H HB2  1  
ATOM 9501   H HB3  . ASN H  1 55 ? -10.309 -12.428 -228.993 1.00 0.00 ?  55 ASN H HB3  1  
ATOM 9502   H HD21 . ASN H  1 55 ? -9.308  -12.476 -226.213 1.00 0.00 ?  55 ASN H HD21 1  
ATOM 9503   H HD22 . ASN H  1 55 ? -10.438 -11.530 -225.302 1.00 0.00 ?  55 ASN H HD22 1  
ATOM 9504   N N    . LEU H  1 56 ? -10.873 -15.293 -230.497 1.00 0.00 ?  56 LEU H N    1  
ATOM 9505   C CA   . LEU H  1 56 ? -10.378 -15.862 -231.744 1.00 0.00 ?  56 LEU H CA   1  
ATOM 9506   C C    . LEU H  1 56 ? -11.521 -16.386 -232.603 1.00 0.00 ?  56 LEU H C    1  
ATOM 9507   O O    . LEU H  1 56 ? -11.405 -16.470 -233.825 1.00 0.00 ?  56 LEU H O    1  
ATOM 9508   C CB   . LEU H  1 56 ? -9.372  -16.983 -231.453 1.00 0.00 ?  56 LEU H CB   1  
ATOM 9509   C CG   . LEU H  1 56 ? -8.094  -16.541 -230.729 1.00 0.00 ?  56 LEU H CG   1  
ATOM 9510   C CD1  . LEU H  1 56 ? -7.191  -17.743 -230.483 1.00 0.00 ?  56 LEU H CD1  1  
ATOM 9511   C CD2  . LEU H  1 56 ? -7.376  -15.489 -231.561 1.00 0.00 ?  56 LEU H CD2  1  
ATOM 9512   H H    . LEU H  1 56 ? -10.874 -15.862 -229.662 1.00 0.00 ?  56 LEU H H    1  
ATOM 9513   H HA   . LEU H  1 56 ? -9.883  -15.087 -232.328 1.00 0.00 ?  56 LEU H HA   1  
ATOM 9514   H HB2  . LEU H  1 56 ? -9.981  -17.600 -230.793 1.00 0.00 ?  56 LEU H HB2  1  
ATOM 9515   H HB3  . LEU H  1 56 ? -9.125  -17.547 -232.352 1.00 0.00 ?  56 LEU H HB3  1  
ATOM 9516   H HG   . LEU H  1 56 ? -8.397  -16.075 -229.791 1.00 0.00 ?  56 LEU H HG   1  
ATOM 9517   H HD11 . LEU H  1 56 ? -6.286  -17.420 -229.968 1.00 0.00 ?  56 LEU H HD11 1  
ATOM 9518   H HD12 . LEU H  1 56 ? -7.717  -18.472 -229.866 1.00 0.00 ?  56 LEU H HD12 1  
ATOM 9519   H HD13 . LEU H  1 56 ? -6.924  -18.198 -231.436 1.00 0.00 ?  56 LEU H HD13 1  
ATOM 9520   H HD21 . LEU H  1 56 ? -8.028  -14.628 -231.702 1.00 0.00 ?  56 LEU H HD21 1  
ATOM 9521   H HD22 . LEU H  1 56 ? -6.467  -15.176 -231.045 1.00 0.00 ?  56 LEU H HD22 1  
ATOM 9522   H HD23 . LEU H  1 56 ? -7.115  -15.909 -232.533 1.00 0.00 ?  56 LEU H HD23 1  
ATOM 9523   N N    . TYR H  1 57 ? -12.627 -16.738 -231.956 1.00 0.00 ?  57 TYR H N    1  
ATOM 9524   C CA   . TYR H  1 57 ? -13.841 -17.124 -232.666 1.00 0.00 ?  57 TYR H CA   1  
ATOM 9525   C C    . TYR H  1 57 ? -14.191 -16.112 -233.749 1.00 0.00 ?  57 TYR H C    1  
ATOM 9526   O O    . TYR H  1 57 ? -14.700 -16.475 -234.810 1.00 0.00 ?  57 TYR H O    1  
ATOM 9527   C CB   . TYR H  1 57 ? -15.009 -17.272 -231.689 1.00 0.00 ?  57 TYR H CB   1  
ATOM 9528   C CG   . TYR H  1 57 ? -16.291 -17.750 -232.334 1.00 0.00 ?  57 TYR H CG   1  
ATOM 9529   C CD1  . TYR H  1 57 ? -16.500 -19.097 -232.591 1.00 0.00 ?  57 TYR H CD1  1  
ATOM 9530   C CD2  . TYR H  1 57 ? -17.289 -16.852 -232.682 1.00 0.00 ?  57 TYR H CD2  1  
ATOM 9531   C CE1  . TYR H  1 57 ? -17.669 -19.539 -233.180 1.00 0.00 ?  57 TYR H CE1  1  
ATOM 9532   C CE2  . TYR H  1 57 ? -18.462 -17.283 -233.271 1.00 0.00 ?  57 TYR H CE2  1  
ATOM 9533   C CZ   . TYR H  1 57 ? -18.649 -18.627 -233.519 1.00 0.00 ?  57 TYR H CZ   1  
ATOM 9534   O OH   . TYR H  1 57 ? -19.816 -19.061 -234.104 1.00 0.00 ?  57 TYR H OH   1  
ATOM 9535   H H    . TYR H  1 57 ? -12.628 -16.737 -230.946 1.00 0.00 ?  57 TYR H H    1  
ATOM 9536   H HA   . TYR H  1 57 ? -13.686 -18.078 -233.170 1.00 0.00 ?  57 TYR H HA   1  
ATOM 9537   H HB2  . TYR H  1 57 ? -14.700 -17.984 -230.922 1.00 0.00 ?  57 TYR H HB2  1  
ATOM 9538   H HB3  . TYR H  1 57 ? -15.173 -16.296 -231.233 1.00 0.00 ?  57 TYR H HB3  1  
ATOM 9539   H HD1  . TYR H  1 57 ? -15.722 -19.811 -232.321 1.00 0.00 ?  57 TYR H HD1  1  
ATOM 9540   H HD2  . TYR H  1 57 ? -17.136 -15.791 -232.484 1.00 0.00 ?  57 TYR H HD2  1  
ATOM 9541   H HE1  . TYR H  1 57 ? -17.820 -20.600 -233.377 1.00 0.00 ?  57 TYR H HE1  1  
ATOM 9542   H HE2  . TYR H  1 57 ? -19.235 -16.561 -233.538 1.00 0.00 ?  57 TYR H HE2  1  
ATOM 9543   H HH   . TYR H  1 57 ? -20.597 -18.632 -233.748 1.00 0.00 ?  57 TYR H HH   1  
ATOM 9544   N N    . ARG H  1 58 ? -13.915 -14.841 -233.476 1.00 0.00 ?  58 ARG H N    1  
ATOM 9545   C CA   . ARG H  1 58 ? -14.171 -13.778 -234.440 1.00 0.00 ?  58 ARG H CA   1  
ATOM 9546   C C    . ARG H  1 58 ? -12.895 -13.376 -235.169 1.00 0.00 ?  58 ARG H C    1  
ATOM 9547   O O    . ARG H  1 58 ? -12.884 -13.240 -236.392 1.00 0.00 ?  58 ARG H O    1  
ATOM 9548   C CB   . ARG H  1 58 ? -14.849 -12.575 -233.801 1.00 0.00 ?  58 ARG H CB   1  
ATOM 9549   C CG   . ARG H  1 58 ? -16.144 -12.886 -233.067 1.00 0.00 ?  58 ARG H CG   1  
ATOM 9550   C CD   . ARG H  1 58 ? -17.282 -13.235 -233.956 1.00 0.00 ?  58 ARG H CD   1  
ATOM 9551   N NE   . ARG H  1 58 ? -18.520 -13.543 -233.257 1.00 0.00 ?  58 ARG H NE   1  
ATOM 9552   C CZ   . ARG H  1 58 ? -19.668 -13.909 -233.860 1.00 0.00 ?  58 ARG H CZ   1  
ATOM 9553   N NH1  . ARG H  1 58 ? -19.754 -13.977 -235.170 1.00 0.00 1  58 ARG H NH1  1  
ATOM 9554   N NH2  . ARG H  1 58 ? -20.715 -14.175 -233.098 1.00 0.00 ?  58 ARG H NH2  1  
ATOM 9555   H H    . ARG H  1 58 ? -13.518 -14.606 -232.578 1.00 0.00 ?  58 ARG H H    1  
ATOM 9556   H HA   . ARG H  1 58 ? -14.866 -14.130 -235.202 1.00 0.00 ?  58 ARG H HA   1  
ATOM 9557   H HB2  . ARG H  1 58 ? -14.136 -12.141 -233.102 1.00 0.00 ?  58 ARG H HB2  1  
ATOM 9558   H HB3  . ARG H  1 58 ? -15.052 -11.863 -234.600 1.00 0.00 ?  58 ARG H HB3  1  
ATOM 9559   H HG2  . ARG H  1 58 ? -15.970 -13.729 -232.398 1.00 0.00 ?  58 ARG H HG2  1  
ATOM 9560   H HG3  . ARG H  1 58 ? -16.430 -12.011 -232.483 1.00 0.00 ?  58 ARG H HG3  1  
ATOM 9561   H HD2  . ARG H  1 58 ? -17.484 -12.395 -234.620 1.00 0.00 ?  58 ARG H HD2  1  
ATOM 9562   H HD3  . ARG H  1 58 ? -17.014 -14.109 -234.547 1.00 0.00 ?  58 ARG H HD3  1  
ATOM 9563   H HE   . ARG H  1 58 ? -18.719 -13.537 -232.265 1.00 0.00 ?  58 ARG H HE   1  
ATOM 9564   H HH11 . ARG H  1 58 ? -18.949 -13.753 -235.738 1.00 0.00 ?  58 ARG H HH11 1  
ATOM 9565   H HH12 . ARG H  1 58 ? -20.623 -14.252 -235.602 1.00 0.00 ?  58 ARG H HH12 1  
ATOM 9566   H HH21 . ARG H  1 58 ? -20.637 -14.100 -232.093 1.00 0.00 ?  58 ARG H HH21 1  
ATOM 9567   H HH22 . ARG H  1 58 ? -21.588 -14.450 -233.524 1.00 0.00 ?  58 ARG H HH22 1  
ATOM 9568   N N    . ASN H  1 59 ? -11.821 -13.187 -234.410 1.00 0.00 ?  59 ASN H N    1  
ATOM 9569   C CA   . ASN H  1 59 ? -10.566 -12.697 -234.968 1.00 0.00 ?  59 ASN H CA   1  
ATOM 9570   C C    . ASN H  1 59 ? -9.970  -13.698 -235.949 1.00 0.00 ?  59 ASN H C    1  
ATOM 9571   O O    . ASN H  1 59 ? -9.804  -13.400 -237.131 1.00 0.00 ?  59 ASN H O    1  
ATOM 9572   C CB   . ASN H  1 59 ? -9.563  -12.372 -233.876 1.00 0.00 ?  59 ASN H CB   1  
ATOM 9573   C CG   . ASN H  1 59 ? -8.367  -11.602 -234.362 1.00 0.00 ?  59 ASN H CG   1  
ATOM 9574   O OD1  . ASN H  1 59 ? -8.079  -11.556 -235.564 1.00 0.00 ?  59 ASN H OD1  1  
ATOM 9575   N ND2  . ASN H  1 59 ? -7.624  -11.064 -233.429 1.00 0.00 ?  59 ASN H ND2  1  
ATOM 9576   H H    . ASN H  1 59 ? -11.875 -13.388 -233.422 1.00 0.00 ?  59 ASN H H    1  
ATOM 9577   H HA   . ASN H  1 59 ? -10.745 -11.780 -235.532 1.00 0.00 ?  59 ASN H HA   1  
ATOM 9578   H HB2  . ASN H  1 59 ? -9.891  -11.958 -232.922 1.00 0.00 ?  59 ASN H HB2  1  
ATOM 9579   H HB3  . ASN H  1 59 ? -9.277  -13.415 -233.740 1.00 0.00 ?  59 ASN H HB3  1  
ATOM 9580   H HD21 . ASN H  1 59 ? -7.868  -11.181 -232.467 1.00 0.00 ?  59 ASN H HD21 1  
ATOM 9581   H HD22 . ASN H  1 59 ? -6.811  -10.536 -233.679 1.00 0.00 ?  59 ASN H HD22 1  
ATOM 9582   N N    . ALA H  1 60 ? -9.651  -14.888 -235.451 1.00 0.00 ?  60 ALA H N    1  
ATOM 9583   C CA   . ALA H  1 60 ? -9.013  -15.914 -236.267 1.00 0.00 ?  60 ALA H CA   1  
ATOM 9584   C C    . ALA H  1 60 ? -9.911  -16.334 -237.424 1.00 0.00 ?  60 ALA H C    1  
ATOM 9585   O O    . ALA H  1 60 ? -9.431  -16.638 -238.516 1.00 0.00 ?  60 ALA H O    1  
ATOM 9586   C CB   . ALA H  1 60 ? -8.646  -17.119 -235.413 1.00 0.00 ?  60 ALA H CB   1  
ATOM 9587   H H    . ALA H  1 60 ? -9.855  -15.087 -234.482 1.00 0.00 ?  60 ALA H H    1  
ATOM 9588   H HA   . ALA H  1 60 ? -8.101  -15.501 -236.697 1.00 0.00 ?  60 ALA H HA   1  
ATOM 9589   H HB1  . ALA H  1 60 ? -9.547  -17.534 -234.963 1.00 0.00 ?  60 ALA H HB1  1  
ATOM 9590   H HB2  . ALA H  1 60 ? -8.171  -17.875 -236.038 1.00 0.00 ?  60 ALA H HB2  1  
ATOM 9591   H HB3  . ALA H  1 60 ? -7.956  -16.811 -234.627 1.00 0.00 ?  60 ALA H HB3  1  
ATOM 9592   N N    . GLN H  1 61 ? -11.217 -16.348 -237.179 1.00 0.00 ?  61 GLN H N    1  
ATOM 9593   C CA   . GLN H  1 61 ? -12.189 -16.644 -238.223 1.00 0.00 ?  61 GLN H CA   1  
ATOM 9594   C C    . GLN H  1 61 ? -12.014 -15.717 -239.419 1.00 0.00 ?  61 GLN H C    1  
ATOM 9595   O O    . GLN H  1 61 ? -11.842 -16.172 -240.550 1.00 0.00 ?  61 GLN H O    1  
ATOM 9596   C CB   . GLN H  1 61 ? -13.615 -16.521 -237.679 1.00 0.00 ?  61 GLN H CB   1  
ATOM 9597   C CG   . GLN H  1 61 ? -14.699 -16.838 -238.695 1.00 0.00 ?  61 GLN H CG   1  
ATOM 9598   C CD   . GLN H  1 61 ? -16.094 -16.641 -238.133 1.00 0.00 ?  61 GLN H CD   1  
ATOM 9599   O OE1  . GLN H  1 61 ? -16.265 -16.137 -237.019 1.00 0.00 ?  61 GLN H OE1  1  
ATOM 9600   N NE2  . GLN H  1 61 ? -17.102 -17.042 -238.899 1.00 0.00 ?  61 GLN H NE2  1  
ATOM 9601   H H    . GLN H  1 61 ? -11.543 -16.149 -236.244 1.00 0.00 ?  61 GLN H H    1  
ATOM 9602   H HA   . GLN H  1 61 ? -12.032 -17.658 -238.592 1.00 0.00 ?  61 GLN H HA   1  
ATOM 9603   H HB2  . GLN H  1 61 ? -13.690 -17.205 -236.833 1.00 0.00 ?  61 GLN H HB2  1  
ATOM 9604   H HB3  . GLN H  1 61 ? -13.729 -15.496 -237.326 1.00 0.00 ?  61 GLN H HB3  1  
ATOM 9605   H HG2  . GLN H  1 61 ? -14.689 -16.444 -239.710 1.00 0.00 ?  61 GLN H HG2  1  
ATOM 9606   H HG3  . GLN H  1 61 ? -14.485 -17.907 -238.719 1.00 0.00 ?  61 GLN H HG3  1  
ATOM 9607   H HE21 . GLN H  1 61 ? -16.919 -17.447 -239.795 1.00 0.00 ?  61 GLN H HE21 1  
ATOM 9608   H HE22 . GLN H  1 61 ? -18.045 -16.937 -238.581 1.00 0.00 ?  61 GLN H HE22 1  
ATOM 9609   N N    . SER H  1 62 ? -12.058 -14.414 -239.162 1.00 0.00 ?  62 SER H N    1  
ATOM 9610   C CA   . SER H  1 62 ? -11.975 -13.420 -240.225 1.00 0.00 ?  62 SER H CA   1  
ATOM 9611   C C    . SER H  1 62 ? -10.583 -13.389 -240.843 1.00 0.00 ?  62 SER H C    1  
ATOM 9612   O O    . SER H  1 62 ? -10.419 -13.023 -242.007 1.00 0.00 ?  62 SER H O    1  
ATOM 9613   C CB   . SER H  1 62 ? -12.346 -12.051 -239.690 1.00 0.00 ?  62 SER H CB   1  
ATOM 9614   O OG   . SER H  1 62 ? -11.368 -11.540 -238.828 1.00 0.00 ?  62 SER H OG   1  
ATOM 9615   H H    . SER H  1 62 ? -12.150 -14.104 -238.205 1.00 0.00 ?  62 SER H H    1  
ATOM 9616   H HA   . SER H  1 62 ? -12.725 -13.558 -241.006 1.00 0.00 ?  62 SER H HA   1  
ATOM 9617   H HB2  . SER H  1 62 ? -12.468 -11.369 -240.532 1.00 0.00 ?  62 SER H HB2  1  
ATOM 9618   H HB3  . SER H  1 62 ? -13.289 -12.131 -239.149 1.00 0.00 ?  62 SER H HB3  1  
ATOM 9619   H HG   . SER H  1 62 ? -11.135 -12.207 -238.177 1.00 0.00 ?  62 SER H HG   1  
ATOM 9620   N N    . ASN H  1 63 ? -9.584  -13.774 -240.058 1.00 0.00 ?  63 ASN H N    1  
ATOM 9621   C CA   . ASN H  1 63 ? -8.204  -13.794 -240.527 1.00 0.00 ?  63 ASN H CA   1  
ATOM 9622   C C    . ASN H  1 63 ? -8.007  -14.841 -241.615 1.00 0.00 ?  63 ASN H C    1  
ATOM 9623   O O    . ASN H  1 63 ? -7.423  -14.561 -242.662 1.00 0.00 ?  63 ASN H O    1  
ATOM 9624   C CB   . ASN H  1 63 ? -7.232  -14.033 -239.386 1.00 0.00 ?  63 ASN H CB   1  
ATOM 9625   C CG   . ASN H  1 63 ? -7.071  -12.852 -238.470 1.00 0.00 ?  63 ASN H CG   1  
ATOM 9626   O OD1  . ASN H  1 63 ? -7.236  -11.697 -238.879 1.00 0.00 ?  63 ASN H OD1  1  
ATOM 9627   N ND2  . ASN H  1 63 ? -6.670  -13.129 -237.256 1.00 0.00 ?  63 ASN H ND2  1  
ATOM 9628   H H    . ASN H  1 63 ? -9.785  -14.062 -239.111 1.00 0.00 ?  63 ASN H H    1  
ATOM 9629   H HA   . ASN H  1 63 ? -7.952  -12.831 -240.976 1.00 0.00 ?  63 ASN H HA   1  
ATOM 9630   H HB2  . ASN H  1 63 ? -7.287  -14.944 -238.789 1.00 0.00 ?  63 ASN H HB2  1  
ATOM 9631   H HB3  . ASN H  1 63 ? -6.368  -14.085 -240.048 1.00 0.00 ?  63 ASN H HB3  1  
ATOM 9632   H HD21 . ASN H  1 63 ? -6.493  -14.077 -236.992 1.00 0.00 ?  63 ASN H HD21 1  
ATOM 9633   H HD22 . ASN H  1 63 ? -6.542  -12.392 -236.592 1.00 0.00 ?  63 ASN H HD22 1  
ATOM 9634   N N    . THR H  1 64 ? -8.497  -16.050 -241.362 1.00 0.00 ?  64 THR H N    1  
ATOM 9635   C CA   . THR H  1 64 ? -8.342  -17.152 -242.303 1.00 0.00 ?  64 THR H CA   1  
ATOM 9636   C C    . THR H  1 64 ? -9.112  -16.890 -243.591 1.00 0.00 ?  64 THR H C    1  
ATOM 9637   O O    . THR H  1 64 ? -8.646  -17.218 -244.682 1.00 0.00 ?  64 THR H O    1  
ATOM 9638   C CB   . THR H  1 64 ? -8.818  -18.485 -241.696 1.00 0.00 ?  64 THR H CB   1  
ATOM 9639   O OG1  . THR H  1 64 ? -10.187 -18.365 -241.286 1.00 0.00 ?  64 THR H OG1  1  
ATOM 9640   C CG2  . THR H  1 64 ? -7.965  -18.859 -240.494 1.00 0.00 ?  64 THR H CG2  1  
ATOM 9641   H H    . THR H  1 64 ? -8.990  -16.209 -240.495 1.00 0.00 ?  64 THR H H    1  
ATOM 9642   H HA   . THR H  1 64 ? -7.294  -17.252 -242.585 1.00 0.00 ?  64 THR H HA   1  
ATOM 9643   H HB   . THR H  1 64 ? -8.742  -19.266 -242.451 1.00 0.00 ?  64 THR H HB   1  
ATOM 9644   H HG1  . THR H  1 64 ? -10.482 -19.197 -240.908 1.00 0.00 ?  64 THR H HG1  1  
ATOM 9645   H HG21 . THR H  1 64 ? -8.316  -19.803 -240.078 1.00 0.00 ?  64 THR H HG21 1  
ATOM 9646   H HG22 . THR H  1 64 ? -6.925  -18.962 -240.804 1.00 0.00 ?  64 THR H HG22 1  
ATOM 9647   H HG23 . THR H  1 64 ? -8.042  -18.078 -239.737 1.00 0.00 ?  64 THR H HG23 1  
ATOM 9648   N N    . VAL H  1 65 ? -10.293 -16.295 -243.458 1.00 0.00 ?  65 VAL H N    1  
ATOM 9649   C CA   . VAL H  1 65 ? -11.101 -15.928 -244.615 1.00 0.00 ?  65 VAL H CA   1  
ATOM 9650   C C    . VAL H  1 65 ? -10.401 -14.876 -245.464 1.00 0.00 ?  65 VAL H C    1  
ATOM 9651   O O    . VAL H  1 65 ? -10.398 -14.958 -246.693 1.00 0.00 ?  65 VAL H O    1  
ATOM 9652   C CB   . VAL H  1 65 ? -12.484 -15.397 -244.193 1.00 0.00 ?  65 VAL H CB   1  
ATOM 9653   C CG1  . VAL H  1 65 ? -13.221 -14.819 -245.392 1.00 0.00 ?  65 VAL H CG1  1  
ATOM 9654   C CG2  . VAL H  1 65 ? -13.305 -16.502 -243.546 1.00 0.00 ?  65 VAL H CG2  1  
ATOM 9655   H H    . VAL H  1 65 ? -10.640 -16.092 -242.531 1.00 0.00 ?  65 VAL H H    1  
ATOM 9656   H HA   . VAL H  1 65 ? -11.244 -16.778 -245.283 1.00 0.00 ?  65 VAL H HA   1  
ATOM 9657   H HB   . VAL H  1 65 ? -12.350 -14.620 -243.439 1.00 0.00 ?  65 VAL H HB   1  
ATOM 9658   H HG11 . VAL H  1 65 ? -14.196 -14.447 -245.075 1.00 0.00 ?  65 VAL H HG11 1  
ATOM 9659   H HG12 . VAL H  1 65 ? -12.640 -13.999 -245.815 1.00 0.00 ?  65 VAL H HG12 1  
ATOM 9660   H HG13 . VAL H  1 65 ? -13.356 -15.595 -246.144 1.00 0.00 ?  65 VAL H HG13 1  
ATOM 9661   H HG21 . VAL H  1 65 ? -12.784 -16.874 -242.664 1.00 0.00 ?  65 VAL H HG21 1  
ATOM 9662   H HG22 . VAL H  1 65 ? -14.278 -16.109 -243.254 1.00 0.00 ?  65 VAL H HG22 1  
ATOM 9663   H HG23 . VAL H  1 65 ? -13.441 -17.316 -244.258 1.00 0.00 ?  65 VAL H HG23 1  
ATOM 9664   N N    . LYS H  1 66 ? -9.808  -13.888 -244.803 1.00 0.00 ?  66 LYS H N    1  
ATOM 9665   C CA   . LYS H  1 66 ? -9.030  -12.864 -245.492 1.00 0.00 ?  66 LYS H CA   1  
ATOM 9666   C C    . LYS H  1 66 ? -7.932  -13.486 -246.344 1.00 0.00 ?  66 LYS H C    1  
ATOM 9667   O O    . LYS H  1 66 ? -7.764  -13.134 -247.511 1.00 0.00 ?  66 LYS H O    1  
ATOM 9668   C CB   . LYS H  1 66 ? -8.424  -11.885 -244.485 1.00 0.00 ?  66 LYS H CB   1  
ATOM 9669   C CG   . LYS H  1 66 ? -7.550  -10.804 -245.107 1.00 0.00 ?  66 LYS H CG   1  
ATOM 9670   C CD   . LYS H  1 66 ? -6.935  -9.908  -244.042 1.00 0.00 ?  66 LYS H CD   1  
ATOM 9671   C CE   . LYS H  1 66 ? -5.985  -8.890  -244.655 1.00 0.00 ?  66 LYS H CE   1  
ATOM 9672   N NZ   . LYS H  1 66 ? -4.751  -9.529  -245.186 1.00 0.00 1  66 LYS H NZ   1  
ATOM 9673   H H    . LYS H  1 66 ? -9.898  -13.844 -243.798 1.00 0.00 ?  66 LYS H H    1  
ATOM 9674   H HA   . LYS H  1 66 ? -9.675  -12.307 -246.173 1.00 0.00 ?  66 LYS H HA   1  
ATOM 9675   H HB2  . LYS H  1 66 ? -9.254  -11.419 -243.953 1.00 0.00 ?  66 LYS H HB2  1  
ATOM 9676   H HB3  . LYS H  1 66 ? -7.829  -12.473 -243.785 1.00 0.00 ?  66 LYS H HB3  1  
ATOM 9677   H HG2  . LYS H  1 66 ? -6.757  -11.286 -245.680 1.00 0.00 ?  66 LYS H HG2  1  
ATOM 9678   H HG3  . LYS H  1 66 ? -8.166  -10.203 -245.776 1.00 0.00 ?  66 LYS H HG3  1  
ATOM 9679   H HD2  . LYS H  1 66 ? -7.739  -9.388  -243.519 1.00 0.00 ?  66 LYS H HD2  1  
ATOM 9680   H HD3  . LYS H  1 66 ? -6.389  -10.534 -243.336 1.00 0.00 ?  66 LYS H HD3  1  
ATOM 9681   H HE2  . LYS H  1 66 ? -6.507  -8.380  -245.464 1.00 0.00 ?  66 LYS H HE2  1  
ATOM 9682   H HE3  . LYS H  1 66 ? -5.717  -8.167  -243.884 1.00 0.00 ?  66 LYS H HE3  1  
ATOM 9683   H HZ1  . LYS H  1 66 ? -4.999  -10.198 -245.900 1.00 0.00 ?  66 LYS H HZ1  1  
ATOM 9684   H HZ2  . LYS H  1 66 ? -4.149  -8.821  -245.582 1.00 0.00 ?  66 LYS H HZ2  1  
ATOM 9685   H HZ3  . LYS H  1 66 ? -4.266  -10.001 -244.436 1.00 0.00 ?  66 LYS H HZ3  1  
ATOM 9686   N N    . VAL H  1 67 ? -7.186  -14.413 -245.753 1.00 0.00 ?  67 VAL H N    1  
ATOM 9687   C CA   . VAL H  1 67 ? -6.052  -15.030 -246.431 1.00 0.00 ?  67 VAL H CA   1  
ATOM 9688   C C    . VAL H  1 67 ? -6.503  -15.817 -247.655 1.00 0.00 ?  67 VAL H C    1  
ATOM 9689   O O    . VAL H  1 67 ? -5.882  -15.744 -248.715 1.00 0.00 ?  67 VAL H O    1  
ATOM 9690   C CB   . VAL H  1 67 ? -5.272  -15.967 -245.490 1.00 0.00 ?  67 VAL H CB   1  
ATOM 9691   C CG1  . VAL H  1 67 ? -4.252  -16.780 -246.273 1.00 0.00 ?  67 VAL H CG1  1  
ATOM 9692   C CG2  . VAL H  1 67 ? -4.585  -15.169 -244.392 1.00 0.00 ?  67 VAL H CG2  1  
ATOM 9693   H H    . VAL H  1 67 ? -7.410  -14.698 -244.811 1.00 0.00 ?  67 VAL H H    1  
ATOM 9694   H HA   . VAL H  1 67 ? -5.365  -14.277 -246.820 1.00 0.00 ?  67 VAL H HA   1  
ATOM 9695   H HB   . VAL H  1 67 ? -5.974  -16.641 -244.999 1.00 0.00 ?  67 VAL H HB   1  
ATOM 9696   H HG11 . VAL H  1 67 ? -3.710  -17.437 -245.592 1.00 0.00 ?  67 VAL H HG11 1  
ATOM 9697   H HG12 . VAL H  1 67 ? -4.764  -17.381 -247.024 1.00 0.00 ?  67 VAL H HG12 1  
ATOM 9698   H HG13 . VAL H  1 67 ? -3.549  -16.107 -246.763 1.00 0.00 ?  67 VAL H HG13 1  
ATOM 9699   H HG21 . VAL H  1 67 ? -5.334  -14.628 -243.813 1.00 0.00 ?  67 VAL H HG21 1  
ATOM 9700   H HG22 . VAL H  1 67 ? -4.039  -15.846 -243.736 1.00 0.00 ?  67 VAL H HG22 1  
ATOM 9701   H HG23 . VAL H  1 67 ? -3.890  -14.459 -244.841 1.00 0.00 ?  67 VAL H HG23 1  
ATOM 9702   N N    . PHE H  1 68 ? -7.587  -16.569 -247.502 1.00 0.00 ?  68 PHE H N    1  
ATOM 9703   C CA   . PHE H  1 68 ? -8.154  -17.330 -248.609 1.00 0.00 ?  68 PHE H CA   1  
ATOM 9704   C C    . PHE H  1 68 ? -8.718  -16.407 -249.681 1.00 0.00 ?  68 PHE H C    1  
ATOM 9705   O O    . PHE H  1 68 ? -8.795  -16.775 -250.853 1.00 0.00 ?  68 PHE H O    1  
ATOM 9706   C CB   . PHE H  1 68 ? -9.244  -18.277 -248.103 1.00 0.00 ?  68 PHE H CB   1  
ATOM 9707   C CG   . PHE H  1 68 ? -8.714  -19.557 -247.524 1.00 0.00 ?  68 PHE H CG   1  
ATOM 9708   C CD1  . PHE H  1 68 ? -8.064  -20.482 -248.326 1.00 0.00 ?  68 PHE H CD1  1  
ATOM 9709   C CD2  . PHE H  1 68 ? -8.864  -19.839 -246.174 1.00 0.00 ?  68 PHE H CD2  1  
ATOM 9710   C CE1  . PHE H  1 68 ? -7.577  -21.661 -247.795 1.00 0.00 ?  68 PHE H CE1  1  
ATOM 9711   C CE2  . PHE H  1 68 ? -8.376  -21.016 -245.640 1.00 0.00 ?  68 PHE H CE2  1  
ATOM 9712   C CZ   . PHE H  1 68 ? -7.733  -21.927 -246.450 1.00 0.00 ?  68 PHE H CZ   1  
ATOM 9713   H H    . PHE H  1 68 ? -8.031  -16.614 -246.596 1.00 0.00 ?  68 PHE H H    1  
ATOM 9714   H HA   . PHE H  1 68 ? -7.374  -17.922 -249.089 1.00 0.00 ?  68 PHE H HA   1  
ATOM 9715   H HB2  . PHE H  1 68 ? -9.824  -17.795 -247.317 1.00 0.00 ?  68 PHE H HB2  1  
ATOM 9716   H HB3  . PHE H  1 68 ? -9.906  -18.556 -248.922 1.00 0.00 ?  68 PHE H HB3  1  
ATOM 9717   H HD1  . PHE H  1 68 ? -7.941  -20.271 -249.389 1.00 0.00 ?  68 PHE H HD1  1  
ATOM 9718   H HD2  . PHE H  1 68 ? -9.373  -19.118 -245.533 1.00 0.00 ?  68 PHE H HD2  1  
ATOM 9719   H HE1  . PHE H  1 68 ? -7.069  -22.380 -248.437 1.00 0.00 ?  68 PHE H HE1  1  
ATOM 9720   H HE2  . PHE H  1 68 ? -8.500  -21.225 -244.577 1.00 0.00 ?  68 PHE H HE2  1  
ATOM 9721   H HZ   . PHE H  1 68 ? -7.348  -22.855 -246.030 1.00 0.00 ?  68 PHE H HZ   1  
ATOM 9722   N N    . LYS H  1 69 ? -9.111  -15.205 -249.273 1.00 0.00 ?  69 LYS H N    1  
ATOM 9723   C CA   . LYS H  1 69 ? -9.523  -14.172 -250.215 1.00 0.00 ?  69 LYS H CA   1  
ATOM 9724   C C    . LYS H  1 69 ? -8.317  -13.478 -250.834 1.00 0.00 ?  69 LYS H C    1  
ATOM 9725   O O    . LYS H  1 69 ? -8.376  -13.004 -251.969 1.00 0.00 ?  69 LYS H O    1  
ATOM 9726   C CB   . LYS H  1 69 ? -10.423 -13.145 -249.526 1.00 0.00 ?  69 LYS H CB   1  
ATOM 9727   C CG   . LYS H  1 69 ? -11.151 -12.206 -250.479 1.00 0.00 ?  69 LYS H CG   1  
ATOM 9728   C CD   . LYS H  1 69 ? -10.336 -10.949 -250.747 1.00 0.00 ?  69 LYS H CD   1  
ATOM 9729   C CE   . LYS H  1 69 ? -11.068 -10.005 -251.689 1.00 0.00 ?  69 LYS H CE   1  
ATOM 9730   N NZ   . LYS H  1 69 ? -10.195 -8.890  -252.148 1.00 0.00 1  69 LYS H NZ   1  
ATOM 9731   H H    . LYS H  1 69 ? -9.125  -15.002 -248.283 1.00 0.00 ?  69 LYS H H    1  
ATOM 9732   H HA   . LYS H  1 69 ? -10.078 -14.624 -251.039 1.00 0.00 ?  69 LYS H HA   1  
ATOM 9733   H HB2  . LYS H  1 69 ? -11.153 -13.704 -248.939 1.00 0.00 ?  69 LYS H HB2  1  
ATOM 9734   H HB3  . LYS H  1 69 ? -9.790  -12.563 -248.857 1.00 0.00 ?  69 LYS H HB3  1  
ATOM 9735   H HG2  . LYS H  1 69 ? -11.327 -12.733 -251.418 1.00 0.00 ?  69 LYS H HG2  1  
ATOM 9736   H HG3  . LYS H  1 69 ? -12.107 -11.932 -250.033 1.00 0.00 ?  69 LYS H HG3  1  
ATOM 9737   H HD2  . LYS H  1 69 ? -10.153 -10.446 -249.797 1.00 0.00 ?  69 LYS H HD2  1  
ATOM 9738   H HD3  . LYS H  1 69 ? -9.385  -11.240 -251.192 1.00 0.00 ?  69 LYS H HD3  1  
ATOM 9739   H HE2  . LYS H  1 69 ? -11.408 -10.578 -252.551 1.00 0.00 ?  69 LYS H HE2  1  
ATOM 9740   H HE3  . LYS H  1 69 ? -11.930 -9.597  -251.163 1.00 0.00 ?  69 LYS H HE3  1  
ATOM 9741   H HZ1  . LYS H  1 69 ? -9.396  -9.268  -252.637 1.00 0.00 ?  69 LYS H HZ1  1  
ATOM 9742   H HZ2  . LYS H  1 69 ? -10.717 -8.289  -252.769 1.00 0.00 ?  69 LYS H HZ2  1  
ATOM 9743   H HZ3  . LYS H  1 69 ? -9.880  -8.358  -251.349 1.00 0.00 ?  69 LYS H HZ3  1  
ATOM 9744   N N    . ASP H  1 70 ? -7.222  -13.423 -250.083 1.00 0.00 ?  70 ASP H N    1  
ATOM 9745   C CA   . ASP H  1 70 ? -6.007  -12.766 -250.547 1.00 0.00 ?  70 ASP H CA   1  
ATOM 9746   C C    . ASP H  1 70 ? -5.349  -13.554 -251.673 1.00 0.00 ?  70 ASP H C    1  
ATOM 9747   O O    . ASP H  1 70 ? -4.812  -12.975 -252.617 1.00 0.00 ?  70 ASP H O    1  
ATOM 9748   C CB   . ASP H  1 70 ? -5.021  -12.581 -249.390 1.00 0.00 ?  70 ASP H CB   1  
ATOM 9749   C CG   . ASP H  1 70 ? -5.391  -11.466 -248.421 1.00 0.00 ?  70 ASP H CG   1  
ATOM 9750   O OD1  . ASP H  1 70 ? -6.256  -10.687 -248.744 1.00 0.00 ?  70 ASP H OD1  1  
ATOM 9751   O OD2  . ASP H  1 70 ? -4.922  -11.494 -247.308 1.00 0.00 -1 70 ASP H OD2  1  
ATOM 9752   H H    . ASP H  1 70 ? -7.233  -13.847 -249.166 1.00 0.00 ?  70 ASP H H    1  
ATOM 9753   H HA   . ASP H  1 70 ? -6.250  -11.785 -250.956 1.00 0.00 ?  70 ASP H HA   1  
ATOM 9754   H HB2  . ASP H  1 70 ? -4.830  -13.498 -248.832 1.00 0.00 ?  70 ASP H HB2  1  
ATOM 9755   H HB3  . ASP H  1 70 ? -4.126  -12.298 -249.944 1.00 0.00 ?  70 ASP H HB3  1  
ATOM 9756   N N    . ILE H  1 71 ? -5.396  -14.877 -251.567 1.00 0.00 ?  71 ILE H N    1  
ATOM 9757   C CA   . ILE H  1 71 ? -4.882  -15.748 -252.617 1.00 0.00 ?  71 ILE H CA   1  
ATOM 9758   C C    . ILE H  1 71 ? -5.814  -15.768 -253.822 1.00 0.00 ?  71 ILE H C    1  
ATOM 9759   O O    . ILE H  1 71 ? -5.400  -16.092 -254.935 1.00 0.00 ?  71 ILE H O    1  
ATOM 9760   C CB   . ILE H  1 71 ? -4.683  -17.188 -252.110 1.00 0.00 ?  71 ILE H CB   1  
ATOM 9761   C CG1  . ILE H  1 71 ? -6.016  -17.779 -251.642 1.00 0.00 ?  71 ILE H CG1  1  
ATOM 9762   C CG2  . ILE H  1 71 ? -3.659  -17.219 -250.985 1.00 0.00 ?  71 ILE H CG2  1  
ATOM 9763   C CD1  . ILE H  1 71 ? -5.921  -19.218 -251.190 1.00 0.00 ?  71 ILE H CD1  1  
ATOM 9764   H H    . ILE H  1 71 ? -5.798  -15.291 -250.738 1.00 0.00 ?  71 ILE H H    1  
ATOM 9765   H HA   . ILE H  1 71 ? -3.938  -15.367 -253.005 1.00 0.00 ?  71 ILE H HA   1  
ATOM 9766   H HB   . ILE H  1 71 ? -4.336  -17.811 -252.934 1.00 0.00 ?  71 ILE H HB   1  
ATOM 9767   H HG12 . ILE H  1 71 ? -6.372  -17.162 -250.818 1.00 0.00 ?  71 ILE H HG12 1  
ATOM 9768   H HG13 . ILE H  1 71 ? -6.713  -17.706 -252.477 1.00 0.00 ?  71 ILE H HG13 1  
ATOM 9769   H HG21 . ILE H  1 71 ? -3.531  -18.244 -250.638 1.00 0.00 ?  71 ILE H HG21 1  
ATOM 9770   H HG22 . ILE H  1 71 ? -2.707  -16.838 -251.350 1.00 0.00 ?  71 ILE H HG22 1  
ATOM 9771   H HG23 . ILE H  1 71 ? -4.007  -16.598 -250.160 1.00 0.00 ?  71 ILE H HG23 1  
ATOM 9772   H HD11 . ILE H  1 71 ? -5.226  -19.293 -250.355 1.00 0.00 ?  71 ILE H HD11 1  
ATOM 9773   H HD12 . ILE H  1 71 ? -6.904  -19.567 -250.874 1.00 0.00 ?  71 ILE H HD12 1  
ATOM 9774   H HD13 . ILE H  1 71 ? -5.565  -19.837 -252.015 1.00 0.00 ?  71 ILE H HD13 1  
ATOM 9775   N N    . ASP H  1 72 ? -7.076  -15.421 -253.592 1.00 0.00 ?  72 ASP H N    1  
ATOM 9776   C CA   . ASP H  1 72 ? -8.013  -15.176 -254.682 1.00 0.00 ?  72 ASP H CA   1  
ATOM 9777   C C    . ASP H  1 72 ? -7.628  -13.932 -255.471 1.00 0.00 ?  72 ASP H C    1  
ATOM 9778   O O    . ASP H  1 72 ? -7.599  -13.949 -256.702 1.00 0.00 ?  72 ASP H O    1  
ATOM 9779   C CB   . ASP H  1 72 ? -9.439  -15.035 -254.142 1.00 0.00 ?  72 ASP H CB   1  
ATOM 9780   C CG   . ASP H  1 72 ? -10.053 -16.335 -253.642 1.00 0.00 ?  72 ASP H CG   1  
ATOM 9781   O OD1  . ASP H  1 72 ? -9.535  -17.378 -253.965 1.00 0.00 ?  72 ASP H OD1  1  
ATOM 9782   O OD2  . ASP H  1 72 ? -10.935 -16.274 -252.819 1.00 0.00 -1 72 ASP H OD2  1  
ATOM 9783   H H    . ASP H  1 72 ? -7.394  -15.324 -252.639 1.00 0.00 ?  72 ASP H H    1  
ATOM 9784   H HA   . ASP H  1 72 ? -7.988  -16.009 -255.385 1.00 0.00 ?  72 ASP H HA   1  
ATOM 9785   H HB2  . ASP H  1 72 ? -9.539  -14.268 -253.375 1.00 0.00 ?  72 ASP H HB2  1  
ATOM 9786   H HB3  . ASP H  1 72 ? -9.955  -14.714 -255.048 1.00 0.00 ?  72 ASP H HB3  1  
ATOM 9787   N N    . ALA H  1 73 ? -7.331  -12.852 -254.756 1.00 0.00 ?  73 ALA H N    1  
ATOM 9788   C CA   . ALA H  1 73 ? -6.865  -11.621 -255.384 1.00 0.00 ?  73 ALA H CA   1  
ATOM 9789   C C    . ALA H  1 73 ? -5.553  -11.843 -256.125 1.00 0.00 ?  73 ALA H C    1  
ATOM 9790   O O    . ALA H  1 73 ? -5.341  -11.299 -257.208 1.00 0.00 ?  73 ALA H O    1  
ATOM 9791   C CB   . ALA H  1 73 ? -6.711  -10.521 -254.344 1.00 0.00 ?  73 ALA H CB   1  
ATOM 9792   H H    . ALA H  1 73 ? -7.431  -12.884 -253.752 1.00 0.00 ?  73 ALA H H    1  
ATOM 9793   H HA   . ALA H  1 73 ? -7.604  -11.303 -256.120 1.00 0.00 ?  73 ALA H HA   1  
ATOM 9794   H HB1  . ALA H  1 73 ? -5.987  -10.831 -253.592 1.00 0.00 ?  73 ALA H HB1  1  
ATOM 9795   H HB2  . ALA H  1 73 ? -6.363  -9.609  -254.829 1.00 0.00 ?  73 ALA H HB2  1  
ATOM 9796   H HB3  . ALA H  1 73 ? -7.674  -10.333 -253.867 1.00 0.00 ?  73 ALA H HB3  1  
ATOM 9797   N N    . ALA H  1 74 ? -4.674  -12.646 -255.534 1.00 0.00 ?  74 ALA H N    1  
ATOM 9798   C CA   . ALA H  1 74 ? -3.381  -12.942 -256.137 1.00 0.00 ?  74 ALA H CA   1  
ATOM 9799   C C    . ALA H  1 74 ? -3.547  -13.587 -257.507 1.00 0.00 ?  74 ALA H C    1  
ATOM 9800   O O    . ALA H  1 74 ? -2.814  -13.272 -258.445 1.00 0.00 ?  74 ALA H O    1  
ATOM 9801   C CB   . ALA H  1 74 ? -2.562  -13.840 -255.221 1.00 0.00 ?  74 ALA H CB   1  
ATOM 9802   H H    . ALA H  1 74 ? -4.909  -13.061 -254.643 1.00 0.00 ?  74 ALA H H    1  
ATOM 9803   H HA   . ALA H  1 74 ? -2.840  -12.007 -256.281 1.00 0.00 ?  74 ALA H HA   1  
ATOM 9804   H HB1  . ALA H  1 74 ? -3.097  -14.774 -255.054 1.00 0.00 ?  74 ALA H HB1  1  
ATOM 9805   H HB2  . ALA H  1 74 ? -1.599  -14.052 -255.686 1.00 0.00 ?  74 ALA H HB2  1  
ATOM 9806   H HB3  . ALA H  1 74 ? -2.401  -13.338 -254.267 1.00 0.00 ?  74 ALA H HB3  1  
ATOM 9807   N N    . ILE H  1 75 ? -4.515  -14.490 -257.617 1.00 0.00 ?  75 ILE H N    1  
ATOM 9808   C CA   . ILE H  1 75 ? -4.752  -15.211 -258.862 1.00 0.00 ?  75 ILE H CA   1  
ATOM 9809   C C    . ILE H  1 75 ? -5.333  -14.293 -259.929 1.00 0.00 ?  75 ILE H C    1  
ATOM 9810   O O    . ILE H  1 75 ? -4.858  -14.265 -261.064 1.00 0.00 ?  75 ILE H O    1  
ATOM 9811   C CB   . ILE H  1 75 ? -5.703  -16.404 -258.651 1.00 0.00 ?  75 ILE H CB   1  
ATOM 9812   C CG1  . ILE H  1 75 ? -5.040  -17.466 -257.770 1.00 0.00 ?  75 ILE H CG1  1  
ATOM 9813   C CG2  . ILE H  1 75 ? -6.113  -16.999 -259.989 1.00 0.00 ?  75 ILE H CG2  1  
ATOM 9814   C CD1  . ILE H  1 75 ? -5.997  -18.519 -257.259 1.00 0.00 ?  75 ILE H CD1  1  
ATOM 9815   H H    . ILE H  1 75 ? -5.101  -14.682 -256.818 1.00 0.00 ?  75 ILE H H    1  
ATOM 9816   H HA   . ILE H  1 75 ? -3.813  -15.567 -259.285 1.00 0.00 ?  75 ILE H HA   1  
ATOM 9817   H HB   . ILE H  1 75 ? -6.589  -16.062 -258.118 1.00 0.00 ?  75 ILE H HB   1  
ATOM 9818   H HG12 . ILE H  1 75 ? -4.260  -17.941 -258.364 1.00 0.00 ?  75 ILE H HG12 1  
ATOM 9819   H HG13 . ILE H  1 75 ? -4.586  -16.948 -256.924 1.00 0.00 ?  75 ILE H HG13 1  
ATOM 9820   H HG21 . ILE H  1 75 ? -6.784  -17.842 -259.822 1.00 0.00 ?  75 ILE H HG21 1  
ATOM 9821   H HG22 . ILE H  1 75 ? -6.623  -16.242 -260.583 1.00 0.00 ?  75 ILE H HG22 1  
ATOM 9822   H HG23 . ILE H  1 75 ? -5.227  -17.343 -260.523 1.00 0.00 ?  75 ILE H HG23 1  
ATOM 9823   H HD11 . ILE H  1 75 ? -6.450  -19.039 -258.102 1.00 0.00 ?  75 ILE H HD11 1  
ATOM 9824   H HD12 . ILE H  1 75 ? -5.454  -19.236 -256.642 1.00 0.00 ?  75 ILE H HD12 1  
ATOM 9825   H HD13 . ILE H  1 75 ? -6.777  -18.045 -256.663 1.00 0.00 ?  75 ILE H HD13 1  
ATOM 9826   N N    . ILE H  1 76 ? -6.364  -13.541 -259.557 1.00 0.00 ?  76 ILE H N    1  
ATOM 9827   C CA   . ILE H  1 76 ? -7.067  -12.683 -260.504 1.00 0.00 ?  76 ILE H CA   1  
ATOM 9828   C C    . ILE H  1 76 ? -6.249  -11.440 -260.832 1.00 0.00 ?  76 ILE H C    1  
ATOM 9829   O O    . ILE H  1 76 ? -6.542  -10.729 -261.793 1.00 0.00 ?  76 ILE H O    1  
ATOM 9830   C CB   . ILE H  1 76 ? -8.442  -12.253 -259.963 1.00 0.00 ?  76 ILE H CB   1  
ATOM 9831   C CG1  . ILE H  1 76 ? -8.277  -11.377 -258.718 1.00 0.00 ?  76 ILE H CG1  1  
ATOM 9832   C CG2  . ILE H  1 76 ? -9.296  -13.472 -259.650 1.00 0.00 ?  76 ILE H CG2  1  
ATOM 9833   C CD1  . ILE H  1 76 ? -9.570  -10.775 -258.219 1.00 0.00 ?  76 ILE H CD1  1  
ATOM 9834   H H    . ILE H  1 76 ? -6.669  -13.565 -258.595 1.00 0.00 ?  76 ILE H H    1  
ATOM 9835   H HA   . ILE H  1 76 ? -7.195  -13.189 -261.459 1.00 0.00 ?  76 ILE H HA   1  
ATOM 9836   H HB   . ILE H  1 76 ? -8.943  -11.641 -260.712 1.00 0.00 ?  76 ILE H HB   1  
ATOM 9837   H HG12 . ILE H  1 76 ? -7.842  -12.001 -257.938 1.00 0.00 ?  76 ILE H HG12 1  
ATOM 9838   H HG13 . ILE H  1 76 ? -7.580  -10.579 -258.974 1.00 0.00 ?  76 ILE H HG13 1  
ATOM 9839   H HG21 . ILE H  1 76 ? -10.264 -13.150 -259.268 1.00 0.00 ?  76 ILE H HG21 1  
ATOM 9840   H HG22 . ILE H  1 76 ? -9.440  -14.057 -260.557 1.00 0.00 ?  76 ILE H HG22 1  
ATOM 9841   H HG23 . ILE H  1 76 ? -8.795  -14.084 -258.899 1.00 0.00 ?  76 ILE H HG23 1  
ATOM 9842   H HD11 . ILE H  1 76 ? -10.268 -11.570 -257.961 1.00 0.00 ?  76 ILE H HD11 1  
ATOM 9843   H HD12 . ILE H  1 76 ? -9.373  -10.167 -257.335 1.00 0.00 ?  76 ILE H HD12 1  
ATOM 9844   H HD13 . ILE H  1 76 ? -10.006 -10.149 -258.998 1.00 0.00 ?  76 ILE H HD13 1  
ATOM 9845   N N    . GLN H  1 77 ? -5.223  -11.183 -260.027 1.00 0.00 ?  77 GLN H N    1  
ATOM 9846   C CA   . GLN H  1 77 ? -4.221  -10.178 -260.361 1.00 0.00 ?  77 GLN H CA   1  
ATOM 9847   C C    . GLN H  1 77 ? -3.473  -10.547 -261.635 1.00 0.00 ?  77 GLN H C    1  
ATOM 9848   O O    . GLN H  1 77 ? -3.006  -9.674  -262.367 1.00 0.00 ?  77 GLN H O    1  
ATOM 9849   C CB   . GLN H  1 77 ? -3.227  -10.010 -259.209 1.00 0.00 ?  77 GLN H CB   1  
ATOM 9850   C CG   . GLN H  1 77 ? -2.234  -8.877  -259.404 1.00 0.00 ?  77 GLN H CG   1  
ATOM 9851   C CD   . GLN H  1 77 ? -2.910  -7.522  -259.487 1.00 0.00 ?  77 GLN H CD   1  
ATOM 9852   O OE1  . GLN H  1 77 ? -3.799  -7.206  -258.692 1.00 0.00 ?  77 GLN H OE1  1  
ATOM 9853   N NE2  . GLN H  1 77 ? -2.495  -6.713  -260.455 1.00 0.00 ?  77 GLN H NE2  1  
ATOM 9854   H H    . GLN H  1 77 ? -5.135  -11.698 -259.163 1.00 0.00 ?  77 GLN H H    1  
ATOM 9855   H HA   . GLN H  1 77 ? -4.712  -9.224  -260.554 1.00 0.00 ?  77 GLN H HA   1  
ATOM 9856   H HB2  . GLN H  1 77 ? -3.815  -9.833  -258.308 1.00 0.00 ?  77 GLN H HB2  1  
ATOM 9857   H HB3  . GLN H  1 77 ? -2.693  -10.955 -259.113 1.00 0.00 ?  77 GLN H HB3  1  
ATOM 9858   H HG2  . GLN H  1 77 ? -1.337  -8.767  -258.794 1.00 0.00 ?  77 GLN H HG2  1  
ATOM 9859   H HG3  . GLN H  1 77 ? -1.950  -9.183  -260.412 1.00 0.00 ?  77 GLN H HG3  1  
ATOM 9860   H HE21 . GLN H  1 77 ? -1.772  -7.009  -261.080 1.00 0.00 ?  77 GLN H HE21 1  
ATOM 9861   H HE22 . GLN H  1 77 ? -2.905  -5.805  -260.559 1.00 0.00 ?  77 GLN H HE22 1  
ATOM 9862   N N    . ASN H  1 78 ? -3.363  -11.845 -261.896 1.00 0.00 ?  78 ASN H N    1  
ATOM 9863   C CA   . ASN H  1 78 ? -2.725  -12.331 -263.114 1.00 0.00 ?  78 ASN H CA   1  
ATOM 9864   C C    . ASN H  1 78 ? -3.760  -12.816 -264.121 1.00 0.00 ?  78 ASN H C    1  
ATOM 9865   O O    . ASN H  1 78 ? -3.480  -13.692 -264.939 1.00 0.00 ?  78 ASN H O    1  
ATOM 9866   C CB   . ASN H  1 78 ? -1.726  -13.433 -262.815 1.00 0.00 ?  78 ASN H CB   1  
ATOM 9867   C CG   . ASN H  1 78 ? -0.544  -12.976 -262.006 1.00 0.00 ?  78 ASN H CG   1  
ATOM 9868   O OD1  . ASN H  1 78 ? -0.103  -11.826 -262.110 1.00 0.00 ?  78 ASN H OD1  1  
ATOM 9869   N ND2  . ASN H  1 78 ? 0.020   -13.894 -261.263 1.00 0.00 ?  78 ASN H ND2  1  
ATOM 9870   H H    . ASN H  1 78 ? -3.730  -12.513 -261.233 1.00 0.00 ?  78 ASN H H    1  
ATOM 9871   H HA   . ASN H  1 78 ? -2.182  -11.517 -263.596 1.00 0.00 ?  78 ASN H HA   1  
ATOM 9872   H HB2  . ASN H  1 78 ? -2.059  -14.404 -262.445 1.00 0.00 ?  78 ASN H HB2  1  
ATOM 9873   H HB3  . ASN H  1 78 ? -1.423  -13.528 -263.858 1.00 0.00 ?  78 ASN H HB3  1  
ATOM 9874   H HD21 . ASN H  1 78 ? -0.340  -14.826 -261.260 1.00 0.00 ?  78 ASN H HD21 1  
ATOM 9875   H HD22 . ASN H  1 78 ? 0.812   -13.661 -260.698 1.00 0.00 ?  78 ASN H HD22 1  
ATOM 9876   N N    . PHE H  1 79 ? -4.956  -12.241 -264.057 1.00 0.00 ?  79 PHE H N    1  
ATOM 9877   C CA   . PHE H  1 79 ? -6.060  -12.672 -264.906 1.00 0.00 ?  79 PHE H CA   1  
ATOM 9878   C C    . PHE H  1 79 ? -5.931  -12.097 -266.310 1.00 0.00 ?  79 PHE H C    1  
ATOM 9879   O O    . PHE H  1 79 ? -6.703  -11.223 -266.707 1.00 0.00 ?  79 PHE H O    1  
ATOM 9880   C CB   . PHE H  1 79 ? -7.399  -12.263 -264.290 1.00 0.00 ?  79 PHE H CB   1  
ATOM 9881   C CG   . PHE H  1 79 ? -8.575  -13.019 -264.840 1.00 0.00 ?  79 PHE H CG   1  
ATOM 9882   C CD1  . PHE H  1 79 ? -8.829  -14.323 -264.440 1.00 0.00 ?  79 PHE H CD1  1  
ATOM 9883   C CD2  . PHE H  1 79 ? -9.429  -12.429 -265.760 1.00 0.00 ?  79 PHE H CD2  1  
ATOM 9884   C CE1  . PHE H  1 79 ? -9.911  -15.019 -264.945 1.00 0.00 ?  79 PHE H CE1  1  
ATOM 9885   C CE2  . PHE H  1 79 ? -10.511 -13.122 -266.266 1.00 0.00 ?  79 PHE H CE2  1  
ATOM 9886   C CZ   . PHE H  1 79 ? -10.752 -14.419 -265.858 1.00 0.00 ?  79 PHE H CZ   1  
ATOM 9887   H H    . PHE H  1 79 ? -5.105  -11.486 -263.402 1.00 0.00 ?  79 PHE H H    1  
ATOM 9888   H HA   . PHE H  1 79 ? -6.043  -13.758 -265.013 1.00 0.00 ?  79 PHE H HA   1  
ATOM 9889   H HB2  . PHE H  1 79 ? -7.389  -12.442 -263.216 1.00 0.00 ?  79 PHE H HB2  1  
ATOM 9890   H HB3  . PHE H  1 79 ? -7.591  -11.208 -264.480 1.00 0.00 ?  79 PHE H HB3  1  
ATOM 9891   H HD1  . PHE H  1 79 ? -8.164  -14.797 -263.717 1.00 0.00 ?  79 PHE H HD1  1  
ATOM 9892   H HD2  . PHE H  1 79 ? -9.239  -11.405 -266.082 1.00 0.00 ?  79 PHE H HD2  1  
ATOM 9893   H HE1  . PHE H  1 79 ? -10.098 -16.043 -264.622 1.00 0.00 ?  79 PHE H HE1  1  
ATOM 9894   H HE2  . PHE H  1 79 ? -11.175 -12.647 -266.988 1.00 0.00 ?  79 PHE H HE2  1  
ATOM 9895   H HZ   . PHE H  1 79 ? -11.604 -14.967 -266.258 1.00 0.00 ?  79 PHE H HZ   1  
ATOM 9896   N N    . ARG H  1 80 ? -4.952  -12.592 -267.060 1.00 0.00 ?  80 ARG H N    1  
ATOM 9897   C CA   . ARG H  1 80 ? -4.671  -12.074 -268.393 1.00 0.00 ?  80 ARG H CA   1  
ATOM 9898   C C    . ARG H  1 80 ? -5.799  -12.406 -269.362 1.00 0.00 ?  80 ARG H C    1  
ATOM 9899   O O    . ARG H  1 80 ? -6.799  -11.743 -269.368 1.00 0.00 ?  80 ARG H O    1  
ATOM 9900   C CB   . ARG H  1 80 ? -3.326  -12.548 -268.922 1.00 0.00 ?  80 ARG H CB   1  
ATOM 9901   C CG   . ARG H  1 80 ? -2.126  -12.129 -268.087 1.00 0.00 ?  80 ARG H CG   1  
ATOM 9902   C CD   . ARG H  1 80 ? -1.946  -10.659 -267.970 1.00 0.00 ?  80 ARG H CD   1  
ATOM 9903   N NE   . ARG H  1 80 ? -1.589  -9.995  -269.213 1.00 0.00 ?  80 ARG H NE   1  
ATOM 9904   C CZ   . ARG H  1 80 ? -1.580  -8.659  -269.392 1.00 0.00 ?  80 ARG H CZ   1  
ATOM 9905   N NH1  . ARG H  1 80 ? -1.943  -7.844  -268.426 1.00 0.00 1  80 ARG H NH1  1  
ATOM 9906   N NH2  . ARG H  1 80 ? -1.219  -8.190  -270.573 1.00 0.00 ?  80 ARG H NH2  1  
ATOM 9907   O OXT  . ARG H  1 80 ? -6.089  -13.550 -269.576 1.00 0.00 -1 80 ARG H OXT  1  
ATOM 9908   H H    . ARG H  1 80 ? -4.388  -13.347 -266.696 1.00 0.00 ?  80 ARG H H    1  
ATOM 9909   H HA   . ARG H  1 80 ? -4.601  -10.986 -268.359 1.00 0.00 ?  80 ARG H HA   1  
ATOM 9910   H HB2  . ARG H  1 80 ? -3.368  -13.636 -268.969 1.00 0.00 ?  80 ARG H HB2  1  
ATOM 9911   H HB3  . ARG H  1 80 ? -3.220  -12.145 -269.929 1.00 0.00 ?  80 ARG H HB3  1  
ATOM 9912   H HG2  . ARG H  1 80 ? -2.245  -12.533 -267.081 1.00 0.00 ?  80 ARG H HG2  1  
ATOM 9913   H HG3  . ARG H  1 80 ? -1.226  -12.543 -268.541 1.00 0.00 ?  80 ARG H HG3  1  
ATOM 9914   H HD2  . ARG H  1 80 ? -2.877  -10.215 -267.619 1.00 0.00 ?  80 ARG H HD2  1  
ATOM 9915   H HD3  . ARG H  1 80 ? -1.153  -10.456 -267.251 1.00 0.00 ?  80 ARG H HD3  1  
ATOM 9916   H HE   . ARG H  1 80 ? -1.304  -10.393 -270.098 1.00 0.00 ?  80 ARG H HE   1  
ATOM 9917   H HH11 . ARG H  1 80 ? -2.233  -8.219  -267.534 1.00 0.00 ?  80 ARG H HH11 1  
ATOM 9918   H HH12 . ARG H  1 80 ? -1.930  -6.846  -268.580 1.00 0.00 ?  80 ARG H HH12 1  
ATOM 9919   H HH21 . ARG H  1 80 ? -0.960  -8.831  -271.310 1.00 0.00 ?  80 ARG H HH21 1  
ATOM 9920   H HH22 . ARG H  1 80 ? -1.204  -7.194  -270.734 1.00 0.00 ?  80 ARG H HH22 1  
ATOM 9921   N N    . MET I  1 1  ? 10.808  -44.958 -245.136 1.00 0.00 ?  1  MET I N    1  
ATOM 9922   C CA   . MET I  1 1  ? 11.613  -44.407 -246.220 1.00 0.00 ?  1  MET I CA   1  
ATOM 9923   C C    . MET I  1 1  ? 11.028  -43.096 -246.728 1.00 0.00 ?  1  MET I C    1  
ATOM 9924   O O    . MET I  1 1  ? 11.756  -42.222 -247.199 1.00 0.00 ?  1  MET I O    1  
ATOM 9925   C CB   . MET I  1 1  ? 11.721  -45.416 -247.362 1.00 0.00 ?  1  MET I CB   1  
ATOM 9926   C CG   . MET I  1 1  ? 12.440  -46.707 -246.996 1.00 0.00 ?  1  MET I CG   1  
ATOM 9927   S SD   . MET I  1 1  ? 14.117  -46.422 -246.397 1.00 0.00 ?  1  MET I SD   1  
ATOM 9928   C CE   . MET I  1 1  ? 14.924  -45.872 -247.897 1.00 0.00 ?  1  MET I CE   1  
ATOM 9929   H H1   . MET I  1 1  ? 10.390  -45.861 -245.233 1.00 0.00 ?  1  MET I H1   1  
ATOM 9930   H H2   . MET I  1 1  ? 11.217  -45.105 -244.235 1.00 0.00 ?  1  MET I H2   1  
ATOM 9931   H H3   . MET I  1 1  ? 9.990   -44.474 -244.824 1.00 0.00 ?  1  MET I H3   1  
ATOM 9932   H HA   . MET I  1 1  ? 12.616  -44.180 -245.860 1.00 0.00 ?  1  MET I HA   1  
ATOM 9933   H HB2  . MET I  1 1  ? 10.704  -45.644 -247.681 1.00 0.00 ?  1  MET I HB2  1  
ATOM 9934   H HB3  . MET I  1 1  ? 12.254  -44.921 -248.174 1.00 0.00 ?  1  MET I HB3  1  
ATOM 9935   H HG2  . MET I  1 1  ? 11.863  -47.209 -246.221 1.00 0.00 ?  1  MET I HG2  1  
ATOM 9936   H HG3  . MET I  1 1  ? 12.479  -47.336 -247.885 1.00 0.00 ?  1  MET I HG3  1  
ATOM 9937   H HE1  . MET I  1 1  ? 14.434  -44.970 -248.264 1.00 0.00 ?  1  MET I HE1  1  
ATOM 9938   H HE2  . MET I  1 1  ? 15.972  -45.656 -247.689 1.00 0.00 ?  1  MET I HE2  1  
ATOM 9939   H HE3  . MET I  1 1  ? 14.858  -46.655 -248.654 1.00 0.00 ?  1  MET I HE3  1  
ATOM 9940   N N    . ALA I  1 2  ? 9.709   -42.964 -246.631 1.00 0.00 ?  2  ALA I N    1  
ATOM 9941   C CA   . ALA I  1 2  ? 9.023   -41.765 -247.094 1.00 0.00 ?  2  ALA I CA   1  
ATOM 9942   C C    . ALA I  1 2  ? 9.233   -40.603 -246.131 1.00 0.00 ?  2  ALA I C    1  
ATOM 9943   O O    . ALA I  1 2  ? 9.307   -40.797 -244.917 1.00 0.00 ?  2  ALA I O    1  
ATOM 9944   C CB   . ALA I  1 2  ? 7.538   -42.042 -247.279 1.00 0.00 ?  2  ALA I CB   1  
ATOM 9945   H H    . ALA I  1 2  ? 9.169   -43.715 -246.226 1.00 0.00 ?  2  ALA I H    1  
ATOM 9946   H HA   . ALA I  1 2  ? 9.444   -41.470 -248.055 1.00 0.00 ?  2  ALA I HA   1  
ATOM 9947   H HB1  . ALA I  1 2  ? 7.105   -42.353 -246.330 1.00 0.00 ?  2  ALA I HB1  1  
ATOM 9948   H HB2  . ALA I  1 2  ? 7.040   -41.136 -247.625 1.00 0.00 ?  2  ALA I HB2  1  
ATOM 9949   H HB3  . ALA I  1 2  ? 7.405   -42.834 -248.017 1.00 0.00 ?  2  ALA I HB3  1  
ATOM 9950   N N    . THR I  1 3  ? 9.327   -39.397 -246.679 1.00 0.00 ?  3  THR I N    1  
ATOM 9951   C CA   . THR I  1 3  ? 9.515   -38.200 -245.868 1.00 0.00 ?  3  THR I CA   1  
ATOM 9952   C C    . THR I  1 3  ? 8.510   -37.118 -246.240 1.00 0.00 ?  3  THR I C    1  
ATOM 9953   O O    . THR I  1 3  ? 8.428   -36.705 -247.397 1.00 0.00 ?  3  THR I O    1  
ATOM 9954   C CB   . THR I  1 3  ? 10.940  -37.635 -246.016 1.00 0.00 ?  3  THR I CB   1  
ATOM 9955   O OG1  . THR I  1 3  ? 11.895  -38.629 -245.622 1.00 0.00 ?  3  THR I OG1  1  
ATOM 9956   C CG2  . THR I  1 3  ? 11.116  -36.397 -245.149 1.00 0.00 ?  3  THR I CG2  1  
ATOM 9957   H H    . THR I  1 3  ? 9.267   -39.306 -247.683 1.00 0.00 ?  3  THR I H    1  
ATOM 9958   H HA   . THR I  1 3  ? 9.340   -38.434 -244.817 1.00 0.00 ?  3  THR I HA   1  
ATOM 9959   H HB   . THR I  1 3  ? 11.111  -37.373 -247.060 1.00 0.00 ?  3  THR I HB   1  
ATOM 9960   H HG1  . THR I  1 3  ? 12.782  -38.275 -245.716 1.00 0.00 ?  3  THR I HG1  1  
ATOM 9961   H HG21 . THR I  1 3  ? 12.129  -36.013 -245.268 1.00 0.00 ?  3  THR I HG21 1  
ATOM 9962   H HG22 . THR I  1 3  ? 10.399  -35.635 -245.454 1.00 0.00 ?  3  THR I HG22 1  
ATOM 9963   H HG23 . THR I  1 3  ? 10.947  -36.658 -244.105 1.00 0.00 ?  3  THR I HG23 1  
ATOM 9964   N N    . PRO I  1 4  ? 7.745   -36.662 -245.254 1.00 0.00 ?  4  PRO I N    1  
ATOM 9965   C CA   . PRO I  1 4  ? 6.771   -35.599 -245.468 1.00 0.00 ?  4  PRO I CA   1  
ATOM 9966   C C    . PRO I  1 4  ? 7.427   -34.364 -246.073 1.00 0.00 ?  4  PRO I C    1  
ATOM 9967   O O    . PRO I  1 4  ? 8.562   -34.025 -245.737 1.00 0.00 ?  4  PRO I O    1  
ATOM 9968   C CB   . PRO I  1 4  ? 6.204   -35.324 -244.071 1.00 0.00 ?  4  PRO I CB   1  
ATOM 9969   C CG   . PRO I  1 4  ? 6.406   -36.602 -243.330 1.00 0.00 ?  4  PRO I CG   1  
ATOM 9970   C CD   . PRO I  1 4  ? 7.708   -37.158 -243.843 1.00 0.00 ?  4  PRO I CD   1  
ATOM 9971   H HA   . PRO I  1 4  ? 5.984   -35.881 -246.182 1.00 0.00 ?  4  PRO I HA   1  
ATOM 9972   H HB2  . PRO I  1 4  ? 6.728   -34.491 -243.580 1.00 0.00 ?  4  PRO I HB2  1  
ATOM 9973   H HB3  . PRO I  1 4  ? 5.138   -35.054 -244.115 1.00 0.00 ?  4  PRO I HB3  1  
ATOM 9974   H HG2  . PRO I  1 4  ? 6.450   -36.429 -242.245 1.00 0.00 ?  4  PRO I HG2  1  
ATOM 9975   H HG3  . PRO I  1 4  ? 5.578   -37.302 -243.512 1.00 0.00 ?  4  PRO I HG3  1  
ATOM 9976   H HD2  . PRO I  1 4  ? 8.572   -36.794 -243.267 1.00 0.00 ?  4  PRO I HD2  1  
ATOM 9977   H HD3  . PRO I  1 4  ? 7.736   -38.257 -243.802 1.00 0.00 ?  4  PRO I HD3  1  
ATOM 9978   N N    . TRP I  1 5  ? 6.707   -33.696 -246.967 1.00 0.00 ?  5  TRP I N    1  
ATOM 9979   C CA   . TRP I  1 5  ? 7.222   -32.503 -247.628 1.00 0.00 ?  5  TRP I CA   1  
ATOM 9980   C C    . TRP I  1 5  ? 7.442   -31.372 -246.631 1.00 0.00 ?  5  TRP I C    1  
ATOM 9981   O O    . TRP I  1 5  ? 6.640   -31.170 -245.720 1.00 0.00 ?  5  TRP I O    1  
ATOM 9982   C CB   . TRP I  1 5  ? 6.264   -32.050 -248.732 1.00 0.00 ?  5  TRP I CB   1  
ATOM 9983   C CG   . TRP I  1 5  ? 6.686   -30.779 -249.405 1.00 0.00 ?  5  TRP I CG   1  
ATOM 9984   C CD1  . TRP I  1 5  ? 7.483   -30.665 -250.504 1.00 0.00 ?  5  TRP I CD1  1  
ATOM 9985   C CD2  . TRP I  1 5  ? 6.332   -29.444 -249.025 1.00 0.00 ?  5  TRP I CD2  1  
ATOM 9986   N NE1  . TRP I  1 5  ? 7.650   -29.342 -250.833 1.00 0.00 ?  5  TRP I NE1  1  
ATOM 9987   C CE2  . TRP I  1 5  ? 6.951   -28.572 -249.939 1.00 0.00 ?  5  TRP I CE2  1  
ATOM 9988   C CE3  . TRP I  1 5  ? 5.549   -28.901 -247.998 1.00 0.00 ?  5  TRP I CE3  1  
ATOM 9989   C CZ2  . TRP I  1 5  ? 6.816   -27.195 -249.859 1.00 0.00 ?  5  TRP I CZ2  1  
ATOM 9990   C CZ3  . TRP I  1 5  ? 5.413   -27.520 -247.920 1.00 0.00 ?  5  TRP I CZ3  1  
ATOM 9991   C CH2  . TRP I  1 5  ? 6.028   -26.692 -248.824 1.00 0.00 ?  5  TRP I CH2  1  
ATOM 9992   H H    . TRP I  1 5  ? 5.778   -34.022 -247.194 1.00 0.00 ?  5  TRP I H    1  
ATOM 9993   H HA   . TRP I  1 5  ? 8.192   -32.718 -248.076 1.00 0.00 ?  5  TRP I HA   1  
ATOM 9994   H HB2  . TRP I  1 5  ? 6.199   -32.809 -249.511 1.00 0.00 ?  5  TRP I HB2  1  
ATOM 9995   H HB3  . TRP I  1 5  ? 5.272   -31.869 -248.317 1.00 0.00 ?  5  TRP I HB3  1  
ATOM 9996   H HD1  . TRP I  1 5  ? 7.854   -31.590 -250.942 1.00 0.00 ?  5  TRP I HD1  1  
ATOM 9997   H HE1  . TRP I  1 5  ? 8.199   -28.993 -251.605 1.00 0.00 ?  5  TRP I HE1  1  
ATOM 9998   H HE3  . TRP I  1 5  ? 5.037   -29.513 -247.256 1.00 0.00 ?  5  TRP I HE3  1  
ATOM 9999   H HZ2  . TRP I  1 5  ? 7.322   -26.573 -250.599 1.00 0.00 ?  5  TRP I HZ2  1  
ATOM 10000  H HZ3  . TRP I  1 5  ? 4.802   -27.111 -247.115 1.00 0.00 ?  5  TRP I HZ3  1  
ATOM 10001  H HH2  . TRP I  1 5  ? 5.896   -25.614 -248.727 1.00 0.00 ?  5  TRP I HH2  1  
ATOM 10002  N N    . SER I  1 6  ? 8.535   -30.637 -246.811 1.00 0.00 ?  6  SER I N    1  
ATOM 10003  C CA   . SER I  1 6  ? 8.811   -29.463 -245.992 1.00 0.00 ?  6  SER I CA   1  
ATOM 10004  C C    . SER I  1 6  ? 9.416   -28.340 -246.825 1.00 0.00 ?  6  SER I C    1  
ATOM 10005  O O    . SER I  1 6  ? 10.424  -28.533 -247.505 1.00 0.00 ?  6  SER I O    1  
ATOM 10006  C CB   . SER I  1 6  ? 9.737   -29.830 -244.848 1.00 0.00 ?  6  SER I CB   1  
ATOM 10007  O OG   . SER I  1 6  ? 10.089  -28.714 -244.077 1.00 0.00 ?  6  SER I OG   1  
ATOM 10008  H H    . SER I  1 6  ? 9.191   -30.899 -247.533 1.00 0.00 ?  6  SER I H    1  
ATOM 10009  H HA   . SER I  1 6  ? 7.936   -29.095 -245.453 1.00 0.00 ?  6  SER I HA   1  
ATOM 10010  H HB2  . SER I  1 6  ? 9.232   -30.556 -244.211 1.00 0.00 ?  6  SER I HB2  1  
ATOM 10011  H HB3  . SER I  1 6  ? 10.641  -30.276 -245.260 1.00 0.00 ?  6  SER I HB3  1  
ATOM 10012  H HG   . SER I  1 6  ? 11.010  -28.494 -244.236 1.00 0.00 ?  6  SER I HG   1  
ATOM 10013  N N    . GLY I  1 7  ? 8.795   -27.167 -246.767 1.00 0.00 ?  7  GLY I N    1  
ATOM 10014  C CA   . GLY I  1 7  ? 9.276   -26.008 -247.510 1.00 0.00 ?  7  GLY I CA   1  
ATOM 10015  C C    . GLY I  1 7  ? 10.421  -25.321 -246.777 1.00 0.00 ?  7  GLY I C    1  
ATOM 10016  O O    . GLY I  1 7  ? 10.858  -25.779 -245.721 1.00 0.00 ?  7  GLY I O    1  
ATOM 10017  H H    . GLY I  1 7  ? 7.968   -27.076 -246.195 1.00 0.00 ?  7  GLY I H    1  
ATOM 10018  H HA2  . GLY I  1 7  ? 9.626   -26.333 -248.490 1.00 0.00 ?  7  GLY I HA2  1  
ATOM 10019  H HA3  . GLY I  1 7  ? 8.458   -25.300 -247.634 1.00 0.00 ?  7  GLY I HA3  1  
ATOM 10020  N N    . TYR I  1 8  ? 10.904  -24.221 -247.344 1.00 0.00 ?  8  TYR I N    1  
ATOM 10021  C CA   . TYR I  1 8  ? 11.990  -23.460 -246.738 1.00 0.00 ?  8  TYR I CA   1  
ATOM 10022  C C    . TYR I  1 8  ? 11.566  -22.863 -245.402 1.00 0.00 ?  8  TYR I C    1  
ATOM 10023  O O    . TYR I  1 8  ? 12.274  -22.987 -244.403 1.00 0.00 ?  8  TYR I O    1  
ATOM 10024  C CB   . TYR I  1 8  ? 12.459  -22.351 -247.682 1.00 0.00 ?  8  TYR I CB   1  
ATOM 10025  C CG   . TYR I  1 8  ? 13.565  -21.489 -247.114 1.00 0.00 ?  8  TYR I CG   1  
ATOM 10026  C CD1  . TYR I  1 8  ? 14.897  -21.838 -247.280 1.00 0.00 ?  8  TYR I CD1  1  
ATOM 10027  C CD2  . TYR I  1 8  ? 13.272  -20.327 -246.416 1.00 0.00 ?  8  TYR I CD2  1  
ATOM 10028  C CE1  . TYR I  1 8  ? 15.911  -21.054 -246.763 1.00 0.00 ?  8  TYR I CE1  1  
ATOM 10029  C CE2  . TYR I  1 8  ? 14.277  -19.536 -245.895 1.00 0.00 ?  8  TYR I CE2  1  
ATOM 10030  C CZ   . TYR I  1 8  ? 15.596  -19.902 -246.071 1.00 0.00 ?  8  TYR I CZ   1  
ATOM 10031  O OH   . TYR I  1 8  ? 16.601  -19.117 -245.555 1.00 0.00 ?  8  TYR I OH   1  
ATOM 10032  H H    . TYR I  1 8  ? 10.508  -23.903 -248.217 1.00 0.00 ?  8  TYR I H    1  
ATOM 10033  H HA   . TYR I  1 8  ? 12.833  -24.120 -246.530 1.00 0.00 ?  8  TYR I HA   1  
ATOM 10034  H HB2  . TYR I  1 8  ? 12.808  -22.833 -248.597 1.00 0.00 ?  8  TYR I HB2  1  
ATOM 10035  H HB3  . TYR I  1 8  ? 11.592  -21.730 -247.906 1.00 0.00 ?  8  TYR I HB3  1  
ATOM 10036  H HD1  . TYR I  1 8  ? 15.138  -22.749 -247.828 1.00 0.00 ?  8  TYR I HD1  1  
ATOM 10037  H HD2  . TYR I  1 8  ? 12.228  -20.043 -246.280 1.00 0.00 ?  8  TYR I HD2  1  
ATOM 10038  H HE1  . TYR I  1 8  ? 16.953  -21.341 -246.901 1.00 0.00 ?  8  TYR I HE1  1  
ATOM 10039  H HE2  . TYR I  1 8  ? 14.026  -18.627 -245.347 1.00 0.00 ?  8  TYR I HE2  1  
ATOM 10040  H HH   . TYR I  1 8  ? 17.478  -19.464 -245.734 1.00 0.00 ?  8  TYR I HH   1  
ATOM 10041  N N    . LEU I  1 9  ? 10.406  -22.216 -245.391 1.00 0.00 ?  9  LEU I N    1  
ATOM 10042  C CA   . LEU I  1 9  ? 9.888   -21.592 -244.179 1.00 0.00 ?  9  LEU I CA   1  
ATOM 10043  C C    . LEU I  1 9  ? 9.570   -22.636 -243.115 1.00 0.00 ?  9  LEU I C    1  
ATOM 10044  O O    . LEU I  1 9  ? 9.735   -22.389 -241.921 1.00 0.00 ?  9  LEU I O    1  
ATOM 10045  C CB   . LEU I  1 9  ? 8.640   -20.761 -244.501 1.00 0.00 ?  9  LEU I CB   1  
ATOM 10046  C CG   . LEU I  1 9  ? 8.891   -19.510 -245.353 1.00 0.00 ?  9  LEU I CG   1  
ATOM 10047  C CD1  . LEU I  1 9  ? 7.567   -18.853 -245.718 1.00 0.00 ?  9  LEU I CD1  1  
ATOM 10048  C CD2  . LEU I  1 9  ? 9.780   -18.543 -244.586 1.00 0.00 ?  9  LEU I CD2  1  
ATOM 10049  H H    . LEU I  1 9  ? 9.868   -22.154 -246.244 1.00 0.00 ?  9  LEU I H    1  
ATOM 10050  H HA   . LEU I  1 9  ? 10.647  -20.938 -243.752 1.00 0.00 ?  9  LEU I HA   1  
ATOM 10051  H HB2  . LEU I  1 9  ? 8.080   -21.498 -245.076 1.00 0.00 ?  9  LEU I HB2  1  
ATOM 10052  H HB3  . LEU I  1 9  ? 8.083   -20.503 -243.601 1.00 0.00 ?  9  LEU I HB3  1  
ATOM 10053  H HG   . LEU I  1 9  ? 9.434   -19.828 -246.243 1.00 0.00 ?  9  LEU I HG   1  
ATOM 10054  H HD11 . LEU I  1 9  ? 7.755   -17.966 -246.323 1.00 0.00 ?  9  LEU I HD11 1  
ATOM 10055  H HD12 . LEU I  1 9  ? 6.957   -19.555 -246.286 1.00 0.00 ?  9  LEU I HD12 1  
ATOM 10056  H HD13 . LEU I  1 9  ? 7.040   -18.567 -244.809 1.00 0.00 ?  9  LEU I HD13 1  
ATOM 10057  H HD21 . LEU I  1 9  ? 10.732  -19.024 -244.359 1.00 0.00 ?  9  LEU I HD21 1  
ATOM 10058  H HD22 . LEU I  1 9  ? 9.958   -17.654 -245.192 1.00 0.00 ?  9  LEU I HD22 1  
ATOM 10059  H HD23 . LEU I  1 9  ? 9.288   -18.256 -243.656 1.00 0.00 ?  9  LEU I HD23 1  
ATOM 10060  N N    . ASP I  1 10 ? 9.112   -23.803 -243.557 1.00 0.00 ?  10 ASP I N    1  
ATOM 10061  C CA   . ASP I  1 10 ? 9.018   -24.968 -242.685 1.00 0.00 ?  10 ASP I CA   1  
ATOM 10062  C C    . ASP I  1 10 ? 10.368  -25.300 -242.062 1.00 0.00 ?  10 ASP I C    1  
ATOM 10063  O O    . ASP I  1 10 ? 10.462  -25.559 -240.863 1.00 0.00 ?  10 ASP I O    1  
ATOM 10064  C CB   . ASP I  1 10 ? 8.485   -26.175 -243.460 1.00 0.00 ?  10 ASP I CB   1  
ATOM 10065  C CG   . ASP I  1 10 ? 7.016   -26.075 -243.848 1.00 0.00 ?  10 ASP I CG   1  
ATOM 10066  O OD1  . ASP I  1 10 ? 6.331   -25.249 -243.294 1.00 0.00 ?  10 ASP I OD1  1  
ATOM 10067  O OD2  . ASP I  1 10 ? 6.629   -26.711 -244.799 1.00 0.00 -1 10 ASP I OD2  1  
ATOM 10068  H H    . ASP I  1 10 ? 8.823   -23.885 -244.521 1.00 0.00 ?  10 ASP I H    1  
ATOM 10069  H HA   . ASP I  1 10 ? 8.339   -24.757 -241.859 1.00 0.00 ?  10 ASP I HA   1  
ATOM 10070  H HB2  . ASP I  1 10 ? 9.077   -26.422 -244.341 1.00 0.00 ?  10 ASP I HB2  1  
ATOM 10071  H HB3  . ASP I  1 10 ? 8.609   -26.955 -242.708 1.00 0.00 ?  10 ASP I HB3  1  
ATOM 10072  N N    . ASP I  1 11 ? 11.412  -25.291 -242.884 1.00 0.00 ?  11 ASP I N    1  
ATOM 10073  C CA   . ASP I  1 11 ? 12.762  -25.575 -242.412 1.00 0.00 ?  11 ASP I CA   1  
ATOM 10074  C C    . ASP I  1 11 ? 13.238  -24.509 -241.434 1.00 0.00 ?  11 ASP I C    1  
ATOM 10075  O O    . ASP I  1 11 ? 13.932  -24.810 -240.462 1.00 0.00 ?  11 ASP I O    1  
ATOM 10076  C CB   . ASP I  1 11 ? 13.732  -25.677 -243.591 1.00 0.00 ?  11 ASP I CB   1  
ATOM 10077  C CG   . ASP I  1 11 ? 13.542  -26.915 -244.457 1.00 0.00 ?  11 ASP I CG   1  
ATOM 10078  O OD1  . ASP I  1 11 ? 12.830  -27.800 -244.045 1.00 0.00 ?  11 ASP I OD1  1  
ATOM 10079  O OD2  . ASP I  1 11 ? 13.978  -26.901 -245.583 1.00 0.00 -1 11 ASP I OD2  1  
ATOM 10080  H H    . ASP I  1 11 ? 11.266  -25.082 -243.862 1.00 0.00 ?  11 ASP I H    1  
ATOM 10081  H HA   . ASP I  1 11 ? 12.772  -26.520 -241.870 1.00 0.00 ?  11 ASP I HA   1  
ATOM 10082  H HB2  . ASP I  1 11 ? 13.742  -24.790 -244.225 1.00 0.00 ?  11 ASP I HB2  1  
ATOM 10083  H HB3  . ASP I  1 11 ? 14.678  -25.752 -243.055 1.00 0.00 ?  11 ASP I HB3  1  
ATOM 10084  N N    . VAL I  1 12 ? 12.862  -23.262 -241.695 1.00 0.00 ?  12 VAL I N    1  
ATOM 10085  C CA   . VAL I  1 12 ? 13.195  -22.158 -240.803 1.00 0.00 ?  12 VAL I CA   1  
ATOM 10086  C C    . VAL I  1 12 ? 12.582  -22.361 -239.423 1.00 0.00 ?  12 VAL I C    1  
ATOM 10087  O O    . VAL I  1 12 ? 13.244  -22.163 -238.404 1.00 0.00 ?  12 VAL I O    1  
ATOM 10088  C CB   . VAL I  1 12 ? 12.719  -20.808 -241.372 1.00 0.00 ?  12 VAL I CB   1  
ATOM 10089  C CG1  . VAL I  1 12 ? 12.848  -19.713 -240.323 1.00 0.00 ?  12 VAL I CG1  1  
ATOM 10090  C CG2  . VAL I  1 12 ? 13.512  -20.446 -242.619 1.00 0.00 ?  12 VAL I CG2  1  
ATOM 10091  H H    . VAL I  1 12 ? 12.332  -23.074 -242.534 1.00 0.00 ?  12 VAL I H    1  
ATOM 10092  H HA   . VAL I  1 12 ? 14.270  -22.101 -240.626 1.00 0.00 ?  12 VAL I HA   1  
ATOM 10093  H HB   . VAL I  1 12 ? 11.676  -20.899 -241.675 1.00 0.00 ?  12 VAL I HB   1  
ATOM 10094  H HG11 . VAL I  1 12 ? 12.507  -18.766 -240.742 1.00 0.00 ?  12 VAL I HG11 1  
ATOM 10095  H HG12 . VAL I  1 12 ? 12.239  -19.966 -239.456 1.00 0.00 ?  12 VAL I HG12 1  
ATOM 10096  H HG13 . VAL I  1 12 ? 13.891  -19.620 -240.021 1.00 0.00 ?  12 VAL I HG13 1  
ATOM 10097  H HG21 . VAL I  1 12 ? 13.372  -21.218 -243.376 1.00 0.00 ?  12 VAL I HG21 1  
ATOM 10098  H HG22 . VAL I  1 12 ? 13.162  -19.490 -243.008 1.00 0.00 ?  12 VAL I HG22 1  
ATOM 10099  H HG23 . VAL I  1 12 ? 14.570  -20.371 -242.367 1.00 0.00 ?  12 VAL I HG23 1  
ATOM 10100  N N    . SER I  1 13 ? 11.314  -22.756 -239.397 1.00 0.00 ?  13 SER I N    1  
ATOM 10101  C CA   . SER I  1 13 ? 10.637  -23.076 -238.146 1.00 0.00 ?  13 SER I CA   1  
ATOM 10102  C C    . SER I  1 13 ? 11.343  -24.208 -237.411 1.00 0.00 ?  13 SER I C    1  
ATOM 10103  O O    . SER I  1 13 ? 11.529  -24.151 -236.196 1.00 0.00 ?  13 SER I O    1  
ATOM 10104  C CB   . SER I  1 13 ? 9.190   -23.443 -238.415 1.00 0.00 ?  13 SER I CB   1  
ATOM 10105  O OG   . SER I  1 13 ? 8.517   -23.820 -237.246 1.00 0.00 ?  13 SER I OG   1  
ATOM 10106  H H    . SER I  1 13 ? 10.806  -22.837 -240.267 1.00 0.00 ?  13 SER I H    1  
ATOM 10107  H HA   . SER I  1 13 ? 10.522  -22.217 -237.484 1.00 0.00 ?  13 SER I HA   1  
ATOM 10108  H HB2  . SER I  1 13 ? 8.687   -22.581 -238.851 1.00 0.00 ?  13 SER I HB2  1  
ATOM 10109  H HB3  . SER I  1 13 ? 9.165   -24.272 -239.121 1.00 0.00 ?  13 SER I HB3  1  
ATOM 10110  H HG   . SER I  1 13 ? 7.761   -24.366 -237.474 1.00 0.00 ?  13 SER I HG   1  
ATOM 10111  N N    . ALA I  1 14 ? 11.736  -25.236 -238.156 1.00 0.00 ?  14 ALA I N    1  
ATOM 10112  C CA   . ALA I  1 14 ? 12.450  -26.370 -237.581 1.00 0.00 ?  14 ALA I CA   1  
ATOM 10113  C C    . ALA I  1 14 ? 13.814  -25.949 -237.050 1.00 0.00 ?  14 ALA I C    1  
ATOM 10114  O O    . ALA I  1 14 ? 14.251  -26.413 -235.996 1.00 0.00 ?  14 ALA I O    1  
ATOM 10115  C CB   . ALA I  1 14 ? 12.598  -27.480 -238.611 1.00 0.00 ?  14 ALA I CB   1  
ATOM 10116  H H    . ALA I  1 14 ? 11.534  -25.233 -239.145 1.00 0.00 ?  14 ALA I H    1  
ATOM 10117  H HA   . ALA I  1 14 ? 11.877  -26.753 -236.737 1.00 0.00 ?  14 ALA I HA   1  
ATOM 10118  H HB1  . ALA I  1 14 ? 13.156  -27.109 -239.469 1.00 0.00 ?  14 ALA I HB1  1  
ATOM 10119  H HB2  . ALA I  1 14 ? 13.133  -28.319 -238.166 1.00 0.00 ?  14 ALA I HB2  1  
ATOM 10120  H HB3  . ALA I  1 14 ? 11.611  -27.811 -238.934 1.00 0.00 ?  14 ALA I HB3  1  
ATOM 10121  N N    . LYS I  1 15 ? 14.484  -25.068 -237.785 1.00 0.00 ?  15 LYS I N    1  
ATOM 10122  C CA   . LYS I  1 15 ? 15.815  -24.608 -237.407 1.00 0.00 ?  15 LYS I CA   1  
ATOM 10123  C C    . LYS I  1 15 ? 15.785  -23.876 -236.071 1.00 0.00 ?  15 LYS I C    1  
ATOM 10124  O O    . LYS I  1 15 ? 16.664  -24.064 -235.230 1.00 0.00 ?  15 LYS I O    1  
ATOM 10125  C CB   . LYS I  1 15 ? 16.396  -23.699 -238.491 1.00 0.00 ?  15 LYS I CB   1  
ATOM 10126  C CG   . LYS I  1 15 ? 16.923  -24.438 -239.714 1.00 0.00 ?  15 LYS I CG   1  
ATOM 10127  C CD   . LYS I  1 15 ? 17.325  -23.468 -240.816 1.00 0.00 ?  15 LYS I CD   1  
ATOM 10128  C CE   . LYS I  1 15 ? 17.740  -24.206 -242.080 1.00 0.00 ?  15 LYS I CE   1  
ATOM 10129  N NZ   . LYS I  1 15 ? 19.010  -24.958 -241.893 1.00 0.00 1  15 LYS I NZ   1  
ATOM 10130  H H    . LYS I  1 15 ? 14.060  -24.708 -238.628 1.00 0.00 ?  15 LYS I H    1  
ATOM 10131  H HA   . LYS I  1 15 ? 16.478  -25.463 -237.277 1.00 0.00 ?  15 LYS I HA   1  
ATOM 10132  H HB2  . LYS I  1 15 ? 15.602  -23.016 -238.794 1.00 0.00 ?  15 LYS I HB2  1  
ATOM 10133  H HB3  . LYS I  1 15 ? 17.207  -23.133 -238.033 1.00 0.00 ?  15 LYS I HB3  1  
ATOM 10134  H HG2  . LYS I  1 15 ? 17.790  -25.028 -239.415 1.00 0.00 ?  15 LYS I HG2  1  
ATOM 10135  H HG3  . LYS I  1 15 ? 16.141  -25.102 -240.082 1.00 0.00 ?  15 LYS I HG3  1  
ATOM 10136  H HD2  . LYS I  1 15 ? 16.475  -22.820 -241.035 1.00 0.00 ?  15 LYS I HD2  1  
ATOM 10137  H HD3  . LYS I  1 15 ? 18.158  -22.863 -240.459 1.00 0.00 ?  15 LYS I HD3  1  
ATOM 10138  H HE2  . LYS I  1 15 ? 16.944  -24.899 -242.348 1.00 0.00 ?  15 LYS I HE2  1  
ATOM 10139  H HE3  . LYS I  1 15 ? 17.866  -23.473 -242.877 1.00 0.00 ?  15 LYS I HE3  1  
ATOM 10140  H HZ1  . LYS I  1 15 ? 18.894  -25.638 -241.155 1.00 0.00 ?  15 LYS I HZ1  1  
ATOM 10141  H HZ2  . LYS I  1 15 ? 19.250  -25.432 -242.753 1.00 0.00 ?  15 LYS I HZ2  1  
ATOM 10142  H HZ3  . LYS I  1 15 ? 19.750  -24.315 -241.645 1.00 0.00 ?  15 LYS I HZ3  1  
ATOM 10143  N N    . PHE I  1 16 ? 14.769  -23.041 -235.882 1.00 0.00 ?  16 PHE I N    1  
ATOM 10144  C CA   . PHE I  1 16 ? 14.563  -22.360 -234.609 1.00 0.00 ?  16 PHE I CA   1  
ATOM 10145  C C    . PHE I  1 16 ? 14.239  -23.351 -233.499 1.00 0.00 ?  16 PHE I C    1  
ATOM 10146  O O    . PHE I  1 16 ? 14.847  -23.321 -232.429 1.00 0.00 ?  16 PHE I O    1  
ATOM 10147  C CB   . PHE I  1 16 ? 13.445  -21.324 -234.732 1.00 0.00 ?  16 PHE I CB   1  
ATOM 10148  C CG   . PHE I  1 16 ? 13.174  -20.570 -233.461 1.00 0.00 ?  16 PHE I CG   1  
ATOM 10149  C CD1  . PHE I  1 16 ? 13.892  -19.424 -233.151 1.00 0.00 ?  16 PHE I CD1  1  
ATOM 10150  C CD2  . PHE I  1 16 ? 12.203  -21.006 -232.573 1.00 0.00 ?  16 PHE I CD2  1  
ATOM 10151  C CE1  . PHE I  1 16 ? 13.644  -18.731 -231.982 1.00 0.00 ?  16 PHE I CE1  1  
ATOM 10152  C CE2  . PHE I  1 16 ? 11.952  -20.314 -231.404 1.00 0.00 ?  16 PHE I CE2  1  
ATOM 10153  C CZ   . PHE I  1 16 ? 12.674  -19.175 -231.108 1.00 0.00 ?  16 PHE I CZ   1  
ATOM 10154  H H    . PHE I  1 16 ? 14.122  -22.874 -236.639 1.00 0.00 ?  16 PHE I H    1  
ATOM 10155  H HA   . PHE I  1 16 ? 15.480  -21.849 -234.311 1.00 0.00 ?  16 PHE I HA   1  
ATOM 10156  H HB2  . PHE I  1 16 ? 13.703  -20.581 -235.486 1.00 0.00 ?  16 PHE I HB2  1  
ATOM 10157  H HB3  . PHE I  1 16 ? 12.511  -21.812 -235.009 1.00 0.00 ?  16 PHE I HB3  1  
ATOM 10158  H HD1  . PHE I  1 16 ? 14.658  -19.072 -233.842 1.00 0.00 ?  16 PHE I HD1  1  
ATOM 10159  H HD2  . PHE I  1 16 ? 11.633  -21.906 -232.806 1.00 0.00 ?  16 PHE I HD2  1  
ATOM 10160  H HE1  . PHE I  1 16 ? 14.215  -17.832 -231.750 1.00 0.00 ?  16 PHE I HE1  1  
ATOM 10161  H HE2  . PHE I  1 16 ? 11.185  -20.666 -230.714 1.00 0.00 ?  16 PHE I HE2  1  
ATOM 10162  H HZ   . PHE I  1 16 ? 12.478  -18.629 -230.186 1.00 0.00 ?  16 PHE I HZ   1  
ATOM 10163  N N    . ASP I  1 17 ? 13.278  -24.231 -233.761 1.00 0.00 ?  17 ASP I N    1  
ATOM 10164  C CA   . ASP I  1 17 ? 12.811  -25.177 -232.755 1.00 0.00 ?  17 ASP I CA   1  
ATOM 10165  C C    . ASP I  1 17 ? 13.922  -26.133 -232.340 1.00 0.00 ?  17 ASP I C    1  
ATOM 10166  O O    . ASP I  1 17 ? 13.952  -26.610 -231.206 1.00 0.00 ?  17 ASP I O    1  
ATOM 10167  C CB   . ASP I  1 17 ? 11.607  -25.964 -233.277 1.00 0.00 ?  17 ASP I CB   1  
ATOM 10168  C CG   . ASP I  1 17 ? 10.306  -25.174 -233.313 1.00 0.00 ?  17 ASP I CG   1  
ATOM 10169  O OD1  . ASP I  1 17 ? 10.256  -24.122 -232.720 1.00 0.00 ?  17 ASP I OD1  1  
ATOM 10170  O OD2  . ASP I  1 17 ? 9.429   -25.545 -234.056 1.00 0.00 -1 17 ASP I OD2  1  
ATOM 10171  H H    . ASP I  1 17 ? 12.860  -24.244 -234.680 1.00 0.00 ?  17 ASP I H    1  
ATOM 10172  H HA   . ASP I  1 17 ? 12.512  -24.640 -231.854 1.00 0.00 ?  17 ASP I HA   1  
ATOM 10173  H HB2  . ASP I  1 17 ? 11.778  -26.426 -234.249 1.00 0.00 ?  17 ASP I HB2  1  
ATOM 10174  H HB3  . ASP I  1 17 ? 11.539  -26.739 -232.513 1.00 0.00 ?  17 ASP I HB3  1  
ATOM 10175  N N    . THR I  1 18 ? 14.833  -26.410 -233.266 1.00 0.00 ?  18 THR I N    1  
ATOM 10176  C CA   . THR I  1 18 ? 15.947  -27.313 -232.999 1.00 0.00 ?  18 THR I CA   1  
ATOM 10177  C C    . THR I  1 18 ? 16.662  -26.938 -231.707 1.00 0.00 ?  18 THR I C    1  
ATOM 10178  O O    . THR I  1 18 ? 17.004  -27.804 -230.902 1.00 0.00 ?  18 THR I O    1  
ATOM 10179  C CB   . THR I  1 18 ? 16.964  -27.312 -234.155 1.00 0.00 ?  18 THR I CB   1  
ATOM 10180  O OG1  . THR I  1 18 ? 16.339  -27.809 -235.346 1.00 0.00 ?  18 THR I OG1  1  
ATOM 10181  C CG2  . THR I  1 18 ? 18.161  -28.186 -233.813 1.00 0.00 ?  18 THR I CG2  1  
ATOM 10182  H H    . THR I  1 18 ? 14.752  -25.985 -234.179 1.00 0.00 ?  18 THR I H    1  
ATOM 10183  H HA   . THR I  1 18 ? 15.574  -28.328 -232.862 1.00 0.00 ?  18 THR I HA   1  
ATOM 10184  H HB   . THR I  1 18 ? 17.300  -26.291 -234.332 1.00 0.00 ?  18 THR I HB   1  
ATOM 10185  H HG1  . THR I  1 18 ? 16.975  -27.807 -236.065 1.00 0.00 ?  18 THR I HG1  1  
ATOM 10186  H HG21 . THR I  1 18 ? 18.869  -28.173 -234.642 1.00 0.00 ?  18 THR I HG21 1  
ATOM 10187  H HG22 . THR I  1 18 ? 18.645  -27.804 -232.915 1.00 0.00 ?  18 THR I HG22 1  
ATOM 10188  H HG23 . THR I  1 18 ? 17.826  -29.208 -233.638 1.00 0.00 ?  18 THR I HG23 1  
ATOM 10189  N N    . GLY I  1 19 ? 16.885  -25.642 -231.515 1.00 0.00 ?  19 GLY I N    1  
ATOM 10190  C CA   . GLY I  1 19 ? 17.695  -25.162 -230.402 1.00 0.00 ?  19 GLY I CA   1  
ATOM 10191  C C    . GLY I  1 19 ? 16.865  -25.037 -229.130 1.00 0.00 ?  19 GLY I C    1  
ATOM 10192  O O    . GLY I  1 19 ? 17.408  -24.892 -228.035 1.00 0.00 ?  19 GLY I O    1  
ATOM 10193  H H    . GLY I  1 19 ? 16.483  -24.973 -232.156 1.00 0.00 ?  19 GLY I H    1  
ATOM 10194  H HA2  . GLY I  1 19 ? 18.511  -25.863 -230.226 1.00 0.00 ?  19 GLY I HA2  1  
ATOM 10195  H HA3  . GLY I  1 19 ? 18.105  -24.185 -230.656 1.00 0.00 ?  19 GLY I HA3  1  
ATOM 10196  N N    . VAL I  1 20 ? 15.546  -25.094 -229.283 1.00 0.00 ?  20 VAL I N    1  
ATOM 10197  C CA   . VAL I  1 20 ? 14.638  -24.953 -228.151 1.00 0.00 ?  20 VAL I CA   1  
ATOM 10198  C C    . VAL I  1 20 ? 13.592  -26.061 -228.144 1.00 0.00 ?  20 VAL I C    1  
ATOM 10199  O O    . VAL I  1 20 ? 12.495  -25.888 -227.611 1.00 0.00 ?  20 VAL I O    1  
ATOM 10200  C CB   . VAL I  1 20 ? 13.925  -23.588 -228.164 1.00 0.00 ?  20 VAL I CB   1  
ATOM 10201  C CG1  . VAL I  1 20 ? 14.907  -22.472 -227.839 1.00 0.00 ?  20 VAL I CG1  1  
ATOM 10202  C CG2  . VAL I  1 20 ? 13.269  -23.342 -229.514 1.00 0.00 ?  20 VAL I CG2  1  
ATOM 10203  H H    . VAL I  1 20 ? 15.163  -25.238 -230.206 1.00 0.00 ?  20 VAL I H    1  
ATOM 10204  H HA   . VAL I  1 20 ? 15.166  -25.061 -227.203 1.00 0.00 ?  20 VAL I HA   1  
ATOM 10205  H HB   . VAL I  1 20 ? 13.128  -23.597 -227.421 1.00 0.00 ?  20 VAL I HB   1  
ATOM 10206  H HG11 . VAL I  1 20 ? 14.387  -21.514 -227.853 1.00 0.00 ?  20 VAL I HG11 1  
ATOM 10207  H HG12 . VAL I  1 20 ? 15.334  -22.639 -226.850 1.00 0.00 ?  20 VAL I HG12 1  
ATOM 10208  H HG13 . VAL I  1 20 ? 15.704  -22.461 -228.582 1.00 0.00 ?  20 VAL I HG13 1  
ATOM 10209  H HG21 . VAL I  1 20 ? 12.537  -24.125 -229.711 1.00 0.00 ?  20 VAL I HG21 1  
ATOM 10210  H HG22 . VAL I  1 20 ? 12.770  -22.373 -229.506 1.00 0.00 ?  20 VAL I HG22 1  
ATOM 10211  H HG23 . VAL I  1 20 ? 14.030  -23.352 -230.295 1.00 0.00 ?  20 VAL I HG23 1  
ATOM 10212  N N    . ASP I  1 21 ? 13.937  -27.198 -228.738 1.00 0.00 ?  21 ASP I N    1  
ATOM 10213  C CA   . ASP I  1 21 ? 13.061  -28.363 -228.730 1.00 0.00 ?  21 ASP I CA   1  
ATOM 10214  C C    . ASP I  1 21 ? 12.748  -28.807 -227.307 1.00 0.00 ?  21 ASP I C    1  
ATOM 10215  O O    . ASP I  1 21 ? 11.636  -29.248 -227.014 1.00 0.00 ?  21 ASP I O    1  
ATOM 10216  C CB   . ASP I  1 21 ? 13.694  -29.516 -229.513 1.00 0.00 ?  21 ASP I CB   1  
ATOM 10217  C CG   . ASP I  1 21 ? 12.780  -30.718 -229.712 1.00 0.00 ?  21 ASP I CG   1  
ATOM 10218  O OD1  . ASP I  1 21 ? 11.755  -30.563 -230.332 1.00 0.00 ?  21 ASP I OD1  1  
ATOM 10219  O OD2  . ASP I  1 21 ? 13.185  -31.807 -229.383 1.00 0.00 -1 21 ASP I OD2  1  
ATOM 10220  H H    . ASP I  1 21 ? 14.829  -27.256 -229.208 1.00 0.00 ?  21 ASP I H    1  
ATOM 10221  H HA   . ASP I  1 21 ? 12.106  -28.111 -229.193 1.00 0.00 ?  21 ASP I HA   1  
ATOM 10222  H HB2  . ASP I  1 21 ? 14.108  -29.212 -230.475 1.00 0.00 ?  21 ASP I HB2  1  
ATOM 10223  H HB3  . ASP I  1 21 ? 14.505  -29.785 -228.836 1.00 0.00 ?  21 ASP I HB3  1  
ATOM 10224  N N    . ASN I  1 22 ? 13.735  -28.689 -226.425 1.00 0.00 ?  22 ASN I N    1  
ATOM 10225  C CA   . ASN I  1 22 ? 13.578  -29.111 -225.038 1.00 0.00 ?  22 ASN I CA   1  
ATOM 10226  C C    . ASN I  1 22 ? 12.820  -28.068 -224.228 1.00 0.00 ?  22 ASN I C    1  
ATOM 10227  O O    . ASN I  1 22 ? 12.154  -28.395 -223.245 1.00 0.00 ?  22 ASN I O    1  
ATOM 10228  C CB   . ASN I  1 22 ? 14.920  -29.404 -224.392 1.00 0.00 ?  22 ASN I CB   1  
ATOM 10229  C CG   . ASN I  1 22 ? 15.581  -30.651 -224.910 1.00 0.00 ?  22 ASN I CG   1  
ATOM 10230  O OD1  . ASN I  1 22 ? 14.924  -31.549 -225.448 1.00 0.00 ?  22 ASN I OD1  1  
ATOM 10231  N ND2  . ASN I  1 22 ? 16.865  -30.747 -224.676 1.00 0.00 ?  22 ASN I ND2  1  
ATOM 10232  H H    . ASN I  1 22 ? 14.617  -28.297 -226.723 1.00 0.00 ?  22 ASN I H    1  
ATOM 10233  H HA   . ASN I  1 22 ? 12.986  -30.026 -224.995 1.00 0.00 ?  22 ASN I HA   1  
ATOM 10234  H HB2  . ASN I  1 22 ? 15.670  -28.619 -224.283 1.00 0.00 ?  22 ASN I HB2  1  
ATOM 10235  H HB3  . ASN I  1 22 ? 14.476  -29.619 -223.420 1.00 0.00 ?  22 ASN I HB3  1  
ATOM 10236  H HD21 . ASN I  1 22 ? 17.340  -30.019 -224.183 1.00 0.00 ?  22 ASN I HD21 1  
ATOM 10237  H HD22 . ASN I  1 22 ? 17.372  -31.550 -224.992 1.00 0.00 ?  22 ASN I HD22 1  
ATOM 10238  N N    . LEU I  1 23 ? 12.924  -26.811 -224.645 1.00 0.00 ?  23 LEU I N    1  
ATOM 10239  C CA   . LEU I  1 23 ? 12.282  -25.711 -223.935 1.00 0.00 ?  23 LEU I CA   1  
ATOM 10240  C C    . LEU I  1 23 ? 10.802  -25.994 -223.706 1.00 0.00 ?  23 LEU I C    1  
ATOM 10241  O O    . LEU I  1 23 ? 10.300  -25.855 -222.590 1.00 0.00 ?  23 LEU I O    1  
ATOM 10242  C CB   . LEU I  1 23 ? 12.460  -24.401 -224.712 1.00 0.00 ?  23 LEU I CB   1  
ATOM 10243  C CG   . LEU I  1 23 ? 11.593  -23.232 -224.229 1.00 0.00 ?  23 LEU I CG   1  
ATOM 10244  C CD1  . LEU I  1 23 ? 11.862  -22.956 -222.756 1.00 0.00 ?  23 LEU I CD1  1  
ATOM 10245  C CD2  . LEU I  1 23 ? 11.886  -21.999 -225.071 1.00 0.00 ?  23 LEU I CD2  1  
ATOM 10246  H H    . LEU I  1 23 ? 13.463  -26.611 -225.476 1.00 0.00 ?  23 LEU I H    1  
ATOM 10247  H HA   . LEU I  1 23 ? 12.732  -25.601 -222.949 1.00 0.00 ?  23 LEU I HA   1  
ATOM 10248  H HB2  . LEU I  1 23 ? 13.508  -24.206 -224.491 1.00 0.00 ?  23 LEU I HB2  1  
ATOM 10249  H HB3  . LEU I  1 23 ? 12.337  -24.549 -225.785 1.00 0.00 ?  23 LEU I HB3  1  
ATOM 10250  H HG   . LEU I  1 23 ? 10.552  -23.510 -224.397 1.00 0.00 ?  23 LEU I HG   1  
ATOM 10251  H HD11 . LEU I  1 23 ? 11.241  -22.124 -222.422 1.00 0.00 ?  23 LEU I HD11 1  
ATOM 10252  H HD12 . LEU I  1 23 ? 11.623  -23.844 -222.170 1.00 0.00 ?  23 LEU I HD12 1  
ATOM 10253  H HD13 . LEU I  1 23 ? 12.912  -22.702 -222.620 1.00 0.00 ?  23 LEU I HD13 1  
ATOM 10254  H HD21 . LEU I  1 23 ? 11.660  -22.210 -226.117 1.00 0.00 ?  23 LEU I HD21 1  
ATOM 10255  H HD22 . LEU I  1 23 ? 11.268  -21.169 -224.727 1.00 0.00 ?  23 LEU I HD22 1  
ATOM 10256  H HD23 . LEU I  1 23 ? 12.939  -21.734 -224.974 1.00 0.00 ?  23 LEU I HD23 1  
ATOM 10257  N N    . GLN I  1 24 ? 10.109  -26.391 -224.767 1.00 0.00 ?  24 GLN I N    1  
ATOM 10258  C CA   . GLN I  1 24 ? 8.685   -26.693 -224.684 1.00 0.00 ?  24 GLN I CA   1  
ATOM 10259  C C    . GLN I  1 24 ? 8.411   -27.777 -223.650 1.00 0.00 ?  24 GLN I C    1  
ATOM 10260  O O    . GLN I  1 24 ? 7.493   -27.657 -222.839 1.00 0.00 ?  24 GLN I O    1  
ATOM 10261  C CB   . GLN I  1 24 ? 8.150   -27.133 -226.049 1.00 0.00 ?  24 GLN I CB   1  
ATOM 10262  C CG   . GLN I  1 24 ? 6.658   -27.417 -226.070 1.00 0.00 ?  24 GLN I CG   1  
ATOM 10263  C CD   . GLN I  1 24 ? 6.169   -27.843 -227.442 1.00 0.00 ?  24 GLN I CD   1  
ATOM 10264  O OE1  . GLN I  1 24 ? 6.960   -28.007 -228.375 1.00 0.00 ?  24 GLN I OE1  1  
ATOM 10265  N NE2  . GLN I  1 24 ? 4.860   -28.020 -227.574 1.00 0.00 ?  24 GLN I NE2  1  
ATOM 10266  H H    . GLN I  1 24 ? 10.581  -26.487 -225.655 1.00 0.00 ?  24 GLN I H    1  
ATOM 10267  H HA   . GLN I  1 24 ? 8.143   -25.806 -224.355 1.00 0.00 ?  24 GLN I HA   1  
ATOM 10268  H HB2  . GLN I  1 24 ? 8.384   -26.333 -226.752 1.00 0.00 ?  24 GLN I HB2  1  
ATOM 10269  H HB3  . GLN I  1 24 ? 8.699   -28.032 -226.327 1.00 0.00 ?  24 GLN I HB3  1  
ATOM 10270  H HG2  . GLN I  1 24 ? 6.167   -28.047 -225.330 1.00 0.00 ?  24 GLN I HG2  1  
ATOM 10271  H HG3  . GLN I  1 24 ? 6.370   -26.378 -225.909 1.00 0.00 ?  24 GLN I HG3  1  
ATOM 10272  H HE21 . GLN I  1 24 ? 4.253   -27.874 -226.792 1.00 0.00 ?  24 GLN I HE21 1  
ATOM 10273  H HE22 . GLN I  1 24 ? 4.478   -28.301 -228.456 1.00 0.00 ?  24 GLN I HE22 1  
ATOM 10274  N N    . THR I  1 25 ? 9.213   -28.836 -223.684 1.00 0.00 ?  25 THR I N    1  
ATOM 10275  C CA   . THR I  1 25 ? 9.041   -29.957 -222.768 1.00 0.00 ?  25 THR I CA   1  
ATOM 10276  C C    . THR I  1 25 ? 9.299   -29.537 -221.327 1.00 0.00 ?  25 THR I C    1  
ATOM 10277  O O    . THR I  1 25 ? 8.584   -29.946 -220.413 1.00 0.00 ?  25 THR I O    1  
ATOM 10278  C CB   . THR I  1 25 ? 9.975   -31.128 -223.126 1.00 0.00 ?  25 THR I CB   1  
ATOM 10279  O OG1  . THR I  1 25 ? 9.656   -31.614 -224.437 1.00 0.00 ?  25 THR I OG1  1  
ATOM 10280  C CG2  . THR I  1 25 ? 9.823   -32.258 -222.120 1.00 0.00 ?  25 THR I CG2  1  
ATOM 10281  H H    . THR I  1 25 ? 9.962   -28.865 -224.362 1.00 0.00 ?  25 THR I H    1  
ATOM 10282  H HA   . THR I  1 25 ? 8.009   -30.309 -222.806 1.00 0.00 ?  25 THR I HA   1  
ATOM 10283  H HB   . THR I  1 25 ? 11.005  -30.774 -223.120 1.00 0.00 ?  25 THR I HB   1  
ATOM 10284  H HG1  . THR I  1 25 ? 9.776   -30.908 -225.077 1.00 0.00 ?  25 THR I HG1  1  
ATOM 10285  H HG21 . THR I  1 25 ? 10.491  -33.076 -222.389 1.00 0.00 ?  25 THR I HG21 1  
ATOM 10286  H HG22 . THR I  1 25 ? 10.075  -31.895 -221.124 1.00 0.00 ?  25 THR I HG22 1  
ATOM 10287  H HG23 . THR I  1 25 ? 8.793   -32.614 -222.126 1.00 0.00 ?  25 THR I HG23 1  
ATOM 10288  N N    . GLN I  1 26 ? 10.326  -28.717 -221.131 1.00 0.00 ?  26 GLN I N    1  
ATOM 10289  C CA   . GLN I  1 26 ? 10.719  -28.287 -219.794 1.00 0.00 ?  26 GLN I CA   1  
ATOM 10290  C C    . GLN I  1 26 ? 9.627   -27.447 -219.143 1.00 0.00 ?  26 GLN I C    1  
ATOM 10291  O O    . GLN I  1 26 ? 9.278   -27.658 -217.982 1.00 0.00 ?  26 GLN I O    1  
ATOM 10292  C CB   . GLN I  1 26 ? 12.023  -27.487 -219.849 1.00 0.00 ?  26 GLN I CB   1  
ATOM 10293  C CG   . GLN I  1 26 ? 13.257  -28.327 -220.132 1.00 0.00 ?  26 GLN I CG   1  
ATOM 10294  C CD   . GLN I  1 26 ? 14.516  -27.488 -220.238 1.00 0.00 ?  26 GLN I CD   1  
ATOM 10295  O OE1  . GLN I  1 26 ? 14.477  -26.263 -220.092 1.00 0.00 ?  26 GLN I OE1  1  
ATOM 10296  N NE2  . GLN I  1 26 ? 15.642  -28.142 -220.497 1.00 0.00 ?  26 GLN I NE2  1  
ATOM 10297  H H    . GLN I  1 26 ? 10.849  -28.383 -221.928 1.00 0.00 ?  26 GLN I H    1  
ATOM 10298  H HA   . GLN I  1 26 ? 10.859  -29.160 -219.157 1.00 0.00 ?  26 GLN I HA   1  
ATOM 10299  H HB2  . GLN I  1 26 ? 11.899  -26.737 -220.631 1.00 0.00 ?  26 GLN I HB2  1  
ATOM 10300  H HB3  . GLN I  1 26 ? 12.128  -26.990 -218.885 1.00 0.00 ?  26 GLN I HB3  1  
ATOM 10301  H HG2  . GLN I  1 26 ? 13.500  -29.226 -219.566 1.00 0.00 ?  26 GLN I HG2  1  
ATOM 10302  H HG3  . GLN I  1 26 ? 12.943  -28.606 -221.138 1.00 0.00 ?  26 GLN I HG3  1  
ATOM 10303  H HE21 . GLN I  1 26 ? 15.629  -29.136 -220.609 1.00 0.00 ?  26 GLN I HE21 1  
ATOM 10304  H HE22 . GLN I  1 26 ? 16.505  -27.642 -220.579 1.00 0.00 ?  26 GLN I HE22 1  
ATOM 10305  N N    . VAL I  1 27 ? 9.092   -26.493 -219.898 1.00 0.00 ?  27 VAL I N    1  
ATOM 10306  C CA   . VAL I  1 27 ? 8.092   -25.571 -219.374 1.00 0.00 ?  27 VAL I CA   1  
ATOM 10307  C C    . VAL I  1 27 ? 6.738   -26.253 -219.226 1.00 0.00 ?  27 VAL I C    1  
ATOM 10308  O O    . VAL I  1 27 ? 5.926   -25.866 -218.385 1.00 0.00 ?  27 VAL I O    1  
ATOM 10309  C CB   . VAL I  1 27 ? 7.937   -24.333 -220.276 1.00 0.00 ?  27 VAL I CB   1  
ATOM 10310  C CG1  . VAL I  1 27 ? 7.116   -24.673 -221.511 1.00 0.00 ?  27 VAL I CG1  1  
ATOM 10311  C CG2  . VAL I  1 27 ? 7.291   -23.190 -219.507 1.00 0.00 ?  27 VAL I CG2  1  
ATOM 10312  H H    . VAL I  1 27 ? 9.386   -26.405 -220.861 1.00 0.00 ?  27 VAL I H    1  
ATOM 10313  H HA   . VAL I  1 27 ? 8.349   -25.238 -218.367 1.00 0.00 ?  27 VAL I HA   1  
ATOM 10314  H HB   . VAL I  1 27 ? 8.926   -23.990 -220.580 1.00 0.00 ?  27 VAL I HB   1  
ATOM 10315  H HG11 . VAL I  1 27 ? 7.016   -23.786 -222.137 1.00 0.00 ?  27 VAL I HG11 1  
ATOM 10316  H HG12 . VAL I  1 27 ? 7.616   -25.460 -222.074 1.00 0.00 ?  27 VAL I HG12 1  
ATOM 10317  H HG13 . VAL I  1 27 ? 6.126   -25.014 -221.207 1.00 0.00 ?  27 VAL I HG13 1  
ATOM 10318  H HG21 . VAL I  1 27 ? 7.914   -22.929 -218.651 1.00 0.00 ?  27 VAL I HG21 1  
ATOM 10319  H HG22 . VAL I  1 27 ? 7.189   -22.323 -220.159 1.00 0.00 ?  27 VAL I HG22 1  
ATOM 10320  H HG23 . VAL I  1 27 ? 6.306   -23.500 -219.157 1.00 0.00 ?  27 VAL I HG23 1  
ATOM 10321  N N    . THR I  1 28 ? 6.500   -27.269 -220.048 1.00 0.00 ?  28 THR I N    1  
ATOM 10322  C CA   . THR I  1 28 ? 5.295   -28.082 -219.932 1.00 0.00 ?  28 THR I CA   1  
ATOM 10323  C C    . THR I  1 28 ? 5.319   -28.925 -218.664 1.00 0.00 ?  28 THR I C    1  
ATOM 10324  O O    . THR I  1 28 ? 4.325   -29.008 -217.943 1.00 0.00 ?  28 THR I O    1  
ATOM 10325  C CB   . THR I  1 28 ? 5.120   -29.008 -221.150 1.00 0.00 ?  28 THR I CB   1  
ATOM 10326  O OG1  . THR I  1 28 ? 4.937   -28.219 -222.332 1.00 0.00 ?  28 THR I OG1  1  
ATOM 10327  C CG2  . THR I  1 28 ? 3.914   -29.916 -220.960 1.00 0.00 ?  28 THR I CG2  1  
ATOM 10328  H H    . THR I  1 28 ? 7.171   -27.484 -220.771 1.00 0.00 ?  28 THR I H    1  
ATOM 10329  H HA   . THR I  1 28 ? 4.420   -27.436 -219.856 1.00 0.00 ?  28 THR I HA   1  
ATOM 10330  H HB   . THR I  1 28 ? 6.017   -29.617 -221.264 1.00 0.00 ?  28 THR I HB   1  
ATOM 10331  H HG1  . THR I  1 28 ? 5.596   -27.521 -222.355 1.00 0.00 ?  28 THR I HG1  1  
ATOM 10332  H HG21 . THR I  1 28 ? 3.806   -30.563 -221.830 1.00 0.00 ?  28 THR I HG21 1  
ATOM 10333  H HG22 . THR I  1 28 ? 4.055   -30.526 -220.068 1.00 0.00 ?  28 THR I HG22 1  
ATOM 10334  H HG23 . THR I  1 28 ? 3.017   -29.309 -220.846 1.00 0.00 ?  28 THR I HG23 1  
ATOM 10335  N N    . GLU I  1 29 ? 6.460   -29.551 -218.397 1.00 0.00 ?  29 GLU I N    1  
ATOM 10336  C CA   . GLU I  1 29 ? 6.637   -30.337 -217.182 1.00 0.00 ?  29 GLU I CA   1  
ATOM 10337  C C    . GLU I  1 29 ? 6.636   -29.448 -215.946 1.00 0.00 ?  29 GLU I C    1  
ATOM 10338  O O    . GLU I  1 29 ? 6.146   -29.841 -214.887 1.00 0.00 ?  29 GLU I O    1  
ATOM 10339  C CB   . GLU I  1 29 ? 7.936   -31.143 -217.250 1.00 0.00 ?  29 GLU I CB   1  
ATOM 10340  C CG   . GLU I  1 29 ? 7.903   -32.310 -218.227 1.00 0.00 ?  29 GLU I CG   1  
ATOM 10341  C CD   . GLU I  1 29 ? 9.245   -32.979 -218.324 1.00 0.00 ?  29 GLU I CD   1  
ATOM 10342  O OE1  . GLU I  1 29 ? 10.172  -32.501 -217.715 1.00 0.00 ?  29 GLU I OE1  1  
ATOM 10343  O OE2  . GLU I  1 29 ? 9.321   -34.031 -218.915 1.00 0.00 -1 29 GLU I OE2  1  
ATOM 10344  H H    . GLU I  1 29 ? 7.225   -29.480 -219.053 1.00 0.00 ?  29 GLU I H    1  
ATOM 10345  H HA   . GLU I  1 29 ? 5.803   -31.030 -217.066 1.00 0.00 ?  29 GLU I HA   1  
ATOM 10346  H HB2  . GLU I  1 29 ? 8.726   -30.449 -217.540 1.00 0.00 ?  29 GLU I HB2  1  
ATOM 10347  H HB3  . GLU I  1 29 ? 8.132   -31.517 -216.245 1.00 0.00 ?  29 GLU I HB3  1  
ATOM 10348  H HG2  . GLU I  1 29 ? 7.143   -33.053 -217.988 1.00 0.00 ?  29 GLU I HG2  1  
ATOM 10349  H HG3  . GLU I  1 29 ? 7.662   -31.839 -219.179 1.00 0.00 ?  29 GLU I HG3  1  
ATOM 10350  N N    . ALA I  1 30 ? 7.188   -28.247 -216.086 1.00 0.00 ?  30 ALA I N    1  
ATOM 10351  C CA   . ALA I  1 30 ? 7.156   -27.259 -215.014 1.00 0.00 ?  30 ALA I CA   1  
ATOM 10352  C C    . ALA I  1 30 ? 5.728   -26.835 -214.699 1.00 0.00 ?  30 ALA I C    1  
ATOM 10353  O O    . ALA I  1 30 ? 5.374   -26.627 -213.538 1.00 0.00 ?  30 ALA I O    1  
ATOM 10354  C CB   . ALA I  1 30 ? 8.003   -26.050 -215.383 1.00 0.00 ?  30 ALA I CB   1  
ATOM 10355  H H    . ALA I  1 30 ? 7.641   -28.013 -216.958 1.00 0.00 ?  30 ALA I H    1  
ATOM 10356  H HA   . ALA I  1 30 ? 7.568   -27.710 -214.111 1.00 0.00 ?  30 ALA I HA   1  
ATOM 10357  H HB1  . ALA I  1 30 ? 7.613   -25.597 -216.293 1.00 0.00 ?  30 ALA I HB1  1  
ATOM 10358  H HB2  . ALA I  1 30 ? 7.968   -25.322 -214.572 1.00 0.00 ?  30 ALA I HB2  1  
ATOM 10359  H HB3  . ALA I  1 30 ? 9.034   -26.363 -215.545 1.00 0.00 ?  30 ALA I HB3  1  
ATOM 10360  N N    . LEU I  1 31 ? 4.910   -26.708 -215.738 1.00 0.00 ?  31 LEU I N    1  
ATOM 10361  C CA   . LEU I  1 31 ? 3.488   -26.437 -215.566 1.00 0.00 ?  31 LEU I CA   1  
ATOM 10362  C C    . LEU I  1 31 ? 2.786   -27.598 -214.874 1.00 0.00 ?  31 LEU I C    1  
ATOM 10363  O O    . LEU I  1 31 ? 1.987   -27.396 -213.959 1.00 0.00 ?  31 LEU I O    1  
ATOM 10364  C CB   . LEU I  1 31 ? 2.835   -26.151 -216.924 1.00 0.00 ?  31 LEU I CB   1  
ATOM 10365  C CG   . LEU I  1 31 ? 1.324   -25.886 -216.879 1.00 0.00 ?  31 LEU I CG   1  
ATOM 10366  C CD1  . LEU I  1 31 ? 1.033   -24.676 -216.002 1.00 0.00 ?  31 LEU I CD1  1  
ATOM 10367  C CD2  . LEU I  1 31 ? 0.804   -25.666 -218.292 1.00 0.00 ?  31 LEU I CD2  1  
ATOM 10368  H H    . LEU I  1 31 ? 5.284   -26.801 -216.672 1.00 0.00 ?  31 LEU I H    1  
ATOM 10369  H HA   . LEU I  1 31 ? 3.357   -25.568 -214.922 1.00 0.00 ?  31 LEU I HA   1  
ATOM 10370  H HB2  . LEU I  1 31 ? 3.367   -25.239 -217.189 1.00 0.00 ?  31 LEU I HB2  1  
ATOM 10371  H HB3  . LEU I  1 31 ? 3.063   -26.929 -217.653 1.00 0.00 ?  31 LEU I HB3  1  
ATOM 10372  H HG   . LEU I  1 31 ? 0.849   -26.785 -216.485 1.00 0.00 ?  31 LEU I HG   1  
ATOM 10373  H HD11 . LEU I  1 31 ? -0.042  -24.495 -215.976 1.00 0.00 ?  31 LEU I HD11 1  
ATOM 10374  H HD12 . LEU I  1 31 ? 1.393   -24.864 -214.991 1.00 0.00 ?  31 LEU I HD12 1  
ATOM 10375  H HD13 . LEU I  1 31 ? 1.538   -23.801 -216.411 1.00 0.00 ?  31 LEU I HD13 1  
ATOM 10376  H HD21 . LEU I  1 31 ? 0.998   -26.554 -218.894 1.00 0.00 ?  31 LEU I HD21 1  
ATOM 10377  H HD22 . LEU I  1 31 ? -0.270  -25.478 -218.259 1.00 0.00 ?  31 LEU I HD22 1  
ATOM 10378  H HD23 . LEU I  1 31 ? 1.310   -24.809 -218.737 1.00 0.00 ?  31 LEU I HD23 1  
ATOM 10379  N N    . ASP I  1 32 ? 3.088   -28.814 -215.315 1.00 0.00 ?  32 ASP I N    1  
ATOM 10380  C CA   . ASP I  1 32 ? 2.471   -30.009 -214.753 1.00 0.00 ?  32 ASP I CA   1  
ATOM 10381  C C    . ASP I  1 32 ? 2.717   -30.102 -213.253 1.00 0.00 ?  32 ASP I C    1  
ATOM 10382  O O    . ASP I  1 32 ? 1.808   -30.413 -212.483 1.00 0.00 ?  32 ASP I O    1  
ATOM 10383  C CB   . ASP I  1 32 ? 2.998   -31.265 -215.452 1.00 0.00 ?  32 ASP I CB   1  
ATOM 10384  C CG   . ASP I  1 32 ? 2.481   -31.459 -216.871 1.00 0.00 ?  32 ASP I CG   1  
ATOM 10385  O OD1  . ASP I  1 32 ? 1.552   -30.782 -217.242 1.00 0.00 ?  32 ASP I OD1  1  
ATOM 10386  O OD2  . ASP I  1 32 ? 3.113   -32.164 -217.620 1.00 0.00 -1 32 ASP I OD2  1  
ATOM 10387  H H    . ASP I  1 32 ? 3.764   -28.913 -216.060 1.00 0.00 ?  32 ASP I H    1  
ATOM 10388  H HA   . ASP I  1 32 ? 1.389   -29.964 -214.888 1.00 0.00 ?  32 ASP I HA   1  
ATOM 10389  H HB2  . ASP I  1 32 ? 4.086   -31.339 -215.448 1.00 0.00 ?  32 ASP I HB2  1  
ATOM 10390  H HB3  . ASP I  1 32 ? 2.578   -32.035 -214.804 1.00 0.00 ?  32 ASP I HB3  1  
ATOM 10391  N N    . LYS I  1 33 ? 3.951   -29.831 -212.843 1.00 0.00 ?  33 LYS I N    1  
ATOM 10392  C CA   . LYS I  1 33 ? 4.313   -29.861 -211.431 1.00 0.00 ?  33 LYS I CA   1  
ATOM 10393  C C    . LYS I  1 33 ? 3.694   -28.690 -210.678 1.00 0.00 ?  33 LYS I C    1  
ATOM 10394  O O    . LYS I  1 33 ? 3.141   -28.861 -209.592 1.00 0.00 ?  33 LYS I O    1  
ATOM 10395  C CB   . LYS I  1 33 ? 5.834   -29.846 -211.268 1.00 0.00 ?  33 LYS I CB   1  
ATOM 10396  C CG   . LYS I  1 33 ? 6.529   -31.118 -211.733 1.00 0.00 ?  33 LYS I CG   1  
ATOM 10397  C CD   . LYS I  1 33 ? 8.040   -31.006 -211.594 1.00 0.00 ?  33 LYS I CD   1  
ATOM 10398  C CE   . LYS I  1 33 ? 8.741   -32.240 -212.142 1.00 0.00 ?  33 LYS I CE   1  
ATOM 10399  N NZ   . LYS I  1 33 ? 10.222  -32.126 -212.050 1.00 0.00 1  33 LYS I NZ   1  
ATOM 10400  H H    . LYS I  1 33 ? 4.657   -29.598 -213.527 1.00 0.00 ?  33 LYS I H    1  
ATOM 10401  H HA   . LYS I  1 33 ? 3.923   -30.768 -210.969 1.00 0.00 ?  33 LYS I HA   1  
ATOM 10402  H HB2  . LYS I  1 33 ? 6.208   -28.997 -211.841 1.00 0.00 ?  33 LYS I HB2  1  
ATOM 10403  H HB3  . LYS I  1 33 ? 6.041   -29.687 -210.209 1.00 0.00 ?  33 LYS I HB3  1  
ATOM 10404  H HG2  . LYS I  1 33 ? 6.169   -31.951 -211.129 1.00 0.00 ?  33 LYS I HG2  1  
ATOM 10405  H HG3  . LYS I  1 33 ? 6.272   -31.291 -212.778 1.00 0.00 ?  33 LYS I HG3  1  
ATOM 10406  H HD2  . LYS I  1 33 ? 8.375   -30.124 -212.142 1.00 0.00 ?  33 LYS I HD2  1  
ATOM 10407  H HD3  . LYS I  1 33 ? 8.284   -30.889 -210.538 1.00 0.00 ?  33 LYS I HD3  1  
ATOM 10408  H HE2  . LYS I  1 33 ? 8.408   -33.105 -211.569 1.00 0.00 ?  33 LYS I HE2  1  
ATOM 10409  H HE3  . LYS I  1 33 ? 8.450   -32.363 -213.185 1.00 0.00 ?  33 LYS I HE3  1  
ATOM 10410  H HZ1  . LYS I  1 33 ? 10.492  -32.013 -211.084 1.00 0.00 ?  33 LYS I HZ1  1  
ATOM 10411  H HZ2  . LYS I  1 33 ? 10.647  -32.963 -212.423 1.00 0.00 ?  33 LYS I HZ2  1  
ATOM 10412  H HZ3  . LYS I  1 33 ? 10.532  -31.325 -212.582 1.00 0.00 ?  33 LYS I HZ3  1  
ATOM 10413  N N    . LEU I  1 34 ? 3.791   -27.501 -211.262 1.00 0.00 ?  34 LEU I N    1  
ATOM 10414  C CA   . LEU I  1 34 ? 3.258   -26.295 -210.638 1.00 0.00 ?  34 LEU I CA   1  
ATOM 10415  C C    . LEU I  1 34 ? 1.759   -26.418 -210.395 1.00 0.00 ?  34 LEU I C    1  
ATOM 10416  O O    . LEU I  1 34 ? 1.239   -25.913 -209.399 1.00 0.00 ?  34 LEU I O    1  
ATOM 10417  C CB   . LEU I  1 34 ? 3.558   -25.070 -211.510 1.00 0.00 ?  34 LEU I CB   1  
ATOM 10418  C CG   . LEU I  1 34 ? 3.110   -23.725 -210.924 1.00 0.00 ?  34 LEU I CG   1  
ATOM 10419  C CD1  . LEU I  1 34 ? 3.839   -23.458 -209.614 1.00 0.00 ?  34 LEU I CD1  1  
ATOM 10420  C CD2  . LEU I  1 34 ? 3.382   -22.616 -211.928 1.00 0.00 ?  34 LEU I CD2  1  
ATOM 10421  H H    . LEU I  1 34 ? 4.245   -27.429 -212.162 1.00 0.00 ?  34 LEU I H    1  
ATOM 10422  H HA   . LEU I  1 34 ? 3.719   -26.156 -209.661 1.00 0.00 ?  34 LEU I HA   1  
ATOM 10423  H HB2  . LEU I  1 34 ? 4.646   -25.127 -211.527 1.00 0.00 ?  34 LEU I HB2  1  
ATOM 10424  H HB3  . LEU I  1 34 ? 3.173   -25.191 -212.523 1.00 0.00 ?  34 LEU I HB3  1  
ATOM 10425  H HG   . LEU I  1 34 ? 2.032   -23.781 -210.773 1.00 0.00 ?  34 LEU I HG   1  
ATOM 10426  H HD11 . LEU I  1 34 ? 3.514   -22.501 -209.204 1.00 0.00 ?  34 LEU I HD11 1  
ATOM 10427  H HD12 . LEU I  1 34 ? 3.611   -24.252 -208.902 1.00 0.00 ?  34 LEU I HD12 1  
ATOM 10428  H HD13 . LEU I  1 34 ? 4.913   -23.429 -209.795 1.00 0.00 ?  34 LEU I HD13 1  
ATOM 10429  H HD21 . LEU I  1 34 ? 2.829   -22.812 -212.847 1.00 0.00 ?  34 LEU I HD21 1  
ATOM 10430  H HD22 . LEU I  1 34 ? 3.062   -21.661 -211.510 1.00 0.00 ?  34 LEU I HD22 1  
ATOM 10431  H HD23 . LEU I  1 34 ? 4.449   -22.577 -212.148 1.00 0.00 ?  34 LEU I HD23 1  
ATOM 10432  N N    . ALA I  1 35 ? 1.069   -27.091 -211.309 1.00 0.00 ?  35 ALA I N    1  
ATOM 10433  C CA   . ALA I  1 35 ? -0.362  -27.328 -211.167 1.00 0.00 ?  35 ALA I CA   1  
ATOM 10434  C C    . ALA I  1 35 ? -0.676  -28.040 -209.858 1.00 0.00 ?  35 ALA I C    1  
ATOM 10435  O O    . ALA I  1 35 ? -1.700  -27.778 -209.227 1.00 0.00 ?  35 ALA I O    1  
ATOM 10436  C CB   . ALA I  1 35 ? -0.886  -28.130 -212.349 1.00 0.00 ?  35 ALA I CB   1  
ATOM 10437  H H    . ALA I  1 35 ? 1.549   -27.448 -212.123 1.00 0.00 ?  35 ALA I H    1  
ATOM 10438  H HA   . ALA I  1 35 ? -0.875  -26.366 -211.145 1.00 0.00 ?  35 ALA I HA   1  
ATOM 10439  H HB1  . ALA I  1 35 ? -0.372  -29.089 -212.395 1.00 0.00 ?  35 ALA I HB1  1  
ATOM 10440  H HB2  . ALA I  1 35 ? -1.956  -28.298 -212.228 1.00 0.00 ?  35 ALA I HB2  1  
ATOM 10441  H HB3  . ALA I  1 35 ? -0.708  -27.577 -213.272 1.00 0.00 ?  35 ALA I HB3  1  
ATOM 10442  N N    . ALA I  1 36 ? 0.212   -28.943 -209.454 1.00 0.00 ?  36 ALA I N    1  
ATOM 10443  C CA   . ALA I  1 36 ? 0.035   -29.690 -208.214 1.00 0.00 ?  36 ALA I CA   1  
ATOM 10444  C C    . ALA I  1 36 ? 0.272   -28.803 -206.999 1.00 0.00 ?  36 ALA I C    1  
ATOM 10445  O O    . ALA I  1 36 ? -0.470  -28.866 -206.018 1.00 0.00 ?  36 ALA I O    1  
ATOM 10446  C CB   . ALA I  1 36 ? 0.965   -30.894 -208.184 1.00 0.00 ?  36 ALA I CB   1  
ATOM 10447  H H    . ALA I  1 36 ? 1.029   -29.117 -210.021 1.00 0.00 ?  36 ALA I H    1  
ATOM 10448  H HA   . ALA I  1 36 ? -0.995  -30.044 -208.163 1.00 0.00 ?  36 ALA I HA   1  
ATOM 10449  H HB1  . ALA I  1 36 ? 1.998   -30.558 -208.251 1.00 0.00 ?  36 ALA I HB1  1  
ATOM 10450  H HB2  . ALA I  1 36 ? 0.820   -31.441 -207.252 1.00 0.00 ?  36 ALA I HB2  1  
ATOM 10451  H HB3  . ALA I  1 36 ? 0.740   -31.549 -209.027 1.00 0.00 ?  36 ALA I HB3  1  
ATOM 10452  N N    . LYS I  1 37 ? 1.309   -27.976 -207.069 1.00 0.00 ?  37 LYS I N    1  
ATOM 10453  C CA   . LYS I  1 37 ? 1.632   -27.058 -205.983 1.00 0.00 ?  37 LYS I CA   1  
ATOM 10454  C C    . LYS I  1 37 ? 1.927   -25.661 -206.513 1.00 0.00 ?  37 LYS I C    1  
ATOM 10455  O O    . LYS I  1 37 ? 3.086   -25.260 -206.624 1.00 0.00 ?  37 LYS I O    1  
ATOM 10456  C CB   . LYS I  1 37 ? 2.824   -27.577 -205.178 1.00 0.00 ?  37 LYS I CB   1  
ATOM 10457  C CG   . LYS I  1 37 ? 2.592   -28.927 -204.512 1.00 0.00 ?  37 LYS I CG   1  
ATOM 10458  C CD   . LYS I  1 37 ? 3.758   -29.307 -203.611 1.00 0.00 ?  37 LYS I CD   1  
ATOM 10459  C CE   . LYS I  1 37 ? 3.554   -30.682 -202.991 1.00 0.00 ?  37 LYS I CE   1  
ATOM 10460  N NZ   . LYS I  1 37 ? 4.683   -31.062 -202.099 1.00 0.00 1  37 LYS I NZ   1  
ATOM 10461  H H    . LYS I  1 37 ? 1.890   -27.985 -207.895 1.00 0.00 ?  37 LYS I H    1  
ATOM 10462  H HA   . LYS I  1 37 ? 0.776   -26.961 -205.315 1.00 0.00 ?  37 LYS I HA   1  
ATOM 10463  H HB2  . LYS I  1 37 ? 3.666   -27.652 -205.866 1.00 0.00 ?  37 LYS I HB2  1  
ATOM 10464  H HB3  . LYS I  1 37 ? 3.044   -26.831 -204.415 1.00 0.00 ?  37 LYS I HB3  1  
ATOM 10465  H HG2  . LYS I  1 37 ? 1.678   -28.869 -203.919 1.00 0.00 ?  37 LYS I HG2  1  
ATOM 10466  H HG3  . LYS I  1 37 ? 2.473   -29.681 -205.289 1.00 0.00 ?  37 LYS I HG3  1  
ATOM 10467  H HD2  . LYS I  1 37 ? 4.671   -29.309 -204.208 1.00 0.00 ?  37 LYS I HD2  1  
ATOM 10468  H HD3  . LYS I  1 37 ? 3.843   -28.562 -202.820 1.00 0.00 ?  37 LYS I HD3  1  
ATOM 10469  H HE2  . LYS I  1 37 ? 2.629   -30.664 -202.417 1.00 0.00 ?  37 LYS I HE2  1  
ATOM 10470  H HE3  . LYS I  1 37 ? 3.467   -31.410 -203.797 1.00 0.00 ?  37 LYS I HE3  1  
ATOM 10471  H HZ1  . LYS I  1 37 ? 4.763   -30.388 -201.351 1.00 0.00 ?  37 LYS I HZ1  1  
ATOM 10472  H HZ2  . LYS I  1 37 ? 4.509   -31.978 -201.709 1.00 0.00 ?  37 LYS I HZ2  1  
ATOM 10473  H HZ3  . LYS I  1 37 ? 5.542   -31.080 -202.631 1.00 0.00 ?  37 LYS I HZ3  1  
ATOM 10474  N N    . PRO I  1 38 ? 0.872   -24.922 -206.840 1.00 0.00 ?  38 PRO I N    1  
ATOM 10475  C CA   . PRO I  1 38 ? 1.018   -23.577 -207.385 1.00 0.00 ?  38 PRO I CA   1  
ATOM 10476  C C    . PRO I  1 38 ? 1.761   -22.668 -206.414 1.00 0.00 ?  38 PRO I C    1  
ATOM 10477  O O    . PRO I  1 38 ? 2.378   -21.683 -206.821 1.00 0.00 ?  38 PRO I O    1  
ATOM 10478  C CB   . PRO I  1 38 ? -0.422  -23.112 -207.623 1.00 0.00 ?  38 PRO I CB   1  
ATOM 10479  C CG   . PRO I  1 38 ? -1.203  -24.375 -207.757 1.00 0.00 ?  38 PRO I CG   1  
ATOM 10480  C CD   . PRO I  1 38 ? -0.553  -25.349 -206.811 1.00 0.00 ?  38 PRO I CD   1  
ATOM 10481  H HA   . PRO I  1 38 ? 1.614   -23.554 -208.309 1.00 0.00 ?  38 PRO I HA   1  
ATOM 10482  H HB2  . PRO I  1 38 ? -0.792  -22.502 -206.786 1.00 0.00 ?  38 PRO I HB2  1  
ATOM 10483  H HB3  . PRO I  1 38 ? -0.502  -22.496 -208.531 1.00 0.00 ?  38 PRO I HB3  1  
ATOM 10484  H HG2  . PRO I  1 38 ? -2.261  -24.218 -207.498 1.00 0.00 ?  38 PRO I HG2  1  
ATOM 10485  H HG3  . PRO I  1 38 ? -1.177  -24.750 -208.791 1.00 0.00 ?  38 PRO I HG3  1  
ATOM 10486  H HD2  . PRO I  1 38 ? -0.971  -25.285 -205.796 1.00 0.00 ?  38 PRO I HD2  1  
ATOM 10487  H HD3  . PRO I  1 38 ? -0.670  -26.391 -207.142 1.00 0.00 ?  38 PRO I HD3  1  
ATOM 10488  N N    . SER I  1 39 ? 1.697   -23.003 -205.130 1.00 0.00 ?  39 SER I N    1  
ATOM 10489  C CA   . SER I  1 39 ? 2.220   -22.132 -204.084 1.00 0.00 ?  39 SER I CA   1  
ATOM 10490  C C    . SER I  1 39 ? 3.684   -22.435 -203.795 1.00 0.00 ?  39 SER I C    1  
ATOM 10491  O O    . SER I  1 39 ? 4.259   -21.913 -202.840 1.00 0.00 ?  39 SER I O    1  
ATOM 10492  C CB   . SER I  1 39 ? 1.391   -22.277 -202.823 1.00 0.00 ?  39 SER I CB   1  
ATOM 10493  O OG   . SER I  1 39 ? 1.524   -23.547 -202.248 1.00 0.00 ?  39 SER I OG   1  
ATOM 10494  H H    . SER I  1 39 ? 1.277   -23.884 -204.872 1.00 0.00 ?  39 SER I H    1  
ATOM 10495  H HA   . SER I  1 39 ? 2.097   -21.070 -204.304 1.00 0.00 ?  39 SER I HA   1  
ATOM 10496  H HB2  . SER I  1 39 ? 1.718   -21.526 -202.104 1.00 0.00 ?  39 SER I HB2  1  
ATOM 10497  H HB3  . SER I  1 39 ? 0.344   -22.108 -203.071 1.00 0.00 ?  39 SER I HB3  1  
ATOM 10498  H HG   . SER I  1 39 ? 1.236   -24.214 -202.876 1.00 0.00 ?  39 SER I HG   1  
ATOM 10499  N N    . ASP I  1 40 ? 4.283   -23.283 -204.625 1.00 0.00 ?  40 ASP I N    1  
ATOM 10500  C CA   . ASP I  1 40 ? 5.698   -23.608 -204.498 1.00 0.00 ?  40 ASP I CA   1  
ATOM 10501  C C    . ASP I  1 40 ? 6.566   -22.571 -205.198 1.00 0.00 ?  40 ASP I C    1  
ATOM 10502  O O    . ASP I  1 40 ? 6.517   -22.428 -206.420 1.00 0.00 ?  40 ASP I O    1  
ATOM 10503  C CB   . ASP I  1 40 ? 5.982   -25.001 -205.067 1.00 0.00 ?  40 ASP I CB   1  
ATOM 10504  C CG   . ASP I  1 40 ? 7.415   -25.479 -204.874 1.00 0.00 ?  40 ASP I CG   1  
ATOM 10505  O OD1  . ASP I  1 40 ? 8.221   -24.707 -204.412 1.00 0.00 ?  40 ASP I OD1  1  
ATOM 10506  O OD2  . ASP I  1 40 ? 7.656   -26.651 -205.040 1.00 0.00 -1 40 ASP I OD2  1  
ATOM 10507  H H    . ASP I  1 40 ? 3.743   -23.713 -205.362 1.00 0.00 ?  40 ASP I H    1  
ATOM 10508  H HA   . ASP I  1 40 ? 5.987   -23.596 -203.447 1.00 0.00 ?  40 ASP I HA   1  
ATOM 10509  H HB2  . ASP I  1 40 ? 5.293   -25.765 -204.707 1.00 0.00 ?  40 ASP I HB2  1  
ATOM 10510  H HB3  . ASP I  1 40 ? 5.800   -24.816 -206.126 1.00 0.00 ?  40 ASP I HB3  1  
ATOM 10511  N N    . PRO I  1 41 ? 7.362   -21.848 -204.417 1.00 0.00 ?  41 PRO I N    1  
ATOM 10512  C CA   . PRO I  1 41 ? 8.243   -20.821 -204.960 1.00 0.00 ?  41 PRO I CA   1  
ATOM 10513  C C    . PRO I  1 41 ? 9.192   -21.404 -205.999 1.00 0.00 ?  41 PRO I C    1  
ATOM 10514  O O    . PRO I  1 41 ? 9.514   -20.754 -206.994 1.00 0.00 ?  41 PRO I O    1  
ATOM 10515  C CB   . PRO I  1 41 ? 8.989   -20.282 -203.736 1.00 0.00 ?  41 PRO I CB   1  
ATOM 10516  C CG   . PRO I  1 41 ? 8.091   -20.591 -202.587 1.00 0.00 ?  41 PRO I CG   1  
ATOM 10517  C CD   . PRO I  1 41 ? 7.434   -21.900 -202.936 1.00 0.00 ?  41 PRO I CD   1  
ATOM 10518  H HA   . PRO I  1 41 ? 7.696   -20.028 -205.490 1.00 0.00 ?  41 PRO I HA   1  
ATOM 10519  H HB2  . PRO I  1 41 ? 9.970   -20.766 -203.616 1.00 0.00 ?  41 PRO I HB2  1  
ATOM 10520  H HB3  . PRO I  1 41 ? 9.172   -19.200 -203.819 1.00 0.00 ?  41 PRO I HB3  1  
ATOM 10521  H HG2  . PRO I  1 41 ? 8.659   -20.672 -201.649 1.00 0.00 ?  41 PRO I HG2  1  
ATOM 10522  H HG3  . PRO I  1 41 ? 7.342   -19.798 -202.443 1.00 0.00 ?  41 PRO I HG3  1  
ATOM 10523  H HD2  . PRO I  1 41 ? 8.022   -22.765 -202.596 1.00 0.00 ?  41 PRO I HD2  1  
ATOM 10524  H HD3  . PRO I  1 41 ? 6.434   -21.996 -202.487 1.00 0.00 ?  41 PRO I HD3  1  
ATOM 10525  N N    . ALA I  1 42 ? 9.638   -22.633 -205.763 1.00 0.00 ?  42 ALA I N    1  
ATOM 10526  C CA   . ALA I  1 42 ? 10.590  -23.288 -206.652 1.00 0.00 ?  42 ALA I CA   1  
ATOM 10527  C C    . ALA I  1 42 ? 9.963   -23.584 -208.008 1.00 0.00 ?  42 ALA I C    1  
ATOM 10528  O O    . ALA I  1 42 ? 10.586  -23.378 -209.050 1.00 0.00 ?  42 ALA I O    1  
ATOM 10529  C CB   . ALA I  1 42 ? 11.116  -24.567 -206.017 1.00 0.00 ?  42 ALA I CB   1  
ATOM 10530  H H    . ALA I  1 42 ? 9.309   -23.127 -204.945 1.00 0.00 ?  42 ALA I H    1  
ATOM 10531  H HA   . ALA I  1 42 ? 11.430  -22.613 -206.823 1.00 0.00 ?  42 ALA I HA   1  
ATOM 10532  H HB1  . ALA I  1 42 ? 10.286  -25.245 -205.826 1.00 0.00 ?  42 ALA I HB1  1  
ATOM 10533  H HB2  . ALA I  1 42 ? 11.825  -25.043 -206.694 1.00 0.00 ?  42 ALA I HB2  1  
ATOM 10534  H HB3  . ALA I  1 42 ? 11.615  -24.329 -205.078 1.00 0.00 ?  42 ALA I HB3  1  
ATOM 10535  N N    . LEU I  1 43 ? 8.726   -24.068 -207.989 1.00 0.00 ?  43 LEU I N    1  
ATOM 10536  C CA   . LEU I  1 43 ? 8.003   -24.372 -209.219 1.00 0.00 ?  43 LEU I CA   1  
ATOM 10537  C C    . LEU I  1 43 ? 7.584   -23.099 -209.941 1.00 0.00 ?  43 LEU I C    1  
ATOM 10538  O O    . LEU I  1 43 ? 7.572   -23.047 -211.171 1.00 0.00 ?  43 LEU I O    1  
ATOM 10539  C CB   . LEU I  1 43 ? 6.776   -25.239 -208.911 1.00 0.00 ?  43 LEU I CB   1  
ATOM 10540  C CG   . LEU I  1 43 ? 7.086   -26.644 -208.378 1.00 0.00 ?  43 LEU I CG   1  
ATOM 10541  C CD1  . LEU I  1 43 ? 5.800   -27.332 -207.941 1.00 0.00 ?  43 LEU I CD1  1  
ATOM 10542  C CD2  . LEU I  1 43 ? 7.790   -27.453 -209.457 1.00 0.00 ?  43 LEU I CD2  1  
ATOM 10543  H H    . LEU I  1 43 ? 8.274   -24.229 -207.100 1.00 0.00 ?  43 LEU I H    1  
ATOM 10544  H HA   . LEU I  1 43 ? 8.656   -24.915 -209.901 1.00 0.00 ?  43 LEU I HA   1  
ATOM 10545  H HB2  . LEU I  1 43 ? 6.323   -24.634 -208.127 1.00 0.00 ?  43 LEU I HB2  1  
ATOM 10546  H HB3  . LEU I  1 43 ? 6.098   -25.296 -209.762 1.00 0.00 ?  43 LEU I HB3  1  
ATOM 10547  H HG   . LEU I  1 43 ? 7.777   -26.529 -207.543 1.00 0.00 ?  43 LEU I HG   1  
ATOM 10548  H HD11 . LEU I  1 43 ? 6.030   -28.329 -207.564 1.00 0.00 ?  43 LEU I HD11 1  
ATOM 10549  H HD12 . LEU I  1 43 ? 5.325   -26.748 -207.153 1.00 0.00 ?  43 LEU I HD12 1  
ATOM 10550  H HD13 . LEU I  1 43 ? 5.123   -27.414 -208.791 1.00 0.00 ?  43 LEU I HD13 1  
ATOM 10551  H HD21 . LEU I  1 43 ? 8.720   -26.958 -209.735 1.00 0.00 ?  43 LEU I HD21 1  
ATOM 10552  H HD22 . LEU I  1 43 ? 8.011   -28.451 -209.077 1.00 0.00 ?  43 LEU I HD22 1  
ATOM 10553  H HD23 . LEU I  1 43 ? 7.145   -27.532 -210.333 1.00 0.00 ?  43 LEU I HD23 1  
ATOM 10554  N N    . LEU I  1 44 ? 7.241   -22.072 -209.171 1.00 0.00 ?  44 LEU I N    1  
ATOM 10555  C CA   . LEU I  1 44 ? 6.870   -20.780 -209.735 1.00 0.00 ?  44 LEU I CA   1  
ATOM 10556  C C    . LEU I  1 44 ? 8.050   -20.131 -210.447 1.00 0.00 ?  44 LEU I C    1  
ATOM 10557  O O    . LEU I  1 44 ? 7.923   -19.663 -211.579 1.00 0.00 ?  44 LEU I O    1  
ATOM 10558  C CB   . LEU I  1 44 ? 6.336   -19.855 -208.635 1.00 0.00 ?  44 LEU I CB   1  
ATOM 10559  C CG   . LEU I  1 44 ? 4.917   -20.173 -208.147 1.00 0.00 ?  44 LEU I CG   1  
ATOM 10560  C CD1  . LEU I  1 44 ? 4.605   -19.370 -206.891 1.00 0.00 ?  44 LEU I CD1  1  
ATOM 10561  C CD2  . LEU I  1 44 ? 3.917   -19.859 -209.249 1.00 0.00 ?  44 LEU I CD2  1  
ATOM 10562  H H    . LEU I  1 44 ? 7.238   -22.190 -208.167 1.00 0.00 ?  44 LEU I H    1  
ATOM 10563  H HA   . LEU I  1 44 ? 6.094   -20.920 -210.487 1.00 0.00 ?  44 LEU I HA   1  
ATOM 10564  H HB2  . LEU I  1 44 ? 7.059   -20.075 -207.851 1.00 0.00 ?  44 LEU I HB2  1  
ATOM 10565  H HB3  . LEU I  1 44 ? 6.415   -18.805 -208.917 1.00 0.00 ?  44 LEU I HB3  1  
ATOM 10566  H HG   . LEU I  1 44 ? 4.874   -21.245 -207.953 1.00 0.00 ?  44 LEU I HG   1  
ATOM 10567  H HD11 . LEU I  1 44 ? 3.596   -19.603 -206.551 1.00 0.00 ?  44 LEU I HD11 1  
ATOM 10568  H HD12 . LEU I  1 44 ? 5.318   -19.628 -206.108 1.00 0.00 ?  44 LEU I HD12 1  
ATOM 10569  H HD13 . LEU I  1 44 ? 4.677   -18.306 -207.112 1.00 0.00 ?  44 LEU I HD13 1  
ATOM 10570  H HD21 . LEU I  1 44 ? 4.141   -20.464 -210.128 1.00 0.00 ?  44 LEU I HD21 1  
ATOM 10571  H HD22 . LEU I  1 44 ? 2.909   -20.086 -208.901 1.00 0.00 ?  44 LEU I HD22 1  
ATOM 10572  H HD23 . LEU I  1 44 ? 3.982   -18.802 -209.510 1.00 0.00 ?  44 LEU I HD23 1  
ATOM 10573  N N    . ALA I  1 45 ? 9.197   -20.106 -209.778 1.00 0.00 ?  45 ALA I N    1  
ATOM 10574  C CA   . ALA I  1 45 ? 10.393  -19.479 -210.330 1.00 0.00 ?  45 ALA I CA   1  
ATOM 10575  C C    . ALA I  1 45 ? 10.880  -20.220 -211.569 1.00 0.00 ?  45 ALA I C    1  
ATOM 10576  O O    . ALA I  1 45 ? 11.201  -19.604 -212.586 1.00 0.00 ?  45 ALA I O    1  
ATOM 10577  C CB   . ALA I  1 45 ? 11.491  -19.417 -209.279 1.00 0.00 ?  45 ALA I CB   1  
ATOM 10578  H H    . ALA I  1 45 ? 9.243   -20.531 -208.863 1.00 0.00 ?  45 ALA I H    1  
ATOM 10579  H HA   . ALA I  1 45 ? 10.145  -18.463 -210.636 1.00 0.00 ?  45 ALA I HA   1  
ATOM 10580  H HB1  . ALA I  1 45 ? 11.740  -20.425 -208.952 1.00 0.00 ?  45 ALA I HB1  1  
ATOM 10581  H HB2  . ALA I  1 45 ? 12.377  -18.946 -209.708 1.00 0.00 ?  45 ALA I HB2  1  
ATOM 10582  H HB3  . ALA I  1 45 ? 11.147  -18.832 -208.426 1.00 0.00 ?  45 ALA I HB3  1  
ATOM 10583  N N    . ALA I  1 46 ? 10.934  -21.544 -211.478 1.00 0.00 ?  46 ALA I N    1  
ATOM 10584  C CA   . ALA I  1 46 ? 11.398  -22.370 -212.586 1.00 0.00 ?  46 ALA I CA   1  
ATOM 10585  C C    . ALA I  1 46 ? 10.465  -22.257 -213.785 1.00 0.00 ?  46 ALA I C    1  
ATOM 10586  O O    . ALA I  1 46 ? 10.912  -22.057 -214.915 1.00 0.00 ?  46 ALA I O    1  
ATOM 10587  C CB   . ALA I  1 46 ? 11.528  -23.821 -212.147 1.00 0.00 ?  46 ALA I CB   1  
ATOM 10588  H H    . ALA I  1 46 ? 10.646  -21.990 -210.619 1.00 0.00 ?  46 ALA I H    1  
ATOM 10589  H HA   . ALA I  1 46 ? 12.378  -22.013 -212.902 1.00 0.00 ?  46 ALA I HA   1  
ATOM 10590  H HB1  . ALA I  1 46 ? 10.559  -24.189 -211.813 1.00 0.00 ?  46 ALA I HB1  1  
ATOM 10591  H HB2  . ALA I  1 46 ? 11.876  -24.424 -212.986 1.00 0.00 ?  46 ALA I HB2  1  
ATOM 10592  H HB3  . ALA I  1 46 ? 12.245  -23.891 -211.329 1.00 0.00 ?  46 ALA I HB3  1  
ATOM 10593  N N    . TYR I  1 47 ? 9.167   -22.386 -213.533 1.00 0.00 ?  47 TYR I N    1  
ATOM 10594  C CA   . TYR I  1 47 ? 8.172   -22.345 -214.598 1.00 0.00 ?  47 TYR I CA   1  
ATOM 10595  C C    . TYR I  1 47 ? 8.143   -20.979 -215.272 1.00 0.00 ?  47 TYR I C    1  
ATOM 10596  O O    . TYR I  1 47 ? 8.173   -20.881 -216.499 1.00 0.00 ?  47 TYR I O    1  
ATOM 10597  C CB   . TYR I  1 47 ? 6.786   -22.688 -214.049 1.00 0.00 ?  47 TYR I CB   1  
ATOM 10598  C CG   . TYR I  1 47 ? 5.665   -22.491 -215.045 1.00 0.00 ?  47 TYR I CG   1  
ATOM 10599  C CD1  . TYR I  1 47 ? 5.622   -23.222 -216.223 1.00 0.00 ?  47 TYR I CD1  1  
ATOM 10600  C CD2  . TYR I  1 47 ? 4.653   -21.574 -214.804 1.00 0.00 ?  47 TYR I CD2  1  
ATOM 10601  C CE1  . TYR I  1 47 ? 4.601   -23.046 -217.137 1.00 0.00 ?  47 TYR I CE1  1  
ATOM 10602  C CE2  . TYR I  1 47 ? 3.627   -21.390 -215.710 1.00 0.00 ?  47 TYR I CE2  1  
ATOM 10603  C CZ   . TYR I  1 47 ? 3.604   -22.127 -216.876 1.00 0.00 ?  47 TYR I CZ   1  
ATOM 10604  O OH   . TYR I  1 47 ? 2.584   -21.948 -217.782 1.00 0.00 ?  47 TYR I OH   1  
ATOM 10605  H H    . TYR I  1 47 ? 8.862   -22.517 -212.579 1.00 0.00 ?  47 TYR I H    1  
ATOM 10606  H HA   . TYR I  1 47 ? 8.428   -23.068 -215.373 1.00 0.00 ?  47 TYR I HA   1  
ATOM 10607  H HB2  . TYR I  1 47 ? 6.813   -23.733 -213.734 1.00 0.00 ?  47 TYR I HB2  1  
ATOM 10608  H HB3  . TYR I  1 47 ? 6.616   -22.052 -213.181 1.00 0.00 ?  47 TYR I HB3  1  
ATOM 10609  H HD1  . TYR I  1 47 ? 6.413   -23.946 -216.423 1.00 0.00 ?  47 TYR I HD1  1  
ATOM 10610  H HD2  . TYR I  1 47 ? 4.676   -20.994 -213.882 1.00 0.00 ?  47 TYR I HD2  1  
ATOM 10611  H HE1  . TYR I  1 47 ? 4.580   -23.627 -218.059 1.00 0.00 ?  47 TYR I HE1  1  
ATOM 10612  H HE2  . TYR I  1 47 ? 2.840   -20.663 -215.503 1.00 0.00 ?  47 TYR I HE2  1  
ATOM 10613  H HH   . TYR I  1 47 ? 1.945   -21.288 -217.502 1.00 0.00 ?  47 TYR I HH   1  
ATOM 10614  N N    . GLN I  1 48 ? 8.085   -19.927 -214.463 1.00 0.00 ?  48 GLN I N    1  
ATOM 10615  C CA   . GLN I  1 48 ? 7.991   -18.567 -214.980 1.00 0.00 ?  48 GLN I CA   1  
ATOM 10616  C C    . GLN I  1 48 ? 9.245   -18.184 -215.755 1.00 0.00 ?  48 GLN I C    1  
ATOM 10617  O O    . GLN I  1 48 ? 9.170   -17.507 -216.781 1.00 0.00 ?  48 GLN I O    1  
ATOM 10618  C CB   . GLN I  1 48 ? 7.765   -17.573 -213.837 1.00 0.00 ?  48 GLN I CB   1  
ATOM 10619  C CG   . GLN I  1 48 ? 7.439   -16.162 -214.295 1.00 0.00 ?  48 GLN I CG   1  
ATOM 10620  C CD   . GLN I  1 48 ? 8.677   -15.380 -214.690 1.00 0.00 ?  48 GLN I CD   1  
ATOM 10621  O OE1  . GLN I  1 48 ? 9.740   -15.526 -214.080 1.00 0.00 ?  48 GLN I OE1  1  
ATOM 10622  N NE2  . GLN I  1 48 ? 8.546   -14.542 -215.711 1.00 0.00 ?  48 GLN I NE2  1  
ATOM 10623  H H    . GLN I  1 48 ? 8.107   -20.073 -213.464 1.00 0.00 ?  48 GLN I H    1  
ATOM 10624  H HA   . GLN I  1 48 ? 7.160   -18.501 -215.683 1.00 0.00 ?  48 GLN I HA   1  
ATOM 10625  H HB2  . GLN I  1 48 ? 6.945   -17.966 -213.236 1.00 0.00 ?  48 GLN I HB2  1  
ATOM 10626  H HB3  . GLN I  1 48 ? 8.679   -17.565 -213.243 1.00 0.00 ?  48 GLN I HB3  1  
ATOM 10627  H HG2  . GLN I  1 48 ? 6.659   -15.944 -215.024 1.00 0.00 ?  48 GLN I HG2  1  
ATOM 10628  H HG3  . GLN I  1 48 ? 7.117   -15.824 -213.309 1.00 0.00 ?  48 GLN I HG3  1  
ATOM 10629  H HE21 . GLN I  1 48 ? 7.665   -14.453 -216.176 1.00 0.00 ?  48 GLN I HE21 1  
ATOM 10630  H HE22 . GLN I  1 48 ? 9.329   -13.998 -216.017 1.00 0.00 ?  48 GLN I HE22 1  
ATOM 10631  N N    . SER I  1 49 ? 10.398  -18.620 -215.258 1.00 0.00 ?  49 SER I N    1  
ATOM 10632  C CA   . SER I  1 49 ? 11.666  -18.366 -215.930 1.00 0.00 ?  49 SER I CA   1  
ATOM 10633  C C    . SER I  1 49 ? 11.702  -19.021 -217.305 1.00 0.00 ?  49 SER I C    1  
ATOM 10634  O O    . SER I  1 49 ? 12.144  -18.414 -218.281 1.00 0.00 ?  49 SER I O    1  
ATOM 10635  C CB   . SER I  1 49 ? 12.817  -18.865 -215.078 1.00 0.00 ?  49 SER I CB   1  
ATOM 10636  O OG   . SER I  1 49 ? 14.055  -18.692 -215.711 1.00 0.00 ?  49 SER I OG   1  
ATOM 10637  H H    . SER I  1 49 ? 10.395  -19.141 -214.393 1.00 0.00 ?  49 SER I H    1  
ATOM 10638  H HA   . SER I  1 49 ? 11.906  -17.306 -216.017 1.00 0.00 ?  49 SER I HA   1  
ATOM 10639  H HB2  . SER I  1 49 ? 12.819  -18.314 -214.138 1.00 0.00 ?  49 SER I HB2  1  
ATOM 10640  H HB3  . SER I  1 49 ? 12.668  -19.925 -214.875 1.00 0.00 ?  49 SER I HB3  1  
ATOM 10641  H HG   . SER I  1 49 ? 14.072  -19.201 -216.524 1.00 0.00 ?  49 SER I HG   1  
ATOM 10642  N N    . LYS I  1 50 ? 11.234  -20.262 -217.376 1.00 0.00 ?  50 LYS I N    1  
ATOM 10643  C CA   . LYS I  1 50 ? 11.203  -20.998 -218.634 1.00 0.00 ?  50 LYS I CA   1  
ATOM 10644  C C    . LYS I  1 50 ? 10.025  -20.565 -219.498 1.00 0.00 ?  50 LYS I C    1  
ATOM 10645  O O    . LYS I  1 50 ? 10.041  -20.735 -220.717 1.00 0.00 ?  50 LYS I O    1  
ATOM 10646  C CB   . LYS I  1 50 ? 11.138  -22.504 -218.373 1.00 0.00 ?  50 LYS I CB   1  
ATOM 10647  C CG   . LYS I  1 50 ? 12.383  -23.083 -217.714 1.00 0.00 ?  50 LYS I CG   1  
ATOM 10648  C CD   . LYS I  1 50 ? 12.227  -24.573 -217.451 1.00 0.00 ?  50 LYS I CD   1  
ATOM 10649  C CE   . LYS I  1 50 ? 13.435  -25.135 -216.714 1.00 0.00 ?  50 LYS I CE   1  
ATOM 10650  N NZ   . LYS I  1 50 ? 14.690  -24.970 -217.496 1.00 0.00 1  50 LYS I NZ   1  
ATOM 10651  H H    . LYS I  1 50 ? 10.890  -20.707 -216.537 1.00 0.00 ?  50 LYS I H    1  
ATOM 10652  H HA   . LYS I  1 50 ? 12.105  -20.784 -219.209 1.00 0.00 ?  50 LYS I HA   1  
ATOM 10653  H HB2  . LYS I  1 50 ? 10.273  -22.679 -217.731 1.00 0.00 ?  50 LYS I HB2  1  
ATOM 10654  H HB3  . LYS I  1 50 ? 10.978  -22.989 -219.336 1.00 0.00 ?  50 LYS I HB3  1  
ATOM 10655  H HG2  . LYS I  1 50 ? 13.233  -22.917 -218.377 1.00 0.00 ?  50 LYS I HG2  1  
ATOM 10656  H HG3  . LYS I  1 50 ? 12.550  -22.562 -216.772 1.00 0.00 ?  50 LYS I HG3  1  
ATOM 10657  H HD2  . LYS I  1 50 ? 11.330  -24.728 -216.850 1.00 0.00 ?  50 LYS I HD2  1  
ATOM 10658  H HD3  . LYS I  1 50 ? 12.116  -25.085 -218.406 1.00 0.00 ?  50 LYS I HD3  1  
ATOM 10659  H HE2  . LYS I  1 50 ? 13.529  -24.612 -215.763 1.00 0.00 ?  50 LYS I HE2  1  
ATOM 10660  H HE3  . LYS I  1 50 ? 13.259  -26.194 -216.529 1.00 0.00 ?  50 LYS I HE3  1  
ATOM 10661  H HZ1  . LYS I  1 50 ? 14.853  -23.988 -217.667 1.00 0.00 ?  50 LYS I HZ1  1  
ATOM 10662  H HZ2  . LYS I  1 50 ? 15.465  -25.355 -216.975 1.00 0.00 ?  50 LYS I HZ2  1  
ATOM 10663  H HZ3  . LYS I  1 50 ? 14.604  -25.456 -218.378 1.00 0.00 ?  50 LYS I HZ3  1  
ATOM 10664  N N    . LEU I  1 51 ? 9.004   -20.004 -218.858 1.00 0.00 ?  51 LEU I N    1  
ATOM 10665  C CA   . LEU I  1 51 ? 7.827   -19.521 -219.570 1.00 0.00 ?  51 LEU I CA   1  
ATOM 10666  C C    . LEU I  1 51 ? 8.121   -18.217 -220.300 1.00 0.00 ?  51 LEU I C    1  
ATOM 10667  O O    . LEU I  1 51 ? 7.633   -17.991 -221.407 1.00 0.00 ?  51 LEU I O    1  
ATOM 10668  C CB   . LEU I  1 51 ? 6.658   -19.336 -218.595 1.00 0.00 ?  51 LEU I CB   1  
ATOM 10669  C CG   . LEU I  1 51 ? 5.311   -18.997 -219.247 1.00 0.00 ?  51 LEU I CG   1  
ATOM 10670  C CD1  . LEU I  1 51 ? 4.847   -20.157 -220.118 1.00 0.00 ?  51 LEU I CD1  1  
ATOM 10671  C CD2  . LEU I  1 51 ? 4.285   -18.690 -218.166 1.00 0.00 ?  51 LEU I CD2  1  
ATOM 10672  H H    . LEU I  1 51 ? 9.045   -19.910 -217.854 1.00 0.00 ?  51 LEU I H    1  
ATOM 10673  H HA   . LEU I  1 51 ? 7.539   -20.244 -220.332 1.00 0.00 ?  51 LEU I HA   1  
ATOM 10674  H HB2  . LEU I  1 51 ? 6.624   -20.336 -218.166 1.00 0.00 ?  51 LEU I HB2  1  
ATOM 10675  H HB3  . LEU I  1 51 ? 6.894   -18.613 -217.814 1.00 0.00 ?  51 LEU I HB3  1  
ATOM 10676  H HG   . LEU I  1 51 ? 5.456   -18.092 -219.837 1.00 0.00 ?  51 LEU I HG   1  
ATOM 10677  H HD11 . LEU I  1 51 ? 3.890   -19.907 -220.577 1.00 0.00 ?  51 LEU I HD11 1  
ATOM 10678  H HD12 . LEU I  1 51 ? 5.584   -20.344 -220.898 1.00 0.00 ?  51 LEU I HD12 1  
ATOM 10679  H HD13 . LEU I  1 51 ? 4.732   -21.049 -219.504 1.00 0.00 ?  51 LEU I HD13 1  
ATOM 10680  H HD21 . LEU I  1 51 ? 4.624   -17.840 -217.574 1.00 0.00 ?  51 LEU I HD21 1  
ATOM 10681  H HD22 . LEU I  1 51 ? 3.329   -18.448 -218.631 1.00 0.00 ?  51 LEU I HD22 1  
ATOM 10682  H HD23 . LEU I  1 51 ? 4.166   -19.559 -217.519 1.00 0.00 ?  51 LEU I HD23 1  
ATOM 10683  N N    . SER I  1 52 ? 8.921   -17.362 -219.674 1.00 0.00 ?  52 SER I N    1  
ATOM 10684  C CA   . SER I  1 52 ? 9.354   -16.118 -220.300 1.00 0.00 ?  52 SER I CA   1  
ATOM 10685  C C    . SER I  1 52 ? 10.229  -16.389 -221.517 1.00 0.00 ?  52 SER I C    1  
ATOM 10686  O O    . SER I  1 52 ? 10.308  -15.570 -222.432 1.00 0.00 ?  52 SER I O    1  
ATOM 10687  C CB   . SER I  1 52 ? 10.097  -15.259 -219.296 1.00 0.00 ?  52 SER I CB   1  
ATOM 10688  O OG   . SER I  1 52 ? 11.329  -15.820 -218.933 1.00 0.00 ?  52 SER I OG   1  
ATOM 10689  H H    . SER I  1 52 ? 9.238   -17.578 -218.739 1.00 0.00 ?  52 SER I H    1  
ATOM 10690  H HA   . SER I  1 52 ? 8.527   -15.462 -220.576 1.00 0.00 ?  52 SER I HA   1  
ATOM 10691  H HB2  . SER I  1 52 ? 10.271  -14.278 -219.738 1.00 0.00 ?  52 SER I HB2  1  
ATOM 10692  H HB3  . SER I  1 52 ? 9.480   -15.151 -218.404 1.00 0.00 ?  52 SER I HB3  1  
ATOM 10693  H HG   . SER I  1 52 ? 11.766  -15.247 -218.298 1.00 0.00 ?  52 SER I HG   1  
ATOM 10694  N N    . GLU I  1 53 ? 10.885  -17.545 -221.521 1.00 0.00 ?  53 GLU I N    1  
ATOM 10695  C CA   . GLU I  1 53 ? 11.586  -18.023 -222.707 1.00 0.00 ?  53 GLU I CA   1  
ATOM 10696  C C    . GLU I  1 53 ? 10.622  -18.668 -223.694 1.00 0.00 ?  53 GLU I C    1  
ATOM 10697  O O    . GLU I  1 53 ? 10.758  -18.504 -224.907 1.00 0.00 ?  53 GLU I O    1  
ATOM 10698  C CB   . GLU I  1 53 ? 12.682  -19.018 -222.317 1.00 0.00 ?  53 GLU I CB   1  
ATOM 10699  C CG   . GLU I  1 53 ? 13.853  -18.400 -221.566 1.00 0.00 ?  53 GLU I CG   1  
ATOM 10700  C CD   . GLU I  1 53 ? 14.843  -19.448 -221.141 1.00 0.00 ?  53 GLU I CD   1  
ATOM 10701  O OE1  . GLU I  1 53 ? 14.539  -20.611 -221.264 1.00 0.00 ?  53 GLU I OE1  1  
ATOM 10702  O OE2  . GLU I  1 53 ? 15.946  -19.092 -220.798 1.00 0.00 -1 53 GLU I OE2  1  
ATOM 10703  H H    . GLU I  1 53 ? 10.899  -18.106 -220.682 1.00 0.00 ?  53 GLU I H    1  
ATOM 10704  H HA   . GLU I  1 53 ? 12.047  -17.183 -223.228 1.00 0.00 ?  53 GLU I HA   1  
ATOM 10705  H HB2  . GLU I  1 53 ? 12.213  -19.779 -221.694 1.00 0.00 ?  53 GLU I HB2  1  
ATOM 10706  H HB3  . GLU I  1 53 ? 13.042  -19.473 -223.239 1.00 0.00 ?  53 GLU I HB3  1  
ATOM 10707  H HG2  . GLU I  1 53 ? 14.368  -17.623 -222.130 1.00 0.00 ?  53 GLU I HG2  1  
ATOM 10708  H HG3  . GLU I  1 53 ? 13.389  -17.960 -220.685 1.00 0.00 ?  53 GLU I HG3  1  
ATOM 10709  N N    . TYR I  1 54 ? 9.646   -19.401 -223.168 1.00 0.00 ?  54 TYR I N    1  
ATOM 10710  C CA   . TYR I  1 54 ? 8.620   -20.019 -223.999 1.00 0.00 ?  54 TYR I CA   1  
ATOM 10711  C C    . TYR I  1 54 ? 7.791   -18.967 -224.724 1.00 0.00 ?  54 TYR I C    1  
ATOM 10712  O O    . TYR I  1 54 ? 7.189   -19.245 -225.762 1.00 0.00 ?  54 TYR I O    1  
ATOM 10713  C CB   . TYR I  1 54 ? 7.710   -20.911 -223.150 1.00 0.00 ?  54 TYR I CB   1  
ATOM 10714  C CG   . TYR I  1 54 ? 6.685   -21.681 -223.952 1.00 0.00 ?  54 TYR I CG   1  
ATOM 10715  C CD1  . TYR I  1 54 ? 7.063   -22.747 -224.755 1.00 0.00 ?  54 TYR I CD1  1  
ATOM 10716  C CD2  . TYR I  1 54 ? 5.342   -21.341 -223.902 1.00 0.00 ?  54 TYR I CD2  1  
ATOM 10717  C CE1  . TYR I  1 54 ? 6.131   -23.454 -225.491 1.00 0.00 ?  54 TYR I CE1  1  
ATOM 10718  C CE2  . TYR I  1 54 ? 4.401   -22.040 -224.632 1.00 0.00 ?  54 TYR I CE2  1  
ATOM 10719  C CZ   . TYR I  1 54 ? 4.799   -23.097 -225.426 1.00 0.00 ?  54 TYR I CZ   1  
ATOM 10720  O OH   . TYR I  1 54 ? 3.866   -23.798 -226.154 1.00 0.00 ?  54 TYR I OH   1  
ATOM 10721  H H    . TYR I  1 54 ? 9.615   -19.533 -222.168 1.00 0.00 ?  54 TYR I H    1  
ATOM 10722  H HA   . TYR I  1 54 ? 9.087   -20.633 -224.769 1.00 0.00 ?  54 TYR I HA   1  
ATOM 10723  H HB2  . TYR I  1 54 ? 8.353   -21.611 -222.614 1.00 0.00 ?  54 TYR I HB2  1  
ATOM 10724  H HB3  . TYR I  1 54 ? 7.202   -20.264 -222.435 1.00 0.00 ?  54 TYR I HB3  1  
ATOM 10725  H HD1  . TYR I  1 54 ? 8.117   -23.023 -224.802 1.00 0.00 ?  54 TYR I HD1  1  
ATOM 10726  H HD2  . TYR I  1 54 ? 5.033   -20.505 -223.274 1.00 0.00 ?  54 TYR I HD2  1  
ATOM 10727  H HE1  . TYR I  1 54 ? 6.442   -24.289 -226.118 1.00 0.00 ?  54 TYR I HE1  1  
ATOM 10728  H HE2  . TYR I  1 54 ? 3.349   -21.756 -224.581 1.00 0.00 ?  54 TYR I HE2  1  
ATOM 10729  H HH   . TYR I  1 54 ? 3.035   -23.915 -225.687 1.00 0.00 ?  54 TYR I HH   1  
ATOM 10730  N N    . ASN I  1 55 ? 7.762   -17.759 -224.172 1.00 0.00 ?  55 ASN I N    1  
ATOM 10731  C CA   . ASN I  1 55 ? 7.138   -16.625 -224.843 1.00 0.00 ?  55 ASN I CA   1  
ATOM 10732  C C    . ASN I  1 55 ? 7.777   -16.368 -226.201 1.00 0.00 ?  55 ASN I C    1  
ATOM 10733  O O    . ASN I  1 55 ? 7.090   -16.041 -227.169 1.00 0.00 ?  55 ASN I O    1  
ATOM 10734  C CB   . ASN I  1 55 ? 7.201   -15.372 -223.988 1.00 0.00 ?  55 ASN I CB   1  
ATOM 10735  C CG   . ASN I  1 55 ? 6.260   -15.392 -222.816 1.00 0.00 ?  55 ASN I CG   1  
ATOM 10736  O OD1  . ASN I  1 55 ? 5.290   -16.157 -222.785 1.00 0.00 ?  55 ASN I OD1  1  
ATOM 10737  N ND2  . ASN I  1 55 ? 6.494   -14.497 -221.889 1.00 0.00 ?  55 ASN I ND2  1  
ATOM 10738  H H    . ASN I  1 55 ? 8.184   -17.623 -223.265 1.00 0.00 ?  55 ASN I H    1  
ATOM 10739  H HA   . ASN I  1 55 ? 6.085   -16.841 -225.032 1.00 0.00 ?  55 ASN I HA   1  
ATOM 10740  H HB2  . ASN I  1 55 ? 8.160   -14.960 -223.671 1.00 0.00 ?  55 ASN I HB2  1  
ATOM 10741  H HB3  . ASN I  1 55 ? 6.775   -14.741 -224.769 1.00 0.00 ?  55 ASN I HB3  1  
ATOM 10742  H HD21 . ASN I  1 55 ? 7.258   -13.860 -221.991 1.00 0.00 ?  55 ASN I HD21 1  
ATOM 10743  H HD22 . ASN I  1 55 ? 5.909   -14.452 -221.079 1.00 0.00 ?  55 ASN I HD22 1  
ATOM 10744  N N    . LEU I  1 56 ? 9.096   -16.518 -226.267 1.00 0.00 ?  56 LEU I N    1  
ATOM 10745  C CA   . LEU I  1 56 ? 9.827   -16.328 -227.514 1.00 0.00 ?  56 LEU I CA   1  
ATOM 10746  C C    . LEU I  1 56 ? 9.792   -17.587 -228.371 1.00 0.00 ?  56 LEU I C    1  
ATOM 10747  O O    . LEU I  1 56 ? 9.920   -17.522 -229.593 1.00 0.00 ?  56 LEU I O    1  
ATOM 10748  C CB   . LEU I  1 56 ? 11.277  -15.922 -227.222 1.00 0.00 ?  56 LEU I CB   1  
ATOM 10749  C CG   . LEU I  1 56 ? 11.446  -14.579 -226.500 1.00 0.00 ?  56 LEU I CG   1  
ATOM 10750  C CD1  . LEU I  1 56 ? 12.923  -14.302 -226.253 1.00 0.00 ?  56 LEU I CD1  1  
ATOM 10751  C CD2  . LEU I  1 56 ? 10.822  -13.471 -227.335 1.00 0.00 ?  56 LEU I CD2  1  
ATOM 10752  H H    . LEU I  1 56 ? 9.605   -16.770 -225.432 1.00 0.00 ?  56 LEU I H    1  
ATOM 10753  H HA   . LEU I  1 56 ? 9.352   -15.542 -228.100 1.00 0.00 ?  56 LEU I HA   1  
ATOM 10754  H HB2  . LEU I  1 56 ? 11.560  -16.740 -226.560 1.00 0.00 ?  56 LEU I HB2  1  
ATOM 10755  H HB3  . LEU I  1 56 ? 11.894  -15.952 -228.120 1.00 0.00 ?  56 LEU I HB3  1  
ATOM 10756  H HG   . LEU I  1 56 ? 10.892  -14.643 -225.563 1.00 0.00 ?  56 LEU I HG   1  
ATOM 10757  H HD11 . LEU I  1 56 ? 13.033  -13.346 -225.740 1.00 0.00 ?  56 LEU I HD11 1  
ATOM 10758  H HD12 . LEU I  1 56 ? 13.343  -15.095 -225.634 1.00 0.00 ?  56 LEU I HD12 1  
ATOM 10759  H HD13 . LEU I  1 56 ? 13.450  -14.265 -227.205 1.00 0.00 ?  56 LEU I HD13 1  
ATOM 10760  H HD21 . LEU I  1 56 ? 9.760   -13.675 -227.476 1.00 0.00 ?  56 LEU I HD21 1  
ATOM 10761  H HD22 . LEU I  1 56 ? 10.942  -12.517 -226.821 1.00 0.00 ?  56 LEU I HD22 1  
ATOM 10762  H HD23 . LEU I  1 56 ? 11.315  -13.425 -228.307 1.00 0.00 ?  56 LEU I HD23 1  
ATOM 10763  N N    . TYR I  1 57 ? 9.617   -18.733 -227.722 1.00 0.00 ?  57 TYR I N    1  
ATOM 10764  C CA   . TYR I  1 57 ? 9.427   -19.994 -228.430 1.00 0.00 ?  57 TYR I CA   1  
ATOM 10765  C C    . TYR I  1 57 ? 8.366   -19.861 -229.515 1.00 0.00 ?  57 TYR I C    1  
ATOM 10766  O O    . TYR I  1 57 ? 8.467   -20.480 -230.574 1.00 0.00 ?  57 TYR I O    1  
ATOM 10767  C CB   . TYR I  1 57 ? 9.041   -21.105 -227.451 1.00 0.00 ?  57 TYR I CB   1  
ATOM 10768  C CG   . TYR I  1 57 ? 8.903   -22.467 -228.094 1.00 0.00 ?  57 TYR I CG   1  
ATOM 10769  C CD1  . TYR I  1 57 ? 10.018  -23.252 -228.348 1.00 0.00 ?  57 TYR I CD1  1  
ATOM 10770  C CD2  . TYR I  1 57 ? 7.656   -22.966 -228.442 1.00 0.00 ?  57 TYR I CD2  1  
ATOM 10771  C CE1  . TYR I  1 57 ? 9.897   -24.496 -228.936 1.00 0.00 ?  57 TYR I CE1  1  
ATOM 10772  C CE2  . TYR I  1 57 ? 7.523   -24.209 -229.029 1.00 0.00 ?  57 TYR I CE2  1  
ATOM 10773  C CZ   . TYR I  1 57 ? 8.647   -24.972 -229.274 1.00 0.00 ?  57 TYR I CZ   1  
ATOM 10774  O OH   . TYR I  1 57 ? 8.520   -26.212 -229.858 1.00 0.00 ?  57 TYR I OH   1  
ATOM 10775  H H    . TYR I  1 57 ? 9.615   -18.732 -226.712 1.00 0.00 ?  57 TYR I H    1  
ATOM 10776  H HA   . TYR I  1 57 ? 10.351  -20.279 -228.933 1.00 0.00 ?  57 TYR I HA   1  
ATOM 10777  H HB2  . TYR I  1 57 ? 9.815   -21.142 -226.683 1.00 0.00 ?  57 TYR I HB2  1  
ATOM 10778  H HB3  . TYR I  1 57 ? 8.092   -20.819 -226.997 1.00 0.00 ?  57 TYR I HB3  1  
ATOM 10779  H HD1  . TYR I  1 57 ? 11.003  -22.870 -228.078 1.00 0.00 ?  57 TYR I HD1  1  
ATOM 10780  H HD2  . TYR I  1 57 ? 6.773   -22.358 -228.246 1.00 0.00 ?  57 TYR I HD2  1  
ATOM 10781  H HE1  . TYR I  1 57 ? 10.782  -25.102 -229.130 1.00 0.00 ?  57 TYR I HE1  1  
ATOM 10782  H HE2  . TYR I  1 57 ? 6.535   -24.583 -229.297 1.00 0.00 ?  57 TYR I HE2  1  
ATOM 10783  H HH   . TYR I  1 57 ? 7.788   -26.721 -229.502 1.00 0.00 ?  57 TYR I HH   1  
ATOM 10784  N N    . ARG I  1 58 ? 7.348   -19.051 -229.244 1.00 0.00 ?  58 ARG I N    1  
ATOM 10785  C CA   . ARG I  1 58 ? 6.282   -18.811 -230.209 1.00 0.00 ?  58 ARG I CA   1  
ATOM 10786  C C    . ARG I  1 58 ? 6.487   -17.491 -230.941 1.00 0.00 ?  58 ARG I C    1  
ATOM 10787  O O    . ARG I  1 58 ? 6.372   -17.423 -232.164 1.00 0.00 ?  58 ARG I O    1  
ATOM 10788  C CB   . ARG I  1 58 ? 4.902   -18.886 -229.572 1.00 0.00 ?  58 ARG I CB   1  
ATOM 10789  C CG   . ARG I  1 58 ? 4.607   -20.184 -228.836 1.00 0.00 ?  58 ARG I CG   1  
ATOM 10790  C CD   . ARG I  1 58 ? 4.417   -21.360 -229.723 1.00 0.00 ?  58 ARG I CD   1  
ATOM 10791  N NE   . ARG I  1 58 ? 4.145   -22.605 -229.022 1.00 0.00 ?  58 ARG I NE   1  
ATOM 10792  C CZ   . ARG I  1 58 ? 3.965   -23.797 -229.623 1.00 0.00 ?  58 ARG I CZ   1  
ATOM 10793  N NH1  . ARG I  1 58 ? 3.990   -23.907 -230.933 1.00 0.00 1  58 ARG I NH1  1  
ATOM 10794  N NH2  . ARG I  1 58 ? 3.739   -24.853 -228.860 1.00 0.00 ?  58 ARG I NH2  1  
ATOM 10795  H H    . ARG I  1 58 ? 7.312   -18.589 -228.347 1.00 0.00 ?  58 ARG I H    1  
ATOM 10796  H HA   . ARG I  1 58 ? 6.291   -19.592 -230.971 1.00 0.00 ?  58 ARG I HA   1  
ATOM 10797  H HB2  . ARG I  1 58 ? 4.829   -18.053 -228.874 1.00 0.00 ?  58 ARG I HB2  1  
ATOM 10798  H HB3  . ARG I  1 58 ? 4.175   -18.754 -230.372 1.00 0.00 ?  58 ARG I HB3  1  
ATOM 10799  H HG2  . ARG I  1 58 ? 5.439   -20.400 -228.166 1.00 0.00 ?  58 ARG I HG2  1  
ATOM 10800  H HG3  . ARG I  1 58 ? 3.695   -20.051 -228.253 1.00 0.00 ?  58 ARG I HG3  1  
ATOM 10801  H HD2  . ARG I  1 58 ? 3.576   -21.170 -230.388 1.00 0.00 ?  58 ARG I HD2  1  
ATOM 10802  H HD3  . ARG I  1 58 ? 5.321   -21.508 -230.313 1.00 0.00 ?  58 ARG I HD3  1  
ATOM 10803  H HE   . ARG I  1 58 ? 4.051   -22.779 -228.030 1.00 0.00 ?  58 ARG I HE   1  
ATOM 10804  H HH11 . ARG I  1 58 ? 4.146   -23.087 -231.502 1.00 0.00 ?  58 ARG I HH11 1  
ATOM 10805  H HH12 . ARG I  1 58 ? 3.852   -24.809 -231.364 1.00 0.00 ?  58 ARG I HH12 1  
ATOM 10806  H HH21 . ARG I  1 58 ? 3.706   -24.748 -227.855 1.00 0.00 ?  58 ARG I HH21 1  
ATOM 10807  H HH22 . ARG I  1 58 ? 3.600   -25.758 -229.284 1.00 0.00 ?  58 ARG I HH22 1  
ATOM 10808  N N    . ASN I  1 59 ? 6.793   -16.443 -230.183 1.00 0.00 ?  59 ASN I N    1  
ATOM 10809  C CA   . ASN I  1 59 ? 6.909   -15.101 -230.743 1.00 0.00 ?  59 ASN I CA   1  
ATOM 10810  C C    . ASN I  1 59 ? 8.072   -15.013 -231.723 1.00 0.00 ?  59 ASN I C    1  
ATOM 10811  O O    . ASN I  1 59 ? 7.879   -14.734 -232.906 1.00 0.00 ?  59 ASN I O    1  
ATOM 10812  C CB   . ASN I  1 59 ? 7.061   -14.056 -229.653 1.00 0.00 ?  59 ASN I CB   1  
ATOM 10813  C CG   . ASN I  1 59 ? 6.900   -12.644 -230.142 1.00 0.00 ?  59 ASN I CG   1  
ATOM 10814  O OD1  . ASN I  1 59 ? 6.988   -12.368 -231.344 1.00 0.00 ?  59 ASN I OD1  1  
ATOM 10815  N ND2  . ASN I  1 59 ? 6.746   -11.738 -229.211 1.00 0.00 ?  59 ASN I ND2  1  
ATOM 10816  H H    . ASN I  1 59 ? 6.948   -16.578 -229.195 1.00 0.00 ?  59 ASN I H    1  
ATOM 10817  H HA   . ASN I  1 59 ? 6.009   -14.857 -231.309 1.00 0.00 ?  59 ASN I HA   1  
ATOM 10818  H HB2  . ASN I  1 59 ? 6.543   -14.166 -228.699 1.00 0.00 ?  59 ASN I HB2  1  
ATOM 10819  H HB3  . ASN I  1 59 ? 8.123   -14.262 -229.516 1.00 0.00 ?  59 ASN I HB3  1  
ATOM 10820  H HD21 . ASN I  1 59 ? 6.742   -12.006 -228.248 1.00 0.00 ?  59 ASN I HD21 1  
ATOM 10821  H HD22 . ASN I  1 59 ? 6.633   -10.776 -229.463 1.00 0.00 ?  59 ASN I HD22 1  
ATOM 10822  N N    . ALA I  1 60 ? 9.280   -15.252 -231.223 1.00 0.00 ?  60 ALA I N    1  
ATOM 10823  C CA   . ALA I  1 60 ? 10.483  -15.136 -232.039 1.00 0.00 ?  60 ALA I CA   1  
ATOM 10824  C C    . ALA I  1 60 ? 10.463  -16.129 -233.194 1.00 0.00 ?  60 ALA I C    1  
ATOM 10825  O O    . ALA I  1 60 ? 10.950  -15.835 -234.286 1.00 0.00 ?  60 ALA I O    1  
ATOM 10826  C CB   . ALA I  1 60 ? 11.725  -15.338 -231.182 1.00 0.00 ?  60 ALA I CB   1  
ATOM 10827  H H    . ALA I  1 60 ? 9.367   -15.521 -230.254 1.00 0.00 ?  60 ALA I H    1  
ATOM 10828  H HA   . ALA I  1 60 ? 10.518  -14.136 -232.470 1.00 0.00 ?  60 ALA I HA   1  
ATOM 10829  H HB1  . ALA I  1 60 ? 11.697  -16.329 -230.731 1.00 0.00 ?  60 ALA I HB1  1  
ATOM 10830  H HB2  . ALA I  1 60 ? 12.614  -15.249 -231.806 1.00 0.00 ?  60 ALA I HB2  1  
ATOM 10831  H HB3  . ALA I  1 60 ? 11.754  -14.582 -230.398 1.00 0.00 ?  60 ALA I HB3  1  
ATOM 10832  N N    . GLN I  1 61 ? 9.898   -17.305 -232.947 1.00 0.00 ?  61 GLN I N    1  
ATOM 10833  C CA   . GLN I  1 61 ? 9.734   -18.311 -233.990 1.00 0.00 ?  61 GLN I CA   1  
ATOM 10834  C C    . GLN I  1 61 ? 8.981   -17.745 -235.187 1.00 0.00 ?  61 GLN I C    1  
ATOM 10835  O O    . GLN I  1 61 ? 9.467   -17.794 -236.317 1.00 0.00 ?  61 GLN I O    1  
ATOM 10836  C CB   . GLN I  1 61 ? 8.991   -19.533 -233.444 1.00 0.00 ?  61 GLN I CB   1  
ATOM 10837  C CG   . GLN I  1 61 ? 8.797   -20.648 -234.458 1.00 0.00 ?  61 GLN I CG   1  
ATOM 10838  C CD   . GLN I  1 61 ? 8.002   -21.810 -233.895 1.00 0.00 ?  61 GLN I CD   1  
ATOM 10839  O OE1  . GLN I  1 61 ? 7.473   -21.738 -232.782 1.00 0.00 ?  61 GLN I OE1  1  
ATOM 10840  N NE2  . GLN I  1 61 ? 7.916   -22.893 -234.660 1.00 0.00 ?  61 GLN I NE2  1  
ATOM 10841  H H    . GLN I  1 61 ? 9.573   -17.509 -232.012 1.00 0.00 ?  61 GLN I H    1  
ATOM 10842  H HA   . GLN I  1 61 ? 10.713  -18.619 -234.357 1.00 0.00 ?  61 GLN I HA   1  
ATOM 10843  H HB2  . GLN I  1 61 ? 9.571   -19.902 -232.597 1.00 0.00 ?  61 GLN I HB2  1  
ATOM 10844  H HB3  . GLN I  1 61 ? 8.021   -19.181 -233.093 1.00 0.00 ?  61 GLN I HB3  1  
ATOM 10845  H HG2  . GLN I  1 61 ? 8.449   -20.466 -235.475 1.00 0.00 ?  61 GLN I HG2  1  
ATOM 10846  H HG3  . GLN I  1 61 ? 9.850   -20.929 -234.481 1.00 0.00 ?  61 GLN I HG3  1  
ATOM 10847  H HE21 . GLN I  1 61 ? 8.361   -22.910 -235.555 1.00 0.00 ?  61 GLN I HE21 1  
ATOM 10848  H HE22 . GLN I  1 61 ? 7.405   -23.692 -234.341 1.00 0.00 ?  61 GLN I HE22 1  
ATOM 10849  N N    . SER I  1 62 ? 7.794   -17.207 -234.932 1.00 0.00 ?  62 SER I N    1  
ATOM 10850  C CA   . SER I  1 62 ? 6.940   -16.695 -235.998 1.00 0.00 ?  62 SER I CA   1  
ATOM 10851  C C    . SER I  1 62 ? 7.529   -15.434 -236.618 1.00 0.00 ?  62 SER I C    1  
ATOM 10852  O O    . SER I  1 62 ? 7.275   -15.126 -237.782 1.00 0.00 ?  62 SER I O    1  
ATOM 10853  C CB   . SER I  1 62 ? 5.547   -16.420 -235.465 1.00 0.00 ?  62 SER I CB   1  
ATOM 10854  O OG   . SER I  1 62 ? 5.521   -15.315 -234.604 1.00 0.00 ?  62 SER I OG   1  
ATOM 10855  H H    . SER I  1 62 ? 7.473   -17.151 -233.976 1.00 0.00 ?  62 SER I H    1  
ATOM 10856  H HA   . SER I  1 62 ? 6.733   -17.429 -236.777 1.00 0.00 ?  62 SER I HA   1  
ATOM 10857  H HB2  . SER I  1 62 ? 4.883   -16.230 -236.307 1.00 0.00 ?  62 SER I HB2  1  
ATOM 10858  H HB3  . SER I  1 62 ? 5.201   -17.300 -234.923 1.00 0.00 ?  62 SER I HB3  1  
ATOM 10859  H HG   . SER I  1 62 ? 6.222   -15.400 -233.953 1.00 0.00 ?  62 SER I HG   1  
ATOM 10860  N N    . ASN I  1 63 ? 8.316   -14.707 -235.832 1.00 0.00 ?  63 ASN I N    1  
ATOM 10861  C CA   . ASN I  1 63 ? 8.945   -13.479 -236.303 1.00 0.00 ?  63 ASN I CA   1  
ATOM 10862  C C    . ASN I  1 63 ? 9.973   -13.768 -237.390 1.00 0.00 ?  63 ASN I C    1  
ATOM 10863  O O    . ASN I  1 63 ? 9.981   -13.122 -238.438 1.00 0.00 ?  63 ASN I O    1  
ATOM 10864  C CB   . ASN I  1 63 ? 9.589   -12.712 -235.163 1.00 0.00 ?  63 ASN I CB   1  
ATOM 10865  C CG   . ASN I  1 63 ? 8.600   -12.043 -234.249 1.00 0.00 ?  63 ASN I CG   1  
ATOM 10866  O OD1  . ASN I  1 63 ? 7.491   -11.680 -234.660 1.00 0.00 ?  63 ASN I OD1  1  
ATOM 10867  N ND2  . ASN I  1 63 ? 9.025   -11.804 -233.035 1.00 0.00 ?  63 ASN I ND2  1  
ATOM 10868  H H    . ASN I  1 63 ? 8.484   -15.013 -234.884 1.00 0.00 ?  63 ASN I H    1  
ATOM 10869  H HA   . ASN I  1 63 ? 8.194   -12.828 -236.754 1.00 0.00 ?  63 ASN I HA   1  
ATOM 10870  H HB2  . ASN I  1 63 ? 10.381  -13.163 -234.564 1.00 0.00 ?  63 ASN I HB2  1  
ATOM 10871  H HB3  . ASN I  1 63 ? 10.018  -11.961 -235.826 1.00 0.00 ?  63 ASN I HB3  1  
ATOM 10872  H HD21 . ASN I  1 63 ? 9.952   -12.064 -232.770 1.00 0.00 ?  63 ASN I HD21 1  
ATOM 10873  H HD22 . ASN I  1 63 ? 8.420   -11.361 -232.372 1.00 0.00 ?  63 ASN I HD22 1  
ATOM 10874  N N    . THR I  1 64 ? 10.839  -14.742 -237.133 1.00 0.00 ?  64 THR I N    1  
ATOM 10875  C CA   . THR I  1 64 ? 11.897  -15.093 -238.073 1.00 0.00 ?  64 THR I CA   1  
ATOM 10876  C C    . THR I  1 64 ? 11.322  -15.670 -239.360 1.00 0.00 ?  64 THR I C    1  
ATOM 10877  O O    . THR I  1 64 ? 11.825  -15.399 -240.451 1.00 0.00 ?  64 THR I O    1  
ATOM 10878  C CB   . THR I  1 64 ? 12.881  -16.109 -237.462 1.00 0.00 ?  64 THR I CB   1  
ATOM 10879  O OG1  . THR I  1 64 ? 12.167  -17.282 -237.052 1.00 0.00 ?  64 THR I OG1  1  
ATOM 10880  C CG2  . THR I  1 64 ? 13.592  -15.507 -236.261 1.00 0.00 ?  64 THR I CG2  1  
ATOM 10881  H H    . THR I  1 64 ? 10.762  -15.253 -236.265 1.00 0.00 ?  64 THR I H    1  
ATOM 10882  H HA   . THR I  1 64 ? 12.451  -14.198 -238.356 1.00 0.00 ?  64 THR I HA   1  
ATOM 10883  H HB   . THR I  1 64 ? 13.616  -16.388 -238.217 1.00 0.00 ?  64 THR I HB   1  
ATOM 10884  H HG1  . THR I  1 64 ? 12.782  -17.914 -236.672 1.00 0.00 ?  64 THR I HG1  1  
ATOM 10885  H HG21 . THR I  1 64 ? 14.283  -16.239 -235.843 1.00 0.00 ?  64 THR I HG21 1  
ATOM 10886  H HG22 . THR I  1 64 ? 14.146  -14.621 -236.572 1.00 0.00 ?  64 THR I HG22 1  
ATOM 10887  H HG23 . THR I  1 64 ? 12.858  -15.229 -235.506 1.00 0.00 ?  64 THR I HG23 1  
ATOM 10888  N N    . VAL I  1 65 ? 10.266  -16.465 -239.227 1.00 0.00 ?  65 VAL I N    1  
ATOM 10889  C CA   . VAL I  1 65 ? 9.581   -17.029 -240.383 1.00 0.00 ?  65 VAL I CA   1  
ATOM 10890  C C    . VAL I  1 65 ? 8.949   -15.937 -241.236 1.00 0.00 ?  65 VAL I C    1  
ATOM 10891  O O    . VAL I  1 65 ? 9.025   -15.973 -242.464 1.00 0.00 ?  65 VAL I O    1  
ATOM 10892  C CB   . VAL I  1 65 ? 8.492   -18.033 -239.961 1.00 0.00 ?  65 VAL I CB   1  
ATOM 10893  C CG1  . VAL I  1 65 ? 7.649   -18.440 -241.160 1.00 0.00 ?  65 VAL I CG1  1  
ATOM 10894  C CG2  . VAL I  1 65 ? 9.118   -19.257 -239.312 1.00 0.00 ?  65 VAL I CG2  1  
ATOM 10895  H H    . VAL I  1 65 ? 9.930   -16.684 -238.300 1.00 0.00 ?  65 VAL I H    1  
ATOM 10896  H HA   . VAL I  1 65 ? 10.280  -17.535 -241.051 1.00 0.00 ?  65 VAL I HA   1  
ATOM 10897  H HB   . VAL I  1 65 ? 7.854   -17.567 -239.209 1.00 0.00 ?  65 VAL I HB   1  
ATOM 10898  H HG11 . VAL I  1 65 ? 6.884   -19.149 -240.843 1.00 0.00 ?  65 VAL I HG11 1  
ATOM 10899  H HG12 . VAL I  1 65 ? 7.171   -17.557 -241.585 1.00 0.00 ?  65 VAL I HG12 1  
ATOM 10900  H HG13 . VAL I  1 65 ? 8.286   -18.906 -241.911 1.00 0.00 ?  65 VAL I HG13 1  
ATOM 10901  H HG21 . VAL I  1 65 ? 9.681   -18.954 -238.429 1.00 0.00 ?  65 VAL I HG21 1  
ATOM 10902  H HG22 . VAL I  1 65 ? 8.335   -19.955 -239.019 1.00 0.00 ?  65 VAL I HG22 1  
ATOM 10903  H HG23 . VAL I  1 65 ? 9.789   -19.741 -240.022 1.00 0.00 ?  65 VAL I HG23 1  
ATOM 10904  N N    . LYS I  1 66 ? 8.324   -14.967 -240.578 1.00 0.00 ?  66 LYS I N    1  
ATOM 10905  C CA   . LYS I  1 66 ? 7.751   -13.818 -241.268 1.00 0.00 ?  66 LYS I CA   1  
ATOM 10906  C C    . LYS I  1 66 ? 8.797   -13.110 -242.121 1.00 0.00 ?  66 LYS I C    1  
ATOM 10907  O O    . LYS I  1 66 ? 8.556   -12.806 -243.289 1.00 0.00 ?  66 LYS I O    1  
ATOM 10908  C CB   . LYS I  1 66 ? 7.141   -12.838 -240.264 1.00 0.00 ?  66 LYS I CB   1  
ATOM 10909  C CG   . LYS I  1 66 ? 6.559   -11.578 -240.889 1.00 0.00 ?  66 LYS I CG   1  
ATOM 10910  C CD   . LYS I  1 66 ? 6.027   -10.628 -239.826 1.00 0.00 ?  66 LYS I CD   1  
ATOM 10911  C CE   . LYS I  1 66 ? 5.535   -9.326  -240.442 1.00 0.00 ?  66 LYS I CE   1  
ATOM 10912  N NZ   . LYS I  1 66 ? 6.655   -8.503  -240.973 1.00 0.00 1  66 LYS I NZ   1  
ATOM 10913  H H    . LYS I  1 66 ? 8.244   -15.026 -239.573 1.00 0.00 ?  66 LYS I H    1  
ATOM 10914  H HA   . LYS I  1 66 ? 6.968   -14.150 -241.950 1.00 0.00 ?  66 LYS I HA   1  
ATOM 10915  H HB2  . LYS I  1 66 ? 6.355   -13.375 -239.732 1.00 0.00 ?  66 LYS I HB2  1  
ATOM 10916  H HB3  . LYS I  1 66 ? 7.930   -12.564 -239.564 1.00 0.00 ?  66 LYS I HB3  1  
ATOM 10917  H HG2  . LYS I  1 66 ? 7.343   -11.081 -241.462 1.00 0.00 ?  66 LYS I HG2  1  
ATOM 10918  H HG3  . LYS I  1 66 ? 5.748   -11.865 -241.558 1.00 0.00 ?  66 LYS I HG3  1  
ATOM 10919  H HD2  . LYS I  1 66 ? 5.204   -11.117 -239.303 1.00 0.00 ?  66 LYS I HD2  1  
ATOM 10920  H HD3  . LYS I  1 66 ? 6.829   -10.414 -239.120 1.00 0.00 ?  66 LYS I HD3  1  
ATOM 10921  H HE2  . LYS I  1 66 ? 4.848   -9.569  -241.251 1.00 0.00 ?  66 LYS I HE2  1  
ATOM 10922  H HE3  . LYS I  1 66 ? 5.005   -8.764  -239.673 1.00 0.00 ?  66 LYS I HE3  1  
ATOM 10923  H HZ1  . LYS I  1 66 ? 7.146   -9.023  -241.686 1.00 0.00 ?  66 LYS I HZ1  1  
ATOM 10924  H HZ2  . LYS I  1 66 ? 6.287   -7.651  -241.372 1.00 0.00 ?  66 LYS I HZ2  1  
ATOM 10925  H HZ3  . LYS I  1 66 ? 7.293   -8.277  -240.223 1.00 0.00 ?  66 LYS I HZ3  1  
ATOM 10926  N N    . VAL I  1 67 ? 9.958   -12.850 -241.529 1.00 0.00 ?  67 VAL I N    1  
ATOM 10927  C CA   . VAL I  1 67 ? 11.013  -12.107 -242.207 1.00 0.00 ?  67 VAL I CA   1  
ATOM 10928  C C    . VAL I  1 67 ? 11.520  -12.862 -243.429 1.00 0.00 ?  67 VAL I C    1  
ATOM 10929  O O    . VAL I  1 67 ? 11.731  -12.275 -244.490 1.00 0.00 ?  67 VAL I O    1  
ATOM 10930  C CB   . VAL I  1 67 ? 12.198  -11.821 -241.265 1.00 0.00 ?  67 VAL I CB   1  
ATOM 10931  C CG1  . VAL I  1 67 ? 13.379  -11.268 -242.048 1.00 0.00 ?  67 VAL I CG1  1  
ATOM 10932  C CG2  . VAL I  1 67 ? 11.785  -10.850 -240.170 1.00 0.00 ?  67 VAL I CG2  1  
ATOM 10933  H H    . VAL I  1 67 ? 10.113  -13.175 -240.586 1.00 0.00 ?  67 VAL I H    1  
ATOM 10934  H HA   . VAL I  1 67 ? 10.643  -11.159 -242.598 1.00 0.00 ?  67 VAL I HA   1  
ATOM 10935  H HB   . VAL I  1 67 ? 12.490  -12.748 -240.772 1.00 0.00 ?  67 VAL I HB   1  
ATOM 10936  H HG11 . VAL I  1 67 ? 14.208  -11.072 -241.366 1.00 0.00 ?  67 VAL I HG11 1  
ATOM 10937  H HG12 . VAL I  1 67 ? 13.692  -11.995 -242.797 1.00 0.00 ?  67 VAL I HG12 1  
ATOM 10938  H HG13 . VAL I  1 67 ? 13.088  -10.340 -242.540 1.00 0.00 ?  67 VAL I HG13 1  
ATOM 10939  H HG21 . VAL I  1 67 ? 10.968  -11.281 -239.591 1.00 0.00 ?  67 VAL I HG21 1  
ATOM 10940  H HG22 . VAL I  1 67 ? 12.633  -10.659 -239.513 1.00 0.00 ?  67 VAL I HG22 1  
ATOM 10941  H HG23 . VAL I  1 67 ? 11.456  -9.913  -240.620 1.00 0.00 ?  67 VAL I HG23 1  
ATOM 10942  N N    . PHE I  1 68 ? 11.714  -14.167 -243.274 1.00 0.00 ?  68 PHE I N    1  
ATOM 10943  C CA   . PHE I  1 68 ? 12.147  -15.015 -244.379 1.00 0.00 ?  68 PHE I CA   1  
ATOM 10944  C C    . PHE I  1 68 ? 11.071  -15.113 -245.452 1.00 0.00 ?  68 PHE I C    1  
ATOM 10945  O O    . PHE I  1 68 ? 11.368  -15.348 -246.623 1.00 0.00 ?  68 PHE I O    1  
ATOM 10946  C CB   . PHE I  1 68 ? 12.513  -16.410 -243.870 1.00 0.00 ?  68 PHE I CB   1  
ATOM 10947  C CG   . PHE I  1 68 ? 13.895  -16.501 -243.289 1.00 0.00 ?  68 PHE I CG   1  
ATOM 10948  C CD1  . PHE I  1 68 ? 15.013  -16.329 -244.090 1.00 0.00 ?  68 PHE I CD1  1  
ATOM 10949  C CD2  . PHE I  1 68 ? 14.080  -16.757 -241.938 1.00 0.00 ?  68 PHE I CD2  1  
ATOM 10950  C CE1  . PHE I  1 68 ? 16.285  -16.413 -243.558 1.00 0.00 ?  68 PHE I CE1  1  
ATOM 10951  C CE2  . PHE I  1 68 ? 15.351  -16.840 -241.402 1.00 0.00 ?  68 PHE I CE2  1  
ATOM 10952  C CZ   . PHE I  1 68 ? 16.454  -16.669 -242.212 1.00 0.00 ?  68 PHE I CZ   1  
ATOM 10953  H H    . PHE I  1 68 ? 11.558  -14.583 -242.367 1.00 0.00 ?  68 PHE I H    1  
ATOM 10954  H HA   . PHE I  1 68 ? 13.024  -14.578 -244.858 1.00 0.00 ?  68 PHE I HA   1  
ATOM 10955  H HB2  . PHE I  1 68 ? 11.824  -16.716 -243.084 1.00 0.00 ?  68 PHE I HB2  1  
ATOM 10956  H HB3  . PHE I  1 68 ? 12.472  -17.129 -244.687 1.00 0.00 ?  68 PHE I HB3  1  
ATOM 10957  H HD1  . PHE I  1 68 ? 14.880  -16.127 -245.154 1.00 0.00 ?  68 PHE I HD1  1  
ATOM 10958  H HD2  . PHE I  1 68 ? 13.208  -16.894 -241.298 1.00 0.00 ?  68 PHE I HD2  1  
ATOM 10959  H HE1  . PHE I  1 68 ? 17.156  -16.277 -244.199 1.00 0.00 ?  68 PHE I HE1  1  
ATOM 10960  H HE2  . PHE I  1 68 ? 15.481  -17.042 -240.339 1.00 0.00 ?  68 PHE I HE2  1  
ATOM 10961  H HZ   . PHE I  1 68 ? 17.456  -16.733 -241.790 1.00 0.00 ?  68 PHE I HZ   1  
ATOM 10962  N N    . LYS I  1 69 ? 9.819   -14.933 -245.045 1.00 0.00 ?  69 LYS I N    1  
ATOM 10963  C CA   . LYS I  1 69 ? 8.711   -14.847 -245.989 1.00 0.00 ?  69 LYS I CA   1  
ATOM 10964  C C    . LYS I  1 69 ? 8.624   -13.459 -246.611 1.00 0.00 ?  69 LYS I C    1  
ATOM 10965  O O    . LYS I  1 69 ? 8.174   -13.304 -247.746 1.00 0.00 ?  69 LYS I O    1  
ATOM 10966  C CB   . LYS I  1 69 ? 7.392   -15.198 -245.301 1.00 0.00 ?  69 LYS I CB   1  
ATOM 10967  C CG   . LYS I  1 69 ? 6.228   -15.437 -246.255 1.00 0.00 ?  69 LYS I CG   1  
ATOM 10968  C CD   . LYS I  1 69 ? 5.462   -14.150 -246.526 1.00 0.00 ?  69 LYS I CD   1  
ATOM 10969  C CE   . LYS I  1 69 ? 4.293   -14.390 -247.469 1.00 0.00 ?  69 LYS I CE   1  
ATOM 10970  N NZ   . LYS I  1 69 ? 3.680   -13.115 -247.931 1.00 0.00 1  69 LYS I NZ   1  
ATOM 10971  H H    . LYS I  1 69 ? 9.629   -14.854 -244.056 1.00 0.00 ?  69 LYS I H    1  
ATOM 10972  H HA   . LYS I  1 69 ? 8.872   -15.546 -246.811 1.00 0.00 ?  69 LYS I HA   1  
ATOM 10973  H HB2  . LYS I  1 69 ? 7.568   -16.099 -244.712 1.00 0.00 ?  69 LYS I HB2  1  
ATOM 10974  H HB3  . LYS I  1 69 ? 7.149   -14.371 -244.633 1.00 0.00 ?  69 LYS I HB3  1  
ATOM 10975  H HG2  . LYS I  1 69 ? 6.624   -15.829 -247.192 1.00 0.00 ?  69 LYS I HG2  1  
ATOM 10976  H HG3  . LYS I  1 69 ? 5.559   -16.171 -245.808 1.00 0.00 ?  69 LYS I HG3  1  
ATOM 10977  H HD2  . LYS I  1 69 ? 5.091   -13.761 -245.577 1.00 0.00 ?  69 LYS I HD2  1  
ATOM 10978  H HD3  . LYS I  1 69 ? 6.145   -13.427 -246.971 1.00 0.00 ?  69 LYS I HD3  1  
ATOM 10979  H HE2  . LYS I  1 69 ? 4.657   -14.950 -248.329 1.00 0.00 ?  69 LYS I HE2  1  
ATOM 10980  H HE3  . LYS I  1 69 ? 3.545   -14.982 -246.942 1.00 0.00 ?  69 LYS I HE3  1  
ATOM 10981  H HZ1  . LYS I  1 69 ? 4.373   -12.566 -248.420 1.00 0.00 ?  69 LYS I HZ1  1  
ATOM 10982  H HZ2  . LYS I  1 69 ? 2.910   -13.317 -248.553 1.00 0.00 ?  69 LYS I HZ2  1  
ATOM 10983  H HZ3  . LYS I  1 69 ? 3.341   -12.595 -247.133 1.00 0.00 ?  69 LYS I HZ3  1  
ATOM 10984  N N    . ASP I  1 70 ? 9.058   -12.452 -245.861 1.00 0.00 ?  70 ASP I N    1  
ATOM 10985  C CA   . ASP I  1 70 ? 9.008   -11.072 -246.327 1.00 0.00 ?  70 ASP I CA   1  
ATOM 10986  C C    . ASP I  1 70 ? 10.006  -10.833 -247.452 1.00 0.00 ?  70 ASP I C    1  
ATOM 10987  O O    . ASP I  1 70 ? 9.727   -10.097 -248.398 1.00 0.00 ?  70 ASP I O    1  
ATOM 10988  C CB   . ASP I  1 70 ? 9.277   -10.104 -245.172 1.00 0.00 ?  70 ASP I CB   1  
ATOM 10989  C CG   . ASP I  1 70 ? 8.112   -9.941  -244.204 1.00 0.00 ?  70 ASP I CG   1  
ATOM 10990  O OD1  . ASP I  1 70 ? 7.031   -10.372 -244.528 1.00 0.00 ?  70 ASP I OD1  1  
ATOM 10991  O OD2  . ASP I  1 70 ? 8.344   -9.531  -243.092 1.00 0.00 -1 70 ASP I OD2  1  
ATOM 10992  H H    . ASP I  1 70 ? 9.433   -12.648 -244.943 1.00 0.00 ?  70 ASP I H    1  
ATOM 10993  H HA   . ASP I  1 70 ? 8.021   -10.857 -246.738 1.00 0.00 ?  70 ASP I HA   1  
ATOM 10994  H HB2  . ASP I  1 70 ? 10.183  -10.337 -244.612 1.00 0.00 ?  70 ASP I HB2  1  
ATOM 10995  H HB3  . ASP I  1 70 ? 9.420   -9.177  -245.728 1.00 0.00 ?  70 ASP I HB3  1  
ATOM 10996  N N    . ILE I  1 71 ? 11.173  -11.461 -247.344 1.00 0.00 ?  71 ILE I N    1  
ATOM 10997  C CA   . ILE I  1 71 ? 12.182  -11.388 -248.393 1.00 0.00 ?  71 ILE I CA   1  
ATOM 10998  C C    . ILE I  1 71 ? 11.789  -12.235 -249.597 1.00 0.00 ?  71 ILE I C    1  
ATOM 10999  O O    . ILE I  1 71 ? 12.264  -12.008 -250.709 1.00 0.00 ?  71 ILE I O    1  
ATOM 11000  C CB   . ILE I  1 71 ? 13.561  -11.846 -247.884 1.00 0.00 ?  71 ILE I CB   1  
ATOM 11001  C CG1  . ILE I  1 71 ? 13.500  -13.301 -247.413 1.00 0.00 ?  71 ILE I CG1  1  
ATOM 11002  C CG2  . ILE I  1 71 ? 14.041  -10.940 -246.760 1.00 0.00 ?  71 ILE I CG2  1  
ATOM 11003  C CD1  . ILE I  1 71 ? 14.832  -13.853 -246.959 1.00 0.00 ?  71 ILE I CD1  1  
ATOM 11004  H H    . ILE I  1 71 ? 11.365  -12.003 -246.514 1.00 0.00 ?  71 ILE I H    1  
ATOM 11005  H HA   . ILE I  1 71 ? 12.259  -10.373 -248.782 1.00 0.00 ?  71 ILE I HA   1  
ATOM 11006  H HB   . ILE I  1 71 ? 14.274  -11.812 -248.707 1.00 0.00 ?  71 ILE I HB   1  
ATOM 11007  H HG12 . ILE I  1 71 ? 12.788  -13.347 -246.590 1.00 0.00 ?  71 ILE I HG12 1  
ATOM 11008  H HG13 . ILE I  1 71 ? 13.127  -13.896 -248.248 1.00 0.00 ?  71 ILE I HG13 1  
ATOM 11009  H HG21 . ILE I  1 71 ? 15.016  -11.278 -246.411 1.00 0.00 ?  71 ILE I HG21 1  
ATOM 11010  H HG22 . ILE I  1 71 ? 14.121  -9.917  -247.126 1.00 0.00 ?  71 ILE I HG22 1  
ATOM 11011  H HG23 . ILE I  1 71 ? 13.329  -10.974 -245.935 1.00 0.00 ?  71 ILE I HG23 1  
ATOM 11012  H HD11 . ILE I  1 71 ? 15.206  -13.261 -246.125 1.00 0.00 ?  71 ILE I HD11 1  
ATOM 11013  H HD12 . ILE I  1 71 ? 14.709  -14.888 -246.641 1.00 0.00 ?  71 ILE I HD12 1  
ATOM 11014  H HD13 . ILE I  1 71 ? 15.545  -13.809 -247.783 1.00 0.00 ?  71 ILE I HD13 1  
ATOM 11015  N N    . ASP I  1 72 ? 10.918  -13.212 -249.367 1.00 0.00 ?  72 ASP I N    1  
ATOM 11016  C CA   . ASP I  1 72 ? 10.285  -13.946 -250.456 1.00 0.00 ?  72 ASP I CA   1  
ATOM 11017  C C    . ASP I  1 72 ? 9.341   -13.050 -251.248 1.00 0.00 ?  72 ASP I C    1  
ATOM 11018  O O    . ASP I  1 72 ? 9.371   -13.035 -252.478 1.00 0.00 ?  72 ASP I O    1  
ATOM 11019  C CB   . ASP I  1 72 ? 9.527   -15.160 -249.915 1.00 0.00 ?  72 ASP I CB   1  
ATOM 11020  C CG   . ASP I  1 72 ? 10.420  -16.286 -249.411 1.00 0.00 ?  72 ASP I CG   1  
ATOM 11021  O OD1  . ASP I  1 72 ? 11.585  -16.283 -249.733 1.00 0.00 ?  72 ASP I OD1  1  
ATOM 11022  O OD2  . ASP I  1 72 ? 9.974   -17.048 -248.587 1.00 0.00 -1 72 ASP I OD2  1  
ATOM 11023  H H    . ASP I  1 72 ? 10.690  -13.452 -248.413 1.00 0.00 ?  72 ASP I H    1  
ATOM 11024  H HA   . ASP I  1 72 ? 11.044  -14.293 -251.157 1.00 0.00 ?  72 ASP I HA   1  
ATOM 11025  H HB2  . ASP I  1 72 ? 8.794   -14.909 -249.148 1.00 0.00 ?  72 ASP I HB2  1  
ATOM 11026  H HB3  . ASP I  1 72 ? 9.012   -15.483 -250.820 1.00 0.00 ?  72 ASP I HB3  1  
ATOM 11027  N N    . ALA I  1 73 ? 8.503   -12.305 -250.535 1.00 0.00 ?  73 ALA I N    1  
ATOM 11028  C CA   . ALA I  1 73 ? 7.607   -11.344 -251.165 1.00 0.00 ?  73 ALA I CA   1  
ATOM 11029  C C    . ALA I  1 73 ? 8.388   -10.266 -251.907 1.00 0.00 ?  73 ALA I C    1  
ATOM 11030  O O    . ALA I  1 73 ? 7.995   -9.837  -252.992 1.00 0.00 ?  73 ALA I O    1  
ATOM 11031  C CB   . ALA I  1 73 ? 6.687   -10.717 -250.127 1.00 0.00 ?  73 ALA I CB   1  
ATOM 11032  H H    . ALA I  1 73 ? 8.487   -12.407 -249.530 1.00 0.00 ?  73 ALA I H    1  
ATOM 11033  H HA   . ALA I  1 73 ? 6.995   -11.866 -251.901 1.00 0.00 ?  73 ALA I HA   1  
ATOM 11034  H HB1  . ALA I  1 73 ? 7.285   -10.203 -249.376 1.00 0.00 ?  73 ALA I HB1  1  
ATOM 11035  H HB2  . ALA I  1 73 ? 6.025   -10.002 -250.615 1.00 0.00 ?  73 ALA I HB2  1  
ATOM 11036  H HB3  . ALA I  1 73 ? 6.093   -11.495 -249.650 1.00 0.00 ?  73 ALA I HB3  1  
ATOM 11037  N N    . ALA I  1 74 ? 9.496   -9.833  -251.316 1.00 0.00 ?  74 ALA I N    1  
ATOM 11038  C CA   . ALA I  1 74 ? 10.335  -8.805  -251.920 1.00 0.00 ?  74 ALA I CA   1  
ATOM 11039  C C    . ALA I  1 74 ? 10.841  -9.242  -253.289 1.00 0.00 ?  74 ALA I C    1  
ATOM 11040  O O    . ALA I  1 74 ? 10.884  -8.447  -254.228 1.00 0.00 ?  74 ALA I O    1  
ATOM 11041  C CB   . ALA I  1 74 ? 11.502  -8.467  -251.003 1.00 0.00 ?  74 ALA I CB   1  
ATOM 11042  H H    . ALA I  1 74 ? 9.763   -10.225 -250.424 1.00 0.00 ?  74 ALA I H    1  
ATOM 11043  H HA   . ALA I  1 74 ? 9.736   -7.906  -252.067 1.00 0.00 ?  74 ALA I HA   1  
ATOM 11044  H HB1  . ALA I  1 74 ? 12.102  -9.360  -250.834 1.00 0.00 ?  74 ALA I HB1  1  
ATOM 11045  H HB2  . ALA I  1 74 ? 12.118  -7.699  -251.469 1.00 0.00 ?  74 ALA I HB2  1  
ATOM 11046  H HB3  . ALA I  1 74 ? 11.121  -8.099  -250.050 1.00 0.00 ?  74 ALA I HB3  1  
ATOM 11047  N N    . ILE I  1 75 ? 11.223  -10.510 -253.396 1.00 0.00 ?  75 ILE I N    1  
ATOM 11048  C CA   . ILE I  1 75 ? 11.766  -11.044 -254.639 1.00 0.00 ?  75 ILE I CA   1  
ATOM 11049  C C    . ILE I  1 75 ? 10.686  -11.161 -255.707 1.00 0.00 ?  75 ILE I C    1  
ATOM 11050  O O    . ILE I  1 75 ? 10.873  -10.724 -256.843 1.00 0.00 ?  75 ILE I O    1  
ATOM 11051  C CB   . ILE I  1 75 ? 12.414  -12.425 -254.425 1.00 0.00 ?  75 ILE I CB   1  
ATOM 11052  C CG1  . ILE I  1 75 ? 13.658  -12.299 -253.542 1.00 0.00 ?  75 ILE I CG1  1  
ATOM 11053  C CG2  . ILE I  1 75 ? 12.768  -13.059 -255.762 1.00 0.00 ?  75 ILE I CG2  1  
ATOM 11054  C CD1  . ILE I  1 75 ? 14.179  -13.622 -253.029 1.00 0.00 ?  75 ILE I CD1  1  
ATOM 11055  H H    . ILE I  1 75 ? 11.134  -11.120 -252.595 1.00 0.00 ?  75 ILE I H    1  
ATOM 11056  H HA   . ILE I  1 75 ? 12.500  -10.361 -255.062 1.00 0.00 ?  75 ILE I HA   1  
ATOM 11057  H HB   . ILE I  1 75 ? 11.714  -13.067 -253.892 1.00 0.00 ?  75 ILE I HB   1  
ATOM 11058  H HG12 . ILE I  1 75 ? 14.430  -11.811 -254.137 1.00 0.00 ?  75 ILE I HG12 1  
ATOM 11059  H HG13 . ILE I  1 75 ? 13.394  -11.661 -252.699 1.00 0.00 ?  75 ILE I HG13 1  
ATOM 11060  H HG21 . ILE I  1 75 ? 13.225  -14.033 -255.593 1.00 0.00 ?  75 ILE I HG21 1  
ATOM 11061  H HG22 . ILE I  1 75 ? 11.864  -13.181 -256.357 1.00 0.00 ?  75 ILE I HG22 1  
ATOM 11062  H HG23 . ILE I  1 75 ? 13.469  -12.417 -256.295 1.00 0.00 ?  75 ILE I HG23 1  
ATOM 11063  H HD11 . ILE I  1 75 ? 14.445  -14.260 -253.870 1.00 0.00 ?  75 ILE I HD11 1  
ATOM 11064  H HD12 . ILE I  1 75 ? 15.061  -13.452 -252.411 1.00 0.00 ?  75 ILE I HD12 1  
ATOM 11065  H HD13 . ILE I  1 75 ? 13.408  -14.111 -252.432 1.00 0.00 ?  75 ILE I HD13 1  
ATOM 11066  N N    . ILE I  1 76 ? 9.555   -11.752 -255.336 1.00 0.00 ?  76 ILE I N    1  
ATOM 11067  C CA   . ILE I  1 76 ? 8.475   -12.003 -256.283 1.00 0.00 ?  76 ILE I CA   1  
ATOM 11068  C C    . ILE I  1 76 ? 7.723   -10.721 -256.614 1.00 0.00 ?  76 ILE I C    1  
ATOM 11069  O O    . ILE I  1 76 ? 6.957   -10.670 -257.577 1.00 0.00 ?  76 ILE I O    1  
ATOM 11070  C CB   . ILE I  1 76 ? 7.480   -13.046 -255.741 1.00 0.00 ?  76 ILE I CB   1  
ATOM 11071  C CG1  . ILE I  1 76 ? 6.767   -12.507 -254.498 1.00 0.00 ?  76 ILE I CG1  1  
ATOM 11072  C CG2  . ILE I  1 76 ? 8.195   -14.350 -255.425 1.00 0.00 ?  76 ILE I CG2  1  
ATOM 11073  C CD1  . ILE I  1 76 ? 5.653   -13.399 -253.999 1.00 0.00 ?  76 ILE I CD1  1  
ATOM 11074  H H    . ILE I  1 76 ? 9.440   -12.034 -254.373 1.00 0.00 ?  76 ILE I H    1  
ATOM 11075  H HA   . ILE I  1 76 ? 8.874   -12.345 -257.237 1.00 0.00 ?  76 ILE I HA   1  
ATOM 11076  H HB   . ILE I  1 76 ? 6.711   -13.225 -256.491 1.00 0.00 ?  76 ILE I HB   1  
ATOM 11077  H HG12 . ILE I  1 76 ? 7.518   -12.392 -253.718 1.00 0.00 ?  76 ILE I HG12 1  
ATOM 11078  H HG13 . ILE I  1 76 ? 6.360   -11.529 -254.756 1.00 0.00 ?  76 ILE I HG13 1  
ATOM 11079  H HG21 . ILE I  1 76 ? 7.478   -15.075 -255.043 1.00 0.00 ?  76 ILE I HG21 1  
ATOM 11080  H HG22 . ILE I  1 76 ? 8.658   -14.740 -256.331 1.00 0.00 ?  76 ILE I HG22 1  
ATOM 11081  H HG23 . ILE I  1 76 ? 8.965   -14.171 -254.674 1.00 0.00 ?  76 ILE I HG23 1  
ATOM 11082  H HD11 . ILE I  1 76 ? 6.058   -14.377 -253.739 1.00 0.00 ?  76 ILE I HD11 1  
ATOM 11083  H HD12 . ILE I  1 76 ? 5.195   -12.952 -253.116 1.00 0.00 ?  76 ILE I HD12 1  
ATOM 11084  H HD13 . ILE I  1 76 ? 4.900   -13.514 -254.779 1.00 0.00 ?  76 ILE I HD13 1  
ATOM 11085  N N    . GLN I  1 77 ? 7.946   -9.686  -255.811 1.00 0.00 ?  77 GLN I N    1  
ATOM 11086  C CA   . GLN I  1 77 ? 7.489   -8.343  -256.148 1.00 0.00 ?  77 GLN I CA   1  
ATOM 11087  C C    . GLN I  1 77 ? 8.153   -7.838  -257.422 1.00 0.00 ?  77 GLN I C    1  
ATOM 11088  O O    . GLN I  1 77 ? 7.578   -7.034  -258.156 1.00 0.00 ?  77 GLN I O    1  
ATOM 11089  C CB   . GLN I  1 77 ? 7.777   -7.375  -254.997 1.00 0.00 ?  77 GLN I CB   1  
ATOM 11090  C CG   . GLN I  1 77 ? 7.202   -5.983  -255.196 1.00 0.00 ?  77 GLN I CG   1  
ATOM 11091  C CD   . GLN I  1 77 ? 5.687   -5.990  -255.280 1.00 0.00 ?  77 GLN I CD   1  
ATOM 11092  O OE1  . GLN I  1 77 ? 5.010   -6.646  -254.484 1.00 0.00 ?  77 GLN I OE1  1  
ATOM 11093  N NE2  . GLN I  1 77 ? 5.146   -5.261  -256.250 1.00 0.00 ?  77 GLN I NE2  1  
ATOM 11094  H H    . GLN I  1 77 ? 8.446   -9.833  -254.946 1.00 0.00 ?  77 GLN I H    1  
ATOM 11095  H HA   . GLN I  1 77 ? 6.417   -8.360  -256.342 1.00 0.00 ?  77 GLN I HA   1  
ATOM 11096  H HB2  . GLN I  1 77 ? 7.358   -7.823  -254.096 1.00 0.00 ?  77 GLN I HB2  1  
ATOM 11097  H HB3  . GLN I  1 77 ? 8.861   -7.314  -254.901 1.00 0.00 ?  77 GLN I HB3  1  
ATOM 11098  H HG2  . GLN I  1 77 ? 7.499   -5.129  -254.587 1.00 0.00 ?  77 GLN I HG2  1  
ATOM 11099  H HG3  . GLN I  1 77 ? 7.603   -5.866  -256.203 1.00 0.00 ?  77 GLN I HG3  1  
ATOM 11100  H HE21 . GLN I  1 77 ? 5.733   -4.745  -256.875 1.00 0.00 ?  77 GLN I HE21 1  
ATOM 11101  H HE22 . GLN I  1 77 ? 4.152   -5.227  -256.356 1.00 0.00 ?  77 GLN I HE22 1  
ATOM 11102  N N    . ASN I  1 78 ? 9.366   -8.314  -257.680 1.00 0.00 ?  78 ASN I N    1  
ATOM 11103  C CA   . ASN I  1 78 ? 10.085  -7.960  -258.898 1.00 0.00 ?  78 ASN I CA   1  
ATOM 11104  C C    . ASN I  1 78 ? 10.063  -9.104  -259.904 1.00 0.00 ?  78 ASN I C    1  
ATOM 11105  O O    . ASN I  1 78 ? 10.974  -9.242  -260.720 1.00 0.00 ?  78 ASN I O    1  
ATOM 11106  C CB   . ASN I  1 78 ? 11.516  -7.551  -258.599 1.00 0.00 ?  78 ASN I CB   1  
ATOM 11107  C CG   . ASN I  1 78 ? 11.628  -6.287  -257.792 1.00 0.00 ?  78 ASN I CG   1  
ATOM 11108  O OD1  . ASN I  1 78 ? 10.792  -5.382  -257.899 1.00 0.00 ?  78 ASN I OD1  1  
ATOM 11109  N ND2  . ASN I  1 78 ? 12.700  -6.186  -257.048 1.00 0.00 ?  78 ASN I ND2  1  
ATOM 11110  H H    . ASN I  1 78 ? 9.801   -8.938  -257.016 1.00 0.00 ?  78 ASN I H    1  
ATOM 11111  H HA   . ASN I  1 78 ? 9.597   -7.113  -259.383 1.00 0.00 ?  78 ASN I HA   1  
ATOM 11112  H HB2  . ASN I  1 78 ? 12.238  -8.279  -258.226 1.00 0.00 ?  78 ASN I HB2  1  
ATOM 11113  H HB3  . ASN I  1 78 ? 11.736  -7.323  -259.642 1.00 0.00 ?  78 ASN I HB3  1  
ATOM 11114  H HD21 . ASN I  1 78 ? 13.376  -6.922  -257.043 1.00 0.00 ?  78 ASN I HD21 1  
ATOM 11115  H HD22 . ASN I  1 78 ? 12.841  -5.372  -256.484 1.00 0.00 ?  78 ASN I HD22 1  
ATOM 11116  N N    . PHE I  1 79 ? 9.018   -9.922  -259.839 1.00 0.00 ?  79 PHE I N    1  
ATOM 11117  C CA   . PHE I  1 79 ? 8.917   -11.104 -260.686 1.00 0.00 ?  79 PHE I CA   1  
ATOM 11118  C C    . PHE I  1 79 ? 8.460   -10.736 -262.092 1.00 0.00 ?  79 PHE I C    1  
ATOM 11119  O O    . PHE I  1 79 ? 7.335   -11.042 -262.489 1.00 0.00 ?  79 PHE I O    1  
ATOM 11120  C CB   . PHE I  1 79 ? 7.957   -12.123 -260.070 1.00 0.00 ?  79 PHE I CB   1  
ATOM 11121  C CG   . PHE I  1 79 ? 8.114   -13.513 -260.617 1.00 0.00 ?  79 PHE I CG   1  
ATOM 11122  C CD1  . PHE I  1 79 ? 9.170   -14.317 -260.214 1.00 0.00 ?  79 PHE I CD1  1  
ATOM 11123  C CD2  . PHE I  1 79 ? 7.209   -14.019 -261.537 1.00 0.00 ?  79 PHE I CD2  1  
ATOM 11124  C CE1  . PHE I  1 79 ? 9.316   -15.596 -260.717 1.00 0.00 ?  79 PHE I CE1  1  
ATOM 11125  C CE2  . PHE I  1 79 ? 7.351   -15.297 -262.041 1.00 0.00 ?  79 PHE I CE2  1  
ATOM 11126  C CZ   . PHE I  1 79 ? 8.407   -16.086 -261.630 1.00 0.00 ?  79 PHE I CZ   1  
ATOM 11127  H H    . PHE I  1 79 ? 8.275   -9.720  -259.186 1.00 0.00 ?  79 PHE I H    1  
ATOM 11128  H HA   . PHE I  1 79 ? 9.898   -11.569 -260.791 1.00 0.00 ?  79 PHE I HA   1  
ATOM 11129  H HB2  . PHE I  1 79 ? 8.121   -12.191 -258.995 1.00 0.00 ?  79 PHE I HB2  1  
ATOM 11130  H HB3  . PHE I  1 79 ? 6.926   -11.828 -260.261 1.00 0.00 ?  79 PHE I HB3  1  
ATOM 11131  H HD1  . PHE I  1 79 ? 9.889   -13.929 -259.491 1.00 0.00 ?  79 PHE I HD1  1  
ATOM 11132  H HD2  . PHE I  1 79 ? 6.375   -13.395 -261.862 1.00 0.00 ?  79 PHE I HD2  1  
ATOM 11133  H HE1  . PHE I  1 79 ? 10.151  -16.217 -260.392 1.00 0.00 ?  79 PHE I HE1  1  
ATOM 11134  H HE2  . PHE I  1 79 ? 6.632   -15.683 -262.763 1.00 0.00 ?  79 PHE I HE2  1  
ATOM 11135  H HZ   . PHE I  1 79 ? 8.522   -17.093 -262.028 1.00 0.00 ?  79 PHE I HZ   1  
ATOM 11136  N N    . ARG I  1 80 ? 9.338   -10.079 -262.842 1.00 0.00 ?  80 ARG I N    1  
ATOM 11137  C CA   . ARG I  1 80 ? 8.999   -9.600  -264.176 1.00 0.00 ?  80 ARG I CA   1  
ATOM 11138  C C    . ARG I  1 80 ? 8.799   -10.760 -265.143 1.00 0.00 ?  80 ARG I C    1  
ATOM 11139  O O    . ARG I  1 80 ? 7.762   -11.364 -265.149 1.00 0.00 ?  80 ARG I O    1  
ATOM 11140  C CB   . ARG I  1 80 ? 10.021  -8.605  -264.705 1.00 0.00 ?  80 ARG I CB   1  
ATOM 11141  C CG   . ARG I  1 80 ? 10.175  -7.342  -263.872 1.00 0.00 ?  80 ARG I CG   1  
ATOM 11142  C CD   . ARG I  1 80 ? 8.937   -6.529  -263.758 1.00 0.00 ?  80 ARG I CD   1  
ATOM 11143  N NE   . ARG I  1 80 ? 8.501   -5.917  -265.003 1.00 0.00 ?  80 ARG I NE   1  
ATOM 11144  C CZ   . ARG I  1 80 ? 7.307   -5.318  -265.184 1.00 0.00 ?  80 ARG I CZ   1  
ATOM 11145  N NH1  . ARG I  1 80 ? 6.415   -5.281  -264.220 1.00 0.00 1  80 ARG I NH1  1  
ATOM 11146  N NH2  . ARG I  1 80 ? 7.048   -4.789  -266.367 1.00 0.00 ?  80 ARG I NH2  1  
ATOM 11147  O OXT  . ARG I  1 80 ? 9.697   -11.527 -265.354 1.00 0.00 -1 80 ARG I OXT  1  
ATOM 11148  H H    . ARG I  1 80 ? 10.264  -9.907  -262.477 1.00 0.00 ?  80 ARG I H    1  
ATOM 11149  H HA   . ARG I  1 80 ? 8.055   -9.056  -264.145 1.00 0.00 ?  80 ARG I HA   1  
ATOM 11150  H HB2  . ARG I  1 80 ? 10.977  -9.124  -264.751 1.00 0.00 ?  80 ARG I HB2  1  
ATOM 11151  H HB3  . ARG I  1 80 ? 9.708   -8.333  -265.713 1.00 0.00 ?  80 ARG I HB3  1  
ATOM 11152  H HG2  . ARG I  1 80 ? 10.484  -7.625  -262.866 1.00 0.00 ?  80 ARG I HG2  1  
ATOM 11153  H HG3  . ARG I  1 80 ? 10.945  -6.719  -264.327 1.00 0.00 ?  80 ARG I HG3  1  
ATOM 11154  H HD2  . ARG I  1 80 ? 8.126   -7.167  -263.407 1.00 0.00 ?  80 ARG I HD2  1  
ATOM 11155  H HD3  . ARG I  1 80 ? 9.105   -5.727  -263.041 1.00 0.00 ?  80 ARG I HD3  1  
ATOM 11156  H HE   . ARG I  1 80 ? 8.985   -5.840  -265.887 1.00 0.00 ?  80 ARG I HE   1  
ATOM 11157  H HH11 . ARG I  1 80 ? 6.622   -5.706  -263.327 1.00 0.00 ?  80 ARG I HH11 1  
ATOM 11158  H HH12 . ARG I  1 80 ? 5.526   -4.828  -264.376 1.00 0.00 ?  80 ARG I HH12 1  
ATOM 11159  H HH21 . ARG I  1 80 ? 7.738   -4.842  -267.103 1.00 0.00 ?  80 ARG I HH21 1  
ATOM 11160  H HH22 . ARG I  1 80 ? 6.161   -4.335  -266.530 1.00 0.00 ?  80 ARG I HH22 1  
ATOM 11161  N N    . MET J  1 1  ? 45.311  -10.237 -240.876 1.00 0.00 ?  1  MET J N    1  
ATOM 11162  C CA   . MET J  1 1  ? 45.175  -9.274  -241.962 1.00 0.00 ?  1  MET J CA   1  
ATOM 11163  C C    . MET J  1 1  ? 43.741  -9.219  -242.472 1.00 0.00 ?  1  MET J C    1  
ATOM 11164  O O    . MET J  1 1  ? 43.280  -8.180  -242.945 1.00 0.00 ?  1  MET J O    1  
ATOM 11165  C CB   . MET J  1 1  ? 46.128  -9.626  -243.102 1.00 0.00 ?  1  MET J CB   1  
ATOM 11166  C CG   . MET J  1 1  ? 47.604  -9.552  -242.735 1.00 0.00 ?  1  MET J CG   1  
ATOM 11167  S SD   . MET J  1 1  ? 48.091  -7.921  -242.137 1.00 0.00 ?  1  MET J SD   1  
ATOM 11168  C CE   . MET J  1 1  ? 47.957  -6.956  -243.640 1.00 0.00 ?  1  MET J CE   1  
ATOM 11169  H H1   . MET J  1 1  ? 45.936  -11.012 -240.970 1.00 0.00 ?  1  MET J H1   1  
ATOM 11170  H H2   . MET J  1 1  ? 45.623  -9.935  -239.975 1.00 0.00 ?  1  MET J H2   1  
ATOM 11171  H H3   . MET J  1 1  ? 44.515  -10.756 -240.564 1.00 0.00 ?  1  MET J H3   1  
ATOM 11172  H HA   . MET J  1 1  ? 45.415  -8.273  -241.603 1.00 0.00 ?  1  MET J HA   1  
ATOM 11173  H HB2  . MET J  1 1  ? 45.883  -10.638 -243.419 1.00 0.00 ?  1  MET J HB2  1  
ATOM 11174  H HB3  . MET J  1 1  ? 45.921  -8.929  -243.915 1.00 0.00 ?  1  MET J HB3  1  
ATOM 11175  H HG2  . MET J  1 1  ? 47.798  -10.290 -241.958 1.00 0.00 ?  1  MET J HG2  1  
ATOM 11176  H HG3  . MET J  1 1  ? 48.187  -9.796  -243.622 1.00 0.00 ?  1  MET J HG3  1  
ATOM 11177  H HE1  . MET J  1 1  ? 46.931  -6.998  -244.008 1.00 0.00 ?  1  MET J HE1  1  
ATOM 11178  H HE2  . MET J  1 1  ? 48.226  -5.921  -243.433 1.00 0.00 ?  1  MET J HE2  1  
ATOM 11179  H HE3  . MET J  1 1  ? 48.630  -7.364  -244.395 1.00 0.00 ?  1  MET J HE3  1  
ATOM 11180  N N    . ALA J  1 2  ? 43.039  -10.343 -242.373 1.00 0.00 ?  2  ALA J N    1  
ATOM 11181  C CA   . ALA J  1 2  ? 41.660  -10.428 -242.838 1.00 0.00 ?  2  ALA J CA   1  
ATOM 11182  C C    . ALA J  1 2  ? 40.710  -9.724  -241.877 1.00 0.00 ?  2  ALA J C    1  
ATOM 11183  O O    . ALA J  1 2  ? 40.915  -9.740  -240.663 1.00 0.00 ?  2  ALA J O    1  
ATOM 11184  C CB   . ALA J  1 2  ? 41.251  -11.882 -243.021 1.00 0.00 ?  2  ALA J CB   1  
ATOM 11185  H H    . ALA J  1 2  ? 43.472  -11.159 -241.966 1.00 0.00 ?  2  ALA J H    1  
ATOM 11186  H HA   . ALA J  1 2  ? 41.583  -9.921  -243.800 1.00 0.00 ?  2  ALA J HA   1  
ATOM 11187  H HB1  . ALA J  1 2  ? 41.338  -12.407 -242.071 1.00 0.00 ?  2  ALA J HB1  1  
ATOM 11188  H HB2  . ALA J  1 2  ? 40.219  -11.928 -243.368 1.00 0.00 ?  2  ALA J HB2  1  
ATOM 11189  H HB3  . ALA J  1 2  ? 41.903  -12.354 -243.757 1.00 0.00 ?  2  ALA J HB3  1  
ATOM 11190  N N    . THR J  1 3  ? 39.671  -9.106  -242.427 1.00 0.00 ?  3  THR J N    1  
ATOM 11191  C CA   . THR J  1 3  ? 38.680  -8.406  -241.618 1.00 0.00 ?  3  THR J CA   1  
ATOM 11192  C C    . THR J  1 3  ? 37.265  -8.829  -241.992 1.00 0.00 ?  3  THR J C    1  
ATOM 11193  O O    . THR J  1 3  ? 36.860  -8.721  -243.149 1.00 0.00 ?  3  THR J O    1  
ATOM 11194  C CB   . THR J  1 3  ? 38.804  -6.878  -241.769 1.00 0.00 ?  3  THR J CB   1  
ATOM 11195  O OG1  . THR J  1 3  ? 40.118  -6.462  -241.375 1.00 0.00 ?  3  THR J OG1  1  
ATOM 11196  C CG2  . THR J  1 3  ? 37.772  -6.171  -240.905 1.00 0.00 ?  3  THR J CG2  1  
ATOM 11197  H H    . THR J  1 3  ? 39.564  -9.121  -243.431 1.00 0.00 ?  3  THR J H    1  
ATOM 11198  H HA   . THR J  1 3  ? 38.812  -8.665  -240.567 1.00 0.00 ?  3  THR J HA   1  
ATOM 11199  H HB   . THR J  1 3  ? 38.647  -6.611  -242.814 1.00 0.00 ?  3  THR J HB   1  
ATOM 11200  H HG1  . THR J  1 3  ? 40.193  -5.509  -241.470 1.00 0.00 ?  3  THR J HG1  1  
ATOM 11201  H HG21 . THR J  1 3  ? 37.875  -5.093  -241.025 1.00 0.00 ?  3  THR J HG21 1  
ATOM 11202  H HG22 . THR J  1 3  ? 36.771  -6.477  -241.210 1.00 0.00 ?  3  THR J HG22 1  
ATOM 11203  H HG23 . THR J  1 3  ? 37.930  -6.436  -239.860 1.00 0.00 ?  3  THR J HG23 1  
ATOM 11204  N N    . PRO J  1 4  ? 36.517  -9.311  -241.005 1.00 0.00 ?  4  PRO J N    1  
ATOM 11205  C CA   . PRO J  1 4  ? 35.132  -9.714  -241.220 1.00 0.00 ?  4  PRO J CA   1  
ATOM 11206  C C    . PRO J  1 4  ? 34.317  -8.580  -241.828 1.00 0.00 ?  4  PRO J C    1  
ATOM 11207  O O    . PRO J  1 4  ? 34.514  -7.412  -241.494 1.00 0.00 ?  4  PRO J O    1  
ATOM 11208  C CB   . PRO J  1 4  ? 34.634  -10.099 -239.824 1.00 0.00 ?  4  PRO J CB   1  
ATOM 11209  C CG   . PRO J  1 4  ? 35.868  -10.481 -239.081 1.00 0.00 ?  4  PRO J CG   1  
ATOM 11210  C CD   . PRO J  1 4  ? 36.944  -9.562  -239.594 1.00 0.00 ?  4  PRO J CD   1  
ATOM 11211  H HA   . PRO J  1 4  ? 35.037  -10.546 -241.933 1.00 0.00 ?  4  PRO J HA   1  
ATOM 11212  H HB2  . PRO J  1 4  ? 34.118  -9.259  -239.334 1.00 0.00 ?  4  PRO J HB2  1  
ATOM 11213  H HB3  . PRO J  1 4  ? 33.919  -10.934 -239.867 1.00 0.00 ?  4  PRO J HB3  1  
ATOM 11214  H HG2  . PRO J  1 4  ? 35.731  -10.364 -237.995 1.00 0.00 ?  4  PRO J HG2  1  
ATOM 11215  H HG3  . PRO J  1 4  ? 36.129  -11.535 -239.260 1.00 0.00 ?  4  PRO J HG3  1  
ATOM 11216  H HD2  . PRO J  1 4  ? 36.998  -8.625  -239.020 1.00 0.00 ?  4  PRO J HD2  1  
ATOM 11217  H HD3  . PRO J  1 4  ? 37.941  -10.023 -239.550 1.00 0.00 ?  4  PRO J HD3  1  
ATOM 11218  N N    . TRP J  1 5  ? 33.399  -8.932  -242.723 1.00 0.00 ?  5  TRP J N    1  
ATOM 11219  C CA   . TRP J  1 5  ? 32.558  -7.943  -243.387 1.00 0.00 ?  5  TRP J CA   1  
ATOM 11220  C C    . TRP J  1 5  ? 31.641  -7.243  -242.392 1.00 0.00 ?  5  TRP J C    1  
ATOM 11221  O O    . TRP J  1 5  ? 31.104  -7.871  -241.480 1.00 0.00 ?  5  TRP J O    1  
ATOM 11222  C CB   . TRP J  1 5  ? 31.729  -8.603  -244.490 1.00 0.00 ?  5  TRP J CB   1  
ATOM 11223  C CG   . TRP J  1 5  ? 30.777  -7.664  -245.167 1.00 0.00 ?  5  TRP J CG   1  
ATOM 11224  C CD1  . TRP J  1 5  ? 31.030  -6.900  -246.267 1.00 0.00 ?  5  TRP J CD1  1  
ATOM 11225  C CD2  . TRP J  1 5  ? 29.423  -7.389  -244.788 1.00 0.00 ?  5  TRP J CD2  1  
ATOM 11226  N NE1  . TRP J  1 5  ? 29.918  -6.166  -246.598 1.00 0.00 ?  5  TRP J NE1  1  
ATOM 11227  C CE2  . TRP J  1 5  ? 28.916  -6.450  -245.704 1.00 0.00 ?  5  TRP J CE2  1  
ATOM 11228  C CE3  . TRP J  1 5  ? 28.589  -7.849  -243.762 1.00 0.00 ?  5  TRP J CE3  1  
ATOM 11229  C CZ2  . TRP J  1 5  ? 27.622  -5.961  -245.627 1.00 0.00 ?  5  TRP J CZ2  1  
ATOM 11230  C CZ3  . TRP J  1 5  ? 27.290  -7.360  -243.686 1.00 0.00 ?  5  TRP J CZ3  1  
ATOM 11231  C CH2  . TRP J  1 5  ? 26.821  -6.443  -244.592 1.00 0.00 ?  5  TRP J CH2  1  
ATOM 11232  H H    . TRP J  1 5  ? 33.281  -9.909  -242.948 1.00 0.00 ?  5  TRP J H    1  
ATOM 11233  H HA   . TRP J  1 5  ? 33.181  -7.169  -243.835 1.00 0.00 ?  5  TRP J HA   1  
ATOM 11234  H HB2  . TRP J  1 5  ? 32.382  -8.999  -245.268 1.00 0.00 ?  5  TRP J HB2  1  
ATOM 11235  H HB3  . TRP J  1 5  ? 31.128  -9.412  -244.075 1.00 0.00 ?  5  TRP J HB3  1  
ATOM 11236  H HD1  . TRP J  1 5  ? 32.024  -6.978  -246.703 1.00 0.00 ?  5  TRP J HD1  1  
ATOM 11237  H HE1  . TRP J  1 5  ? 29.848  -5.520  -247.371 1.00 0.00 ?  5  TRP J HE1  1  
ATOM 11238  H HE3  . TRP J  1 5  ? 28.910  -8.578  -243.018 1.00 0.00 ?  5  TRP J HE3  1  
ATOM 11239  H HZ2  . TRP J  1 5  ? 27.289  -5.233  -246.368 1.00 0.00 ?  5  TRP J HZ2  1  
ATOM 11240  H HZ3  . TRP J  1 5  ? 26.652  -7.725  -242.881 1.00 0.00 ?  5  TRP J HZ3  1  
ATOM 11241  H HH2  . TRP J  1 5  ? 25.795  -6.084  -244.497 1.00 0.00 ?  5  TRP J HH2  1  
ATOM 11242  N N    . SER J  1 6  ? 31.466  -5.939  -242.574 1.00 0.00 ?  6  SER J N    1  
ATOM 11243  C CA   . SER J  1 6  ? 30.534  -5.170  -241.758 1.00 0.00 ?  6  SER J CA   1  
ATOM 11244  C C    . SER J  1 6  ? 29.796  -4.132  -242.593 1.00 0.00 ?  6  SER J C    1  
ATOM 11245  O O    . SER J  1 6  ? 30.416  -3.314  -243.274 1.00 0.00 ?  6  SER J O    1  
ATOM 11246  C CB   . SER J  1 6  ? 31.272  -4.500  -240.614 1.00 0.00 ?  6  SER J CB   1  
ATOM 11247  O OG   . SER J  1 6  ? 30.426  -3.689  -239.846 1.00 0.00 ?  6  SER J OG   1  
ATOM 11248  H H    . SER J  1 6  ? 31.992  -5.467  -243.296 1.00 0.00 ?  6  SER J H    1  
ATOM 11249  H HA   . SER J  1 6  ? 29.817  -5.790  -241.219 1.00 0.00 ?  6  SER J HA   1  
ATOM 11250  H HB2  . SER J  1 6  ? 31.699  -5.273  -239.976 1.00 0.00 ?  6  SER J HB2  1  
ATOM 11251  H HB3  . SER J  1 6  ? 32.073  -3.887  -241.027 1.00 0.00 ?  6  SER J HB3  1  
ATOM 11252  H HG   . SER J  1 6  ? 30.637  -2.766  -240.006 1.00 0.00 ?  6  SER J HG   1  
ATOM 11253  N N    . GLY J  1 7  ? 28.469  -4.169  -242.538 1.00 0.00 ?  7  GLY J N    1  
ATOM 11254  C CA   . GLY J  1 7  ? 27.644  -3.226  -243.283 1.00 0.00 ?