data_2LQ6
# 
_entry.id   2LQ6 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LQ6         
RCSB  RCSB102694   
BMRB  18296        
WWPDB D_1000102694 
# 
_pdbx_database_related.db_id          18296 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LQ6 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2012-02-25 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, L.' 1 
'Wu, J.'  2 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of an atypical PHD finger in BRPF2 and its interaction with DNA' 
_citation.journal_abbrev            J.Struct.Biol. 
_citation.journal_volume            180 
_citation.page_first                165 
_citation.page_last                 173 
_citation.year                      2012 
_citation.journal_id_ASTM           JSBIEM 
_citation.country                   US 
_citation.journal_id_ISSN           1047-8477 
_citation.journal_id_CSD            0803 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22820306 
_citation.pdbx_database_id_DOI      10.1016/j.jsb.2012.06.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, L.'   1 
primary 'Qin, S.'   2 
primary 'Zhang, J.' 3 
primary 'Ji, P.'    4 
primary 'Shi, Y.'   5 
primary 'Wu, J.'    6 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Bromodomain-containing protein 1' 9657.266 1 ? 'C338S, C393S' 'UNP residues 317-394' ? 
2 non-polymer syn 'ZINC ION'                         65.409   2 ? ?              ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BR140-like protein, Bromodomain and PHD finger-containing protein 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHMNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDV
HTPPGST
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHMNIPPARWKLTCYLCKQKGVGASIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDV
HTPPGST
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  MET n 
1 2  GLY n 
1 3  HIS n 
1 4  HIS n 
1 5  HIS n 
1 6  HIS n 
1 7  HIS n 
1 8  HIS n 
1 9  MET n 
1 10 ASN n 
1 11 ILE n 
1 12 PRO n 
1 13 PRO n 
1 14 ALA n 
1 15 ARG n 
1 16 TRP n 
1 17 LYS n 
1 18 LEU n 
1 19 THR n 
1 20 CYS n 
1 21 TYR n 
1 22 LEU n 
1 23 CYS n 
1 24 LYS n 
1 25 GLN n 
1 26 LYS n 
1 27 GLY n 
1 28 VAL n 
1 29 GLY n 
1 30 ALA n 
1 31 SER n 
1 32 ILE n 
1 33 GLN n 
1 34 CYS n 
1 35 HIS n 
1 36 LYS n 
1 37 ALA n 
1 38 ASN n 
1 39 CYS n 
1 40 TYR n 
1 41 THR n 
1 42 ALA n 
1 43 PHE n 
1 44 HIS n 
1 45 VAL n 
1 46 THR n 
1 47 CYS n 
1 48 ALA n 
1 49 GLN n 
1 50 LYS n 
1 51 ALA n 
1 52 GLY n 
1 53 LEU n 
1 54 TYR n 
1 55 MET n 
1 56 LYS n 
1 57 MET n 
1 58 GLU n 
1 59 PRO n 
1 60 VAL n 
1 61 LYS n 
1 62 GLU n 
1 63 LEU n 
1 64 THR n 
1 65 GLY n 
1 66 GLY n 
1 67 GLY n 
1 68 THR n 
1 69 THR n 
1 70 PHE n 
1 71 SER n 
1 72 VAL n 
1 73 ARG n 
1 74 LYS n 
1 75 THR n 
1 76 ALA n 
1 77 TYR n 
1 78 CYS n 
1 79 ASP n 
1 80 VAL n 
1 81 HIS n 
1 82 THR n 
1 83 PRO n 
1 84 PRO n 
1 85 GLY n 
1 86 SER n 
1 87 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'BRD1, BRL, BRPF2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          vector 
_entity_src_gen.pdbx_host_org_vector               pET28 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BRD1_HUMAN 
_struct_ref.pdbx_db_accession          O95696 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   NIPPARWKLTCYLCKQKGVGACIQCHKANCYTAFHVTCAQKAGLYMKMEPVKELTGGGTTFSVRKTAYCDVHTPPGCT 
_struct_ref.pdbx_align_begin           317 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LQ6 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 10 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 87 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             O95696 
_struct_ref_seq.db_align_beg                  317 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  394 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       317 
_struct_ref_seq.pdbx_auth_seq_align_end       394 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LQ6 MET A 1  ? UNP O95696 ?   ?   'EXPRESSION TAG'      308 1  
1 2LQ6 GLY A 2  ? UNP O95696 ?   ?   'EXPRESSION TAG'      309 2  
1 2LQ6 HIS A 3  ? UNP O95696 ?   ?   'EXPRESSION TAG'      310 3  
1 2LQ6 HIS A 4  ? UNP O95696 ?   ?   'EXPRESSION TAG'      311 4  
1 2LQ6 HIS A 5  ? UNP O95696 ?   ?   'EXPRESSION TAG'      312 5  
1 2LQ6 HIS A 6  ? UNP O95696 ?   ?   'EXPRESSION TAG'      313 6  
1 2LQ6 HIS A 7  ? UNP O95696 ?   ?   'EXPRESSION TAG'      314 7  
1 2LQ6 HIS A 8  ? UNP O95696 ?   ?   'EXPRESSION TAG'      315 8  
1 2LQ6 MET A 9  ? UNP O95696 ?   ?   'EXPRESSION TAG'      316 9  
1 2LQ6 SER A 31 ? UNP O95696 CYS 338 'ENGINEERED MUTATION' 338 10 
1 2LQ6 SER A 86 ? UNP O95696 CYS 393 'ENGINEERED MUTATION' 393 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'  
1 2  2 '3D CBCA(CO)NH'   
1 3  2 '3D HNCACB'       
1 4  2 '3D HNCO'         
1 5  2 '3D HN(CO)CA'     
1 6  2 '3D HBHA(CO)NH'   
1 7  2 '3D H(CCO)NH'     
1 8  3 '3D HCCH-COSY'    
1 9  3 '3D HCCH-TOCSY'   
1 10 2 '3D 1H-15N NOESY' 
1 11 3 '3D 1H-13C NOESY' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      150 
_pdbx_nmr_exptl_sample_conditions.pH                  6.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         293 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'0.3 mM [U-15N] protein-1, 90% H2O/10% D2O'        1 '90% H2O/10% D2O' 
'0.4 mM [U-13C; U-15N] protein-2, 90% H2O/10% D2O' 2 '90% H2O/10% D2O' 
'0.4 mM [U-13C; U-15N] protein-3, 100% D2O'        3 '100% D2O'        
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             DMX 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker DMX' 
# 
_pdbx_nmr_refine.entry_id           2LQ6 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LQ6 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.representative_conformer                      1 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LQ6 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.version 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNS     1 1.2 
Goddard                                             'chemical shift assignment' SPARKY  2 ?   
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe 3 ?   
?                                                   refinement                  CNS     4 ?   
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LQ6 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LQ6 
_struct.title                     'Solution structure of BRD1 PHD2 finger' 
_struct.pdbx_descriptor           'Bromodomain-containing protein 1' 
_struct.pdbx_model_details        'minimized average structure, model 1' 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        2LQ6 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'PHD finger, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 45 ? GLY A 52 ? VAL A 352 GLY A 359 1 ? 8 
HELX_P HELX_P2 2 CYS A 78 ? THR A 82 ? CYS A 385 THR A 389 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 41 OG1 ? ? ? 1_555 C ZN . ZN ? ? A THR 348 A ZN 402 1_555 ? ? ? ? ? ? ? 1.759 ? 
metalc2  metalc ? ? A LEU 22 O   ? ? ? 1_555 B ZN . ZN ? ? A LEU 329 A ZN 401 1_555 ? ? ? ? ? ? ? 2.125 ? 
metalc3  metalc ? ? A CYS 39 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 346 A ZN 402 1_555 ? ? ? ? ? ? ? 2.173 ? 
metalc4  metalc ? ? A CYS 23 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 330 A ZN 401 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc5  metalc ? ? A CYS 78 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 385 A ZN 402 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc6  metalc ? ? A CYS 47 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 354 A ZN 401 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc7  metalc ? ? A HIS 44 ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 351 A ZN 401 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc8  metalc ? ? A HIS 81 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 388 A ZN 402 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc9  metalc ? ? A CYS 34 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 341 A ZN 402 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc10 metalc ? ? A CYS 20 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 327 A ZN 401 1_555 ? ? ? ? ? ? ? 2.460 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 31 ? GLN A 33 ? SER A 338 GLN A 340 
A 2 ALA A 42 ? HIS A 44 ? ALA A 349 HIS A 351 
B 1 MET A 55 ? GLU A 62 ? MET A 362 GLU A 369 
B 2 THR A 69 ? ALA A 76 ? THR A 376 ALA A 383 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 32 ? N ILE A 339 O PHE A 43 ? O PHE A 350 
B 1 2 N LYS A 56 ? N LYS A 363 O THR A 75 ? O THR A 382 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 401' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 402' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 CYS A 20 ? CYS A 327 . ? 1_555 ? 
2  AC1 5 LEU A 22 ? LEU A 329 . ? 1_555 ? 
3  AC1 5 CYS A 23 ? CYS A 330 . ? 1_555 ? 
4  AC1 5 HIS A 44 ? HIS A 351 . ? 1_555 ? 
5  AC1 5 CYS A 47 ? CYS A 354 . ? 1_555 ? 
6  AC2 5 CYS A 34 ? CYS A 341 . ? 1_555 ? 
7  AC2 5 CYS A 39 ? CYS A 346 . ? 1_555 ? 
8  AC2 5 THR A 41 ? THR A 348 . ? 1_555 ? 
9  AC2 5 CYS A 78 ? CYS A 385 . ? 1_555 ? 
10 AC2 5 HIS A 81 ? HIS A 388 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2LQ6 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . MET A 1 9  ? -5.529  27.242  1.127   1.00 0.00 ? 316 MET A N    1  
ATOM   2     C  CA   . MET A 1 9  ? -5.410  27.458  2.587   1.00 0.00 ? 316 MET A CA   1  
ATOM   3     C  C    . MET A 1 9  ? -4.209  26.693  3.122   1.00 0.00 ? 316 MET A C    1  
ATOM   4     O  O    . MET A 1 9  ? -3.556  25.962  2.379   1.00 0.00 ? 316 MET A O    1  
ATOM   5     C  CB   . MET A 1 9  ? -6.688  27.009  3.316   1.00 0.00 ? 316 MET A CB   1  
ATOM   6     C  CG   . MET A 1 9  ? -6.952  25.506  3.276   1.00 0.00 ? 316 MET A CG   1  
ATOM   7     S  SD   . MET A 1 9  ? -7.353  24.898  1.625   1.00 0.00 ? 316 MET A SD   1  
ATOM   8     C  CE   . MET A 1 9  ? -7.674  23.168  1.966   1.00 0.00 ? 316 MET A CE   1  
ATOM   9     H  H    . MET A 1 9  ? -5.647  26.228  0.923   1.00 0.00 ? 316 MET A H    1  
ATOM   10    H  HA   . MET A 1 9  ? -5.254  28.513  2.762   1.00 0.00 ? 316 MET A HA   1  
ATOM   11    H  HB2  . MET A 1 9  ? -6.617  27.307  4.352   1.00 0.00 ? 316 MET A HB2  1  
ATOM   12    H  HB3  . MET A 1 9  ? -7.534  27.512  2.868   1.00 0.00 ? 316 MET A HB3  1  
ATOM   13    H  HG2  . MET A 1 9  ? -6.069  24.992  3.626   1.00 0.00 ? 316 MET A HG2  1  
ATOM   14    H  HG3  . MET A 1 9  ? -7.778  25.285  3.935   1.00 0.00 ? 316 MET A HG3  1  
ATOM   15    H  HE1  . MET A 1 9  ? -8.481  23.084  2.679   1.00 0.00 ? 316 MET A HE1  1  
ATOM   16    H  HE2  . MET A 1 9  ? -6.785  22.712  2.373   1.00 0.00 ? 316 MET A HE2  1  
ATOM   17    H  HE3  . MET A 1 9  ? -7.949  22.665  1.049   1.00 0.00 ? 316 MET A HE3  1  
ATOM   18    N  N    . ASN A 1 10 ? -3.917  26.856  4.404   1.00 0.00 ? 317 ASN A N    1  
ATOM   19    C  CA   . ASN A 1 10 ? -2.814  26.142  5.020   1.00 0.00 ? 317 ASN A CA   1  
ATOM   20    C  C    . ASN A 1 10 ? -3.273  24.740  5.366   1.00 0.00 ? 317 ASN A C    1  
ATOM   21    O  O    . ASN A 1 10 ? -3.933  24.525  6.385   1.00 0.00 ? 317 ASN A O    1  
ATOM   22    C  CB   . ASN A 1 10 ? -2.320  26.867  6.275   1.00 0.00 ? 317 ASN A CB   1  
ATOM   23    C  CG   . ASN A 1 10 ? -1.083  26.219  6.872   1.00 0.00 ? 317 ASN A CG   1  
ATOM   24    O  OD1  . ASN A 1 10 ? -1.175  25.334  7.726   1.00 0.00 ? 317 ASN A OD1  1  
ATOM   25    N  ND2  . ASN A 1 10 ? 0.084   26.654  6.424   1.00 0.00 ? 317 ASN A ND2  1  
ATOM   26    H  H    . ASN A 1 10 ? -4.463  27.455  4.950   1.00 0.00 ? 317 ASN A H    1  
ATOM   27    H  HA   . ASN A 1 10 ? -2.011  26.083  4.300   1.00 0.00 ? 317 ASN A HA   1  
ATOM   28    H  HB2  . ASN A 1 10 ? -2.083  27.889  6.022   1.00 0.00 ? 317 ASN A HB2  1  
ATOM   29    H  HB3  . ASN A 1 10 ? -3.101  26.858  7.020   1.00 0.00 ? 317 ASN A HB3  1  
ATOM   30    H  HD21 . ASN A 1 10 ? 0.086   27.361  5.740   1.00 0.00 ? 317 ASN A HD21 1  
ATOM   31    H  HD22 . ASN A 1 10 ? 0.899   26.253  6.789   1.00 0.00 ? 317 ASN A HD22 1  
ATOM   32    N  N    . ILE A 1 11 ? -2.966  23.802  4.491   1.00 0.00 ? 318 ILE A N    1  
ATOM   33    C  CA   . ILE A 1 11 ? -3.420  22.438  4.659   1.00 0.00 ? 318 ILE A CA   1  
ATOM   34    C  C    . ILE A 1 11 ? -2.297  21.560  5.231   1.00 0.00 ? 318 ILE A C    1  
ATOM   35    O  O    . ILE A 1 11 ? -1.294  21.295  4.562   1.00 0.00 ? 318 ILE A O    1  
ATOM   36    C  CB   . ILE A 1 11 ? -3.962  21.863  3.319   1.00 0.00 ? 318 ILE A CB   1  
ATOM   37    C  CG1  . ILE A 1 11 ? -4.473  20.430  3.496   1.00 0.00 ? 318 ILE A CG1  1  
ATOM   38    C  CG2  . ILE A 1 11 ? -2.914  21.933  2.215   1.00 0.00 ? 318 ILE A CG2  1  
ATOM   39    C  CD1  . ILE A 1 11 ? -5.733  20.339  4.333   1.00 0.00 ? 318 ILE A CD1  1  
ATOM   40    H  H    . ILE A 1 11 ? -2.417  24.033  3.712   1.00 0.00 ? 318 ILE A H    1  
ATOM   41    H  HA   . ILE A 1 11 ? -4.234  22.465  5.367   1.00 0.00 ? 318 ILE A HA   1  
ATOM   42    H  HB   . ILE A 1 11 ? -4.792  22.485  3.014   1.00 0.00 ? 318 ILE A HB   1  
ATOM   43    H  HG12 . ILE A 1 11 ? -4.689  20.008  2.525   1.00 0.00 ? 318 ILE A HG12 1  
ATOM   44    H  HG13 . ILE A 1 11 ? -3.708  19.839  3.979   1.00 0.00 ? 318 ILE A HG13 1  
ATOM   45    H  HG21 . ILE A 1 11 ? -2.055  21.340  2.495   1.00 0.00 ? 318 ILE A HG21 1  
ATOM   46    H  HG22 . ILE A 1 11 ? -2.610  22.960  2.072   1.00 0.00 ? 318 ILE A HG22 1  
ATOM   47    H  HG23 . ILE A 1 11 ? -3.332  21.550  1.295   1.00 0.00 ? 318 ILE A HG23 1  
ATOM   48    H  HD11 . ILE A 1 11 ? -6.522  20.900  3.856   1.00 0.00 ? 318 ILE A HD11 1  
ATOM   49    H  HD12 . ILE A 1 11 ? -5.546  20.745  5.316   1.00 0.00 ? 318 ILE A HD12 1  
ATOM   50    H  HD13 . ILE A 1 11 ? -6.031  19.305  4.421   1.00 0.00 ? 318 ILE A HD13 1  
ATOM   51    N  N    . PRO A 1 12 ? -2.427  21.143  6.504   1.00 0.00 ? 319 PRO A N    1  
ATOM   52    C  CA   . PRO A 1 12 ? -1.432  20.285  7.161   1.00 0.00 ? 319 PRO A CA   1  
ATOM   53    C  C    . PRO A 1 12 ? -1.215  18.934  6.449   1.00 0.00 ? 319 PRO A C    1  
ATOM   54    O  O    . PRO A 1 12 ? -0.065  18.574  6.184   1.00 0.00 ? 319 PRO A O    1  
ATOM   55    C  CB   . PRO A 1 12 ? -1.978  20.090  8.583   1.00 0.00 ? 319 PRO A CB   1  
ATOM   56    C  CG   . PRO A 1 12 ? -2.972  21.186  8.777   1.00 0.00 ? 319 PRO A CG   1  
ATOM   57    C  CD   . PRO A 1 12 ? -3.527  21.505  7.415   1.00 0.00 ? 319 PRO A CD   1  
ATOM   58    H  HA   . PRO A 1 12 ? -0.479  20.792  7.221   1.00 0.00 ? 319 PRO A HA   1  
ATOM   59    H  HB2  . PRO A 1 12 ? -2.437  19.119  8.666   1.00 0.00 ? 319 PRO A HB2  1  
ATOM   60    H  HB3  . PRO A 1 12 ? -1.168  20.168  9.293   1.00 0.00 ? 319 PRO A HB3  1  
ATOM   61    H  HG2  . PRO A 1 12 ? -3.762  20.852  9.433   1.00 0.00 ? 319 PRO A HG2  1  
ATOM   62    H  HG3  . PRO A 1 12 ? -2.481  22.053  9.192   1.00 0.00 ? 319 PRO A HG3  1  
ATOM   63    H  HD2  . PRO A 1 12 ? -4.404  20.909  7.215   1.00 0.00 ? 319 PRO A HD2  1  
ATOM   64    H  HD3  . PRO A 1 12 ? -3.758  22.558  7.340   1.00 0.00 ? 319 PRO A HD3  1  
ATOM   65    N  N    . PRO A 1 13 ? -2.283  18.149  6.131   1.00 0.00 ? 320 PRO A N    1  
ATOM   66    C  CA   . PRO A 1 13 ? -2.122  16.898  5.382   1.00 0.00 ? 320 PRO A CA   1  
ATOM   67    C  C    . PRO A 1 13 ? -1.523  17.129  3.999   1.00 0.00 ? 320 PRO A C    1  
ATOM   68    O  O    . PRO A 1 13 ? -1.880  18.080  3.303   1.00 0.00 ? 320 PRO A O    1  
ATOM   69    C  CB   . PRO A 1 13 ? -3.548  16.347  5.260   1.00 0.00 ? 320 PRO A CB   1  
ATOM   70    C  CG   . PRO A 1 13 ? -4.312  17.024  6.341   1.00 0.00 ? 320 PRO A CG   1  
ATOM   71    C  CD   . PRO A 1 13 ? -3.700  18.384  6.475   1.00 0.00 ? 320 PRO A CD   1  
ATOM   72    H  HA   . PRO A 1 13 ? -1.506  16.194  5.923   1.00 0.00 ? 320 PRO A HA   1  
ATOM   73    H  HB2  . PRO A 1 13 ? -3.946  16.585  4.285   1.00 0.00 ? 320 PRO A HB2  1  
ATOM   74    H  HB3  . PRO A 1 13 ? -3.535  15.277  5.400   1.00 0.00 ? 320 PRO A HB3  1  
ATOM   75    H  HG2  . PRO A 1 13 ? -5.353  17.106  6.063   1.00 0.00 ? 320 PRO A HG2  1  
ATOM   76    H  HG3  . PRO A 1 13 ? -4.211  16.474  7.264   1.00 0.00 ? 320 PRO A HG3  1  
ATOM   77    H  HD2  . PRO A 1 13 ? -4.158  19.074  5.775   1.00 0.00 ? 320 PRO A HD2  1  
ATOM   78    H  HD3  . PRO A 1 13 ? -3.798  18.743  7.493   1.00 0.00 ? 320 PRO A HD3  1  
ATOM   79    N  N    . ALA A 1 14 ? -0.621  16.247  3.605   1.00 0.00 ? 321 ALA A N    1  
ATOM   80    C  CA   . ALA A 1 14 ? 0.070   16.364  2.334   1.00 0.00 ? 321 ALA A CA   1  
ATOM   81    C  C    . ALA A 1 14 ? 0.138   14.994  1.696   1.00 0.00 ? 321 ALA A C    1  
ATOM   82    O  O    . ALA A 1 14 ? 1.035   14.690  0.910   1.00 0.00 ? 321 ALA A O    1  
ATOM   83    C  CB   . ALA A 1 14 ? 1.465   16.943  2.535   1.00 0.00 ? 321 ALA A CB   1  
ATOM   84    H  H    . ALA A 1 14 ? -0.423  15.474  4.180   1.00 0.00 ? 321 ALA A H    1  
ATOM   85    H  HA   . ALA A 1 14 ? -0.496  17.030  1.698   1.00 0.00 ? 321 ALA A HA   1  
ATOM   86    H  HB1  . ALA A 1 14 ? 1.388   17.915  2.999   1.00 0.00 ? 321 ALA A HB1  1  
ATOM   87    H  HB2  . ALA A 1 14 ? 1.955   17.039  1.577   1.00 0.00 ? 321 ALA A HB2  1  
ATOM   88    H  HB3  . ALA A 1 14 ? 2.039   16.285  3.169   1.00 0.00 ? 321 ALA A HB3  1  
ATOM   89    N  N    . ARG A 1 15 ? -0.832  14.170  2.055   1.00 0.00 ? 322 ARG A N    1  
ATOM   90    C  CA   . ARG A 1 15 ? -0.892  12.805  1.577   1.00 0.00 ? 322 ARG A CA   1  
ATOM   91    C  C    . ARG A 1 15 ? -1.283  12.760  0.114   1.00 0.00 ? 322 ARG A C    1  
ATOM   92    O  O    . ARG A 1 15 ? -2.467  12.799  -0.226  1.00 0.00 ? 322 ARG A O    1  
ATOM   93    C  CB   . ARG A 1 15 ? -1.867  11.981  2.416   1.00 0.00 ? 322 ARG A CB   1  
ATOM   94    C  CG   . ARG A 1 15 ? -1.382  11.707  3.831   1.00 0.00 ? 322 ARG A CG   1  
ATOM   95    C  CD   . ARG A 1 15 ? -0.055  10.961  3.828   1.00 0.00 ? 322 ARG A CD   1  
ATOM   96    N  NE   . ARG A 1 15 ? 0.394   10.626  5.176   1.00 0.00 ? 322 ARG A NE   1  
ATOM   97    C  CZ   . ARG A 1 15 ? 1.623   10.206  5.470   1.00 0.00 ? 322 ARG A CZ   1  
ATOM   98    N  NH1  . ARG A 1 15 ? 2.534   10.069  4.509   1.00 0.00 ? 322 ARG A NH1  1  
ATOM   99    N  NH2  . ARG A 1 15 ? 1.940   9.920   6.724   1.00 0.00 ? 322 ARG A NH2  1  
ATOM   100   H  H    . ARG A 1 15 ? -1.538  14.498  2.651   1.00 0.00 ? 322 ARG A H    1  
ATOM   101   H  HA   . ARG A 1 15 ? 0.090   12.385  1.675   1.00 0.00 ? 322 ARG A HA   1  
ATOM   102   H  HB2  . ARG A 1 15 ? -2.803  12.517  2.482   1.00 0.00 ? 322 ARG A HB2  1  
ATOM   103   H  HB3  . ARG A 1 15 ? -2.037  11.036  1.925   1.00 0.00 ? 322 ARG A HB3  1  
ATOM   104   H  HG2  . ARG A 1 15 ? -1.255  12.648  4.347   1.00 0.00 ? 322 ARG A HG2  1  
ATOM   105   H  HG3  . ARG A 1 15 ? -2.120  11.110  4.347   1.00 0.00 ? 322 ARG A HG3  1  
ATOM   106   H  HD2  . ARG A 1 15 ? -0.173  10.050  3.261   1.00 0.00 ? 322 ARG A HD2  1  
ATOM   107   H  HD3  . ARG A 1 15 ? 0.693   11.581  3.355   1.00 0.00 ? 322 ARG A HD3  1  
ATOM   108   H  HE   . ARG A 1 15 ? -0.263  10.717  5.905   1.00 0.00 ? 322 ARG A HE   1  
ATOM   109   H  HH11 . ARG A 1 15 ? 2.303   10.286  3.560   1.00 0.00 ? 322 ARG A HH11 1  
ATOM   110   H  HH12 . ARG A 1 15 ? 3.460   9.747   4.728   1.00 0.00 ? 322 ARG A HH12 1  
ATOM   111   H  HH21 . ARG A 1 15 ? 1.258   10.025  7.453   1.00 0.00 ? 322 ARG A HH21 1  
ATOM   112   H  HH22 . ARG A 1 15 ? 2.860   9.591   6.950   1.00 0.00 ? 322 ARG A HH22 1  
ATOM   113   N  N    . TRP A 1 16 ? -0.275  12.706  -0.744  1.00 0.00 ? 323 TRP A N    1  
ATOM   114   C  CA   . TRP A 1 16 ? -0.491  12.578  -2.172  1.00 0.00 ? 323 TRP A CA   1  
ATOM   115   C  C    . TRP A 1 16 ? -0.958  11.176  -2.517  1.00 0.00 ? 323 TRP A C    1  
ATOM   116   O  O    . TRP A 1 16 ? -0.175  10.329  -2.934  1.00 0.00 ? 323 TRP A O    1  
ATOM   117   C  CB   . TRP A 1 16 ? 0.777   12.927  -2.949  1.00 0.00 ? 323 TRP A CB   1  
ATOM   118   C  CG   . TRP A 1 16 ? 1.092   14.387  -2.916  1.00 0.00 ? 323 TRP A CG   1  
ATOM   119   C  CD1  . TRP A 1 16 ? 0.330   15.388  -3.440  1.00 0.00 ? 323 TRP A CD1  1  
ATOM   120   C  CD2  . TRP A 1 16 ? 2.242   15.013  -2.336  1.00 0.00 ? 323 TRP A CD2  1  
ATOM   121   N  NE1  . TRP A 1 16 ? 0.933   16.600  -3.223  1.00 0.00 ? 323 TRP A NE1  1  
ATOM   122   C  CE2  . TRP A 1 16 ? 2.109   16.399  -2.547  1.00 0.00 ? 323 TRP A CE2  1  
ATOM   123   C  CE3  . TRP A 1 16 ? 3.371   14.539  -1.658  1.00 0.00 ? 323 TRP A CE3  1  
ATOM   124   C  CZ2  . TRP A 1 16 ? 3.061   17.313  -2.105  1.00 0.00 ? 323 TRP A CZ2  1  
ATOM   125   C  CZ3  . TRP A 1 16 ? 4.314   15.449  -1.218  1.00 0.00 ? 323 TRP A CZ3  1  
ATOM   126   C  CH2  . TRP A 1 16 ? 4.154   16.822  -1.443  1.00 0.00 ? 323 TRP A CH2  1  
ATOM   127   H  H    . TRP A 1 16 ? 0.643   12.769  -0.405  1.00 0.00 ? 323 TRP A H    1  
ATOM   128   H  HA   . TRP A 1 16 ? -1.268  13.275  -2.446  1.00 0.00 ? 323 TRP A HA   1  
ATOM   129   H  HB2  . TRP A 1 16 ? 1.614   12.395  -2.523  1.00 0.00 ? 323 TRP A HB2  1  
ATOM   130   H  HB3  . TRP A 1 16 ? 0.654   12.634  -3.981  1.00 0.00 ? 323 TRP A HB3  1  
ATOM   131   H  HD1  . TRP A 1 16 ? -0.612  15.231  -3.948  1.00 0.00 ? 323 TRP A HD1  1  
ATOM   132   H  HE1  . TRP A 1 16 ? 0.578   17.471  -3.509  1.00 0.00 ? 323 TRP A HE1  1  
ATOM   133   H  HE3  . TRP A 1 16 ? 3.509   13.483  -1.475  1.00 0.00 ? 323 TRP A HE3  1  
ATOM   134   H  HZ2  . TRP A 1 16 ? 2.953   18.376  -2.267  1.00 0.00 ? 323 TRP A HZ2  1  
ATOM   135   H  HZ3  . TRP A 1 16 ? 5.191   15.102  -0.693  1.00 0.00 ? 323 TRP A HZ3  1  
ATOM   136   H  HH2  . TRP A 1 16 ? 4.918   17.495  -1.082  1.00 0.00 ? 323 TRP A HH2  1  
ATOM   137   N  N    . LYS A 1 17 ? -2.232  10.936  -2.257  1.00 0.00 ? 324 LYS A N    1  
ATOM   138   C  CA   . LYS A 1 17 ? -2.903  9.702   -2.640  1.00 0.00 ? 324 LYS A CA   1  
ATOM   139   C  C    . LYS A 1 17 ? -2.723  9.422   -4.136  1.00 0.00 ? 324 LYS A C    1  
ATOM   140   O  O    . LYS A 1 17 ? -3.316  10.099  -4.982  1.00 0.00 ? 324 LYS A O    1  
ATOM   141   C  CB   . LYS A 1 17 ? -4.391  9.811   -2.291  1.00 0.00 ? 324 LYS A CB   1  
ATOM   142   C  CG   . LYS A 1 17 ? -4.652  9.889   -0.792  1.00 0.00 ? 324 LYS A CG   1  
ATOM   143   C  CD   . LYS A 1 17 ? -6.095  10.265  -0.479  1.00 0.00 ? 324 LYS A CD   1  
ATOM   144   C  CE   . LYS A 1 17 ? -6.393  11.708  -0.859  1.00 0.00 ? 324 LYS A CE   1  
ATOM   145   N  NZ   . LYS A 1 17 ? -7.785  12.101  -0.519  1.00 0.00 ? 324 LYS A NZ   1  
ATOM   146   H  H    . LYS A 1 17 ? -2.738  11.616  -1.758  1.00 0.00 ? 324 LYS A H    1  
ATOM   147   H  HA   . LYS A 1 17 ? -2.465  8.893   -2.076  1.00 0.00 ? 324 LYS A HA   1  
ATOM   148   H  HB2  . LYS A 1 17 ? -4.786  10.715  -2.752  1.00 0.00 ? 324 LYS A HB2  1  
ATOM   149   H  HB3  . LYS A 1 17 ? -4.910  8.940   -2.685  1.00 0.00 ? 324 LYS A HB3  1  
ATOM   150   H  HG2  . LYS A 1 17 ? -4.442  8.925   -0.351  1.00 0.00 ? 324 LYS A HG2  1  
ATOM   151   H  HG3  . LYS A 1 17 ? -3.995  10.632  -0.362  1.00 0.00 ? 324 LYS A HG3  1  
ATOM   152   H  HD2  . LYS A 1 17 ? -6.755  9.614   -1.033  1.00 0.00 ? 324 LYS A HD2  1  
ATOM   153   H  HD3  . LYS A 1 17 ? -6.267  10.139  0.579   1.00 0.00 ? 324 LYS A HD3  1  
ATOM   154   H  HE2  . LYS A 1 17 ? -5.709  12.355  -0.330  1.00 0.00 ? 324 LYS A HE2  1  
ATOM   155   H  HE3  . LYS A 1 17 ? -6.246  11.824  -1.922  1.00 0.00 ? 324 LYS A HE3  1  
ATOM   156   H  HZ1  . LYS A 1 17 ? -7.974  13.071  -0.842  1.00 0.00 ? 324 LYS A HZ1  1  
ATOM   157   H  HZ2  . LYS A 1 17 ? -7.930  12.060  0.512   1.00 0.00 ? 324 LYS A HZ2  1  
ATOM   158   H  HZ3  . LYS A 1 17 ? -8.462  11.461  -0.976  1.00 0.00 ? 324 LYS A HZ3  1  
ATOM   159   N  N    . LEU A 1 18 ? -1.895  8.430   -4.451  1.00 0.00 ? 325 LEU A N    1  
ATOM   160   C  CA   . LEU A 1 18 ? -1.596  8.087   -5.837  1.00 0.00 ? 325 LEU A CA   1  
ATOM   161   C  C    . LEU A 1 18 ? -2.752  7.316   -6.465  1.00 0.00 ? 325 LEU A C    1  
ATOM   162   O  O    . LEU A 1 18 ? -3.595  6.755   -5.762  1.00 0.00 ? 325 LEU A O    1  
ATOM   163   C  CB   . LEU A 1 18 ? -0.315  7.246   -5.948  1.00 0.00 ? 325 LEU A CB   1  
ATOM   164   C  CG   . LEU A 1 18 ? 0.995   7.914   -5.499  1.00 0.00 ? 325 LEU A CG   1  
ATOM   165   C  CD1  . LEU A 1 18 ? 1.065   9.362   -5.969  1.00 0.00 ? 325 LEU A CD1  1  
ATOM   166   C  CD2  . LEU A 1 18 ? 1.170   7.811   -3.989  1.00 0.00 ? 325 LEU A CD2  1  
ATOM   167   H  H    . LEU A 1 18 ? -1.478  7.913   -3.732  1.00 0.00 ? 325 LEU A H    1  
ATOM   168   H  HA   . LEU A 1 18 ? -1.458  9.009   -6.383  1.00 0.00 ? 325 LEU A HA   1  
ATOM   169   H  HB2  . LEU A 1 18 ? -0.454  6.349   -5.343  1.00 0.00 ? 325 LEU A HB2  1  
ATOM   170   H  HB3  . LEU A 1 18 ? -0.200  6.952   -6.993  1.00 0.00 ? 325 LEU A HB3  1  
ATOM   171   H  HG   . LEU A 1 18 ? 1.819   7.391   -5.959  1.00 0.00 ? 325 LEU A HG   1  
ATOM   172   H  HD11 . LEU A 1 18 ? 2.008   9.793   -5.669  1.00 0.00 ? 325 LEU A HD11 1  
ATOM   173   H  HD12 . LEU A 1 18 ? 0.256   9.923   -5.526  1.00 0.00 ? 325 LEU A HD12 1  
ATOM   174   H  HD13 . LEU A 1 18 ? 0.978   9.394   -7.045  1.00 0.00 ? 325 LEU A HD13 1  
ATOM   175   H  HD21 . LEU A 1 18 ? 1.194   6.769   -3.700  1.00 0.00 ? 325 LEU A HD21 1  
ATOM   176   H  HD22 . LEU A 1 18 ? 0.345   8.301   -3.495  1.00 0.00 ? 325 LEU A HD22 1  
ATOM   177   H  HD23 . LEU A 1 18 ? 2.097   8.285   -3.700  1.00 0.00 ? 325 LEU A HD23 1  
ATOM   178   N  N    . THR A 1 19 ? -2.780  7.291   -7.790  1.00 0.00 ? 326 THR A N    1  
ATOM   179   C  CA   . THR A 1 19 ? -3.810  6.573   -8.517  1.00 0.00 ? 326 THR A CA   1  
ATOM   180   C  C    . THR A 1 19 ? -3.429  5.102   -8.676  1.00 0.00 ? 326 THR A C    1  
ATOM   181   O  O    . THR A 1 19 ? -2.333  4.770   -9.125  1.00 0.00 ? 326 THR A O    1  
ATOM   182   C  CB   . THR A 1 19 ? -4.052  7.196   -9.903  1.00 0.00 ? 326 THR A CB   1  
ATOM   183   O  OG1  . THR A 1 19 ? -4.145  8.625   -9.780  1.00 0.00 ? 326 THR A OG1  1  
ATOM   184   C  CG2  . THR A 1 19 ? -5.333  6.654   -10.529 1.00 0.00 ? 326 THR A CG2  1  
ATOM   185   H  H    . THR A 1 19 ? -2.091  7.769   -8.293  1.00 0.00 ? 326 THR A H    1  
ATOM   186   H  HA   . THR A 1 19 ? -4.726  6.639   -7.948  1.00 0.00 ? 326 THR A HA   1  
ATOM   187   H  HB   . THR A 1 19 ? -3.220  6.948   -10.543 1.00 0.00 ? 326 THR A HB   1  
ATOM   188   H  HG1  . THR A 1 19 ? -3.676  9.040   -10.515 1.00 0.00 ? 326 THR A HG1  1  
ATOM   189   H  HG21 . THR A 1 19 ? -5.267  5.578   -10.616 1.00 0.00 ? 326 THR A HG21 1  
ATOM   190   H  HG22 . THR A 1 19 ? -5.468  7.087   -11.509 1.00 0.00 ? 326 THR A HG22 1  
ATOM   191   H  HG23 . THR A 1 19 ? -6.177  6.911   -9.905  1.00 0.00 ? 326 THR A HG23 1  
ATOM   192   N  N    . CYS A 1 20 ? -4.350  4.237   -8.301  1.00 0.00 ? 327 CYS A N    1  
ATOM   193   C  CA   . CYS A 1 20 ? -4.141  2.801   -8.339  1.00 0.00 ? 327 CYS A CA   1  
ATOM   194   C  C    . CYS A 1 20 ? -4.635  2.235   -9.665  1.00 0.00 ? 327 CYS A C    1  
ATOM   195   O  O    . CYS A 1 20 ? -5.831  2.291   -9.954  1.00 0.00 ? 327 CYS A O    1  
ATOM   196   C  CB   . CYS A 1 20 ? -4.894  2.167   -7.162  1.00 0.00 ? 327 CYS A CB   1  
ATOM   197   S  SG   . CYS A 1 20 ? -5.063  0.363   -7.218  1.00 0.00 ? 327 CYS A SG   1  
ATOM   198   H  H    . CYS A 1 20 ? -5.223  4.583   -8.006  1.00 0.00 ? 327 CYS A H    1  
ATOM   199   H  HA   . CYS A 1 20 ? -3.083  2.609   -8.234  1.00 0.00 ? 327 CYS A HA   1  
ATOM   200   H  HB2  . CYS A 1 20 ? -4.377  2.412   -6.246  1.00 0.00 ? 327 CYS A HB2  1  
ATOM   201   H  HB3  . CYS A 1 20 ? -5.889  2.587   -7.122  1.00 0.00 ? 327 CYS A HB3  1  
ATOM   202   N  N    . TYR A 1 21 ? -3.724  1.686   -10.471 1.00 0.00 ? 328 TYR A N    1  
ATOM   203   C  CA   . TYR A 1 21 ? -4.101  1.163   -11.783 1.00 0.00 ? 328 TYR A CA   1  
ATOM   204   C  C    . TYR A 1 21 ? -5.014  -0.050  -11.625 1.00 0.00 ? 328 TYR A C    1  
ATOM   205   O  O    . TYR A 1 21 ? -5.889  -0.301  -12.455 1.00 0.00 ? 328 TYR A O    1  
ATOM   206   C  CB   . TYR A 1 21 ? -2.863  0.816   -12.625 1.00 0.00 ? 328 TYR A CB   1  
ATOM   207   C  CG   . TYR A 1 21 ? -2.075  -0.378  -12.135 1.00 0.00 ? 328 TYR A CG   1  
ATOM   208   C  CD1  . TYR A 1 21 ? -1.157  -0.254  -11.102 1.00 0.00 ? 328 TYR A CD1  1  
ATOM   209   C  CD2  . TYR A 1 21 ? -2.245  -1.629  -12.714 1.00 0.00 ? 328 TYR A CD2  1  
ATOM   210   C  CE1  . TYR A 1 21 ? -0.432  -1.341  -10.659 1.00 0.00 ? 328 TYR A CE1  1  
ATOM   211   C  CE2  . TYR A 1 21 ? -1.525  -2.721  -12.275 1.00 0.00 ? 328 TYR A CE2  1  
ATOM   212   C  CZ   . TYR A 1 21 ? -0.619  -2.572  -11.250 1.00 0.00 ? 328 TYR A CZ   1  
ATOM   213   O  OH   . TYR A 1 21 ? 0.097   -3.661  -10.810 1.00 0.00 ? 328 TYR A OH   1  
ATOM   214   H  H    . TYR A 1 21 ? -2.783  1.636   -10.179 1.00 0.00 ? 328 TYR A H    1  
ATOM   215   H  HA   . TYR A 1 21 ? -4.658  1.939   -12.289 1.00 0.00 ? 328 TYR A HA   1  
ATOM   216   H  HB2  . TYR A 1 21 ? -3.175  0.609   -13.637 1.00 0.00 ? 328 TYR A HB2  1  
ATOM   217   H  HB3  . TYR A 1 21 ? -2.198  1.669   -12.630 1.00 0.00 ? 328 TYR A HB3  1  
ATOM   218   H  HD1  . TYR A 1 21 ? -1.014  0.712   -10.641 1.00 0.00 ? 328 TYR A HD1  1  
ATOM   219   H  HD2  . TYR A 1 21 ? -2.956  -1.743  -13.520 1.00 0.00 ? 328 TYR A HD2  1  
ATOM   220   H  HE1  . TYR A 1 21 ? 0.277   -1.223  -9.854  1.00 0.00 ? 328 TYR A HE1  1  
ATOM   221   H  HE2  . TYR A 1 21 ? -1.672  -3.683  -12.736 1.00 0.00 ? 328 TYR A HE2  1  
ATOM   222   H  HH   . TYR A 1 21 ? 0.123   -4.332  -11.519 1.00 0.00 ? 328 TYR A HH   1  
ATOM   223   N  N    . LEU A 1 22 ? -4.816  -0.792  -10.542 1.00 0.00 ? 329 LEU A N    1  
ATOM   224   C  CA   . LEU A 1 22 ? -5.729  -1.865  -10.180 1.00 0.00 ? 329 LEU A CA   1  
ATOM   225   C  C    . LEU A 1 22 ? -6.881  -1.288  -9.366  1.00 0.00 ? 329 LEU A C    1  
ATOM   226   O  O    . LEU A 1 22 ? -6.991  -1.549  -8.157  1.00 0.00 ? 329 LEU A O    1  
ATOM   227   C  CB   . LEU A 1 22 ? -5.003  -2.962  -9.391  1.00 0.00 ? 329 LEU A CB   1  
ATOM   228   C  CG   . LEU A 1 22 ? -3.944  -3.738  -10.176 1.00 0.00 ? 329 LEU A CG   1  
ATOM   229   C  CD1  . LEU A 1 22 ? -3.203  -4.706  -9.267  1.00 0.00 ? 329 LEU A CD1  1  
ATOM   230   C  CD2  . LEU A 1 22 ? -4.580  -4.483  -11.339 1.00 0.00 ? 329 LEU A CD2  1  
ATOM   231   H  H    . LEU A 1 22 ? -4.036  -0.613  -9.979  1.00 0.00 ? 329 LEU A H    1  
ATOM   232   H  HA   . LEU A 1 22 ? -6.125  -2.285  -11.092 1.00 0.00 ? 329 LEU A HA   1  
ATOM   233   H  HB2  . LEU A 1 22 ? -4.523  -2.503  -8.538  1.00 0.00 ? 329 LEU A HB2  1  
ATOM   234   H  HB3  . LEU A 1 22 ? -5.740  -3.665  -9.034  1.00 0.00 ? 329 LEU A HB3  1  
ATOM   235   H  HG   . LEU A 1 22 ? -3.222  -3.042  -10.579 1.00 0.00 ? 329 LEU A HG   1  
ATOM   236   H  HD11 . LEU A 1 22 ? -2.682  -4.153  -8.500  1.00 0.00 ? 329 LEU A HD11 1  
ATOM   237   H  HD12 . LEU A 1 22 ? -2.491  -5.273  -9.848  1.00 0.00 ? 329 LEU A HD12 1  
ATOM   238   H  HD13 . LEU A 1 22 ? -3.909  -5.382  -8.808  1.00 0.00 ? 329 LEU A HD13 1  
ATOM   239   H  HD21 . LEU A 1 22 ? -5.360  -5.132  -10.970 1.00 0.00 ? 329 LEU A HD21 1  
ATOM   240   H  HD22 . LEU A 1 22 ? -3.830  -5.073  -11.843 1.00 0.00 ? 329 LEU A HD22 1  
ATOM   241   H  HD23 . LEU A 1 22 ? -5.003  -3.772  -12.034 1.00 0.00 ? 329 LEU A HD23 1  
ATOM   242   N  N    . CYS A 1 23 ? -7.679  -0.454  -10.044 1.00 0.00 ? 330 CYS A N    1  
ATOM   243   C  CA   . CYS A 1 23 ? -8.819  0.272   -9.469  1.00 0.00 ? 330 CYS A CA   1  
ATOM   244   C  C    . CYS A 1 23 ? -9.305  1.327   -10.455 1.00 0.00 ? 330 CYS A C    1  
ATOM   245   O  O    . CYS A 1 23 ? -10.495 1.421   -10.749 1.00 0.00 ? 330 CYS A O    1  
ATOM   246   C  CB   . CYS A 1 23 ? -8.451  0.992   -8.168  1.00 0.00 ? 330 CYS A CB   1  
ATOM   247   S  SG   . CYS A 1 23 ? -8.587  -0.010  -6.672  1.00 0.00 ? 330 CYS A SG   1  
ATOM   248   H  H    . CYS A 1 23 ? -7.489  -0.321  -11.001 1.00 0.00 ? 330 CYS A H    1  
ATOM   249   H  HA   . CYS A 1 23 ? -9.614  -0.435  -9.280  1.00 0.00 ? 330 CYS A HA   1  
ATOM   250   H  HB2  . CYS A 1 23 ? -7.428  1.331   -8.236  1.00 0.00 ? 330 CYS A HB2  1  
ATOM   251   H  HB3  . CYS A 1 23 ? -9.097  1.848   -8.050  1.00 0.00 ? 330 CYS A HB3  1  
ATOM   252   N  N    . LYS A 1 24 ? -8.345  2.122   -10.934 1.00 0.00 ? 331 LYS A N    1  
ATOM   253   C  CA   . LYS A 1 24 ? -8.586  3.285   -11.793 1.00 0.00 ? 331 LYS A CA   1  
ATOM   254   C  C    . LYS A 1 24 ? -9.080  4.454   -10.945 1.00 0.00 ? 331 LYS A C    1  
ATOM   255   O  O    . LYS A 1 24 ? -9.621  5.434   -11.455 1.00 0.00 ? 331 LYS A O    1  
ATOM   256   C  CB   . LYS A 1 24 ? -9.564  2.982   -12.937 1.00 0.00 ? 331 LYS A CB   1  
ATOM   257   C  CG   . LYS A 1 24 ? -9.384  3.905   -14.138 1.00 0.00 ? 331 LYS A CG   1  
ATOM   258   C  CD   . LYS A 1 24 ? -10.440 3.677   -15.212 1.00 0.00 ? 331 LYS A CD   1  
ATOM   259   C  CE   . LYS A 1 24 ? -11.670 4.555   -15.006 1.00 0.00 ? 331 LYS A CE   1  
ATOM   260   N  NZ   . LYS A 1 24 ? -12.422 4.204   -13.772 1.00 0.00 ? 331 LYS A NZ   1  
ATOM   261   H  H    . LYS A 1 24 ? -7.416  1.929   -10.681 1.00 0.00 ? 331 LYS A H    1  
ATOM   262   H  HA   . LYS A 1 24 ? -7.632  3.565   -12.220 1.00 0.00 ? 331 LYS A HA   1  
ATOM   263   H  HB2  . LYS A 1 24 ? -9.416  1.963   -13.266 1.00 0.00 ? 331 LYS A HB2  1  
ATOM   264   H  HB3  . LYS A 1 24 ? -10.574 3.091   -12.573 1.00 0.00 ? 331 LYS A HB3  1  
ATOM   265   H  HG2  . LYS A 1 24 ? -9.449  4.929   -13.802 1.00 0.00 ? 331 LYS A HG2  1  
ATOM   266   H  HG3  . LYS A 1 24 ? -8.408  3.729   -14.566 1.00 0.00 ? 331 LYS A HG3  1  
ATOM   267   H  HD2  . LYS A 1 24 ? -10.012 3.903   -16.176 1.00 0.00 ? 331 LYS A HD2  1  
ATOM   268   H  HD3  . LYS A 1 24 ? -10.744 2.640   -15.189 1.00 0.00 ? 331 LYS A HD3  1  
ATOM   269   H  HE2  . LYS A 1 24 ? -11.352 5.584   -14.939 1.00 0.00 ? 331 LYS A HE2  1  
ATOM   270   H  HE3  . LYS A 1 24 ? -12.322 4.437   -15.860 1.00 0.00 ? 331 LYS A HE3  1  
ATOM   271   H  HZ1  . LYS A 1 24 ? -12.670 3.193   -13.776 1.00 0.00 ? 331 LYS A HZ1  1  
ATOM   272   H  HZ2  . LYS A 1 24 ? -13.299 4.761   -13.718 1.00 0.00 ? 331 LYS A HZ2  1  
ATOM   273   H  HZ3  . LYS A 1 24 ? -11.849 4.407   -12.930 1.00 0.00 ? 331 LYS A HZ3  1  
ATOM   274   N  N    . GLN A 1 25 ? -8.882  4.333   -9.635  1.00 0.00 ? 332 GLN A N    1  
ATOM   275   C  CA   . GLN A 1 25 ? -9.173  5.384   -8.707  1.00 0.00 ? 332 GLN A CA   1  
ATOM   276   C  C    . GLN A 1 25 ? -7.984  5.531   -7.768  1.00 0.00 ? 332 GLN A C    1  
ATOM   277   O  O    . GLN A 1 25 ? -6.871  5.136   -8.107  1.00 0.00 ? 332 GLN A O    1  
ATOM   278   C  CB   . GLN A 1 25 ? -10.446 5.060   -7.932  1.00 0.00 ? 332 GLN A CB   1  
ATOM   279   C  CG   . GLN A 1 25 ? -10.365 3.779   -7.129  1.00 0.00 ? 332 GLN A CG   1  
ATOM   280   C  CD   . GLN A 1 25 ? -11.141 3.882   -5.843  1.00 0.00 ? 332 GLN A CD   1  
ATOM   281   O  OE1  . GLN A 1 25 ? -11.255 4.958   -5.262  1.00 0.00 ? 332 GLN A OE1  1  
ATOM   282   N  NE2  . GLN A 1 25 ? -11.680 2.774   -5.391  1.00 0.00 ? 332 GLN A NE2  1  
ATOM   283   H  H    . GLN A 1 25 ? -8.522  3.509   -9.277  1.00 0.00 ? 332 GLN A H    1  
ATOM   284   H  HA   . GLN A 1 25 ? -9.307  6.300   -9.262  1.00 0.00 ? 332 GLN A HA   1  
ATOM   285   H  HB2  . GLN A 1 25 ? -10.663 5.869   -7.256  1.00 0.00 ? 332 GLN A HB2  1  
ATOM   286   H  HB3  . GLN A 1 25 ? -11.256 4.961   -8.636  1.00 0.00 ? 332 GLN A HB3  1  
ATOM   287   H  HG2  . GLN A 1 25 ? -10.775 2.970   -7.716  1.00 0.00 ? 332 GLN A HG2  1  
ATOM   288   H  HG3  . GLN A 1 25 ? -9.330  3.572   -6.897  1.00 0.00 ? 332 GLN A HG3  1  
ATOM   289   H  HE21 . GLN A 1 25 ? -11.556 1.950   -5.905  1.00 0.00 ? 332 GLN A HE21 1  
ATOM   290   H  HE22 . GLN A 1 25 ? -12.191 2.822   -4.563  1.00 0.00 ? 332 GLN A HE22 1  
ATOM   291   N  N    . LYS A 1 26 ? -8.223  6.038   -6.583  1.00 0.00 ? 333 LYS A N    1  
ATOM   292   C  CA   . LYS A 1 26 ? -7.132  6.388   -5.680  1.00 0.00 ? 333 LYS A CA   1  
ATOM   293   C  C    . LYS A 1 26 ? -7.372  5.909   -4.244  1.00 0.00 ? 333 LYS A C    1  
ATOM   294   O  O    . LYS A 1 26 ? -6.654  5.034   -3.752  1.00 0.00 ? 333 LYS A O    1  
ATOM   295   C  CB   . LYS A 1 26 ? -6.905  7.905   -5.711  1.00 0.00 ? 333 LYS A CB   1  
ATOM   296   C  CG   . LYS A 1 26 ? -8.192  8.710   -5.615  1.00 0.00 ? 333 LYS A CG   1  
ATOM   297   C  CD   . LYS A 1 26 ? -7.945  10.202  -5.722  1.00 0.00 ? 333 LYS A CD   1  
ATOM   298   C  CE   . LYS A 1 26 ? -9.256  10.970  -5.719  1.00 0.00 ? 333 LYS A CE   1  
ATOM   299   N  NZ   . LYS A 1 26 ? -10.084 10.639  -4.531  1.00 0.00 ? 333 LYS A NZ   1  
ATOM   300   H  H    . LYS A 1 26 ? -9.150  6.160   -6.303  1.00 0.00 ? 333 LYS A H    1  
ATOM   301   H  HA   . LYS A 1 26 ? -6.241  5.907   -6.050  1.00 0.00 ? 333 LYS A HA   1  
ATOM   302   H  HB2  . LYS A 1 26 ? -6.269  8.180   -4.882  1.00 0.00 ? 333 LYS A HB2  1  
ATOM   303   H  HB3  . LYS A 1 26 ? -6.411  8.164   -6.635  1.00 0.00 ? 333 LYS A HB3  1  
ATOM   304   H  HG2  . LYS A 1 26 ? -8.851  8.409   -6.414  1.00 0.00 ? 333 LYS A HG2  1  
ATOM   305   H  HG3  . LYS A 1 26 ? -8.658  8.502   -4.666  1.00 0.00 ? 333 LYS A HG3  1  
ATOM   306   H  HD2  . LYS A 1 26 ? -7.349  10.522  -4.882  1.00 0.00 ? 333 LYS A HD2  1  
ATOM   307   H  HD3  . LYS A 1 26 ? -7.420  10.407  -6.643  1.00 0.00 ? 333 LYS A HD3  1  
ATOM   308   H  HE2  . LYS A 1 26 ? -9.040  12.028  -5.711  1.00 0.00 ? 333 LYS A HE2  1  
ATOM   309   H  HE3  . LYS A 1 26 ? -9.806  10.721  -6.613  1.00 0.00 ? 333 LYS A HE3  1  
ATOM   310   H  HZ1  . LYS A 1 26 ? -9.564  10.860  -3.658  1.00 0.00 ? 333 LYS A HZ1  1  
ATOM   311   H  HZ2  . LYS A 1 26 ? -10.325 9.626   -4.531  1.00 0.00 ? 333 LYS A HZ2  1  
ATOM   312   H  HZ3  . LYS A 1 26 ? -10.964 11.190  -4.542  1.00 0.00 ? 333 LYS A HZ3  1  
ATOM   313   N  N    . GLY A 1 27 ? -8.390  6.447   -3.583  1.00 0.00 ? 334 GLY A N    1  
ATOM   314   C  CA   . GLY A 1 27 ? -8.527  6.243   -2.154  1.00 0.00 ? 334 GLY A CA   1  
ATOM   315   C  C    . GLY A 1 27 ? -9.478  5.125   -1.787  1.00 0.00 ? 334 GLY A C    1  
ATOM   316   O  O    . GLY A 1 27 ? -10.485 4.909   -2.459  1.00 0.00 ? 334 GLY A O    1  
ATOM   317   H  H    . GLY A 1 27 ? -9.067  6.965   -4.070  1.00 0.00 ? 334 GLY A H    1  
ATOM   318   H  HA2  . GLY A 1 27 ? -7.554  6.016   -1.743  1.00 0.00 ? 334 GLY A HA2  1  
ATOM   319   H  HA3  . GLY A 1 27 ? -8.882  7.160   -1.707  1.00 0.00 ? 334 GLY A HA3  1  
ATOM   320   N  N    . VAL A 1 28 ? -9.146  4.428   -0.703  1.00 0.00 ? 335 VAL A N    1  
ATOM   321   C  CA   . VAL A 1 28 ? -9.970  3.344   -0.170  1.00 0.00 ? 335 VAL A CA   1  
ATOM   322   C  C    . VAL A 1 28 ? -9.261  2.695   1.020   1.00 0.00 ? 335 VAL A C    1  
ATOM   323   O  O    . VAL A 1 28 ? -9.898  2.206   1.952   1.00 0.00 ? 335 VAL A O    1  
ATOM   324   C  CB   . VAL A 1 28 ? -10.299 2.264   -1.238  1.00 0.00 ? 335 VAL A CB   1  
ATOM   325   C  CG1  . VAL A 1 28 ? -9.051  1.513   -1.684  1.00 0.00 ? 335 VAL A CG1  1  
ATOM   326   C  CG2  . VAL A 1 28 ? -11.349 1.294   -0.717  1.00 0.00 ? 335 VAL A CG2  1  
ATOM   327   H  H    . VAL A 1 28 ? -8.319  4.669   -0.228  1.00 0.00 ? 335 VAL A H    1  
ATOM   328   H  HA   . VAL A 1 28 ? -10.900 3.778   0.176   1.00 0.00 ? 335 VAL A HA   1  
ATOM   329   H  HB   . VAL A 1 28 ? -10.710 2.767   -2.103  1.00 0.00 ? 335 VAL A HB   1  
ATOM   330   H  HG11 . VAL A 1 28 ? -8.338  2.211   -2.094  1.00 0.00 ? 335 VAL A HG11 1  
ATOM   331   H  HG12 . VAL A 1 28 ? -9.317  0.784   -2.439  1.00 0.00 ? 335 VAL A HG12 1  
ATOM   332   H  HG13 . VAL A 1 28 ? -8.613  1.009   -0.835  1.00 0.00 ? 335 VAL A HG13 1  
ATOM   333   H  HG21 . VAL A 1 28 ? -11.544 0.539   -1.466  1.00 0.00 ? 335 VAL A HG21 1  
ATOM   334   H  HG22 . VAL A 1 28 ? -12.261 1.830   -0.500  1.00 0.00 ? 335 VAL A HG22 1  
ATOM   335   H  HG23 . VAL A 1 28 ? -10.986 0.821   0.183   1.00 0.00 ? 335 VAL A HG23 1  
ATOM   336   N  N    . GLY A 1 29 ? -7.933  2.715   0.986   1.00 0.00 ? 336 GLY A N    1  
ATOM   337   C  CA   . GLY A 1 29 ? -7.151  2.122   2.049   1.00 0.00 ? 336 GLY A CA   1  
ATOM   338   C  C    . GLY A 1 29 ? -5.727  2.633   2.057   1.00 0.00 ? 336 GLY A C    1  
ATOM   339   O  O    . GLY A 1 29 ? -5.461  3.736   2.535   1.00 0.00 ? 336 GLY A O    1  
ATOM   340   H  H    . GLY A 1 29 ? -7.481  3.145   0.234   1.00 0.00 ? 336 GLY A H    1  
ATOM   341   H  HA2  . GLY A 1 29 ? -7.618  2.368   3.003   1.00 0.00 ? 336 GLY A HA2  1  
ATOM   342   H  HA3  . GLY A 1 29 ? -7.137  1.038   1.912   1.00 0.00 ? 336 GLY A HA3  1  
ATOM   343   N  N    . ALA A 1 30 ? -4.814  1.849   1.504   1.00 0.00 ? 337 ALA A N    1  
ATOM   344   C  CA   . ALA A 1 30 ? -3.407  2.217   1.484   1.00 0.00 ? 337 ALA A CA   1  
ATOM   345   C  C    . ALA A 1 30 ? -2.826  2.031   0.091   1.00 0.00 ? 337 ALA A C    1  
ATOM   346   O  O    . ALA A 1 30 ? -3.204  1.102   -0.635  1.00 0.00 ? 337 ALA A O    1  
ATOM   347   C  CB   . ALA A 1 30 ? -2.629  1.395   2.500   1.00 0.00 ? 337 ALA A CB   1  
ATOM   348   H  H    . ALA A 1 30 ? -5.091  1.006   1.088   1.00 0.00 ? 337 ALA A H    1  
ATOM   349   H  HA   . ALA A 1 30 ? -3.329  3.259   1.761   1.00 0.00 ? 337 ALA A HA   1  
ATOM   350   H  HB1  . ALA A 1 30 ? -2.678  0.350   2.232   1.00 0.00 ? 337 ALA A HB1  1  
ATOM   351   H  HB2  . ALA A 1 30 ? -3.061  1.535   3.481   1.00 0.00 ? 337 ALA A HB2  1  
ATOM   352   H  HB3  . ALA A 1 30 ? -1.598  1.717   2.511   1.00 0.00 ? 337 ALA A HB3  1  
ATOM   353   N  N    . SER A 1 31 ? -1.923  2.919   -0.284  1.00 0.00 ? 338 SER A N    1  
ATOM   354   C  CA   . SER A 1 31 ? -1.313  2.877   -1.598  1.00 0.00 ? 338 SER A CA   1  
ATOM   355   C  C    . SER A 1 31 ? 0.158   2.480   -1.511  1.00 0.00 ? 338 SER A C    1  
ATOM   356   O  O    . SER A 1 31 ? 0.862   2.858   -0.571  1.00 0.00 ? 338 SER A O    1  
ATOM   357   C  CB   . SER A 1 31 ? -1.463  4.237   -2.280  1.00 0.00 ? 338 SER A CB   1  
ATOM   358   O  OG   . SER A 1 31 ? -1.090  5.290   -1.405  1.00 0.00 ? 338 SER A OG   1  
ATOM   359   H  H    . SER A 1 31 ? -1.654  3.626   0.339   1.00 0.00 ? 338 SER A H    1  
ATOM   360   H  HA   . SER A 1 31 ? -1.836  2.134   -2.181  1.00 0.00 ? 338 SER A HA   1  
ATOM   361   H  HB2  . SER A 1 31 ? -0.832  4.271   -3.154  1.00 0.00 ? 338 SER A HB2  1  
ATOM   362   H  HB3  . SER A 1 31 ? -2.493  4.377   -2.574  1.00 0.00 ? 338 SER A HB3  1  
ATOM   363   H  HG   . SER A 1 31 ? -0.158  5.204   -1.178  1.00 0.00 ? 338 SER A HG   1  
ATOM   364   N  N    . ILE A 1 32 ? 0.600   1.709   -2.490  1.00 0.00 ? 339 ILE A N    1  
ATOM   365   C  CA   . ILE A 1 32 ? 1.990   1.297   -2.605  1.00 0.00 ? 339 ILE A CA   1  
ATOM   366   C  C    . ILE A 1 32 ? 2.487   1.612   -4.015  1.00 0.00 ? 339 ILE A C    1  
ATOM   367   O  O    . ILE A 1 32 ? 1.764   1.411   -4.994  1.00 0.00 ? 339 ILE A O    1  
ATOM   368   C  CB   . ILE A 1 32 ? 2.160   -0.215  -2.287  1.00 0.00 ? 339 ILE A CB   1  
ATOM   369   C  CG1  . ILE A 1 32 ? 3.588   -0.694  -2.569  1.00 0.00 ? 339 ILE A CG1  1  
ATOM   370   C  CG2  . ILE A 1 32 ? 1.157   -1.051  -3.069  1.00 0.00 ? 339 ILE A CG2  1  
ATOM   371   C  CD1  . ILE A 1 32 ? 4.626   -0.103  -1.639  1.00 0.00 ? 339 ILE A CD1  1  
ATOM   372   H  H    . ILE A 1 32 ? -0.037  1.404   -3.177  1.00 0.00 ? 339 ILE A H    1  
ATOM   373   H  HA   . ILE A 1 32 ? 2.569   1.866   -1.891  1.00 0.00 ? 339 ILE A HA   1  
ATOM   374   H  HB   . ILE A 1 32 ? 1.948   -0.355  -1.236  1.00 0.00 ? 339 ILE A HB   1  
ATOM   375   H  HG12 . ILE A 1 32 ? 3.627   -1.775  -2.460  1.00 0.00 ? 339 ILE A HG12 1  
ATOM   376   H  HG13 . ILE A 1 32 ? 3.858   -0.418  -3.587  1.00 0.00 ? 339 ILE A HG13 1  
ATOM   377   H  HG21 . ILE A 1 32 ? 1.282   -2.094  -2.817  1.00 0.00 ? 339 ILE A HG21 1  
ATOM   378   H  HG22 . ILE A 1 32 ? 1.326   -0.914  -4.126  1.00 0.00 ? 339 ILE A HG22 1  
ATOM   379   H  HG23 . ILE A 1 32 ? 0.154   -0.738  -2.821  1.00 0.00 ? 339 ILE A HG23 1  
ATOM   380   H  HD11 . ILE A 1 32 ? 4.383   -0.359  -0.619  1.00 0.00 ? 339 ILE A HD11 1  
ATOM   381   H  HD12 . ILE A 1 32 ? 4.640   0.971   -1.749  1.00 0.00 ? 339 ILE A HD12 1  
ATOM   382   H  HD13 . ILE A 1 32 ? 5.599   -0.503  -1.889  1.00 0.00 ? 339 ILE A HD13 1  
ATOM   383   N  N    . GLN A 1 33 ? 3.700   2.130   -4.113  1.00 0.00 ? 340 GLN A N    1  
ATOM   384   C  CA   . GLN A 1 33 ? 4.254   2.528   -5.390  1.00 0.00 ? 340 GLN A CA   1  
ATOM   385   C  C    . GLN A 1 33 ? 5.407   1.601   -5.752  1.00 0.00 ? 340 GLN A C    1  
ATOM   386   O  O    . GLN A 1 33 ? 6.356   1.441   -4.984  1.00 0.00 ? 340 GLN A O    1  
ATOM   387   C  CB   . GLN A 1 33 ? 4.715   3.988   -5.328  1.00 0.00 ? 340 GLN A CB   1  
ATOM   388   C  CG   . GLN A 1 33 ? 4.863   4.643   -6.693  1.00 0.00 ? 340 GLN A CG   1  
ATOM   389   C  CD   . GLN A 1 33 ? 5.116   6.107   -6.616  1.00 0.00 ? 340 GLN A CD   1  
ATOM   390   O  OE1  . GLN A 1 33 ? 5.633   6.631   -5.628  1.00 0.00 ? 340 GLN A OE1  1  
ATOM   391   N  NE2  . GLN A 1 33 ? 4.806   6.768   -7.692  1.00 0.00 ? 340 GLN A NE2  1  
ATOM   392   H  H    . GLN A 1 33 ? 4.244   2.230   -3.311  1.00 0.00 ? 340 GLN A H    1  
ATOM   393   H  HA   . GLN A 1 33 ? 3.479   2.432   -6.134  1.00 0.00 ? 340 GLN A HA   1  
ATOM   394   H  HB2  . GLN A 1 33 ? 3.994   4.555   -4.757  1.00 0.00 ? 340 GLN A HB2  1  
ATOM   395   H  HB3  . GLN A 1 33 ? 5.671   4.030   -4.826  1.00 0.00 ? 340 GLN A HB3  1  
ATOM   396   H  HG2  . GLN A 1 33 ? 5.700   4.224   -7.219  1.00 0.00 ? 340 GLN A HG2  1  
ATOM   397   H  HG3  . GLN A 1 33 ? 3.944   4.483   -7.258  1.00 0.00 ? 340 GLN A HG3  1  
ATOM   398   H  HE21 . GLN A 1 33 ? 4.425   6.276   -8.451  1.00 0.00 ? 340 GLN A HE21 1  
ATOM   399   H  HE22 . GLN A 1 33 ? 5.009   7.692   -7.710  1.00 0.00 ? 340 GLN A HE22 1  
ATOM   400   N  N    . CYS A 1 34 ? 5.295   0.970   -6.909  1.00 0.00 ? 341 CYS A N    1  
ATOM   401   C  CA   . CYS A 1 34 ? 6.272   -0.011  -7.351  1.00 0.00 ? 341 CYS A CA   1  
ATOM   402   C  C    . CYS A 1 34 ? 7.632   0.627   -7.601  1.00 0.00 ? 341 CYS A C    1  
ATOM   403   O  O    . CYS A 1 34 ? 7.734   1.816   -7.914  1.00 0.00 ? 341 CYS A O    1  
ATOM   404   C  CB   . CYS A 1 34 ? 5.791   -0.728  -8.615  1.00 0.00 ? 341 CYS A CB   1  
ATOM   405   S  SG   . CYS A 1 34 ? 6.447   -0.064  -10.165 1.00 0.00 ? 341 CYS A SG   1  
ATOM   406   H  H    . CYS A 1 34 ? 4.517   1.158   -7.475  1.00 0.00 ? 341 CYS A H    1  
ATOM   407   H  HA   . CYS A 1 34 ? 6.378   -0.739  -6.560  1.00 0.00 ? 341 CYS A HA   1  
ATOM   408   H  HB2  . CYS A 1 34 ? 6.079   -1.766  -8.561  1.00 0.00 ? 341 CYS A HB2  1  
ATOM   409   H  HB3  . CYS A 1 34 ? 4.716   -0.665  -8.664  1.00 0.00 ? 341 CYS A HB3  1  
ATOM   410   N  N    . HIS A 1 35 ? 8.655   -0.205  -7.500  1.00 0.00 ? 342 HIS A N    1  
ATOM   411   C  CA   . HIS A 1 35 ? 10.042  0.223   -7.574  1.00 0.00 ? 342 HIS A CA   1  
ATOM   412   C  C    . HIS A 1 35 ? 10.420  0.582   -9.016  1.00 0.00 ? 342 HIS A C    1  
ATOM   413   O  O    . HIS A 1 35 ? 9.638   0.358   -9.946  1.00 0.00 ? 342 HIS A O    1  
ATOM   414   C  CB   . HIS A 1 35 ? 10.931  -0.903  -7.023  1.00 0.00 ? 342 HIS A CB   1  
ATOM   415   C  CG   . HIS A 1 35 ? 12.322  -0.491  -6.634  1.00 0.00 ? 342 HIS A CG   1  
ATOM   416   N  ND1  . HIS A 1 35 ? 12.620  0.106   -5.428  1.00 0.00 ? 342 HIS A ND1  1  
ATOM   417   C  CD2  . HIS A 1 35 ? 13.502  -0.638  -7.278  1.00 0.00 ? 342 HIS A CD2  1  
ATOM   418   C  CE1  . HIS A 1 35 ? 13.923  0.306   -5.348  1.00 0.00 ? 342 HIS A CE1  1  
ATOM   419   N  NE2  . HIS A 1 35 ? 14.483  -0.138  -6.460  1.00 0.00 ? 342 HIS A NE2  1  
ATOM   420   H  H    . HIS A 1 35 ? 8.463   -1.165  -7.369  1.00 0.00 ? 342 HIS A H    1  
ATOM   421   H  HA   . HIS A 1 35 ? 10.155  1.099   -6.953  1.00 0.00 ? 342 HIS A HA   1  
ATOM   422   H  HB2  . HIS A 1 35 ? 10.458  -1.317  -6.131  1.00 0.00 ? 342 HIS A HB2  1  
ATOM   423   H  HB3  . HIS A 1 35 ? 11.019  -1.680  -7.786  1.00 0.00 ? 342 HIS A HB3  1  
ATOM   424   H  HD1  . HIS A 1 35 ? 11.971  0.354   -4.730  1.00 0.00 ? 342 HIS A HD1  1  
ATOM   425   H  HD2  . HIS A 1 35 ? 13.645  -1.075  -8.258  1.00 0.00 ? 342 HIS A HD2  1  
ATOM   426   H  HE1  . HIS A 1 35 ? 14.444  0.754   -4.514  1.00 0.00 ? 342 HIS A HE1  1  
ATOM   427   H  HE2  . HIS A 1 35 ? 15.449  -0.313  -6.569  1.00 0.00 ? 342 HIS A HE2  1  
ATOM   428   N  N    . LYS A 1 36 ? 11.630  1.117   -9.170  1.00 0.00 ? 343 LYS A N    1  
ATOM   429   C  CA   . LYS A 1 36 ? 12.154  1.635   -10.434 1.00 0.00 ? 343 LYS A CA   1  
ATOM   430   C  C    . LYS A 1 36 ? 11.583  3.026   -10.693 1.00 0.00 ? 343 LYS A C    1  
ATOM   431   O  O    . LYS A 1 36 ? 10.407  3.180   -11.031 1.00 0.00 ? 343 LYS A O    1  
ATOM   432   C  CB   . LYS A 1 36 ? 11.872  0.686   -11.611 1.00 0.00 ? 343 LYS A CB   1  
ATOM   433   C  CG   . LYS A 1 36 ? 12.773  0.903   -12.821 1.00 0.00 ? 343 LYS A CG   1  
ATOM   434   C  CD   . LYS A 1 36 ? 14.050  0.058   -12.751 1.00 0.00 ? 343 LYS A CD   1  
ATOM   435   C  CE   . LYS A 1 36 ? 14.919  0.398   -11.545 1.00 0.00 ? 343 LYS A CE   1  
ATOM   436   N  NZ   . LYS A 1 36 ? 16.175  -0.397  -11.519 1.00 0.00 ? 343 LYS A NZ   1  
ATOM   437   H  H    . LYS A 1 36 ? 12.199  1.186   -8.381  1.00 0.00 ? 343 LYS A H    1  
ATOM   438   H  HA   . LYS A 1 36 ? 13.225  1.731   -10.316 1.00 0.00 ? 343 LYS A HA   1  
ATOM   439   H  HB2  . LYS A 1 36 ? 12.005  -0.332  -11.275 1.00 0.00 ? 343 LYS A HB2  1  
ATOM   440   H  HB3  . LYS A 1 36 ? 10.848  0.819   -11.925 1.00 0.00 ? 343 LYS A HB3  1  
ATOM   441   H  HG2  . LYS A 1 36 ? 12.221  0.626   -13.719 1.00 0.00 ? 343 LYS A HG2  1  
ATOM   442   H  HG3  . LYS A 1 36 ? 13.050  1.957   -12.861 1.00 0.00 ? 343 LYS A HG3  1  
ATOM   443   H  HD2  . LYS A 1 36 ? 13.766  -0.992  -12.682 1.00 0.00 ? 343 LYS A HD2  1  
ATOM   444   H  HD3  . LYS A 1 36 ? 14.628  0.230   -13.661 1.00 0.00 ? 343 LYS A HD3  1  
ATOM   445   H  HE2  . LYS A 1 36 ? 15.171  1.446   -11.579 1.00 0.00 ? 343 LYS A HE2  1  
ATOM   446   H  HE3  . LYS A 1 36 ? 14.356  0.192   -10.647 1.00 0.00 ? 343 LYS A HE3  1  
ATOM   447   H  HZ1  . LYS A 1 36 ? 15.962  -1.414  -11.508 1.00 0.00 ? 343 LYS A HZ1  1  
ATOM   448   H  HZ2  . LYS A 1 36 ? 16.731  -0.161  -10.671 1.00 0.00 ? 343 LYS A HZ2  1  
ATOM   449   H  HZ3  . LYS A 1 36 ? 16.751  -0.189  -12.361 1.00 0.00 ? 343 LYS A HZ3  1  
ATOM   450   N  N    . ALA A 1 37 ? 12.430  4.036   -10.520 1.00 0.00 ? 344 ALA A N    1  
ATOM   451   C  CA   . ALA A 1 37 ? 12.012  5.435   -10.582 1.00 0.00 ? 344 ALA A CA   1  
ATOM   452   C  C    . ALA A 1 37 ? 11.474  5.822   -11.955 1.00 0.00 ? 344 ALA A C    1  
ATOM   453   O  O    . ALA A 1 37 ? 10.654  6.727   -12.073 1.00 0.00 ? 344 ALA A O    1  
ATOM   454   C  CB   . ALA A 1 37 ? 13.172  6.340   -10.202 1.00 0.00 ? 344 ALA A CB   1  
ATOM   455   H  H    . ALA A 1 37 ? 13.375  3.835   -10.344 1.00 0.00 ? 344 ALA A H    1  
ATOM   456   H  HA   . ALA A 1 37 ? 11.229  5.574   -9.852  1.00 0.00 ? 344 ALA A HA   1  
ATOM   457   H  HB1  . ALA A 1 37 ? 13.545  6.058   -9.228  1.00 0.00 ? 344 ALA A HB1  1  
ATOM   458   H  HB2  . ALA A 1 37 ? 12.835  7.366   -10.176 1.00 0.00 ? 344 ALA A HB2  1  
ATOM   459   H  HB3  . ALA A 1 37 ? 13.962  6.241   -10.933 1.00 0.00 ? 344 ALA A HB3  1  
ATOM   460   N  N    . ASN A 1 38 ? 11.934  5.137   -12.994 1.00 0.00 ? 345 ASN A N    1  
ATOM   461   C  CA   . ASN A 1 38 ? 11.470  5.413   -14.350 1.00 0.00 ? 345 ASN A CA   1  
ATOM   462   C  C    . ASN A 1 38 ? 10.149  4.707   -14.630 1.00 0.00 ? 345 ASN A C    1  
ATOM   463   O  O    . ASN A 1 38 ? 9.671   4.677   -15.767 1.00 0.00 ? 345 ASN A O    1  
ATOM   464   C  CB   . ASN A 1 38 ? 12.516  4.989   -15.384 1.00 0.00 ? 345 ASN A CB   1  
ATOM   465   C  CG   . ASN A 1 38 ? 13.698  5.938   -15.446 1.00 0.00 ? 345 ASN A CG   1  
ATOM   466   O  OD1  . ASN A 1 38 ? 13.674  6.930   -16.172 1.00 0.00 ? 345 ASN A OD1  1  
ATOM   467   N  ND2  . ASN A 1 38 ? 14.744  5.636   -14.701 1.00 0.00 ? 345 ASN A ND2  1  
ATOM   468   H  H    . ASN A 1 38 ? 12.602  4.434   -12.846 1.00 0.00 ? 345 ASN A H    1  
ATOM   469   H  HA   . ASN A 1 38 ? 11.314  6.479   -14.430 1.00 0.00 ? 345 ASN A HA   1  
ATOM   470   H  HB2  . ASN A 1 38 ? 12.885  4.007   -15.128 1.00 0.00 ? 345 ASN A HB2  1  
ATOM   471   H  HB3  . ASN A 1 38 ? 12.054  4.951   -16.359 1.00 0.00 ? 345 ASN A HB3  1  
ATOM   472   H  HD21 . ASN A 1 38 ? 14.705  4.824   -14.154 1.00 0.00 ? 345 ASN A HD21 1  
ATOM   473   H  HD22 . ASN A 1 38 ? 15.522  6.233   -14.729 1.00 0.00 ? 345 ASN A HD22 1  
ATOM   474   N  N    . CYS A 1 39 ? 9.559   4.146   -13.590 1.00 0.00 ? 346 CYS A N    1  
ATOM   475   C  CA   . CYS A 1 39 ? 8.300   3.443   -13.713 1.00 0.00 ? 346 CYS A CA   1  
ATOM   476   C  C    . CYS A 1 39 ? 7.277   4.006   -12.736 1.00 0.00 ? 346 CYS A C    1  
ATOM   477   O  O    . CYS A 1 39 ? 6.262   4.560   -13.158 1.00 0.00 ? 346 CYS A O    1  
ATOM   478   C  CB   . CYS A 1 39 ? 8.507   1.949   -13.464 1.00 0.00 ? 346 CYS A CB   1  
ATOM   479   S  SG   . CYS A 1 39 ? 6.990   0.962   -13.533 1.00 0.00 ? 346 CYS A SG   1  
ATOM   480   H  H    . CYS A 1 39 ? 9.979   4.218   -12.706 1.00 0.00 ? 346 CYS A H    1  
ATOM   481   H  HA   . CYS A 1 39 ? 7.935   3.585   -14.719 1.00 0.00 ? 346 CYS A HA   1  
ATOM   482   H  HB2  . CYS A 1 39 ? 9.184   1.560   -14.208 1.00 0.00 ? 346 CYS A HB2  1  
ATOM   483   H  HB3  . CYS A 1 39 ? 8.943   1.816   -12.484 1.00 0.00 ? 346 CYS A HB3  1  
ATOM   484   N  N    . TYR A 1 40 ? 7.564   3.860   -11.438 1.00 0.00 ? 347 TYR A N    1  
ATOM   485   C  CA   . TYR A 1 40 ? 6.666   4.309   -10.369 1.00 0.00 ? 347 TYR A CA   1  
ATOM   486   C  C    . TYR A 1 40 ? 5.213   3.914   -10.632 1.00 0.00 ? 347 TYR A C    1  
ATOM   487   O  O    . TYR A 1 40 ? 4.405   4.730   -11.067 1.00 0.00 ? 347 TYR A O    1  
ATOM   488   C  CB   . TYR A 1 40 ? 6.762   5.825   -10.161 1.00 0.00 ? 347 TYR A CB   1  
ATOM   489   C  CG   . TYR A 1 40 ? 7.946   6.268   -9.325  1.00 0.00 ? 347 TYR A CG   1  
ATOM   490   C  CD1  . TYR A 1 40 ? 8.355   5.534   -8.216  1.00 0.00 ? 347 TYR A CD1  1  
ATOM   491   C  CD2  . TYR A 1 40 ? 8.639   7.432   -9.633  1.00 0.00 ? 347 TYR A CD2  1  
ATOM   492   C  CE1  . TYR A 1 40 ? 9.422   5.946   -7.444  1.00 0.00 ? 347 TYR A CE1  1  
ATOM   493   C  CE2  . TYR A 1 40 ? 9.704   7.852   -8.861  1.00 0.00 ? 347 TYR A CE2  1  
ATOM   494   C  CZ   . TYR A 1 40 ? 10.092  7.105   -7.767  1.00 0.00 ? 347 TYR A CZ   1  
ATOM   495   O  OH   . TYR A 1 40 ? 11.148  7.524   -6.992  1.00 0.00 ? 347 TYR A OH   1  
ATOM   496   H  H    . TYR A 1 40 ? 8.418   3.440   -11.187 1.00 0.00 ? 347 TYR A H    1  
ATOM   497   H  HA   . TYR A 1 40 ? 6.985   3.821   -9.463  1.00 0.00 ? 347 TYR A HA   1  
ATOM   498   H  HB2  . TYR A 1 40 ? 6.841   6.306   -11.126 1.00 0.00 ? 347 TYR A HB2  1  
ATOM   499   H  HB3  . TYR A 1 40 ? 5.865   6.168   -9.671  1.00 0.00 ? 347 TYR A HB3  1  
ATOM   500   H  HD1  . TYR A 1 40 ? 7.830   4.626   -7.962  1.00 0.00 ? 347 TYR A HD1  1  
ATOM   501   H  HD2  . TYR A 1 40 ? 8.332   8.014   -10.490 1.00 0.00 ? 347 TYR A HD2  1  
ATOM   502   H  HE1  . TYR A 1 40 ? 9.725   5.360   -6.589  1.00 0.00 ? 347 TYR A HE1  1  
ATOM   503   H  HE2  . TYR A 1 40 ? 10.230  8.760   -9.116  1.00 0.00 ? 347 TYR A HE2  1  
ATOM   504   H  HH   . TYR A 1 40 ? 10.999  8.442   -6.727  1.00 0.00 ? 347 TYR A HH   1  
ATOM   505   N  N    . THR A 1 41 ? 4.880   2.665   -10.363 1.00 0.00 ? 348 THR A N    1  
ATOM   506   C  CA   . THR A 1 41 ? 3.525   2.190   -10.603 1.00 0.00 ? 348 THR A CA   1  
ATOM   507   C  C    . THR A 1 41 ? 2.752   2.126   -9.288  1.00 0.00 ? 348 THR A C    1  
ATOM   508   O  O    . THR A 1 41 ? 3.146   1.407   -8.377  1.00 0.00 ? 348 THR A O    1  
ATOM   509   C  CB   . THR A 1 41 ? 3.522   0.797   -11.262 1.00 0.00 ? 348 THR A CB   1  
ATOM   510   O  OG1  . THR A 1 41 ? 4.571   0.700   -12.250 1.00 0.00 ? 348 THR A OG1  1  
ATOM   511   C  CG2  . THR A 1 41 ? 2.182   0.535   -11.927 1.00 0.00 ? 348 THR A CG2  1  
ATOM   512   H  H    . THR A 1 41 ? 5.551   2.058   -9.974  1.00 0.00 ? 348 THR A H    1  
ATOM   513   H  HA   . THR A 1 41 ? 3.036   2.888   -11.267 1.00 0.00 ? 348 THR A HA   1  
ATOM   514   H  HB   . THR A 1 41 ? 3.682   0.049   -10.498 1.00 0.00 ? 348 THR A HB   1  
ATOM   515   H  HG1  . THR A 1 41 ? 4.469   1.441   -12.887 1.00 0.00 ? 348 THR A HG1  1  
ATOM   516   H  HG21 . THR A 1 41 ? 2.186   -0.449  -12.370 1.00 0.00 ? 348 THR A HG21 1  
ATOM   517   H  HG22 . THR A 1 41 ? 2.007   1.276   -12.694 1.00 0.00 ? 348 THR A HG22 1  
ATOM   518   H  HG23 . THR A 1 41 ? 1.398   0.591   -11.186 1.00 0.00 ? 348 THR A HG23 1  
ATOM   519   N  N    . ALA A 1 42 ? 1.658   2.863   -9.194  1.00 0.00 ? 349 ALA A N    1  
ATOM   520   C  CA   . ALA A 1 42 ? 0.927   2.963   -7.940  1.00 0.00 ? 349 ALA A CA   1  
ATOM   521   C  C    . ALA A 1 42 ? -0.299  2.056   -7.920  1.00 0.00 ? 349 ALA A C    1  
ATOM   522   O  O    . ALA A 1 42 ? -1.045  1.964   -8.898  1.00 0.00 ? 349 ALA A O    1  
ATOM   523   C  CB   . ALA A 1 42 ? 0.521   4.404   -7.687  1.00 0.00 ? 349 ALA A CB   1  
ATOM   524   H  H    . ALA A 1 42 ? 1.330   3.348   -9.980  1.00 0.00 ? 349 ALA A H    1  
ATOM   525   H  HA   . ALA A 1 42 ? 1.592   2.662   -7.145  1.00 0.00 ? 349 ALA A HA   1  
ATOM   526   H  HB1  . ALA A 1 42 ? -0.174  4.720   -8.451  1.00 0.00 ? 349 ALA A HB1  1  
ATOM   527   H  HB2  . ALA A 1 42 ? 1.399   5.034   -7.715  1.00 0.00 ? 349 ALA A HB2  1  
ATOM   528   H  HB3  . ALA A 1 42 ? 0.053   4.482   -6.717  1.00 0.00 ? 349 ALA A HB3  1  
ATOM   529   N  N    . PHE A 1 43 ? -0.484  1.372   -6.798  1.00 0.00 ? 350 PHE A N    1  
ATOM   530   C  CA   . PHE A 1 43 ? -1.625  0.495   -6.597  1.00 0.00 ? 350 PHE A CA   1  
ATOM   531   C  C    . PHE A 1 43 ? -1.909  0.336   -5.106  1.00 0.00 ? 350 PHE A C    1  
ATOM   532   O  O    . PHE A 1 43 ? -1.318  1.029   -4.281  1.00 0.00 ? 350 PHE A O    1  
ATOM   533   C  CB   . PHE A 1 43 ? -1.401  -0.871  -7.273  1.00 0.00 ? 350 PHE A CB   1  
ATOM   534   C  CG   . PHE A 1 43 ? -0.076  -1.527  -6.969  1.00 0.00 ? 350 PHE A CG   1  
ATOM   535   C  CD1  . PHE A 1 43 ? 1.105   -1.020  -7.493  1.00 0.00 ? 350 PHE A CD1  1  
ATOM   536   C  CD2  . PHE A 1 43 ? -0.012  -2.666  -6.183  1.00 0.00 ? 350 PHE A CD2  1  
ATOM   537   C  CE1  . PHE A 1 43 ? 2.316   -1.629  -7.235  1.00 0.00 ? 350 PHE A CE1  1  
ATOM   538   C  CE2  . PHE A 1 43 ? 1.201   -3.277  -5.921  1.00 0.00 ? 350 PHE A CE2  1  
ATOM   539   C  CZ   . PHE A 1 43 ? 2.364   -2.757  -6.448  1.00 0.00 ? 350 PHE A CZ   1  
ATOM   540   H  H    . PHE A 1 43 ? 0.183   1.455   -6.076  1.00 0.00 ? 350 PHE A H    1  
ATOM   541   H  HA   . PHE A 1 43 ? -2.482  0.971   -7.054  1.00 0.00 ? 350 PHE A HA   1  
ATOM   542   H  HB2  . PHE A 1 43 ? -2.176  -1.548  -6.953  1.00 0.00 ? 350 PHE A HB2  1  
ATOM   543   H  HB3  . PHE A 1 43 ? -1.467  -0.742  -8.345  1.00 0.00 ? 350 PHE A HB3  1  
ATOM   544   H  HD1  . PHE A 1 43 ? 1.070   -0.132  -8.107  1.00 0.00 ? 350 PHE A HD1  1  
ATOM   545   H  HD2  . PHE A 1 43 ? -0.920  -3.074  -5.768  1.00 0.00 ? 350 PHE A HD2  1  
ATOM   546   H  HE1  . PHE A 1 43 ? 3.224   -1.220  -7.649  1.00 0.00 ? 350 PHE A HE1  1  
ATOM   547   H  HE2  . PHE A 1 43 ? 1.240   -4.163  -5.308  1.00 0.00 ? 350 PHE A HE2  1  
ATOM   548   H  HZ   . PHE A 1 43 ? 3.311   -3.235  -6.244  1.00 0.00 ? 350 PHE A HZ   1  
ATOM   549   N  N    . HIS A 1 44 ? -2.822  -0.558  -4.753  1.00 0.00 ? 351 HIS A N    1  
ATOM   550   C  CA   . HIS A 1 44 ? -3.191  -0.745  -3.352  1.00 0.00 ? 351 HIS A CA   1  
ATOM   551   C  C    . HIS A 1 44 ? -2.534  -1.987  -2.783  1.00 0.00 ? 351 HIS A C    1  
ATOM   552   O  O    . HIS A 1 44 ? -2.223  -2.923  -3.518  1.00 0.00 ? 351 HIS A O    1  
ATOM   553   C  CB   . HIS A 1 44 ? -4.708  -0.873  -3.180  1.00 0.00 ? 351 HIS A CB   1  
ATOM   554   C  CG   . HIS A 1 44 ? -5.472  0.375   -3.481  1.00 0.00 ? 351 HIS A CG   1  
ATOM   555   N  ND1  . HIS A 1 44 ? -6.444  0.445   -4.466  1.00 0.00 ? 351 HIS A ND1  1  
ATOM   556   C  CD2  . HIS A 1 44 ? -5.423  1.603   -2.906  1.00 0.00 ? 351 HIS A CD2  1  
ATOM   557   C  CE1  . HIS A 1 44 ? -6.953  1.678   -4.474  1.00 0.00 ? 351 HIS A CE1  1  
ATOM   558   N  NE2  . HIS A 1 44 ? -6.349  2.389   -3.544  1.00 0.00 ? 351 HIS A NE2  1  
ATOM   559   H  H    . HIS A 1 44 ? -3.228  -1.125  -5.440  1.00 0.00 ? 351 HIS A H    1  
ATOM   560   H  HA   . HIS A 1 44 ? -2.846  0.118   -2.800  1.00 0.00 ? 351 HIS A HA   1  
ATOM   561   H  HB2  . HIS A 1 44 ? -5.073  -1.649  -3.839  1.00 0.00 ? 351 HIS A HB2  1  
ATOM   562   H  HB3  . HIS A 1 44 ? -4.920  -1.153  -2.160  1.00 0.00 ? 351 HIS A HB3  1  
ATOM   563   H  HD2  . HIS A 1 44 ? -4.788  1.900   -2.081  1.00 0.00 ? 351 HIS A HD2  1  
ATOM   564   H  HE1  . HIS A 1 44 ? -7.732  2.034   -5.133  1.00 0.00 ? 351 HIS A HE1  1  
ATOM   565   H  HE2  . HIS A 1 44 ? -6.414  3.375   -3.459  1.00 0.00 ? 351 HIS A HE2  1  
ATOM   566   N  N    . VAL A 1 45 ? -2.354  -2.003  -1.471  1.00 0.00 ? 352 VAL A N    1  
ATOM   567   C  CA   . VAL A 1 45 ? -1.809  -3.169  -0.786  1.00 0.00 ? 352 VAL A CA   1  
ATOM   568   C  C    . VAL A 1 45 ? -2.717  -4.381  -1.000  1.00 0.00 ? 352 VAL A C    1  
ATOM   569   O  O    . VAL A 1 45 ? -2.245  -5.496  -1.221  1.00 0.00 ? 352 VAL A O    1  
ATOM   570   C  CB   . VAL A 1 45 ? -1.642  -2.905  0.726   1.00 0.00 ? 352 VAL A CB   1  
ATOM   571   C  CG1  . VAL A 1 45 ? -1.003  -4.097  1.421   1.00 0.00 ? 352 VAL A CG1  1  
ATOM   572   C  CG2  . VAL A 1 45 ? -0.820  -1.645  0.960   1.00 0.00 ? 352 VAL A CG2  1  
ATOM   573   H  H    . VAL A 1 45 ? -2.581  -1.203  -0.947  1.00 0.00 ? 352 VAL A H    1  
ATOM   574   H  HA   . VAL A 1 45 ? -0.835  -3.380  -1.207  1.00 0.00 ? 352 VAL A HA   1  
ATOM   575   H  HB   . VAL A 1 45 ? -2.623  -2.752  1.153   1.00 0.00 ? 352 VAL A HB   1  
ATOM   576   H  HG11 . VAL A 1 45 ? -0.920  -3.893  2.478   1.00 0.00 ? 352 VAL A HG11 1  
ATOM   577   H  HG12 . VAL A 1 45 ? -0.020  -4.269  1.009   1.00 0.00 ? 352 VAL A HG12 1  
ATOM   578   H  HG13 . VAL A 1 45 ? -1.616  -4.973  1.269   1.00 0.00 ? 352 VAL A HG13 1  
ATOM   579   H  HG21 . VAL A 1 45 ? 0.155   -1.763  0.514   1.00 0.00 ? 352 VAL A HG21 1  
ATOM   580   H  HG22 . VAL A 1 45 ? -0.712  -1.477  2.023   1.00 0.00 ? 352 VAL A HG22 1  
ATOM   581   H  HG23 . VAL A 1 45 ? -1.322  -0.800  0.513   1.00 0.00 ? 352 VAL A HG23 1  
ATOM   582   N  N    . THR A 1 46 ? -4.027  -4.143  -0.959  1.00 0.00 ? 353 THR A N    1  
ATOM   583   C  CA   . THR A 1 46 ? -5.006  -5.194  -1.208  1.00 0.00 ? 353 THR A CA   1  
ATOM   584   C  C    . THR A 1 46 ? -4.893  -5.711  -2.645  1.00 0.00 ? 353 THR A C    1  
ATOM   585   O  O    . THR A 1 46 ? -5.150  -6.881  -2.915  1.00 0.00 ? 353 THR A O    1  
ATOM   586   C  CB   . THR A 1 46 ? -6.452  -4.703  -0.935  1.00 0.00 ? 353 THR A CB   1  
ATOM   587   O  OG1  . THR A 1 46 ? -7.388  -5.774  -1.110  1.00 0.00 ? 353 THR A OG1  1  
ATOM   588   C  CG2  . THR A 1 46 ? -6.831  -3.545  -1.850  1.00 0.00 ? 353 THR A CG2  1  
ATOM   589   H  H    . THR A 1 46 ? -4.340  -3.244  -0.737  1.00 0.00 ? 353 THR A H    1  
ATOM   590   H  HA   . THR A 1 46 ? -4.792  -6.009  -0.531  1.00 0.00 ? 353 THR A HA   1  
ATOM   591   H  HB   . THR A 1 46 ? -6.507  -4.358  0.088   1.00 0.00 ? 353 THR A HB   1  
ATOM   592   H  HG1  . THR A 1 46 ? -7.630  -6.127  -0.245  1.00 0.00 ? 353 THR A HG1  1  
ATOM   593   H  HG21 . THR A 1 46 ? -7.842  -3.230  -1.633  1.00 0.00 ? 353 THR A HG21 1  
ATOM   594   H  HG22 . THR A 1 46 ? -6.766  -3.862  -2.879  1.00 0.00 ? 353 THR A HG22 1  
ATOM   595   H  HG23 . THR A 1 46 ? -6.154  -2.720  -1.685  1.00 0.00 ? 353 THR A HG23 1  
ATOM   596   N  N    . CYS A 1 47 ? -4.472  -4.844  -3.560  1.00 0.00 ? 354 CYS A N    1  
ATOM   597   C  CA   . CYS A 1 47 ? -4.302  -5.233  -4.949  1.00 0.00 ? 354 CYS A CA   1  
ATOM   598   C  C    . CYS A 1 47 ? -3.073  -6.123  -5.089  1.00 0.00 ? 354 CYS A C    1  
ATOM   599   O  O    . CYS A 1 47 ? -3.072  -7.084  -5.853  1.00 0.00 ? 354 CYS A O    1  
ATOM   600   C  CB   . CYS A 1 47 ? -4.157  -3.998  -5.842  1.00 0.00 ? 354 CYS A CB   1  
ATOM   601   S  SG   . CYS A 1 47 ? -5.565  -2.859  -5.793  1.00 0.00 ? 354 CYS A SG   1  
ATOM   602   H  H    . CYS A 1 47 ? -4.252  -3.930  -3.289  1.00 0.00 ? 354 CYS A H    1  
ATOM   603   H  HA   . CYS A 1 47 ? -5.177  -5.790  -5.251  1.00 0.00 ? 354 CYS A HA   1  
ATOM   604   H  HB2  . CYS A 1 47 ? -3.281  -3.445  -5.534  1.00 0.00 ? 354 CYS A HB2  1  
ATOM   605   H  HB3  . CYS A 1 47 ? -4.030  -4.318  -6.865  1.00 0.00 ? 354 CYS A HB3  1  
ATOM   606   N  N    . ALA A 1 48 ? -2.040  -5.803  -4.321  1.00 0.00 ? 355 ALA A N    1  
ATOM   607   C  CA   . ALA A 1 48 ? -0.798  -6.560  -4.344  1.00 0.00 ? 355 ALA A CA   1  
ATOM   608   C  C    . ALA A 1 48 ? -1.006  -7.971  -3.821  1.00 0.00 ? 355 ALA A C    1  
ATOM   609   O  O    . ALA A 1 48 ? -0.565  -8.941  -4.435  1.00 0.00 ? 355 ALA A O    1  
ATOM   610   C  CB   . ALA A 1 48 ? 0.266   -5.849  -3.529  1.00 0.00 ? 355 ALA A CB   1  
ATOM   611   H  H    . ALA A 1 48 ? -2.114  -5.031  -3.721  1.00 0.00 ? 355 ALA A H    1  
ATOM   612   H  HA   . ALA A 1 48 ? -0.461  -6.615  -5.368  1.00 0.00 ? 355 ALA A HA   1  
ATOM   613   H  HB1  . ALA A 1 48 ? 1.230   -6.297  -3.723  1.00 0.00 ? 355 ALA A HB1  1  
ATOM   614   H  HB2  . ALA A 1 48 ? 0.033   -5.941  -2.478  1.00 0.00 ? 355 ALA A HB2  1  
ATOM   615   H  HB3  . ALA A 1 48 ? 0.290   -4.805  -3.799  1.00 0.00 ? 355 ALA A HB3  1  
ATOM   616   N  N    . GLN A 1 49 ? -1.682  -8.079  -2.683  1.00 0.00 ? 356 GLN A N    1  
ATOM   617   C  CA   . GLN A 1 49 ? -1.981  -9.376  -2.089  1.00 0.00 ? 356 GLN A CA   1  
ATOM   618   C  C    . GLN A 1 49 ? -2.903  -10.175 -2.996  1.00 0.00 ? 356 GLN A C    1  
ATOM   619   O  O    . GLN A 1 49 ? -2.809  -11.401 -3.077  1.00 0.00 ? 356 GLN A O    1  
ATOM   620   C  CB   . GLN A 1 49 ? -2.643  -9.198  -0.723  1.00 0.00 ? 356 GLN A CB   1  
ATOM   621   C  CG   . GLN A 1 49 ? -1.763  -8.506  0.303   1.00 0.00 ? 356 GLN A CG   1  
ATOM   622   C  CD   . GLN A 1 49 ? -2.477  -8.311  1.623   1.00 0.00 ? 356 GLN A CD   1  
ATOM   623   O  OE1  . GLN A 1 49 ? -3.356  -9.092  1.985   1.00 0.00 ? 356 GLN A OE1  1  
ATOM   624   N  NE2  . GLN A 1 49 ? -2.106  -7.276  2.353   1.00 0.00 ? 356 GLN A NE2  1  
ATOM   625   H  H    . GLN A 1 49 ? -1.986  -7.263  -2.228  1.00 0.00 ? 356 GLN A H    1  
ATOM   626   H  HA   . GLN A 1 49 ? -1.053  -9.914  -1.967  1.00 0.00 ? 356 GLN A HA   1  
ATOM   627   H  HB2  . GLN A 1 49 ? -3.545  -8.602  -0.850  1.00 0.00 ? 356 GLN A HB2  1  
ATOM   628   H  HB3  . GLN A 1 49 ? -2.908  -10.180 -0.335  1.00 0.00 ? 356 GLN A HB3  1  
ATOM   629   H  HG2  . GLN A 1 49 ? -0.877  -9.116  0.475   1.00 0.00 ? 356 GLN A HG2  1  
ATOM   630   H  HG3  . GLN A 1 49 ? -1.477  -7.528  -0.086  1.00 0.00 ? 356 GLN A HG3  1  
ATOM   631   H  HE21 . GLN A 1 49 ? -1.397  -6.695  2.009   1.00 0.00 ? 356 GLN A HE21 1  
ATOM   632   H  HE22 . GLN A 1 49 ? -2.556  -7.132  3.213   1.00 0.00 ? 356 GLN A HE22 1  
ATOM   633   N  N    . LYS A 1 50 ? -3.788  -9.462  -3.678  1.00 0.00 ? 357 LYS A N    1  
ATOM   634   C  CA   . LYS A 1 50 ? -4.775  -10.076 -4.550  1.00 0.00 ? 357 LYS A CA   1  
ATOM   635   C  C    . LYS A 1 50 ? -4.108  -10.657 -5.797  1.00 0.00 ? 357 LYS A C    1  
ATOM   636   O  O    . LYS A 1 50 ? -4.455  -11.746 -6.246  1.00 0.00 ? 357 LYS A O    1  
ATOM   637   C  CB   . LYS A 1 50 ? -5.817  -9.033  -4.949  1.00 0.00 ? 357 LYS A CB   1  
ATOM   638   C  CG   . LYS A 1 50 ? -7.200  -9.599  -5.217  1.00 0.00 ? 357 LYS A CG   1  
ATOM   639   C  CD   . LYS A 1 50 ? -8.163  -8.504  -5.662  1.00 0.00 ? 357 LYS A CD   1  
ATOM   640   C  CE   . LYS A 1 50 ? -8.254  -7.367  -4.646  1.00 0.00 ? 357 LYS A CE   1  
ATOM   641   N  NZ   . LYS A 1 50 ? -8.818  -7.811  -3.343  1.00 0.00 ? 357 LYS A NZ   1  
ATOM   642   H  H    . LYS A 1 50 ? -3.782  -8.485  -3.584  1.00 0.00 ? 357 LYS A H    1  
ATOM   643   H  HA   . LYS A 1 50 ? -5.258  -10.871 -4.005  1.00 0.00 ? 357 LYS A HA   1  
ATOM   644   H  HB2  . LYS A 1 50 ? -5.898  -8.310  -4.152  1.00 0.00 ? 357 LYS A HB2  1  
ATOM   645   H  HB3  . LYS A 1 50 ? -5.479  -8.529  -5.843  1.00 0.00 ? 357 LYS A HB3  1  
ATOM   646   H  HG2  . LYS A 1 50 ? -7.130  -10.346 -6.004  1.00 0.00 ? 357 LYS A HG2  1  
ATOM   647   H  HG3  . LYS A 1 50 ? -7.577  -10.053 -4.304  1.00 0.00 ? 357 LYS A HG3  1  
ATOM   648   H  HD2  . LYS A 1 50 ? -7.819  -8.103  -6.601  1.00 0.00 ? 357 LYS A HD2  1  
ATOM   649   H  HD3  . LYS A 1 50 ? -9.145  -8.937  -5.794  1.00 0.00 ? 357 LYS A HD3  1  
ATOM   650   H  HE2  . LYS A 1 50 ? -7.264  -6.969  -4.479  1.00 0.00 ? 357 LYS A HE2  1  
ATOM   651   H  HE3  . LYS A 1 50 ? -8.884  -6.591  -5.053  1.00 0.00 ? 357 LYS A HE3  1  
ATOM   652   H  HZ1  . LYS A 1 50 ? -8.224  -8.558  -2.927  1.00 0.00 ? 357 LYS A HZ1  1  
ATOM   653   H  HZ2  . LYS A 1 50 ? -9.781  -8.184  -3.480  1.00 0.00 ? 357 LYS A HZ2  1  
ATOM   654   H  HZ3  . LYS A 1 50 ? -8.861  -7.011  -2.680  1.00 0.00 ? 357 LYS A HZ3  1  
ATOM   655   N  N    . ALA A 1 51 ? -3.145  -9.922  -6.344  1.00 0.00 ? 358 ALA A N    1  
ATOM   656   C  CA   . ALA A 1 51 ? -2.437  -10.361 -7.540  1.00 0.00 ? 358 ALA A CA   1  
ATOM   657   C  C    . ALA A 1 51 ? -1.327  -11.345 -7.190  1.00 0.00 ? 358 ALA A C    1  
ATOM   658   O  O    . ALA A 1 51 ? -1.033  -12.263 -7.956  1.00 0.00 ? 358 ALA A O    1  
ATOM   659   C  CB   . ALA A 1 51 ? -1.869  -9.162  -8.283  1.00 0.00 ? 358 ALA A CB   1  
ATOM   660   H  H    . ALA A 1 51 ? -2.908  -9.057  -5.939  1.00 0.00 ? 358 ALA A H    1  
ATOM   661   H  HA   . ALA A 1 51 ? -3.149  -10.851 -8.187  1.00 0.00 ? 358 ALA A HA   1  
ATOM   662   H  HB1  . ALA A 1 51 ? -2.669  -8.478  -8.528  1.00 0.00 ? 358 ALA A HB1  1  
ATOM   663   H  HB2  . ALA A 1 51 ? -1.388  -9.493  -9.191  1.00 0.00 ? 358 ALA A HB2  1  
ATOM   664   H  HB3  . ALA A 1 51 ? -1.146  -8.659  -7.656  1.00 0.00 ? 358 ALA A HB3  1  
ATOM   665   N  N    . GLY A 1 52 ? -0.722  -11.155 -6.023  1.00 0.00 ? 359 GLY A N    1  
ATOM   666   C  CA   . GLY A 1 52 ? 0.378   -12.000 -5.607  1.00 0.00 ? 359 GLY A CA   1  
ATOM   667   C  C    . GLY A 1 52 ? 1.647   -11.667 -6.361  1.00 0.00 ? 359 GLY A C    1  
ATOM   668   O  O    . GLY A 1 52 ? 2.417   -12.555 -6.729  1.00 0.00 ? 359 GLY A O    1  
ATOM   669   H  H    . GLY A 1 52 ? -1.024  -10.423 -5.438  1.00 0.00 ? 359 GLY A H    1  
ATOM   670   H  HA2  . GLY A 1 52 ? 0.549   -11.862 -4.549  1.00 0.00 ? 359 GLY A HA2  1  
ATOM   671   H  HA3  . GLY A 1 52 ? 0.121   -13.032 -5.792  1.00 0.00 ? 359 GLY A HA3  1  
ATOM   672   N  N    . LEU A 1 53 ? 1.860   -10.376 -6.586  1.00 0.00 ? 360 LEU A N    1  
ATOM   673   C  CA   . LEU A 1 53 ? 2.990   -9.906  -7.383  1.00 0.00 ? 360 LEU A CA   1  
ATOM   674   C  C    . LEU A 1 53 ? 4.309   -9.985  -6.611  1.00 0.00 ? 360 LEU A C    1  
ATOM   675   O  O    . LEU A 1 53 ? 4.357   -10.490 -5.487  1.00 0.00 ? 360 LEU A O    1  
ATOM   676   C  CB   . LEU A 1 53 ? 2.728   -8.480  -7.901  1.00 0.00 ? 360 LEU A CB   1  
ATOM   677   C  CG   . LEU A 1 53 ? 2.190   -7.467  -6.878  1.00 0.00 ? 360 LEU A CG   1  
ATOM   678   C  CD1  . LEU A 1 53 ? 3.283   -6.994  -5.928  1.00 0.00 ? 360 LEU A CD1  1  
ATOM   679   C  CD2  . LEU A 1 53 ? 1.560   -6.284  -7.598  1.00 0.00 ? 360 LEU A CD2  1  
ATOM   680   H  H    . LEU A 1 53 ? 1.242   -9.723  -6.204  1.00 0.00 ? 360 LEU A H    1  
ATOM   681   H  HA   . LEU A 1 53 ? 3.066   -10.563 -8.237  1.00 0.00 ? 360 LEU A HA   1  
ATOM   682   H  HB2  . LEU A 1 53 ? 3.672   -8.088  -8.289  1.00 0.00 ? 360 LEU A HB2  1  
ATOM   683   H  HB3  . LEU A 1 53 ? 2.003   -8.548  -8.717  1.00 0.00 ? 360 LEU A HB3  1  
ATOM   684   H  HG   . LEU A 1 53 ? 1.423   -7.938  -6.286  1.00 0.00 ? 360 LEU A HG   1  
ATOM   685   H  HD11 . LEU A 1 53 ? 4.086   -6.548  -6.496  1.00 0.00 ? 360 LEU A HD11 1  
ATOM   686   H  HD12 . LEU A 1 53 ? 3.663   -7.837  -5.370  1.00 0.00 ? 360 LEU A HD12 1  
ATOM   687   H  HD13 . LEU A 1 53 ? 2.876   -6.263  -5.244  1.00 0.00 ? 360 LEU A HD13 1  
ATOM   688   H  HD21 . LEU A 1 53 ? 2.298   -5.810  -8.226  1.00 0.00 ? 360 LEU A HD21 1  
ATOM   689   H  HD22 . LEU A 1 53 ? 1.195   -5.575  -6.871  1.00 0.00 ? 360 LEU A HD22 1  
ATOM   690   H  HD23 . LEU A 1 53 ? 0.736   -6.629  -8.206  1.00 0.00 ? 360 LEU A HD23 1  
ATOM   691   N  N    . TYR A 1 54 ? 5.375   -9.488  -7.227  1.00 0.00 ? 361 TYR A N    1  
ATOM   692   C  CA   . TYR A 1 54 ? 6.714   -9.611  -6.673  1.00 0.00 ? 361 TYR A CA   1  
ATOM   693   C  C    . TYR A 1 54 ? 6.967   -8.570  -5.587  1.00 0.00 ? 361 TYR A C    1  
ATOM   694   O  O    . TYR A 1 54 ? 6.947   -7.363  -5.847  1.00 0.00 ? 361 TYR A O    1  
ATOM   695   C  CB   . TYR A 1 54 ? 7.756   -9.468  -7.787  1.00 0.00 ? 361 TYR A CB   1  
ATOM   696   C  CG   . TYR A 1 54 ? 9.174   -9.743  -7.337  1.00 0.00 ? 361 TYR A CG   1  
ATOM   697   C  CD1  . TYR A 1 54 ? 9.982   -8.724  -6.849  1.00 0.00 ? 361 TYR A CD1  1  
ATOM   698   C  CD2  . TYR A 1 54 ? 9.703   -11.025 -7.401  1.00 0.00 ? 361 TYR A CD2  1  
ATOM   699   C  CE1  . TYR A 1 54 ? 11.275  -8.975  -6.439  1.00 0.00 ? 361 TYR A CE1  1  
ATOM   700   C  CE2  . TYR A 1 54 ? 10.995  -11.284 -6.993  1.00 0.00 ? 361 TYR A CE2  1  
ATOM   701   C  CZ   . TYR A 1 54 ? 11.778  -10.257 -6.512  1.00 0.00 ? 361 TYR A CZ   1  
ATOM   702   O  OH   . TYR A 1 54 ? 13.069  -10.515 -6.108  1.00 0.00 ? 361 TYR A OH   1  
ATOM   703   H  H    . TYR A 1 54 ? 5.257   -9.015  -8.077  1.00 0.00 ? 361 TYR A H    1  
ATOM   704   H  HA   . TYR A 1 54 ? 6.802   -10.596 -6.239  1.00 0.00 ? 361 TYR A HA   1  
ATOM   705   H  HB2  . TYR A 1 54 ? 7.521   -10.160 -8.580  1.00 0.00 ? 361 TYR A HB2  1  
ATOM   706   H  HB3  . TYR A 1 54 ? 7.722   -8.459  -8.173  1.00 0.00 ? 361 TYR A HB3  1  
ATOM   707   H  HD1  . TYR A 1 54 ? 9.586   -7.721  -6.793  1.00 0.00 ? 361 TYR A HD1  1  
ATOM   708   H  HD2  . TYR A 1 54 ? 9.087   -11.827 -7.778  1.00 0.00 ? 361 TYR A HD2  1  
ATOM   709   H  HE1  . TYR A 1 54 ? 11.885  -8.168  -6.060  1.00 0.00 ? 361 TYR A HE1  1  
ATOM   710   H  HE2  . TYR A 1 54 ? 11.388  -12.289 -7.050  1.00 0.00 ? 361 TYR A HE2  1  
ATOM   711   H  HH   . TYR A 1 54 ? 13.238  -10.071 -5.272  1.00 0.00 ? 361 TYR A HH   1  
ATOM   712   N  N    . MET A 1 55 ? 7.196   -9.047  -4.371  1.00 0.00 ? 362 MET A N    1  
ATOM   713   C  CA   . MET A 1 55 ? 7.547   -8.176  -3.260  1.00 0.00 ? 362 MET A CA   1  
ATOM   714   C  C    . MET A 1 55 ? 8.789   -8.681  -2.538  1.00 0.00 ? 362 MET A C    1  
ATOM   715   O  O    . MET A 1 55 ? 8.772   -9.742  -1.915  1.00 0.00 ? 362 MET A O    1  
ATOM   716   C  CB   . MET A 1 55 ? 6.391   -8.051  -2.265  1.00 0.00 ? 362 MET A CB   1  
ATOM   717   C  CG   . MET A 1 55 ? 5.380   -6.982  -2.635  1.00 0.00 ? 362 MET A CG   1  
ATOM   718   S  SD   . MET A 1 55 ? 4.144   -6.724  -1.349  1.00 0.00 ? 362 MET A SD   1  
ATOM   719   C  CE   . MET A 1 55 ? 3.358   -5.228  -1.942  1.00 0.00 ? 362 MET A CE   1  
ATOM   720   H  H    . MET A 1 55 ? 7.134   -10.015 -4.216  1.00 0.00 ? 362 MET A H    1  
ATOM   721   H  HA   . MET A 1 55 ? 7.761   -7.199  -3.667  1.00 0.00 ? 362 MET A HA   1  
ATOM   722   H  HB2  . MET A 1 55 ? 5.875   -8.996  -2.210  1.00 0.00 ? 362 MET A HB2  1  
ATOM   723   H  HB3  . MET A 1 55 ? 6.794   -7.812  -1.290  1.00 0.00 ? 362 MET A HB3  1  
ATOM   724   H  HG2  . MET A 1 55 ? 5.904   -6.055  -2.803  1.00 0.00 ? 362 MET A HG2  1  
ATOM   725   H  HG3  . MET A 1 55 ? 4.878   -7.279  -3.545  1.00 0.00 ? 362 MET A HG3  1  
ATOM   726   H  HE1  . MET A 1 55 ? 2.942   -5.402  -2.924  1.00 0.00 ? 362 MET A HE1  1  
ATOM   727   H  HE2  . MET A 1 55 ? 4.090   -4.436  -1.996  1.00 0.00 ? 362 MET A HE2  1  
ATOM   728   H  HE3  . MET A 1 55 ? 2.569   -4.943  -1.263  1.00 0.00 ? 362 MET A HE3  1  
ATOM   729   N  N    . LYS A 1 56 ? 9.865   -7.919  -2.637  1.00 0.00 ? 363 LYS A N    1  
ATOM   730   C  CA   . LYS A 1 56 ? 11.068  -8.186  -1.866  1.00 0.00 ? 363 LYS A CA   1  
ATOM   731   C  C    . LYS A 1 56 ? 10.890  -7.526  -0.507  1.00 0.00 ? 363 LYS A C    1  
ATOM   732   O  O    . LYS A 1 56 ? 10.267  -6.471  -0.411  1.00 0.00 ? 363 LYS A O    1  
ATOM   733   C  CB   . LYS A 1 56 ? 12.303  -7.619  -2.580  1.00 0.00 ? 363 LYS A CB   1  
ATOM   734   C  CG   . LYS A 1 56 ? 13.471  -8.596  -2.692  1.00 0.00 ? 363 LYS A CG   1  
ATOM   735   C  CD   . LYS A 1 56 ? 14.034  -8.982  -1.331  1.00 0.00 ? 363 LYS A CD   1  
ATOM   736   C  CE   . LYS A 1 56 ? 15.257  -9.878  -1.468  1.00 0.00 ? 363 LYS A CE   1  
ATOM   737   N  NZ   . LYS A 1 56 ? 15.768  -10.335 -0.147  1.00 0.00 ? 363 LYS A NZ   1  
ATOM   738   H  H    . LYS A 1 56 ? 9.840   -7.133  -3.229  1.00 0.00 ? 363 LYS A H    1  
ATOM   739   H  HA   . LYS A 1 56 ? 11.169  -9.254  -1.742  1.00 0.00 ? 363 LYS A HA   1  
ATOM   740   H  HB2  . LYS A 1 56 ? 12.014  -7.323  -3.589  1.00 0.00 ? 363 LYS A HB2  1  
ATOM   741   H  HB3  . LYS A 1 56 ? 12.648  -6.743  -2.025  1.00 0.00 ? 363 LYS A HB3  1  
ATOM   742   H  HG2  . LYS A 1 56 ? 13.131  -9.489  -3.194  1.00 0.00 ? 363 LYS A HG2  1  
ATOM   743   H  HG3  . LYS A 1 56 ? 14.255  -8.134  -3.275  1.00 0.00 ? 363 LYS A HG3  1  
ATOM   744   H  HD2  . LYS A 1 56 ? 14.315  -8.086  -0.800  1.00 0.00 ? 363 LYS A HD2  1  
ATOM   745   H  HD3  . LYS A 1 56 ? 13.274  -9.509  -0.774  1.00 0.00 ? 363 LYS A HD3  1  
ATOM   746   H  HE2  . LYS A 1 56 ? 14.991  -10.741 -2.059  1.00 0.00 ? 363 LYS A HE2  1  
ATOM   747   H  HE3  . LYS A 1 56 ? 16.035  -9.326  -1.973  1.00 0.00 ? 363 LYS A HE3  1  
ATOM   748   H  HZ1  . LYS A 1 56 ? 15.977  -9.515  0.470   1.00 0.00 ? 363 LYS A HZ1  1  
ATOM   749   H  HZ2  . LYS A 1 56 ? 16.636  -10.893 -0.269  1.00 0.00 ? 363 LYS A HZ2  1  
ATOM   750   H  HZ3  . LYS A 1 56 ? 15.058  -10.931 0.322   1.00 0.00 ? 363 LYS A HZ3  1  
ATOM   751   N  N    . MET A 1 57 ? 11.417  -8.123  0.542   1.00 0.00 ? 364 MET A N    1  
ATOM   752   C  CA   . MET A 1 57 ? 11.137  -7.647  1.880   1.00 0.00 ? 364 MET A CA   1  
ATOM   753   C  C    . MET A 1 57 ? 12.405  -7.663  2.697   1.00 0.00 ? 364 MET A C    1  
ATOM   754   O  O    . MET A 1 57 ? 12.897  -8.718  3.091   1.00 0.00 ? 364 MET A O    1  
ATOM   755   C  CB   . MET A 1 57 ? 10.046  -8.499  2.537   1.00 0.00 ? 364 MET A CB   1  
ATOM   756   C  CG   . MET A 1 57 ? 8.756   -8.516  1.735   1.00 0.00 ? 364 MET A CG   1  
ATOM   757   S  SD   . MET A 1 57 ? 7.412   -9.404  2.541   1.00 0.00 ? 364 MET A SD   1  
ATOM   758   C  CE   . MET A 1 57 ? 6.110   -9.134  1.341   1.00 0.00 ? 364 MET A CE   1  
ATOM   759   H  H    . MET A 1 57 ? 12.045  -8.861  0.422   1.00 0.00 ? 364 MET A H    1  
ATOM   760   H  HA   . MET A 1 57 ? 10.788  -6.628  1.801   1.00 0.00 ? 364 MET A HA   1  
ATOM   761   H  HB2  . MET A 1 57 ? 10.405  -9.514  2.635   1.00 0.00 ? 364 MET A HB2  1  
ATOM   762   H  HB3  . MET A 1 57 ? 9.834   -8.102  3.519   1.00 0.00 ? 364 MET A HB3  1  
ATOM   763   H  HG2  . MET A 1 57 ? 8.440   -7.499  1.568   1.00 0.00 ? 364 MET A HG2  1  
ATOM   764   H  HG3  . MET A 1 57 ? 8.953   -8.987  0.782   1.00 0.00 ? 364 MET A HG3  1  
ATOM   765   H  HE1  . MET A 1 57 ? 5.210   -9.637  1.662   1.00 0.00 ? 364 MET A HE1  1  
ATOM   766   H  HE2  . MET A 1 57 ? 6.419   -9.521  0.380   1.00 0.00 ? 364 MET A HE2  1  
ATOM   767   H  HE3  . MET A 1 57 ? 5.920   -8.074  1.255   1.00 0.00 ? 364 MET A HE3  1  
ATOM   768   N  N    . GLU A 1 58 ? 12.936  -6.485  2.923   1.00 0.00 ? 365 GLU A N    1  
ATOM   769   C  CA   . GLU A 1 58 ? 14.186  -6.341  3.624   1.00 0.00 ? 365 GLU A CA   1  
ATOM   770   C  C    . GLU A 1 58 ? 13.949  -5.680  4.978   1.00 0.00 ? 365 GLU A C    1  
ATOM   771   O  O    . GLU A 1 58 ? 13.379  -4.589  5.053   1.00 0.00 ? 365 GLU A O    1  
ATOM   772   C  CB   . GLU A 1 58 ? 15.123  -5.494  2.770   1.00 0.00 ? 365 GLU A CB   1  
ATOM   773   C  CG   . GLU A 1 58 ? 15.636  -6.194  1.524   1.00 0.00 ? 365 GLU A CG   1  
ATOM   774   C  CD   . GLU A 1 58 ? 16.566  -7.346  1.830   1.00 0.00 ? 365 GLU A CD   1  
ATOM   775   O  OE1  . GLU A 1 58 ? 17.726  -7.090  2.215   1.00 0.00 ? 365 GLU A OE1  1  
ATOM   776   O  OE2  . GLU A 1 58 ? 16.148  -8.509  1.683   1.00 0.00 ? 365 GLU A OE2  1  
ATOM   777   H  H    . GLU A 1 58 ? 12.469  -5.679  2.610   1.00 0.00 ? 365 GLU A H    1  
ATOM   778   H  HA   . GLU A 1 58 ? 14.617  -7.320  3.766   1.00 0.00 ? 365 GLU A HA   1  
ATOM   779   H  HB2  . GLU A 1 58 ? 14.580  -4.622  2.450   1.00 0.00 ? 365 GLU A HB2  1  
ATOM   780   H  HB3  . GLU A 1 58 ? 15.965  -5.189  3.366   1.00 0.00 ? 365 GLU A HB3  1  
ATOM   781   H  HG2  . GLU A 1 58 ? 14.793  -6.575  0.968   1.00 0.00 ? 365 GLU A HG2  1  
ATOM   782   H  HG3  . GLU A 1 58 ? 16.167  -5.474  0.919   1.00 0.00 ? 365 GLU A HG3  1  
ATOM   783   N  N    . PRO A 1 59 ? 14.354  -6.343  6.064   1.00 0.00 ? 366 PRO A N    1  
ATOM   784   C  CA   . PRO A 1 59 ? 14.235  -5.801  7.405   1.00 0.00 ? 366 PRO A CA   1  
ATOM   785   C  C    . PRO A 1 59 ? 15.518  -5.117  7.876   1.00 0.00 ? 366 PRO A C    1  
ATOM   786   O  O    . PRO A 1 59 ? 16.582  -5.737  7.932   1.00 0.00 ? 366 PRO A O    1  
ATOM   787   C  CB   . PRO A 1 59 ? 13.960  -7.056  8.231   1.00 0.00 ? 366 PRO A CB   1  
ATOM   788   C  CG   . PRO A 1 59 ? 14.663  -8.169  7.508   1.00 0.00 ? 366 PRO A CG   1  
ATOM   789   C  CD   . PRO A 1 59 ? 14.921  -7.701  6.091   1.00 0.00 ? 366 PRO A CD   1  
ATOM   790   H  HA   . PRO A 1 59 ? 13.403  -5.119  7.488   1.00 0.00 ? 366 PRO A HA   1  
ATOM   791   H  HB2  . PRO A 1 59 ? 14.353  -6.923  9.229   1.00 0.00 ? 366 PRO A HB2  1  
ATOM   792   H  HB3  . PRO A 1 59 ? 12.895  -7.230  8.279   1.00 0.00 ? 366 PRO A HB3  1  
ATOM   793   H  HG2  . PRO A 1 59 ? 15.600  -8.386  8.000   1.00 0.00 ? 366 PRO A HG2  1  
ATOM   794   H  HG3  . PRO A 1 59 ? 14.038  -9.049  7.501   1.00 0.00 ? 366 PRO A HG3  1  
ATOM   795   H  HD2  . PRO A 1 59 ? 15.982  -7.678  5.889   1.00 0.00 ? 366 PRO A HD2  1  
ATOM   796   H  HD3  . PRO A 1 59 ? 14.416  -8.345  5.388   1.00 0.00 ? 366 PRO A HD3  1  
ATOM   797   N  N    . VAL A 1 60 ? 15.431  -3.837  8.200   1.00 0.00 ? 367 VAL A N    1  
ATOM   798   C  CA   . VAL A 1 60 ? 16.576  -3.144  8.758   1.00 0.00 ? 367 VAL A CA   1  
ATOM   799   C  C    . VAL A 1 60 ? 16.428  -3.056  10.272  1.00 0.00 ? 367 VAL A C    1  
ATOM   800   O  O    . VAL A 1 60 ? 15.384  -2.644  10.789  1.00 0.00 ? 367 VAL A O    1  
ATOM   801   C  CB   . VAL A 1 60 ? 16.794  -1.735  8.135   1.00 0.00 ? 367 VAL A CB   1  
ATOM   802   C  CG1  . VAL A 1 60 ? 15.807  -0.714  8.658   1.00 0.00 ? 367 VAL A CG1  1  
ATOM   803   C  CG2  . VAL A 1 60 ? 18.221  -1.266  8.362   1.00 0.00 ? 367 VAL A CG2  1  
ATOM   804   H  H    . VAL A 1 60 ? 14.583  -3.354  8.074   1.00 0.00 ? 367 VAL A H    1  
ATOM   805   H  HA   . VAL A 1 60 ? 17.449  -3.743  8.542   1.00 0.00 ? 367 VAL A HA   1  
ATOM   806   H  HB   . VAL A 1 60 ? 16.634  -1.812  7.072   1.00 0.00 ? 367 VAL A HB   1  
ATOM   807   H  HG11 . VAL A 1 60 ? 14.804  -1.056  8.453   1.00 0.00 ? 367 VAL A HG11 1  
ATOM   808   H  HG12 . VAL A 1 60 ? 15.974  0.234   8.167   1.00 0.00 ? 367 VAL A HG12 1  
ATOM   809   H  HG13 . VAL A 1 60 ? 15.938  -0.597  9.724   1.00 0.00 ? 367 VAL A HG13 1  
ATOM   810   H  HG21 . VAL A 1 60 ? 18.423  -1.233  9.422   1.00 0.00 ? 367 VAL A HG21 1  
ATOM   811   H  HG22 . VAL A 1 60 ? 18.348  -0.281  7.940   1.00 0.00 ? 367 VAL A HG22 1  
ATOM   812   H  HG23 . VAL A 1 60 ? 18.906  -1.952  7.885   1.00 0.00 ? 367 VAL A HG23 1  
ATOM   813   N  N    . LYS A 1 61 ? 17.449  -3.498  10.977  1.00 0.00 ? 368 LYS A N    1  
ATOM   814   C  CA   . LYS A 1 61 ? 17.439  -3.443  12.421  1.00 0.00 ? 368 LYS A CA   1  
ATOM   815   C  C    . LYS A 1 61 ? 18.512  -2.494  12.925  1.00 0.00 ? 368 LYS A C    1  
ATOM   816   O  O    . LYS A 1 61 ? 19.599  -2.401  12.353  1.00 0.00 ? 368 LYS A O    1  
ATOM   817   C  CB   . LYS A 1 61 ? 17.583  -4.848  13.039  1.00 0.00 ? 368 LYS A CB   1  
ATOM   818   C  CG   . LYS A 1 61 ? 18.614  -5.767  12.373  1.00 0.00 ? 368 LYS A CG   1  
ATOM   819   C  CD   . LYS A 1 61 ? 20.054  -5.303  12.569  1.00 0.00 ? 368 LYS A CD   1  
ATOM   820   C  CE   . LYS A 1 61 ? 20.399  -5.097  14.037  1.00 0.00 ? 368 LYS A CE   1  
ATOM   821   N  NZ   . LYS A 1 61 ? 20.197  -6.327  14.847  1.00 0.00 ? 368 LYS A NZ   1  
ATOM   822   H  H    . LYS A 1 61 ? 18.233  -3.861  10.515  1.00 0.00 ? 368 LYS A H    1  
ATOM   823   H  HA   . LYS A 1 61 ? 16.479  -3.040  12.713  1.00 0.00 ? 368 LYS A HA   1  
ATOM   824   H  HB2  . LYS A 1 61 ? 17.857  -4.737  14.076  1.00 0.00 ? 368 LYS A HB2  1  
ATOM   825   H  HB3  . LYS A 1 61 ? 16.622  -5.338  12.991  1.00 0.00 ? 368 LYS A HB3  1  
ATOM   826   H  HG2  . LYS A 1 61 ? 18.514  -6.755  12.793  1.00 0.00 ? 368 LYS A HG2  1  
ATOM   827   H  HG3  . LYS A 1 61 ? 18.404  -5.808  11.313  1.00 0.00 ? 368 LYS A HG3  1  
ATOM   828   H  HD2  . LYS A 1 61 ? 20.719  -6.046  12.156  1.00 0.00 ? 368 LYS A HD2  1  
ATOM   829   H  HD3  . LYS A 1 61 ? 20.191  -4.368  12.043  1.00 0.00 ? 368 LYS A HD3  1  
ATOM   830   H  HE2  . LYS A 1 61 ? 21.434  -4.800  14.109  1.00 0.00 ? 368 LYS A HE2  1  
ATOM   831   H  HE3  . LYS A 1 61 ? 19.775  -4.310  14.429  1.00 0.00 ? 368 LYS A HE3  1  
ATOM   832   H  HZ1  . LYS A 1 61 ? 19.222  -6.670  14.745  1.00 0.00 ? 368 LYS A HZ1  1  
ATOM   833   H  HZ2  . LYS A 1 61 ? 20.378  -6.126  15.850  1.00 0.00 ? 368 LYS A HZ2  1  
ATOM   834   H  HZ3  . LYS A 1 61 ? 20.850  -7.075  14.533  1.00 0.00 ? 368 LYS A HZ3  1  
ATOM   835   N  N    . GLU A 1 62 ? 18.182  -1.774  13.971  1.00 0.00 ? 369 GLU A N    1  
ATOM   836   C  CA   . GLU A 1 62 ? 19.086  -0.818  14.571  1.00 0.00 ? 369 GLU A CA   1  
ATOM   837   C  C    . GLU A 1 62 ? 18.695  -0.625  16.033  1.00 0.00 ? 369 GLU A C    1  
ATOM   838   O  O    . GLU A 1 62 ? 17.753  -1.257  16.511  1.00 0.00 ? 369 GLU A O    1  
ATOM   839   C  CB   . GLU A 1 62 ? 19.063  0.496   13.783  1.00 0.00 ? 369 GLU A CB   1  
ATOM   840   C  CG   . GLU A 1 62 ? 20.437  1.003   13.380  1.00 0.00 ? 369 GLU A CG   1  
ATOM   841   C  CD   . GLU A 1 62 ? 21.066  1.896   14.426  1.00 0.00 ? 369 GLU A CD   1  
ATOM   842   O  OE1  . GLU A 1 62 ? 21.452  1.389   15.494  1.00 0.00 ? 369 GLU A OE1  1  
ATOM   843   O  OE2  . GLU A 1 62 ? 21.168  3.119   14.183  1.00 0.00 ? 369 GLU A OE2  1  
ATOM   844   H  H    . GLU A 1 62 ? 17.279  -1.871  14.352  1.00 0.00 ? 369 GLU A H    1  
ATOM   845   H  HA   . GLU A 1 62 ? 20.083  -1.238  14.532  1.00 0.00 ? 369 GLU A HA   1  
ATOM   846   H  HB2  . GLU A 1 62 ? 18.482  0.350   12.885  1.00 0.00 ? 369 GLU A HB2  1  
ATOM   847   H  HB3  . GLU A 1 62 ? 18.587  1.255   14.388  1.00 0.00 ? 369 GLU A HB3  1  
ATOM   848   H  HG2  . GLU A 1 62 ? 21.086  0.154   13.219  1.00 0.00 ? 369 GLU A HG2  1  
ATOM   849   H  HG3  . GLU A 1 62 ? 20.343  1.559   12.462  1.00 0.00 ? 369 GLU A HG3  1  
ATOM   850   N  N    . LEU A 1 63 ? 19.447  0.183   16.749  1.00 0.00 ? 370 LEU A N    1  
ATOM   851   C  CA   . LEU A 1 63 ? 19.273  0.379   18.158  1.00 0.00 ? 370 LEU A CA   1  
ATOM   852   C  C    . LEU A 1 63 ? 19.318  1.866   18.491  1.00 0.00 ? 370 LEU A C    1  
ATOM   853   O  O    . LEU A 1 63 ? 19.537  2.249   19.642  1.00 0.00 ? 370 LEU A O    1  
ATOM   854   C  CB   . LEU A 1 63 ? 20.378  -0.358  18.915  1.00 0.00 ? 370 LEU A CB   1  
ATOM   855   C  CG   . LEU A 1 63 ? 21.711  -0.560  18.175  1.00 0.00 ? 370 LEU A CG   1  
ATOM   856   C  CD1  . LEU A 1 63 ? 22.852  -0.689  19.172  1.00 0.00 ? 370 LEU A CD1  1  
ATOM   857   C  CD2  . LEU A 1 63 ? 21.661  -1.805  17.295  1.00 0.00 ? 370 LEU A CD2  1  
ATOM   858   H  H    . LEU A 1 63 ? 20.154  0.674   16.316  1.00 0.00 ? 370 LEU A H    1  
ATOM   859   H  HA   . LEU A 1 63 ? 18.314  -0.024  18.443  1.00 0.00 ? 370 LEU A HA   1  
ATOM   860   H  HB2  . LEU A 1 63 ? 20.583  0.208   19.796  1.00 0.00 ? 370 LEU A HB2  1  
ATOM   861   H  HB3  . LEU A 1 63 ? 20.002  -1.324  19.202  1.00 0.00 ? 370 LEU A HB3  1  
ATOM   862   H  HG   . LEU A 1 63 ? 21.905  0.295   17.546  1.00 0.00 ? 370 LEU A HG   1  
ATOM   863   H  HD11 . LEU A 1 63 ? 22.917  0.212   19.764  1.00 0.00 ? 370 LEU A HD11 1  
ATOM   864   H  HD12 . LEU A 1 63 ? 23.780  -0.837  18.641  1.00 0.00 ? 370 LEU A HD12 1  
ATOM   865   H  HD13 . LEU A 1 63 ? 22.671  -1.533  19.820  1.00 0.00 ? 370 LEU A HD13 1  
ATOM   866   H  HD21 . LEU A 1 63 ? 21.468  -2.673  17.906  1.00 0.00 ? 370 LEU A HD21 1  
ATOM   867   H  HD22 . LEU A 1 63 ? 22.605  -1.923  16.785  1.00 0.00 ? 370 LEU A HD22 1  
ATOM   868   H  HD23 . LEU A 1 63 ? 20.869  -1.698  16.567  1.00 0.00 ? 370 LEU A HD23 1  
ATOM   869   N  N    . THR A 1 64 ? 19.086  2.690   17.471  1.00 0.00 ? 371 THR A N    1  
ATOM   870   C  CA   . THR A 1 64 ? 19.188  4.142   17.584  1.00 0.00 ? 371 THR A CA   1  
ATOM   871   C  C    . THR A 1 64 ? 18.377  4.685   18.761  1.00 0.00 ? 371 THR A C    1  
ATOM   872   O  O    . THR A 1 64 ? 17.186  4.397   18.895  1.00 0.00 ? 371 THR A O    1  
ATOM   873   C  CB   . THR A 1 64 ? 18.692  4.819   16.293  1.00 0.00 ? 371 THR A CB   1  
ATOM   874   O  OG1  . THR A 1 64 ? 18.869  3.934   15.177  1.00 0.00 ? 371 THR A OG1  1  
ATOM   875   C  CG2  . THR A 1 64 ? 19.445  6.117   16.037  1.00 0.00 ? 371 THR A CG2  1  
ATOM   876   H  H    . THR A 1 64 ? 18.837  2.306   16.603  1.00 0.00 ? 371 THR A H    1  
ATOM   877   H  HA   . THR A 1 64 ? 20.229  4.396   17.723  1.00 0.00 ? 371 THR A HA   1  
ATOM   878   H  HB   . THR A 1 64 ? 17.641  5.045   16.402  1.00 0.00 ? 371 THR A HB   1  
ATOM   879   H  HG1  . THR A 1 64 ? 19.821  3.769   15.039  1.00 0.00 ? 371 THR A HG1  1  
ATOM   880   H  HG21 . THR A 1 64 ? 19.048  6.594   15.152  1.00 0.00 ? 371 THR A HG21 1  
ATOM   881   H  HG22 . THR A 1 64 ? 20.492  5.903   15.890  1.00 0.00 ? 371 THR A HG22 1  
ATOM   882   H  HG23 . THR A 1 64 ? 19.328  6.775   16.884  1.00 0.00 ? 371 THR A HG23 1  
ATOM   883   N  N    . GLY A 1 65 ? 19.034  5.459   19.613  1.00 0.00 ? 372 GLY A N    1  
ATOM   884   C  CA   . GLY A 1 65 ? 18.362  6.055   20.749  1.00 0.00 ? 372 GLY A CA   1  
ATOM   885   C  C    . GLY A 1 65 ? 18.476  5.200   21.991  1.00 0.00 ? 372 GLY A C    1  
ATOM   886   O  O    . GLY A 1 65 ? 17.787  5.439   22.984  1.00 0.00 ? 372 GLY A O    1  
ATOM   887   H  H    . GLY A 1 65 ? 19.990  5.626   19.470  1.00 0.00 ? 372 GLY A H    1  
ATOM   888   H  HA2  . GLY A 1 65 ? 18.801  7.021   20.947  1.00 0.00 ? 372 GLY A HA2  1  
ATOM   889   H  HA3  . GLY A 1 65 ? 17.317  6.187   20.508  1.00 0.00 ? 372 GLY A HA3  1  
ATOM   890   N  N    . GLY A 1 66 ? 19.346  4.200   21.935  1.00 0.00 ? 373 GLY A N    1  
ATOM   891   C  CA   . GLY A 1 66 ? 19.537  3.316   23.065  1.00 0.00 ? 373 GLY A CA   1  
ATOM   892   C  C    . GLY A 1 66 ? 18.388  2.347   23.234  1.00 0.00 ? 373 GLY A C    1  
ATOM   893   O  O    . GLY A 1 66 ? 17.847  2.200   24.328  1.00 0.00 ? 373 GLY A O    1  
ATOM   894   H  H    . GLY A 1 66 ? 19.866  4.063   21.113  1.00 0.00 ? 373 GLY A H    1  
ATOM   895   H  HA2  . GLY A 1 66 ? 20.448  2.755   22.921  1.00 0.00 ? 373 GLY A HA2  1  
ATOM   896   H  HA3  . GLY A 1 66 ? 19.629  3.909   23.962  1.00 0.00 ? 373 GLY A HA3  1  
ATOM   897   N  N    . GLY A 1 67 ? 18.006  1.698   22.146  1.00 0.00 ? 374 GLY A N    1  
ATOM   898   C  CA   . GLY A 1 67 ? 16.918  0.746   22.199  1.00 0.00 ? 374 GLY A CA   1  
ATOM   899   C  C    . GLY A 1 67 ? 16.934  -0.195  21.017  1.00 0.00 ? 374 GLY A C    1  
ATOM   900   O  O    . GLY A 1 67 ? 17.929  -0.878  20.778  1.00 0.00 ? 374 GLY A O    1  
ATOM   901   H  H    . GLY A 1 67 ? 18.468  1.867   21.295  1.00 0.00 ? 374 GLY A H    1  
ATOM   902   H  HA2  . GLY A 1 67 ? 16.999  0.169   23.109  1.00 0.00 ? 374 GLY A HA2  1  
ATOM   903   H  HA3  . GLY A 1 67 ? 15.981  1.284   22.206  1.00 0.00 ? 374 GLY A HA3  1  
ATOM   904   N  N    . THR A 1 68 ? 15.832  -0.248  20.291  1.00 0.00 ? 375 THR A N    1  
ATOM   905   C  CA   . THR A 1 68 ? 15.752  -1.030  19.070  1.00 0.00 ? 375 THR A CA   1  
ATOM   906   C  C    . THR A 1 68 ? 14.890  -0.303  18.044  1.00 0.00 ? 375 THR A C    1  
ATOM   907   O  O    . THR A 1 68 ? 13.766  0.100   18.349  1.00 0.00 ? 375 THR A O    1  
ATOM   908   C  CB   . THR A 1 68 ? 15.162  -2.433  19.341  1.00 0.00 ? 375 THR A CB   1  
ATOM   909   O  OG1  . THR A 1 68 ? 15.956  -3.113  20.323  1.00 0.00 ? 375 THR A OG1  1  
ATOM   910   C  CG2  . THR A 1 68 ? 15.110  -3.264  18.067  1.00 0.00 ? 375 THR A CG2  1  
ATOM   911   H  H    . THR A 1 68 ? 15.041  0.246   20.588  1.00 0.00 ? 375 THR A H    1  
ATOM   912   H  HA   . THR A 1 68 ? 16.750  -1.147  18.677  1.00 0.00 ? 375 THR A HA   1  
ATOM   913   H  HB   . THR A 1 68 ? 14.157  -2.315  19.719  1.00 0.00 ? 375 THR A HB   1  
ATOM   914   H  HG1  . THR A 1 68 ? 16.735  -2.581  20.527  1.00 0.00 ? 375 THR A HG1  1  
ATOM   915   H  HG21 . THR A 1 68 ? 16.112  -3.403  17.688  1.00 0.00 ? 375 THR A HG21 1  
ATOM   916   H  HG22 . THR A 1 68 ? 14.512  -2.755  17.326  1.00 0.00 ? 375 THR A HG22 1  
ATOM   917   H  HG23 . THR A 1 68 ? 14.672  -4.226  18.283  1.00 0.00 ? 375 THR A HG23 1  
ATOM   918   N  N    . THR A 1 69 ? 15.409  -0.117  16.839  1.00 0.00 ? 376 THR A N    1  
ATOM   919   C  CA   . THR A 1 69 ? 14.656  0.501   15.795  1.00 0.00 ? 376 THR A CA   1  
ATOM   920   C  C    . THR A 1 69 ? 14.534  -0.480  14.650  1.00 0.00 ? 376 THR A C    1  
ATOM   921   O  O    . THR A 1 69 ? 15.515  -0.984  14.107  1.00 0.00 ? 376 THR A O    1  
ATOM   922   C  CB   . THR A 1 69 ? 15.299  1.821   15.318  1.00 0.00 ? 376 THR A CB   1  
ATOM   923   O  OG1  . THR A 1 69 ? 16.556  1.570   14.693  1.00 0.00 ? 376 THR A OG1  1  
ATOM   924   C  CG2  . THR A 1 69 ? 15.523  2.749   16.492  1.00 0.00 ? 376 THR A CG2  1  
ATOM   925   H  H    . THR A 1 69 ? 16.302  -0.442  16.634  1.00 0.00 ? 376 THR A H    1  
ATOM   926   H  HA   . THR A 1 69 ? 13.668  0.717   16.178  1.00 0.00 ? 376 THR A HA   1  
ATOM   927   H  HB   . THR A 1 69 ? 14.638  2.303   14.613  1.00 0.00 ? 376 THR A HB   1  
ATOM   928   H  HG1  . THR A 1 69 ? 16.971  2.407   14.455  1.00 0.00 ? 376 THR A HG1  1  
ATOM   929   H  HG21 . THR A 1 69 ? 16.341  2.369   17.093  1.00 0.00 ? 376 THR A HG21 1  
ATOM   930   H  HG22 . THR A 1 69 ? 14.624  2.796   17.087  1.00 0.00 ? 376 THR A HG22 1  
ATOM   931   H  HG23 . THR A 1 69 ? 15.770  3.736   16.128  1.00 0.00 ? 376 THR A HG23 1  
ATOM   932   N  N    . PHE A 1 70 ? 13.311  -0.780  14.355  1.00 0.00 ? 377 PHE A N    1  
ATOM   933   C  CA   . PHE A 1 70 ? 12.970  -1.680  13.275  1.00 0.00 ? 377 PHE A CA   1  
ATOM   934   C  C    . PHE A 1 70 ? 12.238  -0.953  12.156  1.00 0.00 ? 377 PHE A C    1  
ATOM   935   O  O    . PHE A 1 70 ? 11.227  -0.288  12.387  1.00 0.00 ? 377 PHE A O    1  
ATOM   936   C  CB   . PHE A 1 70 ? 12.093  -2.800  13.813  1.00 0.00 ? 377 PHE A CB   1  
ATOM   937   C  CG   . PHE A 1 70 ? 12.460  -4.142  13.272  1.00 0.00 ? 377 PHE A CG   1  
ATOM   938   C  CD1  . PHE A 1 70 ? 13.547  -4.810  13.791  1.00 0.00 ? 377 PHE A CD1  1  
ATOM   939   C  CD2  . PHE A 1 70 ? 11.734  -4.726  12.252  1.00 0.00 ? 377 PHE A CD2  1  
ATOM   940   C  CE1  . PHE A 1 70 ? 13.907  -6.053  13.311  1.00 0.00 ? 377 PHE A CE1  1  
ATOM   941   C  CE2  . PHE A 1 70 ? 12.084  -5.971  11.763  1.00 0.00 ? 377 PHE A CE2  1  
ATOM   942   C  CZ   . PHE A 1 70 ? 13.177  -6.634  12.291  1.00 0.00 ? 377 PHE A CZ   1  
ATOM   943   H  H    . PHE A 1 70 ? 12.619  -0.439  14.930  1.00 0.00 ? 377 PHE A H    1  
ATOM   944   H  HA   . PHE A 1 70 ? 13.885  -2.102  12.887  1.00 0.00 ? 377 PHE A HA   1  
ATOM   945   H  HB2  . PHE A 1 70 ? 12.197  -2.842  14.898  1.00 0.00 ? 377 PHE A HB2  1  
ATOM   946   H  HB3  . PHE A 1 70 ? 11.056  -2.598  13.544  1.00 0.00 ? 377 PHE A HB3  1  
ATOM   947   H  HD1  . PHE A 1 70 ? 14.114  -4.345  14.588  1.00 0.00 ? 377 PHE A HD1  1  
ATOM   948   H  HD2  . PHE A 1 70 ? 10.882  -4.202  11.842  1.00 0.00 ? 377 PHE A HD2  1  
ATOM   949   H  HE1  . PHE A 1 70 ? 14.762  -6.567  13.727  1.00 0.00 ? 377 PHE A HE1  1  
ATOM   950   H  HE2  . PHE A 1 70 ? 11.509  -6.422  10.967  1.00 0.00 ? 377 PHE A HE2  1  
ATOM   951   H  HZ   . PHE A 1 70 ? 13.454  -7.607  11.911  1.00 0.00 ? 377 PHE A HZ   1  
ATOM   952   N  N    . SER A 1 71 ? 12.769  -1.054  10.952  1.00 0.00 ? 378 SER A N    1  
ATOM   953   C  CA   . SER A 1 71 ? 12.096  -0.539  9.771   1.00 0.00 ? 378 SER A CA   1  
ATOM   954   C  C    . SER A 1 71 ? 12.094  -1.596  8.678   1.00 0.00 ? 378 SER A C    1  
ATOM   955   O  O    . SER A 1 71 ? 13.147  -2.105  8.292   1.00 0.00 ? 378 SER A O    1  
ATOM   956   C  CB   . SER A 1 71 ? 12.781  0.738   9.274   1.00 0.00 ? 378 SER A CB   1  
ATOM   957   O  OG   . SER A 1 71 ? 12.822  1.719   10.297  1.00 0.00 ? 378 SER A OG   1  
ATOM   958   H  H    . SER A 1 71 ? 13.642  -1.497  10.848  1.00 0.00 ? 378 SER A H    1  
ATOM   959   H  HA   . SER A 1 71 ? 11.075  -0.312  10.041  1.00 0.00 ? 378 SER A HA   1  
ATOM   960   H  HB2  . SER A 1 71 ? 13.791  0.508   8.968   1.00 0.00 ? 378 SER A HB2  1  
ATOM   961   H  HB3  . SER A 1 71 ? 12.232  1.134   8.431   1.00 0.00 ? 378 SER A HB3  1  
ATOM   962   H  HG   . SER A 1 71 ? 12.655  1.297   11.147  1.00 0.00 ? 378 SER A HG   1  
ATOM   963   N  N    . VAL A 1 72 ? 10.922  -1.956  8.195   1.00 0.00 ? 379 VAL A N    1  
ATOM   964   C  CA   . VAL A 1 72 ? 10.845  -2.891  7.094   1.00 0.00 ? 379 VAL A CA   1  
ATOM   965   C  C    . VAL A 1 72 ? 10.720  -2.123  5.795   1.00 0.00 ? 379 VAL A C    1  
ATOM   966   O  O    . VAL A 1 72 ? 9.894   -1.221  5.667   1.00 0.00 ? 379 VAL A O    1  
ATOM   967   C  CB   . VAL A 1 72 ? 9.658   -3.860  7.205   1.00 0.00 ? 379 VAL A CB   1  
ATOM   968   C  CG1  . VAL A 1 72 ? 9.866   -5.070  6.303   1.00 0.00 ? 379 VAL A CG1  1  
ATOM   969   C  CG2  . VAL A 1 72 ? 9.423   -4.289  8.647   1.00 0.00 ? 379 VAL A CG2  1  
ATOM   970   H  H    . VAL A 1 72 ? 10.097  -1.582  8.578   1.00 0.00 ? 379 VAL A H    1  
ATOM   971   H  HA   . VAL A 1 72 ? 11.761  -3.465  7.078   1.00 0.00 ? 379 VAL A HA   1  
ATOM   972   H  HB   . VAL A 1 72 ? 8.789   -3.338  6.854   1.00 0.00 ? 379 VAL A HB   1  
ATOM   973   H  HG11 . VAL A 1 72 ? 9.981   -4.742  5.281   1.00 0.00 ? 379 VAL A HG11 1  
ATOM   974   H  HG12 . VAL A 1 72 ? 9.010   -5.724  6.376   1.00 0.00 ? 379 VAL A HG12 1  
ATOM   975   H  HG13 . VAL A 1 72 ? 10.754  -5.602  6.613   1.00 0.00 ? 379 VAL A HG13 1  
ATOM   976   H  HG21 . VAL A 1 72 ? 9.227   -3.419  9.254   1.00 0.00 ? 379 VAL A HG21 1  
ATOM   977   H  HG22 . VAL A 1 72 ? 10.301  -4.796  9.018   1.00 0.00 ? 379 VAL A HG22 1  
ATOM   978   H  HG23 . VAL A 1 72 ? 8.575   -4.958  8.690   1.00 0.00 ? 379 VAL A HG23 1  
ATOM   979   N  N    . ARG A 1 73 ? 11.534  -2.491  4.839   1.00 0.00 ? 380 ARG A N    1  
ATOM   980   C  CA   . ARG A 1 73 ? 11.535  -1.835  3.548   1.00 0.00 ? 380 ARG A CA   1  
ATOM   981   C  C    . ARG A 1 73 ? 11.205  -2.852  2.468   1.00 0.00 ? 380 ARG A C    1  
ATOM   982   O  O    . ARG A 1 73 ? 12.000  -3.743  2.156   1.00 0.00 ? 380 ARG A O    1  
ATOM   983   C  CB   . ARG A 1 73 ? 12.882  -1.143  3.278   1.00 0.00 ? 380 ARG A CB   1  
ATOM   984   C  CG   . ARG A 1 73 ? 14.082  -2.073  3.340   1.00 0.00 ? 380 ARG A CG   1  
ATOM   985   C  CD   . ARG A 1 73 ? 15.380  -1.346  3.040   1.00 0.00 ? 380 ARG A CD   1  
ATOM   986   N  NE   . ARG A 1 73 ? 16.529  -2.253  3.070   1.00 0.00 ? 380 ARG A NE   1  
ATOM   987   C  CZ   . ARG A 1 73 ? 17.706  -1.991  2.501   1.00 0.00 ? 380 ARG A CZ   1  
ATOM   988   N  NH1  . ARG A 1 73 ? 17.908  -0.836  1.876   1.00 0.00 ? 380 ARG A NH1  1  
ATOM   989   N  NH2  . ARG A 1 73 ? 18.689  -2.881  2.570   1.00 0.00 ? 380 ARG A NH2  1  
ATOM   990   H  H    . ARG A 1 73 ? 12.134  -3.249  4.998   1.00 0.00 ? 380 ARG A H    1  
ATOM   991   H  HA   . ARG A 1 73 ? 10.754  -1.086  3.562   1.00 0.00 ? 380 ARG A HA   1  
ATOM   992   H  HB2  . ARG A 1 73 ? 12.853  -0.695  2.295   1.00 0.00 ? 380 ARG A HB2  1  
ATOM   993   H  HB3  . ARG A 1 73 ? 13.023  -0.364  4.012   1.00 0.00 ? 380 ARG A HB3  1  
ATOM   994   H  HG2  . ARG A 1 73 ? 14.142  -2.503  4.328   1.00 0.00 ? 380 ARG A HG2  1  
ATOM   995   H  HG3  . ARG A 1 73 ? 13.946  -2.860  2.613   1.00 0.00 ? 380 ARG A HG3  1  
ATOM   996   H  HD2  . ARG A 1 73 ? 15.312  -0.898  2.059   1.00 0.00 ? 380 ARG A HD2  1  
ATOM   997   H  HD3  . ARG A 1 73 ? 15.524  -0.575  3.780   1.00 0.00 ? 380 ARG A HD3  1  
ATOM   998   H  HE   . ARG A 1 73 ? 16.412  -3.111  3.536   1.00 0.00 ? 380 ARG A HE   1  
ATOM   999   H  HH11 . ARG A 1 73 ? 17.177  -0.152  1.828   1.00 0.00 ? 380 ARG A HH11 1  
ATOM   1000  H  HH12 . ARG A 1 73 ? 18.796  -0.647  1.443   1.00 0.00 ? 380 ARG A HH12 1  
ATOM   1001  H  HH21 . ARG A 1 73 ? 18.551  -3.754  3.047   1.00 0.00 ? 380 ARG A HH21 1  
ATOM   1002  H  HH22 . ARG A 1 73 ? 19.572  -2.688  2.135   1.00 0.00 ? 380 ARG A HH22 1  
ATOM   1003  N  N    . LYS A 1 74 ? 10.005  -2.752  1.933   1.00 0.00 ? 381 LYS A N    1  
ATOM   1004  C  CA   . LYS A 1 74 ? 9.566   -3.678  0.911   1.00 0.00 ? 381 LYS A CA   1  
ATOM   1005  C  C    . LYS A 1 74 ? 9.838   -3.111  -0.470  1.00 0.00 ? 381 LYS A C    1  
ATOM   1006  O  O    . LYS A 1 74 ? 9.460   -1.983  -0.779  1.00 0.00 ? 381 LYS A O    1  
ATOM   1007  C  CB   . LYS A 1 74 ? 8.081   -4.010  1.069   1.00 0.00 ? 381 LYS A CB   1  
ATOM   1008  C  CG   . LYS A 1 74 ? 7.762   -4.818  2.317   1.00 0.00 ? 381 LYS A CG   1  
ATOM   1009  C  CD   . LYS A 1 74 ? 6.323   -5.301  2.300   1.00 0.00 ? 381 LYS A CD   1  
ATOM   1010  C  CE   . LYS A 1 74 ? 6.003   -6.184  3.500   1.00 0.00 ? 381 LYS A CE   1  
ATOM   1011  N  NZ   . LYS A 1 74 ? 6.155   -5.468  4.794   1.00 0.00 ? 381 LYS A NZ   1  
ATOM   1012  H  H    . LYS A 1 74 ? 9.406   -2.034  2.224   1.00 0.00 ? 381 LYS A H    1  
ATOM   1013  H  HA   . LYS A 1 74 ? 10.140  -4.586  1.027   1.00 0.00 ? 381 LYS A HA   1  
ATOM   1014  H  HB2  . LYS A 1 74 ? 7.520   -3.089  1.113   1.00 0.00 ? 381 LYS A HB2  1  
ATOM   1015  H  HB3  . LYS A 1 74 ? 7.758   -4.577  0.209   1.00 0.00 ? 381 LYS A HB3  1  
ATOM   1016  H  HG2  . LYS A 1 74 ? 8.420   -5.673  2.362   1.00 0.00 ? 381 LYS A HG2  1  
ATOM   1017  H  HG3  . LYS A 1 74 ? 7.913   -4.198  3.185   1.00 0.00 ? 381 LYS A HG3  1  
ATOM   1018  H  HD2  . LYS A 1 74 ? 5.670   -4.444  2.310   1.00 0.00 ? 381 LYS A HD2  1  
ATOM   1019  H  HD3  . LYS A 1 74 ? 6.161   -5.866  1.395   1.00 0.00 ? 381 LYS A HD3  1  
ATOM   1020  H  HE2  . LYS A 1 74 ? 4.984   -6.527  3.410   1.00 0.00 ? 381 LYS A HE2  1  
ATOM   1021  H  HE3  . LYS A 1 74 ? 6.669   -7.036  3.491   1.00 0.00 ? 381 LYS A HE3  1  
ATOM   1022  H  HZ1  . LYS A 1 74 ? 7.117   -5.093  4.889   1.00 0.00 ? 381 LYS A HZ1  1  
ATOM   1023  H  HZ2  . LYS A 1 74 ? 5.970   -6.119  5.588   1.00 0.00 ? 381 LYS A HZ2  1  
ATOM   1024  H  HZ3  . LYS A 1 74 ? 5.481   -4.678  4.851   1.00 0.00 ? 381 LYS A HZ3  1  
ATOM   1025  N  N    . THR A 1 75 ? 10.514  -3.899  -1.282  1.00 0.00 ? 382 THR A N    1  
ATOM   1026  C  CA   . THR A 1 75 ? 10.784  -3.523  -2.651  1.00 0.00 ? 382 THR A CA   1  
ATOM   1027  C  C    . THR A 1 75 ? 9.816   -4.272  -3.553  1.00 0.00 ? 382 THR A C    1  
ATOM   1028  O  O    . THR A 1 75 ? 9.927   -5.484  -3.731  1.00 0.00 ? 382 THR A O    1  
ATOM   1029  C  CB   . THR A 1 75 ? 12.237  -3.862  -3.038  1.00 0.00 ? 382 THR A CB   1  
ATOM   1030  O  OG1  . THR A 1 75 ? 13.139  -3.274  -2.093  1.00 0.00 ? 382 THR A OG1  1  
ATOM   1031  C  CG2  . THR A 1 75 ? 12.565  -3.356  -4.434  1.00 0.00 ? 382 THR A CG2  1  
ATOM   1032  H  H    . THR A 1 75 ? 10.808  -4.779  -0.958  1.00 0.00 ? 382 THR A H    1  
ATOM   1033  H  HA   . THR A 1 75 ? 10.629  -2.460  -2.756  1.00 0.00 ? 382 THR A HA   1  
ATOM   1034  H  HB   . THR A 1 75 ? 12.360  -4.936  -3.023  1.00 0.00 ? 382 THR A HB   1  
ATOM   1035  H  HG1  . THR A 1 75 ? 12.630  -2.865  -1.384  1.00 0.00 ? 382 THR A HG1  1  
ATOM   1036  H  HG21 . THR A 1 75 ? 12.435  -2.282  -4.467  1.00 0.00 ? 382 THR A HG21 1  
ATOM   1037  H  HG22 . THR A 1 75 ? 11.903  -3.820  -5.149  1.00 0.00 ? 382 THR A HG22 1  
ATOM   1038  H  HG23 . THR A 1 75 ? 13.588  -3.601  -4.676  1.00 0.00 ? 382 THR A HG23 1  
ATOM   1039  N  N    . ALA A 1 76 ? 8.868   -3.557  -4.117  1.00 0.00 ? 383 ALA A N    1  
ATOM   1040  C  CA   . ALA A 1 76 ? 7.782   -4.194  -4.828  1.00 0.00 ? 383 ALA A CA   1  
ATOM   1041  C  C    . ALA A 1 76 ? 7.725   -3.733  -6.268  1.00 0.00 ? 383 ALA A C    1  
ATOM   1042  O  O    . ALA A 1 76 ? 7.958   -2.566  -6.566  1.00 0.00 ? 383 ALA A O    1  
ATOM   1043  C  CB   . ALA A 1 76 ? 6.464   -3.901  -4.127  1.00 0.00 ? 383 ALA A CB   1  
ATOM   1044  H  H    . ALA A 1 76 ? 8.899   -2.574  -4.062  1.00 0.00 ? 383 ALA A H    1  
ATOM   1045  H  HA   . ALA A 1 76 ? 7.948   -5.262  -4.807  1.00 0.00 ? 383 ALA A HA   1  
ATOM   1046  H  HB1  . ALA A 1 76 ? 5.668   -4.443  -4.614  1.00 0.00 ? 383 ALA A HB1  1  
ATOM   1047  H  HB2  . ALA A 1 76 ? 6.260   -2.841  -4.173  1.00 0.00 ? 383 ALA A HB2  1  
ATOM   1048  H  HB3  . ALA A 1 76 ? 6.530   -4.207  -3.092  1.00 0.00 ? 383 ALA A HB3  1  
ATOM   1049  N  N    . TYR A 1 77 ? 7.432   -4.654  -7.157  1.00 0.00 ? 384 TYR A N    1  
ATOM   1050  C  CA   . TYR A 1 77 ? 7.204   -4.315  -8.543  1.00 0.00 ? 384 TYR A CA   1  
ATOM   1051  C  C    . TYR A 1 77 ? 5.767   -4.652  -8.901  1.00 0.00 ? 384 TYR A C    1  
ATOM   1052  O  O    . TYR A 1 77 ? 5.227   -5.645  -8.419  1.00 0.00 ? 384 TYR A O    1  
ATOM   1053  C  CB   . TYR A 1 77 ? 8.176   -5.061  -9.464  1.00 0.00 ? 384 TYR A CB   1  
ATOM   1054  C  CG   . TYR A 1 77 ? 9.632   -4.673  -9.278  1.00 0.00 ? 384 TYR A CG   1  
ATOM   1055  C  CD1  . TYR A 1 77 ? 10.099  -3.415  -9.656  1.00 0.00 ? 384 TYR A CD1  1  
ATOM   1056  C  CD2  . TYR A 1 77 ? 10.543  -5.571  -8.735  1.00 0.00 ? 384 TYR A CD2  1  
ATOM   1057  C  CE1  . TYR A 1 77 ? 11.423  -3.071  -9.496  1.00 0.00 ? 384 TYR A CE1  1  
ATOM   1058  C  CE2  . TYR A 1 77 ? 11.873  -5.228  -8.572  1.00 0.00 ? 384 TYR A CE2  1  
ATOM   1059  C  CZ   . TYR A 1 77 ? 12.307  -3.978  -8.957  1.00 0.00 ? 384 TYR A CZ   1  
ATOM   1060  O  OH   . TYR A 1 77 ? 13.626  -3.629  -8.795  1.00 0.00 ? 384 TYR A OH   1  
ATOM   1061  H  H    . TYR A 1 77 ? 7.343   -5.591  -6.869  1.00 0.00 ? 384 TYR A H    1  
ATOM   1062  H  HA   . TYR A 1 77 ? 7.356   -3.252  -8.655  1.00 0.00 ? 384 TYR A HA   1  
ATOM   1063  H  HB2  . TYR A 1 77 ? 8.094   -6.128  -9.268  1.00 0.00 ? 384 TYR A HB2  1  
ATOM   1064  H  HB3  . TYR A 1 77 ? 7.909   -4.857  -10.498 1.00 0.00 ? 384 TYR A HB3  1  
ATOM   1065  H  HD1  . TYR A 1 77 ? 9.410   -2.694  -10.074 1.00 0.00 ? 384 TYR A HD1  1  
ATOM   1066  H  HD2  . TYR A 1 77 ? 10.202  -6.550  -8.437  1.00 0.00 ? 384 TYR A HD2  1  
ATOM   1067  H  HE1  . TYR A 1 77 ? 11.766  -2.093  -9.798  1.00 0.00 ? 384 TYR A HE1  1  
ATOM   1068  H  HE2  . TYR A 1 77 ? 12.565  -5.939  -8.149  1.00 0.00 ? 384 TYR A HE2  1  
ATOM   1069  H  HH   . TYR A 1 77 ? 14.188  -4.345  -9.106  1.00 0.00 ? 384 TYR A HH   1  
ATOM   1070  N  N    . CYS A 1 78 ? 5.146   -3.819  -9.723  1.00 0.00 ? 385 CYS A N    1  
ATOM   1071  C  CA   . CYS A 1 78 ? 3.771   -4.070  -10.148 1.00 0.00 ? 385 CYS A CA   1  
ATOM   1072  C  C    . CYS A 1 78 ? 3.680   -5.377  -10.939 1.00 0.00 ? 385 CYS A C    1  
ATOM   1073  O  O    . CYS A 1 78 ? 4.681   -5.862  -11.463 1.00 0.00 ? 385 CYS A O    1  
ATOM   1074  C  CB   . CYS A 1 78 ? 3.234   -2.888  -10.971 1.00 0.00 ? 385 CYS A CB   1  
ATOM   1075  S  SG   . CYS A 1 78 ? 4.405   -2.169  -12.159 1.00 0.00 ? 385 CYS A SG   1  
ATOM   1076  H  H    . CYS A 1 78 ? 5.608   -3.011  -10.022 1.00 0.00 ? 385 CYS A H    1  
ATOM   1077  H  HA   . CYS A 1 78 ? 3.170   -4.169  -9.257  1.00 0.00 ? 385 CYS A HA   1  
ATOM   1078  H  HB2  . CYS A 1 78 ? 2.368   -3.216  -11.528 1.00 0.00 ? 385 CYS A HB2  1  
ATOM   1079  H  HB3  . CYS A 1 78 ? 2.935   -2.100  -10.295 1.00 0.00 ? 385 CYS A HB3  1  
ATOM   1080  N  N    . ASP A 1 79 ? 2.484   -5.953  -11.002 1.00 0.00 ? 386 ASP A N    1  
ATOM   1081  C  CA   . ASP A 1 79 ? 2.290   -7.278  -11.601 1.00 0.00 ? 386 ASP A CA   1  
ATOM   1082  C  C    . ASP A 1 79 ? 2.794   -7.329  -13.048 1.00 0.00 ? 386 ASP A C    1  
ATOM   1083  O  O    . ASP A 1 79 ? 3.499   -8.265  -13.431 1.00 0.00 ? 386 ASP A O    1  
ATOM   1084  C  CB   . ASP A 1 79 ? 0.813   -7.699  -11.525 1.00 0.00 ? 386 ASP A CB   1  
ATOM   1085  C  CG   . ASP A 1 79 ? -0.106  -6.860  -12.396 1.00 0.00 ? 386 ASP A CG   1  
ATOM   1086  O  OD1  . ASP A 1 79 ? 0.087   -5.629  -12.462 1.00 0.00 ? 386 ASP A OD1  1  
ATOM   1087  O  OD2  . ASP A 1 79 ? -1.038  -7.433  -13.004 1.00 0.00 ? 386 ASP A OD2  1  
ATOM   1088  H  H    . ASP A 1 79 ? 1.705   -5.476  -10.633 1.00 0.00 ? 386 ASP A H    1  
ATOM   1089  H  HA   . ASP A 1 79 ? 2.875   -7.976  -11.021 1.00 0.00 ? 386 ASP A HA   1  
ATOM   1090  H  HB2  . ASP A 1 79 ? 0.729   -8.735  -11.853 1.00 0.00 ? 386 ASP A HB2  1  
ATOM   1091  H  HB3  . ASP A 1 79 ? 0.476   -7.610  -10.489 1.00 0.00 ? 386 ASP A HB3  1  
ATOM   1092  N  N    . VAL A 1 80 ? 2.463   -6.311  -13.832 1.00 0.00 ? 387 VAL A N    1  
ATOM   1093  C  CA   . VAL A 1 80 ? 2.900   -6.239  -15.226 1.00 0.00 ? 387 VAL A CA   1  
ATOM   1094  C  C    . VAL A 1 80 ? 4.310   -5.654  -15.343 1.00 0.00 ? 387 VAL A C    1  
ATOM   1095  O  O    . VAL A 1 80 ? 4.748   -5.262  -16.423 1.00 0.00 ? 387 VAL A O    1  
ATOM   1096  C  CB   . VAL A 1 80 ? 1.925   -5.400  -16.079 1.00 0.00 ? 387 VAL A CB   1  
ATOM   1097  C  CG1  . VAL A 1 80 ? 0.571   -6.089  -16.182 1.00 0.00 ? 387 VAL A CG1  1  
ATOM   1098  C  CG2  . VAL A 1 80 ? 1.771   -4.000  -15.504 1.00 0.00 ? 387 VAL A CG2  1  
ATOM   1099  H  H    . VAL A 1 80 ? 1.888   -5.597  -13.470 1.00 0.00 ? 387 VAL A H    1  
ATOM   1100  H  HA   . VAL A 1 80 ? 2.911   -7.246  -15.619 1.00 0.00 ? 387 VAL A HA   1  
ATOM   1101  H  HB   . VAL A 1 80 ? 2.337   -5.315  -17.075 1.00 0.00 ? 387 VAL A HB   1  
ATOM   1102  H  HG11 . VAL A 1 80 ? 0.695   -7.064  -16.629 1.00 0.00 ? 387 VAL A HG11 1  
ATOM   1103  H  HG12 . VAL A 1 80 ? -0.088  -5.493  -16.795 1.00 0.00 ? 387 VAL A HG12 1  
ATOM   1104  H  HG13 . VAL A 1 80 ? 0.146   -6.194  -15.195 1.00 0.00 ? 387 VAL A HG13 1  
ATOM   1105  H  HG21 . VAL A 1 80 ? 1.095   -3.430  -16.123 1.00 0.00 ? 387 VAL A HG21 1  
ATOM   1106  H  HG22 . VAL A 1 80 ? 2.735   -3.514  -15.480 1.00 0.00 ? 387 VAL A HG22 1  
ATOM   1107  H  HG23 . VAL A 1 80 ? 1.375   -4.067  -14.501 1.00 0.00 ? 387 VAL A HG23 1  
ATOM   1108  N  N    . HIS A 1 81 ? 5.016   -5.608  -14.225 1.00 0.00 ? 388 HIS A N    1  
ATOM   1109  C  CA   . HIS A 1 81 ? 6.376   -5.081  -14.182 1.00 0.00 ? 388 HIS A CA   1  
ATOM   1110  C  C    . HIS A 1 81 ? 7.375   -6.233  -14.149 1.00 0.00 ? 388 HIS A C    1  
ATOM   1111  O  O    . HIS A 1 81 ? 8.558   -6.050  -14.413 1.00 0.00 ? 388 HIS A O    1  
ATOM   1112  C  CB   . HIS A 1 81 ? 6.531   -4.214  -12.928 1.00 0.00 ? 388 HIS A CB   1  
ATOM   1113  C  CG   . HIS A 1 81 ? 7.686   -3.262  -12.921 1.00 0.00 ? 388 HIS A CG   1  
ATOM   1114  N  ND1  . HIS A 1 81 ? 7.553   -1.922  -12.557 1.00 0.00 ? 388 HIS A ND1  1  
ATOM   1115  C  CD2  . HIS A 1 81 ? 9.003   -3.463  -13.155 1.00 0.00 ? 388 HIS A CD2  1  
ATOM   1116  C  CE1  . HIS A 1 81 ? 8.762   -1.364  -12.573 1.00 0.00 ? 388 HIS A CE1  1  
ATOM   1117  N  NE2  . HIS A 1 81 ? 9.644   -2.274  -12.931 1.00 0.00 ? 388 HIS A NE2  1  
ATOM   1118  H  H    . HIS A 1 81 ? 4.611   -5.939  -13.394 1.00 0.00 ? 388 HIS A H    1  
ATOM   1119  H  HA   . HIS A 1 81 ? 6.543   -4.479  -15.063 1.00 0.00 ? 388 HIS A HA   1  
ATOM   1120  H  HB2  . HIS A 1 81 ? 5.634   -3.630  -12.803 1.00 0.00 ? 388 HIS A HB2  1  
ATOM   1121  H  HB3  . HIS A 1 81 ? 6.637   -4.866  -12.073 1.00 0.00 ? 388 HIS A HB3  1  
ATOM   1122  H  HD2  . HIS A 1 81 ? 9.464   -4.390  -13.462 1.00 0.00 ? 388 HIS A HD2  1  
ATOM   1123  H  HE1  . HIS A 1 81 ? 8.982   -0.336  -12.328 1.00 0.00 ? 388 HIS A HE1  1  
ATOM   1124  H  HE2  . HIS A 1 81 ? 10.599  -2.104  -13.096 1.00 0.00 ? 388 HIS A HE2  1  
ATOM   1125  N  N    . THR A 1 82 ? 6.879   -7.418  -13.827 1.00 0.00 ? 389 THR A N    1  
ATOM   1126  C  CA   . THR A 1 82 ? 7.726   -8.594  -13.689 1.00 0.00 ? 389 THR A CA   1  
ATOM   1127  C  C    . THR A 1 82 ? 8.250   -9.106  -15.047 1.00 0.00 ? 389 THR A C    1  
ATOM   1128  O  O    . THR A 1 82 ? 9.439   -9.408  -15.167 1.00 0.00 ? 389 THR A O    1  
ATOM   1129  C  CB   . THR A 1 82 ? 6.980   -9.724  -12.950 1.00 0.00 ? 389 THR A CB   1  
ATOM   1130  O  OG1  . THR A 1 82 ? 6.269   -9.182  -11.828 1.00 0.00 ? 389 THR A OG1  1  
ATOM   1131  C  CG2  . THR A 1 82 ? 7.953   -10.790 -12.466 1.00 0.00 ? 389 THR A CG2  1  
ATOM   1132  H  H    . THR A 1 82 ? 5.918   -7.507  -13.673 1.00 0.00 ? 389 THR A H    1  
ATOM   1133  H  HA   . THR A 1 82 ? 8.576   -8.310  -13.084 1.00 0.00 ? 389 THR A HA   1  
ATOM   1134  H  HB   . THR A 1 82 ? 6.277   -10.180 -13.628 1.00 0.00 ? 389 THR A HB   1  
ATOM   1135  H  HG1  . THR A 1 82 ? 5.351   -9.032  -12.070 1.00 0.00 ? 389 THR A HG1  1  
ATOM   1136  H  HG21 . THR A 1 82 ? 8.672   -10.343 -11.794 1.00 0.00 ? 389 THR A HG21 1  
ATOM   1137  H  HG22 . THR A 1 82 ? 8.469   -11.218 -13.312 1.00 0.00 ? 389 THR A HG22 1  
ATOM   1138  H  HG23 . THR A 1 82 ? 7.409   -11.565 -11.947 1.00 0.00 ? 389 THR A HG23 1  
ATOM   1139  N  N    . PRO A 1 83 ? 7.385   -9.240  -16.089 1.00 0.00 ? 390 PRO A N    1  
ATOM   1140  C  CA   . PRO A 1 83 ? 7.839   -9.658  -17.425 1.00 0.00 ? 390 PRO A CA   1  
ATOM   1141  C  C    . PRO A 1 83 ? 8.920   -8.739  -18.037 1.00 0.00 ? 390 PRO A C    1  
ATOM   1142  O  O    . PRO A 1 83 ? 9.904   -9.249  -18.584 1.00 0.00 ? 390 PRO A O    1  
ATOM   1143  C  CB   . PRO A 1 83 ? 6.564   -9.658  -18.274 1.00 0.00 ? 390 PRO A CB   1  
ATOM   1144  C  CG   . PRO A 1 83 ? 5.449   -9.762  -17.292 1.00 0.00 ? 390 PRO A CG   1  
ATOM   1145  C  CD   . PRO A 1 83 ? 5.917   -9.053  -16.054 1.00 0.00 ? 390 PRO A CD   1  
ATOM   1146  H  HA   . PRO A 1 83 ? 8.232   -10.667 -17.389 1.00 0.00 ? 390 PRO A HA   1  
ATOM   1147  H  HB2  . PRO A 1 83 ? 6.509   -8.743  -18.842 1.00 0.00 ? 390 PRO A HB2  1  
ATOM   1148  H  HB3  . PRO A 1 83 ? 6.579   -10.503 -18.946 1.00 0.00 ? 390 PRO A HB3  1  
ATOM   1149  H  HG2  . PRO A 1 83 ? 4.565   -9.284  -17.687 1.00 0.00 ? 390 PRO A HG2  1  
ATOM   1150  H  HG3  . PRO A 1 83 ? 5.247   -10.801 -17.074 1.00 0.00 ? 390 PRO A HG3  1  
ATOM   1151  H  HD2  . PRO A 1 83 ? 5.662   -8.004  -16.100 1.00 0.00 ? 390 PRO A HD2  1  
ATOM   1152  H  HD3  . PRO A 1 83 ? 5.491   -9.507  -15.175 1.00 0.00 ? 390 PRO A HD3  1  
ATOM   1153  N  N    . PRO A 1 84 ? 8.771   -7.385  -18.000 1.00 0.00 ? 391 PRO A N    1  
ATOM   1154  C  CA   . PRO A 1 84 ? 9.848   -6.480  -18.427 1.00 0.00 ? 391 PRO A CA   1  
ATOM   1155  C  C    . PRO A 1 84 ? 11.081  -6.642  -17.546 1.00 0.00 ? 391 PRO A C    1  
ATOM   1156  O  O    . PRO A 1 84 ? 11.089  -6.235  -16.383 1.00 0.00 ? 391 PRO A O    1  
ATOM   1157  C  CB   . PRO A 1 84 ? 9.251   -5.077  -18.267 1.00 0.00 ? 391 PRO A CB   1  
ATOM   1158  C  CG   . PRO A 1 84 ? 7.778   -5.289  -18.226 1.00 0.00 ? 391 PRO A CG   1  
ATOM   1159  C  CD   . PRO A 1 84 ? 7.579   -6.627  -17.578 1.00 0.00 ? 391 PRO A CD   1  
ATOM   1160  H  HA   . PRO A 1 84 ? 10.120  -6.649  -19.458 1.00 0.00 ? 391 PRO A HA   1  
ATOM   1161  H  HB2  . PRO A 1 84 ? 9.614   -4.633  -17.351 1.00 0.00 ? 391 PRO A HB2  1  
ATOM   1162  H  HB3  . PRO A 1 84 ? 9.537   -4.463  -19.109 1.00 0.00 ? 391 PRO A HB3  1  
ATOM   1163  H  HG2  . PRO A 1 84 ? 7.312   -4.513  -17.637 1.00 0.00 ? 391 PRO A HG2  1  
ATOM   1164  H  HG3  . PRO A 1 84 ? 7.379   -5.294  -19.230 1.00 0.00 ? 391 PRO A HG3  1  
ATOM   1165  H  HD2  . PRO A 1 84 ? 7.547   -6.524  -16.502 1.00 0.00 ? 391 PRO A HD2  1  
ATOM   1166  H  HD3  . PRO A 1 84 ? 6.676   -7.092  -17.939 1.00 0.00 ? 391 PRO A HD3  1  
ATOM   1167  N  N    . GLY A 1 85 ? 12.119  -7.240  -18.107 1.00 0.00 ? 392 GLY A N    1  
ATOM   1168  C  CA   . GLY A 1 85 ? 13.264  -7.631  -17.316 1.00 0.00 ? 392 GLY A CA   1  
ATOM   1169  C  C    . GLY A 1 85 ? 13.222  -9.115  -17.030 1.00 0.00 ? 392 GLY A C    1  
ATOM   1170  O  O    . GLY A 1 85 ? 13.295  -9.540  -15.876 1.00 0.00 ? 392 GLY A O    1  
ATOM   1171  H  H    . GLY A 1 85 ? 12.104  -7.421  -19.067 1.00 0.00 ? 392 GLY A H    1  
ATOM   1172  H  HA2  . GLY A 1 85 ? 14.169  -7.396  -17.857 1.00 0.00 ? 392 GLY A HA2  1  
ATOM   1173  H  HA3  . GLY A 1 85 ? 13.253  -7.089  -16.383 1.00 0.00 ? 392 GLY A HA3  1  
ATOM   1174  N  N    . SER A 1 86 ? 13.085  -9.893  -18.103 1.00 0.00 ? 393 SER A N    1  
ATOM   1175  C  CA   . SER A 1 86 ? 12.927  -11.337 -18.018 1.00 0.00 ? 393 SER A CA   1  
ATOM   1176  C  C    . SER A 1 86 ? 14.003  -11.967 -17.138 1.00 0.00 ? 393 SER A C    1  
ATOM   1177  O  O    . SER A 1 86 ? 15.195  -11.915 -17.456 1.00 0.00 ? 393 SER A O    1  
ATOM   1178  C  CB   . SER A 1 86 ? 12.978  -11.930 -19.425 1.00 0.00 ? 393 SER A CB   1  
ATOM   1179  O  OG   . SER A 1 86 ? 12.043  -11.282 -20.276 1.00 0.00 ? 393 SER A OG   1  
ATOM   1180  H  H    . SER A 1 86 ? 13.094  -9.476  -18.987 1.00 0.00 ? 393 SER A H    1  
ATOM   1181  H  HA   . SER A 1 86 ? 11.959  -11.540 -17.588 1.00 0.00 ? 393 SER A HA   1  
ATOM   1182  H  HB2  . SER A 1 86 ? 13.969  -11.801 -19.833 1.00 0.00 ? 393 SER A HB2  1  
ATOM   1183  H  HB3  . SER A 1 86 ? 12.739  -12.981 -19.383 1.00 0.00 ? 393 SER A HB3  1  
ATOM   1184  H  HG   . SER A 1 86 ? 11.209  -11.161 -19.800 1.00 0.00 ? 393 SER A HG   1  
ATOM   1185  N  N    . THR A 1 87 ? 13.569  -12.532 -16.021 1.00 0.00 ? 394 THR A N    1  
ATOM   1186  C  CA   . THR A 1 87 ? 14.473  -13.155 -15.074 1.00 0.00 ? 394 THR A CA   1  
ATOM   1187  C  C    . THR A 1 87 ? 14.913  -14.528 -15.579 1.00 0.00 ? 394 THR A C    1  
ATOM   1188  O  O    . THR A 1 87 ? 14.154  -15.501 -15.399 1.00 0.00 ? 394 THR A O    1  
ATOM   1189  C  CB   . THR A 1 87 ? 13.798  -13.293 -13.697 1.00 0.00 ? 394 THR A CB   1  
ATOM   1190  O  OG1  . THR A 1 87 ? 13.280  -12.018 -13.287 1.00 0.00 ? 394 THR A OG1  1  
ATOM   1191  C  CG2  . THR A 1 87 ? 14.781  -13.809 -12.653 1.00 0.00 ? 394 THR A CG2  1  
ATOM   1192  O  OXT  . THR A 1 87 ? 16.007  -14.625 -16.175 1.00 0.00 ? 394 THR A OXT  1  
ATOM   1193  H  H    . THR A 1 87 ? 12.606  -12.529 -15.830 1.00 0.00 ? 394 THR A H    1  
ATOM   1194  H  HA   . THR A 1 87 ? 15.340  -12.521 -14.967 1.00 0.00 ? 394 THR A HA   1  
ATOM   1195  H  HB   . THR A 1 87 ? 12.981  -13.996 -13.782 1.00 0.00 ? 394 THR A HB   1  
ATOM   1196  H  HG1  . THR A 1 87 ? 13.622  -11.330 -13.873 1.00 0.00 ? 394 THR A HG1  1  
ATOM   1197  H  HG21 . THR A 1 87 ? 15.151  -14.777 -12.954 1.00 0.00 ? 394 THR A HG21 1  
ATOM   1198  H  HG22 . THR A 1 87 ? 14.281  -13.894 -11.698 1.00 0.00 ? 394 THR A HG22 1  
ATOM   1199  H  HG23 . THR A 1 87 ? 15.606  -13.120 -12.565 1.00 0.00 ? 394 THR A HG23 1  
HETATM 1200  ZN ZN   . ZN  B 2 .  ? -6.752  -1.039  -6.108  1.00 0.00 ? 401 ZN  A ZN   1  
HETATM 1201  ZN ZN   . ZN  C 2 .  ? 5.806   -0.530  -12.488 1.00 0.00 ? 402 ZN  A ZN   1  
ATOM   1202  N  N    . MET A 1 9  ? 3.543   30.063  -6.408  1.00 0.00 ? 316 MET A N    2  
ATOM   1203  C  CA   . MET A 1 9  ? 2.799   30.221  -5.141  1.00 0.00 ? 316 MET A CA   2  
ATOM   1204  C  C    . MET A 1 9  ? 1.349   30.591  -5.419  1.00 0.00 ? 316 MET A C    2  
ATOM   1205  O  O    . MET A 1 9  ? 1.059   31.679  -5.920  1.00 0.00 ? 316 MET A O    2  
ATOM   1206  C  CB   . MET A 1 9  ? 3.446   31.292  -4.258  1.00 0.00 ? 316 MET A CB   2  
ATOM   1207  C  CG   . MET A 1 9  ? 2.737   31.488  -2.927  1.00 0.00 ? 316 MET A CG   2  
ATOM   1208  S  SD   . MET A 1 9  ? 3.519   32.743  -1.891  1.00 0.00 ? 316 MET A SD   2  
ATOM   1209  C  CE   . MET A 1 9  ? 5.133   32.012  -1.623  1.00 0.00 ? 316 MET A CE   2  
ATOM   1210  H  H    . MET A 1 9  ? 3.127   29.292  -6.971  1.00 0.00 ? 316 MET A H    2  
ATOM   1211  H  HA   . MET A 1 9  ? 2.820   29.276  -4.620  1.00 0.00 ? 316 MET A HA   2  
ATOM   1212  H  HB2  . MET A 1 9  ? 4.469   31.009  -4.059  1.00 0.00 ? 316 MET A HB2  2  
ATOM   1213  H  HB3  . MET A 1 9  ? 3.437   32.234  -4.789  1.00 0.00 ? 316 MET A HB3  2  
ATOM   1214  H  HG2  . MET A 1 9  ? 1.717   31.787  -3.119  1.00 0.00 ? 316 MET A HG2  2  
ATOM   1215  H  HG3  . MET A 1 9  ? 2.738   30.549  -2.393  1.00 0.00 ? 316 MET A HG3  2  
ATOM   1216  H  HE1  . MET A 1 9  ? 5.019   31.060  -1.126  1.00 0.00 ? 316 MET A HE1  2  
ATOM   1217  H  HE2  . MET A 1 9  ? 5.728   32.670  -1.007  1.00 0.00 ? 316 MET A HE2  2  
ATOM   1218  H  HE3  . MET A 1 9  ? 5.625   31.865  -2.572  1.00 0.00 ? 316 MET A HE3  2  
ATOM   1219  N  N    . ASN A 1 10 ? 0.458   29.668  -5.103  1.00 0.00 ? 317 ASN A N    2  
ATOM   1220  C  CA   . ASN A 1 10 ? -0.977  29.863  -5.262  1.00 0.00 ? 317 ASN A CA   2  
ATOM   1221  C  C    . ASN A 1 10 ? -1.690  28.706  -4.592  1.00 0.00 ? 317 ASN A C    2  
ATOM   1222  O  O    . ASN A 1 10 ? -2.443  28.888  -3.635  1.00 0.00 ? 317 ASN A O    2  
ATOM   1223  C  CB   . ASN A 1 10 ? -1.363  29.939  -6.744  1.00 0.00 ? 317 ASN A CB   2  
ATOM   1224  C  CG   . ASN A 1 10 ? -2.857  30.105  -6.948  1.00 0.00 ? 317 ASN A CG   2  
ATOM   1225  O  OD1  . ASN A 1 10 ? -3.558  30.674  -6.111  1.00 0.00 ? 317 ASN A OD1  2  
ATOM   1226  N  ND2  . ASN A 1 10 ? -3.354  29.620  -8.073  1.00 0.00 ? 317 ASN A ND2  2  
ATOM   1227  H  H    . ASN A 1 10 ? 0.778   28.811  -4.740  1.00 0.00 ? 317 ASN A H    2  
ATOM   1228  H  HA   . ASN A 1 10 ? -1.251  30.784  -4.768  1.00 0.00 ? 317 ASN A HA   2  
ATOM   1229  H  HB2  . ASN A 1 10 ? -0.861  30.782  -7.197  1.00 0.00 ? 317 ASN A HB2  2  
ATOM   1230  H  HB3  . ASN A 1 10 ? -1.048  29.031  -7.236  1.00 0.00 ? 317 ASN A HB3  2  
ATOM   1231  H  HD21 . ASN A 1 10 ? -2.737  29.188  -8.704  1.00 0.00 ? 317 ASN A HD21 2  
ATOM   1232  H  HD22 . ASN A 1 10 ? -4.316  29.708  -8.232  1.00 0.00 ? 317 ASN A HD22 2  
ATOM   1233  N  N    . ILE A 1 11 ? -1.421  27.510  -5.089  1.00 0.00 ? 318 ILE A N    2  
ATOM   1234  C  CA   . ILE A 1 11 ? -1.892  26.292  -4.461  1.00 0.00 ? 318 ILE A CA   2  
ATOM   1235  C  C    . ILE A 1 11 ? -0.729  25.325  -4.306  1.00 0.00 ? 318 ILE A C    2  
ATOM   1236  O  O    . ILE A 1 11 ? 0.172   25.298  -5.146  1.00 0.00 ? 318 ILE A O    2  
ATOM   1237  C  CB   . ILE A 1 11 ? -3.031  25.613  -5.260  1.00 0.00 ? 318 ILE A CB   2  
ATOM   1238  C  CG1  . ILE A 1 11 ? -2.604  25.366  -6.711  1.00 0.00 ? 318 ILE A CG1  2  
ATOM   1239  C  CG2  . ILE A 1 11 ? -4.299  26.457  -5.206  1.00 0.00 ? 318 ILE A CG2  2  
ATOM   1240  C  CD1  . ILE A 1 11 ? -3.621  24.586  -7.515  1.00 0.00 ? 318 ILE A CD1  2  
ATOM   1241  H  H    . ILE A 1 11 ? -0.879  27.443  -5.905  1.00 0.00 ? 318 ILE A H    2  
ATOM   1242  H  HA   . ILE A 1 11 ? -2.262  26.549  -3.483  1.00 0.00 ? 318 ILE A HA   2  
ATOM   1243  H  HB   . ILE A 1 11 ? -3.247  24.663  -4.792  1.00 0.00 ? 318 ILE A HB   2  
ATOM   1244  H  HG12 . ILE A 1 11 ? -2.451  26.315  -7.202  1.00 0.00 ? 318 ILE A HG12 2  
ATOM   1245  H  HG13 . ILE A 1 11 ? -1.677  24.809  -6.715  1.00 0.00 ? 318 ILE A HG13 2  
ATOM   1246  H  HG21 . ILE A 1 11 ? -4.105  27.427  -5.640  1.00 0.00 ? 318 ILE A HG21 2  
ATOM   1247  H  HG22 . ILE A 1 11 ? -4.609  26.577  -4.179  1.00 0.00 ? 318 ILE A HG22 2  
ATOM   1248  H  HG23 . ILE A 1 11 ? -5.083  25.964  -5.763  1.00 0.00 ? 318 ILE A HG23 2  
ATOM   1249  H  HD11 . ILE A 1 11 ? -3.253  24.441  -8.521  1.00 0.00 ? 318 ILE A HD11 2  
ATOM   1250  H  HD12 . ILE A 1 11 ? -4.552  25.133  -7.547  1.00 0.00 ? 318 ILE A HD12 2  
ATOM   1251  H  HD13 . ILE A 1 11 ? -3.785  23.626  -7.050  1.00 0.00 ? 318 ILE A HD13 2  
ATOM   1252  N  N    . PRO A 1 12 ? -0.706  24.544  -3.218  1.00 0.00 ? 319 PRO A N    2  
ATOM   1253  C  CA   . PRO A 1 12 ? 0.377   23.603  -2.950  1.00 0.00 ? 319 PRO A CA   2  
ATOM   1254  C  C    . PRO A 1 12 ? 0.306   22.373  -3.849  1.00 0.00 ? 319 PRO A C    2  
ATOM   1255  O  O    . PRO A 1 12 ? -0.672  21.622  -3.810  1.00 0.00 ? 319 PRO A O    2  
ATOM   1256  C  CB   . PRO A 1 12 ? 0.165   23.203  -1.481  1.00 0.00 ? 319 PRO A CB   2  
ATOM   1257  C  CG   . PRO A 1 12 ? -0.906  24.110  -0.965  1.00 0.00 ? 319 PRO A CG   2  
ATOM   1258  C  CD   . PRO A 1 12 ? -1.717  24.513  -2.159  1.00 0.00 ? 319 PRO A CD   2  
ATOM   1259  H  HA   . PRO A 1 12 ? 1.341   24.074  -3.059  1.00 0.00 ? 319 PRO A HA   2  
ATOM   1260  H  HB2  . PRO A 1 12 ? -0.139  22.167  -1.430  1.00 0.00 ? 319 PRO A HB2  2  
ATOM   1261  H  HB3  . PRO A 1 12 ? 1.088   23.336  -0.935  1.00 0.00 ? 319 PRO A HB3  2  
ATOM   1262  H  HG2  . PRO A 1 12 ? -1.523  23.583  -0.255  1.00 0.00 ? 319 PRO A HG2  2  
ATOM   1263  H  HG3  . PRO A 1 12 ? -0.459  24.979  -0.506  1.00 0.00 ? 319 PRO A HG3  2  
ATOM   1264  H  HD2  . PRO A 1 12 ? -2.479  23.774  -2.370  1.00 0.00 ? 319 PRO A HD2  2  
ATOM   1265  H  HD3  . PRO A 1 12 ? -2.155  25.485  -2.011  1.00 0.00 ? 319 PRO A HD3  2  
ATOM   1266  N  N    . PRO A 1 13 ? 1.325   22.170  -4.698  1.00 0.00 ? 320 PRO A N    2  
ATOM   1267  C  CA   . PRO A 1 13 ? 1.416   20.984  -5.549  1.00 0.00 ? 320 PRO A CA   2  
ATOM   1268  C  C    . PRO A 1 13 ? 1.570   19.703  -4.730  1.00 0.00 ? 320 PRO A C    2  
ATOM   1269  O  O    . PRO A 1 13 ? 2.683   19.274  -4.420  1.00 0.00 ? 320 PRO A O    2  
ATOM   1270  C  CB   . PRO A 1 13 ? 2.663   21.234  -6.402  1.00 0.00 ? 320 PRO A CB   2  
ATOM   1271  C  CG   . PRO A 1 13 ? 3.455   22.240  -5.638  1.00 0.00 ? 320 PRO A CG   2  
ATOM   1272  C  CD   . PRO A 1 13 ? 2.452   23.092  -4.915  1.00 0.00 ? 320 PRO A CD   2  
ATOM   1273  H  HA   . PRO A 1 13 ? 0.550   20.894  -6.188  1.00 0.00 ? 320 PRO A HA   2  
ATOM   1274  H  HB2  . PRO A 1 13 ? 3.211   20.309  -6.523  1.00 0.00 ? 320 PRO A HB2  2  
ATOM   1275  H  HB3  . PRO A 1 13 ? 2.371   21.616  -7.369  1.00 0.00 ? 320 PRO A HB3  2  
ATOM   1276  H  HG2  . PRO A 1 13 ? 4.101   21.739  -4.932  1.00 0.00 ? 320 PRO A HG2  2  
ATOM   1277  H  HG3  . PRO A 1 13 ? 4.039   22.842  -6.319  1.00 0.00 ? 320 PRO A HG3  2  
ATOM   1278  H  HD2  . PRO A 1 13 ? 2.855   23.439  -3.971  1.00 0.00 ? 320 PRO A HD2  2  
ATOM   1279  H  HD3  . PRO A 1 13 ? 2.149   23.928  -5.537  1.00 0.00 ? 320 PRO A HD3  2  
ATOM   1280  N  N    . ALA A 1 14 ? 0.441   19.117  -4.361  1.00 0.00 ? 321 ALA A N    2  
ATOM   1281  C  CA   . ALA A 1 14 ? 0.418   17.886  -3.600  1.00 0.00 ? 321 ALA A CA   2  
ATOM   1282  C  C    . ALA A 1 14 ? -0.723  17.043  -4.115  1.00 0.00 ? 321 ALA A C    2  
ATOM   1283  O  O    . ALA A 1 14 ? -1.182  16.100  -3.467  1.00 0.00 ? 321 ALA A O    2  
ATOM   1284  C  CB   . ALA A 1 14 ? 0.256   18.176  -2.113  1.00 0.00 ? 321 ALA A CB   2  
ATOM   1285  H  H    . ALA A 1 14 ? -0.418  19.524  -4.613  1.00 0.00 ? 321 ALA A H    2  
ATOM   1286  H  HA   . ALA A 1 14 ? 1.353   17.366  -3.757  1.00 0.00 ? 321 ALA A HA   2  
ATOM   1287  H  HB1  . ALA A 1 14 ? -0.667  18.711  -1.948  1.00 0.00 ? 321 ALA A HB1  2  
ATOM   1288  H  HB2  . ALA A 1 14 ? 1.085   18.779  -1.772  1.00 0.00 ? 321 ALA A HB2  2  
ATOM   1289  H  HB3  . ALA A 1 14 ? 0.236   17.247  -1.563  1.00 0.00 ? 321 ALA A HB3  2  
ATOM   1290  N  N    . ARG A 1 15 ? -1.172  17.399  -5.309  1.00 0.00 ? 322 ARG A N    2  
ATOM   1291  C  CA   . ARG A 1 15 ? -2.292  16.733  -5.927  1.00 0.00 ? 322 ARG A CA   2  
ATOM   1292  C  C    . ARG A 1 15 ? -1.802  15.482  -6.637  1.00 0.00 ? 322 ARG A C    2  
ATOM   1293  O  O    . ARG A 1 15 ? -1.845  15.385  -7.863  1.00 0.00 ? 322 ARG A O    2  
ATOM   1294  C  CB   . ARG A 1 15 ? -3.005  17.679  -6.902  1.00 0.00 ? 322 ARG A CB   2  
ATOM   1295  C  CG   . ARG A 1 15 ? -4.490  17.390  -7.072  1.00 0.00 ? 322 ARG A CG   2  
ATOM   1296  C  CD   . ARG A 1 15 ? -5.203  17.401  -5.730  1.00 0.00 ? 322 ARG A CD   2  
ATOM   1297  N  NE   . ARG A 1 15 ? -6.649  17.579  -5.854  1.00 0.00 ? 322 ARG A NE   2  
ATOM   1298  C  CZ   . ARG A 1 15 ? -7.519  17.235  -4.904  1.00 0.00 ? 322 ARG A CZ   2  
ATOM   1299  N  NH1  . ARG A 1 15 ? -7.111  16.560  -3.836  1.00 0.00 ? 322 ARG A NH1  2  
ATOM   1300  N  NH2  . ARG A 1 15 ? -8.803  17.540  -5.039  1.00 0.00 ? 322 ARG A NH2  2  
ATOM   1301  H  H    . ARG A 1 15 ? -0.720  18.119  -5.792  1.00 0.00 ? 322 ARG A H    2  
ATOM   1302  H  HA   . ARG A 1 15 ? -2.966  16.453  -5.146  1.00 0.00 ? 322 ARG A HA   2  
ATOM   1303  H  HB2  . ARG A 1 15 ? -2.897  18.691  -6.541  1.00 0.00 ? 322 ARG A HB2  2  
ATOM   1304  H  HB3  . ARG A 1 15 ? -2.530  17.601  -7.869  1.00 0.00 ? 322 ARG A HB3  2  
ATOM   1305  H  HG2  . ARG A 1 15 ? -4.926  18.146  -7.710  1.00 0.00 ? 322 ARG A HG2  2  
ATOM   1306  H  HG3  . ARG A 1 15 ? -4.609  16.418  -7.526  1.00 0.00 ? 322 ARG A HG3  2  
ATOM   1307  H  HD2  . ARG A 1 15 ? -5.016  16.462  -5.234  1.00 0.00 ? 322 ARG A HD2  2  
ATOM   1308  H  HD3  . ARG A 1 15 ? -4.803  18.205  -5.132  1.00 0.00 ? 322 ARG A HD3  2  
ATOM   1309  H  HE   . ARG A 1 15 ? -6.984  18.023  -6.668  1.00 0.00 ? 322 ARG A HE   2  
ATOM   1310  H  HH11 . ARG A 1 15 ? -6.146  16.297  -3.740  1.00 0.00 ? 322 ARG A HH11 2  
ATOM   1311  H  HH12 . ARG A 1 15 ? -7.762  16.317  -3.112  1.00 0.00 ? 322 ARG A HH12 2  
ATOM   1312  H  HH21 . ARG A 1 15 ? -9.122  18.030  -5.857  1.00 0.00 ? 322 ARG A HH21 2  
ATOM   1313  H  HH22 . ARG A 1 15 ? -9.460  17.287  -4.326  1.00 0.00 ? 322 ARG A HH22 2  
ATOM   1314  N  N    . TRP A 1 16 ? -1.300  14.542  -5.851  1.00 0.00 ? 323 TRP A N    2  
ATOM   1315  C  CA   . TRP A 1 16 ? -0.708  13.335  -6.387  1.00 0.00 ? 323 TRP A CA   2  
ATOM   1316  C  C    . TRP A 1 16 ? -1.774  12.369  -6.858  1.00 0.00 ? 323 TRP A C    2  
ATOM   1317  O  O    . TRP A 1 16 ? -2.155  11.437  -6.152  1.00 0.00 ? 323 TRP A O    2  
ATOM   1318  C  CB   . TRP A 1 16 ? 0.204   12.684  -5.354  1.00 0.00 ? 323 TRP A CB   2  
ATOM   1319  C  CG   . TRP A 1 16 ? 1.359   13.560  -4.994  1.00 0.00 ? 323 TRP A CG   2  
ATOM   1320  C  CD1  . TRP A 1 16 ? 2.275   14.085  -5.857  1.00 0.00 ? 323 TRP A CD1  2  
ATOM   1321  C  CD2  . TRP A 1 16 ? 1.722   14.022  -3.688  1.00 0.00 ? 323 TRP A CD2  2  
ATOM   1322  N  NE1  . TRP A 1 16 ? 3.189   14.844  -5.167  1.00 0.00 ? 323 TRP A NE1  2  
ATOM   1323  C  CE2  . TRP A 1 16 ? 2.871   14.821  -3.834  1.00 0.00 ? 323 TRP A CE2  2  
ATOM   1324  C  CE3  . TRP A 1 16 ? 1.187   13.840  -2.411  1.00 0.00 ? 323 TRP A CE3  2  
ATOM   1325  C  CZ2  . TRP A 1 16 ? 3.496   15.433  -2.752  1.00 0.00 ? 323 TRP A CZ2  2  
ATOM   1326  C  CZ3  . TRP A 1 16 ? 1.808   14.448  -1.336  1.00 0.00 ? 323 TRP A CZ3  2  
ATOM   1327  C  CH2  . TRP A 1 16 ? 2.951   15.238  -1.513  1.00 0.00 ? 323 TRP A CH2  2  
ATOM   1328  H  H    . TRP A 1 16 ? -1.326  14.672  -4.878  1.00 0.00 ? 323 TRP A H    2  
ATOM   1329  H  HA   . TRP A 1 16 ? -0.109  13.620  -7.241  1.00 0.00 ? 323 TRP A HA   2  
ATOM   1330  H  HB2  . TRP A 1 16 ? -0.359  12.482  -4.455  1.00 0.00 ? 323 TRP A HB2  2  
ATOM   1331  H  HB3  . TRP A 1 16 ? 0.593   11.758  -5.749  1.00 0.00 ? 323 TRP A HB3  2  
ATOM   1332  H  HD1  . TRP A 1 16 ? 2.264   13.918  -6.927  1.00 0.00 ? 323 TRP A HD1  2  
ATOM   1333  H  HE1  . TRP A 1 16 ? 3.947   15.326  -5.565  1.00 0.00 ? 323 TRP A HE1  2  
ATOM   1334  H  HE3  . TRP A 1 16 ? 0.305   13.236  -2.255  1.00 0.00 ? 323 TRP A HE3  2  
ATOM   1335  H  HZ2  . TRP A 1 16 ? 4.377   16.046  -2.873  1.00 0.00 ? 323 TRP A HZ2  2  
ATOM   1336  H  HZ3  . TRP A 1 16 ? 1.409   14.318  -0.342  1.00 0.00 ? 323 TRP A HZ3  2  
ATOM   1337  H  HH2  . TRP A 1 16 ? 3.403   15.695  -0.646  1.00 0.00 ? 323 TRP A HH2  2  
ATOM   1338  N  N    . LYS A 1 17 ? -2.295  12.660  -8.033  1.00 0.00 ? 324 LYS A N    2  
ATOM   1339  C  CA   . LYS A 1 17 ? -3.234  11.788  -8.705  1.00 0.00 ? 324 LYS A CA   2  
ATOM   1340  C  C    . LYS A 1 17 ? -2.561  10.478  -9.105  1.00 0.00 ? 324 LYS A C    2  
ATOM   1341  O  O    . LYS A 1 17 ? -2.054  10.333  -10.218 1.00 0.00 ? 324 LYS A O    2  
ATOM   1342  C  CB   . LYS A 1 17 ? -3.801  12.501  -9.930  1.00 0.00 ? 324 LYS A CB   2  
ATOM   1343  C  CG   . LYS A 1 17 ? -4.832  11.689  -10.696 1.00 0.00 ? 324 LYS A CG   2  
ATOM   1344  C  CD   . LYS A 1 17 ? -5.457  12.505  -11.814 1.00 0.00 ? 324 LYS A CD   2  
ATOM   1345  C  CE   . LYS A 1 17 ? -6.437  11.682  -12.631 1.00 0.00 ? 324 LYS A CE   2  
ATOM   1346  N  NZ   . LYS A 1 17 ? -5.760  10.612  -13.412 1.00 0.00 ? 324 LYS A NZ   2  
ATOM   1347  H  H    . LYS A 1 17 ? -2.057  13.520  -8.451  1.00 0.00 ? 324 LYS A H    2  
ATOM   1348  H  HA   . LYS A 1 17 ? -4.039  11.572  -8.018  1.00 0.00 ? 324 LYS A HA   2  
ATOM   1349  H  HB2  . LYS A 1 17 ? -4.270  13.426  -9.604  1.00 0.00 ? 324 LYS A HB2  2  
ATOM   1350  H  HB3  . LYS A 1 17 ? -2.975  12.730  -10.604 1.00 0.00 ? 324 LYS A HB3  2  
ATOM   1351  H  HG2  . LYS A 1 17 ? -4.351  10.821  -11.122 1.00 0.00 ? 324 LYS A HG2  2  
ATOM   1352  H  HG3  . LYS A 1 17 ? -5.609  11.375  -10.014 1.00 0.00 ? 324 LYS A HG3  2  
ATOM   1353  H  HD2  . LYS A 1 17 ? -5.981  13.344  -11.382 1.00 0.00 ? 324 LYS A HD2  2  
ATOM   1354  H  HD3  . LYS A 1 17 ? -4.674  12.865  -12.463 1.00 0.00 ? 324 LYS A HD3  2  
ATOM   1355  H  HE2  . LYS A 1 17 ? -7.151  11.226  -11.962 1.00 0.00 ? 324 LYS A HE2  2  
ATOM   1356  H  HE3  . LYS A 1 17 ? -6.955  12.339  -13.313 1.00 0.00 ? 324 LYS A HE3  2  
ATOM   1357  H  HZ1  . LYS A 1 17 ? -5.064  11.028  -14.065 1.00 0.00 ? 324 LYS A HZ1  2  
ATOM   1358  H  HZ2  . LYS A 1 17 ? -6.459  10.080  -13.968 1.00 0.00 ? 324 LYS A HZ2  2  
ATOM   1359  H  HZ3  . LYS A 1 17 ? -5.270  9.955   -12.775 1.00 0.00 ? 324 LYS A HZ3  2  
ATOM   1360  N  N    . LEU A 1 18 ? -2.523  9.543   -8.172  1.00 0.00 ? 325 LEU A N    2  
ATOM   1361  C  CA   . LEU A 1 18 ? -1.967  8.227   -8.427  1.00 0.00 ? 325 LEU A CA   2  
ATOM   1362  C  C    . LEU A 1 18 ? -3.087  7.197   -8.506  1.00 0.00 ? 325 LEU A C    2  
ATOM   1363  O  O    . LEU A 1 18 ? -3.805  6.963   -7.538  1.00 0.00 ? 325 LEU A O    2  
ATOM   1364  C  CB   . LEU A 1 18 ? -0.928  7.866   -7.353  1.00 0.00 ? 325 LEU A CB   2  
ATOM   1365  C  CG   . LEU A 1 18 ? -1.350  8.098   -5.895  1.00 0.00 ? 325 LEU A CG   2  
ATOM   1366  C  CD1  . LEU A 1 18 ? -1.866  6.816   -5.262  1.00 0.00 ? 325 LEU A CD1  2  
ATOM   1367  C  CD2  . LEU A 1 18 ? -0.186  8.652   -5.093  1.00 0.00 ? 325 LEU A CD2  2  
ATOM   1368  H  H    . LEU A 1 18 ? -2.871  9.749   -7.279  1.00 0.00 ? 325 LEU A H    2  
ATOM   1369  H  HA   . LEU A 1 18 ? -1.474  8.268   -9.386  1.00 0.00 ? 325 LEU A HA   2  
ATOM   1370  H  HB2  . LEU A 1 18 ? -0.685  6.811   -7.466  1.00 0.00 ? 325 LEU A HB2  2  
ATOM   1371  H  HB3  . LEU A 1 18 ? -0.031  8.458   -7.541  1.00 0.00 ? 325 LEU A HB3  2  
ATOM   1372  H  HG   . LEU A 1 18 ? -2.148  8.825   -5.871  1.00 0.00 ? 325 LEU A HG   2  
ATOM   1373  H  HD11 . LEU A 1 18 ? -2.702  6.441   -5.836  1.00 0.00 ? 325 LEU A HD11 2  
ATOM   1374  H  HD12 . LEU A 1 18 ? -2.185  7.017   -4.250  1.00 0.00 ? 325 LEU A HD12 2  
ATOM   1375  H  HD13 . LEU A 1 18 ? -1.078  6.078   -5.249  1.00 0.00 ? 325 LEU A HD13 2  
ATOM   1376  H  HD21 . LEU A 1 18 ? 0.134   9.589   -5.522  1.00 0.00 ? 325 LEU A HD21 2  
ATOM   1377  H  HD22 . LEU A 1 18 ? 0.632   7.947   -5.115  1.00 0.00 ? 325 LEU A HD22 2  
ATOM   1378  H  HD23 . LEU A 1 18 ? -0.496  8.811   -4.071  1.00 0.00 ? 325 LEU A HD23 2  
ATOM   1379  N  N    . THR A 1 19 ? -3.261  6.614   -9.675  1.00 0.00 ? 326 THR A N    2  
ATOM   1380  C  CA   . THR A 1 19 ? -4.348  5.677   -9.890  1.00 0.00 ? 326 THR A CA   2  
ATOM   1381  C  C    . THR A 1 19 ? -3.891  4.244   -9.657  1.00 0.00 ? 326 THR A C    2  
ATOM   1382  O  O    . THR A 1 19 ? -2.849  3.822   -10.155 1.00 0.00 ? 326 THR A O    2  
ATOM   1383  C  CB   . THR A 1 19 ? -4.915  5.804   -11.314 1.00 0.00 ? 326 THR A CB   2  
ATOM   1384  O  OG1  . THR A 1 19 ? -5.155  7.183   -11.615 1.00 0.00 ? 326 THR A OG1  2  
ATOM   1385  C  CG2  . THR A 1 19 ? -6.213  5.020   -11.463 1.00 0.00 ? 326 THR A CG2  2  
ATOM   1386  H  H    . THR A 1 19 ? -2.645  6.814   -10.411 1.00 0.00 ? 326 THR A H    2  
ATOM   1387  H  HA   . THR A 1 19 ? -5.135  5.913   -9.189  1.00 0.00 ? 326 THR A HA   2  
ATOM   1388  H  HB   . THR A 1 19 ? -4.191  5.407   -12.007 1.00 0.00 ? 326 THR A HB   2  
ATOM   1389  H  HG1  . THR A 1 19 ? -4.617  7.443   -12.374 1.00 0.00 ? 326 THR A HG1  2  
ATOM   1390  H  HG21 . THR A 1 19 ? -6.583  5.127   -12.473 1.00 0.00 ? 326 THR A HG21 2  
ATOM   1391  H  HG22 . THR A 1 19 ? -6.947  5.401   -10.769 1.00 0.00 ? 326 THR A HG22 2  
ATOM   1392  H  HG23 . THR A 1 19 ? -6.029  3.976   -11.256 1.00 0.00 ? 326 THR A HG23 2  
ATOM   1393  N  N    . CYS A 1 20 ? -4.687  3.507   -8.901  1.00 0.00 ? 327 CYS A N    2  
ATOM   1394  C  CA   . CYS A 1 20 ? -4.419  2.105   -8.642  1.00 0.00 ? 327 CYS A CA   2  
ATOM   1395  C  C    . CYS A 1 20 ? -4.875  1.276   -9.833  1.00 0.00 ? 327 CYS A C    2  
ATOM   1396  O  O    . CYS A 1 20 ? -6.075  1.093   -10.049 1.00 0.00 ? 327 CYS A O    2  
ATOM   1397  C  CB   . CYS A 1 20 ? -5.142  1.668   -7.366  1.00 0.00 ? 327 CYS A CB   2  
ATOM   1398  S  SG   . CYS A 1 20 ? -5.059  -0.102  -6.987  1.00 0.00 ? 327 CYS A SG   2  
ATOM   1399  H  H    . CYS A 1 20 ? -5.482  3.924   -8.513  1.00 0.00 ? 327 CYS A H    2  
ATOM   1400  H  HA   . CYS A 1 20 ? -3.354  1.985   -8.511  1.00 0.00 ? 327 CYS A HA   2  
ATOM   1401  H  HB2  . CYS A 1 20 ? -4.715  2.194   -6.526  1.00 0.00 ? 327 CYS A HB2  2  
ATOM   1402  H  HB3  . CYS A 1 20 ? -6.186  1.936   -7.450  1.00 0.00 ? 327 CYS A HB3  2  
ATOM   1403  N  N    . TYR A 1 21 ? -3.910  0.763   -10.588 1.00 0.00 ? 328 TYR A N    2  
ATOM   1404  C  CA   . TYR A 1 21 ? -4.187  0.109   -11.871 1.00 0.00 ? 328 TYR A CA   2  
ATOM   1405  C  C    . TYR A 1 21 ? -4.877  -1.244  -11.693 1.00 0.00 ? 328 TYR A C    2  
ATOM   1406  O  O    . TYR A 1 21 ? -5.136  -1.948  -12.666 1.00 0.00 ? 328 TYR A O    2  
ATOM   1407  C  CB   . TYR A 1 21 ? -2.891  -0.058  -12.680 1.00 0.00 ? 328 TYR A CB   2  
ATOM   1408  C  CG   . TYR A 1 21 ? -1.880  -1.016  -12.073 1.00 0.00 ? 328 TYR A CG   2  
ATOM   1409  C  CD1  . TYR A 1 21 ? -1.053  -0.623  -11.028 1.00 0.00 ? 328 TYR A CD1  2  
ATOM   1410  C  CD2  . TYR A 1 21 ? -1.748  -2.315  -12.557 1.00 0.00 ? 328 TYR A CD2  2  
ATOM   1411  C  CE1  . TYR A 1 21 ? -0.126  -1.493  -10.483 1.00 0.00 ? 328 TYR A CE1  2  
ATOM   1412  C  CE2  . TYR A 1 21 ? -0.823  -3.191  -12.015 1.00 0.00 ? 328 TYR A CE2  2  
ATOM   1413  C  CZ   . TYR A 1 21 ? -0.016  -2.776  -10.978 1.00 0.00 ? 328 TYR A CZ   2  
ATOM   1414  O  OH   . TYR A 1 21 ? 0.912   -3.646  -10.440 1.00 0.00 ? 328 TYR A OH   2  
ATOM   1415  H  H    . TYR A 1 21 ? -2.979  0.832   -10.279 1.00 0.00 ? 328 TYR A H    2  
ATOM   1416  H  HA   . TYR A 1 21 ? -4.853  0.757   -12.423 1.00 0.00 ? 328 TYR A HA   2  
ATOM   1417  H  HB2  . TYR A 1 21 ? -3.139  -0.423  -13.665 1.00 0.00 ? 328 TYR A HB2  2  
ATOM   1418  H  HB3  . TYR A 1 21 ? -2.415  0.909   -12.776 1.00 0.00 ? 328 TYR A HB3  2  
ATOM   1419  H  HD1  . TYR A 1 21 ? -1.140  0.383   -10.639 1.00 0.00 ? 328 TYR A HD1  2  
ATOM   1420  H  HD2  . TYR A 1 21 ? -2.379  -2.638  -13.372 1.00 0.00 ? 328 TYR A HD2  2  
ATOM   1421  H  HE1  . TYR A 1 21 ? 0.507   -1.167  -9.668  1.00 0.00 ? 328 TYR A HE1  2  
ATOM   1422  H  HE2  . TYR A 1 21 ? -0.740  -4.194  -12.403 1.00 0.00 ? 328 TYR A HE2  2  
ATOM   1423  H  HH   . TYR A 1 21 ? 0.821   -3.660  -9.481  1.00 0.00 ? 328 TYR A HH   2  
ATOM   1424  N  N    . LEU A 1 22 ? -5.182  -1.597  -10.456 1.00 0.00 ? 329 LEU A N    2  
ATOM   1425  C  CA   . LEU A 1 22 ? -5.854  -2.854  -10.175 1.00 0.00 ? 329 LEU A CA   2  
ATOM   1426  C  C    . LEU A 1 22 ? -7.367  -2.659  -10.076 1.00 0.00 ? 329 LEU A C    2  
ATOM   1427  O  O    . LEU A 1 22 ? -8.120  -3.629  -10.091 1.00 0.00 ? 329 LEU A O    2  
ATOM   1428  C  CB   . LEU A 1 22 ? -5.319  -3.460  -8.873  1.00 0.00 ? 329 LEU A CB   2  
ATOM   1429  C  CG   . LEU A 1 22 ? -4.646  -4.833  -9.007  1.00 0.00 ? 329 LEU A CG   2  
ATOM   1430  C  CD1  . LEU A 1 22 ? -5.626  -5.871  -9.536  1.00 0.00 ? 329 LEU A CD1  2  
ATOM   1431  C  CD2  . LEU A 1 22 ? -3.421  -4.747  -9.904  1.00 0.00 ? 329 LEU A CD2  2  
ATOM   1432  H  H    . LEU A 1 22 ? -4.945  -1.000  -9.719  1.00 0.00 ? 329 LEU A H    2  
ATOM   1433  H  HA   . LEU A 1 22 ? -5.643  -3.530  -10.990 1.00 0.00 ? 329 LEU A HA   2  
ATOM   1434  H  HB2  . LEU A 1 22 ? -4.602  -2.773  -8.450  1.00 0.00 ? 329 LEU A HB2  2  
ATOM   1435  H  HB3  . LEU A 1 22 ? -6.146  -3.557  -8.184  1.00 0.00 ? 329 LEU A HB3  2  
ATOM   1436  H  HG   . LEU A 1 22 ? -4.319  -5.159  -8.029  1.00 0.00 ? 329 LEU A HG   2  
ATOM   1437  H  HD11 . LEU A 1 22 ? -6.454  -5.968  -8.849  1.00 0.00 ? 329 LEU A HD11 2  
ATOM   1438  H  HD12 . LEU A 1 22 ? -5.126  -6.823  -9.632  1.00 0.00 ? 329 LEU A HD12 2  
ATOM   1439  H  HD13 . LEU A 1 22 ? -5.994  -5.560  -10.502 1.00 0.00 ? 329 LEU A HD13 2  
ATOM   1440  H  HD21 . LEU A 1 22 ? -2.711  -4.055  -9.478  1.00 0.00 ? 329 LEU A HD21 2  
ATOM   1441  H  HD22 . LEU A 1 22 ? -3.715  -4.401  -10.884 1.00 0.00 ? 329 LEU A HD22 2  
ATOM   1442  H  HD23 . LEU A 1 22 ? -2.967  -5.724  -9.988  1.00 0.00 ? 329 LEU A HD23 2  
ATOM   1443  N  N    . CYS A 1 23 ? -7.814  -1.406  -9.967  1.00 0.00 ? 330 CYS A N    2  
ATOM   1444  C  CA   . CYS A 1 23 ? -9.248  -1.141  -9.793  1.00 0.00 ? 330 CYS A CA   2  
ATOM   1445  C  C    . CYS A 1 23 ? -9.707  0.225   -10.319 1.00 0.00 ? 330 CYS A C    2  
ATOM   1446  O  O    . CYS A 1 23 ? -10.899 0.526   -10.248 1.00 0.00 ? 330 CYS A O    2  
ATOM   1447  C  CB   . CYS A 1 23 ? -9.615  -1.263  -8.317  1.00 0.00 ? 330 CYS A CB   2  
ATOM   1448  S  SG   . CYS A 1 23 ? -8.612  -0.229  -7.220  1.00 0.00 ? 330 CYS A SG   2  
ATOM   1449  H  H    . CYS A 1 23 ? -7.180  -0.665  -10.001 1.00 0.00 ? 330 CYS A H    2  
ATOM   1450  H  HA   . CYS A 1 23 ? -9.780  -1.906  -10.335 1.00 0.00 ? 330 CYS A HA   2  
ATOM   1451  H  HB2  . CYS A 1 23 ? -10.647 -0.974  -8.186  1.00 0.00 ? 330 CYS A HB2  2  
ATOM   1452  H  HB3  . CYS A 1 23 ? -9.491  -2.290  -8.007  1.00 0.00 ? 330 CYS A HB3  2  
ATOM   1453  N  N    . LYS A 1 24 ? -8.777  1.061   -10.802 1.00 0.00 ? 331 LYS A N    2  
ATOM   1454  C  CA   . LYS A 1 24 ? -9.118  2.357   -11.389 1.00 0.00 ? 331 LYS A CA   2  
ATOM   1455  C  C    . LYS A 1 24 ? -9.541  3.316   -10.293 1.00 0.00 ? 331 LYS A C    2  
ATOM   1456  O  O    . LYS A 1 24 ? -10.301 4.254   -10.523 1.00 0.00 ? 331 LYS A O    2  
ATOM   1457  C  CB   . LYS A 1 24 ? -10.236 2.227   -12.437 1.00 0.00 ? 331 LYS A CB   2  
ATOM   1458  C  CG   . LYS A 1 24 ? -9.904  1.302   -13.597 1.00 0.00 ? 331 LYS A CG   2  
ATOM   1459  C  CD   . LYS A 1 24 ? -8.768  1.846   -14.446 1.00 0.00 ? 331 LYS A CD   2  
ATOM   1460  C  CE   . LYS A 1 24 ? -8.525  0.972   -15.665 1.00 0.00 ? 331 LYS A CE   2  
ATOM   1461  N  NZ   . LYS A 1 24 ? -7.471  1.529   -16.551 1.00 0.00 ? 331 LYS A NZ   2  
ATOM   1462  H  H    . LYS A 1 24 ? -7.842  0.830   -10.723 1.00 0.00 ? 331 LYS A H    2  
ATOM   1463  H  HA   . LYS A 1 24 ? -8.230  2.746   -11.867 1.00 0.00 ? 331 LYS A HA   2  
ATOM   1464  H  HB2  . LYS A 1 24 ? -11.123 1.852   -11.951 1.00 0.00 ? 331 LYS A HB2  2  
ATOM   1465  H  HB3  . LYS A 1 24 ? -10.446 3.208   -12.837 1.00 0.00 ? 331 LYS A HB3  2  
ATOM   1466  H  HG2  . LYS A 1 24 ? -9.614  0.339   -13.204 1.00 0.00 ? 331 LYS A HG2  2  
ATOM   1467  H  HG3  . LYS A 1 24 ? -10.782 1.190   -14.215 1.00 0.00 ? 331 LYS A HG3  2  
ATOM   1468  H  HD2  . LYS A 1 24 ? -9.020  2.842   -14.773 1.00 0.00 ? 331 LYS A HD2  2  
ATOM   1469  H  HD3  . LYS A 1 24 ? -7.868  1.876   -13.851 1.00 0.00 ? 331 LYS A HD3  2  
ATOM   1470  H  HE2  . LYS A 1 24 ? -8.222  -0.010  -15.335 1.00 0.00 ? 331 LYS A HE2  2  
ATOM   1471  H  HE3  . LYS A 1 24 ? -9.447  0.892   -16.223 1.00 0.00 ? 331 LYS A HE3  2  
ATOM   1472  H  HZ1  . LYS A 1 24 ? -7.759  2.461   -16.908 1.00 0.00 ? 331 LYS A HZ1  2  
ATOM   1473  H  HZ2  . LYS A 1 24 ? -7.312  0.894   -17.359 1.00 0.00 ? 331 LYS A HZ2  2  
ATOM   1474  H  HZ3  . LYS A 1 24 ? -6.579  1.632   -16.028 1.00 0.00 ? 331 LYS A HZ3  2  
ATOM   1475  N  N    . GLN A 1 25 ? -9.019  3.085   -9.097  1.00 0.00 ? 332 GLN A N    2  
ATOM   1476  C  CA   . GLN A 1 25 ? -9.398  3.862   -7.946  1.00 0.00 ? 332 GLN A CA   2  
ATOM   1477  C  C    . GLN A 1 25 ? -8.163  4.333   -7.197  1.00 0.00 ? 332 GLN A C    2  
ATOM   1478  O  O    . GLN A 1 25 ? -7.405  3.525   -6.662  1.00 0.00 ? 332 GLN A O    2  
ATOM   1479  C  CB   . GLN A 1 25 ? -10.316 3.058   -7.021  1.00 0.00 ? 332 GLN A CB   2  
ATOM   1480  C  CG   . GLN A 1 25 ? -11.611 2.627   -7.689  1.00 0.00 ? 332 GLN A CG   2  
ATOM   1481  C  CD   . GLN A 1 25 ? -12.539 1.860   -6.767  1.00 0.00 ? 332 GLN A CD   2  
ATOM   1482  O  OE1  . GLN A 1 25 ? -13.761 1.912   -6.919  1.00 0.00 ? 332 GLN A OE1  2  
ATOM   1483  N  NE2  . GLN A 1 25 ? -11.974 1.141   -5.813  1.00 0.00 ? 332 GLN A NE2  2  
ATOM   1484  H  H    . GLN A 1 25 ? -8.345  2.395   -8.997  1.00 0.00 ? 332 GLN A H    2  
ATOM   1485  H  HA   . GLN A 1 25 ? -9.930  4.716   -8.312  1.00 0.00 ? 332 GLN A HA   2  
ATOM   1486  H  HB2  . GLN A 1 25 ? -9.791  2.173   -6.692  1.00 0.00 ? 332 GLN A HB2  2  
ATOM   1487  H  HB3  . GLN A 1 25 ? -10.562 3.662   -6.161  1.00 0.00 ? 332 GLN A HB3  2  
ATOM   1488  H  HG2  . GLN A 1 25 ? -12.129 3.507   -8.038  1.00 0.00 ? 332 GLN A HG2  2  
ATOM   1489  H  HG3  . GLN A 1 25 ? -11.370 1.998   -8.535  1.00 0.00 ? 332 GLN A HG3  2  
ATOM   1490  H  HE21 . GLN A 1 25 ? -11.001 1.140   -5.749  1.00 0.00 ? 332 GLN A HE21 2  
ATOM   1491  H  HE22 . GLN A 1 25 ? -12.560 0.638   -5.206  1.00 0.00 ? 332 GLN A HE22 2  
ATOM   1492  N  N    . LYS A 1 26 ? -7.969  5.638   -7.206  1.00 0.00 ? 333 LYS A N    2  
ATOM   1493  C  CA   . LYS A 1 26 ? -6.834  6.292   -6.549  1.00 0.00 ? 333 LYS A CA   2  
ATOM   1494  C  C    . LYS A 1 26 ? -6.725  5.926   -5.064  1.00 0.00 ? 333 LYS A C    2  
ATOM   1495  O  O    . LYS A 1 26 ? -5.870  5.128   -4.670  1.00 0.00 ? 333 LYS A O    2  
ATOM   1496  C  CB   . LYS A 1 26 ? -6.962  7.816   -6.706  1.00 0.00 ? 333 LYS A CB   2  
ATOM   1497  C  CG   . LYS A 1 26 ? -5.917  8.623   -5.943  1.00 0.00 ? 333 LYS A CG   2  
ATOM   1498  C  CD   . LYS A 1 26 ? -6.121  10.118  -6.141  1.00 0.00 ? 333 LYS A CD   2  
ATOM   1499  C  CE   . LYS A 1 26 ? -5.147  10.940  -5.311  1.00 0.00 ? 333 LYS A CE   2  
ATOM   1500  N  NZ   . LYS A 1 26 ? -5.343  10.742  -3.850  1.00 0.00 ? 333 LYS A NZ   2  
ATOM   1501  H  H    . LYS A 1 26 ? -8.612  6.192   -7.696  1.00 0.00 ? 333 LYS A H    2  
ATOM   1502  H  HA   . LYS A 1 26 ? -5.935  5.968   -7.050  1.00 0.00 ? 333 LYS A HA   2  
ATOM   1503  H  HB2  . LYS A 1 26 ? -6.877  8.062   -7.754  1.00 0.00 ? 333 LYS A HB2  2  
ATOM   1504  H  HB3  . LYS A 1 26 ? -7.939  8.116   -6.357  1.00 0.00 ? 333 LYS A HB3  2  
ATOM   1505  H  HG2  . LYS A 1 26 ? -5.996  8.394   -4.890  1.00 0.00 ? 333 LYS A HG2  2  
ATOM   1506  H  HG3  . LYS A 1 26 ? -4.935  8.351   -6.301  1.00 0.00 ? 333 LYS A HG3  2  
ATOM   1507  H  HD2  . LYS A 1 26 ? -5.978  10.356  -7.184  1.00 0.00 ? 333 LYS A HD2  2  
ATOM   1508  H  HD3  . LYS A 1 26 ? -7.131  10.371  -5.850  1.00 0.00 ? 333 LYS A HD3  2  
ATOM   1509  H  HE2  . LYS A 1 26 ? -4.140  10.649  -5.571  1.00 0.00 ? 333 LYS A HE2  2  
ATOM   1510  H  HE3  . LYS A 1 26 ? -5.289  11.985  -5.546  1.00 0.00 ? 333 LYS A HE3  2  
ATOM   1511  H  HZ1  . LYS A 1 26 ? -4.723  11.383  -3.316  1.00 0.00 ? 333 LYS A HZ1  2  
ATOM   1512  H  HZ2  . LYS A 1 26 ? -5.116  9.762   -3.585  1.00 0.00 ? 333 LYS A HZ2  2  
ATOM   1513  H  HZ3  . LYS A 1 26 ? -6.330  10.938  -3.588  1.00 0.00 ? 333 LYS A HZ3  2  
ATOM   1514  N  N    . GLY A 1 27 ? -7.602  6.489   -4.246  1.00 0.00 ? 334 GLY A N    2  
ATOM   1515  C  CA   . GLY A 1 27 ? -7.461  6.345   -2.812  1.00 0.00 ? 334 GLY A CA   2  
ATOM   1516  C  C    . GLY A 1 27 ? -8.536  5.490   -2.183  1.00 0.00 ? 334 GLY A C    2  
ATOM   1517  O  O    . GLY A 1 27 ? -9.710  5.607   -2.521  1.00 0.00 ? 334 GLY A O    2  
ATOM   1518  H  H    . GLY A 1 27 ? -8.351  7.002   -4.614  1.00 0.00 ? 334 GLY A H    2  
ATOM   1519  H  HA2  . GLY A 1 27 ? -6.499  5.903   -2.600  1.00 0.00 ? 334 GLY A HA2  2  
ATOM   1520  H  HA3  . GLY A 1 27 ? -7.494  7.326   -2.363  1.00 0.00 ? 334 GLY A HA3  2  
ATOM   1521  N  N    . VAL A 1 28 ? -8.120  4.614   -1.278  1.00 0.00 ? 335 VAL A N    2  
ATOM   1522  C  CA   . VAL A 1 28 ? -9.055  3.800   -0.502  1.00 0.00 ? 335 VAL A CA   2  
ATOM   1523  C  C    . VAL A 1 28 ? -8.621  3.724   0.964   1.00 0.00 ? 335 VAL A C    2  
ATOM   1524  O  O    . VAL A 1 28 ? -9.461  3.637   1.858   1.00 0.00 ? 335 VAL A O    2  
ATOM   1525  C  CB   . VAL A 1 28 ? -9.202  2.360   -1.055  1.00 0.00 ? 335 VAL A CB   2  
ATOM   1526  C  CG1  . VAL A 1 28 ? -9.695  2.370   -2.494  1.00 0.00 ? 335 VAL A CG1  2  
ATOM   1527  C  CG2  . VAL A 1 28 ? -7.896  1.594   -0.934  1.00 0.00 ? 335 VAL A CG2  2  
ATOM   1528  H  H    . VAL A 1 28 ? -7.164  4.522   -1.121  1.00 0.00 ? 335 VAL A H    2  
ATOM   1529  H  HA   . VAL A 1 28 ? -10.023 4.279   -0.550  1.00 0.00 ? 335 VAL A HA   2  
ATOM   1530  H  HB   . VAL A 1 28 ? -9.944  1.849   -0.457  1.00 0.00 ? 335 VAL A HB   2  
ATOM   1531  H  HG11 . VAL A 1 28 ? -10.661 2.852   -2.542  1.00 0.00 ? 335 VAL A HG11 2  
ATOM   1532  H  HG12 . VAL A 1 28 ? -9.782  1.354   -2.853  1.00 0.00 ? 335 VAL A HG12 2  
ATOM   1533  H  HG13 . VAL A 1 28 ? -8.992  2.909   -3.112  1.00 0.00 ? 335 VAL A HG13 2  
ATOM   1534  H  HG21 . VAL A 1 28 ? -7.125  2.110   -1.488  1.00 0.00 ? 335 VAL A HG21 2  
ATOM   1535  H  HG22 . VAL A 1 28 ? -8.021  0.601   -1.333  1.00 0.00 ? 335 VAL A HG22 2  
ATOM   1536  H  HG23 . VAL A 1 28 ? -7.611  1.533   0.106   1.00 0.00 ? 335 VAL A HG23 2  
ATOM   1537  N  N    . GLY A 1 29 ? -7.308  3.757   1.203   1.00 0.00 ? 336 GLY A N    2  
ATOM   1538  C  CA   . GLY A 1 29 ? -6.794  3.670   2.554   1.00 0.00 ? 336 GLY A CA   2  
ATOM   1539  C  C    . GLY A 1 29 ? -5.287  3.476   2.588   1.00 0.00 ? 336 GLY A C    2  
ATOM   1540  O  O    . GLY A 1 29 ? -4.584  4.192   3.296   1.00 0.00 ? 336 GLY A O    2  
ATOM   1541  H  H    . GLY A 1 29 ? -6.685  3.843   0.463   1.00 0.00 ? 336 GLY A H    2  
ATOM   1542  H  HA2  . GLY A 1 29 ? -7.040  4.593   3.080   1.00 0.00 ? 336 GLY A HA2  2  
ATOM   1543  H  HA3  . GLY A 1 29 ? -7.267  2.822   3.054   1.00 0.00 ? 336 GLY A HA3  2  
ATOM   1544  N  N    . ALA A 1 30 ? -4.781  2.529   1.802   1.00 0.00 ? 337 ALA A N    2  
ATOM   1545  C  CA   . ALA A 1 30 ? -3.356  2.212   1.822   1.00 0.00 ? 337 ALA A CA   2  
ATOM   1546  C  C    . ALA A 1 30 ? -2.809  2.082   0.408   1.00 0.00 ? 337 ALA A C    2  
ATOM   1547  O  O    . ALA A 1 30 ? -3.323  1.299   -0.395  1.00 0.00 ? 337 ALA A O    2  
ATOM   1548  C  CB   . ALA A 1 30 ? -3.113  0.931   2.602   1.00 0.00 ? 337 ALA A CB   2  
ATOM   1549  H  H    . ALA A 1 30 ? -5.371  2.041   1.191   1.00 0.00 ? 337 ALA A H    2  
ATOM   1550  H  HA   . ALA A 1 30 ? -2.841  3.018   2.324   1.00 0.00 ? 337 ALA A HA   2  
ATOM   1551  H  HB1  . ALA A 1 30 ? -2.051  0.741   2.661   1.00 0.00 ? 337 ALA A HB1  2  
ATOM   1552  H  HB2  . ALA A 1 30 ? -3.599  0.109   2.099   1.00 0.00 ? 337 ALA A HB2  2  
ATOM   1553  H  HB3  . ALA A 1 30 ? -3.516  1.034   3.598   1.00 0.00 ? 337 ALA A HB3  2  
ATOM   1554  N  N    . SER A 1 31 ? -1.770  2.847   0.111   1.00 0.00 ? 338 SER A N    2  
ATOM   1555  C  CA   . SER A 1 31 ? -1.176  2.863   -1.215  1.00 0.00 ? 338 SER A CA   2  
ATOM   1556  C  C    . SER A 1 31 ? 0.246   2.306   -1.188  1.00 0.00 ? 338 SER A C    2  
ATOM   1557  O  O    . SER A 1 31 ? 0.896   2.277   -0.141  1.00 0.00 ? 338 SER A O    2  
ATOM   1558  C  CB   . SER A 1 31 ? -1.166  4.295   -1.749  1.00 0.00 ? 338 SER A CB   2  
ATOM   1559  O  OG   . SER A 1 31 ? -0.575  5.178   -0.810  1.00 0.00 ? 338 SER A OG   2  
ATOM   1560  H  H    . SER A 1 31 ? -1.387  3.422   0.806   1.00 0.00 ? 338 SER A H    2  
ATOM   1561  H  HA   . SER A 1 31 ? -1.782  2.249   -1.863  1.00 0.00 ? 338 SER A HA   2  
ATOM   1562  H  HB2  . SER A 1 31 ? -0.599  4.333   -2.668  1.00 0.00 ? 338 SER A HB2  2  
ATOM   1563  H  HB3  . SER A 1 31 ? -2.180  4.614   -1.938  1.00 0.00 ? 338 SER A HB3  2  
ATOM   1564  H  HG   . SER A 1 31 ? -0.839  6.084   -1.015  1.00 0.00 ? 338 SER A HG   2  
ATOM   1565  N  N    . ILE A 1 32 ? 0.709   1.853   -2.342  1.00 0.00 ? 339 ILE A N    2  
ATOM   1566  C  CA   . ILE A 1 32 ? 2.070   1.375   -2.504  1.00 0.00 ? 339 ILE A CA   2  
ATOM   1567  C  C    . ILE A 1 32 ? 2.484   1.573   -3.964  1.00 0.00 ? 339 ILE A C    2  
ATOM   1568  O  O    . ILE A 1 32 ? 1.684   1.352   -4.878  1.00 0.00 ? 339 ILE A O    2  
ATOM   1569  C  CB   . ILE A 1 32 ? 2.195   -0.115  -2.057  1.00 0.00 ? 339 ILE A CB   2  
ATOM   1570  C  CG1  . ILE A 1 32 ? 3.666   -0.570  -1.964  1.00 0.00 ? 339 ILE A CG1  2  
ATOM   1571  C  CG2  . ILE A 1 32 ? 1.401   -1.031  -2.978  1.00 0.00 ? 339 ILE A CG2  2  
ATOM   1572  C  CD1  . ILE A 1 32 ? 4.300   -0.962  -3.286  1.00 0.00 ? 339 ILE A CD1  2  
ATOM   1573  H  H    . ILE A 1 32 ? 0.108   1.834   -3.124  1.00 0.00 ? 339 ILE A H    2  
ATOM   1574  H  HA   . ILE A 1 32 ? 2.711   1.979   -1.875  1.00 0.00 ? 339 ILE A HA   2  
ATOM   1575  H  HB   . ILE A 1 32 ? 1.751   -0.192  -1.074  1.00 0.00 ? 339 ILE A HB   2  
ATOM   1576  H  HG12 . ILE A 1 32 ? 4.258   0.244   -1.551  1.00 0.00 ? 339 ILE A HG12 2  
ATOM   1577  H  HG13 . ILE A 1 32 ? 3.723   -1.434  -1.302  1.00 0.00 ? 339 ILE A HG13 2  
ATOM   1578  H  HG21 . ILE A 1 32 ? 1.509   -2.055  -2.648  1.00 0.00 ? 339 ILE A HG21 2  
ATOM   1579  H  HG22 . ILE A 1 32 ? 1.773   -0.938  -3.987  1.00 0.00 ? 339 ILE A HG22 2  
ATOM   1580  H  HG23 . ILE A 1 32 ? 0.358   -0.751  -2.952  1.00 0.00 ? 339 ILE A HG23 2  
ATOM   1581  H  HD11 . ILE A 1 32 ? 5.321   -1.273  -3.119  1.00 0.00 ? 339 ILE A HD11 2  
ATOM   1582  H  HD12 . ILE A 1 32 ? 4.285   -0.115  -3.957  1.00 0.00 ? 339 ILE A HD12 2  
ATOM   1583  H  HD13 . ILE A 1 32 ? 3.743   -1.776  -3.725  1.00 0.00 ? 339 ILE A HD13 2  
ATOM   1584  N  N    . GLN A 1 33 ? 3.707   2.034   -4.180  1.00 0.00 ? 340 GLN A N    2  
ATOM   1585  C  CA   . GLN A 1 33 ? 4.180   2.329   -5.521  1.00 0.00 ? 340 GLN A CA   2  
ATOM   1586  C  C    . GLN A 1 33 ? 5.371   1.462   -5.883  1.00 0.00 ? 340 GLN A C    2  
ATOM   1587  O  O    . GLN A 1 33 ? 6.316   1.322   -5.106  1.00 0.00 ? 340 GLN A O    2  
ATOM   1588  C  CB   . GLN A 1 33 ? 4.585   3.797   -5.657  1.00 0.00 ? 340 GLN A CB   2  
ATOM   1589  C  CG   . GLN A 1 33 ? 3.430   4.776   -5.533  1.00 0.00 ? 340 GLN A CG   2  
ATOM   1590  C  CD   . GLN A 1 33 ? 3.822   6.169   -5.862  1.00 0.00 ? 340 GLN A CD   2  
ATOM   1591  O  OE1  . GLN A 1 33 ? 4.781   6.416   -6.592  1.00 0.00 ? 340 GLN A OE1  2  
ATOM   1592  N  NE2  . GLN A 1 33 ? 3.037   7.090   -5.387  1.00 0.00 ? 340 GLN A NE2  2  
ATOM   1593  H  H    . GLN A 1 33 ? 4.313   2.158   -3.427  1.00 0.00 ? 340 GLN A H    2  
ATOM   1594  H  HA   . GLN A 1 33 ? 3.374   2.123   -6.212  1.00 0.00 ? 340 GLN A HA   2  
ATOM   1595  H  HB2  . GLN A 1 33 ? 5.307   4.029   -4.890  1.00 0.00 ? 340 GLN A HB2  2  
ATOM   1596  H  HB3  . GLN A 1 33 ? 5.045   3.940   -6.623  1.00 0.00 ? 340 GLN A HB3  2  
ATOM   1597  H  HG2  . GLN A 1 33 ? 2.645   4.517   -6.219  1.00 0.00 ? 340 GLN A HG2  2  
ATOM   1598  H  HG3  . GLN A 1 33 ? 3.061   4.754   -4.509  1.00 0.00 ? 340 GLN A HG3  2  
ATOM   1599  H  HE21 . GLN A 1 33 ? 2.264   6.814   -4.844  1.00 0.00 ? 340 GLN A HE21 2  
ATOM   1600  H  HE22 . GLN A 1 33 ? 3.228   7.986   -5.621  1.00 0.00 ? 340 GLN A HE22 2  
ATOM   1601  N  N    . CYS A 1 34 ? 5.308   0.876   -7.062  1.00 0.00 ? 341 CYS A N    2  
ATOM   1602  C  CA   . CYS A 1 34 ? 6.448   0.182   -7.638  1.00 0.00 ? 341 CYS A CA   2  
ATOM   1603  C  C    . CYS A 1 34 ? 7.537   1.188   -7.963  1.00 0.00 ? 341 CYS A C    2  
ATOM   1604  O  O    . CYS A 1 34 ? 7.245   2.332   -8.319  1.00 0.00 ? 341 CYS A O    2  
ATOM   1605  C  CB   . CYS A 1 34 ? 6.050   -0.559  -8.913  1.00 0.00 ? 341 CYS A CB   2  
ATOM   1606  S  SG   . CYS A 1 34 ? 7.455   -1.197  -9.872  1.00 0.00 ? 341 CYS A SG   2  
ATOM   1607  H  H    . CYS A 1 34 ? 4.463   0.917   -7.558  1.00 0.00 ? 341 CYS A H    2  
ATOM   1608  H  HA   . CYS A 1 34 ? 6.820   -0.525  -6.911  1.00 0.00 ? 341 CYS A HA   2  
ATOM   1609  H  HB2  . CYS A 1 34 ? 5.423   -1.399  -8.654  1.00 0.00 ? 341 CYS A HB2  2  
ATOM   1610  H  HB3  . CYS A 1 34 ? 5.498   0.112   -9.550  1.00 0.00 ? 341 CYS A HB3  2  
ATOM   1611  N  N    . HIS A 1 35 ? 8.787   0.757   -7.881  1.00 0.00 ? 342 HIS A N    2  
ATOM   1612  C  CA   . HIS A 1 35 ? 9.898   1.688   -8.102  1.00 0.00 ? 342 HIS A CA   2  
ATOM   1613  C  C    . HIS A 1 35 ? 11.254  0.998   -8.264  1.00 0.00 ? 342 HIS A C    2  
ATOM   1614  O  O    . HIS A 1 35 ? 11.826  1.030   -9.353  1.00 0.00 ? 342 HIS A O    2  
ATOM   1615  C  CB   . HIS A 1 35 ? 9.965   2.774   -6.997  1.00 0.00 ? 342 HIS A CB   2  
ATOM   1616  C  CG   . HIS A 1 35 ? 10.166  2.269   -5.590  1.00 0.00 ? 342 HIS A CG   2  
ATOM   1617  N  ND1  . HIS A 1 35 ? 11.359  2.397   -4.911  1.00 0.00 ? 342 HIS A ND1  2  
ATOM   1618  C  CD2  . HIS A 1 35 ? 9.315   1.660   -4.730  1.00 0.00 ? 342 HIS A CD2  2  
ATOM   1619  C  CE1  . HIS A 1 35 ? 11.234  1.889   -3.699  1.00 0.00 ? 342 HIS A CE1  2  
ATOM   1620  N  NE2  . HIS A 1 35 ? 10.003  1.435   -3.563  1.00 0.00 ? 342 HIS A NE2  2  
ATOM   1621  H  H    . HIS A 1 35 ? 8.954   -0.206  -7.722  1.00 0.00 ? 342 HIS A H    2  
ATOM   1622  H  HA   . HIS A 1 35 ? 9.689   2.191   -9.034  1.00 0.00 ? 342 HIS A HA   2  
ATOM   1623  H  HB2  . HIS A 1 35 ? 10.798  3.442   -7.219  1.00 0.00 ? 342 HIS A HB2  2  
ATOM   1624  H  HB3  . HIS A 1 35 ? 9.028   3.340   -7.014  1.00 0.00 ? 342 HIS A HB3  2  
ATOM   1625  H  HD1  . HIS A 1 35 ? 12.180  2.820   -5.258  1.00 0.00 ? 342 HIS A HD1  2  
ATOM   1626  H  HD2  . HIS A 1 35 ? 8.287   1.393   -4.930  1.00 0.00 ? 342 HIS A HD2  2  
ATOM   1627  H  HE1  . HIS A 1 35 ? 12.012  1.844   -2.951  1.00 0.00 ? 342 HIS A HE1  2  
ATOM   1628  H  HE2  . HIS A 1 35 ? 9.593   1.188   -2.702  1.00 0.00 ? 342 HIS A HE2  2  
ATOM   1629  N  N    . LYS A 1 36 ? 11.746  0.365   -7.200  1.00 0.00 ? 343 LYS A N    2  
ATOM   1630  C  CA   . LYS A 1 36 ? 13.151  -0.056  -7.109  1.00 0.00 ? 343 LYS A CA   2  
ATOM   1631  C  C    . LYS A 1 36 ? 14.045  1.186   -7.056  1.00 0.00 ? 343 LYS A C    2  
ATOM   1632  O  O    . LYS A 1 36 ? 14.546  1.545   -5.994  1.00 0.00 ? 343 LYS A O    2  
ATOM   1633  C  CB   . LYS A 1 36 ? 13.568  -0.981  -8.270  1.00 0.00 ? 343 LYS A CB   2  
ATOM   1634  C  CG   . LYS A 1 36 ? 15.058  -1.311  -8.288  1.00 0.00 ? 343 LYS A CG   2  
ATOM   1635  C  CD   . LYS A 1 36 ? 15.512  -1.946  -6.982  1.00 0.00 ? 343 LYS A CD   2  
ATOM   1636  C  CE   . LYS A 1 36 ? 17.030  -2.040  -6.904  1.00 0.00 ? 343 LYS A CE   2  
ATOM   1637  N  NZ   . LYS A 1 36 ? 17.597  -2.979  -7.909  1.00 0.00 ? 343 LYS A NZ   2  
ATOM   1638  H  H    . LYS A 1 36 ? 11.154  0.183   -6.445  1.00 0.00 ? 343 LYS A H    2  
ATOM   1639  H  HA   . LYS A 1 36 ? 13.264  -0.593  -6.177  1.00 0.00 ? 343 LYS A HA   2  
ATOM   1640  H  HB2  . LYS A 1 36 ? 13.016  -1.905  -8.195  1.00 0.00 ? 343 LYS A HB2  2  
ATOM   1641  H  HB3  . LYS A 1 36 ? 13.317  -0.499  -9.204  1.00 0.00 ? 343 LYS A HB3  2  
ATOM   1642  H  HG2  . LYS A 1 36 ? 15.253  -2.010  -9.101  1.00 0.00 ? 343 LYS A HG2  2  
ATOM   1643  H  HG3  . LYS A 1 36 ? 15.617  -0.388  -8.444  1.00 0.00 ? 343 LYS A HG3  2  
ATOM   1644  H  HD2  . LYS A 1 36 ? 15.157  -1.334  -6.154  1.00 0.00 ? 343 LYS A HD2  2  
ATOM   1645  H  HD3  . LYS A 1 36 ? 15.093  -2.951  -6.915  1.00 0.00 ? 343 LYS A HD3  2  
ATOM   1646  H  HE2  . LYS A 1 36 ? 17.443  -1.057  -7.074  1.00 0.00 ? 343 LYS A HE2  2  
ATOM   1647  H  HE3  . LYS A 1 36 ? 17.304  -2.374  -5.915  1.00 0.00 ? 343 LYS A HE3  2  
ATOM   1648  H  HZ1  . LYS A 1 36 ? 18.632  -3.015  -7.818  1.00 0.00 ? 343 LYS A HZ1  2  
ATOM   1649  H  HZ2  . LYS A 1 36 ? 17.358  -2.668  -8.871  1.00 0.00 ? 343 LYS A HZ2  2  
ATOM   1650  H  HZ3  . LYS A 1 36 ? 17.218  -3.937  -7.763  1.00 0.00 ? 343 LYS A HZ3  2  
ATOM   1651  N  N    . ALA A 1 37 ? 14.210  1.840   -8.199  1.00 0.00 ? 344 ALA A N    2  
ATOM   1652  C  CA   . ALA A 1 37 ? 14.916  3.113   -8.269  1.00 0.00 ? 344 ALA A CA   2  
ATOM   1653  C  C    . ALA A 1 37 ? 13.952  4.209   -8.712  1.00 0.00 ? 344 ALA A C    2  
ATOM   1654  O  O    . ALA A 1 37 ? 13.952  5.317   -8.176  1.00 0.00 ? 344 ALA A O    2  
ATOM   1655  C  CB   . ALA A 1 37 ? 16.098  3.016   -9.225  1.00 0.00 ? 344 ALA A CB   2  
ATOM   1656  H  H    . ALA A 1 37 ? 13.843  1.454   -9.021  1.00 0.00 ? 344 ALA A H    2  
ATOM   1657  H  HA   . ALA A 1 37 ? 15.291  3.346   -7.284  1.00 0.00 ? 344 ALA A HA   2  
ATOM   1658  H  HB1  . ALA A 1 37 ? 15.741  2.774   -10.216 1.00 0.00 ? 344 ALA A HB1  2  
ATOM   1659  H  HB2  . ALA A 1 37 ? 16.771  2.242   -8.887  1.00 0.00 ? 344 ALA A HB2  2  
ATOM   1660  H  HB3  . ALA A 1 37 ? 16.619  3.960   -9.250  1.00 0.00 ? 344 ALA A HB3  2  
ATOM   1661  N  N    . ASN A 1 38 ? 13.124  3.876   -9.697  1.00 0.00 ? 345 ASN A N    2  
ATOM   1662  C  CA   . ASN A 1 38 ? 12.080  4.770   -10.184 1.00 0.00 ? 345 ASN A CA   2  
ATOM   1663  C  C    . ASN A 1 38 ? 11.138  4.001   -11.101 1.00 0.00 ? 345 ASN A C    2  
ATOM   1664  O  O    . ASN A 1 38 ? 11.565  3.094   -11.817 1.00 0.00 ? 345 ASN A O    2  
ATOM   1665  C  CB   . ASN A 1 38 ? 12.675  5.981   -10.923 1.00 0.00 ? 345 ASN A CB   2  
ATOM   1666  C  CG   . ASN A 1 38 ? 13.517  5.600   -12.129 1.00 0.00 ? 345 ASN A CG   2  
ATOM   1667  O  OD1  . ASN A 1 38 ? 13.009  5.476   -13.244 1.00 0.00 ? 345 ASN A OD1  2  
ATOM   1668  N  ND2  . ASN A 1 38 ? 14.815  5.431   -11.922 1.00 0.00 ? 345 ASN A ND2  2  
ATOM   1669  H  H    . ASN A 1 38 ? 13.220  2.998   -10.120 1.00 0.00 ? 345 ASN A H    2  
ATOM   1670  H  HA   . ASN A 1 38 ? 11.519  5.119   -9.328  1.00 0.00 ? 345 ASN A HA   2  
ATOM   1671  H  HB2  . ASN A 1 38 ? 11.870  6.616   -11.260 1.00 0.00 ? 345 ASN A HB2  2  
ATOM   1672  H  HB3  . ASN A 1 38 ? 13.298  6.535   -10.235 1.00 0.00 ? 345 ASN A HB3  2  
ATOM   1673  H  HD21 . ASN A 1 38 ? 15.162  5.560   -11.012 1.00 0.00 ? 345 ASN A HD21 2  
ATOM   1674  H  HD22 . ASN A 1 38 ? 15.380  5.192   -12.688 1.00 0.00 ? 345 ASN A HD22 2  
ATOM   1675  N  N    . CYS A 1 39 ? 9.856   4.338   -11.042 1.00 0.00 ? 346 CYS A N    2  
ATOM   1676  C  CA   . CYS A 1 39 ? 8.842   3.665   -11.848 1.00 0.00 ? 346 CYS A CA   2  
ATOM   1677  C  C    . CYS A 1 39 ? 7.495   4.363   -11.681 1.00 0.00 ? 346 CYS A C    2  
ATOM   1678  O  O    . CYS A 1 39 ? 6.780   4.598   -12.656 1.00 0.00 ? 346 CYS A O    2  
ATOM   1679  C  CB   . CYS A 1 39 ? 8.730   2.192   -11.431 1.00 0.00 ? 346 CYS A CB   2  
ATOM   1680  S  SG   . CYS A 1 39 ? 7.731   1.161   -12.536 1.00 0.00 ? 346 CYS A SG   2  
ATOM   1681  H  H    . CYS A 1 39 ? 9.583   5.066   -10.447 1.00 0.00 ? 346 CYS A H    2  
ATOM   1682  H  HA   . CYS A 1 39 ? 9.143   3.721   -12.884 1.00 0.00 ? 346 CYS A HA   2  
ATOM   1683  H  HB2  . CYS A 1 39 ? 9.721   1.764   -11.395 1.00 0.00 ? 346 CYS A HB2  2  
ATOM   1684  H  HB3  . CYS A 1 39 ? 8.287   2.141   -10.447 1.00 0.00 ? 346 CYS A HB3  2  
ATOM   1685  N  N    . TYR A 1 40 ? 7.163   4.680   -10.427 1.00 0.00 ? 347 TYR A N    2  
ATOM   1686  C  CA   . TYR A 1 40 ? 5.932   5.392   -10.081 1.00 0.00 ? 347 TYR A CA   2  
ATOM   1687  C  C    . TYR A 1 40 ? 4.706   4.663   -10.628 1.00 0.00 ? 347 TYR A C    2  
ATOM   1688  O  O    . TYR A 1 40 ? 3.946   5.200   -11.434 1.00 0.00 ? 347 TYR A O    2  
ATOM   1689  C  CB   . TYR A 1 40 ? 5.971   6.840   -10.590 1.00 0.00 ? 347 TYR A CB   2  
ATOM   1690  C  CG   . TYR A 1 40 ? 5.106   7.798   -9.791  1.00 0.00 ? 347 TYR A CG   2  
ATOM   1691  C  CD1  . TYR A 1 40 ? 3.776   7.507   -9.510  1.00 0.00 ? 347 TYR A CD1  2  
ATOM   1692  C  CD2  . TYR A 1 40 ? 5.623   9.003   -9.326  1.00 0.00 ? 347 TYR A CD2  2  
ATOM   1693  C  CE1  . TYR A 1 40 ? 2.987   8.384   -8.788  1.00 0.00 ? 347 TYR A CE1  2  
ATOM   1694  C  CE2  . TYR A 1 40 ? 4.840   9.885   -8.602  1.00 0.00 ? 347 TYR A CE2  2  
ATOM   1695  C  CZ   . TYR A 1 40 ? 3.524   9.571   -8.337  1.00 0.00 ? 347 TYR A CZ   2  
ATOM   1696  O  OH   . TYR A 1 40 ? 2.743   10.448  -7.617  1.00 0.00 ? 347 TYR A OH   2  
ATOM   1697  H  H    . TYR A 1 40 ? 7.764   4.413   -9.703  1.00 0.00 ? 347 TYR A H    2  
ATOM   1698  H  HA   . TYR A 1 40 ? 5.861   5.409   -9.002  1.00 0.00 ? 347 TYR A HA   2  
ATOM   1699  H  HB2  . TYR A 1 40 ? 6.987   7.202   -10.552 1.00 0.00 ? 347 TYR A HB2  2  
ATOM   1700  H  HB3  . TYR A 1 40 ? 5.627   6.861   -11.614 1.00 0.00 ? 347 TYR A HB3  2  
ATOM   1701  H  HD1  . TYR A 1 40 ? 3.360   6.572   -9.859  1.00 0.00 ? 347 TYR A HD1  2  
ATOM   1702  H  HD2  . TYR A 1 40 ? 6.654   9.248   -9.535  1.00 0.00 ? 347 TYR A HD2  2  
ATOM   1703  H  HE1  . TYR A 1 40 ? 1.956   8.137   -8.579  1.00 0.00 ? 347 TYR A HE1  2  
ATOM   1704  H  HE2  . TYR A 1 40 ? 5.263   10.816  -8.248  1.00 0.00 ? 347 TYR A HE2  2  
ATOM   1705  H  HH   . TYR A 1 40 ? 2.190   9.956   -7.004  1.00 0.00 ? 347 TYR A HH   2  
ATOM   1706  N  N    . THR A 1 41 ? 4.550   3.418   -10.224 1.00 0.00 ? 348 THR A N    2  
ATOM   1707  C  CA   . THR A 1 41 ? 3.346   2.665   -10.520 1.00 0.00 ? 348 THR A CA   2  
ATOM   1708  C  C    . THR A 1 41 ? 2.557   2.491   -9.237  1.00 0.00 ? 348 THR A C    2  
ATOM   1709  O  O    . THR A 1 41 ? 3.012   1.806   -8.320  1.00 0.00 ? 348 THR A O    2  
ATOM   1710  C  CB   . THR A 1 41 ? 3.661   1.285   -11.117 1.00 0.00 ? 348 THR A CB   2  
ATOM   1711  O  OG1  . THR A 1 41 ? 4.814   1.369   -11.965 1.00 0.00 ? 348 THR A OG1  2  
ATOM   1712  C  CG2  . THR A 1 41 ? 2.479   0.764   -11.922 1.00 0.00 ? 348 THR A CG2  2  
ATOM   1713  H  H    . THR A 1 41 ? 5.257   2.999   -9.692  1.00 0.00 ? 348 THR A H    2  
ATOM   1714  H  HA   . THR A 1 41 ? 2.756   3.232   -11.229 1.00 0.00 ? 348 THR A HA   2  
ATOM   1715  H  HB   . THR A 1 41 ? 3.859   0.596   -10.311 1.00 0.00 ? 348 THR A HB   2  
ATOM   1716  H  HG1  . THR A 1 41 ? 4.861   2.254   -12.350 1.00 0.00 ? 348 THR A HG1  2  
ATOM   1717  H  HG21 . THR A 1 41 ? 2.721   -0.208  -12.327 1.00 0.00 ? 348 THR A HG21 2  
ATOM   1718  H  HG22 . THR A 1 41 ? 2.263   1.446   -12.730 1.00 0.00 ? 348 THR A HG22 2  
ATOM   1719  H  HG23 . THR A 1 41 ? 1.615   0.680   -11.280 1.00 0.00 ? 348 THR A HG23 2  
ATOM   1720  N  N    . ALA A 1 42 ? 1.388   3.096   -9.161  1.00 0.00 ? 349 ALA A N    2  
ATOM   1721  C  CA   . ALA A 1 42 ? 0.660   3.148   -7.909  1.00 0.00 ? 349 ALA A CA   2  
ATOM   1722  C  C    . ALA A 1 42 ? -0.452  2.114   -7.851  1.00 0.00 ? 349 ALA A C    2  
ATOM   1723  O  O    . ALA A 1 42 ? -1.180  1.892   -8.819  1.00 0.00 ? 349 ALA A O    2  
ATOM   1724  C  CB   . ALA A 1 42 ? 0.097   4.538   -7.689  1.00 0.00 ? 349 ALA A CB   2  
ATOM   1725  H  H    . ALA A 1 42 ? 1.006   3.512   -9.961  1.00 0.00 ? 349 ALA A H    2  
ATOM   1726  H  HA   . ALA A 1 42 ? 1.360   2.945   -7.114  1.00 0.00 ? 349 ALA A HA   2  
ATOM   1727  H  HB1  . ALA A 1 42 ? 0.901   5.258   -7.726  1.00 0.00 ? 349 ALA A HB1  2  
ATOM   1728  H  HB2  . ALA A 1 42 ? -0.381  4.582   -6.723  1.00 0.00 ? 349 ALA A HB2  2  
ATOM   1729  H  HB3  . ALA A 1 42 ? -0.625  4.763   -8.460  1.00 0.00 ? 349 ALA A HB3  2  
ATOM   1730  N  N    . PHE A 1 43 ? -0.542  1.462   -6.707  1.00 0.00 ? 350 PHE A N    2  
ATOM   1731  C  CA   . PHE A 1 43 ? -1.598  0.513   -6.433  1.00 0.00 ? 350 PHE A CA   2  
ATOM   1732  C  C    . PHE A 1 43 ? -1.809  0.411   -4.928  1.00 0.00 ? 350 PHE A C    2  
ATOM   1733  O  O    . PHE A 1 43 ? -1.231  1.182   -4.165  1.00 0.00 ? 350 PHE A O    2  
ATOM   1734  C  CB   . PHE A 1 43 ? -1.310  -0.863  -7.072  1.00 0.00 ? 350 PHE A CB   2  
ATOM   1735  C  CG   . PHE A 1 43 ? 0.082   -1.421  -6.862  1.00 0.00 ? 350 PHE A CG   2  
ATOM   1736  C  CD1  . PHE A 1 43 ? 1.201   -0.766  -7.360  1.00 0.00 ? 350 PHE A CD1  2  
ATOM   1737  C  CD2  . PHE A 1 43 ? 0.266   -2.624  -6.199  1.00 0.00 ? 350 PHE A CD2  2  
ATOM   1738  C  CE1  . PHE A 1 43 ? 2.466   -1.294  -7.200  1.00 0.00 ? 350 PHE A CE1  2  
ATOM   1739  C  CE2  . PHE A 1 43 ? 1.533   -3.156  -6.035  1.00 0.00 ? 350 PHE A CE2  2  
ATOM   1740  C  CZ   . PHE A 1 43 ? 2.633   -2.490  -6.536  1.00 0.00 ? 350 PHE A CZ   2  
ATOM   1741  H  H    . PHE A 1 43 ? 0.139   1.624   -6.013  1.00 0.00 ? 350 PHE A H    2  
ATOM   1742  H  HA   . PHE A 1 43 ? -2.503  0.913   -6.870  1.00 0.00 ? 350 PHE A HA   2  
ATOM   1743  H  HB2  . PHE A 1 43 ? -2.006  -1.581  -6.667  1.00 0.00 ? 350 PHE A HB2  2  
ATOM   1744  H  HB3  . PHE A 1 43 ? -1.474  -0.786  -8.138  1.00 0.00 ? 350 PHE A HB3  2  
ATOM   1745  H  HD1  . PHE A 1 43 ? 1.075   0.174   -7.879  1.00 0.00 ? 350 PHE A HD1  2  
ATOM   1746  H  HD2  . PHE A 1 43 ? -0.592  -3.150  -5.806  1.00 0.00 ? 350 PHE A HD2  2  
ATOM   1747  H  HE1  . PHE A 1 43 ? 3.324   -0.771  -7.595  1.00 0.00 ? 350 PHE A HE1  2  
ATOM   1748  H  HE2  . PHE A 1 43 ? 1.663   -4.096  -5.523  1.00 0.00 ? 350 PHE A HE2  2  
ATOM   1749  H  HZ   . PHE A 1 43 ? 3.622   -2.905  -6.409  1.00 0.00 ? 350 PHE A HZ   2  
ATOM   1750  N  N    . HIS A 1 44 ? -2.656  -0.504  -4.495  1.00 0.00 ? 351 HIS A N    2  
ATOM   1751  C  CA   . HIS A 1 44 ? -2.959  -0.623  -3.074  1.00 0.00 ? 351 HIS A CA   2  
ATOM   1752  C  C    . HIS A 1 44 ? -2.339  -1.886  -2.504  1.00 0.00 ? 351 HIS A C    2  
ATOM   1753  O  O    . HIS A 1 44 ? -2.196  -2.879  -3.214  1.00 0.00 ? 351 HIS A O    2  
ATOM   1754  C  CB   . HIS A 1 44 ? -4.471  -0.632  -2.828  1.00 0.00 ? 351 HIS A CB   2  
ATOM   1755  C  CG   . HIS A 1 44 ? -5.161  0.639   -3.224  1.00 0.00 ? 351 HIS A CG   2  
ATOM   1756  N  ND1  . HIS A 1 44 ? -6.138  0.693   -4.204  1.00 0.00 ? 351 HIS A ND1  2  
ATOM   1757  C  CD2  . HIS A 1 44 ? -5.018  1.907   -2.768  1.00 0.00 ? 351 HIS A CD2  2  
ATOM   1758  C  CE1  . HIS A 1 44 ? -6.556  1.946   -4.326  1.00 0.00 ? 351 HIS A CE1  2  
ATOM   1759  N  NE2  . HIS A 1 44 ? -5.894  2.700   -3.473  1.00 0.00 ? 351 HIS A NE2  2  
ATOM   1760  H  H    . HIS A 1 44 ? -3.059  -1.126  -5.134  1.00 0.00 ? 351 HIS A H    2  
ATOM   1761  H  HA   . HIS A 1 44 ? -2.528  0.231   -2.574  1.00 0.00 ? 351 HIS A HA   2  
ATOM   1762  H  HB2  . HIS A 1 44 ? -4.915  -1.437  -3.393  1.00 0.00 ? 351 HIS A HB2  2  
ATOM   1763  H  HB3  . HIS A 1 44 ? -4.656  -0.794  -1.776  1.00 0.00 ? 351 HIS A HB3  2  
ATOM   1764  H  HD2  . HIS A 1 44 ? -4.366  2.229   -1.962  1.00 0.00 ? 351 HIS A HD2  2  
ATOM   1765  H  HE1  . HIS A 1 44 ? -7.318  2.293   -5.010  1.00 0.00 ? 351 HIS A HE1  2  
ATOM   1766  H  HE2  . HIS A 1 44 ? -5.816  3.681   -3.558  1.00 0.00 ? 351 HIS A HE2  2  
ATOM   1767  N  N    . VAL A 1 45 ? -1.984  -1.844  -1.223  1.00 0.00 ? 352 VAL A N    2  
ATOM   1768  C  CA   . VAL A 1 45 ? -1.381  -2.992  -0.549  1.00 0.00 ? 352 VAL A CA   2  
ATOM   1769  C  C    . VAL A 1 45 ? -2.291  -4.216  -0.646  1.00 0.00 ? 352 VAL A C    2  
ATOM   1770  O  O    . VAL A 1 45 ? -1.836  -5.327  -0.915  1.00 0.00 ? 352 VAL A O    2  
ATOM   1771  C  CB   . VAL A 1 45 ? -1.092  -2.682  0.936   1.00 0.00 ? 352 VAL A CB   2  
ATOM   1772  C  CG1  . VAL A 1 45 ? -0.423  -3.864  1.624   1.00 0.00 ? 352 VAL A CG1  2  
ATOM   1773  C  CG2  . VAL A 1 45 ? -0.231  -1.433  1.062   1.00 0.00 ? 352 VAL A CG2  2  
ATOM   1774  H  H    . VAL A 1 45 ? -2.118  -1.013  -0.718  1.00 0.00 ? 352 VAL A H    2  
ATOM   1775  H  HA   . VAL A 1 45 ? -0.443  -3.214  -1.039  1.00 0.00 ? 352 VAL A HA   2  
ATOM   1776  H  HB   . VAL A 1 45 ? -2.033  -2.493  1.430   1.00 0.00 ? 352 VAL A HB   2  
ATOM   1777  H  HG11 . VAL A 1 45 ? -0.246  -3.622  2.661   1.00 0.00 ? 352 VAL A HG11 2  
ATOM   1778  H  HG12 . VAL A 1 45 ? 0.519   -4.077  1.140   1.00 0.00 ? 352 VAL A HG12 2  
ATOM   1779  H  HG13 . VAL A 1 45 ? -1.065  -4.730  1.559   1.00 0.00 ? 352 VAL A HG13 2  
ATOM   1780  H  HG21 . VAL A 1 45 ? 0.705   -1.589  0.546   1.00 0.00 ? 352 VAL A HG21 2  
ATOM   1781  H  HG22 . VAL A 1 45 ? -0.038  -1.234  2.107   1.00 0.00 ? 352 VAL A HG22 2  
ATOM   1782  H  HG23 . VAL A 1 45 ? -0.747  -0.592  0.625   1.00 0.00 ? 352 VAL A HG23 2  
ATOM   1783  N  N    . THR A 1 46 ? -3.582  -3.998  -0.435  1.00 0.00 ? 353 THR A N    2  
ATOM   1784  C  CA   . THR A 1 46 ? -4.563  -5.064  -0.572  1.00 0.00 ? 353 THR A CA   2  
ATOM   1785  C  C    . THR A 1 46 ? -4.616  -5.573  -2.014  1.00 0.00 ? 353 THR A C    2  
ATOM   1786  O  O    . THR A 1 46 ? -4.666  -6.776  -2.252  1.00 0.00 ? 353 THR A O    2  
ATOM   1787  C  CB   . THR A 1 46 ? -5.971  -4.607  -0.113  1.00 0.00 ? 353 THR A CB   2  
ATOM   1788  O  OG1  . THR A 1 46 ? -6.933  -5.630  -0.391  1.00 0.00 ? 353 THR A OG1  2  
ATOM   1789  C  CG2  . THR A 1 46 ? -6.384  -3.310  -0.796  1.00 0.00 ? 353 THR A CG2  2  
ATOM   1790  H  H    . THR A 1 46 ? -3.880  -3.107  -0.168  1.00 0.00 ? 353 THR A H    2  
ATOM   1791  H  HA   . THR A 1 46 ? -4.251  -5.877  0.069   1.00 0.00 ? 353 THR A HA   2  
ATOM   1792  H  HB   . THR A 1 46 ? -5.943  -4.438  0.953   1.00 0.00 ? 353 THR A HB   2  
ATOM   1793  H  HG1  . THR A 1 46 ? -7.798  -5.361  -0.058  1.00 0.00 ? 353 THR A HG1  2  
ATOM   1794  H  HG21 . THR A 1 46 ? -6.405  -3.455  -1.866  1.00 0.00 ? 353 THR A HG21 2  
ATOM   1795  H  HG22 . THR A 1 46 ? -5.673  -2.536  -0.552  1.00 0.00 ? 353 THR A HG22 2  
ATOM   1796  H  HG23 . THR A 1 46 ? -7.365  -3.019  -0.454  1.00 0.00 ? 353 THR A HG23 2  
ATOM   1797  N  N    . CYS A 1 47 ? -4.552  -4.656  -2.975  1.00 0.00 ? 354 CYS A N    2  
ATOM   1798  C  CA   . CYS A 1 47 ? -4.633  -5.019  -4.384  1.00 0.00 ? 354 CYS A CA   2  
ATOM   1799  C  C    . CYS A 1 47 ? -3.422  -5.839  -4.804  1.00 0.00 ? 354 CYS A C    2  
ATOM   1800  O  O    . CYS A 1 47 ? -3.528  -6.725  -5.648  1.00 0.00 ? 354 CYS A O    2  
ATOM   1801  C  CB   . CYS A 1 47 ? -4.740  -3.769  -5.248  1.00 0.00 ? 354 CYS A CB   2  
ATOM   1802  S  SG   . CYS A 1 47 ? -6.188  -2.752  -4.886  1.00 0.00 ? 354 CYS A SG   2  
ATOM   1803  H  H    . CYS A 1 47 ? -4.440  -3.719  -2.731  1.00 0.00 ? 354 CYS A H    2  
ATOM   1804  H  HA   . CYS A 1 47 ? -5.520  -5.617  -4.520  1.00 0.00 ? 354 CYS A HA   2  
ATOM   1805  H  HB2  . CYS A 1 47 ? -3.865  -3.159  -5.095  1.00 0.00 ? 354 CYS A HB2  2  
ATOM   1806  H  HB3  . CYS A 1 47 ? -4.792  -4.063  -6.285  1.00 0.00 ? 354 CYS A HB3  2  
ATOM   1807  N  N    . ALA A 1 48 ? -2.276  -5.538  -4.209  1.00 0.00 ? 355 ALA A N    2  
ATOM   1808  C  CA   . ALA A 1 48 ? -1.065  -6.299  -4.461  1.00 0.00 ? 355 ALA A CA   2  
ATOM   1809  C  C    . ALA A 1 48 ? -1.245  -7.733  -3.988  1.00 0.00 ? 355 ALA A C    2  
ATOM   1810  O  O    . ALA A 1 48 ? -0.766  -8.673  -4.621  1.00 0.00 ? 355 ALA A O    2  
ATOM   1811  C  CB   . ALA A 1 48 ? 0.119   -5.645  -3.765  1.00 0.00 ? 355 ALA A CB   2  
ATOM   1812  H  H    . ALA A 1 48 ? -2.243  -4.778  -3.589  1.00 0.00 ? 355 ALA A H    2  
ATOM   1813  H  HA   . ALA A 1 48 ? -0.879  -6.298  -5.526  1.00 0.00 ? 355 ALA A HA   2  
ATOM   1814  H  HB1  . ALA A 1 48 ? -0.049  -5.639  -2.698  1.00 0.00 ? 355 ALA A HB1  2  
ATOM   1815  H  HB2  . ALA A 1 48 ? 0.230   -4.631  -4.118  1.00 0.00 ? 355 ALA A HB2  2  
ATOM   1816  H  HB3  . ALA A 1 48 ? 1.018   -6.203  -3.983  1.00 0.00 ? 355 ALA A HB3  2  
ATOM   1817  N  N    . GLN A 1 49 ? -1.947  -7.890  -2.873  1.00 0.00 ? 356 GLN A N    2  
ATOM   1818  C  CA   . GLN A 1 49 ? -2.278  -9.203  -2.340  1.00 0.00 ? 356 GLN A CA   2  
ATOM   1819  C  C    . GLN A 1 49 ? -3.332  -9.892  -3.211  1.00 0.00 ? 356 GLN A C    2  
ATOM   1820  O  O    . GLN A 1 49 ? -3.247  -11.092 -3.470  1.00 0.00 ? 356 GLN A O    2  
ATOM   1821  C  CB   . GLN A 1 49 ? -2.765  -9.078  -0.898  1.00 0.00 ? 356 GLN A CB   2  
ATOM   1822  C  CG   . GLN A 1 49 ? -1.689  -8.591  0.058   1.00 0.00 ? 356 GLN A CG   2  
ATOM   1823  C  CD   . GLN A 1 49 ? -2.221  -8.316  1.448   1.00 0.00 ? 356 GLN A CD   2  
ATOM   1824  O  OE1  . GLN A 1 49 ? -2.261  -9.205  2.297   1.00 0.00 ? 356 GLN A OE1  2  
ATOM   1825  N  NE2  . GLN A 1 49 ? -2.627  -7.081  1.688   1.00 0.00 ? 356 GLN A NE2  2  
ATOM   1826  H  H    . GLN A 1 49 ? -2.256  -7.092  -2.392  1.00 0.00 ? 356 GLN A H    2  
ATOM   1827  H  HA   . GLN A 1 49 ? -1.376  -9.801  -2.356  1.00 0.00 ? 356 GLN A HA   2  
ATOM   1828  H  HB2  . GLN A 1 49 ? -3.592  -8.370  -0.868  1.00 0.00 ? 356 GLN A HB2  2  
ATOM   1829  H  HB3  . GLN A 1 49 ? -3.109  -10.053 -0.556  1.00 0.00 ? 356 GLN A HB3  2  
ATOM   1830  H  HG2  . GLN A 1 49 ? -0.916  -9.356  0.131   1.00 0.00 ? 356 GLN A HG2  2  
ATOM   1831  H  HG3  . GLN A 1 49 ? -1.265  -7.669  -0.340  1.00 0.00 ? 356 GLN A HG3  2  
ATOM   1832  H  HE21 . GLN A 1 49 ? -2.555  -6.422  0.966   1.00 0.00 ? 356 GLN A HE21 2  
ATOM   1833  H  HE22 . GLN A 1 49 ? -2.982  -6.876  2.579   1.00 0.00 ? 356 GLN A HE22 2  
ATOM   1834  N  N    . LYS A 1 50 ? -4.322  -9.123  -3.664  1.00 0.00 ? 357 LYS A N    2  
ATOM   1835  C  CA   . LYS A 1 50 ? -5.356  -9.649  -4.557  1.00 0.00 ? 357 LYS A CA   2  
ATOM   1836  C  C    . LYS A 1 50 ? -4.742  -10.146 -5.862  1.00 0.00 ? 357 LYS A C    2  
ATOM   1837  O  O    . LYS A 1 50 ? -5.140  -11.186 -6.392  1.00 0.00 ? 357 LYS A O    2  
ATOM   1838  C  CB   . LYS A 1 50 ? -6.418  -8.585  -4.868  1.00 0.00 ? 357 LYS A CB   2  
ATOM   1839  C  CG   . LYS A 1 50 ? -7.674  -8.650  -3.999  1.00 0.00 ? 357 LYS A CG   2  
ATOM   1840  C  CD   . LYS A 1 50 ? -7.467  -8.048  -2.613  1.00 0.00 ? 357 LYS A CD   2  
ATOM   1841  C  CE   . LYS A 1 50 ? -6.840  -9.032  -1.636  1.00 0.00 ? 357 LYS A CE   2  
ATOM   1842  N  NZ   . LYS A 1 50 ? -7.742  -10.173 -1.335  1.00 0.00 ? 357 LYS A NZ   2  
ATOM   1843  H  H    . LYS A 1 50 ? -4.363  -8.182  -3.386  1.00 0.00 ? 357 LYS A H    2  
ATOM   1844  H  HA   . LYS A 1 50 ? -5.829  -10.481 -4.058  1.00 0.00 ? 357 LYS A HA   2  
ATOM   1845  H  HB2  . LYS A 1 50 ? -5.975  -7.611  -4.736  1.00 0.00 ? 357 LYS A HB2  2  
ATOM   1846  H  HB3  . LYS A 1 50 ? -6.720  -8.692  -5.900  1.00 0.00 ? 357 LYS A HB3  2  
ATOM   1847  H  HG2  . LYS A 1 50 ? -8.468  -8.098  -4.497  1.00 0.00 ? 357 LYS A HG2  2  
ATOM   1848  H  HG3  . LYS A 1 50 ? -7.964  -9.694  -3.889  1.00 0.00 ? 357 LYS A HG3  2  
ATOM   1849  H  HD2  . LYS A 1 50 ? -6.818  -7.192  -2.703  1.00 0.00 ? 357 LYS A HD2  2  
ATOM   1850  H  HD3  . LYS A 1 50 ? -8.425  -7.734  -2.226  1.00 0.00 ? 357 LYS A HD3  2  
ATOM   1851  H  HE2  . LYS A 1 50 ? -5.924  -9.413  -2.064  1.00 0.00 ? 357 LYS A HE2  2  
ATOM   1852  H  HE3  . LYS A 1 50 ? -6.616  -8.510  -0.717  1.00 0.00 ? 357 LYS A HE3  2  
ATOM   1853  H  HZ1  . LYS A 1 50 ? -8.004  -10.665 -2.210  1.00 0.00 ? 357 LYS A HZ1  2  
ATOM   1854  H  HZ2  . LYS A 1 50 ? -8.610  -9.832  -0.871  1.00 0.00 ? 357 LYS A HZ2  2  
ATOM   1855  H  HZ3  . LYS A 1 50 ? -7.268  -10.845 -0.700  1.00 0.00 ? 357 LYS A HZ3  2  
ATOM   1856  N  N    . ALA A 1 51 ? -3.777  -9.396  -6.382  1.00 0.00 ? 358 ALA A N    2  
ATOM   1857  C  CA   . ALA A 1 51 ? -3.091  -9.772  -7.609  1.00 0.00 ? 358 ALA A CA   2  
ATOM   1858  C  C    . ALA A 1 51 ? -2.089  -10.891 -7.348  1.00 0.00 ? 358 ALA A C    2  
ATOM   1859  O  O    . ALA A 1 51 ? -1.978  -11.835 -8.128  1.00 0.00 ? 358 ALA A O    2  
ATOM   1860  C  CB   . ALA A 1 51 ? -2.394  -8.563  -8.217  1.00 0.00 ? 358 ALA A CB   2  
ATOM   1861  H  H    . ALA A 1 51 ? -3.527  -8.557  -5.933  1.00 0.00 ? 358 ALA A H    2  
ATOM   1862  H  HA   . ALA A 1 51 ? -3.832  -10.123 -8.313  1.00 0.00 ? 358 ALA A HA   2  
ATOM   1863  H  HB1  . ALA A 1 51 ? -3.121  -7.789  -8.411  1.00 0.00 ? 358 ALA A HB1  2  
ATOM   1864  H  HB2  . ALA A 1 51 ? -1.917  -8.850  -9.144  1.00 0.00 ? 358 ALA A HB2  2  
ATOM   1865  H  HB3  . ALA A 1 51 ? -1.649  -8.192  -7.529  1.00 0.00 ? 358 ALA A HB3  2  
ATOM   1866  N  N    . GLY A 1 52 ? -1.372  -10.783 -6.240  1.00 0.00 ? 359 GLY A N    2  
ATOM   1867  C  CA   . GLY A 1 52 ? -0.368  -11.772 -5.910  1.00 0.00 ? 359 GLY A CA   2  
ATOM   1868  C  C    . GLY A 1 52 ? 0.933   -11.516 -6.638  1.00 0.00 ? 359 GLY A C    2  
ATOM   1869  O  O    . GLY A 1 52 ? 1.569   -12.447 -7.135  1.00 0.00 ? 359 GLY A O    2  
ATOM   1870  H  H    . GLY A 1 52 ? -1.522  -10.022 -5.639  1.00 0.00 ? 359 GLY A H    2  
ATOM   1871  H  HA2  . GLY A 1 52 ? -0.185  -11.746 -4.846  1.00 0.00 ? 359 GLY A HA2  2  
ATOM   1872  H  HA3  . GLY A 1 52 ? -0.736  -12.750 -6.181  1.00 0.00 ? 359 GLY A HA3  2  
ATOM   1873  N  N    . LEU A 1 53 ? 1.323   -10.250 -6.707  1.00 0.00 ? 360 LEU A N    2  
ATOM   1874  C  CA   . LEU A 1 53 ? 2.533   -9.864  -7.415  1.00 0.00 ? 360 LEU A CA   2  
ATOM   1875  C  C    . LEU A 1 53 ? 3.757   -9.967  -6.510  1.00 0.00 ? 360 LEU A C    2  
ATOM   1876  O  O    . LEU A 1 53 ? 3.643   -10.291 -5.324  1.00 0.00 ? 360 LEU A O    2  
ATOM   1877  C  CB   . LEU A 1 53 ? 2.386   -8.452  -8.005  1.00 0.00 ? 360 LEU A CB   2  
ATOM   1878  C  CG   . LEU A 1 53 ? 1.855   -7.371  -7.052  1.00 0.00 ? 360 LEU A CG   2  
ATOM   1879  C  CD1  . LEU A 1 53 ? 2.932   -6.908  -6.080  1.00 0.00 ? 360 LEU A CD1  2  
ATOM   1880  C  CD2  . LEU A 1 53 ? 1.313   -6.195  -7.848  1.00 0.00 ? 360 LEU A CD2  2  
ATOM   1881  H  H    . LEU A 1 53 ? 0.790   -9.563  -6.257  1.00 0.00 ? 360 LEU A H    2  
ATOM   1882  H  HA   . LEU A 1 53 ? 2.662   -10.563 -8.229  1.00 0.00 ? 360 LEU A HA   2  
ATOM   1883  H  HB2  . LEU A 1 53 ? 3.369   -8.133  -8.356  1.00 0.00 ? 360 LEU A HB2  2  
ATOM   1884  H  HB3  . LEU A 1 53 ? 1.701   -8.515  -8.856  1.00 0.00 ? 360 LEU A HB3  2  
ATOM   1885  H  HG   . LEU A 1 53 ? 1.041   -7.783  -6.472  1.00 0.00 ? 360 LEU A HG   2  
ATOM   1886  H  HD11 . LEU A 1 53 ? 3.766   -6.504  -6.633  1.00 0.00 ? 360 LEU A HD11 2  
ATOM   1887  H  HD12 . LEU A 1 53 ? 3.266   -7.747  -5.485  1.00 0.00 ? 360 LEU A HD12 2  
ATOM   1888  H  HD13 . LEU A 1 53 ? 2.528   -6.147  -5.432  1.00 0.00 ? 360 LEU A HD13 2  
ATOM   1889  H  HD21 . LEU A 1 53 ? 0.964   -5.429  -7.170  1.00 0.00 ? 360 LEU A HD21 2  
ATOM   1890  H  HD22 . LEU A 1 53 ? 0.492   -6.527  -8.468  1.00 0.00 ? 360 LEU A HD22 2  
ATOM   1891  H  HD23 . LEU A 1 53 ? 2.095   -5.792  -8.473  1.00 0.00 ? 360 LEU A HD23 2  
ATOM   1892  N  N    . TYR A 1 54 ? 4.921   -9.678  -7.071  1.00 0.00 ? 361 TYR A N    2  
ATOM   1893  C  CA   . TYR A 1 54 ? 6.177   -9.868  -6.365  1.00 0.00 ? 361 TYR A CA   2  
ATOM   1894  C  C    . TYR A 1 54 ? 6.470   -8.715  -5.403  1.00 0.00 ? 361 TYR A C    2  
ATOM   1895  O  O    . TYR A 1 54 ? 6.492   -7.546  -5.793  1.00 0.00 ? 361 TYR A O    2  
ATOM   1896  C  CB   . TYR A 1 54 ? 7.327   -10.020 -7.369  1.00 0.00 ? 361 TYR A CB   2  
ATOM   1897  C  CG   . TYR A 1 54 ? 8.674   -10.265 -6.720  1.00 0.00 ? 361 TYR A CG   2  
ATOM   1898  C  CD1  . TYR A 1 54 ? 9.482   -9.204  -6.335  1.00 0.00 ? 361 TYR A CD1  2  
ATOM   1899  C  CD2  . TYR A 1 54 ? 9.133   -11.557 -6.483  1.00 0.00 ? 361 TYR A CD2  2  
ATOM   1900  C  CE1  . TYR A 1 54 ? 10.707  -9.416  -5.738  1.00 0.00 ? 361 TYR A CE1  2  
ATOM   1901  C  CE2  . TYR A 1 54 ? 10.361  -11.778 -5.887  1.00 0.00 ? 361 TYR A CE2  2  
ATOM   1902  C  CZ   . TYR A 1 54 ? 11.142  -10.705 -5.513  1.00 0.00 ? 361 TYR A CZ   2  
ATOM   1903  O  OH   . TYR A 1 54 ? 12.364  -10.924 -4.917  1.00 0.00 ? 361 TYR A OH   2  
ATOM   1904  H  H    . TYR A 1 54 ? 4.934   -9.321  -7.983  1.00 0.00 ? 361 TYR A H    2  
ATOM   1905  H  HA   . TYR A 1 54 ? 6.094   -10.780 -5.794  1.00 0.00 ? 361 TYR A HA   2  
ATOM   1906  H  HB2  . TYR A 1 54 ? 7.116   -10.854 -8.022  1.00 0.00 ? 361 TYR A HB2  2  
ATOM   1907  H  HB3  . TYR A 1 54 ? 7.400   -9.117  -7.959  1.00 0.00 ? 361 TYR A HB3  2  
ATOM   1908  H  HD1  . TYR A 1 54 ? 9.140   -8.195  -6.511  1.00 0.00 ? 361 TYR A HD1  2  
ATOM   1909  H  HD2  . TYR A 1 54 ? 8.518   -12.394 -6.777  1.00 0.00 ? 361 TYR A HD2  2  
ATOM   1910  H  HE1  . TYR A 1 54 ? 11.313  -8.573  -5.444  1.00 0.00 ? 361 TYR A HE1  2  
ATOM   1911  H  HE2  . TYR A 1 54 ? 10.701  -12.789 -5.712  1.00 0.00 ? 361 TYR A HE2  2  
ATOM   1912  H  HH   . TYR A 1 54 ? 12.449  -10.358 -4.142  1.00 0.00 ? 361 TYR A HH   2  
ATOM   1913  N  N    . MET A 1 55 ? 6.697   -9.064  -4.145  1.00 0.00 ? 362 MET A N    2  
ATOM   1914  C  CA   . MET A 1 55 ? 7.151   -8.111  -3.146  1.00 0.00 ? 362 MET A CA   2  
ATOM   1915  C  C    . MET A 1 55 ? 8.565   -8.461  -2.710  1.00 0.00 ? 362 MET A C    2  
ATOM   1916  O  O    . MET A 1 55 ? 8.823   -9.579  -2.268  1.00 0.00 ? 362 MET A O    2  
ATOM   1917  C  CB   . MET A 1 55 ? 6.232   -8.121  -1.921  1.00 0.00 ? 362 MET A CB   2  
ATOM   1918  C  CG   . MET A 1 55 ? 4.868   -7.495  -2.150  1.00 0.00 ? 362 MET A CG   2  
ATOM   1919  S  SD   . MET A 1 55 ? 3.822   -7.599  -0.683  1.00 0.00 ? 362 MET A SD   2  
ATOM   1920  C  CE   . MET A 1 55 ? 2.334   -6.795  -1.265  1.00 0.00 ? 362 MET A CE   2  
ATOM   1921  H  H    . MET A 1 55 ? 6.556   -9.997  -3.877  1.00 0.00 ? 362 MET A H    2  
ATOM   1922  H  HA   . MET A 1 55 ? 7.148   -7.128  -3.589  1.00 0.00 ? 362 MET A HA   2  
ATOM   1923  H  HB2  . MET A 1 55 ? 6.081   -9.145  -1.612  1.00 0.00 ? 362 MET A HB2  2  
ATOM   1924  H  HB3  . MET A 1 55 ? 6.718   -7.585  -1.119  1.00 0.00 ? 362 MET A HB3  2  
ATOM   1925  H  HG2  . MET A 1 55 ? 5.003   -6.455  -2.404  1.00 0.00 ? 362 MET A HG2  2  
ATOM   1926  H  HG3  . MET A 1 55 ? 4.380   -8.003  -2.967  1.00 0.00 ? 362 MET A HG3  2  
ATOM   1927  H  HE1  . MET A 1 55 ? 2.562   -5.781  -1.558  1.00 0.00 ? 362 MET A HE1  2  
ATOM   1928  H  HE2  . MET A 1 55 ? 1.598   -6.785  -0.474  1.00 0.00 ? 362 MET A HE2  2  
ATOM   1929  H  HE3  . MET A 1 55 ? 1.941   -7.335  -2.114  1.00 0.00 ? 362 MET A HE3  2  
ATOM   1930  N  N    . LYS A 1 56 ? 9.485   -7.523  -2.846  1.00 0.00 ? 363 LYS A N    2  
ATOM   1931  C  CA   . LYS A 1 56 ? 10.843  -7.738  -2.383  1.00 0.00 ? 363 LYS A CA   2  
ATOM   1932  C  C    . LYS A 1 56 ? 10.918  -7.362  -0.912  1.00 0.00 ? 363 LYS A C    2  
ATOM   1933  O  O    . LYS A 1 56 ? 10.366  -6.343  -0.502  1.00 0.00 ? 363 LYS A O    2  
ATOM   1934  C  CB   . LYS A 1 56 ? 11.836  -6.908  -3.194  1.00 0.00 ? 363 LYS A CB   2  
ATOM   1935  C  CG   . LYS A 1 56 ? 13.276  -7.351  -3.020  1.00 0.00 ? 363 LYS A CG   2  
ATOM   1936  C  CD   . LYS A 1 56 ? 14.234  -6.362  -3.653  1.00 0.00 ? 363 LYS A CD   2  
ATOM   1937  C  CE   . LYS A 1 56 ? 15.667  -6.853  -3.589  1.00 0.00 ? 363 LYS A CE   2  
ATOM   1938  N  NZ   . LYS A 1 56 ? 16.635  -5.789  -3.962  1.00 0.00 ? 363 LYS A NZ   2  
ATOM   1939  H  H    . LYS A 1 56 ? 9.245   -6.659  -3.248  1.00 0.00 ? 363 LYS A H    2  
ATOM   1940  H  HA   . LYS A 1 56 ? 11.075  -8.788  -2.492  1.00 0.00 ? 363 LYS A HA   2  
ATOM   1941  H  HB2  . LYS A 1 56 ? 11.579  -6.990  -4.251  1.00 0.00 ? 363 LYS A HB2  2  
ATOM   1942  H  HB3  . LYS A 1 56 ? 11.760  -5.866  -2.875  1.00 0.00 ? 363 LYS A HB3  2  
ATOM   1943  H  HG2  . LYS A 1 56 ? 13.496  -7.427  -1.966  1.00 0.00 ? 363 LYS A HG2  2  
ATOM   1944  H  HG3  . LYS A 1 56 ? 13.405  -8.316  -3.489  1.00 0.00 ? 363 LYS A HG3  2  
ATOM   1945  H  HD2  . LYS A 1 56 ? 13.957  -6.218  -4.688  1.00 0.00 ? 363 LYS A HD2  2  
ATOM   1946  H  HD3  . LYS A 1 56 ? 14.161  -5.422  -3.126  1.00 0.00 ? 363 LYS A HD3  2  
ATOM   1947  H  HE2  . LYS A 1 56 ? 15.879  -7.181  -2.583  1.00 0.00 ? 363 LYS A HE2  2  
ATOM   1948  H  HE3  . LYS A 1 56 ? 15.780  -7.684  -4.269  1.00 0.00 ? 363 LYS A HE3  2  
ATOM   1949  H  HZ1  . LYS A 1 56 ? 16.473  -5.479  -4.941  1.00 0.00 ? 363 LYS A HZ1  2  
ATOM   1950  H  HZ2  . LYS A 1 56 ? 17.607  -6.145  -3.879  1.00 0.00 ? 363 LYS A HZ2  2  
ATOM   1951  H  HZ3  . LYS A 1 56 ? 16.527  -4.969  -3.329  1.00 0.00 ? 363 LYS A HZ3  2  
ATOM   1952  N  N    . MET A 1 57 ? 11.594  -8.172  -0.119  1.00 0.00 ? 364 MET A N    2  
ATOM   1953  C  CA   . MET A 1 57 ? 11.593  -7.997  1.321   1.00 0.00 ? 364 MET A CA   2  
ATOM   1954  C  C    . MET A 1 57 ? 13.011  -8.102  1.836   1.00 0.00 ? 364 MET A C    2  
ATOM   1955  O  O    . MET A 1 57 ? 13.587  -9.189  1.884   1.00 0.00 ? 364 MET A O    2  
ATOM   1956  C  CB   . MET A 1 57 ? 10.705  -9.051  1.991   1.00 0.00 ? 364 MET A CB   2  
ATOM   1957  C  CG   . MET A 1 57 ? 9.275   -9.069  1.476   1.00 0.00 ? 364 MET A CG   2  
ATOM   1958  S  SD   . MET A 1 57 ? 8.295   -10.412 2.170   1.00 0.00 ? 364 MET A SD   2  
ATOM   1959  C  CE   . MET A 1 57 ? 6.777   -10.229 1.235   1.00 0.00 ? 364 MET A CE   2  
ATOM   1960  H  H    . MET A 1 57 ? 12.146  -8.880  -0.507  1.00 0.00 ? 364 MET A H    2  
ATOM   1961  H  HA   . MET A 1 57 ? 11.208  -7.011  1.540   1.00 0.00 ? 364 MET A HA   2  
ATOM   1962  H  HB2  . MET A 1 57 ? 11.134  -10.022 1.816   1.00 0.00 ? 364 MET A HB2  2  
ATOM   1963  H  HB3  . MET A 1 57 ? 10.681  -8.863  3.054   1.00 0.00 ? 364 MET A HB3  2  
ATOM   1964  H  HG2  . MET A 1 57 ? 8.807   -8.134  1.734   1.00 0.00 ? 364 MET A HG2  2  
ATOM   1965  H  HG3  . MET A 1 57 ? 9.297   -9.175  0.401   1.00 0.00 ? 364 MET A HG3  2  
ATOM   1966  H  HE1  . MET A 1 57 ? 6.341   -9.263  1.445   1.00 0.00 ? 364 MET A HE1  2  
ATOM   1967  H  HE2  . MET A 1 57 ? 6.084   -11.006 1.517   1.00 0.00 ? 364 MET A HE2  2  
ATOM   1968  H  HE3  . MET A 1 57 ? 6.994   -10.302 0.179   1.00 0.00 ? 364 MET A HE3  2  
ATOM   1969  N  N    . GLU A 1 58 ? 13.573  -6.971  2.196   1.00 0.00 ? 365 GLU A N    2  
ATOM   1970  C  CA   . GLU A 1 58 ? 14.946  -6.913  2.642   1.00 0.00 ? 365 GLU A CA   2  
ATOM   1971  C  C    . GLU A 1 58 ? 15.009  -6.383  4.069   1.00 0.00 ? 365 GLU A C    2  
ATOM   1972  O  O    . GLU A 1 58 ? 14.469  -5.317  4.369   1.00 0.00 ? 365 GLU A O    2  
ATOM   1973  C  CB   . GLU A 1 58 ? 15.750  -6.026  1.696   1.00 0.00 ? 365 GLU A CB   2  
ATOM   1974  C  CG   . GLU A 1 58 ? 15.888  -6.592  0.294   1.00 0.00 ? 365 GLU A CG   2  
ATOM   1975  C  CD   . GLU A 1 58 ? 16.628  -5.657  -0.642  1.00 0.00 ? 365 GLU A CD   2  
ATOM   1976  O  OE1  . GLU A 1 58 ? 16.098  -4.568  -0.947  1.00 0.00 ? 365 GLU A OE1  2  
ATOM   1977  O  OE2  . GLU A 1 58 ? 17.732  -6.015  -1.100  1.00 0.00 ? 365 GLU A OE2  2  
ATOM   1978  H  H    . GLU A 1 58 ? 13.048  -6.143  2.164   1.00 0.00 ? 365 GLU A H    2  
ATOM   1979  H  HA   . GLU A 1 58 ? 15.349  -7.914  2.618   1.00 0.00 ? 365 GLU A HA   2  
ATOM   1980  H  HB2  . GLU A 1 58 ? 15.247  -5.077  1.618   1.00 0.00 ? 365 GLU A HB2  2  
ATOM   1981  H  HB3  . GLU A 1 58 ? 16.736  -5.877  2.104   1.00 0.00 ? 365 GLU A HB3  2  
ATOM   1982  H  HG2  . GLU A 1 58 ? 16.428  -7.525  0.348   1.00 0.00 ? 365 GLU A HG2  2  
ATOM   1983  H  HG3  . GLU A 1 58 ? 14.901  -6.772  -0.107  1.00 0.00 ? 365 GLU A HG3  2  
ATOM   1984  N  N    . PRO A 1 59 ? 15.640  -7.136  4.973   1.00 0.00 ? 366 PRO A N    2  
ATOM   1985  C  CA   . PRO A 1 59 ? 15.732  -6.763  6.380   1.00 0.00 ? 366 PRO A CA   2  
ATOM   1986  C  C    . PRO A 1 59 ? 16.842  -5.749  6.653   1.00 0.00 ? 366 PRO A C    2  
ATOM   1987  O  O    . PRO A 1 59 ? 17.974  -5.904  6.197   1.00 0.00 ? 366 PRO A O    2  
ATOM   1988  C  CB   . PRO A 1 59 ? 16.039  -8.094  7.062   1.00 0.00 ? 366 PRO A CB   2  
ATOM   1989  C  CG   . PRO A 1 59 ? 16.806  -8.872  6.047   1.00 0.00 ? 366 PRO A CG   2  
ATOM   1990  C  CD   . PRO A 1 59 ? 16.312  -8.419  4.695   1.00 0.00 ? 366 PRO A CD   2  
ATOM   1991  H  HA   . PRO A 1 59 ? 14.794  -6.375  6.748   1.00 0.00 ? 366 PRO A HA   2  
ATOM   1992  H  HB2  . PRO A 1 59 ? 16.624  -7.920  7.954   1.00 0.00 ? 366 PRO A HB2  2  
ATOM   1993  H  HB3  . PRO A 1 59 ? 15.114  -8.590  7.320   1.00 0.00 ? 366 PRO A HB3  2  
ATOM   1994  H  HG2  . PRO A 1 59 ? 17.861  -8.661  6.148   1.00 0.00 ? 366 PRO A HG2  2  
ATOM   1995  H  HG3  . PRO A 1 59 ? 16.622  -9.928  6.178   1.00 0.00 ? 366 PRO A HG3  2  
ATOM   1996  H  HD2  . PRO A 1 59 ? 17.141  -8.279  4.020   1.00 0.00 ? 366 PRO A HD2  2  
ATOM   1997  H  HD3  . PRO A 1 59 ? 15.613  -9.138  4.293   1.00 0.00 ? 366 PRO A HD3  2  
ATOM   1998  N  N    . VAL A 1 60 ? 16.503  -4.710  7.396   1.00 0.00 ? 367 VAL A N    2  
ATOM   1999  C  CA   . VAL A 1 60 ? 17.479  -3.725  7.825   1.00 0.00 ? 367 VAL A CA   2  
ATOM   2000  C  C    . VAL A 1 60 ? 17.541  -3.694  9.349   1.00 0.00 ? 367 VAL A C    2  
ATOM   2001  O  O    . VAL A 1 60 ? 16.555  -3.382  10.020  1.00 0.00 ? 367 VAL A O    2  
ATOM   2002  C  CB   . VAL A 1 60 ? 17.175  -2.313  7.268   1.00 0.00 ? 367 VAL A CB   2  
ATOM   2003  C  CG1  . VAL A 1 60 ? 17.553  -2.231  5.797   1.00 0.00 ? 367 VAL A CG1  2  
ATOM   2004  C  CG2  . VAL A 1 60 ? 15.710  -1.945  7.451   1.00 0.00 ? 367 VAL A CG2  2  
ATOM   2005  H  H    . VAL A 1 60 ? 15.567  -4.610  7.683   1.00 0.00 ? 367 VAL A H    2  
ATOM   2006  H  HA   . VAL A 1 60 ? 18.444  -4.037  7.449   1.00 0.00 ? 367 VAL A HA   2  
ATOM   2007  H  HB   . VAL A 1 60 ? 17.775  -1.596  7.811   1.00 0.00 ? 367 VAL A HB   2  
ATOM   2008  H  HG11 . VAL A 1 60 ? 18.608  -2.427  5.686   1.00 0.00 ? 367 VAL A HG11 2  
ATOM   2009  H  HG12 . VAL A 1 60 ? 17.327  -1.243  5.423   1.00 0.00 ? 367 VAL A HG12 2  
ATOM   2010  H  HG13 . VAL A 1 60 ? 16.990  -2.964  5.238   1.00 0.00 ? 367 VAL A HG13 2  
ATOM   2011  H  HG21 . VAL A 1 60 ? 15.461  -1.978  8.500   1.00 0.00 ? 367 VAL A HG21 2  
ATOM   2012  H  HG22 . VAL A 1 60 ? 15.093  -2.648  6.912   1.00 0.00 ? 367 VAL A HG22 2  
ATOM   2013  H  HG23 . VAL A 1 60 ? 15.539  -0.949  7.071   1.00 0.00 ? 367 VAL A HG23 2  
ATOM   2014  N  N    . LYS A 1 61 ? 18.689  -4.056  9.895   1.00 0.00 ? 368 LYS A N    2  
ATOM   2015  C  CA   . LYS A 1 61 ? 18.832  -4.159  11.337  1.00 0.00 ? 368 LYS A CA   2  
ATOM   2016  C  C    . LYS A 1 61 ? 19.201  -2.823  11.955  1.00 0.00 ? 368 LYS A C    2  
ATOM   2017  O  O    . LYS A 1 61 ? 19.857  -1.984  11.332  1.00 0.00 ? 368 LYS A O    2  
ATOM   2018  C  CB   . LYS A 1 61 ? 19.867  -5.218  11.712  1.00 0.00 ? 368 LYS A CB   2  
ATOM   2019  C  CG   . LYS A 1 61 ? 21.223  -5.014  11.061  1.00 0.00 ? 368 LYS A CG   2  
ATOM   2020  C  CD   . LYS A 1 61 ? 22.232  -6.021  11.576  1.00 0.00 ? 368 LYS A CD   2  
ATOM   2021  C  CE   . LYS A 1 61 ? 22.698  -5.688  12.984  1.00 0.00 ? 368 LYS A CE   2  
ATOM   2022  N  NZ   . LYS A 1 61 ? 23.683  -6.680  13.494  1.00 0.00 ? 368 LYS A NZ   2  
ATOM   2023  H  H    . LYS A 1 61 ? 19.460  -4.244  9.319   1.00 0.00 ? 368 LYS A H    2  
ATOM   2024  H  HA   . LYS A 1 61 ? 17.874  -4.462  11.734  1.00 0.00 ? 368 LYS A HA   2  
ATOM   2025  H  HB2  . LYS A 1 61 ? 20.002  -5.206  12.783  1.00 0.00 ? 368 LYS A HB2  2  
ATOM   2026  H  HB3  . LYS A 1 61 ? 19.495  -6.187  11.419  1.00 0.00 ? 368 LYS A HB3  2  
ATOM   2027  H  HG2  . LYS A 1 61 ? 21.121  -5.134  9.993   1.00 0.00 ? 368 LYS A HG2  2  
ATOM   2028  H  HG3  . LYS A 1 61 ? 21.574  -4.019  11.283  1.00 0.00 ? 368 LYS A HG3  2  
ATOM   2029  H  HD2  . LYS A 1 61 ? 21.766  -6.992  11.590  1.00 0.00 ? 368 LYS A HD2  2  
ATOM   2030  H  HD3  . LYS A 1 61 ? 23.084  -6.034  10.916  1.00 0.00 ? 368 LYS A HD3  2  
ATOM   2031  H  HE2  . LYS A 1 61 ? 23.158  -4.712  12.976  1.00 0.00 ? 368 LYS A HE2  2  
ATOM   2032  H  HE3  . LYS A 1 61 ? 21.842  -5.674  13.641  1.00 0.00 ? 368 LYS A HE3  2  
ATOM   2033  H  HZ1  . LYS A 1 61 ? 23.951  -6.446  14.469  1.00 0.00 ? 368 LYS A HZ1  2  
ATOM   2034  H  HZ2  . LYS A 1 61 ? 24.536  -6.676  12.902  1.00 0.00 ? 368 LYS A HZ2  2  
ATOM   2035  H  HZ3  . LYS A 1 61 ? 23.270  -7.635  13.482  1.00 0.00 ? 368 LYS A HZ3  2  
ATOM   2036  N  N    . GLU A 1 62 ? 18.791  -2.651  13.194  1.00 0.00 ? 369 GLU A N    2  
ATOM   2037  C  CA   . GLU A 1 62 ? 18.972  -1.403  13.922  1.00 0.00 ? 369 GLU A CA   2  
ATOM   2038  C  C    . GLU A 1 62 ? 19.185  -1.711  15.401  1.00 0.00 ? 369 GLU A C    2  
ATOM   2039  O  O    . GLU A 1 62 ? 19.165  -2.871  15.808  1.00 0.00 ? 369 GLU A O    2  
ATOM   2040  C  CB   . GLU A 1 62 ? 17.765  -0.474  13.756  1.00 0.00 ? 369 GLU A CB   2  
ATOM   2041  C  CG   . GLU A 1 62 ? 17.369  -0.194  12.317  1.00 0.00 ? 369 GLU A CG   2  
ATOM   2042  C  CD   . GLU A 1 62 ? 16.124  0.661   12.227  1.00 0.00 ? 369 GLU A CD   2  
ATOM   2043  O  OE1  . GLU A 1 62 ? 15.057  0.219   12.701  1.00 0.00 ? 369 GLU A OE1  2  
ATOM   2044  O  OE2  . GLU A 1 62 ? 16.208  1.789   11.695  1.00 0.00 ? 369 GLU A OE2  2  
ATOM   2045  H  H    . GLU A 1 62 ? 18.359  -3.404  13.650  1.00 0.00 ? 369 GLU A H    2  
ATOM   2046  H  HA   . GLU A 1 62 ? 19.855  -0.916  13.533  1.00 0.00 ? 369 GLU A HA   2  
ATOM   2047  H  HB2  . GLU A 1 62 ? 16.919  -0.919  14.252  1.00 0.00 ? 369 GLU A HB2  2  
ATOM   2048  H  HB3  . GLU A 1 62 ? 17.989  0.470   14.231  1.00 0.00 ? 369 GLU A HB3  2  
ATOM   2049  H  HG2  . GLU A 1 62 ? 18.181  0.320   11.824  1.00 0.00 ? 369 GLU A HG2  2  
ATOM   2050  H  HG3  . GLU A 1 62 ? 17.182  -1.134  11.819  1.00 0.00 ? 369 GLU A HG3  2  
ATOM   2051  N  N    . LEU A 1 63 ? 19.412  -0.674  16.185  1.00 0.00 ? 370 LEU A N    2  
ATOM   2052  C  CA   . LEU A 1 63 ? 19.722  -0.789  17.573  1.00 0.00 ? 370 LEU A CA   2  
ATOM   2053  C  C    . LEU A 1 63 ? 18.945  0.260   18.358  1.00 0.00 ? 370 LEU A C    2  
ATOM   2054  O  O    . LEU A 1 63 ? 19.351  0.666   19.450  1.00 0.00 ? 370 LEU A O    2  
ATOM   2055  C  CB   . LEU A 1 63 ? 21.209  -0.552  17.771  1.00 0.00 ? 370 LEU A CB   2  
ATOM   2056  C  CG   . LEU A 1 63 ? 21.856  0.533   16.895  1.00 0.00 ? 370 LEU A CG   2  
ATOM   2057  C  CD1  . LEU A 1 63 ? 23.035  1.153   17.626  1.00 0.00 ? 370 LEU A CD1  2  
ATOM   2058  C  CD2  . LEU A 1 63 ? 22.326  -0.040  15.565  1.00 0.00 ? 370 LEU A CD2  2  
ATOM   2059  H  H    . LEU A 1 63 ? 19.368  0.208   15.827  1.00 0.00 ? 370 LEU A H    2  
ATOM   2060  H  HA   . LEU A 1 63 ? 19.459  -1.777  17.916  1.00 0.00 ? 370 LEU A HA   2  
ATOM   2061  H  HB2  . LEU A 1 63 ? 21.326  -0.250  18.774  1.00 0.00 ? 370 LEU A HB2  2  
ATOM   2062  H  HB3  . LEU A 1 63 ? 21.737  -1.481  17.616  1.00 0.00 ? 370 LEU A HB3  2  
ATOM   2063  H  HG   . LEU A 1 63 ? 21.133  1.310   16.695  1.00 0.00 ? 370 LEU A HG   2  
ATOM   2064  H  HD11 . LEU A 1 63 ? 22.695  1.589   18.553  1.00 0.00 ? 370 LEU A HD11 2  
ATOM   2065  H  HD12 . LEU A 1 63 ? 23.478  1.920   17.009  1.00 0.00 ? 370 LEU A HD12 2  
ATOM   2066  H  HD13 . LEU A 1 63 ? 23.770  0.390   17.834  1.00 0.00 ? 370 LEU A HD13 2  
ATOM   2067  H  HD21 . LEU A 1 63 ? 21.482  -0.459  15.036  1.00 0.00 ? 370 LEU A HD21 2  
ATOM   2068  H  HD22 . LEU A 1 63 ? 23.059  -0.812  15.744  1.00 0.00 ? 370 LEU A HD22 2  
ATOM   2069  H  HD23 . LEU A 1 63 ? 22.769  0.745   14.971  1.00 0.00 ? 370 LEU A HD23 2  
ATOM   2070  N  N    . THR A 1 64 ? 17.834  0.702   17.784  1.00 0.00 ? 371 THR A N    2  
ATOM   2071  C  CA   . THR A 1 64 ? 17.068  1.809   18.335  1.00 0.00 ? 371 THR A CA   2  
ATOM   2072  C  C    . THR A 1 64 ? 16.533  1.486   19.733  1.00 0.00 ? 371 THR A C    2  
ATOM   2073  O  O    . THR A 1 64 ? 15.738  0.564   19.913  1.00 0.00 ? 371 THR A O    2  
ATOM   2074  C  CB   . THR A 1 64 ? 15.898  2.157   17.395  1.00 0.00 ? 371 THR A CB   2  
ATOM   2075  O  OG1  . THR A 1 64 ? 16.388  2.290   16.052  1.00 0.00 ? 371 THR A OG1  2  
ATOM   2076  C  CG2  . THR A 1 64 ? 15.219  3.449   17.820  1.00 0.00 ? 371 THR A CG2  2  
ATOM   2077  H  H    . THR A 1 64 ? 17.511  0.265   16.968  1.00 0.00 ? 371 THR A H    2  
ATOM   2078  H  HA   . THR A 1 64 ? 17.718  2.668   18.399  1.00 0.00 ? 371 THR A HA   2  
ATOM   2079  H  HB   . THR A 1 64 ? 15.174  1.355   17.431  1.00 0.00 ? 371 THR A HB   2  
ATOM   2080  H  HG1  . THR A 1 64 ? 15.642  2.358   15.442  1.00 0.00 ? 371 THR A HG1  2  
ATOM   2081  H  HG21 . THR A 1 64 ? 14.407  3.668   17.143  1.00 0.00 ? 371 THR A HG21 2  
ATOM   2082  H  HG22 . THR A 1 64 ? 15.936  4.257   17.796  1.00 0.00 ? 371 THR A HG22 2  
ATOM   2083  H  HG23 . THR A 1 64 ? 14.833  3.341   18.823  1.00 0.00 ? 371 THR A HG23 2  
ATOM   2084  N  N    . GLY A 1 65 ? 16.974  2.258   20.719  1.00 0.00 ? 372 GLY A N    2  
ATOM   2085  C  CA   . GLY A 1 65 ? 16.517  2.057   22.078  1.00 0.00 ? 372 GLY A CA   2  
ATOM   2086  C  C    . GLY A 1 65 ? 17.469  1.197   22.886  1.00 0.00 ? 372 GLY A C    2  
ATOM   2087  O  O    . GLY A 1 65 ? 18.678  1.442   22.904  1.00 0.00 ? 372 GLY A O    2  
ATOM   2088  H  H    . GLY A 1 65 ? 17.630  2.960   20.525  1.00 0.00 ? 372 GLY A H    2  
ATOM   2089  H  HA2  . GLY A 1 65 ? 16.422  3.019   22.560  1.00 0.00 ? 372 GLY A HA2  2  
ATOM   2090  H  HA3  . GLY A 1 65 ? 15.549  1.579   22.054  1.00 0.00 ? 372 GLY A HA3  2  
ATOM   2091  N  N    . GLY A 1 66 ? 16.927  0.184   23.547  1.00 0.00 ? 373 GLY A N    2  
ATOM   2092  C  CA   . GLY A 1 66 ? 17.742  -0.688  24.368  1.00 0.00 ? 373 GLY A CA   2  
ATOM   2093  C  C    . GLY A 1 66 ? 17.818  -2.095  23.811  1.00 0.00 ? 373 GLY A C    2  
ATOM   2094  O  O    . GLY A 1 66 ? 17.504  -3.062  24.505  1.00 0.00 ? 373 GLY A O    2  
ATOM   2095  H  H    . GLY A 1 66 ? 15.962  0.023   23.475  1.00 0.00 ? 373 GLY A H    2  
ATOM   2096  H  HA2  . GLY A 1 66 ? 18.741  -0.281  24.427  1.00 0.00 ? 373 GLY A HA2  2  
ATOM   2097  H  HA3  . GLY A 1 66 ? 17.320  -0.728  25.361  1.00 0.00 ? 373 GLY A HA3  2  
ATOM   2098  N  N    . GLY A 1 67 ? 18.218  -2.206  22.555  1.00 0.00 ? 374 GLY A N    2  
ATOM   2099  C  CA   . GLY A 1 67 ? 18.358  -3.505  21.932  1.00 0.00 ? 374 GLY A CA   2  
ATOM   2100  C  C    . GLY A 1 67 ? 18.310  -3.413  20.425  1.00 0.00 ? 374 GLY A C    2  
ATOM   2101  O  O    . GLY A 1 67 ? 18.165  -2.324  19.873  1.00 0.00 ? 374 GLY A O    2  
ATOM   2102  H  H    . GLY A 1 67 ? 18.408  -1.396  22.036  1.00 0.00 ? 374 GLY A H    2  
ATOM   2103  H  HA2  . GLY A 1 67 ? 19.301  -3.936  22.229  1.00 0.00 ? 374 GLY A HA2  2  
ATOM   2104  H  HA3  . GLY A 1 67 ? 17.556  -4.145  22.269  1.00 0.00 ? 374 GLY A HA3  2  
ATOM   2105  N  N    . THR A 1 68 ? 18.441  -4.549  19.757  1.00 0.00 ? 375 THR A N    2  
ATOM   2106  C  CA   . THR A 1 68 ? 18.388  -4.588  18.307  1.00 0.00 ? 375 THR A CA   2  
ATOM   2107  C  C    . THR A 1 68 ? 16.945  -4.499  17.824  1.00 0.00 ? 375 THR A C    2  
ATOM   2108  O  O    . THR A 1 68 ? 16.059  -5.138  18.389  1.00 0.00 ? 375 THR A O    2  
ATOM   2109  C  CB   . THR A 1 68 ? 19.040  -5.874  17.759  1.00 0.00 ? 375 THR A CB   2  
ATOM   2110  O  OG1  . THR A 1 68 ? 18.513  -7.020  18.440  1.00 0.00 ? 375 THR A OG1  2  
ATOM   2111  C  CG2  . THR A 1 68 ? 20.553  -5.832  17.921  1.00 0.00 ? 375 THR A CG2  2  
ATOM   2112  H  H    . THR A 1 68 ? 18.567  -5.384  20.255  1.00 0.00 ? 375 THR A H    2  
ATOM   2113  H  HA   . THR A 1 68 ? 18.939  -3.740  17.928  1.00 0.00 ? 375 THR A HA   2  
ATOM   2114  H  HB   . THR A 1 68 ? 18.808  -5.955  16.707  1.00 0.00 ? 375 THR A HB   2  
ATOM   2115  H  HG1  . THR A 1 68 ? 17.747  -6.753  18.971  1.00 0.00 ? 375 THR A HG1  2  
ATOM   2116  H  HG21 . THR A 1 68 ? 20.802  -5.733  18.968  1.00 0.00 ? 375 THR A HG21 2  
ATOM   2117  H  HG22 . THR A 1 68 ? 20.949  -4.989  17.375  1.00 0.00 ? 375 THR A HG22 2  
ATOM   2118  H  HG23 . THR A 1 68 ? 20.983  -6.745  17.535  1.00 0.00 ? 375 THR A HG23 2  
ATOM   2119  N  N    . THR A 1 69 ? 16.710  -3.716  16.781  1.00 0.00 ? 376 THR A N    2  
ATOM   2120  C  CA   . THR A 1 69 ? 15.394  -3.550  16.258  1.00 0.00 ? 376 THR A CA   2  
ATOM   2121  C  C    . THR A 1 69 ? 15.396  -3.990  14.814  1.00 0.00 ? 376 THR A C    2  
ATOM   2122  O  O    . THR A 1 69 ? 16.152  -3.499  13.976  1.00 0.00 ? 376 THR A O    2  
ATOM   2123  C  CB   . THR A 1 69 ? 14.899  -2.093  16.385  1.00 0.00 ? 376 THR A CB   2  
ATOM   2124  O  OG1  . THR A 1 69 ? 15.632  -1.229  15.520  1.00 0.00 ? 376 THR A OG1  2  
ATOM   2125  C  CG2  . THR A 1 69 ? 15.069  -1.604  17.807  1.00 0.00 ? 376 THR A CG2  2  
ATOM   2126  H  H    . THR A 1 69 ? 17.440  -3.280  16.326  1.00 0.00 ? 376 THR A H    2  
ATOM   2127  H  HA   . THR A 1 69 ? 14.728  -4.190  16.821  1.00 0.00 ? 376 THR A HA   2  
ATOM   2128  H  HB   . THR A 1 69 ? 13.850  -2.053  16.128  1.00 0.00 ? 376 THR A HB   2  
ATOM   2129  H  HG1  . THR A 1 69 ? 15.328  -1.350  14.612  1.00 0.00 ? 376 THR A HG1  2  
ATOM   2130  H  HG21 . THR A 1 69 ? 14.679  -2.347  18.488  1.00 0.00 ? 376 THR A HG21 2  
ATOM   2131  H  HG22 . THR A 1 69 ? 14.538  -0.674  17.936  1.00 0.00 ? 376 THR A HG22 2  
ATOM   2132  H  HG23 . THR A 1 69 ? 16.123  -1.446  18.002  1.00 0.00 ? 376 THR A HG23 2  
ATOM   2133  N  N    . PHE A 1 70 ? 14.577  -4.954  14.569  1.00 0.00 ? 377 PHE A N    2  
ATOM   2134  C  CA   . PHE A 1 70 ? 14.432  -5.550  13.260  1.00 0.00 ? 377 PHE A CA   2  
ATOM   2135  C  C    . PHE A 1 70 ? 13.402  -4.792  12.423  1.00 0.00 ? 377 PHE A C    2  
ATOM   2136  O  O    . PHE A 1 70 ? 12.205  -4.822  12.708  1.00 0.00 ? 377 PHE A O    2  
ATOM   2137  C  CB   . PHE A 1 70 ? 14.038  -7.019  13.438  1.00 0.00 ? 377 PHE A CB   2  
ATOM   2138  C  CG   . PHE A 1 70 ? 13.555  -7.687  12.189  1.00 0.00 ? 377 PHE A CG   2  
ATOM   2139  C  CD1  . PHE A 1 70 ? 14.443  -8.122  11.225  1.00 0.00 ? 377 PHE A CD1  2  
ATOM   2140  C  CD2  . PHE A 1 70 ? 12.203  -7.885  11.996  1.00 0.00 ? 377 PHE A CD2  2  
ATOM   2141  C  CE1  . PHE A 1 70 ? 13.988  -8.746  10.079  1.00 0.00 ? 377 PHE A CE1  2  
ATOM   2142  C  CE2  . PHE A 1 70 ? 11.736  -8.509  10.856  1.00 0.00 ? 377 PHE A CE2  2  
ATOM   2143  C  CZ   . PHE A 1 70 ? 12.631  -8.941  9.894   1.00 0.00 ? 377 PHE A CZ   2  
ATOM   2144  H  H    . PHE A 1 70 ? 14.065  -5.301  15.313  1.00 0.00 ? 377 PHE A H    2  
ATOM   2145  H  HA   . PHE A 1 70 ? 15.389  -5.502  12.764  1.00 0.00 ? 377 PHE A HA   2  
ATOM   2146  H  HB2  . PHE A 1 70 ? 14.908  -7.575  13.789  1.00 0.00 ? 377 PHE A HB2  2  
ATOM   2147  H  HB3  . PHE A 1 70 ? 13.238  -7.078  14.180  1.00 0.00 ? 377 PHE A HB3  2  
ATOM   2148  H  HD1  . PHE A 1 70 ? 15.502  -7.967  11.371  1.00 0.00 ? 377 PHE A HD1  2  
ATOM   2149  H  HD2  . PHE A 1 70 ? 11.510  -7.540  12.752  1.00 0.00 ? 377 PHE A HD2  2  
ATOM   2150  H  HE1  . PHE A 1 70 ? 14.690  -9.083  9.331   1.00 0.00 ? 377 PHE A HE1  2  
ATOM   2151  H  HE2  . PHE A 1 70 ? 10.677  -8.659  10.715  1.00 0.00 ? 377 PHE A HE2  2  
ATOM   2152  H  HZ   . PHE A 1 70 ? 12.272  -9.429  9.001   1.00 0.00 ? 377 PHE A HZ   2  
ATOM   2153  N  N    . SER A 1 71 ? 13.880  -4.095  11.405  1.00 0.00 ? 378 SER A N    2  
ATOM   2154  C  CA   . SER A 1 71 ? 13.008  -3.394  10.481  1.00 0.00 ? 378 SER A CA   2  
ATOM   2155  C  C    . SER A 1 71 ? 13.135  -4.000  9.090   1.00 0.00 ? 378 SER A C    2  
ATOM   2156  O  O    . SER A 1 71 ? 14.124  -4.670  8.784   1.00 0.00 ? 378 SER A O    2  
ATOM   2157  C  CB   . SER A 1 71 ? 13.358  -1.904  10.453  1.00 0.00 ? 378 SER A CB   2  
ATOM   2158  O  OG   . SER A 1 71 ? 13.191  -1.318  11.733  1.00 0.00 ? 378 SER A OG   2  
ATOM   2159  H  H    . SER A 1 71 ? 14.850  -4.049  11.267  1.00 0.00 ? 378 SER A H    2  
ATOM   2160  H  HA   . SER A 1 71 ? 11.991  -3.514  10.825  1.00 0.00 ? 378 SER A HA   2  
ATOM   2161  H  HB2  . SER A 1 71 ? 14.387  -1.785  10.150  1.00 0.00 ? 378 SER A HB2  2  
ATOM   2162  H  HB3  . SER A 1 71 ? 12.713  -1.397  9.750   1.00 0.00 ? 378 SER A HB3  2  
ATOM   2163  H  HG   . SER A 1 71 ? 13.975  -0.778  11.945  1.00 0.00 ? 378 SER A HG   2  
ATOM   2164  N  N    . VAL A 1 72 ? 12.136  -3.788  8.251   1.00 0.00 ? 379 VAL A N    2  
ATOM   2165  C  CA   . VAL A 1 72 ? 12.166  -4.320  6.901   1.00 0.00 ? 379 VAL A CA   2  
ATOM   2166  C  C    . VAL A 1 72 ? 11.918  -3.211  5.895   1.00 0.00 ? 379 VAL A C    2  
ATOM   2167  O  O    . VAL A 1 72 ? 11.081  -2.333  6.116   1.00 0.00 ? 379 VAL A O    2  
ATOM   2168  C  CB   . VAL A 1 72 ? 11.099  -5.415  6.681   1.00 0.00 ? 379 VAL A CB   2  
ATOM   2169  C  CG1  . VAL A 1 72 ? 11.380  -6.203  5.408   1.00 0.00 ? 379 VAL A CG1  2  
ATOM   2170  C  CG2  . VAL A 1 72 ? 10.995  -6.348  7.880   1.00 0.00 ? 379 VAL A CG2  2  
ATOM   2171  H  H    . VAL A 1 72 ? 11.363  -3.259  8.542   1.00 0.00 ? 379 VAL A H    2  
ATOM   2172  H  HA   . VAL A 1 72 ? 13.144  -4.747  6.726   1.00 0.00 ? 379 VAL A HA   2  
ATOM   2173  H  HB   . VAL A 1 72 ? 10.152  -4.922  6.554   1.00 0.00 ? 379 VAL A HB   2  
ATOM   2174  H  HG11 . VAL A 1 72 ? 12.348  -6.676  5.483   1.00 0.00 ? 379 VAL A HG11 2  
ATOM   2175  H  HG12 . VAL A 1 72 ? 11.369  -5.534  4.562   1.00 0.00 ? 379 VAL A HG12 2  
ATOM   2176  H  HG13 . VAL A 1 72 ? 10.618  -6.959  5.280   1.00 0.00 ? 379 VAL A HG13 2  
ATOM   2177  H  HG21 . VAL A 1 72 ? 10.737  -5.776  8.758   1.00 0.00 ? 379 VAL A HG21 2  
ATOM   2178  H  HG22 . VAL A 1 72 ? 11.943  -6.841  8.038   1.00 0.00 ? 379 VAL A HG22 2  
ATOM   2179  H  HG23 . VAL A 1 72 ? 10.231  -7.089  7.694   1.00 0.00 ? 379 VAL A HG23 2  
ATOM   2180  N  N    . ARG A 1 73 ? 12.647  -3.255  4.799   1.00 0.00 ? 380 ARG A N    2  
ATOM   2181  C  CA   . ARG A 1 73 ? 12.406  -2.361  3.683   1.00 0.00 ? 380 ARG A CA   2  
ATOM   2182  C  C    . ARG A 1 73 ? 11.779  -3.160  2.550   1.00 0.00 ? 380 ARG A C    2  
ATOM   2183  O  O    . ARG A 1 73 ? 12.465  -3.845  1.789   1.00 0.00 ? 380 ARG A O    2  
ATOM   2184  C  CB   . ARG A 1 73 ? 13.699  -1.650  3.237   1.00 0.00 ? 380 ARG A CB   2  
ATOM   2185  C  CG   . ARG A 1 73 ? 14.872  -2.580  2.956   1.00 0.00 ? 380 ARG A CG   2  
ATOM   2186  C  CD   . ARG A 1 73 ? 15.302  -2.530  1.495   1.00 0.00 ? 380 ARG A CD   2  
ATOM   2187  N  NE   . ARG A 1 73 ? 15.942  -1.265  1.142   1.00 0.00 ? 380 ARG A NE   2  
ATOM   2188  C  CZ   . ARG A 1 73 ? 16.930  -1.155  0.250   1.00 0.00 ? 380 ARG A CZ   2  
ATOM   2189  N  NH1  . ARG A 1 73 ? 17.322  -2.214  -0.451  1.00 0.00 ? 380 ARG A NH1  2  
ATOM   2190  N  NH2  . ARG A 1 73 ? 17.500  0.023   0.036   1.00 0.00 ? 380 ARG A NH2  2  
ATOM   2191  H  H    . ARG A 1 73 ? 13.353  -3.933  4.728   1.00 0.00 ? 380 ARG A H    2  
ATOM   2192  H  HA   . ARG A 1 73 ? 11.691  -1.617  4.011   1.00 0.00 ? 380 ARG A HA   2  
ATOM   2193  H  HB2  . ARG A 1 73 ? 13.492  -1.094  2.335   1.00 0.00 ? 380 ARG A HB2  2  
ATOM   2194  H  HB3  . ARG A 1 73 ? 13.996  -0.958  4.011   1.00 0.00 ? 380 ARG A HB3  2  
ATOM   2195  H  HG2  . ARG A 1 73 ? 15.706  -2.286  3.574   1.00 0.00 ? 380 ARG A HG2  2  
ATOM   2196  H  HG3  . ARG A 1 73 ? 14.580  -3.591  3.203   1.00 0.00 ? 380 ARG A HG3  2  
ATOM   2197  H  HD2  . ARG A 1 73 ? 15.999  -3.333  1.313   1.00 0.00 ? 380 ARG A HD2  2  
ATOM   2198  H  HD3  . ARG A 1 73 ? 14.429  -2.667  0.874   1.00 0.00 ? 380 ARG A HD3  2  
ATOM   2199  H  HE   . ARG A 1 73 ? 15.633  -0.456  1.610   1.00 0.00 ? 380 ARG A HE   2  
ATOM   2200  H  HH11 . ARG A 1 73 ? 16.871  -3.111  -0.322  1.00 0.00 ? 380 ARG A HH11 2  
ATOM   2201  H  HH12 . ARG A 1 73 ? 18.076  -2.133  -1.104  1.00 0.00 ? 380 ARG A HH12 2  
ATOM   2202  H  HH21 . ARG A 1 73 ? 17.187  0.832   0.542   1.00 0.00 ? 380 ARG A HH21 2  
ATOM   2203  H  HH22 . ARG A 1 73 ? 18.249  0.111   -0.622  1.00 0.00 ? 380 ARG A HH22 2  
ATOM   2204  N  N    . LYS A 1 74 ? 10.460  -3.126  2.481   1.00 0.00 ? 381 LYS A N    2  
ATOM   2205  C  CA   . LYS A 1 74 ? 9.746   -3.918  1.504   1.00 0.00 ? 381 LYS A CA   2  
ATOM   2206  C  C    . LYS A 1 74 ? 9.500   -3.102  0.249   1.00 0.00 ? 381 LYS A C    2  
ATOM   2207  O  O    . LYS A 1 74 ? 8.766   -2.113  0.262   1.00 0.00 ? 381 LYS A O    2  
ATOM   2208  C  CB   . LYS A 1 74 ? 8.423   -4.430  2.077   1.00 0.00 ? 381 LYS A CB   2  
ATOM   2209  C  CG   . LYS A 1 74 ? 7.758   -5.482  1.201   1.00 0.00 ? 381 LYS A CG   2  
ATOM   2210  C  CD   . LYS A 1 74 ? 6.407   -5.910  1.749   1.00 0.00 ? 381 LYS A CD   2  
ATOM   2211  C  CE   . LYS A 1 74 ? 6.535   -6.579  3.109   1.00 0.00 ? 381 LYS A CE   2  
ATOM   2212  N  NZ   . LYS A 1 74 ? 5.220   -7.017  3.645   1.00 0.00 ? 381 LYS A NZ   2  
ATOM   2213  H  H    . LYS A 1 74 ? 9.959   -2.544  3.092   1.00 0.00 ? 381 LYS A H    2  
ATOM   2214  H  HA   . LYS A 1 74 ? 10.367  -4.764  1.249   1.00 0.00 ? 381 LYS A HA   2  
ATOM   2215  H  HB2  . LYS A 1 74 ? 8.609   -4.863  3.049   1.00 0.00 ? 381 LYS A HB2  2  
ATOM   2216  H  HB3  . LYS A 1 74 ? 7.742   -3.599  2.185   1.00 0.00 ? 381 LYS A HB3  2  
ATOM   2217  H  HG2  . LYS A 1 74 ? 7.619   -5.075  0.211   1.00 0.00 ? 381 LYS A HG2  2  
ATOM   2218  H  HG3  . LYS A 1 74 ? 8.405   -6.349  1.147   1.00 0.00 ? 381 LYS A HG3  2  
ATOM   2219  H  HD2  . LYS A 1 74 ? 5.777   -5.039  1.846   1.00 0.00 ? 381 LYS A HD2  2  
ATOM   2220  H  HD3  . LYS A 1 74 ? 5.956   -6.606  1.056   1.00 0.00 ? 381 LYS A HD3  2  
ATOM   2221  H  HE2  . LYS A 1 74 ? 7.177   -7.442  3.012   1.00 0.00 ? 381 LYS A HE2  2  
ATOM   2222  H  HE3  . LYS A 1 74 ? 6.981   -5.880  3.800   1.00 0.00 ? 381 LYS A HE3  2  
ATOM   2223  H  HZ1  . LYS A 1 74 ? 5.346   -7.473  4.572   1.00 0.00 ? 381 LYS A HZ1  2  
ATOM   2224  H  HZ2  . LYS A 1 74 ? 4.773   -7.696  2.996   1.00 0.00 ? 381 LYS A HZ2  2  
ATOM   2225  H  HZ3  . LYS A 1 74 ? 4.588   -6.199  3.759   1.00 0.00 ? 381 LYS A HZ3  2  
ATOM   2226  N  N    . THR A 1 75 ? 10.134  -3.514  -0.828  1.00 0.00 ? 382 THR A N    2  
ATOM   2227  C  CA   . THR A 1 75 ? 9.963   -2.865  -2.108  1.00 0.00 ? 382 THR A CA   2  
ATOM   2228  C  C    . THR A 1 75 ? 9.238   -3.799  -3.060  1.00 0.00 ? 382 THR A C    2  
ATOM   2229  O  O    . THR A 1 75 ? 9.794   -4.797  -3.508  1.00 0.00 ? 382 THR A O    2  
ATOM   2230  C  CB   . THR A 1 75 ? 11.323  -2.465  -2.712  1.00 0.00 ? 382 THR A CB   2  
ATOM   2231  O  OG1  . THR A 1 75 ? 11.980  -1.525  -1.854  1.00 0.00 ? 382 THR A OG1  2  
ATOM   2232  C  CG2  . THR A 1 75 ? 11.151  -1.864  -4.099  1.00 0.00 ? 382 THR A CG2  2  
ATOM   2233  H  H    . THR A 1 75 ? 10.723  -4.295  -0.763  1.00 0.00 ? 382 THR A H    2  
ATOM   2234  H  HA   . THR A 1 75 ? 9.372   -1.972  -1.961  1.00 0.00 ? 382 THR A HA   2  
ATOM   2235  H  HB   . THR A 1 75 ? 11.937  -3.351  -2.796  1.00 0.00 ? 382 THR A HB   2  
ATOM   2236  H  HG1  . THR A 1 75 ? 11.358  -1.210  -1.190  1.00 0.00 ? 382 THR A HG1  2  
ATOM   2237  H  HG21 . THR A 1 75 ? 10.676  -2.589  -4.746  1.00 0.00 ? 382 THR A HG21 2  
ATOM   2238  H  HG22 . THR A 1 75 ? 12.117  -1.597  -4.501  1.00 0.00 ? 382 THR A HG22 2  
ATOM   2239  H  HG23 . THR A 1 75 ? 10.533  -0.980  -4.033  1.00 0.00 ? 382 THR A HG23 2  
ATOM   2240  N  N    . ALA A 1 76 ? 7.997   -3.488  -3.362  1.00 0.00 ? 383 ALA A N    2  
ATOM   2241  C  CA   . ALA A 1 76 ? 7.223   -4.327  -4.250  1.00 0.00 ? 383 ALA A CA   2  
ATOM   2242  C  C    . ALA A 1 76 ? 7.323   -3.809  -5.668  1.00 0.00 ? 383 ALA A C    2  
ATOM   2243  O  O    . ALA A 1 76 ? 7.525   -2.611  -5.894  1.00 0.00 ? 383 ALA A O    2  
ATOM   2244  C  CB   . ALA A 1 76 ? 5.772   -4.402  -3.797  1.00 0.00 ? 383 ALA A CB   2  
ATOM   2245  H  H    . ALA A 1 76 ? 7.597   -2.673  -2.994  1.00 0.00 ? 383 ALA A H    2  
ATOM   2246  H  HA   . ALA A 1 76 ? 7.644   -5.324  -4.214  1.00 0.00 ? 383 ALA A HA   2  
ATOM   2247  H  HB1  . ALA A 1 76 ? 5.286   -3.456  -3.980  1.00 0.00 ? 383 ALA A HB1  2  
ATOM   2248  H  HB2  . ALA A 1 76 ? 5.738   -4.623  -2.739  1.00 0.00 ? 383 ALA A HB2  2  
ATOM   2249  H  HB3  . ALA A 1 76 ? 5.261   -5.183  -4.343  1.00 0.00 ? 383 ALA A HB3  2  
ATOM   2250  N  N    . TYR A 1 77 ? 7.209   -4.707  -6.623  1.00 0.00 ? 384 TYR A N    2  
ATOM   2251  C  CA   . TYR A 1 77 ? 7.277   -4.329  -8.014  1.00 0.00 ? 384 TYR A CA   2  
ATOM   2252  C  C    . TYR A 1 77 ? 5.918   -4.517  -8.652  1.00 0.00 ? 384 TYR A C    2  
ATOM   2253  O  O    . TYR A 1 77 ? 5.189   -5.445  -8.306  1.00 0.00 ? 384 TYR A O    2  
ATOM   2254  C  CB   . TYR A 1 77 ? 8.332   -5.154  -8.757  1.00 0.00 ? 384 TYR A CB   2  
ATOM   2255  C  CG   . TYR A 1 77 ? 9.712   -5.078  -8.140  1.00 0.00 ? 384 TYR A CG   2  
ATOM   2256  C  CD1  . TYR A 1 77 ? 10.261  -3.858  -7.759  1.00 0.00 ? 384 TYR A CD1  2  
ATOM   2257  C  CD2  . TYR A 1 77 ? 10.462  -6.226  -7.932  1.00 0.00 ? 384 TYR A CD2  2  
ATOM   2258  C  CE1  . TYR A 1 77 ? 11.518  -3.790  -7.191  1.00 0.00 ? 384 TYR A CE1  2  
ATOM   2259  C  CE2  . TYR A 1 77 ? 11.720  -6.166  -7.363  1.00 0.00 ? 384 TYR A CE2  2  
ATOM   2260  C  CZ   . TYR A 1 77 ? 12.243  -4.945  -6.995  1.00 0.00 ? 384 TYR A CZ   2  
ATOM   2261  O  OH   . TYR A 1 77 ? 13.497  -4.879  -6.430  1.00 0.00 ? 384 TYR A OH   2  
ATOM   2262  H  H    . TYR A 1 77 ? 7.058   -5.651  -6.385  1.00 0.00 ? 384 TYR A H    2  
ATOM   2263  H  HA   . TYR A 1 77 ? 7.545   -3.284  -8.063  1.00 0.00 ? 384 TYR A HA   2  
ATOM   2264  H  HB2  . TYR A 1 77 ? 8.030   -6.199  -8.759  1.00 0.00 ? 384 TYR A HB2  2  
ATOM   2265  H  HB3  . TYR A 1 77 ? 8.406   -4.794  -9.782  1.00 0.00 ? 384 TYR A HB3  2  
ATOM   2266  H  HD1  . TYR A 1 77 ? 9.691   -2.954  -7.915  1.00 0.00 ? 384 TYR A HD1  2  
ATOM   2267  H  HD2  . TYR A 1 77 ? 10.050  -7.182  -8.222  1.00 0.00 ? 384 TYR A HD2  2  
ATOM   2268  H  HE1  . TYR A 1 77 ? 11.925  -2.835  -6.900  1.00 0.00 ? 384 TYR A HE1  2  
ATOM   2269  H  HE2  . TYR A 1 77 ? 12.287  -7.071  -7.210  1.00 0.00 ? 384 TYR A HE2  2  
ATOM   2270  H  HH   . TYR A 1 77 ? 13.461  -4.335  -5.635  1.00 0.00 ? 384 TYR A HH   2  
ATOM   2271  N  N    . CYS A 1 78 ? 5.566   -3.622  -9.560  1.00 0.00 ? 385 CYS A N    2  
ATOM   2272  C  CA   . CYS A 1 78 ? 4.284   -3.739  -10.254 1.00 0.00 ? 385 CYS A CA   2  
ATOM   2273  C  C    . CYS A 1 78 ? 4.234   -5.032  -11.064 1.00 0.00 ? 385 CYS A C    2  
ATOM   2274  O  O    . CYS A 1 78 ? 5.271   -5.552  -11.481 1.00 0.00 ? 385 CYS A O    2  
ATOM   2275  C  CB   . CYS A 1 78 ? 4.022   -2.524  -11.157 1.00 0.00 ? 385 CYS A CB   2  
ATOM   2276  S  SG   . CYS A 1 78 ? 5.255   -2.246  -12.459 1.00 0.00 ? 385 CYS A SG   2  
ATOM   2277  H  H    . CYS A 1 78 ? 6.160   -2.850  -9.729  1.00 0.00 ? 385 CYS A H    2  
ATOM   2278  H  HA   . CYS A 1 78 ? 3.512   -3.783  -9.498  1.00 0.00 ? 385 CYS A HA   2  
ATOM   2279  H  HB2  . CYS A 1 78 ? 3.066   -2.650  -11.641 1.00 0.00 ? 385 CYS A HB2  2  
ATOM   2280  H  HB3  . CYS A 1 78 ? 3.990   -1.636  -10.542 1.00 0.00 ? 385 CYS A HB3  2  
ATOM   2281  N  N    . ASP A 1 79 ? 3.023   -5.547  -11.261 1.00 0.00 ? 386 ASP A N    2  
ATOM   2282  C  CA   . ASP A 1 79 ? 2.800   -6.828  -11.946 1.00 0.00 ? 386 ASP A CA   2  
ATOM   2283  C  C    . ASP A 1 79 ? 3.568   -6.921  -13.267 1.00 0.00 ? 386 ASP A C    2  
ATOM   2284  O  O    . ASP A 1 79 ? 4.127   -7.967  -13.601 1.00 0.00 ? 386 ASP A O    2  
ATOM   2285  C  CB   . ASP A 1 79 ? 1.302   -7.022  -12.197 1.00 0.00 ? 386 ASP A CB   2  
ATOM   2286  C  CG   . ASP A 1 79 ? 0.987   -8.308  -12.941 1.00 0.00 ? 386 ASP A CG   2  
ATOM   2287  O  OD1  . ASP A 1 79 ? 1.111   -9.396  -12.341 1.00 0.00 ? 386 ASP A OD1  2  
ATOM   2288  O  OD2  . ASP A 1 79 ? 0.578   -8.235  -14.120 1.00 0.00 ? 386 ASP A OD2  2  
ATOM   2289  H  H    . ASP A 1 79 ? 2.242   -5.055  -10.917 1.00 0.00 ? 386 ASP A H    2  
ATOM   2290  H  HA   . ASP A 1 79 ? 3.145   -7.615  -11.292 1.00 0.00 ? 386 ASP A HA   2  
ATOM   2291  H  HB2  . ASP A 1 79 ? 0.785   -7.049  -11.238 1.00 0.00 ? 386 ASP A HB2  2  
ATOM   2292  H  HB3  . ASP A 1 79 ? 0.936   -6.183  -12.793 1.00 0.00 ? 386 ASP A HB3  2  
ATOM   2293  N  N    . VAL A 1 80 ? 3.619   -5.820  -13.999 1.00 0.00 ? 387 VAL A N    2  
ATOM   2294  C  CA   . VAL A 1 80 ? 4.268   -5.797  -15.308 1.00 0.00 ? 387 VAL A CA   2  
ATOM   2295  C  C    . VAL A 1 80 ? 5.714   -5.296  -15.221 1.00 0.00 ? 387 VAL A C    2  
ATOM   2296  O  O    . VAL A 1 80 ? 6.242   -4.734  -16.179 1.00 0.00 ? 387 VAL A O    2  
ATOM   2297  C  CB   . VAL A 1 80 ? 3.478   -4.910  -16.296 1.00 0.00 ? 387 VAL A CB   2  
ATOM   2298  C  CG1  . VAL A 1 80 ? 2.120   -5.528  -16.599 1.00 0.00 ? 387 VAL A CG1  2  
ATOM   2299  C  CG2  . VAL A 1 80 ? 3.309   -3.499  -15.744 1.00 0.00 ? 387 VAL A CG2  2  
ATOM   2300  H  H    . VAL A 1 80 ? 3.206   -5.003  -13.656 1.00 0.00 ? 387 VAL A H    2  
ATOM   2301  H  HA   . VAL A 1 80 ? 4.274   -6.807  -15.691 1.00 0.00 ? 387 VAL A HA   2  
ATOM   2302  H  HB   . VAL A 1 80 ? 4.036   -4.849  -17.220 1.00 0.00 ? 387 VAL A HB   2  
ATOM   2303  H  HG11 . VAL A 1 80 ? 2.259   -6.507  -17.034 1.00 0.00 ? 387 VAL A HG11 2  
ATOM   2304  H  HG12 . VAL A 1 80 ? 1.585   -4.899  -17.294 1.00 0.00 ? 387 VAL A HG12 2  
ATOM   2305  H  HG13 . VAL A 1 80 ? 1.554   -5.619  -15.685 1.00 0.00 ? 387 VAL A HG13 2  
ATOM   2306  H  HG21 . VAL A 1 80 ? 2.764   -2.897  -16.455 1.00 0.00 ? 387 VAL A HG21 2  
ATOM   2307  H  HG22 . VAL A 1 80 ? 4.282   -3.061  -15.572 1.00 0.00 ? 387 VAL A HG22 2  
ATOM   2308  H  HG23 . VAL A 1 80 ? 2.763   -3.541  -14.813 1.00 0.00 ? 387 VAL A HG23 2  
ATOM   2309  N  N    . HIS A 1 81 ? 6.365   -5.514  -14.084 1.00 0.00 ? 388 HIS A N    2  
ATOM   2310  C  CA   . HIS A 1 81 ? 7.734   -5.039  -13.898 1.00 0.00 ? 388 HIS A CA   2  
ATOM   2311  C  C    . HIS A 1 81 ? 8.753   -6.167  -14.056 1.00 0.00 ? 388 HIS A C    2  
ATOM   2312  O  O    . HIS A 1 81 ? 9.863   -5.937  -14.529 1.00 0.00 ? 388 HIS A O    2  
ATOM   2313  C  CB   . HIS A 1 81 ? 7.891   -4.400  -12.514 1.00 0.00 ? 388 HIS A CB   2  
ATOM   2314  C  CG   . HIS A 1 81 ? 9.166   -3.627  -12.331 1.00 0.00 ? 388 HIS A CG   2  
ATOM   2315  N  ND1  . HIS A 1 81 ? 9.196   -2.249  -12.194 1.00 0.00 ? 388 HIS A ND1  2  
ATOM   2316  C  CD2  . HIS A 1 81 ? 10.455  -4.038  -12.251 1.00 0.00 ? 388 HIS A CD2  2  
ATOM   2317  C  CE1  . HIS A 1 81 ? 10.457  -1.857  -12.042 1.00 0.00 ? 388 HIS A CE1  2  
ATOM   2318  N  NE2  . HIS A 1 81 ? 11.235  -2.920  -12.073 1.00 0.00 ? 388 HIS A NE2  2  
ATOM   2319  H  H    . HIS A 1 81 ? 5.911   -5.990  -13.352 1.00 0.00 ? 388 HIS A H    2  
ATOM   2320  H  HA   . HIS A 1 81 ? 7.928   -4.291  -14.650 1.00 0.00 ? 388 HIS A HA   2  
ATOM   2321  H  HB2  . HIS A 1 81 ? 7.068   -3.721  -12.347 1.00 0.00 ? 388 HIS A HB2  2  
ATOM   2322  H  HB3  . HIS A 1 81 ? 7.864   -5.178  -11.765 1.00 0.00 ? 388 HIS A HB3  2  
ATOM   2323  H  HD2  . HIS A 1 81 ? 10.805  -5.057  -12.316 1.00 0.00 ? 388 HIS A HD2  2  
ATOM   2324  H  HE1  . HIS A 1 81 ? 10.791  -0.838  -11.910 1.00 0.00 ? 388 HIS A HE1  2  
ATOM   2325  H  HE2  . HIS A 1 81 ? 12.208  -2.889  -12.230 1.00 0.00 ? 388 HIS A HE2  2  
ATOM   2326  N  N    . THR A 1 82 ? 8.379   -7.370  -13.654 1.00 0.00 ? 389 THR A N    2  
ATOM   2327  C  CA   . THR A 1 82 ? 9.326   -8.478  -13.601 1.00 0.00 ? 389 THR A CA   2  
ATOM   2328  C  C    . THR A 1 82 ? 9.644   -9.061  -14.993 1.00 0.00 ? 389 THR A C    2  
ATOM   2329  O  O    . THR A 1 82 ? 10.814  -9.109  -15.380 1.00 0.00 ? 389 THR A O    2  
ATOM   2330  C  CB   . THR A 1 82 ? 8.814   -9.594  -12.666 1.00 0.00 ? 389 THR A CB   2  
ATOM   2331  O  OG1  . THR A 1 82 ? 8.263   -9.013  -11.475 1.00 0.00 ? 389 THR A OG1  2  
ATOM   2332  C  CG2  . THR A 1 82 ? 9.941   -10.546 -12.291 1.00 0.00 ? 389 THR A CG2  2  
ATOM   2333  H  H    . THR A 1 82 ? 7.452   -7.522  -13.382 1.00 0.00 ? 389 THR A H    2  
ATOM   2334  H  HA   . THR A 1 82 ? 10.242  -8.094  -13.179 1.00 0.00 ? 389 THR A HA   2  
ATOM   2335  H  HB   . THR A 1 82 ? 8.045   -10.151 -13.176 1.00 0.00 ? 389 THR A HB   2  
ATOM   2336  H  HG1  . THR A 1 82 ? 7.824   -9.695  -10.960 1.00 0.00 ? 389 THR A HG1  2  
ATOM   2337  H  HG21 . THR A 1 82 ? 10.324  -11.020 -13.183 1.00 0.00 ? 389 THR A HG21 2  
ATOM   2338  H  HG22 . THR A 1 82 ? 9.568   -11.300 -11.615 1.00 0.00 ? 389 THR A HG22 2  
ATOM   2339  H  HG23 . THR A 1 82 ? 10.736  -9.992  -11.810 1.00 0.00 ? 389 THR A HG23 2  
ATOM   2340  N  N    . PRO A 1 83 ? 8.630   -9.523  -15.768 1.00 0.00 ? 390 PRO A N    2  
ATOM   2341  C  CA   . PRO A 1 83 ? 8.869   -10.174 -17.071 1.00 0.00 ? 390 PRO A CA   2  
ATOM   2342  C  C    . PRO A 1 83 ? 9.591   -9.331  -18.153 1.00 0.00 ? 390 PRO A C    2  
ATOM   2343  O  O    . PRO A 1 83 ? 10.310  -9.921  -18.959 1.00 0.00 ? 390 PRO A O    2  
ATOM   2344  C  CB   . PRO A 1 83 ? 7.473   -10.583 -17.556 1.00 0.00 ? 390 PRO A CB   2  
ATOM   2345  C  CG   . PRO A 1 83 ? 6.505   -9.803  -16.735 1.00 0.00 ? 390 PRO A CG   2  
ATOM   2346  C  CD   . PRO A 1 83 ? 7.190   -9.500  -15.430 1.00 0.00 ? 390 PRO A CD   2  
ATOM   2347  H  HA   . PRO A 1 83 ? 9.451   -11.074 -16.925 1.00 0.00 ? 390 PRO A HA   2  
ATOM   2348  H  HB2  . PRO A 1 83 ? 7.374   -10.345 -18.605 1.00 0.00 ? 390 PRO A HB2  2  
ATOM   2349  H  HB3  . PRO A 1 83 ? 7.341   -11.647 -17.414 1.00 0.00 ? 390 PRO A HB3  2  
ATOM   2350  H  HG2  . PRO A 1 83 ? 6.248   -8.888  -17.244 1.00 0.00 ? 390 PRO A HG2  2  
ATOM   2351  H  HG3  . PRO A 1 83 ? 5.618   -10.392 -16.562 1.00 0.00 ? 390 PRO A HG3  2  
ATOM   2352  H  HD2  . PRO A 1 83 ? 6.894   -8.527  -15.068 1.00 0.00 ? 390 PRO A HD2  2  
ATOM   2353  H  HD3  . PRO A 1 83 ? 6.954   -10.262 -14.702 1.00 0.00 ? 390 PRO A HD3  2  
ATOM   2354  N  N    . PRO A 1 84 ? 9.405   -7.978  -18.245 1.00 0.00 ? 391 PRO A N    2  
ATOM   2355  C  CA   . PRO A 1 84 ? 10.089  -7.155  -19.262 1.00 0.00 ? 391 PRO A CA   2  
ATOM   2356  C  C    . PRO A 1 84 ? 11.562  -7.513  -19.454 1.00 0.00 ? 391 PRO A C    2  
ATOM   2357  O  O    . PRO A 1 84 ? 12.363  -7.456  -18.516 1.00 0.00 ? 391 PRO A O    2  
ATOM   2358  C  CB   . PRO A 1 84 ? 9.960   -5.745  -18.703 1.00 0.00 ? 391 PRO A CB   2  
ATOM   2359  C  CG   . PRO A 1 84 ? 8.659   -5.758  -17.988 1.00 0.00 ? 391 PRO A CG   2  
ATOM   2360  C  CD   . PRO A 1 84 ? 8.511   -7.142  -17.414 1.00 0.00 ? 391 PRO A CD   2  
ATOM   2361  H  HA   . PRO A 1 84 ? 9.584   -7.210  -20.214 1.00 0.00 ? 391 PRO A HA   2  
ATOM   2362  H  HB2  . PRO A 1 84 ? 10.782  -5.542  -18.031 1.00 0.00 ? 391 PRO A HB2  2  
ATOM   2363  H  HB3  . PRO A 1 84 ? 9.961   -5.028  -19.511 1.00 0.00 ? 391 PRO A HB3  2  
ATOM   2364  H  HG2  . PRO A 1 84 ? 8.668   -5.022  -17.196 1.00 0.00 ? 391 PRO A HG2  2  
ATOM   2365  H  HG3  . PRO A 1 84 ? 7.857   -5.552  -18.681 1.00 0.00 ? 391 PRO A HG3  2  
ATOM   2366  H  HD2  . PRO A 1 84 ? 8.825   -7.157  -16.381 1.00 0.00 ? 391 PRO A HD2  2  
ATOM   2367  H  HD3  . PRO A 1 84 ? 7.488   -7.473  -17.500 1.00 0.00 ? 391 PRO A HD3  2  
ATOM   2368  N  N    . GLY A 1 85 ? 11.907  -7.891  -20.677 1.00 0.00 ? 392 GLY A N    2  
ATOM   2369  C  CA   . GLY A 1 85 ? 13.270  -8.252  -20.987 1.00 0.00 ? 392 GLY A CA   2  
ATOM   2370  C  C    . GLY A 1 85 ? 13.571  -9.691  -20.635 1.00 0.00 ? 392 GLY A C    2  
ATOM   2371  O  O    . GLY A 1 85 ? 13.055  -10.615 -21.267 1.00 0.00 ? 392 GLY A O    2  
ATOM   2372  H  H    . GLY A 1 85 ? 11.222  -7.938  -21.377 1.00 0.00 ? 392 GLY A H    2  
ATOM   2373  H  HA2  . GLY A 1 85 ? 13.440  -8.107  -22.042 1.00 0.00 ? 392 GLY A HA2  2  
ATOM   2374  H  HA3  . GLY A 1 85 ? 13.939  -7.611  -20.433 1.00 0.00 ? 392 GLY A HA3  2  
ATOM   2375  N  N    . SER A 1 86 ? 14.404  -9.873  -19.624 1.00 0.00 ? 393 SER A N    2  
ATOM   2376  C  CA   . SER A 1 86 ? 14.804  -11.197 -19.168 1.00 0.00 ? 393 SER A CA   2  
ATOM   2377  C  C    . SER A 1 86 ? 15.609  -11.063 -17.880 1.00 0.00 ? 393 SER A C    2  
ATOM   2378  O  O    . SER A 1 86 ? 16.578  -11.795 -17.668 1.00 0.00 ? 393 SER A O    2  
ATOM   2379  C  CB   . SER A 1 86 ? 15.636  -11.894 -20.250 1.00 0.00 ? 393 SER A CB   2  
ATOM   2380  O  OG   . SER A 1 86 ? 16.727  -11.083 -20.667 1.00 0.00 ? 393 SER A OG   2  
ATOM   2381  H  H    . SER A 1 86 ? 14.767  -9.087  -19.165 1.00 0.00 ? 393 SER A H    2  
ATOM   2382  H  HA   . SER A 1 86 ? 13.911  -11.771 -18.972 1.00 0.00 ? 393 SER A HA   2  
ATOM   2383  H  HB2  . SER A 1 86 ? 16.024  -12.823 -19.860 1.00 0.00 ? 393 SER A HB2  2  
ATOM   2384  H  HB3  . SER A 1 86 ? 15.010  -12.100 -21.105 1.00 0.00 ? 393 SER A HB3  2  
ATOM   2385  H  HG   . SER A 1 86 ? 17.229  -10.798 -19.890 1.00 0.00 ? 393 SER A HG   2  
ATOM   2386  N  N    . THR A 1 87 ? 15.161  -10.150 -17.017 1.00 0.00 ? 394 THR A N    2  
ATOM   2387  C  CA   . THR A 1 87 ? 15.923  -9.730  -15.844 1.00 0.00 ? 394 THR A CA   2  
ATOM   2388  C  C    . THR A 1 87 ? 17.125  -8.888  -16.281 1.00 0.00 ? 394 THR A C    2  
ATOM   2389  O  O    . THR A 1 87 ? 16.932  -7.683  -16.556 1.00 0.00 ? 394 THR A O    2  
ATOM   2390  C  CB   . THR A 1 87 ? 16.402  -10.932 -14.994 1.00 0.00 ? 394 THR A CB   2  
ATOM   2391  O  OG1  . THR A 1 87 ? 15.300  -11.811 -14.717 1.00 0.00 ? 394 THR A OG1  2  
ATOM   2392  C  CG2  . THR A 1 87 ? 17.010  -10.462 -13.681 1.00 0.00 ? 394 THR A CG2  2  
ATOM   2393  O  OXT  . THR A 1 87 ? 18.245  -9.432  -16.383 1.00 0.00 ? 394 THR A OXT  2  
ATOM   2394  H  H    . THR A 1 87 ? 14.276  -9.752  -17.169 1.00 0.00 ? 394 THR A H    2  
ATOM   2395  H  HA   . THR A 1 87 ? 15.275  -9.118  -15.232 1.00 0.00 ? 394 THR A HA   2  
ATOM   2396  H  HB   . THR A 1 87 ? 17.153  -11.471 -15.550 1.00 0.00 ? 394 THR A HB   2  
ATOM   2397  H  HG1  . THR A 1 87 ? 14.470  -11.337 -14.851 1.00 0.00 ? 394 THR A HG1  2  
ATOM   2398  H  HG21 . THR A 1 87 ? 17.857  -9.823  -13.885 1.00 0.00 ? 394 THR A HG21 2  
ATOM   2399  H  HG22 . THR A 1 87 ? 17.334  -11.319 -13.108 1.00 0.00 ? 394 THR A HG22 2  
ATOM   2400  H  HG23 . THR A 1 87 ? 16.272  -9.911  -13.118 1.00 0.00 ? 394 THR A HG23 2  
HETATM 2401  ZN ZN   . ZN  B 2 .  ? -6.945  -0.814  -5.598  1.00 0.00 ? 401 ZN  A ZN   2  
HETATM 2402  ZN ZN   . ZN  C 2 .  ? 7.341   -1.056  -12.308 1.00 0.00 ? 402 ZN  A ZN   2  
ATOM   2403  N  N    . MET A 1 9  ? 3.960   15.690  -12.330 1.00 0.00 ? 316 MET A N    3  
ATOM   2404  C  CA   . MET A 1 9  ? 5.296   16.287  -12.103 1.00 0.00 ? 316 MET A CA   3  
ATOM   2405  C  C    . MET A 1 9  ? 5.402   16.779  -10.668 1.00 0.00 ? 316 MET A C    3  
ATOM   2406  O  O    . MET A 1 9  ? 5.996   16.115  -9.825  1.00 0.00 ? 316 MET A O    3  
ATOM   2407  C  CB   . MET A 1 9  ? 5.559   17.438  -13.078 1.00 0.00 ? 316 MET A CB   3  
ATOM   2408  C  CG   . MET A 1 9  ? 6.955   18.031  -12.956 1.00 0.00 ? 316 MET A CG   3  
ATOM   2409  S  SD   . MET A 1 9  ? 7.229   19.408  -14.086 1.00 0.00 ? 316 MET A SD   3  
ATOM   2410  C  CE   . MET A 1 9  ? 8.916   19.847  -13.674 1.00 0.00 ? 316 MET A CE   3  
ATOM   2411  H  H    . MET A 1 9  ? 3.214   16.390  -12.149 1.00 0.00 ? 316 MET A H    3  
ATOM   2412  H  HA   . MET A 1 9  ? 6.040   15.516  -12.257 1.00 0.00 ? 316 MET A HA   3  
ATOM   2413  H  HB2  . MET A 1 9  ? 5.432   17.077  -14.088 1.00 0.00 ? 316 MET A HB2  3  
ATOM   2414  H  HB3  . MET A 1 9  ? 4.840   18.222  -12.892 1.00 0.00 ? 316 MET A HB3  3  
ATOM   2415  H  HG2  . MET A 1 9  ? 7.094   18.381  -11.945 1.00 0.00 ? 316 MET A HG2  3  
ATOM   2416  H  HG3  . MET A 1 9  ? 7.678   17.257  -13.171 1.00 0.00 ? 316 MET A HG3  3  
ATOM   2417  H  HE1  . MET A 1 9  ? 9.239   20.664  -14.304 1.00 0.00 ? 316 MET A HE1  3  
ATOM   2418  H  HE2  . MET A 1 9  ? 9.557   18.995  -13.835 1.00 0.00 ? 316 MET A HE2  3  
ATOM   2419  H  HE3  . MET A 1 9  ? 8.968   20.146  -12.639 1.00 0.00 ? 316 MET A HE3  3  
ATOM   2420  N  N    . ASN A 1 10 ? 4.805   17.931  -10.381 1.00 0.00 ? 317 ASN A N    3  
ATOM   2421  C  CA   . ASN A 1 10 ? 4.789   18.447  -9.022  1.00 0.00 ? 317 ASN A CA   3  
ATOM   2422  C  C    . ASN A 1 10 ? 3.476   19.152  -8.724  1.00 0.00 ? 317 ASN A C    3  
ATOM   2423  O  O    . ASN A 1 10 ? 3.245   20.282  -9.158  1.00 0.00 ? 317 ASN A O    3  
ATOM   2424  C  CB   . ASN A 1 10 ? 5.964   19.394  -8.766  1.00 0.00 ? 317 ASN A CB   3  
ATOM   2425  C  CG   . ASN A 1 10 ? 5.973   19.922  -7.339  1.00 0.00 ? 317 ASN A CG   3  
ATOM   2426  O  OD1  . ASN A 1 10 ? 5.459   21.003  -7.059  1.00 0.00 ? 317 ASN A OD1  3  
ATOM   2427  N  ND2  . ASN A 1 10 ? 6.534   19.146  -6.421  1.00 0.00 ? 317 ASN A ND2  3  
ATOM   2428  H  H    . ASN A 1 10 ? 4.371   18.446  -11.094 1.00 0.00 ? 317 ASN A H    3  
ATOM   2429  H  HA   . ASN A 1 10 ? 4.876   17.602  -8.356  1.00 0.00 ? 317 ASN A HA   3  
ATOM   2430  H  HB2  . ASN A 1 10 ? 6.889   18.867  -8.942  1.00 0.00 ? 317 ASN A HB2  3  
ATOM   2431  H  HB3  . ASN A 1 10 ? 5.897   20.234  -9.440  1.00 0.00 ? 317 ASN A HB3  3  
ATOM   2432  H  HD21 . ASN A 1 10 ? 6.911   18.281  -6.709  1.00 0.00 ? 317 ASN A HD21 3  
ATOM   2433  H  HD22 . ASN A 1 10 ? 6.548   19.464  -5.493  1.00 0.00 ? 317 ASN A HD22 3  
ATOM   2434  N  N    . ILE A 1 11 ? 2.616   18.454  -8.009  1.00 0.00 ? 318 ILE A N    3  
ATOM   2435  C  CA   . ILE A 1 11 ? 1.361   19.000  -7.530  1.00 0.00 ? 318 ILE A CA   3  
ATOM   2436  C  C    . ILE A 1 11 ? 1.238   18.690  -6.042  1.00 0.00 ? 318 ILE A C    3  
ATOM   2437  O  O    . ILE A 1 11 ? 2.013   17.872  -5.547  1.00 0.00 ? 318 ILE A O    3  
ATOM   2438  C  CB   . ILE A 1 11 ? 0.148   18.437  -8.325  1.00 0.00 ? 318 ILE A CB   3  
ATOM   2439  C  CG1  . ILE A 1 11 ? 0.338   16.952  -8.677  1.00 0.00 ? 318 ILE A CG1  3  
ATOM   2440  C  CG2  . ILE A 1 11 ? -0.078  19.253  -9.590  1.00 0.00 ? 318 ILE A CG2  3  
ATOM   2441  C  CD1  . ILE A 1 11 ? 0.174   16.006  -7.505  1.00 0.00 ? 318 ILE A CD1  3  
ATOM   2442  H  H    . ILE A 1 11 ? 2.839   17.529  -7.777  1.00 0.00 ? 318 ILE A H    3  
ATOM   2443  H  HA   . ILE A 1 11 ? 1.394   20.072  -7.663  1.00 0.00 ? 318 ILE A HA   3  
ATOM   2444  H  HB   . ILE A 1 11 ? -0.732  18.537  -7.709  1.00 0.00 ? 318 ILE A HB   3  
ATOM   2445  H  HG12 . ILE A 1 11 ? -0.385  16.673  -9.427  1.00 0.00 ? 318 ILE A HG12 3  
ATOM   2446  H  HG13 . ILE A 1 11 ? 1.331   16.815  -9.076  1.00 0.00 ? 318 ILE A HG13 3  
ATOM   2447  H  HG21 . ILE A 1 11 ? -0.922  18.851  -10.130 1.00 0.00 ? 318 ILE A HG21 3  
ATOM   2448  H  HG22 . ILE A 1 11 ? 0.804   19.202  -10.209 1.00 0.00 ? 318 ILE A HG22 3  
ATOM   2449  H  HG23 . ILE A 1 11 ? -0.275  20.282  -9.326  1.00 0.00 ? 318 ILE A HG23 3  
ATOM   2450  H  HD11 . ILE A 1 11 ? 0.356   14.992  -7.831  1.00 0.00 ? 318 ILE A HD11 3  
ATOM   2451  H  HD12 . ILE A 1 11 ? -0.831  16.084  -7.116  1.00 0.00 ? 318 ILE A HD12 3  
ATOM   2452  H  HD13 . ILE A 1 11 ? 0.880   16.268  -6.732  1.00 0.00 ? 318 ILE A HD13 3  
ATOM   2453  N  N    . PRO A 1 12 ? 0.306   19.357  -5.318  1.00 0.00 ? 319 PRO A N    3  
ATOM   2454  C  CA   . PRO A 1 12 ? 0.073   19.166  -3.884  1.00 0.00 ? 319 PRO A CA   3  
ATOM   2455  C  C    . PRO A 1 12 ? 0.500   17.789  -3.352  1.00 0.00 ? 319 PRO A C    3  
ATOM   2456  O  O    . PRO A 1 12 ? -0.214  16.795  -3.509  1.00 0.00 ? 319 PRO A O    3  
ATOM   2457  C  CB   . PRO A 1 12 ? -1.439  19.347  -3.780  1.00 0.00 ? 319 PRO A CB   3  
ATOM   2458  C  CG   . PRO A 1 12 ? -1.823  20.242  -4.928  1.00 0.00 ? 319 PRO A CG   3  
ATOM   2459  C  CD   . PRO A 1 12 ? -0.610  20.385  -5.825  1.00 0.00 ? 319 PRO A CD   3  
ATOM   2460  H  HA   . PRO A 1 12 ? 0.563   19.935  -3.305  1.00 0.00 ? 319 PRO A HA   3  
ATOM   2461  H  HB2  . PRO A 1 12 ? -1.921  18.384  -3.853  1.00 0.00 ? 319 PRO A HB2  3  
ATOM   2462  H  HB3  . PRO A 1 12 ? -1.682  19.801  -2.831  1.00 0.00 ? 319 PRO A HB3  3  
ATOM   2463  H  HG2  . PRO A 1 12 ? -2.638  19.796  -5.477  1.00 0.00 ? 319 PRO A HG2  3  
ATOM   2464  H  HG3  . PRO A 1 12 ? -2.119  21.210  -4.549  1.00 0.00 ? 319 PRO A HG3  3  
ATOM   2465  H  HD2  . PRO A 1 12 ? -0.874  20.197  -6.853  1.00 0.00 ? 319 PRO A HD2  3  
ATOM   2466  H  HD3  . PRO A 1 12 ? -0.179  21.370  -5.720  1.00 0.00 ? 319 PRO A HD3  3  
ATOM   2467  N  N    . PRO A 1 13 ? 1.681   17.732  -2.714  1.00 0.00 ? 320 PRO A N    3  
ATOM   2468  C  CA   . PRO A 1 13 ? 2.303   16.478  -2.271  1.00 0.00 ? 320 PRO A CA   3  
ATOM   2469  C  C    . PRO A 1 13 ? 1.711   15.946  -0.968  1.00 0.00 ? 320 PRO A C    3  
ATOM   2470  O  O    . PRO A 1 13 ? 2.420   15.383  -0.129  1.00 0.00 ? 320 PRO A O    3  
ATOM   2471  C  CB   . PRO A 1 13 ? 3.762   16.878  -2.076  1.00 0.00 ? 320 PRO A CB   3  
ATOM   2472  C  CG   . PRO A 1 13 ? 3.709   18.312  -1.680  1.00 0.00 ? 320 PRO A CG   3  
ATOM   2473  C  CD   . PRO A 1 13 ? 2.514   18.904  -2.380  1.00 0.00 ? 320 PRO A CD   3  
ATOM   2474  H  HA   . PRO A 1 13 ? 2.236   15.714  -3.032  1.00 0.00 ? 320 PRO A HA   3  
ATOM   2475  H  HB2  . PRO A 1 13 ? 4.206   16.268  -1.303  1.00 0.00 ? 320 PRO A HB2  3  
ATOM   2476  H  HB3  . PRO A 1 13 ? 4.302   16.746  -3.001  1.00 0.00 ? 320 PRO A HB3  3  
ATOM   2477  H  HG2  . PRO A 1 13 ? 3.589   18.391  -0.610  1.00 0.00 ? 320 PRO A HG2  3  
ATOM   2478  H  HG3  . PRO A 1 13 ? 4.612   18.813  -1.995  1.00 0.00 ? 320 PRO A HG3  3  
ATOM   2479  H  HD2  . PRO A 1 13 ? 1.982   19.574  -1.712  1.00 0.00 ? 320 PRO A HD2  3  
ATOM   2480  H  HD3  . PRO A 1 13 ? 2.825   19.423  -3.280  1.00 0.00 ? 320 PRO A HD3  3  
ATOM   2481  N  N    . ALA A 1 14 ? 0.406   16.098  -0.827  1.00 0.00 ? 321 ALA A N    3  
ATOM   2482  C  CA   . ALA A 1 14 ? -0.312  15.632  0.331   1.00 0.00 ? 321 ALA A CA   3  
ATOM   2483  C  C    . ALA A 1 14 ? -1.717  15.375  -0.124  1.00 0.00 ? 321 ALA A C    3  
ATOM   2484  O  O    . ALA A 1 14 ? -2.634  15.132  0.659   1.00 0.00 ? 321 ALA A O    3  
ATOM   2485  C  CB   . ALA A 1 14 ? -0.263  16.651  1.459   1.00 0.00 ? 321 ALA A CB   3  
ATOM   2486  H  H    . ALA A 1 14 ? -0.117  16.512  -1.555  1.00 0.00 ? 321 ALA A H    3  
ATOM   2487  H  HA   . ALA A 1 14 ? 0.131   14.708  0.655   1.00 0.00 ? 321 ALA A HA   3  
ATOM   2488  H  HB1  . ALA A 1 14 ? -0.842  16.290  2.296   1.00 0.00 ? 321 ALA A HB1  3  
ATOM   2489  H  HB2  . ALA A 1 14 ? -0.675  17.589  1.115   1.00 0.00 ? 321 ALA A HB2  3  
ATOM   2490  H  HB3  . ALA A 1 14 ? 0.761   16.798  1.767   1.00 0.00 ? 321 ALA A HB3  3  
ATOM   2491  N  N    . ARG A 1 15 ? -1.850  15.429  -1.434  1.00 0.00 ? 322 ARG A N    3  
ATOM   2492  C  CA   . ARG A 1 15 ? -3.107  15.197  -2.085  1.00 0.00 ? 322 ARG A CA   3  
ATOM   2493  C  C    . ARG A 1 15 ? -2.863  14.513  -3.419  1.00 0.00 ? 322 ARG A C    3  
ATOM   2494  O  O    . ARG A 1 15 ? -3.627  14.668  -4.374  1.00 0.00 ? 322 ARG A O    3  
ATOM   2495  C  CB   . ARG A 1 15 ? -3.887  16.499  -2.277  1.00 0.00 ? 322 ARG A CB   3  
ATOM   2496  C  CG   . ARG A 1 15 ? -5.377  16.275  -2.480  1.00 0.00 ? 322 ARG A CG   3  
ATOM   2497  C  CD   . ARG A 1 15 ? -6.092  17.549  -2.888  1.00 0.00 ? 322 ARG A CD   3  
ATOM   2498  N  NE   . ARG A 1 15 ? -5.722  17.981  -4.236  1.00 0.00 ? 322 ARG A NE   3  
ATOM   2499  C  CZ   . ARG A 1 15 ? -6.124  19.128  -4.782  1.00 0.00 ? 322 ARG A CZ   3  
ATOM   2500  N  NH1  . ARG A 1 15 ? -6.899  19.959  -4.098  1.00 0.00 ? 322 ARG A NH1  3  
ATOM   2501  N  NH2  . ARG A 1 15 ? -5.762  19.439  -6.021  1.00 0.00 ? 322 ARG A NH2  3  
ATOM   2502  H  H    . ARG A 1 15 ? -1.058  15.600  -1.978  1.00 0.00 ? 322 ARG A H    3  
ATOM   2503  H  HA   . ARG A 1 15 ? -3.655  14.542  -1.457  1.00 0.00 ? 322 ARG A HA   3  
ATOM   2504  H  HB2  . ARG A 1 15 ? -3.750  17.119  -1.404  1.00 0.00 ? 322 ARG A HB2  3  
ATOM   2505  H  HB3  . ARG A 1 15 ? -3.497  17.016  -3.142  1.00 0.00 ? 322 ARG A HB3  3  
ATOM   2506  H  HG2  . ARG A 1 15 ? -5.516  15.535  -3.253  1.00 0.00 ? 322 ARG A HG2  3  
ATOM   2507  H  HG3  . ARG A 1 15 ? -5.802  15.915  -1.554  1.00 0.00 ? 322 ARG A HG3  3  
ATOM   2508  H  HD2  . ARG A 1 15 ? -7.157  17.374  -2.861  1.00 0.00 ? 322 ARG A HD2  3  
ATOM   2509  H  HD3  . ARG A 1 15 ? -5.838  18.329  -2.187  1.00 0.00 ? 322 ARG A HD3  3  
ATOM   2510  H  HE   . ARG A 1 15 ? -5.149  17.381  -4.759  1.00 0.00 ? 322 ARG A HE   3  
ATOM   2511  H  HH11 . ARG A 1 15 ? -7.191  19.727  -3.168  1.00 0.00 ? 322 ARG A HH11 3  
ATOM   2512  H  HH12 . ARG A 1 15 ? -7.189  20.830  -4.506  1.00 0.00 ? 322 ARG A HH12 3  
ATOM   2513  H  HH21 . ARG A 1 15 ? -5.189  18.812  -6.553  1.00 0.00 ? 322 ARG A HH21 3  
ATOM   2514  H  HH22 . ARG A 1 15 ? -6.065  20.304  -6.429  1.00 0.00 ? 322 ARG A HH22 3  
ATOM   2515  N  N    . TRP A 1 16 ? -1.781  13.753  -3.472  1.00 0.00 ? 323 TRP A N    3  
ATOM   2516  C  CA   . TRP A 1 16 ? -1.454  12.980  -4.650  1.00 0.00 ? 323 TRP A CA   3  
ATOM   2517  C  C    . TRP A 1 16 ? -2.419  11.810  -4.803  1.00 0.00 ? 323 TRP A C    3  
ATOM   2518  O  O    . TRP A 1 16 ? -2.178  10.714  -4.305  1.00 0.00 ? 323 TRP A O    3  
ATOM   2519  C  CB   . TRP A 1 16 ? 0.008   12.497  -4.619  1.00 0.00 ? 323 TRP A CB   3  
ATOM   2520  C  CG   . TRP A 1 16 ? 0.499   12.022  -3.272  1.00 0.00 ? 323 TRP A CG   3  
ATOM   2521  C  CD1  . TRP A 1 16 ? -0.226  11.403  -2.290  1.00 0.00 ? 323 TRP A CD1  3  
ATOM   2522  C  CD2  . TRP A 1 16 ? 1.839   12.114  -2.776  1.00 0.00 ? 323 TRP A CD2  3  
ATOM   2523  N  NE1  . TRP A 1 16 ? 0.579   11.122  -1.214  1.00 0.00 ? 323 TRP A NE1  3  
ATOM   2524  C  CE2  . TRP A 1 16 ? 1.851   11.542  -1.489  1.00 0.00 ? 323 TRP A CE2  3  
ATOM   2525  C  CE3  . TRP A 1 16 ? 3.034   12.625  -3.296  1.00 0.00 ? 323 TRP A CE3  3  
ATOM   2526  C  CZ2  . TRP A 1 16 ? 3.006   11.472  -0.716  1.00 0.00 ? 323 TRP A CZ2  3  
ATOM   2527  C  CZ3  . TRP A 1 16 ? 4.180   12.552  -2.527  1.00 0.00 ? 323 TRP A CZ3  3  
ATOM   2528  C  CH2  . TRP A 1 16 ? 4.160   11.975  -1.251  1.00 0.00 ? 323 TRP A CH2  3  
ATOM   2529  H  H    . TRP A 1 16 ? -1.193  13.705  -2.692  1.00 0.00 ? 323 TRP A H    3  
ATOM   2530  H  HA   . TRP A 1 16 ? -1.581  13.632  -5.503  1.00 0.00 ? 323 TRP A HA   3  
ATOM   2531  H  HB2  . TRP A 1 16 ? 0.118   11.676  -5.312  1.00 0.00 ? 323 TRP A HB2  3  
ATOM   2532  H  HB3  . TRP A 1 16 ? 0.647   13.309  -4.937  1.00 0.00 ? 323 TRP A HB3  3  
ATOM   2533  H  HD1  . TRP A 1 16 ? -1.281  11.184  -2.361  1.00 0.00 ? 323 TRP A HD1  3  
ATOM   2534  H  HE1  . TRP A 1 16 ? 0.290   10.683  -0.387  1.00 0.00 ? 323 TRP A HE1  3  
ATOM   2535  H  HE3  . TRP A 1 16 ? 3.068   13.073  -4.280  1.00 0.00 ? 323 TRP A HE3  3  
ATOM   2536  H  HZ2  . TRP A 1 16 ? 3.006   11.031  0.271   1.00 0.00 ? 323 TRP A HZ2  3  
ATOM   2537  H  HZ3  . TRP A 1 16 ? 5.111   12.939  -2.912  1.00 0.00 ? 323 TRP A HZ3  3  
ATOM   2538  H  HH2  . TRP A 1 16 ? 5.080   11.941  -0.686  1.00 0.00 ? 323 TRP A HH2  3  
ATOM   2539  N  N    . LYS A 1 17 ? -3.548  12.083  -5.440  1.00 0.00 ? 324 LYS A N    3  
ATOM   2540  C  CA   . LYS A 1 17 ? -4.552  11.060  -5.718  1.00 0.00 ? 324 LYS A CA   3  
ATOM   2541  C  C    . LYS A 1 17 ? -4.046  10.016  -6.725  1.00 0.00 ? 324 LYS A C    3  
ATOM   2542  O  O    . LYS A 1 17 ? -4.565  9.888   -7.833  1.00 0.00 ? 324 LYS A O    3  
ATOM   2543  C  CB   . LYS A 1 17 ? -5.891  11.695  -6.170  1.00 0.00 ? 324 LYS A CB   3  
ATOM   2544  C  CG   . LYS A 1 17 ? -5.787  12.904  -7.117  1.00 0.00 ? 324 LYS A CG   3  
ATOM   2545  C  CD   . LYS A 1 17 ? -5.352  12.517  -8.525  1.00 0.00 ? 324 LYS A CD   3  
ATOM   2546  C  CE   . LYS A 1 17 ? -5.522  13.664  -9.512  1.00 0.00 ? 324 LYS A CE   3  
ATOM   2547  N  NZ   . LYS A 1 17 ? -4.623  14.810  -9.207  1.00 0.00 ? 324 LYS A NZ   3  
ATOM   2548  H  H    . LYS A 1 17 ? -3.724  13.009  -5.695  1.00 0.00 ? 324 LYS A H    3  
ATOM   2549  H  HA   . LYS A 1 17 ? -4.729  10.545  -4.784  1.00 0.00 ? 324 LYS A HA   3  
ATOM   2550  H  HB2  . LYS A 1 17 ? -6.472  10.930  -6.681  1.00 0.00 ? 324 LYS A HB2  3  
ATOM   2551  H  HB3  . LYS A 1 17 ? -6.431  12.016  -5.277  1.00 0.00 ? 324 LYS A HB3  3  
ATOM   2552  H  HG2  . LYS A 1 17 ? -6.755  13.376  -7.178  1.00 0.00 ? 324 LYS A HG2  3  
ATOM   2553  H  HG3  . LYS A 1 17 ? -5.077  13.608  -6.714  1.00 0.00 ? 324 LYS A HG3  3  
ATOM   2554  H  HD2  . LYS A 1 17 ? -4.313  12.231  -8.500  1.00 0.00 ? 324 LYS A HD2  3  
ATOM   2555  H  HD3  . LYS A 1 17 ? -5.948  11.679  -8.856  1.00 0.00 ? 324 LYS A HD3  3  
ATOM   2556  H  HE2  . LYS A 1 17 ? -5.302  13.302  -10.505 1.00 0.00 ? 324 LYS A HE2  3  
ATOM   2557  H  HE3  . LYS A 1 17 ? -6.547  14.001  -9.472  1.00 0.00 ? 324 LYS A HE3  3  
ATOM   2558  H  HZ1  . LYS A 1 17 ? -4.870  15.231  -8.289  1.00 0.00 ? 324 LYS A HZ1  3  
ATOM   2559  H  HZ2  . LYS A 1 17 ? -4.715  15.541  -9.943  1.00 0.00 ? 324 LYS A HZ2  3  
ATOM   2560  H  HZ3  . LYS A 1 17 ? -3.634  14.493  -9.179  1.00 0.00 ? 324 LYS A HZ3  3  
ATOM   2561  N  N    . LEU A 1 18 ? -3.026  9.273   -6.318  1.00 0.00 ? 325 LEU A N    3  
ATOM   2562  C  CA   . LEU A 1 18 ? -2.432  8.238   -7.148  1.00 0.00 ? 325 LEU A CA   3  
ATOM   2563  C  C    . LEU A 1 18 ? -3.477  7.192   -7.511  1.00 0.00 ? 325 LEU A C    3  
ATOM   2564  O  O    . LEU A 1 18 ? -4.126  6.615   -6.632  1.00 0.00 ? 325 LEU A O    3  
ATOM   2565  C  CB   . LEU A 1 18 ? -1.264  7.580   -6.407  1.00 0.00 ? 325 LEU A CB   3  
ATOM   2566  C  CG   . LEU A 1 18 ? -0.157  8.535   -5.953  1.00 0.00 ? 325 LEU A CG   3  
ATOM   2567  C  CD1  . LEU A 1 18 ? 0.884   7.785   -5.136  1.00 0.00 ? 325 LEU A CD1  3  
ATOM   2568  C  CD2  . LEU A 1 18 ? 0.497   9.212   -7.150  1.00 0.00 ? 325 LEU A CD2  3  
ATOM   2569  H  H    . LEU A 1 18 ? -2.659  9.427   -5.417  1.00 0.00 ? 325 LEU A H    3  
ATOM   2570  H  HA   . LEU A 1 18 ? -2.066  8.699   -8.053  1.00 0.00 ? 325 LEU A HA   3  
ATOM   2571  H  HB2  . LEU A 1 18 ? -1.664  7.083   -5.525  1.00 0.00 ? 325 LEU A HB2  3  
ATOM   2572  H  HB3  . LEU A 1 18 ? -0.818  6.835   -7.066  1.00 0.00 ? 325 LEU A HB3  3  
ATOM   2573  H  HG   . LEU A 1 18 ? -0.588  9.305   -5.325  1.00 0.00 ? 325 LEU A HG   3  
ATOM   2574  H  HD11 . LEU A 1 18 ? 1.667   8.467   -4.840  1.00 0.00 ? 325 LEU A HD11 3  
ATOM   2575  H  HD12 . LEU A 1 18 ? 1.303   6.988   -5.732  1.00 0.00 ? 325 LEU A HD12 3  
ATOM   2576  H  HD13 . LEU A 1 18 ? 0.418   7.369   -4.254  1.00 0.00 ? 325 LEU A HD13 3  
ATOM   2577  H  HD21 . LEU A 1 18 ? 1.283   9.869   -6.805  1.00 0.00 ? 325 LEU A HD21 3  
ATOM   2578  H  HD22 . LEU A 1 18 ? -0.241  9.786   -7.689  1.00 0.00 ? 325 LEU A HD22 3  
ATOM   2579  H  HD23 . LEU A 1 18 ? 0.917   8.463   -7.805  1.00 0.00 ? 325 LEU A HD23 3  
ATOM   2580  N  N    . THR A 1 19 ? -3.659  6.967   -8.802  1.00 0.00 ? 326 THR A N    3  
ATOM   2581  C  CA   . THR A 1 19 ? -4.638  6.006   -9.255  1.00 0.00 ? 326 THR A CA   3  
ATOM   2582  C  C    . THR A 1 19 ? -4.061  4.602   -9.236  1.00 0.00 ? 326 THR A C    3  
ATOM   2583  O  O    . THR A 1 19 ? -3.005  4.334   -9.806  1.00 0.00 ? 326 THR A O    3  
ATOM   2584  C  CB   . THR A 1 19 ? -5.151  6.327   -10.666 1.00 0.00 ? 326 THR A CB   3  
ATOM   2585  O  OG1  . THR A 1 19 ? -5.443  7.729   -10.769 1.00 0.00 ? 326 THR A OG1  3  
ATOM   2586  C  CG2  . THR A 1 19 ? -6.407  5.521   -10.976 1.00 0.00 ? 326 THR A CG2  3  
ATOM   2587  H  H    . THR A 1 19 ? -3.120  7.450   -9.458  1.00 0.00 ? 326 THR A H    3  
ATOM   2588  H  HA   . THR A 1 19 ? -5.476  6.047   -8.576  1.00 0.00 ? 326 THR A HA   3  
ATOM   2589  H  HB   . THR A 1 19 ? -4.388  6.062   -11.375 1.00 0.00 ? 326 THR A HB   3  
ATOM   2590  H  HG1  . THR A 1 19 ? -5.192  8.168   -9.947  1.00 0.00 ? 326 THR A HG1  3  
ATOM   2591  H  HG21 . THR A 1 19 ? -7.168  5.738   -10.240 1.00 0.00 ? 326 THR A HG21 3  
ATOM   2592  H  HG22 . THR A 1 19 ? -6.173  4.467   -10.950 1.00 0.00 ? 326 THR A HG22 3  
ATOM   2593  H  HG23 . THR A 1 19 ? -6.773  5.784   -11.957 1.00 0.00 ? 326 THR A HG23 3  
ATOM   2594  N  N    . CYS A 1 20 ? -4.769  3.729   -8.560  1.00 0.00 ? 327 CYS A N    3  
ATOM   2595  C  CA   . CYS A 1 20 ? -4.408  2.329   -8.472  1.00 0.00 ? 327 CYS A CA   3  
ATOM   2596  C  C    . CYS A 1 20 ? -4.864  1.621   -9.736  1.00 0.00 ? 327 CYS A C    3  
ATOM   2597  O  O    . CYS A 1 20 ? -6.062  1.541   -9.991  1.00 0.00 ? 327 CYS A O    3  
ATOM   2598  C  CB   . CYS A 1 20 ? -5.079  1.728   -7.229  1.00 0.00 ? 327 CYS A CB   3  
ATOM   2599  S  SG   . CYS A 1 20 ? -5.071  -0.083  -7.115  1.00 0.00 ? 327 CYS A SG   3  
ATOM   2600  H  H    . CYS A 1 20 ? -5.584  4.037   -8.121  1.00 0.00 ? 327 CYS A H    3  
ATOM   2601  H  HA   . CYS A 1 20 ? -3.333  2.255   -8.381  1.00 0.00 ? 327 CYS A HA   3  
ATOM   2602  H  HB2  . CYS A 1 20 ? -4.578  2.104   -6.351  1.00 0.00 ? 327 CYS A HB2  3  
ATOM   2603  H  HB3  . CYS A 1 20 ? -6.108  2.054   -7.206  1.00 0.00 ? 327 CYS A HB3  3  
ATOM   2604  N  N    . TYR A 1 21 ? -3.918  1.124   -10.532 1.00 0.00 ? 328 TYR A N    3  
ATOM   2605  C  CA   . TYR A 1 21 ? -4.266  0.485   -11.799 1.00 0.00 ? 328 TYR A CA   3  
ATOM   2606  C  C    . TYR A 1 21 ? -5.007  -0.821  -11.537 1.00 0.00 ? 328 TYR A C    3  
ATOM   2607  O  O    . TYR A 1 21 ? -5.767  -1.298  -12.376 1.00 0.00 ? 328 TYR A O    3  
ATOM   2608  C  CB   . TYR A 1 21 ? -3.022  0.256   -12.668 1.00 0.00 ? 328 TYR A CB   3  
ATOM   2609  C  CG   . TYR A 1 21 ? -2.091  -0.819  -12.162 1.00 0.00 ? 328 TYR A CG   3  
ATOM   2610  C  CD1  . TYR A 1 21 ? -1.167  -0.551  -11.164 1.00 0.00 ? 328 TYR A CD1  3  
ATOM   2611  C  CD2  . TYR A 1 21 ? -2.136  -2.102  -12.689 1.00 0.00 ? 328 TYR A CD2  3  
ATOM   2612  C  CE1  . TYR A 1 21 ? -0.311  -1.532  -10.704 1.00 0.00 ? 328 TYR A CE1  3  
ATOM   2613  C  CE2  . TYR A 1 21 ? -1.286  -3.086  -12.236 1.00 0.00 ? 328 TYR A CE2  3  
ATOM   2614  C  CZ   . TYR A 1 21 ? -0.377  -2.800  -11.247 1.00 0.00 ? 328 TYR A CZ   3  
ATOM   2615  O  OH   . TYR A 1 21 ? 0.467   -3.790  -10.802 1.00 0.00 ? 328 TYR A OH   3  
ATOM   2616  H  H    . TYR A 1 21 ? -2.974  1.185   -10.266 1.00 0.00 ? 328 TYR A H    3  
ATOM   2617  H  HA   . TYR A 1 21 ? -4.936  1.152   -12.322 1.00 0.00 ? 328 TYR A HA   3  
ATOM   2618  H  HB2  . TYR A 1 21 ? -3.337  -0.026  -13.660 1.00 0.00 ? 328 TYR A HB2  3  
ATOM   2619  H  HB3  . TYR A 1 21 ? -2.463  1.179   -12.727 1.00 0.00 ? 328 TYR A HB3  3  
ATOM   2620  H  HD1  . TYR A 1 21 ? -1.123  0.444   -10.745 1.00 0.00 ? 328 TYR A HD1  3  
ATOM   2621  H  HD2  . TYR A 1 21 ? -2.849  -2.325  -13.467 1.00 0.00 ? 328 TYR A HD2  3  
ATOM   2622  H  HE1  . TYR A 1 21 ? 0.401   -1.302  -9.925  1.00 0.00 ? 328 TYR A HE1  3  
ATOM   2623  H  HE2  . TYR A 1 21 ? -1.338  -4.077  -12.659 1.00 0.00 ? 328 TYR A HE2  3  
ATOM   2624  H  HH   . TYR A 1 21 ? 0.548   -4.463  -11.486 1.00 0.00 ? 328 TYR A HH   3  
ATOM   2625  N  N    . LEU A 1 22 ? -4.779  -1.391  -10.361 1.00 0.00 ? 329 LEU A N    3  
ATOM   2626  C  CA   . LEU A 1 22 ? -5.597  -2.489  -9.874  1.00 0.00 ? 329 LEU A CA   3  
ATOM   2627  C  C    . LEU A 1 22 ? -6.789  -1.896  -9.131  1.00 0.00 ? 329 LEU A C    3  
ATOM   2628  O  O    . LEU A 1 22 ? -6.919  -2.050  -7.904  1.00 0.00 ? 329 LEU A O    3  
ATOM   2629  C  CB   . LEU A 1 22 ? -4.784  -3.413  -8.960  1.00 0.00 ? 329 LEU A CB   3  
ATOM   2630  C  CG   . LEU A 1 22 ? -3.572  -4.083  -9.615  1.00 0.00 ? 329 LEU A CG   3  
ATOM   2631  C  CD1  . LEU A 1 22 ? -2.766  -4.859  -8.587  1.00 0.00 ? 329 LEU A CD1  3  
ATOM   2632  C  CD2  . LEU A 1 22 ? -4.013  -4.999  -10.746 1.00 0.00 ? 329 LEU A CD2  3  
ATOM   2633  H  H    . LEU A 1 22 ? -4.044  -1.060  -9.806  1.00 0.00 ? 329 LEU A H    3  
ATOM   2634  H  HA   . LEU A 1 22 ? -5.955  -3.045  -10.729 1.00 0.00 ? 329 LEU A HA   3  
ATOM   2635  H  HB2  . LEU A 1 22 ? -4.435  -2.834  -8.118  1.00 0.00 ? 329 LEU A HB2  3  
ATOM   2636  H  HB3  . LEU A 1 22 ? -5.442  -4.188  -8.594  1.00 0.00 ? 329 LEU A HB3  3  
ATOM   2637  H  HG   . LEU A 1 22 ? -2.932  -3.321  -10.032 1.00 0.00 ? 329 LEU A HG   3  
ATOM   2638  H  HD11 . LEU A 1 22 ? -3.381  -5.633  -8.156  1.00 0.00 ? 329 LEU A HD11 3  
ATOM   2639  H  HD12 . LEU A 1 22 ? -2.435  -4.188  -7.810  1.00 0.00 ? 329 LEU A HD12 3  
ATOM   2640  H  HD13 . LEU A 1 22 ? -1.906  -5.308  -9.066  1.00 0.00 ? 329 LEU A HD13 3  
ATOM   2641  H  HD21 . LEU A 1 22 ? -4.560  -4.427  -11.479 1.00 0.00 ? 329 LEU A HD21 3  
ATOM   2642  H  HD22 . LEU A 1 22 ? -4.646  -5.780  -10.353 1.00 0.00 ? 329 LEU A HD22 3  
ATOM   2643  H  HD23 . LEU A 1 22 ? -3.143  -5.441  -11.210 1.00 0.00 ? 329 LEU A HD23 3  
ATOM   2644  N  N    . CYS A 1 23 ? -7.587  -1.146  -9.901  1.00 0.00 ? 330 CYS A N    3  
ATOM   2645  C  CA   . CYS A 1 23 ? -8.750  -0.390  -9.433  1.00 0.00 ? 330 CYS A CA   3  
ATOM   2646  C  C    . CYS A 1 23 ? -9.184  0.576   -10.529 1.00 0.00 ? 330 CYS A C    3  
ATOM   2647  O  O    . CYS A 1 23 ? -8.539  0.688   -11.571 1.00 0.00 ? 330 CYS A O    3  
ATOM   2648  C  CB   . CYS A 1 23 ? -8.440  0.458   -8.188  1.00 0.00 ? 330 CYS A CB   3  
ATOM   2649  S  SG   . CYS A 1 23 ? -8.612  -0.379  -6.599  1.00 0.00 ? 330 CYS A SG   3  
ATOM   2650  H  H    . CYS A 1 23 ? -7.374  -1.090  -10.861 1.00 0.00 ? 330 CYS A H    3  
ATOM   2651  H  HA   . CYS A 1 23 ? -9.551  -1.080  -9.217  1.00 0.00 ? 330 CYS A HA   3  
ATOM   2652  H  HB2  . CYS A 1 23 ? -7.424  0.810   -8.253  1.00 0.00 ? 330 CYS A HB2  3  
ATOM   2653  H  HB3  . CYS A 1 23 ? -9.102  1.309   -8.176  1.00 0.00 ? 330 CYS A HB3  3  
ATOM   2654  N  N    . LYS A 1 24 ? -10.281 1.268   -10.278 1.00 0.00 ? 331 LYS A N    3  
ATOM   2655  C  CA   . LYS A 1 24 ? -10.631 2.453   -11.038 1.00 0.00 ? 331 LYS A CA   3  
ATOM   2656  C  C    . LYS A 1 24 ? -10.822 3.584   -10.034 1.00 0.00 ? 331 LYS A C    3  
ATOM   2657  O  O    . LYS A 1 24 ? -11.513 4.567   -10.278 1.00 0.00 ? 331 LYS A O    3  
ATOM   2658  C  CB   . LYS A 1 24 ? -11.901 2.224   -11.863 1.00 0.00 ? 331 LYS A CB   3  
ATOM   2659  C  CG   . LYS A 1 24 ? -12.179 3.341   -12.859 1.00 0.00 ? 331 LYS A CG   3  
ATOM   2660  C  CD   . LYS A 1 24 ? -13.512 3.157   -13.560 1.00 0.00 ? 331 LYS A CD   3  
ATOM   2661  C  CE   . LYS A 1 24 ? -13.793 4.295   -14.531 1.00 0.00 ? 331 LYS A CE   3  
ATOM   2662  N  NZ   . LYS A 1 24 ? -13.980 5.598   -13.834 1.00 0.00 ? 331 LYS A NZ   3  
ATOM   2663  H  H    . LYS A 1 24 ? -10.880 0.969   -9.566  1.00 0.00 ? 331 LYS A H    3  
ATOM   2664  H  HA   . LYS A 1 24 ? -9.806  2.693   -11.693 1.00 0.00 ? 331 LYS A HA   3  
ATOM   2665  H  HB2  . LYS A 1 24 ? -11.795 1.298   -12.411 1.00 0.00 ? 331 LYS A HB2  3  
ATOM   2666  H  HB3  . LYS A 1 24 ? -12.746 2.145   -11.195 1.00 0.00 ? 331 LYS A HB3  3  
ATOM   2667  H  HG2  . LYS A 1 24 ? -12.190 4.283   -12.332 1.00 0.00 ? 331 LYS A HG2  3  
ATOM   2668  H  HG3  . LYS A 1 24 ? -11.390 3.351   -13.599 1.00 0.00 ? 331 LYS A HG3  3  
ATOM   2669  H  HD2  . LYS A 1 24 ? -13.495 2.227   -14.107 1.00 0.00 ? 331 LYS A HD2  3  
ATOM   2670  H  HD3  . LYS A 1 24 ? -14.296 3.125   -12.817 1.00 0.00 ? 331 LYS A HD3  3  
ATOM   2671  H  HE2  . LYS A 1 24 ? -12.963 4.379   -15.215 1.00 0.00 ? 331 LYS A HE2  3  
ATOM   2672  H  HE3  . LYS A 1 24 ? -14.689 4.061   -15.084 1.00 0.00 ? 331 LYS A HE3  3  
ATOM   2673  H  HZ1  . LYS A 1 24 ? -13.152 5.813   -13.244 1.00 0.00 ? 331 LYS A HZ1  3  
ATOM   2674  H  HZ2  . LYS A 1 24 ? -14.821 5.562   -13.225 1.00 0.00 ? 331 LYS A HZ2  3  
ATOM   2675  H  HZ3  . LYS A 1 24 ? -14.101 6.364   -14.529 1.00 0.00 ? 331 LYS A HZ3  3  
ATOM   2676  N  N    . GLN A 1 25 ? -10.149 3.431   -8.904  1.00 0.00 ? 332 GLN A N    3  
ATOM   2677  C  CA   . GLN A 1 25 ? -10.349 4.289   -7.756  1.00 0.00 ? 332 GLN A CA   3  
ATOM   2678  C  C    . GLN A 1 25 ? -9.015  4.833   -7.271  1.00 0.00 ? 332 GLN A C    3  
ATOM   2679  O  O    . GLN A 1 25 ? -8.166  4.084   -6.776  1.00 0.00 ? 332 GLN A O    3  
ATOM   2680  C  CB   . GLN A 1 25 ? -11.038 3.514   -6.629  1.00 0.00 ? 332 GLN A CB   3  
ATOM   2681  C  CG   . GLN A 1 25 ? -12.433 3.016   -6.989  1.00 0.00 ? 332 GLN A CG   3  
ATOM   2682  C  CD   . GLN A 1 25 ? -13.078 2.189   -5.889  1.00 0.00 ? 332 GLN A CD   3  
ATOM   2683  O  OE1  . GLN A 1 25 ? -14.299 2.198   -5.728  1.00 0.00 ? 332 GLN A OE1  3  
ATOM   2684  N  NE2  . GLN A 1 25 ? -12.276 1.453   -5.134  1.00 0.00 ? 332 GLN A NE2  3  
ATOM   2685  H  H    . GLN A 1 25 ? -9.465  2.741   -8.858  1.00 0.00 ? 332 GLN A H    3  
ATOM   2686  H  HA   . GLN A 1 25 ? -10.979 5.111   -8.058  1.00 0.00 ? 332 GLN A HA   3  
ATOM   2687  H  HB2  . GLN A 1 25 ? -10.428 2.660   -6.374  1.00 0.00 ? 332 GLN A HB2  3  
ATOM   2688  H  HB3  . GLN A 1 25 ? -11.120 4.155   -5.766  1.00 0.00 ? 332 GLN A HB3  3  
ATOM   2689  H  HG2  . GLN A 1 25 ? -13.065 3.869   -7.188  1.00 0.00 ? 332 GLN A HG2  3  
ATOM   2690  H  HG3  . GLN A 1 25 ? -12.365 2.408   -7.880  1.00 0.00 ? 332 GLN A HG3  3  
ATOM   2691  H  HE21 . GLN A 1 25 ? -11.318 1.475   -5.316  1.00 0.00 ? 332 GLN A HE21 3  
ATOM   2692  H  HE22 . GLN A 1 25 ? -12.679 0.911   -4.423  1.00 0.00 ? 332 GLN A HE22 3  
ATOM   2693  N  N    . LYS A 1 26 ? -8.832  6.123   -7.443  1.00 0.00 ? 333 LYS A N    3  
ATOM   2694  C  CA   . LYS A 1 26 ? -7.634  6.806   -6.973  1.00 0.00 ? 333 LYS A CA   3  
ATOM   2695  C  C    . LYS A 1 26 ? -7.737  7.078   -5.477  1.00 0.00 ? 333 LYS A C    3  
ATOM   2696  O  O    . LYS A 1 26 ? -8.760  7.568   -4.994  1.00 0.00 ? 333 LYS A O    3  
ATOM   2697  C  CB   . LYS A 1 26 ? -7.404  8.109   -7.758  1.00 0.00 ? 333 LYS A CB   3  
ATOM   2698  C  CG   . LYS A 1 26 ? -8.666  8.923   -7.997  1.00 0.00 ? 333 LYS A CG   3  
ATOM   2699  C  CD   . LYS A 1 26 ? -8.385  10.167  -8.820  1.00 0.00 ? 333 LYS A CD   3  
ATOM   2700  C  CE   . LYS A 1 26 ? -9.671  10.758  -9.384  1.00 0.00 ? 333 LYS A CE   3  
ATOM   2701  N  NZ   . LYS A 1 26 ? -10.393 9.795   -10.262 1.00 0.00 ? 333 LYS A NZ   3  
ATOM   2702  H  H    . LYS A 1 26 ? -9.532  6.632   -7.896  1.00 0.00 ? 333 LYS A H    3  
ATOM   2703  H  HA   . LYS A 1 26 ? -6.798  6.144   -7.142  1.00 0.00 ? 333 LYS A HA   3  
ATOM   2704  H  HB2  . LYS A 1 26 ? -6.707  8.725   -7.209  1.00 0.00 ? 333 LYS A HB2  3  
ATOM   2705  H  HB3  . LYS A 1 26 ? -6.972  7.864   -8.717  1.00 0.00 ? 333 LYS A HB3  3  
ATOM   2706  H  HG2  . LYS A 1 26 ? -9.378  8.320   -8.530  1.00 0.00 ? 333 LYS A HG2  3  
ATOM   2707  H  HG3  . LYS A 1 26 ? -9.080  9.218   -7.044  1.00 0.00 ? 333 LYS A HG3  3  
ATOM   2708  H  HD2  . LYS A 1 26 ? -7.908  10.903  -8.189  1.00 0.00 ? 333 LYS A HD2  3  
ATOM   2709  H  HD3  . LYS A 1 26 ? -7.728  9.907   -9.635  1.00 0.00 ? 333 LYS A HD3  3  
ATOM   2710  H  HE2  . LYS A 1 26 ? -10.315 11.032  -8.564  1.00 0.00 ? 333 LYS A HE2  3  
ATOM   2711  H  HE3  . LYS A 1 26 ? -9.426  11.639  -9.957  1.00 0.00 ? 333 LYS A HE3  3  
ATOM   2712  H  HZ1  . LYS A 1 26 ? -10.677 8.958   -9.718  1.00 0.00 ? 333 LYS A HZ1  3  
ATOM   2713  H  HZ2  . LYS A 1 26 ? -9.778  9.494   -11.047 1.00 0.00 ? 333 LYS A HZ2  3  
ATOM   2714  H  HZ3  . LYS A 1 26 ? -11.247 10.238  -10.658 1.00 0.00 ? 333 LYS A HZ3  3  
ATOM   2715  N  N    . GLY A 1 27 ? -6.679  6.744   -4.749  1.00 0.00 ? 334 GLY A N    3  
ATOM   2716  C  CA   . GLY A 1 27 ? -6.702  6.864   -3.305  1.00 0.00 ? 334 GLY A CA   3  
ATOM   2717  C  C    . GLY A 1 27 ? -7.459  5.719   -2.657  1.00 0.00 ? 334 GLY A C    3  
ATOM   2718  O  O    . GLY A 1 27 ? -7.135  4.544   -2.887  1.00 0.00 ? 334 GLY A O    3  
ATOM   2719  H  H    . GLY A 1 27 ? -5.868  6.421   -5.198  1.00 0.00 ? 334 GLY A H    3  
ATOM   2720  H  HA2  . GLY A 1 27 ? -5.687  6.868   -2.938  1.00 0.00 ? 334 GLY A HA2  3  
ATOM   2721  H  HA3  . GLY A 1 27 ? -7.176  7.796   -3.037  1.00 0.00 ? 334 GLY A HA3  3  
ATOM   2722  N  N    . VAL A 1 28 ? -8.468  6.061   -1.852  1.00 0.00 ? 335 VAL A N    3  
ATOM   2723  C  CA   . VAL A 1 28 ? -9.329  5.082   -1.177  1.00 0.00 ? 335 VAL A CA   3  
ATOM   2724  C  C    . VAL A 1 28 ? -8.617  4.407   0.002   1.00 0.00 ? 335 VAL A C    3  
ATOM   2725  O  O    . VAL A 1 28 ? -9.126  4.415   1.125   1.00 0.00 ? 335 VAL A O    3  
ATOM   2726  C  CB   . VAL A 1 28 ? -9.887  4.016   -2.155  1.00 0.00 ? 335 VAL A CB   3  
ATOM   2727  C  CG1  . VAL A 1 28 ? -10.526 2.851   -1.400  1.00 0.00 ? 335 VAL A CG1  3  
ATOM   2728  C  CG2  . VAL A 1 28 ? -10.894 4.653   -3.110  1.00 0.00 ? 335 VAL A CG2  3  
ATOM   2729  H  H    . VAL A 1 28 ? -8.637  7.017   -1.697  1.00 0.00 ? 335 VAL A H    3  
ATOM   2730  H  HA   . VAL A 1 28 ? -10.173 5.630   -0.779  1.00 0.00 ? 335 VAL A HA   3  
ATOM   2731  H  HB   . VAL A 1 28 ? -9.066  3.630   -2.740  1.00 0.00 ? 335 VAL A HB   3  
ATOM   2732  H  HG11 . VAL A 1 28 ? -11.316 3.223   -0.764  1.00 0.00 ? 335 VAL A HG11 3  
ATOM   2733  H  HG12 . VAL A 1 28 ? -9.777  2.359   -0.794  1.00 0.00 ? 335 VAL A HG12 3  
ATOM   2734  H  HG13 . VAL A 1 28 ? -10.936 2.145   -2.107  1.00 0.00 ? 335 VAL A HG13 3  
ATOM   2735  H  HG21 . VAL A 1 28 ? -11.725 5.056   -2.544  1.00 0.00 ? 335 VAL A HG21 3  
ATOM   2736  H  HG22 . VAL A 1 28 ? -11.260 3.909   -3.801  1.00 0.00 ? 335 VAL A HG22 3  
ATOM   2737  H  HG23 . VAL A 1 28 ? -10.416 5.451   -3.660  1.00 0.00 ? 335 VAL A HG23 3  
ATOM   2738  N  N    . GLY A 1 29 ? -7.448  3.829   -0.243  1.00 0.00 ? 336 GLY A N    3  
ATOM   2739  C  CA   . GLY A 1 29 ? -6.717  3.176   0.819   1.00 0.00 ? 336 GLY A CA   3  
ATOM   2740  C  C    . GLY A 1 29 ? -5.241  3.495   0.768   1.00 0.00 ? 336 GLY A C    3  
ATOM   2741  O  O    . GLY A 1 29 ? -4.853  4.621   0.464   1.00 0.00 ? 336 GLY A O    3  
ATOM   2742  H  H    . GLY A 1 29 ? -7.073  3.859   -1.148  1.00 0.00 ? 336 GLY A H    3  
ATOM   2743  H  HA2  . GLY A 1 29 ? -7.114  3.515   1.776   1.00 0.00 ? 336 GLY A HA2  3  
ATOM   2744  H  HA3  . GLY A 1 29 ? -6.846  2.096   0.726   1.00 0.00 ? 336 GLY A HA3  3  
ATOM   2745  N  N    . ALA A 1 30 ? -4.421  2.501   1.051   1.00 0.00 ? 337 ALA A N    3  
ATOM   2746  C  CA   . ALA A 1 30 ? -2.979  2.670   1.021   1.00 0.00 ? 337 ALA A CA   3  
ATOM   2747  C  C    . ALA A 1 30 ? -2.443  2.321   -0.356  1.00 0.00 ? 337 ALA A C    3  
ATOM   2748  O  O    . ALA A 1 30 ? -2.804  1.287   -0.926  1.00 0.00 ? 337 ALA A O    3  
ATOM   2749  C  CB   . ALA A 1 30 ? -2.318  1.811   2.087   1.00 0.00 ? 337 ALA A CB   3  
ATOM   2750  H  H    . ALA A 1 30 ? -4.796  1.625   1.279   1.00 0.00 ? 337 ALA A H    3  
ATOM   2751  H  HA   . ALA A 1 30 ? -2.759  3.707   1.235   1.00 0.00 ? 337 ALA A HA   3  
ATOM   2752  H  HB1  . ALA A 1 30 ? -2.536  0.769   1.897   1.00 0.00 ? 337 ALA A HB1  3  
ATOM   2753  H  HB2  . ALA A 1 30 ? -2.701  2.087   3.059   1.00 0.00 ? 337 ALA A HB2  3  
ATOM   2754  H  HB3  . ALA A 1 30 ? -1.250  1.965   2.065   1.00 0.00 ? 337 ALA A HB3  3  
ATOM   2755  N  N    . SER A 1 31 ? -1.608  3.189   -0.896  1.00 0.00 ? 338 SER A N    3  
ATOM   2756  C  CA   . SER A 1 31 ? -1.029  2.970   -2.204  1.00 0.00 ? 338 SER A CA   3  
ATOM   2757  C  C    . SER A 1 31 ? 0.491   2.887   -2.124  1.00 0.00 ? 338 SER A C    3  
ATOM   2758  O  O    . SER A 1 31 ? 1.159   3.823   -1.680  1.00 0.00 ? 338 SER A O    3  
ATOM   2759  C  CB   . SER A 1 31 ? -1.467  4.084   -3.156  1.00 0.00 ? 338 SER A CB   3  
ATOM   2760  O  OG   . SER A 1 31 ? -1.333  5.360   -2.552  1.00 0.00 ? 338 SER A OG   3  
ATOM   2761  H  H    . SER A 1 31 ? -1.378  4.008   -0.406  1.00 0.00 ? 338 SER A H    3  
ATOM   2762  H  HA   . SER A 1 31 ? -1.403  2.029   -2.575  1.00 0.00 ? 338 SER A HA   3  
ATOM   2763  H  HB2  . SER A 1 31 ? -0.857  4.053   -4.045  1.00 0.00 ? 338 SER A HB2  3  
ATOM   2764  H  HB3  . SER A 1 31 ? -2.502  3.933   -3.425  1.00 0.00 ? 338 SER A HB3  3  
ATOM   2765  H  HG   . SER A 1 31 ? -0.608  5.340   -1.916  1.00 0.00 ? 338 SER A HG   3  
ATOM   2766  N  N    . ILE A 1 32 ? 1.023   1.751   -2.538  1.00 0.00 ? 339 ILE A N    3  
ATOM   2767  C  CA   . ILE A 1 32 ? 2.456   1.549   -2.582  1.00 0.00 ? 339 ILE A CA   3  
ATOM   2768  C  C    . ILE A 1 32 ? 2.931   1.697   -4.028  1.00 0.00 ? 339 ILE A C    3  
ATOM   2769  O  O    . ILE A 1 32 ? 2.163   1.459   -4.964  1.00 0.00 ? 339 ILE A O    3  
ATOM   2770  C  CB   . ILE A 1 32 ? 2.839   0.159   -2.011  1.00 0.00 ? 339 ILE A CB   3  
ATOM   2771  C  CG1  . ILE A 1 32 ? 4.360   0.005   -1.918  1.00 0.00 ? 339 ILE A CG1  3  
ATOM   2772  C  CG2  . ILE A 1 32 ? 2.237   -0.960  -2.854  1.00 0.00 ? 339 ILE A CG2  3  
ATOM   2773  C  CD1  . ILE A 1 32 ? 4.801   -1.290  -1.268  1.00 0.00 ? 339 ILE A CD1  3  
ATOM   2774  H  H    . ILE A 1 32 ? 0.430   1.029   -2.846  1.00 0.00 ? 339 ILE A H    3  
ATOM   2775  H  HA   . ILE A 1 32 ? 2.922   2.314   -1.977  1.00 0.00 ? 339 ILE A HA   3  
ATOM   2776  H  HB   . ILE A 1 32 ? 2.422   0.086   -1.018  1.00 0.00 ? 339 ILE A HB   3  
ATOM   2777  H  HG12 . ILE A 1 32 ? 4.778   0.029   -2.920  1.00 0.00 ? 339 ILE A HG12 3  
ATOM   2778  H  HG13 . ILE A 1 32 ? 4.764   0.829   -1.331  1.00 0.00 ? 339 ILE A HG13 3  
ATOM   2779  H  HG21 . ILE A 1 32 ? 2.611   -0.891  -3.864  1.00 0.00 ? 339 ILE A HG21 3  
ATOM   2780  H  HG22 . ILE A 1 32 ? 1.161   -0.867  -2.862  1.00 0.00 ? 339 ILE A HG22 3  
ATOM   2781  H  HG23 . ILE A 1 32 ? 2.513   -1.916  -2.432  1.00 0.00 ? 339 ILE A HG23 3  
ATOM   2782  H  HD11 . ILE A 1 32 ? 4.399   -1.345  -0.267  1.00 0.00 ? 339 ILE A HD11 3  
ATOM   2783  H  HD12 . ILE A 1 32 ? 5.879   -1.323  -1.225  1.00 0.00 ? 339 ILE A HD12 3  
ATOM   2784  H  HD13 . ILE A 1 32 ? 4.437   -2.124  -1.849  1.00 0.00 ? 339 ILE A HD13 3  
ATOM   2785  N  N    . GLN A 1 33 ? 4.176   2.111   -4.216  1.00 0.00 ? 340 GLN A N    3  
ATOM   2786  C  CA   . GLN A 1 33 ? 4.684   2.382   -5.541  1.00 0.00 ? 340 GLN A CA   3  
ATOM   2787  C  C    . GLN A 1 33 ? 5.730   1.370   -5.955  1.00 0.00 ? 340 GLN A C    3  
ATOM   2788  O  O    . GLN A 1 33 ? 6.633   1.026   -5.188  1.00 0.00 ? 340 GLN A O    3  
ATOM   2789  C  CB   . GLN A 1 33 ? 5.272   3.787   -5.634  1.00 0.00 ? 340 GLN A CB   3  
ATOM   2790  C  CG   . GLN A 1 33 ? 4.231   4.880   -5.777  1.00 0.00 ? 340 GLN A CG   3  
ATOM   2791  C  CD   . GLN A 1 33 ? 4.831   6.198   -6.094  1.00 0.00 ? 340 GLN A CD   3  
ATOM   2792  O  OE1  . GLN A 1 33 ? 5.989   6.480   -5.782  1.00 0.00 ? 340 GLN A OE1  3  
ATOM   2793  N  NE2  . GLN A 1 33 ? 4.024   7.033   -6.671  1.00 0.00 ? 340 GLN A NE2  3  
ATOM   2794  H  H    . GLN A 1 33 ? 4.774   2.211   -3.454  1.00 0.00 ? 340 GLN A H    3  
ATOM   2795  H  HA   . GLN A 1 33 ? 3.854   2.311   -6.226  1.00 0.00 ? 340 GLN A HA   3  
ATOM   2796  H  HB2  . GLN A 1 33 ? 5.844   3.982   -4.740  1.00 0.00 ? 340 GLN A HB2  3  
ATOM   2797  H  HB3  . GLN A 1 33 ? 5.930   3.835   -6.489  1.00 0.00 ? 340 GLN A HB3  3  
ATOM   2798  H  HG2  . GLN A 1 33 ? 3.550   4.615   -6.582  1.00 0.00 ? 340 GLN A HG2  3  
ATOM   2799  H  HG3  . GLN A 1 33 ? 3.684   5.002   -4.857  1.00 0.00 ? 340 GLN A HG3  3  
ATOM   2800  H  HE21 . GLN A 1 33 ? 3.113   6.739   -6.867  1.00 0.00 ? 340 GLN A HE21 3  
ATOM   2801  H  HE22 . GLN A 1 33 ? 4.345   7.906   -6.832  1.00 0.00 ? 340 GLN A HE22 3  
ATOM   2802  N  N    . CYS A 1 34 ? 5.561   0.888   -7.169  1.00 0.00 ? 341 CYS A N    3  
ATOM   2803  C  CA   . CYS A 1 34 ? 6.554   0.058   -7.828  1.00 0.00 ? 341 CYS A CA   3  
ATOM   2804  C  C    . CYS A 1 34 ? 7.889   0.781   -7.868  1.00 0.00 ? 341 CYS A C    3  
ATOM   2805  O  O    . CYS A 1 34 ? 7.949   1.981   -8.146  1.00 0.00 ? 341 CYS A O    3  
ATOM   2806  C  CB   . CYS A 1 34 ? 6.112   -0.281  -9.256  1.00 0.00 ? 341 CYS A CB   3  
ATOM   2807  S  SG   . CYS A 1 34 ? 7.351   -1.177  -10.236 1.00 0.00 ? 341 CYS A SG   3  
ATOM   2808  H  H    . CYS A 1 34 ? 4.727   1.095   -7.631  1.00 0.00 ? 341 CYS A H    3  
ATOM   2809  H  HA   . CYS A 1 34 ? 6.660   -0.854  -7.261  1.00 0.00 ? 341 CYS A HA   3  
ATOM   2810  H  HB2  . CYS A 1 34 ? 5.224   -0.895  -9.214  1.00 0.00 ? 341 CYS A HB2  3  
ATOM   2811  H  HB3  . CYS A 1 34 ? 5.883   0.637   -9.778  1.00 0.00 ? 341 CYS A HB3  3  
ATOM   2812  N  N    . HIS A 1 35 ? 8.951   0.042   -7.610  1.00 0.00 ? 342 HIS A N    3  
ATOM   2813  C  CA   . HIS A 1 35 ? 10.282  0.616   -7.566  1.00 0.00 ? 342 HIS A CA   3  
ATOM   2814  C  C    . HIS A 1 35 ? 10.788  0.871   -8.993  1.00 0.00 ? 342 HIS A C    3  
ATOM   2815  O  O    . HIS A 1 35 ? 10.034  0.712   -9.959  1.00 0.00 ? 342 HIS A O    3  
ATOM   2816  C  CB   . HIS A 1 35 ? 11.220  -0.315  -6.785  1.00 0.00 ? 342 HIS A CB   3  
ATOM   2817  C  CG   . HIS A 1 35 ? 12.465  0.349   -6.274  1.00 0.00 ? 342 HIS A CG   3  
ATOM   2818  N  ND1  . HIS A 1 35 ? 13.734  -0.099  -6.570  1.00 0.00 ? 342 HIS A ND1  3  
ATOM   2819  C  CD2  . HIS A 1 35 ? 12.626  1.424   -5.468  1.00 0.00 ? 342 HIS A CD2  3  
ATOM   2820  C  CE1  . HIS A 1 35 ? 14.620  0.672   -5.968  1.00 0.00 ? 342 HIS A CE1  3  
ATOM   2821  N  NE2  . HIS A 1 35 ? 13.974  1.606   -5.290  1.00 0.00 ? 342 HIS A NE2  3  
ATOM   2822  H  H    . HIS A 1 35 ? 8.832   -0.922  -7.451  1.00 0.00 ? 342 HIS A H    3  
ATOM   2823  H  HA   . HIS A 1 35 ? 10.215  1.562   -7.048  1.00 0.00 ? 342 HIS A HA   3  
ATOM   2824  H  HB2  . HIS A 1 35 ? 10.683  -0.710  -5.922  1.00 0.00 ? 342 HIS A HB2  3  
ATOM   2825  H  HB3  . HIS A 1 35 ? 11.523  -1.137  -7.438  1.00 0.00 ? 342 HIS A HB3  3  
ATOM   2826  H  HD1  . HIS A 1 35 ? 13.959  -0.887  -7.126  1.00 0.00 ? 342 HIS A HD1  3  
ATOM   2827  H  HD2  . HIS A 1 35 ? 11.839  2.031   -5.047  1.00 0.00 ? 342 HIS A HD2  3  
ATOM   2828  H  HE1  . HIS A 1 35 ? 15.693  0.560   -6.020  1.00 0.00 ? 342 HIS A HE1  3  
ATOM   2829  H  HE2  . HIS A 1 35 ? 14.373  2.138   -4.566  1.00 0.00 ? 342 HIS A HE2  3  
ATOM   2830  N  N    . LYS A 1 36 ? 12.066  1.235   -9.105  1.00 0.00 ? 343 LYS A N    3  
ATOM   2831  C  CA   . LYS A 1 36 ? 12.675  1.681   -10.360 1.00 0.00 ? 343 LYS A CA   3  
ATOM   2832  C  C    . LYS A 1 36 ? 12.207  3.100   -10.691 1.00 0.00 ? 343 LYS A C    3  
ATOM   2833  O  O    . LYS A 1 36 ? 11.012  3.350   -10.873 1.00 0.00 ? 343 LYS A O    3  
ATOM   2834  C  CB   . LYS A 1 36 ? 12.384  0.712   -11.514 1.00 0.00 ? 343 LYS A CB   3  
ATOM   2835  C  CG   . LYS A 1 36 ? 13.432  0.737   -12.614 1.00 0.00 ? 343 LYS A CG   3  
ATOM   2836  C  CD   . LYS A 1 36 ? 14.806  0.364   -12.075 1.00 0.00 ? 343 LYS A CD   3  
ATOM   2837  C  CE   . LYS A 1 36 ? 15.824  0.196   -13.189 1.00 0.00 ? 343 LYS A CE   3  
ATOM   2838  N  NZ   . LYS A 1 36 ? 15.485  -0.932  -14.097 1.00 0.00 ? 343 LYS A NZ   3  
ATOM   2839  H  H    . LYS A 1 36 ? 12.628  1.193   -8.311  1.00 0.00 ? 343 LYS A H    3  
ATOM   2840  H  HA   . LYS A 1 36 ? 13.744  1.712   -10.196 1.00 0.00 ? 343 LYS A HA   3  
ATOM   2841  H  HB2  . LYS A 1 36 ? 12.331  -0.293  -11.121 1.00 0.00 ? 343 LYS A HB2  3  
ATOM   2842  H  HB3  . LYS A 1 36 ? 11.430  0.967   -11.952 1.00 0.00 ? 343 LYS A HB3  3  
ATOM   2843  H  HG2  . LYS A 1 36 ? 13.150  0.020   -13.382 1.00 0.00 ? 343 LYS A HG2  3  
ATOM   2844  H  HG3  . LYS A 1 36 ? 13.478  1.742   -13.032 1.00 0.00 ? 343 LYS A HG3  3  
ATOM   2845  H  HD2  . LYS A 1 36 ? 15.150  1.159   -11.415 1.00 0.00 ? 343 LYS A HD2  3  
ATOM   2846  H  HD3  . LYS A 1 36 ? 14.725  -0.574  -11.525 1.00 0.00 ? 343 LYS A HD3  3  
ATOM   2847  H  HE2  . LYS A 1 36 ? 15.861  1.107   -13.765 1.00 0.00 ? 343 LYS A HE2  3  
ATOM   2848  H  HE3  . LYS A 1 36 ? 16.792  0.013   -12.746 1.00 0.00 ? 343 LYS A HE3  3  
ATOM   2849  H  HZ1  . LYS A 1 36 ? 15.352  -1.806  -13.552 1.00 0.00 ? 343 LYS A HZ1  3  
ATOM   2850  H  HZ2  . LYS A 1 36 ? 16.251  -1.077  -14.782 1.00 0.00 ? 343 LYS A HZ2  3  
ATOM   2851  H  HZ3  . LYS A 1 36 ? 14.609  -0.724  -14.615 1.00 0.00 ? 343 LYS A HZ3  3  
ATOM   2852  N  N    . ALA A 1 37 ? 13.172  4.016   -10.761 1.00 0.00 ? 344 ALA A N    3  
ATOM   2853  C  CA   . ALA A 1 37 ? 12.911  5.455   -10.876 1.00 0.00 ? 344 ALA A CA   3  
ATOM   2854  C  C    . ALA A 1 37 ? 11.921  5.809   -11.981 1.00 0.00 ? 344 ALA A C    3  
ATOM   2855  O  O    . ALA A 1 37 ? 11.001  6.595   -11.764 1.00 0.00 ? 344 ALA A O    3  
ATOM   2856  C  CB   . ALA A 1 37 ? 14.219  6.197   -11.109 1.00 0.00 ? 344 ALA A CB   3  
ATOM   2857  H  H    . ALA A 1 37 ? 14.106  3.715   -10.728 1.00 0.00 ? 344 ALA A H    3  
ATOM   2858  H  HA   . ALA A 1 37 ? 12.508  5.791   -9.932  1.00 0.00 ? 344 ALA A HA   3  
ATOM   2859  H  HB1  . ALA A 1 37 ? 14.901  5.990   -10.298 1.00 0.00 ? 344 ALA A HB1  3  
ATOM   2860  H  HB2  . ALA A 1 37 ? 14.027  7.258   -11.155 1.00 0.00 ? 344 ALA A HB2  3  
ATOM   2861  H  HB3  . ALA A 1 37 ? 14.658  5.869   -12.041 1.00 0.00 ? 344 ALA A HB3  3  
ATOM   2862  N  N    . ASN A 1 38 ? 12.102  5.233   -13.160 1.00 0.00 ? 345 ASN A N    3  
ATOM   2863  C  CA   . ASN A 1 38 ? 11.311  5.626   -14.326 1.00 0.00 ? 345 ASN A CA   3  
ATOM   2864  C  C    . ASN A 1 38 ? 9.934   4.978   -14.325 1.00 0.00 ? 345 ASN A C    3  
ATOM   2865  O  O    . ASN A 1 38 ? 9.179   5.117   -15.286 1.00 0.00 ? 345 ASN A O    3  
ATOM   2866  C  CB   . ASN A 1 38 ? 12.043  5.257   -15.621 1.00 0.00 ? 345 ASN A CB   3  
ATOM   2867  C  CG   . ASN A 1 38 ? 13.356  6.002   -15.797 1.00 0.00 ? 345 ASN A CG   3  
ATOM   2868  O  OD1  . ASN A 1 38 ? 14.322  5.447   -16.321 1.00 0.00 ? 345 ASN A OD1  3  
ATOM   2869  N  ND2  . ASN A 1 38 ? 13.402  7.261   -15.382 1.00 0.00 ? 345 ASN A ND2  3  
ATOM   2870  H  H    . ASN A 1 38 ? 12.778  4.530   -13.251 1.00 0.00 ? 345 ASN A H    3  
ATOM   2871  H  HA   . ASN A 1 38 ? 11.189  6.698   -14.291 1.00 0.00 ? 345 ASN A HA   3  
ATOM   2872  H  HB2  . ASN A 1 38 ? 12.251  4.199   -15.618 1.00 0.00 ? 345 ASN A HB2  3  
ATOM   2873  H  HB3  . ASN A 1 38 ? 11.405  5.489   -16.463 1.00 0.00 ? 345 ASN A HB3  3  
ATOM   2874  H  HD21 . ASN A 1 38 ? 12.596  7.653   -14.984 1.00 0.00 ? 345 ASN A HD21 3  
ATOM   2875  H  HD22 . ASN A 1 38 ? 14.245  7.754   -15.498 1.00 0.00 ? 345 ASN A HD22 3  
ATOM   2876  N  N    . CYS A 1 39 ? 9.599   4.283   -13.249 1.00 0.00 ? 346 CYS A N    3  
ATOM   2877  C  CA   . CYS A 1 39 ? 8.342   3.561   -13.191 1.00 0.00 ? 346 CYS A CA   3  
ATOM   2878  C  C    . CYS A 1 39 ? 7.349   4.256   -12.258 1.00 0.00 ? 346 CYS A C    3  
ATOM   2879  O  O    . CYS A 1 39 ? 6.421   4.914   -12.728 1.00 0.00 ? 346 CYS A O    3  
ATOM   2880  C  CB   . CYS A 1 39 ? 8.587   2.116   -12.747 1.00 0.00 ? 346 CYS A CB   3  
ATOM   2881  S  SG   . CYS A 1 39 ? 7.202   0.991   -13.058 1.00 0.00 ? 346 CYS A SG   3  
ATOM   2882  H  H    . CYS A 1 39 ? 10.206  4.266   -12.477 1.00 0.00 ? 346 CYS A H    3  
ATOM   2883  H  HA   . CYS A 1 39 ? 7.929   3.552   -14.188 1.00 0.00 ? 346 CYS A HA   3  
ATOM   2884  H  HB2  . CYS A 1 39 ? 9.445   1.727   -13.273 1.00 0.00 ? 346 CYS A HB2  3  
ATOM   2885  H  HB3  . CYS A 1 39 ? 8.788   2.105   -11.686 1.00 0.00 ? 346 CYS A HB3  3  
ATOM   2886  N  N    . TYR A 1 40 ? 7.560   4.112   -10.944 1.00 0.00 ? 347 TYR A N    3  
ATOM   2887  C  CA   . TYR A 1 40 ? 6.660   4.672   -9.926  1.00 0.00 ? 347 TYR A CA   3  
ATOM   2888  C  C    . TYR A 1 40 ? 5.192   4.382   -10.231 1.00 0.00 ? 347 TYR A C    3  
ATOM   2889  O  O    . TYR A 1 40 ? 4.437   5.253   -10.662 1.00 0.00 ? 347 TYR A O    3  
ATOM   2890  C  CB   . TYR A 1 40 ? 6.894   6.175   -9.745  1.00 0.00 ? 347 TYR A CB   3  
ATOM   2891  C  CG   . TYR A 1 40 ? 8.176   6.492   -9.010  1.00 0.00 ? 347 TYR A CG   3  
ATOM   2892  C  CD1  . TYR A 1 40 ? 8.549   5.760   -7.890  1.00 0.00 ? 347 TYR A CD1  3  
ATOM   2893  C  CD2  . TYR A 1 40 ? 9.004   7.527   -9.424  1.00 0.00 ? 347 TYR A CD2  3  
ATOM   2894  C  CE1  . TYR A 1 40 ? 9.712   6.049   -7.203  1.00 0.00 ? 347 TYR A CE1  3  
ATOM   2895  C  CE2  . TYR A 1 40 ? 10.171  7.821   -8.743  1.00 0.00 ? 347 TYR A CE2  3  
ATOM   2896  C  CZ   . TYR A 1 40 ? 10.519  7.081   -7.634  1.00 0.00 ? 347 TYR A CZ   3  
ATOM   2897  O  OH   . TYR A 1 40 ? 11.680  7.377   -6.950  1.00 0.00 ? 347 TYR A OH   3  
ATOM   2898  H  H    . TYR A 1 40 ? 8.356   3.623   -10.646 1.00 0.00 ? 347 TYR A H    3  
ATOM   2899  H  HA   . TYR A 1 40 ? 6.898   4.182   -8.995  1.00 0.00 ? 347 TYR A HA   3  
ATOM   2900  H  HB2  . TYR A 1 40 ? 6.945   6.645   -10.716 1.00 0.00 ? 347 TYR A HB2  3  
ATOM   2901  H  HB3  . TYR A 1 40 ? 6.074   6.599   -9.185  1.00 0.00 ? 347 TYR A HB3  3  
ATOM   2902  H  HD1  . TYR A 1 40 ? 7.911   4.951   -7.555  1.00 0.00 ? 347 TYR A HD1  3  
ATOM   2903  H  HD2  . TYR A 1 40 ? 8.729   8.106   -10.294 1.00 0.00 ? 347 TYR A HD2  3  
ATOM   2904  H  HE1  . TYR A 1 40 ? 9.984   5.468   -6.334  1.00 0.00 ? 347 TYR A HE1  3  
ATOM   2905  H  HE2  . TYR A 1 40 ? 10.801  8.630   -9.079  1.00 0.00 ? 347 TYR A HE2  3  
ATOM   2906  H  HH   . TYR A 1 40 ? 11.687  8.319   -6.734  1.00 0.00 ? 347 TYR A HH   3  
ATOM   2907  N  N    . THR A 1 41 ? 4.797   3.143   -9.997  1.00 0.00 ? 348 THR A N    3  
ATOM   2908  C  CA   . THR A 1 41 ? 3.431   2.711   -10.260 1.00 0.00 ? 348 THR A CA   3  
ATOM   2909  C  C    . THR A 1 41 ? 2.684   2.526   -8.945  1.00 0.00 ? 348 THR A C    3  
ATOM   2910  O  O    . THR A 1 41 ? 3.166   1.833   -8.055  1.00 0.00 ? 348 THR A O    3  
ATOM   2911  C  CB   . THR A 1 41 ? 3.416   1.390   -11.047 1.00 0.00 ? 348 THR A CB   3  
ATOM   2912  O  OG1  . THR A 1 41 ? 4.406   1.431   -12.081 1.00 0.00 ? 348 THR A OG1  3  
ATOM   2913  C  CG2  . THR A 1 41 ? 2.052   1.140   -11.666 1.00 0.00 ? 348 THR A CG2  3  
ATOM   2914  H  H    . THR A 1 41 ? 5.438   2.508   -9.622  1.00 0.00 ? 348 THR A H    3  
ATOM   2915  H  HA   . THR A 1 41 ? 2.939   3.473   -10.847 1.00 0.00 ? 348 THR A HA   3  
ATOM   2916  H  HB   . THR A 1 41 ? 3.644   0.579   -10.370 1.00 0.00 ? 348 THR A HB   3  
ATOM   2917  H  HG1  . THR A 1 41 ? 4.628   2.353   -12.268 1.00 0.00 ? 348 THR A HG1  3  
ATOM   2918  H  HG21 . THR A 1 41 ? 1.311   1.056   -10.884 1.00 0.00 ? 348 THR A HG21 3  
ATOM   2919  H  HG22 . THR A 1 41 ? 2.078   0.223   -12.237 1.00 0.00 ? 348 THR A HG22 3  
ATOM   2920  H  HG23 . THR A 1 41 ? 1.798   1.964   -12.316 1.00 0.00 ? 348 THR A HG23 3  
ATOM   2921  N  N    . ALA A 1 42 ? 1.514   3.136   -8.824  1.00 0.00 ? 349 ALA A N    3  
ATOM   2922  C  CA   . ALA A 1 42 ? 0.783   3.119   -7.568  1.00 0.00 ? 349 ALA A CA   3  
ATOM   2923  C  C    . ALA A 1 42 ? -0.336  2.087   -7.577  1.00 0.00 ? 349 ALA A C    3  
ATOM   2924  O  O    . ALA A 1 42 ? -1.133  2.016   -8.516  1.00 0.00 ? 349 ALA A O    3  
ATOM   2925  C  CB   . ALA A 1 42 ? 0.227   4.499   -7.263  1.00 0.00 ? 349 ALA A CB   3  
ATOM   2926  H  H    . ALA A 1 42 ? 1.127   3.593   -9.597  1.00 0.00 ? 349 ALA A H    3  
ATOM   2927  H  HA   . ALA A 1 42 ? 1.483   2.865   -6.786  1.00 0.00 ? 349 ALA A HA   3  
ATOM   2928  H  HB1  . ALA A 1 42 ? 1.035   5.214   -7.236  1.00 0.00 ? 349 ALA A HB1  3  
ATOM   2929  H  HB2  . ALA A 1 42 ? -0.272  4.482   -6.304  1.00 0.00 ? 349 ALA A HB2  3  
ATOM   2930  H  HB3  . ALA A 1 42 ? -0.477  4.780   -8.030  1.00 0.00 ? 349 ALA A HB3  3  
ATOM   2931  N  N    . PHE A 1 43 ? -0.377  1.285   -6.525  1.00 0.00 ? 350 PHE A N    3  
ATOM   2932  C  CA   . PHE A 1 43 ? -1.428  0.295   -6.344  1.00 0.00 ? 350 PHE A CA   3  
ATOM   2933  C  C    . PHE A 1 43 ? -1.641  0.026   -4.857  1.00 0.00 ? 350 PHE A C    3  
ATOM   2934  O  O    . PHE A 1 43 ? -0.771  0.314   -4.038  1.00 0.00 ? 350 PHE A O    3  
ATOM   2935  C  CB   . PHE A 1 43 ? -1.104  -1.003  -7.105  1.00 0.00 ? 350 PHE A CB   3  
ATOM   2936  C  CG   . PHE A 1 43 ? 0.293   -1.535  -6.899  1.00 0.00 ? 350 PHE A CG   3  
ATOM   2937  C  CD1  . PHE A 1 43 ? 1.368   -0.981  -7.578  1.00 0.00 ? 350 PHE A CD1  3  
ATOM   2938  C  CD2  . PHE A 1 43 ? 0.528   -2.598  -6.041  1.00 0.00 ? 350 PHE A CD2  3  
ATOM   2939  C  CE1  . PHE A 1 43 ? 2.647   -1.476  -7.406  1.00 0.00 ? 350 PHE A CE1  3  
ATOM   2940  C  CE2  . PHE A 1 43 ? 1.805   -3.095  -5.867  1.00 0.00 ? 350 PHE A CE2  3  
ATOM   2941  C  CZ   . PHE A 1 43 ? 2.866   -2.532  -6.550  1.00 0.00 ? 350 PHE A CZ   3  
ATOM   2942  H  H    . PHE A 1 43 ? 0.337   1.351   -5.848  1.00 0.00 ? 350 PHE A H    3  
ATOM   2943  H  HA   . PHE A 1 43 ? -2.338  0.717   -6.747  1.00 0.00 ? 350 PHE A HA   3  
ATOM   2944  H  HB2  . PHE A 1 43 ? -1.792  -1.770  -6.786  1.00 0.00 ? 350 PHE A HB2  3  
ATOM   2945  H  HB3  . PHE A 1 43 ? -1.240  -0.830  -8.165  1.00 0.00 ? 350 PHE A HB3  3  
ATOM   2946  H  HD1  . PHE A 1 43 ? 1.198   -0.152  -8.249  1.00 0.00 ? 350 PHE A HD1  3  
ATOM   2947  H  HD2  . PHE A 1 43 ? -0.299  -3.039  -5.506  1.00 0.00 ? 350 PHE A HD2  3  
ATOM   2948  H  HE1  . PHE A 1 43 ? 3.474   -1.034  -7.941  1.00 0.00 ? 350 PHE A HE1  3  
ATOM   2949  H  HE2  . PHE A 1 43 ? 1.974   -3.924  -5.200  1.00 0.00 ? 350 PHE A HE2  3  
ATOM   2950  H  HZ   . PHE A 1 43 ? 3.865   -2.921  -6.413  1.00 0.00 ? 350 PHE A HZ   3  
ATOM   2951  N  N    . HIS A 1 44 ? -2.807  -0.504  -4.502  1.00 0.00 ? 351 HIS A N    3  
ATOM   2952  C  CA   . HIS A 1 44 ? -3.131  -0.748  -3.098  1.00 0.00 ? 351 HIS A CA   3  
ATOM   2953  C  C    . HIS A 1 44 ? -2.329  -1.925  -2.568  1.00 0.00 ? 351 HIS A C    3  
ATOM   2954  O  O    . HIS A 1 44 ? -2.012  -2.852  -3.315  1.00 0.00 ? 351 HIS A O    3  
ATOM   2955  C  CB   . HIS A 1 44 ? -4.627  -1.030  -2.902  1.00 0.00 ? 351 HIS A CB   3  
ATOM   2956  C  CG   . HIS A 1 44 ? -5.541  0.074   -3.332  1.00 0.00 ? 351 HIS A CG   3  
ATOM   2957  N  ND1  . HIS A 1 44 ? -6.471  -0.049  -4.370  1.00 0.00 ? 351 HIS A ND1  3  
ATOM   2958  C  CD2  . HIS A 1 44 ? -5.692  1.321   -2.827  1.00 0.00 ? 351 HIS A CD2  3  
ATOM   2959  C  CE1  . HIS A 1 44 ? -7.142  1.105   -4.457  1.00 0.00 ? 351 HIS A CE1  3  
ATOM   2960  N  NE2  . HIS A 1 44 ? -6.687  1.935   -3.540  1.00 0.00 ? 351 HIS A NE2  3  
ATOM   2961  H  H    . HIS A 1 44 ? -3.449  -0.750  -5.195  1.00 0.00 ? 351 HIS A H    3  
ATOM   2962  H  HA   . HIS A 1 44 ? -2.862  0.138   -2.537  1.00 0.00 ? 351 HIS A HA   3  
ATOM   2963  H  HB2  . HIS A 1 44 ? -4.893  -1.912  -3.460  1.00 0.00 ? 351 HIS A HB2  3  
ATOM   2964  H  HB3  . HIS A 1 44 ? -4.810  -1.213  -1.853  1.00 0.00 ? 351 HIS A HB3  3  
ATOM   2965  H  HD2  . HIS A 1 44 ? -5.135  1.750   -2.004  1.00 0.00 ? 351 HIS A HD2  3  
ATOM   2966  H  HE1  . HIS A 1 44 ? -7.929  1.322   -5.165  1.00 0.00 ? 351 HIS A HE1  3  
ATOM   2967  H  HE2  . HIS A 1 44 ? -6.936  2.891   -3.466  1.00 0.00 ? 351 HIS A HE2  3  
ATOM   2968  N  N    . VAL A 1 45 ? -2.020  -1.893  -1.281  1.00 0.00 ? 352 VAL A N    3  
ATOM   2969  C  CA   . VAL A 1 45 ? -1.282  -2.979  -0.645  1.00 0.00 ? 352 VAL A CA   3  
ATOM   2970  C  C    . VAL A 1 45 ? -2.097  -4.269  -0.693  1.00 0.00 ? 352 VAL A C    3  
ATOM   2971  O  O    . VAL A 1 45 ? -1.556  -5.353  -0.913  1.00 0.00 ? 352 VAL A O    3  
ATOM   2972  C  CB   . VAL A 1 45 ? -0.930  -2.640  0.821   1.00 0.00 ? 352 VAL A CB   3  
ATOM   2973  C  CG1  . VAL A 1 45 ? -0.093  -3.743  1.453   1.00 0.00 ? 352 VAL A CG1  3  
ATOM   2974  C  CG2  . VAL A 1 45 ? -0.207  -1.304  0.902   1.00 0.00 ? 352 VAL A CG2  3  
ATOM   2975  H  H    . VAL A 1 45 ? -2.294  -1.118  -0.739  1.00 0.00 ? 352 VAL A H    3  
ATOM   2976  H  HA   . VAL A 1 45 ? -0.364  -3.126  -1.194  1.00 0.00 ? 352 VAL A HA   3  
ATOM   2977  H  HB   . VAL A 1 45 ? -1.851  -2.559  1.377   1.00 0.00 ? 352 VAL A HB   3  
ATOM   2978  H  HG11 . VAL A 1 45 ? 0.834   -3.847  0.910   1.00 0.00 ? 352 VAL A HG11 3  
ATOM   2979  H  HG12 . VAL A 1 45 ? -0.639  -4.674  1.417   1.00 0.00 ? 352 VAL A HG12 3  
ATOM   2980  H  HG13 . VAL A 1 45 ? 0.120   -3.491  2.482   1.00 0.00 ? 352 VAL A HG13 3  
ATOM   2981  H  HG21 . VAL A 1 45 ? -0.842  -0.526  0.509   1.00 0.00 ? 352 VAL A HG21 3  
ATOM   2982  H  HG22 . VAL A 1 45 ? 0.704   -1.350  0.323   1.00 0.00 ? 352 VAL A HG22 3  
ATOM   2983  H  HG23 . VAL A 1 45 ? 0.034   -1.086  1.933   1.00 0.00 ? 352 VAL A HG23 3  
ATOM   2984  N  N    . THR A 1 46 ? -3.405  -4.141  -0.510  1.00 0.00 ? 353 THR A N    3  
ATOM   2985  C  CA   . THR A 1 46 ? -4.302  -5.284  -0.587  1.00 0.00 ? 353 THR A CA   3  
ATOM   2986  C  C    . THR A 1 46 ? -4.379  -5.808  -2.025  1.00 0.00 ? 353 THR A C    3  
ATOM   2987  O  O    . THR A 1 46 ? -4.589  -6.998  -2.252  1.00 0.00 ? 353 THR A O    3  
ATOM   2988  C  CB   . THR A 1 46 ? -5.721  -4.931  -0.065  1.00 0.00 ? 353 THR A CB   3  
ATOM   2989  O  OG1  . THR A 1 46 ? -6.563  -6.089  -0.079  1.00 0.00 ? 353 THR A OG1  3  
ATOM   2990  C  CG2  . THR A 1 46 ? -6.362  -3.828  -0.895  1.00 0.00 ? 353 THR A CG2  3  
ATOM   2991  H  H    . THR A 1 46 ? -3.775  -3.254  -0.307  1.00 0.00 ? 353 THR A H    3  
ATOM   2992  H  HA   . THR A 1 46 ? -3.895  -6.063  0.042   1.00 0.00 ? 353 THR A HA   3  
ATOM   2993  H  HB   . THR A 1 46 ? -5.630  -4.580  0.954   1.00 0.00 ? 353 THR A HB   3  
ATOM   2994  H  HG1  . THR A 1 46 ? -7.450  -5.836  -0.371  1.00 0.00 ? 353 THR A HG1  3  
ATOM   2995  H  HG21 . THR A 1 46 ? -6.487  -4.171  -1.912  1.00 0.00 ? 353 THR A HG21 3  
ATOM   2996  H  HG22 . THR A 1 46 ? -5.730  -2.953  -0.885  1.00 0.00 ? 353 THR A HG22 3  
ATOM   2997  H  HG23 . THR A 1 46 ? -7.327  -3.581  -0.479  1.00 0.00 ? 353 THR A HG23 3  
ATOM   2998  N  N    . CYS A 1 47 ? -4.168  -4.921  -2.996  1.00 0.00 ? 354 CYS A N    3  
ATOM   2999  C  CA   . CYS A 1 47 ? -4.198  -5.309  -4.400  1.00 0.00 ? 354 CYS A CA   3  
ATOM   3000  C  C    . CYS A 1 47 ? -3.008  -6.192  -4.733  1.00 0.00 ? 354 CYS A C    3  
ATOM   3001  O  O    . CYS A 1 47 ? -3.125  -7.142  -5.499  1.00 0.00 ? 354 CYS A O    3  
ATOM   3002  C  CB   . CYS A 1 47 ? -4.185  -4.078  -5.306  1.00 0.00 ? 354 CYS A CB   3  
ATOM   3003  S  SG   . CYS A 1 47 ? -5.592  -2.968  -5.084  1.00 0.00 ? 354 CYS A SG   3  
ATOM   3004  H  H    . CYS A 1 47 ? -3.977  -3.993  -2.761  1.00 0.00 ? 354 CYS A H    3  
ATOM   3005  H  HA   . CYS A 1 47 ? -5.106  -5.867  -4.573  1.00 0.00 ? 354 CYS A HA   3  
ATOM   3006  H  HB2  . CYS A 1 47 ? -3.288  -3.510  -5.111  1.00 0.00 ? 354 CYS A HB2  3  
ATOM   3007  H  HB3  . CYS A 1 47 ? -4.185  -4.401  -6.335  1.00 0.00 ? 354 CYS A HB3  3  
ATOM   3008  N  N    . ALA A 1 48 ? -1.867  -5.872  -4.145  1.00 0.00 ? 355 ALA A N    3  
ATOM   3009  C  CA   . ALA A 1 48 ? -0.654  -6.632  -4.381  1.00 0.00 ? 355 ALA A CA   3  
ATOM   3010  C  C    . ALA A 1 48 ? -0.797  -8.052  -3.859  1.00 0.00 ? 355 ALA A C    3  
ATOM   3011  O  O    . ALA A 1 48 ? -0.405  -9.013  -4.523  1.00 0.00 ? 355 ALA A O    3  
ATOM   3012  C  CB   . ALA A 1 48 ? 0.535   -5.942  -3.734  1.00 0.00 ? 355 ALA A CB   3  
ATOM   3013  H  H    . ALA A 1 48 ? -1.839  -5.101  -3.536  1.00 0.00 ? 355 ALA A H    3  
ATOM   3014  H  HA   . ALA A 1 48 ? -0.490  -6.672  -5.449  1.00 0.00 ? 355 ALA A HA   3  
ATOM   3015  H  HB1  . ALA A 1 48 ? 0.616   -4.935  -4.116  1.00 0.00 ? 355 ALA A HB1  3  
ATOM   3016  H  HB2  . ALA A 1 48 ? 1.436   -6.488  -3.961  1.00 0.00 ? 355 ALA A HB2  3  
ATOM   3017  H  HB3  . ALA A 1 48 ? 0.393   -5.910  -2.664  1.00 0.00 ? 355 ALA A HB3  3  
ATOM   3018  N  N    . GLN A 1 49 ? -1.376  -8.175  -2.674  1.00 0.00 ? 356 GLN A N    3  
ATOM   3019  C  CA   . GLN A 1 49 ? -1.614  -9.477  -2.071  1.00 0.00 ? 356 GLN A CA   3  
ATOM   3020  C  C    . GLN A 1 49 ? -2.664  -10.248 -2.858  1.00 0.00 ? 356 GLN A C    3  
ATOM   3021  O  O    . GLN A 1 49 ? -2.570  -11.465 -3.022  1.00 0.00 ? 356 GLN A O    3  
ATOM   3022  C  CB   . GLN A 1 49 ? -2.069  -9.304  -0.621  1.00 0.00 ? 356 GLN A CB   3  
ATOM   3023  C  CG   . GLN A 1 49 ? -1.029  -8.637  0.263   1.00 0.00 ? 356 GLN A CG   3  
ATOM   3024  C  CD   . GLN A 1 49 ? -1.544  -8.374  1.666   1.00 0.00 ? 356 GLN A CD   3  
ATOM   3025  O  OE1  . GLN A 1 49 ? -2.403  -9.095  2.171   1.00 0.00 ? 356 GLN A OE1  3  
ATOM   3026  N  NE2  . GLN A 1 49 ? -1.019  -7.341  2.305   1.00 0.00 ? 356 GLN A NE2  3  
ATOM   3027  H  H    . GLN A 1 49 ? -1.650  -7.367  -2.189  1.00 0.00 ? 356 GLN A H    3  
ATOM   3028  H  HA   . GLN A 1 49 ? -0.686  -10.028 -2.088  1.00 0.00 ? 356 GLN A HA   3  
ATOM   3029  H  HB2  . GLN A 1 49 ? -2.969  -8.693  -0.608  1.00 0.00 ? 356 GLN A HB2  3  
ATOM   3030  H  HB3  . GLN A 1 49 ? -2.290  -10.286 -0.204  1.00 0.00 ? 356 GLN A HB3  3  
ATOM   3031  H  HG2  . GLN A 1 49 ? -0.160  -9.292  0.331   1.00 0.00 ? 356 GLN A HG2  3  
ATOM   3032  H  HG3  . GLN A 1 49 ? -0.746  -7.685  -0.188  1.00 0.00 ? 356 GLN A HG3  3  
ATOM   3033  H  HE21 . GLN A 1 49 ? -0.339  -6.810  1.845   1.00 0.00 ? 356 GLN A HE21 3  
ATOM   3034  H  HE22 . GLN A 1 49 ? -1.327  -7.157  3.217   1.00 0.00 ? 356 GLN A HE22 3  
ATOM   3035  N  N    . LYS A 1 50 ? -3.656  -9.529  -3.366  1.00 0.00 ? 357 LYS A N    3  
ATOM   3036  C  CA   . LYS A 1 50 ? -4.763  -10.155 -4.072  1.00 0.00 ? 357 LYS A CA   3  
ATOM   3037  C  C    . LYS A 1 50 ? -4.355  -10.564 -5.486  1.00 0.00 ? 357 LYS A C    3  
ATOM   3038  O  O    . LYS A 1 50 ? -4.859  -11.549 -6.024  1.00 0.00 ? 357 LYS A O    3  
ATOM   3039  C  CB   . LYS A 1 50 ? -5.958  -9.199  -4.121  1.00 0.00 ? 357 LYS A CB   3  
ATOM   3040  C  CG   . LYS A 1 50 ? -7.308  -9.897  -4.075  1.00 0.00 ? 357 LYS A CG   3  
ATOM   3041  C  CD   . LYS A 1 50 ? -7.467  -10.724 -2.807  1.00 0.00 ? 357 LYS A CD   3  
ATOM   3042  C  CE   . LYS A 1 50 ? -7.303  -9.875  -1.549  1.00 0.00 ? 357 LYS A CE   3  
ATOM   3043  N  NZ   . LYS A 1 50 ? -7.432  -10.681 -0.303  1.00 0.00 ? 357 LYS A NZ   3  
ATOM   3044  H  H    . LYS A 1 50 ? -3.651  -8.553  -3.249  1.00 0.00 ? 357 LYS A H    3  
ATOM   3045  H  HA   . LYS A 1 50 ? -5.044  -11.040 -3.526  1.00 0.00 ? 357 LYS A HA   3  
ATOM   3046  H  HB2  . LYS A 1 50 ? -5.899  -8.524  -3.282  1.00 0.00 ? 357 LYS A HB2  3  
ATOM   3047  H  HB3  . LYS A 1 50 ? -5.906  -8.625  -5.035  1.00 0.00 ? 357 LYS A HB3  3  
ATOM   3048  H  HG2  . LYS A 1 50 ? -8.093  -9.145  -4.100  1.00 0.00 ? 357 LYS A HG2  3  
ATOM   3049  H  HG3  . LYS A 1 50 ? -7.393  -10.554 -4.940  1.00 0.00 ? 357 LYS A HG3  3  
ATOM   3050  H  HD2  . LYS A 1 50 ? -8.451  -11.166 -2.803  1.00 0.00 ? 357 LYS A HD2  3  
ATOM   3051  H  HD3  . LYS A 1 50 ? -6.722  -11.506 -2.803  1.00 0.00 ? 357 LYS A HD3  3  
ATOM   3052  H  HE2  . LYS A 1 50 ? -6.327  -9.416  -1.563  1.00 0.00 ? 357 LYS A HE2  3  
ATOM   3053  H  HE3  . LYS A 1 50 ? -8.060  -9.105  -1.550  1.00 0.00 ? 357 LYS A HE3  3  
ATOM   3054  H  HZ1  . LYS A 1 50 ? -6.716  -11.434 -0.286  1.00 0.00 ? 357 LYS A HZ1  3  
ATOM   3055  H  HZ2  . LYS A 1 50 ? -8.376  -11.113 -0.252  1.00 0.00 ? 357 LYS A HZ2  3  
ATOM   3056  H  HZ3  . LYS A 1 50 ? -7.299  -10.074 0.530   1.00 0.00 ? 357 LYS A HZ3  3  
ATOM   3057  N  N    . ALA A 1 51 ? -3.447  -9.805  -6.085  1.00 0.00 ? 358 ALA A N    3  
ATOM   3058  C  CA   . ALA A 1 51 ? -2.963  -10.120 -7.424  1.00 0.00 ? 358 ALA A CA   3  
ATOM   3059  C  C    . ALA A 1 51 ? -1.849  -11.155 -7.367  1.00 0.00 ? 358 ALA A C    3  
ATOM   3060  O  O    . ALA A 1 51 ? -1.742  -12.014 -8.242  1.00 0.00 ? 358 ALA A O    3  
ATOM   3061  C  CB   . ALA A 1 51 ? -2.481  -8.863  -8.131  1.00 0.00 ? 358 ALA A CB   3  
ATOM   3062  H  H    . ALA A 1 51 ? -3.098  -9.011  -5.620  1.00 0.00 ? 358 ALA A H    3  
ATOM   3063  H  HA   . ALA A 1 51 ? -3.790  -10.528 -7.989  1.00 0.00 ? 358 ALA A HA   3  
ATOM   3064  H  HB1  . ALA A 1 51 ? -2.185  -9.111  -9.139  1.00 0.00 ? 358 ALA A HB1  3  
ATOM   3065  H  HB2  . ALA A 1 51 ? -1.637  -8.453  -7.600  1.00 0.00 ? 358 ALA A HB2  3  
ATOM   3066  H  HB3  . ALA A 1 51 ? -3.279  -8.135  -8.159  1.00 0.00 ? 358 ALA A HB3  3  
ATOM   3067  N  N    . GLY A 1 52 ? -1.027  -11.075 -6.328  1.00 0.00 ? 359 GLY A N    3  
ATOM   3068  C  CA   . GLY A 1 52 ? 0.092   -11.984 -6.194  1.00 0.00 ? 359 GLY A CA   3  
ATOM   3069  C  C    . GLY A 1 52 ? 1.252   -11.576 -7.074  1.00 0.00 ? 359 GLY A C    3  
ATOM   3070  O  O    . GLY A 1 52 ? 1.802   -12.394 -7.812  1.00 0.00 ? 359 GLY A O    3  
ATOM   3071  H  H    . GLY A 1 52 ? -1.182  -10.390 -5.645  1.00 0.00 ? 359 GLY A H    3  
ATOM   3072  H  HA2  . GLY A 1 52 ? 0.418   -11.995 -5.164  1.00 0.00 ? 359 GLY A HA2  3  
ATOM   3073  H  HA3  . GLY A 1 52 ? -0.230  -12.976 -6.472  1.00 0.00 ? 359 GLY A HA3  3  
ATOM   3074  N  N    . LEU A 1 53 ? 1.613   -10.302 -7.008  1.00 0.00 ? 360 LEU A N    3  
ATOM   3075  C  CA   . LEU A 1 53 ? 2.699   -9.772  -7.821  1.00 0.00 ? 360 LEU A CA   3  
ATOM   3076  C  C    . LEU A 1 53 ? 4.037   -9.895  -7.095  1.00 0.00 ? 360 LEU A C    3  
ATOM   3077  O  O    . LEU A 1 53 ? 4.124   -10.531 -6.042  1.00 0.00 ? 360 LEU A O    3  
ATOM   3078  C  CB   . LEU A 1 53 ? 2.407   -8.317  -8.223  1.00 0.00 ? 360 LEU A CB   3  
ATOM   3079  C  CG   . LEU A 1 53 ? 1.947   -7.383  -7.093  1.00 0.00 ? 360 LEU A CG   3  
ATOM   3080  C  CD1  . LEU A 1 53 ? 3.118   -6.946  -6.222  1.00 0.00 ? 360 LEU A CD1  3  
ATOM   3081  C  CD2  . LEU A 1 53 ? 1.224   -6.174  -7.671  1.00 0.00 ? 360 LEU A CD2  3  
ATOM   3082  H  H    . LEU A 1 53 ? 1.142   -9.707  -6.390  1.00 0.00 ? 360 LEU A H    3  
ATOM   3083  H  HA   . LEU A 1 53 ? 2.748   -10.371 -8.718  1.00 0.00 ? 360 LEU A HA   3  
ATOM   3084  H  HB2  . LEU A 1 53 ? 3.320   -7.899  -8.650  1.00 0.00 ? 360 LEU A HB2  3  
ATOM   3085  H  HB3  . LEU A 1 53 ? 1.624   -8.331  -8.987  1.00 0.00 ? 360 LEU A HB3  3  
ATOM   3086  H  HG   . LEU A 1 53 ? 1.250   -7.915  -6.462  1.00 0.00 ? 360 LEU A HG   3  
ATOM   3087  H  HD11 . LEU A 1 53 ? 2.772   -6.249  -5.473  1.00 0.00 ? 360 LEU A HD11 3  
ATOM   3088  H  HD12 . LEU A 1 53 ? 3.869   -6.472  -6.836  1.00 0.00 ? 360 LEU A HD12 3  
ATOM   3089  H  HD13 . LEU A 1 53 ? 3.545   -7.812  -5.736  1.00 0.00 ? 360 LEU A HD13 3  
ATOM   3090  H  HD21 . LEU A 1 53 ? 0.892   -5.533  -6.866  1.00 0.00 ? 360 LEU A HD21 3  
ATOM   3091  H  HD22 . LEU A 1 53 ? 0.369   -6.507  -8.241  1.00 0.00 ? 360 LEU A HD22 3  
ATOM   3092  H  HD23 . LEU A 1 53 ? 1.894   -5.625  -8.316  1.00 0.00 ? 360 LEU A HD23 3  
ATOM   3093  N  N    . TYR A 1 54 ? 5.079   -9.298  -7.655  1.00 0.00 ? 361 TYR A N    3  
ATOM   3094  C  CA   . TYR A 1 54 ? 6.408   -9.400  -7.073  1.00 0.00 ? 361 TYR A CA   3  
ATOM   3095  C  C    . TYR A 1 54 ? 6.584   -8.391  -5.943  1.00 0.00 ? 361 TYR A C    3  
ATOM   3096  O  O    . TYR A 1 54 ? 6.631   -7.181  -6.170  1.00 0.00 ? 361 TYR A O    3  
ATOM   3097  C  CB   . TYR A 1 54 ? 7.486   -9.186  -8.142  1.00 0.00 ? 361 TYR A CB   3  
ATOM   3098  C  CG   . TYR A 1 54 ? 8.896   -9.360  -7.620  1.00 0.00 ? 361 TYR A CG   3  
ATOM   3099  C  CD1  . TYR A 1 54 ? 9.580   -8.294  -7.052  1.00 0.00 ? 361 TYR A CD1  3  
ATOM   3100  C  CD2  . TYR A 1 54 ? 9.536   -10.590 -7.689  1.00 0.00 ? 361 TYR A CD2  3  
ATOM   3101  C  CE1  . TYR A 1 54 ? 10.864  -8.448  -6.569  1.00 0.00 ? 361 TYR A CE1  3  
ATOM   3102  C  CE2  . TYR A 1 54 ? 10.821  -10.754 -7.206  1.00 0.00 ? 361 TYR A CE2  3  
ATOM   3103  C  CZ   . TYR A 1 54 ? 11.480  -9.681  -6.647  1.00 0.00 ? 361 TYR A CZ   3  
ATOM   3104  O  OH   . TYR A 1 54 ? 12.757  -9.841  -6.161  1.00 0.00 ? 361 TYR A OH   3  
ATOM   3105  H  H    . TYR A 1 54 ? 4.951   -8.770  -8.470  1.00 0.00 ? 361 TYR A H    3  
ATOM   3106  H  HA   . TYR A 1 54 ? 6.514   -10.395 -6.667  1.00 0.00 ? 361 TYR A HA   3  
ATOM   3107  H  HB2  . TYR A 1 54 ? 7.340   -9.899  -8.939  1.00 0.00 ? 361 TYR A HB2  3  
ATOM   3108  H  HB3  . TYR A 1 54 ? 7.398   -8.185  -8.537  1.00 0.00 ? 361 TYR A HB3  3  
ATOM   3109  H  HD1  . TYR A 1 54 ? 9.091   -7.333  -6.990  1.00 0.00 ? 361 TYR A HD1  3  
ATOM   3110  H  HD2  . TYR A 1 54 ? 9.017   -11.429 -8.127  1.00 0.00 ? 361 TYR A HD2  3  
ATOM   3111  H  HE1  . TYR A 1 54 ? 11.379  -7.604  -6.133  1.00 0.00 ? 361 TYR A HE1  3  
ATOM   3112  H  HE2  . TYR A 1 54 ? 11.302  -11.719 -7.269  1.00 0.00 ? 361 TYR A HE2  3  
ATOM   3113  H  HH   . TYR A 1 54 ? 12.820  -9.426  -5.295  1.00 0.00 ? 361 TYR A HH   3  
ATOM   3114  N  N    . MET A 1 55 ? 6.671   -8.900  -4.726  1.00 0.00 ? 362 MET A N    3  
ATOM   3115  C  CA   . MET A 1 55 ? 6.909   -8.063  -3.562  1.00 0.00 ? 362 MET A CA   3  
ATOM   3116  C  C    . MET A 1 55 ? 8.153   -8.531  -2.824  1.00 0.00 ? 362 MET A C    3  
ATOM   3117  O  O    . MET A 1 55 ? 8.174   -9.623  -2.260  1.00 0.00 ? 362 MET A O    3  
ATOM   3118  C  CB   . MET A 1 55 ? 5.707   -8.091  -2.617  1.00 0.00 ? 362 MET A CB   3  
ATOM   3119  C  CG   . MET A 1 55 ? 4.995   -6.755  -2.497  1.00 0.00 ? 362 MET A CG   3  
ATOM   3120  S  SD   . MET A 1 55 ? 3.686   -6.771  -1.255  1.00 0.00 ? 362 MET A SD   3  
ATOM   3121  C  CE   . MET A 1 55 ? 3.120   -5.074  -1.345  1.00 0.00 ? 362 MET A CE   3  
ATOM   3122  H  H    . MET A 1 55 ? 6.572   -9.867  -4.604  1.00 0.00 ? 362 MET A H    3  
ATOM   3123  H  HA   . MET A 1 55 ? 7.066   -7.052  -3.905  1.00 0.00 ? 362 MET A HA   3  
ATOM   3124  H  HB2  . MET A 1 55 ? 4.996   -8.820  -2.976  1.00 0.00 ? 362 MET A HB2  3  
ATOM   3125  H  HB3  . MET A 1 55 ? 6.045   -8.384  -1.634  1.00 0.00 ? 362 MET A HB3  3  
ATOM   3126  H  HG2  . MET A 1 55 ? 5.717   -5.999  -2.228  1.00 0.00 ? 362 MET A HG2  3  
ATOM   3127  H  HG3  . MET A 1 55 ? 4.560   -6.511  -3.455  1.00 0.00 ? 362 MET A HG3  3  
ATOM   3128  H  HE1  . MET A 1 55 ? 3.937   -4.409  -1.110  1.00 0.00 ? 362 MET A HE1  3  
ATOM   3129  H  HE2  . MET A 1 55 ? 2.318   -4.922  -0.638  1.00 0.00 ? 362 MET A HE2  3  
ATOM   3130  H  HE3  . MET A 1 55 ? 2.763   -4.866  -2.344  1.00 0.00 ? 362 MET A HE3  3  
ATOM   3131  N  N    . LYS A 1 56 ? 9.190   -7.712  -2.848  1.00 0.00 ? 363 LYS A N    3  
ATOM   3132  C  CA   . LYS A 1 56 ? 10.414  -8.013  -2.127  1.00 0.00 ? 363 LYS A CA   3  
ATOM   3133  C  C    . LYS A 1 56 ? 10.313  -7.407  -0.734  1.00 0.00 ? 363 LYS A C    3  
ATOM   3134  O  O    . LYS A 1 56 ? 9.648   -6.386  -0.548  1.00 0.00 ? 363 LYS A O    3  
ATOM   3135  C  CB   . LYS A 1 56 ? 11.624  -7.453  -2.886  1.00 0.00 ? 363 LYS A CB   3  
ATOM   3136  C  CG   . LYS A 1 56 ? 12.925  -8.191  -2.608  1.00 0.00 ? 363 LYS A CG   3  
ATOM   3137  C  CD   . LYS A 1 56 ? 14.057  -7.667  -3.478  1.00 0.00 ? 363 LYS A CD   3  
ATOM   3138  C  CE   . LYS A 1 56 ? 15.257  -8.604  -3.461  1.00 0.00 ? 363 LYS A CE   3  
ATOM   3139  N  NZ   . LYS A 1 56 ? 15.907  -8.673  -2.129  1.00 0.00 ? 363 LYS A NZ   3  
ATOM   3140  H  H    . LYS A 1 56 ? 9.127   -6.869  -3.350  1.00 0.00 ? 363 LYS A H    3  
ATOM   3141  H  HA   . LYS A 1 56 ? 10.503  -9.087  -2.042  1.00 0.00 ? 363 LYS A HA   3  
ATOM   3142  H  HB2  . LYS A 1 56 ? 11.423  -7.520  -3.956  1.00 0.00 ? 363 LYS A HB2  3  
ATOM   3143  H  HB3  . LYS A 1 56 ? 11.758  -6.409  -2.600  1.00 0.00 ? 363 LYS A HB3  3  
ATOM   3144  H  HG2  . LYS A 1 56 ? 13.191  -8.054  -1.571  1.00 0.00 ? 363 LYS A HG2  3  
ATOM   3145  H  HG3  . LYS A 1 56 ? 12.783  -9.242  -2.811  1.00 0.00 ? 363 LYS A HG3  3  
ATOM   3146  H  HD2  . LYS A 1 56 ? 13.703  -7.569  -4.493  1.00 0.00 ? 363 LYS A HD2  3  
ATOM   3147  H  HD3  . LYS A 1 56 ? 14.363  -6.699  -3.107  1.00 0.00 ? 363 LYS A HD3  3  
ATOM   3148  H  HE2  . LYS A 1 56 ? 14.923  -9.592  -3.737  1.00 0.00 ? 363 LYS A HE2  3  
ATOM   3149  H  HE3  . LYS A 1 56 ? 15.978  -8.257  -4.186  1.00 0.00 ? 363 LYS A HE3  3  
ATOM   3150  H  HZ1  . LYS A 1 56 ? 16.601  -9.446  -2.110  1.00 0.00 ? 363 LYS A HZ1  3  
ATOM   3151  H  HZ2  . LYS A 1 56 ? 15.197  -8.843  -1.380  1.00 0.00 ? 363 LYS A HZ2  3  
ATOM   3152  H  HZ3  . LYS A 1 56 ? 16.399  -7.781  -1.923  1.00 0.00 ? 363 LYS A HZ3  3  
ATOM   3153  N  N    . MET A 1 57 ? 10.961  -8.018  0.244   1.00 0.00 ? 364 MET A N    3  
ATOM   3154  C  CA   . MET A 1 57 ? 10.787  -7.627  1.632   1.00 0.00 ? 364 MET A CA   3  
ATOM   3155  C  C    . MET A 1 57 ? 12.100  -7.818  2.352   1.00 0.00 ? 364 MET A C    3  
ATOM   3156  O  O    . MET A 1 57 ? 12.519  -8.941  2.637   1.00 0.00 ? 364 MET A O    3  
ATOM   3157  C  CB   . MET A 1 57 ? 9.677   -8.444  2.309   1.00 0.00 ? 364 MET A CB   3  
ATOM   3158  C  CG   . MET A 1 57 ? 8.334   -8.341  1.607   1.00 0.00 ? 364 MET A CG   3  
ATOM   3159  S  SD   . MET A 1 57 ? 6.984   -9.077  2.543   1.00 0.00 ? 364 MET A SD   3  
ATOM   3160  C  CE   . MET A 1 57 ? 5.658   -8.910  1.353   1.00 0.00 ? 364 MET A CE   3  
ATOM   3161  H  H    . MET A 1 57 ? 11.624  -8.708  0.031   1.00 0.00 ? 364 MET A H    3  
ATOM   3162  H  HA   . MET A 1 57 ? 10.522  -6.578  1.654   1.00 0.00 ? 364 MET A HA   3  
ATOM   3163  H  HB2  . MET A 1 57 ? 9.968   -9.484  2.329   1.00 0.00 ? 364 MET A HB2  3  
ATOM   3164  H  HB3  . MET A 1 57 ? 9.554   -8.094  3.322   1.00 0.00 ? 364 MET A HB3  3  
ATOM   3165  H  HG2  . MET A 1 57 ? 8.110   -7.297  1.445   1.00 0.00 ? 364 MET A HG2  3  
ATOM   3166  H  HG3  . MET A 1 57 ? 8.405   -8.841  0.652   1.00 0.00 ? 364 MET A HG3  3  
ATOM   3167  H  HE1  . MET A 1 57 ? 4.747   -9.306  1.774   1.00 0.00 ? 364 MET A HE1  3  
ATOM   3168  H  HE2  . MET A 1 57 ? 5.909   -9.456  0.456   1.00 0.00 ? 364 MET A HE2  3  
ATOM   3169  H  HE3  . MET A 1 57 ? 5.520   -7.867  1.113   1.00 0.00 ? 364 MET A HE3  3  
ATOM   3170  N  N    . GLU A 1 58 ? 12.748  -6.716  2.633   1.00 0.00 ? 365 GLU A N    3  
ATOM   3171  C  CA   . GLU A 1 58 ? 14.091  -6.743  3.143   1.00 0.00 ? 365 GLU A CA   3  
ATOM   3172  C  C    . GLU A 1 58 ? 14.108  -6.387  4.621   1.00 0.00 ? 365 GLU A C    3  
ATOM   3173  O  O    . GLU A 1 58 ? 13.626  -5.325  5.012   1.00 0.00 ? 365 GLU A O    3  
ATOM   3174  C  CB   . GLU A 1 58 ? 14.924  -5.747  2.347   1.00 0.00 ? 365 GLU A CB   3  
ATOM   3175  C  CG   . GLU A 1 58 ? 14.937  -6.015  0.853   1.00 0.00 ? 365 GLU A CG   3  
ATOM   3176  C  CD   . GLU A 1 58 ? 15.430  -7.402  0.513   1.00 0.00 ? 365 GLU A CD   3  
ATOM   3177  O  OE1  . GLU A 1 58 ? 16.652  -7.634  0.572   1.00 0.00 ? 365 GLU A OE1  3  
ATOM   3178  O  OE2  . GLU A 1 58 ? 14.599  -8.262  0.158   1.00 0.00 ? 365 GLU A OE2  3  
ATOM   3179  H  H    . GLU A 1 58 ? 12.307  -5.846  2.488   1.00 0.00 ? 365 GLU A H    3  
ATOM   3180  H  HA   . GLU A 1 58 ? 14.492  -7.735  3.002   1.00 0.00 ? 365 GLU A HA   3  
ATOM   3181  H  HB2  . GLU A 1 58 ? 14.509  -4.763  2.499   1.00 0.00 ? 365 GLU A HB2  3  
ATOM   3182  H  HB3  . GLU A 1 58 ? 15.937  -5.769  2.707   1.00 0.00 ? 365 GLU A HB3  3  
ATOM   3183  H  HG2  . GLU A 1 58 ? 13.934  -5.902  0.470   1.00 0.00 ? 365 GLU A HG2  3  
ATOM   3184  H  HG3  . GLU A 1 58 ? 15.584  -5.292  0.378   1.00 0.00 ? 365 GLU A HG3  3  
ATOM   3185  N  N    . PRO A 1 59 ? 14.641  -7.272  5.468   1.00 0.00 ? 366 PRO A N    3  
ATOM   3186  C  CA   . PRO A 1 59 ? 14.781  -7.015  6.885   1.00 0.00 ? 366 PRO A CA   3  
ATOM   3187  C  C    . PRO A 1 59 ? 16.189  -6.548  7.257   1.00 0.00 ? 366 PRO A C    3  
ATOM   3188  O  O    . PRO A 1 59 ? 17.110  -7.356  7.402   1.00 0.00 ? 366 PRO A O    3  
ATOM   3189  C  CB   . PRO A 1 59 ? 14.488  -8.388  7.487   1.00 0.00 ? 366 PRO A CB   3  
ATOM   3190  C  CG   . PRO A 1 59 ? 14.881  -9.384  6.429   1.00 0.00 ? 366 PRO A CG   3  
ATOM   3191  C  CD   . PRO A 1 59 ? 15.102  -8.622  5.138   1.00 0.00 ? 366 PRO A CD   3  
ATOM   3192  H  HA   . PRO A 1 59 ? 14.053  -6.295  7.231   1.00 0.00 ? 366 PRO A HA   3  
ATOM   3193  H  HB2  . PRO A 1 59 ? 15.073  -8.516  8.386   1.00 0.00 ? 366 PRO A HB2  3  
ATOM   3194  H  HB3  . PRO A 1 59 ? 13.437  -8.461  7.724   1.00 0.00 ? 366 PRO A HB3  3  
ATOM   3195  H  HG2  . PRO A 1 59 ? 15.793  -9.881  6.722   1.00 0.00 ? 366 PRO A HG2  3  
ATOM   3196  H  HG3  . PRO A 1 59 ? 14.089  -10.110 6.302   1.00 0.00 ? 366 PRO A HG3  3  
ATOM   3197  H  HD2  . PRO A 1 59 ? 16.149  -8.619  4.877   1.00 0.00 ? 366 PRO A HD2  3  
ATOM   3198  H  HD3  . PRO A 1 59 ? 14.512  -9.051  4.343   1.00 0.00 ? 366 PRO A HD3  3  
ATOM   3199  N  N    . VAL A 1 60 ? 16.353  -5.244  7.396   1.00 0.00 ? 367 VAL A N    3  
ATOM   3200  C  CA   . VAL A 1 60 ? 17.645  -4.673  7.757   1.00 0.00 ? 367 VAL A CA   3  
ATOM   3201  C  C    . VAL A 1 60 ? 17.683  -4.336  9.242   1.00 0.00 ? 367 VAL A C    3  
ATOM   3202  O  O    . VAL A 1 60 ? 16.653  -4.041  9.851   1.00 0.00 ? 367 VAL A O    3  
ATOM   3203  C  CB   . VAL A 1 60 ? 17.975  -3.413  6.929   1.00 0.00 ? 367 VAL A CB   3  
ATOM   3204  C  CG1  . VAL A 1 60 ? 18.423  -3.790  5.525   1.00 0.00 ? 367 VAL A CG1  3  
ATOM   3205  C  CG2  . VAL A 1 60 ? 16.780  -2.484  6.868   1.00 0.00 ? 367 VAL A CG2  3  
ATOM   3206  H  H    . VAL A 1 60 ? 15.584  -4.648  7.269   1.00 0.00 ? 367 VAL A H    3  
ATOM   3207  H  HA   . VAL A 1 60 ? 18.402  -5.418  7.553   1.00 0.00 ? 367 VAL A HA   3  
ATOM   3208  H  HB   . VAL A 1 60 ? 18.782  -2.886  7.418   1.00 0.00 ? 367 VAL A HB   3  
ATOM   3209  H  HG11 . VAL A 1 60 ? 18.641  -2.894  4.964   1.00 0.00 ? 367 VAL A HG11 3  
ATOM   3210  H  HG12 . VAL A 1 60 ? 17.635  -4.339  5.032   1.00 0.00 ? 367 VAL A HG12 3  
ATOM   3211  H  HG13 . VAL A 1 60 ? 19.310  -4.404  5.580   1.00 0.00 ? 367 VAL A HG13 3  
ATOM   3212  H  HG21 . VAL A 1 60 ? 17.015  -1.635  6.245   1.00 0.00 ? 367 VAL A HG21 3  
ATOM   3213  H  HG22 . VAL A 1 60 ? 16.542  -2.146  7.862   1.00 0.00 ? 367 VAL A HG22 3  
ATOM   3214  H  HG23 . VAL A 1 60 ? 15.934  -3.011  6.456   1.00 0.00 ? 367 VAL A HG23 3  
ATOM   3215  N  N    . LYS A 1 61 ? 18.870  -4.408  9.827   1.00 0.00 ? 368 LYS A N    3  
ATOM   3216  C  CA   . LYS A 1 61 ? 19.020  -4.152  11.246  1.00 0.00 ? 368 LYS A CA   3  
ATOM   3217  C  C    . LYS A 1 61 ? 20.045  -3.051  11.502  1.00 0.00 ? 368 LYS A C    3  
ATOM   3218  O  O    . LYS A 1 61 ? 21.224  -3.178  11.164  1.00 0.00 ? 368 LYS A O    3  
ATOM   3219  C  CB   . LYS A 1 61 ? 19.409  -5.433  11.987  1.00 0.00 ? 368 LYS A CB   3  
ATOM   3220  C  CG   . LYS A 1 61 ? 19.547  -5.243  13.487  1.00 0.00 ? 368 LYS A CG   3  
ATOM   3221  C  CD   . LYS A 1 61 ? 19.728  -6.570  14.208  1.00 0.00 ? 368 LYS A CD   3  
ATOM   3222  C  CE   . LYS A 1 61 ? 18.419  -7.348  14.282  1.00 0.00 ? 368 LYS A CE   3  
ATOM   3223  N  NZ   . LYS A 1 61 ? 18.593  -8.665  14.952  1.00 0.00 ? 368 LYS A NZ   3  
ATOM   3224  H  H    . LYS A 1 61 ? 19.660  -4.625  9.291   1.00 0.00 ? 368 LYS A H    3  
ATOM   3225  H  HA   . LYS A 1 61 ? 18.062  -3.818  11.618  1.00 0.00 ? 368 LYS A HA   3  
ATOM   3226  H  HB2  . LYS A 1 61 ? 18.654  -6.184  11.806  1.00 0.00 ? 368 LYS A HB2  3  
ATOM   3227  H  HB3  . LYS A 1 61 ? 20.356  -5.788  11.602  1.00 0.00 ? 368 LYS A HB3  3  
ATOM   3228  H  HG2  . LYS A 1 61 ? 20.406  -4.618  13.683  1.00 0.00 ? 368 LYS A HG2  3  
ATOM   3229  H  HG3  . LYS A 1 61 ? 18.655  -4.760  13.860  1.00 0.00 ? 368 LYS A HG3  3  
ATOM   3230  H  HD2  . LYS A 1 61 ? 20.456  -7.160  13.673  1.00 0.00 ? 368 LYS A HD2  3  
ATOM   3231  H  HD3  . LYS A 1 61 ? 20.084  -6.379  15.209  1.00 0.00 ? 368 LYS A HD3  3  
ATOM   3232  H  HE2  . LYS A 1 61 ? 17.698  -6.765  14.836  1.00 0.00 ? 368 LYS A HE2  3  
ATOM   3233  H  HE3  . LYS A 1 61 ? 18.054  -7.512  13.278  1.00 0.00 ? 368 LYS A HE3  3  
ATOM   3234  H  HZ1  . LYS A 1 61 ? 19.045  -8.538  15.880  1.00 0.00 ? 368 LYS A HZ1  3  
ATOM   3235  H  HZ2  . LYS A 1 61 ? 19.194  -9.286  14.373  1.00 0.00 ? 368 LYS A HZ2  3  
ATOM   3236  H  HZ3  . LYS A 1 61 ? 17.671  -9.123  15.092  1.00 0.00 ? 368 LYS A HZ3  3  
ATOM   3237  N  N    . GLU A 1 62 ? 19.564  -1.971  12.088  1.00 0.00 ? 369 GLU A N    3  
ATOM   3238  C  CA   . GLU A 1 62 ? 20.393  -0.846  12.481  1.00 0.00 ? 369 GLU A CA   3  
ATOM   3239  C  C    . GLU A 1 62 ? 20.661  -0.920  13.982  1.00 0.00 ? 369 GLU A C    3  
ATOM   3240  O  O    . GLU A 1 62 ? 20.212  -1.846  14.647  1.00 0.00 ? 369 GLU A O    3  
ATOM   3241  C  CB   . GLU A 1 62 ? 19.746  0.497   12.117  1.00 0.00 ? 369 GLU A CB   3  
ATOM   3242  C  CG   . GLU A 1 62 ? 19.698  0.796   10.622  1.00 0.00 ? 369 GLU A CG   3  
ATOM   3243  C  CD   . GLU A 1 62 ? 18.715  -0.077  9.868   1.00 0.00 ? 369 GLU A CD   3  
ATOM   3244  O  OE1  . GLU A 1 62 ? 17.494  0.138   10.014  1.00 0.00 ? 369 GLU A OE1  3  
ATOM   3245  O  OE2  . GLU A 1 62 ? 19.163  -0.962  9.112   1.00 0.00 ? 369 GLU A OE2  3  
ATOM   3246  H  H    . GLU A 1 62 ? 18.599  -1.935  12.275  1.00 0.00 ? 369 GLU A H    3  
ATOM   3247  H  HA   . GLU A 1 62 ? 21.336  -0.935  11.959  1.00 0.00 ? 369 GLU A HA   3  
ATOM   3248  H  HB2  . GLU A 1 62 ? 18.732  0.503   12.490  1.00 0.00 ? 369 GLU A HB2  3  
ATOM   3249  H  HB3  . GLU A 1 62 ? 20.298  1.288   12.602  1.00 0.00 ? 369 GLU A HB3  3  
ATOM   3250  H  HG2  . GLU A 1 62 ? 19.411  1.826   10.485  1.00 0.00 ? 369 GLU A HG2  3  
ATOM   3251  H  HG3  . GLU A 1 62 ? 20.684  0.641   10.207  1.00 0.00 ? 369 GLU A HG3  3  
ATOM   3252  N  N    . LEU A 1 63 ? 21.433  0.021   14.492  1.00 0.00 ? 370 LEU A N    3  
ATOM   3253  C  CA   . LEU A 1 63 ? 21.859  0.035   15.867  1.00 0.00 ? 370 LEU A CA   3  
ATOM   3254  C  C    . LEU A 1 63 ? 21.580  1.405   16.482  1.00 0.00 ? 370 LEU A C    3  
ATOM   3255  O  O    . LEU A 1 63 ? 22.185  1.784   17.489  1.00 0.00 ? 370 LEU A O    3  
ATOM   3256  C  CB   . LEU A 1 63 ? 23.354  -0.257  15.944  1.00 0.00 ? 370 LEU A CB   3  
ATOM   3257  C  CG   . LEU A 1 63 ? 24.213  0.240   14.770  1.00 0.00 ? 370 LEU A CG   3  
ATOM   3258  C  CD1  . LEU A 1 63 ? 25.630  0.535   15.244  1.00 0.00 ? 370 LEU A CD1  3  
ATOM   3259  C  CD2  . LEU A 1 63 ? 24.253  -0.789  13.645  1.00 0.00 ? 370 LEU A CD2  3  
ATOM   3260  H  H    . LEU A 1 63 ? 21.706  0.749   13.941  1.00 0.00 ? 370 LEU A H    3  
ATOM   3261  H  HA   . LEU A 1 63 ? 21.313  -0.724  16.404  1.00 0.00 ? 370 LEU A HA   3  
ATOM   3262  H  HB2  . LEU A 1 63 ? 23.711  0.224   16.823  1.00 0.00 ? 370 LEU A HB2  3  
ATOM   3263  H  HB3  . LEU A 1 63 ? 23.495  -1.323  16.045  1.00 0.00 ? 370 LEU A HB3  3  
ATOM   3264  H  HG   . LEU A 1 63 ? 23.790  1.155   14.380  1.00 0.00 ? 370 LEU A HG   3  
ATOM   3265  H  HD11 . LEU A 1 63 ? 26.219  0.894   14.414  1.00 0.00 ? 370 LEU A HD11 3  
ATOM   3266  H  HD12 . LEU A 1 63 ? 26.074  -0.368  15.637  1.00 0.00 ? 370 LEU A HD12 3  
ATOM   3267  H  HD13 . LEU A 1 63 ? 25.601  1.288   16.017  1.00 0.00 ? 370 LEU A HD13 3  
ATOM   3268  H  HD21 . LEU A 1 63 ? 23.251  -0.962  13.280  1.00 0.00 ? 370 LEU A HD21 3  
ATOM   3269  H  HD22 . LEU A 1 63 ? 24.665  -1.714  14.020  1.00 0.00 ? 370 LEU A HD22 3  
ATOM   3270  H  HD23 . LEU A 1 63 ? 24.871  -0.420  12.842  1.00 0.00 ? 370 LEU A HD23 3  
ATOM   3271  N  N    . THR A 1 64 ? 20.662  2.135   15.863  1.00 0.00 ? 371 THR A N    3  
ATOM   3272  C  CA   . THR A 1 64 ? 20.358  3.505   16.254  1.00 0.00 ? 371 THR A CA   3  
ATOM   3273  C  C    . THR A 1 64 ? 19.805  3.577   17.679  1.00 0.00 ? 371 THR A C    3  
ATOM   3274  O  O    . THR A 1 64 ? 18.834  2.903   18.014  1.00 0.00 ? 371 THR A O    3  
ATOM   3275  C  CB   . THR A 1 64 ? 19.337  4.117   15.276  1.00 0.00 ? 371 THR A CB   3  
ATOM   3276  O  OG1  . THR A 1 64 ? 19.706  3.786   13.929  1.00 0.00 ? 371 THR A OG1  3  
ATOM   3277  C  CG2  . THR A 1 64 ? 19.274  5.631   15.427  1.00 0.00 ? 371 THR A CG2  3  
ATOM   3278  H  H    . THR A 1 64 ? 20.162  1.739   15.123  1.00 0.00 ? 371 THR A H    3  
ATOM   3279  H  HA   . THR A 1 64 ? 21.269  4.083   16.196  1.00 0.00 ? 371 THR A HA   3  
ATOM   3280  H  HB   . THR A 1 64 ? 18.362  3.705   15.489  1.00 0.00 ? 371 THR A HB   3  
ATOM   3281  H  HG1  . THR A 1 64 ? 18.928  3.489   13.451  1.00 0.00 ? 371 THR A HG1  3  
ATOM   3282  H  HG21 . THR A 1 64 ? 20.242  6.054   15.207  1.00 0.00 ? 371 THR A HG21 3  
ATOM   3283  H  HG22 . THR A 1 64 ? 18.995  5.880   16.440  1.00 0.00 ? 371 THR A HG22 3  
ATOM   3284  H  HG23 . THR A 1 64 ? 18.541  6.032   14.742  1.00 0.00 ? 371 THR A HG23 3  
ATOM   3285  N  N    . GLY A 1 65 ? 20.438  4.395   18.513  1.00 0.00 ? 372 GLY A N    3  
ATOM   3286  C  CA   . GLY A 1 65 ? 19.969  4.571   19.874  1.00 0.00 ? 372 GLY A CA   3  
ATOM   3287  C  C    . GLY A 1 65 ? 20.624  3.614   20.848  1.00 0.00 ? 372 GLY A C    3  
ATOM   3288  O  O    . GLY A 1 65 ? 20.234  3.536   22.013  1.00 0.00 ? 372 GLY A O    3  
ATOM   3289  H  H    . GLY A 1 65 ? 21.227  4.888   18.200  1.00 0.00 ? 372 GLY A H    3  
ATOM   3290  H  HA2  . GLY A 1 65 ? 20.180  5.583   20.188  1.00 0.00 ? 372 GLY A HA2  3  
ATOM   3291  H  HA3  . GLY A 1 65 ? 18.902  4.413   19.899  1.00 0.00 ? 372 GLY A HA3  3  
ATOM   3292  N  N    . GLY A 1 66 ? 21.611  2.870   20.369  1.00 0.00 ? 373 GLY A N    3  
ATOM   3293  C  CA   . GLY A 1 66 ? 22.323  1.946   21.228  1.00 0.00 ? 373 GLY A CA   3  
ATOM   3294  C  C    . GLY A 1 66 ? 21.774  0.541   21.119  1.00 0.00 ? 373 GLY A C    3  
ATOM   3295  O  O    . GLY A 1 66 ? 22.475  -0.438  21.387  1.00 0.00 ? 373 GLY A O    3  
ATOM   3296  H  H    . GLY A 1 66 ? 21.844  2.935   19.419  1.00 0.00 ? 373 GLY A H    3  
ATOM   3297  H  HA2  . GLY A 1 66 ? 23.367  1.940   20.951  1.00 0.00 ? 373 GLY A HA2  3  
ATOM   3298  H  HA3  . GLY A 1 66 ? 22.233  2.280   22.251  1.00 0.00 ? 373 GLY A HA3  3  
ATOM   3299  N  N    . GLY A 1 67 ? 20.513  0.445   20.730  1.00 0.00 ? 374 GLY A N    3  
ATOM   3300  C  CA   . GLY A 1 67 ? 19.886  -0.842  20.545  1.00 0.00 ? 374 GLY A CA   3  
ATOM   3301  C  C    . GLY A 1 67 ? 19.669  -1.136  19.083  1.00 0.00 ? 374 GLY A C    3  
ATOM   3302  O  O    . GLY A 1 67 ? 19.530  -0.218  18.278  1.00 0.00 ? 374 GLY A O    3  
ATOM   3303  H  H    . GLY A 1 67 ? 20.002  1.264   20.557  1.00 0.00 ? 374 GLY A H    3  
ATOM   3304  H  HA2  . GLY A 1 67 ? 20.515  -1.608  20.972  1.00 0.00 ? 374 GLY A HA2  3  
ATOM   3305  H  HA3  . GLY A 1 67 ? 18.931  -0.846  21.049  1.00 0.00 ? 374 GLY A HA3  3  
ATOM   3306  N  N    . THR A 1 68 ? 19.653  -2.406  18.731  1.00 0.00 ? 375 THR A N    3  
ATOM   3307  C  CA   . THR A 1 68 ? 19.440  -2.800  17.355  1.00 0.00 ? 375 THR A CA   3  
ATOM   3308  C  C    . THR A 1 68 ? 18.024  -2.456  16.913  1.00 0.00 ? 375 THR A C    3  
ATOM   3309  O  O    . THR A 1 68 ? 17.054  -2.822  17.582  1.00 0.00 ? 375 THR A O    3  
ATOM   3310  C  CB   . THR A 1 68 ? 19.695  -4.303  17.174  1.00 0.00 ? 375 THR A CB   3  
ATOM   3311  O  OG1  . THR A 1 68 ? 18.994  -5.036  18.187  1.00 0.00 ? 375 THR A OG1  3  
ATOM   3312  C  CG2  . THR A 1 68 ? 21.184  -4.614  17.250  1.00 0.00 ? 375 THR A CG2  3  
ATOM   3313  H  H    . THR A 1 68 ? 19.775  -3.098  19.414  1.00 0.00 ? 375 THR A H    3  
ATOM   3314  H  HA   . THR A 1 68 ? 20.141  -2.257  16.739  1.00 0.00 ? 375 THR A HA   3  
ATOM   3315  H  HB   . THR A 1 68 ? 19.328  -4.603  16.203  1.00 0.00 ? 375 THR A HB   3  
ATOM   3316  H  HG1  . THR A 1 68 ? 18.160  -4.591  18.384  1.00 0.00 ? 375 THR A HG1  3  
ATOM   3317  H  HG21 . THR A 1 68 ? 21.710  -4.038  16.503  1.00 0.00 ? 375 THR A HG21 3  
ATOM   3318  H  HG22 . THR A 1 68 ? 21.340  -5.668  17.068  1.00 0.00 ? 375 THR A HG22 3  
ATOM   3319  H  HG23 . THR A 1 68 ? 21.556  -4.359  18.231  1.00 0.00 ? 375 THR A HG23 3  
ATOM   3320  N  N    . THR A 1 69 ? 17.901  -1.763  15.792  1.00 0.00 ? 376 THR A N    3  
ATOM   3321  C  CA   . THR A 1 69 ? 16.627  -1.374  15.296  1.00 0.00 ? 376 THR A CA   3  
ATOM   3322  C  C    . THR A 1 69 ? 16.344  -2.164  14.054  1.00 0.00 ? 376 THR A C    3  
ATOM   3323  O  O    . THR A 1 69 ? 17.075  -2.126  13.069  1.00 0.00 ? 376 THR A O    3  
ATOM   3324  C  CB   . THR A 1 69 ? 16.566  0.133   14.986  1.00 0.00 ? 376 THR A CB   3  
ATOM   3325  O  OG1  . THR A 1 69 ? 17.370  0.447   13.845  1.00 0.00 ? 376 THR A OG1  3  
ATOM   3326  C  CG2  . THR A 1 69 ? 17.073  0.916   16.172  1.00 0.00 ? 376 THR A CG2  3  
ATOM   3327  H  H    . THR A 1 69 ? 18.682  -1.557  15.259  1.00 0.00 ? 376 THR A H    3  
ATOM   3328  H  HA   . THR A 1 69 ? 15.884  -1.606  16.046  1.00 0.00 ? 376 THR A HA   3  
ATOM   3329  H  HB   . THR A 1 69 ? 15.542  0.415   14.794  1.00 0.00 ? 376 THR A HB   3  
ATOM   3330  H  HG1  . THR A 1 69 ? 17.143  -0.147  13.118  1.00 0.00 ? 376 THR A HG1  3  
ATOM   3331  H  HG21 . THR A 1 69 ? 18.153  0.823   16.225  1.00 0.00 ? 376 THR A HG21 3  
ATOM   3332  H  HG22 . THR A 1 69 ? 16.628  0.516   17.071  1.00 0.00 ? 376 THR A HG22 3  
ATOM   3333  H  HG23 . THR A 1 69 ? 16.801  1.953   16.061  1.00 0.00 ? 376 THR A HG23 3  
ATOM   3334  N  N    . PHE A 1 70 ? 15.290  -2.883  14.140  1.00 0.00 ? 377 PHE A N    3  
ATOM   3335  C  CA   . PHE A 1 70 ? 14.800  -3.668  13.054  1.00 0.00 ? 377 PHE A CA   3  
ATOM   3336  C  C    . PHE A 1 70 ? 13.938  -2.823  12.125  1.00 0.00 ? 377 PHE A C    3  
ATOM   3337  O  O    . PHE A 1 70 ? 12.940  -2.231  12.541  1.00 0.00 ? 377 PHE A O    3  
ATOM   3338  C  CB   . PHE A 1 70 ? 14.038  -4.872  13.608  1.00 0.00 ? 377 PHE A CB   3  
ATOM   3339  C  CG   . PHE A 1 70 ? 12.791  -4.551  14.392  1.00 0.00 ? 377 PHE A CG   3  
ATOM   3340  C  CD1  . PHE A 1 70 ? 12.866  -4.131  15.711  1.00 0.00 ? 377 PHE A CD1  3  
ATOM   3341  C  CD2  . PHE A 1 70 ? 11.539  -4.695  13.810  1.00 0.00 ? 377 PHE A CD2  3  
ATOM   3342  C  CE1  . PHE A 1 70 ? 11.719  -3.858  16.430  1.00 0.00 ? 377 PHE A CE1  3  
ATOM   3343  C  CE2  . PHE A 1 70 ? 10.390  -4.422  14.525  1.00 0.00 ? 377 PHE A CE2  3  
ATOM   3344  C  CZ   . PHE A 1 70 ? 10.479  -4.003  15.837  1.00 0.00 ? 377 PHE A CZ   3  
ATOM   3345  H  H    . PHE A 1 70 ? 14.855  -2.930  14.990  1.00 0.00 ? 377 PHE A H    3  
ATOM   3346  H  HA   . PHE A 1 70 ? 15.654  -4.024  12.499  1.00 0.00 ? 377 PHE A HA   3  
ATOM   3347  H  HB2  . PHE A 1 70 ? 13.740  -5.480  12.779  1.00 0.00 ? 377 PHE A HB2  3  
ATOM   3348  H  HB3  . PHE A 1 70 ? 14.711  -5.435  14.270  1.00 0.00 ? 377 PHE A HB3  3  
ATOM   3349  H  HD1  . PHE A 1 70 ? 13.833  -4.015  16.177  1.00 0.00 ? 377 PHE A HD1  3  
ATOM   3350  H  HD2  . PHE A 1 70 ? 11.467  -5.023  12.783  1.00 0.00 ? 377 PHE A HD2  3  
ATOM   3351  H  HE1  . PHE A 1 70 ? 11.788  -3.531  17.457  1.00 0.00 ? 377 PHE A HE1  3  
ATOM   3352  H  HE2  . PHE A 1 70 ? 9.424   -4.535  14.058  1.00 0.00 ? 377 PHE A HE2  3  
ATOM   3353  H  HZ   . PHE A 1 70 ? 9.583   -3.789  16.399  1.00 0.00 ? 377 PHE A HZ   3  
ATOM   3354  N  N    . SER A 1 71 ? 14.354  -2.735  10.880  1.00 0.00 ? 378 SER A N    3  
ATOM   3355  C  CA   . SER A 1 71 ? 13.616  -1.990  9.883   1.00 0.00 ? 378 SER A CA   3  
ATOM   3356  C  C    . SER A 1 71 ? 13.226  -2.905  8.731   1.00 0.00 ? 378 SER A C    3  
ATOM   3357  O  O    . SER A 1 71 ? 14.086  -3.489  8.070   1.00 0.00 ? 378 SER A O    3  
ATOM   3358  C  CB   . SER A 1 71 ? 14.459  -0.820  9.365   1.00 0.00 ? 378 SER A CB   3  
ATOM   3359  O  OG   . SER A 1 71 ? 14.891  0.018   10.427  1.00 0.00 ? 378 SER A OG   3  
ATOM   3360  H  H    . SER A 1 71 ? 15.193  -3.181  10.616  1.00 0.00 ? 378 SER A H    3  
ATOM   3361  H  HA   . SER A 1 71 ? 12.721  -1.604  10.348  1.00 0.00 ? 378 SER A HA   3  
ATOM   3362  H  HB2  . SER A 1 71 ? 15.330  -1.207  8.859   1.00 0.00 ? 378 SER A HB2  3  
ATOM   3363  H  HB3  . SER A 1 71 ? 13.873  -0.234  8.674   1.00 0.00 ? 378 SER A HB3  3  
ATOM   3364  H  HG   . SER A 1 71 ? 15.866  0.006   10.461  1.00 0.00 ? 378 SER A HG   3  
ATOM   3365  N  N    . VAL A 1 72 ? 11.935  -3.052  8.495   1.00 0.00 ? 379 VAL A N    3  
ATOM   3366  C  CA   . VAL A 1 72 ? 11.475  -3.856  7.380   1.00 0.00 ? 379 VAL A CA   3  
ATOM   3367  C  C    . VAL A 1 72 ? 11.212  -2.962  6.189   1.00 0.00 ? 379 VAL A C    3  
ATOM   3368  O  O    . VAL A 1 72 ? 10.517  -1.952  6.289   1.00 0.00 ? 379 VAL A O    3  
ATOM   3369  C  CB   . VAL A 1 72 ? 10.193  -4.641  7.691   1.00 0.00 ? 379 VAL A CB   3  
ATOM   3370  C  CG1  . VAL A 1 72 ? 10.016  -5.794  6.710   1.00 0.00 ? 379 VAL A CG1  3  
ATOM   3371  C  CG2  . VAL A 1 72 ? 10.186  -5.147  9.127   1.00 0.00 ? 379 VAL A CG2  3  
ATOM   3372  H  H    . VAL A 1 72 ? 11.279  -2.603  9.071   1.00 0.00 ? 379 VAL A H    3  
ATOM   3373  H  HA   . VAL A 1 72 ? 12.258  -4.558  7.129   1.00 0.00 ? 379 VAL A HA   3  
ATOM   3374  H  HB   . VAL A 1 72 ? 9.365   -3.972  7.557   1.00 0.00 ? 379 VAL A HB   3  
ATOM   3375  H  HG11 . VAL A 1 72 ? 9.902   -5.403  5.710   1.00 0.00 ? 379 VAL A HG11 3  
ATOM   3376  H  HG12 . VAL A 1 72 ? 9.137   -6.363  6.977   1.00 0.00 ? 379 VAL A HG12 3  
ATOM   3377  H  HG13 . VAL A 1 72 ? 10.884  -6.435  6.748   1.00 0.00 ? 379 VAL A HG13 3  
ATOM   3378  H  HG21 . VAL A 1 72 ? 10.242  -4.307  9.807   1.00 0.00 ? 379 VAL A HG21 3  
ATOM   3379  H  HG22 . VAL A 1 72 ? 11.037  -5.794  9.286   1.00 0.00 ? 379 VAL A HG22 3  
ATOM   3380  H  HG23 . VAL A 1 72 ? 9.276   -5.698  9.309   1.00 0.00 ? 379 VAL A HG23 3  
ATOM   3381  N  N    . ARG A 1 73 ? 11.769  -3.346  5.072   1.00 0.00 ? 380 ARG A N    3  
ATOM   3382  C  CA   . ARG A 1 73 ? 11.670  -2.566  3.852   1.00 0.00 ? 380 ARG A CA   3  
ATOM   3383  C  C    . ARG A 1 73 ? 10.991  -3.371  2.765   1.00 0.00 ? 380 ARG A C    3  
ATOM   3384  O  O    . ARG A 1 73 ? 11.574  -4.309  2.227   1.00 0.00 ? 380 ARG A O    3  
ATOM   3385  C  CB   . ARG A 1 73 ? 13.060  -2.149  3.369   1.00 0.00 ? 380 ARG A CB   3  
ATOM   3386  C  CG   . ARG A 1 73 ? 13.786  -1.198  4.297   1.00 0.00 ? 380 ARG A CG   3  
ATOM   3387  C  CD   . ARG A 1 73 ? 15.214  -0.982  3.829   1.00 0.00 ? 380 ARG A CD   3  
ATOM   3388  N  NE   . ARG A 1 73 ? 15.914  0.018   4.634   1.00 0.00 ? 380 ARG A NE   3  
ATOM   3389  C  CZ   . ARG A 1 73 ? 17.238  0.176   4.637   1.00 0.00 ? 380 ARG A CZ   3  
ATOM   3390  N  NH1  . ARG A 1 73 ? 17.997  -0.585  3.856   1.00 0.00 ? 380 ARG A NH1  3  
ATOM   3391  N  NH2  . ARG A 1 73 ? 17.802  1.091   5.418   1.00 0.00 ? 380 ARG A NH2  3  
ATOM   3392  H  H    . ARG A 1 73 ? 12.256  -4.200  5.063   1.00 0.00 ? 380 ARG A H    3  
ATOM   3393  H  HA   . ARG A 1 73 ? 11.085  -1.683  4.060   1.00 0.00 ? 380 ARG A HA   3  
ATOM   3394  H  HB2  . ARG A 1 73 ? 13.666  -3.034  3.258   1.00 0.00 ? 380 ARG A HB2  3  
ATOM   3395  H  HB3  . ARG A 1 73 ? 12.963  -1.671  2.406   1.00 0.00 ? 380 ARG A HB3  3  
ATOM   3396  H  HG2  . ARG A 1 73 ? 13.269  -0.251  4.308   1.00 0.00 ? 380 ARG A HG2  3  
ATOM   3397  H  HG3  . ARG A 1 73 ? 13.799  -1.619  5.292   1.00 0.00 ? 380 ARG A HG3  3  
ATOM   3398  H  HD2  . ARG A 1 73 ? 15.745  -1.921  3.901   1.00 0.00 ? 380 ARG A HD2  3  
ATOM   3399  H  HD3  . ARG A 1 73 ? 15.197  -0.661  2.798   1.00 0.00 ? 380 ARG A HD3  3  
ATOM   3400  H  HE   . ARG A 1 73 ? 15.365  0.598   5.210   1.00 0.00 ? 380 ARG A HE   3  
ATOM   3401  H  HH11 . ARG A 1 73 ? 17.577  -1.278  3.262   1.00 0.00 ? 380 ARG A HH11 3  
ATOM   3402  H  HH12 . ARG A 1 73 ? 18.994  -0.472  3.858   1.00 0.00 ? 380 ARG A HH12 3  
ATOM   3403  H  HH21 . ARG A 1 73 ? 17.234  1.673   6.008   1.00 0.00 ? 380 ARG A HH21 3  
ATOM   3404  H  HH22 . ARG A 1 73 ? 18.800  1.196   5.435   1.00 0.00 ? 380 ARG A HH22 3  
ATOM   3405  N  N    . LYS A 1 74 ? 9.760   -3.029  2.443   1.00 0.00 ? 381 LYS A N    3  
ATOM   3406  C  CA   . LYS A 1 74 ? 9.086   -3.694  1.348   1.00 0.00 ? 381 LYS A CA   3  
ATOM   3407  C  C    . LYS A 1 74 ? 9.381   -2.980  0.045   1.00 0.00 ? 381 LYS A C    3  
ATOM   3408  O  O    . LYS A 1 74 ? 9.038   -1.811  -0.132  1.00 0.00 ? 381 LYS A O    3  
ATOM   3409  C  CB   . LYS A 1 74 ? 7.575   -3.766  1.559   1.00 0.00 ? 381 LYS A CB   3  
ATOM   3410  C  CG   . LYS A 1 74 ? 7.140   -4.685  2.684   1.00 0.00 ? 381 LYS A CG   3  
ATOM   3411  C  CD   . LYS A 1 74 ? 5.682   -5.074  2.508   1.00 0.00 ? 381 LYS A CD   3  
ATOM   3412  C  CE   . LYS A 1 74 ? 5.059   -5.615  3.784   1.00 0.00 ? 381 LYS A CE   3  
ATOM   3413  N  NZ   . LYS A 1 74 ? 5.833   -6.743  4.369   1.00 0.00 ? 381 LYS A NZ   3  
ATOM   3414  H  H    . LYS A 1 74 ? 9.304   -2.313  2.935   1.00 0.00 ? 381 LYS A H    3  
ATOM   3415  H  HA   . LYS A 1 74 ? 9.483   -4.698  1.286   1.00 0.00 ? 381 LYS A HA   3  
ATOM   3416  H  HB2  . LYS A 1 74 ? 7.210   -2.773  1.779   1.00 0.00 ? 381 LYS A HB2  3  
ATOM   3417  H  HB3  . LYS A 1 74 ? 7.114   -4.112  0.646   1.00 0.00 ? 381 LYS A HB3  3  
ATOM   3418  H  HG2  . LYS A 1 74 ? 7.750   -5.575  2.670   1.00 0.00 ? 381 LYS A HG2  3  
ATOM   3419  H  HG3  . LYS A 1 74 ? 7.261   -4.177  3.626   1.00 0.00 ? 381 LYS A HG3  3  
ATOM   3420  H  HD2  . LYS A 1 74 ? 5.130   -4.198  2.200   1.00 0.00 ? 381 LYS A HD2  3  
ATOM   3421  H  HD3  . LYS A 1 74 ? 5.618   -5.827  1.736   1.00 0.00 ? 381 LYS A HD3  3  
ATOM   3422  H  HE2  . LYS A 1 74 ? 5.008   -4.816  4.506   1.00 0.00 ? 381 LYS A HE2  3  
ATOM   3423  H  HE3  . LYS A 1 74 ? 4.059   -5.955  3.559   1.00 0.00 ? 381 LYS A HE3  3  
ATOM   3424  H  HZ1  . LYS A 1 74 ? 6.721   -6.395  4.781   1.00 0.00 ? 381 LYS A HZ1  3  
ATOM   3425  H  HZ2  . LYS A 1 74 ? 6.049   -7.452  3.641   1.00 0.00 ? 381 LYS A HZ2  3  
ATOM   3426  H  HZ3  . LYS A 1 74 ? 5.277   -7.201  5.121   1.00 0.00 ? 381 LYS A HZ3  3  
ATOM   3427  N  N    . THR A 1 75 ? 10.032  -3.685  -0.853  1.00 0.00 ? 382 THR A N    3  
ATOM   3428  C  CA   . THR A 1 75 ? 10.295  -3.166  -2.175  1.00 0.00 ? 382 THR A CA   3  
ATOM   3429  C  C    . THR A 1 75 ? 9.382   -3.872  -3.163  1.00 0.00 ? 382 THR A C    3  
ATOM   3430  O  O    . THR A 1 75 ? 9.558   -5.052  -3.451  1.00 0.00 ? 382 THR A O    3  
ATOM   3431  C  CB   . THR A 1 75 ? 11.770  -3.367  -2.576  1.00 0.00 ? 382 THR A CB   3  
ATOM   3432  O  OG1  . THR A 1 75 ? 12.622  -2.806  -1.569  1.00 0.00 ? 382 THR A OG1  3  
ATOM   3433  C  CG2  . THR A 1 75 ? 12.070  -2.716  -3.915  1.00 0.00 ? 382 THR A CG2  3  
ATOM   3434  H  H    . THR A 1 75 ? 10.317  -4.601  -0.632  1.00 0.00 ? 382 THR A H    3  
ATOM   3435  H  HA   . THR A 1 75 ? 10.072  -2.108  -2.173  1.00 0.00 ? 382 THR A HA   3  
ATOM   3436  H  HB   . THR A 1 75 ? 11.968  -4.428  -2.652  1.00 0.00 ? 382 THR A HB   3  
ATOM   3437  H  HG1  . THR A 1 75 ? 12.136  -2.747  -0.740  1.00 0.00 ? 382 THR A HG1  3  
ATOM   3438  H  HG21 . THR A 1 75 ? 11.885  -1.653  -3.846  1.00 0.00 ? 382 THR A HG21 3  
ATOM   3439  H  HG22 . THR A 1 75 ? 11.434  -3.143  -4.676  1.00 0.00 ? 382 THR A HG22 3  
ATOM   3440  H  HG23 . THR A 1 75 ? 13.105  -2.885  -4.176  1.00 0.00 ? 382 THR A HG23 3  
ATOM   3441  N  N    . ALA A 1 76 ? 8.402   -3.157  -3.670  1.00 0.00 ? 383 ALA A N    3  
ATOM   3442  C  CA   . ALA A 1 76 ? 7.404   -3.767  -4.518  1.00 0.00 ? 383 ALA A CA   3  
ATOM   3443  C  C    . ALA A 1 76 ? 7.589   -3.354  -5.959  1.00 0.00 ? 383 ALA A C    3  
ATOM   3444  O  O    . ALA A 1 76 ? 8.050   -2.251  -6.251  1.00 0.00 ? 383 ALA A O    3  
ATOM   3445  C  CB   . ALA A 1 76 ? 6.007   -3.406  -4.044  1.00 0.00 ? 383 ALA A CB   3  
ATOM   3446  H  H    . ALA A 1 76 ? 8.354   -2.195  -3.481  1.00 0.00 ? 383 ALA A H    3  
ATOM   3447  H  HA   . ALA A 1 76 ? 7.515   -4.839  -4.444  1.00 0.00 ? 383 ALA A HA   3  
ATOM   3448  H  HB1  . ALA A 1 76 ? 5.277   -3.888  -4.678  1.00 0.00 ? 383 ALA A HB1  3  
ATOM   3449  H  HB2  . ALA A 1 76 ? 5.876   -2.335  -4.096  1.00 0.00 ? 383 ALA A HB2  3  
ATOM   3450  H  HB3  . ALA A 1 76 ? 5.873   -3.737  -3.025  1.00 0.00 ? 383 ALA A HB3  3  
ATOM   3451  N  N    . TYR A 1 77 ? 7.252   -4.259  -6.851  1.00 0.00 ? 384 TYR A N    3  
ATOM   3452  C  CA   . TYR A 1 77 ? 7.244   -3.966  -8.262  1.00 0.00 ? 384 TYR A CA   3  
ATOM   3453  C  C    . TYR A 1 77 ? 5.869   -4.284  -8.817  1.00 0.00 ? 384 TYR A C    3  
ATOM   3454  O  O    . TYR A 1 77 ? 5.205   -5.207  -8.350  1.00 0.00 ? 384 TYR A O    3  
ATOM   3455  C  CB   . TYR A 1 77 ? 8.336   -4.750  -8.994  1.00 0.00 ? 384 TYR A CB   3  
ATOM   3456  C  CG   . TYR A 1 77 ? 9.739   -4.263  -8.680  1.00 0.00 ? 384 TYR A CG   3  
ATOM   3457  C  CD1  . TYR A 1 77 ? 10.242  -3.114  -9.274  1.00 0.00 ? 384 TYR A CD1  3  
ATOM   3458  C  CD2  . TYR A 1 77 ? 10.555  -4.948  -7.788  1.00 0.00 ? 384 TYR A CD2  3  
ATOM   3459  C  CE1  . TYR A 1 77 ? 11.514  -2.666  -8.993  1.00 0.00 ? 384 TYR A CE1  3  
ATOM   3460  C  CE2  . TYR A 1 77 ? 11.830  -4.502  -7.501  1.00 0.00 ? 384 TYR A CE2  3  
ATOM   3461  C  CZ   . TYR A 1 77 ? 12.304  -3.359  -8.108  1.00 0.00 ? 384 TYR A CZ   3  
ATOM   3462  O  OH   . TYR A 1 77 ? 13.568  -2.902  -7.827  1.00 0.00 ? 384 TYR A OH   3  
ATOM   3463  H  H    . TYR A 1 77 ? 6.985   -5.155  -6.549  1.00 0.00 ? 384 TYR A H    3  
ATOM   3464  H  HA   . TYR A 1 77 ? 7.428   -2.911  -8.379  1.00 0.00 ? 384 TYR A HA   3  
ATOM   3465  H  HB2  . TYR A 1 77 ? 8.276   -5.796  -8.705  1.00 0.00 ? 384 TYR A HB2  3  
ATOM   3466  H  HB3  . TYR A 1 77 ? 8.183   -4.655  -10.068 1.00 0.00 ? 384 TYR A HB3  3  
ATOM   3467  H  HD1  . TYR A 1 77 ? 9.624   -2.563  -9.967  1.00 0.00 ? 384 TYR A HD1  3  
ATOM   3468  H  HD2  . TYR A 1 77 ? 10.183  -5.841  -7.317  1.00 0.00 ? 384 TYR A HD2  3  
ATOM   3469  H  HE1  . TYR A 1 77 ? 11.887  -1.771  -9.470  1.00 0.00 ? 384 TYR A HE1  3  
ATOM   3470  H  HE2  . TYR A 1 77 ? 12.451  -5.049  -6.808  1.00 0.00 ? 384 TYR A HE2  3  
ATOM   3471  H  HH   . TYR A 1 77 ? 14.190  -3.639  -7.885  1.00 0.00 ? 384 TYR A HH   3  
ATOM   3472  N  N    . CYS A 1 78 ? 5.437   -3.504  -9.794  1.00 0.00 ? 385 CYS A N    3  
ATOM   3473  C  CA   . CYS A 1 78 ? 4.103   -3.666  -10.357 1.00 0.00 ? 385 CYS A CA   3  
ATOM   3474  C  C    . CYS A 1 78 ? 3.948   -5.040  -10.996 1.00 0.00 ? 385 CYS A C    3  
ATOM   3475  O  O    . CYS A 1 78 ? 4.923   -5.631  -11.453 1.00 0.00 ? 385 CYS A O    3  
ATOM   3476  C  CB   . CYS A 1 78 ? 3.805   -2.557  -11.380 1.00 0.00 ? 385 CYS A CB   3  
ATOM   3477  S  SG   . CYS A 1 78 ? 5.055   -2.368  -12.686 1.00 0.00 ? 385 CYS A SG   3  
ATOM   3478  H  H    . CYS A 1 78 ? 6.023   -2.797  -10.128 1.00 0.00 ? 385 CYS A H    3  
ATOM   3479  H  HA   . CYS A 1 78 ? 3.396   -3.586  -9.543  1.00 0.00 ? 385 CYS A HA   3  
ATOM   3480  H  HB2  . CYS A 1 78 ? 2.863   -2.770  -11.861 1.00 0.00 ? 385 CYS A HB2  3  
ATOM   3481  H  HB3  . CYS A 1 78 ? 3.729   -1.612  -10.861 1.00 0.00 ? 385 CYS A HB3  3  
ATOM   3482  N  N    . ASP A 1 79 ? 2.718   -5.542  -10.997 1.00 0.00 ? 386 ASP A N    3  
ATOM   3483  C  CA   . ASP A 1 79 ? 2.410   -6.872  -11.533 1.00 0.00 ? 386 ASP A CA   3  
ATOM   3484  C  C    . ASP A 1 79 ? 3.048   -7.090  -12.908 1.00 0.00 ? 386 ASP A C    3  
ATOM   3485  O  O    . ASP A 1 79 ? 3.649   -8.130  -13.160 1.00 0.00 ? 386 ASP A O    3  
ATOM   3486  C  CB   . ASP A 1 79 ? 0.892   -7.061  -11.626 1.00 0.00 ? 386 ASP A CB   3  
ATOM   3487  C  CG   . ASP A 1 79 ? 0.501   -8.485  -11.974 1.00 0.00 ? 386 ASP A CG   3  
ATOM   3488  O  OD1  . ASP A 1 79 ? 0.415   -8.807  -13.179 1.00 0.00 ? 386 ASP A OD1  3  
ATOM   3489  O  OD2  . ASP A 1 79 ? 0.263   -9.287  -11.047 1.00 0.00 ? 386 ASP A OD2  3  
ATOM   3490  H  H    . ASP A 1 79 ? 1.992   -5.012  -10.596 1.00 0.00 ? 386 ASP A H    3  
ATOM   3491  H  HA   . ASP A 1 79 ? 2.810   -7.603  -10.847 1.00 0.00 ? 386 ASP A HA   3  
ATOM   3492  H  HB2  . ASP A 1 79 ? 0.445   -6.811  -10.663 1.00 0.00 ? 386 ASP A HB2  3  
ATOM   3493  H  HB3  . ASP A 1 79 ? 0.501   -6.399  -12.399 1.00 0.00 ? 386 ASP A HB3  3  
ATOM   3494  N  N    . VAL A 1 80 ? 2.956   -6.084  -13.774 1.00 0.00 ? 387 VAL A N    3  
ATOM   3495  C  CA   . VAL A 1 80 ? 3.475   -6.191  -15.137 1.00 0.00 ? 387 VAL A CA   3  
ATOM   3496  C  C    . VAL A 1 80 ? 4.934   -5.712  -15.219 1.00 0.00 ? 387 VAL A C    3  
ATOM   3497  O  O    . VAL A 1 80 ? 5.440   -5.354  -16.279 1.00 0.00 ? 387 VAL A O    3  
ATOM   3498  C  CB   . VAL A 1 80 ? 2.579   -5.397  -16.119 1.00 0.00 ? 387 VAL A CB   3  
ATOM   3499  C  CG1  . VAL A 1 80 ? 2.666   -3.900  -15.855 1.00 0.00 ? 387 VAL A CG1  3  
ATOM   3500  C  CG2  . VAL A 1 80 ? 2.903   -5.725  -17.570 1.00 0.00 ? 387 VAL A CG2  3  
ATOM   3501  H  H    . VAL A 1 80 ? 2.525   -5.253  -13.493 1.00 0.00 ? 387 VAL A H    3  
ATOM   3502  H  HA   . VAL A 1 80 ? 3.441   -7.233  -15.420 1.00 0.00 ? 387 VAL A HA   3  
ATOM   3503  H  HB   . VAL A 1 80 ? 1.561   -5.700  -15.937 1.00 0.00 ? 387 VAL A HB   3  
ATOM   3504  H  HG11 . VAL A 1 80 ? 2.328   -3.692  -14.851 1.00 0.00 ? 387 VAL A HG11 3  
ATOM   3505  H  HG12 . VAL A 1 80 ? 2.043   -3.373  -16.561 1.00 0.00 ? 387 VAL A HG12 3  
ATOM   3506  H  HG13 . VAL A 1 80 ? 3.691   -3.576  -15.964 1.00 0.00 ? 387 VAL A HG13 3  
ATOM   3507  H  HG21 . VAL A 1 80 ? 2.257   -5.156  -18.223 1.00 0.00 ? 387 VAL A HG21 3  
ATOM   3508  H  HG22 . VAL A 1 80 ? 2.748   -6.781  -17.743 1.00 0.00 ? 387 VAL A HG22 3  
ATOM   3509  H  HG23 . VAL A 1 80 ? 3.932   -5.473  -17.775 1.00 0.00 ? 387 VAL A HG23 3  
ATOM   3510  N  N    . HIS A 1 81 ? 5.622   -5.723  -14.090 1.00 0.00 ? 388 HIS A N    3  
ATOM   3511  C  CA   . HIS A 1 81 ? 7.037   -5.377  -14.071 1.00 0.00 ? 388 HIS A CA   3  
ATOM   3512  C  C    . HIS A 1 81 ? 7.871   -6.624  -14.339 1.00 0.00 ? 388 HIS A C    3  
ATOM   3513  O  O    . HIS A 1 81 ? 9.027   -6.536  -14.752 1.00 0.00 ? 388 HIS A O    3  
ATOM   3514  C  CB   . HIS A 1 81 ? 7.426   -4.760  -12.721 1.00 0.00 ? 388 HIS A CB   3  
ATOM   3515  C  CG   . HIS A 1 81 ? 8.730   -4.017  -12.720 1.00 0.00 ? 388 HIS A CG   3  
ATOM   3516  N  ND1  . HIS A 1 81 ? 8.815   -2.642  -12.525 1.00 0.00 ? 388 HIS A ND1  3  
ATOM   3517  C  CD2  . HIS A 1 81 ? 10.008  -4.452  -12.853 1.00 0.00 ? 388 HIS A CD2  3  
ATOM   3518  C  CE1  . HIS A 1 81 ? 10.094  -2.284  -12.540 1.00 0.00 ? 388 HIS A CE1  3  
ATOM   3519  N  NE2  . HIS A 1 81 ? 10.827  -3.359  -12.735 1.00 0.00 ? 388 HIS A NE2  3  
ATOM   3520  H  H    . HIS A 1 81 ? 5.170   -5.968  -13.250 1.00 0.00 ? 388 HIS A H    3  
ATOM   3521  H  HA   . HIS A 1 81 ? 7.215   -4.659  -14.857 1.00 0.00 ? 388 HIS A HA   3  
ATOM   3522  H  HB2  . HIS A 1 81 ? 6.657   -4.065  -12.420 1.00 0.00 ? 388 HIS A HB2  3  
ATOM   3523  H  HB3  . HIS A 1 81 ? 7.494   -5.548  -11.986 1.00 0.00 ? 388 HIS A HB3  3  
ATOM   3524  H  HD2  . HIS A 1 81 ? 10.320  -5.470  -13.031 1.00 0.00 ? 388 HIS A HD2  3  
ATOM   3525  H  HE1  . HIS A 1 81 ? 10.468  -1.282  -12.411 1.00 0.00 ? 388 HIS A HE1  3  
ATOM   3526  H  HE2  . HIS A 1 81 ? 11.811  -3.393  -12.656 1.00 0.00 ? 388 HIS A HE2  3  
ATOM   3527  N  N    . THR A 1 82 ? 7.271   -7.785  -14.115 1.00 0.00 ? 389 THR A N    3  
ATOM   3528  C  CA   . THR A 1 82 ? 7.980   -9.042  -14.276 1.00 0.00 ? 389 THR A CA   3  
ATOM   3529  C  C    . THR A 1 82 ? 7.634   -9.741  -15.602 1.00 0.00 ? 389 THR A C    3  
ATOM   3530  O  O    . THR A 1 82 ? 8.534   -10.018 -16.391 1.00 0.00 ? 389 THR A O    3  
ATOM   3531  C  CB   . THR A 1 82 ? 7.726   -9.993  -13.082 1.00 0.00 ? 389 THR A CB   3  
ATOM   3532  O  OG1  . THR A 1 82 ? 7.827   -9.262  -11.849 1.00 0.00 ? 389 THR A OG1  3  
ATOM   3533  C  CG2  . THR A 1 82 ? 8.733   -11.128 -13.070 1.00 0.00 ? 389 THR A CG2  3  
ATOM   3534  H  H    . THR A 1 82 ? 6.333   -7.796  -13.833 1.00 0.00 ? 389 THR A H    3  
ATOM   3535  H  HA   . THR A 1 82 ? 9.037   -8.811  -14.289 1.00 0.00 ? 389 THR A HA   3  
ATOM   3536  H  HB   . THR A 1 82 ? 6.736   -10.412 -13.165 1.00 0.00 ? 389 THR A HB   3  
ATOM   3537  H  HG1  . THR A 1 82 ? 7.166   -9.585  -11.230 1.00 0.00 ? 389 THR A HG1  3  
ATOM   3538  H  HG21 . THR A 1 82 ? 8.530   -11.781 -12.235 1.00 0.00 ? 389 THR A HG21 3  
ATOM   3539  H  HG22 . THR A 1 82 ? 9.729   -10.722 -12.977 1.00 0.00 ? 389 THR A HG22 3  
ATOM   3540  H  HG23 . THR A 1 82 ? 8.656   -11.686 -13.991 1.00 0.00 ? 389 THR A HG23 3  
ATOM   3541  N  N    . PRO A 1 83 ? 6.344   -10.039 -15.894 1.00 0.00 ? 390 PRO A N    3  
ATOM   3542  C  CA   . PRO A 1 83 ? 5.948   -10.779 -17.085 1.00 0.00 ? 390 PRO A CA   3  
ATOM   3543  C  C    . PRO A 1 83 ? 5.173   -9.978  -18.164 1.00 0.00 ? 390 PRO A C    3  
ATOM   3544  O  O    . PRO A 1 83 ? 4.139   -10.456 -18.634 1.00 0.00 ? 390 PRO A O    3  
ATOM   3545  C  CB   . PRO A 1 83 ? 5.006   -11.803 -16.443 1.00 0.00 ? 390 PRO A CB   3  
ATOM   3546  C  CG   . PRO A 1 83 ? 4.386   -11.083 -15.269 1.00 0.00 ? 390 PRO A CG   3  
ATOM   3547  C  CD   . PRO A 1 83 ? 5.155   -9.790  -15.089 1.00 0.00 ? 390 PRO A CD   3  
ATOM   3548  H  HA   . PRO A 1 83 ? 6.783   -11.294 -17.536 1.00 0.00 ? 390 PRO A HA   3  
ATOM   3549  H  HB2  . PRO A 1 83 ? 4.259   -12.107 -17.162 1.00 0.00 ? 390 PRO A HB2  3  
ATOM   3550  H  HB3  . PRO A 1 83 ? 5.573   -12.664 -16.121 1.00 0.00 ? 390 PRO A HB3  3  
ATOM   3551  H  HG2  . PRO A 1 83 ? 3.348   -10.872 -15.476 1.00 0.00 ? 390 PRO A HG2  3  
ATOM   3552  H  HG3  . PRO A 1 83 ? 4.473   -11.693 -14.382 1.00 0.00 ? 390 PRO A HG3  3  
ATOM   3553  H  HD2  . PRO A 1 83 ? 4.591   -8.956  -15.478 1.00 0.00 ? 390 PRO A HD2  3  
ATOM   3554  H  HD3  . PRO A 1 83 ? 5.404   -9.631  -14.052 1.00 0.00 ? 390 PRO A HD3  3  
ATOM   3555  N  N    . PRO A 1 84 ? 5.616   -8.762  -18.575 1.00 0.00 ? 391 PRO A N    3  
ATOM   3556  C  CA   . PRO A 1 84 ? 5.050   -8.089  -19.762 1.00 0.00 ? 391 PRO A CA   3  
ATOM   3557  C  C    . PRO A 1 84 ? 5.282   -8.881  -21.054 1.00 0.00 ? 391 PRO A C    3  
ATOM   3558  O  O    . PRO A 1 84 ? 5.558   -10.082 -21.025 1.00 0.00 ? 391 PRO A O    3  
ATOM   3559  C  CB   . PRO A 1 84 ? 5.810   -6.756  -19.821 1.00 0.00 ? 391 PRO A CB   3  
ATOM   3560  C  CG   . PRO A 1 84 ? 7.027   -6.973  -18.994 1.00 0.00 ? 391 PRO A CG   3  
ATOM   3561  C  CD   . PRO A 1 84 ? 6.607   -7.909  -17.906 1.00 0.00 ? 391 PRO A CD   3  
ATOM   3562  H  HA   . PRO A 1 84 ? 3.993   -7.900  -19.641 1.00 0.00 ? 391 PRO A HA   3  
ATOM   3563  H  HB2  . PRO A 1 84 ? 6.064   -6.533  -20.849 1.00 0.00 ? 391 PRO A HB2  3  
ATOM   3564  H  HB3  . PRO A 1 84 ? 5.192   -5.966  -19.421 1.00 0.00 ? 391 PRO A HB3  3  
ATOM   3565  H  HG2  . PRO A 1 84 ? 7.807   -7.420  -19.592 1.00 0.00 ? 391 PRO A HG2  3  
ATOM   3566  H  HG3  . PRO A 1 84 ? 7.363   -6.036  -18.574 1.00 0.00 ? 391 PRO A HG3  3  
ATOM   3567  H  HD2  . PRO A 1 84 ? 7.448   -8.488  -17.557 1.00 0.00 ? 391 PRO A HD2  3  
ATOM   3568  H  HD3  . PRO A 1 84 ? 6.149   -7.361  -17.089 1.00 0.00 ? 391 PRO A HD3  3  
ATOM   3569  N  N    . GLY A 1 85 ? 5.174   -8.196  -22.191 1.00 0.00 ? 392 GLY A N    3  
ATOM   3570  C  CA   . GLY A 1 85 ? 5.363   -8.840  -23.482 1.00 0.00 ? 392 GLY A CA   3  
ATOM   3571  C  C    . GLY A 1 85 ? 6.712   -9.531  -23.605 1.00 0.00 ? 392 GLY A C    3  
ATOM   3572  O  O    . GLY A 1 85 ? 6.806   -10.633 -24.147 1.00 0.00 ? 392 GLY A O    3  
ATOM   3573  H  H    . GLY A 1 85 ? 4.954   -7.239  -22.157 1.00 0.00 ? 392 GLY A H    3  
ATOM   3574  H  HA2  . GLY A 1 85 ? 4.580   -9.572  -23.621 1.00 0.00 ? 392 GLY A HA2  3  
ATOM   3575  H  HA3  . GLY A 1 85 ? 5.283   -8.094  -24.257 1.00 0.00 ? 392 GLY A HA3  3  
ATOM   3576  N  N    . SER A 1 86 ? 7.755   -8.883  -23.107 1.00 0.00 ? 393 SER A N    3  
ATOM   3577  C  CA   . SER A 1 86 ? 9.095   -9.452  -23.129 1.00 0.00 ? 393 SER A CA   3  
ATOM   3578  C  C    . SER A 1 86 ? 9.878   -9.010  -21.900 1.00 0.00 ? 393 SER A C    3  
ATOM   3579  O  O    . SER A 1 86 ? 10.066  -7.815  -21.672 1.00 0.00 ? 393 SER A O    3  
ATOM   3580  C  CB   . SER A 1 86 ? 9.834   -9.032  -24.405 1.00 0.00 ? 393 SER A CB   3  
ATOM   3581  O  OG   . SER A 1 86 ? 9.114   -9.431  -25.559 1.00 0.00 ? 393 SER A OG   3  
ATOM   3582  H  H    . SER A 1 86 ? 7.622   -7.999  -22.707 1.00 0.00 ? 393 SER A H    3  
ATOM   3583  H  HA   . SER A 1 86 ? 9.000   -10.528 -23.113 1.00 0.00 ? 393 SER A HA   3  
ATOM   3584  H  HB2  . SER A 1 86 ? 9.945   -7.958  -24.418 1.00 0.00 ? 393 SER A HB2  3  
ATOM   3585  H  HB3  . SER A 1 86 ? 10.810  -9.495  -24.424 1.00 0.00 ? 393 SER A HB3  3  
ATOM   3586  H  HG   . SER A 1 86 ? 8.301   -9.876  -25.286 1.00 0.00 ? 393 SER A HG   3  
ATOM   3587  N  N    . THR A 1 87 ? 10.301  -9.974  -21.099 1.00 0.00 ? 394 THR A N    3  
ATOM   3588  C  CA   . THR A 1 87 ? 11.108  -9.688  -19.925 1.00 0.00 ? 394 THR A CA   3  
ATOM   3589  C  C    . THR A 1 87 ? 12.590  -9.658  -20.291 1.00 0.00 ? 394 THR A C    3  
ATOM   3590  O  O    . THR A 1 87 ? 13.159  -8.553  -20.402 1.00 0.00 ? 394 THR A O    3  
ATOM   3591  C  CB   . THR A 1 87 ? 10.882  -10.740 -18.826 1.00 0.00 ? 394 THR A CB   3  
ATOM   3592  O  OG1  . THR A 1 87 ? 9.476   -10.971 -18.652 1.00 0.00 ? 394 THR A OG1  3  
ATOM   3593  C  CG2  . THR A 1 87 ? 11.490  -10.282 -17.510 1.00 0.00 ? 394 THR A CG2  3  
ATOM   3594  O  OXT  . THR A 1 87 ? 13.170  -10.745 -20.490 1.00 0.00 ? 394 THR A OXT  3  
ATOM   3595  H  H    . THR A 1 87 ? 10.062  -10.900 -21.295 1.00 0.00 ? 394 THR A H    3  
ATOM   3596  H  HA   . THR A 1 87 ? 10.817  -8.721  -19.539 1.00 0.00 ? 394 THR A HA   3  
ATOM   3597  H  HB   . THR A 1 87 ? 11.358  -11.662 -19.125 1.00 0.00 ? 394 THR A HB   3  
ATOM   3598  H  HG1  . THR A 1 87 ? 9.168   -10.491 -17.867 1.00 0.00 ? 394 THR A HG1  3  
ATOM   3599  H  HG21 . THR A 1 87 ? 12.554  -10.143 -17.635 1.00 0.00 ? 394 THR A HG21 3  
ATOM   3600  H  HG22 . THR A 1 87 ? 11.310  -11.027 -16.750 1.00 0.00 ? 394 THR A HG22 3  
ATOM   3601  H  HG23 . THR A 1 87 ? 11.038  -9.347  -17.211 1.00 0.00 ? 394 THR A HG23 3  
HETATM 3602  ZN ZN   . ZN  B 2 .  ? -6.817  -1.481  -6.088  1.00 0.00 ? 401 ZN  A ZN   3  
HETATM 3603  ZN ZN   . ZN  C 2 .  ? 7.158   -1.190  -12.665 1.00 0.00 ? 402 ZN  A ZN   3  
ATOM   3604  N  N    . MET A 1 9  ? 6.129   16.870  11.962  1.00 0.00 ? 316 MET A N    4  
ATOM   3605  C  CA   . MET A 1 9  ? 5.722   15.538  11.469  1.00 0.00 ? 316 MET A CA   4  
ATOM   3606  C  C    . MET A 1 9  ? 5.189   15.658  10.052  1.00 0.00 ? 316 MET A C    4  
ATOM   3607  O  O    . MET A 1 9  ? 4.798   16.745  9.622   1.00 0.00 ? 316 MET A O    4  
ATOM   3608  C  CB   . MET A 1 9  ? 4.651   14.922  12.379  1.00 0.00 ? 316 MET A CB   4  
ATOM   3609  C  CG   . MET A 1 9  ? 5.149   14.546  13.768  1.00 0.00 ? 316 MET A CG   4  
ATOM   3610  S  SD   . MET A 1 9  ? 5.669   15.973  14.746  1.00 0.00 ? 316 MET A SD   4  
ATOM   3611  C  CE   . MET A 1 9  ? 6.169   15.175  16.271  1.00 0.00 ? 316 MET A CE   4  
ATOM   3612  H  H    . MET A 1 9  ? 6.882   17.257  11.359  1.00 0.00 ? 316 MET A H    4  
ATOM   3613  H  HA   . MET A 1 9  ? 6.591   14.900  11.459  1.00 0.00 ? 316 MET A HA   4  
ATOM   3614  H  HB2  . MET A 1 9  ? 3.845   15.629  12.493  1.00 0.00 ? 316 MET A HB2  4  
ATOM   3615  H  HB3  . MET A 1 9  ? 4.268   14.029  11.905  1.00 0.00 ? 316 MET A HB3  4  
ATOM   3616  H  HG2  . MET A 1 9  ? 4.353   14.041  14.296  1.00 0.00 ? 316 MET A HG2  4  
ATOM   3617  H  HG3  . MET A 1 9  ? 5.989   13.876  13.663  1.00 0.00 ? 316 MET A HG3  4  
ATOM   3618  H  HE1  . MET A 1 9  ? 6.521   15.921  16.968  1.00 0.00 ? 316 MET A HE1  4  
ATOM   3619  H  HE2  . MET A 1 9  ? 6.961   14.471  16.066  1.00 0.00 ? 316 MET A HE2  4  
ATOM   3620  H  HE3  . MET A 1 9  ? 5.326   14.653  16.698  1.00 0.00 ? 316 MET A HE3  4  
ATOM   3621  N  N    . ASN A 1 10 ? 5.175   14.550  9.331   1.00 0.00 ? 317 ASN A N    4  
ATOM   3622  C  CA   . ASN A 1 10 ? 4.720   14.552  7.950   1.00 0.00 ? 317 ASN A CA   4  
ATOM   3623  C  C    . ASN A 1 10 ? 3.558   13.583  7.777   1.00 0.00 ? 317 ASN A C    4  
ATOM   3624  O  O    . ASN A 1 10 ? 3.745   12.366  7.777   1.00 0.00 ? 317 ASN A O    4  
ATOM   3625  C  CB   . ASN A 1 10 ? 5.870   14.174  7.013   1.00 0.00 ? 317 ASN A CB   4  
ATOM   3626  C  CG   . ASN A 1 10 ? 5.575   14.489  5.558   1.00 0.00 ? 317 ASN A CG   4  
ATOM   3627  O  OD1  . ASN A 1 10 ? 4.430   14.461  5.110   1.00 0.00 ? 317 ASN A OD1  4  
ATOM   3628  N  ND2  . ASN A 1 10 ? 6.613   14.799  4.805   1.00 0.00 ? 317 ASN A ND2  4  
ATOM   3629  H  H    . ASN A 1 10 ? 5.475   13.705  9.735   1.00 0.00 ? 317 ASN A H    4  
ATOM   3630  H  HA   . ASN A 1 10 ? 4.381   15.550  7.712   1.00 0.00 ? 317 ASN A HA   4  
ATOM   3631  H  HB2  . ASN A 1 10 ? 6.756   14.717  7.306   1.00 0.00 ? 317 ASN A HB2  4  
ATOM   3632  H  HB3  . ASN A 1 10 ? 6.061   13.115  7.100   1.00 0.00 ? 317 ASN A HB3  4  
ATOM   3633  H  HD21 . ASN A 1 10 ? 7.501   14.807  5.220   1.00 0.00 ? 317 ASN A HD21 4  
ATOM   3634  H  HD22 . ASN A 1 10 ? 6.456   15.012  3.863   1.00 0.00 ? 317 ASN A HD22 4  
ATOM   3635  N  N    . ILE A 1 11 ? 2.358   14.131  7.655   1.00 0.00 ? 318 ILE A N    4  
ATOM   3636  C  CA   . ILE A 1 11 ? 1.160   13.325  7.483   1.00 0.00 ? 318 ILE A CA   4  
ATOM   3637  C  C    . ILE A 1 11 ? 0.514   13.637  6.137   1.00 0.00 ? 318 ILE A C    4  
ATOM   3638  O  O    . ILE A 1 11 ? 0.192   14.792  5.857   1.00 0.00 ? 318 ILE A O    4  
ATOM   3639  C  CB   . ILE A 1 11 ? 0.115   13.568  8.608   1.00 0.00 ? 318 ILE A CB   4  
ATOM   3640  C  CG1  . ILE A 1 11 ? 0.688   13.240  9.995   1.00 0.00 ? 318 ILE A CG1  4  
ATOM   3641  C  CG2  . ILE A 1 11 ? -1.143  12.745  8.361   1.00 0.00 ? 318 ILE A CG2  4  
ATOM   3642  C  CD1  . ILE A 1 11 ? 1.509   14.356  10.606  1.00 0.00 ? 318 ILE A CD1  4  
ATOM   3643  H  H    . ILE A 1 11 ? 2.274   15.110  7.668   1.00 0.00 ? 318 ILE A H    4  
ATOM   3644  H  HA   . ILE A 1 11 ? 1.448   12.286  7.505   1.00 0.00 ? 318 ILE A HA   4  
ATOM   3645  H  HB   . ILE A 1 11 ? -0.164  14.611  8.584   1.00 0.00 ? 318 ILE A HB   4  
ATOM   3646  H  HG12 . ILE A 1 11 ? -0.125  13.023  10.670  1.00 0.00 ? 318 ILE A HG12 4  
ATOM   3647  H  HG13 . ILE A 1 11 ? 1.322   12.369  9.915   1.00 0.00 ? 318 ILE A HG13 4  
ATOM   3648  H  HG21 . ILE A 1 11 ? -1.578  13.027  7.414   1.00 0.00 ? 318 ILE A HG21 4  
ATOM   3649  H  HG22 . ILE A 1 11 ? -1.854  12.929  9.153   1.00 0.00 ? 318 ILE A HG22 4  
ATOM   3650  H  HG23 . ILE A 1 11 ? -0.889  11.695  8.343   1.00 0.00 ? 318 ILE A HG23 4  
ATOM   3651  H  HD11 . ILE A 1 11 ? 1.844   14.061  11.588  1.00 0.00 ? 318 ILE A HD11 4  
ATOM   3652  H  HD12 . ILE A 1 11 ? 0.903   15.247  10.686  1.00 0.00 ? 318 ILE A HD12 4  
ATOM   3653  H  HD13 . ILE A 1 11 ? 2.365   14.558  9.978   1.00 0.00 ? 318 ILE A HD13 4  
ATOM   3654  N  N    . PRO A 1 12 ? 0.362   12.629  5.264   1.00 0.00 ? 319 PRO A N    4  
ATOM   3655  C  CA   . PRO A 1 12 ? -0.354  12.766  4.008   1.00 0.00 ? 319 PRO A CA   4  
ATOM   3656  C  C    . PRO A 1 12 ? -1.790  12.232  4.082   1.00 0.00 ? 319 PRO A C    4  
ATOM   3657  O  O    . PRO A 1 12 ? -2.045  11.077  3.741   1.00 0.00 ? 319 PRO A O    4  
ATOM   3658  C  CB   . PRO A 1 12 ? 0.496   11.907  3.072   1.00 0.00 ? 319 PRO A CB   4  
ATOM   3659  C  CG   . PRO A 1 12 ? 1.120   10.853  3.947   1.00 0.00 ? 319 PRO A CG   4  
ATOM   3660  C  CD   . PRO A 1 12 ? 0.935   11.285  5.388   1.00 0.00 ? 319 PRO A CD   4  
ATOM   3661  H  HA   . PRO A 1 12 ? -0.362  13.788  3.662   1.00 0.00 ? 319 PRO A HA   4  
ATOM   3662  H  HB2  . PRO A 1 12 ? -0.136  11.465  2.315   1.00 0.00 ? 319 PRO A HB2  4  
ATOM   3663  H  HB3  . PRO A 1 12 ? 1.251   12.523  2.601   1.00 0.00 ? 319 PRO A HB3  4  
ATOM   3664  H  HG2  . PRO A 1 12 ? 0.630   9.906   3.781   1.00 0.00 ? 319 PRO A HG2  4  
ATOM   3665  H  HG3  . PRO A 1 12 ? 2.173   10.770  3.717   1.00 0.00 ? 319 PRO A HG3  4  
ATOM   3666  H  HD2  . PRO A 1 12 ? 0.252   10.621  5.897   1.00 0.00 ? 319 PRO A HD2  4  
ATOM   3667  H  HD3  . PRO A 1 12 ? 1.886   11.316  5.896   1.00 0.00 ? 319 PRO A HD3  4  
ATOM   3668  N  N    . PRO A 1 13 ? -2.751  13.053  4.537   1.00 0.00 ? 320 PRO A N    4  
ATOM   3669  C  CA   . PRO A 1 13 ? -4.137  12.637  4.683   1.00 0.00 ? 320 PRO A CA   4  
ATOM   3670  C  C    . PRO A 1 13 ? -5.001  13.016  3.481   1.00 0.00 ? 320 PRO A C    4  
ATOM   3671  O  O    . PRO A 1 13 ? -6.181  12.681  3.424   1.00 0.00 ? 320 PRO A O    4  
ATOM   3672  C  CB   . PRO A 1 13 ? -4.567  13.416  5.922   1.00 0.00 ? 320 PRO A CB   4  
ATOM   3673  C  CG   . PRO A 1 13 ? -3.766  14.683  5.889   1.00 0.00 ? 320 PRO A CG   4  
ATOM   3674  C  CD   . PRO A 1 13 ? -2.576  14.444  4.983   1.00 0.00 ? 320 PRO A CD   4  
ATOM   3675  H  HA   . PRO A 1 13 ? -4.218  11.578  4.872   1.00 0.00 ? 320 PRO A HA   4  
ATOM   3676  H  HB2  . PRO A 1 13 ? -5.626  13.620  5.869   1.00 0.00 ? 320 PRO A HB2  4  
ATOM   3677  H  HB3  . PRO A 1 13 ? -4.351  12.837  6.808   1.00 0.00 ? 320 PRO A HB3  4  
ATOM   3678  H  HG2  . PRO A 1 13 ? -4.373  15.485  5.497   1.00 0.00 ? 320 PRO A HG2  4  
ATOM   3679  H  HG3  . PRO A 1 13 ? -3.430  14.926  6.886   1.00 0.00 ? 320 PRO A HG3  4  
ATOM   3680  H  HD2  . PRO A 1 13 ? -2.604  15.123  4.138   1.00 0.00 ? 320 PRO A HD2  4  
ATOM   3681  H  HD3  . PRO A 1 13 ? -1.651  14.558  5.539   1.00 0.00 ? 320 PRO A HD3  4  
ATOM   3682  N  N    . ALA A 1 14 ? -4.402  13.702  2.519   1.00 0.00 ? 321 ALA A N    4  
ATOM   3683  C  CA   . ALA A 1 14 ? -5.115  14.171  1.344   1.00 0.00 ? 321 ALA A CA   4  
ATOM   3684  C  C    . ALA A 1 14 ? -4.114  14.367  0.230   1.00 0.00 ? 321 ALA A C    4  
ATOM   3685  O  O    . ALA A 1 14 ? -4.308  15.167  -0.682  1.00 0.00 ? 321 ALA A O    4  
ATOM   3686  C  CB   . ALA A 1 14 ? -5.844  15.473  1.650   1.00 0.00 ? 321 ALA A CB   4  
ATOM   3687  H  H    . ALA A 1 14 ? -3.441  13.888  2.588   1.00 0.00 ? 321 ALA A H    4  
ATOM   3688  H  HA   . ALA A 1 14 ? -5.837  13.422  1.055   1.00 0.00 ? 321 ALA A HA   4  
ATOM   3689  H  HB1  . ALA A 1 14 ? -6.355  15.817  0.764   1.00 0.00 ? 321 ALA A HB1  4  
ATOM   3690  H  HB2  . ALA A 1 14 ? -5.130  16.220  1.966   1.00 0.00 ? 321 ALA A HB2  4  
ATOM   3691  H  HB3  . ALA A 1 14 ? -6.563  15.307  2.439   1.00 0.00 ? 321 ALA A HB3  4  
ATOM   3692  N  N    . ARG A 1 15 ? -3.036  13.603  0.314   1.00 0.00 ? 322 ARG A N    4  
ATOM   3693  C  CA   . ARG A 1 15 ? -1.926  13.762  -0.597  1.00 0.00 ? 322 ARG A CA   4  
ATOM   3694  C  C    . ARG A 1 15 ? -1.940  12.633  -1.620  1.00 0.00 ? 322 ARG A C    4  
ATOM   3695  O  O    . ARG A 1 15 ? -0.938  12.353  -2.279  1.00 0.00 ? 322 ARG A O    4  
ATOM   3696  C  CB   . ARG A 1 15 ? -0.605  13.784  0.180   1.00 0.00 ? 322 ARG A CB   4  
ATOM   3697  C  CG   . ARG A 1 15 ? 0.545   14.444  -0.575  1.00 0.00 ? 322 ARG A CG   4  
ATOM   3698  C  CD   . ARG A 1 15 ? 1.829   14.441  0.244   1.00 0.00 ? 322 ARG A CD   4  
ATOM   3699  N  NE   . ARG A 1 15 ? 1.662   15.105  1.541   1.00 0.00 ? 322 ARG A NE   4  
ATOM   3700  C  CZ   . ARG A 1 15 ? 2.502   14.952  2.568   1.00 0.00 ? 322 ARG A CZ   4  
ATOM   3701  N  NH1  . ARG A 1 15 ? 3.591   14.207  2.437   1.00 0.00 ? 322 ARG A NH1  4  
ATOM   3702  N  NH2  . ARG A 1 15 ? 2.265   15.554  3.727   1.00 0.00 ? 322 ARG A NH2  4  
ATOM   3703  H  H    . ARG A 1 15 ? -3.008  12.888  0.987   1.00 0.00 ? 322 ARG A H    4  
ATOM   3704  H  HA   . ARG A 1 15 ? -2.056  14.700  -1.102  1.00 0.00 ? 322 ARG A HA   4  
ATOM   3705  H  HB2  . ARG A 1 15 ? -0.754  14.321  1.104   1.00 0.00 ? 322 ARG A HB2  4  
ATOM   3706  H  HB3  . ARG A 1 15 ? -0.320  12.767  0.408   1.00 0.00 ? 322 ARG A HB3  4  
ATOM   3707  H  HG2  . ARG A 1 15 ? 0.715   13.907  -1.494  1.00 0.00 ? 322 ARG A HG2  4  
ATOM   3708  H  HG3  . ARG A 1 15 ? 0.273   15.466  -0.799  1.00 0.00 ? 322 ARG A HG3  4  
ATOM   3709  H  HD2  . ARG A 1 15 ? 2.132   13.420  0.411   1.00 0.00 ? 322 ARG A HD2  4  
ATOM   3710  H  HD3  . ARG A 1 15 ? 2.597   14.957  -0.317  1.00 0.00 ? 322 ARG A HD3  4  
ATOM   3711  H  HE   . ARG A 1 15 ? 0.877   15.684  1.651   1.00 0.00 ? 322 ARG A HE   4  
ATOM   3712  H  HH11 . ARG A 1 15 ? 3.792   13.751  1.564   1.00 0.00 ? 322 ARG A HH11 4  
ATOM   3713  H  HH12 . ARG A 1 15 ? 4.220   14.096  3.214   1.00 0.00 ? 322 ARG A HH12 4  
ATOM   3714  H  HH21 . ARG A 1 15 ? 1.455   16.128  3.846   1.00 0.00 ? 322 ARG A HH21 4  
ATOM   3715  H  HH22 . ARG A 1 15 ? 2.903   15.431  4.498   1.00 0.00 ? 322 ARG A HH22 4  
ATOM   3716  N  N    . TRP A 1 16 ? -3.097  11.996  -1.743  1.00 0.00 ? 323 TRP A N    4  
ATOM   3717  C  CA   . TRP A 1 16 ? -3.282  10.898  -2.677  1.00 0.00 ? 323 TRP A CA   4  
ATOM   3718  C  C    . TRP A 1 16 ? -3.292  11.390  -4.125  1.00 0.00 ? 323 TRP A C    4  
ATOM   3719  O  O    . TRP A 1 16 ? -4.338  11.631  -4.719  1.00 0.00 ? 323 TRP A O    4  
ATOM   3720  C  CB   . TRP A 1 16 ? -4.564  10.113  -2.352  1.00 0.00 ? 323 TRP A CB   4  
ATOM   3721  C  CG   . TRP A 1 16 ? -5.770  10.961  -2.018  1.00 0.00 ? 323 TRP A CG   4  
ATOM   3722  C  CD1  . TRP A 1 16 ? -6.018  12.254  -2.399  1.00 0.00 ? 323 TRP A CD1  4  
ATOM   3723  C  CD2  . TRP A 1 16 ? -6.905  10.553  -1.242  1.00 0.00 ? 323 TRP A CD2  4  
ATOM   3724  N  NE1  . TRP A 1 16 ? -7.228  12.672  -1.900  1.00 0.00 ? 323 TRP A NE1  4  
ATOM   3725  C  CE2  . TRP A 1 16 ? -7.793  11.646  -1.189  1.00 0.00 ? 323 TRP A CE2  4  
ATOM   3726  C  CE3  . TRP A 1 16 ? -7.256  9.369   -0.588  1.00 0.00 ? 323 TRP A CE3  4  
ATOM   3727  C  CZ2  . TRP A 1 16 ? -9.008  11.586  -0.508  1.00 0.00 ? 323 TRP A CZ2  4  
ATOM   3728  C  CZ3  . TRP A 1 16 ? -8.460  9.312   0.088   1.00 0.00 ? 323 TRP A CZ3  4  
ATOM   3729  C  CH2  . TRP A 1 16 ? -9.323  10.415  0.124   1.00 0.00 ? 323 TRP A CH2  4  
ATOM   3730  H  H    . TRP A 1 16 ? -3.853  12.277  -1.188  1.00 0.00 ? 323 TRP A H    4  
ATOM   3731  H  HA   . TRP A 1 16 ? -2.439  10.234  -2.558  1.00 0.00 ? 323 TRP A HA   4  
ATOM   3732  H  HB2  . TRP A 1 16 ? -4.822  9.502   -3.204  1.00 0.00 ? 323 TRP A HB2  4  
ATOM   3733  H  HB3  . TRP A 1 16 ? -4.370  9.468   -1.507  1.00 0.00 ? 323 TRP A HB3  4  
ATOM   3734  H  HD1  . TRP A 1 16 ? -5.347  12.851  -2.998  1.00 0.00 ? 323 TRP A HD1  4  
ATOM   3735  H  HE1  . TRP A 1 16 ? -7.623  13.561  -2.037  1.00 0.00 ? 323 TRP A HE1  4  
ATOM   3736  H  HE3  . TRP A 1 16 ? -6.603  8.510   -0.602  1.00 0.00 ? 323 TRP A HE3  4  
ATOM   3737  H  HZ2  . TRP A 1 16 ? -9.683  12.428  -0.469  1.00 0.00 ? 323 TRP A HZ2  4  
ATOM   3738  H  HZ3  . TRP A 1 16 ? -8.748  8.404   0.599   1.00 0.00 ? 323 TRP A HZ3  4  
ATOM   3739  H  HH2  . TRP A 1 16 ? -10.255 10.323  0.664   1.00 0.00 ? 323 TRP A HH2  4  
ATOM   3740  N  N    . LYS A 1 17 ? -2.108  11.565  -4.675  1.00 0.00 ? 324 LYS A N    4  
ATOM   3741  C  CA   . LYS A 1 17 ? -1.958  11.979  -6.063  1.00 0.00 ? 324 LYS A CA   4  
ATOM   3742  C  C    . LYS A 1 17 ? -1.584  10.783  -6.929  1.00 0.00 ? 324 LYS A C    4  
ATOM   3743  O  O    . LYS A 1 17 ? -1.054  10.932  -8.030  1.00 0.00 ? 324 LYS A O    4  
ATOM   3744  C  CB   . LYS A 1 17 ? -0.890  13.063  -6.160  1.00 0.00 ? 324 LYS A CB   4  
ATOM   3745  C  CG   . LYS A 1 17 ? -1.203  14.282  -5.306  1.00 0.00 ? 324 LYS A CG   4  
ATOM   3746  C  CD   . LYS A 1 17 ? -0.015  15.225  -5.218  1.00 0.00 ? 324 LYS A CD   4  
ATOM   3747  C  CE   . LYS A 1 17 ? 0.325   15.838  -6.566  1.00 0.00 ? 324 LYS A CE   4  
ATOM   3748  N  NZ   . LYS A 1 17 ? 1.598   16.596  -6.516  1.00 0.00 ? 324 LYS A NZ   4  
ATOM   3749  H  H    . LYS A 1 17 ? -1.305  11.442  -4.122  1.00 0.00 ? 324 LYS A H    4  
ATOM   3750  H  HA   . LYS A 1 17 ? -2.905  12.377  -6.399  1.00 0.00 ? 324 LYS A HA   4  
ATOM   3751  H  HB2  . LYS A 1 17 ? 0.060   12.648  -5.830  1.00 0.00 ? 324 LYS A HB2  4  
ATOM   3752  H  HB3  . LYS A 1 17 ? -0.810  13.383  -7.197  1.00 0.00 ? 324 LYS A HB3  4  
ATOM   3753  H  HG2  . LYS A 1 17 ? -2.037  14.809  -5.740  1.00 0.00 ? 324 LYS A HG2  4  
ATOM   3754  H  HG3  . LYS A 1 17 ? -1.463  13.950  -4.310  1.00 0.00 ? 324 LYS A HG3  4  
ATOM   3755  H  HD2  . LYS A 1 17 ? -0.251  16.017  -4.526  1.00 0.00 ? 324 LYS A HD2  4  
ATOM   3756  H  HD3  . LYS A 1 17 ? 0.842   14.674  -4.857  1.00 0.00 ? 324 LYS A HD3  4  
ATOM   3757  H  HE2  . LYS A 1 17 ? 0.416   15.048  -7.295  1.00 0.00 ? 324 LYS A HE2  4  
ATOM   3758  H  HE3  . LYS A 1 17 ? -0.472  16.505  -6.856  1.00 0.00 ? 324 LYS A HE3  4  
ATOM   3759  H  HZ1  . LYS A 1 17 ? 1.556   17.319  -5.769  1.00 0.00 ? 324 LYS A HZ1  4  
ATOM   3760  H  HZ2  . LYS A 1 17 ? 1.773   17.064  -7.427  1.00 0.00 ? 324 LYS A HZ2  4  
ATOM   3761  H  HZ3  . LYS A 1 17 ? 2.389   15.953  -6.316  1.00 0.00 ? 324 LYS A HZ3  4  
ATOM   3762  N  N    . LEU A 1 18 ? -1.880  9.595   -6.422  1.00 0.00 ? 325 LEU A N    4  
ATOM   3763  C  CA   . LEU A 1 18 ? -1.545  8.357   -7.105  1.00 0.00 ? 325 LEU A CA   4  
ATOM   3764  C  C    . LEU A 1 18 ? -2.772  7.454   -7.193  1.00 0.00 ? 325 LEU A C    4  
ATOM   3765  O  O    . LEU A 1 18 ? -3.531  7.331   -6.231  1.00 0.00 ? 325 LEU A O    4  
ATOM   3766  C  CB   . LEU A 1 18 ? -0.380  7.631   -6.403  1.00 0.00 ? 325 LEU A CB   4  
ATOM   3767  C  CG   . LEU A 1 18 ? -0.492  7.471   -4.876  1.00 0.00 ? 325 LEU A CG   4  
ATOM   3768  C  CD1  . LEU A 1 18 ? 0.397   6.336   -4.396  1.00 0.00 ? 325 LEU A CD1  4  
ATOM   3769  C  CD2  . LEU A 1 18 ? -0.093  8.755   -4.163  1.00 0.00 ? 325 LEU A CD2  4  
ATOM   3770  H  H    . LEU A 1 18 ? -2.353  9.550   -5.565  1.00 0.00 ? 325 LEU A H    4  
ATOM   3771  H  HA   . LEU A 1 18 ? -1.238  8.614   -8.109  1.00 0.00 ? 325 LEU A HA   4  
ATOM   3772  H  HB2  . LEU A 1 18 ? -0.301  6.635   -6.835  1.00 0.00 ? 325 LEU A HB2  4  
ATOM   3773  H  HB3  . LEU A 1 18 ? 0.537   8.184   -6.616  1.00 0.00 ? 325 LEU A HB3  4  
ATOM   3774  H  HG   . LEU A 1 18 ? -1.513  7.238   -4.613  1.00 0.00 ? 325 LEU A HG   4  
ATOM   3775  H  HD11 . LEU A 1 18 ? 0.031   5.401   -4.788  1.00 0.00 ? 325 LEU A HD11 4  
ATOM   3776  H  HD12 . LEU A 1 18 ? 0.385   6.304   -3.317  1.00 0.00 ? 325 LEU A HD12 4  
ATOM   3777  H  HD13 . LEU A 1 18 ? 1.408   6.500   -4.739  1.00 0.00 ? 325 LEU A HD13 4  
ATOM   3778  H  HD21 . LEU A 1 18 ? -0.153  8.607   -3.096  1.00 0.00 ? 325 LEU A HD21 4  
ATOM   3779  H  HD22 . LEU A 1 18 ? -0.759  9.551   -4.456  1.00 0.00 ? 325 LEU A HD22 4  
ATOM   3780  H  HD23 . LEU A 1 18 ? 0.920   9.015   -4.434  1.00 0.00 ? 325 LEU A HD23 4  
ATOM   3781  N  N    . THR A 1 19 ? -2.964  6.837   -8.351  1.00 0.00 ? 326 THR A N    4  
ATOM   3782  C  CA   . THR A 1 19 ? -4.141  6.019   -8.605  1.00 0.00 ? 326 THR A CA   4  
ATOM   3783  C  C    . THR A 1 19 ? -3.770  4.534   -8.729  1.00 0.00 ? 326 THR A C    4  
ATOM   3784  O  O    . THR A 1 19 ? -2.729  4.186   -9.284  1.00 0.00 ? 326 THR A O    4  
ATOM   3785  C  CB   . THR A 1 19 ? -4.856  6.488   -9.894  1.00 0.00 ? 326 THR A CB   4  
ATOM   3786  O  OG1  . THR A 1 19 ? -5.155  7.892   -9.804  1.00 0.00 ? 326 THR A OG1  4  
ATOM   3787  C  CG2  . THR A 1 19 ? -6.144  5.709   -10.131 1.00 0.00 ? 326 THR A CG2  4  
ATOM   3788  H  H    . THR A 1 19 ? -2.291  6.931   -9.059  1.00 0.00 ? 326 THR A H    4  
ATOM   3789  H  HA   . THR A 1 19 ? -4.820  6.144   -7.776  1.00 0.00 ? 326 THR A HA   4  
ATOM   3790  H  HB   . THR A 1 19 ? -4.194  6.324   -10.732 1.00 0.00 ? 326 THR A HB   4  
ATOM   3791  H  HG1  . THR A 1 19 ? -5.724  8.146   -10.542 1.00 0.00 ? 326 THR A HG1  4  
ATOM   3792  H  HG21 . THR A 1 19 ? -6.821  5.869   -9.304  1.00 0.00 ? 326 THR A HG21 4  
ATOM   3793  H  HG22 . THR A 1 19 ? -5.916  4.656   -10.210 1.00 0.00 ? 326 THR A HG22 4  
ATOM   3794  H  HG23 . THR A 1 19 ? -6.607  6.046   -11.047 1.00 0.00 ? 326 THR A HG23 4  
ATOM   3795  N  N    . CYS A 1 20 ? -4.626  3.669   -8.197  1.00 0.00 ? 327 CYS A N    4  
ATOM   3796  C  CA   . CYS A 1 20 ? -4.411  2.227   -8.250  1.00 0.00 ? 327 CYS A CA   4  
ATOM   3797  C  C    . CYS A 1 20 ? -4.959  1.658   -9.561  1.00 0.00 ? 327 CYS A C    4  
ATOM   3798  O  O    . CYS A 1 20 ? -6.174  1.634   -9.776  1.00 0.00 ? 327 CYS A O    4  
ATOM   3799  C  CB   . CYS A 1 20 ? -5.099  1.580   -7.047  1.00 0.00 ? 327 CYS A CB   4  
ATOM   3800  S  SG   . CYS A 1 20 ? -4.871  -0.209  -6.866  1.00 0.00 ? 327 CYS A SG   4  
ATOM   3801  H  H    . CYS A 1 20 ? -5.431  4.012   -7.757  1.00 0.00 ? 327 CYS A H    4  
ATOM   3802  H  HA   . CYS A 1 20 ? -3.347  2.042   -8.198  1.00 0.00 ? 327 CYS A HA   4  
ATOM   3803  H  HB2  . CYS A 1 20 ? -4.726  2.042   -6.145  1.00 0.00 ? 327 CYS A HB2  4  
ATOM   3804  H  HB3  . CYS A 1 20 ? -6.161  1.767   -7.117  1.00 0.00 ? 327 CYS A HB3  4  
ATOM   3805  N  N    . TYR A 1 21 ? -4.062  1.190   -10.426 1.00 0.00 ? 328 TYR A N    4  
ATOM   3806  C  CA   . TYR A 1 21 ? -4.427  0.772   -11.784 1.00 0.00 ? 328 TYR A CA   4  
ATOM   3807  C  C    . TYR A 1 21 ? -5.212  -0.544  -11.819 1.00 0.00 ? 328 TYR A C    4  
ATOM   3808  O  O    . TYR A 1 21 ? -5.742  -0.919  -12.861 1.00 0.00 ? 328 TYR A O    4  
ATOM   3809  C  CB   . TYR A 1 21 ? -3.171  0.661   -12.665 1.00 0.00 ? 328 TYR A CB   4  
ATOM   3810  C  CG   . TYR A 1 21 ? -2.169  -0.389  -12.219 1.00 0.00 ? 328 TYR A CG   4  
ATOM   3811  C  CD1  . TYR A 1 21 ? -1.268  -0.130  -11.193 1.00 0.00 ? 328 TYR A CD1  4  
ATOM   3812  C  CD2  . TYR A 1 21 ? -2.113  -1.634  -12.837 1.00 0.00 ? 328 TYR A CD2  4  
ATOM   3813  C  CE1  . TYR A 1 21 ? -0.348  -1.082  -10.792 1.00 0.00 ? 328 TYR A CE1  4  
ATOM   3814  C  CE2  . TYR A 1 21 ? -1.195  -2.591  -12.439 1.00 0.00 ? 328 TYR A CE2  4  
ATOM   3815  C  CZ   . TYR A 1 21 ? -0.313  -2.307  -11.417 1.00 0.00 ? 328 TYR A CZ   4  
ATOM   3816  O  OH   . TYR A 1 21 ? 0.600   -3.255  -11.010 1.00 0.00 ? 328 TYR A OH   4  
ATOM   3817  H  H    . TYR A 1 21 ? -3.119  1.142   -10.154 1.00 0.00 ? 328 TYR A H    4  
ATOM   3818  H  HA   . TYR A 1 21 ? -5.057  1.547   -12.194 1.00 0.00 ? 328 TYR A HA   4  
ATOM   3819  H  HB2  . TYR A 1 21 ? -3.471  0.416   -13.672 1.00 0.00 ? 328 TYR A HB2  4  
ATOM   3820  H  HB3  . TYR A 1 21 ? -2.666  1.617   -12.673 1.00 0.00 ? 328 TYR A HB3  4  
ATOM   3821  H  HD1  . TYR A 1 21 ? -1.296  0.830   -10.700 1.00 0.00 ? 328 TYR A HD1  4  
ATOM   3822  H  HD2  . TYR A 1 21 ? -2.803  -1.853  -13.637 1.00 0.00 ? 328 TYR A HD2  4  
ATOM   3823  H  HE1  . TYR A 1 21 ? 0.342   -0.858  -9.993  1.00 0.00 ? 328 TYR A HE1  4  
ATOM   3824  H  HE2  . TYR A 1 21 ? -1.171  -3.553  -12.930 1.00 0.00 ? 328 TYR A HE2  4  
ATOM   3825  H  HH   . TYR A 1 21 ? 0.547   -3.356  -10.054 1.00 0.00 ? 328 TYR A HH   4  
ATOM   3826  N  N    . LEU A 1 22 ? -5.308  -1.235  -10.690 1.00 0.00 ? 329 LEU A N    4  
ATOM   3827  C  CA   . LEU A 1 22 ? -6.009  -2.521  -10.653 1.00 0.00 ? 329 LEU A CA   4  
ATOM   3828  C  C    . LEU A 1 22 ? -7.500  -2.342  -10.378 1.00 0.00 ? 329 LEU A C    4  
ATOM   3829  O  O    . LEU A 1 22 ? -8.192  -3.311  -10.070 1.00 0.00 ? 329 LEU A O    4  
ATOM   3830  C  CB   . LEU A 1 22 ? -5.421  -3.456  -9.587  1.00 0.00 ? 329 LEU A CB   4  
ATOM   3831  C  CG   . LEU A 1 22 ? -3.975  -3.901  -9.811  1.00 0.00 ? 329 LEU A CG   4  
ATOM   3832  C  CD1  . LEU A 1 22 ? -3.007  -2.866  -9.275  1.00 0.00 ? 329 LEU A CD1  4  
ATOM   3833  C  CD2  . LEU A 1 22 ? -3.724  -5.253  -9.159  1.00 0.00 ? 329 LEU A CD2  4  
ATOM   3834  H  H    . LEU A 1 22 ? -4.899  -0.883  -9.877  1.00 0.00 ? 329 LEU A H    4  
ATOM   3835  H  HA   . LEU A 1 22 ? -5.893  -2.984  -11.621 1.00 0.00 ? 329 LEU A HA   4  
ATOM   3836  H  HB2  . LEU A 1 22 ? -5.473  -2.953  -8.633  1.00 0.00 ? 329 LEU A HB2  4  
ATOM   3837  H  HB3  . LEU A 1 22 ? -6.041  -4.340  -9.539  1.00 0.00 ? 329 LEU A HB3  4  
ATOM   3838  H  HG   . LEU A 1 22 ? -3.797  -4.004  -10.871 1.00 0.00 ? 329 LEU A HG   4  
ATOM   3839  H  HD11 . LEU A 1 22 ? -1.994  -3.211  -9.422  1.00 0.00 ? 329 LEU A HD11 4  
ATOM   3840  H  HD12 . LEU A 1 22 ? -3.188  -2.714  -8.222  1.00 0.00 ? 329 LEU A HD12 4  
ATOM   3841  H  HD13 . LEU A 1 22 ? -3.149  -1.935  -9.803  1.00 0.00 ? 329 LEU A HD13 4  
ATOM   3842  H  HD21 . LEU A 1 22 ? -4.392  -5.986  -9.587  1.00 0.00 ? 329 LEU A HD21 4  
ATOM   3843  H  HD22 . LEU A 1 22 ? -3.900  -5.180  -8.097  1.00 0.00 ? 329 LEU A HD22 4  
ATOM   3844  H  HD23 . LEU A 1 22 ? -2.702  -5.552  -9.336  1.00 0.00 ? 329 LEU A HD23 4  
ATOM   3845  N  N    . CYS A 1 23 ? -7.995  -1.113  -10.493 1.00 0.00 ? 330 CYS A N    4  
ATOM   3846  C  CA   . CYS A 1 23 ? -9.396  -0.830  -10.168 1.00 0.00 ? 330 CYS A CA   4  
ATOM   3847  C  C    . CYS A 1 23 ? -9.824  0.604   -10.519 1.00 0.00 ? 330 CYS A C    4  
ATOM   3848  O  O    . CYS A 1 23 ? -11.020 0.894   -10.538 1.00 0.00 ? 330 CYS A O    4  
ATOM   3849  C  CB   . CYS A 1 23 ? -9.658  -1.103  -8.682  1.00 0.00 ? 330 CYS A CB   4  
ATOM   3850  S  SG   . CYS A 1 23 ? -8.349  -0.505  -7.580  1.00 0.00 ? 330 CYS A SG   4  
ATOM   3851  H  H    . CYS A 1 23 ? -7.419  -0.401  -10.829 1.00 0.00 ? 330 CYS A H    4  
ATOM   3852  H  HA   . CYS A 1 23 ? -10.001 -1.510  -10.749 1.00 0.00 ? 330 CYS A HA   4  
ATOM   3853  H  HB2  . CYS A 1 23 ? -10.579 -0.620  -8.392  1.00 0.00 ? 330 CYS A HB2  4  
ATOM   3854  H  HB3  . CYS A 1 23 ? -9.754  -2.168  -8.530  1.00 0.00 ? 330 CYS A HB3  4  
ATOM   3855  N  N    . LYS A 1 24 ? -8.859  1.509   -10.732 1.00 0.00 ? 331 LYS A N    4  
ATOM   3856  C  CA   . LYS A 1 24 ? -9.153  2.871   -11.178 1.00 0.00 ? 331 LYS A CA   4  
ATOM   3857  C  C    . LYS A 1 24 ? -9.779  3.662   -10.045 1.00 0.00 ? 331 LYS A C    4  
ATOM   3858  O  O    . LYS A 1 24 ? -10.592 4.556   -10.261 1.00 0.00 ? 331 LYS A O    4  
ATOM   3859  C  CB   . LYS A 1 24 ? -10.065 2.885   -12.412 1.00 0.00 ? 331 LYS A CB   4  
ATOM   3860  C  CG   . LYS A 1 24 ? -9.376  2.426   -13.686 1.00 0.00 ? 331 LYS A CG   4  
ATOM   3861  C  CD   . LYS A 1 24 ? -10.326 2.460   -14.873 1.00 0.00 ? 331 LYS A CD   4  
ATOM   3862  C  CE   . LYS A 1 24 ? -9.630  2.056   -16.162 1.00 0.00 ? 331 LYS A CE   4  
ATOM   3863  N  NZ   . LYS A 1 24 ? -8.571  3.023   -16.555 1.00 0.00 ? 331 LYS A NZ   4  
ATOM   3864  H  H    . LYS A 1 24 ? -7.937  1.283   -10.525 1.00 0.00 ? 331 LYS A H    4  
ATOM   3865  H  HA   . LYS A 1 24 ? -8.212  3.337   -11.436 1.00 0.00 ? 331 LYS A HA   4  
ATOM   3866  H  HB2  . LYS A 1 24 ? -10.907 2.233   -12.229 1.00 0.00 ? 331 LYS A HB2  4  
ATOM   3867  H  HB3  . LYS A 1 24 ? -10.428 3.890   -12.566 1.00 0.00 ? 331 LYS A HB3  4  
ATOM   3868  H  HG2  . LYS A 1 24 ? -8.541  3.083   -13.888 1.00 0.00 ? 331 LYS A HG2  4  
ATOM   3869  H  HG3  . LYS A 1 24 ? -9.019  1.417   -13.549 1.00 0.00 ? 331 LYS A HG3  4  
ATOM   3870  H  HD2  . LYS A 1 24 ? -11.141 1.778   -14.688 1.00 0.00 ? 331 LYS A HD2  4  
ATOM   3871  H  HD3  . LYS A 1 24 ? -10.713 3.464   -14.984 1.00 0.00 ? 331 LYS A HD3  4  
ATOM   3872  H  HE2  . LYS A 1 24 ? -9.180  1.085   -16.021 1.00 0.00 ? 331 LYS A HE2  4  
ATOM   3873  H  HE3  . LYS A 1 24 ? -10.366 2.000   -16.951 1.00 0.00 ? 331 LYS A HE3  4  
ATOM   3874  H  HZ1  . LYS A 1 24 ? -7.847  3.091   -15.811 1.00 0.00 ? 331 LYS A HZ1  4  
ATOM   3875  H  HZ2  . LYS A 1 24 ? -8.982  3.968   -16.710 1.00 0.00 ? 331 LYS A HZ2  4  
ATOM   3876  H  HZ3  . LYS A 1 24 ? -8.114  2.714   -17.433 1.00 0.00 ? 331 LYS A HZ3  4  
ATOM   3877  N  N    . GLN A 1 25 ? -9.382  3.321   -8.834  1.00 0.00 ? 332 GLN A N    4  
ATOM   3878  C  CA   . GLN A 1 25 ? -9.804  4.029   -7.668  1.00 0.00 ? 332 GLN A CA   4  
ATOM   3879  C  C    . GLN A 1 25 ? -8.571  4.491   -6.909  1.00 0.00 ? 332 GLN A C    4  
ATOM   3880  O  O    . GLN A 1 25 ? -7.734  3.688   -6.485  1.00 0.00 ? 332 GLN A O    4  
ATOM   3881  C  CB   . GLN A 1 25 ? -10.706 3.166   -6.788  1.00 0.00 ? 332 GLN A CB   4  
ATOM   3882  C  CG   . GLN A 1 25 ? -10.066 1.864   -6.355  1.00 0.00 ? 332 GLN A CG   4  
ATOM   3883  C  CD   . GLN A 1 25 ? -10.772 1.203   -5.193  1.00 0.00 ? 332 GLN A CD   4  
ATOM   3884  O  OE1  . GLN A 1 25 ? -10.136 0.536   -4.378  1.00 0.00 ? 332 GLN A OE1  4  
ATOM   3885  N  NE2  . GLN A 1 25 ? -12.079 1.373   -5.110  1.00 0.00 ? 332 GLN A NE2  4  
ATOM   3886  H  H    . GLN A 1 25 ? -8.771  2.589   -8.726  1.00 0.00 ? 332 GLN A H    4  
ATOM   3887  H  HA   . GLN A 1 25 ? -10.352 4.889   -8.003  1.00 0.00 ? 332 GLN A HA   4  
ATOM   3888  H  HB2  . GLN A 1 25 ? -10.972 3.723   -5.903  1.00 0.00 ? 332 GLN A HB2  4  
ATOM   3889  H  HB3  . GLN A 1 25 ? -11.603 2.932   -7.341  1.00 0.00 ? 332 GLN A HB3  4  
ATOM   3890  H  HG2  . GLN A 1 25 ? -10.075 1.181   -7.192  1.00 0.00 ? 332 GLN A HG2  4  
ATOM   3891  H  HG3  . GLN A 1 25 ? -9.046  2.062   -6.072  1.00 0.00 ? 332 GLN A HG3  4  
ATOM   3892  H  HE21 . GLN A 1 25 ? -12.523 1.913   -5.802  1.00 0.00 ? 332 GLN A HE21 4  
ATOM   3893  H  HE22 . GLN A 1 25 ? -12.555 0.950   -4.366  1.00 0.00 ? 332 GLN A HE22 4  
ATOM   3894  N  N    . LYS A 1 26 ? -8.450  5.790   -6.830  1.00 0.00 ? 333 LYS A N    4  
ATOM   3895  C  CA   . LYS A 1 26 ? -7.326  6.464   -6.186  1.00 0.00 ? 333 LYS A CA   4  
ATOM   3896  C  C    . LYS A 1 26 ? -7.058  5.964   -4.757  1.00 0.00 ? 333 LYS A C    4  
ATOM   3897  O  O    . LYS A 1 26 ? -6.187  5.115   -4.541  1.00 0.00 ? 333 LYS A O    4  
ATOM   3898  C  CB   . LYS A 1 26 ? -7.584  7.974   -6.187  1.00 0.00 ? 333 LYS A CB   4  
ATOM   3899  C  CG   . LYS A 1 26 ? -6.508  8.798   -5.503  1.00 0.00 ? 333 LYS A CG   4  
ATOM   3900  C  CD   . LYS A 1 26 ? -6.905  10.264  -5.425  1.00 0.00 ? 333 LYS A CD   4  
ATOM   3901  C  CE   . LYS A 1 26 ? -6.960  10.913  -6.800  1.00 0.00 ? 333 LYS A CE   4  
ATOM   3902  N  NZ   . LYS A 1 26 ? -7.334  12.350  -6.717  1.00 0.00 ? 333 LYS A NZ   4  
ATOM   3903  H  H    . LYS A 1 26 ? -9.138  6.331   -7.262  1.00 0.00 ? 333 LYS A H    4  
ATOM   3904  H  HA   . LYS A 1 26 ? -6.448  6.271   -6.781  1.00 0.00 ? 333 LYS A HA   4  
ATOM   3905  H  HB2  . LYS A 1 26 ? -7.659  8.307   -7.210  1.00 0.00 ? 333 LYS A HB2  4  
ATOM   3906  H  HB3  . LYS A 1 26 ? -8.523  8.165   -5.688  1.00 0.00 ? 333 LYS A HB3  4  
ATOM   3907  H  HG2  . LYS A 1 26 ? -6.361  8.421   -4.503  1.00 0.00 ? 333 LYS A HG2  4  
ATOM   3908  H  HG3  . LYS A 1 26 ? -5.588  8.711   -6.063  1.00 0.00 ? 333 LYS A HG3  4  
ATOM   3909  H  HD2  . LYS A 1 26 ? -7.880  10.336  -4.969  1.00 0.00 ? 333 LYS A HD2  4  
ATOM   3910  H  HD3  . LYS A 1 26 ? -6.183  10.790  -4.818  1.00 0.00 ? 333 LYS A HD3  4  
ATOM   3911  H  HE2  . LYS A 1 26 ? -5.990  10.829  -7.264  1.00 0.00 ? 333 LYS A HE2  4  
ATOM   3912  H  HE3  . LYS A 1 26 ? -7.694  10.395  -7.399  1.00 0.00 ? 333 LYS A HE3  4  
ATOM   3913  H  HZ1  . LYS A 1 26 ? -7.283  12.791  -7.656  1.00 0.00 ? 333 LYS A HZ1  4  
ATOM   3914  H  HZ2  . LYS A 1 26 ? -6.686  12.854  -6.075  1.00 0.00 ? 333 LYS A HZ2  4  
ATOM   3915  H  HZ3  . LYS A 1 26 ? -8.302  12.447  -6.353  1.00 0.00 ? 333 LYS A HZ3  4  
ATOM   3916  N  N    . GLY A 1 27 ? -7.815  6.463   -3.787  1.00 0.00 ? 334 GLY A N    4  
ATOM   3917  C  CA   . GLY A 1 27 ? -7.488  6.195   -2.401  1.00 0.00 ? 334 GLY A CA   4  
ATOM   3918  C  C    . GLY A 1 27 ? -8.643  5.638   -1.602  1.00 0.00 ? 334 GLY A C    4  
ATOM   3919  O  O    . GLY A 1 27 ? -9.679  6.285   -1.452  1.00 0.00 ? 334 GLY A O    4  
ATOM   3920  H  H    . GLY A 1 27 ? -8.598  7.010   -4.011  1.00 0.00 ? 334 GLY A H    4  
ATOM   3921  H  HA2  . GLY A 1 27 ? -6.675  5.486   -2.370  1.00 0.00 ? 334 GLY A HA2  4  
ATOM   3922  H  HA3  . GLY A 1 27 ? -7.160  7.116   -1.943  1.00 0.00 ? 334 GLY A HA3  4  
ATOM   3923  N  N    . VAL A 1 28 ? -8.460  4.428   -1.090  1.00 0.00 ? 335 VAL A N    4  
ATOM   3924  C  CA   . VAL A 1 28 ? -9.445  3.797   -0.222  1.00 0.00 ? 335 VAL A CA   4  
ATOM   3925  C  C    . VAL A 1 28 ? -8.821  3.393   1.110   1.00 0.00 ? 335 VAL A C    4  
ATOM   3926  O  O    . VAL A 1 28 ? -9.520  3.167   2.094   1.00 0.00 ? 335 VAL A O    4  
ATOM   3927  C  CB   . VAL A 1 28 ? -10.076 2.553   -0.877  1.00 0.00 ? 335 VAL A CB   4  
ATOM   3928  C  CG1  . VAL A 1 28 ? -10.934 2.950   -2.064  1.00 0.00 ? 335 VAL A CG1  4  
ATOM   3929  C  CG2  . VAL A 1 28 ? -9.006  1.556   -1.298  1.00 0.00 ? 335 VAL A CG2  4  
ATOM   3930  H  H    . VAL A 1 28 ? -7.641  3.943   -1.305  1.00 0.00 ? 335 VAL A H    4  
ATOM   3931  H  HA   . VAL A 1 28 ? -10.230 4.516   -0.035  1.00 0.00 ? 335 VAL A HA   4  
ATOM   3932  H  HB   . VAL A 1 28 ? -10.709 2.075   -0.147  1.00 0.00 ? 335 VAL A HB   4  
ATOM   3933  H  HG11 . VAL A 1 28 ? -11.712 3.623   -1.736  1.00 0.00 ? 335 VAL A HG11 4  
ATOM   3934  H  HG12 . VAL A 1 28 ? -11.379 2.067   -2.496  1.00 0.00 ? 335 VAL A HG12 4  
ATOM   3935  H  HG13 . VAL A 1 28 ? -10.319 3.443   -2.803  1.00 0.00 ? 335 VAL A HG13 4  
ATOM   3936  H  HG21 . VAL A 1 28 ? -8.422  1.269   -0.435  1.00 0.00 ? 335 VAL A HG21 4  
ATOM   3937  H  HG22 . VAL A 1 28 ? -8.360  2.012   -2.033  1.00 0.00 ? 335 VAL A HG22 4  
ATOM   3938  H  HG23 . VAL A 1 28 ? -9.476  0.682   -1.721  1.00 0.00 ? 335 VAL A HG23 4  
ATOM   3939  N  N    . GLY A 1 29 ? -7.497  3.304   1.128   1.00 0.00 ? 336 GLY A N    4  
ATOM   3940  C  CA   . GLY A 1 29 ? -6.786  2.922   2.334   1.00 0.00 ? 336 GLY A CA   4  
ATOM   3941  C  C    . GLY A 1 29 ? -5.316  3.279   2.260   1.00 0.00 ? 336 GLY A C    4  
ATOM   3942  O  O    . GLY A 1 29 ? -4.894  4.309   2.785   1.00 0.00 ? 336 GLY A O    4  
ATOM   3943  H  H    . GLY A 1 29 ? -6.996  3.506   0.318   1.00 0.00 ? 336 GLY A H    4  
ATOM   3944  H  HA2  . GLY A 1 29 ? -7.232  3.444   3.183   1.00 0.00 ? 336 GLY A HA2  4  
ATOM   3945  H  HA3  . GLY A 1 29 ? -6.881  1.843   2.474   1.00 0.00 ? 336 GLY A HA3  4  
ATOM   3946  N  N    . ALA A 1 30 ? -4.539  2.440   1.587   1.00 0.00 ? 337 ALA A N    4  
ATOM   3947  C  CA   . ALA A 1 30 ? -3.107  2.665   1.443   1.00 0.00 ? 337 ALA A CA   4  
ATOM   3948  C  C    . ALA A 1 30 ? -2.630  2.200   0.071   1.00 0.00 ? 337 ALA A C    4  
ATOM   3949  O  O    . ALA A 1 30 ? -3.198  1.269   -0.508  1.00 0.00 ? 337 ALA A O    4  
ATOM   3950  C  CB   . ALA A 1 30 ? -2.343  1.941   2.542   1.00 0.00 ? 337 ALA A CB   4  
ATOM   3951  H  H    . ALA A 1 30 ? -4.935  1.646   1.174   1.00 0.00 ? 337 ALA A H    4  
ATOM   3952  H  HA   . ALA A 1 30 ? -2.921  3.726   1.541   1.00 0.00 ? 337 ALA A HA   4  
ATOM   3953  H  HB1  . ALA A 1 30 ? -1.289  2.156   2.451   1.00 0.00 ? 337 ALA A HB1  4  
ATOM   3954  H  HB2  . ALA A 1 30 ? -2.502  0.877   2.448   1.00 0.00 ? 337 ALA A HB2  4  
ATOM   3955  H  HB3  . ALA A 1 30 ? -2.697  2.273   3.507   1.00 0.00 ? 337 ALA A HB3  4  
ATOM   3956  N  N    . SER A 1 31 ? -1.597  2.849   -0.445  1.00 0.00 ? 338 SER A N    4  
ATOM   3957  C  CA   . SER A 1 31 ? -1.058  2.515   -1.753  1.00 0.00 ? 338 SER A CA   4  
ATOM   3958  C  C    . SER A 1 31 ? 0.460   2.388   -1.694  1.00 0.00 ? 338 SER A C    4  
ATOM   3959  O  O    . SER A 1 31 ? 1.124   3.130   -0.970  1.00 0.00 ? 338 SER A O    4  
ATOM   3960  C  CB   . SER A 1 31 ? -1.453  3.585   -2.775  1.00 0.00 ? 338 SER A CB   4  
ATOM   3961  O  OG   . SER A 1 31 ? -2.859  3.792   -2.798  1.00 0.00 ? 338 SER A OG   4  
ATOM   3962  H  H    . SER A 1 31 ? -1.177  3.571   0.070   1.00 0.00 ? 338 SER A H    4  
ATOM   3963  H  HA   . SER A 1 31 ? -1.475  1.567   -2.053  1.00 0.00 ? 338 SER A HA   4  
ATOM   3964  H  HB2  . SER A 1 31 ? -0.971  4.517   -2.516  1.00 0.00 ? 338 SER A HB2  4  
ATOM   3965  H  HB3  . SER A 1 31 ? -1.129  3.277   -3.759  1.00 0.00 ? 338 SER A HB3  4  
ATOM   3966  H  HG   . SER A 1 31 ? -3.038  4.709   -3.039  1.00 0.00 ? 338 SER A HG   4  
ATOM   3967  N  N    . ILE A 1 32 ? 0.996   1.439   -2.445  1.00 0.00 ? 339 ILE A N    4  
ATOM   3968  C  CA   . ILE A 1 32 ? 2.432   1.266   -2.563  1.00 0.00 ? 339 ILE A CA   4  
ATOM   3969  C  C    . ILE A 1 32 ? 2.841   1.549   -4.007  1.00 0.00 ? 339 ILE A C    4  
ATOM   3970  O  O    . ILE A 1 32 ? 2.042   1.373   -4.928  1.00 0.00 ? 339 ILE A O    4  
ATOM   3971  C  CB   . ILE A 1 32 ? 2.873   -0.157  -2.131  1.00 0.00 ? 339 ILE A CB   4  
ATOM   3972  C  CG1  . ILE A 1 32 ? 4.401   -0.268  -2.115  1.00 0.00 ? 339 ILE A CG1  4  
ATOM   3973  C  CG2  . ILE A 1 32 ? 2.264   -1.216  -3.043  1.00 0.00 ? 339 ILE A CG2  4  
ATOM   3974  C  CD1  . ILE A 1 32 ? 4.910   -1.573  -1.540  1.00 0.00 ? 339 ILE A CD1  4  
ATOM   3975  H  H    . ILE A 1 32 ? 0.406   0.844   -2.959  1.00 0.00 ? 339 ILE A H    4  
ATOM   3976  H  HA   . ILE A 1 32 ? 2.912   1.988   -1.916  1.00 0.00 ? 339 ILE A HA   4  
ATOM   3977  H  HB   . ILE A 1 32 ? 2.501   -0.329  -1.131  1.00 0.00 ? 339 ILE A HB   4  
ATOM   3978  H  HG12 . ILE A 1 32 ? 4.771   -0.194  -3.136  1.00 0.00 ? 339 ILE A HG12 4  
ATOM   3979  H  HG13 . ILE A 1 32 ? 4.809   0.543   -1.515  1.00 0.00 ? 339 ILE A HG13 4  
ATOM   3980  H  HG21 . ILE A 1 32 ? 1.186   -1.141  -3.014  1.00 0.00 ? 339 ILE A HG21 4  
ATOM   3981  H  HG22 . ILE A 1 32 ? 2.565   -2.198  -2.708  1.00 0.00 ? 339 ILE A HG22 4  
ATOM   3982  H  HG23 . ILE A 1 32 ? 2.608   -1.060  -4.055  1.00 0.00 ? 339 ILE A HG23 4  
ATOM   3983  H  HD11 . ILE A 1 32 ? 4.582   -1.665  -0.516  1.00 0.00 ? 339 ILE A HD11 4  
ATOM   3984  H  HD12 . ILE A 1 32 ? 5.989   -1.586  -1.576  1.00 0.00 ? 339 ILE A HD12 4  
ATOM   3985  H  HD13 . ILE A 1 32 ? 4.520   -2.397  -2.118  1.00 0.00 ? 339 ILE A HD13 4  
ATOM   3986  N  N    . GLN A 1 33 ? 4.064   2.009   -4.209  1.00 0.00 ? 340 GLN A N    4  
ATOM   3987  C  CA   . GLN A 1 33 ? 4.480   2.470   -5.520  1.00 0.00 ? 340 GLN A CA   4  
ATOM   3988  C  C    . GLN A 1 33 ? 5.685   1.683   -6.029  1.00 0.00 ? 340 GLN A C    4  
ATOM   3989  O  O    . GLN A 1 33 ? 6.759   1.705   -5.419  1.00 0.00 ? 340 GLN A O    4  
ATOM   3990  C  CB   . GLN A 1 33 ? 4.805   3.962   -5.449  1.00 0.00 ? 340 GLN A CB   4  
ATOM   3991  C  CG   . GLN A 1 33 ? 4.848   4.653   -6.801  1.00 0.00 ? 340 GLN A CG   4  
ATOM   3992  C  CD   . GLN A 1 33 ? 5.098   6.110   -6.701  1.00 0.00 ? 340 GLN A CD   4  
ATOM   3993  O  OE1  . GLN A 1 33 ? 5.694   6.604   -5.742  1.00 0.00 ? 340 GLN A OE1  4  
ATOM   3994  N  NE2  . GLN A 1 33 ? 4.693   6.802   -7.723  1.00 0.00 ? 340 GLN A NE2  4  
ATOM   3995  H  H    . GLN A 1 33 ? 4.699   2.036   -3.465  1.00 0.00 ? 340 GLN A H    4  
ATOM   3996  H  HA   . GLN A 1 33 ? 3.657   2.323   -6.201  1.00 0.00 ? 340 GLN A HA   4  
ATOM   3997  H  HB2  . GLN A 1 33 ? 4.055   4.450   -4.846  1.00 0.00 ? 340 GLN A HB2  4  
ATOM   3998  H  HB3  . GLN A 1 33 ? 5.767   4.086   -4.977  1.00 0.00 ? 340 GLN A HB3  4  
ATOM   3999  H  HG2  . GLN A 1 33 ? 5.648   4.259   -7.397  1.00 0.00 ? 340 GLN A HG2  4  
ATOM   4000  H  HG3  . GLN A 1 33 ? 3.893   4.501   -7.301  1.00 0.00 ? 340 GLN A HG3  4  
ATOM   4001  H  HE21 . GLN A 1 33 ? 4.248   6.333   -8.465  1.00 0.00 ? 340 GLN A HE21 4  
ATOM   4002  H  HE22 . GLN A 1 33 ? 4.886   7.731   -7.726  1.00 0.00 ? 340 GLN A HE22 4  
ATOM   4003  N  N    . CYS A 1 34 ? 5.495   0.990   -7.146  1.00 0.00 ? 341 CYS A N    4  
ATOM   4004  C  CA   . CYS A 1 34 ? 6.575   0.269   -7.799  1.00 0.00 ? 341 CYS A CA   4  
ATOM   4005  C  C    . CYS A 1 34 ? 7.647   1.235   -8.245  1.00 0.00 ? 341 CYS A C    4  
ATOM   4006  O  O    . CYS A 1 34 ? 7.353   2.373   -8.620  1.00 0.00 ? 341 CYS A O    4  
ATOM   4007  C  CB   . CYS A 1 34 ? 6.071   -0.509  -9.013  1.00 0.00 ? 341 CYS A CB   4  
ATOM   4008  S  SG   . CYS A 1 34 ? 7.390   -1.236  -10.035 1.00 0.00 ? 341 CYS A SG   4  
ATOM   4009  H  H    . CYS A 1 34 ? 4.596   0.980   -7.550  1.00 0.00 ? 341 CYS A H    4  
ATOM   4010  H  HA   . CYS A 1 34 ? 6.997   -0.422  -7.083  1.00 0.00 ? 341 CYS A HA   4  
ATOM   4011  H  HB2  . CYS A 1 34 ? 5.439   -1.315  -8.676  1.00 0.00 ? 341 CYS A HB2  4  
ATOM   4012  H  HB3  . CYS A 1 34 ? 5.495   0.152   -9.641  1.00 0.00 ? 341 CYS A HB3  4  
ATOM   4013  N  N    . HIS A 1 35 ? 8.879   0.761   -8.256  1.00 0.00 ? 342 HIS A N    4  
ATOM   4014  C  CA   . HIS A 1 35 ? 10.006  1.638   -8.553  1.00 0.00 ? 342 HIS A CA   4  
ATOM   4015  C  C    . HIS A 1 35 ? 11.181  0.902   -9.191  1.00 0.00 ? 342 HIS A C    4  
ATOM   4016  O  O    . HIS A 1 35 ? 11.345  0.974   -10.408 1.00 0.00 ? 342 HIS A O    4  
ATOM   4017  C  CB   . HIS A 1 35 ? 10.449  2.460   -7.320  1.00 0.00 ? 342 HIS A CB   4  
ATOM   4018  C  CG   . HIS A 1 35 ? 10.618  1.695   -6.035  1.00 0.00 ? 342 HIS A CG   4  
ATOM   4019  N  ND1  . HIS A 1 35 ? 9.567   1.374   -5.206  1.00 0.00 ? 342 HIS A ND1  4  
ATOM   4020  C  CD2  . HIS A 1 35 ? 11.732  1.232   -5.418  1.00 0.00 ? 342 HIS A CD2  4  
ATOM   4021  C  CE1  . HIS A 1 35 ? 10.027  0.752   -4.137  1.00 0.00 ? 342 HIS A CE1  4  
ATOM   4022  N  NE2  . HIS A 1 35 ? 11.340  0.653   -4.236  1.00 0.00 ? 342 HIS A NE2  4  
ATOM   4023  H  H    . HIS A 1 35 ? 9.018   -0.206  -8.119  1.00 0.00 ? 342 HIS A H    4  
ATOM   4024  H  HA   . HIS A 1 35 ? 9.642   2.341   -9.289  1.00 0.00 ? 342 HIS A HA   4  
ATOM   4025  H  HB2  . HIS A 1 35 ? 11.412  2.922   -7.544  1.00 0.00 ? 342 HIS A HB2  4  
ATOM   4026  H  HB3  . HIS A 1 35 ? 9.702   3.239   -7.143  1.00 0.00 ? 342 HIS A HB3  4  
ATOM   4027  H  HD1  . HIS A 1 35 ? 8.618   1.594   -5.363  1.00 0.00 ? 342 HIS A HD1  4  
ATOM   4028  H  HD2  . HIS A 1 35 ? 12.743  1.305   -5.789  1.00 0.00 ? 342 HIS A HD2  4  
ATOM   4029  H  HE1  . HIS A 1 35 ? 9.428   0.384   -3.318  1.00 0.00 ? 342 HIS A HE1  4  
ATOM   4030  H  HE2  . HIS A 1 35 ? 11.940  0.503   -3.469  1.00 0.00 ? 342 HIS A HE2  4  
ATOM   4031  N  N    . LYS A 1 36 ? 11.974  0.182   -8.390  1.00 0.00 ? 343 LYS A N    4  
ATOM   4032  C  CA   . LYS A 1 36 ? 13.237  -0.413  -8.856  1.00 0.00 ? 343 LYS A CA   4  
ATOM   4033  C  C    . LYS A 1 36 ? 14.274  0.683   -9.114  1.00 0.00 ? 343 LYS A C    4  
ATOM   4034  O  O    . LYS A 1 36 ? 15.322  0.719   -8.473  1.00 0.00 ? 343 LYS A O    4  
ATOM   4035  C  CB   . LYS A 1 36 ? 13.011  -1.274  -10.113 1.00 0.00 ? 343 LYS A CB   4  
ATOM   4036  C  CG   . LYS A 1 36 ? 14.278  -1.641  -10.875 1.00 0.00 ? 343 LYS A CG   4  
ATOM   4037  C  CD   . LYS A 1 36 ? 15.235  -2.459  -10.028 1.00 0.00 ? 343 LYS A CD   4  
ATOM   4038  C  CE   . LYS A 1 36 ? 16.457  -2.864  -10.833 1.00 0.00 ? 343 LYS A CE   4  
ATOM   4039  N  NZ   . LYS A 1 36 ? 17.457  -3.586  -10.008 1.00 0.00 ? 343 LYS A NZ   4  
ATOM   4040  H  H    . LYS A 1 36 ? 11.710  0.049   -7.458  1.00 0.00 ? 343 LYS A H    4  
ATOM   4041  H  HA   . LYS A 1 36 ? 13.605  -1.047  -8.061  1.00 0.00 ? 343 LYS A HA   4  
ATOM   4042  H  HB2  . LYS A 1 36 ? 12.523  -2.190  -9.817  1.00 0.00 ? 343 LYS A HB2  4  
ATOM   4043  H  HB3  . LYS A 1 36 ? 12.359  -0.735  -10.784 1.00 0.00 ? 343 LYS A HB3  4  
ATOM   4044  H  HG2  . LYS A 1 36 ? 14.002  -2.229  -11.750 1.00 0.00 ? 343 LYS A HG2  4  
ATOM   4045  H  HG3  . LYS A 1 36 ? 14.779  -0.722  -11.184 1.00 0.00 ? 343 LYS A HG3  4  
ATOM   4046  H  HD2  . LYS A 1 36 ? 15.558  -1.858  -9.179  1.00 0.00 ? 343 LYS A HD2  4  
ATOM   4047  H  HD3  . LYS A 1 36 ? 14.724  -3.356  -9.683  1.00 0.00 ? 343 LYS A HD3  4  
ATOM   4048  H  HE2  . LYS A 1 36 ? 16.141  -3.507  -11.642 1.00 0.00 ? 343 LYS A HE2  4  
ATOM   4049  H  HE3  . LYS A 1 36 ? 16.912  -1.973  -11.242 1.00 0.00 ? 343 LYS A HE3  4  
ATOM   4050  H  HZ1  . LYS A 1 36 ? 17.773  -2.982  -9.221  1.00 0.00 ? 343 LYS A HZ1  4  
ATOM   4051  H  HZ2  . LYS A 1 36 ? 18.280  -3.844  -10.586 1.00 0.00 ? 343 LYS A HZ2  4  
ATOM   4052  H  HZ3  . LYS A 1 36 ? 17.038  -4.455  -9.617  1.00 0.00 ? 343 LYS A HZ3  4  
ATOM   4053  N  N    . ALA A 1 37 ? 13.961  1.571   -10.046 1.00 0.00 ? 344 ALA A N    4  
ATOM   4054  C  CA   . ALA A 1 37 ? 14.790  2.729   -10.340 1.00 0.00 ? 344 ALA A CA   4  
ATOM   4055  C  C    . ALA A 1 37 ? 13.938  3.805   -10.991 1.00 0.00 ? 344 ALA A C    4  
ATOM   4056  O  O    . ALA A 1 37 ? 13.600  4.813   -10.368 1.00 0.00 ? 344 ALA A O    4  
ATOM   4057  C  CB   . ALA A 1 37 ? 15.954  2.350   -11.247 1.00 0.00 ? 344 ALA A CB   4  
ATOM   4058  H  H    . ALA A 1 37 ? 13.129  1.446   -10.555 1.00 0.00 ? 344 ALA A H    4  
ATOM   4059  H  HA   . ALA A 1 37 ? 15.188  3.107   -9.408  1.00 0.00 ? 344 ALA A HA   4  
ATOM   4060  H  HB1  . ALA A 1 37 ? 16.538  3.231   -11.474 1.00 0.00 ? 344 ALA A HB1  4  
ATOM   4061  H  HB2  . ALA A 1 37 ? 15.571  1.928   -12.166 1.00 0.00 ? 344 ALA A HB2  4  
ATOM   4062  H  HB3  . ALA A 1 37 ? 16.578  1.623   -10.750 1.00 0.00 ? 344 ALA A HB3  4  
ATOM   4063  N  N    . ASN A 1 38 ? 13.565  3.560   -12.238 1.00 0.00 ? 345 ASN A N    4  
ATOM   4064  C  CA   . ASN A 1 38 ? 12.724  4.481   -12.988 1.00 0.00 ? 345 ASN A CA   4  
ATOM   4065  C  C    . ASN A 1 38 ? 11.347  3.872   -13.204 1.00 0.00 ? 345 ASN A C    4  
ATOM   4066  O  O    . ASN A 1 38 ? 11.132  3.112   -14.150 1.00 0.00 ? 345 ASN A O    4  
ATOM   4067  C  CB   . ASN A 1 38 ? 13.369  4.823   -14.336 1.00 0.00 ? 345 ASN A CB   4  
ATOM   4068  C  CG   . ASN A 1 38 ? 14.648  5.624   -14.183 1.00 0.00 ? 345 ASN A CG   4  
ATOM   4069  O  OD1  . ASN A 1 38 ? 14.765  6.467   -13.295 1.00 0.00 ? 345 ASN A OD1  4  
ATOM   4070  N  ND2  . ASN A 1 38 ? 15.623  5.357   -15.037 1.00 0.00 ? 345 ASN A ND2  4  
ATOM   4071  H  H    . ASN A 1 38 ? 13.865  2.734   -12.671 1.00 0.00 ? 345 ASN A H    4  
ATOM   4072  H  HA   . ASN A 1 38 ? 12.620  5.385   -12.406 1.00 0.00 ? 345 ASN A HA   4  
ATOM   4073  H  HB2  . ASN A 1 38 ? 13.602  3.907   -14.858 1.00 0.00 ? 345 ASN A HB2  4  
ATOM   4074  H  HB3  . ASN A 1 38 ? 12.671  5.401   -14.925 1.00 0.00 ? 345 ASN A HB3  4  
ATOM   4075  H  HD21 . ASN A 1 38 ? 15.471  4.667   -15.717 1.00 0.00 ? 345 ASN A HD21 4  
ATOM   4076  H  HD22 . ASN A 1 38 ? 16.465  5.854   -14.947 1.00 0.00 ? 345 ASN A HD22 4  
ATOM   4077  N  N    . CYS A 1 39 ? 10.428  4.184   -12.299 1.00 0.00 ? 346 CYS A N    4  
ATOM   4078  C  CA   . CYS A 1 39 ? 9.074   3.657   -12.351 1.00 0.00 ? 346 CYS A CA   4  
ATOM   4079  C  C    . CYS A 1 39 ? 8.249   4.313   -11.249 1.00 0.00 ? 346 CYS A C    4  
ATOM   4080  O  O    . CYS A 1 39 ? 8.769   4.596   -10.171 1.00 0.00 ? 346 CYS A O    4  
ATOM   4081  C  CB   . CYS A 1 39 ? 9.097   2.132   -12.184 1.00 0.00 ? 346 CYS A CB   4  
ATOM   4082  S  SG   . CYS A 1 39 ? 7.534   1.295   -12.549 1.00 0.00 ? 346 CYS A SG   4  
ATOM   4083  H  H    . CYS A 1 39 ? 10.670  4.791   -11.567 1.00 0.00 ? 346 CYS A H    4  
ATOM   4084  H  HA   . CYS A 1 39 ? 8.648   3.909   -13.312 1.00 0.00 ? 346 CYS A HA   4  
ATOM   4085  H  HB2  . CYS A 1 39 ? 9.845   1.721   -12.846 1.00 0.00 ? 346 CYS A HB2  4  
ATOM   4086  H  HB3  . CYS A 1 39 ? 9.364   1.897   -11.165 1.00 0.00 ? 346 CYS A HB3  4  
ATOM   4087  N  N    . TYR A 1 40 ? 6.976   4.563   -11.521 1.00 0.00 ? 347 TYR A N    4  
ATOM   4088  C  CA   . TYR A 1 40 ? 6.131   5.298   -10.586 1.00 0.00 ? 347 TYR A CA   4  
ATOM   4089  C  C    . TYR A 1 40 ? 4.755   4.649   -10.446 1.00 0.00 ? 347 TYR A C    4  
ATOM   4090  O  O    . TYR A 1 40 ? 3.797   5.295   -10.025 1.00 0.00 ? 347 TYR A O    4  
ATOM   4091  C  CB   . TYR A 1 40 ? 5.981   6.751   -11.060 1.00 0.00 ? 347 TYR A CB   4  
ATOM   4092  C  CG   . TYR A 1 40 ? 5.498   6.890   -12.492 1.00 0.00 ? 347 TYR A CG   4  
ATOM   4093  C  CD1  . TYR A 1 40 ? 4.181   6.608   -12.836 1.00 0.00 ? 347 TYR A CD1  4  
ATOM   4094  C  CD2  . TYR A 1 40 ? 6.361   7.310   -13.499 1.00 0.00 ? 347 TYR A CD2  4  
ATOM   4095  C  CE1  . TYR A 1 40 ? 3.738   6.737   -14.137 1.00 0.00 ? 347 TYR A CE1  4  
ATOM   4096  C  CE2  . TYR A 1 40 ? 5.923   7.445   -14.803 1.00 0.00 ? 347 TYR A CE2  4  
ATOM   4097  C  CZ   . TYR A 1 40 ? 4.611   7.157   -15.117 1.00 0.00 ? 347 TYR A CZ   4  
ATOM   4098  O  OH   . TYR A 1 40 ? 4.169   7.292   -16.413 1.00 0.00 ? 347 TYR A OH   4  
ATOM   4099  H  H    . TYR A 1 40 ? 6.596   4.249   -12.367 1.00 0.00 ? 347 TYR A H    4  
ATOM   4100  H  HA   . TYR A 1 40 ? 6.619   5.293   -9.625  1.00 0.00 ? 347 TYR A HA   4  
ATOM   4101  H  HB2  . TYR A 1 40 ? 5.269   7.255   -10.424 1.00 0.00 ? 347 TYR A HB2  4  
ATOM   4102  H  HB3  . TYR A 1 40 ? 6.937   7.249   -10.982 1.00 0.00 ? 347 TYR A HB3  4  
ATOM   4103  H  HD1  . TYR A 1 40 ? 3.501   6.277   -12.066 1.00 0.00 ? 347 TYR A HD1  4  
ATOM   4104  H  HD2  . TYR A 1 40 ? 7.388   7.534   -13.252 1.00 0.00 ? 347 TYR A HD2  4  
ATOM   4105  H  HE1  . TYR A 1 40 ? 2.710   6.512   -14.381 1.00 0.00 ? 347 TYR A HE1  4  
ATOM   4106  H  HE2  . TYR A 1 40 ? 6.608   7.771   -15.571 1.00 0.00 ? 347 TYR A HE2  4  
ATOM   4107  H  HH   . TYR A 1 40 ? 3.331   7.769   -16.415 1.00 0.00 ? 347 TYR A HH   4  
ATOM   4108  N  N    . THR A 1 41 ? 4.673   3.368   -10.767 1.00 0.00 ? 348 THR A N    4  
ATOM   4109  C  CA   . THR A 1 41 ? 3.385   2.680   -10.828 1.00 0.00 ? 348 THR A CA   4  
ATOM   4110  C  C    . THR A 1 41 ? 2.820   2.444   -9.430  1.00 0.00 ? 348 THR A C    4  
ATOM   4111  O  O    . THR A 1 41 ? 3.400   1.704   -8.636  1.00 0.00 ? 348 THR A O    4  
ATOM   4112  C  CB   . THR A 1 41 ? 3.519   1.329   -11.552 1.00 0.00 ? 348 THR A CB   4  
ATOM   4113  O  OG1  . THR A 1 41 ? 4.458   1.448   -12.630 1.00 0.00 ? 348 THR A OG1  4  
ATOM   4114  C  CG2  . THR A 1 41 ? 2.176   0.877   -12.103 1.00 0.00 ? 348 THR A CG2  4  
ATOM   4115  H  H    . THR A 1 41 ? 5.496   2.867   -10.942 1.00 0.00 ? 348 THR A H    4  
ATOM   4116  H  HA   . THR A 1 41 ? 2.700   3.300   -11.386 1.00 0.00 ? 348 THR A HA   4  
ATOM   4117  H  HB   . THR A 1 41 ? 3.874   0.589   -10.850 1.00 0.00 ? 348 THR A HB   4  
ATOM   4118  H  HG1  . THR A 1 41 ? 4.053   1.943   -13.351 1.00 0.00 ? 348 THR A HG1  4  
ATOM   4119  H  HG21 . THR A 1 41 ? 1.799   1.618   -12.792 1.00 0.00 ? 348 THR A HG21 4  
ATOM   4120  H  HG22 . THR A 1 41 ? 1.477   0.753   -11.289 1.00 0.00 ? 348 THR A HG22 4  
ATOM   4121  H  HG23 . THR A 1 41 ? 2.296   -0.064  -12.619 1.00 0.00 ? 348 THR A HG23 4  
ATOM   4122  N  N    . ALA A 1 42 ? 1.689   3.068   -9.137  1.00 0.00 ? 349 ALA A N    4  
ATOM   4123  C  CA   . ALA A 1 42 ? 1.092   2.989   -7.814  1.00 0.00 ? 349 ALA A CA   4  
ATOM   4124  C  C    . ALA A 1 42 ? -0.082  2.019   -7.782  1.00 0.00 ? 349 ALA A C    4  
ATOM   4125  O  O    . ALA A 1 42 ? -0.864  1.931   -8.732  1.00 0.00 ? 349 ALA A O    4  
ATOM   4126  C  CB   . ALA A 1 42 ? 0.648   4.366   -7.363  1.00 0.00 ? 349 ALA A CB   4  
ATOM   4127  H  H    . ALA A 1 42 ? 1.238   3.595   -9.832  1.00 0.00 ? 349 ALA A H    4  
ATOM   4128  H  HA   . ALA A 1 42 ? 1.849   2.641   -7.129  1.00 0.00 ? 349 ALA A HA   4  
ATOM   4129  H  HB1  . ALA A 1 42 ? -0.107  4.739   -8.039  1.00 0.00 ? 349 ALA A HB1  4  
ATOM   4130  H  HB2  . ALA A 1 42 ? 1.494   5.036   -7.363  1.00 0.00 ? 349 ALA A HB2  4  
ATOM   4131  H  HB3  . ALA A 1 42 ? 0.237   4.302   -6.368  1.00 0.00 ? 349 ALA A HB3  4  
ATOM   4132  N  N    . PHE A 1 43 ? -0.193  1.289   -6.681  1.00 0.00 ? 350 PHE A N    4  
ATOM   4133  C  CA   . PHE A 1 43 ? -1.273  0.333   -6.496  1.00 0.00 ? 350 PHE A CA   4  
ATOM   4134  C  C    . PHE A 1 43 ? -1.495  0.050   -5.015  1.00 0.00 ? 350 PHE A C    4  
ATOM   4135  O  O    . PHE A 1 43 ? -0.587  0.194   -4.207  1.00 0.00 ? 350 PHE A O    4  
ATOM   4136  C  CB   . PHE A 1 43 ? -0.992  -0.965  -7.269  1.00 0.00 ? 350 PHE A CB   4  
ATOM   4137  C  CG   . PHE A 1 43 ? 0.387   -1.546  -7.072  1.00 0.00 ? 350 PHE A CG   4  
ATOM   4138  C  CD1  . PHE A 1 43 ? 1.494   -0.959  -7.666  1.00 0.00 ? 350 PHE A CD1  4  
ATOM   4139  C  CD2  . PHE A 1 43 ? 0.571   -2.687  -6.314  1.00 0.00 ? 350 PHE A CD2  4  
ATOM   4140  C  CE1  . PHE A 1 43 ? 2.755   -1.495  -7.504  1.00 0.00 ? 350 PHE A CE1  4  
ATOM   4141  C  CE2  . PHE A 1 43 ? 1.833   -3.228  -6.145  1.00 0.00 ? 350 PHE A CE2  4  
ATOM   4142  C  CZ   . PHE A 1 43 ? 2.926   -2.632  -6.742  1.00 0.00 ? 350 PHE A CZ   4  
ATOM   4143  H  H    . PHE A 1 43 ? 0.482   1.387   -5.970  1.00 0.00 ? 350 PHE A H    4  
ATOM   4144  H  HA   . PHE A 1 43 ? -2.172  0.783   -6.894  1.00 0.00 ? 350 PHE A HA   4  
ATOM   4145  H  HB2  . PHE A 1 43 ? -1.705  -1.714  -6.959  1.00 0.00 ? 350 PHE A HB2  4  
ATOM   4146  H  HB3  . PHE A 1 43 ? -1.122  -0.776  -8.326  1.00 0.00 ? 350 PHE A HB3  4  
ATOM   4147  H  HD1  . PHE A 1 43 ? 1.364   -0.065  -8.258  1.00 0.00 ? 350 PHE A HD1  4  
ATOM   4148  H  HD2  . PHE A 1 43 ? -0.283  -3.153  -5.846  1.00 0.00 ? 350 PHE A HD2  4  
ATOM   4149  H  HE1  . PHE A 1 43 ? 3.605   -1.026  -7.973  1.00 0.00 ? 350 PHE A HE1  4  
ATOM   4150  H  HE2  . PHE A 1 43 ? 1.965   -4.120  -5.551  1.00 0.00 ? 350 PHE A HE2  4  
ATOM   4151  H  HZ   . PHE A 1 43 ? 3.913   -3.054  -6.613  1.00 0.00 ? 350 PHE A HZ   4  
ATOM   4152  N  N    . HIS A 1 44 ? -2.712  -0.343  -4.661  1.00 0.00 ? 351 HIS A N    4  
ATOM   4153  C  CA   . HIS A 1 44 ? -3.052  -0.582  -3.264  1.00 0.00 ? 351 HIS A CA   4  
ATOM   4154  C  C    . HIS A 1 44 ? -2.374  -1.843  -2.767  1.00 0.00 ? 351 HIS A C    4  
ATOM   4155  O  O    . HIS A 1 44 ? -2.284  -2.830  -3.498  1.00 0.00 ? 351 HIS A O    4  
ATOM   4156  C  CB   . HIS A 1 44 ? -4.566  -0.709  -3.069  1.00 0.00 ? 351 HIS A CB   4  
ATOM   4157  C  CG   . HIS A 1 44 ? -5.326  0.546   -3.358  1.00 0.00 ? 351 HIS A CG   4  
ATOM   4158  N  ND1  . HIS A 1 44 ? -6.358  0.607   -4.280  1.00 0.00 ? 351 HIS A ND1  4  
ATOM   4159  C  CD2  . HIS A 1 44 ? -5.212  1.791   -2.836  1.00 0.00 ? 351 HIS A CD2  4  
ATOM   4160  C  CE1  . HIS A 1 44 ? -6.836  1.848   -4.300  1.00 0.00 ? 351 HIS A CE1  4  
ATOM   4161  N  NE2  . HIS A 1 44 ? -6.158  2.582   -3.441  1.00 0.00 ? 351 HIS A NE2  4  
ATOM   4162  H  H    . HIS A 1 44 ? -3.383  -0.496  -5.352  1.00 0.00 ? 351 HIS A H    4  
ATOM   4163  H  HA   . HIS A 1 44 ? -2.693  0.256   -2.690  1.00 0.00 ? 351 HIS A HA   4  
ATOM   4164  H  HB2  . HIS A 1 44 ? -4.940  -1.480  -3.723  1.00 0.00 ? 351 HIS A HB2  4  
ATOM   4165  H  HB3  . HIS A 1 44 ? -4.764  -0.989  -2.044  1.00 0.00 ? 351 HIS A HB3  4  
ATOM   4166  H  HD2  . HIS A 1 44 ? -4.511  2.102   -2.073  1.00 0.00 ? 351 HIS A HD2  4  
ATOM   4167  H  HE1  . HIS A 1 44 ? -7.642  2.200   -4.921  1.00 0.00 ? 351 HIS A HE1  4  
ATOM   4168  H  HE2  . HIS A 1 44 ? -6.110  3.569   -3.487  1.00 0.00 ? 351 HIS A HE2  4  
ATOM   4169  N  N    . VAL A 1 45 ? -1.923  -1.803  -1.520  1.00 0.00 ? 352 VAL A N    4  
ATOM   4170  C  CA   . VAL A 1 45 ? -1.229  -2.929  -0.911  1.00 0.00 ? 352 VAL A CA   4  
ATOM   4171  C  C    . VAL A 1 45 ? -2.103  -4.181  -0.937  1.00 0.00 ? 352 VAL A C    4  
ATOM   4172  O  O    . VAL A 1 45 ? -1.613  -5.287  -1.176  1.00 0.00 ? 352 VAL A O    4  
ATOM   4173  C  CB   . VAL A 1 45 ? -0.825  -2.612  0.547   1.00 0.00 ? 352 VAL A CB   4  
ATOM   4174  C  CG1  . VAL A 1 45 ? 0.001   -3.742  1.144   1.00 0.00 ? 352 VAL A CG1  4  
ATOM   4175  C  CG2  . VAL A 1 45 ? -0.062  -1.295  0.618   1.00 0.00 ? 352 VAL A CG2  4  
ATOM   4176  H  H    . VAL A 1 45 ? -2.057  -0.986  -0.991  1.00 0.00 ? 352 VAL A H    4  
ATOM   4177  H  HA   . VAL A 1 45 ? -0.330  -3.115  -1.480  1.00 0.00 ? 352 VAL A HA   4  
ATOM   4178  H  HB   . VAL A 1 45 ? -1.726  -2.509  1.132   1.00 0.00 ? 352 VAL A HB   4  
ATOM   4179  H  HG11 . VAL A 1 45 ? -0.571  -4.659  1.124   1.00 0.00 ? 352 VAL A HG11 4  
ATOM   4180  H  HG12 . VAL A 1 45 ? 0.256   -3.501  2.167   1.00 0.00 ? 352 VAL A HG12 4  
ATOM   4181  H  HG13 . VAL A 1 45 ? 0.907   -3.870  0.570   1.00 0.00 ? 352 VAL A HG13 4  
ATOM   4182  H  HG21 . VAL A 1 45 ? -0.685  -0.495  0.245   1.00 0.00 ? 352 VAL A HG21 4  
ATOM   4183  H  HG22 . VAL A 1 45 ? 0.833   -1.364  0.018   1.00 0.00 ? 352 VAL A HG22 4  
ATOM   4184  H  HG23 . VAL A 1 45 ? 0.209   -1.091  1.645   1.00 0.00 ? 352 VAL A HG23 4  
ATOM   4185  N  N    . THR A 1 46 ? -3.397  -3.997  -0.709  1.00 0.00 ? 353 THR A N    4  
ATOM   4186  C  CA   . THR A 1 46 ? -4.336  -5.109  -0.724  1.00 0.00 ? 353 THR A CA   4  
ATOM   4187  C  C    . THR A 1 46 ? -4.423  -5.732  -2.120  1.00 0.00 ? 353 THR A C    4  
ATOM   4188  O  O    . THR A 1 46 ? -4.334  -6.949  -2.263  1.00 0.00 ? 353 THR A O    4  
ATOM   4189  C  CB   . THR A 1 46 ? -5.745  -4.680  -0.233  1.00 0.00 ? 353 THR A CB   4  
ATOM   4190  O  OG1  . THR A 1 46 ? -6.663  -5.773  -0.341  1.00 0.00 ? 353 THR A OG1  4  
ATOM   4191  C  CG2  . THR A 1 46 ? -6.279  -3.488  -1.020  1.00 0.00 ? 353 THR A CG2  4  
ATOM   4192  H  H    . THR A 1 46 ? -3.726  -3.095  -0.510  1.00 0.00 ? 353 THR A H    4  
ATOM   4193  H  HA   . THR A 1 46 ? -3.959  -5.858  -0.042  1.00 0.00 ? 353 THR A HA   4  
ATOM   4194  H  HB   . THR A 1 46 ? -5.671  -4.395  0.806   1.00 0.00 ? 353 THR A HB   4  
ATOM   4195  H  HG1  . THR A 1 46 ? -7.393  -5.642  0.274   1.00 0.00 ? 353 THR A HG1  4  
ATOM   4196  H  HG21 . THR A 1 46 ? -7.274  -3.246  -0.677  1.00 0.00 ? 353 THR A HG21 4  
ATOM   4197  H  HG22 . THR A 1 46 ? -6.310  -3.736  -2.070  1.00 0.00 ? 353 THR A HG22 4  
ATOM   4198  H  HG23 . THR A 1 46 ? -5.632  -2.636  -0.872  1.00 0.00 ? 353 THR A HG23 4  
ATOM   4199  N  N    . CYS A 1 47 ? -4.536  -4.891  -3.151  1.00 0.00 ? 354 CYS A N    4  
ATOM   4200  C  CA   . CYS A 1 47 ? -4.686  -5.363  -4.526  1.00 0.00 ? 354 CYS A CA   4  
ATOM   4201  C  C    . CYS A 1 47 ? -3.487  -6.205  -4.944  1.00 0.00 ? 354 CYS A C    4  
ATOM   4202  O  O    . CYS A 1 47 ? -3.627  -7.200  -5.651  1.00 0.00 ? 354 CYS A O    4  
ATOM   4203  C  CB   . CYS A 1 47 ? -4.835  -4.182  -5.485  1.00 0.00 ? 354 CYS A CB   4  
ATOM   4204  S  SG   . CYS A 1 47 ? -6.137  -3.008  -5.032  1.00 0.00 ? 354 CYS A SG   4  
ATOM   4205  H  H    . CYS A 1 47 ? -4.513  -3.928  -2.979  1.00 0.00 ? 354 CYS A H    4  
ATOM   4206  H  HA   . CYS A 1 47 ? -5.575  -5.976  -4.576  1.00 0.00 ? 354 CYS A HA   4  
ATOM   4207  H  HB2  . CYS A 1 47 ? -3.903  -3.637  -5.520  1.00 0.00 ? 354 CYS A HB2  4  
ATOM   4208  H  HB3  . CYS A 1 47 ? -5.061  -4.558  -6.471  1.00 0.00 ? 354 CYS A HB3  4  
ATOM   4209  N  N    . ALA A 1 48 ? -2.310  -5.795  -4.491  1.00 0.00 ? 355 ALA A N    4  
ATOM   4210  C  CA   . ALA A 1 48 ? -1.082  -6.506  -4.807  1.00 0.00 ? 355 ALA A CA   4  
ATOM   4211  C  C    . ALA A 1 48 ? -1.101  -7.902  -4.207  1.00 0.00 ? 355 ALA A C    4  
ATOM   4212  O  O    . ALA A 1 48 ? -0.722  -8.875  -4.858  1.00 0.00 ? 355 ALA A O    4  
ATOM   4213  C  CB   . ALA A 1 48 ? 0.115   -5.729  -4.291  1.00 0.00 ? 355 ALA A CB   4  
ATOM   4214  H  H    . ALA A 1 48 ? -2.267  -4.995  -3.926  1.00 0.00 ? 355 ALA A H    4  
ATOM   4215  H  HA   . ALA A 1 48 ? -1.003  -6.582  -5.881  1.00 0.00 ? 355 ALA A HA   4  
ATOM   4216  H  HB1  . ALA A 1 48 ? 0.134   -4.751  -4.747  1.00 0.00 ? 355 ALA A HB1  4  
ATOM   4217  H  HB2  . ALA A 1 48 ? 1.020   -6.260  -4.539  1.00 0.00 ? 355 ALA A HB2  4  
ATOM   4218  H  HB3  . ALA A 1 48 ? 0.040   -5.624  -3.219  1.00 0.00 ? 355 ALA A HB3  4  
ATOM   4219  N  N    . GLN A 1 49 ? -1.553  -7.990  -2.964  1.00 0.00 ? 356 GLN A N    4  
ATOM   4220  C  CA   . GLN A 1 49 ? -1.642  -9.261  -2.259  1.00 0.00 ? 356 GLN A CA   4  
ATOM   4221  C  C    . GLN A 1 49 ? -2.770  -10.120 -2.821  1.00 0.00 ? 356 GLN A C    4  
ATOM   4222  O  O    . GLN A 1 49 ? -2.744  -11.343 -2.714  1.00 0.00 ? 356 GLN A O    4  
ATOM   4223  C  CB   . GLN A 1 49 ? -1.848  -9.019  -0.765  1.00 0.00 ? 356 GLN A CB   4  
ATOM   4224  C  CG   . GLN A 1 49 ? -0.705  -8.245  -0.127  1.00 0.00 ? 356 GLN A CG   4  
ATOM   4225  C  CD   . GLN A 1 49 ? -1.003  -7.841  1.303   1.00 0.00 ? 356 GLN A CD   4  
ATOM   4226  O  OE1  . GLN A 1 49 ? -0.700  -8.569  2.244   1.00 0.00 ? 356 GLN A OE1  4  
ATOM   4227  N  NE2  . GLN A 1 49 ? -1.595  -6.676  1.473   1.00 0.00 ? 356 GLN A NE2  4  
ATOM   4228  H  H    . GLN A 1 49 ? -1.847  -7.172  -2.506  1.00 0.00 ? 356 GLN A H    4  
ATOM   4229  H  HA   . GLN A 1 49 ? -0.705  -9.782  -2.403  1.00 0.00 ? 356 GLN A HA   4  
ATOM   4230  H  HB2  . GLN A 1 49 ? -2.765  -8.447  -0.626  1.00 0.00 ? 356 GLN A HB2  4  
ATOM   4231  H  HB3  . GLN A 1 49 ? -1.934  -9.978  -0.261  1.00 0.00 ? 356 GLN A HB3  4  
ATOM   4232  H  HG2  . GLN A 1 49 ? 0.184   -8.875  -0.126  1.00 0.00 ? 356 GLN A HG2  4  
ATOM   4233  H  HG3  . GLN A 1 49 ? -0.525  -7.342  -0.711  1.00 0.00 ? 356 GLN A HG3  4  
ATOM   4234  H  HE21 . GLN A 1 49 ? -1.806  -6.140  0.677   1.00 0.00 ? 356 GLN A HE21 4  
ATOM   4235  H  HE22 . GLN A 1 49 ? -1.799  -6.386  2.390   1.00 0.00 ? 356 GLN A HE22 4  
ATOM   4236  N  N    . LYS A 1 50 ? -3.770  -9.465  -3.408  1.00 0.00 ? 357 LYS A N    4  
ATOM   4237  C  CA   . LYS A 1 50 ? -4.880  -10.168 -4.040  1.00 0.00 ? 357 LYS A CA   4  
ATOM   4238  C  C    . LYS A 1 50 ? -4.432  -10.794 -5.353  1.00 0.00 ? 357 LYS A C    4  
ATOM   4239  O  O    . LYS A 1 50 ? -4.809  -11.917 -5.682  1.00 0.00 ? 357 LYS A O    4  
ATOM   4240  C  CB   . LYS A 1 50 ? -6.063  -9.224  -4.293  1.00 0.00 ? 357 LYS A CB   4  
ATOM   4241  C  CG   . LYS A 1 50 ? -6.686  -8.621  -3.038  1.00 0.00 ? 357 LYS A CG   4  
ATOM   4242  C  CD   . LYS A 1 50 ? -7.081  -9.683  -2.026  1.00 0.00 ? 357 LYS A CD   4  
ATOM   4243  C  CE   . LYS A 1 50 ? -6.001  -9.886  -0.973  1.00 0.00 ? 357 LYS A CE   4  
ATOM   4244  N  NZ   . LYS A 1 50 ? -6.360  -10.957 -0.005  1.00 0.00 ? 357 LYS A NZ   4  
ATOM   4245  H  H    . LYS A 1 50 ? -3.762  -8.482  -3.407  1.00 0.00 ? 357 LYS A H    4  
ATOM   4246  H  HA   . LYS A 1 50 ? -5.193  -10.955 -3.371  1.00 0.00 ? 357 LYS A HA   4  
ATOM   4247  H  HB2  . LYS A 1 50 ? -5.725  -8.411  -4.918  1.00 0.00 ? 357 LYS A HB2  4  
ATOM   4248  H  HB3  . LYS A 1 50 ? -6.832  -9.768  -4.821  1.00 0.00 ? 357 LYS A HB3  4  
ATOM   4249  H  HG2  . LYS A 1 50 ? -5.963  -7.952  -2.577  1.00 0.00 ? 357 LYS A HG2  4  
ATOM   4250  H  HG3  . LYS A 1 50 ? -7.575  -8.063  -3.327  1.00 0.00 ? 357 LYS A HG3  4  
ATOM   4251  H  HD2  . LYS A 1 50 ? -7.994  -9.379  -1.537  1.00 0.00 ? 357 LYS A HD2  4  
ATOM   4252  H  HD3  . LYS A 1 50 ? -7.243  -10.615 -2.547  1.00 0.00 ? 357 LYS A HD3  4  
ATOM   4253  H  HE2  . LYS A 1 50 ? -5.079  -10.156 -1.466  1.00 0.00 ? 357 LYS A HE2  4  
ATOM   4254  H  HE3  . LYS A 1 50 ? -5.862  -8.960  -0.435  1.00 0.00 ? 357 LYS A HE3  4  
ATOM   4255  H  HZ1  . LYS A 1 50 ? -7.301  -10.778 0.394   1.00 0.00 ? 357 LYS A HZ1  4  
ATOM   4256  H  HZ2  . LYS A 1 50 ? -5.666  -10.986 0.770   1.00 0.00 ? 357 LYS A HZ2  4  
ATOM   4257  H  HZ3  . LYS A 1 50 ? -6.368  -11.884 -0.480  1.00 0.00 ? 357 LYS A HZ3  4  
ATOM   4258  N  N    . ALA A 1 51 ? -3.624  -10.055 -6.104  1.00 0.00 ? 358 ALA A N    4  
ATOM   4259  C  CA   . ALA A 1 51 ? -3.097  -10.545 -7.370  1.00 0.00 ? 358 ALA A CA   4  
ATOM   4260  C  C    . ALA A 1 51 ? -1.984  -11.560 -7.134  1.00 0.00 ? 358 ALA A C    4  
ATOM   4261  O  O    . ALA A 1 51 ? -1.917  -12.593 -7.799  1.00 0.00 ? 358 ALA A O    4  
ATOM   4262  C  CB   . ALA A 1 51 ? -2.593  -9.386  -8.218  1.00 0.00 ? 358 ALA A CB   4  
ATOM   4263  H  H    . ALA A 1 51 ? -3.385  -9.150  -5.802  1.00 0.00 ? 358 ALA A H    4  
ATOM   4264  H  HA   . ALA A 1 51 ? -3.904  -11.027 -7.904  1.00 0.00 ? 358 ALA A HA   4  
ATOM   4265  H  HB1  . ALA A 1 51 ? -3.393  -8.676  -8.369  1.00 0.00 ? 358 ALA A HB1  4  
ATOM   4266  H  HB2  . ALA A 1 51 ? -2.257  -9.758  -9.173  1.00 0.00 ? 358 ALA A HB2  4  
ATOM   4267  H  HB3  . ALA A 1 51 ? -1.771  -8.900  -7.712  1.00 0.00 ? 358 ALA A HB3  4  
ATOM   4268  N  N    . GLY A 1 52 ? -1.121  -11.262 -6.175  1.00 0.00 ? 359 GLY A N    4  
ATOM   4269  C  CA   . GLY A 1 52 ? -0.015  -12.145 -5.871  1.00 0.00 ? 359 GLY A CA   4  
ATOM   4270  C  C    . GLY A 1 52 ? 1.225   -11.789 -6.661  1.00 0.00 ? 359 GLY A C    4  
ATOM   4271  O  O    . GLY A 1 52 ? 1.943   -12.670 -7.135  1.00 0.00 ? 359 GLY A O    4  
ATOM   4272  H  H    . GLY A 1 52 ? -1.234  -10.431 -5.665  1.00 0.00 ? 359 GLY A H    4  
ATOM   4273  H  HA2  . GLY A 1 52 ? 0.209   -12.078 -4.816  1.00 0.00 ? 359 GLY A HA2  4  
ATOM   4274  H  HA3  . GLY A 1 52 ? -0.300  -13.159 -6.105  1.00 0.00 ? 359 GLY A HA3  4  
ATOM   4275  N  N    . LEU A 1 53 ? 1.475   -10.495 -6.811  1.00 0.00 ? 360 LEU A N    4  
ATOM   4276  C  CA   . LEU A 1 53 ? 2.639   -10.031 -7.552  1.00 0.00 ? 360 LEU A CA   4  
ATOM   4277  C  C    . LEU A 1 53 ? 3.895   -10.075 -6.681  1.00 0.00 ? 360 LEU A C    4  
ATOM   4278  O  O    . LEU A 1 53 ? 3.848   -10.510 -5.527  1.00 0.00 ? 360 LEU A O    4  
ATOM   4279  C  CB   . LEU A 1 53 ? 2.398   -8.624  -8.130  1.00 0.00 ? 360 LEU A CB   4  
ATOM   4280  C  CG   . LEU A 1 53 ? 1.908   -7.555  -7.143  1.00 0.00 ? 360 LEU A CG   4  
ATOM   4281  C  CD1  . LEU A 1 53 ? 3.048   -7.031  -6.282  1.00 0.00 ? 360 LEU A CD1  4  
ATOM   4282  C  CD2  . LEU A 1 53 ? 1.241   -6.414  -7.896  1.00 0.00 ? 360 LEU A CD2  4  
ATOM   4283  H  H    . LEU A 1 53 ? 0.867   -9.840  -6.411  1.00 0.00 ? 360 LEU A H    4  
ATOM   4284  H  HA   . LEU A 1 53 ? 2.781   -10.717 -8.375  1.00 0.00 ? 360 LEU A HA   4  
ATOM   4285  H  HB2  . LEU A 1 53 ? 3.341   -8.274  -8.557  1.00 0.00 ? 360 LEU A HB2  4  
ATOM   4286  H  HB3  . LEU A 1 53 ? 1.654   -8.714  -8.926  1.00 0.00 ? 360 LEU A HB3  4  
ATOM   4287  H  HG   . LEU A 1 53 ? 1.172   -7.994  -6.485  1.00 0.00 ? 360 LEU A HG   4  
ATOM   4288  H  HD11 . LEU A 1 53 ? 3.469   -7.844  -5.708  1.00 0.00 ? 360 LEU A HD11 4  
ATOM   4289  H  HD12 . LEU A 1 53 ? 2.676   -6.273  -5.610  1.00 0.00 ? 360 LEU A HD12 4  
ATOM   4290  H  HD13 . LEU A 1 53 ? 3.812   -6.605  -6.916  1.00 0.00 ? 360 LEU A HD13 4  
ATOM   4291  H  HD21 . LEU A 1 53 ? 1.954   -5.960  -8.568  1.00 0.00 ? 360 LEU A HD21 4  
ATOM   4292  H  HD22 . LEU A 1 53 ? 0.890   -5.675  -7.192  1.00 0.00 ? 360 LEU A HD22 4  
ATOM   4293  H  HD23 . LEU A 1 53 ? 0.406   -6.797  -8.462  1.00 0.00 ? 360 LEU A HD23 4  
ATOM   4294  N  N    . TYR A 1 54 ? 5.012   -9.626  -7.231  1.00 0.00 ? 361 TYR A N    4  
ATOM   4295  C  CA   . TYR A 1 54 ? 6.291   -9.735  -6.545  1.00 0.00 ? 361 TYR A CA   4  
ATOM   4296  C  C    . TYR A 1 54 ? 6.476   -8.647  -5.489  1.00 0.00 ? 361 TYR A C    4  
ATOM   4297  O  O    . TYR A 1 54 ? 6.384   -7.451  -5.774  1.00 0.00 ? 361 TYR A O    4  
ATOM   4298  C  CB   . TYR A 1 54 ? 7.446   -9.684  -7.545  1.00 0.00 ? 361 TYR A CB   4  
ATOM   4299  C  CG   . TYR A 1 54 ? 8.800   -9.810  -6.887  1.00 0.00 ? 361 TYR A CG   4  
ATOM   4300  C  CD1  . TYR A 1 54 ? 9.275   -11.045 -6.471  1.00 0.00 ? 361 TYR A CD1  4  
ATOM   4301  C  CD2  . TYR A 1 54 ? 9.594   -8.693  -6.663  1.00 0.00 ? 361 TYR A CD2  4  
ATOM   4302  C  CE1  . TYR A 1 54 ? 10.503  -11.164 -5.853  1.00 0.00 ? 361 TYR A CE1  4  
ATOM   4303  C  CE2  . TYR A 1 54 ? 10.822  -8.804  -6.042  1.00 0.00 ? 361 TYR A CE2  4  
ATOM   4304  C  CZ   . TYR A 1 54 ? 11.273  -10.042 -5.640  1.00 0.00 ? 361 TYR A CZ   4  
ATOM   4305  O  OH   . TYR A 1 54 ? 12.491  -10.157 -5.012  1.00 0.00 ? 361 TYR A OH   4  
ATOM   4306  H  H    . TYR A 1 54 ? 4.977   -9.210  -8.117  1.00 0.00 ? 361 TYR A H    4  
ATOM   4307  H  HA   . TYR A 1 54 ? 6.309   -10.693 -6.050  1.00 0.00 ? 361 TYR A HA   4  
ATOM   4308  H  HB2  . TYR A 1 54 ? 7.340   -10.493 -8.251  1.00 0.00 ? 361 TYR A HB2  4  
ATOM   4309  H  HB3  . TYR A 1 54 ? 7.417   -8.742  -8.073  1.00 0.00 ? 361 TYR A HB3  4  
ATOM   4310  H  HD1  . TYR A 1 54 ? 8.671   -11.924 -6.640  1.00 0.00 ? 361 TYR A HD1  4  
ATOM   4311  H  HD2  . TYR A 1 54 ? 9.236   -7.725  -6.982  1.00 0.00 ? 361 TYR A HD2  4  
ATOM   4312  H  HE1  . TYR A 1 54 ? 10.856  -12.135 -5.539  1.00 0.00 ? 361 TYR A HE1  4  
ATOM   4313  H  HE2  . TYR A 1 54 ? 11.425  -7.923  -5.876  1.00 0.00 ? 361 TYR A HE2  4  
ATOM   4314  H  HH   . TYR A 1 54 ? 12.826  -11.055 -5.127  1.00 0.00 ? 361 TYR A HH   4  
ATOM   4315  N  N    . MET A 1 55 ? 6.750   -9.085  -4.268  1.00 0.00 ? 362 MET A N    4  
ATOM   4316  C  CA   . MET A 1 55 ? 7.117   -8.193  -3.182  1.00 0.00 ? 362 MET A CA   4  
ATOM   4317  C  C    . MET A 1 55 ? 8.406   -8.673  -2.535  1.00 0.00 ? 362 MET A C    4  
ATOM   4318  O  O    . MET A 1 55 ? 8.544   -9.853  -2.217  1.00 0.00 ? 362 MET A O    4  
ATOM   4319  C  CB   . MET A 1 55 ? 6.017   -8.122  -2.120  1.00 0.00 ? 362 MET A CB   4  
ATOM   4320  C  CG   . MET A 1 55 ? 4.843   -7.230  -2.487  1.00 0.00 ? 362 MET A CG   4  
ATOM   4321  S  SD   . MET A 1 55 ? 3.666   -7.056  -1.130  1.00 0.00 ? 362 MET A SD   4  
ATOM   4322  C  CE   . MET A 1 55 ? 2.575   -5.797  -1.786  1.00 0.00 ? 362 MET A CE   4  
ATOM   4323  H  H    . MET A 1 55 ? 6.710   -10.048 -4.093  1.00 0.00 ? 362 MET A H    4  
ATOM   4324  H  HA   . MET A 1 55 ? 7.276   -7.209  -3.596  1.00 0.00 ? 362 MET A HA   4  
ATOM   4325  H  HB2  . MET A 1 55 ? 5.638   -9.119  -1.947  1.00 0.00 ? 362 MET A HB2  4  
ATOM   4326  H  HB3  . MET A 1 55 ? 6.448   -7.750  -1.201  1.00 0.00 ? 362 MET A HB3  4  
ATOM   4327  H  HG2  . MET A 1 55 ? 5.218   -6.252  -2.747  1.00 0.00 ? 362 MET A HG2  4  
ATOM   4328  H  HG3  . MET A 1 55 ? 4.332   -7.654  -3.338  1.00 0.00 ? 362 MET A HG3  4  
ATOM   4329  H  HE1  . MET A 1 55 ? 3.136   -4.893  -1.971  1.00 0.00 ? 362 MET A HE1  4  
ATOM   4330  H  HE2  . MET A 1 55 ? 1.791   -5.594  -1.073  1.00 0.00 ? 362 MET A HE2  4  
ATOM   4331  H  HE3  . MET A 1 55 ? 2.140   -6.146  -2.711  1.00 0.00 ? 362 MET A HE3  4  
ATOM   4332  N  N    . LYS A 1 56 ? 9.354   -7.764  -2.367  1.00 0.00 ? 363 LYS A N    4  
ATOM   4333  C  CA   . LYS A 1 56 ? 10.594  -8.069  -1.672  1.00 0.00 ? 363 LYS A CA   4  
ATOM   4334  C  C    . LYS A 1 56 ? 10.526  -7.492  -0.261  1.00 0.00 ? 363 LYS A C    4  
ATOM   4335  O  O    . LYS A 1 56 ? 9.815   -6.514  -0.024  1.00 0.00 ? 363 LYS A O    4  
ATOM   4336  C  CB   . LYS A 1 56 ? 11.790  -7.484  -2.435  1.00 0.00 ? 363 LYS A CB   4  
ATOM   4337  C  CG   . LYS A 1 56 ? 13.127  -8.080  -2.020  1.00 0.00 ? 363 LYS A CG   4  
ATOM   4338  C  CD   . LYS A 1 56 ? 14.296  -7.414  -2.732  1.00 0.00 ? 363 LYS A CD   4  
ATOM   4339  C  CE   . LYS A 1 56 ? 14.458  -5.965  -2.303  1.00 0.00 ? 363 LYS A CE   4  
ATOM   4340  N  NZ   . LYS A 1 56 ? 15.770  -5.404  -2.718  1.00 0.00 ? 363 LYS A NZ   4  
ATOM   4341  H  H    . LYS A 1 56 ? 9.217   -6.856  -2.722  1.00 0.00 ? 363 LYS A H    4  
ATOM   4342  H  HA   . LYS A 1 56 ? 10.692  -9.143  -1.616  1.00 0.00 ? 363 LYS A HA   4  
ATOM   4343  H  HB2  . LYS A 1 56 ? 11.650  -7.670  -3.501  1.00 0.00 ? 363 LYS A HB2  4  
ATOM   4344  H  HB3  . LYS A 1 56 ? 11.825  -6.409  -2.250  1.00 0.00 ? 363 LYS A HB3  4  
ATOM   4345  H  HG2  . LYS A 1 56 ? 13.251  -7.951  -0.955  1.00 0.00 ? 363 LYS A HG2  4  
ATOM   4346  H  HG3  . LYS A 1 56 ? 13.127  -9.133  -2.257  1.00 0.00 ? 363 LYS A HG3  4  
ATOM   4347  H  HD2  . LYS A 1 56 ? 15.202  -7.950  -2.495  1.00 0.00 ? 363 LYS A HD2  4  
ATOM   4348  H  HD3  . LYS A 1 56 ? 14.125  -7.447  -3.797  1.00 0.00 ? 363 LYS A HD3  4  
ATOM   4349  H  HE2  . LYS A 1 56 ? 13.670  -5.379  -2.752  1.00 0.00 ? 363 LYS A HE2  4  
ATOM   4350  H  HE3  . LYS A 1 56 ? 14.377  -5.911  -1.229  1.00 0.00 ? 363 LYS A HE3  4  
ATOM   4351  H  HZ1  . LYS A 1 56 ? 15.759  -5.159  -3.728  1.00 0.00 ? 363 LYS A HZ1  4  
ATOM   4352  H  HZ2  . LYS A 1 56 ? 16.524  -6.098  -2.546  1.00 0.00 ? 363 LYS A HZ2  4  
ATOM   4353  H  HZ3  . LYS A 1 56 ? 15.978  -4.548  -2.162  1.00 0.00 ? 363 LYS A HZ3  4  
ATOM   4354  N  N    . MET A 1 57 ? 11.274  -8.073  0.666   1.00 0.00 ? 364 MET A N    4  
ATOM   4355  C  CA   . MET A 1 57 ? 11.203  -7.689  2.063   1.00 0.00 ? 364 MET A CA   4  
ATOM   4356  C  C    . MET A 1 57 ? 12.597  -7.724  2.649   1.00 0.00 ? 364 MET A C    4  
ATOM   4357  O  O    . MET A 1 57 ? 13.164  -8.796  2.860   1.00 0.00 ? 364 MET A O    4  
ATOM   4358  C  CB   . MET A 1 57 ? 10.301  -8.622  2.889   1.00 0.00 ? 364 MET A CB   4  
ATOM   4359  C  CG   . MET A 1 57 ? 8.857   -8.730  2.419   1.00 0.00 ? 364 MET A CG   4  
ATOM   4360  S  SD   . MET A 1 57 ? 8.643   -9.912  1.077   1.00 0.00 ? 364 MET A SD   4  
ATOM   4361  C  CE   . MET A 1 57 ? 6.859   -9.940  0.929   1.00 0.00 ? 364 MET A CE   4  
ATOM   4362  H  H    . MET A 1 57 ? 11.936  -8.744  0.400   1.00 0.00 ? 364 MET A H    4  
ATOM   4363  H  HA   . MET A 1 57 ? 10.820  -6.679  2.117   1.00 0.00 ? 364 MET A HA   4  
ATOM   4364  H  HB2  . MET A 1 57 ? 10.724  -9.609  2.866   1.00 0.00 ? 364 MET A HB2  4  
ATOM   4365  H  HB3  . MET A 1 57 ? 10.293  -8.275  3.912   1.00 0.00 ? 364 MET A HB3  4  
ATOM   4366  H  HG2  . MET A 1 57 ? 8.243   -9.039  3.252   1.00 0.00 ? 364 MET A HG2  4  
ATOM   4367  H  HG3  . MET A 1 57 ? 8.534   -7.760  2.079   1.00 0.00 ? 364 MET A HG3  4  
ATOM   4368  H  HE1  . MET A 1 57 ? 6.577   -10.598 0.120   1.00 0.00 ? 364 MET A HE1  4  
ATOM   4369  H  HE2  . MET A 1 57 ? 6.499   -8.942  0.725   1.00 0.00 ? 364 MET A HE2  4  
ATOM   4370  H  HE3  . MET A 1 57 ? 6.427   -10.297 1.852   1.00 0.00 ? 364 MET A HE3  4  
ATOM   4371  N  N    . GLU A 1 58 ? 13.161  -6.560  2.874   1.00 0.00 ? 365 GLU A N    4  
ATOM   4372  C  CA   . GLU A 1 58 ? 14.491  -6.467  3.430   1.00 0.00 ? 365 GLU A CA   4  
ATOM   4373  C  C    . GLU A 1 58 ? 14.435  -5.964  4.867   1.00 0.00 ? 365 GLU A C    4  
ATOM   4374  O  O    . GLU A 1 58 ? 13.894  -4.894  5.128   1.00 0.00 ? 365 GLU A O    4  
ATOM   4375  C  CB   . GLU A 1 58 ? 15.313  -5.513  2.576   1.00 0.00 ? 365 GLU A CB   4  
ATOM   4376  C  CG   . GLU A 1 58 ? 15.715  -6.076  1.230   1.00 0.00 ? 365 GLU A CG   4  
ATOM   4377  C  CD   . GLU A 1 58 ? 16.632  -5.143  0.465   1.00 0.00 ? 365 GLU A CD   4  
ATOM   4378  O  OE1  . GLU A 1 58 ? 16.126  -4.259  -0.259  1.00 0.00 ? 365 GLU A OE1  4  
ATOM   4379  O  OE2  . GLU A 1 58 ? 17.868  -5.292  0.579   1.00 0.00 ? 365 GLU A OE2  4  
ATOM   4380  H  H    . GLU A 1 58 ? 12.671  -5.735  2.658   1.00 0.00 ? 365 GLU A H    4  
ATOM   4381  H  HA   . GLU A 1 58 ? 14.943  -7.445  3.407   1.00 0.00 ? 365 GLU A HA   4  
ATOM   4382  H  HB2  . GLU A 1 58 ? 14.716  -4.638  2.393   1.00 0.00 ? 365 GLU A HB2  4  
ATOM   4383  H  HB3  . GLU A 1 58 ? 16.203  -5.237  3.113   1.00 0.00 ? 365 GLU A HB3  4  
ATOM   4384  H  HG2  . GLU A 1 58 ? 16.227  -7.013  1.386   1.00 0.00 ? 365 GLU A HG2  4  
ATOM   4385  H  HG3  . GLU A 1 58 ? 14.824  -6.246  0.643   1.00 0.00 ? 365 GLU A HG3  4  
ATOM   4386  N  N    . PRO A 1 59 ? 14.974  -6.723  5.824   1.00 0.00 ? 366 PRO A N    4  
ATOM   4387  C  CA   . PRO A 1 59 ? 15.049  -6.296  7.209   1.00 0.00 ? 366 PRO A CA   4  
ATOM   4388  C  C    . PRO A 1 59 ? 16.353  -5.564  7.519   1.00 0.00 ? 366 PRO A C    4  
ATOM   4389  O  O    . PRO A 1 59 ? 17.442  -6.119  7.364   1.00 0.00 ? 366 PRO A O    4  
ATOM   4390  C  CB   . PRO A 1 59 ? 14.974  -7.617  7.991   1.00 0.00 ? 366 PRO A CB   4  
ATOM   4391  C  CG   . PRO A 1 59 ? 15.121  -8.720  6.979   1.00 0.00 ? 366 PRO A CG   4  
ATOM   4392  C  CD   . PRO A 1 59 ? 15.502  -8.078  5.671   1.00 0.00 ? 366 PRO A CD   4  
ATOM   4393  H  HA   . PRO A 1 59 ? 14.210  -5.666  7.474   1.00 0.00 ? 366 PRO A HA   4  
ATOM   4394  H  HB2  . PRO A 1 59 ? 15.772  -7.647  8.720   1.00 0.00 ? 366 PRO A HB2  4  
ATOM   4395  H  HB3  . PRO A 1 59 ? 14.022  -7.678  8.498   1.00 0.00 ? 366 PRO A HB3  4  
ATOM   4396  H  HG2  . PRO A 1 59 ? 15.894  -9.404  7.295   1.00 0.00 ? 366 PRO A HG2  4  
ATOM   4397  H  HG3  . PRO A 1 59 ? 14.183  -9.244  6.875   1.00 0.00 ? 366 PRO A HG3  4  
ATOM   4398  H  HD2  . PRO A 1 59 ? 16.576  -8.067  5.552   1.00 0.00 ? 366 PRO A HD2  4  
ATOM   4399  H  HD3  . PRO A 1 59 ? 15.030  -8.592  4.849   1.00 0.00 ? 366 PRO A HD3  4  
ATOM   4400  N  N    . VAL A 1 60 ? 16.241  -4.313  7.936   1.00 0.00 ? 367 VAL A N    4  
ATOM   4401  C  CA   . VAL A 1 60 ? 17.403  -3.545  8.350   1.00 0.00 ? 367 VAL A CA   4  
ATOM   4402  C  C    . VAL A 1 60 ? 17.285  -3.180  9.828   1.00 0.00 ? 367 VAL A C    4  
ATOM   4403  O  O    . VAL A 1 60 ? 16.332  -2.521  10.253  1.00 0.00 ? 367 VAL A O    4  
ATOM   4404  C  CB   . VAL A 1 60 ? 17.608  -2.277  7.482   1.00 0.00 ? 367 VAL A CB   4  
ATOM   4405  C  CG1  . VAL A 1 60 ? 18.049  -2.658  6.079   1.00 0.00 ? 367 VAL A CG1  4  
ATOM   4406  C  CG2  . VAL A 1 60 ? 16.346  -1.431  7.420   1.00 0.00 ? 367 VAL A CG2  4  
ATOM   4407  H  H    . VAL A 1 60 ? 15.350  -3.895  7.980   1.00 0.00 ? 367 VAL A H    4  
ATOM   4408  H  HA   . VAL A 1 60 ? 18.269  -4.179  8.224   1.00 0.00 ? 367 VAL A HA   4  
ATOM   4409  H  HB   . VAL A 1 60 ? 18.389  -1.682  7.932   1.00 0.00 ? 367 VAL A HB   4  
ATOM   4410  H  HG11 . VAL A 1 60 ? 17.329  -3.336  5.645   1.00 0.00 ? 367 VAL A HG11 4  
ATOM   4411  H  HG12 . VAL A 1 60 ? 19.015  -3.137  6.124   1.00 0.00 ? 367 VAL A HG12 4  
ATOM   4412  H  HG13 . VAL A 1 60 ? 18.117  -1.769  5.469   1.00 0.00 ? 367 VAL A HG13 4  
ATOM   4413  H  HG21 . VAL A 1 60 ? 15.537  -2.018  7.014   1.00 0.00 ? 367 VAL A HG21 4  
ATOM   4414  H  HG22 . VAL A 1 60 ? 16.520  -0.571  6.790   1.00 0.00 ? 367 VAL A HG22 4  
ATOM   4415  H  HG23 . VAL A 1 60 ? 16.091  -1.103  8.414   1.00 0.00 ? 367 VAL A HG23 4  
ATOM   4416  N  N    . LYS A 1 61 ? 18.234  -3.654  10.620  1.00 0.00 ? 368 LYS A N    4  
ATOM   4417  C  CA   . LYS A 1 61 ? 18.180  -3.473  12.059  1.00 0.00 ? 368 LYS A CA   4  
ATOM   4418  C  C    . LYS A 1 61 ? 18.677  -2.097  12.474  1.00 0.00 ? 368 LYS A C    4  
ATOM   4419  O  O    . LYS A 1 61 ? 19.877  -1.812  12.434  1.00 0.00 ? 368 LYS A O    4  
ATOM   4420  C  CB   . LYS A 1 61 ? 18.988  -4.561  12.771  1.00 0.00 ? 368 LYS A CB   4  
ATOM   4421  C  CG   . LYS A 1 61 ? 18.220  -5.213  13.904  1.00 0.00 ? 368 LYS A CG   4  
ATOM   4422  C  CD   . LYS A 1 61 ? 16.998  -5.944  13.373  1.00 0.00 ? 368 LYS A CD   4  
ATOM   4423  C  CE   . LYS A 1 61 ? 15.818  -5.829  14.320  1.00 0.00 ? 368 LYS A CE   4  
ATOM   4424  N  NZ   . LYS A 1 61 ? 16.075  -6.483  15.631  1.00 0.00 ? 368 LYS A NZ   4  
ATOM   4425  H  H    . LYS A 1 61 ? 18.983  -4.148  10.230  1.00 0.00 ? 368 LYS A H    4  
ATOM   4426  H  HA   . LYS A 1 61 ? 17.146  -3.563  12.358  1.00 0.00 ? 368 LYS A HA   4  
ATOM   4427  H  HB2  . LYS A 1 61 ? 19.257  -5.324  12.056  1.00 0.00 ? 368 LYS A HB2  4  
ATOM   4428  H  HB3  . LYS A 1 61 ? 19.889  -4.121  13.177  1.00 0.00 ? 368 LYS A HB3  4  
ATOM   4429  H  HG2  . LYS A 1 61 ? 18.863  -5.920  14.407  1.00 0.00 ? 368 LYS A HG2  4  
ATOM   4430  H  HG3  . LYS A 1 61 ? 17.900  -4.452  14.600  1.00 0.00 ? 368 LYS A HG3  4  
ATOM   4431  H  HD2  . LYS A 1 61 ? 16.723  -5.521  12.419  1.00 0.00 ? 368 LYS A HD2  4  
ATOM   4432  H  HD3  . LYS A 1 61 ? 17.246  -6.988  13.247  1.00 0.00 ? 368 LYS A HD3  4  
ATOM   4433  H  HE2  . LYS A 1 61 ? 15.613  -4.781  14.483  1.00 0.00 ? 368 LYS A HE2  4  
ATOM   4434  H  HE3  . LYS A 1 61 ? 14.961  -6.292  13.855  1.00 0.00 ? 368 LYS A HE3  4  
ATOM   4435  H  HZ1  . LYS A 1 61 ? 15.255  -6.356  16.260  1.00 0.00 ? 368 LYS A HZ1  4  
ATOM   4436  H  HZ2  . LYS A 1 61 ? 16.913  -6.066  16.084  1.00 0.00 ? 368 LYS A HZ2  4  
ATOM   4437  H  HZ3  . LYS A 1 61 ? 16.238  -7.502  15.498  1.00 0.00 ? 368 LYS A HZ3  4  
ATOM   4438  N  N    . GLU A 1 62 ? 17.745  -1.247  12.866  1.00 0.00 ? 369 GLU A N    4  
ATOM   4439  C  CA   . GLU A 1 62 ? 18.067  0.060   13.398  1.00 0.00 ? 369 GLU A CA   4  
ATOM   4440  C  C    . GLU A 1 62 ? 18.107  0.015   14.921  1.00 0.00 ? 369 GLU A C    4  
ATOM   4441  O  O    . GLU A 1 62 ? 17.833  -1.020  15.524  1.00 0.00 ? 369 GLU A O    4  
ATOM   4442  C  CB   . GLU A 1 62 ? 17.092  1.121   12.892  1.00 0.00 ? 369 GLU A CB   4  
ATOM   4443  C  CG   . GLU A 1 62 ? 17.332  1.521   11.448  1.00 0.00 ? 369 GLU A CG   4  
ATOM   4444  C  CD   . GLU A 1 62 ? 18.733  2.052   11.227  1.00 0.00 ? 369 GLU A CD   4  
ATOM   4445  O  OE1  . GLU A 1 62 ? 18.951  3.262   11.429  1.00 0.00 ? 369 GLU A OE1  4  
ATOM   4446  O  OE2  . GLU A 1 62 ? 19.628  1.260   10.865  1.00 0.00 ? 369 GLU A OE2  4  
ATOM   4447  H  H    . GLU A 1 62 ? 16.801  -1.511  12.804  1.00 0.00 ? 369 GLU A H    4  
ATOM   4448  H  HA   . GLU A 1 62 ? 19.058  0.308   13.045  1.00 0.00 ? 369 GLU A HA   4  
ATOM   4449  H  HB2  . GLU A 1 62 ? 16.085  0.737   12.975  1.00 0.00 ? 369 GLU A HB2  4  
ATOM   4450  H  HB3  . GLU A 1 62 ? 17.185  2.003   13.508  1.00 0.00 ? 369 GLU A HB3  4  
ATOM   4451  H  HG2  . GLU A 1 62 ? 17.183  0.660   10.814  1.00 0.00 ? 369 GLU A HG2  4  
ATOM   4452  H  HG3  . GLU A 1 62 ? 16.625  2.293   11.181  1.00 0.00 ? 369 GLU A HG3  4  
ATOM   4453  N  N    . LEU A 1 63 ? 18.437  1.137   15.529  1.00 0.00 ? 370 LEU A N    4  
ATOM   4454  C  CA   . LEU A 1 63 ? 18.844  1.171   16.935  1.00 0.00 ? 370 LEU A CA   4  
ATOM   4455  C  C    . LEU A 1 63 ? 18.634  2.555   17.542  1.00 0.00 ? 370 LEU A C    4  
ATOM   4456  O  O    . LEU A 1 63 ? 18.314  2.695   18.723  1.00 0.00 ? 370 LEU A O    4  
ATOM   4457  C  CB   . LEU A 1 63 ? 20.321  0.765   17.051  1.00 0.00 ? 370 LEU A CB   4  
ATOM   4458  C  CG   . LEU A 1 63 ? 20.922  0.821   18.458  1.00 0.00 ? 370 LEU A CG   4  
ATOM   4459  C  CD1  . LEU A 1 63 ? 20.217  -0.154  19.388  1.00 0.00 ? 370 LEU A CD1  4  
ATOM   4460  C  CD2  . LEU A 1 63 ? 22.412  0.523   18.403  1.00 0.00 ? 370 LEU A CD2  4  
ATOM   4461  H  H    . LEU A 1 63 ? 18.338  1.969   15.035  1.00 0.00 ? 370 LEU A H    4  
ATOM   4462  H  HA   . LEU A 1 63 ? 18.247  0.467   17.472  1.00 0.00 ? 370 LEU A HA   4  
ATOM   4463  H  HB2  . LEU A 1 63 ? 20.421  -0.247  16.684  1.00 0.00 ? 370 LEU A HB2  4  
ATOM   4464  H  HB3  . LEU A 1 63 ? 20.900  1.415   16.413  1.00 0.00 ? 370 LEU A HB3  4  
ATOM   4465  H  HG   . LEU A 1 63 ? 20.794  1.814   18.859  1.00 0.00 ? 370 LEU A HG   4  
ATOM   4466  H  HD11 . LEU A 1 63 ? 20.661  -0.097  20.371  1.00 0.00 ? 370 LEU A HD11 4  
ATOM   4467  H  HD12 . LEU A 1 63 ? 20.321  -1.156  19.002  1.00 0.00 ? 370 LEU A HD12 4  
ATOM   4468  H  HD13 . LEU A 1 63 ? 19.171  0.103   19.449  1.00 0.00 ? 370 LEU A HD13 4  
ATOM   4469  H  HD21 . LEU A 1 63 ? 22.568  -0.453  17.971  1.00 0.00 ? 370 LEU A HD21 4  
ATOM   4470  H  HD22 . LEU A 1 63 ? 22.822  0.544   19.403  1.00 0.00 ? 370 LEU A HD22 4  
ATOM   4471  H  HD23 . LEU A 1 63 ? 22.904  1.269   17.797  1.00 0.00 ? 370 LEU A HD23 4  
ATOM   4472  N  N    . THR A 1 64 ? 18.829  3.563   16.722  1.00 0.00 ? 371 THR A N    4  
ATOM   4473  C  CA   . THR A 1 64 ? 18.690  4.949   17.139  1.00 0.00 ? 371 THR A CA   4  
ATOM   4474  C  C    . THR A 1 64 ? 17.254  5.262   17.565  1.00 0.00 ? 371 THR A C    4  
ATOM   4475  O  O    . THR A 1 64 ? 16.289  4.784   16.962  1.00 0.00 ? 371 THR A O    4  
ATOM   4476  C  CB   . THR A 1 64 ? 19.139  5.920   16.017  1.00 0.00 ? 371 THR A CB   4  
ATOM   4477  O  OG1  . THR A 1 64 ? 19.121  7.273   16.491  1.00 0.00 ? 371 THR A OG1  4  
ATOM   4478  C  CG2  . THR A 1 64 ? 18.251  5.797   14.785  1.00 0.00 ? 371 THR A CG2  4  
ATOM   4479  H  H    . THR A 1 64 ? 19.096  3.369   15.814  1.00 0.00 ? 371 THR A H    4  
ATOM   4480  H  HA   . THR A 1 64 ? 19.337  5.100   17.990  1.00 0.00 ? 371 THR A HA   4  
ATOM   4481  H  HB   . THR A 1 64 ? 20.151  5.666   15.733  1.00 0.00 ? 371 THR A HB   4  
ATOM   4482  H  HG1  . THR A 1 64 ? 19.971  7.477   16.903  1.00 0.00 ? 371 THR A HG1  4  
ATOM   4483  H  HG21 . THR A 1 64 ? 18.316  4.792   14.394  1.00 0.00 ? 371 THR A HG21 4  
ATOM   4484  H  HG22 . THR A 1 64 ? 18.581  6.498   14.032  1.00 0.00 ? 371 THR A HG22 4  
ATOM   4485  H  HG23 . THR A 1 64 ? 17.228  6.013   15.054  1.00 0.00 ? 371 THR A HG23 4  
ATOM   4486  N  N    . GLY A 1 65 ? 17.125  6.052   18.622  1.00 0.00 ? 372 GLY A N    4  
ATOM   4487  C  CA   . GLY A 1 65 ? 15.817  6.428   19.117  1.00 0.00 ? 372 GLY A CA   4  
ATOM   4488  C  C    . GLY A 1 65 ? 15.644  6.078   20.578  1.00 0.00 ? 372 GLY A C    4  
ATOM   4489  O  O    . GLY A 1 65 ? 14.953  6.778   21.319  1.00 0.00 ? 372 GLY A O    4  
ATOM   4490  H  H    . GLY A 1 65 ? 17.929  6.384   19.074  1.00 0.00 ? 372 GLY A H    4  
ATOM   4491  H  HA2  . GLY A 1 65 ? 15.690  7.493   18.994  1.00 0.00 ? 372 GLY A HA2  4  
ATOM   4492  H  HA3  . GLY A 1 65 ? 15.062  5.914   18.541  1.00 0.00 ? 372 GLY A HA3  4  
ATOM   4493  N  N    . GLY A 1 66 ? 16.291  5.002   20.998  1.00 0.00 ? 373 GLY A N    4  
ATOM   4494  C  CA   . GLY A 1 66 ? 16.197  4.566   22.377  1.00 0.00 ? 373 GLY A CA   4  
ATOM   4495  C  C    . GLY A 1 66 ? 16.179  3.060   22.488  1.00 0.00 ? 373 GLY A C    4  
ATOM   4496  O  O    . GLY A 1 66 ? 16.704  2.486   23.444  1.00 0.00 ? 373 GLY A O    4  
ATOM   4497  H  H    . GLY A 1 66 ? 16.841  4.492   20.364  1.00 0.00 ? 373 GLY A H    4  
ATOM   4498  H  HA2  . GLY A 1 66 ? 17.046  4.948   22.922  1.00 0.00 ? 373 GLY A HA2  4  
ATOM   4499  H  HA3  . GLY A 1 66 ? 15.292  4.962   22.811  1.00 0.00 ? 373 GLY A HA3  4  
ATOM   4500  N  N    . GLY A 1 67 ? 15.560  2.425   21.510  1.00 0.00 ? 374 GLY A N    4  
ATOM   4501  C  CA   . GLY A 1 67 ? 15.546  0.985   21.447  1.00 0.00 ? 374 GLY A CA   4  
ATOM   4502  C  C    . GLY A 1 67 ? 15.860  0.498   20.054  1.00 0.00 ? 374 GLY A C    4  
ATOM   4503  O  O    . GLY A 1 67 ? 15.758  1.259   19.093  1.00 0.00 ? 374 GLY A O    4  
ATOM   4504  H  H    . GLY A 1 67 ? 15.099  2.944   20.818  1.00 0.00 ? 374 GLY A H    4  
ATOM   4505  H  HA2  . GLY A 1 67 ? 16.282  0.592   22.133  1.00 0.00 ? 374 GLY A HA2  4  
ATOM   4506  H  HA3  . GLY A 1 67 ? 14.569  0.628   21.731  1.00 0.00 ? 374 GLY A HA3  4  
ATOM   4507  N  N    . THR A 1 68 ? 16.250  -0.759  19.944  1.00 0.00 ? 375 THR A N    4  
ATOM   4508  C  CA   . THR A 1 68 ? 16.534  -1.357  18.654  1.00 0.00 ? 375 THR A CA   4  
ATOM   4509  C  C    . THR A 1 68 ? 15.241  -1.484  17.857  1.00 0.00 ? 375 THR A C    4  
ATOM   4510  O  O    . THR A 1 68 ? 14.265  -2.071  18.331  1.00 0.00 ? 375 THR A O    4  
ATOM   4511  C  CB   . THR A 1 68 ? 17.175  -2.747  18.842  1.00 0.00 ? 375 THR A CB   4  
ATOM   4512  O  OG1  . THR A 1 68 ? 18.235  -2.662  19.802  1.00 0.00 ? 375 THR A OG1  4  
ATOM   4513  C  CG2  . THR A 1 68 ? 17.722  -3.292  17.531  1.00 0.00 ? 375 THR A CG2  4  
ATOM   4514  H  H    . THR A 1 68 ? 16.333  -1.308  20.752  1.00 0.00 ? 375 THR A H    4  
ATOM   4515  H  HA   . THR A 1 68 ? 17.225  -0.711  18.117  1.00 0.00 ? 375 THR A HA   4  
ATOM   4516  H  HB   . THR A 1 68 ? 16.420  -3.426  19.210  1.00 0.00 ? 375 THR A HB   4  
ATOM   4517  H  HG1  . THR A 1 68 ? 18.544  -1.753  19.857  1.00 0.00 ? 375 THR A HG1  4  
ATOM   4518  H  HG21 . THR A 1 68 ? 18.467  -2.613  17.143  1.00 0.00 ? 375 THR A HG21 4  
ATOM   4519  H  HG22 . THR A 1 68 ? 16.917  -3.390  16.817  1.00 0.00 ? 375 THR A HG22 4  
ATOM   4520  H  HG23 . THR A 1 68 ? 18.170  -4.258  17.704  1.00 0.00 ? 375 THR A HG23 4  
ATOM   4521  N  N    . THR A 1 69 ? 15.237  -0.959  16.646  1.00 0.00 ? 376 THR A N    4  
ATOM   4522  C  CA   . THR A 1 69 ? 14.032  -0.838  15.892  1.00 0.00 ? 376 THR A CA   4  
ATOM   4523  C  C    . THR A 1 69 ? 14.135  -1.674  14.643  1.00 0.00 ? 376 THR A C    4  
ATOM   4524  O  O    . THR A 1 69 ? 15.039  -1.523  13.816  1.00 0.00 ? 376 THR A O    4  
ATOM   4525  C  CB   . THR A 1 69 ? 13.736  0.630   15.518  1.00 0.00 ? 376 THR A CB   4  
ATOM   4526  O  OG1  . THR A 1 69 ? 14.755  1.141   14.660  1.00 0.00 ? 376 THR A OG1  4  
ATOM   4527  C  CG2  . THR A 1 69 ? 13.673  1.497   16.757  1.00 0.00 ? 376 THR A CG2  4  
ATOM   4528  H  H    . THR A 1 69 ? 16.065  -0.715  16.224  1.00 0.00 ? 376 THR A H    4  
ATOM   4529  H  HA   . THR A 1 69 ? 13.218  -1.208  16.500  1.00 0.00 ? 376 THR A HA   4  
ATOM   4530  H  HB   . THR A 1 69 ? 12.783  0.678   15.011  1.00 0.00 ? 376 THR A HB   4  
ATOM   4531  H  HG1  . THR A 1 69 ? 14.786  2.097   14.736  1.00 0.00 ? 376 THR A HG1  4  
ATOM   4532  H  HG21 . THR A 1 69 ? 13.292  2.471   16.497  1.00 0.00 ? 376 THR A HG21 4  
ATOM   4533  H  HG22 . THR A 1 69 ? 14.671  1.596   17.167  1.00 0.00 ? 376 THR A HG22 4  
ATOM   4534  H  HG23 . THR A 1 69 ? 13.026  1.033   17.485  1.00 0.00 ? 376 THR A HG23 4  
ATOM   4535  N  N    . PHE A 1 70 ? 13.225  -2.586  14.554  1.00 0.00 ? 377 PHE A N    4  
ATOM   4536  C  CA   . PHE A 1 70 ? 13.054  -3.392  13.385  1.00 0.00 ? 377 PHE A CA   4  
ATOM   4537  C  C    . PHE A 1 70 ? 12.477  -2.549  12.254  1.00 0.00 ? 377 PHE A C    4  
ATOM   4538  O  O    . PHE A 1 70 ? 11.330  -2.110  12.297  1.00 0.00 ? 377 PHE A O    4  
ATOM   4539  C  CB   . PHE A 1 70 ? 12.159  -4.591  13.721  1.00 0.00 ? 377 PHE A CB   4  
ATOM   4540  C  CG   . PHE A 1 70 ? 10.813  -4.246  14.312  1.00 0.00 ? 377 PHE A CG   4  
ATOM   4541  C  CD1  . PHE A 1 70 ? 10.692  -3.875  15.644  1.00 0.00 ? 377 PHE A CD1  4  
ATOM   4542  C  CD2  . PHE A 1 70 ? 9.666   -4.304  13.533  1.00 0.00 ? 377 PHE A CD2  4  
ATOM   4543  C  CE1  . PHE A 1 70 ? 9.457   -3.569  16.185  1.00 0.00 ? 377 PHE A CE1  4  
ATOM   4544  C  CE2  . PHE A 1 70 ? 8.429   -3.997  14.069  1.00 0.00 ? 377 PHE A CE2  4  
ATOM   4545  C  CZ   . PHE A 1 70 ? 8.324   -3.627  15.394  1.00 0.00 ? 377 PHE A CZ   4  
ATOM   4546  H  H    . PHE A 1 70 ? 12.670  -2.746  15.323  1.00 0.00 ? 377 PHE A H    4  
ATOM   4547  H  HA   . PHE A 1 70 ? 14.026  -3.752  13.086  1.00 0.00 ? 377 PHE A HA   4  
ATOM   4548  H  HB2  . PHE A 1 70 ? 11.976  -5.137  12.811  1.00 0.00 ? 377 PHE A HB2  4  
ATOM   4549  H  HB3  . PHE A 1 70 ? 12.685  -5.228  14.442  1.00 0.00 ? 377 PHE A HB3  4  
ATOM   4550  H  HD1  . PHE A 1 70 ? 11.577  -3.826  16.263  1.00 0.00 ? 377 PHE A HD1  4  
ATOM   4551  H  HD2  . PHE A 1 70 ? 9.744   -4.592  12.496  1.00 0.00 ? 377 PHE A HD2  4  
ATOM   4552  H  HE1  . PHE A 1 70 ? 9.378   -3.281  17.222  1.00 0.00 ? 377 PHE A HE1  4  
ATOM   4553  H  HE2  . PHE A 1 70 ? 7.545   -4.044  13.450  1.00 0.00 ? 377 PHE A HE2  4  
ATOM   4554  H  HZ   . PHE A 1 70 ? 7.358   -3.387  15.815  1.00 0.00 ? 377 PHE A HZ   4  
ATOM   4555  N  N    . SER A 1 71 ? 13.301  -2.293  11.257  1.00 0.00 ? 378 SER A N    4  
ATOM   4556  C  CA   . SER A 1 71 ? 12.883  -1.517  10.114  1.00 0.00 ? 378 SER A CA   4  
ATOM   4557  C  C    . SER A 1 71 ? 12.885  -2.398  8.875   1.00 0.00 ? 378 SER A C    4  
ATOM   4558  O  O    . SER A 1 71 ? 13.899  -3.005  8.537   1.00 0.00 ? 378 SER A O    4  
ATOM   4559  C  CB   . SER A 1 71 ? 13.813  -0.316  9.929   1.00 0.00 ? 378 SER A CB   4  
ATOM   4560  O  OG   . SER A 1 71 ? 13.841  0.487   11.097  1.00 0.00 ? 378 SER A OG   4  
ATOM   4561  H  H    . SER A 1 71 ? 14.219  -2.636  11.289  1.00 0.00 ? 378 SER A H    4  
ATOM   4562  H  HA   . SER A 1 71 ? 11.877  -1.166  10.296  1.00 0.00 ? 378 SER A HA   4  
ATOM   4563  H  HB2  . SER A 1 71 ? 14.814  -0.667  9.725   1.00 0.00 ? 378 SER A HB2  4  
ATOM   4564  H  HB3  . SER A 1 71 ? 13.466  0.283   9.101   1.00 0.00 ? 378 SER A HB3  4  
ATOM   4565  H  HG   . SER A 1 71 ? 13.967  -0.076  11.870  1.00 0.00 ? 378 SER A HG   4  
ATOM   4566  N  N    . VAL A 1 72 ? 11.746  -2.499  8.220   1.00 0.00 ? 379 VAL A N    4  
ATOM   4567  C  CA   . VAL A 1 72 ? 11.647  -3.332  7.039   1.00 0.00 ? 379 VAL A CA   4  
ATOM   4568  C  C    . VAL A 1 72 ? 11.541  -2.474  5.795   1.00 0.00 ? 379 VAL A C    4  
ATOM   4569  O  O    . VAL A 1 72 ? 10.767  -1.518  5.739   1.00 0.00 ? 379 VAL A O    4  
ATOM   4570  C  CB   . VAL A 1 72 ? 10.435  -4.279  7.080   1.00 0.00 ? 379 VAL A CB   4  
ATOM   4571  C  CG1  . VAL A 1 72 ? 10.600  -5.413  6.076   1.00 0.00 ? 379 VAL A CG1  4  
ATOM   4572  C  CG2  . VAL A 1 72 ? 10.204  -4.822  8.486   1.00 0.00 ? 379 VAL A CG2  4  
ATOM   4573  H  H    . VAL A 1 72 ? 10.965  -1.998  8.529   1.00 0.00 ? 379 VAL A H    4  
ATOM   4574  H  HA   . VAL A 1 72 ? 12.546  -3.929  6.975   1.00 0.00 ? 379 VAL A HA   4  
ATOM   4575  H  HB   . VAL A 1 72 ? 9.574   -3.711  6.787   1.00 0.00 ? 379 VAL A HB   4  
ATOM   4576  H  HG11 . VAL A 1 72 ? 10.702  -5.002  5.083   1.00 0.00 ? 379 VAL A HG11 4  
ATOM   4577  H  HG12 . VAL A 1 72 ? 9.733   -6.054  6.113   1.00 0.00 ? 379 VAL A HG12 4  
ATOM   4578  H  HG13 . VAL A 1 72 ? 11.482  -5.987  6.321   1.00 0.00 ? 379 VAL A HG13 4  
ATOM   4579  H  HG21 . VAL A 1 72 ? 10.025  -4.001  9.164   1.00 0.00 ? 379 VAL A HG21 4  
ATOM   4580  H  HG22 . VAL A 1 72 ? 11.076  -5.372  8.808   1.00 0.00 ? 379 VAL A HG22 4  
ATOM   4581  H  HG23 . VAL A 1 72 ? 9.345   -5.479  8.482   1.00 0.00 ? 379 VAL A HG23 4  
ATOM   4582  N  N    . ARG A 1 73 ? 12.322  -2.835  4.810   1.00 0.00 ? 380 ARG A N    4  
ATOM   4583  C  CA   . ARG A 1 73 ? 12.294  -2.183  3.518   1.00 0.00 ? 380 ARG A CA   4  
ATOM   4584  C  C    . ARG A 1 73 ? 11.570  -3.091  2.539   1.00 0.00 ? 380 ARG A C    4  
ATOM   4585  O  O    . ARG A 1 73 ? 12.155  -4.026  1.992   1.00 0.00 ? 380 ARG A O    4  
ATOM   4586  C  CB   . ARG A 1 73 ? 13.716  -1.897  3.021   1.00 0.00 ? 380 ARG A CB   4  
ATOM   4587  C  CG   . ARG A 1 73 ? 13.765  -1.160  1.691   1.00 0.00 ? 380 ARG A CG   4  
ATOM   4588  C  CD   . ARG A 1 73 ? 15.172  -1.143  1.117   1.00 0.00 ? 380 ARG A CD   4  
ATOM   4589  N  NE   . ARG A 1 73 ? 15.272  -0.298  -0.075  1.00 0.00 ? 380 ARG A NE   4  
ATOM   4590  C  CZ   . ARG A 1 73 ? 16.086  -0.546  -1.105  1.00 0.00 ? 380 ARG A CZ   4  
ATOM   4591  N  NH1  . ARG A 1 73 ? 16.785  -1.676  -1.155  1.00 0.00 ? 380 ARG A NH1  4  
ATOM   4592  N  NH2  . ARG A 1 73 ? 16.173  0.323   -2.104  1.00 0.00 ? 380 ARG A NH2  4  
ATOM   4593  H  H    . ARG A 1 73 ? 12.926  -3.597  4.952   1.00 0.00 ? 380 ARG A H    4  
ATOM   4594  H  HA   . ARG A 1 73 ? 11.751  -1.256  3.615   1.00 0.00 ? 380 ARG A HA   4  
ATOM   4595  H  HB2  . ARG A 1 73 ? 14.227  -1.296  3.758   1.00 0.00 ? 380 ARG A HB2  4  
ATOM   4596  H  HB3  . ARG A 1 73 ? 14.240  -2.833  2.908   1.00 0.00 ? 380 ARG A HB3  4  
ATOM   4597  H  HG2  . ARG A 1 73 ? 13.107  -1.655  0.992   1.00 0.00 ? 380 ARG A HG2  4  
ATOM   4598  H  HG3  . ARG A 1 73 ? 13.434  -0.143  1.841   1.00 0.00 ? 380 ARG A HG3  4  
ATOM   4599  H  HD2  . ARG A 1 73 ? 15.849  -0.769  1.870   1.00 0.00 ? 380 ARG A HD2  4  
ATOM   4600  H  HD3  . ARG A 1 73 ? 15.450  -2.154  0.855   1.00 0.00 ? 380 ARG A HD3  4  
ATOM   4601  H  HE   . ARG A 1 73 ? 14.726  0.516   -0.093  1.00 0.00 ? 380 ARG A HE   4  
ATOM   4602  H  HH11 . ARG A 1 73 ? 16.704  -2.360  -0.420  1.00 0.00 ? 380 ARG A HH11 4  
ATOM   4603  H  HH12 . ARG A 1 73 ? 17.405  -1.851  -1.926  1.00 0.00 ? 380 ARG A HH12 4  
ATOM   4604  H  HH21 . ARG A 1 73 ? 15.628  1.167   -2.088  1.00 0.00 ? 380 ARG A HH21 4  
ATOM   4605  H  HH22 . ARG A 1 73 ? 16.784  0.141   -2.878  1.00 0.00 ? 380 ARG A HH22 4  
ATOM   4606  N  N    . LYS A 1 74 ? 10.287  -2.851  2.362   1.00 0.00 ? 381 LYS A N    4  
ATOM   4607  C  CA   . LYS A 1 74 ? 9.483   -3.699  1.507   1.00 0.00 ? 381 LYS A CA   4  
ATOM   4608  C  C    . LYS A 1 74 ? 9.407   -3.096  0.113   1.00 0.00 ? 381 LYS A C    4  
ATOM   4609  O  O    . LYS A 1 74 ? 8.878   -2.001  -0.077  1.00 0.00 ? 381 LYS A O    4  
ATOM   4610  C  CB   . LYS A 1 74 ? 8.085   -3.877  2.095   1.00 0.00 ? 381 LYS A CB   4  
ATOM   4611  C  CG   . LYS A 1 74 ? 7.379   -5.133  1.617   1.00 0.00 ? 381 LYS A CG   4  
ATOM   4612  C  CD   . LYS A 1 74 ? 5.988   -5.238  2.212   1.00 0.00 ? 381 LYS A CD   4  
ATOM   4613  C  CE   . LYS A 1 74 ? 5.328   -6.565  1.872   1.00 0.00 ? 381 LYS A CE   4  
ATOM   4614  N  NZ   . LYS A 1 74 ? 3.972   -6.682  2.470   1.00 0.00 ? 381 LYS A NZ   4  
ATOM   4615  H  H    . LYS A 1 74 ? 9.872   -2.083  2.806   1.00 0.00 ? 381 LYS A H    4  
ATOM   4616  H  HA   . LYS A 1 74 ? 9.970   -4.663  1.444   1.00 0.00 ? 381 LYS A HA   4  
ATOM   4617  H  HB2  . LYS A 1 74 ? 8.164   -3.921  3.172   1.00 0.00 ? 381 LYS A HB2  4  
ATOM   4618  H  HB3  . LYS A 1 74 ? 7.482   -3.023  1.822   1.00 0.00 ? 381 LYS A HB3  4  
ATOM   4619  H  HG2  . LYS A 1 74 ? 7.301   -5.106  0.540   1.00 0.00 ? 381 LYS A HG2  4  
ATOM   4620  H  HG3  . LYS A 1 74 ? 7.958   -5.998  1.918   1.00 0.00 ? 381 LYS A HG3  4  
ATOM   4621  H  HD2  . LYS A 1 74 ? 6.059   -5.148  3.284   1.00 0.00 ? 381 LYS A HD2  4  
ATOM   4622  H  HD3  . LYS A 1 74 ? 5.382   -4.434  1.820   1.00 0.00 ? 381 LYS A HD3  4  
ATOM   4623  H  HE2  . LYS A 1 74 ? 5.245   -6.647  0.798   1.00 0.00 ? 381 LYS A HE2  4  
ATOM   4624  H  HE3  . LYS A 1 74 ? 5.947   -7.366  2.247   1.00 0.00 ? 381 LYS A HE3  4  
ATOM   4625  H  HZ1  . LYS A 1 74 ? 4.028   -6.607  3.506   1.00 0.00 ? 381 LYS A HZ1  4  
ATOM   4626  H  HZ2  . LYS A 1 74 ? 3.550   -7.599  2.223   1.00 0.00 ? 381 LYS A HZ2  4  
ATOM   4627  H  HZ3  . LYS A 1 74 ? 3.355   -5.924  2.116   1.00 0.00 ? 381 LYS A HZ3  4  
ATOM   4628  N  N    . THR A 1 75 ? 9.949   -3.810  -0.851  1.00 0.00 ? 382 THR A N    4  
ATOM   4629  C  CA   . THR A 1 75 ? 10.036  -3.311  -2.209  1.00 0.00 ? 382 THR A CA   4  
ATOM   4630  C  C    . THR A 1 75 ? 9.154   -4.133  -3.133  1.00 0.00 ? 382 THR A C    4  
ATOM   4631  O  O    . THR A 1 75 ? 9.452   -5.290  -3.423  1.00 0.00 ? 382 THR A O    4  
ATOM   4632  C  CB   . THR A 1 75 ? 11.489  -3.355  -2.715  1.00 0.00 ? 382 THR A CB   4  
ATOM   4633  O  OG1  . THR A 1 75 ? 12.347  -2.680  -1.785  1.00 0.00 ? 382 THR A OG1  4  
ATOM   4634  C  CG2  . THR A 1 75 ? 11.615  -2.710  -4.089  1.00 0.00 ? 382 THR A CG2  4  
ATOM   4635  H  H    . THR A 1 75 ? 10.276  -4.714  -0.649  1.00 0.00 ? 382 THR A H    4  
ATOM   4636  H  HA   . THR A 1 75 ? 9.700   -2.284  -2.216  1.00 0.00 ? 382 THR A HA   4  
ATOM   4637  H  HB   . THR A 1 75 ? 11.794  -4.388  -2.787  1.00 0.00 ? 382 THR A HB   4  
ATOM   4638  H  HG1  . THR A 1 75 ? 11.915  -2.638  -0.924  1.00 0.00 ? 382 THR A HG1  4  
ATOM   4639  H  HG21 . THR A 1 75 ? 11.284  -1.684  -4.036  1.00 0.00 ? 382 THR A HG21 4  
ATOM   4640  H  HG22 . THR A 1 75 ? 11.005  -3.252  -4.797  1.00 0.00 ? 382 THR A HG22 4  
ATOM   4641  H  HG23 . THR A 1 75 ? 12.647  -2.741  -4.408  1.00 0.00 ? 382 THR A HG23 4  
ATOM   4642  N  N    . ALA A 1 76 ? 8.065   -3.542  -3.585  1.00 0.00 ? 383 ALA A N    4  
ATOM   4643  C  CA   . ALA A 1 76 ? 7.162   -4.230  -4.482  1.00 0.00 ? 383 ALA A CA   4  
ATOM   4644  C  C    . ALA A 1 76 ? 7.316   -3.703  -5.895  1.00 0.00 ? 383 ALA A C    4  
ATOM   4645  O  O    . ALA A 1 76 ? 7.609   -2.521  -6.108  1.00 0.00 ? 383 ALA A O    4  
ATOM   4646  C  CB   . ALA A 1 76 ? 5.727   -4.077  -4.013  1.00 0.00 ? 383 ALA A CB   4  
ATOM   4647  H  H    . ALA A 1 76 ? 7.865   -2.624  -3.314  1.00 0.00 ? 383 ALA A H    4  
ATOM   4648  H  HA   . ALA A 1 76 ? 7.413   -5.280  -4.470  1.00 0.00 ? 383 ALA A HA   4  
ATOM   4649  H  HB1  . ALA A 1 76 ? 5.411   -3.054  -4.147  1.00 0.00 ? 383 ALA A HB1  4  
ATOM   4650  H  HB2  . ALA A 1 76 ? 5.661   -4.341  -2.969  1.00 0.00 ? 383 ALA A HB2  4  
ATOM   4651  H  HB3  . ALA A 1 76 ? 5.088   -4.731  -4.591  1.00 0.00 ? 383 ALA A HB3  4  
ATOM   4652  N  N    . TYR A 1 77 ? 7.139   -4.585  -6.858  1.00 0.00 ? 384 TYR A N    4  
ATOM   4653  C  CA   . TYR A 1 77 ? 7.149   -4.192  -8.248  1.00 0.00 ? 384 TYR A CA   4  
ATOM   4654  C  C    . TYR A 1 77 ? 5.750   -4.355  -8.811  1.00 0.00 ? 384 TYR A C    4  
ATOM   4655  O  O    . TYR A 1 77 ? 5.016   -5.246  -8.402  1.00 0.00 ? 384 TYR A O    4  
ATOM   4656  C  CB   . TYR A 1 77 ? 8.139   -5.038  -9.060  1.00 0.00 ? 384 TYR A CB   4  
ATOM   4657  C  CG   . TYR A 1 77 ? 9.582   -4.909  -8.619  1.00 0.00 ? 384 TYR A CG   4  
ATOM   4658  C  CD1  . TYR A 1 77 ? 10.125  -3.678  -8.272  1.00 0.00 ? 384 TYR A CD1  4  
ATOM   4659  C  CD2  . TYR A 1 77 ? 10.406  -6.024  -8.568  1.00 0.00 ? 384 TYR A CD2  4  
ATOM   4660  C  CE1  . TYR A 1 77 ? 11.447  -3.566  -7.882  1.00 0.00 ? 384 TYR A CE1  4  
ATOM   4661  C  CE2  . TYR A 1 77 ? 11.728  -5.921  -8.178  1.00 0.00 ? 384 TYR A CE2  4  
ATOM   4662  C  CZ   . TYR A 1 77 ? 12.244  -4.690  -7.837  1.00 0.00 ? 384 TYR A CZ   4  
ATOM   4663  O  OH   . TYR A 1 77 ? 13.561  -4.582  -7.455  1.00 0.00 ? 384 TYR A OH   4  
ATOM   4664  H  H    . TYR A 1 77 ? 6.980   -5.527  -6.625  1.00 0.00 ? 384 TYR A H    4  
ATOM   4665  H  HA   . TYR A 1 77 ? 7.434   -3.153  -8.304  1.00 0.00 ? 384 TYR A HA   4  
ATOM   4666  H  HB2  . TYR A 1 77 ? 7.861   -6.087  -8.969  1.00 0.00 ? 384 TYR A HB2  4  
ATOM   4667  H  HB3  . TYR A 1 77 ? 8.083   -4.735  -10.107 1.00 0.00 ? 384 TYR A HB3  4  
ATOM   4668  H  HD1  . TYR A 1 77 ? 9.499   -2.798  -8.307  1.00 0.00 ? 384 TYR A HD1  4  
ATOM   4669  H  HD2  . TYR A 1 77 ? 10.001  -6.989  -8.836  1.00 0.00 ? 384 TYR A HD2  4  
ATOM   4670  H  HE1  . TYR A 1 77 ? 11.851  -2.600  -7.616  1.00 0.00 ? 384 TYR A HE1  4  
ATOM   4671  H  HE2  . TYR A 1 77 ? 12.351  -6.802  -8.143  1.00 0.00 ? 384 TYR A HE2  4  
ATOM   4672  H  HH   . TYR A 1 77 ? 13.623  -4.075  -6.640  1.00 0.00 ? 384 TYR A HH   4  
ATOM   4673  N  N    . CYS A 1 78 ? 5.380   -3.476  -9.728  1.00 0.00 ? 385 CYS A N    4  
ATOM   4674  C  CA   . CYS A 1 78 ? 4.075   -3.595  -10.380 1.00 0.00 ? 385 CYS A CA   4  
ATOM   4675  C  C    . CYS A 1 78 ? 4.011   -4.906  -11.159 1.00 0.00 ? 385 CYS A C    4  
ATOM   4676  O  O    . CYS A 1 78 ? 5.036   -5.414  -11.603 1.00 0.00 ? 385 CYS A O    4  
ATOM   4677  C  CB   . CYS A 1 78 ? 3.805   -2.398  -11.308 1.00 0.00 ? 385 CYS A CB   4  
ATOM   4678  S  SG   . CYS A 1 78 ? 5.060   -2.103  -12.585 1.00 0.00 ? 385 CYS A SG   4  
ATOM   4679  H  H    . CYS A 1 78 ? 5.976   -2.715  -9.933  1.00 0.00 ? 385 CYS A H    4  
ATOM   4680  H  HA   . CYS A 1 78 ? 3.324   -3.616  -9.608  1.00 0.00 ? 385 CYS A HA   4  
ATOM   4681  H  HB2  . CYS A 1 78 ? 2.865   -2.557  -11.813 1.00 0.00 ? 385 CYS A HB2  4  
ATOM   4682  H  HB3  . CYS A 1 78 ? 3.733   -1.503  -10.709 1.00 0.00 ? 385 CYS A HB3  4  
ATOM   4683  N  N    . ASP A 1 79 ? 2.816   -5.462  -11.305 1.00 0.00 ? 386 ASP A N    4  
ATOM   4684  C  CA   . ASP A 1 79 ? 2.663   -6.784  -11.917 1.00 0.00 ? 386 ASP A CA   4  
ATOM   4685  C  C    . ASP A 1 79 ? 3.234   -6.809  -13.335 1.00 0.00 ? 386 ASP A C    4  
ATOM   4686  O  O    . ASP A 1 79 ? 3.902   -7.761  -13.732 1.00 0.00 ? 386 ASP A O    4  
ATOM   4687  C  CB   . ASP A 1 79 ? 1.193   -7.194  -11.943 1.00 0.00 ? 386 ASP A CB   4  
ATOM   4688  C  CG   . ASP A 1 79 ? 1.023   -8.678  -12.212 1.00 0.00 ? 386 ASP A CG   4  
ATOM   4689  O  OD1  . ASP A 1 79 ? 1.017   -9.081  -13.394 1.00 0.00 ? 386 ASP A OD1  4  
ATOM   4690  O  OD2  . ASP A 1 79 ? 0.891   -9.450  -11.240 1.00 0.00 ? 386 ASP A OD2  4  
ATOM   4691  H  H    . ASP A 1 79 ? 2.019   -4.986  -10.987 1.00 0.00 ? 386 ASP A H    4  
ATOM   4692  H  HA   . ASP A 1 79 ? 3.212   -7.490  -11.312 1.00 0.00 ? 386 ASP A HA   4  
ATOM   4693  H  HB2  . ASP A 1 79 ? 0.743   -6.965  -10.977 1.00 0.00 ? 386 ASP A HB2  4  
ATOM   4694  H  HB3  . ASP A 1 79 ? 0.685   -6.640  -12.731 1.00 0.00 ? 386 ASP A HB3  4  
ATOM   4695  N  N    . VAL A 1 80 ? 3.001   -5.735  -14.082 1.00 0.00 ? 387 VAL A N    4  
ATOM   4696  C  CA   . VAL A 1 80 ? 3.470   -5.638  -15.461 1.00 0.00 ? 387 VAL A CA   4  
ATOM   4697  C  C    . VAL A 1 80 ? 4.948   -5.242  -15.533 1.00 0.00 ? 387 VAL A C    4  
ATOM   4698  O  O    . VAL A 1 80 ? 5.480   -4.985  -16.615 1.00 0.00 ? 387 VAL A O    4  
ATOM   4699  C  CB   . VAL A 1 80 ? 2.633   -4.624  -16.269 1.00 0.00 ? 387 VAL A CB   4  
ATOM   4700  C  CG1  . VAL A 1 80 ? 1.195   -5.098  -16.394 1.00 0.00 ? 387 VAL A CG1  4  
ATOM   4701  C  CG2  . VAL A 1 80 ? 2.684   -3.246  -15.625 1.00 0.00 ? 387 VAL A CG2  4  
ATOM   4702  H  H    . VAL A 1 80 ? 2.494   -4.991  -13.695 1.00 0.00 ? 387 VAL A H    4  
ATOM   4703  H  HA   . VAL A 1 80 ? 3.349   -6.608  -15.917 1.00 0.00 ? 387 VAL A HA   4  
ATOM   4704  H  HB   . VAL A 1 80 ? 3.053   -4.550  -17.262 1.00 0.00 ? 387 VAL A HB   4  
ATOM   4705  H  HG11 . VAL A 1 80 ? 1.170   -6.043  -16.916 1.00 0.00 ? 387 VAL A HG11 4  
ATOM   4706  H  HG12 . VAL A 1 80 ? 0.620   -4.367  -16.944 1.00 0.00 ? 387 VAL A HG12 4  
ATOM   4707  H  HG13 . VAL A 1 80 ? 0.772   -5.221  -15.408 1.00 0.00 ? 387 VAL A HG13 4  
ATOM   4708  H  HG21 . VAL A 1 80 ? 2.107   -2.551  -16.217 1.00 0.00 ? 387 VAL A HG21 4  
ATOM   4709  H  HG22 . VAL A 1 80 ? 3.708   -2.911  -15.570 1.00 0.00 ? 387 VAL A HG22 4  
ATOM   4710  H  HG23 . VAL A 1 80 ? 2.268   -3.301  -14.629 1.00 0.00 ? 387 VAL A HG23 4  
ATOM   4711  N  N    . HIS A 1 81 ? 5.604   -5.199  -14.380 1.00 0.00 ? 388 HIS A N    4  
ATOM   4712  C  CA   . HIS A 1 81 ? 7.018   -4.848  -14.307 1.00 0.00 ? 388 HIS A CA   4  
ATOM   4713  C  C    . HIS A 1 81 ? 7.868   -6.049  -14.694 1.00 0.00 ? 388 HIS A C    4  
ATOM   4714  O  O    . HIS A 1 81 ? 8.899   -5.909  -15.346 1.00 0.00 ? 388 HIS A O    4  
ATOM   4715  C  CB   . HIS A 1 81 ? 7.363   -4.396  -12.880 1.00 0.00 ? 388 HIS A CB   4  
ATOM   4716  C  CG   . HIS A 1 81 ? 8.728   -3.806  -12.701 1.00 0.00 ? 388 HIS A CG   4  
ATOM   4717  N  ND1  . HIS A 1 81 ? 8.934   -2.460  -12.423 1.00 0.00 ? 388 HIS A ND1  4  
ATOM   4718  C  CD2  . HIS A 1 81 ? 9.951   -4.386  -12.700 1.00 0.00 ? 388 HIS A CD2  4  
ATOM   4719  C  CE1  . HIS A 1 81 ? 10.241  -2.253  -12.266 1.00 0.00 ? 388 HIS A CE1  4  
ATOM   4720  N  NE2  . HIS A 1 81 ? 10.869  -3.402  -12.427 1.00 0.00 ? 388 HIS A NE2  4  
ATOM   4721  H  H    . HIS A 1 81 ? 5.126   -5.427  -13.552 1.00 0.00 ? 388 HIS A H    4  
ATOM   4722  H  HA   . HIS A 1 81 ? 7.206   -4.039  -14.997 1.00 0.00 ? 388 HIS A HA   4  
ATOM   4723  H  HB2  . HIS A 1 81 ? 6.646   -3.649  -12.572 1.00 0.00 ? 388 HIS A HB2  4  
ATOM   4724  H  HB3  . HIS A 1 81 ? 7.281   -5.248  -12.221 1.00 0.00 ? 388 HIS A HB3  4  
ATOM   4725  H  HD2  . HIS A 1 81 ? 10.163  -5.428  -12.879 1.00 0.00 ? 388 HIS A HD2  4  
ATOM   4726  H  HE1  . HIS A 1 81 ? 10.706  -1.305  -12.042 1.00 0.00 ? 388 HIS A HE1  4  
ATOM   4727  H  HE2  . HIS A 1 81 ? 11.825  -3.559  -12.239 1.00 0.00 ? 388 HIS A HE2  4  
ATOM   4728  N  N    . THR A 1 82 ? 7.414   -7.220  -14.287 1.00 0.00 ? 389 THR A N    4  
ATOM   4729  C  CA   . THR A 1 82 ? 8.137   -8.454  -14.528 1.00 0.00 ? 389 THR A CA   4  
ATOM   4730  C  C    . THR A 1 82 ? 7.331   -9.353  -15.472 1.00 0.00 ? 389 THR A C    4  
ATOM   4731  O  O    . THR A 1 82 ? 6.151   -9.595  -15.219 1.00 0.00 ? 389 THR A O    4  
ATOM   4732  C  CB   . THR A 1 82 ? 8.396   -9.180  -13.191 1.00 0.00 ? 389 THR A CB   4  
ATOM   4733  O  OG1  . THR A 1 82 ? 8.856   -8.236  -12.211 1.00 0.00 ? 389 THR A OG1  4  
ATOM   4734  C  CG2  . THR A 1 82 ? 9.433   -10.284 -13.342 1.00 0.00 ? 389 THR A CG2  4  
ATOM   4735  H  H    . THR A 1 82 ? 6.560   -7.261  -13.808 1.00 0.00 ? 389 THR A H    4  
ATOM   4736  H  HA   . THR A 1 82 ? 9.086   -8.213  -14.984 1.00 0.00 ? 389 THR A HA   4  
ATOM   4737  H  HB   . THR A 1 82 ? 7.470   -9.619  -12.853 1.00 0.00 ? 389 THR A HB   4  
ATOM   4738  H  HG1  . THR A 1 82 ? 9.197   -8.715  -11.448 1.00 0.00 ? 389 THR A HG1  4  
ATOM   4739  H  HG21 . THR A 1 82 ? 9.090   -11.004 -14.071 1.00 0.00 ? 389 THR A HG21 4  
ATOM   4740  H  HG22 . THR A 1 82 ? 9.575   -10.774 -12.389 1.00 0.00 ? 389 THR A HG22 4  
ATOM   4741  H  HG23 . THR A 1 82 ? 10.369  -9.857  -13.669 1.00 0.00 ? 389 THR A HG23 4  
ATOM   4742  N  N    . PRO A 1 83 ? 7.973   -9.842  -16.561 1.00 0.00 ? 390 PRO A N    4  
ATOM   4743  C  CA   . PRO A 1 83 ? 7.346   -10.629 -17.638 1.00 0.00 ? 390 PRO A CA   4  
ATOM   4744  C  C    . PRO A 1 83 ? 6.097   -11.419 -17.230 1.00 0.00 ? 390 PRO A C    4  
ATOM   4745  O  O    . PRO A 1 83 ? 6.197   -12.508 -16.657 1.00 0.00 ? 390 PRO A O    4  
ATOM   4746  C  CB   . PRO A 1 83 ? 8.479   -11.569 -18.020 1.00 0.00 ? 390 PRO A CB   4  
ATOM   4747  C  CG   . PRO A 1 83 ? 9.716   -10.746 -17.861 1.00 0.00 ? 390 PRO A CG   4  
ATOM   4748  C  CD   . PRO A 1 83 ? 9.411   -9.675  -16.835 1.00 0.00 ? 390 PRO A CD   4  
ATOM   4749  H  HA   . PRO A 1 83 ? 7.109   -10.015 -18.491 1.00 0.00 ? 390 PRO A HA   4  
ATOM   4750  H  HB2  . PRO A 1 83 ? 8.479   -12.421 -17.357 1.00 0.00 ? 390 PRO A HB2  4  
ATOM   4751  H  HB3  . PRO A 1 83 ? 8.351   -11.897 -19.040 1.00 0.00 ? 390 PRO A HB3  4  
ATOM   4752  H  HG2  . PRO A 1 83 ? 10.525  -11.372 -17.515 1.00 0.00 ? 390 PRO A HG2  4  
ATOM   4753  H  HG3  . PRO A 1 83 ? 9.976   -10.293 -18.807 1.00 0.00 ? 390 PRO A HG3  4  
ATOM   4754  H  HD2  . PRO A 1 83 ? 9.994   -9.835  -15.939 1.00 0.00 ? 390 PRO A HD2  4  
ATOM   4755  H  HD3  . PRO A 1 83 ? 9.612   -8.695  -17.244 1.00 0.00 ? 390 PRO A HD3  4  
ATOM   4756  N  N    . PRO A 1 84 ? 4.903   -10.863 -17.512 1.00 0.00 ? 391 PRO A N    4  
ATOM   4757  C  CA   . PRO A 1 84 ? 3.624   -11.511 -17.242 1.00 0.00 ? 391 PRO A CA   4  
ATOM   4758  C  C    . PRO A 1 84 ? 3.207   -12.424 -18.389 1.00 0.00 ? 391 PRO A C    4  
ATOM   4759  O  O    . PRO A 1 84 ? 3.016   -11.973 -19.519 1.00 0.00 ? 391 PRO A O    4  
ATOM   4760  C  CB   . PRO A 1 84 ? 2.639   -10.335 -17.112 1.00 0.00 ? 391 PRO A CB   4  
ATOM   4761  C  CG   . PRO A 1 84 ? 3.418   -9.093  -17.437 1.00 0.00 ? 391 PRO A CG   4  
ATOM   4762  C  CD   . PRO A 1 84 ? 4.692   -9.540  -18.098 1.00 0.00 ? 391 PRO A CD   4  
ATOM   4763  H  HA   . PRO A 1 84 ? 3.647   -12.074 -16.320 1.00 0.00 ? 391 PRO A HA   4  
ATOM   4764  H  HB2  . PRO A 1 84 ? 1.822   -10.475 -17.804 1.00 0.00 ? 391 PRO A HB2  4  
ATOM   4765  H  HB3  . PRO A 1 84 ? 2.254   -10.303 -16.103 1.00 0.00 ? 391 PRO A HB3  4  
ATOM   4766  H  HG2  . PRO A 1 84 ? 2.849   -8.470  -18.112 1.00 0.00 ? 391 PRO A HG2  4  
ATOM   4767  H  HG3  . PRO A 1 84 ? 3.639   -8.553  -16.528 1.00 0.00 ? 391 PRO A HG3  4  
ATOM   4768  H  HD2  . PRO A 1 84 ? 4.561   -9.606  -19.168 1.00 0.00 ? 391 PRO A HD2  4  
ATOM   4769  H  HD3  . PRO A 1 84 ? 5.503   -8.871  -17.851 1.00 0.00 ? 391 PRO A HD3  4  
ATOM   4770  N  N    . GLY A 1 85 ? 3.095   -13.715 -18.106 1.00 0.00 ? 392 GLY A N    4  
ATOM   4771  C  CA   . GLY A 1 85 ? 2.759   -14.673 -19.143 1.00 0.00 ? 392 GLY A CA   4  
ATOM   4772  C  C    . GLY A 1 85 ? 3.992   -15.107 -19.904 1.00 0.00 ? 392 GLY A C    4  
ATOM   4773  O  O    . GLY A 1 85 ? 3.936   -15.973 -20.776 1.00 0.00 ? 392 GLY A O    4  
ATOM   4774  H  H    . GLY A 1 85 ? 3.248   -14.022 -17.185 1.00 0.00 ? 392 GLY A H    4  
ATOM   4775  H  HA2  . GLY A 1 85 ? 2.299   -15.539 -18.691 1.00 0.00 ? 392 GLY A HA2  4  
ATOM   4776  H  HA3  . GLY A 1 85 ? 2.063   -14.220 -19.832 1.00 0.00 ? 392 GLY A HA3  4  
ATOM   4777  N  N    . SER A 1 86 ? 5.109   -14.489 -19.560 1.00 0.00 ? 393 SER A N    4  
ATOM   4778  C  CA   . SER A 1 86 ? 6.386   -14.787 -20.173 1.00 0.00 ? 393 SER A CA   4  
ATOM   4779  C  C    . SER A 1 86 ? 7.405   -15.109 -19.082 1.00 0.00 ? 393 SER A C    4  
ATOM   4780  O  O    . SER A 1 86 ? 7.032   -15.573 -18.002 1.00 0.00 ? 393 SER A O    4  
ATOM   4781  C  CB   . SER A 1 86 ? 6.835   -13.594 -21.022 1.00 0.00 ? 393 SER A CB   4  
ATOM   4782  O  OG   . SER A 1 86 ? 5.854   -13.276 -21.997 1.00 0.00 ? 393 SER A OG   4  
ATOM   4783  H  H    . SER A 1 86 ? 5.072   -13.812 -18.854 1.00 0.00 ? 393 SER A H    4  
ATOM   4784  H  HA   . SER A 1 86 ? 6.262   -15.652 -20.807 1.00 0.00 ? 393 SER A HA   4  
ATOM   4785  H  HB2  . SER A 1 86 ? 6.984   -12.736 -20.385 1.00 0.00 ? 393 SER A HB2  4  
ATOM   4786  H  HB3  . SER A 1 86 ? 7.757   -13.837 -21.524 1.00 0.00 ? 393 SER A HB3  4  
ATOM   4787  H  HG   . SER A 1 86 ? 4.987   -13.544 -21.673 1.00 0.00 ? 393 SER A HG   4  
ATOM   4788  N  N    . THR A 1 87 ? 8.677   -14.851 -19.345 1.00 0.00 ? 394 THR A N    4  
ATOM   4789  C  CA   . THR A 1 87 ? 9.731   -15.215 -18.414 1.00 0.00 ? 394 THR A CA   4  
ATOM   4790  C  C    . THR A 1 87 ? 11.051  -14.554 -18.816 1.00 0.00 ? 394 THR A C    4  
ATOM   4791  O  O    . THR A 1 87 ? 11.635  -13.837 -17.976 1.00 0.00 ? 394 THR A O    4  
ATOM   4792  C  CB   . THR A 1 87 ? 9.891   -16.760 -18.305 1.00 0.00 ? 394 THR A CB   4  
ATOM   4793  O  OG1  . THR A 1 87 ? 10.918  -17.097 -17.363 1.00 0.00 ? 394 THR A OG1  4  
ATOM   4794  C  CG2  . THR A 1 87 ? 10.204  -17.396 -19.654 1.00 0.00 ? 394 THR A CG2  4  
ATOM   4795  O  OXT  . THR A 1 87 ? 11.479  -14.716 -19.980 1.00 0.00 ? 394 THR A OXT  4  
ATOM   4796  H  H    . THR A 1 87 ? 8.912   -14.380 -20.173 1.00 0.00 ? 394 THR A H    4  
ATOM   4797  H  HA   . THR A 1 87 ? 9.446   -14.839 -17.441 1.00 0.00 ? 394 THR A HA   4  
ATOM   4798  H  HB   . THR A 1 87 ? 8.954   -17.169 -17.949 1.00 0.00 ? 394 THR A HB   4  
ATOM   4799  H  HG1  . THR A 1 87 ? 10.521  -17.542 -16.604 1.00 0.00 ? 394 THR A HG1  4  
ATOM   4800  H  HG21 . THR A 1 87 ? 10.322  -18.463 -19.532 1.00 0.00 ? 394 THR A HG21 4  
ATOM   4801  H  HG22 . THR A 1 87 ? 11.117  -16.975 -20.047 1.00 0.00 ? 394 THR A HG22 4  
ATOM   4802  H  HG23 . THR A 1 87 ? 9.393   -17.201 -20.341 1.00 0.00 ? 394 THR A HG23 4  
HETATM 4803  ZN ZN   . ZN  B 2 .  ? -6.887  -0.980  -5.732  1.00 0.00 ? 401 ZN  A ZN   4  
HETATM 4804  ZN ZN   . ZN  C 2 .  ? 7.227   -1.058  -12.457 1.00 0.00 ? 402 ZN  A ZN   4  
ATOM   4805  N  N    . MET A 1 9  ? 9.282   28.893  -16.164 1.00 0.00 ? 316 MET A N    5  
ATOM   4806  C  CA   . MET A 1 9  ? 9.447   28.989  -14.698 1.00 0.00 ? 316 MET A CA   5  
ATOM   4807  C  C    . MET A 1 9  ? 10.033  27.683  -14.175 1.00 0.00 ? 316 MET A C    5  
ATOM   4808  O  O    . MET A 1 9  ? 9.598   26.602  -14.570 1.00 0.00 ? 316 MET A O    5  
ATOM   4809  C  CB   . MET A 1 9  ? 8.093   29.266  -14.034 1.00 0.00 ? 316 MET A CB   5  
ATOM   4810  C  CG   . MET A 1 9  ? 8.178   30.096  -12.759 1.00 0.00 ? 316 MET A CG   5  
ATOM   4811  S  SD   . MET A 1 9  ? 9.109   29.293  -11.441 1.00 0.00 ? 316 MET A SD   5  
ATOM   4812  C  CE   . MET A 1 9  ? 9.021   30.539  -10.159 1.00 0.00 ? 316 MET A CE   5  
ATOM   4813  H  H    . MET A 1 9  ? 8.663   28.094  -16.401 1.00 0.00 ? 316 MET A H    5  
ATOM   4814  H  HA   . MET A 1 9  ? 10.130  29.796  -14.478 1.00 0.00 ? 316 MET A HA   5  
ATOM   4815  H  HB2  . MET A 1 9  ? 7.462   29.790  -14.734 1.00 0.00 ? 316 MET A HB2  5  
ATOM   4816  H  HB3  . MET A 1 9  ? 7.631   28.321  -13.788 1.00 0.00 ? 316 MET A HB3  5  
ATOM   4817  H  HG2  . MET A 1 9  ? 8.657   31.036  -12.993 1.00 0.00 ? 316 MET A HG2  5  
ATOM   4818  H  HG3  . MET A 1 9  ? 7.175   30.288  -12.406 1.00 0.00 ? 316 MET A HG3  5  
ATOM   4819  H  HE1  . MET A 1 9  ? 9.553   30.195  -9.285  1.00 0.00 ? 316 MET A HE1  5  
ATOM   4820  H  HE2  . MET A 1 9  ? 7.986   30.720  -9.905  1.00 0.00 ? 316 MET A HE2  5  
ATOM   4821  H  HE3  . MET A 1 9  ? 9.468   31.455  -10.516 1.00 0.00 ? 316 MET A HE3  5  
ATOM   4822  N  N    . ASN A 1 10 ? 11.016  27.779  -13.286 1.00 0.00 ? 317 ASN A N    5  
ATOM   4823  C  CA   . ASN A 1 10 ? 11.674  26.599  -12.750 1.00 0.00 ? 317 ASN A CA   5  
ATOM   4824  C  C    . ASN A 1 10 ? 10.920  26.122  -11.520 1.00 0.00 ? 317 ASN A C    5  
ATOM   4825  O  O    . ASN A 1 10 ? 11.368  26.293  -10.383 1.00 0.00 ? 317 ASN A O    5  
ATOM   4826  C  CB   . ASN A 1 10 ? 13.136  26.902  -12.400 1.00 0.00 ? 317 ASN A CB   5  
ATOM   4827  C  CG   . ASN A 1 10 ? 13.917  25.660  -11.997 1.00 0.00 ? 317 ASN A CG   5  
ATOM   4828  O  OD1  . ASN A 1 10 ? 13.672  24.563  -12.500 1.00 0.00 ? 317 ASN A OD1  5  
ATOM   4829  N  ND2  . ASN A 1 10 ? 14.867  25.823  -11.088 1.00 0.00 ? 317 ASN A ND2  5  
ATOM   4830  H  H    . ASN A 1 10 ? 11.279  28.660  -12.955 1.00 0.00 ? 317 ASN A H    5  
ATOM   4831  H  HA   . ASN A 1 10 ? 11.641  25.827  -13.505 1.00 0.00 ? 317 ASN A HA   5  
ATOM   4832  H  HB2  . ASN A 1 10 ? 13.619  27.343  -13.259 1.00 0.00 ? 317 ASN A HB2  5  
ATOM   4833  H  HB3  . ASN A 1 10 ? 13.163  27.603  -11.580 1.00 0.00 ? 317 ASN A HB3  5  
ATOM   4834  H  HD21 . ASN A 1 10 ? 15.014  26.726  -10.729 1.00 0.00 ? 317 ASN A HD21 5  
ATOM   4835  H  HD22 . ASN A 1 10 ? 15.379  25.038  -10.805 1.00 0.00 ? 317 ASN A HD22 5  
ATOM   4836  N  N    . ILE A 1 11 ? 9.745   25.570  -11.752 1.00 0.00 ? 318 ILE A N    5  
ATOM   4837  C  CA   . ILE A 1 11 ? 8.892   25.136  -10.670 1.00 0.00 ? 318 ILE A CA   5  
ATOM   4838  C  C    . ILE A 1 11 ? 8.548   23.657  -10.819 1.00 0.00 ? 318 ILE A C    5  
ATOM   4839  O  O    . ILE A 1 11 ? 7.890   23.254  -11.777 1.00 0.00 ? 318 ILE A O    5  
ATOM   4840  C  CB   . ILE A 1 11 ? 7.614   26.027  -10.578 1.00 0.00 ? 318 ILE A CB   5  
ATOM   4841  C  CG1  . ILE A 1 11 ? 6.711   25.619  -9.394  1.00 0.00 ? 318 ILE A CG1  5  
ATOM   4842  C  CG2  . ILE A 1 11 ? 6.834   26.020  -11.889 1.00 0.00 ? 318 ILE A CG2  5  
ATOM   4843  C  CD1  . ILE A 1 11 ? 5.737   24.490  -9.682  1.00 0.00 ? 318 ILE A CD1  5  
ATOM   4844  H  H    . ILE A 1 11 ? 9.445   25.450  -12.680 1.00 0.00 ? 318 ILE A H    5  
ATOM   4845  H  HA   . ILE A 1 11 ? 9.449   25.263  -9.757  1.00 0.00 ? 318 ILE A HA   5  
ATOM   4846  H  HB   . ILE A 1 11 ? 7.947   27.041  -10.414 1.00 0.00 ? 318 ILE A HB   5  
ATOM   4847  H  HG12 . ILE A 1 11 ? 7.336   25.302  -8.575  1.00 0.00 ? 318 ILE A HG12 5  
ATOM   4848  H  HG13 . ILE A 1 11 ? 6.137   26.480  -9.083  1.00 0.00 ? 318 ILE A HG13 5  
ATOM   4849  H  HG21 . ILE A 1 11 ? 7.471   26.368  -12.689 1.00 0.00 ? 318 ILE A HG21 5  
ATOM   4850  H  HG22 . ILE A 1 11 ? 5.978   26.672  -11.801 1.00 0.00 ? 318 ILE A HG22 5  
ATOM   4851  H  HG23 . ILE A 1 11 ? 6.501   25.016  -12.107 1.00 0.00 ? 318 ILE A HG23 5  
ATOM   4852  H  HD11 . ILE A 1 11 ? 5.149   24.288  -8.799  1.00 0.00 ? 318 ILE A HD11 5  
ATOM   4853  H  HD12 . ILE A 1 11 ? 6.288   23.603  -9.958  1.00 0.00 ? 318 ILE A HD12 5  
ATOM   4854  H  HD13 . ILE A 1 11 ? 5.084   24.775  -10.494 1.00 0.00 ? 318 ILE A HD13 5  
ATOM   4855  N  N    . PRO A 1 12 ? 9.045   22.821  -9.897  1.00 0.00 ? 319 PRO A N    5  
ATOM   4856  C  CA   . PRO A 1 12 ? 8.716   21.408  -9.859  1.00 0.00 ? 319 PRO A CA   5  
ATOM   4857  C  C    . PRO A 1 12 ? 7.471   21.134  -9.014  1.00 0.00 ? 319 PRO A C    5  
ATOM   4858  O  O    . PRO A 1 12 ? 7.511   21.221  -7.786  1.00 0.00 ? 319 PRO A O    5  
ATOM   4859  C  CB   . PRO A 1 12 ? 9.955   20.786  -9.220  1.00 0.00 ? 319 PRO A CB   5  
ATOM   4860  C  CG   . PRO A 1 12 ? 10.532  21.854  -8.344  1.00 0.00 ? 319 PRO A CG   5  
ATOM   4861  C  CD   . PRO A 1 12 ? 9.996   23.184  -8.830  1.00 0.00 ? 319 PRO A CD   5  
ATOM   4862  H  HA   . PRO A 1 12 ? 8.574   21.006  -10.850 1.00 0.00 ? 319 PRO A HA   5  
ATOM   4863  H  HB2  . PRO A 1 12 ? 9.667   19.918  -8.647  1.00 0.00 ? 319 PRO A HB2  5  
ATOM   4864  H  HB3  . PRO A 1 12 ? 10.650  20.494  -9.994  1.00 0.00 ? 319 PRO A HB3  5  
ATOM   4865  H  HG2  . PRO A 1 12 ? 10.230  21.685  -7.321  1.00 0.00 ? 319 PRO A HG2  5  
ATOM   4866  H  HG3  . PRO A 1 12 ? 11.610  21.839  -8.418  1.00 0.00 ? 319 PRO A HG3  5  
ATOM   4867  H  HD2  . PRO A 1 12 ? 9.493   23.702  -8.028  1.00 0.00 ? 319 PRO A HD2  5  
ATOM   4868  H  HD3  . PRO A 1 12 ? 10.800  23.790  -9.221  1.00 0.00 ? 319 PRO A HD3  5  
ATOM   4869  N  N    . PRO A 1 13 ? 6.338   20.839  -9.667  1.00 0.00 ? 320 PRO A N    5  
ATOM   4870  C  CA   . PRO A 1 13 ? 5.087   20.526  -8.974  1.00 0.00 ? 320 PRO A CA   5  
ATOM   4871  C  C    . PRO A 1 13 ? 5.081   19.119  -8.378  1.00 0.00 ? 320 PRO A C    5  
ATOM   4872  O  O    . PRO A 1 13 ? 6.067   18.391  -8.457  1.00 0.00 ? 320 PRO A O    5  
ATOM   4873  C  CB   . PRO A 1 13 ? 4.043   20.636  -10.084 1.00 0.00 ? 320 PRO A CB   5  
ATOM   4874  C  CG   . PRO A 1 13 ? 4.786   20.280  -11.324 1.00 0.00 ? 320 PRO A CG   5  
ATOM   4875  C  CD   . PRO A 1 13 ? 6.182   20.805  -11.134 1.00 0.00 ? 320 PRO A CD   5  
ATOM   4876  H  HA   . PRO A 1 13 ? 4.871   21.246  -8.199  1.00 0.00 ? 320 PRO A HA   5  
ATOM   4877  H  HB2  . PRO A 1 13 ? 3.235   19.944  -9.891  1.00 0.00 ? 320 PRO A HB2  5  
ATOM   4878  H  HB3  . PRO A 1 13 ? 3.661   21.645  -10.127 1.00 0.00 ? 320 PRO A HB3  5  
ATOM   4879  H  HG2  . PRO A 1 13 ? 4.801   19.208  -11.449 1.00 0.00 ? 320 PRO A HG2  5  
ATOM   4880  H  HG3  . PRO A 1 13 ? 4.322   20.752  -12.178 1.00 0.00 ? 320 PRO A HG3  5  
ATOM   4881  H  HD2  . PRO A 1 13 ? 6.907   20.136  -11.583 1.00 0.00 ? 320 PRO A HD2  5  
ATOM   4882  H  HD3  . PRO A 1 13 ? 6.268   21.803  -11.552 1.00 0.00 ? 320 PRO A HD3  5  
ATOM   4883  N  N    . ALA A 1 14 ? 3.952   18.742  -7.801  1.00 0.00 ? 321 ALA A N    5  
ATOM   4884  C  CA   . ALA A 1 14 ? 3.784   17.426  -7.206  1.00 0.00 ? 321 ALA A CA   5  
ATOM   4885  C  C    . ALA A 1 14 ? 2.451   16.857  -7.648  1.00 0.00 ? 321 ALA A C    5  
ATOM   4886  O  O    . ALA A 1 14 ? 1.839   16.036  -6.963  1.00 0.00 ? 321 ALA A O    5  
ATOM   4887  C  CB   . ALA A 1 14 ? 3.859   17.514  -5.688  1.00 0.00 ? 321 ALA A CB   5  
ATOM   4888  H  H    . ALA A 1 14 ? 3.194   19.366  -7.780  1.00 0.00 ? 321 ALA A H    5  
ATOM   4889  H  HA   . ALA A 1 14 ? 4.581   16.787  -7.558  1.00 0.00 ? 321 ALA A HA   5  
ATOM   4890  H  HB1  . ALA A 1 14 ? 3.750   16.525  -5.266  1.00 0.00 ? 321 ALA A HB1  5  
ATOM   4891  H  HB2  . ALA A 1 14 ? 3.066   18.149  -5.325  1.00 0.00 ? 321 ALA A HB2  5  
ATOM   4892  H  HB3  . ALA A 1 14 ? 4.814   17.926  -5.397  1.00 0.00 ? 321 ALA A HB3  5  
ATOM   4893  N  N    . ARG A 1 15 ? 2.029   17.285  -8.833  1.00 0.00 ? 322 ARG A N    5  
ATOM   4894  C  CA   . ARG A 1 15 ? 0.717   16.950  -9.367  1.00 0.00 ? 322 ARG A CA   5  
ATOM   4895  C  C    . ARG A 1 15 ? 0.658   15.511  -9.870  1.00 0.00 ? 322 ARG A C    5  
ATOM   4896  O  O    . ARG A 1 15 ? -0.358  15.079  -10.420 1.00 0.00 ? 322 ARG A O    5  
ATOM   4897  C  CB   . ARG A 1 15 ? 0.348   17.920  -10.491 1.00 0.00 ? 322 ARG A CB   5  
ATOM   4898  C  CG   . ARG A 1 15 ? -0.034  19.303  -9.990  1.00 0.00 ? 322 ARG A CG   5  
ATOM   4899  C  CD   . ARG A 1 15 ? -0.147  20.312  -11.123 1.00 0.00 ? 322 ARG A CD   5  
ATOM   4900  N  NE   . ARG A 1 15 ? -1.036  19.861  -12.196 1.00 0.00 ? 322 ARG A NE   5  
ATOM   4901  C  CZ   . ARG A 1 15 ? -2.331  20.162  -12.269 1.00 0.00 ? 322 ARG A CZ   5  
ATOM   4902  N  NH1  . ARG A 1 15 ? -2.934  20.785  -11.262 1.00 0.00 ? 322 ARG A NH1  5  
ATOM   4903  N  NH2  . ARG A 1 15 ? -3.027  19.814  -13.345 1.00 0.00 ? 322 ARG A NH2  5  
ATOM   4904  H  H    . ARG A 1 15 ? 2.629   17.842  -9.370  1.00 0.00 ? 322 ARG A H    5  
ATOM   4905  H  HA   . ARG A 1 15 ? 0.006   17.067  -8.565  1.00 0.00 ? 322 ARG A HA   5  
ATOM   4906  H  HB2  . ARG A 1 15 ? 1.195   18.021  -11.157 1.00 0.00 ? 322 ARG A HB2  5  
ATOM   4907  H  HB3  . ARG A 1 15 ? -0.489  17.516  -11.041 1.00 0.00 ? 322 ARG A HB3  5  
ATOM   4908  H  HG2  . ARG A 1 15 ? -0.986  19.241  -9.485  1.00 0.00 ? 322 ARG A HG2  5  
ATOM   4909  H  HG3  . ARG A 1 15 ? 0.722   19.640  -9.296  1.00 0.00 ? 322 ARG A HG3  5  
ATOM   4910  H  HD2  . ARG A 1 15 ? -0.532  21.239  -10.723 1.00 0.00 ? 322 ARG A HD2  5  
ATOM   4911  H  HD3  . ARG A 1 15 ? 0.837   20.482  -11.535 1.00 0.00 ? 322 ARG A HD3  5  
ATOM   4912  H  HE   . ARG A 1 15 ? -0.630  19.343  -12.930 1.00 0.00 ? 322 ARG A HE   5  
ATOM   4913  H  HH11 . ARG A 1 15 ? -2.419  21.030  -10.439 1.00 0.00 ? 322 ARG A HH11 5  
ATOM   4914  H  HH12 . ARG A 1 15 ? -3.911  21.016  -11.322 1.00 0.00 ? 322 ARG A HH12 5  
ATOM   4915  H  HH21 . ARG A 1 15 ? -2.578  19.323  -14.099 1.00 0.00 ? 322 ARG A HH21 5  
ATOM   4916  H  HH22 . ARG A 1 15 ? -3.996  20.057  -13.420 1.00 0.00 ? 322 ARG A HH22 5  
ATOM   4917  N  N    . TRP A 1 16 ? 1.742   14.772  -9.688  1.00 0.00 ? 323 TRP A N    5  
ATOM   4918  C  CA   . TRP A 1 16 ? 1.757   13.361  -10.031 1.00 0.00 ? 323 TRP A CA   5  
ATOM   4919  C  C    . TRP A 1 16 ? 1.010   12.551  -8.974  1.00 0.00 ? 323 TRP A C    5  
ATOM   4920  O  O    . TRP A 1 16 ? 1.584   12.087  -7.988  1.00 0.00 ? 323 TRP A O    5  
ATOM   4921  C  CB   . TRP A 1 16 ? 3.193   12.844  -10.214 1.00 0.00 ? 323 TRP A CB   5  
ATOM   4922  C  CG   . TRP A 1 16 ? 4.191   13.387  -9.227  1.00 0.00 ? 323 TRP A CG   5  
ATOM   4923  C  CD1  . TRP A 1 16 ? 4.230   13.163  -7.879  1.00 0.00 ? 323 TRP A CD1  5  
ATOM   4924  C  CD2  . TRP A 1 16 ? 5.314   14.226  -9.527  1.00 0.00 ? 323 TRP A CD2  5  
ATOM   4925  N  NE1  . TRP A 1 16 ? 5.301   13.820  -7.322  1.00 0.00 ? 323 TRP A NE1  5  
ATOM   4926  C  CE2  . TRP A 1 16 ? 5.984   14.477  -8.313  1.00 0.00 ? 323 TRP A CE2  5  
ATOM   4927  C  CE3  . TRP A 1 16 ? 5.815   14.790  -10.704 1.00 0.00 ? 323 TRP A CE3  5  
ATOM   4928  C  CZ2  . TRP A 1 16 ? 7.129   15.267  -8.247  1.00 0.00 ? 323 TRP A CZ2  5  
ATOM   4929  C  CZ3  . TRP A 1 16 ? 6.952   15.572  -10.636 1.00 0.00 ? 323 TRP A CZ3  5  
ATOM   4930  C  CH2  . TRP A 1 16 ? 7.597   15.804  -9.415  1.00 0.00 ? 323 TRP A CH2  5  
ATOM   4931  H  H    . TRP A 1 16 ? 2.548   15.184  -9.311  1.00 0.00 ? 323 TRP A H    5  
ATOM   4932  H  HA   . TRP A 1 16 ? 1.232   13.257  -10.971 1.00 0.00 ? 323 TRP A HA   5  
ATOM   4933  H  HB2  . TRP A 1 16 ? 3.191   11.769  -10.116 1.00 0.00 ? 323 TRP A HB2  5  
ATOM   4934  H  HB3  . TRP A 1 16 ? 3.533   13.103  -11.206 1.00 0.00 ? 323 TRP A HB3  5  
ATOM   4935  H  HD1  . TRP A 1 16 ? 3.508   12.562  -7.343  1.00 0.00 ? 323 TRP A HD1  5  
ATOM   4936  H  HE1  . TRP A 1 16 ? 5.540   13.815  -6.367  1.00 0.00 ? 323 TRP A HE1  5  
ATOM   4937  H  HE3  . TRP A 1 16 ? 5.330   14.624  -11.655 1.00 0.00 ? 323 TRP A HE3  5  
ATOM   4938  H  HZ2  . TRP A 1 16 ? 7.640   15.455  -7.314  1.00 0.00 ? 323 TRP A HZ2  5  
ATOM   4939  H  HZ3  . TRP A 1 16 ? 7.354   16.015  -11.537 1.00 0.00 ? 323 TRP A HZ3  5  
ATOM   4940  H  HH2  . TRP A 1 16 ? 8.483   16.422  -9.409  1.00 0.00 ? 323 TRP A HH2  5  
ATOM   4941  N  N    . LYS A 1 17 ? -0.290  12.422  -9.159  1.00 0.00 ? 324 LYS A N    5  
ATOM   4942  C  CA   . LYS A 1 17 ? -1.114  11.674  -8.230  1.00 0.00 ? 324 LYS A CA   5  
ATOM   4943  C  C    . LYS A 1 17 ? -1.028  10.186  -8.510  1.00 0.00 ? 324 LYS A C    5  
ATOM   4944  O  O    . LYS A 1 17 ? -1.704  9.668   -9.402  1.00 0.00 ? 324 LYS A O    5  
ATOM   4945  C  CB   . LYS A 1 17 ? -2.566  12.151  -8.286  1.00 0.00 ? 324 LYS A CB   5  
ATOM   4946  C  CG   . LYS A 1 17 ? -2.796  13.461  -7.553  1.00 0.00 ? 324 LYS A CG   5  
ATOM   4947  C  CD   . LYS A 1 17 ? -2.570  13.298  -6.058  1.00 0.00 ? 324 LYS A CD   5  
ATOM   4948  C  CE   . LYS A 1 17 ? -2.775  14.602  -5.311  1.00 0.00 ? 324 LYS A CE   5  
ATOM   4949  N  NZ   . LYS A 1 17 ? -2.598  14.424  -3.847  1.00 0.00 ? 324 LYS A NZ   5  
ATOM   4950  H  H    . LYS A 1 17 ? -0.709  12.842  -9.942  1.00 0.00 ? 324 LYS A H    5  
ATOM   4951  H  HA   . LYS A 1 17 ? -0.727  11.854  -7.239  1.00 0.00 ? 324 LYS A HA   5  
ATOM   4952  H  HB2  . LYS A 1 17 ? -2.848  12.291  -9.327  1.00 0.00 ? 324 LYS A HB2  5  
ATOM   4953  H  HB3  . LYS A 1 17 ? -3.202  11.391  -7.833  1.00 0.00 ? 324 LYS A HB3  5  
ATOM   4954  H  HG2  . LYS A 1 17 ? -2.110  14.202  -7.933  1.00 0.00 ? 324 LYS A HG2  5  
ATOM   4955  H  HG3  . LYS A 1 17 ? -3.813  13.784  -7.722  1.00 0.00 ? 324 LYS A HG3  5  
ATOM   4956  H  HD2  . LYS A 1 17 ? -3.264  12.566  -5.676  1.00 0.00 ? 324 LYS A HD2  5  
ATOM   4957  H  HD3  . LYS A 1 17 ? -1.560  12.957  -5.893  1.00 0.00 ? 324 LYS A HD3  5  
ATOM   4958  H  HE2  . LYS A 1 17 ? -2.057  15.325  -5.667  1.00 0.00 ? 324 LYS A HE2  5  
ATOM   4959  H  HE3  . LYS A 1 17 ? -3.774  14.962  -5.504  1.00 0.00 ? 324 LYS A HE3  5  
ATOM   4960  H  HZ1  . LYS A 1 17 ? -1.650  14.054  -3.639  1.00 0.00 ? 324 LYS A HZ1  5  
ATOM   4961  H  HZ2  . LYS A 1 17 ? -3.307  13.756  -3.481  1.00 0.00 ? 324 LYS A HZ2  5  
ATOM   4962  H  HZ3  . LYS A 1 17 ? -2.716  15.335  -3.361  1.00 0.00 ? 324 LYS A HZ3  5  
ATOM   4963  N  N    . LEU A 1 18 ? -0.161  9.519   -7.761  1.00 0.00 ? 325 LEU A N    5  
ATOM   4964  C  CA   . LEU A 1 18 ? 0.010   8.079   -7.865  1.00 0.00 ? 325 LEU A CA   5  
ATOM   4965  C  C    . LEU A 1 18 ? -1.336  7.366   -7.741  1.00 0.00 ? 325 LEU A C    5  
ATOM   4966  O  O    . LEU A 1 18 ? -1.988  7.398   -6.697  1.00 0.00 ? 325 LEU A O    5  
ATOM   4967  C  CB   . LEU A 1 18 ? 1.006   7.564   -6.811  1.00 0.00 ? 325 LEU A CB   5  
ATOM   4968  C  CG   . LEU A 1 18 ? 0.587   7.698   -5.334  1.00 0.00 ? 325 LEU A CG   5  
ATOM   4969  C  CD1  . LEU A 1 18 ? 1.431   6.781   -4.465  1.00 0.00 ? 325 LEU A CD1  5  
ATOM   4970  C  CD2  . LEU A 1 18 ? 0.727   9.132   -4.843  1.00 0.00 ? 325 LEU A CD2  5  
ATOM   4971  H  H    . LEU A 1 18 ? 0.395   10.016  -7.129  1.00 0.00 ? 325 LEU A H    5  
ATOM   4972  H  HA   . LEU A 1 18 ? 0.411   7.874   -8.846  1.00 0.00 ? 325 LEU A HA   5  
ATOM   4973  H  HB2  . LEU A 1 18 ? 1.183   6.511   -7.010  1.00 0.00 ? 325 LEU A HB2  5  
ATOM   4974  H  HB3  . LEU A 1 18 ? 1.940   8.112   -6.944  1.00 0.00 ? 325 LEU A HB3  5  
ATOM   4975  H  HG   . LEU A 1 18 ? -0.448  7.403   -5.228  1.00 0.00 ? 325 LEU A HG   5  
ATOM   4976  H  HD11 . LEU A 1 18 ? 2.475   7.019   -4.599  1.00 0.00 ? 325 LEU A HD11 5  
ATOM   4977  H  HD12 . LEU A 1 18 ? 1.255   5.753   -4.748  1.00 0.00 ? 325 LEU A HD12 5  
ATOM   4978  H  HD13 . LEU A 1 18 ? 1.160   6.920   -3.428  1.00 0.00 ? 325 LEU A HD13 5  
ATOM   4979  H  HD21 . LEU A 1 18 ? 0.558   9.164   -3.777  1.00 0.00 ? 325 LEU A HD21 5  
ATOM   4980  H  HD22 . LEU A 1 18 ? 0.003   9.757   -5.341  1.00 0.00 ? 325 LEU A HD22 5  
ATOM   4981  H  HD23 . LEU A 1 18 ? 1.722   9.489   -5.060  1.00 0.00 ? 325 LEU A HD23 5  
ATOM   4982  N  N    . THR A 1 19 ? -1.757  6.746   -8.830  1.00 0.00 ? 326 THR A N    5  
ATOM   4983  C  CA   . THR A 1 19 ? -3.041  6.079   -8.876  1.00 0.00 ? 326 THR A CA   5  
ATOM   4984  C  C    . THR A 1 19 ? -2.861  4.565   -8.910  1.00 0.00 ? 326 THR A C    5  
ATOM   4985  O  O    . THR A 1 19 ? -2.001  4.047   -9.621  1.00 0.00 ? 326 THR A O    5  
ATOM   4986  C  CB   . THR A 1 19 ? -3.849  6.529   -10.111 1.00 0.00 ? 326 THR A CB   5  
ATOM   4987  O  OG1  . THR A 1 19 ? -3.875  7.963   -10.177 1.00 0.00 ? 326 THR A OG1  5  
ATOM   4988  C  CG2  . THR A 1 19 ? -5.276  5.996   -10.054 1.00 0.00 ? 326 THR A CG2  5  
ATOM   4989  H  H    . THR A 1 19 ? -1.182  6.733   -9.628  1.00 0.00 ? 326 THR A H    5  
ATOM   4990  H  HA   . THR A 1 19 ? -3.594  6.351   -7.987  1.00 0.00 ? 326 THR A HA   5  
ATOM   4991  H  HB   . THR A 1 19 ? -3.371  6.143   -10.998 1.00 0.00 ? 326 THR A HB   5  
ATOM   4992  H  HG1  . THR A 1 19 ? -3.092  8.322   -9.725  1.00 0.00 ? 326 THR A HG1  5  
ATOM   4993  H  HG21 . THR A 1 19 ? -5.803  6.277   -10.953 1.00 0.00 ? 326 THR A HG21 5  
ATOM   4994  H  HG22 . THR A 1 19 ? -5.782  6.409   -9.194  1.00 0.00 ? 326 THR A HG22 5  
ATOM   4995  H  HG23 . THR A 1 19 ? -5.254  4.919   -9.972  1.00 0.00 ? 326 THR A HG23 5  
ATOM   4996  N  N    . CYS A 1 20 ? -3.672  3.866   -8.132  1.00 0.00 ? 327 CYS A N    5  
ATOM   4997  C  CA   . CYS A 1 20 ? -3.661  2.415   -8.131  1.00 0.00 ? 327 CYS A CA   5  
ATOM   4998  C  C    . CYS A 1 20 ? -4.441  1.902   -9.326  1.00 0.00 ? 327 CYS A C    5  
ATOM   4999  O  O    . CYS A 1 20 ? -5.675  1.967   -9.342  1.00 0.00 ? 327 CYS A O    5  
ATOM   5000  C  CB   . CYS A 1 20 ? -4.272  1.881   -6.833  1.00 0.00 ? 327 CYS A CB   5  
ATOM   5001  S  SG   . CYS A 1 20 ? -4.643  0.105   -6.843  1.00 0.00 ? 327 CYS A SG   5  
ATOM   5002  H  H    . CYS A 1 20 ? -4.292  4.340   -7.546  1.00 0.00 ? 327 CYS A H    5  
ATOM   5003  H  HA   . CYS A 1 20 ? -2.635  2.084   -8.208  1.00 0.00 ? 327 CYS A HA   5  
ATOM   5004  H  HB2  . CYS A 1 20 ? -3.586  2.066   -6.020  1.00 0.00 ? 327 CYS A HB2  5  
ATOM   5005  H  HB3  . CYS A 1 20 ? -5.196  2.407   -6.639  1.00 0.00 ? 327 CYS A HB3  5  
ATOM   5006  N  N    . TYR A 1 21 ? -3.719  1.411   -10.326 1.00 0.00 ? 328 TYR A N    5  
ATOM   5007  C  CA   . TYR A 1 21 ? -4.336  0.932   -11.558 1.00 0.00 ? 328 TYR A CA   5  
ATOM   5008  C  C    . TYR A 1 21 ? -5.321  -0.197  -11.276 1.00 0.00 ? 328 TYR A C    5  
ATOM   5009  O  O    . TYR A 1 21 ? -6.338  -0.333  -11.957 1.00 0.00 ? 328 TYR A O    5  
ATOM   5010  C  CB   . TYR A 1 21 ? -3.267  0.482   -12.567 1.00 0.00 ? 328 TYR A CB   5  
ATOM   5011  C  CG   . TYR A 1 21 ? -2.388  -0.667  -12.110 1.00 0.00 ? 328 TYR A CG   5  
ATOM   5012  C  CD1  . TYR A 1 21 ? -1.307  -0.452  -11.264 1.00 0.00 ? 328 TYR A CD1  5  
ATOM   5013  C  CD2  . TYR A 1 21 ? -2.632  -1.966  -12.543 1.00 0.00 ? 328 TYR A CD2  5  
ATOM   5014  C  CE1  . TYR A 1 21 ? -0.499  -1.497  -10.858 1.00 0.00 ? 328 TYR A CE1  5  
ATOM   5015  C  CE2  . TYR A 1 21 ? -1.828  -3.015  -12.141 1.00 0.00 ? 328 TYR A CE2  5  
ATOM   5016  C  CZ   . TYR A 1 21 ? -0.763  -2.775  -11.300 1.00 0.00 ? 328 TYR A CZ   5  
ATOM   5017  O  OH   . TYR A 1 21 ? 0.033   -3.821  -10.893 1.00 0.00 ? 328 TYR A OH   5  
ATOM   5018  H  H    . TYR A 1 21 ? -2.738  1.386   -10.237 1.00 0.00 ? 328 TYR A H    5  
ATOM   5019  H  HA   . TYR A 1 21 ? -4.884  1.759   -11.984 1.00 0.00 ? 328 TYR A HA   5  
ATOM   5020  H  HB2  . TYR A 1 21 ? -3.757  0.173   -13.476 1.00 0.00 ? 328 TYR A HB2  5  
ATOM   5021  H  HB3  . TYR A 1 21 ? -2.623  1.322   -12.785 1.00 0.00 ? 328 TYR A HB3  5  
ATOM   5022  H  HD1  . TYR A 1 21 ? -1.103  0.550   -10.919 1.00 0.00 ? 328 TYR A HD1  5  
ATOM   5023  H  HD2  . TYR A 1 21 ? -3.465  -2.152  -13.203 1.00 0.00 ? 328 TYR A HD2  5  
ATOM   5024  H  HE1  . TYR A 1 21 ? 0.336   -1.309  -10.200 1.00 0.00 ? 328 TYR A HE1  5  
ATOM   5025  H  HE2  . TYR A 1 21 ? -2.034  -4.017  -12.488 1.00 0.00 ? 328 TYR A HE2  5  
ATOM   5026  H  HH   . TYR A 1 21 ? -0.127  -4.588  -11.477 1.00 0.00 ? 328 TYR A HH   5  
ATOM   5027  N  N    . LEU A 1 22 ? -5.030  -0.987  -10.252 1.00 0.00 ? 329 LEU A N    5  
ATOM   5028  C  CA   . LEU A 1 22 ? -5.928  -2.046  -9.829  1.00 0.00 ? 329 LEU A CA   5  
ATOM   5029  C  C    . LEU A 1 22 ? -7.062  -1.470  -8.984  1.00 0.00 ? 329 LEU A C    5  
ATOM   5030  O  O    . LEU A 1 22 ? -7.009  -1.541  -7.744  1.00 0.00 ? 329 LEU A O    5  
ATOM   5031  C  CB   . LEU A 1 22 ? -5.170  -3.124  -9.048  1.00 0.00 ? 329 LEU A CB   5  
ATOM   5032  C  CG   . LEU A 1 22 ? -4.104  -3.884  -9.843  1.00 0.00 ? 329 LEU A CG   5  
ATOM   5033  C  CD1  . LEU A 1 22 ? -3.322  -4.815  -8.931  1.00 0.00 ? 329 LEU A CD1  5  
ATOM   5034  C  CD2  . LEU A 1 22 ? -4.744  -4.672  -10.974 1.00 0.00 ? 329 LEU A CD2  5  
ATOM   5035  H  H    . LEU A 1 22 ? -4.188  -0.855  -9.772  1.00 0.00 ? 329 LEU A H    5  
ATOM   5036  H  HA   . LEU A 1 22 ? -6.354  -2.489  -10.716 1.00 0.00 ? 329 LEU A HA   5  
ATOM   5037  H  HB2  . LEU A 1 22 ? -4.689  -2.654  -8.203  1.00 0.00 ? 329 LEU A HB2  5  
ATOM   5038  H  HB3  . LEU A 1 22 ? -5.887  -3.842  -8.678  1.00 0.00 ? 329 LEU A HB3  5  
ATOM   5039  H  HG   . LEU A 1 22 ? -3.410  -3.177  -10.275 1.00 0.00 ? 329 LEU A HG   5  
ATOM   5040  H  HD11 . LEU A 1 22 ? -2.581  -5.348  -9.509  1.00 0.00 ? 329 LEU A HD11 5  
ATOM   5041  H  HD12 . LEU A 1 22 ? -3.999  -5.522  -8.475  1.00 0.00 ? 329 LEU A HD12 5  
ATOM   5042  H  HD13 . LEU A 1 22 ? -2.832  -4.238  -8.162  1.00 0.00 ? 329 LEU A HD13 5  
ATOM   5043  H  HD21 . LEU A 1 22 ? -5.447  -5.381  -10.563 1.00 0.00 ? 329 LEU A HD21 5  
ATOM   5044  H  HD22 . LEU A 1 22 ? -3.980  -5.201  -11.523 1.00 0.00 ? 329 LEU A HD22 5  
ATOM   5045  H  HD23 . LEU A 1 22 ? -5.261  -3.996  -11.639 1.00 0.00 ? 329 LEU A HD23 5  
ATOM   5046  N  N    . CYS A 1 23 ? -7.997  -0.803  -9.692  1.00 0.00 ? 330 CYS A N    5  
ATOM   5047  C  CA   . CYS A 1 23 ? -9.285  -0.281  -9.179  1.00 0.00 ? 330 CYS A CA   5  
ATOM   5048  C  C    . CYS A 1 23 ? -9.523  1.135   -9.697  1.00 0.00 ? 330 CYS A C    5  
ATOM   5049  O  O    . CYS A 1 23 ? -10.665 1.535   -9.907  1.00 0.00 ? 330 CYS A O    5  
ATOM   5050  C  CB   . CYS A 1 23 ? -9.411  -0.289  -7.647  1.00 0.00 ? 330 CYS A CB   5  
ATOM   5051  S  SG   . CYS A 1 23 ? -8.155  0.681   -6.770  1.00 0.00 ? 330 CYS A SG   5  
ATOM   5052  H  H    . CYS A 1 23 ? -7.804  -0.648  -10.645 1.00 0.00 ? 330 CYS A H    5  
ATOM   5053  H  HA   . CYS A 1 23 ? -10.063 -0.915  -9.588  1.00 0.00 ? 330 CYS A HA   5  
ATOM   5054  H  HB2  . CYS A 1 23 ? -10.376 0.108   -7.373  1.00 0.00 ? 330 CYS A HB2  5  
ATOM   5055  H  HB3  . CYS A 1 23 ? -9.339  -1.308  -7.299  1.00 0.00 ? 330 CYS A HB3  5  
ATOM   5056  N  N    . LYS A 1 24 ? -8.431  1.891   -9.877  1.00 0.00 ? 331 LYS A N    5  
ATOM   5057  C  CA   . LYS A 1 24 ? -8.483  3.254   -10.404 1.00 0.00 ? 331 LYS A CA   5  
ATOM   5058  C  C    . LYS A 1 24 ? -9.090  4.171   -9.351  1.00 0.00 ? 331 LYS A C    5  
ATOM   5059  O  O    . LYS A 1 24 ? -9.769  5.150   -9.650  1.00 0.00 ? 331 LYS A O    5  
ATOM   5060  C  CB   . LYS A 1 24 ? -9.271  3.314   -11.723 1.00 0.00 ? 331 LYS A CB   5  
ATOM   5061  C  CG   . LYS A 1 24 ? -9.225  4.675   -12.407 1.00 0.00 ? 331 LYS A CG   5  
ATOM   5062  C  CD   . LYS A 1 24 ? -10.160 4.733   -13.602 1.00 0.00 ? 331 LYS A CD   5  
ATOM   5063  C  CE   . LYS A 1 24 ? -10.292 6.149   -14.141 1.00 0.00 ? 331 LYS A CE   5  
ATOM   5064  N  NZ   . LYS A 1 24 ? -10.863 7.078   -13.131 1.00 0.00 ? 331 LYS A NZ   5  
ATOM   5065  H  H    . LYS A 1 24 ? -7.565  1.534   -9.609  1.00 0.00 ? 331 LYS A H    5  
ATOM   5066  H  HA   . LYS A 1 24 ? -7.465  3.570   -10.589 1.00 0.00 ? 331 LYS A HA   5  
ATOM   5067  H  HB2  . LYS A 1 24 ? -8.863  2.581   -12.403 1.00 0.00 ? 331 LYS A HB2  5  
ATOM   5068  H  HB3  . LYS A 1 24 ? -10.304 3.070   -11.523 1.00 0.00 ? 331 LYS A HB3  5  
ATOM   5069  H  HG2  . LYS A 1 24 ? -9.518  5.432   -11.696 1.00 0.00 ? 331 LYS A HG2  5  
ATOM   5070  H  HG3  . LYS A 1 24 ? -8.215  4.864   -12.742 1.00 0.00 ? 331 LYS A HG3  5  
ATOM   5071  H  HD2  . LYS A 1 24 ? -9.771  4.096   -14.382 1.00 0.00 ? 331 LYS A HD2  5  
ATOM   5072  H  HD3  . LYS A 1 24 ? -11.135 4.379   -13.299 1.00 0.00 ? 331 LYS A HD3  5  
ATOM   5073  H  HE2  . LYS A 1 24 ? -9.314  6.502   -14.430 1.00 0.00 ? 331 LYS A HE2  5  
ATOM   5074  H  HE3  . LYS A 1 24 ? -10.937 6.132   -15.007 1.00 0.00 ? 331 LYS A HE3  5  
ATOM   5075  H  HZ1  . LYS A 1 24 ? -10.231 7.146   -12.308 1.00 0.00 ? 331 LYS A HZ1  5  
ATOM   5076  H  HZ2  . LYS A 1 24 ? -11.793 6.735   -12.811 1.00 0.00 ? 331 LYS A HZ2  5  
ATOM   5077  H  HZ3  . LYS A 1 24 ? -10.980 8.026   -13.539 1.00 0.00 ? 331 LYS A HZ3  5  
ATOM   5078  N  N    . GLN A 1 25 ? -8.810  3.857   -8.098  1.00 0.00 ? 332 GLN A N    5  
ATOM   5079  C  CA   . GLN A 1 25 ? -9.376  4.609   -6.996  1.00 0.00 ? 332 GLN A CA   5  
ATOM   5080  C  C    . GLN A 1 25 ? -8.296  5.389   -6.251  1.00 0.00 ? 332 GLN A C    5  
ATOM   5081  O  O    . GLN A 1 25 ? -8.460  5.723   -5.077  1.00 0.00 ? 332 GLN A O    5  
ATOM   5082  C  CB   . GLN A 1 25 ? -10.128 3.683   -6.037  1.00 0.00 ? 332 GLN A CB   5  
ATOM   5083  C  CG   . GLN A 1 25 ? -11.315 2.982   -6.681  1.00 0.00 ? 332 GLN A CG   5  
ATOM   5084  C  CD   . GLN A 1 25 ? -12.118 2.146   -5.703  1.00 0.00 ? 332 GLN A CD   5  
ATOM   5085  O  OE1  . GLN A 1 25 ? -13.324 1.968   -5.864  1.00 0.00 ? 332 GLN A OE1  5  
ATOM   5086  N  NE2  . GLN A 1 25 ? -11.456 1.624   -4.681  1.00 0.00 ? 332 GLN A NE2  5  
ATOM   5087  H  H    . GLN A 1 25 ? -8.211  3.108   -7.913  1.00 0.00 ? 332 GLN A H    5  
ATOM   5088  H  HA   . GLN A 1 25 ? -10.072 5.304   -7.423  1.00 0.00 ? 332 GLN A HA   5  
ATOM   5089  H  HB2  . GLN A 1 25 ? -9.446  2.929   -5.671  1.00 0.00 ? 332 GLN A HB2  5  
ATOM   5090  H  HB3  . GLN A 1 25 ? -10.490 4.264   -5.201  1.00 0.00 ? 332 GLN A HB3  5  
ATOM   5091  H  HG2  . GLN A 1 25 ? -11.968 3.730   -7.107  1.00 0.00 ? 332 GLN A HG2  5  
ATOM   5092  H  HG3  . GLN A 1 25 ? -10.951 2.337   -7.467  1.00 0.00 ? 332 GLN A HG3  5  
ATOM   5093  H  HE21 . GLN A 1 25 ? -10.501 1.804   -4.612  1.00 0.00 ? 332 GLN A HE21 5  
ATOM   5094  H  HE22 . GLN A 1 25 ? -11.953 1.072   -4.041  1.00 0.00 ? 332 GLN A HE22 5  
ATOM   5095  N  N    . LYS A 1 26 ? -7.205  5.684   -6.958  1.00 0.00 ? 333 LYS A N    5  
ATOM   5096  C  CA   . LYS A 1 26 ? -6.070  6.423   -6.398  1.00 0.00 ? 333 LYS A CA   5  
ATOM   5097  C  C    . LYS A 1 26 ? -5.604  5.800   -5.076  1.00 0.00 ? 333 LYS A C    5  
ATOM   5098  O  O    . LYS A 1 26 ? -5.218  4.627   -5.042  1.00 0.00 ? 333 LYS A O    5  
ATOM   5099  C  CB   . LYS A 1 26 ? -6.427  7.906   -6.218  1.00 0.00 ? 333 LYS A CB   5  
ATOM   5100  C  CG   . LYS A 1 26 ? -6.784  8.614   -7.517  1.00 0.00 ? 333 LYS A CG   5  
ATOM   5101  C  CD   . LYS A 1 26 ? -7.234  10.048  -7.268  1.00 0.00 ? 333 LYS A CD   5  
ATOM   5102  C  CE   . LYS A 1 26 ? -7.630  10.738  -8.561  1.00 0.00 ? 333 LYS A CE   5  
ATOM   5103  N  NZ   . LYS A 1 26 ? -8.215  12.086  -8.325  1.00 0.00 ? 333 LYS A NZ   5  
ATOM   5104  H  H    . LYS A 1 26 ? -7.168  5.407   -7.895  1.00 0.00 ? 333 LYS A H    5  
ATOM   5105  H  HA   . LYS A 1 26 ? -5.261  6.348   -7.107  1.00 0.00 ? 333 LYS A HA   5  
ATOM   5106  H  HB2  . LYS A 1 26 ? -7.272  7.984   -5.552  1.00 0.00 ? 333 LYS A HB2  5  
ATOM   5107  H  HB3  . LYS A 1 26 ? -5.580  8.416   -5.782  1.00 0.00 ? 333 LYS A HB3  5  
ATOM   5108  H  HG2  . LYS A 1 26 ? -5.916  8.625   -8.161  1.00 0.00 ? 333 LYS A HG2  5  
ATOM   5109  H  HG3  . LYS A 1 26 ? -7.585  8.073   -8.000  1.00 0.00 ? 333 LYS A HG3  5  
ATOM   5110  H  HD2  . LYS A 1 26 ? -8.086  10.039  -6.605  1.00 0.00 ? 333 LYS A HD2  5  
ATOM   5111  H  HD3  . LYS A 1 26 ? -6.425  10.599  -6.811  1.00 0.00 ? 333 LYS A HD3  5  
ATOM   5112  H  HE2  . LYS A 1 26 ? -6.752  10.840  -9.181  1.00 0.00 ? 333 LYS A HE2  5  
ATOM   5113  H  HE3  . LYS A 1 26 ? -8.356  10.124  -9.071  1.00 0.00 ? 333 LYS A HE3  5  
ATOM   5114  H  HZ1  . LYS A 1 26 ? -8.542  12.495  -9.223  1.00 0.00 ? 333 LYS A HZ1  5  
ATOM   5115  H  HZ2  . LYS A 1 26 ? -7.505  12.721  -7.906  1.00 0.00 ? 333 LYS A HZ2  5  
ATOM   5116  H  HZ3  . LYS A 1 26 ? -9.026  12.016  -7.678  1.00 0.00 ? 333 LYS A HZ3  5  
ATOM   5117  N  N    . GLY A 1 27 ? -5.668  6.565   -3.992  1.00 0.00 ? 334 GLY A N    5  
ATOM   5118  C  CA   . GLY A 1 27 ? -5.234  6.073   -2.704  1.00 0.00 ? 334 GLY A CA   5  
ATOM   5119  C  C    . GLY A 1 27 ? -6.278  6.302   -1.633  1.00 0.00 ? 334 GLY A C    5  
ATOM   5120  O  O    . GLY A 1 27 ? -6.546  7.438   -1.257  1.00 0.00 ? 334 GLY A O    5  
ATOM   5121  H  H    . GLY A 1 27 ? -6.027  7.472   -4.063  1.00 0.00 ? 334 GLY A H    5  
ATOM   5122  H  HA2  . GLY A 1 27 ? -5.033  5.015   -2.779  1.00 0.00 ? 334 GLY A HA2  5  
ATOM   5123  H  HA3  . GLY A 1 27 ? -4.325  6.584   -2.421  1.00 0.00 ? 334 GLY A HA3  5  
ATOM   5124  N  N    . VAL A 1 28 ? -6.881  5.224   -1.156  1.00 0.00 ? 335 VAL A N    5  
ATOM   5125  C  CA   . VAL A 1 28 ? -7.906  5.323   -0.127  1.00 0.00 ? 335 VAL A CA   5  
ATOM   5126  C  C    . VAL A 1 28 ? -7.336  5.004   1.255   1.00 0.00 ? 335 VAL A C    5  
ATOM   5127  O  O    . VAL A 1 28 ? -7.489  5.791   2.189   1.00 0.00 ? 335 VAL A O    5  
ATOM   5128  C  CB   . VAL A 1 28 ? -9.119  4.407   -0.430  1.00 0.00 ? 335 VAL A CB   5  
ATOM   5129  C  CG1  . VAL A 1 28 ? -9.943  4.976   -1.577  1.00 0.00 ? 335 VAL A CG1  5  
ATOM   5130  C  CG2  . VAL A 1 28 ? -8.674  2.987   -0.765  1.00 0.00 ? 335 VAL A CG2  5  
ATOM   5131  H  H    . VAL A 1 28 ? -6.634  4.347   -1.499  1.00 0.00 ? 335 VAL A H    5  
ATOM   5132  H  HA   . VAL A 1 28 ? -8.256  6.346   -0.122  1.00 0.00 ? 335 VAL A HA   5  
ATOM   5133  H  HB   . VAL A 1 28 ? -9.744  4.369   0.450   1.00 0.00 ? 335 VAL A HB   5  
ATOM   5134  H  HG11 . VAL A 1 28 ? -9.323  5.059   -2.458  1.00 0.00 ? 335 VAL A HG11 5  
ATOM   5135  H  HG12 . VAL A 1 28 ? -10.316 5.952   -1.305  1.00 0.00 ? 335 VAL A HG12 5  
ATOM   5136  H  HG13 . VAL A 1 28 ? -10.774 4.317   -1.783  1.00 0.00 ? 335 VAL A HG13 5  
ATOM   5137  H  HG21 . VAL A 1 28 ? -9.541  2.373   -0.961  1.00 0.00 ? 335 VAL A HG21 5  
ATOM   5138  H  HG22 . VAL A 1 28 ? -8.123  2.574   0.067   1.00 0.00 ? 335 VAL A HG22 5  
ATOM   5139  H  HG23 . VAL A 1 28 ? -8.042  3.005   -1.641  1.00 0.00 ? 335 VAL A HG23 5  
ATOM   5140  N  N    . GLY A 1 29 ? -6.648  3.873   1.371   1.00 0.00 ? 336 GLY A N    5  
ATOM   5141  C  CA   . GLY A 1 29 ? -6.125  3.458   2.659   1.00 0.00 ? 336 GLY A CA   5  
ATOM   5142  C  C    . GLY A 1 29 ? -4.646  3.146   2.612   1.00 0.00 ? 336 GLY A C    5  
ATOM   5143  O  O    . GLY A 1 29 ? -3.840  3.847   3.219   1.00 0.00 ? 336 GLY A O    5  
ATOM   5144  H  H    . GLY A 1 29 ? -6.496  3.319   0.583   1.00 0.00 ? 336 GLY A H    5  
ATOM   5145  H  HA2  . GLY A 1 29 ? -6.288  4.265   3.376   1.00 0.00 ? 336 GLY A HA2  5  
ATOM   5146  H  HA3  . GLY A 1 29 ? -6.662  2.564   2.982   1.00 0.00 ? 336 GLY A HA3  5  
ATOM   5147  N  N    . ALA A 1 30 ? -4.284  2.096   1.887   1.00 0.00 ? 337 ALA A N    5  
ATOM   5148  C  CA   . ALA A 1 30 ? -2.894  1.672   1.808   1.00 0.00 ? 337 ALA A CA   5  
ATOM   5149  C  C    . ALA A 1 30 ? -2.456  1.517   0.359   1.00 0.00 ? 337 ALA A C    5  
ATOM   5150  O  O    . ALA A 1 30 ? -3.065  0.765   -0.406  1.00 0.00 ? 337 ALA A O    5  
ATOM   5151  C  CB   . ALA A 1 30 ? -2.695  0.369   2.567   1.00 0.00 ? 337 ALA A CB   5  
ATOM   5152  H  H    . ALA A 1 30 ? -4.964  1.596   1.391   1.00 0.00 ? 337 ALA A H    5  
ATOM   5153  H  HA   . ALA A 1 30 ? -2.288  2.432   2.277   1.00 0.00 ? 337 ALA A HA   5  
ATOM   5154  H  HB1  . ALA A 1 30 ? -1.652  0.092   2.536   1.00 0.00 ? 337 ALA A HB1  5  
ATOM   5155  H  HB2  . ALA A 1 30 ? -3.288  -0.409  2.108   1.00 0.00 ? 337 ALA A HB2  5  
ATOM   5156  H  HB3  . ALA A 1 30 ? -3.003  0.498   3.593   1.00 0.00 ? 337 ALA A HB3  5  
ATOM   5157  N  N    . SER A 1 31 ? -1.405  2.234   -0.011  1.00 0.00 ? 338 SER A N    5  
ATOM   5158  C  CA   . SER A 1 31 ? -0.875  2.177   -1.363  1.00 0.00 ? 338 SER A CA   5  
ATOM   5159  C  C    . SER A 1 31 ? 0.637   1.989   -1.326  1.00 0.00 ? 338 SER A C    5  
ATOM   5160  O  O    . SER A 1 31 ? 1.323   2.564   -0.479  1.00 0.00 ? 338 SER A O    5  
ATOM   5161  C  CB   . SER A 1 31 ? -1.228  3.459   -2.125  1.00 0.00 ? 338 SER A CB   5  
ATOM   5162  O  OG   . SER A 1 31 ? -2.620  3.736   -2.045  1.00 0.00 ? 338 SER A OG   5  
ATOM   5163  H  H    . SER A 1 31 ? -0.965  2.815   0.645   1.00 0.00 ? 338 SER A H    5  
ATOM   5164  H  HA   . SER A 1 31 ? -1.323  1.332   -1.862  1.00 0.00 ? 338 SER A HA   5  
ATOM   5165  H  HB2  . SER A 1 31 ? -0.685  4.289   -1.701  1.00 0.00 ? 338 SER A HB2  5  
ATOM   5166  H  HB3  . SER A 1 31 ? -0.954  3.343   -3.163  1.00 0.00 ? 338 SER A HB3  5  
ATOM   5167  H  HG   . SER A 1 31 ? -2.740  4.657   -1.792  1.00 0.00 ? 338 SER A HG   5  
ATOM   5168  N  N    . ILE A 1 32 ? 1.146   1.169   -2.229  1.00 0.00 ? 339 ILE A N    5  
ATOM   5169  C  CA   . ILE A 1 32 ? 2.574   0.942   -2.340  1.00 0.00 ? 339 ILE A CA   5  
ATOM   5170  C  C    . ILE A 1 32 ? 3.017   1.233   -3.772  1.00 0.00 ? 339 ILE A C    5  
ATOM   5171  O  O    . ILE A 1 32 ? 2.218   1.130   -4.707  1.00 0.00 ? 339 ILE A O    5  
ATOM   5172  C  CB   . ILE A 1 32 ? 2.947   -0.505  -1.923  1.00 0.00 ? 339 ILE A CB   5  
ATOM   5173  C  CG1  . ILE A 1 32 ? 4.468   -0.701  -1.934  1.00 0.00 ? 339 ILE A CG1  5  
ATOM   5174  C  CG2  . ILE A 1 32 ? 2.266   -1.519  -2.833  1.00 0.00 ? 339 ILE A CG2  5  
ATOM   5175  C  CD1  . ILE A 1 32 ? 4.912   -2.046  -1.401  1.00 0.00 ? 339 ILE A CD1  5  
ATOM   5176  H  H    . ILE A 1 32 ? 0.542   0.709   -2.856  1.00 0.00 ? 339 ILE A H    5  
ATOM   5177  H  HA   . ILE A 1 32 ? 3.074   1.631   -1.671  1.00 0.00 ? 339 ILE A HA   5  
ATOM   5178  H  HB   . ILE A 1 32 ? 2.583   -0.665  -0.920  1.00 0.00 ? 339 ILE A HB   5  
ATOM   5179  H  HG12 . ILE A 1 32 ? 4.827   -0.618  -2.957  1.00 0.00 ? 339 ILE A HG12 5  
ATOM   5180  H  HG13 . ILE A 1 32 ? 4.928   0.071   -1.319  1.00 0.00 ? 339 ILE A HG13 5  
ATOM   5181  H  HG21 . ILE A 1 32 ? 2.541   -2.517  -2.528  1.00 0.00 ? 339 ILE A HG21 5  
ATOM   5182  H  HG22 . ILE A 1 32 ? 2.580   -1.356  -3.853  1.00 0.00 ? 339 ILE A HG22 5  
ATOM   5183  H  HG23 . ILE A 1 32 ? 1.195   -1.404  -2.763  1.00 0.00 ? 339 ILE A HG23 5  
ATOM   5184  H  HD11 . ILE A 1 32 ? 4.582   -2.155  -0.378  1.00 0.00 ? 339 ILE A HD11 5  
ATOM   5185  H  HD12 . ILE A 1 32 ? 5.990   -2.112  -1.440  1.00 0.00 ? 339 ILE A HD12 5  
ATOM   5186  H  HD13 . ILE A 1 32 ? 4.481   -2.830  -2.004  1.00 0.00 ? 339 ILE A HD13 5  
ATOM   5187  N  N    . GLN A 1 33 ? 4.270   1.617   -3.942  1.00 0.00 ? 340 GLN A N    5  
ATOM   5188  C  CA   . GLN A 1 33 ? 4.764   2.030   -5.237  1.00 0.00 ? 340 GLN A CA   5  
ATOM   5189  C  C    . GLN A 1 33 ? 5.841   1.071   -5.725  1.00 0.00 ? 340 GLN A C    5  
ATOM   5190  O  O    . GLN A 1 33 ? 6.786   0.755   -5.002  1.00 0.00 ? 340 GLN A O    5  
ATOM   5191  C  CB   . GLN A 1 33 ? 5.309   3.457   -5.151  1.00 0.00 ? 340 GLN A CB   5  
ATOM   5192  C  CG   . GLN A 1 33 ? 5.456   4.143   -6.500  1.00 0.00 ? 340 GLN A CG   5  
ATOM   5193  C  CD   . GLN A 1 33 ? 5.895   5.558   -6.391  1.00 0.00 ? 340 GLN A CD   5  
ATOM   5194  O  OE1  . GLN A 1 33 ? 6.540   5.967   -5.424  1.00 0.00 ? 340 GLN A OE1  5  
ATOM   5195  N  NE2  . GLN A 1 33 ? 5.605   6.302   -7.420  1.00 0.00 ? 340 GLN A NE2  5  
ATOM   5196  H  H    . GLN A 1 33 ? 4.882   1.608   -3.184  1.00 0.00 ? 340 GLN A H    5  
ATOM   5197  H  HA   . GLN A 1 33 ? 3.936   2.010   -5.930  1.00 0.00 ? 340 GLN A HA   5  
ATOM   5198  H  HB2  . GLN A 1 33 ? 4.641   4.048   -4.542  1.00 0.00 ? 340 GLN A HB2  5  
ATOM   5199  H  HB3  . GLN A 1 33 ? 6.280   3.428   -4.680  1.00 0.00 ? 340 GLN A HB3  5  
ATOM   5200  H  HG2  . GLN A 1 33 ? 6.202   3.647   -7.092  1.00 0.00 ? 340 GLN A HG2  5  
ATOM   5201  H  HG3  . GLN A 1 33 ? 4.493   4.122   -7.010  1.00 0.00 ? 340 GLN A HG3  5  
ATOM   5202  H  HE21 . GLN A 1 33 ? 5.115   5.898   -8.167  1.00 0.00 ? 340 GLN A HE21 5  
ATOM   5203  H  HE22 . GLN A 1 33 ? 5.927   7.193   -7.417  1.00 0.00 ? 340 GLN A HE22 5  
ATOM   5204  N  N    . CYS A 1 34 ? 5.665   0.594   -6.944  1.00 0.00 ? 341 CYS A N    5  
ATOM   5205  C  CA   . CYS A 1 34 ? 6.624   -0.294  -7.579  1.00 0.00 ? 341 CYS A CA   5  
ATOM   5206  C  C    . CYS A 1 34 ? 7.916   0.454   -7.855  1.00 0.00 ? 341 CYS A C    5  
ATOM   5207  O  O    . CYS A 1 34 ? 7.923   1.682   -7.939  1.00 0.00 ? 341 CYS A O    5  
ATOM   5208  C  CB   . CYS A 1 34 ? 6.046   -0.879  -8.877  1.00 0.00 ? 341 CYS A CB   5  
ATOM   5209  S  SG   . CYS A 1 34 ? 6.744   -0.217  -10.418 1.00 0.00 ? 341 CYS A SG   5  
ATOM   5210  H  H    . CYS A 1 34 ? 4.854   0.847   -7.430  1.00 0.00 ? 341 CYS A H    5  
ATOM   5211  H  HA   . CYS A 1 34 ? 6.833   -1.101  -6.892  1.00 0.00 ? 341 CYS A HA   5  
ATOM   5212  H  HB2  . CYS A 1 34 ? 6.208   -1.944  -8.881  1.00 0.00 ? 341 CYS A HB2  5  
ATOM   5213  H  HB3  . CYS A 1 34 ? 4.985   -0.687  -8.897  1.00 0.00 ? 341 CYS A HB3  5  
ATOM   5214  N  N    . HIS A 1 35 ? 8.996   -0.284  -8.012  1.00 0.00 ? 342 HIS A N    5  
ATOM   5215  C  CA   . HIS A 1 35 ? 10.312  0.324   -8.126  1.00 0.00 ? 342 HIS A CA   5  
ATOM   5216  C  C    . HIS A 1 35 ? 10.680  0.565   -9.590  1.00 0.00 ? 342 HIS A C    5  
ATOM   5217  O  O    . HIS A 1 35 ? 9.800   0.605   -10.457 1.00 0.00 ? 342 HIS A O    5  
ATOM   5218  C  CB   . HIS A 1 35 ? 11.351  -0.563  -7.434  1.00 0.00 ? 342 HIS A CB   5  
ATOM   5219  C  CG   . HIS A 1 35 ? 12.406  0.215   -6.703  1.00 0.00 ? 342 HIS A CG   5  
ATOM   5220  N  ND1  . HIS A 1 35 ? 12.113  1.134   -5.717  1.00 0.00 ? 342 HIS A ND1  5  
ATOM   5221  C  CD2  . HIS A 1 35 ? 13.756  0.209   -6.814  1.00 0.00 ? 342 HIS A CD2  5  
ATOM   5222  C  CE1  . HIS A 1 35 ? 13.235  1.658   -5.259  1.00 0.00 ? 342 HIS A CE1  5  
ATOM   5223  N  NE2  . HIS A 1 35 ? 14.247  1.113   -5.906  1.00 0.00 ? 342 HIS A NE2  5  
ATOM   5224  H  H    . HIS A 1 35 ? 8.903   -1.263  -8.057  1.00 0.00 ? 342 HIS A H    5  
ATOM   5225  H  HA   . HIS A 1 35 ? 10.278  1.275   -7.620  1.00 0.00 ? 342 HIS A HA   5  
ATOM   5226  H  HB2  . HIS A 1 35 ? 10.845  -1.200  -6.707  1.00 0.00 ? 342 HIS A HB2  5  
ATOM   5227  H  HB3  . HIS A 1 35 ? 11.849  -1.177  -8.186  1.00 0.00 ? 342 HIS A HB3  5  
ATOM   5228  H  HD1  . HIS A 1 35 ? 11.212  1.365   -5.394  1.00 0.00 ? 342 HIS A HD1  5  
ATOM   5229  H  HD2  . HIS A 1 35 ? 14.338  -0.396  -7.493  1.00 0.00 ? 342 HIS A HD2  5  
ATOM   5230  H  HE1  . HIS A 1 35 ? 13.311  2.405   -4.490  1.00 0.00 ? 342 HIS A HE1  5  
ATOM   5231  H  HE2  . HIS A 1 35 ? 15.184  1.161   -5.612  1.00 0.00 ? 342 HIS A HE2  5  
ATOM   5232  N  N    . LYS A 1 36 ? 11.985  0.720   -9.843  1.00 0.00 ? 343 LYS A N    5  
ATOM   5233  C  CA   . LYS A 1 36 ? 12.528  1.082   -11.157 1.00 0.00 ? 343 LYS A CA   5  
ATOM   5234  C  C    . LYS A 1 36 ? 12.326  2.574   -11.409 1.00 0.00 ? 343 LYS A C    5  
ATOM   5235  O  O    . LYS A 1 36 ? 11.198  3.072   -11.393 1.00 0.00 ? 343 LYS A O    5  
ATOM   5236  C  CB   . LYS A 1 36 ? 11.920  0.248   -12.299 1.00 0.00 ? 343 LYS A CB   5  
ATOM   5237  C  CG   . LYS A 1 36 ? 12.090  -1.260  -12.134 1.00 0.00 ? 343 LYS A CG   5  
ATOM   5238  C  CD   . LYS A 1 36 ? 13.555  -1.671  -12.046 1.00 0.00 ? 343 LYS A CD   5  
ATOM   5239  C  CE   . LYS A 1 36 ? 14.290  -1.420  -13.354 1.00 0.00 ? 343 LYS A CE   5  
ATOM   5240  N  NZ   . LYS A 1 36 ? 15.722  -1.808  -13.272 1.00 0.00 ? 343 LYS A NZ   5  
ATOM   5241  H  H    . LYS A 1 36 ? 12.613  0.601   -9.104  1.00 0.00 ? 343 LYS A H    5  
ATOM   5242  H  HA   . LYS A 1 36 ? 13.592  0.894   -11.122 1.00 0.00 ? 343 LYS A HA   5  
ATOM   5243  H  HB2  . LYS A 1 36 ? 10.864  0.461   -12.358 1.00 0.00 ? 343 LYS A HB2  5  
ATOM   5244  H  HB3  . LYS A 1 36 ? 12.387  0.541   -13.228 1.00 0.00 ? 343 LYS A HB3  5  
ATOM   5245  H  HG2  . LYS A 1 36 ? 11.588  -1.566  -11.218 1.00 0.00 ? 343 LYS A HG2  5  
ATOM   5246  H  HG3  . LYS A 1 36 ? 11.637  -1.756  -12.994 1.00 0.00 ? 343 LYS A HG3  5  
ATOM   5247  H  HD2  . LYS A 1 36 ? 14.035  -1.093  -11.259 1.00 0.00 ? 343 LYS A HD2  5  
ATOM   5248  H  HD3  . LYS A 1 36 ? 13.604  -2.736  -11.813 1.00 0.00 ? 343 LYS A HD3  5  
ATOM   5249  H  HE2  . LYS A 1 36 ? 13.815  -1.996  -14.134 1.00 0.00 ? 343 LYS A HE2  5  
ATOM   5250  H  HE3  . LYS A 1 36 ? 14.224  -0.369  -13.592 1.00 0.00 ? 343 LYS A HE3  5  
ATOM   5251  H  HZ1  . LYS A 1 36 ? 15.809  -2.815  -13.026 1.00 0.00 ? 343 LYS A HZ1  5  
ATOM   5252  H  HZ2  . LYS A 1 36 ? 16.205  -1.244  -12.545 1.00 0.00 ? 343 LYS A HZ2  5  
ATOM   5253  H  HZ3  . LYS A 1 36 ? 16.190  -1.647  -14.187 1.00 0.00 ? 343 LYS A HZ3  5  
ATOM   5254  N  N    . ALA A 1 37 ? 13.435  3.272   -11.641 1.00 0.00 ? 344 ALA A N    5  
ATOM   5255  C  CA   . ALA A 1 37 ? 13.444  4.729   -11.737 1.00 0.00 ? 344 ALA A CA   5  
ATOM   5256  C  C    . ALA A 1 37 ? 12.504  5.247   -12.817 1.00 0.00 ? 344 ALA A C    5  
ATOM   5257  O  O    . ALA A 1 37 ? 11.936  6.331   -12.689 1.00 0.00 ? 344 ALA A O    5  
ATOM   5258  C  CB   . ALA A 1 37 ? 14.861  5.222   -11.987 1.00 0.00 ? 344 ALA A CB   5  
ATOM   5259  H  H    . ALA A 1 37 ? 14.280  2.787   -11.750 1.00 0.00 ? 344 ALA A H    5  
ATOM   5260  H  HA   . ALA A 1 37 ? 13.122  5.122   -10.784 1.00 0.00 ? 344 ALA A HA   5  
ATOM   5261  H  HB1  . ALA A 1 37 ? 14.871  6.302   -11.989 1.00 0.00 ? 344 ALA A HB1  5  
ATOM   5262  H  HB2  . ALA A 1 37 ? 15.205  4.856   -12.942 1.00 0.00 ? 344 ALA A HB2  5  
ATOM   5263  H  HB3  . ALA A 1 37 ? 15.512  4.857   -11.206 1.00 0.00 ? 344 ALA A HB3  5  
ATOM   5264  N  N    . ASN A 1 38 ? 12.334  4.475   -13.876 1.00 0.00 ? 345 ASN A N    5  
ATOM   5265  C  CA   . ASN A 1 38 ? 11.471  4.883   -14.971 1.00 0.00 ? 345 ASN A CA   5  
ATOM   5266  C  C    . ASN A 1 38 ? 10.216  4.027   -15.015 1.00 0.00 ? 345 ASN A C    5  
ATOM   5267  O  O    . ASN A 1 38 ? 10.004  3.265   -15.959 1.00 0.00 ? 345 ASN A O    5  
ATOM   5268  C  CB   . ASN A 1 38 ? 12.217  4.811   -16.307 1.00 0.00 ? 345 ASN A CB   5  
ATOM   5269  C  CG   . ASN A 1 38 ? 13.403  5.754   -16.358 1.00 0.00 ? 345 ASN A CG   5  
ATOM   5270  O  OD1  . ASN A 1 38 ? 13.266  6.917   -16.737 1.00 0.00 ? 345 ASN A OD1  5  
ATOM   5271  N  ND2  . ASN A 1 38 ? 14.573  5.258   -15.985 1.00 0.00 ? 345 ASN A ND2  5  
ATOM   5272  H  H    . ASN A 1 38 ? 12.791  3.608   -13.920 1.00 0.00 ? 345 ASN A H    5  
ATOM   5273  H  HA   . ASN A 1 38 ? 11.181  5.909   -14.792 1.00 0.00 ? 345 ASN A HA   5  
ATOM   5274  H  HB2  . ASN A 1 38 ? 12.574  3.804   -16.458 1.00 0.00 ? 345 ASN A HB2  5  
ATOM   5275  H  HB3  . ASN A 1 38 ? 11.538  5.070   -17.105 1.00 0.00 ? 345 ASN A HB3  5  
ATOM   5276  H  HD21 . ASN A 1 38 ? 14.611  4.321   -15.699 1.00 0.00 ? 345 ASN A HD21 5  
ATOM   5277  H  HD22 . ASN A 1 38 ? 15.357  5.850   -16.005 1.00 0.00 ? 345 ASN A HD22 5  
ATOM   5278  N  N    . CYS A 1 39 ? 9.405   4.134   -13.971 1.00 0.00 ? 346 CYS A N    5  
ATOM   5279  C  CA   . CYS A 1 39 ? 8.122   3.446   -13.909 1.00 0.00 ? 346 CYS A CA   5  
ATOM   5280  C  C    . CYS A 1 39 ? 7.341   3.906   -12.687 1.00 0.00 ? 346 CYS A C    5  
ATOM   5281  O  O    . CYS A 1 39 ? 6.391   4.676   -12.812 1.00 0.00 ? 346 CYS A O    5  
ATOM   5282  C  CB   . CYS A 1 39 ? 8.310   1.925   -13.868 1.00 0.00 ? 346 CYS A CB   5  
ATOM   5283  S  SG   . CYS A 1 39 ? 6.760   0.978   -13.777 1.00 0.00 ? 346 CYS A SG   5  
ATOM   5284  H  H    . CYS A 1 39 ? 9.680   4.697   -13.213 1.00 0.00 ? 346 CYS A H    5  
ATOM   5285  H  HA   . CYS A 1 39 ? 7.567   3.709   -14.797 1.00 0.00 ? 346 CYS A HA   5  
ATOM   5286  H  HB2  . CYS A 1 39 ? 8.833   1.611   -14.759 1.00 0.00 ? 346 CYS A HB2  5  
ATOM   5287  H  HB3  . CYS A 1 39 ? 8.902   1.670   -13.002 1.00 0.00 ? 346 CYS A HB3  5  
ATOM   5288  N  N    . TYR A 1 40 ? 7.772   3.438   -11.512 1.00 0.00 ? 347 TYR A N    5  
ATOM   5289  C  CA   . TYR A 1 40 ? 7.125   3.750   -10.234 1.00 0.00 ? 347 TYR A CA   5  
ATOM   5290  C  C    . TYR A 1 40 ? 5.606   3.618   -10.311 1.00 0.00 ? 347 TYR A C    5  
ATOM   5291  O  O    . TYR A 1 40 ? 4.877   4.604   -10.418 1.00 0.00 ? 347 TYR A O    5  
ATOM   5292  C  CB   . TYR A 1 40 ? 7.538   5.136   -9.741  1.00 0.00 ? 347 TYR A CB   5  
ATOM   5293  C  CG   . TYR A 1 40 ? 8.993   5.198   -9.339  1.00 0.00 ? 347 TYR A CG   5  
ATOM   5294  C  CD1  . TYR A 1 40 ? 9.529   4.231   -8.500  1.00 0.00 ? 347 TYR A CD1  5  
ATOM   5295  C  CD2  . TYR A 1 40 ? 9.828   6.211   -9.795  1.00 0.00 ? 347 TYR A CD2  5  
ATOM   5296  C  CE1  . TYR A 1 40 ? 10.858  4.267   -8.125  1.00 0.00 ? 347 TYR A CE1  5  
ATOM   5297  C  CE2  . TYR A 1 40 ? 11.160  6.255   -9.424  1.00 0.00 ? 347 TYR A CE2  5  
ATOM   5298  C  CZ   . TYR A 1 40 ? 11.670  5.280   -8.589  1.00 0.00 ? 347 TYR A CZ   5  
ATOM   5299  O  OH   . TYR A 1 40 ? 12.997  5.316   -8.222  1.00 0.00 ? 347 TYR A OH   5  
ATOM   5300  H  H    . TYR A 1 40 ? 8.571   2.867   -11.499 1.00 0.00 ? 347 TYR A H    5  
ATOM   5301  H  HA   . TYR A 1 40 ? 7.479   3.020   -9.521  1.00 0.00 ? 347 TYR A HA   5  
ATOM   5302  H  HB2  . TYR A 1 40 ? 7.375   5.857   -10.529 1.00 0.00 ? 347 TYR A HB2  5  
ATOM   5303  H  HB3  . TYR A 1 40 ? 6.941   5.401   -8.881  1.00 0.00 ? 347 TYR A HB3  5  
ATOM   5304  H  HD1  . TYR A 1 40 ? 8.885   3.434   -8.142  1.00 0.00 ? 347 TYR A HD1  5  
ATOM   5305  H  HD2  . TYR A 1 40 ? 9.423   6.972   -10.448 1.00 0.00 ? 347 TYR A HD2  5  
ATOM   5306  H  HE1  . TYR A 1 40 ? 11.256  3.504   -7.473  1.00 0.00 ? 347 TYR A HE1  5  
ATOM   5307  H  HE2  . TYR A 1 40 ? 11.795  7.049   -9.788  1.00 0.00 ? 347 TYR A HE2  5  
ATOM   5308  H  HH   . TYR A 1 40 ? 13.237  6.215   -7.978  1.00 0.00 ? 347 TYR A HH   5  
ATOM   5309  N  N    . THR A 1 41 ? 5.144   2.384   -10.242 1.00 0.00 ? 348 THR A N    5  
ATOM   5310  C  CA   . THR A 1 41 ? 3.730   2.077   -10.421 1.00 0.00 ? 348 THR A CA   5  
ATOM   5311  C  C    . THR A 1 41 ? 3.037   1.961   -9.067  1.00 0.00 ? 348 THR A C    5  
ATOM   5312  O  O    . THR A 1 41 ? 3.497   1.229   -8.202  1.00 0.00 ? 348 THR A O    5  
ATOM   5313  C  CB   . THR A 1 41 ? 3.552   0.749   -11.184 1.00 0.00 ? 348 THR A CB   5  
ATOM   5314  O  OG1  . THR A 1 41 ? 4.554   0.628   -12.217 1.00 0.00 ? 348 THR A OG1  5  
ATOM   5315  C  CG2  . THR A 1 41 ? 2.167   0.672   -11.808 1.00 0.00 ? 348 THR A CG2  5  
ATOM   5316  H  H    . THR A 1 41 ? 5.773   1.658   -10.034 1.00 0.00 ? 348 THR A H    5  
ATOM   5317  H  HA   . THR A 1 41 ? 3.275   2.873   -10.993 1.00 0.00 ? 348 THR A HA   5  
ATOM   5318  H  HB   . THR A 1 41 ? 3.662   -0.069  -10.486 1.00 0.00 ? 348 THR A HB   5  
ATOM   5319  H  HG1  . THR A 1 41 ? 4.503   1.420   -12.788 1.00 0.00 ? 348 THR A HG1  5  
ATOM   5320  H  HG21 . THR A 1 41 ? 1.419   0.750   -11.033 1.00 0.00 ? 348 THR A HG21 5  
ATOM   5321  H  HG22 . THR A 1 41 ? 2.054   -0.272  -12.324 1.00 0.00 ? 348 THR A HG22 5  
ATOM   5322  H  HG23 . THR A 1 41 ? 2.043   1.482   -12.509 1.00 0.00 ? 348 THR A HG23 5  
ATOM   5323  N  N    . ALA A 1 42 ? 1.929   2.657   -8.887  1.00 0.00 ? 349 ALA A N    5  
ATOM   5324  C  CA   . ALA A 1 42 ? 1.248   2.656   -7.602  1.00 0.00 ? 349 ALA A CA   5  
ATOM   5325  C  C    . ALA A 1 42 ? 0.057   1.712   -7.602  1.00 0.00 ? 349 ALA A C    5  
ATOM   5326  O  O    . ALA A 1 42 ? -0.683  1.621   -8.582  1.00 0.00 ? 349 ALA A O    5  
ATOM   5327  C  CB   . ALA A 1 42 ? 0.811   4.063   -7.241  1.00 0.00 ? 349 ALA A CB   5  
ATOM   5328  H  H    . ALA A 1 42 ? 1.555   3.177   -9.628  1.00 0.00 ? 349 ALA A H    5  
ATOM   5329  H  HA   . ALA A 1 42 ? 1.953   2.325   -6.853  1.00 0.00 ? 349 ALA A HA   5  
ATOM   5330  H  HB1  . ALA A 1 42 ? 0.331   4.055   -6.274  1.00 0.00 ? 349 ALA A HB1  5  
ATOM   5331  H  HB2  . ALA A 1 42 ? 0.119   4.427   -7.986  1.00 0.00 ? 349 ALA A HB2  5  
ATOM   5332  H  HB3  . ALA A 1 42 ? 1.677   4.703   -7.208  1.00 0.00 ? 349 ALA A HB3  5  
ATOM   5333  N  N    . PHE A 1 43 ? -0.102  0.991   -6.503  1.00 0.00 ? 350 PHE A N    5  
ATOM   5334  C  CA   . PHE A 1 43 ? -1.216  0.076   -6.330  1.00 0.00 ? 350 PHE A CA   5  
ATOM   5335  C  C    . PHE A 1 43 ? -1.457  -0.197  -4.850  1.00 0.00 ? 350 PHE A C    5  
ATOM   5336  O  O    . PHE A 1 43 ? -0.587  0.034   -4.014  1.00 0.00 ? 350 PHE A O    5  
ATOM   5337  C  CB   . PHE A 1 43 ? -0.981  -1.232  -7.104  1.00 0.00 ? 350 PHE A CB   5  
ATOM   5338  C  CG   . PHE A 1 43 ? 0.375   -1.850  -6.895  1.00 0.00 ? 350 PHE A CG   5  
ATOM   5339  C  CD1  . PHE A 1 43 ? 1.478   -1.388  -7.597  1.00 0.00 ? 350 PHE A CD1  5  
ATOM   5340  C  CD2  . PHE A 1 43 ? 0.544   -2.898  -6.008  1.00 0.00 ? 350 PHE A CD2  5  
ATOM   5341  C  CE1  . PHE A 1 43 ? 2.721   -1.957  -7.415  1.00 0.00 ? 350 PHE A CE1  5  
ATOM   5342  C  CE2  . PHE A 1 43 ? 1.787   -3.471  -5.824  1.00 0.00 ? 350 PHE A CE2  5  
ATOM   5343  C  CZ   . PHE A 1 43 ? 2.875   -3.000  -6.528  1.00 0.00 ? 350 PHE A CZ   5  
ATOM   5344  H  H    . PHE A 1 43 ? 0.562   1.070   -5.779  1.00 0.00 ? 350 PHE A H    5  
ATOM   5345  H  HA   . PHE A 1 43 ? -2.094  0.560   -6.731  1.00 0.00 ? 350 PHE A HA   5  
ATOM   5346  H  HB2  . PHE A 1 43 ? -1.720  -1.957  -6.799  1.00 0.00 ? 350 PHE A HB2  5  
ATOM   5347  H  HB3  . PHE A 1 43 ? -1.096  -1.037  -8.161  1.00 0.00 ? 350 PHE A HB3  5  
ATOM   5348  H  HD1  . PHE A 1 43 ? 1.359   -0.570  -8.293  1.00 0.00 ? 350 PHE A HD1  5  
ATOM   5349  H  HD2  . PHE A 1 43 ? -0.309  -3.266  -5.456  1.00 0.00 ? 350 PHE A HD2  5  
ATOM   5350  H  HE1  . PHE A 1 43 ? 3.569   -1.588  -7.968  1.00 0.00 ? 350 PHE A HE1  5  
ATOM   5351  H  HE2  . PHE A 1 43 ? 1.906   -4.290  -5.134  1.00 0.00 ? 350 PHE A HE2  5  
ATOM   5352  H  HZ   . PHE A 1 43 ? 3.848   -3.448  -6.382  1.00 0.00 ? 350 PHE A HZ   5  
ATOM   5353  N  N    . HIS A 1 44 ? -2.655  -0.660  -4.528  1.00 0.00 ? 351 HIS A N    5  
ATOM   5354  C  CA   . HIS A 1 44 ? -3.021  -0.918  -3.141  1.00 0.00 ? 351 HIS A CA   5  
ATOM   5355  C  C    . HIS A 1 44 ? -2.442  -2.245  -2.678  1.00 0.00 ? 351 HIS A C    5  
ATOM   5356  O  O    . HIS A 1 44 ? -2.316  -3.179  -3.469  1.00 0.00 ? 351 HIS A O    5  
ATOM   5357  C  CB   . HIS A 1 44 ? -4.544  -0.925  -2.961  1.00 0.00 ? 351 HIS A CB   5  
ATOM   5358  C  CG   . HIS A 1 44 ? -5.196  0.395   -3.237  1.00 0.00 ? 351 HIS A CG   5  
ATOM   5359  N  ND1  . HIS A 1 44 ? -6.164  0.572   -4.211  1.00 0.00 ? 351 HIS A ND1  5  
ATOM   5360  C  CD2  . HIS A 1 44 ? -5.015  1.608   -2.663  1.00 0.00 ? 351 HIS A CD2  5  
ATOM   5361  C  CE1  . HIS A 1 44 ? -6.543  1.843   -4.213  1.00 0.00 ? 351 HIS A CE1  5  
ATOM   5362  N  NE2  . HIS A 1 44 ? -5.862  2.494   -3.291  1.00 0.00 ? 351 HIS A NE2  5  
ATOM   5363  H  H    . HIS A 1 44 ? -3.298  -0.845  -5.239  1.00 0.00 ? 351 HIS A H    5  
ATOM   5364  H  HA   . HIS A 1 44 ? -2.602  -0.129  -2.538  1.00 0.00 ? 351 HIS A HA   5  
ATOM   5365  H  HB2  . HIS A 1 44 ? -4.975  -1.653  -3.632  1.00 0.00 ? 351 HIS A HB2  5  
ATOM   5366  H  HB3  . HIS A 1 44 ? -4.777  -1.204  -1.943  1.00 0.00 ? 351 HIS A HB3  5  
ATOM   5367  H  HD2  . HIS A 1 44 ? -4.343  1.836   -1.846  1.00 0.00 ? 351 HIS A HD2  5  
ATOM   5368  H  HE1  . HIS A 1 44 ? -7.288  2.274   -4.866  1.00 0.00 ? 351 HIS A HE1  5  
ATOM   5369  H  HE2  . HIS A 1 44 ? -5.713  3.466   -3.317  1.00 0.00 ? 351 HIS A HE2  5  
ATOM   5370  N  N    . VAL A 1 45 ? -2.102  -2.322  -1.397  1.00 0.00 ? 352 VAL A N    5  
ATOM   5371  C  CA   . VAL A 1 45 ? -1.531  -3.539  -0.828  1.00 0.00 ? 352 VAL A CA   5  
ATOM   5372  C  C    . VAL A 1 45 ? -2.492  -4.716  -0.992  1.00 0.00 ? 352 VAL A C    5  
ATOM   5373  O  O    . VAL A 1 45 ? -2.076  -5.835  -1.294  1.00 0.00 ? 352 VAL A O    5  
ATOM   5374  C  CB   . VAL A 1 45 ? -1.187  -3.352  0.666   1.00 0.00 ? 352 VAL A CB   5  
ATOM   5375  C  CG1  . VAL A 1 45 ? -0.539  -4.604  1.237   1.00 0.00 ? 352 VAL A CG1  5  
ATOM   5376  C  CG2  . VAL A 1 45 ? -0.282  -2.145  0.856   1.00 0.00 ? 352 VAL A CG2  5  
ATOM   5377  H  H    . VAL A 1 45 ? -2.232  -1.540  -0.818  1.00 0.00 ? 352 VAL A H    5  
ATOM   5378  H  HA   . VAL A 1 45 ? -0.616  -3.755  -1.364  1.00 0.00 ? 352 VAL A HA   5  
ATOM   5379  H  HB   . VAL A 1 45 ? -2.103  -3.174  1.206   1.00 0.00 ? 352 VAL A HB   5  
ATOM   5380  H  HG11 . VAL A 1 45 ? -0.305  -4.444  2.279   1.00 0.00 ? 352 VAL A HG11 5  
ATOM   5381  H  HG12 . VAL A 1 45 ? 0.369   -4.820  0.693   1.00 0.00 ? 352 VAL A HG12 5  
ATOM   5382  H  HG13 . VAL A 1 45 ? -1.221  -5.435  1.145   1.00 0.00 ? 352 VAL A HG13 5  
ATOM   5383  H  HG21 . VAL A 1 45 ? -0.779  -1.264  0.481   1.00 0.00 ? 352 VAL A HG21 5  
ATOM   5384  H  HG22 . VAL A 1 45 ? 0.641   -2.298  0.314   1.00 0.00 ? 352 VAL A HG22 5  
ATOM   5385  H  HG23 . VAL A 1 45 ? -0.066  -2.017  1.906   1.00 0.00 ? 352 VAL A HG23 5  
ATOM   5386  N  N    . THR A 1 46 ? -3.781  -4.455  -0.808  1.00 0.00 ? 353 THR A N    5  
ATOM   5387  C  CA   . THR A 1 46 ? -4.798  -5.476  -1.004  1.00 0.00 ? 353 THR A CA   5  
ATOM   5388  C  C    . THR A 1 46 ? -4.860  -5.905  -2.475  1.00 0.00 ? 353 THR A C    5  
ATOM   5389  O  O    . THR A 1 46 ? -4.960  -7.094  -2.772  1.00 0.00 ? 353 THR A O    5  
ATOM   5390  C  CB   . THR A 1 46 ? -6.192  -4.999  -0.516  1.00 0.00 ? 353 THR A CB   5  
ATOM   5391  O  OG1  . THR A 1 46 ? -7.180  -6.015  -0.744  1.00 0.00 ? 353 THR A OG1  5  
ATOM   5392  C  CG2  . THR A 1 46 ? -6.616  -3.711  -1.208  1.00 0.00 ? 353 THR A CG2  5  
ATOM   5393  H  H    . THR A 1 46 ? -4.051  -3.560  -0.513  1.00 0.00 ? 353 THR A H    5  
ATOM   5394  H  HA   . THR A 1 46 ? -4.512  -6.333  -0.410  1.00 0.00 ? 353 THR A HA   5  
ATOM   5395  H  HB   . THR A 1 46 ? -6.132  -4.811  0.546   1.00 0.00 ? 353 THR A HB   5  
ATOM   5396  H  HG1  . THR A 1 46 ? -7.022  -6.755  -0.144  1.00 0.00 ? 353 THR A HG1  5  
ATOM   5397  H  HG21 . THR A 1 46 ? -7.594  -3.419  -0.855  1.00 0.00 ? 353 THR A HG21 5  
ATOM   5398  H  HG22 . THR A 1 46 ? -6.652  -3.870  -2.277  1.00 0.00 ? 353 THR A HG22 5  
ATOM   5399  H  HG23 . THR A 1 46 ? -5.904  -2.931  -0.984  1.00 0.00 ? 353 THR A HG23 5  
ATOM   5400  N  N    . CYS A 1 47 ? -4.750  -4.936  -3.390  1.00 0.00 ? 354 CYS A N    5  
ATOM   5401  C  CA   . CYS A 1 47 ? -4.764  -5.217  -4.825  1.00 0.00 ? 354 CYS A CA   5  
ATOM   5402  C  C    . CYS A 1 47 ? -3.585  -6.105  -5.206  1.00 0.00 ? 354 CYS A C    5  
ATOM   5403  O  O    . CYS A 1 47 ? -3.711  -7.002  -6.036  1.00 0.00 ? 354 CYS A O    5  
ATOM   5404  C  CB   . CYS A 1 47 ? -4.705  -3.918  -5.635  1.00 0.00 ? 354 CYS A CB   5  
ATOM   5405  S  SG   . CYS A 1 47 ? -6.101  -2.791  -5.377  1.00 0.00 ? 354 CYS A SG   5  
ATOM   5406  H  H    . CYS A 1 47 ? -4.658  -4.013  -3.089  1.00 0.00 ? 354 CYS A H    5  
ATOM   5407  H  HA   . CYS A 1 47 ? -5.682  -5.738  -5.057  1.00 0.00 ? 354 CYS A HA   5  
ATOM   5408  H  HB2  . CYS A 1 47 ? -3.803  -3.385  -5.374  1.00 0.00 ? 354 CYS A HB2  5  
ATOM   5409  H  HB3  . CYS A 1 47 ? -4.674  -4.165  -6.687  1.00 0.00 ? 354 CYS A HB3  5  
ATOM   5410  N  N    . ALA A 1 48 ? -2.441  -5.851  -4.584  1.00 0.00 ? 355 ALA A N    5  
ATOM   5411  C  CA   . ALA A 1 48 ? -1.247  -6.644  -4.825  1.00 0.00 ? 355 ALA A CA   5  
ATOM   5412  C  C    . ALA A 1 48 ? -1.479  -8.096  -4.432  1.00 0.00 ? 355 ALA A C    5  
ATOM   5413  O  O    . ALA A 1 48 ? -1.048  -9.017  -5.124  1.00 0.00 ? 355 ALA A O    5  
ATOM   5414  C  CB   . ALA A 1 48 ? -0.074  -6.074  -4.053  1.00 0.00 ? 355 ALA A CB   5  
ATOM   5415  H  H    . ALA A 1 48 ? -2.398  -5.102  -3.947  1.00 0.00 ? 355 ALA A H    5  
ATOM   5416  H  HA   . ALA A 1 48 ? -1.016  -6.594  -5.880  1.00 0.00 ? 355 ALA A HA   5  
ATOM   5417  H  HB1  . ALA A 1 48 ? 0.100   -5.054  -4.362  1.00 0.00 ? 355 ALA A HB1  5  
ATOM   5418  H  HB2  . ALA A 1 48 ? 0.808   -6.666  -4.249  1.00 0.00 ? 355 ALA A HB2  5  
ATOM   5419  H  HB3  . ALA A 1 48 ? -0.294  -6.097  -2.995  1.00 0.00 ? 355 ALA A HB3  5  
ATOM   5420  N  N    . GLN A 1 49 ? -2.166  -8.284  -3.313  1.00 0.00 ? 356 GLN A N    5  
ATOM   5421  C  CA   . GLN A 1 49 ? -2.496  -9.616  -2.822  1.00 0.00 ? 356 GLN A CA   5  
ATOM   5422  C  C    . GLN A 1 49 ? -3.564  -10.275 -3.690  1.00 0.00 ? 356 GLN A C    5  
ATOM   5423  O  O    . GLN A 1 49 ? -3.682  -11.500 -3.726  1.00 0.00 ? 356 GLN A O    5  
ATOM   5424  C  CB   . GLN A 1 49 ? -2.957  -9.534  -1.366  1.00 0.00 ? 356 GLN A CB   5  
ATOM   5425  C  CG   . GLN A 1 49 ? -1.866  -9.041  -0.431  1.00 0.00 ? 356 GLN A CG   5  
ATOM   5426  C  CD   . GLN A 1 49 ? -2.395  -8.721  0.953   1.00 0.00 ? 356 GLN A CD   5  
ATOM   5427  O  OE1  . GLN A 1 49 ? -2.442  -9.583  1.829   1.00 0.00 ? 356 GLN A OE1  5  
ATOM   5428  N  NE2  . GLN A 1 49 ? -2.791  -7.475  1.160   1.00 0.00 ? 356 GLN A NE2  5  
ATOM   5429  H  H    . GLN A 1 49 ? -2.461  -7.500  -2.802  1.00 0.00 ? 356 GLN A H    5  
ATOM   5430  H  HA   . GLN A 1 49 ? -1.598  -10.215 -2.868  1.00 0.00 ? 356 GLN A HA   5  
ATOM   5431  H  HB2  . GLN A 1 49 ? -3.798  -8.846  -1.303  1.00 0.00 ? 356 GLN A HB2  5  
ATOM   5432  H  HB3  . GLN A 1 49 ? -3.267  -10.525 -1.041  1.00 0.00 ? 356 GLN A HB3  5  
ATOM   5433  H  HG2  . GLN A 1 49 ? -1.109  -9.820  -0.338  1.00 0.00 ? 356 GLN A HG2  5  
ATOM   5434  H  HG3  . GLN A 1 49 ? -1.427  -8.138  -0.853  1.00 0.00 ? 356 GLN A HG3  5  
ATOM   5435  H  HE21 . GLN A 1 49 ? -2.718  -6.836  0.420   1.00 0.00 ? 356 GLN A HE21 5  
ATOM   5436  H  HE22 . GLN A 1 49 ? -3.144  -7.241  2.048   1.00 0.00 ? 356 GLN A HE22 5  
ATOM   5437  N  N    . LYS A 1 50 ? -4.351  -9.454  -4.373  1.00 0.00 ? 357 LYS A N    5  
ATOM   5438  C  CA   . LYS A 1 50 ? -5.351  -9.957  -5.307  1.00 0.00 ? 357 LYS A CA   5  
ATOM   5439  C  C    . LYS A 1 50 ? -4.671  -10.560 -6.535  1.00 0.00 ? 357 LYS A C    5  
ATOM   5440  O  O    . LYS A 1 50 ? -5.044  -11.637 -6.997  1.00 0.00 ? 357 LYS A O    5  
ATOM   5441  C  CB   . LYS A 1 50 ? -6.303  -8.840  -5.755  1.00 0.00 ? 357 LYS A CB   5  
ATOM   5442  C  CG   . LYS A 1 50 ? -7.105  -8.187  -4.637  1.00 0.00 ? 357 LYS A CG   5  
ATOM   5443  C  CD   . LYS A 1 50 ? -7.970  -9.191  -3.888  1.00 0.00 ? 357 LYS A CD   5  
ATOM   5444  C  CE   . LYS A 1 50 ? -7.328  -9.617  -2.573  1.00 0.00 ? 357 LYS A CE   5  
ATOM   5445  N  NZ   . LYS A 1 50 ? -8.139  -10.640 -1.864  1.00 0.00 ? 357 LYS A NZ   5  
ATOM   5446  H  H    . LYS A 1 50 ? -4.260  -8.484  -4.243  1.00 0.00 ? 357 LYS A H    5  
ATOM   5447  H  HA   . LYS A 1 50 ? -5.918  -10.726 -4.806  1.00 0.00 ? 357 LYS A HA   5  
ATOM   5448  H  HB2  . LYS A 1 50 ? -5.722  -8.070  -6.242  1.00 0.00 ? 357 LYS A HB2  5  
ATOM   5449  H  HB3  . LYS A 1 50 ? -6.998  -9.249  -6.471  1.00 0.00 ? 357 LYS A HB3  5  
ATOM   5450  H  HG2  . LYS A 1 50 ? -6.416  -7.730  -3.932  1.00 0.00 ? 357 LYS A HG2  5  
ATOM   5451  H  HG3  . LYS A 1 50 ? -7.750  -7.424  -5.072  1.00 0.00 ? 357 LYS A HG3  5  
ATOM   5452  H  HD2  . LYS A 1 50 ? -8.926  -8.739  -3.679  1.00 0.00 ? 357 LYS A HD2  5  
ATOM   5453  H  HD3  . LYS A 1 50 ? -8.109  -10.063 -4.509  1.00 0.00 ? 357 LYS A HD3  5  
ATOM   5454  H  HE2  . LYS A 1 50 ? -6.350  -10.023 -2.781  1.00 0.00 ? 357 LYS A HE2  5  
ATOM   5455  H  HE3  . LYS A 1 50 ? -7.228  -8.748  -1.941  1.00 0.00 ? 357 LYS A HE3  5  
ATOM   5456  H  HZ1  . LYS A 1 50 ? -8.258  -11.483 -2.464  1.00 0.00 ? 357 LYS A HZ1  5  
ATOM   5457  H  HZ2  . LYS A 1 50 ? -9.078  -10.259 -1.633  1.00 0.00 ? 357 LYS A HZ2  5  
ATOM   5458  H  HZ3  . LYS A 1 50 ? -7.666  -10.922 -0.985  1.00 0.00 ? 357 LYS A HZ3  5  
ATOM   5459  N  N    . ALA A 1 51 ? -3.672  -9.852  -7.053  1.00 0.00 ? 358 ALA A N    5  
ATOM   5460  C  CA   . ALA A 1 51 ? -2.970  -10.277 -8.260  1.00 0.00 ? 358 ALA A CA   5  
ATOM   5461  C  C    . ALA A 1 51 ? -1.887  -11.310 -7.949  1.00 0.00 ? 358 ALA A C    5  
ATOM   5462  O  O    . ALA A 1 51 ? -1.695  -12.264 -8.703  1.00 0.00 ? 358 ALA A O    5  
ATOM   5463  C  CB   . ALA A 1 51 ? -2.365  -9.072  -8.968  1.00 0.00 ? 358 ALA A CB   5  
ATOM   5464  H  H    . ALA A 1 51 ? -3.408  -9.012  -6.618  1.00 0.00 ? 358 ALA A H    5  
ATOM   5465  H  HA   . ALA A 1 51 ? -3.695  -10.725 -8.925  1.00 0.00 ? 358 ALA A HA   5  
ATOM   5466  H  HB1  . ALA A 1 51 ? -1.635  -8.606  -8.324  1.00 0.00 ? 358 ALA A HB1  5  
ATOM   5467  H  HB2  . ALA A 1 51 ? -3.146  -8.362  -9.199  1.00 0.00 ? 358 ALA A HB2  5  
ATOM   5468  H  HB3  . ALA A 1 51 ? -1.888  -9.393  -9.883  1.00 0.00 ? 358 ALA A HB3  5  
ATOM   5469  N  N    . GLY A 1 52 ? -1.185  -11.118 -6.842  1.00 0.00 ? 359 GLY A N    5  
ATOM   5470  C  CA   . GLY A 1 52 ? -0.103  -12.017 -6.483  1.00 0.00 ? 359 GLY A CA   5  
ATOM   5471  C  C    . GLY A 1 52 ? 1.193   -11.631 -7.164  1.00 0.00 ? 359 GLY A C    5  
ATOM   5472  O  O    . GLY A 1 52 ? 1.825   -12.451 -7.830  1.00 0.00 ? 359 GLY A O    5  
ATOM   5473  H  H    . GLY A 1 52 ? -1.395  -10.352 -6.264  1.00 0.00 ? 359 GLY A H    5  
ATOM   5474  H  HA2  . GLY A 1 52 ? 0.038   -11.985 -5.412  1.00 0.00 ? 359 GLY A HA2  5  
ATOM   5475  H  HA3  . GLY A 1 52 ? -0.368  -13.022 -6.775  1.00 0.00 ? 359 GLY A HA3  5  
ATOM   5476  N  N    . LEU A 1 53 ? 1.587   -10.377 -7.000  1.00 0.00 ? 360 LEU A N    5  
ATOM   5477  C  CA   . LEU A 1 53 ? 2.774   -9.858  -7.670  1.00 0.00 ? 360 LEU A CA   5  
ATOM   5478  C  C    . LEU A 1 53 ? 4.020   -9.990  -6.794  1.00 0.00 ? 360 LEU A C    5  
ATOM   5479  O  O    . LEU A 1 53 ? 3.963   -10.556 -5.701  1.00 0.00 ? 360 LEU A O    5  
ATOM   5480  C  CB   . LEU A 1 53 ? 2.543   -8.405  -8.101  1.00 0.00 ? 360 LEU A CB   5  
ATOM   5481  C  CG   . LEU A 1 53 ? 1.971   -7.469  -7.029  1.00 0.00 ? 360 LEU A CG   5  
ATOM   5482  C  CD1  . LEU A 1 53 ? 3.053   -6.992  -6.072  1.00 0.00 ? 360 LEU A CD1  5  
ATOM   5483  C  CD2  . LEU A 1 53 ? 1.280   -6.287  -7.684  1.00 0.00 ? 360 LEU A CD2  5  
ATOM   5484  H  H    . LEU A 1 53 ? 1.075   -9.792  -6.408  1.00 0.00 ? 360 LEU A H    5  
ATOM   5485  H  HA   . LEU A 1 53 ? 2.923   -10.457 -8.557  1.00 0.00 ? 360 LEU A HA   5  
ATOM   5486  H  HB2  . LEU A 1 53 ? 3.503   -7.994  -8.425  1.00 0.00 ? 360 LEU A HB2  5  
ATOM   5487  H  HB3  . LEU A 1 53 ? 1.850   -8.414  -8.946  1.00 0.00 ? 360 LEU A HB3  5  
ATOM   5488  H  HG   . LEU A 1 53 ? 1.232   -8.003  -6.452  1.00 0.00 ? 360 LEU A HG   5  
ATOM   5489  H  HD11 . LEU A 1 53 ? 3.819   -6.469  -6.625  1.00 0.00 ? 360 LEU A HD11 5  
ATOM   5490  H  HD12 . LEU A 1 53 ? 3.489   -7.842  -5.569  1.00 0.00 ? 360 LEU A HD12 5  
ATOM   5491  H  HD13 . LEU A 1 53 ? 2.619   -6.326  -5.341  1.00 0.00 ? 360 LEU A HD13 5  
ATOM   5492  H  HD21 . LEU A 1 53 ? 0.885   -5.634  -6.921  1.00 0.00 ? 360 LEU A HD21 5  
ATOM   5493  H  HD22 . LEU A 1 53 ? 0.473   -6.642  -8.308  1.00 0.00 ? 360 LEU A HD22 5  
ATOM   5494  H  HD23 . LEU A 1 53 ? 1.991   -5.745  -8.289  1.00 0.00 ? 360 LEU A HD23 5  
ATOM   5495  N  N    . TYR A 1 54 ? 5.137   -9.460  -7.275  1.00 0.00 ? 361 TYR A N    5  
ATOM   5496  C  CA   . TYR A 1 54 ? 6.413   -9.608  -6.588  1.00 0.00 ? 361 TYR A CA   5  
ATOM   5497  C  C    . TYR A 1 54 ? 6.656   -8.449  -5.628  1.00 0.00 ? 361 TYR A C    5  
ATOM   5498  O  O    . TYR A 1 54 ? 6.564   -7.277  -6.006  1.00 0.00 ? 361 TYR A O    5  
ATOM   5499  C  CB   . TYR A 1 54 ? 7.554   -9.690  -7.610  1.00 0.00 ? 361 TYR A CB   5  
ATOM   5500  C  CG   . TYR A 1 54 ? 8.906   -10.003 -7.000  1.00 0.00 ? 361 TYR A CG   5  
ATOM   5501  C  CD1  . TYR A 1 54 ? 9.681   -9.002  -6.427  1.00 0.00 ? 361 TYR A CD1  5  
ATOM   5502  C  CD2  . TYR A 1 54 ? 9.408   -11.298 -7.003  1.00 0.00 ? 361 TYR A CD2  5  
ATOM   5503  C  CE1  . TYR A 1 54 ? 10.914  -9.281  -5.872  1.00 0.00 ? 361 TYR A CE1  5  
ATOM   5504  C  CE2  . TYR A 1 54 ? 10.641  -11.586 -6.452  1.00 0.00 ? 361 TYR A CE2  5  
ATOM   5505  C  CZ   . TYR A 1 54 ? 11.391  -10.575 -5.889  1.00 0.00 ? 361 TYR A CZ   5  
ATOM   5506  O  OH   . TYR A 1 54 ? 12.621  -10.856 -5.340  1.00 0.00 ? 361 TYR A OH   5  
ATOM   5507  H  H    . TYR A 1 54 ? 5.104   -8.943  -8.106  1.00 0.00 ? 361 TYR A H    5  
ATOM   5508  H  HA   . TYR A 1 54 ? 6.380   -10.527 -6.025  1.00 0.00 ? 361 TYR A HA   5  
ATOM   5509  H  HB2  . TYR A 1 54 ? 7.331   -10.465 -8.328  1.00 0.00 ? 361 TYR A HB2  5  
ATOM   5510  H  HB3  . TYR A 1 54 ? 7.635   -8.745  -8.124  1.00 0.00 ? 361 TYR A HB3  5  
ATOM   5511  H  HD1  . TYR A 1 54 ? 9.301   -7.991  -6.413  1.00 0.00 ? 361 TYR A HD1  5  
ATOM   5512  H  HD2  . TYR A 1 54 ? 8.819   -12.088 -7.445  1.00 0.00 ? 361 TYR A HD2  5  
ATOM   5513  H  HE1  . TYR A 1 54 ? 11.499  -8.487  -5.430  1.00 0.00 ? 361 TYR A HE1  5  
ATOM   5514  H  HE2  . TYR A 1 54 ? 11.016  -12.600 -6.465  1.00 0.00 ? 361 TYR A HE2  5  
ATOM   5515  H  HH   . TYR A 1 54 ? 12.668  -10.491 -4.454  1.00 0.00 ? 361 TYR A HH   5  
ATOM   5516  N  N    . MET A 1 55 ? 6.976   -8.785  -4.387  1.00 0.00 ? 362 MET A N    5  
ATOM   5517  C  CA   . MET A 1 55 ? 7.317   -7.785  -3.386  1.00 0.00 ? 362 MET A CA   5  
ATOM   5518  C  C    . MET A 1 55 ? 8.644   -8.113  -2.718  1.00 0.00 ? 362 MET A C    5  
ATOM   5519  O  O    . MET A 1 55 ? 9.072   -9.266  -2.686  1.00 0.00 ? 362 MET A O    5  
ATOM   5520  C  CB   . MET A 1 55 ? 6.224   -7.670  -2.322  1.00 0.00 ? 362 MET A CB   5  
ATOM   5521  C  CG   . MET A 1 55 ? 5.053   -6.798  -2.738  1.00 0.00 ? 362 MET A CG   5  
ATOM   5522  S  SD   . MET A 1 55 ? 3.867   -6.548  -1.403  1.00 0.00 ? 362 MET A SD   5  
ATOM   5523  C  CE   . MET A 1 55 ? 2.763   -5.360  -2.155  1.00 0.00 ? 362 MET A CE   5  
ATOM   5524  H  H    . MET A 1 55 ? 6.987   -9.734  -4.136  1.00 0.00 ? 362 MET A H    5  
ATOM   5525  H  HA   . MET A 1 55 ? 7.409   -6.837  -3.893  1.00 0.00 ? 362 MET A HA   5  
ATOM   5526  H  HB2  . MET A 1 55 ? 5.847   -8.659  -2.103  1.00 0.00 ? 362 MET A HB2  5  
ATOM   5527  H  HB3  . MET A 1 55 ? 6.654   -7.253  -1.424  1.00 0.00 ? 362 MET A HB3  5  
ATOM   5528  H  HG2  . MET A 1 55 ? 5.431   -5.835  -3.046  1.00 0.00 ? 362 MET A HG2  5  
ATOM   5529  H  HG3  . MET A 1 55 ? 4.547   -7.268  -3.569  1.00 0.00 ? 362 MET A HG3  5  
ATOM   5530  H  HE1  . MET A 1 55 ? 2.315   -5.794  -3.035  1.00 0.00 ? 362 MET A HE1  5  
ATOM   5531  H  HE2  . MET A 1 55 ? 3.320   -4.479  -2.434  1.00 0.00 ? 362 MET A HE2  5  
ATOM   5532  H  HE3  . MET A 1 55 ? 1.989   -5.092  -1.451  1.00 0.00 ? 362 MET A HE3  5  
ATOM   5533  N  N    . LYS A 1 56 ? 9.290   -7.081  -2.202  1.00 0.00 ? 363 LYS A N    5  
ATOM   5534  C  CA   . LYS A 1 56 ? 10.532  -7.219  -1.467  1.00 0.00 ? 363 LYS A CA   5  
ATOM   5535  C  C    . LYS A 1 56 ? 10.410  -6.478  -0.144  1.00 0.00 ? 363 LYS A C    5  
ATOM   5536  O  O    . LYS A 1 56 ? 10.108  -5.288  -0.117  1.00 0.00 ? 363 LYS A O    5  
ATOM   5537  C  CB   . LYS A 1 56 ? 11.693  -6.647  -2.285  1.00 0.00 ? 363 LYS A CB   5  
ATOM   5538  C  CG   . LYS A 1 56 ? 12.715  -7.686  -2.724  1.00 0.00 ? 363 LYS A CG   5  
ATOM   5539  C  CD   . LYS A 1 56 ? 13.519  -8.215  -1.546  1.00 0.00 ? 363 LYS A CD   5  
ATOM   5540  C  CE   . LYS A 1 56 ? 14.610  -9.172  -2.003  1.00 0.00 ? 363 LYS A CE   5  
ATOM   5541  N  NZ   . LYS A 1 56 ? 15.455  -9.643  -0.874  1.00 0.00 ? 363 LYS A NZ   5  
ATOM   5542  H  H    . LYS A 1 56 ? 8.913   -6.178  -2.317  1.00 0.00 ? 363 LYS A H    5  
ATOM   5543  H  HA   . LYS A 1 56 ? 10.704  -8.267  -1.276  1.00 0.00 ? 363 LYS A HA   5  
ATOM   5544  H  HB2  . LYS A 1 56 ? 11.286  -6.178  -3.180  1.00 0.00 ? 363 LYS A HB2  5  
ATOM   5545  H  HB3  . LYS A 1 56 ? 12.209  -5.899  -1.678  1.00 0.00 ? 363 LYS A HB3  5  
ATOM   5546  H  HG2  . LYS A 1 56 ? 12.196  -8.509  -3.192  1.00 0.00 ? 363 LYS A HG2  5  
ATOM   5547  H  HG3  . LYS A 1 56 ? 13.389  -7.233  -3.435  1.00 0.00 ? 363 LYS A HG3  5  
ATOM   5548  H  HD2  . LYS A 1 56 ? 13.978  -7.385  -1.031  1.00 0.00 ? 363 LYS A HD2  5  
ATOM   5549  H  HD3  . LYS A 1 56 ? 12.855  -8.737  -0.874  1.00 0.00 ? 363 LYS A HD3  5  
ATOM   5550  H  HE2  . LYS A 1 56 ? 14.146  -10.027 -2.473  1.00 0.00 ? 363 LYS A HE2  5  
ATOM   5551  H  HE3  . LYS A 1 56 ? 15.235  -8.664  -2.722  1.00 0.00 ? 363 LYS A HE3  5  
ATOM   5552  H  HZ1  . LYS A 1 56 ? 14.873  -10.133 -0.169  1.00 0.00 ? 363 LYS A HZ1  5  
ATOM   5553  H  HZ2  . LYS A 1 56 ? 15.934  -8.831  -0.415  1.00 0.00 ? 363 LYS A HZ2  5  
ATOM   5554  H  HZ3  . LYS A 1 56 ? 16.181  -10.303 -1.223  1.00 0.00 ? 363 LYS A HZ3  5  
ATOM   5555  N  N    . MET A 1 57 ? 10.617  -7.180  0.952   1.00 0.00 ? 364 MET A N    5  
ATOM   5556  C  CA   . MET A 1 57 ? 10.519  -6.571  2.265   1.00 0.00 ? 364 MET A CA   5  
ATOM   5557  C  C    . MET A 1 57 ? 11.718  -6.996  3.081   1.00 0.00 ? 364 MET A C    5  
ATOM   5558  O  O    . MET A 1 57 ? 11.813  -8.143  3.519   1.00 0.00 ? 364 MET A O    5  
ATOM   5559  C  CB   . MET A 1 57 ? 9.220   -6.978  2.969   1.00 0.00 ? 364 MET A CB   5  
ATOM   5560  C  CG   . MET A 1 57 ? 7.969   -6.693  2.155   1.00 0.00 ? 364 MET A CG   5  
ATOM   5561  S  SD   . MET A 1 57 ? 6.451   -7.037  3.064   1.00 0.00 ? 364 MET A SD   5  
ATOM   5562  C  CE   . MET A 1 57 ? 5.248   -6.894  1.748   1.00 0.00 ? 364 MET A CE   5  
ATOM   5563  H  H    . MET A 1 57 ? 10.882  -8.121  0.879   1.00 0.00 ? 364 MET A H    5  
ATOM   5564  H  HA   . MET A 1 57 ? 10.540  -5.500  2.139   1.00 0.00 ? 364 MET A HA   5  
ATOM   5565  H  HB2  . MET A 1 57 ? 9.253   -8.033  3.177   1.00 0.00 ? 364 MET A HB2  5  
ATOM   5566  H  HB3  . MET A 1 57 ? 9.147   -6.437  3.902   1.00 0.00 ? 364 MET A HB3  5  
ATOM   5567  H  HG2  . MET A 1 57 ? 7.969   -5.652  1.869   1.00 0.00 ? 364 MET A HG2  5  
ATOM   5568  H  HG3  . MET A 1 57 ? 7.986   -7.308  1.268   1.00 0.00 ? 364 MET A HG3  5  
ATOM   5569  H  HE1  . MET A 1 57 ? 4.262   -7.100  2.137   1.00 0.00 ? 364 MET A HE1  5  
ATOM   5570  H  HE2  . MET A 1 57 ? 5.483   -7.600  0.966   1.00 0.00 ? 364 MET A HE2  5  
ATOM   5571  H  HE3  . MET A 1 57 ? 5.274   -5.891  1.347   1.00 0.00 ? 364 MET A HE3  5  
ATOM   5572  N  N    . GLU A 1 58 ? 12.631  -6.071  3.264   1.00 0.00 ? 365 GLU A N    5  
ATOM   5573  C  CA   . GLU A 1 58 ? 13.903  -6.387  3.872   1.00 0.00 ? 365 GLU A CA   5  
ATOM   5574  C  C    . GLU A 1 58 ? 14.093  -5.605  5.164   1.00 0.00 ? 365 GLU A C    5  
ATOM   5575  O  O    . GLU A 1 58 ? 14.015  -4.380  5.171   1.00 0.00 ? 365 GLU A O    5  
ATOM   5576  C  CB   . GLU A 1 58 ? 15.016  -6.046  2.882   1.00 0.00 ? 365 GLU A CB   5  
ATOM   5577  C  CG   . GLU A 1 58 ? 14.968  -6.858  1.599   1.00 0.00 ? 365 GLU A CG   5  
ATOM   5578  C  CD   . GLU A 1 58 ? 16.136  -6.567  0.678   1.00 0.00 ? 365 GLU A CD   5  
ATOM   5579  O  OE1  . GLU A 1 58 ? 16.466  -5.381  0.477   1.00 0.00 ? 365 GLU A OE1  5  
ATOM   5580  O  OE2  . GLU A 1 58 ? 16.722  -7.530  0.141   1.00 0.00 ? 365 GLU A OE2  5  
ATOM   5581  H  H    . GLU A 1 58 ? 12.452  -5.151  2.974   1.00 0.00 ? 365 GLU A H    5  
ATOM   5582  H  HA   . GLU A 1 58 ? 13.926  -7.443  4.084   1.00 0.00 ? 365 GLU A HA   5  
ATOM   5583  H  HB2  . GLU A 1 58 ? 14.919  -5.005  2.613   1.00 0.00 ? 365 GLU A HB2  5  
ATOM   5584  H  HB3  . GLU A 1 58 ? 15.970  -6.205  3.354   1.00 0.00 ? 365 GLU A HB3  5  
ATOM   5585  H  HG2  . GLU A 1 58 ? 14.981  -7.908  1.850   1.00 0.00 ? 365 GLU A HG2  5  
ATOM   5586  H  HG3  . GLU A 1 58 ? 14.049  -6.625  1.079   1.00 0.00 ? 365 GLU A HG3  5  
ATOM   5587  N  N    . PRO A 1 59 ? 14.320  -6.301  6.280   1.00 0.00 ? 366 PRO A N    5  
ATOM   5588  C  CA   . PRO A 1 59 ? 14.665  -5.668  7.535   1.00 0.00 ? 366 PRO A CA   5  
ATOM   5589  C  C    . PRO A 1 59 ? 16.179  -5.563  7.704   1.00 0.00 ? 366 PRO A C    5  
ATOM   5590  O  O    . PRO A 1 59 ? 16.846  -6.536  8.070   1.00 0.00 ? 366 PRO A O    5  
ATOM   5591  C  CB   . PRO A 1 59 ? 14.059  -6.615  8.574   1.00 0.00 ? 366 PRO A CB   5  
ATOM   5592  C  CG   . PRO A 1 59 ? 13.997  -7.962  7.910   1.00 0.00 ? 366 PRO A CG   5  
ATOM   5593  C  CD   . PRO A 1 59 ? 14.224  -7.760  6.427   1.00 0.00 ? 366 PRO A CD   5  
ATOM   5594  H  HA   . PRO A 1 59 ? 14.215  -4.685  7.624   1.00 0.00 ? 366 PRO A HA   5  
ATOM   5595  H  HB2  . PRO A 1 59 ? 14.691  -6.637  9.449   1.00 0.00 ? 366 PRO A HB2  5  
ATOM   5596  H  HB3  . PRO A 1 59 ? 13.072  -6.267  8.847   1.00 0.00 ? 366 PRO A HB3  5  
ATOM   5597  H  HG2  . PRO A 1 59 ? 14.768  -8.600  8.316   1.00 0.00 ? 366 PRO A HG2  5  
ATOM   5598  H  HG3  . PRO A 1 59 ? 13.025  -8.404  8.079   1.00 0.00 ? 366 PRO A HG3  5  
ATOM   5599  H  HD2  . PRO A 1 59 ? 15.141  -8.237  6.118   1.00 0.00 ? 366 PRO A HD2  5  
ATOM   5600  H  HD3  . PRO A 1 59 ? 13.388  -8.150  5.865   1.00 0.00 ? 366 PRO A HD3  5  
ATOM   5601  N  N    . VAL A 1 60 ? 16.721  -4.395  7.404   1.00 0.00 ? 367 VAL A N    5  
ATOM   5602  C  CA   . VAL A 1 60 ? 18.158  -4.184  7.480   1.00 0.00 ? 367 VAL A CA   5  
ATOM   5603  C  C    . VAL A 1 60 ? 18.546  -3.571  8.816   1.00 0.00 ? 367 VAL A C    5  
ATOM   5604  O  O    . VAL A 1 60 ? 17.797  -2.782  9.395   1.00 0.00 ? 367 VAL A O    5  
ATOM   5605  C  CB   . VAL A 1 60 ? 18.682  -3.299  6.324   1.00 0.00 ? 367 VAL A CB   5  
ATOM   5606  C  CG1  . VAL A 1 60 ? 18.729  -4.093  5.028   1.00 0.00 ? 367 VAL A CG1  5  
ATOM   5607  C  CG2  . VAL A 1 60 ? 17.823  -2.055  6.144   1.00 0.00 ? 367 VAL A CG2  5  
ATOM   5608  H  H    . VAL A 1 60 ? 16.139  -3.645  7.145   1.00 0.00 ? 367 VAL A H    5  
ATOM   5609  H  HA   . VAL A 1 60 ? 18.632  -5.153  7.400   1.00 0.00 ? 367 VAL A HA   5  
ATOM   5610  H  HB   . VAL A 1 60 ? 19.684  -2.980  6.569   1.00 0.00 ? 367 VAL A HB   5  
ATOM   5611  H  HG11 . VAL A 1 60 ? 19.385  -4.942  5.149   1.00 0.00 ? 367 VAL A HG11 5  
ATOM   5612  H  HG12 . VAL A 1 60 ? 19.099  -3.462  4.232   1.00 0.00 ? 367 VAL A HG12 5  
ATOM   5613  H  HG13 . VAL A 1 60 ? 17.735  -4.437  4.781   1.00 0.00 ? 367 VAL A HG13 5  
ATOM   5614  H  HG21 . VAL A 1 60 ? 17.867  -1.455  7.039   1.00 0.00 ? 367 VAL A HG21 5  
ATOM   5615  H  HG22 . VAL A 1 60 ? 16.801  -2.348  5.956   1.00 0.00 ? 367 VAL A HG22 5  
ATOM   5616  H  HG23 . VAL A 1 60 ? 18.192  -1.479  5.307   1.00 0.00 ? 367 VAL A HG23 5  
ATOM   5617  N  N    . LYS A 1 61 ? 19.706  -3.955  9.317   1.00 0.00 ? 368 LYS A N    5  
ATOM   5618  C  CA   . LYS A 1 61 ? 20.187  -3.438  10.580  1.00 0.00 ? 368 LYS A CA   5  
ATOM   5619  C  C    . LYS A 1 61 ? 20.993  -2.169  10.369  1.00 0.00 ? 368 LYS A C    5  
ATOM   5620  O  O    . LYS A 1 61 ? 22.153  -2.210  9.956   1.00 0.00 ? 368 LYS A O    5  
ATOM   5621  C  CB   . LYS A 1 61 ? 21.029  -4.485  11.309  1.00 0.00 ? 368 LYS A CB   5  
ATOM   5622  C  CG   . LYS A 1 61 ? 20.216  -5.624  11.907  1.00 0.00 ? 368 LYS A CG   5  
ATOM   5623  C  CD   . LYS A 1 61 ? 19.320  -5.153  13.048  1.00 0.00 ? 368 LYS A CD   5  
ATOM   5624  C  CE   . LYS A 1 61 ? 20.135  -4.579  14.196  1.00 0.00 ? 368 LYS A CE   5  
ATOM   5625  N  NZ   . LYS A 1 61 ? 19.295  -4.271  15.385  1.00 0.00 ? 368 LYS A NZ   5  
ATOM   5626  H  H    . LYS A 1 61 ? 20.254  -4.598  8.820   1.00 0.00 ? 368 LYS A H    5  
ATOM   5627  H  HA   . LYS A 1 61 ? 19.328  -3.199  11.186  1.00 0.00 ? 368 LYS A HA   5  
ATOM   5628  H  HB2  . LYS A 1 61 ? 21.736  -4.908  10.611  1.00 0.00 ? 368 LYS A HB2  5  
ATOM   5629  H  HB3  . LYS A 1 61 ? 21.572  -4.001  12.107  1.00 0.00 ? 368 LYS A HB3  5  
ATOM   5630  H  HG2  . LYS A 1 61 ? 19.596  -6.054  11.134  1.00 0.00 ? 368 LYS A HG2  5  
ATOM   5631  H  HG3  . LYS A 1 61 ? 20.895  -6.375  12.283  1.00 0.00 ? 368 LYS A HG3  5  
ATOM   5632  H  HD2  . LYS A 1 61 ? 18.652  -4.389  12.680  1.00 0.00 ? 368 LYS A HD2  5  
ATOM   5633  H  HD3  . LYS A 1 61 ? 18.745  -5.992  13.410  1.00 0.00 ? 368 LYS A HD3  5  
ATOM   5634  H  HE2  . LYS A 1 61 ? 20.889  -5.297  14.479  1.00 0.00 ? 368 LYS A HE2  5  
ATOM   5635  H  HE3  . LYS A 1 61 ? 20.614  -3.671  13.861  1.00 0.00 ? 368 LYS A HE3  5  
ATOM   5636  H  HZ1  . LYS A 1 61 ? 18.558  -3.582  15.139  1.00 0.00 ? 368 LYS A HZ1  5  
ATOM   5637  H  HZ2  . LYS A 1 61 ? 19.885  -3.877  16.148  1.00 0.00 ? 368 LYS A HZ2  5  
ATOM   5638  H  HZ3  . LYS A 1 61 ? 18.836  -5.139  15.732  1.00 0.00 ? 368 LYS A HZ3  5  
ATOM   5639  N  N    . GLU A 1 62 ? 20.358  -1.048  10.639  1.00 0.00 ? 369 GLU A N    5  
ATOM   5640  C  CA   . GLU A 1 62 ? 21.016  0.237   10.577  1.00 0.00 ? 369 GLU A CA   5  
ATOM   5641  C  C    . GLU A 1 62 ? 21.752  0.479   11.892  1.00 0.00 ? 369 GLU A C    5  
ATOM   5642  O  O    . GLU A 1 62 ? 21.676  -0.337  12.809  1.00 0.00 ? 369 GLU A O    5  
ATOM   5643  C  CB   . GLU A 1 62 ? 20.007  1.347   10.294  1.00 0.00 ? 369 GLU A CB   5  
ATOM   5644  C  CG   . GLU A 1 62 ? 20.580  2.502   9.489   1.00 0.00 ? 369 GLU A CG   5  
ATOM   5645  C  CD   . GLU A 1 62 ? 20.362  3.837   10.157  1.00 0.00 ? 369 GLU A CD   5  
ATOM   5646  O  OE1  . GLU A 1 62 ? 21.206  4.224   10.992  1.00 0.00 ? 369 GLU A OE1  5  
ATOM   5647  O  OE2  . GLU A 1 62 ? 19.359  4.514   9.847   1.00 0.00 ? 369 GLU A OE2  5  
ATOM   5648  H  H    . GLU A 1 62 ? 19.414  -1.087  10.907  1.00 0.00 ? 369 GLU A H    5  
ATOM   5649  H  HA   . GLU A 1 62 ? 21.740  0.200   9.775   1.00 0.00 ? 369 GLU A HA   5  
ATOM   5650  H  HB2  . GLU A 1 62 ? 19.175  0.931   9.745   1.00 0.00 ? 369 GLU A HB2  5  
ATOM   5651  H  HB3  . GLU A 1 62 ? 19.649  1.737   11.233  1.00 0.00 ? 369 GLU A HB3  5  
ATOM   5652  H  HG2  . GLU A 1 62 ? 21.642  2.347   9.366   1.00 0.00 ? 369 GLU A HG2  5  
ATOM   5653  H  HG3  . GLU A 1 62 ? 20.105  2.518   8.520   1.00 0.00 ? 369 GLU A HG3  5  
ATOM   5654  N  N    . LEU A 1 63 ? 22.444  1.595   11.989  1.00 0.00 ? 370 LEU A N    5  
ATOM   5655  C  CA   . LEU A 1 63 ? 23.408  1.809   13.051  1.00 0.00 ? 370 LEU A CA   5  
ATOM   5656  C  C    . LEU A 1 63 ? 23.037  2.975   13.966  1.00 0.00 ? 370 LEU A C    5  
ATOM   5657  O  O    . LEU A 1 63 ? 23.445  3.010   15.123  1.00 0.00 ? 370 LEU A O    5  
ATOM   5658  C  CB   . LEU A 1 63 ? 24.800  2.021   12.447  1.00 0.00 ? 370 LEU A CB   5  
ATOM   5659  C  CG   . LEU A 1 63 ? 24.839  2.547   11.001  1.00 0.00 ? 370 LEU A CG   5  
ATOM   5660  C  CD1  . LEU A 1 63 ? 24.464  4.021   10.937  1.00 0.00 ? 370 LEU A CD1  5  
ATOM   5661  C  CD2  . LEU A 1 63 ? 26.213  2.317   10.387  1.00 0.00 ? 370 LEU A CD2  5  
ATOM   5662  H  H    . LEU A 1 63 ? 22.276  2.309   11.358  1.00 0.00 ? 370 LEU A H    5  
ATOM   5663  H  HA   . LEU A 1 63 ? 23.431  0.910   13.647  1.00 0.00 ? 370 LEU A HA   5  
ATOM   5664  H  HB2  . LEU A 1 63 ? 25.317  2.729   13.068  1.00 0.00 ? 370 LEU A HB2  5  
ATOM   5665  H  HB3  . LEU A 1 63 ? 25.332  1.081   12.481  1.00 0.00 ? 370 LEU A HB3  5  
ATOM   5666  H  HG   . LEU A 1 63 ? 24.118  2.001   10.411  1.00 0.00 ? 370 LEU A HG   5  
ATOM   5667  H  HD11 . LEU A 1 63 ? 25.183  4.601   11.494  1.00 0.00 ? 370 LEU A HD11 5  
ATOM   5668  H  HD12 . LEU A 1 63 ? 23.482  4.160   11.363  1.00 0.00 ? 370 LEU A HD12 5  
ATOM   5669  H  HD13 . LEU A 1 63 ? 24.458  4.347   9.907   1.00 0.00 ? 370 LEU A HD13 5  
ATOM   5670  H  HD21 . LEU A 1 63 ? 26.223  2.697   9.375   1.00 0.00 ? 370 LEU A HD21 5  
ATOM   5671  H  HD22 . LEU A 1 63 ? 26.428  1.260   10.376  1.00 0.00 ? 370 LEU A HD22 5  
ATOM   5672  H  HD23 . LEU A 1 63 ? 26.961  2.832   10.971  1.00 0.00 ? 370 LEU A HD23 5  
ATOM   5673  N  N    . THR A 1 64 ? 22.267  3.925   13.468  1.00 0.00 ? 371 THR A N    5  
ATOM   5674  C  CA   . THR A 1 64 ? 21.898  5.076   14.272  1.00 0.00 ? 371 THR A CA   5  
ATOM   5675  C  C    . THR A 1 64 ? 20.585  4.825   15.004  1.00 0.00 ? 371 THR A C    5  
ATOM   5676  O  O    . THR A 1 64 ? 19.539  4.638   14.379  1.00 0.00 ? 371 THR A O    5  
ATOM   5677  C  CB   . THR A 1 64 ? 21.776  6.344   13.406  1.00 0.00 ? 371 THR A CB   5  
ATOM   5678  O  OG1  . THR A 1 64 ? 22.962  6.509   12.619  1.00 0.00 ? 371 THR A OG1  5  
ATOM   5679  C  CG2  . THR A 1 64 ? 21.564  7.577   14.274  1.00 0.00 ? 371 THR A CG2  5  
ATOM   5680  H  H    . THR A 1 64 ? 21.931  3.853   12.542  1.00 0.00 ? 371 THR A H    5  
ATOM   5681  H  HA   . THR A 1 64 ? 22.681  5.236   15.001  1.00 0.00 ? 371 THR A HA   5  
ATOM   5682  H  HB   . THR A 1 64 ? 20.928  6.232   12.748  1.00 0.00 ? 371 THR A HB   5  
ATOM   5683  H  HG1  . THR A 1 64 ? 22.802  6.167   11.733  1.00 0.00 ? 371 THR A HG1  5  
ATOM   5684  H  HG21 . THR A 1 64 ? 20.664  7.455   14.859  1.00 0.00 ? 371 THR A HG21 5  
ATOM   5685  H  HG22 . THR A 1 64 ? 21.470  8.448   13.644  1.00 0.00 ? 371 THR A HG22 5  
ATOM   5686  H  HG23 . THR A 1 64 ? 22.408  7.700   14.936  1.00 0.00 ? 371 THR A HG23 5  
ATOM   5687  N  N    . GLY A 1 65 ? 20.646  4.825   16.328  1.00 0.00 ? 372 GLY A N    5  
ATOM   5688  C  CA   . GLY A 1 65 ? 19.469  4.564   17.133  1.00 0.00 ? 372 GLY A CA   5  
ATOM   5689  C  C    . GLY A 1 65 ? 19.811  3.799   18.394  1.00 0.00 ? 372 GLY A C    5  
ATOM   5690  O  O    . GLY A 1 65 ? 19.323  2.691   18.612  1.00 0.00 ? 372 GLY A O    5  
ATOM   5691  H  H    . GLY A 1 65 ? 21.504  5.006   16.767  1.00 0.00 ? 372 GLY A H    5  
ATOM   5692  H  HA2  . GLY A 1 65 ? 19.015  5.507   17.406  1.00 0.00 ? 372 GLY A HA2  5  
ATOM   5693  H  HA3  . GLY A 1 65 ? 18.765  3.988   16.553  1.00 0.00 ? 372 GLY A HA3  5  
ATOM   5694  N  N    . GLY A 1 66 ? 20.652  4.397   19.227  1.00 0.00 ? 373 GLY A N    5  
ATOM   5695  C  CA   . GLY A 1 66 ? 21.120  3.726   20.423  1.00 0.00 ? 373 GLY A CA   5  
ATOM   5696  C  C    . GLY A 1 66 ? 22.347  2.886   20.137  1.00 0.00 ? 373 GLY A C    5  
ATOM   5697  O  O    . GLY A 1 66 ? 23.478  3.361   20.245  1.00 0.00 ? 373 GLY A O    5  
ATOM   5698  H  H    . GLY A 1 66 ? 20.960  5.305   19.026  1.00 0.00 ? 373 GLY A H    5  
ATOM   5699  H  HA2  . GLY A 1 66 ? 21.363  4.466   21.171  1.00 0.00 ? 373 GLY A HA2  5  
ATOM   5700  H  HA3  . GLY A 1 66 ? 20.335  3.087   20.800  1.00 0.00 ? 373 GLY A HA3  5  
ATOM   5701  N  N    . GLY A 1 67 ? 22.123  1.635   19.776  1.00 0.00 ? 374 GLY A N    5  
ATOM   5702  C  CA   . GLY A 1 67 ? 23.205  0.783   19.334  1.00 0.00 ? 374 GLY A CA   5  
ATOM   5703  C  C    . GLY A 1 67 ? 23.117  0.558   17.847  1.00 0.00 ? 374 GLY A C    5  
ATOM   5704  O  O    . GLY A 1 67 ? 23.994  0.969   17.091  1.00 0.00 ? 374 GLY A O    5  
ATOM   5705  H  H    . GLY A 1 67 ? 21.204  1.287   19.796  1.00 0.00 ? 374 GLY A H    5  
ATOM   5706  H  HA2  . GLY A 1 67 ? 24.150  1.250   19.574  1.00 0.00 ? 374 GLY A HA2  5  
ATOM   5707  H  HA3  . GLY A 1 67 ? 23.139  -0.169  19.840  1.00 0.00 ? 374 GLY A HA3  5  
ATOM   5708  N  N    . THR A 1 68 ? 22.041  -0.097  17.447  1.00 0.00 ? 375 THR A N    5  
ATOM   5709  C  CA   . THR A 1 68 ? 21.671  -0.249  16.051  1.00 0.00 ? 375 THR A CA   5  
ATOM   5710  C  C    . THR A 1 68 ? 20.151  -0.183  15.961  1.00 0.00 ? 375 THR A C    5  
ATOM   5711  O  O    . THR A 1 68 ? 19.477  -0.340  16.980  1.00 0.00 ? 375 THR A O    5  
ATOM   5712  C  CB   . THR A 1 68 ? 22.159  -1.594  15.462  1.00 0.00 ? 375 THR A CB   5  
ATOM   5713  O  OG1  . THR A 1 68 ? 21.717  -2.681  16.284  1.00 0.00 ? 375 THR A OG1  5  
ATOM   5714  C  CG2  . THR A 1 68 ? 23.676  -1.633  15.336  1.00 0.00 ? 375 THR A CG2  5  
ATOM   5715  H  H    . THR A 1 68 ? 21.458  -0.496  18.126  1.00 0.00 ? 375 THR A H    5  
ATOM   5716  H  HA   . THR A 1 68 ? 22.103  0.566   15.488  1.00 0.00 ? 375 THR A HA   5  
ATOM   5717  H  HB   . THR A 1 68 ? 21.731  -1.709  14.476  1.00 0.00 ? 375 THR A HB   5  
ATOM   5718  H  HG1  . THR A 1 68 ? 21.770  -2.421  17.213  1.00 0.00 ? 375 THR A HG1  5  
ATOM   5719  H  HG21 . THR A 1 68 ? 23.977  -2.587  14.931  1.00 0.00 ? 375 THR A HG21 5  
ATOM   5720  H  HG22 . THR A 1 68 ? 24.121  -1.498  16.310  1.00 0.00 ? 375 THR A HG22 5  
ATOM   5721  H  HG23 . THR A 1 68 ? 24.003  -0.843  14.679  1.00 0.00 ? 375 THR A HG23 5  
ATOM   5722  N  N    . THR A 1 69 ? 19.593  0.043   14.782  1.00 0.00 ? 376 THR A N    5  
ATOM   5723  C  CA   . THR A 1 69 ? 18.196  0.067   14.643  1.00 0.00 ? 376 THR A CA   5  
ATOM   5724  C  C    . THR A 1 69 ? 17.829  -0.833  13.507  1.00 0.00 ? 376 THR A C    5  
ATOM   5725  O  O    . THR A 1 69 ? 18.640  -1.237  12.681  1.00 0.00 ? 376 THR A O    5  
ATOM   5726  C  CB   . THR A 1 69 ? 17.627  1.486   14.405  1.00 0.00 ? 376 THR A CB   5  
ATOM   5727  O  OG1  . THR A 1 69 ? 16.196  1.446   14.270  1.00 0.00 ? 376 THR A OG1  5  
ATOM   5728  C  CG2  . THR A 1 69 ? 18.232  2.120   13.163  1.00 0.00 ? 376 THR A CG2  5  
ATOM   5729  H  H    . THR A 1 69 ? 20.117  0.138   13.982  1.00 0.00 ? 376 THR A H    5  
ATOM   5730  H  HA   . THR A 1 69 ? 17.763  -0.325  15.552  1.00 0.00 ? 376 THR A HA   5  
ATOM   5731  H  HB   . THR A 1 69 ? 17.870  2.091   15.255  1.00 0.00 ? 376 THR A HB   5  
ATOM   5732  H  HG1  . THR A 1 69 ? 15.960  1.514   13.334  1.00 0.00 ? 376 THR A HG1  5  
ATOM   5733  H  HG21 . THR A 1 69 ? 19.307  2.161   13.268  1.00 0.00 ? 376 THR A HG21 5  
ATOM   5734  H  HG22 . THR A 1 69 ? 17.843  3.119   13.042  1.00 0.00 ? 376 THR A HG22 5  
ATOM   5735  H  HG23 . THR A 1 69 ? 17.976  1.526   12.297  1.00 0.00 ? 376 THR A HG23 5  
ATOM   5736  N  N    . PHE A 1 70 ? 16.615  -1.156  13.549  1.00 0.00 ? 377 PHE A N    5  
ATOM   5737  C  CA   . PHE A 1 70 ? 15.959  -1.968  12.577  1.00 0.00 ? 377 PHE A CA   5  
ATOM   5738  C  C    . PHE A 1 70 ? 15.289  -1.083  11.543  1.00 0.00 ? 377 PHE A C    5  
ATOM   5739  O  O    . PHE A 1 70 ? 14.334  -0.362  11.838  1.00 0.00 ? 377 PHE A O    5  
ATOM   5740  C  CB   . PHE A 1 70 ? 14.948  -2.879  13.269  1.00 0.00 ? 377 PHE A CB   5  
ATOM   5741  C  CG   . PHE A 1 70 ? 14.093  -2.201  14.311  1.00 0.00 ? 377 PHE A CG   5  
ATOM   5742  C  CD1  . PHE A 1 70 ? 14.590  -1.946  15.580  1.00 0.00 ? 377 PHE A CD1  5  
ATOM   5743  C  CD2  . PHE A 1 70 ? 12.788  -1.828  14.021  1.00 0.00 ? 377 PHE A CD2  5  
ATOM   5744  C  CE1  . PHE A 1 70 ? 13.807  -1.332  16.536  1.00 0.00 ? 377 PHE A CE1  5  
ATOM   5745  C  CE2  . PHE A 1 70 ? 12.000  -1.214  14.976  1.00 0.00 ? 377 PHE A CE2  5  
ATOM   5746  C  CZ   . PHE A 1 70 ? 12.512  -0.965  16.233  1.00 0.00 ? 377 PHE A CZ   5  
ATOM   5747  H  H    . PHE A 1 70 ? 16.124  -0.808  14.284  1.00 0.00 ? 377 PHE A H    5  
ATOM   5748  H  HA   . PHE A 1 70 ? 16.707  -2.574  12.088  1.00 0.00 ? 377 PHE A HA   5  
ATOM   5749  H  HB2  . PHE A 1 70 ? 14.283  -3.264  12.517  1.00 0.00 ? 377 PHE A HB2  5  
ATOM   5750  H  HB3  . PHE A 1 70 ? 15.488  -3.695  13.757  1.00 0.00 ? 377 PHE A HB3  5  
ATOM   5751  H  HD1  . PHE A 1 70 ? 15.604  -2.230  15.819  1.00 0.00 ? 377 PHE A HD1  5  
ATOM   5752  H  HD2  . PHE A 1 70 ? 12.387  -2.020  13.037  1.00 0.00 ? 377 PHE A HD2  5  
ATOM   5753  H  HE1  . PHE A 1 70 ? 14.208  -1.138  17.519  1.00 0.00 ? 377 PHE A HE1  5  
ATOM   5754  H  HE2  . PHE A 1 70 ? 10.986  -0.928  14.738  1.00 0.00 ? 377 PHE A HE2  5  
ATOM   5755  H  HZ   . PHE A 1 70 ? 11.898  -0.487  16.981  1.00 0.00 ? 377 PHE A HZ   5  
ATOM   5756  N  N    . SER A 1 71 ? 15.819  -1.107  10.344  1.00 0.00 ? 378 SER A N    5  
ATOM   5757  C  CA   . SER A 1 71 ? 15.306  -0.285  9.280   1.00 0.00 ? 378 SER A CA   5  
ATOM   5758  C  C    . SER A 1 71 ? 14.601  -1.147  8.251   1.00 0.00 ? 378 SER A C    5  
ATOM   5759  O  O    . SER A 1 71 ? 15.167  -2.114  7.745   1.00 0.00 ? 378 SER A O    5  
ATOM   5760  C  CB   . SER A 1 71 ? 16.447  0.501   8.643   1.00 0.00 ? 378 SER A CB   5  
ATOM   5761  O  OG   . SER A 1 71 ? 17.075  1.325   9.608   1.00 0.00 ? 378 SER A OG   5  
ATOM   5762  H  H    . SER A 1 71 ? 16.579  -1.706  10.163  1.00 0.00 ? 378 SER A H    5  
ATOM   5763  H  HA   . SER A 1 71 ? 14.596  0.405   9.706   1.00 0.00 ? 378 SER A HA   5  
ATOM   5764  H  HB2  . SER A 1 71 ? 17.180  -0.187  8.243   1.00 0.00 ? 378 SER A HB2  5  
ATOM   5765  H  HB3  . SER A 1 71 ? 16.059  1.123   7.850   1.00 0.00 ? 378 SER A HB3  5  
ATOM   5766  H  HG   . SER A 1 71 ? 16.916  2.250   9.389   1.00 0.00 ? 378 SER A HG   5  
ATOM   5767  N  N    . VAL A 1 72 ? 13.359  -0.817  7.961   1.00 0.00 ? 379 VAL A N    5  
ATOM   5768  C  CA   . VAL A 1 72 ? 12.602  -1.576  6.995   1.00 0.00 ? 379 VAL A CA   5  
ATOM   5769  C  C    . VAL A 1 72 ? 12.862  -1.030  5.604   1.00 0.00 ? 379 VAL A C    5  
ATOM   5770  O  O    . VAL A 1 72 ? 12.868  0.182   5.380   1.00 0.00 ? 379 VAL A O    5  
ATOM   5771  C  CB   . VAL A 1 72 ? 11.088  -1.533  7.264   1.00 0.00 ? 379 VAL A CB   5  
ATOM   5772  C  CG1  . VAL A 1 72 ? 10.374  -2.642  6.504   1.00 0.00 ? 379 VAL A CG1  5  
ATOM   5773  C  CG2  . VAL A 1 72 ? 10.792  -1.614  8.754   1.00 0.00 ? 379 VAL A CG2  5  
ATOM   5774  H  H    . VAL A 1 72 ? 12.951  -0.035  8.394   1.00 0.00 ? 379 VAL A H    5  
ATOM   5775  H  HA   . VAL A 1 72 ? 12.933  -2.608  7.042   1.00 0.00 ? 379 VAL A HA   5  
ATOM   5776  H  HB   . VAL A 1 72 ? 10.721  -0.595  6.892   1.00 0.00 ? 379 VAL A HB   5  
ATOM   5777  H  HG11 . VAL A 1 72 ? 10.544  -2.518  5.446   1.00 0.00 ? 379 VAL A HG11 5  
ATOM   5778  H  HG12 . VAL A 1 72 ? 9.314   -2.591  6.707   1.00 0.00 ? 379 VAL A HG12 5  
ATOM   5779  H  HG13 . VAL A 1 72 ? 10.756  -3.602  6.822   1.00 0.00 ? 379 VAL A HG13 5  
ATOM   5780  H  HG21 . VAL A 1 72 ? 11.184  -2.540  9.150   1.00 0.00 ? 379 VAL A HG21 5  
ATOM   5781  H  HG22 . VAL A 1 72 ? 9.725   -1.578  8.911   1.00 0.00 ? 379 VAL A HG22 5  
ATOM   5782  H  HG23 . VAL A 1 72 ? 11.259  -0.781  9.258   1.00 0.00 ? 379 VAL A HG23 5  
ATOM   5783  N  N    . ARG A 1 73 ? 13.092  -1.933  4.690   1.00 0.00 ? 380 ARG A N    5  
ATOM   5784  C  CA   . ARG A 1 73 ? 13.320  -1.598  3.302   1.00 0.00 ? 380 ARG A CA   5  
ATOM   5785  C  C    . ARG A 1 73 ? 12.255  -2.291  2.472   1.00 0.00 ? 380 ARG A C    5  
ATOM   5786  O  O    . ARG A 1 73 ? 12.369  -3.475  2.157   1.00 0.00 ? 380 ARG A O    5  
ATOM   5787  C  CB   . ARG A 1 73 ? 14.718  -2.054  2.877   1.00 0.00 ? 380 ARG A CB   5  
ATOM   5788  C  CG   . ARG A 1 73 ? 15.144  -1.593  1.493   1.00 0.00 ? 380 ARG A CG   5  
ATOM   5789  C  CD   . ARG A 1 73 ? 16.431  -2.286  1.073   1.00 0.00 ? 380 ARG A CD   5  
ATOM   5790  N  NE   . ARG A 1 73 ? 17.058  -1.653  -0.084  1.00 0.00 ? 380 ARG A NE   5  
ATOM   5791  C  CZ   . ARG A 1 73 ? 17.822  -2.303  -0.963  1.00 0.00 ? 380 ARG A CZ   5  
ATOM   5792  N  NH1  . ARG A 1 73 ? 17.923  -3.629  -0.914  1.00 0.00 ? 380 ARG A NH1  5  
ATOM   5793  N  NH2  . ARG A 1 73 ? 18.447  -1.627  -1.922  1.00 0.00 ? 380 ARG A NH2  5  
ATOM   5794  H  H    . ARG A 1 73 ? 13.100  -2.876  4.959   1.00 0.00 ? 380 ARG A H    5  
ATOM   5795  H  HA   . ARG A 1 73 ? 13.231  -0.530  3.186   1.00 0.00 ? 380 ARG A HA   5  
ATOM   5796  H  HB2  . ARG A 1 73 ? 15.435  -1.672  3.589   1.00 0.00 ? 380 ARG A HB2  5  
ATOM   5797  H  HB3  . ARG A 1 73 ? 14.750  -3.130  2.896   1.00 0.00 ? 380 ARG A HB3  5  
ATOM   5798  H  HG2  . ARG A 1 73 ? 14.364  -1.832  0.786   1.00 0.00 ? 380 ARG A HG2  5  
ATOM   5799  H  HG3  . ARG A 1 73 ? 15.308  -0.525  1.511   1.00 0.00 ? 380 ARG A HG3  5  
ATOM   5800  H  HD2  . ARG A 1 73 ? 17.121  -2.260  1.901   1.00 0.00 ? 380 ARG A HD2  5  
ATOM   5801  H  HD3  . ARG A 1 73 ? 16.204  -3.314  0.829   1.00 0.00 ? 380 ARG A HD3  5  
ATOM   5802  H  HE   . ARG A 1 73 ? 16.943  -0.680  -0.183  1.00 0.00 ? 380 ARG A HE   5  
ATOM   5803  H  HH11 . ARG A 1 73 ? 17.420  -4.155  -0.207  1.00 0.00 ? 380 ARG A HH11 5  
ATOM   5804  H  HH12 . ARG A 1 73 ? 18.504  -4.117  -1.568  1.00 0.00 ? 380 ARG A HH12 5  
ATOM   5805  H  HH21 . ARG A 1 73 ? 18.345  -0.633  -1.981  1.00 0.00 ? 380 ARG A HH21 5  
ATOM   5806  H  HH22 . ARG A 1 73 ? 19.037  -2.106  -2.577  1.00 0.00 ? 380 ARG A HH22 5  
ATOM   5807  N  N    . LYS A 1 74 ? 11.194  -1.570  2.172   1.00 0.00 ? 381 LYS A N    5  
ATOM   5808  C  CA   . LYS A 1 74 ? 10.068  -2.161  1.486   1.00 0.00 ? 381 LYS A CA   5  
ATOM   5809  C  C    . LYS A 1 74 ? 10.068  -1.731  0.025   1.00 0.00 ? 381 LYS A C    5  
ATOM   5810  O  O    . LYS A 1 74 ? 10.166  -0.545  -0.290  1.00 0.00 ? 381 LYS A O    5  
ATOM   5811  C  CB   . LYS A 1 74 ? 8.760   -1.751  2.167   1.00 0.00 ? 381 LYS A CB   5  
ATOM   5812  C  CG   . LYS A 1 74 ? 7.603   -2.717  1.942   1.00 0.00 ? 381 LYS A CG   5  
ATOM   5813  C  CD   . LYS A 1 74 ? 6.290   -2.114  2.416   1.00 0.00 ? 381 LYS A CD   5  
ATOM   5814  C  CE   . LYS A 1 74 ? 5.162   -3.135  2.449   1.00 0.00 ? 381 LYS A CE   5  
ATOM   5815  N  NZ   . LYS A 1 74 ? 5.259   -4.041  3.629   1.00 0.00 ? 381 LYS A NZ   5  
ATOM   5816  H  H    . LYS A 1 74 ? 11.172  -0.617  2.408   1.00 0.00 ? 381 LYS A H    5  
ATOM   5817  H  HA   . LYS A 1 74 ? 10.180  -3.237  1.539   1.00 0.00 ? 381 LYS A HA   5  
ATOM   5818  H  HB2  . LYS A 1 74 ? 8.934   -1.677  3.230   1.00 0.00 ? 381 LYS A HB2  5  
ATOM   5819  H  HB3  . LYS A 1 74 ? 8.466   -0.780  1.795   1.00 0.00 ? 381 LYS A HB3  5  
ATOM   5820  H  HG2  . LYS A 1 74 ? 7.528   -2.935  0.886   1.00 0.00 ? 381 LYS A HG2  5  
ATOM   5821  H  HG3  . LYS A 1 74 ? 7.793   -3.631  2.489   1.00 0.00 ? 381 LYS A HG3  5  
ATOM   5822  H  HD2  . LYS A 1 74 ? 6.427   -1.722  3.410   1.00 0.00 ? 381 LYS A HD2  5  
ATOM   5823  H  HD3  . LYS A 1 74 ? 6.013   -1.311  1.748   1.00 0.00 ? 381 LYS A HD3  5  
ATOM   5824  H  HE2  . LYS A 1 74 ? 4.219   -2.609  2.488   1.00 0.00 ? 381 LYS A HE2  5  
ATOM   5825  H  HE3  . LYS A 1 74 ? 5.206   -3.727  1.547   1.00 0.00 ? 381 LYS A HE3  5  
ATOM   5826  H  HZ1  . LYS A 1 74 ? 6.146   -4.580  3.602   1.00 0.00 ? 381 LYS A HZ1  5  
ATOM   5827  H  HZ2  . LYS A 1 74 ? 4.460   -4.707  3.633   1.00 0.00 ? 381 LYS A HZ2  5  
ATOM   5828  H  HZ3  . LYS A 1 74 ? 5.229   -3.484  4.507   1.00 0.00 ? 381 LYS A HZ3  5  
ATOM   5829  N  N    . THR A 1 75 ? 9.991   -2.706  -0.855  1.00 0.00 ? 382 THR A N    5  
ATOM   5830  C  CA   . THR A 1 75 ? 10.009  -2.468  -2.284  1.00 0.00 ? 382 THR A CA   5  
ATOM   5831  C  C    . THR A 1 75 ? 9.050   -3.441  -2.964  1.00 0.00 ? 382 THR A C    5  
ATOM   5832  O  O    . THR A 1 75 ? 8.738   -4.491  -2.408  1.00 0.00 ? 382 THR A O    5  
ATOM   5833  C  CB   . THR A 1 75 ? 11.441  -2.657  -2.827  1.00 0.00 ? 382 THR A CB   5  
ATOM   5834  O  OG1  . THR A 1 75 ? 12.346  -1.825  -2.086  1.00 0.00 ? 382 THR A OG1  5  
ATOM   5835  C  CG2  . THR A 1 75 ? 11.535  -2.313  -4.305  1.00 0.00 ? 382 THR A CG2  5  
ATOM   5836  H  H    . THR A 1 75 ? 9.926   -3.635  -0.532  1.00 0.00 ? 382 THR A H    5  
ATOM   5837  H  HA   . THR A 1 75 ? 9.690   -1.452  -2.470  1.00 0.00 ? 382 THR A HA   5  
ATOM   5838  H  HB   . THR A 1 75 ? 11.725  -3.691  -2.693  1.00 0.00 ? 382 THR A HB   5  
ATOM   5839  H  HG1  . THR A 1 75 ? 11.853  -1.346  -1.409  1.00 0.00 ? 382 THR A HG1  5  
ATOM   5840  H  HG21 . THR A 1 75 ? 12.544  -2.484  -4.651  1.00 0.00 ? 382 THR A HG21 5  
ATOM   5841  H  HG22 . THR A 1 75 ? 11.275  -1.275  -4.451  1.00 0.00 ? 382 THR A HG22 5  
ATOM   5842  H  HG23 . THR A 1 75 ? 10.853  -2.936  -4.864  1.00 0.00 ? 382 THR A HG23 5  
ATOM   5843  N  N    . ALA A 1 76 ? 8.553   -3.092  -4.139  1.00 0.00 ? 383 ALA A N    5  
ATOM   5844  C  CA   . ALA A 1 76 ? 7.658   -3.975  -4.861  1.00 0.00 ? 383 ALA A CA   5  
ATOM   5845  C  C    . ALA A 1 76 ? 7.748   -3.738  -6.355  1.00 0.00 ? 383 ALA A C    5  
ATOM   5846  O  O    . ALA A 1 76 ? 8.284   -2.725  -6.805  1.00 0.00 ? 383 ALA A O    5  
ATOM   5847  C  CB   . ALA A 1 76 ? 6.225   -3.785  -4.386  1.00 0.00 ? 383 ALA A CB   5  
ATOM   5848  H  H    . ALA A 1 76 ? 8.792   -2.222  -4.529  1.00 0.00 ? 383 ALA A H    5  
ATOM   5849  H  HA   . ALA A 1 76 ? 7.951   -4.994  -4.651  1.00 0.00 ? 383 ALA A HA   5  
ATOM   5850  H  HB1  . ALA A 1 76 ? 5.884   -2.798  -4.658  1.00 0.00 ? 383 ALA A HB1  5  
ATOM   5851  H  HB2  . ALA A 1 76 ? 6.185   -3.895  -3.313  1.00 0.00 ? 383 ALA A HB2  5  
ATOM   5852  H  HB3  . ALA A 1 76 ? 5.590   -4.527  -4.848  1.00 0.00 ? 383 ALA A HB3  5  
ATOM   5853  N  N    . TYR A 1 77 ? 7.241   -4.684  -7.117  1.00 0.00 ? 384 TYR A N    5  
ATOM   5854  C  CA   . TYR A 1 77 ? 7.128   -4.533  -8.549  1.00 0.00 ? 384 TYR A CA   5  
ATOM   5855  C  C    . TYR A 1 77 ? 5.708   -4.851  -8.966  1.00 0.00 ? 384 TYR A C    5  
ATOM   5856  O  O    . TYR A 1 77 ? 5.147   -5.862  -8.545  1.00 0.00 ? 384 TYR A O    5  
ATOM   5857  C  CB   . TYR A 1 77 ? 8.121   -5.441  -9.282  1.00 0.00 ? 384 TYR A CB   5  
ATOM   5858  C  CG   . TYR A 1 77 ? 9.567   -5.080  -9.015  1.00 0.00 ? 384 TYR A CG   5  
ATOM   5859  C  CD1  . TYR A 1 77 ? 10.113  -3.906  -9.518  1.00 0.00 ? 384 TYR A CD1  5  
ATOM   5860  C  CD2  . TYR A 1 77 ? 10.379  -5.907  -8.251  1.00 0.00 ? 384 TYR A CD2  5  
ATOM   5861  C  CE1  . TYR A 1 77 ? 11.428  -3.569  -9.266  1.00 0.00 ? 384 TYR A CE1  5  
ATOM   5862  C  CE2  . TYR A 1 77 ? 11.696  -5.573  -7.992  1.00 0.00 ? 384 TYR A CE2  5  
ATOM   5863  C  CZ   . TYR A 1 77 ? 12.213  -4.403  -8.505  1.00 0.00 ? 384 TYR A CZ   5  
ATOM   5864  O  OH   . TYR A 1 77 ? 13.520  -4.059  -8.248  1.00 0.00 ? 384 TYR A OH   5  
ATOM   5865  H  H    . TYR A 1 77 ? 6.919   -5.518  -6.698  1.00 0.00 ? 384 TYR A H    5  
ATOM   5866  H  HA   . TYR A 1 77 ? 7.343   -3.504  -8.791  1.00 0.00 ? 384 TYR A HA   5  
ATOM   5867  H  HB2  . TYR A 1 77 ? 7.969   -6.467  -8.957  1.00 0.00 ? 384 TYR A HB2  5  
ATOM   5868  H  HB3  . TYR A 1 77 ? 7.949   -5.362  -10.354 1.00 0.00 ? 384 TYR A HB3  5  
ATOM   5869  H  HD1  . TYR A 1 77 ? 9.496   -3.250  -10.114 1.00 0.00 ? 384 TYR A HD1  5  
ATOM   5870  H  HD2  . TYR A 1 77 ? 9.971   -6.822  -7.854  1.00 0.00 ? 384 TYR A HD2  5  
ATOM   5871  H  HE1  . TYR A 1 77 ? 11.835  -2.654  -9.664  1.00 0.00 ? 384 TYR A HE1  5  
ATOM   5872  H  HE2  . TYR A 1 77 ? 12.313  -6.229  -7.396  1.00 0.00 ? 384 TYR A HE2  5  
ATOM   5873  H  HH   . TYR A 1 77 ? 14.095  -4.817  -8.431  1.00 0.00 ? 384 TYR A HH   5  
ATOM   5874  N  N    . CYS A 1 78 ? 5.121   -3.983  -9.778  1.00 0.00 ? 385 CYS A N    5  
ATOM   5875  C  CA   . CYS A 1 78 ? 3.737   -4.172  -10.201 1.00 0.00 ? 385 CYS A CA   5  
ATOM   5876  C  C    . CYS A 1 78 ? 3.592   -5.467  -10.996 1.00 0.00 ? 385 CYS A C    5  
ATOM   5877  O  O    . CYS A 1 78 ? 4.549   -5.938  -11.615 1.00 0.00 ? 385 CYS A O    5  
ATOM   5878  C  CB   . CYS A 1 78 ? 3.233   -2.960  -11.003 1.00 0.00 ? 385 CYS A CB   5  
ATOM   5879  S  SG   . CYS A 1 78 ? 4.429   -2.249  -12.170 1.00 0.00 ? 385 CYS A SG   5  
ATOM   5880  H  H    . CYS A 1 78 ? 5.622   -3.202  -10.087 1.00 0.00 ? 385 CYS A H    5  
ATOM   5881  H  HA   . CYS A 1 78 ? 3.141   -4.262  -9.305  1.00 0.00 ? 385 CYS A HA   5  
ATOM   5882  H  HB2  . CYS A 1 78 ? 2.366   -3.255  -11.571 1.00 0.00 ? 385 CYS A HB2  5  
ATOM   5883  H  HB3  . CYS A 1 78 ? 2.950   -2.179  -10.312 1.00 0.00 ? 385 CYS A HB3  5  
ATOM   5884  N  N    . ASP A 1 79 ? 2.402   -6.056  -10.951 1.00 0.00 ? 386 ASP A N    5  
ATOM   5885  C  CA   . ASP A 1 79 ? 2.165   -7.362  -11.569 1.00 0.00 ? 386 ASP A CA   5  
ATOM   5886  C  C    . ASP A 1 79 ? 2.439   -7.322  -13.070 1.00 0.00 ? 386 ASP A C    5  
ATOM   5887  O  O    . ASP A 1 79 ? 2.844   -8.321  -13.660 1.00 0.00 ? 386 ASP A O    5  
ATOM   5888  C  CB   . ASP A 1 79 ? 0.733   -7.840  -11.308 1.00 0.00 ? 386 ASP A CB   5  
ATOM   5889  C  CG   . ASP A 1 79 ? -0.272  -7.222  -12.258 1.00 0.00 ? 386 ASP A CG   5  
ATOM   5890  O  OD1  . ASP A 1 79 ? -0.508  -6.000  -12.171 1.00 0.00 ? 386 ASP A OD1  5  
ATOM   5891  O  OD2  . ASP A 1 79 ? -0.817  -7.959  -13.107 1.00 0.00 ? 386 ASP A OD2  5  
ATOM   5892  H  H    . ASP A 1 79 ? 1.664   -5.607  -10.478 1.00 0.00 ? 386 ASP A H    5  
ATOM   5893  H  HA   . ASP A 1 79 ? 2.851   -8.064  -11.119 1.00 0.00 ? 386 ASP A HA   5  
ATOM   5894  H  HB2  . ASP A 1 79 ? 0.695   -8.923  -11.430 1.00 0.00 ? 386 ASP A HB2  5  
ATOM   5895  H  HB3  . ASP A 1 79 ? 0.451   -7.569  -10.289 1.00 0.00 ? 386 ASP A HB3  5  
ATOM   5896  N  N    . VAL A 1 80 ? 2.242   -6.161  -13.675 1.00 0.00 ? 387 VAL A N    5  
ATOM   5897  C  CA   . VAL A 1 80 ? 2.493   -5.983  -15.101 1.00 0.00 ? 387 VAL A CA   5  
ATOM   5898  C  C    . VAL A 1 80 ? 3.933   -5.532  -15.355 1.00 0.00 ? 387 VAL A C    5  
ATOM   5899  O  O    . VAL A 1 80 ? 4.272   -5.059  -16.438 1.00 0.00 ? 387 VAL A O    5  
ATOM   5900  C  CB   . VAL A 1 80 ? 1.517   -4.952  -15.712 1.00 0.00 ? 387 VAL A CB   5  
ATOM   5901  C  CG1  . VAL A 1 80 ? 0.082   -5.437  -15.587 1.00 0.00 ? 387 VAL A CG1  5  
ATOM   5902  C  CG2  . VAL A 1 80 ? 1.678   -3.591  -15.045 1.00 0.00 ? 387 VAL A CG2  5  
ATOM   5903  H  H    . VAL A 1 80 ? 1.900   -5.406  -13.153 1.00 0.00 ? 387 VAL A H    5  
ATOM   5904  H  HA   . VAL A 1 80 ? 2.334   -6.934  -15.589 1.00 0.00 ? 387 VAL A HA   5  
ATOM   5905  H  HB   . VAL A 1 80 ? 1.747   -4.844  -16.761 1.00 0.00 ? 387 VAL A HB   5  
ATOM   5906  H  HG11 . VAL A 1 80 ? -0.024  -6.380  -16.101 1.00 0.00 ? 387 VAL A HG11 5  
ATOM   5907  H  HG12 . VAL A 1 80 ? -0.584  -4.710  -16.027 1.00 0.00 ? 387 VAL A HG12 5  
ATOM   5908  H  HG13 . VAL A 1 80 ? -0.164  -5.567  -14.543 1.00 0.00 ? 387 VAL A HG13 5  
ATOM   5909  H  HG21 . VAL A 1 80 ? 1.469   -3.681  -13.990 1.00 0.00 ? 387 VAL A HG21 5  
ATOM   5910  H  HG22 . VAL A 1 80 ? 0.988   -2.889  -15.491 1.00 0.00 ? 387 VAL A HG22 5  
ATOM   5911  H  HG23 . VAL A 1 80 ? 2.690   -3.241  -15.184 1.00 0.00 ? 387 VAL A HG23 5  
ATOM   5912  N  N    . HIS A 1 81 ? 4.780   -5.693  -14.349 1.00 0.00 ? 388 HIS A N    5  
ATOM   5913  C  CA   . HIS A 1 81 ? 6.166   -5.243  -14.429 1.00 0.00 ? 388 HIS A CA   5  
ATOM   5914  C  C    . HIS A 1 81 ? 7.126   -6.428  -14.408 1.00 0.00 ? 388 HIS A C    5  
ATOM   5915  O  O    . HIS A 1 81 ? 8.262   -6.328  -14.868 1.00 0.00 ? 388 HIS A O    5  
ATOM   5916  C  CB   . HIS A 1 81 ? 6.463   -4.318  -13.249 1.00 0.00 ? 388 HIS A CB   5  
ATOM   5917  C  CG   . HIS A 1 81 ? 7.556   -3.322  -13.481 1.00 0.00 ? 388 HIS A CG   5  
ATOM   5918  N  ND1  . HIS A 1 81 ? 7.484   -2.004  -13.035 1.00 0.00 ? 388 HIS A ND1  5  
ATOM   5919  C  CD2  . HIS A 1 81 ? 8.765   -3.454  -14.076 1.00 0.00 ? 388 HIS A CD2  5  
ATOM   5920  C  CE1  . HIS A 1 81 ? 8.621   -1.394  -13.355 1.00 0.00 ? 388 HIS A CE1  5  
ATOM   5921  N  NE2  . HIS A 1 81 ? 9.403   -2.245  -13.984 1.00 0.00 ? 388 HIS A NE2  5  
ATOM   5922  H  H    . HIS A 1 81 ? 4.461   -6.113  -13.520 1.00 0.00 ? 388 HIS A H    5  
ATOM   5923  H  HA   . HIS A 1 81 ? 6.294   -4.699  -15.351 1.00 0.00 ? 388 HIS A HA   5  
ATOM   5924  H  HB2  . HIS A 1 81 ? 5.568   -3.769  -13.006 1.00 0.00 ? 388 HIS A HB2  5  
ATOM   5925  H  HB3  . HIS A 1 81 ? 6.744   -4.923  -12.398 1.00 0.00 ? 388 HIS A HB3  5  
ATOM   5926  H  HD2  . HIS A 1 81 ? 9.154   -4.349  -14.541 1.00 0.00 ? 388 HIS A HD2  5  
ATOM   5927  H  HE1  . HIS A 1 81 ? 8.864   -0.366  -13.134 1.00 0.00 ? 388 HIS A HE1  5  
ATOM   5928  H  HE2  . HIS A 1 81 ? 10.187  -1.985  -14.520 1.00 0.00 ? 388 HIS A HE2  5  
ATOM   5929  N  N    . THR A 1 82 ? 6.671   -7.547  -13.870 1.00 0.00 ? 389 THR A N    5  
ATOM   5930  C  CA   . THR A 1 82 ? 7.536   -8.707  -13.708 1.00 0.00 ? 389 THR A CA   5  
ATOM   5931  C  C    . THR A 1 82 ? 7.597   -9.565  -14.988 1.00 0.00 ? 389 THR A C    5  
ATOM   5932  O  O    . THR A 1 82 ? 8.687   -9.784  -15.516 1.00 0.00 ? 389 THR A O    5  
ATOM   5933  C  CB   . THR A 1 82 ? 7.102   -9.559  -12.493 1.00 0.00 ? 389 THR A CB   5  
ATOM   5934  O  OG1  . THR A 1 82 ? 6.977   -8.716  -11.335 1.00 0.00 ? 389 THR A OG1  5  
ATOM   5935  C  CG2  . THR A 1 82 ? 8.111   -10.664 -12.209 1.00 0.00 ? 389 THR A CG2  5  
ATOM   5936  H  H    . THR A 1 82 ? 5.735   -7.597  -13.584 1.00 0.00 ? 389 THR A H    5  
ATOM   5937  H  HA   . THR A 1 82 ? 8.531   -8.335  -13.509 1.00 0.00 ? 389 THR A HA   5  
ATOM   5938  H  HB   . THR A 1 82 ? 6.146   -10.009 -12.708 1.00 0.00 ? 389 THR A HB   5  
ATOM   5939  H  HG1  . THR A 1 82 ? 6.104   -8.317  -11.320 1.00 0.00 ? 389 THR A HG1  5  
ATOM   5940  H  HG21 . THR A 1 82 ? 8.190   -11.310 -13.070 1.00 0.00 ? 389 THR A HG21 5  
ATOM   5941  H  HG22 . THR A 1 82 ? 7.783   -11.239 -11.355 1.00 0.00 ? 389 THR A HG22 5  
ATOM   5942  H  HG23 . THR A 1 82 ? 9.076   -10.226 -11.997 1.00 0.00 ? 389 THR A HG23 5  
ATOM   5943  N  N    . PRO A 1 83 ? 6.441   -10.071 -15.498 1.00 0.00 ? 390 PRO A N    5  
ATOM   5944  C  CA   . PRO A 1 83 ? 6.390   -10.864 -16.738 1.00 0.00 ? 390 PRO A CA   5  
ATOM   5945  C  C    . PRO A 1 83 ? 7.203   -10.294 -17.920 1.00 0.00 ? 390 PRO A C    5  
ATOM   5946  O  O    . PRO A 1 83 ? 7.910   -11.062 -18.572 1.00 0.00 ? 390 PRO A O    5  
ATOM   5947  C  CB   . PRO A 1 83 ? 4.896   -10.928 -17.096 1.00 0.00 ? 390 PRO A CB   5  
ATOM   5948  C  CG   . PRO A 1 83 ? 4.168   -10.147 -16.046 1.00 0.00 ? 390 PRO A CG   5  
ATOM   5949  C  CD   . PRO A 1 83 ? 5.109   -9.980  -14.885 1.00 0.00 ? 390 PRO A CD   5  
ATOM   5950  H  HA   . PRO A 1 83 ? 6.738   -11.869 -16.549 1.00 0.00 ? 390 PRO A HA   5  
ATOM   5951  H  HB2  . PRO A 1 83 ? 4.746   -10.499 -18.076 1.00 0.00 ? 390 PRO A HB2  5  
ATOM   5952  H  HB3  . PRO A 1 83 ? 4.577   -11.960 -17.105 1.00 0.00 ? 390 PRO A HB3  5  
ATOM   5953  H  HG2  . PRO A 1 83 ? 3.887   -9.181  -16.437 1.00 0.00 ? 390 PRO A HG2  5  
ATOM   5954  H  HG3  . PRO A 1 83 ? 3.289   -10.692 -15.736 1.00 0.00 ? 390 PRO A HG3  5  
ATOM   5955  H  HD2  . PRO A 1 83 ? 4.964   -9.018  -14.420 1.00 0.00 ? 390 PRO A HD2  5  
ATOM   5956  H  HD3  . PRO A 1 83 ? 4.961   -10.774 -14.168 1.00 0.00 ? 390 PRO A HD3  5  
ATOM   5957  N  N    . PRO A 1 84 ? 7.110   -8.970  -18.248 1.00 0.00 ? 391 PRO A N    5  
ATOM   5958  C  CA   . PRO A 1 84 ? 7.872   -8.384  -19.367 1.00 0.00 ? 391 PRO A CA   5  
ATOM   5959  C  C    . PRO A 1 84 ? 9.360   -8.733  -19.324 1.00 0.00 ? 391 PRO A C    5  
ATOM   5960  O  O    . PRO A 1 84 ? 10.119  -8.202  -18.509 1.00 0.00 ? 391 PRO A O    5  
ATOM   5961  C  CB   . PRO A 1 84 ? 7.675   -6.879  -19.185 1.00 0.00 ? 391 PRO A CB   5  
ATOM   5962  C  CG   . PRO A 1 84 ? 6.363   -6.758  -18.497 1.00 0.00 ? 391 PRO A CG   5  
ATOM   5963  C  CD   . PRO A 1 84 ? 6.262   -7.952  -17.590 1.00 0.00 ? 391 PRO A CD   5  
ATOM   5964  H  HA   . PRO A 1 84 ? 7.462   -8.686  -20.320 1.00 0.00 ? 391 PRO A HA   5  
ATOM   5965  H  HB2  . PRO A 1 84 ? 8.478   -6.478  -18.583 1.00 0.00 ? 391 PRO A HB2  5  
ATOM   5966  H  HB3  . PRO A 1 84 ? 7.660   -6.394  -20.149 1.00 0.00 ? 391 PRO A HB3  5  
ATOM   5967  H  HG2  . PRO A 1 84 ? 6.333   -5.844  -17.920 1.00 0.00 ? 391 PRO A HG2  5  
ATOM   5968  H  HG3  . PRO A 1 84 ? 5.565   -6.770  -19.224 1.00 0.00 ? 391 PRO A HG3  5  
ATOM   5969  H  HD2  . PRO A 1 84 ? 6.641   -7.713  -16.607 1.00 0.00 ? 391 PRO A HD2  5  
ATOM   5970  H  HD3  . PRO A 1 84 ? 5.239   -8.290  -17.527 1.00 0.00 ? 391 PRO A HD3  5  
ATOM   5971  N  N    . GLY A 1 85 ? 9.767   -9.628  -20.211 1.00 0.00 ? 392 GLY A N    5  
ATOM   5972  C  CA   . GLY A 1 85 ? 11.133  -10.100 -20.230 1.00 0.00 ? 392 GLY A CA   5  
ATOM   5973  C  C    . GLY A 1 85 ? 11.191  -11.610 -20.254 1.00 0.00 ? 392 GLY A C    5  
ATOM   5974  O  O    . GLY A 1 85 ? 11.030  -12.225 -21.308 1.00 0.00 ? 392 GLY A O    5  
ATOM   5975  H  H    . GLY A 1 85 ? 9.122   -9.988  -20.857 1.00 0.00 ? 392 GLY A H    5  
ATOM   5976  H  HA2  . GLY A 1 85 ? 11.629  -9.712  -21.108 1.00 0.00 ? 392 GLY A HA2  5  
ATOM   5977  H  HA3  . GLY A 1 85 ? 11.645  -9.742  -19.348 1.00 0.00 ? 392 GLY A HA3  5  
ATOM   5978  N  N    . SER A 1 86 ? 11.416  -12.212 -19.098 1.00 0.00 ? 393 SER A N    5  
ATOM   5979  C  CA   . SER A 1 86 ? 11.437  -13.662 -18.980 1.00 0.00 ? 393 SER A CA   5  
ATOM   5980  C  C    . SER A 1 86 ? 11.058  -14.082 -17.566 1.00 0.00 ? 393 SER A C    5  
ATOM   5981  O  O    . SER A 1 86 ? 11.549  -13.515 -16.587 1.00 0.00 ? 393 SER A O    5  
ATOM   5982  C  CB   . SER A 1 86 ? 12.822  -14.210 -19.338 1.00 0.00 ? 393 SER A CB   5  
ATOM   5983  O  OG   . SER A 1 86 ? 13.201  -13.831 -20.654 1.00 0.00 ? 393 SER A OG   5  
ATOM   5984  H  H    . SER A 1 86 ? 11.573  -11.668 -18.297 1.00 0.00 ? 393 SER A H    5  
ATOM   5985  H  HA   . SER A 1 86 ? 10.710  -14.062 -19.670 1.00 0.00 ? 393 SER A HA   5  
ATOM   5986  H  HB2  . SER A 1 86 ? 13.550  -13.821 -18.643 1.00 0.00 ? 393 SER A HB2  5  
ATOM   5987  H  HB3  . SER A 1 86 ? 12.806  -15.287 -19.276 1.00 0.00 ? 393 SER A HB3  5  
ATOM   5988  H  HG   . SER A 1 86 ? 12.448  -13.405 -21.092 1.00 0.00 ? 393 SER A HG   5  
ATOM   5989  N  N    . THR A 1 87 ? 10.169  -15.058 -17.463 1.00 0.00 ? 394 THR A N    5  
ATOM   5990  C  CA   . THR A 1 87 ? 9.760   -15.578 -16.174 1.00 0.00 ? 394 THR A CA   5  
ATOM   5991  C  C    . THR A 1 87 ? 10.609  -16.788 -15.798 1.00 0.00 ? 394 THR A C    5  
ATOM   5992  O  O    . THR A 1 87 ? 10.324  -17.896 -16.303 1.00 0.00 ? 394 THR A O    5  
ATOM   5993  C  CB   . THR A 1 87 ? 8.262   -15.952 -16.172 1.00 0.00 ? 394 THR A CB   5  
ATOM   5994  O  OG1  . THR A 1 87 ? 7.929   -16.673 -17.370 1.00 0.00 ? 394 THR A OG1  5  
ATOM   5995  C  CG2  . THR A 1 87 ? 7.397   -14.706 -16.068 1.00 0.00 ? 394 THR A CG2  5  
ATOM   5996  O  OXT  . THR A 1 87 ? 11.575  -16.619 -15.024 1.00 0.00 ? 394 THR A OXT  5  
ATOM   5997  H  H    . THR A 1 87 ? 9.783   -15.445 -18.274 1.00 0.00 ? 394 THR A H    5  
ATOM   5998  H  HA   . THR A 1 87 ? 9.915   -14.801 -15.440 1.00 0.00 ? 394 THR A HA   5  
ATOM   5999  H  HB   . THR A 1 87 ? 8.064   -16.582 -15.316 1.00 0.00 ? 394 THR A HB   5  
ATOM   6000  H  HG1  . THR A 1 87 ? 8.578   -17.379 -17.504 1.00 0.00 ? 394 THR A HG1  5  
ATOM   6001  H  HG21 . THR A 1 87 ? 7.650   -14.166 -15.169 1.00 0.00 ? 394 THR A HG21 5  
ATOM   6002  H  HG22 . THR A 1 87 ? 6.355   -14.990 -16.037 1.00 0.00 ? 394 THR A HG22 5  
ATOM   6003  H  HG23 . THR A 1 87 ? 7.572   -14.075 -16.927 1.00 0.00 ? 394 THR A HG23 5  
HETATM 6004  ZN ZN   . ZN  B 2 .  ? -6.755  -0.765  -5.899  1.00 0.00 ? 401 ZN  A ZN   5  
HETATM 6005  ZN ZN   . ZN  C 2 .  ? 5.784   -0.607  -12.651 1.00 0.00 ? 402 ZN  A ZN   5  
ATOM   6006  N  N    . MET A 1 9  ? 6.529   23.488  -17.604 1.00 0.00 ? 316 MET A N    6  
ATOM   6007  C  CA   . MET A 1 9  ? 5.489   24.262  -16.889 1.00 0.00 ? 316 MET A CA   6  
ATOM   6008  C  C    . MET A 1 9  ? 4.190   23.475  -16.819 1.00 0.00 ? 316 MET A C    6  
ATOM   6009  O  O    . MET A 1 9  ? 3.397   23.487  -17.761 1.00 0.00 ? 316 MET A O    6  
ATOM   6010  C  CB   . MET A 1 9  ? 5.243   25.608  -17.577 1.00 0.00 ? 316 MET A CB   6  
ATOM   6011  C  CG   . MET A 1 9  ? 6.340   26.632  -17.339 1.00 0.00 ? 316 MET A CG   6  
ATOM   6012  S  SD   . MET A 1 9  ? 6.440   27.144  -15.611 1.00 0.00 ? 316 MET A SD   6  
ATOM   6013  C  CE   . MET A 1 9  ? 7.791   28.317  -15.684 1.00 0.00 ? 316 MET A CE   6  
ATOM   6014  H  H    . MET A 1 9  ? 7.416   24.028  -17.656 1.00 0.00 ? 316 MET A H    6  
ATOM   6015  H  HA   . MET A 1 9  ? 5.838   24.441  -15.884 1.00 0.00 ? 316 MET A HA   6  
ATOM   6016  H  HB2  . MET A 1 9  ? 5.160   25.445  -18.641 1.00 0.00 ? 316 MET A HB2  6  
ATOM   6017  H  HB3  . MET A 1 9  ? 4.313   26.018  -17.213 1.00 0.00 ? 316 MET A HB3  6  
ATOM   6018  H  HG2  . MET A 1 9  ? 7.285   26.203  -17.631 1.00 0.00 ? 316 MET A HG2  6  
ATOM   6019  H  HG3  . MET A 1 9  ? 6.137   27.502  -17.945 1.00 0.00 ? 316 MET A HG3  6  
ATOM   6020  H  HE1  . MET A 1 9  ? 7.974   28.716  -14.696 1.00 0.00 ? 316 MET A HE1  6  
ATOM   6021  H  HE2  . MET A 1 9  ? 7.533   29.120  -16.356 1.00 0.00 ? 316 MET A HE2  6  
ATOM   6022  H  HE3  . MET A 1 9  ? 8.678   27.819  -16.042 1.00 0.00 ? 316 MET A HE3  6  
ATOM   6023  N  N    . ASN A 1 10 ? 3.988   22.773  -15.712 1.00 0.00 ? 317 ASN A N    6  
ATOM   6024  C  CA   . ASN A 1 10 ? 2.774   21.995  -15.505 1.00 0.00 ? 317 ASN A CA   6  
ATOM   6025  C  C    . ASN A 1 10 ? 2.610   21.667  -14.024 1.00 0.00 ? 317 ASN A C    6  
ATOM   6026  O  O    . ASN A 1 10 ? 3.587   21.657  -13.272 1.00 0.00 ? 317 ASN A O    6  
ATOM   6027  C  CB   . ASN A 1 10 ? 2.822   20.706  -16.336 1.00 0.00 ? 317 ASN A CB   6  
ATOM   6028  C  CG   . ASN A 1 10 ? 1.522   19.923  -16.301 1.00 0.00 ? 317 ASN A CG   6  
ATOM   6029  O  OD1  . ASN A 1 10 ? 0.440   20.494  -16.143 1.00 0.00 ? 317 ASN A OD1  6  
ATOM   6030  N  ND2  . ASN A 1 10 ? 1.613   18.612  -16.466 1.00 0.00 ? 317 ASN A ND2  6  
ATOM   6031  H  H    . ASN A 1 10 ? 4.680   22.769  -15.012 1.00 0.00 ? 317 ASN A H    6  
ATOM   6032  H  HA   . ASN A 1 10 ? 1.935   22.593  -15.827 1.00 0.00 ? 317 ASN A HA   6  
ATOM   6033  H  HB2  . ASN A 1 10 ? 3.037   20.959  -17.364 1.00 0.00 ? 317 ASN A HB2  6  
ATOM   6034  H  HB3  . ASN A 1 10 ? 3.612   20.073  -15.957 1.00 0.00 ? 317 ASN A HB3  6  
ATOM   6035  H  HD21 . ASN A 1 10 ? 2.504   18.224  -16.605 1.00 0.00 ? 317 ASN A HD21 6  
ATOM   6036  H  HD22 . ASN A 1 10 ? 0.787   18.084  -16.438 1.00 0.00 ? 317 ASN A HD22 6  
ATOM   6037  N  N    . ILE A 1 11 ? 1.380   21.413  -13.607 1.00 0.00 ? 318 ILE A N    6  
ATOM   6038  C  CA   . ILE A 1 11 ? 1.093   21.084  -12.218 1.00 0.00 ? 318 ILE A CA   6  
ATOM   6039  C  C    . ILE A 1 11 ? 0.758   19.605  -12.087 1.00 0.00 ? 318 ILE A C    6  
ATOM   6040  O  O    . ILE A 1 11 ? 0.355   18.979  -13.064 1.00 0.00 ? 318 ILE A O    6  
ATOM   6041  C  CB   . ILE A 1 11 ? -0.074  21.931  -11.658 1.00 0.00 ? 318 ILE A CB   6  
ATOM   6042  C  CG1  . ILE A 1 11 ? -1.336  21.746  -12.510 1.00 0.00 ? 318 ILE A CG1  6  
ATOM   6043  C  CG2  . ILE A 1 11 ? 0.324   23.398  -11.597 1.00 0.00 ? 318 ILE A CG2  6  
ATOM   6044  C  CD1  . ILE A 1 11 ? -2.543  22.493  -11.980 1.00 0.00 ? 318 ILE A CD1  6  
ATOM   6045  H  H    . ILE A 1 11 ? 0.646   21.419  -14.257 1.00 0.00 ? 318 ILE A H    6  
ATOM   6046  H  HA   . ILE A 1 11 ? 1.978   21.292  -11.639 1.00 0.00 ? 318 ILE A HA   6  
ATOM   6047  H  HB   . ILE A 1 11 ? -0.278  21.599  -10.652 1.00 0.00 ? 318 ILE A HB   6  
ATOM   6048  H  HG12 . ILE A 1 11 ? -1.142  22.100  -13.510 1.00 0.00 ? 318 ILE A HG12 6  
ATOM   6049  H  HG13 . ILE A 1 11 ? -1.585  20.696  -12.545 1.00 0.00 ? 318 ILE A HG13 6  
ATOM   6050  H  HG21 . ILE A 1 11 ? 0.593   23.740  -12.585 1.00 0.00 ? 318 ILE A HG21 6  
ATOM   6051  H  HG22 . ILE A 1 11 ? 1.167   23.514  -10.933 1.00 0.00 ? 318 ILE A HG22 6  
ATOM   6052  H  HG23 . ILE A 1 11 ? -0.507  23.982  -11.228 1.00 0.00 ? 318 ILE A HG23 6  
ATOM   6053  H  HD11 . ILE A 1 11 ? -3.380  22.338  -12.644 1.00 0.00 ? 318 ILE A HD11 6  
ATOM   6054  H  HD12 . ILE A 1 11 ? -2.318  23.548  -11.925 1.00 0.00 ? 318 ILE A HD12 6  
ATOM   6055  H  HD13 . ILE A 1 11 ? -2.789  22.125  -10.995 1.00 0.00 ? 318 ILE A HD13 6  
ATOM   6056  N  N    . PRO A 1 12 ? 0.943   19.017  -10.891 1.00 0.00 ? 319 PRO A N    6  
ATOM   6057  C  CA   . PRO A 1 12 ? 0.667   17.606  -10.645 1.00 0.00 ? 319 PRO A CA   6  
ATOM   6058  C  C    . PRO A 1 12 ? -0.806  17.343  -10.318 1.00 0.00 ? 319 PRO A C    6  
ATOM   6059  O  O    . PRO A 1 12 ? -1.270  17.628  -9.211  1.00 0.00 ? 319 PRO A O    6  
ATOM   6060  C  CB   . PRO A 1 12 ? 1.550   17.266  -9.432  1.00 0.00 ? 319 PRO A CB   6  
ATOM   6061  C  CG   . PRO A 1 12 ? 2.204   18.552  -9.010  1.00 0.00 ? 319 PRO A CG   6  
ATOM   6062  C  CD   . PRO A 1 12 ? 1.448   19.666  -9.680  1.00 0.00 ? 319 PRO A CD   6  
ATOM   6063  H  HA   . PRO A 1 12 ? 0.961   16.998  -11.486 1.00 0.00 ? 319 PRO A HA   6  
ATOM   6064  H  HB2  . PRO A 1 12 ? 0.931   16.867  -8.640  1.00 0.00 ? 319 PRO A HB2  6  
ATOM   6065  H  HB3  . PRO A 1 12 ? 2.286   16.530  -9.718  1.00 0.00 ? 319 PRO A HB3  6  
ATOM   6066  H  HG2  . PRO A 1 12 ? 2.144   18.658  -7.936  1.00 0.00 ? 319 PRO A HG2  6  
ATOM   6067  H  HG3  . PRO A 1 12 ? 3.236   18.557  -9.328  1.00 0.00 ? 319 PRO A HG3  6  
ATOM   6068  H  HD2  . PRO A 1 12 ? 0.637   20.006  -9.053  1.00 0.00 ? 319 PRO A HD2  6  
ATOM   6069  H  HD3  . PRO A 1 12 ? 2.111   20.481  -9.922  1.00 0.00 ? 319 PRO A HD3  6  
ATOM   6070  N  N    . PRO A 1 13 ? -1.563  16.793  -11.281 1.00 0.00 ? 320 PRO A N    6  
ATOM   6071  C  CA   . PRO A 1 13 ? -2.981  16.454  -11.096 1.00 0.00 ? 320 PRO A CA   6  
ATOM   6072  C  C    . PRO A 1 13 ? -3.175  15.138  -10.339 1.00 0.00 ? 320 PRO A C    6  
ATOM   6073  O  O    . PRO A 1 13 ? -4.087  14.364  -10.632 1.00 0.00 ? 320 PRO A O    6  
ATOM   6074  C  CB   . PRO A 1 13 ? -3.477  16.320  -12.534 1.00 0.00 ? 320 PRO A CB   6  
ATOM   6075  C  CG   . PRO A 1 13 ? -2.292  15.820  -13.282 1.00 0.00 ? 320 PRO A CG   6  
ATOM   6076  C  CD   . PRO A 1 13 ? -1.099  16.479  -12.647 1.00 0.00 ? 320 PRO A CD   6  
ATOM   6077  H  HA   . PRO A 1 13 ? -3.519  17.243  -10.595 1.00 0.00 ? 320 PRO A HA   6  
ATOM   6078  H  HB2  . PRO A 1 13 ? -4.299  15.621  -12.574 1.00 0.00 ? 320 PRO A HB2  6  
ATOM   6079  H  HB3  . PRO A 1 13 ? -3.796  17.284  -12.902 1.00 0.00 ? 320 PRO A HB3  6  
ATOM   6080  H  HG2  . PRO A 1 13 ? -2.223  14.748  -13.186 1.00 0.00 ? 320 PRO A HG2  6  
ATOM   6081  H  HG3  . PRO A 1 13 ? -2.366  16.101  -14.322 1.00 0.00 ? 320 PRO A HG3  6  
ATOM   6082  H  HD2  . PRO A 1 13 ? -0.254  15.800  -12.620 1.00 0.00 ? 320 PRO A HD2  6  
ATOM   6083  H  HD3  . PRO A 1 13 ? -0.843  17.389  -13.181 1.00 0.00 ? 320 PRO A HD3  6  
ATOM   6084  N  N    . ALA A 1 14 ? -2.325  14.903  -9.348  1.00 0.00 ? 321 ALA A N    6  
ATOM   6085  C  CA   . ALA A 1 14 ? -2.363  13.678  -8.568  1.00 0.00 ? 321 ALA A CA   6  
ATOM   6086  C  C    . ALA A 1 14 ? -2.211  14.020  -7.098  1.00 0.00 ? 321 ALA A C    6  
ATOM   6087  O  O    . ALA A 1 14 ? -1.613  13.276  -6.322  1.00 0.00 ? 321 ALA A O    6  
ATOM   6088  C  CB   . ALA A 1 14 ? -1.259  12.729  -9.021  1.00 0.00 ? 321 ALA A CB   6  
ATOM   6089  H  H    . ALA A 1 14 ? -1.661  15.590  -9.116  1.00 0.00 ? 321 ALA A H    6  
ATOM   6090  H  HA   . ALA A 1 14 ? -3.320  13.200  -8.728  1.00 0.00 ? 321 ALA A HA   6  
ATOM   6091  H  HB1  . ALA A 1 14 ? -1.402  12.480  -10.064 1.00 0.00 ? 321 ALA A HB1  6  
ATOM   6092  H  HB2  . ALA A 1 14 ? -1.293  11.827  -8.427  1.00 0.00 ? 321 ALA A HB2  6  
ATOM   6093  H  HB3  . ALA A 1 14 ? -0.300  13.207  -8.894  1.00 0.00 ? 321 ALA A HB3  6  
ATOM   6094  N  N    . ARG A 1 15 ? -2.762  15.168  -6.722  1.00 0.00 ? 322 ARG A N    6  
ATOM   6095  C  CA   . ARG A 1 15 ? -2.619  15.673  -5.368  1.00 0.00 ? 322 ARG A CA   6  
ATOM   6096  C  C    . ARG A 1 15 ? -3.439  14.832  -4.386  1.00 0.00 ? 322 ARG A C    6  
ATOM   6097  O  O    . ARG A 1 15 ? -3.135  14.773  -3.196  1.00 0.00 ? 322 ARG A O    6  
ATOM   6098  C  CB   . ARG A 1 15 ? -3.045  17.143  -5.302  1.00 0.00 ? 322 ARG A CB   6  
ATOM   6099  C  CG   . ARG A 1 15 ? -2.587  17.870  -4.044  1.00 0.00 ? 322 ARG A CG   6  
ATOM   6100  C  CD   . ARG A 1 15 ? -1.068  17.882  -3.928  1.00 0.00 ? 322 ARG A CD   6  
ATOM   6101  N  NE   . ARG A 1 15 ? -0.607  18.727  -2.827  1.00 0.00 ? 322 ARG A NE   6  
ATOM   6102  C  CZ   . ARG A 1 15 ? 0.647   18.743  -2.369  1.00 0.00 ? 322 ARG A CZ   6  
ATOM   6103  N  NH1  . ARG A 1 15 ? 1.561   17.925  -2.880  1.00 0.00 ? 322 ARG A NH1  6  
ATOM   6104  N  NH2  . ARG A 1 15 ? 0.985   19.571  -1.389  1.00 0.00 ? 322 ARG A NH2  6  
ATOM   6105  H  H    . ARG A 1 15 ? -3.274  15.686  -7.375  1.00 0.00 ? 322 ARG A H    6  
ATOM   6106  H  HA   . ARG A 1 15 ? -1.576  15.599  -5.107  1.00 0.00 ? 322 ARG A HA   6  
ATOM   6107  H  HB2  . ARG A 1 15 ? -2.637  17.661  -6.158  1.00 0.00 ? 322 ARG A HB2  6  
ATOM   6108  H  HB3  . ARG A 1 15 ? -4.123  17.194  -5.346  1.00 0.00 ? 322 ARG A HB3  6  
ATOM   6109  H  HG2  . ARG A 1 15 ? -2.943  18.889  -4.078  1.00 0.00 ? 322 ARG A HG2  6  
ATOM   6110  H  HG3  . ARG A 1 15 ? -3.001  17.369  -3.182  1.00 0.00 ? 322 ARG A HG3  6  
ATOM   6111  H  HD2  . ARG A 1 15 ? -0.724  16.873  -3.756  1.00 0.00 ? 322 ARG A HD2  6  
ATOM   6112  H  HD3  . ARG A 1 15 ? -0.651  18.251  -4.853  1.00 0.00 ? 322 ARG A HD3  6  
ATOM   6113  H  HE   . ARG A 1 15 ? -1.269  19.332  -2.419  1.00 0.00 ? 322 ARG A HE   6  
ATOM   6114  H  HH11 . ARG A 1 15 ? 1.320   17.292  -3.616  1.00 0.00 ? 322 ARG A HH11 6  
ATOM   6115  H  HH12 . ARG A 1 15 ? 2.504   17.938  -2.530  1.00 0.00 ? 322 ARG A HH12 6  
ATOM   6116  H  HH21 . ARG A 1 15 ? 0.305   20.192  -0.991  1.00 0.00 ? 322 ARG A HH21 6  
ATOM   6117  H  HH22 . ARG A 1 15 ? 1.928   19.586  -1.044  1.00 0.00 ? 322 ARG A HH22 6  
ATOM   6118  N  N    . TRP A 1 16 ? -4.469  14.168  -4.902  1.00 0.00 ? 323 TRP A N    6  
ATOM   6119  C  CA   . TRP A 1 16 ? -5.312  13.297  -4.086  1.00 0.00 ? 323 TRP A CA   6  
ATOM   6120  C  C    . TRP A 1 16 ? -4.738  11.885  -4.042  1.00 0.00 ? 323 TRP A C    6  
ATOM   6121  O  O    . TRP A 1 16 ? -5.466  10.896  -4.172  1.00 0.00 ? 323 TRP A O    6  
ATOM   6122  C  CB   . TRP A 1 16 ? -6.755  13.282  -4.615  1.00 0.00 ? 323 TRP A CB   6  
ATOM   6123  C  CG   . TRP A 1 16 ? -6.879  13.116  -6.105  1.00 0.00 ? 323 TRP A CG   6  
ATOM   6124  C  CD1  . TRP A 1 16 ? -6.131  12.311  -6.919  1.00 0.00 ? 323 TRP A CD1  6  
ATOM   6125  C  CD2  . TRP A 1 16 ? -7.832  13.767  -6.952  1.00 0.00 ? 323 TRP A CD2  6  
ATOM   6126  N  NE1  . TRP A 1 16 ? -6.555  12.434  -8.219  1.00 0.00 ? 323 TRP A NE1  6  
ATOM   6127  C  CE2  . TRP A 1 16 ? -7.598  13.318  -8.266  1.00 0.00 ? 323 TRP A CE2  6  
ATOM   6128  C  CE3  . TRP A 1 16 ? -8.858  14.689  -6.728  1.00 0.00 ? 323 TRP A CE3  6  
ATOM   6129  C  CZ2  . TRP A 1 16 ? -8.355  13.759  -9.348  1.00 0.00 ? 323 TRP A CZ2  6  
ATOM   6130  C  CZ3  . TRP A 1 16 ? -9.610  15.125  -7.803  1.00 0.00 ? 323 TRP A CZ3  6  
ATOM   6131  C  CH2  . TRP A 1 16 ? -9.354  14.660  -9.099  1.00 0.00 ? 323 TRP A CH2  6  
ATOM   6132  H  H    . TRP A 1 16 ? -4.657  14.249  -5.858  1.00 0.00 ? 323 TRP A H    6  
ATOM   6133  H  HA   . TRP A 1 16 ? -5.309  13.692  -3.083  1.00 0.00 ? 323 TRP A HA   6  
ATOM   6134  H  HB2  . TRP A 1 16 ? -7.287  12.465  -4.153  1.00 0.00 ? 323 TRP A HB2  6  
ATOM   6135  H  HB3  . TRP A 1 16 ? -7.235  14.211  -4.345  1.00 0.00 ? 323 TRP A HB3  6  
ATOM   6136  H  HD1  . TRP A 1 16 ? -5.321  11.684  -6.577  1.00 0.00 ? 323 TRP A HD1  6  
ATOM   6137  H  HE1  . TRP A 1 16 ? -6.175  11.959  -8.989  1.00 0.00 ? 323 TRP A HE1  6  
ATOM   6138  H  HE3  . TRP A 1 16 ? -9.070  15.058  -5.734  1.00 0.00 ? 323 TRP A HE3  6  
ATOM   6139  H  HZ2  . TRP A 1 16 ? -8.172  13.408  -10.353 1.00 0.00 ? 323 TRP A HZ2  6  
ATOM   6140  H  HZ3  . TRP A 1 16 ? -10.409 15.837  -7.647  1.00 0.00 ? 323 TRP A HZ3  6  
ATOM   6141  H  HH2  . TRP A 1 16 ? -9.967  15.027  -9.909  1.00 0.00 ? 323 TRP A HH2  6  
ATOM   6142  N  N    . LYS A 1 17 ? -3.432  11.821  -3.800  1.00 0.00 ? 324 LYS A N    6  
ATOM   6143  C  CA   . LYS A 1 17 ? -2.659  10.578  -3.839  1.00 0.00 ? 324 LYS A CA   6  
ATOM   6144  C  C    . LYS A 1 17 ? -2.582  10.040  -5.266  1.00 0.00 ? 324 LYS A C    6  
ATOM   6145  O  O    . LYS A 1 17 ? -3.220  10.563  -6.183  1.00 0.00 ? 324 LYS A O    6  
ATOM   6146  C  CB   . LYS A 1 17 ? -3.229  9.491   -2.907  1.00 0.00 ? 324 LYS A CB   6  
ATOM   6147  C  CG   . LYS A 1 17 ? -3.188  9.831   -1.420  1.00 0.00 ? 324 LYS A CG   6  
ATOM   6148  C  CD   . LYS A 1 17 ? -4.363  10.701  -1.011  1.00 0.00 ? 324 LYS A CD   6  
ATOM   6149  C  CE   . LYS A 1 17 ? -4.452  10.861  0.495   1.00 0.00 ? 324 LYS A CE   6  
ATOM   6150  N  NZ   . LYS A 1 17 ? -5.620  11.692  0.889   1.00 0.00 ? 324 LYS A NZ   6  
ATOM   6151  H  H    . LYS A 1 17 ? -2.965  12.657  -3.588  1.00 0.00 ? 324 LYS A H    6  
ATOM   6152  H  HA   . LYS A 1 17 ? -1.656  10.817  -3.516  1.00 0.00 ? 324 LYS A HA   6  
ATOM   6153  H  HB2  . LYS A 1 17 ? -4.267  9.314   -3.179  1.00 0.00 ? 324 LYS A HB2  6  
ATOM   6154  H  HB3  . LYS A 1 17 ? -2.657  8.575   -3.058  1.00 0.00 ? 324 LYS A HB3  6  
ATOM   6155  H  HG2  . LYS A 1 17 ? -3.217  8.915   -0.851  1.00 0.00 ? 324 LYS A HG2  6  
ATOM   6156  H  HG3  . LYS A 1 17 ? -2.270  10.359  -1.210  1.00 0.00 ? 324 LYS A HG3  6  
ATOM   6157  H  HD2  . LYS A 1 17 ? -4.252  11.675  -1.462  1.00 0.00 ? 324 LYS A HD2  6  
ATOM   6158  H  HD3  . LYS A 1 17 ? -5.273  10.241  -1.367  1.00 0.00 ? 324 LYS A HD3  6  
ATOM   6159  H  HE2  . LYS A 1 17 ? -4.547  9.885   0.944   1.00 0.00 ? 324 LYS A HE2  6  
ATOM   6160  H  HE3  . LYS A 1 17 ? -3.548  11.334  0.851   1.00 0.00 ? 324 LYS A HE3  6  
ATOM   6161  H  HZ1  . LYS A 1 17 ? -5.726  11.687  1.924   1.00 0.00 ? 324 LYS A HZ1  6  
ATOM   6162  H  HZ2  . LYS A 1 17 ? -6.491  11.312  0.461   1.00 0.00 ? 324 LYS A HZ2  6  
ATOM   6163  H  HZ3  . LYS A 1 17 ? -5.487  12.672  0.570   1.00 0.00 ? 324 LYS A HZ3  6  
ATOM   6164  N  N    . LEU A 1 18 ? -1.793  8.997   -5.448  1.00 0.00 ? 325 LEU A N    6  
ATOM   6165  C  CA   . LEU A 1 18 ? -1.670  8.364   -6.748  1.00 0.00 ? 325 LEU A CA   6  
ATOM   6166  C  C    . LEU A 1 18 ? -2.773  7.324   -6.896  1.00 0.00 ? 325 LEU A C    6  
ATOM   6167  O  O    . LEU A 1 18 ? -3.140  6.662   -5.924  1.00 0.00 ? 325 LEU A O    6  
ATOM   6168  C  CB   . LEU A 1 18 ? -0.293  7.703   -6.916  1.00 0.00 ? 325 LEU A CB   6  
ATOM   6169  C  CG   . LEU A 1 18 ? 0.922   8.611   -6.683  1.00 0.00 ? 325 LEU A CG   6  
ATOM   6170  C  CD1  . LEU A 1 18 ? 1.259   8.701   -5.199  1.00 0.00 ? 325 LEU A CD1  6  
ATOM   6171  C  CD2  . LEU A 1 18 ? 2.119   8.105   -7.471  1.00 0.00 ? 325 LEU A CD2  6  
ATOM   6172  H  H    . LEU A 1 18 ? -1.293  8.636   -4.692  1.00 0.00 ? 325 LEU A H    6  
ATOM   6173  H  HA   . LEU A 1 18 ? -1.800  9.123   -7.505  1.00 0.00 ? 325 LEU A HA   6  
ATOM   6174  H  HB2  . LEU A 1 18 ? -0.227  6.873   -6.213  1.00 0.00 ? 325 LEU A HB2  6  
ATOM   6175  H  HB3  . LEU A 1 18 ? -0.227  7.313   -7.933  1.00 0.00 ? 325 LEU A HB3  6  
ATOM   6176  H  HG   . LEU A 1 18 ? 0.689   9.607   -7.032  1.00 0.00 ? 325 LEU A HG   6  
ATOM   6177  H  HD11 . LEU A 1 18 ? 2.162   9.276   -5.070  1.00 0.00 ? 325 LEU A HD11 6  
ATOM   6178  H  HD12 . LEU A 1 18 ? 1.404   7.706   -4.800  1.00 0.00 ? 325 LEU A HD12 6  
ATOM   6179  H  HD13 . LEU A 1 18 ? 0.450   9.185   -4.674  1.00 0.00 ? 325 LEU A HD13 6  
ATOM   6180  H  HD21 . LEU A 1 18 ? 2.971   8.739   -7.277  1.00 0.00 ? 325 LEU A HD21 6  
ATOM   6181  H  HD22 . LEU A 1 18 ? 1.891   8.123   -8.526  1.00 0.00 ? 325 LEU A HD22 6  
ATOM   6182  H  HD23 . LEU A 1 18 ? 2.346   7.094   -7.168  1.00 0.00 ? 325 LEU A HD23 6  
ATOM   6183  N  N    . THR A 1 19 ? -3.314  7.190   -8.096  1.00 0.00 ? 326 THR A N    6  
ATOM   6184  C  CA   . THR A 1 19 ? -4.399  6.253   -8.318  1.00 0.00 ? 326 THR A CA   6  
ATOM   6185  C  C    . THR A 1 19 ? -3.873  4.848   -8.590  1.00 0.00 ? 326 THR A C    6  
ATOM   6186  O  O    . THR A 1 19 ? -2.931  4.652   -9.356  1.00 0.00 ? 326 THR A O    6  
ATOM   6187  C  CB   . THR A 1 19 ? -5.316  6.693   -9.475  1.00 0.00 ? 326 THR A CB   6  
ATOM   6188  O  OG1  . THR A 1 19 ? -5.735  8.049   -9.270  1.00 0.00 ? 326 THR A OG1  6  
ATOM   6189  C  CG2  . THR A 1 19 ? -6.539  5.781   -9.574  1.00 0.00 ? 326 THR A CG2  6  
ATOM   6190  H  H    . THR A 1 19 ? -2.976  7.726   -8.843  1.00 0.00 ? 326 THR A H    6  
ATOM   6191  H  HA   . THR A 1 19 ? -4.991  6.225   -7.414  1.00 0.00 ? 326 THR A HA   6  
ATOM   6192  H  HB   . THR A 1 19 ? -4.760  6.629   -10.399 1.00 0.00 ? 326 THR A HB   6  
ATOM   6193  H  HG1  . THR A 1 19 ? -5.308  8.398   -8.480  1.00 0.00 ? 326 THR A HG1  6  
ATOM   6194  H  HG21 . THR A 1 19 ? -7.190  6.133   -10.360 1.00 0.00 ? 326 THR A HG21 6  
ATOM   6195  H  HG22 . THR A 1 19 ? -7.076  5.784   -8.633  1.00 0.00 ? 326 THR A HG22 6  
ATOM   6196  H  HG23 . THR A 1 19 ? -6.222  4.773   -9.797  1.00 0.00 ? 326 THR A HG23 6  
ATOM   6197  N  N    . CYS A 1 20 ? -4.494  3.888   -7.937  1.00 0.00 ? 327 CYS A N    6  
ATOM   6198  C  CA   . CYS A 1 20 ? -4.184  2.486   -8.119  1.00 0.00 ? 327 CYS A CA   6  
ATOM   6199  C  C    . CYS A 1 20 ? -4.864  1.969   -9.385  1.00 0.00 ? 327 CYS A C    6  
ATOM   6200  O  O    . CYS A 1 20 ? -6.060  2.179   -9.570  1.00 0.00 ? 327 CYS A O    6  
ATOM   6201  C  CB   . CYS A 1 20 ? -4.671  1.735   -6.878  1.00 0.00 ? 327 CYS A CB   6  
ATOM   6202  S  SG   . CYS A 1 20 ? -4.697  -0.068  -6.998  1.00 0.00 ? 327 CYS A SG   6  
ATOM   6203  H  H    . CYS A 1 20 ? -5.201  4.133   -7.306  1.00 0.00 ? 327 CYS A H    6  
ATOM   6204  H  HA   . CYS A 1 20 ? -3.115  2.378   -8.212  1.00 0.00 ? 327 CYS A HA   6  
ATOM   6205  H  HB2  . CYS A 1 20 ? -4.033  1.987   -6.048  1.00 0.00 ? 327 CYS A HB2  6  
ATOM   6206  H  HB3  . CYS A 1 20 ? -5.678  2.060   -6.655  1.00 0.00 ? 327 CYS A HB3  6  
ATOM   6207  N  N    . TYR A 1 21 ? -4.107  1.315   -10.262 1.00 0.00 ? 328 TYR A N    6  
ATOM   6208  C  CA   . TYR A 1 21 ? -4.672  0.830   -11.517 1.00 0.00 ? 328 TYR A CA   6  
ATOM   6209  C  C    . TYR A 1 21 ? -5.632  -0.334  -11.277 1.00 0.00 ? 328 TYR A C    6  
ATOM   6210  O  O    . TYR A 1 21 ? -6.650  -0.461  -11.957 1.00 0.00 ? 328 TYR A O    6  
ATOM   6211  C  CB   . TYR A 1 21 ? -3.574  0.454   -12.528 1.00 0.00 ? 328 TYR A CB   6  
ATOM   6212  C  CG   . TYR A 1 21 ? -2.615  -0.627  -12.078 1.00 0.00 ? 328 TYR A CG   6  
ATOM   6213  C  CD1  . TYR A 1 21 ? -1.446  -0.311  -11.394 1.00 0.00 ? 328 TYR A CD1  6  
ATOM   6214  C  CD2  . TYR A 1 21 ? -2.869  -1.963  -12.356 1.00 0.00 ? 328 TYR A CD2  6  
ATOM   6215  C  CE1  . TYR A 1 21 ? -0.558  -1.296  -11.008 1.00 0.00 ? 328 TYR A CE1  6  
ATOM   6216  C  CE2  . TYR A 1 21 ? -1.989  -2.952  -11.968 1.00 0.00 ? 328 TYR A CE2  6  
ATOM   6217  C  CZ   . TYR A 1 21 ? -0.835  -2.613  -11.294 1.00 0.00 ? 328 TYR A CZ   6  
ATOM   6218  O  OH   . TYR A 1 21 ? 0.045   -3.599  -10.914 1.00 0.00 ? 328 TYR A OH   6  
ATOM   6219  H  H    . TYR A 1 21 ? -3.156  1.172   -10.068 1.00 0.00 ? 328 TYR A H    6  
ATOM   6220  H  HA   . TYR A 1 21 ? -5.246  1.647   -11.934 1.00 0.00 ? 328 TYR A HA   6  
ATOM   6221  H  HB2  . TYR A 1 21 ? -4.043  0.107   -13.436 1.00 0.00 ? 328 TYR A HB2  6  
ATOM   6222  H  HB3  . TYR A 1 21 ? -2.993  1.337   -12.752 1.00 0.00 ? 328 TYR A HB3  6  
ATOM   6223  H  HD1  . TYR A 1 21 ? -1.235  0.723   -11.169 1.00 0.00 ? 328 TYR A HD1  6  
ATOM   6224  H  HD2  . TYR A 1 21 ? -3.773  -2.224  -12.885 1.00 0.00 ? 328 TYR A HD2  6  
ATOM   6225  H  HE1  . TYR A 1 21 ? 0.346   -1.029  -10.478 1.00 0.00 ? 328 TYR A HE1  6  
ATOM   6226  H  HE2  . TYR A 1 21 ? -2.206  -3.986  -12.193 1.00 0.00 ? 328 TYR A HE2  6  
ATOM   6227  H  HH   . TYR A 1 21 ? -0.037  -4.349  -11.536 1.00 0.00 ? 328 TYR A HH   6  
ATOM   6228  N  N    . LEU A 1 22 ? -5.314  -1.186  -10.304 1.00 0.00 ? 329 LEU A N    6  
ATOM   6229  C  CA   . LEU A 1 22 ? -6.240  -2.222  -9.867  1.00 0.00 ? 329 LEU A CA   6  
ATOM   6230  C  C    . LEU A 1 22 ? -7.223  -1.618  -8.875  1.00 0.00 ? 329 LEU A C    6  
ATOM   6231  O  O    . LEU A 1 22 ? -6.895  -1.464  -7.692  1.00 0.00 ? 329 LEU A O    6  
ATOM   6232  C  CB   . LEU A 1 22 ? -5.497  -3.396  -9.224  1.00 0.00 ? 329 LEU A CB   6  
ATOM   6233  C  CG   . LEU A 1 22 ? -4.594  -4.200  -10.160 1.00 0.00 ? 329 LEU A CG   6  
ATOM   6234  C  CD1  . LEU A 1 22 ? -3.836  -5.265  -9.377  1.00 0.00 ? 329 LEU A CD1  6  
ATOM   6235  C  CD2  . LEU A 1 22 ? -5.409  -4.837  -11.278 1.00 0.00 ? 329 LEU A CD2  6  
ATOM   6236  H  H    . LEU A 1 22 ? -4.436  -1.116  -9.880  1.00 0.00 ? 329 LEU A H    6  
ATOM   6237  H  HA   . LEU A 1 22 ? -6.786  -2.570  -10.733 1.00 0.00 ? 329 LEU A HA   6  
ATOM   6238  H  HB2  . LEU A 1 22 ? -4.886  -3.007  -8.422  1.00 0.00 ? 329 LEU A HB2  6  
ATOM   6239  H  HB3  . LEU A 1 22 ? -6.226  -4.068  -8.804  1.00 0.00 ? 329 LEU A HB3  6  
ATOM   6240  H  HG   . LEU A 1 22 ? -3.869  -3.535  -10.608 1.00 0.00 ? 329 LEU A HG   6  
ATOM   6241  H  HD11 . LEU A 1 22 ? -3.221  -5.839  -10.054 1.00 0.00 ? 329 LEU A HD11 6  
ATOM   6242  H  HD12 . LEU A 1 22 ? -4.540  -5.920  -8.887  1.00 0.00 ? 329 LEU A HD12 6  
ATOM   6243  H  HD13 . LEU A 1 22 ? -3.210  -4.790  -8.636  1.00 0.00 ? 329 LEU A HD13 6  
ATOM   6244  H  HD21 . LEU A 1 22 ? -6.168  -5.474  -10.851 1.00 0.00 ? 329 LEU A HD21 6  
ATOM   6245  H  HD22 . LEU A 1 22 ? -4.759  -5.425  -11.911 1.00 0.00 ? 329 LEU A HD22 6  
ATOM   6246  H  HD23 . LEU A 1 22 ? -5.879  -4.064  -11.867 1.00 0.00 ? 329 LEU A HD23 6  
ATOM   6247  N  N    . CYS A 1 23 ? -8.407  -1.281  -9.375  1.00 0.00 ? 330 CYS A N    6  
ATOM   6248  C  CA   . CYS A 1 23 ? -9.412  -0.473  -8.672  1.00 0.00 ? 330 CYS A CA   6  
ATOM   6249  C  C    . CYS A 1 23 ? -8.917  0.973   -8.547  1.00 0.00 ? 330 CYS A C    6  
ATOM   6250  O  O    . CYS A 1 23 ? -7.951  1.262   -7.832  1.00 0.00 ? 330 CYS A O    6  
ATOM   6251  C  CB   . CYS A 1 23 ? -9.836  -1.073  -7.310  1.00 0.00 ? 330 CYS A CB   6  
ATOM   6252  S  SG   . CYS A 1 23 ? -8.716  -0.774  -5.913  1.00 0.00 ? 330 CYS A SG   6  
ATOM   6253  H  H    . CYS A 1 23 ? -8.625  -1.589  -10.284 1.00 0.00 ? 330 CYS A H    6  
ATOM   6254  H  HA   . CYS A 1 23 ? -10.283 -0.454  -9.313  1.00 0.00 ? 330 CYS A HA   6  
ATOM   6255  H  HB2  . CYS A 1 23 ? -10.798 -0.662  -7.035  1.00 0.00 ? 330 CYS A HB2  6  
ATOM   6256  H  HB3  . CYS A 1 23 ? -9.938  -2.144  -7.423  1.00 0.00 ? 330 CYS A HB3  6  
ATOM   6257  N  N    . LYS A 1 24 ? -9.627  1.868   -9.239  1.00 0.00 ? 331 LYS A N    6  
ATOM   6258  C  CA   . LYS A 1 24 ? -9.182  3.240   -9.524  1.00 0.00 ? 331 LYS A CA   6  
ATOM   6259  C  C    . LYS A 1 24 ? -9.410  4.170   -8.339  1.00 0.00 ? 331 LYS A C    6  
ATOM   6260  O  O    . LYS A 1 24 ? -9.576  5.379   -8.490  1.00 0.00 ? 331 LYS A O    6  
ATOM   6261  C  CB   . LYS A 1 24 ? -9.961  3.761   -10.732 1.00 0.00 ? 331 LYS A CB   6  
ATOM   6262  C  CG   . LYS A 1 24 ? -11.456 3.896   -10.462 1.00 0.00 ? 331 LYS A CG   6  
ATOM   6263  C  CD   . LYS A 1 24 ? -12.262 4.048   -11.738 1.00 0.00 ? 331 LYS A CD   6  
ATOM   6264  C  CE   . LYS A 1 24 ? -11.840 5.267   -12.538 1.00 0.00 ? 331 LYS A CE   6  
ATOM   6265  N  NZ   . LYS A 1 24 ? -12.610 5.380   -13.806 1.00 0.00 ? 331 LYS A NZ   6  
ATOM   6266  H  H    . LYS A 1 24 ? -10.507 1.600   -9.556  1.00 0.00 ? 331 LYS A H    6  
ATOM   6267  H  HA   . LYS A 1 24 ? -8.130  3.217   -9.763  1.00 0.00 ? 331 LYS A HA   6  
ATOM   6268  H  HB2  . LYS A 1 24 ? -9.573  4.730   -11.008 1.00 0.00 ? 331 LYS A HB2  6  
ATOM   6269  H  HB3  . LYS A 1 24 ? -9.824  3.078   -11.557 1.00 0.00 ? 331 LYS A HB3  6  
ATOM   6270  H  HG2  . LYS A 1 24 ? -11.797 3.014   -9.941  1.00 0.00 ? 331 LYS A HG2  6  
ATOM   6271  H  HG3  . LYS A 1 24 ? -11.620 4.763   -9.838  1.00 0.00 ? 331 LYS A HG3  6  
ATOM   6272  H  HD2  . LYS A 1 24 ? -12.118 3.170   -12.345 1.00 0.00 ? 331 LYS A HD2  6  
ATOM   6273  H  HD3  . LYS A 1 24 ? -13.308 4.141   -11.482 1.00 0.00 ? 331 LYS A HD3  6  
ATOM   6274  H  HE2  . LYS A 1 24 ? -12.011 6.151   -11.943 1.00 0.00 ? 331 LYS A HE2  6  
ATOM   6275  H  HE3  . LYS A 1 24 ? -10.790 5.183   -12.770 1.00 0.00 ? 331 LYS A HE3  6  
ATOM   6276  H  HZ1  . LYS A 1 24 ? -12.192 6.113   -14.415 1.00 0.00 ? 331 LYS A HZ1  6  
ATOM   6277  H  HZ2  . LYS A 1 24 ? -13.600 5.632   -13.607 1.00 0.00 ? 331 LYS A HZ2  6  
ATOM   6278  H  HZ3  . LYS A 1 24 ? -12.594 4.475   -14.317 1.00 0.00 ? 331 LYS A HZ3  6  
ATOM   6279  N  N    . GLN A 1 25 ? -9.358  3.592   -7.170  1.00 0.00 ? 332 GLN A N    6  
ATOM   6280  C  CA   . GLN A 1 25 ? -9.695  4.284   -5.942  1.00 0.00 ? 332 GLN A CA   6  
ATOM   6281  C  C    . GLN A 1 25 ? -8.461  4.908   -5.309  1.00 0.00 ? 332 GLN A C    6  
ATOM   6282  O  O    . GLN A 1 25 ? -7.717  4.253   -4.573  1.00 0.00 ? 332 GLN A O    6  
ATOM   6283  C  CB   . GLN A 1 25 ? -10.352 3.312   -4.967  1.00 0.00 ? 332 GLN A CB   6  
ATOM   6284  C  CG   . GLN A 1 25 ? -11.697 2.793   -5.446  1.00 0.00 ? 332 GLN A CG   6  
ATOM   6285  C  CD   . GLN A 1 25 ? -12.017 1.426   -4.886  1.00 0.00 ? 332 GLN A CD   6  
ATOM   6286  O  OE1  . GLN A 1 25 ? -11.716 0.411   -5.504  1.00 0.00 ? 332 GLN A OE1  6  
ATOM   6287  N  NE2  . GLN A 1 25 ? -12.611 1.388   -3.712  1.00 0.00 ? 332 GLN A NE2  6  
ATOM   6288  H  H    . GLN A 1 25 ? -9.059  2.671   -7.133  1.00 0.00 ? 332 GLN A H    6  
ATOM   6289  H  HA   . GLN A 1 25 ? -10.397 5.066   -6.183  1.00 0.00 ? 332 GLN A HA   6  
ATOM   6290  H  HB2  . GLN A 1 25 ? -9.693  2.469   -4.818  1.00 0.00 ? 332 GLN A HB2  6  
ATOM   6291  H  HB3  . GLN A 1 25 ? -10.498 3.814   -4.023  1.00 0.00 ? 332 GLN A HB3  6  
ATOM   6292  H  HG2  . GLN A 1 25 ? -12.469 3.483   -5.136  1.00 0.00 ? 332 GLN A HG2  6  
ATOM   6293  H  HG3  . GLN A 1 25 ? -11.682 2.727   -6.524  1.00 0.00 ? 332 GLN A HG3  6  
ATOM   6294  H  HE21 . GLN A 1 25 ? -12.816 2.236   -3.268  1.00 0.00 ? 332 GLN A HE21 6  
ATOM   6295  H  HE22 . GLN A 1 25 ? -12.817 0.512   -3.331  1.00 0.00 ? 332 GLN A HE22 6  
ATOM   6296  N  N    . LYS A 1 26 ? -8.229  6.163   -5.633  1.00 0.00 ? 333 LYS A N    6  
ATOM   6297  C  CA   . LYS A 1 26 ? -7.142  6.915   -5.028  1.00 0.00 ? 333 LYS A CA   6  
ATOM   6298  C  C    . LYS A 1 26 ? -7.548  7.414   -3.643  1.00 0.00 ? 333 LYS A C    6  
ATOM   6299  O  O    . LYS A 1 26 ? -8.559  8.102   -3.485  1.00 0.00 ? 333 LYS A O    6  
ATOM   6300  C  CB   . LYS A 1 26 ? -6.688  8.091   -5.917  1.00 0.00 ? 333 LYS A CB   6  
ATOM   6301  C  CG   . LYS A 1 26 ? -7.761  9.132   -6.230  1.00 0.00 ? 333 LYS A CG   6  
ATOM   6302  C  CD   . LYS A 1 26 ? -8.590  8.750   -7.445  1.00 0.00 ? 333 LYS A CD   6  
ATOM   6303  C  CE   . LYS A 1 26 ? -9.587  9.841   -7.801  1.00 0.00 ? 333 LYS A CE   6  
ATOM   6304  N  NZ   . LYS A 1 26 ? -10.426 9.459   -8.967  1.00 0.00 ? 333 LYS A NZ   6  
ATOM   6305  H  H    . LYS A 1 26 ? -8.805  6.590   -6.298  1.00 0.00 ? 333 LYS A H    6  
ATOM   6306  H  HA   . LYS A 1 26 ? -6.312  6.233   -4.911  1.00 0.00 ? 333 LYS A HA   6  
ATOM   6307  H  HB2  . LYS A 1 26 ? -5.873  8.596   -5.422  1.00 0.00 ? 333 LYS A HB2  6  
ATOM   6308  H  HB3  . LYS A 1 26 ? -6.329  7.691   -6.853  1.00 0.00 ? 333 LYS A HB3  6  
ATOM   6309  H  HG2  . LYS A 1 26 ? -8.417  9.223   -5.377  1.00 0.00 ? 333 LYS A HG2  6  
ATOM   6310  H  HG3  . LYS A 1 26 ? -7.280  10.083  -6.416  1.00 0.00 ? 333 LYS A HG3  6  
ATOM   6311  H  HD2  . LYS A 1 26 ? -7.929  8.591   -8.284  1.00 0.00 ? 333 LYS A HD2  6  
ATOM   6312  H  HD3  . LYS A 1 26 ? -9.127  7.842   -7.232  1.00 0.00 ? 333 LYS A HD3  6  
ATOM   6313  H  HE2  . LYS A 1 26 ? -10.228 10.017  -6.950  1.00 0.00 ? 333 LYS A HE2  6  
ATOM   6314  H  HE3  . LYS A 1 26 ? -9.045  10.745  -8.036  1.00 0.00 ? 333 LYS A HE3  6  
ATOM   6315  H  HZ1  . LYS A 1 26 ? -10.992 8.614   -8.742  1.00 0.00 ? 333 LYS A HZ1  6  
ATOM   6316  H  HZ2  . LYS A 1 26 ? -9.823  9.248   -9.788  1.00 0.00 ? 333 LYS A HZ2  6  
ATOM   6317  H  HZ3  . LYS A 1 26 ? -11.071 10.234  -9.218  1.00 0.00 ? 333 LYS A HZ3  6  
ATOM   6318  N  N    . GLY A 1 27 ? -6.764  7.037   -2.640  1.00 0.00 ? 334 GLY A N    6  
ATOM   6319  C  CA   . GLY A 1 27 ? -7.030  7.464   -1.280  1.00 0.00 ? 334 GLY A CA   6  
ATOM   6320  C  C    . GLY A 1 27 ? -8.158  6.690   -0.624  1.00 0.00 ? 334 GLY A C    6  
ATOM   6321  O  O    . GLY A 1 27 ? -9.270  7.197   -0.496  1.00 0.00 ? 334 GLY A O    6  
ATOM   6322  H  H    . GLY A 1 27 ? -5.994  6.468   -2.829  1.00 0.00 ? 334 GLY A H    6  
ATOM   6323  H  HA2  . GLY A 1 27 ? -6.132  7.333   -0.692  1.00 0.00 ? 334 GLY A HA2  6  
ATOM   6324  H  HA3  . GLY A 1 27 ? -7.287  8.512   -1.290  1.00 0.00 ? 334 GLY A HA3  6  
ATOM   6325  N  N    . VAL A 1 28 ? -7.875  5.462   -0.200  1.00 0.00 ? 335 VAL A N    6  
ATOM   6326  C  CA   . VAL A 1 28 ? -8.866  4.641   0.493   1.00 0.00 ? 335 VAL A CA   6  
ATOM   6327  C  C    . VAL A 1 28 ? -8.231  3.864   1.646   1.00 0.00 ? 335 VAL A C    6  
ATOM   6328  O  O    . VAL A 1 28 ? -8.783  3.810   2.743   1.00 0.00 ? 335 VAL A O    6  
ATOM   6329  C  CB   . VAL A 1 28 ? -9.590  3.653   -0.456  1.00 0.00 ? 335 VAL A CB   6  
ATOM   6330  C  CG1  . VAL A 1 28 ? -10.572 4.385   -1.355  1.00 0.00 ? 335 VAL A CG1  6  
ATOM   6331  C  CG2  . VAL A 1 28 ? -8.595  2.863   -1.296  1.00 0.00 ? 335 VAL A CG2  6  
ATOM   6332  H  H    . VAL A 1 28 ? -6.977  5.109   -0.337  1.00 0.00 ? 335 VAL A H    6  
ATOM   6333  H  HA   . VAL A 1 28 ? -9.610  5.311   0.905   1.00 0.00 ? 335 VAL A HA   6  
ATOM   6334  H  HB   . VAL A 1 28 ? -10.148 2.953   0.150   1.00 0.00 ? 335 VAL A HB   6  
ATOM   6335  H  HG11 . VAL A 1 28 ? -11.285 4.923   -0.749  1.00 0.00 ? 335 VAL A HG11 6  
ATOM   6336  H  HG12 . VAL A 1 28 ? -11.094 3.670   -1.974  1.00 0.00 ? 335 VAL A HG12 6  
ATOM   6337  H  HG13 . VAL A 1 28 ? -10.036 5.080   -1.983  1.00 0.00 ? 335 VAL A HG13 6  
ATOM   6338  H  HG21 . VAL A 1 28 ? -8.006  3.544   -1.891  1.00 0.00 ? 335 VAL A HG21 6  
ATOM   6339  H  HG22 . VAL A 1 28 ? -9.133  2.191   -1.947  1.00 0.00 ? 335 VAL A HG22 6  
ATOM   6340  H  HG23 . VAL A 1 28 ? -7.944  2.295   -0.649  1.00 0.00 ? 335 VAL A HG23 6  
ATOM   6341  N  N    . GLY A 1 29 ? -7.068  3.267   1.396   1.00 0.00 ? 336 GLY A N    6  
ATOM   6342  C  CA   . GLY A 1 29 ? -6.387  2.515   2.428   1.00 0.00 ? 336 GLY A CA   6  
ATOM   6343  C  C    . GLY A 1 29 ? -4.889  2.728   2.386   1.00 0.00 ? 336 GLY A C    6  
ATOM   6344  O  O    . GLY A 1 29 ? -4.369  3.659   3.002   1.00 0.00 ? 336 GLY A O    6  
ATOM   6345  H  H    . GLY A 1 29 ? -6.675  3.332   0.506   1.00 0.00 ? 336 GLY A H    6  
ATOM   6346  H  HA2  . GLY A 1 29 ? -6.761  2.840   3.400   1.00 0.00 ? 336 GLY A HA2  6  
ATOM   6347  H  HA3  . GLY A 1 29 ? -6.597  1.454   2.285   1.00 0.00 ? 336 GLY A HA3  6  
ATOM   6348  N  N    . ALA A 1 30 ? -4.193  1.881   1.641   1.00 0.00 ? 337 ALA A N    6  
ATOM   6349  C  CA   . ALA A 1 30 ? -2.746  1.971   1.537   1.00 0.00 ? 337 ALA A CA   6  
ATOM   6350  C  C    . ALA A 1 30 ? -2.300  1.655   0.119   1.00 0.00 ? 337 ALA A C    6  
ATOM   6351  O  O    . ALA A 1 30 ? -2.880  0.791   -0.543  1.00 0.00 ? 337 ALA A O    6  
ATOM   6352  C  CB   . ALA A 1 30 ? -2.079  1.031   2.530   1.00 0.00 ? 337 ALA A CB   6  
ATOM   6353  H  H    . ALA A 1 30 ? -4.663  1.181   1.136   1.00 0.00 ? 337 ALA A H    6  
ATOM   6354  H  HA   . ALA A 1 30 ? -2.454  2.985   1.781   1.00 0.00 ? 337 ALA A HA   6  
ATOM   6355  H  HB1  . ALA A 1 30 ? -2.350  0.012   2.301   1.00 0.00 ? 337 ALA A HB1  6  
ATOM   6356  H  HB2  . ALA A 1 30 ? -2.404  1.274   3.533   1.00 0.00 ? 337 ALA A HB2  6  
ATOM   6357  H  HB3  . ALA A 1 30 ? -1.006  1.141   2.466   1.00 0.00 ? 337 ALA A HB3  6  
ATOM   6358  N  N    . SER A 1 31 ? -1.281  2.358   -0.347  1.00 0.00 ? 338 SER A N    6  
ATOM   6359  C  CA   . SER A 1 31 ? -0.787  2.164   -1.695  1.00 0.00 ? 338 SER A CA   6  
ATOM   6360  C  C    . SER A 1 31 ? 0.736   2.073   -1.694  1.00 0.00 ? 338 SER A C    6  
ATOM   6361  O  O    . SER A 1 31 ? 1.417   2.881   -1.062  1.00 0.00 ? 338 SER A O    6  
ATOM   6362  C  CB   . SER A 1 31 ? -1.264  3.303   -2.605  1.00 0.00 ? 338 SER A CB   6  
ATOM   6363  O  OG   . SER A 1 31 ? -2.653  3.557   -2.424  1.00 0.00 ? 338 SER A OG   6  
ATOM   6364  H  H    . SER A 1 31 ? -0.845  3.018   0.234   1.00 0.00 ? 338 SER A H    6  
ATOM   6365  H  HA   . SER A 1 31 ? -1.189  1.232   -2.062  1.00 0.00 ? 338 SER A HA   6  
ATOM   6366  H  HB2  . SER A 1 31 ? -0.711  4.204   -2.382  1.00 0.00 ? 338 SER A HB2  6  
ATOM   6367  H  HB3  . SER A 1 31 ? -1.100  3.026   -3.635  1.00 0.00 ? 338 SER A HB3  6  
ATOM   6368  H  HG   . SER A 1 31 ? -2.765  4.428   -2.034  1.00 0.00 ? 338 SER A HG   6  
ATOM   6369  N  N    . ILE A 1 32 ? 1.254   1.069   -2.380  1.00 0.00 ? 339 ILE A N    6  
ATOM   6370  C  CA   . ILE A 1 32 ? 2.688   0.865   -2.499  1.00 0.00 ? 339 ILE A CA   6  
ATOM   6371  C  C    . ILE A 1 32 ? 3.108   1.170   -3.933  1.00 0.00 ? 339 ILE A C    6  
ATOM   6372  O  O    . ILE A 1 32 ? 2.292   1.070   -4.853  1.00 0.00 ? 339 ILE A O    6  
ATOM   6373  C  CB   . ILE A 1 32 ? 3.080   -0.583  -2.106  1.00 0.00 ? 339 ILE A CB   6  
ATOM   6374  C  CG1  . ILE A 1 32 ? 4.602   -0.766  -2.128  1.00 0.00 ? 339 ILE A CG1  6  
ATOM   6375  C  CG2  . ILE A 1 32 ? 2.398   -1.593  -3.021  1.00 0.00 ? 339 ILE A CG2  6  
ATOM   6376  C  CD1  . ILE A 1 32 ? 5.057   -2.131  -1.656  1.00 0.00 ? 339 ILE A CD1  6  
ATOM   6377  H  H    . ILE A 1 32 ? 0.649   0.454   -2.853  1.00 0.00 ? 339 ILE A H    6  
ATOM   6378  H  HA   . ILE A 1 32 ? 3.188   1.555   -1.832  1.00 0.00 ? 339 ILE A HA   6  
ATOM   6379  H  HB   . ILE A 1 32 ? 2.723   -0.758  -1.100  1.00 0.00 ? 339 ILE A HB   6  
ATOM   6380  H  HG12 . ILE A 1 32 ? 4.960   -0.636  -3.147  1.00 0.00 ? 339 ILE A HG12 6  
ATOM   6381  H  HG13 . ILE A 1 32 ? 5.058   -0.020  -1.479  1.00 0.00 ? 339 ILE A HG13 6  
ATOM   6382  H  HG21 . ILE A 1 32 ? 1.326   -1.500  -2.926  1.00 0.00 ? 339 ILE A HG21 6  
ATOM   6383  H  HG22 . ILE A 1 32 ? 2.699   -2.592  -2.743  1.00 0.00 ? 339 ILE A HG22 6  
ATOM   6384  H  HG23 . ILE A 1 32 ? 2.686   -1.404  -4.045  1.00 0.00 ? 339 ILE A HG23 6  
ATOM   6385  H  HD11 . ILE A 1 32 ? 4.750   -2.280  -0.631  1.00 0.00 ? 339 ILE A HD11 6  
ATOM   6386  H  HD12 . ILE A 1 32 ? 6.134   -2.194  -1.721  1.00 0.00 ? 339 ILE A HD12 6  
ATOM   6387  H  HD13 . ILE A 1 32 ? 4.615   -2.894  -2.279  1.00 0.00 ? 339 ILE A HD13 6  
ATOM   6388  N  N    . GLN A 1 33 ? 4.357   1.561   -4.131  1.00 0.00 ? 340 GLN A N    6  
ATOM   6389  C  CA   . GLN A 1 33 ? 4.791   2.002   -5.440  1.00 0.00 ? 340 GLN A CA   6  
ATOM   6390  C  C    . GLN A 1 33 ? 5.863   1.083   -6.017  1.00 0.00 ? 340 GLN A C    6  
ATOM   6391  O  O    . GLN A 1 33 ? 6.865   0.773   -5.363  1.00 0.00 ? 340 GLN A O    6  
ATOM   6392  C  CB   . GLN A 1 33 ? 5.297   3.443   -5.368  1.00 0.00 ? 340 GLN A CB   6  
ATOM   6393  C  CG   . GLN A 1 33 ? 4.838   4.292   -6.540  1.00 0.00 ? 340 GLN A CG   6  
ATOM   6394  C  CD   . GLN A 1 33 ? 5.208   5.729   -6.414  1.00 0.00 ? 340 GLN A CD   6  
ATOM   6395  O  OE1  . GLN A 1 33 ? 5.468   6.243   -5.325  1.00 0.00 ? 340 GLN A OE1  6  
ATOM   6396  N  NE2  . GLN A 1 33 ? 5.140   6.408   -7.523  1.00 0.00 ? 340 GLN A NE2  6  
ATOM   6397  H  H    . GLN A 1 33 ? 4.995   1.544   -3.394  1.00 0.00 ? 340 GLN A H    6  
ATOM   6398  H  HA   . GLN A 1 33 ? 3.931   1.974   -6.090  1.00 0.00 ? 340 GLN A HA   6  
ATOM   6399  H  HB2  . GLN A 1 33 ? 4.934   3.895   -4.456  1.00 0.00 ? 340 GLN A HB2  6  
ATOM   6400  H  HB3  . GLN A 1 33 ? 6.377   3.436   -5.354  1.00 0.00 ? 340 GLN A HB3  6  
ATOM   6401  H  HG2  . GLN A 1 33 ? 5.292   3.907   -7.450  1.00 0.00 ? 340 GLN A HG2  6  
ATOM   6402  H  HG3  . GLN A 1 33 ? 3.761   4.250   -6.623  1.00 0.00 ? 340 GLN A HG3  6  
ATOM   6403  H  HE21 . GLN A 1 33 ? 4.876   5.938   -8.344  1.00 0.00 ? 340 GLN A HE21 6  
ATOM   6404  H  HE22 . GLN A 1 33 ? 5.305   7.343   -7.477  1.00 0.00 ? 340 GLN A HE22 6  
ATOM   6405  N  N    . CYS A 1 34 ? 5.612   0.631   -7.236  1.00 0.00 ? 341 CYS A N    6  
ATOM   6406  C  CA   . CYS A 1 34 ? 6.575   -0.140  -8.008  1.00 0.00 ? 341 CYS A CA   6  
ATOM   6407  C  C    . CYS A 1 34 ? 7.811   0.696   -8.283  1.00 0.00 ? 341 CYS A C    6  
ATOM   6408  O  O    . CYS A 1 34 ? 7.739   1.922   -8.344  1.00 0.00 ? 341 CYS A O    6  
ATOM   6409  C  CB   . CYS A 1 34 ? 5.944   -0.586  -9.335  1.00 0.00 ? 341 CYS A CB   6  
ATOM   6410  S  SG   . CYS A 1 34 ? 7.116   -1.177  -10.596 1.00 0.00 ? 341 CYS A SG   6  
ATOM   6411  H  H    . CYS A 1 34 ? 4.737   0.834   -7.634  1.00 0.00 ? 341 CYS A H    6  
ATOM   6412  H  HA   . CYS A 1 34 ? 6.853   -1.010  -7.434  1.00 0.00 ? 341 CYS A HA   6  
ATOM   6413  H  HB2  . CYS A 1 34 ? 5.252   -1.390  -9.139  1.00 0.00 ? 341 CYS A HB2  6  
ATOM   6414  H  HB3  . CYS A 1 34 ? 5.403   0.247   -9.759  1.00 0.00 ? 341 CYS A HB3  6  
ATOM   6415  N  N    . HIS A 1 35 ? 8.932   0.027   -8.465  1.00 0.00 ? 342 HIS A N    6  
ATOM   6416  C  CA   . HIS A 1 35 ? 10.180  0.707   -8.747  1.00 0.00 ? 342 HIS A CA   6  
ATOM   6417  C  C    . HIS A 1 35 ? 10.949  -0.076  -9.815  1.00 0.00 ? 342 HIS A C    6  
ATOM   6418  O  O    . HIS A 1 35 ? 10.360  -0.916  -10.500 1.00 0.00 ? 342 HIS A O    6  
ATOM   6419  C  CB   . HIS A 1 35 ? 11.007  0.875   -7.452  1.00 0.00 ? 342 HIS A CB   6  
ATOM   6420  C  CG   . HIS A 1 35 ? 11.754  -0.355  -7.036  1.00 0.00 ? 342 HIS A CG   6  
ATOM   6421  N  ND1  . HIS A 1 35 ? 11.194  -1.608  -7.042  1.00 0.00 ? 342 HIS A ND1  6  
ATOM   6422  C  CD2  . HIS A 1 35 ? 13.053  -0.528  -6.692  1.00 0.00 ? 342 HIS A CD2  6  
ATOM   6423  C  CE1  . HIS A 1 35 ? 12.112  -2.492  -6.739  1.00 0.00 ? 342 HIS A CE1  6  
ATOM   6424  N  NE2  . HIS A 1 35 ? 13.250  -1.869  -6.518  1.00 0.00 ? 342 HIS A NE2  6  
ATOM   6425  H  H    . HIS A 1 35 ? 8.913   -0.952  -8.436  1.00 0.00 ? 342 HIS A H    6  
ATOM   6426  H  HA   . HIS A 1 35 ? 9.938   1.684   -9.141  1.00 0.00 ? 342 HIS A HA   6  
ATOM   6427  H  HB2  . HIS A 1 35 ? 11.740  1.668   -7.604  1.00 0.00 ? 342 HIS A HB2  6  
ATOM   6428  H  HB3  . HIS A 1 35 ? 10.330  1.147   -6.638  1.00 0.00 ? 342 HIS A HB3  6  
ATOM   6429  H  HD1  . HIS A 1 35 ? 10.247  -1.816  -7.204  1.00 0.00 ? 342 HIS A HD1  6  
ATOM   6430  H  HD2  . HIS A 1 35 ? 13.793  0.248   -6.567  1.00 0.00 ? 342 HIS A HD2  6  
ATOM   6431  H  HE1  . HIS A 1 35 ? 11.970  -3.550  -6.721  1.00 0.00 ? 342 HIS A HE1  6  
ATOM   6432  H  HE2  . HIS A 1 35 ? 14.130  -2.310  -6.473  1.00 0.00 ? 342 HIS A HE2  6  
ATOM   6433  N  N    . LYS A 1 36 ? 12.255  0.190   -9.897  1.00 0.00 ? 343 LYS A N    6  
ATOM   6434  C  CA   . LYS A 1 36 ? 13.178  -0.368  -10.900 1.00 0.00 ? 343 LYS A CA   6  
ATOM   6435  C  C    . LYS A 1 36 ? 14.225  0.687   -11.232 1.00 0.00 ? 343 LYS A C    6  
ATOM   6436  O  O    . LYS A 1 36 ? 15.364  0.613   -10.773 1.00 0.00 ? 343 LYS A O    6  
ATOM   6437  C  CB   . LYS A 1 36 ? 12.477  -0.798  -12.200 1.00 0.00 ? 343 LYS A CB   6  
ATOM   6438  C  CG   . LYS A 1 36 ? 13.396  -1.478  -13.203 1.00 0.00 ? 343 LYS A CG   6  
ATOM   6439  C  CD   . LYS A 1 36 ? 13.972  -2.771  -12.646 1.00 0.00 ? 343 LYS A CD   6  
ATOM   6440  C  CE   . LYS A 1 36 ? 14.910  -3.428  -13.646 1.00 0.00 ? 343 LYS A CE   6  
ATOM   6441  N  NZ   . LYS A 1 36 ? 15.549  -4.651  -13.094 1.00 0.00 ? 343 LYS A NZ   6  
ATOM   6442  H  H    . LYS A 1 36 ? 12.636  0.767   -9.208  1.00 0.00 ? 343 LYS A H    6  
ATOM   6443  H  HA   . LYS A 1 36 ? 13.671  -1.223  -10.456 1.00 0.00 ? 343 LYS A HA   6  
ATOM   6444  H  HB2  . LYS A 1 36 ? 11.681  -1.487  -11.954 1.00 0.00 ? 343 LYS A HB2  6  
ATOM   6445  H  HB3  . LYS A 1 36 ? 12.050  0.075   -12.668 1.00 0.00 ? 343 LYS A HB3  6  
ATOM   6446  H  HG2  . LYS A 1 36 ? 12.824  -1.709  -14.100 1.00 0.00 ? 343 LYS A HG2  6  
ATOM   6447  H  HG3  . LYS A 1 36 ? 14.217  -0.802  -13.444 1.00 0.00 ? 343 LYS A HG3  6  
ATOM   6448  H  HD2  . LYS A 1 36 ? 14.528  -2.545  -11.739 1.00 0.00 ? 343 LYS A HD2  6  
ATOM   6449  H  HD3  . LYS A 1 36 ? 13.151  -3.455  -12.428 1.00 0.00 ? 343 LYS A HD3  6  
ATOM   6450  H  HE2  . LYS A 1 36 ? 14.345  -3.695  -14.526 1.00 0.00 ? 343 LYS A HE2  6  
ATOM   6451  H  HE3  . LYS A 1 36 ? 15.677  -2.719  -13.915 1.00 0.00 ? 343 LYS A HE3  6  
ATOM   6452  H  HZ1  . LYS A 1 36 ? 16.055  -4.427  -12.214 1.00 0.00 ? 343 LYS A HZ1  6  
ATOM   6453  H  HZ2  . LYS A 1 36 ? 16.230  -5.039  -13.779 1.00 0.00 ? 343 LYS A HZ2  6  
ATOM   6454  H  HZ3  . LYS A 1 36 ? 14.831  -5.374  -12.890 1.00 0.00 ? 343 LYS A HZ3  6  
ATOM   6455  N  N    . ALA A 1 37 ? 13.810  1.674   -12.022 1.00 0.00 ? 344 ALA A N    6  
ATOM   6456  C  CA   . ALA A 1 37 ? 14.660  2.803   -12.377 1.00 0.00 ? 344 ALA A CA   6  
ATOM   6457  C  C    . ALA A 1 37 ? 13.824  3.945   -12.952 1.00 0.00 ? 344 ALA A C    6  
ATOM   6458  O  O    . ALA A 1 37 ? 13.886  5.074   -12.474 1.00 0.00 ? 344 ALA A O    6  
ATOM   6459  C  CB   . ALA A 1 37 ? 15.735  2.382   -13.371 1.00 0.00 ? 344 ALA A CB   6  
ATOM   6460  H  H    . ALA A 1 37 ? 12.901  1.640   -12.379 1.00 0.00 ? 344 ALA A H    6  
ATOM   6461  H  HA   . ALA A 1 37 ? 15.149  3.145   -11.477 1.00 0.00 ? 344 ALA A HA   6  
ATOM   6462  H  HB1  . ALA A 1 37 ? 16.306  1.563   -12.959 1.00 0.00 ? 344 ALA A HB1  6  
ATOM   6463  H  HB2  . ALA A 1 37 ? 16.392  3.217   -13.568 1.00 0.00 ? 344 ALA A HB2  6  
ATOM   6464  H  HB3  . ALA A 1 37 ? 15.270  2.067   -14.293 1.00 0.00 ? 344 ALA A HB3  6  
ATOM   6465  N  N    . ASN A 1 38 ? 13.034  3.640   -13.976 1.00 0.00 ? 345 ASN A N    6  
ATOM   6466  C  CA   . ASN A 1 38 ? 12.210  4.651   -14.640 1.00 0.00 ? 345 ASN A CA   6  
ATOM   6467  C  C    . ASN A 1 38 ? 10.730  4.298   -14.553 1.00 0.00 ? 345 ASN A C    6  
ATOM   6468  O  O    . ASN A 1 38 ? 9.931   4.720   -15.385 1.00 0.00 ? 345 ASN A O    6  
ATOM   6469  C  CB   . ASN A 1 38 ? 12.617  4.800   -16.111 1.00 0.00 ? 345 ASN A CB   6  
ATOM   6470  C  CG   . ASN A 1 38 ? 13.967  5.469   -16.290 1.00 0.00 ? 345 ASN A CG   6  
ATOM   6471  O  OD1  . ASN A 1 38 ? 14.063  6.696   -16.339 1.00 0.00 ? 345 ASN A OD1  6  
ATOM   6472  N  ND2  . ASN A 1 38 ? 15.016  4.673   -16.415 1.00 0.00 ? 345 ASN A ND2  6  
ATOM   6473  H  H    . ASN A 1 38 ? 13.008  2.715   -14.303 1.00 0.00 ? 345 ASN A H    6  
ATOM   6474  H  HA   . ASN A 1 38 ? 12.371  5.592   -14.136 1.00 0.00 ? 345 ASN A HA   6  
ATOM   6475  H  HB2  . ASN A 1 38 ? 12.663  3.820   -16.564 1.00 0.00 ? 345 ASN A HB2  6  
ATOM   6476  H  HB3  . ASN A 1 38 ? 11.872  5.391   -16.624 1.00 0.00 ? 345 ASN A HB3  6  
ATOM   6477  H  HD21 . ASN A 1 38 ? 14.872  3.706   -16.388 1.00 0.00 ? 345 ASN A HD21 6  
ATOM   6478  H  HD22 . ASN A 1 38 ? 15.899  5.086   -16.538 1.00 0.00 ? 345 ASN A HD22 6  
ATOM   6479  N  N    . CYS A 1 39 ? 10.363  3.537   -13.534 1.00 0.00 ? 346 CYS A N    6  
ATOM   6480  C  CA   . CYS A 1 39 ? 8.981   3.121   -13.361 1.00 0.00 ? 346 CYS A CA   6  
ATOM   6481  C  C    . CYS A 1 39 ? 8.564   3.222   -11.906 1.00 0.00 ? 346 CYS A C    6  
ATOM   6482  O  O    . CYS A 1 39 ? 9.133   2.554   -11.042 1.00 0.00 ? 346 CYS A O    6  
ATOM   6483  C  CB   . CYS A 1 39 ? 8.787   1.686   -13.856 1.00 0.00 ? 346 CYS A CB   6  
ATOM   6484  S  SG   . CYS A 1 39 ? 7.170   0.967   -13.458 1.00 0.00 ? 346 CYS A SG   6  
ATOM   6485  H  H    . CYS A 1 39 ? 11.032  3.261   -12.876 1.00 0.00 ? 346 CYS A H    6  
ATOM   6486  H  HA   . CYS A 1 39 ? 8.361   3.782   -13.947 1.00 0.00 ? 346 CYS A HA   6  
ATOM   6487  H  HB2  . CYS A 1 39 ? 8.896   1.667   -14.929 1.00 0.00 ? 346 CYS A HB2  6  
ATOM   6488  H  HB3  . CYS A 1 39 ? 9.543   1.060   -13.411 1.00 0.00 ? 346 CYS A HB3  6  
ATOM   6489  N  N    . TYR A 1 40 ? 7.579   4.065   -11.646 1.00 0.00 ? 347 TYR A N    6  
ATOM   6490  C  CA   . TYR A 1 40 ? 6.995   4.186   -10.322 1.00 0.00 ? 347 TYR A CA   6  
ATOM   6491  C  C    . TYR A 1 40 ? 5.484   4.039   -10.411 1.00 0.00 ? 347 TYR A C    6  
ATOM   6492  O  O    . TYR A 1 40 ? 4.761   5.015   -10.618 1.00 0.00 ? 347 TYR A O    6  
ATOM   6493  C  CB   . TYR A 1 40 ? 7.369   5.520   -9.674  1.00 0.00 ? 347 TYR A CB   6  
ATOM   6494  C  CG   . TYR A 1 40 ? 8.824   5.617   -9.281  1.00 0.00 ? 347 TYR A CG   6  
ATOM   6495  C  CD1  . TYR A 1 40 ? 9.402   4.645   -8.480  1.00 0.00 ? 347 TYR A CD1  6  
ATOM   6496  C  CD2  . TYR A 1 40 ? 9.618   6.673   -9.713  1.00 0.00 ? 347 TYR A CD2  6  
ATOM   6497  C  CE1  . TYR A 1 40 ? 10.732  4.718   -8.117  1.00 0.00 ? 347 TYR A CE1  6  
ATOM   6498  C  CE2  . TYR A 1 40 ? 10.949  6.754   -9.355  1.00 0.00 ? 347 TYR A CE2  6  
ATOM   6499  C  CZ   . TYR A 1 40 ? 11.501  5.777   -8.556  1.00 0.00 ? 347 TYR A CZ   6  
ATOM   6500  O  OH   . TYR A 1 40 ? 12.828  5.853   -8.200  1.00 0.00 ? 347 TYR A OH   6  
ATOM   6501  H  H    . TYR A 1 40 ? 7.222   4.619   -12.374 1.00 0.00 ? 347 TYR A H    6  
ATOM   6502  H  HA   . TYR A 1 40 ? 7.384   3.380   -9.716  1.00 0.00 ? 347 TYR A HA   6  
ATOM   6503  H  HB2  . TYR A 1 40 ? 7.159   6.320   -10.367 1.00 0.00 ? 347 TYR A HB2  6  
ATOM   6504  H  HB3  . TYR A 1 40 ? 6.774   5.655   -8.784  1.00 0.00 ? 347 TYR A HB3  6  
ATOM   6505  H  HD1  . TYR A 1 40 ? 8.794   3.816   -8.140  1.00 0.00 ? 347 TYR A HD1  6  
ATOM   6506  H  HD2  . TYR A 1 40 ? 9.182   7.439   -10.336 1.00 0.00 ? 347 TYR A HD2  6  
ATOM   6507  H  HE1  . TYR A 1 40 ? 11.164  3.952   -7.490  1.00 0.00 ? 347 TYR A HE1  6  
ATOM   6508  H  HE2  . TYR A 1 40 ? 11.553  7.582   -9.699  1.00 0.00 ? 347 TYR A HE2  6  
ATOM   6509  H  HH   . TYR A 1 40 ? 12.986  6.687   -7.736  1.00 0.00 ? 347 TYR A HH   6  
ATOM   6510  N  N    . THR A 1 41 ? 5.023   2.807   -10.275 1.00 0.00 ? 348 THR A N    6  
ATOM   6511  C  CA   . THR A 1 41 ? 3.613   2.482   -10.454 1.00 0.00 ? 348 THR A CA   6  
ATOM   6512  C  C    . THR A 1 41 ? 2.915   2.375   -9.105  1.00 0.00 ? 348 THR A C    6  
ATOM   6513  O  O    . THR A 1 41 ? 3.402   1.694   -8.209  1.00 0.00 ? 348 THR A O    6  
ATOM   6514  C  CB   . THR A 1 41 ? 3.452   1.145   -11.202 1.00 0.00 ? 348 THR A CB   6  
ATOM   6515  O  OG1  . THR A 1 41 ? 4.526   0.976   -12.143 1.00 0.00 ? 348 THR A OG1  6  
ATOM   6516  C  CG2  . THR A 1 41 ? 2.120   1.095   -11.935 1.00 0.00 ? 348 THR A CG2  6  
ATOM   6517  H  H    . THR A 1 41 ? 5.649   2.097   -10.031 1.00 0.00 ? 348 THR A H    6  
ATOM   6518  H  HA   . THR A 1 41 ? 3.149   3.265   -11.037 1.00 0.00 ? 348 THR A HA   6  
ATOM   6519  H  HB   . THR A 1 41 ? 3.480   0.340   -10.482 1.00 0.00 ? 348 THR A HB   6  
ATOM   6520  H  HG1  . THR A 1 41 ? 4.525   1.726   -12.760 1.00 0.00 ? 348 THR A HG1  6  
ATOM   6521  H  HG21 . THR A 1 41 ? 2.026   0.150   -12.449 1.00 0.00 ? 348 THR A HG21 6  
ATOM   6522  H  HG22 . THR A 1 41 ? 2.076   1.900   -12.655 1.00 0.00 ? 348 THR A HG22 6  
ATOM   6523  H  HG23 . THR A 1 41 ? 1.314   1.202   -11.225 1.00 0.00 ? 348 THR A HG23 6  
ATOM   6524  N  N    . ALA A 1 42 ? 1.777   3.034   -8.959  1.00 0.00 ? 349 ALA A N    6  
ATOM   6525  C  CA   . ALA A 1 42 ? 1.072   3.039   -7.686  1.00 0.00 ? 349 ALA A CA   6  
ATOM   6526  C  C    . ALA A 1 42 ? -0.091  2.056   -7.684  1.00 0.00 ? 349 ALA A C    6  
ATOM   6527  O  O    . ALA A 1 42 ? -0.904  2.030   -8.611  1.00 0.00 ? 349 ALA A O    6  
ATOM   6528  C  CB   . ALA A 1 42 ? 0.576   4.435   -7.366  1.00 0.00 ? 349 ALA A CB   6  
ATOM   6529  H  H    . ALA A 1 42 ? 1.400   3.521   -9.720  1.00 0.00 ? 349 ALA A H    6  
ATOM   6530  H  HA   . ALA A 1 42 ? 1.773   2.749   -6.919  1.00 0.00 ? 349 ALA A HA   6  
ATOM   6531  H  HB1  . ALA A 1 42 ? -0.139  4.745   -8.114  1.00 0.00 ? 349 ALA A HB1  6  
ATOM   6532  H  HB2  . ALA A 1 42 ? 1.411   5.121   -7.361  1.00 0.00 ? 349 ALA A HB2  6  
ATOM   6533  H  HB3  . ALA A 1 42 ? 0.106   4.436   -6.395  1.00 0.00 ? 349 ALA A HB3  6  
ATOM   6534  N  N    . PHE A 1 43 ? -0.154  1.243   -6.640  1.00 0.00 ? 350 PHE A N    6  
ATOM   6535  C  CA   . PHE A 1 43 ? -1.236  0.288   -6.468  1.00 0.00 ? 350 PHE A CA   6  
ATOM   6536  C  C    . PHE A 1 43 ? -1.408  -0.055  -4.993  1.00 0.00 ? 350 PHE A C    6  
ATOM   6537  O  O    . PHE A 1 43 ? -0.476  0.077   -4.207  1.00 0.00 ? 350 PHE A O    6  
ATOM   6538  C  CB   . PHE A 1 43 ? -0.991  -0.979  -7.302  1.00 0.00 ? 350 PHE A CB   6  
ATOM   6539  C  CG   . PHE A 1 43 ? 0.398   -1.546  -7.188  1.00 0.00 ? 350 PHE A CG   6  
ATOM   6540  C  CD1  . PHE A 1 43 ? 1.439   -1.017  -7.933  1.00 0.00 ? 350 PHE A CD1  6  
ATOM   6541  C  CD2  . PHE A 1 43 ? 0.661   -2.618  -6.353  1.00 0.00 ? 350 PHE A CD2  6  
ATOM   6542  C  CE1  . PHE A 1 43 ? 2.713   -1.541  -7.844  1.00 0.00 ? 350 PHE A CE1  6  
ATOM   6543  C  CE2  . PHE A 1 43 ? 1.934   -3.147  -6.260  1.00 0.00 ? 350 PHE A CE2  6  
ATOM   6544  C  CZ   . PHE A 1 43 ? 2.962   -2.608  -7.009  1.00 0.00 ? 350 PHE A CZ   6  
ATOM   6545  H  H    . PHE A 1 43 ? 0.560   1.282   -5.962  1.00 0.00 ? 350 PHE A H    6  
ATOM   6546  H  HA   . PHE A 1 43 ? -2.144  0.761   -6.817  1.00 0.00 ? 350 PHE A HA   6  
ATOM   6547  H  HB2  . PHE A 1 43 ? -1.683  -1.744  -6.987  1.00 0.00 ? 350 PHE A HB2  6  
ATOM   6548  H  HB3  . PHE A 1 43 ? -1.172  -0.751  -8.342  1.00 0.00 ? 350 PHE A HB3  6  
ATOM   6549  H  HD1  . PHE A 1 43 ? 1.248   -0.177  -8.587  1.00 0.00 ? 350 PHE A HD1  6  
ATOM   6550  H  HD2  . PHE A 1 43 ? -0.141  -3.039  -5.764  1.00 0.00 ? 350 PHE A HD2  6  
ATOM   6551  H  HE1  . PHE A 1 43 ? 3.512   -1.115  -8.429  1.00 0.00 ? 350 PHE A HE1  6  
ATOM   6552  H  HE2  . PHE A 1 43 ? 2.125   -3.984  -5.607  1.00 0.00 ? 350 PHE A HE2  6  
ATOM   6553  H  HZ   . PHE A 1 43 ? 3.959   -3.019  -6.938  1.00 0.00 ? 350 PHE A HZ   6  
ATOM   6554  N  N    . HIS A 1 44 ? -2.605  -0.482  -4.618  1.00 0.00 ? 351 HIS A N    6  
ATOM   6555  C  CA   . HIS A 1 44 ? -2.902  -0.767  -3.219  1.00 0.00 ? 351 HIS A CA   6  
ATOM   6556  C  C    . HIS A 1 44 ? -2.173  -2.016  -2.757  1.00 0.00 ? 351 HIS A C    6  
ATOM   6557  O  O    . HIS A 1 44 ? -1.961  -2.942  -3.541  1.00 0.00 ? 351 HIS A O    6  
ATOM   6558  C  CB   . HIS A 1 44 ? -4.402  -0.956  -2.989  1.00 0.00 ? 351 HIS A CB   6  
ATOM   6559  C  CG   . HIS A 1 44 ? -5.240  0.221   -3.363  1.00 0.00 ? 351 HIS A CG   6  
ATOM   6560  N  ND1  . HIS A 1 44 ? -6.238  0.156   -4.323  1.00 0.00 ? 351 HIS A ND1  6  
ATOM   6561  C  CD2  . HIS A 1 44 ? -5.273  1.482   -2.864  1.00 0.00 ? 351 HIS A CD2  6  
ATOM   6562  C  CE1  . HIS A 1 44 ? -6.850  1.333   -4.386  1.00 0.00 ? 351 HIS A CE1  6  
ATOM   6563  N  NE2  . HIS A 1 44 ? -6.283  2.148   -3.518  1.00 0.00 ? 351 HIS A NE2  6  
ATOM   6564  H  H    . HIS A 1 44 ? -3.293  -0.623  -5.295  1.00 0.00 ? 351 HIS A H    6  
ATOM   6565  H  HA   . HIS A 1 44 ? -2.562  0.070   -2.632  1.00 0.00 ? 351 HIS A HA   6  
ATOM   6566  H  HB2  . HIS A 1 44 ? -4.742  -1.798  -3.570  1.00 0.00 ? 351 HIS A HB2  6  
ATOM   6567  H  HB3  . HIS A 1 44 ? -4.571  -1.159  -1.940  1.00 0.00 ? 351 HIS A HB3  6  
ATOM   6568  H  HD2  . HIS A 1 44 ? -4.622  1.888   -2.096  1.00 0.00 ? 351 HIS A HD2  6  
ATOM   6569  H  HE1  . HIS A 1 44 ? -7.687  1.574   -5.024  1.00 0.00 ? 351 HIS A HE1  6  
ATOM   6570  H  HE2  . HIS A 1 44 ? -6.459  3.116   -3.466  1.00 0.00 ? 351 HIS A HE2  6  
ATOM   6571  N  N    . VAL A 1 45 ? -1.820  -2.044  -1.481  1.00 0.00 ? 352 VAL A N    6  
ATOM   6572  C  CA   . VAL A 1 45 ? -1.140  -3.190  -0.895  1.00 0.00 ? 352 VAL A CA   6  
ATOM   6573  C  C    . VAL A 1 45 ? -2.021  -4.437  -0.992  1.00 0.00 ? 352 VAL A C    6  
ATOM   6574  O  O    . VAL A 1 45 ? -1.537  -5.534  -1.282  1.00 0.00 ? 352 VAL A O    6  
ATOM   6575  C  CB   . VAL A 1 45 ? -0.764  -2.924  0.581   1.00 0.00 ? 352 VAL A CB   6  
ATOM   6576  C  CG1  . VAL A 1 45 ? -0.014  -4.107  1.178   1.00 0.00 ? 352 VAL A CG1  6  
ATOM   6577  C  CG2  . VAL A 1 45 ? 0.061   -1.650  0.698   1.00 0.00 ? 352 VAL A CG2  6  
ATOM   6578  H  H    . VAL A 1 45 ? -2.019  -1.266  -0.913  1.00 0.00 ? 352 VAL A H    6  
ATOM   6579  H  HA   . VAL A 1 45 ? -0.231  -3.359  -1.454  1.00 0.00 ? 352 VAL A HA   6  
ATOM   6580  H  HB   . VAL A 1 45 ? -1.675  -2.786  1.141   1.00 0.00 ? 352 VAL A HB   6  
ATOM   6581  H  HG11 . VAL A 1 45 ? 0.202   -3.910  2.218   1.00 0.00 ? 352 VAL A HG11 6  
ATOM   6582  H  HG12 . VAL A 1 45 ? 0.910   -4.255  0.642   1.00 0.00 ? 352 VAL A HG12 6  
ATOM   6583  H  HG13 . VAL A 1 45 ? -0.621  -4.997  1.099   1.00 0.00 ? 352 VAL A HG13 6  
ATOM   6584  H  HG21 . VAL A 1 45 ? -0.503  -0.818  0.298   1.00 0.00 ? 352 VAL A HG21 6  
ATOM   6585  H  HG22 . VAL A 1 45 ? 0.978   -1.762  0.140   1.00 0.00 ? 352 VAL A HG22 6  
ATOM   6586  H  HG23 . VAL A 1 45 ? 0.290   -1.461  1.736   1.00 0.00 ? 352 VAL A HG23 6  
ATOM   6587  N  N    . THR A 1 46 ? -3.321  -4.256  -0.783  1.00 0.00 ? 353 THR A N    6  
ATOM   6588  C  CA   . THR A 1 46 ? -4.269  -5.358  -0.887  1.00 0.00 ? 353 THR A CA   6  
ATOM   6589  C  C    . THR A 1 46 ? -4.395  -5.829  -2.336  1.00 0.00 ? 353 THR A C    6  
ATOM   6590  O  O    . THR A 1 46 ? -4.590  -7.012  -2.593  1.00 0.00 ? 353 THR A O    6  
ATOM   6591  C  CB   . THR A 1 46 ? -5.667  -4.976  -0.329  1.00 0.00 ? 353 THR A CB   6  
ATOM   6592  O  OG1  . THR A 1 46 ? -6.551  -6.103  -0.396  1.00 0.00 ? 353 THR A OG1  6  
ATOM   6593  C  CG2  . THR A 1 46 ? -6.273  -3.809  -1.098  1.00 0.00 ? 353 THR A CG2  6  
ATOM   6594  H  H    . THR A 1 46 ? -3.647  -3.364  -0.537  1.00 0.00 ? 353 THR A H    6  
ATOM   6595  H  HA   . THR A 1 46 ? -3.886  -6.176  -0.294  1.00 0.00 ? 353 THR A HA   6  
ATOM   6596  H  HB   . THR A 1 46 ? -5.556  -4.682  0.704   1.00 0.00 ? 353 THR A HB   6  
ATOM   6597  H  HG1  . THR A 1 46 ? -6.352  -6.705  0.335   1.00 0.00 ? 353 THR A HG1  6  
ATOM   6598  H  HG21 . THR A 1 46 ? -6.415  -4.094  -2.130  1.00 0.00 ? 353 THR A HG21 6  
ATOM   6599  H  HG22 . THR A 1 46 ? -5.606  -2.961  -1.047  1.00 0.00 ? 353 THR A HG22 6  
ATOM   6600  H  HG23 . THR A 1 46 ? -7.225  -3.544  -0.663  1.00 0.00 ? 353 THR A HG23 6  
ATOM   6601  N  N    . CYS A 1 47 ? -4.245  -4.904  -3.282  1.00 0.00 ? 354 CYS A N    6  
ATOM   6602  C  CA   . CYS A 1 47 ? -4.350  -5.238  -4.698  1.00 0.00 ? 354 CYS A CA   6  
ATOM   6603  C  C    . CYS A 1 47 ? -3.148  -6.060  -5.141  1.00 0.00 ? 354 CYS A C    6  
ATOM   6604  O  O    . CYS A 1 47 ? -3.273  -6.983  -5.945  1.00 0.00 ? 354 CYS A O    6  
ATOM   6605  C  CB   . CYS A 1 47 ? -4.451  -3.965  -5.544  1.00 0.00 ? 354 CYS A CB   6  
ATOM   6606  S  SG   . CYS A 1 47 ? -5.863  -2.906  -5.134  1.00 0.00 ? 354 CYS A SG   6  
ATOM   6607  H  H    . CYS A 1 47 ? -4.051  -3.982  -3.022  1.00 0.00 ? 354 CYS A H    6  
ATOM   6608  H  HA   . CYS A 1 47 ? -5.246  -5.826  -4.837  1.00 0.00 ? 354 CYS A HA   6  
ATOM   6609  H  HB2  . CYS A 1 47 ? -3.553  -3.381  -5.405  1.00 0.00 ? 354 CYS A HB2  6  
ATOM   6610  H  HB3  . CYS A 1 47 ? -4.535  -4.240  -6.586  1.00 0.00 ? 354 CYS A HB3  6  
ATOM   6611  N  N    . ALA A 1 48 ? -1.988  -5.725  -4.596  1.00 0.00 ? 355 ALA A N    6  
ATOM   6612  C  CA   . ALA A 1 48 ? -0.755  -6.413  -4.935  1.00 0.00 ? 355 ALA A CA   6  
ATOM   6613  C  C    . ALA A 1 48 ? -0.788  -7.856  -4.461  1.00 0.00 ? 355 ALA A C    6  
ATOM   6614  O  O    . ALA A 1 48 ? -0.470  -8.775  -5.216  1.00 0.00 ? 355 ALA A O    6  
ATOM   6615  C  CB   . ALA A 1 48 ? 0.426   -5.685  -4.323  1.00 0.00 ? 355 ALA A CB   6  
ATOM   6616  H  H    . ALA A 1 48 ? -1.959  -4.991  -3.945  1.00 0.00 ? 355 ALA A H    6  
ATOM   6617  H  HA   . ALA A 1 48 ? -0.649  -6.401  -6.009  1.00 0.00 ? 355 ALA A HA   6  
ATOM   6618  H  HB1  . ALA A 1 48 ? 0.457   -4.673  -4.696  1.00 0.00 ? 355 ALA A HB1  6  
ATOM   6619  H  HB2  . ALA A 1 48 ? 1.340   -6.196  -4.586  1.00 0.00 ? 355 ALA A HB2  6  
ATOM   6620  H  HB3  . ALA A 1 48 ? 0.319   -5.669  -3.249  1.00 0.00 ? 355 ALA A HB3  6  
ATOM   6621  N  N    . GLN A 1 49 ? -1.183  -8.051  -3.212  1.00 0.00 ? 356 GLN A N    6  
ATOM   6622  C  CA   . GLN A 1 49 ? -1.284  -9.388  -2.648  1.00 0.00 ? 356 GLN A CA   6  
ATOM   6623  C  C    . GLN A 1 49 ? -2.446  -10.143 -3.284  1.00 0.00 ? 356 GLN A C    6  
ATOM   6624  O  O    . GLN A 1 49 ? -2.456  -11.372 -3.328  1.00 0.00 ? 356 GLN A O    6  
ATOM   6625  C  CB   . GLN A 1 49 ? -1.469  -9.314  -1.133  1.00 0.00 ? 356 GLN A CB   6  
ATOM   6626  C  CG   . GLN A 1 49 ? -0.307  -8.647  -0.417  1.00 0.00 ? 356 GLN A CG   6  
ATOM   6627  C  CD   . GLN A 1 49 ? -0.503  -8.607  1.084   1.00 0.00 ? 356 GLN A CD   6  
ATOM   6628  O  OE1  . GLN A 1 49 ? -0.112  -9.532  1.797   1.00 0.00 ? 356 GLN A OE1  6  
ATOM   6629  N  NE2  . GLN A 1 49 ? -1.111  -7.537  1.576   1.00 0.00 ? 356 GLN A NE2  6  
ATOM   6630  H  H    . GLN A 1 49 ? -1.407  -7.274  -2.652  1.00 0.00 ? 356 GLN A H    6  
ATOM   6631  H  HA   . GLN A 1 49 ? -0.365  -9.910  -2.867  1.00 0.00 ? 356 GLN A HA   6  
ATOM   6632  H  HB2  . GLN A 1 49 ? -2.370  -8.744  -0.920  1.00 0.00 ? 356 GLN A HB2  6  
ATOM   6633  H  HB3  . GLN A 1 49 ? -1.575  -10.325 -0.743  1.00 0.00 ? 356 GLN A HB3  6  
ATOM   6634  H  HG2  . GLN A 1 49 ? 0.603   -9.206  -0.632  1.00 0.00 ? 356 GLN A HG2  6  
ATOM   6635  H  HG3  . GLN A 1 49 ? -0.215  -7.624  -0.782  1.00 0.00 ? 356 GLN A HG3  6  
ATOM   6636  H  HE21 . GLN A 1 49 ? -1.399  -6.840  0.952   1.00 0.00 ? 356 GLN A HE21 6  
ATOM   6637  H  HE22 . GLN A 1 49 ? -1.251  -7.488  2.547   1.00 0.00 ? 356 GLN A HE22 6  
ATOM   6638  N  N    . LYS A 1 50 ? -3.420  -9.391  -3.781  1.00 0.00 ? 357 LYS A N    6  
ATOM   6639  C  CA   . LYS A 1 50 ? -4.579  -9.972  -4.444  1.00 0.00 ? 357 LYS A CA   6  
ATOM   6640  C  C    . LYS A 1 50 ? -4.174  -10.555 -5.791  1.00 0.00 ? 357 LYS A C    6  
ATOM   6641  O  O    . LYS A 1 50 ? -4.589  -11.658 -6.151  1.00 0.00 ? 357 LYS A O    6  
ATOM   6642  C  CB   . LYS A 1 50 ? -5.658  -8.905  -4.644  1.00 0.00 ? 357 LYS A CB   6  
ATOM   6643  C  CG   . LYS A 1 50 ? -7.080  -9.443  -4.621  1.00 0.00 ? 357 LYS A CG   6  
ATOM   6644  C  CD   . LYS A 1 50 ? -7.436  -10.042 -3.264  1.00 0.00 ? 357 LYS A CD   6  
ATOM   6645  C  CE   . LYS A 1 50 ? -7.185  -9.066  -2.115  1.00 0.00 ? 357 LYS A CE   6  
ATOM   6646  N  NZ   . LYS A 1 50 ? -7.906  -7.776  -2.294  1.00 0.00 ? 357 LYS A NZ   6  
ATOM   6647  H  H    . LYS A 1 50 ? -3.363  -8.416  -3.690  1.00 0.00 ? 357 LYS A H    6  
ATOM   6648  H  HA   . LYS A 1 50 ? -4.966  -10.759 -3.817  1.00 0.00 ? 357 LYS A HA   6  
ATOM   6649  H  HB2  . LYS A 1 50 ? -5.565  -8.165  -3.866  1.00 0.00 ? 357 LYS A HB2  6  
ATOM   6650  H  HB3  . LYS A 1 50 ? -5.497  -8.428  -5.600  1.00 0.00 ? 357 LYS A HB3  6  
ATOM   6651  H  HG2  . LYS A 1 50 ? -7.767  -8.628  -4.831  1.00 0.00 ? 357 LYS A HG2  6  
ATOM   6652  H  HG3  . LYS A 1 50 ? -7.173  -10.215 -5.382  1.00 0.00 ? 357 LYS A HG3  6  
ATOM   6653  H  HD2  . LYS A 1 50 ? -8.480  -10.313 -3.268  1.00 0.00 ? 357 LYS A HD2  6  
ATOM   6654  H  HD3  . LYS A 1 50 ? -6.836  -10.927 -3.108  1.00 0.00 ? 357 LYS A HD3  6  
ATOM   6655  H  HE2  . LYS A 1 50 ? -7.514  -9.523  -1.195  1.00 0.00 ? 357 LYS A HE2  6  
ATOM   6656  H  HE3  . LYS A 1 50 ? -6.124  -8.869  -2.053  1.00 0.00 ? 357 LYS A HE3  6  
ATOM   6657  H  HZ1  . LYS A 1 50 ? -7.624  -7.329  -3.187  1.00 0.00 ? 357 LYS A HZ1  6  
ATOM   6658  H  HZ2  . LYS A 1 50 ? -7.681  -7.127  -1.509  1.00 0.00 ? 357 LYS A HZ2  6  
ATOM   6659  H  HZ3  . LYS A 1 50 ? -8.933  -7.937  -2.309  1.00 0.00 ? 357 LYS A HZ3  6  
ATOM   6660  N  N    . ALA A 1 51 ? -3.361  -9.804  -6.529  1.00 0.00 ? 358 ALA A N    6  
ATOM   6661  C  CA   . ALA A 1 51 ? -2.875  -10.248 -7.829  1.00 0.00 ? 358 ALA A CA   6  
ATOM   6662  C  C    . ALA A 1 51 ? -1.758  -11.274 -7.670  1.00 0.00 ? 358 ALA A C    6  
ATOM   6663  O  O    . ALA A 1 51 ? -1.605  -12.177 -8.495  1.00 0.00 ? 358 ALA A O    6  
ATOM   6664  C  CB   . ALA A 1 51 ? -2.392  -9.059  -8.648  1.00 0.00 ? 358 ALA A CB   6  
ATOM   6665  H  H    . ALA A 1 51 ? -3.086  -8.919  -6.192  1.00 0.00 ? 358 ALA A H    6  
ATOM   6666  H  HA   . ALA A 1 51 ? -3.700  -10.707 -8.354  1.00 0.00 ? 358 ALA A HA   6  
ATOM   6667  H  HB1  . ALA A 1 51 ? -3.182  -8.325  -8.716  1.00 0.00 ? 358 ALA A HB1  6  
ATOM   6668  H  HB2  . ALA A 1 51 ? -2.121  -9.389  -9.641  1.00 0.00 ? 358 ALA A HB2  6  
ATOM   6669  H  HB3  . ALA A 1 51 ? -1.533  -8.617  -8.167  1.00 0.00 ? 358 ALA A HB3  6  
ATOM   6670  N  N    . GLY A 1 52 ? -0.979  -11.129 -6.607  1.00 0.00 ? 359 GLY A N    6  
ATOM   6671  C  CA   . GLY A 1 52 ? 0.088   -12.069 -6.334  1.00 0.00 ? 359 GLY A CA   6  
ATOM   6672  C  C    . GLY A 1 52 ? 1.379   -11.691 -7.026  1.00 0.00 ? 359 GLY A C    6  
ATOM   6673  O  O    . GLY A 1 52 ? 2.082   -12.551 -7.559  1.00 0.00 ? 359 GLY A O    6  
ATOM   6674  H  H    . GLY A 1 52 ? -1.129  -10.370 -6.002  1.00 0.00 ? 359 GLY A H    6  
ATOM   6675  H  HA2  . GLY A 1 52 ? 0.260   -12.104 -5.270  1.00 0.00 ? 359 GLY A HA2  6  
ATOM   6676  H  HA3  . GLY A 1 52 ? -0.217  -13.048 -6.673  1.00 0.00 ? 359 GLY A HA3  6  
ATOM   6677  N  N    . LEU A 1 53 ? 1.694   -10.405 -7.025  1.00 0.00 ? 360 LEU A N    6  
ATOM   6678  C  CA   . LEU A 1 53 ? 2.909   -9.923  -7.668  1.00 0.00 ? 360 LEU A CA   6  
ATOM   6679  C  C    . LEU A 1 53 ? 4.095   -9.975  -6.706  1.00 0.00 ? 360 LEU A C    6  
ATOM   6680  O  O    . LEU A 1 53 ? 3.923   -10.241 -5.515  1.00 0.00 ? 360 LEU A O    6  
ATOM   6681  C  CB   . LEU A 1 53 ? 2.700   -8.504  -8.224  1.00 0.00 ? 360 LEU A CB   6  
ATOM   6682  C  CG   . LEU A 1 53 ? 2.170   -7.457  -7.236  1.00 0.00 ? 360 LEU A CG   6  
ATOM   6683  C  CD1  . LEU A 1 53 ? 3.288   -6.907  -6.362  1.00 0.00 ? 360 LEU A CD1  6  
ATOM   6684  C  CD2  . LEU A 1 53 ? 1.483   -6.330  -7.988  1.00 0.00 ? 360 LEU A CD2  6  
ATOM   6685  H  H    . LEU A 1 53 ? 1.100   -9.766  -6.578  1.00 0.00 ? 360 LEU A H    6  
ATOM   6686  H  HA   . LEU A 1 53 ? 3.117   -10.588 -8.493  1.00 0.00 ? 360 LEU A HA   6  
ATOM   6687  H  HB2  . LEU A 1 53 ? 3.662   -8.150  -8.600  1.00 0.00 ? 360 LEU A HB2  6  
ATOM   6688  H  HB3  . LEU A 1 53 ? 1.991   -8.572  -9.055  1.00 0.00 ? 360 LEU A HB3  6  
ATOM   6689  H  HG   . LEU A 1 53 ? 1.439   -7.920  -6.589  1.00 0.00 ? 360 LEU A HG   6  
ATOM   6690  H  HD11 . LEU A 1 53 ? 2.901   -6.120  -5.733  1.00 0.00 ? 360 LEU A HD11 6  
ATOM   6691  H  HD12 . LEU A 1 53 ? 4.073   -6.514  -6.991  1.00 0.00 ? 360 LEU A HD12 6  
ATOM   6692  H  HD13 . LEU A 1 53 ? 3.684   -7.698  -5.743  1.00 0.00 ? 360 LEU A HD13 6  
ATOM   6693  H  HD21 . LEU A 1 53 ? 0.648   -6.725  -8.548  1.00 0.00 ? 360 LEU A HD21 6  
ATOM   6694  H  HD22 . LEU A 1 53 ? 2.186   -5.871  -8.667  1.00 0.00 ? 360 LEU A HD22 6  
ATOM   6695  H  HD23 . LEU A 1 53 ? 1.126   -5.591  -7.284  1.00 0.00 ? 360 LEU A HD23 6  
ATOM   6696  N  N    . TYR A 1 54 ? 5.291   -9.725  -7.229  1.00 0.00 ? 361 TYR A N    6  
ATOM   6697  C  CA   . TYR A 1 54 ? 6.514   -9.788  -6.435  1.00 0.00 ? 361 TYR A CA   6  
ATOM   6698  C  C    . TYR A 1 54 ? 6.535   -8.715  -5.350  1.00 0.00 ? 361 TYR A C    6  
ATOM   6699  O  O    . TYR A 1 54 ? 6.547   -7.517  -5.639  1.00 0.00 ? 361 TYR A O    6  
ATOM   6700  C  CB   . TYR A 1 54 ? 7.739   -9.638  -7.343  1.00 0.00 ? 361 TYR A CB   6  
ATOM   6701  C  CG   . TYR A 1 54 ? 9.061   -9.648  -6.604  1.00 0.00 ? 361 TYR A CG   6  
ATOM   6702  C  CD1  . TYR A 1 54 ? 9.666   -10.845 -6.237  1.00 0.00 ? 361 TYR A CD1  6  
ATOM   6703  C  CD2  . TYR A 1 54 ? 9.702   -8.462  -6.274  1.00 0.00 ? 361 TYR A CD2  6  
ATOM   6704  C  CE1  . TYR A 1 54 ? 10.873  -10.855 -5.564  1.00 0.00 ? 361 TYR A CE1  6  
ATOM   6705  C  CE2  . TYR A 1 54 ? 10.908  -8.465  -5.604  1.00 0.00 ? 361 TYR A CE2  6  
ATOM   6706  C  CZ   . TYR A 1 54 ? 11.489  -9.662  -5.250  1.00 0.00 ? 361 TYR A CZ   6  
ATOM   6707  O  OH   . TYR A 1 54 ? 12.690  -9.665  -4.579  1.00 0.00 ? 361 TYR A OH   6  
ATOM   6708  H  H    . TYR A 1 54 ? 5.353   -9.492  -8.180  1.00 0.00 ? 361 TYR A H    6  
ATOM   6709  H  HA   . TYR A 1 54 ? 6.550   -10.759 -5.963  1.00 0.00 ? 361 TYR A HA   6  
ATOM   6710  H  HB2  . TYR A 1 54 ? 7.752   -10.451 -8.052  1.00 0.00 ? 361 TYR A HB2  6  
ATOM   6711  H  HB3  . TYR A 1 54 ? 7.665   -8.702  -7.879  1.00 0.00 ? 361 TYR A HB3  6  
ATOM   6712  H  HD1  . TYR A 1 54 ? 9.181   -11.779 -6.486  1.00 0.00 ? 361 TYR A HD1  6  
ATOM   6713  H  HD2  . TYR A 1 54 ? 9.245   -7.523  -6.552  1.00 0.00 ? 361 TYR A HD2  6  
ATOM   6714  H  HE1  . TYR A 1 54 ? 11.328  -11.793 -5.287  1.00 0.00 ? 361 TYR A HE1  6  
ATOM   6715  H  HE2  . TYR A 1 54 ? 11.389  -7.532  -5.358  1.00 0.00 ? 361 TYR A HE2  6  
ATOM   6716  H  HH   . TYR A 1 54 ? 13.239  -10.388 -4.910  1.00 0.00 ? 361 TYR A HH   6  
ATOM   6717  N  N    . MET A 1 55 ? 6.545   -9.160  -4.103  1.00 0.00 ? 362 MET A N    6  
ATOM   6718  C  CA   . MET A 1 55 ? 6.632   -8.256  -2.967  1.00 0.00 ? 362 MET A CA   6  
ATOM   6719  C  C    . MET A 1 55 ? 7.736   -8.693  -2.016  1.00 0.00 ? 362 MET A C    6  
ATOM   6720  O  O    . MET A 1 55 ? 7.682   -9.781  -1.438  1.00 0.00 ? 362 MET A O    6  
ATOM   6721  C  CB   . MET A 1 55 ? 5.300   -8.207  -2.219  1.00 0.00 ? 362 MET A CB   6  
ATOM   6722  C  CG   . MET A 1 55 ? 4.591   -6.868  -2.319  1.00 0.00 ? 362 MET A CG   6  
ATOM   6723  S  SD   . MET A 1 55 ? 3.056   -6.826  -1.374  1.00 0.00 ? 362 MET A SD   6  
ATOM   6724  C  CE   . MET A 1 55 ? 2.565   -5.122  -1.614  1.00 0.00 ? 362 MET A CE   6  
ATOM   6725  H  H    . MET A 1 55 ? 6.490   -10.125 -3.940  1.00 0.00 ? 362 MET A H    6  
ATOM   6726  H  HA   . MET A 1 55 ? 6.862   -7.271  -3.340  1.00 0.00 ? 362 MET A HA   6  
ATOM   6727  H  HB2  . MET A 1 55 ? 4.647   -8.964  -2.626  1.00 0.00 ? 362 MET A HB2  6  
ATOM   6728  H  HB3  . MET A 1 55 ? 5.477   -8.419  -1.176  1.00 0.00 ? 362 MET A HB3  6  
ATOM   6729  H  HG2  . MET A 1 55 ? 5.248   -6.098  -1.941  1.00 0.00 ? 362 MET A HG2  6  
ATOM   6730  H  HG3  . MET A 1 55 ? 4.366   -6.669  -3.357  1.00 0.00 ? 362 MET A HG3  6  
ATOM   6731  H  HE1  . MET A 1 55 ? 3.308   -4.469  -1.180  1.00 0.00 ? 362 MET A HE1  6  
ATOM   6732  H  HE2  . MET A 1 55 ? 1.614   -4.952  -1.136  1.00 0.00 ? 362 MET A HE2  6  
ATOM   6733  H  HE3  . MET A 1 55 ? 2.478   -4.919  -2.670  1.00 0.00 ? 362 MET A HE3  6  
ATOM   6734  N  N    . LYS A 1 56 ? 8.746   -7.851  -1.869  1.00 0.00 ? 363 LYS A N    6  
ATOM   6735  C  CA   . LYS A 1 56 ? 9.822   -8.110  -0.931  1.00 0.00 ? 363 LYS A CA   6  
ATOM   6736  C  C    . LYS A 1 56 ? 9.820   -7.029  0.148   1.00 0.00 ? 363 LYS A C    6  
ATOM   6737  O  O    . LYS A 1 56 ? 9.551   -5.861  -0.139  1.00 0.00 ? 363 LYS A O    6  
ATOM   6738  C  CB   . LYS A 1 56 ? 11.167  -8.166  -1.669  1.00 0.00 ? 363 LYS A CB   6  
ATOM   6739  C  CG   . LYS A 1 56 ? 12.333  -8.597  -0.792  1.00 0.00 ? 363 LYS A CG   6  
ATOM   6740  C  CD   . LYS A 1 56 ? 13.278  -7.446  -0.495  1.00 0.00 ? 363 LYS A CD   6  
ATOM   6741  C  CE   . LYS A 1 56 ? 14.093  -7.052  -1.718  1.00 0.00 ? 363 LYS A CE   6  
ATOM   6742  N  NZ   . LYS A 1 56 ? 14.937  -5.855  -1.455  1.00 0.00 ? 363 LYS A NZ   6  
ATOM   6743  H  H    . LYS A 1 56 ? 8.772   -7.026  -2.409  1.00 0.00 ? 363 LYS A H    6  
ATOM   6744  H  HA   . LYS A 1 56 ? 9.632   -9.065  -0.465  1.00 0.00 ? 363 LYS A HA   6  
ATOM   6745  H  HB2  . LYS A 1 56 ? 11.082  -8.880  -2.492  1.00 0.00 ? 363 LYS A HB2  6  
ATOM   6746  H  HB3  . LYS A 1 56 ? 11.387  -7.174  -2.065  1.00 0.00 ? 363 LYS A HB3  6  
ATOM   6747  H  HG2  . LYS A 1 56 ? 11.946  -8.979  0.141   1.00 0.00 ? 363 LYS A HG2  6  
ATOM   6748  H  HG3  . LYS A 1 56 ? 12.880  -9.378  -1.300  1.00 0.00 ? 363 LYS A HG3  6  
ATOM   6749  H  HD2  . LYS A 1 56 ? 12.702  -6.592  -0.168  1.00 0.00 ? 363 LYS A HD2  6  
ATOM   6750  H  HD3  . LYS A 1 56 ? 13.954  -7.747  0.289   1.00 0.00 ? 363 LYS A HD3  6  
ATOM   6751  H  HE2  . LYS A 1 56 ? 14.732  -7.878  -1.991  1.00 0.00 ? 363 LYS A HE2  6  
ATOM   6752  H  HE3  . LYS A 1 56 ? 13.418  -6.836  -2.534  1.00 0.00 ? 363 LYS A HE3  6  
ATOM   6753  H  HZ1  . LYS A 1 56 ? 14.345  -4.993  -1.446  1.00 0.00 ? 363 LYS A HZ1  6  
ATOM   6754  H  HZ2  . LYS A 1 56 ? 15.661  -5.755  -2.192  1.00 0.00 ? 363 LYS A HZ2  6  
ATOM   6755  H  HZ3  . LYS A 1 56 ? 15.409  -5.944  -0.527  1.00 0.00 ? 363 LYS A HZ3  6  
ATOM   6756  N  N    . MET A 1 57 ? 10.115  -7.419  1.378   1.00 0.00 ? 364 MET A N    6  
ATOM   6757  C  CA   . MET A 1 57 ? 10.005  -6.537  2.527   1.00 0.00 ? 364 MET A CA   6  
ATOM   6758  C  C    . MET A 1 57 ? 11.019  -6.967  3.561   1.00 0.00 ? 364 MET A C    6  
ATOM   6759  O  O    . MET A 1 57 ? 10.937  -8.062  4.119   1.00 0.00 ? 364 MET A O    6  
ATOM   6760  C  CB   . MET A 1 57 ? 8.596   -6.562  3.133   1.00 0.00 ? 364 MET A CB   6  
ATOM   6761  C  CG   . MET A 1 57 ? 7.517   -5.985  2.230   1.00 0.00 ? 364 MET A CG   6  
ATOM   6762  S  SD   . MET A 1 57 ? 5.904   -5.913  3.029   1.00 0.00 ? 364 MET A SD   6  
ATOM   6763  C  CE   . MET A 1 57 ? 4.912   -5.205  1.716   1.00 0.00 ? 364 MET A CE   6  
ATOM   6764  H  H    . MET A 1 57 ? 10.471  -8.320  1.522   1.00 0.00 ? 364 MET A H    6  
ATOM   6765  H  HA   . MET A 1 57 ? 10.238  -5.533  2.203   1.00 0.00 ? 364 MET A HA   6  
ATOM   6766  H  HB2  . MET A 1 57 ? 8.334   -7.586  3.360   1.00 0.00 ? 364 MET A HB2  6  
ATOM   6767  H  HB3  . MET A 1 57 ? 8.606   -5.994  4.051   1.00 0.00 ? 364 MET A HB3  6  
ATOM   6768  H  HG2  . MET A 1 57 ? 7.804   -4.984  1.945   1.00 0.00 ? 364 MET A HG2  6  
ATOM   6769  H  HG3  . MET A 1 57 ? 7.437   -6.601  1.347   1.00 0.00 ? 364 MET A HG3  6  
ATOM   6770  H  HE1  . MET A 1 57 ? 5.300   -4.229  1.462   1.00 0.00 ? 364 MET A HE1  6  
ATOM   6771  H  HE2  . MET A 1 57 ? 3.890   -5.110  2.050   1.00 0.00 ? 364 MET A HE2  6  
ATOM   6772  H  HE3  . MET A 1 57 ? 4.952   -5.847  0.848   1.00 0.00 ? 364 MET A HE3  6  
ATOM   6773  N  N    . GLU A 1 58 ? 11.988  -6.116  3.786   1.00 0.00 ? 365 GLU A N    6  
ATOM   6774  C  CA   . GLU A 1 58 ? 13.108  -6.444  4.633   1.00 0.00 ? 365 GLU A CA   6  
ATOM   6775  C  C    . GLU A 1 58 ? 13.082  -5.621  5.912   1.00 0.00 ? 365 GLU A C    6  
ATOM   6776  O  O    . GLU A 1 58 ? 13.071  -4.393  5.865   1.00 0.00 ? 365 GLU A O    6  
ATOM   6777  C  CB   . GLU A 1 58 ? 14.391  -6.151  3.870   1.00 0.00 ? 365 GLU A CB   6  
ATOM   6778  C  CG   . GLU A 1 58 ? 14.615  -7.037  2.665   1.00 0.00 ? 365 GLU A CG   6  
ATOM   6779  C  CD   . GLU A 1 58 ? 15.855  -6.638  1.886   1.00 0.00 ? 365 GLU A CD   6  
ATOM   6780  O  OE1  . GLU A 1 58 ? 15.771  -5.709  1.054   1.00 0.00 ? 365 GLU A OE1  6  
ATOM   6781  O  OE2  . GLU A 1 58 ? 16.922  -7.247  2.101   1.00 0.00 ? 365 GLU A OE2  6  
ATOM   6782  H  H    . GLU A 1 58 ? 11.943  -5.222  3.374   1.00 0.00 ? 365 GLU A H    6  
ATOM   6783  H  HA   . GLU A 1 58 ? 13.066  -7.493  4.872   1.00 0.00 ? 365 GLU A HA   6  
ATOM   6784  H  HB2  . GLU A 1 58 ? 14.345  -5.133  3.521   1.00 0.00 ? 365 GLU A HB2  6  
ATOM   6785  H  HB3  . GLU A 1 58 ? 15.227  -6.262  4.537   1.00 0.00 ? 365 GLU A HB3  6  
ATOM   6786  H  HG2  . GLU A 1 58 ? 14.725  -8.058  2.997   1.00 0.00 ? 365 GLU A HG2  6  
ATOM   6787  H  HG3  . GLU A 1 58 ? 13.756  -6.958  2.014   1.00 0.00 ? 365 GLU A HG3  6  
ATOM   6788  N  N    . PRO A 1 59 ? 13.066  -6.280  7.071   1.00 0.00 ? 366 PRO A N    6  
ATOM   6789  C  CA   . PRO A 1 59 ? 13.260  -5.623  8.343   1.00 0.00 ? 366 PRO A CA   6  
ATOM   6790  C  C    . PRO A 1 59 ? 14.723  -5.684  8.765   1.00 0.00 ? 366 PRO A C    6  
ATOM   6791  O  O    . PRO A 1 59 ? 15.268  -6.766  9.003   1.00 0.00 ? 366 PRO A O    6  
ATOM   6792  C  CB   . PRO A 1 59 ? 12.391  -6.445  9.299   1.00 0.00 ? 366 PRO A CB   6  
ATOM   6793  C  CG   . PRO A 1 59 ? 12.136  -7.760  8.611   1.00 0.00 ? 366 PRO A CG   6  
ATOM   6794  C  CD   . PRO A 1 59 ? 12.798  -7.706  7.254   1.00 0.00 ? 366 PRO A CD   6  
ATOM   6795  H  HA   . PRO A 1 59 ? 12.925  -4.594  8.319   1.00 0.00 ? 366 PRO A HA   6  
ATOM   6796  H  HB2  . PRO A 1 59 ? 12.923  -6.586  10.228  1.00 0.00 ? 366 PRO A HB2  6  
ATOM   6797  H  HB3  . PRO A 1 59 ? 11.468  -5.917  9.486   1.00 0.00 ? 366 PRO A HB3  6  
ATOM   6798  H  HG2  . PRO A 1 59 ? 12.561  -8.562  9.194   1.00 0.00 ? 366 PRO A HG2  6  
ATOM   6799  H  HG3  . PRO A 1 59 ? 11.072  -7.907  8.499   1.00 0.00 ? 366 PRO A HG3  6  
ATOM   6800  H  HD2  . PRO A 1 59 ? 13.715  -8.276  7.257   1.00 0.00 ? 366 PRO A HD2  6  
ATOM   6801  H  HD3  . PRO A 1 59 ? 12.125  -8.074  6.494   1.00 0.00 ? 366 PRO A HD3  6  
ATOM   6802  N  N    . VAL A 1 60 ? 15.368  -4.538  8.840   1.00 0.00 ? 367 VAL A N    6  
ATOM   6803  C  CA   . VAL A 1 60 ? 16.770  -4.505  9.186   1.00 0.00 ? 367 VAL A CA   6  
ATOM   6804  C  C    . VAL A 1 60 ? 16.956  -4.037  10.624  1.00 0.00 ? 367 VAL A C    6  
ATOM   6805  O  O    . VAL A 1 60 ? 16.448  -2.987  11.025  1.00 0.00 ? 367 VAL A O    6  
ATOM   6806  C  CB   . VAL A 1 60 ? 17.588  -3.618  8.209   1.00 0.00 ? 367 VAL A CB   6  
ATOM   6807  C  CG1  . VAL A 1 60 ? 17.328  -2.138  8.422   1.00 0.00 ? 367 VAL A CG1  6  
ATOM   6808  C  CG2  . VAL A 1 60 ? 19.070  -3.932  8.321   1.00 0.00 ? 367 VAL A CG2  6  
ATOM   6809  H  H    . VAL A 1 60 ? 14.887  -3.695  8.676   1.00 0.00 ? 367 VAL A H    6  
ATOM   6810  H  HA   . VAL A 1 60 ? 17.145  -5.516  9.106   1.00 0.00 ? 367 VAL A HA   6  
ATOM   6811  H  HB   . VAL A 1 60 ? 17.274  -3.851  7.204   1.00 0.00 ? 367 VAL A HB   6  
ATOM   6812  H  HG11 . VAL A 1 60 ? 17.573  -1.871  9.439   1.00 0.00 ? 367 VAL A HG11 6  
ATOM   6813  H  HG12 . VAL A 1 60 ? 16.286  -1.930  8.236   1.00 0.00 ? 367 VAL A HG12 6  
ATOM   6814  H  HG13 . VAL A 1 60 ? 17.939  -1.563  7.741   1.00 0.00 ? 367 VAL A HG13 6  
ATOM   6815  H  HG21 . VAL A 1 60 ? 19.232  -4.977  8.109   1.00 0.00 ? 367 VAL A HG21 6  
ATOM   6816  H  HG22 . VAL A 1 60 ? 19.408  -3.710  9.322   1.00 0.00 ? 367 VAL A HG22 6  
ATOM   6817  H  HG23 . VAL A 1 60 ? 19.620  -3.333  7.612   1.00 0.00 ? 367 VAL A HG23 6  
ATOM   6818  N  N    . LYS A 1 61 ? 17.628  -4.854  11.417  1.00 0.00 ? 368 LYS A N    6  
ATOM   6819  C  CA   . LYS A 1 61 ? 17.999  -4.467  12.762  1.00 0.00 ? 368 LYS A CA   6  
ATOM   6820  C  C    . LYS A 1 61 ? 19.496  -4.313  12.864  1.00 0.00 ? 368 LYS A C    6  
ATOM   6821  O  O    . LYS A 1 61 ? 20.260  -5.129  12.346  1.00 0.00 ? 368 LYS A O    6  
ATOM   6822  C  CB   . LYS A 1 61 ? 17.500  -5.460  13.803  1.00 0.00 ? 368 LYS A CB   6  
ATOM   6823  C  CG   . LYS A 1 61 ? 16.096  -5.157  14.286  1.00 0.00 ? 368 LYS A CG   6  
ATOM   6824  C  CD   . LYS A 1 61 ? 15.745  -5.979  15.508  1.00 0.00 ? 368 LYS A CD   6  
ATOM   6825  C  CE   . LYS A 1 61 ? 16.660  -5.667  16.681  1.00 0.00 ? 368 LYS A CE   6  
ATOM   6826  N  NZ   . LYS A 1 61 ? 16.259  -6.400  17.908  1.00 0.00 ? 368 LYS A NZ   6  
ATOM   6827  H  H    . LYS A 1 61 ? 17.888  -5.738  11.086  1.00 0.00 ? 368 LYS A H    6  
ATOM   6828  H  HA   . LYS A 1 61 ? 17.546  -3.506  12.956  1.00 0.00 ? 368 LYS A HA   6  
ATOM   6829  H  HB2  . LYS A 1 61 ? 17.507  -6.452  13.376  1.00 0.00 ? 368 LYS A HB2  6  
ATOM   6830  H  HB3  . LYS A 1 61 ? 18.164  -5.437  14.653  1.00 0.00 ? 368 LYS A HB3  6  
ATOM   6831  H  HG2  . LYS A 1 61 ? 16.031  -4.110  14.537  1.00 0.00 ? 368 LYS A HG2  6  
ATOM   6832  H  HG3  . LYS A 1 61 ? 15.398  -5.386  13.494  1.00 0.00 ? 368 LYS A HG3  6  
ATOM   6833  H  HD2  . LYS A 1 61 ? 14.730  -5.761  15.791  1.00 0.00 ? 368 LYS A HD2  6  
ATOM   6834  H  HD3  . LYS A 1 61 ? 15.840  -7.022  15.259  1.00 0.00 ? 368 LYS A HD3  6  
ATOM   6835  H  HE2  . LYS A 1 61 ? 17.664  -5.954  16.420  1.00 0.00 ? 368 LYS A HE2  6  
ATOM   6836  H  HE3  . LYS A 1 61 ? 16.627  -4.607  16.875  1.00 0.00 ? 368 LYS A HE3  6  
ATOM   6837  H  HZ1  . LYS A 1 61 ? 15.271  -6.182  18.150  1.00 0.00 ? 368 LYS A HZ1  6  
ATOM   6838  H  HZ2  . LYS A 1 61 ? 16.866  -6.125  18.705  1.00 0.00 ? 368 LYS A HZ2  6  
ATOM   6839  H  HZ3  . LYS A 1 61 ? 16.347  -7.423  17.760  1.00 0.00 ? 368 LYS A HZ3  6  
ATOM   6840  N  N    . GLU A 1 62 ? 19.899  -3.267  13.541  1.00 0.00 ? 369 GLU A N    6  
ATOM   6841  C  CA   . GLU A 1 62 ? 21.289  -2.869  13.585  1.00 0.00 ? 369 GLU A CA   6  
ATOM   6842  C  C    . GLU A 1 62 ? 21.640  -2.273  14.938  1.00 0.00 ? 369 GLU A C    6  
ATOM   6843  O  O    . GLU A 1 62 ? 20.789  -2.118  15.808  1.00 0.00 ? 369 GLU A O    6  
ATOM   6844  C  CB   . GLU A 1 62 ? 21.617  -1.876  12.468  1.00 0.00 ? 369 GLU A CB   6  
ATOM   6845  C  CG   . GLU A 1 62 ? 21.506  -2.463  11.071  1.00 0.00 ? 369 GLU A CG   6  
ATOM   6846  C  CD   . GLU A 1 62 ? 22.002  -1.517  10.004  1.00 0.00 ? 369 GLU A CD   6  
ATOM   6847  O  OE1  . GLU A 1 62 ? 23.209  -1.560  9.685   1.00 0.00 ? 369 GLU A OE1  6  
ATOM   6848  O  OE2  . GLU A 1 62 ? 21.196  -0.721  9.484   1.00 0.00 ? 369 GLU A OE2  6  
ATOM   6849  H  H    . GLU A 1 62 ? 19.230  -2.747  14.049  1.00 0.00 ? 369 GLU A H    6  
ATOM   6850  H  HA   . GLU A 1 62 ? 21.883  -3.761  13.439  1.00 0.00 ? 369 GLU A HA   6  
ATOM   6851  H  HB2  . GLU A 1 62 ? 20.938  -1.041  12.537  1.00 0.00 ? 369 GLU A HB2  6  
ATOM   6852  H  HB3  . GLU A 1 62 ? 22.627  -1.518  12.606  1.00 0.00 ? 369 GLU A HB3  6  
ATOM   6853  H  HG2  . GLU A 1 62 ? 22.092  -3.370  11.027  1.00 0.00 ? 369 GLU A HG2  6  
ATOM   6854  H  HG3  . GLU A 1 62 ? 20.470  -2.696  10.874  1.00 0.00 ? 369 GLU A HG3  6  
ATOM   6855  N  N    . LEU A 1 63 ? 22.901  -1.927  15.076  1.00 0.00 ? 370 LEU A N    6  
ATOM   6856  C  CA   . LEU A 1 63 ? 23.496  -1.556  16.336  1.00 0.00 ? 370 LEU A CA   6  
ATOM   6857  C  C    . LEU A 1 63 ? 24.097  -0.153  16.269  1.00 0.00 ? 370 LEU A C    6  
ATOM   6858  O  O    . LEU A 1 63 ? 24.827  0.263   17.165  1.00 0.00 ? 370 LEU A O    6  
ATOM   6859  C  CB   . LEU A 1 63 ? 24.578  -2.582  16.672  1.00 0.00 ? 370 LEU A CB   6  
ATOM   6860  C  CG   . LEU A 1 63 ? 25.319  -3.184  15.468  1.00 0.00 ? 370 LEU A CG   6  
ATOM   6861  C  CD1  . LEU A 1 63 ? 26.271  -2.173  14.841  1.00 0.00 ? 370 LEU A CD1  6  
ATOM   6862  C  CD2  . LEU A 1 63 ? 26.067  -4.440  15.879  1.00 0.00 ? 370 LEU A CD2  6  
ATOM   6863  H  H    . LEU A 1 63 ? 23.455  -1.900  14.292  1.00 0.00 ? 370 LEU A H    6  
ATOM   6864  H  HA   . LEU A 1 63 ? 22.733  -1.585  17.096  1.00 0.00 ? 370 LEU A HA   6  
ATOM   6865  H  HB2  . LEU A 1 63 ? 25.301  -2.095  17.292  1.00 0.00 ? 370 LEU A HB2  6  
ATOM   6866  H  HB3  . LEU A 1 63 ? 24.126  -3.387  17.231  1.00 0.00 ? 370 LEU A HB3  6  
ATOM   6867  H  HG   . LEU A 1 63 ? 24.594  -3.461  14.717  1.00 0.00 ? 370 LEU A HG   6  
ATOM   6868  H  HD11 . LEU A 1 63 ? 26.786  -2.632  14.010  1.00 0.00 ? 370 LEU A HD11 6  
ATOM   6869  H  HD12 . LEU A 1 63 ? 26.992  -1.852  15.578  1.00 0.00 ? 370 LEU A HD12 6  
ATOM   6870  H  HD13 . LEU A 1 63 ? 25.709  -1.320  14.491  1.00 0.00 ? 370 LEU A HD13 6  
ATOM   6871  H  HD21 . LEU A 1 63 ? 25.367  -5.163  16.269  1.00 0.00 ? 370 LEU A HD21 6  
ATOM   6872  H  HD22 . LEU A 1 63 ? 26.791  -4.195  16.640  1.00 0.00 ? 370 LEU A HD22 6  
ATOM   6873  H  HD23 . LEU A 1 63 ? 26.573  -4.857  15.021  1.00 0.00 ? 370 LEU A HD23 6  
ATOM   6874  N  N    . THR A 1 64 ? 23.795  0.566   15.201  1.00 0.00 ? 371 THR A N    6  
ATOM   6875  C  CA   . THR A 1 64 ? 24.333  1.903   15.015  1.00 0.00 ? 371 THR A CA   6  
ATOM   6876  C  C    . THR A 1 64 ? 23.263  2.952   15.325  1.00 0.00 ? 371 THR A C    6  
ATOM   6877  O  O    . THR A 1 64 ? 22.122  2.606   15.639  1.00 0.00 ? 371 THR A O    6  
ATOM   6878  C  CB   . THR A 1 64 ? 24.881  2.085   13.579  1.00 0.00 ? 371 THR A CB   6  
ATOM   6879  O  OG1  . THR A 1 64 ? 25.530  3.358   13.437  1.00 0.00 ? 371 THR A OG1  6  
ATOM   6880  C  CG2  . THR A 1 64 ? 23.769  1.961   12.553  1.00 0.00 ? 371 THR A CG2  6  
ATOM   6881  H  H    . THR A 1 64 ? 23.189  0.196   14.529  1.00 0.00 ? 371 THR A H    6  
ATOM   6882  H  HA   . THR A 1 64 ? 25.152  2.027   15.708  1.00 0.00 ? 371 THR A HA   6  
ATOM   6883  H  HB   . THR A 1 64 ? 25.604  1.302   13.391  1.00 0.00 ? 371 THR A HB   6  
ATOM   6884  H  HG1  . THR A 1 64 ? 25.272  3.756   12.595  1.00 0.00 ? 371 THR A HG1  6  
ATOM   6885  H  HG21 . THR A 1 64 ? 23.026  2.723   12.734  1.00 0.00 ? 371 THR A HG21 6  
ATOM   6886  H  HG22 . THR A 1 64 ? 23.312  0.987   12.635  1.00 0.00 ? 371 THR A HG22 6  
ATOM   6887  H  HG23 . THR A 1 64 ? 24.179  2.085   11.562  1.00 0.00 ? 371 THR A HG23 6  
ATOM   6888  N  N    . GLY A 1 65 ? 23.638  4.223   15.261  1.00 0.00 ? 372 GLY A N    6  
ATOM   6889  C  CA   . GLY A 1 65 ? 22.714  5.294   15.579  1.00 0.00 ? 372 GLY A CA   6  
ATOM   6890  C  C    . GLY A 1 65 ? 22.873  5.753   17.013  1.00 0.00 ? 372 GLY A C    6  
ATOM   6891  O  O    . GLY A 1 65 ? 22.947  6.950   17.294  1.00 0.00 ? 372 GLY A O    6  
ATOM   6892  H  H    . GLY A 1 65 ? 24.561  4.437   14.998  1.00 0.00 ? 372 GLY A H    6  
ATOM   6893  H  HA2  . GLY A 1 65 ? 22.901  6.128   14.916  1.00 0.00 ? 372 GLY A HA2  6  
ATOM   6894  H  HA3  . GLY A 1 65 ? 21.704  4.945   15.430  1.00 0.00 ? 372 GLY A HA3  6  
ATOM   6895  N  N    . GLY A 1 66 ? 22.931  4.789   17.913  1.00 0.00 ? 373 GLY A N    6  
ATOM   6896  C  CA   . GLY A 1 66 ? 23.134  5.068   19.320  1.00 0.00 ? 373 GLY A CA   6  
ATOM   6897  C  C    . GLY A 1 66 ? 23.409  3.791   20.075  1.00 0.00 ? 373 GLY A C    6  
ATOM   6898  O  O    . GLY A 1 66 ? 24.482  3.607   20.649  1.00 0.00 ? 373 GLY A O    6  
ATOM   6899  H  H    . GLY A 1 66 ? 22.830  3.859   17.616  1.00 0.00 ? 373 GLY A H    6  
ATOM   6900  H  HA2  . GLY A 1 66 ? 23.973  5.740   19.432  1.00 0.00 ? 373 GLY A HA2  6  
ATOM   6901  H  HA3  . GLY A 1 66 ? 22.247  5.532   19.723  1.00 0.00 ? 373 GLY A HA3  6  
ATOM   6902  N  N    . GLY A 1 67 ? 22.431  2.904   20.055  1.00 0.00 ? 374 GLY A N    6  
ATOM   6903  C  CA   . GLY A 1 67 ? 22.603  1.575   20.594  1.00 0.00 ? 374 GLY A CA   6  
ATOM   6904  C  C    . GLY A 1 67 ? 22.133  0.535   19.603  1.00 0.00 ? 374 GLY A C    6  
ATOM   6905  O  O    . GLY A 1 67 ? 22.836  -0.432  19.315  1.00 0.00 ? 374 GLY A O    6  
ATOM   6906  H  H    . GLY A 1 67 ? 21.566  3.161   19.669  1.00 0.00 ? 374 GLY A H    6  
ATOM   6907  H  HA2  . GLY A 1 67 ? 23.650  1.412   20.813  1.00 0.00 ? 374 GLY A HA2  6  
ATOM   6908  H  HA3  . GLY A 1 67 ? 22.030  1.482   21.504  1.00 0.00 ? 374 GLY A HA3  6  
ATOM   6909  N  N    . THR A 1 68 ? 20.928  0.742   19.089  1.00 0.00 ? 375 THR A N    6  
ATOM   6910  C  CA   . THR A 1 68 ? 20.360  -0.104  18.051  1.00 0.00 ? 375 THR A CA   6  
ATOM   6911  C  C    . THR A 1 68 ? 19.537  0.738   17.080  1.00 0.00 ? 375 THR A C    6  
ATOM   6912  O  O    . THR A 1 68 ? 19.034  1.796   17.457  1.00 0.00 ? 375 THR A O    6  
ATOM   6913  C  CB   . THR A 1 68 ? 19.461  -1.204  18.656  1.00 0.00 ? 375 THR A CB   6  
ATOM   6914  O  OG1  . THR A 1 68 ? 18.650  -0.641  19.698  1.00 0.00 ? 375 THR A OG1  6  
ATOM   6915  C  CG2  . THR A 1 68 ? 20.286  -2.355  19.212  1.00 0.00 ? 375 THR A CG2  6  
ATOM   6916  H  H    . THR A 1 68 ? 20.402  1.505   19.413  1.00 0.00 ? 375 THR A H    6  
ATOM   6917  H  HA   . THR A 1 68 ? 21.169  -0.576  17.514  1.00 0.00 ? 375 THR A HA   6  
ATOM   6918  H  HB   . THR A 1 68 ? 18.815  -1.585  17.877  1.00 0.00 ? 375 THR A HB   6  
ATOM   6919  H  HG1  . THR A 1 68 ? 18.828  0.304   19.763  1.00 0.00 ? 375 THR A HG1  6  
ATOM   6920  H  HG21 . THR A 1 68 ? 20.946  -1.988  19.981  1.00 0.00 ? 375 THR A HG21 6  
ATOM   6921  H  HG22 . THR A 1 68 ? 20.869  -2.798  18.417  1.00 0.00 ? 375 THR A HG22 6  
ATOM   6922  H  HG23 . THR A 1 68 ? 19.626  -3.102  19.631  1.00 0.00 ? 375 THR A HG23 6  
ATOM   6923  N  N    . THR A 1 69 ? 19.389  0.289   15.841  1.00 0.00 ? 376 THR A N    6  
ATOM   6924  C  CA   . THR A 1 69 ? 18.488  0.895   14.947  1.00 0.00 ? 376 THR A CA   6  
ATOM   6925  C  C    . THR A 1 69 ? 17.781  -0.200  14.200  1.00 0.00 ? 376 THR A C    6  
ATOM   6926  O  O    . THR A 1 69 ? 18.199  -1.354  14.161  1.00 0.00 ? 376 THR A O    6  
ATOM   6927  C  CB   . THR A 1 69 ? 19.160  1.887   13.969  1.00 0.00 ? 376 THR A CB   6  
ATOM   6928  O  OG1  . THR A 1 69 ? 18.187  2.479   13.094  1.00 0.00 ? 376 THR A OG1  6  
ATOM   6929  C  CG2  . THR A 1 69 ? 20.239  1.211   13.143  1.00 0.00 ? 376 THR A CG2  6  
ATOM   6930  H  H    . THR A 1 69 ? 19.874  -0.486  15.523  1.00 0.00 ? 376 THR A H    6  
ATOM   6931  H  HA   . THR A 1 69 ? 17.760  1.437   15.535  1.00 0.00 ? 376 THR A HA   6  
ATOM   6932  H  HB   . THR A 1 69 ? 19.611  2.666   14.549  1.00 0.00 ? 376 THR A HB   6  
ATOM   6933  H  HG1  . THR A 1 69 ? 18.537  2.498   12.192  1.00 0.00 ? 376 THR A HG1  6  
ATOM   6934  H  HG21 . THR A 1 69 ? 20.950  0.733   13.801  1.00 0.00 ? 376 THR A HG21 6  
ATOM   6935  H  HG22 . THR A 1 69 ? 20.744  1.949   12.537  1.00 0.00 ? 376 THR A HG22 6  
ATOM   6936  H  HG23 . THR A 1 69 ? 19.784  0.472   12.502  1.00 0.00 ? 376 THR A HG23 6  
ATOM   6937  N  N    . PHE A 1 70 ? 16.707  0.203   13.673  1.00 0.00 ? 377 PHE A N    6  
ATOM   6938  C  CA   . PHE A 1 70 ? 15.773  -0.655  12.974  1.00 0.00 ? 377 PHE A CA   6  
ATOM   6939  C  C    . PHE A 1 70 ? 15.090  0.108   11.841  1.00 0.00 ? 377 PHE A C    6  
ATOM   6940  O  O    . PHE A 1 70 ? 14.563  1.204   12.047  1.00 0.00 ? 377 PHE A O    6  
ATOM   6941  C  CB   . PHE A 1 70 ? 14.745  -1.183  13.977  1.00 0.00 ? 377 PHE A CB   6  
ATOM   6942  C  CG   . PHE A 1 70 ? 13.478  -1.687  13.355  1.00 0.00 ? 377 PHE A CG   6  
ATOM   6943  C  CD1  . PHE A 1 70 ? 13.359  -2.998  12.929  1.00 0.00 ? 377 PHE A CD1  6  
ATOM   6944  C  CD2  . PHE A 1 70 ? 12.400  -0.836  13.211  1.00 0.00 ? 377 PHE A CD2  6  
ATOM   6945  C  CE1  . PHE A 1 70 ? 12.181  -3.451  12.365  1.00 0.00 ? 377 PHE A CE1  6  
ATOM   6946  C  CE2  . PHE A 1 70 ? 11.217  -1.280  12.650  1.00 0.00 ? 377 PHE A CE2  6  
ATOM   6947  C  CZ   . PHE A 1 70 ? 11.109  -2.593  12.227  1.00 0.00 ? 377 PHE A CZ   6  
ATOM   6948  H  H    . PHE A 1 70 ? 16.533  1.138   13.766  1.00 0.00 ? 377 PHE A H    6  
ATOM   6949  H  HA   . PHE A 1 70 ? 16.324  -1.486  12.561  1.00 0.00 ? 377 PHE A HA   6  
ATOM   6950  H  HB2  . PHE A 1 70 ? 15.190  -2.007  14.531  1.00 0.00 ? 377 PHE A HB2  6  
ATOM   6951  H  HB3  . PHE A 1 70 ? 14.480  -0.375  14.664  1.00 0.00 ? 377 PHE A HB3  6  
ATOM   6952  H  HD1  . PHE A 1 70 ? 14.199  -3.667  13.037  1.00 0.00 ? 377 PHE A HD1  6  
ATOM   6953  H  HD2  . PHE A 1 70 ? 12.497  0.192   13.539  1.00 0.00 ? 377 PHE A HD2  6  
ATOM   6954  H  HE1  . PHE A 1 70 ? 12.099  -4.477  12.035  1.00 0.00 ? 377 PHE A HE1  6  
ATOM   6955  H  HE2  . PHE A 1 70 ? 10.382  -0.605  12.545  1.00 0.00 ? 377 PHE A HE2  6  
ATOM   6956  H  HZ   . PHE A 1 70 ? 10.185  -2.945  11.788  1.00 0.00 ? 377 PHE A HZ   6  
ATOM   6957  N  N    . SER A 1 71 ? 15.148  -0.449  10.644  1.00 0.00 ? 378 SER A N    6  
ATOM   6958  C  CA   . SER A 1 71 ? 14.487  0.135   9.486   1.00 0.00 ? 378 SER A CA   6  
ATOM   6959  C  C    . SER A 1 71 ? 13.680  -0.917  8.738   1.00 0.00 ? 378 SER A C    6  
ATOM   6960  O  O    . SER A 1 71 ? 14.027  -2.100  8.752   1.00 0.00 ? 378 SER A O    6  
ATOM   6961  C  CB   . SER A 1 71 ? 15.526  0.768   8.562   1.00 0.00 ? 378 SER A CB   6  
ATOM   6962  O  OG   . SER A 1 71 ? 16.276  1.746   9.261   1.00 0.00 ? 378 SER A OG   6  
ATOM   6963  H  H    . SER A 1 71 ? 15.647  -1.291  10.532  1.00 0.00 ? 378 SER A H    6  
ATOM   6964  H  HA   . SER A 1 71 ? 13.815  0.905   9.840   1.00 0.00 ? 378 SER A HA   6  
ATOM   6965  H  HB2  . SER A 1 71 ? 16.199  -0.003  8.200   1.00 0.00 ? 378 SER A HB2  6  
ATOM   6966  H  HB3  . SER A 1 71 ? 15.029  1.236   7.725   1.00 0.00 ? 378 SER A HB3  6  
ATOM   6967  H  HG   . SER A 1 71 ? 15.889  1.873   10.135  1.00 0.00 ? 378 SER A HG   6  
ATOM   6968  N  N    . VAL A 1 72 ? 12.596  -0.497  8.104   1.00 0.00 ? 379 VAL A N    6  
ATOM   6969  C  CA   . VAL A 1 72 ? 11.838  -1.389  7.242   1.00 0.00 ? 379 VAL A CA   6  
ATOM   6970  C  C    . VAL A 1 72 ? 12.050  -0.988  5.795   1.00 0.00 ? 379 VAL A C    6  
ATOM   6971  O  O    . VAL A 1 72 ? 11.929  0.187   5.442   1.00 0.00 ? 379 VAL A O    6  
ATOM   6972  C  CB   . VAL A 1 72 ? 10.329  -1.372  7.530   1.00 0.00 ? 379 VAL A CB   6  
ATOM   6973  C  CG1  . VAL A 1 72 ? 9.659   -2.602  6.935   1.00 0.00 ? 379 VAL A CG1  6  
ATOM   6974  C  CG2  . VAL A 1 72 ? 10.051  -1.265  9.022   1.00 0.00 ? 379 VAL A CG2  6  
ATOM   6975  H  H    . VAL A 1 72 ? 12.302  0.430   8.213   1.00 0.00 ? 379 VAL A H    6  
ATOM   6976  H  HA   . VAL A 1 72 ? 12.209  -2.393  7.390   1.00 0.00 ? 379 VAL A HA   6  
ATOM   6977  H  HB   . VAL A 1 72 ? 9.916   -0.507  7.042   1.00 0.00 ? 379 VAL A HB   6  
ATOM   6978  H  HG11 . VAL A 1 72 ? 9.808   -2.613  5.866   1.00 0.00 ? 379 VAL A HG11 6  
ATOM   6979  H  HG12 . VAL A 1 72 ? 8.600   -2.574  7.149   1.00 0.00 ? 379 VAL A HG12 6  
ATOM   6980  H  HG13 . VAL A 1 72 ? 10.091  -3.492  7.368   1.00 0.00 ? 379 VAL A HG13 6  
ATOM   6981  H  HG21 . VAL A 1 72 ? 8.983   -1.263  9.190   1.00 0.00 ? 379 VAL A HG21 6  
ATOM   6982  H  HG22 . VAL A 1 72 ? 10.477  -0.349  9.404   1.00 0.00 ? 379 VAL A HG22 6  
ATOM   6983  H  HG23 . VAL A 1 72 ? 10.493  -2.108  9.531   1.00 0.00 ? 379 VAL A HG23 6  
ATOM   6984  N  N    . ARG A 1 73 ? 12.352  -1.963  4.969   1.00 0.00 ? 380 ARG A N    6  
ATOM   6985  C  CA   . ARG A 1 73 ? 12.690  -1.719  3.572   1.00 0.00 ? 380 ARG A CA   6  
ATOM   6986  C  C    . ARG A 1 73 ? 11.750  -2.500  2.664   1.00 0.00 ? 380 ARG A C    6  
ATOM   6987  O  O    . ARG A 1 73 ? 11.686  -3.724  2.742   1.00 0.00 ? 380 ARG A O    6  
ATOM   6988  C  CB   . ARG A 1 73 ? 14.135  -2.148  3.305   1.00 0.00 ? 380 ARG A CB   6  
ATOM   6989  C  CG   . ARG A 1 73 ? 15.107  -1.694  4.380   1.00 0.00 ? 380 ARG A CG   6  
ATOM   6990  C  CD   . ARG A 1 73 ? 16.504  -2.244  4.147   1.00 0.00 ? 380 ARG A CD   6  
ATOM   6991  N  NE   . ARG A 1 73 ? 17.160  -1.621  3.001   1.00 0.00 ? 380 ARG A NE   6  
ATOM   6992  C  CZ   . ARG A 1 73 ? 18.445  -1.269  2.981   1.00 0.00 ? 380 ARG A CZ   6  
ATOM   6993  N  NH1  . ARG A 1 73 ? 19.211  -1.456  4.053   1.00 0.00 ? 380 ARG A NH1  6  
ATOM   6994  N  NH2  . ARG A 1 73 ? 18.961  -0.719  1.891   1.00 0.00 ? 380 ARG A NH2  6  
ATOM   6995  H  H    . ARG A 1 73 ? 12.340  -2.888  5.308   1.00 0.00 ? 380 ARG A H    6  
ATOM   6996  H  HA   . ARG A 1 73 ? 12.585  -0.663  3.372   1.00 0.00 ? 380 ARG A HA   6  
ATOM   6997  H  HB2  . ARG A 1 73 ? 14.171  -3.225  3.247   1.00 0.00 ? 380 ARG A HB2  6  
ATOM   6998  H  HB3  . ARG A 1 73 ? 14.453  -1.735  2.360   1.00 0.00 ? 380 ARG A HB3  6  
ATOM   6999  H  HG2  . ARG A 1 73 ? 15.150  -0.616  4.379   1.00 0.00 ? 380 ARG A HG2  6  
ATOM   7000  H  HG3  . ARG A 1 73 ? 14.751  -2.039  5.340   1.00 0.00 ? 380 ARG A HG3  6  
ATOM   7001  H  HD2  . ARG A 1 73 ? 17.098  -2.065  5.029   1.00 0.00 ? 380 ARG A HD2  6  
ATOM   7002  H  HD3  . ARG A 1 73 ? 16.432  -3.307  3.972   1.00 0.00 ? 380 ARG A HD3  6  
ATOM   7003  H  HE   . ARG A 1 73 ? 16.612  -1.457  2.200   1.00 0.00 ? 380 ARG A HE   6  
ATOM   7004  H  HH11 . ARG A 1 73 ? 18.829  -1.864  4.883   1.00 0.00 ? 380 ARG A HH11 6  
ATOM   7005  H  HH12 . ARG A 1 73 ? 20.177  -1.181  4.036   1.00 0.00 ? 380 ARG A HH12 6  
ATOM   7006  H  HH21 . ARG A 1 73 ? 18.386  -0.570  1.081   1.00 0.00 ? 380 ARG A HH21 6  
ATOM   7007  H  HH22 . ARG A 1 73 ? 19.928  -0.446  1.873   1.00 0.00 ? 380 ARG A HH22 6  
ATOM   7008  N  N    . LYS A 1 74 ? 11.018  -1.806  1.812   1.00 0.00 ? 381 LYS A N    6  
ATOM   7009  C  CA   . LYS A 1 74 ? 10.063  -2.467  0.938   1.00 0.00 ? 381 LYS A CA   6  
ATOM   7010  C  C    . LYS A 1 74 ? 10.524  -2.410  -0.513  1.00 0.00 ? 381 LYS A C    6  
ATOM   7011  O  O    . LYS A 1 74 ? 11.081  -1.408  -0.964  1.00 0.00 ? 381 LYS A O    6  
ATOM   7012  C  CB   . LYS A 1 74 ? 8.674   -1.840  1.085   1.00 0.00 ? 381 LYS A CB   6  
ATOM   7013  C  CG   . LYS A 1 74 ? 8.107   -1.961  2.492   1.00 0.00 ? 381 LYS A CG   6  
ATOM   7014  C  CD   . LYS A 1 74 ? 6.762   -1.263  2.628   1.00 0.00 ? 381 LYS A CD   6  
ATOM   7015  C  CE   . LYS A 1 74 ? 6.241   -1.357  4.055   1.00 0.00 ? 381 LYS A CE   6  
ATOM   7016  N  NZ   . LYS A 1 74 ? 4.963   -0.620  4.241   1.00 0.00 ? 381 LYS A NZ   6  
ATOM   7017  H  H    . LYS A 1 74 ? 11.126  -0.831  1.761   1.00 0.00 ? 381 LYS A H    6  
ATOM   7018  H  HA   . LYS A 1 74 ? 10.014  -3.505  1.242   1.00 0.00 ? 381 LYS A HA   6  
ATOM   7019  H  HB2  . LYS A 1 74 ? 8.734   -0.793  0.832   1.00 0.00 ? 381 LYS A HB2  6  
ATOM   7020  H  HB3  . LYS A 1 74 ? 7.994   -2.328  0.402   1.00 0.00 ? 381 LYS A HB3  6  
ATOM   7021  H  HG2  . LYS A 1 74 ? 7.982   -3.006  2.729   1.00 0.00 ? 381 LYS A HG2  6  
ATOM   7022  H  HG3  . LYS A 1 74 ? 8.806   -1.514  3.186   1.00 0.00 ? 381 LYS A HG3  6  
ATOM   7023  H  HD2  . LYS A 1 74 ? 6.875   -0.223  2.361   1.00 0.00 ? 381 LYS A HD2  6  
ATOM   7024  H  HD3  . LYS A 1 74 ? 6.051   -1.734  1.962   1.00 0.00 ? 381 LYS A HD3  6  
ATOM   7025  H  HE2  . LYS A 1 74 ? 6.081   -2.397  4.297   1.00 0.00 ? 381 LYS A HE2  6  
ATOM   7026  H  HE3  . LYS A 1 74 ? 6.985   -0.946  4.720   1.00 0.00 ? 381 LYS A HE3  6  
ATOM   7027  H  HZ1  . LYS A 1 74 ? 4.673   -0.652  5.240   1.00 0.00 ? 381 LYS A HZ1  6  
ATOM   7028  H  HZ2  . LYS A 1 74 ? 4.213   -1.047  3.662   1.00 0.00 ? 381 LYS A HZ2  6  
ATOM   7029  H  HZ3  . LYS A 1 74 ? 5.077   0.374   3.958   1.00 0.00 ? 381 LYS A HZ3  6  
ATOM   7030  N  N    . THR A 1 75 ? 10.308  -3.499  -1.231  1.00 0.00 ? 382 THR A N    6  
ATOM   7031  C  CA   . THR A 1 75 ? 10.728  -3.610  -2.617  1.00 0.00 ? 382 THR A CA   6  
ATOM   7032  C  C    . THR A 1 75 ? 9.678   -4.374  -3.424  1.00 0.00 ? 382 THR A C    6  
ATOM   7033  O  O    . THR A 1 75 ? 9.441   -5.554  -3.175  1.00 0.00 ? 382 THR A O    6  
ATOM   7034  C  CB   . THR A 1 75 ? 12.071  -4.357  -2.706  1.00 0.00 ? 382 THR A CB   6  
ATOM   7035  O  OG1  . THR A 1 75 ? 12.995  -3.822  -1.754  1.00 0.00 ? 382 THR A OG1  6  
ATOM   7036  C  CG2  . THR A 1 75 ? 12.665  -4.261  -4.099  1.00 0.00 ? 382 THR A CG2  6  
ATOM   7037  H  H    . THR A 1 75 ? 9.852   -4.266  -0.810  1.00 0.00 ? 382 THR A H    6  
ATOM   7038  H  HA   . THR A 1 75 ? 10.850  -2.618  -3.023  1.00 0.00 ? 382 THR A HA   6  
ATOM   7039  H  HB   . THR A 1 75 ? 11.897  -5.396  -2.477  1.00 0.00 ? 382 THR A HB   6  
ATOM   7040  H  HG1  . THR A 1 75 ? 12.660  -2.979  -1.421  1.00 0.00 ? 382 THR A HG1  6  
ATOM   7041  H  HG21 . THR A 1 75 ? 12.845  -3.223  -4.347  1.00 0.00 ? 382 THR A HG21 6  
ATOM   7042  H  HG22 . THR A 1 75 ? 11.976  -4.687  -4.814  1.00 0.00 ? 382 THR A HG22 6  
ATOM   7043  H  HG23 . THR A 1 75 ? 13.599  -4.805  -4.131  1.00 0.00 ? 382 THR A HG23 6  
ATOM   7044  N  N    . ALA A 1 76 ? 9.044   -3.713  -4.382  1.00 0.00 ? 383 ALA A N    6  
ATOM   7045  C  CA   . ALA A 1 76 ? 8.000   -4.357  -5.167  1.00 0.00 ? 383 ALA A CA   6  
ATOM   7046  C  C    . ALA A 1 76 ? 8.012   -3.907  -6.622  1.00 0.00 ? 383 ALA A C    6  
ATOM   7047  O  O    . ALA A 1 76 ? 8.639   -2.901  -6.982  1.00 0.00 ? 383 ALA A O    6  
ATOM   7048  C  CB   . ALA A 1 76 ? 6.636   -4.083  -4.547  1.00 0.00 ? 383 ALA A CB   6  
ATOM   7049  H  H    . ALA A 1 76 ? 9.273   -2.775  -4.563  1.00 0.00 ? 383 ALA A H    6  
ATOM   7050  H  HA   . ALA A 1 76 ? 8.169   -5.424  -5.132  1.00 0.00 ? 383 ALA A HA   6  
ATOM   7051  H  HB1  . ALA A 1 76 ? 5.879   -4.640  -5.080  1.00 0.00 ? 383 ALA A HB1  6  
ATOM   7052  H  HB2  . ALA A 1 76 ? 6.419   -3.028  -4.612  1.00 0.00 ? 383 ALA A HB2  6  
ATOM   7053  H  HB3  . ALA A 1 76 ? 6.643   -4.387  -3.510  1.00 0.00 ? 383 ALA A HB3  6  
ATOM   7054  N  N    . TYR A 1 77 ? 7.329   -4.676  -7.455  1.00 0.00 ? 384 TYR A N    6  
ATOM   7055  C  CA   . TYR A 1 77 ? 7.125   -4.331  -8.853  1.00 0.00 ? 384 TYR A CA   6  
ATOM   7056  C  C    . TYR A 1 77 ? 5.662   -4.557  -9.206  1.00 0.00 ? 384 TYR A C    6  
ATOM   7057  O  O    . TYR A 1 77 ? 5.043   -5.485  -8.694  1.00 0.00 ? 384 TYR A O    6  
ATOM   7058  C  CB   . TYR A 1 77 ? 8.002   -5.185  -9.778  1.00 0.00 ? 384 TYR A CB   6  
ATOM   7059  C  CG   . TYR A 1 77 ? 9.496   -5.043  -9.561  1.00 0.00 ? 384 TYR A CG   6  
ATOM   7060  C  CD1  . TYR A 1 77 ? 10.180  -3.906  -9.978  1.00 0.00 ? 384 TYR A CD1  6  
ATOM   7061  C  CD2  . TYR A 1 77 ? 10.225  -6.057  -8.951  1.00 0.00 ? 384 TYR A CD2  6  
ATOM   7062  C  CE1  . TYR A 1 77 ? 11.545  -3.788  -9.794  1.00 0.00 ? 384 TYR A CE1  6  
ATOM   7063  C  CE2  . TYR A 1 77 ? 11.589  -5.945  -8.766  1.00 0.00 ? 384 TYR A CE2  6  
ATOM   7064  C  CZ   . TYR A 1 77 ? 12.243  -4.808  -9.188  1.00 0.00 ? 384 TYR A CZ   6  
ATOM   7065  O  OH   . TYR A 1 77 ? 13.601  -4.689  -9.003  1.00 0.00 ? 384 TYR A OH   6  
ATOM   7066  H  H    . TYR A 1 77 ? 6.936   -5.511  -7.115  1.00 0.00 ? 384 TYR A H    6  
ATOM   7067  H  HA   . TYR A 1 77 ? 7.368   -3.288  -8.986  1.00 0.00 ? 384 TYR A HA   6  
ATOM   7068  H  HB2  . TYR A 1 77 ? 7.750   -6.232  -9.629  1.00 0.00 ? 384 TYR A HB2  6  
ATOM   7069  H  HB3  . TYR A 1 77 ? 7.790   -4.904  -10.809 1.00 0.00 ? 384 TYR A HB3  6  
ATOM   7070  H  HD1  . TYR A 1 77 ? 9.633   -3.102  -10.449 1.00 0.00 ? 384 TYR A HD1  6  
ATOM   7071  H  HD2  . TYR A 1 77 ? 9.710   -6.946  -8.620  1.00 0.00 ? 384 TYR A HD2  6  
ATOM   7072  H  HE1  . TYR A 1 77 ? 12.060  -2.897  -10.125 1.00 0.00 ? 384 TYR A HE1  6  
ATOM   7073  H  HE2  . TYR A 1 77 ? 12.138  -6.746  -8.291  1.00 0.00 ? 384 TYR A HE2  6  
ATOM   7074  H  HH   . TYR A 1 77 ? 14.036  -5.493  -9.314  1.00 0.00 ? 384 TYR A HH   6  
ATOM   7075  N  N    . CYS A 1 78 ? 5.107   -3.709  -10.065 1.00 0.00 ? 385 CYS A N    6  
ATOM   7076  C  CA   . CYS A 1 78 ? 3.733   -3.896  -10.529 1.00 0.00 ? 385 CYS A CA   6  
ATOM   7077  C  C    . CYS A 1 78 ? 3.614   -5.193  -11.330 1.00 0.00 ? 385 CYS A C    6  
ATOM   7078  O  O    . CYS A 1 78 ? 4.596   -5.658  -11.909 1.00 0.00 ? 385 CYS A O    6  
ATOM   7079  C  CB   . CYS A 1 78 ? 3.254   -2.686  -11.356 1.00 0.00 ? 385 CYS A CB   6  
ATOM   7080  S  SG   . CYS A 1 78 ? 4.394   -2.138  -12.659 1.00 0.00 ? 385 CYS A SG   6  
ATOM   7081  H  H    . CYS A 1 78 ? 5.625   -2.943  -10.379 1.00 0.00 ? 385 CYS A H    6  
ATOM   7082  H  HA   . CYS A 1 78 ? 3.109   -3.982  -9.652  1.00 0.00 ? 385 CYS A HA   6  
ATOM   7083  H  HB2  . CYS A 1 78 ? 2.321   -2.941  -11.834 1.00 0.00 ? 385 CYS A HB2  6  
ATOM   7084  H  HB3  . CYS A 1 78 ? 3.089   -1.850  -10.692 1.00 0.00 ? 385 CYS A HB3  6  
ATOM   7085  N  N    . ASP A 1 79 ? 2.416   -5.773  -11.353 1.00 0.00 ? 386 ASP A N    6  
ATOM   7086  C  CA   . ASP A 1 79 ? 2.194   -7.077  -11.991 1.00 0.00 ? 386 ASP A CA   6  
ATOM   7087  C  C    . ASP A 1 79 ? 2.544   -7.042  -13.478 1.00 0.00 ? 386 ASP A C    6  
ATOM   7088  O  O    . ASP A 1 79 ? 2.953   -8.052  -14.050 1.00 0.00 ? 386 ASP A O    6  
ATOM   7089  C  CB   . ASP A 1 79 ? 0.737   -7.527  -11.816 1.00 0.00 ? 386 ASP A CB   6  
ATOM   7090  C  CG   . ASP A 1 79 ? -0.218  -6.782  -12.729 1.00 0.00 ? 386 ASP A CG   6  
ATOM   7091  O  OD1  . ASP A 1 79 ? -0.365  -5.552  -12.566 1.00 0.00 ? 386 ASP A OD1  6  
ATOM   7092  O  OD2  . ASP A 1 79 ? -0.811  -7.422  -13.623 1.00 0.00 ? 386 ASP A OD2  6  
ATOM   7093  H  H    . ASP A 1 79 ? 1.656   -5.316  -10.926 1.00 0.00 ? 386 ASP A H    6  
ATOM   7094  H  HA   . ASP A 1 79 ? 2.839   -7.793  -11.503 1.00 0.00 ? 386 ASP A HA   6  
ATOM   7095  H  HB2  . ASP A 1 79 ? 0.664   -8.590  -12.046 1.00 0.00 ? 386 ASP A HB2  6  
ATOM   7096  H  HB3  . ASP A 1 79 ? 0.434   -7.346  -10.784 1.00 0.00 ? 386 ASP A HB3  6  
ATOM   7097  N  N    . VAL A 1 80 ? 2.389   -5.878  -14.098 1.00 0.00 ? 387 VAL A N    6  
ATOM   7098  C  CA   . VAL A 1 80 ? 2.713   -5.716  -15.511 1.00 0.00 ? 387 VAL A CA   6  
ATOM   7099  C  C    . VAL A 1 80 ? 4.190   -5.386  -15.715 1.00 0.00 ? 387 VAL A C    6  
ATOM   7100  O  O    . VAL A 1 80 ? 4.641   -5.191  -16.843 1.00 0.00 ? 387 VAL A O    6  
ATOM   7101  C  CB   . VAL A 1 80 ? 1.852   -4.618  -16.174 1.00 0.00 ? 387 VAL A CB   6  
ATOM   7102  C  CG1  . VAL A 1 80 ? 0.382   -5.006  -16.164 1.00 0.00 ? 387 VAL A CG1  6  
ATOM   7103  C  CG2  . VAL A 1 80 ? 2.059   -3.274  -15.486 1.00 0.00 ? 387 VAL A CG2  6  
ATOM   7104  H  H    . VAL A 1 80 ? 2.024   -5.119  -13.600 1.00 0.00 ? 387 VAL A H    6  
ATOM   7105  H  HA   . VAL A 1 80 ? 2.500   -6.653  -16.002 1.00 0.00 ? 387 VAL A HA   6  
ATOM   7106  H  HB   . VAL A 1 80 ? 2.166   -4.522  -17.204 1.00 0.00 ? 387 VAL A HB   6  
ATOM   7107  H  HG11 . VAL A 1 80 ? 0.250   -5.934  -16.699 1.00 0.00 ? 387 VAL A HG11 6  
ATOM   7108  H  HG12 . VAL A 1 80 ? -0.198  -4.229  -16.639 1.00 0.00 ? 387 VAL A HG12 6  
ATOM   7109  H  HG13 . VAL A 1 80 ? 0.050   -5.129  -15.143 1.00 0.00 ? 387 VAL A HG13 6  
ATOM   7110  H  HG21 . VAL A 1 80 ? 1.427   -2.531  -15.949 1.00 0.00 ? 387 VAL A HG21 6  
ATOM   7111  H  HG22 . VAL A 1 80 ? 3.093   -2.976  -15.581 1.00 0.00 ? 387 VAL A HG22 6  
ATOM   7112  H  HG23 . VAL A 1 80 ? 1.805   -3.363  -14.439 1.00 0.00 ? 387 VAL A HG23 6  
ATOM   7113  N  N    . HIS A 1 81 ? 4.940   -5.315  -14.621 1.00 0.00 ? 388 HIS A N    6  
ATOM   7114  C  CA   . HIS A 1 81 ? 6.370   -5.053  -14.698 1.00 0.00 ? 388 HIS A CA   6  
ATOM   7115  C  C    . HIS A 1 81 ? 7.103   -6.363  -14.924 1.00 0.00 ? 388 HIS A C    6  
ATOM   7116  O  O    . HIS A 1 81 ? 8.136   -6.412  -15.584 1.00 0.00 ? 388 HIS A O    6  
ATOM   7117  C  CB   . HIS A 1 81 ? 6.876   -4.389  -13.416 1.00 0.00 ? 388 HIS A CB   6  
ATOM   7118  C  CG   . HIS A 1 81 ? 8.133   -3.603  -13.612 1.00 0.00 ? 388 HIS A CG   6  
ATOM   7119  N  ND1  . HIS A 1 81 ? 8.240   -2.266  -13.268 1.00 0.00 ? 388 HIS A ND1  6  
ATOM   7120  C  CD2  . HIS A 1 81 ? 9.335   -3.960  -14.124 1.00 0.00 ? 388 HIS A CD2  6  
ATOM   7121  C  CE1  . HIS A 1 81 ? 9.462   -1.845  -13.576 1.00 0.00 ? 388 HIS A CE1  6  
ATOM   7122  N  NE2  . HIS A 1 81 ? 10.140  -2.850  -14.093 1.00 0.00 ? 388 HIS A NE2  6  
ATOM   7123  H  H    . HIS A 1 81 ? 4.522   -5.459  -13.744 1.00 0.00 ? 388 HIS A H    6  
ATOM   7124  H  HA   . HIS A 1 81 ? 6.548   -4.398  -15.536 1.00 0.00 ? 388 HIS A HA   6  
ATOM   7125  H  HB2  . HIS A 1 81 ? 6.118   -3.717  -13.040 1.00 0.00 ? 388 HIS A HB2  6  
ATOM   7126  H  HB3  . HIS A 1 81 ? 7.071   -5.153  -12.678 1.00 0.00 ? 388 HIS A HB3  6  
ATOM   7127  H  HD2  . HIS A 1 81 ? 9.609   -4.939  -14.490 1.00 0.00 ? 388 HIS A HD2  6  
ATOM   7128  H  HE1  . HIS A 1 81 ? 9.841   -0.848  -13.420 1.00 0.00 ? 388 HIS A HE1  6  
ATOM   7129  H  HE2  . HIS A 1 81 ? 10.961  -2.744  -14.629 1.00 0.00 ? 388 HIS A HE2  6  
ATOM   7130  N  N    . THR A 1 82 ? 6.552   -7.420  -14.358 1.00 0.00 ? 389 THR A N    6  
ATOM   7131  C  CA   . THR A 1 82 ? 7.048   -8.759  -14.589 1.00 0.00 ? 389 THR A CA   6  
ATOM   7132  C  C    . THR A 1 82 ? 6.212   -9.397  -15.689 1.00 0.00 ? 389 THR A C    6  
ATOM   7133  O  O    . THR A 1 82 ? 5.086   -8.953  -15.904 1.00 0.00 ? 389 THR A O    6  
ATOM   7134  C  CB   . THR A 1 82 ? 6.967   -9.601  -13.301 1.00 0.00 ? 389 THR A CB   6  
ATOM   7135  O  OG1  . THR A 1 82 ? 5.676   -9.443  -12.697 1.00 0.00 ? 389 THR A OG1  6  
ATOM   7136  C  CG2  . THR A 1 82 ? 8.049   -9.185  -12.315 1.00 0.00 ? 389 THR A CG2  6  
ATOM   7137  H  H    . THR A 1 82 ? 5.769   -7.299  -13.778 1.00 0.00 ? 389 THR A H    6  
ATOM   7138  H  HA   . THR A 1 82 ? 8.079   -8.696  -14.906 1.00 0.00 ? 389 THR A HA   6  
ATOM   7139  H  HB   . THR A 1 82 ? 7.112   -10.639 -13.555 1.00 0.00 ? 389 THR A HB   6  
ATOM   7140  H  HG1  . THR A 1 82 ? 4.996   -9.699  -13.331 1.00 0.00 ? 389 THR A HG1  6  
ATOM   7141  H  HG21 . THR A 1 82 ? 9.020   -9.356  -12.757 1.00 0.00 ? 389 THR A HG21 6  
ATOM   7142  H  HG22 . THR A 1 82 ? 7.957   -9.768  -11.411 1.00 0.00 ? 389 THR A HG22 6  
ATOM   7143  H  HG23 . THR A 1 82 ? 7.940   -8.136  -12.081 1.00 0.00 ? 389 THR A HG23 6  
ATOM   7144  N  N    . PRO A 1 83 ? 6.752   -10.418 -16.400 1.00 0.00 ? 390 PRO A N    6  
ATOM   7145  C  CA   . PRO A 1 83 ? 6.077   -11.101 -17.513 1.00 0.00 ? 390 PRO A CA   6  
ATOM   7146  C  C    . PRO A 1 83 ? 4.548   -11.100 -17.411 1.00 0.00 ? 390 PRO A C    6  
ATOM   7147  O  O    . PRO A 1 83 ? 3.963   -11.906 -16.687 1.00 0.00 ? 390 PRO A O    6  
ATOM   7148  C  CB   . PRO A 1 83 ? 6.628   -12.516 -17.389 1.00 0.00 ? 390 PRO A CB   6  
ATOM   7149  C  CG   . PRO A 1 83 ? 8.031   -12.334 -16.897 1.00 0.00 ? 390 PRO A CG   6  
ATOM   7150  C  CD   . PRO A 1 83 ? 8.083   -11.007 -16.168 1.00 0.00 ? 390 PRO A CD   6  
ATOM   7151  H  HA   . PRO A 1 83 ? 6.370   -10.692 -18.469 1.00 0.00 ? 390 PRO A HA   6  
ATOM   7152  H  HB2  . PRO A 1 83 ? 6.031   -13.077 -16.686 1.00 0.00 ? 390 PRO A HB2  6  
ATOM   7153  H  HB3  . PRO A 1 83 ? 6.608   -13.001 -18.354 1.00 0.00 ? 390 PRO A HB3  6  
ATOM   7154  H  HG2  . PRO A 1 83 ? 8.286   -13.138 -16.221 1.00 0.00 ? 390 PRO A HG2  6  
ATOM   7155  H  HG3  . PRO A 1 83 ? 8.712   -12.326 -17.736 1.00 0.00 ? 390 PRO A HG3  6  
ATOM   7156  H  HD2  . PRO A 1 83 ? 8.257   -11.165 -15.115 1.00 0.00 ? 390 PRO A HD2  6  
ATOM   7157  H  HD3  . PRO A 1 83 ? 8.858   -10.381 -16.587 1.00 0.00 ? 390 PRO A HD3  6  
ATOM   7158  N  N    . PRO A 1 84 ? 3.890   -10.152 -18.106 1.00 0.00 ? 391 PRO A N    6  
ATOM   7159  C  CA   . PRO A 1 84 ? 2.429   -10.028 -18.085 1.00 0.00 ? 391 PRO A CA   6  
ATOM   7160  C  C    . PRO A 1 84 ? 1.769   -11.115 -18.914 1.00 0.00 ? 391 PRO A C    6  
ATOM   7161  O  O    . PRO A 1 84 ? 0.707   -11.633 -18.567 1.00 0.00 ? 391 PRO A O    6  
ATOM   7162  C  CB   . PRO A 1 84 ? 2.185   -8.652  -18.706 1.00 0.00 ? 391 PRO A CB   6  
ATOM   7163  C  CG   . PRO A 1 84 ? 3.361   -8.416  -19.592 1.00 0.00 ? 391 PRO A CG   6  
ATOM   7164  C  CD   . PRO A 1 84 ? 4.524   -9.116  -18.945 1.00 0.00 ? 391 PRO A CD   6  
ATOM   7165  H  HA   . PRO A 1 84 ? 2.041   -10.051 -17.077 1.00 0.00 ? 391 PRO A HA   6  
ATOM   7166  H  HB2  . PRO A 1 84 ? 1.262   -8.666  -19.266 1.00 0.00 ? 391 PRO A HB2  6  
ATOM   7167  H  HB3  . PRO A 1 84 ? 2.127   -7.911  -17.928 1.00 0.00 ? 391 PRO A HB3  6  
ATOM   7168  H  HG2  . PRO A 1 84 ? 3.172   -8.833  -20.571 1.00 0.00 ? 391 PRO A HG2  6  
ATOM   7169  H  HG3  . PRO A 1 84 ? 3.557   -7.356  -19.667 1.00 0.00 ? 391 PRO A HG3  6  
ATOM   7170  H  HD2  . PRO A 1 84 ? 5.156   -9.565  -19.697 1.00 0.00 ? 391 PRO A HD2  6  
ATOM   7171  H  HD3  . PRO A 1 84 ? 5.089   -8.422  -18.340 1.00 0.00 ? 391 PRO A HD3  6  
ATOM   7172  N  N    . GLY A 1 85 ? 2.421   -11.460 -20.003 1.00 0.00 ? 392 GLY A N    6  
ATOM   7173  C  CA   . GLY A 1 85 ? 1.944   -12.506 -20.871 1.00 0.00 ? 392 GLY A CA   6  
ATOM   7174  C  C    . GLY A 1 85 ? 3.089   -13.325 -21.412 1.00 0.00 ? 392 GLY A C    6  
ATOM   7175  O  O    . GLY A 1 85 ? 4.210   -13.217 -20.910 1.00 0.00 ? 392 GLY A O    6  
ATOM   7176  H  H    . GLY A 1 85 ? 3.258   -10.997 -20.219 1.00 0.00 ? 392 GLY A H    6  
ATOM   7177  H  HA2  . GLY A 1 85 ? 1.277   -13.148 -20.313 1.00 0.00 ? 392 GLY A HA2  6  
ATOM   7178  H  HA3  . GLY A 1 85 ? 1.403   -12.067 -21.694 1.00 0.00 ? 392 GLY A HA3  6  
ATOM   7179  N  N    . SER A 1 86 ? 2.814   -14.110 -22.447 1.00 0.00 ? 393 SER A N    6  
ATOM   7180  C  CA   . SER A 1 86 ? 3.793   -15.017 -23.041 1.00 0.00 ? 393 SER A CA   6  
ATOM   7181  C  C    . SER A 1 86 ? 4.138   -16.150 -22.076 1.00 0.00 ? 393 SER A C    6  
ATOM   7182  O  O    . SER A 1 86 ? 3.716   -17.292 -22.274 1.00 0.00 ? 393 SER A O    6  
ATOM   7183  C  CB   . SER A 1 86 ? 5.057   -14.264 -23.469 1.00 0.00 ? 393 SER A CB   6  
ATOM   7184  O  OG   . SER A 1 86 ? 4.739   -13.184 -24.331 1.00 0.00 ? 393 SER A OG   6  
ATOM   7185  H  H    . SER A 1 86 ? 1.911   -14.083 -22.828 1.00 0.00 ? 393 SER A H    6  
ATOM   7186  H  HA   . SER A 1 86 ? 3.336   -15.450 -23.918 1.00 0.00 ? 393 SER A HA   6  
ATOM   7187  H  HB2  . SER A 1 86 ? 5.554   -13.874 -22.595 1.00 0.00 ? 393 SER A HB2  6  
ATOM   7188  H  HB3  . SER A 1 86 ? 5.719   -14.942 -23.989 1.00 0.00 ? 393 SER A HB3  6  
ATOM   7189  H  HG   . SER A 1 86 ? 4.220   -12.530 -23.847 1.00 0.00 ? 393 SER A HG   6  
ATOM   7190  N  N    . THR A 1 87 ? 4.888   -15.837 -21.031 1.00 0.00 ? 394 THR A N    6  
ATOM   7191  C  CA   . THR A 1 87 ? 5.263   -16.819 -20.030 1.00 0.00 ? 394 THR A CA   6  
ATOM   7192  C  C    . THR A 1 87 ? 5.577   -16.116 -18.713 1.00 0.00 ? 394 THR A C    6  
ATOM   7193  O  O    . THR A 1 87 ? 4.689   -16.068 -17.840 1.00 0.00 ? 394 THR A O    6  
ATOM   7194  C  CB   . THR A 1 87 ? 6.487   -17.650 -20.476 1.00 0.00 ? 394 THR A CB   6  
ATOM   7195  O  OG1  . THR A 1 87 ? 6.268   -18.186 -21.790 1.00 0.00 ? 394 THR A OG1  6  
ATOM   7196  C  CG2  . THR A 1 87 ? 6.751   -18.792 -19.504 1.00 0.00 ? 394 THR A CG2  6  
ATOM   7197  O  OXT  . THR A 1 87 ? 6.703   -15.595 -18.576 1.00 0.00 ? 394 THR A OXT  6  
ATOM   7198  H  H    . THR A 1 87 ? 5.192   -14.904 -20.916 1.00 0.00 ? 394 THR A H    6  
ATOM   7199  H  HA   . THR A 1 87 ? 4.425   -17.487 -19.882 1.00 0.00 ? 394 THR A HA   6  
ATOM   7200  H  HB   . THR A 1 87 ? 7.353   -17.005 -20.494 1.00 0.00 ? 394 THR A HB   6  
ATOM   7201  H  HG1  . THR A 1 87 ? 5.342   -18.044 -22.036 1.00 0.00 ? 394 THR A HG1  6  
ATOM   7202  H  HG21 . THR A 1 87 ? 6.942   -18.389 -18.522 1.00 0.00 ? 394 THR A HG21 6  
ATOM   7203  H  HG22 . THR A 1 87 ? 7.611   -19.355 -19.838 1.00 0.00 ? 394 THR A HG22 6  
ATOM   7204  H  HG23 . THR A 1 87 ? 5.888   -19.441 -19.465 1.00 0.00 ? 394 THR A HG23 6  
HETATM 7205  ZN ZN   . ZN  B 2 .  ? -6.589  -1.108  -6.123  1.00 0.00 ? 401 ZN  A ZN   6  
HETATM 7206  ZN ZN   . ZN  C 2 .  ? 6.444   -1.022  -12.941 1.00 0.00 ? 402 ZN  A ZN   6  
ATOM   7207  N  N    . MET A 1 9  ? 14.474  28.522  -4.428  1.00 0.00 ? 316 MET A N    7  
ATOM   7208  C  CA   . MET A 1 9  ? 14.232  27.519  -3.368  1.00 0.00 ? 316 MET A CA   7  
ATOM   7209  C  C    . MET A 1 9  ? 12.743  27.292  -3.157  1.00 0.00 ? 316 MET A C    7  
ATOM   7210  O  O    . MET A 1 9  ? 12.010  28.199  -2.759  1.00 0.00 ? 316 MET A O    7  
ATOM   7211  C  CB   . MET A 1 9  ? 14.888  27.946  -2.055  1.00 0.00 ? 316 MET A CB   7  
ATOM   7212  C  CG   . MET A 1 9  ? 16.358  27.580  -1.969  1.00 0.00 ? 316 MET A CG   7  
ATOM   7213  S  SD   . MET A 1 9  ? 16.618  25.798  -2.059  1.00 0.00 ? 316 MET A SD   7  
ATOM   7214  C  CE   . MET A 1 9  ? 18.404  25.714  -2.007  1.00 0.00 ? 316 MET A CE   7  
ATOM   7215  H  H    . MET A 1 9  ? 14.087  28.185  -5.332  1.00 0.00 ? 316 MET A H    7  
ATOM   7216  H  HA   . MET A 1 9  ? 14.674  26.587  -3.688  1.00 0.00 ? 316 MET A HA   7  
ATOM   7217  H  HB2  . MET A 1 9  ? 14.800  29.018  -1.952  1.00 0.00 ? 316 MET A HB2  7  
ATOM   7218  H  HB3  . MET A 1 9  ? 14.373  27.471  -1.233  1.00 0.00 ? 316 MET A HB3  7  
ATOM   7219  H  HG2  . MET A 1 9  ? 16.883  28.050  -2.787  1.00 0.00 ? 316 MET A HG2  7  
ATOM   7220  H  HG3  . MET A 1 9  ? 16.752  27.942  -1.032  1.00 0.00 ? 316 MET A HG3  7  
ATOM   7221  H  HE1  . MET A 1 9  ? 18.813  26.251  -2.850  1.00 0.00 ? 316 MET A HE1  7  
ATOM   7222  H  HE2  . MET A 1 9  ? 18.718  24.682  -2.052  1.00 0.00 ? 316 MET A HE2  7  
ATOM   7223  H  HE3  . MET A 1 9  ? 18.759  26.159  -1.090  1.00 0.00 ? 316 MET A HE3  7  
ATOM   7224  N  N    . ASN A 1 10 ? 12.316  26.071  -3.436  1.00 0.00 ? 317 ASN A N    7  
ATOM   7225  C  CA   . ASN A 1 10 ? 10.932  25.648  -3.258  1.00 0.00 ? 317 ASN A CA   7  
ATOM   7226  C  C    . ASN A 1 10 ? 10.884  24.139  -3.482  1.00 0.00 ? 317 ASN A C    7  
ATOM   7227  O  O    . ASN A 1 10 ? 11.929  23.488  -3.482  1.00 0.00 ? 317 ASN A O    7  
ATOM   7228  C  CB   . ASN A 1 10 ? 10.004  26.379  -4.244  1.00 0.00 ? 317 ASN A CB   7  
ATOM   7229  C  CG   . ASN A 1 10 ? 8.537   26.327  -3.832  1.00 0.00 ? 317 ASN A CG   7  
ATOM   7230  O  OD1  . ASN A 1 10 ? 7.805   25.408  -4.200  1.00 0.00 ? 317 ASN A OD1  7  
ATOM   7231  N  ND2  . ASN A 1 10 ? 8.099   27.314  -3.071  1.00 0.00 ? 317 ASN A ND2  7  
ATOM   7232  H  H    . ASN A 1 10 ? 12.962  25.414  -3.778  1.00 0.00 ? 317 ASN A H    7  
ATOM   7233  H  HA   . ASN A 1 10 ? 10.636  25.869  -2.243  1.00 0.00 ? 317 ASN A HA   7  
ATOM   7234  H  HB2  . ASN A 1 10 ? 10.301  27.415  -4.306  1.00 0.00 ? 317 ASN A HB2  7  
ATOM   7235  H  HB3  . ASN A 1 10 ? 10.099  25.925  -5.220  1.00 0.00 ? 317 ASN A HB3  7  
ATOM   7236  H  HD21 . ASN A 1 10 ? 8.731   28.021  -2.815  1.00 0.00 ? 317 ASN A HD21 7  
ATOM   7237  H  HD22 . ASN A 1 10 ? 7.157   27.306  -2.797  1.00 0.00 ? 317 ASN A HD22 7  
ATOM   7238  N  N    . ILE A 1 11 ? 9.702   23.580  -3.668  1.00 0.00 ? 318 ILE A N    7  
ATOM   7239  C  CA   . ILE A 1 11 ? 9.577   22.164  -3.970  1.00 0.00 ? 318 ILE A CA   7  
ATOM   7240  C  C    . ILE A 1 11 ? 9.079   21.992  -5.403  1.00 0.00 ? 318 ILE A C    7  
ATOM   7241  O  O    . ILE A 1 11 ? 7.873   22.019  -5.657  1.00 0.00 ? 318 ILE A O    7  
ATOM   7242  C  CB   . ILE A 1 11 ? 8.623   21.422  -2.994  1.00 0.00 ? 318 ILE A CB   7  
ATOM   7243  C  CG1  . ILE A 1 11 ? 9.091   21.552  -1.538  1.00 0.00 ? 318 ILE A CG1  7  
ATOM   7244  C  CG2  . ILE A 1 11 ? 8.521   19.950  -3.365  1.00 0.00 ? 318 ILE A CG2  7  
ATOM   7245  C  CD1  . ILE A 1 11 ? 8.730   22.868  -0.882  1.00 0.00 ? 318 ILE A CD1  7  
ATOM   7246  H  H    . ILE A 1 11 ? 8.889   24.133  -3.620  1.00 0.00 ? 318 ILE A H    7  
ATOM   7247  H  HA   . ILE A 1 11 ? 10.561  21.720  -3.888  1.00 0.00 ? 318 ILE A HA   7  
ATOM   7248  H  HB   . ILE A 1 11 ? 7.640   21.859  -3.088  1.00 0.00 ? 318 ILE A HB   7  
ATOM   7249  H  HG12 . ILE A 1 11 ? 8.642   20.762  -0.954  1.00 0.00 ? 318 ILE A HG12 7  
ATOM   7250  H  HG13 . ILE A 1 11 ? 10.165  21.449  -1.504  1.00 0.00 ? 318 ILE A HG13 7  
ATOM   7251  H  HG21 . ILE A 1 11 ? 7.851   19.452  -2.680  1.00 0.00 ? 318 ILE A HG21 7  
ATOM   7252  H  HG22 . ILE A 1 11 ? 9.499   19.496  -3.308  1.00 0.00 ? 318 ILE A HG22 7  
ATOM   7253  H  HG23 . ILE A 1 11 ? 8.139   19.858  -4.372  1.00 0.00 ? 318 ILE A HG23 7  
ATOM   7254  H  HD11 . ILE A 1 11 ? 9.104   22.880  0.132   1.00 0.00 ? 318 ILE A HD11 7  
ATOM   7255  H  HD12 . ILE A 1 11 ? 7.655   22.982  -0.870  1.00 0.00 ? 318 ILE A HD12 7  
ATOM   7256  H  HD13 . ILE A 1 11 ? 9.171   23.682  -1.438  1.00 0.00 ? 318 ILE A HD13 7  
ATOM   7257  N  N    . PRO A 1 12 ? 10.010  21.875  -6.369  1.00 0.00 ? 319 PRO A N    7  
ATOM   7258  C  CA   . PRO A 1 12 ? 9.665   21.686  -7.782  1.00 0.00 ? 319 PRO A CA   7  
ATOM   7259  C  C    . PRO A 1 12 ? 8.799   20.440  -8.045  1.00 0.00 ? 319 PRO A C    7  
ATOM   7260  O  O    . PRO A 1 12 ? 7.759   20.558  -8.695  1.00 0.00 ? 319 PRO A O    7  
ATOM   7261  C  CB   . PRO A 1 12 ? 11.024  21.587  -8.490  1.00 0.00 ? 319 PRO A CB   7  
ATOM   7262  C  CG   . PRO A 1 12 ? 11.997  22.215  -7.550  1.00 0.00 ? 319 PRO A CG   7  
ATOM   7263  C  CD   . PRO A 1 12 ? 11.469  21.955  -6.166  1.00 0.00 ? 319 PRO A CD   7  
ATOM   7264  H  HA   . PRO A 1 12 ? 9.138   22.550  -8.159  1.00 0.00 ? 319 PRO A HA   7  
ATOM   7265  H  HB2  . PRO A 1 12 ? 11.264  20.551  -8.675  1.00 0.00 ? 319 PRO A HB2  7  
ATOM   7266  H  HB3  . PRO A 1 12 ? 10.982  22.121  -9.428  1.00 0.00 ? 319 PRO A HB3  7  
ATOM   7267  H  HG2  . PRO A 1 12 ? 12.970  21.760  -7.670  1.00 0.00 ? 319 PRO A HG2  7  
ATOM   7268  H  HG3  . PRO A 1 12 ? 12.053  23.277  -7.736  1.00 0.00 ? 319 PRO A HG3  7  
ATOM   7269  H  HD2  . PRO A 1 12 ? 11.857  21.024  -5.782  1.00 0.00 ? 319 PRO A HD2  7  
ATOM   7270  H  HD3  . PRO A 1 12 ? 11.721  22.772  -5.507  1.00 0.00 ? 319 PRO A HD3  7  
ATOM   7271  N  N    . PRO A 1 13 ? 9.179   19.229  -7.551  1.00 0.00 ? 320 PRO A N    7  
ATOM   7272  C  CA   . PRO A 1 13 ? 8.366   18.029  -7.752  1.00 0.00 ? 320 PRO A CA   7  
ATOM   7273  C  C    . PRO A 1 13 ? 7.092   18.073  -6.919  1.00 0.00 ? 320 PRO A C    7  
ATOM   7274  O  O    . PRO A 1 13 ? 7.120   17.883  -5.701  1.00 0.00 ? 320 PRO A O    7  
ATOM   7275  C  CB   . PRO A 1 13 ? 9.271   16.873  -7.294  1.00 0.00 ? 320 PRO A CB   7  
ATOM   7276  C  CG   . PRO A 1 13 ? 10.623  17.473  -7.113  1.00 0.00 ? 320 PRO A CG   7  
ATOM   7277  C  CD   . PRO A 1 13 ? 10.388  18.913  -6.774  1.00 0.00 ? 320 PRO A CD   7  
ATOM   7278  H  HA   . PRO A 1 13 ? 8.107   17.898  -8.793  1.00 0.00 ? 320 PRO A HA   7  
ATOM   7279  H  HB2  . PRO A 1 13 ? 8.894   16.466  -6.366  1.00 0.00 ? 320 PRO A HB2  7  
ATOM   7280  H  HB3  . PRO A 1 13 ? 9.282   16.102  -8.050  1.00 0.00 ? 320 PRO A HB3  7  
ATOM   7281  H  HG2  . PRO A 1 13 ? 11.140  16.977  -6.306  1.00 0.00 ? 320 PRO A HG2  7  
ATOM   7282  H  HG3  . PRO A 1 13 ? 11.188  17.390  -8.030  1.00 0.00 ? 320 PRO A HG3  7  
ATOM   7283  H  HD2  . PRO A 1 13 ? 10.206  19.029  -5.710  1.00 0.00 ? 320 PRO A HD2  7  
ATOM   7284  H  HD3  . PRO A 1 13 ? 11.226  19.521  -7.094  1.00 0.00 ? 320 PRO A HD3  7  
ATOM   7285  N  N    . ALA A 1 14 ? 5.977   18.323  -7.582  1.00 0.00 ? 321 ALA A N    7  
ATOM   7286  C  CA   . ALA A 1 14 ? 4.703   18.481  -6.911  1.00 0.00 ? 321 ALA A CA   7  
ATOM   7287  C  C    . ALA A 1 14 ? 3.702   17.536  -7.535  1.00 0.00 ? 321 ALA A C    7  
ATOM   7288  O  O    . ALA A 1 14 ? 2.536   17.883  -7.733  1.00 0.00 ? 321 ALA A O    7  
ATOM   7289  C  CB   . ALA A 1 14 ? 4.228   19.923  -7.014  1.00 0.00 ? 321 ALA A CB   7  
ATOM   7290  H  H    . ALA A 1 14 ? 6.004   18.380  -8.562  1.00 0.00 ? 321 ALA A H    7  
ATOM   7291  H  HA   . ALA A 1 14 ? 4.833   18.231  -5.869  1.00 0.00 ? 321 ALA A HA   7  
ATOM   7292  H  HB1  . ALA A 1 14 ? 4.118   20.192  -8.054  1.00 0.00 ? 321 ALA A HB1  7  
ATOM   7293  H  HB2  . ALA A 1 14 ? 4.950   20.575  -6.546  1.00 0.00 ? 321 ALA A HB2  7  
ATOM   7294  H  HB3  . ALA A 1 14 ? 3.276   20.023  -6.514  1.00 0.00 ? 321 ALA A HB3  7  
ATOM   7295  N  N    . ARG A 1 15 ? 4.183   16.336  -7.839  1.00 0.00 ? 322 ARG A N    7  
ATOM   7296  C  CA   . ARG A 1 15 ? 3.388   15.336  -8.525  1.00 0.00 ? 322 ARG A CA   7  
ATOM   7297  C  C    . ARG A 1 15 ? 2.128   15.018  -7.727  1.00 0.00 ? 322 ARG A C    7  
ATOM   7298  O  O    . ARG A 1 15 ? 1.038   15.452  -8.084  1.00 0.00 ? 322 ARG A O    7  
ATOM   7299  C  CB   . ARG A 1 15 ? 4.218   14.065  -8.747  1.00 0.00 ? 322 ARG A CB   7  
ATOM   7300  C  CG   . ARG A 1 15 ? 3.524   13.003  -9.590  1.00 0.00 ? 322 ARG A CG   7  
ATOM   7301  C  CD   . ARG A 1 15 ? 4.428   11.799  -9.831  1.00 0.00 ? 322 ARG A CD   7  
ATOM   7302  N  NE   . ARG A 1 15 ? 5.713   12.186  -10.421 1.00 0.00 ? 322 ARG A NE   7  
ATOM   7303  C  CZ   . ARG A 1 15 ? 6.392   11.454  -11.307 1.00 0.00 ? 322 ARG A CZ   7  
ATOM   7304  N  NH1  . ARG A 1 15 ? 5.915   10.291  -11.737 1.00 0.00 ? 322 ARG A NH1  7  
ATOM   7305  N  NH2  . ARG A 1 15 ? 7.556   11.896  -11.764 1.00 0.00 ? 322 ARG A NH2  7  
ATOM   7306  H  H    . ARG A 1 15 ? 5.105   16.117  -7.585  1.00 0.00 ? 322 ARG A H    7  
ATOM   7307  H  HA   . ARG A 1 15 ? 3.110   15.750  -9.482  1.00 0.00 ? 322 ARG A HA   7  
ATOM   7308  H  HB2  . ARG A 1 15 ? 5.139   14.335  -9.241  1.00 0.00 ? 322 ARG A HB2  7  
ATOM   7309  H  HB3  . ARG A 1 15 ? 4.453   13.633  -7.786  1.00 0.00 ? 322 ARG A HB3  7  
ATOM   7310  H  HG2  . ARG A 1 15 ? 2.635   12.674  -9.072  1.00 0.00 ? 322 ARG A HG2  7  
ATOM   7311  H  HG3  . ARG A 1 15 ? 3.248   13.434  -10.541 1.00 0.00 ? 322 ARG A HG3  7  
ATOM   7312  H  HD2  . ARG A 1 15 ? 4.611   11.308  -8.888  1.00 0.00 ? 322 ARG A HD2  7  
ATOM   7313  H  HD3  . ARG A 1 15 ? 3.927   11.117  -10.500 1.00 0.00 ? 322 ARG A HD3  7  
ATOM   7314  H  HE   . ARG A 1 15 ? 6.095   13.047  -10.134 1.00 0.00 ? 322 ARG A HE   7  
ATOM   7315  H  HH11 . ARG A 1 15 ? 5.037   9.950   -11.400 1.00 0.00 ? 322 ARG A HH11 7  
ATOM   7316  H  HH12 . ARG A 1 15 ? 6.434   9.746   -12.406 1.00 0.00 ? 322 ARG A HH12 7  
ATOM   7317  H  HH21 . ARG A 1 15 ? 7.923   12.774  -11.442 1.00 0.00 ? 322 ARG A HH21 7  
ATOM   7318  H  HH22 . ARG A 1 15 ? 8.073   11.361  -12.439 1.00 0.00 ? 322 ARG A HH22 7  
ATOM   7319  N  N    . TRP A 1 16 ? 2.316   14.310  -6.609  1.00 0.00 ? 323 TRP A N    7  
ATOM   7320  C  CA   . TRP A 1 16 ? 1.235   13.881  -5.734  1.00 0.00 ? 323 TRP A CA   7  
ATOM   7321  C  C    . TRP A 1 16 ? 0.030   13.391  -6.523  1.00 0.00 ? 323 TRP A C    7  
ATOM   7322  O  O    . TRP A 1 16 ? -1.124  13.673  -6.197  1.00 0.00 ? 323 TRP A O    7  
ATOM   7323  C  CB   . TRP A 1 16 ? 0.886   15.045  -4.837  1.00 0.00 ? 323 TRP A CB   7  
ATOM   7324  C  CG   . TRP A 1 16 ? 2.010   15.449  -3.934  1.00 0.00 ? 323 TRP A CG   7  
ATOM   7325  C  CD1  . TRP A 1 16 ? 3.192   16.005  -4.323  1.00 0.00 ? 323 TRP A CD1  7  
ATOM   7326  C  CD2  . TRP A 1 16 ? 2.063   15.339  -2.510  1.00 0.00 ? 323 TRP A CD2  7  
ATOM   7327  N  NE1  . TRP A 1 16 ? 3.985   16.245  -3.228  1.00 0.00 ? 323 TRP A NE1  7  
ATOM   7328  C  CE2  . TRP A 1 16 ? 3.313   15.850  -2.101  1.00 0.00 ? 323 TRP A CE2  7  
ATOM   7329  C  CE3  . TRP A 1 16 ? 1.178   14.865  -1.538  1.00 0.00 ? 323 TRP A CE3  7  
ATOM   7330  C  CZ2  . TRP A 1 16 ? 3.698   15.893  -0.762  1.00 0.00 ? 323 TRP A CZ2  7  
ATOM   7331  C  CZ3  . TRP A 1 16 ? 1.563   14.908  -0.211  1.00 0.00 ? 323 TRP A CZ3  7  
ATOM   7332  C  CH2  . TRP A 1 16 ? 2.810   15.422  0.166   1.00 0.00 ? 323 TRP A CH2  7  
ATOM   7333  H  H    . TRP A 1 16 ? 3.217   14.141  -6.320  1.00 0.00 ? 323 TRP A H    7  
ATOM   7334  H  HA   . TRP A 1 16 ? 1.603   13.066  -5.137  1.00 0.00 ? 323 TRP A HA   7  
ATOM   7335  H  HB2  . TRP A 1 16 ? 0.668   15.883  -5.469  1.00 0.00 ? 323 TRP A HB2  7  
ATOM   7336  H  HB3  . TRP A 1 16 ? 0.030   14.800  -4.236  1.00 0.00 ? 323 TRP A HB3  7  
ATOM   7337  H  HD1  . TRP A 1 16 ? 3.452   16.208  -5.355  1.00 0.00 ? 323 TRP A HD1  7  
ATOM   7338  H  HE1  . TRP A 1 16 ? 4.883   16.642  -3.249  1.00 0.00 ? 323 TRP A HE1  7  
ATOM   7339  H  HE3  . TRP A 1 16 ? 0.213   14.467  -1.809  1.00 0.00 ? 323 TRP A HE3  7  
ATOM   7340  H  HZ2  . TRP A 1 16 ? 4.655   16.285  -0.455  1.00 0.00 ? 323 TRP A HZ2  7  
ATOM   7341  H  HZ3  . TRP A 1 16 ? 0.892   14.547  0.553   1.00 0.00 ? 323 TRP A HZ3  7  
ATOM   7342  H  HH2  . TRP A 1 16 ? 3.066   15.435  1.215   1.00 0.00 ? 323 TRP A HH2  7  
ATOM   7343  N  N    . LYS A 1 17 ? 0.338   12.610  -7.536  1.00 0.00 ? 324 LYS A N    7  
ATOM   7344  C  CA   . LYS A 1 17 ? -0.641  12.146  -8.502  1.00 0.00 ? 324 LYS A CA   7  
ATOM   7345  C  C    . LYS A 1 17 ? -0.349  10.703  -8.884  1.00 0.00 ? 324 LYS A C    7  
ATOM   7346  O  O    . LYS A 1 17 ? 0.538   10.433  -9.696  1.00 0.00 ? 324 LYS A O    7  
ATOM   7347  C  CB   . LYS A 1 17 ? -0.603  13.037  -9.747  1.00 0.00 ? 324 LYS A CB   7  
ATOM   7348  C  CG   . LYS A 1 17 ? -1.329  14.362  -9.584  1.00 0.00 ? 324 LYS A CG   7  
ATOM   7349  C  CD   . LYS A 1 17 ? -1.067  15.282  -10.763 1.00 0.00 ? 324 LYS A CD   7  
ATOM   7350  C  CE   . LYS A 1 17 ? -1.617  16.677  -10.520 1.00 0.00 ? 324 LYS A CE   7  
ATOM   7351  N  NZ   . LYS A 1 17 ? -1.261  17.608  -11.623 1.00 0.00 ? 324 LYS A NZ   7  
ATOM   7352  H  H    . LYS A 1 17 ? 1.267   12.323  -7.626  1.00 0.00 ? 324 LYS A H    7  
ATOM   7353  H  HA   . LYS A 1 17 ? -1.618  12.203  -8.050  1.00 0.00 ? 324 LYS A HA   7  
ATOM   7354  H  HB2  . LYS A 1 17 ? 0.440   13.260  -9.974  1.00 0.00 ? 324 LYS A HB2  7  
ATOM   7355  H  HB3  . LYS A 1 17 ? -1.052  12.498  -10.578 1.00 0.00 ? 324 LYS A HB3  7  
ATOM   7356  H  HG2  . LYS A 1 17 ? -2.390  14.174  -9.512  1.00 0.00 ? 324 LYS A HG2  7  
ATOM   7357  H  HG3  . LYS A 1 17 ? -0.985  14.842  -8.679  1.00 0.00 ? 324 LYS A HG3  7  
ATOM   7358  H  HD2  . LYS A 1 17 ? -0.001  15.350  -10.924 1.00 0.00 ? 324 LYS A HD2  7  
ATOM   7359  H  HD3  . LYS A 1 17 ? -1.539  14.868  -11.642 1.00 0.00 ? 324 LYS A HD3  7  
ATOM   7360  H  HE2  . LYS A 1 17 ? -2.693  16.619  -10.444 1.00 0.00 ? 324 LYS A HE2  7  
ATOM   7361  H  HE3  . LYS A 1 17 ? -1.211  17.055  -9.595  1.00 0.00 ? 324 LYS A HE3  7  
ATOM   7362  H  HZ1  . LYS A 1 17 ? -1.602  18.567  -11.410 1.00 0.00 ? 324 LYS A HZ1  7  
ATOM   7363  H  HZ2  . LYS A 1 17 ? -1.691  17.290  -12.515 1.00 0.00 ? 324 LYS A HZ2  7  
ATOM   7364  H  HZ3  . LYS A 1 17 ? -0.228  17.642  -11.744 1.00 0.00 ? 324 LYS A HZ3  7  
ATOM   7365  N  N    . LEU A 1 18 ? -1.071  9.780   -8.272  1.00 0.00 ? 325 LEU A N    7  
ATOM   7366  C  CA   . LEU A 1 18 ? -0.867  8.365   -8.528  1.00 0.00 ? 325 LEU A CA   7  
ATOM   7367  C  C    . LEU A 1 18 ? -2.197  7.624   -8.498  1.00 0.00 ? 325 LEU A C    7  
ATOM   7368  O  O    . LEU A 1 18 ? -3.034  7.868   -7.630  1.00 0.00 ? 325 LEU A O    7  
ATOM   7369  C  CB   . LEU A 1 18 ? 0.116   7.748   -7.511  1.00 0.00 ? 325 LEU A CB   7  
ATOM   7370  C  CG   . LEU A 1 18 ? -0.343  7.718   -6.044  1.00 0.00 ? 325 LEU A CG   7  
ATOM   7371  C  CD1  . LEU A 1 18 ? 0.532   6.767   -5.240  1.00 0.00 ? 325 LEU A CD1  7  
ATOM   7372  C  CD2  . LEU A 1 18 ? -0.298  9.108   -5.422  1.00 0.00 ? 325 LEU A CD2  7  
ATOM   7373  H  H    . LEU A 1 18 ? -1.765  10.053  -7.637  1.00 0.00 ? 325 LEU A H    7  
ATOM   7374  H  HA   . LEU A 1 18 ? -0.446  8.271   -9.518  1.00 0.00 ? 325 LEU A HA   7  
ATOM   7375  H  HB2  . LEU A 1 18 ? 0.314   6.722   -7.820  1.00 0.00 ? 325 LEU A HB2  7  
ATOM   7376  H  HB3  . LEU A 1 18 ? 1.045   8.317   -7.560  1.00 0.00 ? 325 LEU A HB3  7  
ATOM   7377  H  HG   . LEU A 1 18 ? -1.360  7.358   -5.996  1.00 0.00 ? 325 LEU A HG   7  
ATOM   7378  H  HD11 . LEU A 1 18 ? 0.206   6.762   -4.210  1.00 0.00 ? 325 LEU A HD11 7  
ATOM   7379  H  HD12 . LEU A 1 18 ? 1.560   7.095   -5.290  1.00 0.00 ? 325 LEU A HD12 7  
ATOM   7380  H  HD13 . LEU A 1 18 ? 0.452   5.771   -5.648  1.00 0.00 ? 325 LEU A HD13 7  
ATOM   7381  H  HD21 . LEU A 1 18 ? -0.612  9.051   -4.391  1.00 0.00 ? 325 LEU A HD21 7  
ATOM   7382  H  HD22 . LEU A 1 18 ? -0.960  9.765   -5.966  1.00 0.00 ? 325 LEU A HD22 7  
ATOM   7383  H  HD23 . LEU A 1 18 ? 0.710   9.491   -5.473  1.00 0.00 ? 325 LEU A HD23 7  
ATOM   7384  N  N    . THR A 1 19 ? -2.402  6.755   -9.472  1.00 0.00 ? 326 THR A N    7  
ATOM   7385  C  CA   . THR A 1 19 ? -3.615  5.965   -9.545  1.00 0.00 ? 326 THR A CA   7  
ATOM   7386  C  C    . THR A 1 19 ? -3.286  4.477   -9.493  1.00 0.00 ? 326 THR A C    7  
ATOM   7387  O  O    . THR A 1 19 ? -2.315  4.026   -10.104 1.00 0.00 ? 326 THR A O    7  
ATOM   7388  C  CB   . THR A 1 19 ? -4.405  6.283   -10.832 1.00 0.00 ? 326 THR A CB   7  
ATOM   7389  O  OG1  . THR A 1 19 ? -4.585  7.702   -10.944 1.00 0.00 ? 326 THR A OG1  7  
ATOM   7390  C  CG2  . THR A 1 19 ? -5.769  5.600   -10.827 1.00 0.00 ? 326 THR A CG2  7  
ATOM   7391  H  H    . THR A 1 19 ? -1.715  6.633   -10.160 1.00 0.00 ? 326 THR A H    7  
ATOM   7392  H  HA   . THR A 1 19 ? -4.233  6.219   -8.694  1.00 0.00 ? 326 THR A HA   7  
ATOM   7393  H  HB   . THR A 1 19 ? -3.840  5.929   -11.682 1.00 0.00 ? 326 THR A HB   7  
ATOM   7394  H  HG1  . THR A 1 19 ? -4.074  8.142   -10.258 1.00 0.00 ? 326 THR A HG1  7  
ATOM   7395  H  HG21 . THR A 1 19 ? -6.298  5.847   -11.735 1.00 0.00 ? 326 THR A HG21 7  
ATOM   7396  H  HG22 . THR A 1 19 ? -6.338  5.938   -9.973  1.00 0.00 ? 326 THR A HG22 7  
ATOM   7397  H  HG23 . THR A 1 19 ? -5.635  4.530   -10.768 1.00 0.00 ? 326 THR A HG23 7  
ATOM   7398  N  N    . CYS A 1 20 ? -4.085  3.727   -8.755  1.00 0.00 ? 327 CYS A N    7  
ATOM   7399  C  CA   . CYS A 1 20 ? -3.918  2.287   -8.659  1.00 0.00 ? 327 CYS A CA   7  
ATOM   7400  C  C    . CYS A 1 20 ? -4.518  1.613   -9.885  1.00 0.00 ? 327 CYS A C    7  
ATOM   7401  O  O    . CYS A 1 20 ? -5.737  1.591   -10.039 1.00 0.00 ? 327 CYS A O    7  
ATOM   7402  C  CB   . CYS A 1 20 ? -4.597  1.778   -7.382  1.00 0.00 ? 327 CYS A CB   7  
ATOM   7403  S  SG   . CYS A 1 20 ? -4.821  -0.021  -7.288  1.00 0.00 ? 327 CYS A SG   7  
ATOM   7404  H  H    . CYS A 1 20 ? -4.814  4.154   -8.264  1.00 0.00 ? 327 CYS A H    7  
ATOM   7405  H  HA   . CYS A 1 20 ? -2.863  2.069   -8.615  1.00 0.00 ? 327 CYS A HA   7  
ATOM   7406  H  HB2  . CYS A 1 20 ? -4.003  2.072   -6.530  1.00 0.00 ? 327 CYS A HB2  7  
ATOM   7407  H  HB3  . CYS A 1 20 ? -5.574  2.233   -7.301  1.00 0.00 ? 327 CYS A HB3  7  
ATOM   7408  N  N    . TYR A 1 21 ? -3.658  1.067   -10.751 1.00 0.00 ? 328 TYR A N    7  
ATOM   7409  C  CA   . TYR A 1 21 ? -4.117  0.439   -11.992 1.00 0.00 ? 328 TYR A CA   7  
ATOM   7410  C  C    . TYR A 1 21 ? -5.045  -0.732  -11.688 1.00 0.00 ? 328 TYR A C    7  
ATOM   7411  O  O    . TYR A 1 21 ? -5.943  -1.052  -12.466 1.00 0.00 ? 328 TYR A O    7  
ATOM   7412  C  CB   . TYR A 1 21 ? -2.932  -0.010  -12.863 1.00 0.00 ? 328 TYR A CB   7  
ATOM   7413  C  CG   . TYR A 1 21 ? -2.091  -1.127  -12.278 1.00 0.00 ? 328 TYR A CG   7  
ATOM   7414  C  CD1  . TYR A 1 21 ? -1.089  -0.861  -11.355 1.00 0.00 ? 328 TYR A CD1  7  
ATOM   7415  C  CD2  . TYR A 1 21 ? -2.293  -2.446  -12.664 1.00 0.00 ? 328 TYR A CD2  7  
ATOM   7416  C  CE1  . TYR A 1 21 ? -0.310  -1.877  -10.836 1.00 0.00 ? 328 TYR A CE1  7  
ATOM   7417  C  CE2  . TYR A 1 21 ? -1.521  -3.467  -12.148 1.00 0.00 ? 328 TYR A CE2  7  
ATOM   7418  C  CZ   . TYR A 1 21 ? -0.530  -3.179  -11.235 1.00 0.00 ? 328 TYR A CZ   7  
ATOM   7419  O  OH   . TYR A 1 21 ? 0.242   -4.199  -10.722 1.00 0.00 ? 328 TYR A OH   7  
ATOM   7420  H  H    . TYR A 1 21 ? -2.694  1.094   -10.554 1.00 0.00 ? 328 TYR A H    7  
ATOM   7421  H  HA   . TYR A 1 21 ? -4.681  1.183   -12.536 1.00 0.00 ? 328 TYR A HA   7  
ATOM   7422  H  HB2  . TYR A 1 21 ? -3.309  -0.352  -13.814 1.00 0.00 ? 328 TYR A HB2  7  
ATOM   7423  H  HB3  . TYR A 1 21 ? -2.282  0.838   -13.029 1.00 0.00 ? 328 TYR A HB3  7  
ATOM   7424  H  HD1  . TYR A 1 21 ? -0.920  0.159   -11.044 1.00 0.00 ? 328 TYR A HD1  7  
ATOM   7425  H  HD2  . TYR A 1 21 ? -3.069  -2.669  -13.380 1.00 0.00 ? 328 TYR A HD2  7  
ATOM   7426  H  HE1  . TYR A 1 21 ? 0.464   -1.648  -10.119 1.00 0.00 ? 328 TYR A HE1  7  
ATOM   7427  H  HE2  . TYR A 1 21 ? -1.693  -4.486  -12.461 1.00 0.00 ? 328 TYR A HE2  7  
ATOM   7428  H  HH   . TYR A 1 21 ? 0.248   -4.931  -11.345 1.00 0.00 ? 328 TYR A HH   7  
ATOM   7429  N  N    . LEU A 1 22 ? -4.829  -1.362  -10.540 1.00 0.00 ? 329 LEU A N    7  
ATOM   7430  C  CA   . LEU A 1 22 ? -5.762  -2.353  -10.032 1.00 0.00 ? 329 LEU A CA   7  
ATOM   7431  C  C    . LEU A 1 22 ? -6.874  -1.637  -9.275  1.00 0.00 ? 329 LEU A C    7  
ATOM   7432  O  O    . LEU A 1 22 ? -6.972  -1.745  -8.037  1.00 0.00 ? 329 LEU A O    7  
ATOM   7433  C  CB   . LEU A 1 22 ? -5.048  -3.364  -9.129  1.00 0.00 ? 329 LEU A CB   7  
ATOM   7434  C  CG   . LEU A 1 22 ? -4.004  -4.239  -9.828  1.00 0.00 ? 329 LEU A CG   7  
ATOM   7435  C  CD1  . LEU A 1 22 ? -3.266  -5.099  -8.816  1.00 0.00 ? 329 LEU A CD1  7  
ATOM   7436  C  CD2  . LEU A 1 22 ? -4.660  -5.114  -10.886 1.00 0.00 ? 329 LEU A CD2  7  
ATOM   7437  H  H    . LEU A 1 22 ? -4.023  -1.152  -10.028 1.00 0.00 ? 329 LEU A H    7  
ATOM   7438  H  HA   . LEU A 1 22 ? -6.193  -2.869  -10.878 1.00 0.00 ? 329 LEU A HA   7  
ATOM   7439  H  HB2  . LEU A 1 22 ? -4.559  -2.821  -8.335  1.00 0.00 ? 329 LEU A HB2  7  
ATOM   7440  H  HB3  . LEU A 1 22 ? -5.793  -4.013  -8.693  1.00 0.00 ? 329 LEU A HB3  7  
ATOM   7441  H  HG   . LEU A 1 22 ? -3.280  -3.604  -10.319 1.00 0.00 ? 329 LEU A HG   7  
ATOM   7442  H  HD11 . LEU A 1 22 ? -3.973  -5.722  -8.290  1.00 0.00 ? 329 LEU A HD11 7  
ATOM   7443  H  HD12 . LEU A 1 22 ? -2.750  -4.464  -8.110  1.00 0.00 ? 329 LEU A HD12 7  
ATOM   7444  H  HD13 . LEU A 1 22 ? -2.549  -5.724  -9.328  1.00 0.00 ? 329 LEU A HD13 7  
ATOM   7445  H  HD21 . LEU A 1 22 ? -5.423  -5.725  -10.426 1.00 0.00 ? 329 LEU A HD21 7  
ATOM   7446  H  HD22 . LEU A 1 22 ? -3.915  -5.750  -11.341 1.00 0.00 ? 329 LEU A HD22 7  
ATOM   7447  H  HD23 . LEU A 1 22 ? -5.109  -4.488  -11.643 1.00 0.00 ? 329 LEU A HD23 7  
ATOM   7448  N  N    . CYS A 1 23 ? -7.618  -0.831  -10.038 1.00 0.00 ? 330 CYS A N    7  
ATOM   7449  C  CA   . CYS A 1 23 ? -8.761  -0.023  -9.590  1.00 0.00 ? 330 CYS A CA   7  
ATOM   7450  C  C    . CYS A 1 23 ? -9.011  1.070   -10.626 1.00 0.00 ? 330 CYS A C    7  
ATOM   7451  O  O    . CYS A 1 23 ? -8.263  1.195   -11.594 1.00 0.00 ? 330 CYS A O    7  
ATOM   7452  C  CB   . CYS A 1 23 ? -8.532  0.658   -8.228  1.00 0.00 ? 330 CYS A CB   7  
ATOM   7453  S  SG   . CYS A 1 23 ? -8.876  -0.371  -6.777  1.00 0.00 ? 330 CYS A SG   7  
ATOM   7454  H  H    . CYS A 1 23 ? -7.372  -0.760  -10.992 1.00 0.00 ? 330 CYS A H    7  
ATOM   7455  H  HA   . CYS A 1 23 ? -9.627  -0.664  -9.534  1.00 0.00 ? 330 CYS A HA   7  
ATOM   7456  H  HB2  . CYS A 1 23 ? -7.501  0.971   -8.163  1.00 0.00 ? 330 CYS A HB2  7  
ATOM   7457  H  HB3  . CYS A 1 23 ? -9.167  1.531   -8.166  1.00 0.00 ? 330 CYS A HB3  7  
ATOM   7458  N  N    . LYS A 1 24 ? -10.057 1.847   -10.422 1.00 0.00 ? 331 LYS A N    7  
ATOM   7459  C  CA   . LYS A 1 24 ? -10.262 3.073   -11.179 1.00 0.00 ? 331 LYS A CA   7  
ATOM   7460  C  C    . LYS A 1 24 ? -10.398 4.211   -10.177 1.00 0.00 ? 331 LYS A C    7  
ATOM   7461  O  O    . LYS A 1 24 ? -10.976 5.262   -10.449 1.00 0.00 ? 331 LYS A O    7  
ATOM   7462  C  CB   . LYS A 1 24 ? -11.507 2.966   -12.070 1.00 0.00 ? 331 LYS A CB   7  
ATOM   7463  C  CG   . LYS A 1 24 ? -11.612 4.068   -13.119 1.00 0.00 ? 331 LYS A CG   7  
ATOM   7464  C  CD   . LYS A 1 24 ? -10.420 4.052   -14.067 1.00 0.00 ? 331 LYS A CD   7  
ATOM   7465  C  CE   . LYS A 1 24 ? -10.535 5.126   -15.138 1.00 0.00 ? 331 LYS A CE   7  
ATOM   7466  N  NZ   . LYS A 1 24 ? -10.558 6.497   -14.561 1.00 0.00 ? 331 LYS A NZ   7  
ATOM   7467  H  H    . LYS A 1 24 ? -10.724 1.586   -9.751  1.00 0.00 ? 331 LYS A H    7  
ATOM   7468  H  HA   . LYS A 1 24 ? -9.388  3.241   -11.791 1.00 0.00 ? 331 LYS A HA   7  
ATOM   7469  H  HB2  . LYS A 1 24 ? -11.488 2.015   -12.581 1.00 0.00 ? 331 LYS A HB2  7  
ATOM   7470  H  HB3  . LYS A 1 24 ? -12.387 3.011   -11.445 1.00 0.00 ? 331 LYS A HB3  7  
ATOM   7471  H  HG2  . LYS A 1 24 ? -12.516 3.925   -13.690 1.00 0.00 ? 331 LYS A HG2  7  
ATOM   7472  H  HG3  . LYS A 1 24 ? -11.648 5.026   -12.619 1.00 0.00 ? 331 LYS A HG3  7  
ATOM   7473  H  HD2  . LYS A 1 24 ? -9.518  4.224   -13.498 1.00 0.00 ? 331 LYS A HD2  7  
ATOM   7474  H  HD3  . LYS A 1 24 ? -10.367 3.084   -14.542 1.00 0.00 ? 331 LYS A HD3  7  
ATOM   7475  H  HE2  . LYS A 1 24 ? -9.690  5.042   -15.804 1.00 0.00 ? 331 LYS A HE2  7  
ATOM   7476  H  HE3  . LYS A 1 24 ? -11.446 4.964   -15.693 1.00 0.00 ? 331 LYS A HE3  7  
ATOM   7477  H  HZ1  . LYS A 1 24 ? -9.715  6.655   -13.974 1.00 0.00 ? 331 LYS A HZ1  7  
ATOM   7478  H  HZ2  . LYS A 1 24 ? -11.405 6.627   -13.973 1.00 0.00 ? 331 LYS A HZ2  7  
ATOM   7479  H  HZ3  . LYS A 1 24 ? -10.567 7.204   -15.324 1.00 0.00 ? 331 LYS A HZ3  7  
ATOM   7480  N  N    . GLN A 1 25 ? -9.810  3.979   -9.012  1.00 0.00 ? 332 GLN A N    7  
ATOM   7481  C  CA   . GLN A 1 25 ? -9.955  4.846   -7.867  1.00 0.00 ? 332 GLN A CA   7  
ATOM   7482  C  C    . GLN A 1 25 ? -8.617  4.952   -7.159  1.00 0.00 ? 332 GLN A C    7  
ATOM   7483  O  O    . GLN A 1 25 ? -8.042  3.940   -6.741  1.00 0.00 ? 332 GLN A O    7  
ATOM   7484  C  CB   . GLN A 1 25 ? -10.984 4.270   -6.894  1.00 0.00 ? 332 GLN A CB   7  
ATOM   7485  C  CG   . GLN A 1 25 ? -12.350 4.008   -7.514  1.00 0.00 ? 332 GLN A CG   7  
ATOM   7486  C  CD   . GLN A 1 25 ? -13.299 3.259   -6.590  1.00 0.00 ? 332 GLN A CD   7  
ATOM   7487  O  OE1  . GLN A 1 25 ? -14.509 3.467   -6.636  1.00 0.00 ? 332 GLN A OE1  7  
ATOM   7488  N  NE2  . GLN A 1 25 ? -12.768 2.355   -5.772  1.00 0.00 ? 332 GLN A NE2  7  
ATOM   7489  H  H    . GLN A 1 25 ? -9.223  3.209   -8.933  1.00 0.00 ? 332 GLN A H    7  
ATOM   7490  H  HA   . GLN A 1 25 ? -10.272 5.820   -8.202  1.00 0.00 ? 332 GLN A HA   7  
ATOM   7491  H  HB2  . GLN A 1 25 ? -10.599 3.341   -6.511  1.00 0.00 ? 332 GLN A HB2  7  
ATOM   7492  H  HB3  . GLN A 1 25 ? -11.112 4.961   -6.074  1.00 0.00 ? 332 GLN A HB3  7  
ATOM   7493  H  HG2  . GLN A 1 25 ? -12.800 4.955   -7.769  1.00 0.00 ? 332 GLN A HG2  7  
ATOM   7494  H  HG3  . GLN A 1 25 ? -12.214 3.424   -8.413  1.00 0.00 ? 332 GLN A HG3  7  
ATOM   7495  H  HE21 . GLN A 1 25 ? -11.808 2.207   -5.800  1.00 0.00 ? 332 GLN A HE21 7  
ATOM   7496  H  HE22 . GLN A 1 25 ? -13.367 1.869   -5.170  1.00 0.00 ? 332 GLN A HE22 7  
ATOM   7497  N  N    . LYS A 1 26 ? -8.114  6.158   -7.055  1.00 0.00 ? 333 LYS A N    7  
ATOM   7498  C  CA   . LYS A 1 26 ? -6.874  6.406   -6.337  1.00 0.00 ? 333 LYS A CA   7  
ATOM   7499  C  C    . LYS A 1 26 ? -7.082  6.226   -4.831  1.00 0.00 ? 333 LYS A C    7  
ATOM   7500  O  O    . LYS A 1 26 ? -6.449  5.367   -4.206  1.00 0.00 ? 333 LYS A O    7  
ATOM   7501  C  CB   . LYS A 1 26 ? -6.331  7.807   -6.667  1.00 0.00 ? 333 LYS A CB   7  
ATOM   7502  C  CG   . LYS A 1 26 ? -7.368  8.917   -6.570  1.00 0.00 ? 333 LYS A CG   7  
ATOM   7503  C  CD   . LYS A 1 26 ? -6.819  10.248  -7.058  1.00 0.00 ? 333 LYS A CD   7  
ATOM   7504  C  CE   . LYS A 1 26 ? -7.879  11.338  -6.998  1.00 0.00 ? 333 LYS A CE   7  
ATOM   7505  N  NZ   . LYS A 1 26 ? -7.398  12.616  -7.582  1.00 0.00 ? 333 LYS A NZ   7  
ATOM   7506  H  H    . LYS A 1 26 ? -8.585  6.902   -7.481  1.00 0.00 ? 333 LYS A H    7  
ATOM   7507  H  HA   . LYS A 1 26 ? -6.155  5.670   -6.669  1.00 0.00 ? 333 LYS A HA   7  
ATOM   7508  H  HB2  . LYS A 1 26 ? -5.527  8.037   -5.984  1.00 0.00 ? 333 LYS A HB2  7  
ATOM   7509  H  HB3  . LYS A 1 26 ? -5.939  7.798   -7.674  1.00 0.00 ? 333 LYS A HB3  7  
ATOM   7510  H  HG2  . LYS A 1 26 ? -8.221  8.651   -7.175  1.00 0.00 ? 333 LYS A HG2  7  
ATOM   7511  H  HG3  . LYS A 1 26 ? -7.674  9.021   -5.539  1.00 0.00 ? 333 LYS A HG3  7  
ATOM   7512  H  HD2  . LYS A 1 26 ? -5.984  10.535  -6.434  1.00 0.00 ? 333 LYS A HD2  7  
ATOM   7513  H  HD3  . LYS A 1 26 ? -6.487  10.138  -8.080  1.00 0.00 ? 333 LYS A HD3  7  
ATOM   7514  H  HE2  . LYS A 1 26 ? -8.747  11.008  -7.547  1.00 0.00 ? 333 LYS A HE2  7  
ATOM   7515  H  HE3  . LYS A 1 26 ? -8.148  11.502  -5.965  1.00 0.00 ? 333 LYS A HE3  7  
ATOM   7516  H  HZ1  . LYS A 1 26 ? -7.155  12.484  -8.584  1.00 0.00 ? 333 LYS A HZ1  7  
ATOM   7517  H  HZ2  . LYS A 1 26 ? -6.558  12.953  -7.071  1.00 0.00 ? 333 LYS A HZ2  7  
ATOM   7518  H  HZ3  . LYS A 1 26 ? -8.143  13.341  -7.512  1.00 0.00 ? 333 LYS A HZ3  7  
ATOM   7519  N  N    . GLY A 1 27 ? -8.009  6.991   -4.267  1.00 0.00 ? 334 GLY A N    7  
ATOM   7520  C  CA   . GLY A 1 27 ? -8.239  6.953   -2.837  1.00 0.00 ? 334 GLY A CA   7  
ATOM   7521  C  C    . GLY A 1 27 ? -9.250  5.899   -2.437  1.00 0.00 ? 334 GLY A C    7  
ATOM   7522  O  O    . GLY A 1 27 ? -10.431 6.005   -2.768  1.00 0.00 ? 334 GLY A O    7  
ATOM   7523  H  H    . GLY A 1 27 ? -8.554  7.578   -4.831  1.00 0.00 ? 334 GLY A H    7  
ATOM   7524  H  HA2  . GLY A 1 27 ? -7.304  6.745   -2.339  1.00 0.00 ? 334 GLY A HA2  7  
ATOM   7525  H  HA3  . GLY A 1 27 ? -8.597  7.920   -2.515  1.00 0.00 ? 334 GLY A HA3  7  
ATOM   7526  N  N    . VAL A 1 28 ? -8.779  4.876   -1.735  1.00 0.00 ? 335 VAL A N    7  
ATOM   7527  C  CA   . VAL A 1 28 ? -9.645  3.804   -1.247  1.00 0.00 ? 335 VAL A CA   7  
ATOM   7528  C  C    . VAL A 1 28 ? -9.275  3.442   0.189   1.00 0.00 ? 335 VAL A C    7  
ATOM   7529  O  O    . VAL A 1 28 ? -10.129 3.412   1.075   1.00 0.00 ? 335 VAL A O    7  
ATOM   7530  C  CB   . VAL A 1 28 ? -9.554  2.538   -2.137  1.00 0.00 ? 335 VAL A CB   7  
ATOM   7531  C  CG1  . VAL A 1 28 ? -10.357 1.392   -1.536  1.00 0.00 ? 335 VAL A CG1  7  
ATOM   7532  C  CG2  . VAL A 1 28 ? -10.037 2.832   -3.548  1.00 0.00 ? 335 VAL A CG2  7  
ATOM   7533  H  H    . VAL A 1 28 ? -7.825  4.847   -1.525  1.00 0.00 ? 335 VAL A H    7  
ATOM   7534  H  HA   . VAL A 1 28 ? -10.664 4.163   -1.267  1.00 0.00 ? 335 VAL A HA   7  
ATOM   7535  H  HB   . VAL A 1 28 ? -8.518  2.233   -2.189  1.00 0.00 ? 335 VAL A HB   7  
ATOM   7536  H  HG11 . VAL A 1 28 ? -10.269 0.522   -2.171  1.00 0.00 ? 335 VAL A HG11 7  
ATOM   7537  H  HG12 . VAL A 1 28 ? -11.394 1.680   -1.460  1.00 0.00 ? 335 VAL A HG12 7  
ATOM   7538  H  HG13 . VAL A 1 28 ? -9.973  1.161   -0.554  1.00 0.00 ? 335 VAL A HG13 7  
ATOM   7539  H  HG21 . VAL A 1 28 ? -9.948  1.942   -4.153  1.00 0.00 ? 335 VAL A HG21 7  
ATOM   7540  H  HG22 . VAL A 1 28 ? -9.436  3.620   -3.979  1.00 0.00 ? 335 VAL A HG22 7  
ATOM   7541  H  HG23 . VAL A 1 28 ? -11.070 3.144   -3.518  1.00 0.00 ? 335 VAL A HG23 7  
ATOM   7542  N  N    . GLY A 1 29 ? -7.997  3.173   0.411   1.00 0.00 ? 336 GLY A N    7  
ATOM   7543  C  CA   . GLY A 1 29 ? -7.529  2.844   1.741   1.00 0.00 ? 336 GLY A CA   7  
ATOM   7544  C  C    . GLY A 1 29 ? -6.040  3.070   1.884   1.00 0.00 ? 336 GLY A C    7  
ATOM   7545  O  O    . GLY A 1 29 ? -5.608  3.986   2.585   1.00 0.00 ? 336 GLY A O    7  
ATOM   7546  H  H    . GLY A 1 29 ? -7.365  3.193   -0.334  1.00 0.00 ? 336 GLY A H    7  
ATOM   7547  H  HA2  . GLY A 1 29 ? -8.050  3.473   2.463   1.00 0.00 ? 336 GLY A HA2  7  
ATOM   7548  H  HA3  . GLY A 1 29 ? -7.746  1.793   1.939   1.00 0.00 ? 336 GLY A HA3  7  
ATOM   7549  N  N    . ALA A 1 30 ? -5.256  2.243   1.208   1.00 0.00 ? 337 ALA A N    7  
ATOM   7550  C  CA   . ALA A 1 30 ? -3.806  2.352   1.254   1.00 0.00 ? 337 ALA A CA   7  
ATOM   7551  C  C    . ALA A 1 30 ? -3.200  1.992   -0.095  1.00 0.00 ? 337 ALA A C    7  
ATOM   7552  O  O    . ALA A 1 30 ? -3.547  0.964   -0.688  1.00 0.00 ? 337 ALA A O    7  
ATOM   7553  C  CB   . ALA A 1 30 ? -3.243  1.452   2.345   1.00 0.00 ? 337 ALA A CB   7  
ATOM   7554  H  H    . ALA A 1 30 ? -5.663  1.536   0.661   1.00 0.00 ? 337 ALA A H    7  
ATOM   7555  H  HA   . ALA A 1 30 ? -3.554  3.374   1.494   1.00 0.00 ? 337 ALA A HA   7  
ATOM   7556  H  HB1  . ALA A 1 30 ? -3.678  1.723   3.295   1.00 0.00 ? 337 ALA A HB1  7  
ATOM   7557  H  HB2  . ALA A 1 30 ? -2.171  1.570   2.392   1.00 0.00 ? 337 ALA A HB2  7  
ATOM   7558  H  HB3  . ALA A 1 30 ? -3.483  0.423   2.121   1.00 0.00 ? 337 ALA A HB3  7  
ATOM   7559  N  N    . SER A 1 31 ? -2.309  2.839   -0.580  1.00 0.00 ? 338 SER A N    7  
ATOM   7560  C  CA   . SER A 1 31 ? -1.682  2.624   -1.872  1.00 0.00 ? 338 SER A CA   7  
ATOM   7561  C  C    . SER A 1 31 ? -0.163  2.578   -1.738  1.00 0.00 ? 338 SER A C    7  
ATOM   7562  O  O    . SER A 1 31 ? 0.425   3.315   -0.944  1.00 0.00 ? 338 SER A O    7  
ATOM   7563  C  CB   . SER A 1 31 ? -2.097  3.730   -2.841  1.00 0.00 ? 338 SER A CB   7  
ATOM   7564  O  OG   . SER A 1 31 ? -3.508  3.904   -2.834  1.00 0.00 ? 338 SER A OG   7  
ATOM   7565  H  H    . SER A 1 31 ? -2.067  3.634   -0.060  1.00 0.00 ? 338 SER A H    7  
ATOM   7566  H  HA   . SER A 1 31 ? -2.025  1.675   -2.252  1.00 0.00 ? 338 SER A HA   7  
ATOM   7567  H  HB2  . SER A 1 31 ? -1.631  4.658   -2.548  1.00 0.00 ? 338 SER A HB2  7  
ATOM   7568  H  HB3  . SER A 1 31 ? -1.784  3.468   -3.840  1.00 0.00 ? 338 SER A HB3  7  
ATOM   7569  H  HG   . SER A 1 31 ? -3.734  4.592   -2.194  1.00 0.00 ? 338 SER A HG   7  
ATOM   7570  N  N    . ILE A 1 32 ? 0.457   1.701   -2.509  1.00 0.00 ? 339 ILE A N    7  
ATOM   7571  C  CA   . ILE A 1 32 ? 1.901   1.572   -2.537  1.00 0.00 ? 339 ILE A CA   7  
ATOM   7572  C  C    . ILE A 1 32 ? 2.395   1.796   -3.966  1.00 0.00 ? 339 ILE A C    7  
ATOM   7573  O  O    . ILE A 1 32 ? 1.657   1.557   -4.926  1.00 0.00 ? 339 ILE A O    7  
ATOM   7574  C  CB   . ILE A 1 32 ? 2.350   0.182   -2.013  1.00 0.00 ? 339 ILE A CB   7  
ATOM   7575  C  CG1  . ILE A 1 32 ? 3.879   0.073   -1.980  1.00 0.00 ? 339 ILE A CG1  7  
ATOM   7576  C  CG2  . ILE A 1 32 ? 1.747   -0.932  -2.862  1.00 0.00 ? 339 ILE A CG2  7  
ATOM   7577  C  CD1  . ILE A 1 32 ? 4.380   -1.241  -1.415  1.00 0.00 ? 339 ILE A CD1  7  
ATOM   7578  H  H    . ILE A 1 32 ? -0.080  1.123   -3.098  1.00 0.00 ? 339 ILE A H    7  
ATOM   7579  H  HA   . ILE A 1 32 ? 2.321   2.336   -1.896  1.00 0.00 ? 339 ILE A HA   7  
ATOM   7580  H  HB   . ILE A 1 32 ? 1.970   0.070   -1.009  1.00 0.00 ? 339 ILE A HB   7  
ATOM   7581  H  HG12 . ILE A 1 32 ? 4.263   0.163   -2.994  1.00 0.00 ? 339 ILE A HG12 7  
ATOM   7582  H  HG13 . ILE A 1 32 ? 4.278   0.875   -1.362  1.00 0.00 ? 339 ILE A HG13 7  
ATOM   7583  H  HG21 . ILE A 1 32 ? 2.075   -1.890  -2.484  1.00 0.00 ? 339 ILE A HG21 7  
ATOM   7584  H  HG22 . ILE A 1 32 ? 2.070   -0.821  -3.887  1.00 0.00 ? 339 ILE A HG22 7  
ATOM   7585  H  HG23 . ILE A 1 32 ? 0.669   -0.876  -2.816  1.00 0.00 ? 339 ILE A HG23 7  
ATOM   7586  H  HD11 . ILE A 1 32 ? 4.004   -2.057  -2.015  1.00 0.00 ? 339 ILE A HD11 7  
ATOM   7587  H  HD12 . ILE A 1 32 ? 4.033   -1.352  -0.398  1.00 0.00 ? 339 ILE A HD12 7  
ATOM   7588  H  HD13 . ILE A 1 32 ? 5.461   -1.252  -1.430  1.00 0.00 ? 339 ILE A HD13 7  
ATOM   7589  N  N    . GLN A 1 33 ? 3.620   2.272   -4.109  1.00 0.00 ? 340 GLN A N    7  
ATOM   7590  C  CA   . GLN A 1 33 ? 4.157   2.588   -5.415  1.00 0.00 ? 340 GLN A CA   7  
ATOM   7591  C  C    . GLN A 1 33 ? 5.368   1.712   -5.697  1.00 0.00 ? 340 GLN A C    7  
ATOM   7592  O  O    . GLN A 1 33 ? 6.287   1.621   -4.883  1.00 0.00 ? 340 GLN A O    7  
ATOM   7593  C  CB   . GLN A 1 33 ? 4.517   4.071   -5.490  1.00 0.00 ? 340 GLN A CB   7  
ATOM   7594  C  CG   . GLN A 1 33 ? 4.671   4.594   -6.907  1.00 0.00 ? 340 GLN A CG   7  
ATOM   7595  C  CD   . GLN A 1 33 ? 4.769   6.076   -6.976  1.00 0.00 ? 340 GLN A CD   7  
ATOM   7596  O  OE1  . GLN A 1 33 ? 5.163   6.746   -6.023  1.00 0.00 ? 340 GLN A OE1  7  
ATOM   7597  N  NE2  . GLN A 1 33 ? 4.470   6.592   -8.134  1.00 0.00 ? 340 GLN A NE2  7  
ATOM   7598  H  H    . GLN A 1 33 ? 4.185   2.394   -3.323  1.00 0.00 ? 340 GLN A H    7  
ATOM   7599  H  HA   . GLN A 1 33 ? 3.392   2.371   -6.148  1.00 0.00 ? 340 GLN A HA   7  
ATOM   7600  H  HB2  . GLN A 1 33 ? 3.740   4.642   -5.003  1.00 0.00 ? 340 GLN A HB2  7  
ATOM   7601  H  HB3  . GLN A 1 33 ? 5.448   4.229   -4.968  1.00 0.00 ? 340 GLN A HB3  7  
ATOM   7602  H  HG2  . GLN A 1 33 ? 5.576   4.216   -7.347  1.00 0.00 ? 340 GLN A HG2  7  
ATOM   7603  H  HG3  . GLN A 1 33 ? 3.808   4.280   -7.493  1.00 0.00 ? 340 GLN A HG3  7  
ATOM   7604  H  HE21 . GLN A 1 33 ? 4.191   5.989   -8.859  1.00 0.00 ? 340 GLN A HE21 7  
ATOM   7605  H  HE22 . GLN A 1 33 ? 4.592   7.525   -8.241  1.00 0.00 ? 340 GLN A HE22 7  
ATOM   7606  N  N    . CYS A 1 34 ? 5.336   1.045   -6.840  1.00 0.00 ? 341 CYS A N    7  
ATOM   7607  C  CA   . CYS A 1 34 ? 6.379   0.110   -7.220  1.00 0.00 ? 341 CYS A CA   7  
ATOM   7608  C  C    . CYS A 1 34 ? 7.693   0.833   -7.463  1.00 0.00 ? 341 CYS A C    7  
ATOM   7609  O  O    . CYS A 1 34 ? 7.711   2.009   -7.827  1.00 0.00 ? 341 CYS A O    7  
ATOM   7610  C  CB   . CYS A 1 34 ? 5.970   -0.684  -8.468  1.00 0.00 ? 341 CYS A CB   7  
ATOM   7611  S  SG   . CYS A 1 34 ? 6.606   -0.040  -10.039 1.00 0.00 ? 341 CYS A SG   7  
ATOM   7612  H  H    . CYS A 1 34 ? 4.573   1.183   -7.439  1.00 0.00 ? 341 CYS A H    7  
ATOM   7613  H  HA   . CYS A 1 34 ? 6.514   -0.580  -6.400  1.00 0.00 ? 341 CYS A HA   7  
ATOM   7614  H  HB2  . CYS A 1 34 ? 6.323   -1.696  -8.369  1.00 0.00 ? 341 CYS A HB2  7  
ATOM   7615  H  HB3  . CYS A 1 34 ? 4.895   -0.694  -8.534  1.00 0.00 ? 341 CYS A HB3  7  
ATOM   7616  N  N    . HIS A 1 35 ? 8.779   0.098   -7.296  1.00 0.00 ? 342 HIS A N    7  
ATOM   7617  C  CA   . HIS A 1 35 ? 10.119  0.665   -7.345  1.00 0.00 ? 342 HIS A CA   7  
ATOM   7618  C  C    . HIS A 1 35 ? 10.554  0.914   -8.800  1.00 0.00 ? 342 HIS A C    7  
ATOM   7619  O  O    . HIS A 1 35 ? 9.784   0.661   -9.730  1.00 0.00 ? 342 HIS A O    7  
ATOM   7620  C  CB   . HIS A 1 35 ? 11.074  -0.296  -6.628  1.00 0.00 ? 342 HIS A CB   7  
ATOM   7621  C  CG   . HIS A 1 35 ? 12.316  0.334   -6.077  1.00 0.00 ? 342 HIS A CG   7  
ATOM   7622  N  ND1  . HIS A 1 35 ? 13.539  -0.303  -6.082  1.00 0.00 ? 342 HIS A ND1  7  
ATOM   7623  C  CD2  . HIS A 1 35 ? 12.514  1.520   -5.453  1.00 0.00 ? 342 HIS A CD2  7  
ATOM   7624  C  CE1  . HIS A 1 35 ? 14.432  0.463   -5.485  1.00 0.00 ? 342 HIS A CE1  7  
ATOM   7625  N  NE2  . HIS A 1 35 ? 13.837  1.575   -5.095  1.00 0.00 ? 342 HIS A NE2  7  
ATOM   7626  H  H    . HIS A 1 35 ? 8.673   -0.868  -7.140  1.00 0.00 ? 342 HIS A H    7  
ATOM   7627  H  HA   . HIS A 1 35 ? 10.104  1.606   -6.817  1.00 0.00 ? 342 HIS A HA   7  
ATOM   7628  H  HB2  . HIS A 1 35 ? 10.545  -0.753  -5.792  1.00 0.00 ? 342 HIS A HB2  7  
ATOM   7629  H  HB3  . HIS A 1 35 ? 11.381  -1.070  -7.335  1.00 0.00 ? 342 HIS A HB3  7  
ATOM   7630  H  HD1  . HIS A 1 35 ? 13.726  -1.195  -6.466  1.00 0.00 ? 342 HIS A HD1  7  
ATOM   7631  H  HD2  . HIS A 1 35 ? 11.768  2.282   -5.273  1.00 0.00 ? 342 HIS A HD2  7  
ATOM   7632  H  HE1  . HIS A 1 35 ? 15.470  0.216   -5.330  1.00 0.00 ? 342 HIS A HE1  7  
ATOM   7633  H  HE2  . HIS A 1 35 ? 14.307  2.381   -4.783  1.00 0.00 ? 342 HIS A HE2  7  
ATOM   7634  N  N    . LYS A 1 36 ? 11.798  1.374   -8.973  1.00 0.00 ? 343 LYS A N    7  
ATOM   7635  C  CA   . LYS A 1 36 ? 12.325  1.837   -10.264 1.00 0.00 ? 343 LYS A CA   7  
ATOM   7636  C  C    . LYS A 1 36 ? 11.695  3.171   -10.675 1.00 0.00 ? 343 LYS A C    7  
ATOM   7637  O  O    . LYS A 1 36 ? 10.482  3.275   -10.878 1.00 0.00 ? 343 LYS A O    7  
ATOM   7638  C  CB   . LYS A 1 36 ? 12.171  0.775   -11.361 1.00 0.00 ? 343 LYS A CB   7  
ATOM   7639  C  CG   . LYS A 1 36 ? 13.182  -0.362  -11.249 1.00 0.00 ? 343 LYS A CG   7  
ATOM   7640  C  CD   . LYS A 1 36 ? 14.602  0.123   -11.514 1.00 0.00 ? 343 LYS A CD   7  
ATOM   7641  C  CE   . LYS A 1 36 ? 15.629  -0.973  -11.256 1.00 0.00 ? 343 LYS A CE   7  
ATOM   7642  N  NZ   . LYS A 1 36 ? 15.488  -2.116  -12.197 1.00 0.00 ? 343 LYS A NZ   7  
ATOM   7643  H  H    . LYS A 1 36 ? 12.394  1.393   -8.201  1.00 0.00 ? 343 LYS A H    7  
ATOM   7644  H  HA   . LYS A 1 36 ? 13.380  2.013   -10.117 1.00 0.00 ? 343 LYS A HA   7  
ATOM   7645  H  HB2  . LYS A 1 36 ? 11.178  0.352   -11.300 1.00 0.00 ? 343 LYS A HB2  7  
ATOM   7646  H  HB3  . LYS A 1 36 ? 12.294  1.244   -12.325 1.00 0.00 ? 343 LYS A HB3  7  
ATOM   7647  H  HG2  . LYS A 1 36 ? 13.140  -0.770  -10.241 1.00 0.00 ? 343 LYS A HG2  7  
ATOM   7648  H  HG3  . LYS A 1 36 ? 12.931  -1.131  -11.978 1.00 0.00 ? 343 LYS A HG3  7  
ATOM   7649  H  HD2  . LYS A 1 36 ? 14.678  0.431   -12.557 1.00 0.00 ? 343 LYS A HD2  7  
ATOM   7650  H  HD3  . LYS A 1 36 ? 14.815  0.966   -10.857 1.00 0.00 ? 343 LYS A HD3  7  
ATOM   7651  H  HE2  . LYS A 1 36 ? 16.618  -0.553  -11.362 1.00 0.00 ? 343 LYS A HE2  7  
ATOM   7652  H  HE3  . LYS A 1 36 ? 15.503  -1.333  -10.246 1.00 0.00 ? 343 LYS A HE3  7  
ATOM   7653  H  HZ1  . LYS A 1 36 ? 14.529  -2.514  -12.141 1.00 0.00 ? 343 LYS A HZ1  7  
ATOM   7654  H  HZ2  . LYS A 1 36 ? 16.176  -2.863  -11.962 1.00 0.00 ? 343 LYS A HZ2  7  
ATOM   7655  H  HZ3  . LYS A 1 36 ? 15.662  -1.801  -13.172 1.00 0.00 ? 343 LYS A HZ3  7  
ATOM   7656  N  N    . ALA A 1 37 ? 12.555  4.183   -10.802 1.00 0.00 ? 344 ALA A N    7  
ATOM   7657  C  CA   . ALA A 1 37 ? 12.128  5.570   -10.998 1.00 0.00 ? 344 ALA A CA   7  
ATOM   7658  C  C    . ALA A 1 37 ? 11.359  5.775   -12.300 1.00 0.00 ? 344 ALA A C    7  
ATOM   7659  O  O    . ALA A 1 37 ? 10.339  6.465   -12.321 1.00 0.00 ? 344 ALA A O    7  
ATOM   7660  C  CB   . ALA A 1 37 ? 13.333  6.499   -10.954 1.00 0.00 ? 344 ALA A CB   7  
ATOM   7661  H  H    . ALA A 1 37 ? 13.514  3.990   -10.759 1.00 0.00 ? 344 ALA A H    7  
ATOM   7662  H  HA   . ALA A 1 37 ? 11.482  5.833   -10.173 1.00 0.00 ? 344 ALA A HA   7  
ATOM   7663  H  HB1  . ALA A 1 37 ? 13.876  6.343   -10.033 1.00 0.00 ? 344 ALA A HB1  7  
ATOM   7664  H  HB2  . ALA A 1 37 ? 12.999  7.526   -11.005 1.00 0.00 ? 344 ALA A HB2  7  
ATOM   7665  H  HB3  . ALA A 1 37 ? 13.979  6.290   -11.794 1.00 0.00 ? 344 ALA A HB3  7  
ATOM   7666  N  N    . ASN A 1 38 ? 11.831  5.168   -13.381 1.00 0.00 ? 345 ASN A N    7  
ATOM   7667  C  CA   . ASN A 1 38 ? 11.192  5.347   -14.682 1.00 0.00 ? 345 ASN A CA   7  
ATOM   7668  C  C    . ASN A 1 38 ? 10.027  4.384   -14.838 1.00 0.00 ? 345 ASN A C    7  
ATOM   7669  O  O    . ASN A 1 38 ? 9.811   3.803   -15.902 1.00 0.00 ? 345 ASN A O    7  
ATOM   7670  C  CB   . ASN A 1 38 ? 12.198  5.164   -15.822 1.00 0.00 ? 345 ASN A CB   7  
ATOM   7671  C  CG   . ASN A 1 38 ? 13.191  6.308   -15.916 1.00 0.00 ? 345 ASN A CG   7  
ATOM   7672  O  OD1  . ASN A 1 38 ? 14.354  6.102   -16.267 1.00 0.00 ? 345 ASN A OD1  7  
ATOM   7673  N  ND2  . ASN A 1 38 ? 12.740  7.522   -15.629 1.00 0.00 ? 345 ASN A ND2  7  
ATOM   7674  H  H    . ASN A 1 38 ? 12.610  4.576   -13.301 1.00 0.00 ? 345 ASN A H    7  
ATOM   7675  H  HA   . ASN A 1 38 ? 10.806  6.353   -14.717 1.00 0.00 ? 345 ASN A HA   7  
ATOM   7676  H  HB2  . ASN A 1 38 ? 12.747  4.248   -15.668 1.00 0.00 ? 345 ASN A HB2  7  
ATOM   7677  H  HB3  . ASN A 1 38 ? 11.661  5.102   -16.757 1.00 0.00 ? 345 ASN A HB3  7  
ATOM   7678  H  HD21 . ASN A 1 38 ? 11.794  7.625   -15.376 1.00 0.00 ? 345 ASN A HD21 7  
ATOM   7679  H  HD22 . ASN A 1 38 ? 13.368  8.274   -15.682 1.00 0.00 ? 345 ASN A HD22 7  
ATOM   7680  N  N    . CYS A 1 39 ? 9.276   4.239   -13.764 1.00 0.00 ? 346 CYS A N    7  
ATOM   7681  C  CA   . CYS A 1 39 ? 8.102   3.399   -13.748 1.00 0.00 ? 346 CYS A CA   7  
ATOM   7682  C  C    . CYS A 1 39 ? 7.146   3.875   -12.659 1.00 0.00 ? 346 CYS A C    7  
ATOM   7683  O  O    . CYS A 1 39 ? 6.080   4.404   -12.963 1.00 0.00 ? 346 CYS A O    7  
ATOM   7684  C  CB   . CYS A 1 39 ? 8.495   1.938   -13.520 1.00 0.00 ? 346 CYS A CB   7  
ATOM   7685  S  SG   . CYS A 1 39 ? 7.097   0.789   -13.476 1.00 0.00 ? 346 CYS A SG   7  
ATOM   7686  H  H    . CYS A 1 39 ? 9.519   4.726   -12.947 1.00 0.00 ? 346 CYS A H    7  
ATOM   7687  H  HA   . CYS A 1 39 ? 7.614   3.491   -14.707 1.00 0.00 ? 346 CYS A HA   7  
ATOM   7688  H  HB2  . CYS A 1 39 ? 9.152   1.622   -14.317 1.00 0.00 ? 346 CYS A HB2  7  
ATOM   7689  H  HB3  . CYS A 1 39 ? 9.018   1.858   -12.578 1.00 0.00 ? 346 CYS A HB3  7  
ATOM   7690  N  N    . TYR A 1 40 ? 7.561   3.703   -11.394 1.00 0.00 ? 347 TYR A N    7  
ATOM   7691  C  CA   . TYR A 1 40 ? 6.748   4.073   -10.229 1.00 0.00 ? 347 TYR A CA   7  
ATOM   7692  C  C    . TYR A 1 40 ? 5.272   3.740   -10.430 1.00 0.00 ? 347 TYR A C    7  
ATOM   7693  O  O    . TYR A 1 40 ? 4.446   4.619   -10.688 1.00 0.00 ? 347 TYR A O    7  
ATOM   7694  C  CB   . TYR A 1 40 ? 6.918   5.556   -9.887  1.00 0.00 ? 347 TYR A CB   7  
ATOM   7695  C  CG   . TYR A 1 40 ? 8.170   5.870   -9.094  1.00 0.00 ? 347 TYR A CG   7  
ATOM   7696  C  CD1  . TYR A 1 40 ? 8.526   5.102   -7.990  1.00 0.00 ? 347 TYR A CD1  7  
ATOM   7697  C  CD2  . TYR A 1 40 ? 8.990   6.933   -9.446  1.00 0.00 ? 347 TYR A CD2  7  
ATOM   7698  C  CE1  . TYR A 1 40 ? 9.663   5.390   -7.257  1.00 0.00 ? 347 TYR A CE1  7  
ATOM   7699  C  CE2  . TYR A 1 40 ? 10.128  7.228   -8.716  1.00 0.00 ? 347 TYR A CE2  7  
ATOM   7700  C  CZ   . TYR A 1 40 ? 10.460  6.452   -7.626  1.00 0.00 ? 347 TYR A CZ   7  
ATOM   7701  O  OH   . TYR A 1 40 ? 11.592  6.747   -6.896  1.00 0.00 ? 347 TYR A OH   7  
ATOM   7702  H  H    . TYR A 1 40 ? 8.457   3.326   -11.238 1.00 0.00 ? 347 TYR A H    7  
ATOM   7703  H  HA   . TYR A 1 40 ? 7.110   3.491   -9.393  1.00 0.00 ? 347 TYR A HA   7  
ATOM   7704  H  HB2  . TYR A 1 40 ? 6.956   6.125   -10.803 1.00 0.00 ? 347 TYR A HB2  7  
ATOM   7705  H  HB3  . TYR A 1 40 ? 6.067   5.881   -9.304  1.00 0.00 ? 347 TYR A HB3  7  
ATOM   7706  H  HD1  . TYR A 1 40 ? 7.900   4.269   -7.705  1.00 0.00 ? 347 TYR A HD1  7  
ATOM   7707  H  HD2  . TYR A 1 40 ? 8.728   7.539   -10.301 1.00 0.00 ? 347 TYR A HD2  7  
ATOM   7708  H  HE1  . TYR A 1 40 ? 9.924   4.784   -6.404  1.00 0.00 ? 347 TYR A HE1  7  
ATOM   7709  H  HE2  . TYR A 1 40 ? 10.753  8.060   -9.005  1.00 0.00 ? 347 TYR A HE2  7  
ATOM   7710  H  HH   . TYR A 1 40 ? 11.639  7.696   -6.752  1.00 0.00 ? 347 TYR A HH   7  
ATOM   7711  N  N    . THR A 1 41 ? 4.946   2.466   -10.307 1.00 0.00 ? 348 THR A N    7  
ATOM   7712  C  CA   . THR A 1 41 ? 3.596   1.999   -10.585 1.00 0.00 ? 348 THR A CA   7  
ATOM   7713  C  C    . THR A 1 41 ? 2.784   1.943   -9.295  1.00 0.00 ? 348 THR A C    7  
ATOM   7714  O  O    . THR A 1 41 ? 3.208   1.321   -8.329  1.00 0.00 ? 348 THR A O    7  
ATOM   7715  C  CB   . THR A 1 41 ? 3.618   0.599   -11.231 1.00 0.00 ? 348 THR A CB   7  
ATOM   7716  O  OG1  . THR A 1 41 ? 4.708   0.499   -12.176 1.00 0.00 ? 348 THR A OG1  7  
ATOM   7717  C  CG2  . THR A 1 41 ? 2.305   0.316   -11.943 1.00 0.00 ? 348 THR A CG2  7  
ATOM   7718  H  H    . THR A 1 41 ? 5.625   1.831   -9.987  1.00 0.00 ? 348 THR A H    7  
ATOM   7719  H  HA   . THR A 1 41 ? 3.128   2.689   -11.272 1.00 0.00 ? 348 THR A HA   7  
ATOM   7720  H  HB   . THR A 1 41 ? 3.756   -0.137  -10.454 1.00 0.00 ? 348 THR A HB   7  
ATOM   7721  H  HG1  . THR A 1 41 ? 4.679   1.279   -12.768 1.00 0.00 ? 348 THR A HG1  7  
ATOM   7722  H  HG21 . THR A 1 41 ? 1.495   0.361   -11.231 1.00 0.00 ? 348 THR A HG21 7  
ATOM   7723  H  HG22 . THR A 1 41 ? 2.341   -0.668  -12.386 1.00 0.00 ? 348 THR A HG22 7  
ATOM   7724  H  HG23 . THR A 1 41 ? 2.148   1.054   -12.716 1.00 0.00 ? 348 THR A HG23 7  
ATOM   7725  N  N    . ALA A 1 42 ? 1.622   2.573   -9.283  1.00 0.00 ? 349 ALA A N    7  
ATOM   7726  C  CA   . ALA A 1 42 ? 0.838   2.684   -8.061  1.00 0.00 ? 349 ALA A CA   7  
ATOM   7727  C  C    . ALA A 1 42 ? -0.287  1.660   -8.015  1.00 0.00 ? 349 ALA A C    7  
ATOM   7728  O  O    . ALA A 1 42 ? -0.983  1.434   -9.008  1.00 0.00 ? 349 ALA A O    7  
ATOM   7729  C  CB   . ALA A 1 42 ? 0.283   4.089   -7.920  1.00 0.00 ? 349 ALA A CB   7  
ATOM   7730  H  H    . ALA A 1 42 ? 1.273   2.966   -10.109 1.00 0.00 ? 349 ALA A H    7  
ATOM   7731  H  HA   . ALA A 1 42 ? 1.503   2.503   -7.225  1.00 0.00 ? 349 ALA A HA   7  
ATOM   7732  H  HB1  . ALA A 1 42 ? 1.096   4.800   -7.938  1.00 0.00 ? 349 ALA A HB1  7  
ATOM   7733  H  HB2  . ALA A 1 42 ? -0.249  4.176   -6.983  1.00 0.00 ? 349 ALA A HB2  7  
ATOM   7734  H  HB3  . ALA A 1 42 ? -0.393  4.294   -8.737  1.00 0.00 ? 349 ALA A HB3  7  
ATOM   7735  N  N    . PHE A 1 43 ? -0.441  1.031   -6.859  1.00 0.00 ? 350 PHE A N    7  
ATOM   7736  C  CA   . PHE A 1 43 ? -1.510  0.072   -6.632  1.00 0.00 ? 350 PHE A CA   7  
ATOM   7737  C  C    . PHE A 1 43 ? -1.801  -0.046  -5.141  1.00 0.00 ? 350 PHE A C    7  
ATOM   7738  O  O    . PHE A 1 43 ? -0.992  0.349   -4.310  1.00 0.00 ? 350 PHE A O    7  
ATOM   7739  C  CB   . PHE A 1 43 ? -1.172  -1.298  -7.243  1.00 0.00 ? 350 PHE A CB   7  
ATOM   7740  C  CG   . PHE A 1 43 ? 0.192   -1.832  -6.893  1.00 0.00 ? 350 PHE A CG   7  
ATOM   7741  C  CD1  . PHE A 1 43 ? 1.324   -1.347  -7.527  1.00 0.00 ? 350 PHE A CD1  7  
ATOM   7742  C  CD2  . PHE A 1 43 ? 0.340   -2.829  -5.944  1.00 0.00 ? 350 PHE A CD2  7  
ATOM   7743  C  CE1  . PHE A 1 43 ? 2.574   -1.841  -7.221  1.00 0.00 ? 350 PHE A CE1  7  
ATOM   7744  C  CE2  . PHE A 1 43 ? 1.592   -3.328  -5.635  1.00 0.00 ? 350 PHE A CE2  7  
ATOM   7745  C  CZ   . PHE A 1 43 ? 2.709   -2.833  -6.274  1.00 0.00 ? 350 PHE A CZ   7  
ATOM   7746  H  H    . PHE A 1 43 ? 0.195   1.213   -6.129  1.00 0.00 ? 350 PHE A H    7  
ATOM   7747  H  HA   . PHE A 1 43 ? -2.394  0.458   -7.118  1.00 0.00 ? 350 PHE A HA   7  
ATOM   7748  H  HB2  . PHE A 1 43 ? -1.899  -2.019  -6.904  1.00 0.00 ? 350 PHE A HB2  7  
ATOM   7749  H  HB3  . PHE A 1 43 ? -1.230  -1.224  -8.319  1.00 0.00 ? 350 PHE A HB3  7  
ATOM   7750  H  HD1  . PHE A 1 43 ? 1.223   -0.568  -8.269  1.00 0.00 ? 350 PHE A HD1  7  
ATOM   7751  H  HD2  . PHE A 1 43 ? -0.535  -3.218  -5.443  1.00 0.00 ? 350 PHE A HD2  7  
ATOM   7752  H  HE1  . PHE A 1 43 ? 3.443   -1.454  -7.726  1.00 0.00 ? 350 PHE A HE1  7  
ATOM   7753  H  HE2  . PHE A 1 43 ? 1.695   -4.106  -4.896  1.00 0.00 ? 350 PHE A HE2  7  
ATOM   7754  H  HZ   . PHE A 1 43 ? 3.687   -3.221  -6.032  1.00 0.00 ? 350 PHE A HZ   7  
ATOM   7755  N  N    . HIS A 1 44 ? -2.969  -0.571  -4.806  1.00 0.00 ? 351 HIS A N    7  
ATOM   7756  C  CA   . HIS A 1 44 ? -3.384  -0.669  -3.410  1.00 0.00 ? 351 HIS A CA   7  
ATOM   7757  C  C    . HIS A 1 44 ? -2.727  -1.865  -2.739  1.00 0.00 ? 351 HIS A C    7  
ATOM   7758  O  O    . HIS A 1 44 ? -2.444  -2.867  -3.395  1.00 0.00 ? 351 HIS A O    7  
ATOM   7759  C  CB   . HIS A 1 44 ? -4.907  -0.796  -3.294  1.00 0.00 ? 351 HIS A CB   7  
ATOM   7760  C  CG   . HIS A 1 44 ? -5.666  0.406   -3.769  1.00 0.00 ? 351 HIS A CG   7  
ATOM   7761  N  ND1  . HIS A 1 44 ? -6.603  0.361   -4.799  1.00 0.00 ? 351 HIS A ND1  7  
ATOM   7762  C  CD2  . HIS A 1 44 ? -5.643  1.688   -3.333  1.00 0.00 ? 351 HIS A CD2  7  
ATOM   7763  C  CE1  . HIS A 1 44 ? -7.114  1.584   -4.956  1.00 0.00 ? 351 HIS A CE1  7  
ATOM   7764  N  NE2  . HIS A 1 44 ? -6.546  2.398   -4.086  1.00 0.00 ? 351 HIS A NE2  7  
ATOM   7765  H  H    . HIS A 1 44 ? -3.551  -0.914  -5.509  1.00 0.00 ? 351 HIS A H    7  
ATOM   7766  H  HA   . HIS A 1 44 ? -3.067  0.228   -2.906  1.00 0.00 ? 351 HIS A HA   7  
ATOM   7767  H  HB2  . HIS A 1 44 ? -5.233  -1.642  -3.877  1.00 0.00 ? 351 HIS A HB2  7  
ATOM   7768  H  HB3  . HIS A 1 44 ? -5.163  -0.962  -2.257  1.00 0.00 ? 351 HIS A HB3  7  
ATOM   7769  H  HD2  . HIS A 1 44 ? -5.028  2.081   -2.533  1.00 0.00 ? 351 HIS A HD2  7  
ATOM   7770  H  HE1  . HIS A 1 44 ? -7.882  1.859   -5.667  1.00 0.00 ? 351 HIS A HE1  7  
ATOM   7771  H  HE2  . HIS A 1 44 ? -6.589  3.384   -4.129  1.00 0.00 ? 351 HIS A HE2  7  
ATOM   7772  N  N    . VAL A 1 45 ? -2.509  -1.762  -1.435  1.00 0.00 ? 352 VAL A N    7  
ATOM   7773  C  CA   . VAL A 1 45 ? -1.924  -2.857  -0.664  1.00 0.00 ? 352 VAL A CA   7  
ATOM   7774  C  C    . VAL A 1 45 ? -2.814  -4.096  -0.741  1.00 0.00 ? 352 VAL A C    7  
ATOM   7775  O  O    . VAL A 1 45 ? -2.329  -5.226  -0.833  1.00 0.00 ? 352 VAL A O    7  
ATOM   7776  C  CB   . VAL A 1 45 ? -1.716  -2.458  0.815   1.00 0.00 ? 352 VAL A CB   7  
ATOM   7777  C  CG1  . VAL A 1 45 ? -1.053  -3.583  1.597   1.00 0.00 ? 352 VAL A CG1  7  
ATOM   7778  C  CG2  . VAL A 1 45 ? -0.890  -1.183  0.911   1.00 0.00 ? 352 VAL A CG2  7  
ATOM   7779  H  H    . VAL A 1 45 ? -2.739  -0.923  -0.975  1.00 0.00 ? 352 VAL A H    7  
ATOM   7780  H  HA   . VAL A 1 45 ? -0.960  -3.089  -1.094  1.00 0.00 ? 352 VAL A HA   7  
ATOM   7781  H  HB   . VAL A 1 45 ? -2.684  -2.266  1.255   1.00 0.00 ? 352 VAL A HB   7  
ATOM   7782  H  HG11 . VAL A 1 45 ? -0.931  -3.283  2.627   1.00 0.00 ? 352 VAL A HG11 7  
ATOM   7783  H  HG12 . VAL A 1 45 ? -0.085  -3.798  1.167   1.00 0.00 ? 352 VAL A HG12 7  
ATOM   7784  H  HG13 . VAL A 1 45 ? -1.672  -4.467  1.550   1.00 0.00 ? 352 VAL A HG13 7  
ATOM   7785  H  HG21 . VAL A 1 45 ? -1.403  -0.383  0.397   1.00 0.00 ? 352 VAL A HG21 7  
ATOM   7786  H  HG22 . VAL A 1 45 ? 0.075   -1.344  0.452   1.00 0.00 ? 352 VAL A HG22 7  
ATOM   7787  H  HG23 . VAL A 1 45 ? -0.757  -0.918  1.948   1.00 0.00 ? 352 VAL A HG23 7  
ATOM   7788  N  N    . THR A 1 46 ? -4.123  -3.873  -0.720  1.00 0.00 ? 353 THR A N    7  
ATOM   7789  C  CA   . THR A 1 46 ? -5.083  -4.956  -0.868  1.00 0.00 ? 353 THR A CA   7  
ATOM   7790  C  C    . THR A 1 46 ? -5.041  -5.523  -2.288  1.00 0.00 ? 353 THR A C    7  
ATOM   7791  O  O    . THR A 1 46 ? -5.304  -6.703  -2.502  1.00 0.00 ? 353 THR A O    7  
ATOM   7792  C  CB   . THR A 1 46 ? -6.523  -4.492  -0.530  1.00 0.00 ? 353 THR A CB   7  
ATOM   7793  O  OG1  . THR A 1 46 ? -7.438  -5.593  -0.630  1.00 0.00 ? 353 THR A OG1  7  
ATOM   7794  C  CG2  . THR A 1 46 ? -6.975  -3.371  -1.455  1.00 0.00 ? 353 THR A CG2  7  
ATOM   7795  H  H    . THR A 1 46 ? -4.449  -2.959  -0.589  1.00 0.00 ? 353 THR A H    7  
ATOM   7796  H  HA   . THR A 1 46 ? -4.807  -5.738  -0.173  1.00 0.00 ? 353 THR A HA   7  
ATOM   7797  H  HB   . THR A 1 46 ? -6.532  -4.123  0.485   1.00 0.00 ? 353 THR A HB   7  
ATOM   7798  H  HG1  . THR A 1 46 ? -7.875  -5.718  0.222   1.00 0.00 ? 353 THR A HG1  7  
ATOM   7799  H  HG21 . THR A 1 46 ? -7.985  -3.081  -1.204  1.00 0.00 ? 353 THR A HG21 7  
ATOM   7800  H  HG22 . THR A 1 46 ? -6.944  -3.714  -2.479  1.00 0.00 ? 353 THR A HG22 7  
ATOM   7801  H  HG23 . THR A 1 46 ? -6.317  -2.522  -1.340  1.00 0.00 ? 353 THR A HG23 7  
ATOM   7802  N  N    . CYS A 1 47 ? -4.673  -4.680  -3.252  1.00 0.00 ? 354 CYS A N    7  
ATOM   7803  C  CA   . CYS A 1 47 ? -4.615  -5.092  -4.649  1.00 0.00 ? 354 CYS A CA   7  
ATOM   7804  C  C    . CYS A 1 47 ? -3.372  -5.934  -4.907  1.00 0.00 ? 354 CYS A C    7  
ATOM   7805  O  O    . CYS A 1 47 ? -3.397  -6.851  -5.720  1.00 0.00 ? 354 CYS A O    7  
ATOM   7806  C  CB   . CYS A 1 47 ? -4.619  -3.873  -5.576  1.00 0.00 ? 354 CYS A CB   7  
ATOM   7807  S  SG   . CYS A 1 47 ? -6.106  -2.842  -5.460  1.00 0.00 ? 354 CYS A SG   7  
ATOM   7808  H  H    . CYS A 1 47 ? -4.417  -3.767  -3.013  1.00 0.00 ? 354 CYS A H    7  
ATOM   7809  H  HA   . CYS A 1 47 ? -5.488  -5.692  -4.854  1.00 0.00 ? 354 CYS A HA   7  
ATOM   7810  H  HB2  . CYS A 1 47 ? -3.770  -3.249  -5.339  1.00 0.00 ? 354 CYS A HB2  7  
ATOM   7811  H  HB3  . CYS A 1 47 ? -4.533  -4.210  -6.599  1.00 0.00 ? 354 CYS A HB3  7  
ATOM   7812  N  N    . ALA A 1 48 ? -2.293  -5.617  -4.202  1.00 0.00 ? 355 ALA A N    7  
ATOM   7813  C  CA   . ALA A 1 48 ? -1.042  -6.351  -4.344  1.00 0.00 ? 355 ALA A CA   7  
ATOM   7814  C  C    . ALA A 1 48 ? -1.208  -7.794  -3.899  1.00 0.00 ? 355 ALA A C    7  
ATOM   7815  O  O    . ALA A 1 48 ? -0.784  -8.725  -4.586  1.00 0.00 ? 355 ALA A O    7  
ATOM   7816  C  CB   . ALA A 1 48 ? 0.057   -5.674  -3.542  1.00 0.00 ? 355 ALA A CB   7  
ATOM   7817  H  H    . ALA A 1 48 ? -2.334  -4.863  -3.575  1.00 0.00 ? 355 ALA A H    7  
ATOM   7818  H  HA   . ALA A 1 48 ? -0.762  -6.336  -5.387  1.00 0.00 ? 355 ALA A HA   7  
ATOM   7819  H  HB1  . ALA A 1 48 ? 0.114   -4.632  -3.819  1.00 0.00 ? 355 ALA A HB1  7  
ATOM   7820  H  HB2  . ALA A 1 48 ? 1.001   -6.153  -3.749  1.00 0.00 ? 355 ALA A HB2  7  
ATOM   7821  H  HB3  . ALA A 1 48 ? -0.165  -5.754  -2.489  1.00 0.00 ? 355 ALA A HB3  7  
ATOM   7822  N  N    . GLN A 1 49 ? -1.837  -7.969  -2.747  1.00 0.00 ? 356 GLN A N    7  
ATOM   7823  C  CA   . GLN A 1 49 ? -2.108  -9.296  -2.212  1.00 0.00 ? 356 GLN A CA   7  
ATOM   7824  C  C    . GLN A 1 49 ? -3.198  -9.986  -3.026  1.00 0.00 ? 356 GLN A C    7  
ATOM   7825  O  O    . GLN A 1 49 ? -3.281  -11.212 -3.067  1.00 0.00 ? 356 GLN A O    7  
ATOM   7826  C  CB   . GLN A 1 49 ? -2.532  -9.191  -0.749  1.00 0.00 ? 356 GLN A CB   7  
ATOM   7827  C  CG   . GLN A 1 49 ? -1.481  -8.550  0.141   1.00 0.00 ? 356 GLN A CG   7  
ATOM   7828  C  CD   . GLN A 1 49 ? -1.994  -8.299  1.543   1.00 0.00 ? 356 GLN A CD   7  
ATOM   7829  O  OE1  . GLN A 1 49 ? -1.886  -9.155  2.423   1.00 0.00 ? 356 GLN A OE1  7  
ATOM   7830  N  NE2  . GLN A 1 49 ? -2.554  -7.121  1.763   1.00 0.00 ? 356 GLN A NE2  7  
ATOM   7831  H  H    . GLN A 1 49 ? -2.125  -7.182  -2.239  1.00 0.00 ? 356 GLN A H    7  
ATOM   7832  H  HA   . GLN A 1 49 ? -1.198  -9.875  -2.277  1.00 0.00 ? 356 GLN A HA   7  
ATOM   7833  H  HB2  . GLN A 1 49 ? -3.438  -8.589  -0.691  1.00 0.00 ? 356 GLN A HB2  7  
ATOM   7834  H  HB3  . GLN A 1 49 ? -2.735  -10.191 -0.372  1.00 0.00 ? 356 GLN A HB3  7  
ATOM   7835  H  HG2  . GLN A 1 49 ? -0.621  -9.216  0.201   1.00 0.00 ? 356 GLN A HG2  7  
ATOM   7836  H  HG3  . GLN A 1 49 ? -1.189  -7.596  -0.298  1.00 0.00 ? 356 GLN A HG3  7  
ATOM   7837  H  HE21 . GLN A 1 49 ? -2.602  -6.485  1.019   1.00 0.00 ? 356 GLN A HE21 7  
ATOM   7838  H  HE22 . GLN A 1 49 ? -2.906  -6.937  2.661   1.00 0.00 ? 356 GLN A HE22 7  
ATOM   7839  N  N    . LYS A 1 50 ? -4.024  -9.180  -3.676  1.00 0.00 ? 357 LYS A N    7  
ATOM   7840  C  CA   . LYS A 1 50 ? -5.125  -9.686  -4.480  1.00 0.00 ? 357 LYS A CA   7  
ATOM   7841  C  C    . LYS A 1 50 ? -4.605  -10.222 -5.808  1.00 0.00 ? 357 LYS A C    7  
ATOM   7842  O  O    . LYS A 1 50 ? -5.108  -11.216 -6.331  1.00 0.00 ? 357 LYS A O    7  
ATOM   7843  C  CB   . LYS A 1 50 ? -6.130  -8.564  -4.724  1.00 0.00 ? 357 LYS A CB   7  
ATOM   7844  C  CG   . LYS A 1 50 ? -7.557  -9.038  -4.925  1.00 0.00 ? 357 LYS A CG   7  
ATOM   7845  C  CD   . LYS A 1 50 ? -8.518  -7.863  -5.062  1.00 0.00 ? 357 LYS A CD   7  
ATOM   7846  C  CE   . LYS A 1 50 ? -8.380  -6.862  -3.916  1.00 0.00 ? 357 LYS A CE   7  
ATOM   7847  N  NZ   . LYS A 1 50 ? -8.516  -7.496  -2.575  1.00 0.00 ? 357 LYS A NZ   7  
ATOM   7848  H  H    . LYS A 1 50 ? -3.892  -8.212  -3.608  1.00 0.00 ? 357 LYS A H    7  
ATOM   7849  H  HA   . LYS A 1 50 ? -5.604  -10.485 -3.936  1.00 0.00 ? 357 LYS A HA   7  
ATOM   7850  H  HB2  . LYS A 1 50 ? -6.115  -7.898  -3.875  1.00 0.00 ? 357 LYS A HB2  7  
ATOM   7851  H  HB3  . LYS A 1 50 ? -5.829  -8.014  -5.604  1.00 0.00 ? 357 LYS A HB3  7  
ATOM   7852  H  HG2  . LYS A 1 50 ? -7.603  -9.636  -5.833  1.00 0.00 ? 357 LYS A HG2  7  
ATOM   7853  H  HG3  . LYS A 1 50 ? -7.853  -9.637  -4.068  1.00 0.00 ? 357 LYS A HG3  7  
ATOM   7854  H  HD2  . LYS A 1 50 ? -8.314  -7.355  -5.993  1.00 0.00 ? 357 LYS A HD2  7  
ATOM   7855  H  HD3  . LYS A 1 50 ? -9.529  -8.243  -5.074  1.00 0.00 ? 357 LYS A HD3  7  
ATOM   7856  H  HE2  . LYS A 1 50 ? -7.412  -6.392  -3.983  1.00 0.00 ? 357 LYS A HE2  7  
ATOM   7857  H  HE3  . LYS A 1 50 ? -9.148  -6.109  -4.026  1.00 0.00 ? 357 LYS A HE3  7  
ATOM   7858  H  HZ1  . LYS A 1 50 ? -7.791  -8.229  -2.448  1.00 0.00 ? 357 LYS A HZ1  7  
ATOM   7859  H  HZ2  . LYS A 1 50 ? -9.454  -7.930  -2.478  1.00 0.00 ? 357 LYS A HZ2  7  
ATOM   7860  H  HZ3  . LYS A 1 50 ? -8.400  -6.779  -1.828  1.00 0.00 ? 357 LYS A HZ3  7  
ATOM   7861  N  N    . ALA A 1 51 ? -3.598  -9.552  -6.354  1.00 0.00 ? 358 ALA A N    7  
ATOM   7862  C  CA   . ALA A 1 51 ? -2.987  -9.977  -7.602  1.00 0.00 ? 358 ALA A CA   7  
ATOM   7863  C  C    . ALA A 1 51 ? -1.954  -11.071 -7.359  1.00 0.00 ? 358 ALA A C    7  
ATOM   7864  O  O    . ALA A 1 51 ? -1.841  -12.014 -8.142  1.00 0.00 ? 358 ALA A O    7  
ATOM   7865  C  CB   . ALA A 1 51 ? -2.348  -8.792  -8.310  1.00 0.00 ? 358 ALA A CB   7  
ATOM   7866  H  H    . ALA A 1 51 ? -3.264  -8.737  -5.910  1.00 0.00 ? 358 ALA A H    7  
ATOM   7867  H  HA   . ALA A 1 51 ? -3.768  -10.366 -8.237  1.00 0.00 ? 358 ALA A HA   7  
ATOM   7868  H  HB1  . ALA A 1 51 ? -3.090  -8.024  -8.468  1.00 0.00 ? 358 ALA A HB1  7  
ATOM   7869  H  HB2  . ALA A 1 51 ? -1.951  -9.111  -9.262  1.00 0.00 ? 358 ALA A HB2  7  
ATOM   7870  H  HB3  . ALA A 1 51 ? -1.547  -8.398  -7.701  1.00 0.00 ? 358 ALA A HB3  7  
ATOM   7871  N  N    . GLY A 1 52 ? -1.216  -10.951 -6.262  1.00 0.00 ? 359 GLY A N    7  
ATOM   7872  C  CA   . GLY A 1 52 ? -0.159  -11.899 -5.974  1.00 0.00 ? 359 GLY A CA   7  
ATOM   7873  C  C    . GLY A 1 52 ? 1.077   -11.610 -6.797  1.00 0.00 ? 359 GLY A C    7  
ATOM   7874  O  O    . GLY A 1 52 ? 1.561   -12.470 -7.534  1.00 0.00 ? 359 GLY A O    7  
ATOM   7875  H  H    . GLY A 1 52 ? -1.388  -10.207 -5.645  1.00 0.00 ? 359 GLY A H    7  
ATOM   7876  H  HA2  . GLY A 1 52 ? 0.093   -11.839 -4.924  1.00 0.00 ? 359 GLY A HA2  7  
ATOM   7877  H  HA3  . GLY A 1 52 ? -0.506  -12.896 -6.199  1.00 0.00 ? 359 GLY A HA3  7  
ATOM   7878  N  N    . LEU A 1 53 ? 1.582   -10.393 -6.669  1.00 0.00 ? 360 LEU A N    7  
ATOM   7879  C  CA   . LEU A 1 53 ? 2.700   -9.932  -7.481  1.00 0.00 ? 360 LEU A CA   7  
ATOM   7880  C  C    . LEU A 1 53 ? 4.034   -10.076 -6.747  1.00 0.00 ? 360 LEU A C    7  
ATOM   7881  O  O    . LEU A 1 53 ? 4.104   -10.665 -5.666  1.00 0.00 ? 360 LEU A O    7  
ATOM   7882  C  CB   . LEU A 1 53 ? 2.460   -8.481  -7.929  1.00 0.00 ? 360 LEU A CB   7  
ATOM   7883  C  CG   . LEU A 1 53 ? 1.951   -7.513  -6.848  1.00 0.00 ? 360 LEU A CG   7  
ATOM   7884  C  CD1  . LEU A 1 53 ? 3.069   -7.091  -5.905  1.00 0.00 ? 360 LEU A CD1  7  
ATOM   7885  C  CD2  . LEU A 1 53 ? 1.310   -6.296  -7.494  1.00 0.00 ? 360 LEU A CD2  7  
ATOM   7886  H  H    . LEU A 1 53 ? 1.198   -9.791  -6.002  1.00 0.00 ? 360 LEU A H    7  
ATOM   7887  H  HA   . LEU A 1 53 ? 2.732   -10.558 -8.360  1.00 0.00 ? 360 LEU A HA   7  
ATOM   7888  H  HB2  . LEU A 1 53 ? 3.405   -8.086  -8.311  1.00 0.00 ? 360 LEU A HB2  7  
ATOM   7889  H  HB3  . LEU A 1 53 ? 1.724   -8.499  -8.737  1.00 0.00 ? 360 LEU A HB3  7  
ATOM   7890  H  HG   . LEU A 1 53 ? 1.194   -8.010  -6.260  1.00 0.00 ? 360 LEU A HG   7  
ATOM   7891  H  HD11 . LEU A 1 53 ? 2.678   -6.410  -5.164  1.00 0.00 ? 360 LEU A HD11 7  
ATOM   7892  H  HD12 . LEU A 1 53 ? 3.849   -6.600  -6.468  1.00 0.00 ? 360 LEU A HD12 7  
ATOM   7893  H  HD13 . LEU A 1 53 ? 3.476   -7.963  -5.414  1.00 0.00 ? 360 LEU A HD13 7  
ATOM   7894  H  HD21 . LEU A 1 53 ? 0.455   -6.606  -8.077  1.00 0.00 ? 360 LEU A HD21 7  
ATOM   7895  H  HD22 . LEU A 1 53 ? 2.027   -5.811  -8.139  1.00 0.00 ? 360 LEU A HD22 7  
ATOM   7896  H  HD23 . LEU A 1 53 ? 0.990   -5.608  -6.727  1.00 0.00 ? 360 LEU A HD23 7  
ATOM   7897  N  N    . TYR A 1 54 ? 5.088   -9.537  -7.348  1.00 0.00 ? 361 TYR A N    7  
ATOM   7898  C  CA   . TYR A 1 54 ? 6.442   -9.682  -6.827  1.00 0.00 ? 361 TYR A CA   7  
ATOM   7899  C  C    . TYR A 1 54 ? 6.752   -8.624  -5.772  1.00 0.00 ? 361 TYR A C    7  
ATOM   7900  O  O    . TYR A 1 54 ? 6.501   -7.434  -5.970  1.00 0.00 ? 361 TYR A O    7  
ATOM   7901  C  CB   . TYR A 1 54 ? 7.448   -9.590  -7.980  1.00 0.00 ? 361 TYR A CB   7  
ATOM   7902  C  CG   . TYR A 1 54 ? 8.900   -9.649  -7.552  1.00 0.00 ? 361 TYR A CG   7  
ATOM   7903  C  CD1  . TYR A 1 54 ? 9.570   -10.862 -7.452  1.00 0.00 ? 361 TYR A CD1  7  
ATOM   7904  C  CD2  . TYR A 1 54 ? 9.602   -8.486  -7.258  1.00 0.00 ? 361 TYR A CD2  7  
ATOM   7905  C  CE1  . TYR A 1 54 ? 10.897  -10.914 -7.070  1.00 0.00 ? 361 TYR A CE1  7  
ATOM   7906  C  CE2  . TYR A 1 54 ? 10.926  -8.530  -6.873  1.00 0.00 ? 361 TYR A CE2  7  
ATOM   7907  C  CZ   . TYR A 1 54 ? 11.572  -9.745  -6.781  1.00 0.00 ? 361 TYR A CZ   7  
ATOM   7908  O  OH   . TYR A 1 54 ? 12.896  -9.792  -6.407  1.00 0.00 ? 361 TYR A OH   7  
ATOM   7909  H  H    . TYR A 1 54 ? 4.952   -9.015  -8.165  1.00 0.00 ? 361 TYR A H    7  
ATOM   7910  H  HA   . TYR A 1 54 ? 6.519   -10.658 -6.373  1.00 0.00 ? 361 TYR A HA   7  
ATOM   7911  H  HB2  . TYR A 1 54 ? 7.274   -10.409 -8.663  1.00 0.00 ? 361 TYR A HB2  7  
ATOM   7912  H  HB3  . TYR A 1 54 ? 7.294   -8.658  -8.504  1.00 0.00 ? 361 TYR A HB3  7  
ATOM   7913  H  HD1  . TYR A 1 54 ? 9.039   -11.775 -7.677  1.00 0.00 ? 361 TYR A HD1  7  
ATOM   7914  H  HD2  . TYR A 1 54 ? 9.095   -7.538  -7.329  1.00 0.00 ? 361 TYR A HD2  7  
ATOM   7915  H  HE1  . TYR A 1 54 ? 11.402  -11.866 -6.996  1.00 0.00 ? 361 TYR A HE1  7  
ATOM   7916  H  HE2  . TYR A 1 54 ? 11.451  -7.613  -6.645  1.00 0.00 ? 361 TYR A HE2  7  
ATOM   7917  H  HH   . TYR A 1 54 ? 13.355  -10.453 -6.940  1.00 0.00 ? 361 TYR A HH   7  
ATOM   7918  N  N    . MET A 1 55 ? 7.309   -9.064  -4.655  1.00 0.00 ? 362 MET A N    7  
ATOM   7919  C  CA   . MET A 1 55 ? 7.719   -8.157  -3.596  1.00 0.00 ? 362 MET A CA   7  
ATOM   7920  C  C    . MET A 1 55 ? 9.177   -8.389  -3.225  1.00 0.00 ? 362 MET A C    7  
ATOM   7921  O  O    . MET A 1 55 ? 9.669   -9.517  -3.255  1.00 0.00 ? 362 MET A O    7  
ATOM   7922  C  CB   . MET A 1 55 ? 6.828   -8.318  -2.361  1.00 0.00 ? 362 MET A CB   7  
ATOM   7923  C  CG   . MET A 1 55 ? 5.478   -7.630  -2.490  1.00 0.00 ? 362 MET A CG   7  
ATOM   7924  S  SD   . MET A 1 55 ? 4.410   -7.908  -1.062  1.00 0.00 ? 362 MET A SD   7  
ATOM   7925  C  CE   . MET A 1 55 ? 3.003   -6.889  -1.500  1.00 0.00 ? 362 MET A CE   7  
ATOM   7926  H  H    . MET A 1 55 ? 7.454   -10.026 -4.539  1.00 0.00 ? 362 MET A H    7  
ATOM   7927  H  HA   . MET A 1 55 ? 7.617   -7.150  -3.969  1.00 0.00 ? 362 MET A HA   7  
ATOM   7928  H  HB2  . MET A 1 55 ? 6.657   -9.371  -2.190  1.00 0.00 ? 362 MET A HB2  7  
ATOM   7929  H  HB3  . MET A 1 55 ? 7.340   -7.902  -1.505  1.00 0.00 ? 362 MET A HB3  7  
ATOM   7930  H  HG2  . MET A 1 55 ? 5.642   -6.568  -2.594  1.00 0.00 ? 362 MET A HG2  7  
ATOM   7931  H  HG3  . MET A 1 55 ? 4.982   -8.001  -3.374  1.00 0.00 ? 362 MET A HG3  7  
ATOM   7932  H  HE1  . MET A 1 55 ? 2.585   -7.235  -2.434  1.00 0.00 ? 362 MET A HE1  7  
ATOM   7933  H  HE2  . MET A 1 55 ? 3.320   -5.862  -1.607  1.00 0.00 ? 362 MET A HE2  7  
ATOM   7934  H  HE3  . MET A 1 55 ? 2.253   -6.956  -0.724  1.00 0.00 ? 362 MET A HE3  7  
ATOM   7935  N  N    . LYS A 1 56 ? 9.857   -7.308  -2.889  1.00 0.00 ? 363 LYS A N    7  
ATOM   7936  C  CA   . LYS A 1 56 ? 11.248  -7.353  -2.482  1.00 0.00 ? 363 LYS A CA   7  
ATOM   7937  C  C    . LYS A 1 56 ? 11.347  -7.014  -1.002  1.00 0.00 ? 363 LYS A C    7  
ATOM   7938  O  O    . LYS A 1 56 ? 10.942  -5.937  -0.577  1.00 0.00 ? 363 LYS A O    7  
ATOM   7939  C  CB   . LYS A 1 56 ? 12.063  -6.350  -3.305  1.00 0.00 ? 363 LYS A CB   7  
ATOM   7940  C  CG   . LYS A 1 56 ? 13.104  -6.990  -4.212  1.00 0.00 ? 363 LYS A CG   7  
ATOM   7941  C  CD   . LYS A 1 56 ? 14.270  -7.556  -3.418  1.00 0.00 ? 363 LYS A CD   7  
ATOM   7942  C  CE   . LYS A 1 56 ? 15.389  -8.031  -4.331  1.00 0.00 ? 363 LYS A CE   7  
ATOM   7943  N  NZ   . LYS A 1 56 ? 16.600  -8.430  -3.567  1.00 0.00 ? 363 LYS A NZ   7  
ATOM   7944  H  H    . LYS A 1 56 ? 9.396   -6.438  -2.891  1.00 0.00 ? 363 LYS A H    7  
ATOM   7945  H  HA   . LYS A 1 56 ? 11.623  -8.350  -2.650  1.00 0.00 ? 363 LYS A HA   7  
ATOM   7946  H  HB2  . LYS A 1 56 ? 11.377  -5.778  -3.932  1.00 0.00 ? 363 LYS A HB2  7  
ATOM   7947  H  HB3  . LYS A 1 56 ? 12.581  -5.678  -2.618  1.00 0.00 ? 363 LYS A HB3  7  
ATOM   7948  H  HG2  . LYS A 1 56 ? 12.640  -7.790  -4.767  1.00 0.00 ? 363 LYS A HG2  7  
ATOM   7949  H  HG3  . LYS A 1 56 ? 13.477  -6.242  -4.899  1.00 0.00 ? 363 LYS A HG3  7  
ATOM   7950  H  HD2  . LYS A 1 56 ? 14.656  -6.786  -2.766  1.00 0.00 ? 363 LYS A HD2  7  
ATOM   7951  H  HD3  . LYS A 1 56 ? 13.920  -8.390  -2.827  1.00 0.00 ? 363 LYS A HD3  7  
ATOM   7952  H  HE2  . LYS A 1 56 ? 15.038  -8.880  -4.899  1.00 0.00 ? 363 LYS A HE2  7  
ATOM   7953  H  HE3  . LYS A 1 56 ? 15.649  -7.229  -5.009  1.00 0.00 ? 363 LYS A HE3  7  
ATOM   7954  H  HZ1  . LYS A 1 56 ? 16.932  -7.636  -2.971  1.00 0.00 ? 363 LYS A HZ1  7  
ATOM   7955  H  HZ2  . LYS A 1 56 ? 17.362  -8.698  -4.218  1.00 0.00 ? 363 LYS A HZ2  7  
ATOM   7956  H  HZ3  . LYS A 1 56 ? 16.388  -9.241  -2.953  1.00 0.00 ? 363 LYS A HZ3  7  
ATOM   7957  N  N    . MET A 1 57 ? 11.895  -7.916  -0.218  1.00 0.00 ? 364 MET A N    7  
ATOM   7958  C  CA   . MET A 1 57 ? 11.952  -7.725  1.216   1.00 0.00 ? 364 MET A CA   7  
ATOM   7959  C  C    . MET A 1 57 ? 13.401  -7.754  1.619   1.00 0.00 ? 364 MET A C    7  
ATOM   7960  O  O    . MET A 1 57 ? 14.038  -8.807  1.625   1.00 0.00 ? 364 MET A O    7  
ATOM   7961  C  CB   . MET A 1 57 ? 11.156  -8.802  1.959   1.00 0.00 ? 364 MET A CB   7  
ATOM   7962  C  CG   . MET A 1 57 ? 9.731   -8.967  1.460   1.00 0.00 ? 364 MET A CG   7  
ATOM   7963  S  SD   . MET A 1 57 ? 8.789   -10.157 2.433   1.00 0.00 ? 364 MET A SD   7  
ATOM   7964  C  CE   . MET A 1 57 ? 7.240   -10.176 1.533   1.00 0.00 ? 364 MET A CE   7  
ATOM   7965  H  H    . MET A 1 57 ? 12.335  -8.690  -0.609  1.00 0.00 ? 364 MET A H    7  
ATOM   7966  H  HA   . MET A 1 57 ? 11.541  -6.752  1.442   1.00 0.00 ? 364 MET A HA   7  
ATOM   7967  H  HB2  . MET A 1 57 ? 11.659  -9.746  1.850   1.00 0.00 ? 364 MET A HB2  7  
ATOM   7968  H  HB3  . MET A 1 57 ? 11.118  -8.544  3.007   1.00 0.00 ? 364 MET A HB3  7  
ATOM   7969  H  HG2  . MET A 1 57 ? 9.236   -8.011  1.507   1.00 0.00 ? 364 MET A HG2  7  
ATOM   7970  H  HG3  . MET A 1 57 ? 9.761   -9.304  0.434   1.00 0.00 ? 364 MET A HG3  7  
ATOM   7971  H  HE1  . MET A 1 57 ? 6.556   -10.863 2.009   1.00 0.00 ? 364 MET A HE1  7  
ATOM   7972  H  HE2  . MET A 1 57 ? 7.419   -10.492 0.516   1.00 0.00 ? 364 MET A HE2  7  
ATOM   7973  H  HE3  . MET A 1 57 ? 6.812   -9.185  1.533   1.00 0.00 ? 364 MET A HE3  7  
ATOM   7974  N  N    . GLU A 1 58 ? 13.920  -6.593  1.925   1.00 0.00 ? 365 GLU A N    7  
ATOM   7975  C  CA   . GLU A 1 58 ? 15.345  -6.414  2.041   1.00 0.00 ? 365 GLU A CA   7  
ATOM   7976  C  C    . GLU A 1 58 ? 15.744  -6.033  3.458   1.00 0.00 ? 365 GLU A C    7  
ATOM   7977  O  O    . GLU A 1 58 ? 15.250  -5.047  4.003   1.00 0.00 ? 365 GLU A O    7  
ATOM   7978  C  CB   . GLU A 1 58 ? 15.764  -5.331  1.053   1.00 0.00 ? 365 GLU A CB   7  
ATOM   7979  C  CG   . GLU A 1 58 ? 15.615  -5.741  -0.404  1.00 0.00 ? 365 GLU A CG   7  
ATOM   7980  C  CD   . GLU A 1 58 ? 16.703  -6.687  -0.866  1.00 0.00 ? 365 GLU A CD   7  
ATOM   7981  O  OE1  . GLU A 1 58 ? 16.945  -7.709  -0.192  1.00 0.00 ? 365 GLU A OE1  7  
ATOM   7982  O  OE2  . GLU A 1 58 ? 17.315  -6.423  -1.919  1.00 0.00 ? 365 GLU A OE2  7  
ATOM   7983  H  H    . GLU A 1 58 ? 13.325  -5.825  2.080   1.00 0.00 ? 365 GLU A H    7  
ATOM   7984  H  HA   . GLU A 1 58 ? 15.824  -7.340  1.771   1.00 0.00 ? 365 GLU A HA   7  
ATOM   7985  H  HB2  . GLU A 1 58 ? 15.142  -4.465  1.215   1.00 0.00 ? 365 GLU A HB2  7  
ATOM   7986  H  HB3  . GLU A 1 58 ? 16.794  -5.069  1.230   1.00 0.00 ? 365 GLU A HB3  7  
ATOM   7987  H  HG2  . GLU A 1 58 ? 14.659  -6.231  -0.527  1.00 0.00 ? 365 GLU A HG2  7  
ATOM   7988  H  HG3  . GLU A 1 58 ? 15.643  -4.853  -1.019  1.00 0.00 ? 365 GLU A HG3  7  
ATOM   7989  N  N    . PRO A 1 59 ? 16.626  -6.821  4.082   1.00 0.00 ? 366 PRO A N    7  
ATOM   7990  C  CA   . PRO A 1 59 ? 17.193  -6.493  5.383   1.00 0.00 ? 366 PRO A CA   7  
ATOM   7991  C  C    . PRO A 1 59 ? 18.237  -5.392  5.257   1.00 0.00 ? 366 PRO A C    7  
ATOM   7992  O  O    . PRO A 1 59 ? 19.371  -5.638  4.848   1.00 0.00 ? 366 PRO A O    7  
ATOM   7993  C  CB   . PRO A 1 59 ? 17.842  -7.803  5.856   1.00 0.00 ? 366 PRO A CB   7  
ATOM   7994  C  CG   . PRO A 1 59 ? 17.439  -8.842  4.858   1.00 0.00 ? 366 PRO A CG   7  
ATOM   7995  C  CD   . PRO A 1 59 ? 17.128  -8.106  3.588   1.00 0.00 ? 366 PRO A CD   7  
ATOM   7996  H  HA   . PRO A 1 59 ? 16.428  -6.186  6.083   1.00 0.00 ? 366 PRO A HA   7  
ATOM   7997  H  HB2  . PRO A 1 59 ? 18.915  -7.683  5.884   1.00 0.00 ? 366 PRO A HB2  7  
ATOM   7998  H  HB3  . PRO A 1 59 ? 17.480  -8.047  6.844   1.00 0.00 ? 366 PRO A HB3  7  
ATOM   7999  H  HG2  . PRO A 1 59 ? 18.253  -9.534  4.702   1.00 0.00 ? 366 PRO A HG2  7  
ATOM   8000  H  HG3  . PRO A 1 59 ? 16.563  -9.366  5.211   1.00 0.00 ? 366 PRO A HG3  7  
ATOM   8001  H  HD2  . PRO A 1 59 ? 18.022  -7.972  2.998   1.00 0.00 ? 366 PRO A HD2  7  
ATOM   8002  H  HD3  . PRO A 1 59 ? 16.372  -8.630  3.025   1.00 0.00 ? 366 PRO A HD3  7  
ATOM   8003  N  N    . VAL A 1 60 ? 17.841  -4.178  5.591   1.00 0.00 ? 367 VAL A N    7  
ATOM   8004  C  CA   . VAL A 1 60 ? 18.711  -3.027  5.456   1.00 0.00 ? 367 VAL A CA   7  
ATOM   8005  C  C    . VAL A 1 60 ? 19.352  -2.666  6.786   1.00 0.00 ? 367 VAL A C    7  
ATOM   8006  O  O    . VAL A 1 60 ? 18.704  -2.696  7.836   1.00 0.00 ? 367 VAL A O    7  
ATOM   8007  C  CB   . VAL A 1 60 ? 17.958  -1.798  4.896   1.00 0.00 ? 367 VAL A CB   7  
ATOM   8008  C  CG1  . VAL A 1 60 ? 17.729  -1.948  3.399   1.00 0.00 ? 367 VAL A CG1  7  
ATOM   8009  C  CG2  . VAL A 1 60 ? 16.631  -1.594  5.612   1.00 0.00 ? 367 VAL A CG2  7  
ATOM   8010  H  H    . VAL A 1 60 ? 16.941  -4.055  5.967   1.00 0.00 ? 367 VAL A H    7  
ATOM   8011  H  HA   . VAL A 1 60 ? 19.492  -3.287  4.757   1.00 0.00 ? 367 VAL A HA   7  
ATOM   8012  H  HB   . VAL A 1 60 ? 18.566  -0.922  5.063   1.00 0.00 ? 367 VAL A HB   7  
ATOM   8013  H  HG11 . VAL A 1 60 ? 17.151  -2.840  3.211   1.00 0.00 ? 367 VAL A HG11 7  
ATOM   8014  H  HG12 . VAL A 1 60 ? 18.682  -2.023  2.895   1.00 0.00 ? 367 VAL A HG12 7  
ATOM   8015  H  HG13 . VAL A 1 60 ? 17.192  -1.087  3.028   1.00 0.00 ? 367 VAL A HG13 7  
ATOM   8016  H  HG21 . VAL A 1 60 ? 16.009  -2.466  5.475   1.00 0.00 ? 367 VAL A HG21 7  
ATOM   8017  H  HG22 . VAL A 1 60 ? 16.131  -0.728  5.203   1.00 0.00 ? 367 VAL A HG22 7  
ATOM   8018  H  HG23 . VAL A 1 60 ? 16.812  -1.442  6.664   1.00 0.00 ? 367 VAL A HG23 7  
ATOM   8019  N  N    . LYS A 1 61 ? 20.636  -2.359  6.740   1.00 0.00 ? 368 LYS A N    7  
ATOM   8020  C  CA   . LYS A 1 61 ? 21.339  -1.890  7.916   1.00 0.00 ? 368 LYS A CA   7  
ATOM   8021  C  C    . LYS A 1 61 ? 20.940  -0.467  8.238   1.00 0.00 ? 368 LYS A C    7  
ATOM   8022  O  O    . LYS A 1 61 ? 20.537  0.297   7.360   1.00 0.00 ? 368 LYS A O    7  
ATOM   8023  C  CB   . LYS A 1 61 ? 22.848  -1.967  7.727   1.00 0.00 ? 368 LYS A CB   7  
ATOM   8024  C  CG   . LYS A 1 61 ? 23.400  -3.373  7.838   1.00 0.00 ? 368 LYS A CG   7  
ATOM   8025  C  CD   . LYS A 1 61 ? 24.898  -3.393  7.613   1.00 0.00 ? 368 LYS A CD   7  
ATOM   8026  C  CE   . LYS A 1 61 ? 25.647  -2.602  8.676   1.00 0.00 ? 368 LYS A CE   7  
ATOM   8027  N  NZ   . LYS A 1 61 ? 27.113  -2.617  8.441   1.00 0.00 ? 368 LYS A NZ   7  
ATOM   8028  H  H    . LYS A 1 61 ? 21.124  -2.455  5.894   1.00 0.00 ? 368 LYS A H    7  
ATOM   8029  H  HA   . LYS A 1 61 ? 21.056  -2.523  8.743   1.00 0.00 ? 368 LYS A HA   7  
ATOM   8030  H  HB2  . LYS A 1 61 ? 23.097  -1.581  6.749   1.00 0.00 ? 368 LYS A HB2  7  
ATOM   8031  H  HB3  . LYS A 1 61 ? 23.322  -1.355  8.479   1.00 0.00 ? 368 LYS A HB3  7  
ATOM   8032  H  HG2  . LYS A 1 61 ? 23.188  -3.755  8.825   1.00 0.00 ? 368 LYS A HG2  7  
ATOM   8033  H  HG3  . LYS A 1 61 ? 22.923  -3.998  7.098   1.00 0.00 ? 368 LYS A HG3  7  
ATOM   8034  H  HD2  . LYS A 1 61 ? 25.239  -4.413  7.633   1.00 0.00 ? 368 LYS A HD2  7  
ATOM   8035  H  HD3  . LYS A 1 61 ? 25.105  -2.959  6.648   1.00 0.00 ? 368 LYS A HD3  7  
ATOM   8036  H  HE2  . LYS A 1 61 ? 25.299  -1.581  8.661   1.00 0.00 ? 368 LYS A HE2  7  
ATOM   8037  H  HE3  . LYS A 1 61 ? 25.442  -3.039  9.643   1.00 0.00 ? 368 LYS A HE3  7  
ATOM   8038  H  HZ1  . LYS A 1 61 ? 27.477  -3.589  8.509   1.00 0.00 ? 368 LYS A HZ1  7  
ATOM   8039  H  HZ2  . LYS A 1 61 ? 27.597  -2.030  9.150   1.00 0.00 ? 368 LYS A HZ2  7  
ATOM   8040  H  HZ3  . LYS A 1 61 ? 27.330  -2.243  7.495   1.00 0.00 ? 368 LYS A HZ3  7  
ATOM   8041  N  N    . GLU A 1 62 ? 21.073  -0.119  9.496   1.00 0.00 ? 369 GLU A N    7  
ATOM   8042  C  CA   . GLU A 1 62 ? 20.652  1.182   9.981   1.00 0.00 ? 369 GLU A CA   7  
ATOM   8043  C  C    . GLU A 1 62 ? 21.661  1.733   10.978  1.00 0.00 ? 369 GLU A C    7  
ATOM   8044  O  O    . GLU A 1 62 ? 22.652  1.084   11.296  1.00 0.00 ? 369 GLU A O    7  
ATOM   8045  C  CB   . GLU A 1 62 ? 19.266  1.094   10.618  1.00 0.00 ? 369 GLU A CB   7  
ATOM   8046  C  CG   . GLU A 1 62 ? 18.212  1.954   9.939   1.00 0.00 ? 369 GLU A CG   7  
ATOM   8047  C  CD   . GLU A 1 62 ? 18.548  3.433   9.970   1.00 0.00 ? 369 GLU A CD   7  
ATOM   8048  O  OE1  . GLU A 1 62 ? 18.950  3.938   11.042  1.00 0.00 ? 369 GLU A OE1  7  
ATOM   8049  O  OE2  . GLU A 1 62 ? 18.397  4.100   8.930   1.00 0.00 ? 369 GLU A OE2  7  
ATOM   8050  H  H    . GLU A 1 62 ? 21.473  -0.760  10.125  1.00 0.00 ? 369 GLU A H    7  
ATOM   8051  H  HA   . GLU A 1 62 ? 20.605  1.849   9.132   1.00 0.00 ? 369 GLU A HA   7  
ATOM   8052  H  HB2  . GLU A 1 62 ? 18.933  0.068   10.587  1.00 0.00 ? 369 GLU A HB2  7  
ATOM   8053  H  HB3  . GLU A 1 62 ? 19.341  1.407   11.647  1.00 0.00 ? 369 GLU A HB3  7  
ATOM   8054  H  HG2  . GLU A 1 62 ? 18.123  1.646   8.909   1.00 0.00 ? 369 GLU A HG2  7  
ATOM   8055  H  HG3  . GLU A 1 62 ? 17.268  1.805   10.441  1.00 0.00 ? 369 GLU A HG3  7  
ATOM   8056  N  N    . LEU A 1 63 ? 21.396  2.934   11.446  1.00 0.00 ? 370 LEU A N    7  
ATOM   8057  C  CA   . LEU A 1 63 ? 22.292  3.662   12.336  1.00 0.00 ? 370 LEU A CA   7  
ATOM   8058  C  C    . LEU A 1 63 ? 21.563  4.051   13.618  1.00 0.00 ? 370 LEU A C    7  
ATOM   8059  O  O    . LEU A 1 63 ? 22.146  4.063   14.705  1.00 0.00 ? 370 LEU A O    7  
ATOM   8060  C  CB   . LEU A 1 63 ? 22.818  4.922   11.632  1.00 0.00 ? 370 LEU A CB   7  
ATOM   8061  C  CG   . LEU A 1 63 ? 23.554  5.930   12.526  1.00 0.00 ? 370 LEU A CG   7  
ATOM   8062  C  CD1  . LEU A 1 63 ? 24.875  5.362   13.022  1.00 0.00 ? 370 LEU A CD1  7  
ATOM   8063  C  CD2  . LEU A 1 63 ? 23.783  7.232   11.775  1.00 0.00 ? 370 LEU A CD2  7  
ATOM   8064  H  H    . LEU A 1 63 ? 20.535  3.337   11.209  1.00 0.00 ? 370 LEU A H    7  
ATOM   8065  H  HA   . LEU A 1 63 ? 23.123  3.017   12.582  1.00 0.00 ? 370 LEU A HA   7  
ATOM   8066  H  HB2  . LEU A 1 63 ? 23.493  4.612   10.847  1.00 0.00 ? 370 LEU A HB2  7  
ATOM   8067  H  HB3  . LEU A 1 63 ? 21.979  5.428   11.178  1.00 0.00 ? 370 LEU A HB3  7  
ATOM   8068  H  HG   . LEU A 1 63 ? 22.941  6.147   13.388  1.00 0.00 ? 370 LEU A HG   7  
ATOM   8069  H  HD11 . LEU A 1 63 ? 25.498  5.114   12.178  1.00 0.00 ? 370 LEU A HD11 7  
ATOM   8070  H  HD12 . LEU A 1 63 ? 24.688  4.474   13.607  1.00 0.00 ? 370 LEU A HD12 7  
ATOM   8071  H  HD13 . LEU A 1 63 ? 25.374  6.098   13.634  1.00 0.00 ? 370 LEU A HD13 7  
ATOM   8072  H  HD21 . LEU A 1 63 ? 24.367  7.037   10.888  1.00 0.00 ? 370 LEU A HD21 7  
ATOM   8073  H  HD22 . LEU A 1 63 ? 24.313  7.926   12.410  1.00 0.00 ? 370 LEU A HD22 7  
ATOM   8074  H  HD23 . LEU A 1 63 ? 22.831  7.657   11.493  1.00 0.00 ? 370 LEU A HD23 7  
ATOM   8075  N  N    . THR A 1 64 ? 20.280  4.354   13.480  1.00 0.00 ? 371 THR A N    7  
ATOM   8076  C  CA   . THR A 1 64 ? 19.477  4.822   14.598  1.00 0.00 ? 371 THR A CA   7  
ATOM   8077  C  C    . THR A 1 64 ? 19.292  3.725   15.641  1.00 0.00 ? 371 THR A C    7  
ATOM   8078  O  O    . THR A 1 64 ? 18.855  2.622   15.328  1.00 0.00 ? 371 THR A O    7  
ATOM   8079  C  CB   . THR A 1 64 ? 18.103  5.336   14.120  1.00 0.00 ? 371 THR A CB   7  
ATOM   8080  O  OG1  . THR A 1 64 ? 17.504  4.399   13.210  1.00 0.00 ? 371 THR A OG1  7  
ATOM   8081  C  CG2  . THR A 1 64 ? 18.243  6.691   13.442  1.00 0.00 ? 371 THR A CG2  7  
ATOM   8082  H  H    . THR A 1 64 ? 19.856  4.243   12.604  1.00 0.00 ? 371 THR A H    7  
ATOM   8083  H  HA   . THR A 1 64 ? 20.004  5.647   15.055  1.00 0.00 ? 371 THR A HA   7  
ATOM   8084  H  HB   . THR A 1 64 ? 17.460  5.448   14.981  1.00 0.00 ? 371 THR A HB   7  
ATOM   8085  H  HG1  . THR A 1 64 ? 18.073  4.289   12.429  1.00 0.00 ? 371 THR A HG1  7  
ATOM   8086  H  HG21 . THR A 1 64 ? 18.902  6.602   12.592  1.00 0.00 ? 371 THR A HG21 7  
ATOM   8087  H  HG22 . THR A 1 64 ? 18.655  7.403   14.142  1.00 0.00 ? 371 THR A HG22 7  
ATOM   8088  H  HG23 . THR A 1 64 ? 17.274  7.031   13.112  1.00 0.00 ? 371 THR A HG23 7  
ATOM   8089  N  N    . GLY A 1 65 ? 19.647  4.029   16.876  1.00 0.00 ? 372 GLY A N    7  
ATOM   8090  C  CA   . GLY A 1 65 ? 19.537  3.055   17.939  1.00 0.00 ? 372 GLY A CA   7  
ATOM   8091  C  C    . GLY A 1 65 ? 20.870  2.797   18.602  1.00 0.00 ? 372 GLY A C    7  
ATOM   8092  O  O    . GLY A 1 65 ? 20.930  2.316   19.733  1.00 0.00 ? 372 GLY A O    7  
ATOM   8093  H  H    . GLY A 1 65 ? 19.993  4.925   17.071  1.00 0.00 ? 372 GLY A H    7  
ATOM   8094  H  HA2  . GLY A 1 65 ? 18.841  3.419   18.678  1.00 0.00 ? 372 GLY A HA2  7  
ATOM   8095  H  HA3  . GLY A 1 65 ? 19.164  2.128   17.529  1.00 0.00 ? 372 GLY A HA3  7  
ATOM   8096  N  N    . GLY A 1 66 ? 21.944  3.127   17.900  1.00 0.00 ? 373 GLY A N    7  
ATOM   8097  C  CA   . GLY A 1 66 ? 23.271  2.932   18.442  1.00 0.00 ? 373 GLY A CA   7  
ATOM   8098  C  C    . GLY A 1 66 ? 24.181  2.225   17.464  1.00 0.00 ? 373 GLY A C    7  
ATOM   8099  O  O    . GLY A 1 66 ? 24.312  1.001   17.502  1.00 0.00 ? 373 GLY A O    7  
ATOM   8100  H  H    . GLY A 1 66 ? 21.835  3.500   16.998  1.00 0.00 ? 373 GLY A H    7  
ATOM   8101  H  HA2  . GLY A 1 66 ? 23.695  3.895   18.687  1.00 0.00 ? 373 GLY A HA2  7  
ATOM   8102  H  HA3  . GLY A 1 66 ? 23.199  2.341   19.343  1.00 0.00 ? 373 GLY A HA3  7  
ATOM   8103  N  N    . GLY A 1 67 ? 24.794  2.992   16.574  1.00 0.00 ? 374 GLY A N    7  
ATOM   8104  C  CA   . GLY A 1 67 ? 25.703  2.421   15.601  1.00 0.00 ? 374 GLY A CA   7  
ATOM   8105  C  C    . GLY A 1 67 ? 24.974  1.762   14.449  1.00 0.00 ? 374 GLY A C    7  
ATOM   8106  O  O    . GLY A 1 67 ? 24.947  2.286   13.339  1.00 0.00 ? 374 GLY A O    7  
ATOM   8107  H  H    . GLY A 1 67 ? 24.630  3.959   16.580  1.00 0.00 ? 374 GLY A H    7  
ATOM   8108  H  HA2  . GLY A 1 67 ? 26.334  3.206   15.212  1.00 0.00 ? 374 GLY A HA2  7  
ATOM   8109  H  HA3  . GLY A 1 67 ? 26.322  1.684   16.091  1.00 0.00 ? 374 GLY A HA3  7  
ATOM   8110  N  N    . THR A 1 68 ? 24.415  0.594   14.702  1.00 0.00 ? 375 THR A N    7  
ATOM   8111  C  CA   . THR A 1 68 ? 23.652  -0.113  13.693  1.00 0.00 ? 375 THR A CA   7  
ATOM   8112  C  C    . THR A 1 68 ? 22.462  -0.844  14.313  1.00 0.00 ? 375 THR A C    7  
ATOM   8113  O  O    . THR A 1 68 ? 22.568  -1.397  15.409  1.00 0.00 ? 375 THR A O    7  
ATOM   8114  C  CB   . THR A 1 68 ? 24.552  -1.123  12.939  1.00 0.00 ? 375 THR A CB   7  
ATOM   8115  O  OG1  . THR A 1 68 ? 25.650  -0.432  12.327  1.00 0.00 ? 375 THR A OG1  7  
ATOM   8116  C  CG2  . THR A 1 68 ? 23.774  -1.881  11.870  1.00 0.00 ? 375 THR A CG2  7  
ATOM   8117  H  H    . THR A 1 68 ? 24.516  0.195   15.596  1.00 0.00 ? 375 THR A H    7  
ATOM   8118  H  HA   . THR A 1 68 ? 23.285  0.614   12.981  1.00 0.00 ? 375 THR A HA   7  
ATOM   8119  H  HB   . THR A 1 68 ? 24.941  -1.837  13.651  1.00 0.00 ? 375 THR A HB   7  
ATOM   8120  H  HG1  . THR A 1 68 ? 25.542  0.517   12.467  1.00 0.00 ? 375 THR A HG1  7  
ATOM   8121  H  HG21 . THR A 1 68 ? 24.423  -2.599  11.393  1.00 0.00 ? 375 THR A HG21 7  
ATOM   8122  H  HG22 . THR A 1 68 ? 23.403  -1.185  11.133  1.00 0.00 ? 375 THR A HG22 7  
ATOM   8123  H  HG23 . THR A 1 68 ? 22.943  -2.396  12.328  1.00 0.00 ? 375 THR A HG23 7  
ATOM   8124  N  N    . THR A 1 69 ? 21.330  -0.834  13.622  1.00 0.00 ? 376 THR A N    7  
ATOM   8125  C  CA   . THR A 1 69 ? 20.248  -1.670  13.945  1.00 0.00 ? 376 THR A CA   7  
ATOM   8126  C  C    . THR A 1 69 ? 19.813  -2.309  12.655  1.00 0.00 ? 376 THR A C    7  
ATOM   8127  O  O    . THR A 1 69 ? 20.229  -1.927  11.561  1.00 0.00 ? 376 THR A O    7  
ATOM   8128  C  CB   . THR A 1 69 ? 19.064  -0.919  14.602  1.00 0.00 ? 376 THR A CB   7  
ATOM   8129  O  OG1  . THR A 1 69 ? 18.018  -1.834  14.952  1.00 0.00 ? 376 THR A OG1  7  
ATOM   8130  C  CG2  . THR A 1 69 ? 18.503  0.151   13.682  1.00 0.00 ? 376 THR A CG2  7  
ATOM   8131  H  H    . THR A 1 69 ? 21.223  -0.277  12.846  1.00 0.00 ? 376 THR A H    7  
ATOM   8132  H  HA   . THR A 1 69 ? 20.598  -2.437  14.623  1.00 0.00 ? 376 THR A HA   7  
ATOM   8133  H  HB   . THR A 1 69 ? 19.419  -0.451  15.497  1.00 0.00 ? 376 THR A HB   7  
ATOM   8134  H  HG1  . THR A 1 69 ? 18.280  -2.345  15.728  1.00 0.00 ? 376 THR A HG1  7  
ATOM   8135  H  HG21 . THR A 1 69 ? 19.255  0.906   13.513  1.00 0.00 ? 376 THR A HG21 7  
ATOM   8136  H  HG22 . THR A 1 69 ? 17.636  0.603   14.140  1.00 0.00 ? 376 THR A HG22 7  
ATOM   8137  H  HG23 . THR A 1 69 ? 18.222  -0.296  12.740  1.00 0.00 ? 376 THR A HG23 7  
ATOM   8138  N  N    . PHE A 1 70 ? 19.003  -3.262  12.822  1.00 0.00 ? 377 PHE A N    7  
ATOM   8139  C  CA   . PHE A 1 70 ? 18.514  -4.088  11.744  1.00 0.00 ? 377 PHE A CA   7  
ATOM   8140  C  C    . PHE A 1 70 ? 17.092  -3.696  11.376  1.00 0.00 ? 377 PHE A C    7  
ATOM   8141  O  O    . PHE A 1 70 ? 16.179  -3.780  12.199  1.00 0.00 ? 377 PHE A O    7  
ATOM   8142  C  CB   . PHE A 1 70 ? 18.564  -5.555  12.156  1.00 0.00 ? 377 PHE A CB   7  
ATOM   8143  C  CG   . PHE A 1 70 ? 19.034  -6.454  11.057  1.00 0.00 ? 377 PHE A CG   7  
ATOM   8144  C  CD1  . PHE A 1 70 ? 20.364  -6.451  10.689  1.00 0.00 ? 377 PHE A CD1  7  
ATOM   8145  C  CD2  . PHE A 1 70 ? 18.156  -7.293  10.395  1.00 0.00 ? 377 PHE A CD2  7  
ATOM   8146  C  CE1  . PHE A 1 70 ? 20.821  -7.273  9.676   1.00 0.00 ? 377 PHE A CE1  7  
ATOM   8147  C  CE2  . PHE A 1 70 ? 18.602  -8.120  9.381   1.00 0.00 ? 377 PHE A CE2  7  
ATOM   8148  C  CZ   . PHE A 1 70 ? 19.936  -8.109  9.020   1.00 0.00 ? 377 PHE A CZ   7  
ATOM   8149  H  H    . PHE A 1 70 ? 18.713  -3.406  13.723  1.00 0.00 ? 377 PHE A H    7  
ATOM   8150  H  HA   . PHE A 1 70 ? 19.155  -3.935  10.890  1.00 0.00 ? 377 PHE A HA   7  
ATOM   8151  H  HB2  . PHE A 1 70 ? 19.252  -5.667  12.995  1.00 0.00 ? 377 PHE A HB2  7  
ATOM   8152  H  HB3  . PHE A 1 70 ? 17.563  -5.874  12.450  1.00 0.00 ? 377 PHE A HB3  7  
ATOM   8153  H  HD1  . PHE A 1 70 ? 21.051  -5.793  11.206  1.00 0.00 ? 377 PHE A HD1  7  
ATOM   8154  H  HD2  . PHE A 1 70 ? 17.114  -7.299  10.678  1.00 0.00 ? 377 PHE A HD2  7  
ATOM   8155  H  HE1  . PHE A 1 70 ? 21.864  -7.262  9.395   1.00 0.00 ? 377 PHE A HE1  7  
ATOM   8156  H  HE2  . PHE A 1 70 ? 17.909  -8.771  8.871   1.00 0.00 ? 377 PHE A HE2  7  
ATOM   8157  H  HZ   . PHE A 1 70 ? 20.288  -8.753  8.227   1.00 0.00 ? 377 PHE A HZ   7  
ATOM   8158  N  N    . SER A 1 71 ? 16.914  -3.256  10.146  1.00 0.00 ? 378 SER A N    7  
ATOM   8159  C  CA   . SER A 1 71 ? 15.607  -2.868  9.657   1.00 0.00 ? 378 SER A CA   7  
ATOM   8160  C  C    . SER A 1 71 ? 15.237  -3.700  8.439   1.00 0.00 ? 378 SER A C    7  
ATOM   8161  O  O    . SER A 1 71 ? 16.098  -4.051  7.638   1.00 0.00 ? 378 SER A O    7  
ATOM   8162  C  CB   . SER A 1 71 ? 15.610  -1.382  9.296   1.00 0.00 ? 378 SER A CB   7  
ATOM   8163  O  OG   . SER A 1 71 ? 15.976  -0.592  10.415  1.00 0.00 ? 378 SER A OG   7  
ATOM   8164  H  H    . SER A 1 71 ? 17.687  -3.192  9.538   1.00 0.00 ? 378 SER A H    7  
ATOM   8165  H  HA   . SER A 1 71 ? 14.885  -3.043  10.440  1.00 0.00 ? 378 SER A HA   7  
ATOM   8166  H  HB2  . SER A 1 71 ? 16.321  -1.207  8.499   1.00 0.00 ? 378 SER A HB2  7  
ATOM   8167  H  HB3  . SER A 1 71 ? 14.624  -1.089  8.969   1.00 0.00 ? 378 SER A HB3  7  
ATOM   8168  H  HG   . SER A 1 71 ? 16.732  -0.995  10.853  1.00 0.00 ? 378 SER A HG   7  
ATOM   8169  N  N    . VAL A 1 72 ? 13.971  -4.042  8.304   1.00 0.00 ? 379 VAL A N    7  
ATOM   8170  C  CA   . VAL A 1 72 ? 13.519  -4.712  7.102   1.00 0.00 ? 379 VAL A CA   7  
ATOM   8171  C  C    . VAL A 1 72 ? 12.795  -3.714  6.222   1.00 0.00 ? 379 VAL A C    7  
ATOM   8172  O  O    . VAL A 1 72 ? 11.951  -2.949  6.691   1.00 0.00 ? 379 VAL A O    7  
ATOM   8173  C  CB   . VAL A 1 72 ? 12.579  -5.895  7.384   1.00 0.00 ? 379 VAL A CB   7  
ATOM   8174  C  CG1  . VAL A 1 72 ? 12.451  -6.786  6.156   1.00 0.00 ? 379 VAL A CG1  7  
ATOM   8175  C  CG2  . VAL A 1 72 ? 13.049  -6.696  8.590   1.00 0.00 ? 379 VAL A CG2  7  
ATOM   8176  H  H    . VAL A 1 72 ? 13.327  -3.837  9.019   1.00 0.00 ? 379 VAL A H    7  
ATOM   8177  H  HA   . VAL A 1 72 ? 14.389  -5.079  6.574   1.00 0.00 ? 379 VAL A HA   7  
ATOM   8178  H  HB   . VAL A 1 72 ? 11.608  -5.491  7.596   1.00 0.00 ? 379 VAL A HB   7  
ATOM   8179  H  HG11 . VAL A 1 72 ? 13.422  -7.178  5.890   1.00 0.00 ? 379 VAL A HG11 7  
ATOM   8180  H  HG12 . VAL A 1 72 ? 12.057  -6.210  5.331   1.00 0.00 ? 379 VAL A HG12 7  
ATOM   8181  H  HG13 . VAL A 1 72 ? 11.781  -7.605  6.374   1.00 0.00 ? 379 VAL A HG13 7  
ATOM   8182  H  HG21 . VAL A 1 72 ? 14.038  -7.090  8.398   1.00 0.00 ? 379 VAL A HG21 7  
ATOM   8183  H  HG22 . VAL A 1 72 ? 12.366  -7.513  8.767   1.00 0.00 ? 379 VAL A HG22 7  
ATOM   8184  H  HG23 . VAL A 1 72 ? 13.079  -6.056  9.459   1.00 0.00 ? 379 VAL A HG23 7  
ATOM   8185  N  N    . ARG A 1 73 ? 13.133  -3.722  4.958   1.00 0.00 ? 380 ARG A N    7  
ATOM   8186  C  CA   . ARG A 1 73 ? 12.552  -2.799  4.005   1.00 0.00 ? 380 ARG A CA   7  
ATOM   8187  C  C    . ARG A 1 73 ? 11.732  -3.572  2.993   1.00 0.00 ? 380 ARG A C    7  
ATOM   8188  O  O    . ARG A 1 73 ? 12.284  -4.235  2.113   1.00 0.00 ? 380 ARG A O    7  
ATOM   8189  C  CB   . ARG A 1 73 ? 13.642  -2.004  3.284   1.00 0.00 ? 380 ARG A CB   7  
ATOM   8190  C  CG   . ARG A 1 73 ? 13.133  -0.735  2.619   1.00 0.00 ? 380 ARG A CG   7  
ATOM   8191  C  CD   . ARG A 1 73 ? 14.161  -0.161  1.657   1.00 0.00 ? 380 ARG A CD   7  
ATOM   8192  N  NE   . ARG A 1 73 ? 13.993  1.281   1.470   1.00 0.00 ? 380 ARG A NE   7  
ATOM   8193  C  CZ   . ARG A 1 73 ? 13.340  1.847   0.451   1.00 0.00 ? 380 ARG A CZ   7  
ATOM   8194  N  NH1  . ARG A 1 73 ? 12.753  1.101   -0.481  1.00 0.00 ? 380 ARG A NH1  7  
ATOM   8195  N  NH2  . ARG A 1 73 ? 13.273  3.171   0.368   1.00 0.00 ? 380 ARG A NH2  7  
ATOM   8196  H  H    . ARG A 1 73 ? 13.785  -4.389  4.652   1.00 0.00 ? 380 ARG A H    7  
ATOM   8197  H  HA   . ARG A 1 73 ? 11.907  -2.118  4.541   1.00 0.00 ? 380 ARG A HA   7  
ATOM   8198  H  HB2  . ARG A 1 73 ? 14.405  -1.730  3.999   1.00 0.00 ? 380 ARG A HB2  7  
ATOM   8199  H  HB3  . ARG A 1 73 ? 14.084  -2.631  2.524   1.00 0.00 ? 380 ARG A HB3  7  
ATOM   8200  H  HG2  . ARG A 1 73 ? 12.231  -0.963  2.072   1.00 0.00 ? 380 ARG A HG2  7  
ATOM   8201  H  HG3  . ARG A 1 73 ? 12.918  -0.002  3.384   1.00 0.00 ? 380 ARG A HG3  7  
ATOM   8202  H  HD2  . ARG A 1 73 ? 15.149  -0.353  2.049   1.00 0.00 ? 380 ARG A HD2  7  
ATOM   8203  H  HD3  . ARG A 1 73 ? 14.052  -0.653  0.701   1.00 0.00 ? 380 ARG A HD3  7  
ATOM   8204  H  HE   . ARG A 1 73 ? 14.409  1.870   2.145   1.00 0.00 ? 380 ARG A HE   7  
ATOM   8205  H  HH11 . ARG A 1 73 ? 12.791  0.100   -0.429  1.00 0.00 ? 380 ARG A HH11 7  
ATOM   8206  H  HH12 . ARG A 1 73 ? 12.265  1.540   -1.239  1.00 0.00 ? 380 ARG A HH12 7  
ATOM   8207  H  HH21 . ARG A 1 73 ? 13.710  3.745   1.068   1.00 0.00 ? 380 ARG A HH21 7  
ATOM   8208  H  HH22 . ARG A 1 73 ? 12.782  3.604   -0.391  1.00 0.00 ? 380 ARG A HH22 7  
ATOM   8209  N  N    . LYS A 1 74 ? 10.423  -3.513  3.132   1.00 0.00 ? 381 LYS A N    7  
ATOM   8210  C  CA   . LYS A 1 74 ? 9.550   -4.215  2.219   1.00 0.00 ? 381 LYS A CA   7  
ATOM   8211  C  C    . LYS A 1 74 ? 9.180   -3.303  1.059   1.00 0.00 ? 381 LYS A C    7  
ATOM   8212  O  O    . LYS A 1 74 ? 8.446   -2.331  1.219   1.00 0.00 ? 381 LYS A O    7  
ATOM   8213  C  CB   . LYS A 1 74 ? 8.293   -4.706  2.932   1.00 0.00 ? 381 LYS A CB   7  
ATOM   8214  C  CG   . LYS A 1 74 ? 7.556   -5.799  2.173   1.00 0.00 ? 381 LYS A CG   7  
ATOM   8215  C  CD   . LYS A 1 74 ? 6.179   -6.060  2.760   1.00 0.00 ? 381 LYS A CD   7  
ATOM   8216  C  CE   . LYS A 1 74 ? 6.256   -6.532  4.206   1.00 0.00 ? 381 LYS A CE   7  
ATOM   8217  N  NZ   . LYS A 1 74 ? 4.907   -6.773  4.786   1.00 0.00 ? 381 LYS A NZ   7  
ATOM   8218  H  H    . LYS A 1 74 ? 10.036  -2.985  3.862   1.00 0.00 ? 381 LYS A H    7  
ATOM   8219  H  HA   . LYS A 1 74 ? 10.093  -5.066  1.831   1.00 0.00 ? 381 LYS A HA   7  
ATOM   8220  H  HB2  . LYS A 1 74 ? 8.572   -5.095  3.902   1.00 0.00 ? 381 LYS A HB2  7  
ATOM   8221  H  HB3  . LYS A 1 74 ? 7.619   -3.873  3.067   1.00 0.00 ? 381 LYS A HB3  7  
ATOM   8222  H  HG2  . LYS A 1 74 ? 7.448   -5.499  1.142   1.00 0.00 ? 381 LYS A HG2  7  
ATOM   8223  H  HG3  . LYS A 1 74 ? 8.139   -6.710  2.226   1.00 0.00 ? 381 LYS A HG3  7  
ATOM   8224  H  HD2  . LYS A 1 74 ? 5.606   -5.146  2.722   1.00 0.00 ? 381 LYS A HD2  7  
ATOM   8225  H  HD3  . LYS A 1 74 ? 5.687   -6.818  2.168   1.00 0.00 ? 381 LYS A HD3  7  
ATOM   8226  H  HE2  . LYS A 1 74 ? 6.822   -7.451  4.242   1.00 0.00 ? 381 LYS A HE2  7  
ATOM   8227  H  HE3  . LYS A 1 74 ? 6.760   -5.777  4.792   1.00 0.00 ? 381 LYS A HE3  7  
ATOM   8228  H  HZ1  . LYS A 1 74 ? 4.412   -7.514  4.253   1.00 0.00 ? 381 LYS A HZ1  7  
ATOM   8229  H  HZ2  . LYS A 1 74 ? 4.343   -5.900  4.753   1.00 0.00 ? 381 LYS A HZ2  7  
ATOM   8230  H  HZ3  . LYS A 1 74 ? 4.994   -7.074  5.777   1.00 0.00 ? 381 LYS A HZ3  7  
ATOM   8231  N  N    . THR A 1 75 ? 9.724   -3.618  -0.094  1.00 0.00 ? 382 THR A N    7  
ATOM   8232  C  CA   . THR A 1 75 ? 9.480   -2.869  -1.311  1.00 0.00 ? 382 THR A CA   7  
ATOM   8233  C  C    . THR A 1 75 ? 8.794   -3.794  -2.310  1.00 0.00 ? 382 THR A C    7  
ATOM   8234  O  O    . THR A 1 75 ? 8.872   -5.008  -2.169  1.00 0.00 ? 382 THR A O    7  
ATOM   8235  C  CB   . THR A 1 75 ? 10.814  -2.336  -1.877  1.00 0.00 ? 382 THR A CB   7  
ATOM   8236  O  OG1  . THR A 1 75 ? 11.500  -1.599  -0.856  1.00 0.00 ? 382 THR A OG1  7  
ATOM   8237  C  CG2  . THR A 1 75 ? 10.601  -1.441  -3.089  1.00 0.00 ? 382 THR A CG2  7  
ATOM   8238  H  H    . THR A 1 75 ? 10.304  -4.413  -0.140  1.00 0.00 ? 382 THR A H    7  
ATOM   8239  H  HA   . THR A 1 75 ? 8.833   -2.034  -1.079  1.00 0.00 ? 382 THR A HA   7  
ATOM   8240  H  HB   . THR A 1 75 ? 11.424  -3.179  -2.171  1.00 0.00 ? 382 THR A HB   7  
ATOM   8241  H  HG1  . THR A 1 75 ? 11.005  -1.671  -0.031  1.00 0.00 ? 382 THR A HG1  7  
ATOM   8242  H  HG21 . THR A 1 75 ? 9.986   -0.599  -2.811  1.00 0.00 ? 382 THR A HG21 7  
ATOM   8243  H  HG22 . THR A 1 75 ? 10.110  -2.006  -3.868  1.00 0.00 ? 382 THR A HG22 7  
ATOM   8244  H  HG23 . THR A 1 75 ? 11.559  -1.087  -3.450  1.00 0.00 ? 382 THR A HG23 7  
ATOM   8245  N  N    . ALA A 1 76 ? 8.097   -3.256  -3.290  1.00 0.00 ? 383 ALA A N    7  
ATOM   8246  C  CA   . ALA A 1 76 ? 7.406   -4.111  -4.233  1.00 0.00 ? 383 ALA A CA   7  
ATOM   8247  C  C    . ALA A 1 76 ? 7.567   -3.625  -5.660  1.00 0.00 ? 383 ALA A C    7  
ATOM   8248  O  O    . ALA A 1 76 ? 7.821   -2.444  -5.915  1.00 0.00 ? 383 ALA A O    7  
ATOM   8249  C  CB   . ALA A 1 76 ? 5.932   -4.220  -3.870  1.00 0.00 ? 383 ALA A CB   7  
ATOM   8250  H  H    . ALA A 1 76 ? 8.044   -2.282  -3.382  1.00 0.00 ? 383 ALA A H    7  
ATOM   8251  H  HA   . ALA A 1 76 ? 7.841   -5.100  -4.159  1.00 0.00 ? 383 ALA A HA   7  
ATOM   8252  H  HB1  . ALA A 1 76 ? 5.445   -3.275  -4.055  1.00 0.00 ? 383 ALA A HB1  7  
ATOM   8253  H  HB2  . ALA A 1 76 ? 5.839   -4.472  -2.825  1.00 0.00 ? 383 ALA A HB2  7  
ATOM   8254  H  HB3  . ALA A 1 76 ? 5.468   -4.990  -4.469  1.00 0.00 ? 383 ALA A HB3  7  
ATOM   8255  N  N    . TYR A 1 77 ? 7.444   -4.556  -6.585  1.00 0.00 ? 384 TYR A N    7  
ATOM   8256  C  CA   . TYR A 1 77 ? 7.398   -4.238  -7.993  1.00 0.00 ? 384 TYR A CA   7  
ATOM   8257  C  C    . TYR A 1 77 ? 6.052   -4.689  -8.529  1.00 0.00 ? 384 TYR A C    7  
ATOM   8258  O  O    . TYR A 1 77 ? 5.586   -5.777  -8.203  1.00 0.00 ? 384 TYR A O    7  
ATOM   8259  C  CB   . TYR A 1 77 ? 8.550   -4.900  -8.754  1.00 0.00 ? 384 TYR A CB   7  
ATOM   8260  C  CG   . TYR A 1 77 ? 9.912   -4.355  -8.373  1.00 0.00 ? 384 TYR A CG   7  
ATOM   8261  C  CD1  . TYR A 1 77 ? 10.429  -3.222  -8.994  1.00 0.00 ? 384 TYR A CD1  7  
ATOM   8262  C  CD2  . TYR A 1 77 ? 10.680  -4.967  -7.389  1.00 0.00 ? 384 TYR A CD2  7  
ATOM   8263  C  CE1  . TYR A 1 77 ? 11.665  -2.722  -8.648  1.00 0.00 ? 384 TYR A CE1  7  
ATOM   8264  C  CE2  . TYR A 1 77 ? 11.919  -4.465  -7.035  1.00 0.00 ? 384 TYR A CE2  7  
ATOM   8265  C  CZ   . TYR A 1 77 ? 12.406  -3.343  -7.670  1.00 0.00 ? 384 TYR A CZ   7  
ATOM   8266  O  OH   . TYR A 1 77 ? 13.632  -2.825  -7.314  1.00 0.00 ? 384 TYR A OH   7  
ATOM   8267  H  H    . TYR A 1 77 ? 7.355   -5.497  -6.309  1.00 0.00 ? 384 TYR A H    7  
ATOM   8268  H  HA   . TYR A 1 77 ? 7.474   -3.167  -8.091  1.00 0.00 ? 384 TYR A HA   7  
ATOM   8269  H  HB2  . TYR A 1 77 ? 8.549   -5.966  -8.544  1.00 0.00 ? 384 TYR A HB2  7  
ATOM   8270  H  HB3  . TYR A 1 77 ? 8.411   -4.733  -9.821  1.00 0.00 ? 384 TYR A HB3  7  
ATOM   8271  H  HD1  . TYR A 1 77 ? 9.850   -2.725  -9.758  1.00 0.00 ? 384 TYR A HD1  7  
ATOM   8272  H  HD2  . TYR A 1 77 ? 10.295  -5.844  -6.895  1.00 0.00 ? 384 TYR A HD2  7  
ATOM   8273  H  HE1  . TYR A 1 77 ? 12.046  -1.844  -9.144  1.00 0.00 ? 384 TYR A HE1  7  
ATOM   8274  H  HE2  . TYR A 1 77 ? 12.499  -4.954  -6.268  1.00 0.00 ? 384 TYR A HE2  7  
ATOM   8275  H  HH   . TYR A 1 77 ? 14.303  -3.524  -7.352  1.00 0.00 ? 384 TYR A HH   7  
ATOM   8276  N  N    . CYS A 1 78 ? 5.427   -3.847  -9.334  1.00 0.00 ? 385 CYS A N    7  
ATOM   8277  C  CA   . CYS A 1 78 ? 4.064   -4.105  -9.790  1.00 0.00 ? 385 CYS A CA   7  
ATOM   8278  C  C    . CYS A 1 78 ? 3.980   -5.380  -10.626 1.00 0.00 ? 385 CYS A C    7  
ATOM   8279  O  O    . CYS A 1 78 ? 4.976   -5.842  -11.175 1.00 0.00 ? 385 CYS A O    7  
ATOM   8280  C  CB   . CYS A 1 78 ? 3.545   -2.911  -10.597 1.00 0.00 ? 385 CYS A CB   7  
ATOM   8281  S  SG   . CYS A 1 78 ? 4.657   -2.351  -11.917 1.00 0.00 ? 385 CYS A SG   7  
ATOM   8282  H  H    . CYS A 1 78 ? 5.885   -3.030  -9.616  1.00 0.00 ? 385 CYS A H    7  
ATOM   8283  H  HA   . CYS A 1 78 ? 3.445   -4.225  -8.916  1.00 0.00 ? 385 CYS A HA   7  
ATOM   8284  H  HB2  . CYS A 1 78 ? 2.605   -3.181  -11.057 1.00 0.00 ? 385 CYS A HB2  7  
ATOM   8285  H  HB3  . CYS A 1 78 ? 3.384   -2.079  -9.929  1.00 0.00 ? 385 CYS A HB3  7  
ATOM   8286  N  N    . ASP A 1 79 ? 2.780   -5.944  -10.698 1.00 0.00 ? 386 ASP A N    7  
ATOM   8287  C  CA   . ASP A 1 79 ? 2.536   -7.161  -11.474 1.00 0.00 ? 386 ASP A CA   7  
ATOM   8288  C  C    . ASP A 1 79 ? 2.993   -6.992  -12.923 1.00 0.00 ? 386 ASP A C    7  
ATOM   8289  O  O    . ASP A 1 79 ? 3.552   -7.906  -13.527 1.00 0.00 ? 386 ASP A O    7  
ATOM   8290  C  CB   . ASP A 1 79 ? 1.048   -7.514  -11.430 1.00 0.00 ? 386 ASP A CB   7  
ATOM   8291  C  CG   . ASP A 1 79 ? 0.712   -8.721  -12.281 1.00 0.00 ? 386 ASP A CG   7  
ATOM   8292  O  OD1  . ASP A 1 79 ? 1.141   -9.837  -11.935 1.00 0.00 ? 386 ASP A OD1  7  
ATOM   8293  O  OD2  . ASP A 1 79 ? 0.004   -8.559  -13.297 1.00 0.00 ? 386 ASP A OD2  7  
ATOM   8294  H  H    . ASP A 1 79 ? 2.035   -5.537  -10.202 1.00 0.00 ? 386 ASP A H    7  
ATOM   8295  H  HA   . ASP A 1 79 ? 3.102   -7.964  -11.022 1.00 0.00 ? 386 ASP A HA   7  
ATOM   8296  H  HB2  . ASP A 1 79 ? 0.767   -7.735  -10.401 1.00 0.00 ? 386 ASP A HB2  7  
ATOM   8297  H  HB3  . ASP A 1 79 ? 0.474   -6.663  -11.800 1.00 0.00 ? 386 ASP A HB3  7  
ATOM   8298  N  N    . VAL A 1 80 ? 2.776   -5.803  -13.458 1.00 0.00 ? 387 VAL A N    7  
ATOM   8299  C  CA   . VAL A 1 80 ? 3.164   -5.482  -14.826 1.00 0.00 ? 387 VAL A CA   7  
ATOM   8300  C  C    . VAL A 1 80 ? 4.575   -4.891  -14.879 1.00 0.00 ? 387 VAL A C    7  
ATOM   8301  O  O    . VAL A 1 80 ? 4.876   -4.040  -15.714 1.00 0.00 ? 387 VAL A O    7  
ATOM   8302  C  CB   . VAL A 1 80 ? 2.168   -4.493  -15.469 1.00 0.00 ? 387 VAL A CB   7  
ATOM   8303  C  CG1  . VAL A 1 80 ? 0.812   -5.156  -15.658 1.00 0.00 ? 387 VAL A CG1  7  
ATOM   8304  C  CG2  . VAL A 1 80 ? 2.026   -3.234  -14.623 1.00 0.00 ? 387 VAL A CG2  7  
ATOM   8305  H  H    . VAL A 1 80 ? 2.338   -5.116  -12.917 1.00 0.00 ? 387 VAL A H    7  
ATOM   8306  H  HA   . VAL A 1 80 ? 3.150   -6.398  -15.398 1.00 0.00 ? 387 VAL A HA   7  
ATOM   8307  H  HB   . VAL A 1 80 ? 2.544   -4.211  -16.442 1.00 0.00 ? 387 VAL A HB   7  
ATOM   8308  H  HG11 . VAL A 1 80 ? 0.915   -6.013  -16.307 1.00 0.00 ? 387 VAL A HG11 7  
ATOM   8309  H  HG12 . VAL A 1 80 ? 0.124   -4.450  -16.100 1.00 0.00 ? 387 VAL A HG12 7  
ATOM   8310  H  HG13 . VAL A 1 80 ? 0.432   -5.475  -14.698 1.00 0.00 ? 387 VAL A HG13 7  
ATOM   8311  H  HG21 . VAL A 1 80 ? 1.665   -3.501  -13.641 1.00 0.00 ? 387 VAL A HG21 7  
ATOM   8312  H  HG22 . VAL A 1 80 ? 1.326   -2.561  -15.094 1.00 0.00 ? 387 VAL A HG22 7  
ATOM   8313  H  HG23 . VAL A 1 80 ? 2.988   -2.750  -14.533 1.00 0.00 ? 387 VAL A HG23 7  
ATOM   8314  N  N    . HIS A 1 81 ? 5.441   -5.331  -13.976 1.00 0.00 ? 388 HIS A N    7  
ATOM   8315  C  CA   . HIS A 1 81 ? 6.799   -4.801  -13.912 1.00 0.00 ? 388 HIS A CA   7  
ATOM   8316  C  C    . HIS A 1 81 ? 7.819   -5.854  -14.342 1.00 0.00 ? 388 HIS A C    7  
ATOM   8317  O  O    . HIS A 1 81 ? 9.020   -5.604  -14.323 1.00 0.00 ? 388 HIS A O    7  
ATOM   8318  C  CB   . HIS A 1 81 ? 7.110   -4.323  -12.493 1.00 0.00 ? 388 HIS A CB   7  
ATOM   8319  C  CG   . HIS A 1 81 ? 8.163   -3.261  -12.415 1.00 0.00 ? 388 HIS A CG   7  
ATOM   8320  N  ND1  . HIS A 1 81 ? 7.878   -1.929  -12.144 1.00 0.00 ? 388 HIS A ND1  7  
ATOM   8321  C  CD2  . HIS A 1 81 ? 9.508   -3.342  -12.540 1.00 0.00 ? 388 HIS A CD2  7  
ATOM   8322  C  CE1  . HIS A 1 81 ? 9.025   -1.254  -12.110 1.00 0.00 ? 388 HIS A CE1  7  
ATOM   8323  N  NE2  . HIS A 1 81 ? 10.018  -2.086  -12.348 1.00 0.00 ? 388 HIS A NE2  7  
ATOM   8324  H  H    . HIS A 1 81 ? 5.164   -6.028  -13.341 1.00 0.00 ? 388 HIS A H    7  
ATOM   8325  H  HA   . HIS A 1 81 ? 6.860   -3.961  -14.589 1.00 0.00 ? 388 HIS A HA   7  
ATOM   8326  H  HB2  . HIS A 1 81 ? 6.209   -3.923  -12.053 1.00 0.00 ? 388 HIS A HB2  7  
ATOM   8327  H  HB3  . HIS A 1 81 ? 7.444   -5.166  -11.906 1.00 0.00 ? 388 HIS A HB3  7  
ATOM   8328  H  HD2  . HIS A 1 81 ? 10.077  -4.237  -12.756 1.00 0.00 ? 388 HIS A HD2  7  
ATOM   8329  H  HE1  . HIS A 1 81 ? 9.126   -0.196  -11.918 1.00 0.00 ? 388 HIS A HE1  7  
ATOM   8330  H  HE2  . HIS A 1 81 ? 10.918  -1.803  -12.635 1.00 0.00 ? 388 HIS A HE2  7  
ATOM   8331  N  N    . THR A 1 82 ? 7.345   -7.030  -14.719 1.00 0.00 ? 389 THR A N    7  
ATOM   8332  C  CA   . THR A 1 82 ? 8.242   -8.090  -15.151 1.00 0.00 ? 389 THR A CA   7  
ATOM   8333  C  C    . THR A 1 82 ? 8.633   -7.959  -16.633 1.00 0.00 ? 389 THR A C    7  
ATOM   8334  O  O    . THR A 1 82 ? 9.822   -8.020  -16.956 1.00 0.00 ? 389 THR A O    7  
ATOM   8335  C  CB   . THR A 1 82 ? 7.657   -9.488  -14.857 1.00 0.00 ? 389 THR A CB   7  
ATOM   8336  O  OG1  . THR A 1 82 ? 6.225   -9.427  -14.799 1.00 0.00 ? 389 THR A OG1  7  
ATOM   8337  C  CG2  . THR A 1 82 ? 8.201   -10.026 -13.544 1.00 0.00 ? 389 THR A CG2  7  
ATOM   8338  H  H    . THR A 1 82 ? 6.380   -7.194  -14.706 1.00 0.00 ? 389 THR A H    7  
ATOM   8339  H  HA   . THR A 1 82 ? 9.146   -7.990  -14.566 1.00 0.00 ? 389 THR A HA   7  
ATOM   8340  H  HB   . THR A 1 82 ? 7.949   -10.158 -15.654 1.00 0.00 ? 389 THR A HB   7  
ATOM   8341  H  HG1  . THR A 1 82 ? 5.888   -10.222 -14.369 1.00 0.00 ? 389 THR A HG1  7  
ATOM   8342  H  HG21 . THR A 1 82 ? 7.945   -9.349  -12.743 1.00 0.00 ? 389 THR A HG21 7  
ATOM   8343  H  HG22 . THR A 1 82 ? 9.276   -10.114 -13.610 1.00 0.00 ? 389 THR A HG22 7  
ATOM   8344  H  HG23 . THR A 1 82 ? 7.773   -10.996 -13.347 1.00 0.00 ? 389 THR A HG23 7  
ATOM   8345  N  N    . PRO A 1 83 ? 7.665   -7.791  -17.568 1.00 0.00 ? 390 PRO A N    7  
ATOM   8346  C  CA   . PRO A 1 83 ? 7.989   -7.541  -18.977 1.00 0.00 ? 390 PRO A CA   7  
ATOM   8347  C  C    . PRO A 1 83 ? 8.794   -6.243  -19.195 1.00 0.00 ? 390 PRO A C    7  
ATOM   8348  O  O    . PRO A 1 83 ? 9.832   -6.281  -19.861 1.00 0.00 ? 390 PRO A O    7  
ATOM   8349  C  CB   . PRO A 1 83 ? 6.625   -7.492  -19.681 1.00 0.00 ? 390 PRO A CB   7  
ATOM   8350  C  CG   . PRO A 1 83 ? 5.671   -8.141  -18.737 1.00 0.00 ? 390 PRO A CG   7  
ATOM   8351  C  CD   . PRO A 1 83 ? 6.207   -7.886  -17.355 1.00 0.00 ? 390 PRO A CD   7  
ATOM   8352  H  HA   . PRO A 1 83 ? 8.564   -8.363  -19.382 1.00 0.00 ? 390 PRO A HA   7  
ATOM   8353  H  HB2  . PRO A 1 83 ? 6.352   -6.467  -19.877 1.00 0.00 ? 390 PRO A HB2  7  
ATOM   8354  H  HB3  . PRO A 1 83 ? 6.682   -8.034  -20.613 1.00 0.00 ? 390 PRO A HB3  7  
ATOM   8355  H  HG2  . PRO A 1 83 ? 4.690   -7.701  -18.845 1.00 0.00 ? 390 PRO A HG2  7  
ATOM   8356  H  HG3  . PRO A 1 83 ? 5.628   -9.202  -18.930 1.00 0.00 ? 390 PRO A HG3  7  
ATOM   8357  H  HD2  . PRO A 1 83 ? 5.816   -6.959  -16.962 1.00 0.00 ? 390 PRO A HD2  7  
ATOM   8358  H  HD3  . PRO A 1 83 ? 5.966   -8.708  -16.696 1.00 0.00 ? 390 PRO A HD3  7  
ATOM   8359  N  N    . PRO A 1 84 ? 8.360   -5.070  -18.662 1.00 0.00 ? 391 PRO A N    7  
ATOM   8360  C  CA   . PRO A 1 84 ? 9.149   -3.844  -18.756 1.00 0.00 ? 391 PRO A CA   7  
ATOM   8361  C  C    . PRO A 1 84 ? 10.305  -3.843  -17.767 1.00 0.00 ? 391 PRO A C    7  
ATOM   8362  O  O    . PRO A 1 84 ? 10.117  -3.675  -16.560 1.00 0.00 ? 391 PRO A O    7  
ATOM   8363  C  CB   . PRO A 1 84 ? 8.159   -2.721  -18.419 1.00 0.00 ? 391 PRO A CB   7  
ATOM   8364  C  CG   . PRO A 1 84 ? 6.824   -3.379  -18.301 1.00 0.00 ? 391 PRO A CG   7  
ATOM   8365  C  CD   . PRO A 1 84 ? 7.099   -4.812  -17.957 1.00 0.00 ? 391 PRO A CD   7  
ATOM   8366  H  HA   . PRO A 1 84 ? 9.533   -3.701  -19.755 1.00 0.00 ? 391 PRO A HA   7  
ATOM   8367  H  HB2  . PRO A 1 84 ? 8.451   -2.251  -17.492 1.00 0.00 ? 391 PRO A HB2  7  
ATOM   8368  H  HB3  . PRO A 1 84 ? 8.172   -1.992  -19.214 1.00 0.00 ? 391 PRO A HB3  7  
ATOM   8369  H  HG2  . PRO A 1 84 ? 6.251   -2.908  -17.515 1.00 0.00 ? 391 PRO A HG2  7  
ATOM   8370  H  HG3  . PRO A 1 84 ? 6.296   -3.313  -19.241 1.00 0.00 ? 391 PRO A HG3  7  
ATOM   8371  H  HD2  . PRO A 1 84 ? 7.218   -4.931  -16.890 1.00 0.00 ? 391 PRO A HD2  7  
ATOM   8372  H  HD3  . PRO A 1 84 ? 6.311   -5.449  -18.323 1.00 0.00 ? 391 PRO A HD3  7  
ATOM   8373  N  N    . GLY A 1 85 ? 11.496  -4.038  -18.294 1.00 0.00 ? 392 GLY A N    7  
ATOM   8374  C  CA   . GLY A 1 85 ? 12.677  -4.136  -17.462 1.00 0.00 ? 392 GLY A CA   7  
ATOM   8375  C  C    . GLY A 1 85 ? 13.766  -4.933  -18.141 1.00 0.00 ? 392 GLY A C    7  
ATOM   8376  O  O    . GLY A 1 85 ? 14.471  -5.711  -17.498 1.00 0.00 ? 392 GLY A O    7  
ATOM   8377  H  H    . GLY A 1 85 ? 11.574  -4.115  -19.266 1.00 0.00 ? 392 GLY A H    7  
ATOM   8378  H  HA2  . GLY A 1 85 ? 13.044  -3.141  -17.249 1.00 0.00 ? 392 GLY A HA2  7  
ATOM   8379  H  HA3  . GLY A 1 85 ? 12.414  -4.622  -16.533 1.00 0.00 ? 392 GLY A HA3  7  
ATOM   8380  N  N    . SER A 1 86 ? 13.885  -4.733  -19.451 1.00 0.00 ? 393 SER A N    7  
ATOM   8381  C  CA   . SER A 1 86 ? 14.870  -5.425  -20.272 1.00 0.00 ? 393 SER A CA   7  
ATOM   8382  C  C    . SER A 1 86 ? 14.592  -6.927  -20.321 1.00 0.00 ? 393 SER A C    7  
ATOM   8383  O  O    . SER A 1 86 ? 15.368  -7.736  -19.812 1.00 0.00 ? 393 SER A O    7  
ATOM   8384  C  CB   . SER A 1 86 ? 16.287  -5.139  -19.766 1.00 0.00 ? 393 SER A CB   7  
ATOM   8385  O  OG   . SER A 1 86 ? 16.529  -3.739  -19.725 1.00 0.00 ? 393 SER A OG   7  
ATOM   8386  H  H    . SER A 1 86 ? 13.287  -4.091  -19.882 1.00 0.00 ? 393 SER A H    7  
ATOM   8387  H  HA   . SER A 1 86 ? 14.780  -5.034  -21.273 1.00 0.00 ? 393 SER A HA   7  
ATOM   8388  H  HB2  . SER A 1 86 ? 16.404  -5.543  -18.771 1.00 0.00 ? 393 SER A HB2  7  
ATOM   8389  H  HB3  . SER A 1 86 ? 17.005  -5.598  -20.429 1.00 0.00 ? 393 SER A HB3  7  
ATOM   8390  H  HG   . SER A 1 86 ? 15.834  -3.285  -20.221 1.00 0.00 ? 393 SER A HG   7  
ATOM   8391  N  N    . THR A 1 87 ? 13.465  -7.282  -20.922 1.00 0.00 ? 394 THR A N    7  
ATOM   8392  C  CA   . THR A 1 87 ? 13.104  -8.674  -21.118 1.00 0.00 ? 394 THR A CA   7  
ATOM   8393  C  C    . THR A 1 87 ? 12.646  -8.888  -22.558 1.00 0.00 ? 394 THR A C    7  
ATOM   8394  O  O    . THR A 1 87 ? 13.513  -9.095  -23.436 1.00 0.00 ? 394 THR A O    7  
ATOM   8395  C  CB   . THR A 1 87 ? 11.984  -9.106  -20.145 1.00 0.00 ? 394 THR A CB   7  
ATOM   8396  O  OG1  . THR A 1 87 ? 12.321  -8.719  -18.804 1.00 0.00 ? 394 THR A OG1  7  
ATOM   8397  C  CG2  . THR A 1 87 ? 11.768  -10.614 -20.200 1.00 0.00 ? 394 THR A CG2  7  
ATOM   8398  O  OXT  . THR A 1 87 ? 11.427  -8.814  -22.817 1.00 0.00 ? 394 THR A OXT  7  
ATOM   8399  H  H    . THR A 1 87 ? 12.853  -6.586  -21.245 1.00 0.00 ? 394 THR A H    7  
ATOM   8400  H  HA   . THR A 1 87 ? 13.978  -9.279  -20.929 1.00 0.00 ? 394 THR A HA   7  
ATOM   8401  H  HB   . THR A 1 87 ? 11.066  -8.614  -20.435 1.00 0.00 ? 394 THR A HB   7  
ATOM   8402  H  HG1  . THR A 1 87 ? 11.843  -7.915  -18.574 1.00 0.00 ? 394 THR A HG1  7  
ATOM   8403  H  HG21 . THR A 1 87 ? 12.678  -11.118 -19.913 1.00 0.00 ? 394 THR A HG21 7  
ATOM   8404  H  HG22 . THR A 1 87 ? 11.498  -10.903 -21.204 1.00 0.00 ? 394 THR A HG22 7  
ATOM   8405  H  HG23 . THR A 1 87 ? 10.975  -10.889 -19.520 1.00 0.00 ? 394 THR A HG23 7  
HETATM 8406  ZN ZN   . ZN  B 2 .  ? -6.836  -1.067  -6.494  1.00 0.00 ? 401 ZN  A ZN   7  
HETATM 8407  ZN ZN   . ZN  C 2 .  ? 6.031   -0.708  -12.324 1.00 0.00 ? 402 ZN  A ZN   7  
ATOM   8408  N  N    . MET A 1 9  ? -1.767  14.311  7.541   1.00 0.00 ? 316 MET A N    8  
ATOM   8409  C  CA   . MET A 1 9  ? -1.593  14.910  8.886   1.00 0.00 ? 316 MET A CA   8  
ATOM   8410  C  C    . MET A 1 9  ? -0.617  16.081  8.839   1.00 0.00 ? 316 MET A C    8  
ATOM   8411  O  O    . MET A 1 9  ? -1.024  17.243  8.851   1.00 0.00 ? 316 MET A O    8  
ATOM   8412  C  CB   . MET A 1 9  ? -1.082  13.872  9.891   1.00 0.00 ? 316 MET A CB   8  
ATOM   8413  C  CG   . MET A 1 9  ? -2.072  12.766  10.208  1.00 0.00 ? 316 MET A CG   8  
ATOM   8414  S  SD   . MET A 1 9  ? -1.403  11.569  11.379  1.00 0.00 ? 316 MET A SD   8  
ATOM   8415  C  CE   . MET A 1 9  ? -2.772  10.424  11.517  1.00 0.00 ? 316 MET A CE   8  
ATOM   8416  H  H    . MET A 1 9  ? -2.116  15.029  6.873   1.00 0.00 ? 316 MET A H    8  
ATOM   8417  H  HA   . MET A 1 9  ? -2.554  15.277  9.216   1.00 0.00 ? 316 MET A HA   8  
ATOM   8418  H  HB2  . MET A 1 9  ? -0.189  13.416  9.492   1.00 0.00 ? 316 MET A HB2  8  
ATOM   8419  H  HB3  . MET A 1 9  ? -0.834  14.377  10.813  1.00 0.00 ? 316 MET A HB3  8  
ATOM   8420  H  HG2  . MET A 1 9  ? -2.962  13.206  10.630  1.00 0.00 ? 316 MET A HG2  8  
ATOM   8421  H  HG3  . MET A 1 9  ? -2.325  12.252  9.293   1.00 0.00 ? 316 MET A HG3  8  
ATOM   8422  H  HE1  . MET A 1 9  ? -3.640  10.945  11.892  1.00 0.00 ? 316 MET A HE1  8  
ATOM   8423  H  HE2  . MET A 1 9  ? -2.508  9.627   12.197  1.00 0.00 ? 316 MET A HE2  8  
ATOM   8424  H  HE3  . MET A 1 9  ? -2.993  10.008  10.545  1.00 0.00 ? 316 MET A HE3  8  
ATOM   8425  N  N    . ASN A 1 10 ? 0.674   15.772  8.769   1.00 0.00 ? 317 ASN A N    8  
ATOM   8426  C  CA   . ASN A 1 10 ? 1.710   16.799  8.833   1.00 0.00 ? 317 ASN A CA   8  
ATOM   8427  C  C    . ASN A 1 10 ? 2.285   17.090  7.457   1.00 0.00 ? 317 ASN A C    8  
ATOM   8428  O  O    . ASN A 1 10 ? 2.900   18.136  7.241   1.00 0.00 ? 317 ASN A O    8  
ATOM   8429  C  CB   . ASN A 1 10 ? 2.838   16.373  9.779   1.00 0.00 ? 317 ASN A CB   8  
ATOM   8430  C  CG   . ASN A 1 10 ? 2.416   16.349  11.236  1.00 0.00 ? 317 ASN A CG   8  
ATOM   8431  O  OD1  . ASN A 1 10 ? 1.251   16.122  11.561  1.00 0.00 ? 317 ASN A OD1  8  
ATOM   8432  N  ND2  . ASN A 1 10 ? 3.366   16.580  12.126  1.00 0.00 ? 317 ASN A ND2  8  
ATOM   8433  H  H    . ASN A 1 10 ? 0.939   14.832  8.672   1.00 0.00 ? 317 ASN A H    8  
ATOM   8434  H  HA   . ASN A 1 10 ? 1.257   17.700  9.216   1.00 0.00 ? 317 ASN A HA   8  
ATOM   8435  H  HB2  . ASN A 1 10 ? 3.169   15.382  9.508   1.00 0.00 ? 317 ASN A HB2  8  
ATOM   8436  H  HB3  . ASN A 1 10 ? 3.663   17.062  9.675   1.00 0.00 ? 317 ASN A HB3  8  
ATOM   8437  H  HD21 . ASN A 1 10 ? 4.275   16.748  11.801  1.00 0.00 ? 317 ASN A HD21 8  
ATOM   8438  H  HD22 . ASN A 1 10 ? 3.122   16.581  13.074  1.00 0.00 ? 317 ASN A HD22 8  
ATOM   8439  N  N    . ILE A 1 11 ? 2.101   16.160  6.534   1.00 0.00 ? 318 ILE A N    8  
ATOM   8440  C  CA   . ILE A 1 11 ? 2.596   16.331  5.177   1.00 0.00 ? 318 ILE A CA   8  
ATOM   8441  C  C    . ILE A 1 11 ? 1.425   16.498  4.209   1.00 0.00 ? 318 ILE A C    8  
ATOM   8442  O  O    . ILE A 1 11 ? 0.773   15.521  3.846   1.00 0.00 ? 318 ILE A O    8  
ATOM   8443  C  CB   . ILE A 1 11 ? 3.482   15.139  4.721   1.00 0.00 ? 318 ILE A CB   8  
ATOM   8444  C  CG1  . ILE A 1 11 ? 4.710   14.968  5.630   1.00 0.00 ? 318 ILE A CG1  8  
ATOM   8445  C  CG2  . ILE A 1 11 ? 3.935   15.322  3.279   1.00 0.00 ? 318 ILE A CG2  8  
ATOM   8446  C  CD1  . ILE A 1 11 ? 4.435   14.226  6.923   1.00 0.00 ? 318 ILE A CD1  8  
ATOM   8447  H  H    . ILE A 1 11 ? 1.620   15.338  6.767   1.00 0.00 ? 318 ILE A H    8  
ATOM   8448  H  HA   . ILE A 1 11 ? 3.197   17.229  5.154   1.00 0.00 ? 318 ILE A HA   8  
ATOM   8449  H  HB   . ILE A 1 11 ? 2.883   14.242  4.770   1.00 0.00 ? 318 ILE A HB   8  
ATOM   8450  H  HG12 . ILE A 1 11 ? 5.469   14.418  5.094   1.00 0.00 ? 318 ILE A HG12 8  
ATOM   8451  H  HG13 . ILE A 1 11 ? 5.096   15.945  5.885   1.00 0.00 ? 318 ILE A HG13 8  
ATOM   8452  H  HG21 . ILE A 1 11 ? 3.070   15.386  2.634   1.00 0.00 ? 318 ILE A HG21 8  
ATOM   8453  H  HG22 . ILE A 1 11 ? 4.542   14.480  2.983   1.00 0.00 ? 318 ILE A HG22 8  
ATOM   8454  H  HG23 . ILE A 1 11 ? 4.512   16.230  3.197   1.00 0.00 ? 318 ILE A HG23 8  
ATOM   8455  H  HD11 . ILE A 1 11 ? 5.341   14.175  7.507   1.00 0.00 ? 318 ILE A HD11 8  
ATOM   8456  H  HD12 . ILE A 1 11 ? 4.092   13.227  6.699   1.00 0.00 ? 318 ILE A HD12 8  
ATOM   8457  H  HD13 . ILE A 1 11 ? 3.674   14.750  7.483   1.00 0.00 ? 318 ILE A HD13 8  
ATOM   8458  N  N    . PRO A 1 12 ? 1.109   17.751  3.832   1.00 0.00 ? 319 PRO A N    8  
ATOM   8459  C  CA   . PRO A 1 12 ? 0.060   18.049  2.844   1.00 0.00 ? 319 PRO A CA   8  
ATOM   8460  C  C    . PRO A 1 12 ? 0.293   17.397  1.463   1.00 0.00 ? 319 PRO A C    8  
ATOM   8461  O  O    . PRO A 1 12 ? -0.654  16.867  0.877   1.00 0.00 ? 319 PRO A O    8  
ATOM   8462  C  CB   . PRO A 1 12 ? 0.074   19.581  2.739   1.00 0.00 ? 319 PRO A CB   8  
ATOM   8463  C  CG   . PRO A 1 12 ? 0.731   20.049  3.994   1.00 0.00 ? 319 PRO A CG   8  
ATOM   8464  C  CD   . PRO A 1 12 ? 1.719   18.980  4.372   1.00 0.00 ? 319 PRO A CD   8  
ATOM   8465  H  HA   . PRO A 1 12 ? -0.906  17.734  3.212   1.00 0.00 ? 319 PRO A HA   8  
ATOM   8466  H  HB2  . PRO A 1 12 ? 0.634   19.881  1.866   1.00 0.00 ? 319 PRO A HB2  8  
ATOM   8467  H  HB3  . PRO A 1 12 ? -0.938  19.947  2.666   1.00 0.00 ? 319 PRO A HB3  8  
ATOM   8468  H  HG2  . PRO A 1 12 ? 1.241   20.984  3.815   1.00 0.00 ? 319 PRO A HG2  8  
ATOM   8469  H  HG3  . PRO A 1 12 ? -0.007  20.168  4.773   1.00 0.00 ? 319 PRO A HG3  8  
ATOM   8470  H  HD2  . PRO A 1 12 ? 2.677   19.172  3.913   1.00 0.00 ? 319 PRO A HD2  8  
ATOM   8471  H  HD3  . PRO A 1 12 ? 1.818   18.922  5.446   1.00 0.00 ? 319 PRO A HD3  8  
ATOM   8472  N  N    . PRO A 1 13 ? 1.524   17.443  0.892   1.00 0.00 ? 320 PRO A N    8  
ATOM   8473  C  CA   . PRO A 1 13 ? 1.815   16.754  -0.372  1.00 0.00 ? 320 PRO A CA   8  
ATOM   8474  C  C    . PRO A 1 13 ? 1.629   15.243  -0.259  1.00 0.00 ? 320 PRO A C    8  
ATOM   8475  O  O    . PRO A 1 13 ? 2.237   14.591  0.589   1.00 0.00 ? 320 PRO A O    8  
ATOM   8476  C  CB   . PRO A 1 13 ? 3.285   17.092  -0.653  1.00 0.00 ? 320 PRO A CB   8  
ATOM   8477  C  CG   . PRO A 1 13 ? 3.558   18.307  0.156   1.00 0.00 ? 320 PRO A CG   8  
ATOM   8478  C  CD   . PRO A 1 13 ? 2.710   18.171  1.382   1.00 0.00 ? 320 PRO A CD   8  
ATOM   8479  H  HA   . PRO A 1 13 ? 1.196   17.128  -1.173  1.00 0.00 ? 320 PRO A HA   8  
ATOM   8480  H  HB2  . PRO A 1 13 ? 3.910   16.266  -0.349  1.00 0.00 ? 320 PRO A HB2  8  
ATOM   8481  H  HB3  . PRO A 1 13 ? 3.417   17.282  -1.708  1.00 0.00 ? 320 PRO A HB3  8  
ATOM   8482  H  HG2  . PRO A 1 13 ? 4.604   18.344  0.424   1.00 0.00 ? 320 PRO A HG2  8  
ATOM   8483  H  HG3  . PRO A 1 13 ? 3.277   19.190  -0.398  1.00 0.00 ? 320 PRO A HG3  8  
ATOM   8484  H  HD2  . PRO A 1 13 ? 3.231   17.594  2.140   1.00 0.00 ? 320 PRO A HD2  8  
ATOM   8485  H  HD3  . PRO A 1 13 ? 2.434   19.148  1.761   1.00 0.00 ? 320 PRO A HD3  8  
ATOM   8486  N  N    . ALA A 1 14 ? 0.795   14.695  -1.129  1.00 0.00 ? 321 ALA A N    8  
ATOM   8487  C  CA   . ALA A 1 14 ? 0.500   13.272  -1.117  1.00 0.00 ? 321 ALA A CA   8  
ATOM   8488  C  C    . ALA A 1 14 ? 0.362   12.779  -2.540  1.00 0.00 ? 321 ALA A C    8  
ATOM   8489  O  O    . ALA A 1 14 ? -0.061  11.649  -2.789  1.00 0.00 ? 321 ALA A O    8  
ATOM   8490  C  CB   . ALA A 1 14 ? -0.761  12.984  -0.314  1.00 0.00 ? 321 ALA A CB   8  
ATOM   8491  H  H    . ALA A 1 14 ? 0.386   15.258  -1.818  1.00 0.00 ? 321 ALA A H    8  
ATOM   8492  H  HA   . ALA A 1 14 ? 1.330   12.768  -0.657  1.00 0.00 ? 321 ALA A HA   8  
ATOM   8493  H  HB1  . ALA A 1 14 ? -1.603  13.478  -0.778  1.00 0.00 ? 321 ALA A HB1  8  
ATOM   8494  H  HB2  . ALA A 1 14 ? -0.638  13.354  0.694   1.00 0.00 ? 321 ALA A HB2  8  
ATOM   8495  H  HB3  . ALA A 1 14 ? -0.937  11.920  -0.289  1.00 0.00 ? 321 ALA A HB3  8  
ATOM   8496  N  N    . ARG A 1 15 ? 0.742   13.679  -3.438  1.00 0.00 ? 322 ARG A N    8  
ATOM   8497  C  CA   . ARG A 1 15 ? 0.760   13.477  -4.887  1.00 0.00 ? 322 ARG A CA   8  
ATOM   8498  C  C    . ARG A 1 15 ? -0.354  12.555  -5.382  1.00 0.00 ? 322 ARG A C    8  
ATOM   8499  O  O    . ARG A 1 15 ? -0.218  11.331  -5.400  1.00 0.00 ? 322 ARG A O    8  
ATOM   8500  C  CB   . ARG A 1 15 ? 2.130   12.965  -5.310  1.00 0.00 ? 322 ARG A CB   8  
ATOM   8501  C  CG   . ARG A 1 15 ? 2.378   13.041  -6.809  1.00 0.00 ? 322 ARG A CG   8  
ATOM   8502  C  CD   . ARG A 1 15 ? 3.783   12.584  -7.173  1.00 0.00 ? 322 ARG A CD   8  
ATOM   8503  N  NE   . ARG A 1 15 ? 4.816   13.341  -6.461  1.00 0.00 ? 322 ARG A NE   8  
ATOM   8504  C  CZ   . ARG A 1 15 ? 5.520   14.340  -6.999  1.00 0.00 ? 322 ARG A CZ   8  
ATOM   8505  N  NH1  . ARG A 1 15 ? 5.262   14.754  -8.235  1.00 0.00 ? 322 ARG A NH1  8  
ATOM   8506  N  NH2  . ARG A 1 15 ? 6.479   14.928  -6.296  1.00 0.00 ? 322 ARG A NH2  8  
ATOM   8507  H  H    . ARG A 1 15 ? 1.062   14.536  -3.092  1.00 0.00 ? 322 ARG A H    8  
ATOM   8508  H  HA   . ARG A 1 15 ? 0.612   14.446  -5.338  1.00 0.00 ? 322 ARG A HA   8  
ATOM   8509  H  HB2  . ARG A 1 15 ? 2.882   13.555  -4.806  1.00 0.00 ? 322 ARG A HB2  8  
ATOM   8510  H  HB3  . ARG A 1 15 ? 2.226   11.935  -4.999  1.00 0.00 ? 322 ARG A HB3  8  
ATOM   8511  H  HG2  . ARG A 1 15 ? 1.664   12.409  -7.315  1.00 0.00 ? 322 ARG A HG2  8  
ATOM   8512  H  HG3  . ARG A 1 15 ? 2.247   14.064  -7.133  1.00 0.00 ? 322 ARG A HG3  8  
ATOM   8513  H  HD2  . ARG A 1 15 ? 3.881   11.539  -6.920  1.00 0.00 ? 322 ARG A HD2  8  
ATOM   8514  H  HD3  . ARG A 1 15 ? 3.923   12.711  -8.235  1.00 0.00 ? 322 ARG A HD3  8  
ATOM   8515  H  HE   . ARG A 1 15 ? 5.009   13.074  -5.535  1.00 0.00 ? 322 ARG A HE   8  
ATOM   8516  H  HH11 . ARG A 1 15 ? 4.536   14.320  -8.775  1.00 0.00 ? 322 ARG A HH11 8  
ATOM   8517  H  HH12 . ARG A 1 15 ? 5.789   15.505  -8.637  1.00 0.00 ? 322 ARG A HH12 8  
ATOM   8518  H  HH21 . ARG A 1 15 ? 6.678   14.623  -5.360  1.00 0.00 ? 322 ARG A HH21 8  
ATOM   8519  H  HH22 . ARG A 1 15 ? 7.008   15.680  -6.695  1.00 0.00 ? 322 ARG A HH22 8  
ATOM   8520  N  N    . TRP A 1 16 ? -1.445  13.150  -5.824  1.00 0.00 ? 323 TRP A N    8  
ATOM   8521  C  CA   . TRP A 1 16 ? -2.615  12.387  -6.223  1.00 0.00 ? 323 TRP A CA   8  
ATOM   8522  C  C    . TRP A 1 16 ? -2.518  12.024  -7.689  1.00 0.00 ? 323 TRP A C    8  
ATOM   8523  O  O    . TRP A 1 16 ? -3.492  12.038  -8.439  1.00 0.00 ? 323 TRP A O    8  
ATOM   8524  C  CB   . TRP A 1 16 ? -3.889  13.181  -5.927  1.00 0.00 ? 323 TRP A CB   8  
ATOM   8525  C  CG   . TRP A 1 16 ? -3.890  13.795  -4.556  1.00 0.00 ? 323 TRP A CG   8  
ATOM   8526  C  CD1  . TRP A 1 16 ? -3.209  14.911  -4.167  1.00 0.00 ? 323 TRP A CD1  8  
ATOM   8527  C  CD2  . TRP A 1 16 ? -4.595  13.331  -3.398  1.00 0.00 ? 323 TRP A CD2  8  
ATOM   8528  N  NE1  . TRP A 1 16 ? -3.441  15.169  -2.838  1.00 0.00 ? 323 TRP A NE1  8  
ATOM   8529  C  CE2  . TRP A 1 16 ? -4.291  14.216  -2.344  1.00 0.00 ? 323 TRP A CE2  8  
ATOM   8530  C  CE3  . TRP A 1 16 ? -5.452  12.257  -3.148  1.00 0.00 ? 323 TRP A CE3  8  
ATOM   8531  C  CZ2  . TRP A 1 16 ? -4.815  14.059  -1.063  1.00 0.00 ? 323 TRP A CZ2  8  
ATOM   8532  C  CZ3  . TRP A 1 16 ? -5.972  12.101  -1.876  1.00 0.00 ? 323 TRP A CZ3  8  
ATOM   8533  C  CH2  . TRP A 1 16 ? -5.652  12.999  -0.848  1.00 0.00 ? 323 TRP A CH2  8  
ATOM   8534  H  H    . TRP A 1 16 ? -1.460  14.129  -5.903  1.00 0.00 ? 323 TRP A H    8  
ATOM   8535  H  HA   . TRP A 1 16 ? -2.610  11.477  -5.656  1.00 0.00 ? 323 TRP A HA   8  
ATOM   8536  H  HB2  . TRP A 1 16 ? -3.987  13.976  -6.650  1.00 0.00 ? 323 TRP A HB2  8  
ATOM   8537  H  HB3  . TRP A 1 16 ? -4.743  12.523  -6.002  1.00 0.00 ? 323 TRP A HB3  8  
ATOM   8538  H  HD1  . TRP A 1 16 ? -2.573  15.490  -4.821  1.00 0.00 ? 323 TRP A HD1  8  
ATOM   8539  H  HE1  . TRP A 1 16 ? -3.060  15.920  -2.327  1.00 0.00 ? 323 TRP A HE1  8  
ATOM   8540  H  HE3  . TRP A 1 16 ? -5.711  11.554  -3.927  1.00 0.00 ? 323 TRP A HE3  8  
ATOM   8541  H  HZ2  . TRP A 1 16 ? -4.579  14.742  -0.261  1.00 0.00 ? 323 TRP A HZ2  8  
ATOM   8542  H  HZ3  . TRP A 1 16 ? -6.637  11.277  -1.664  1.00 0.00 ? 323 TRP A HZ3  8  
ATOM   8543  H  HH2  . TRP A 1 16 ? -6.081  12.838  0.129   1.00 0.00 ? 323 TRP A HH2  8  
ATOM   8544  N  N    . LYS A 1 17 ? -1.316  11.656  -8.058  1.00 0.00 ? 324 LYS A N    8  
ATOM   8545  C  CA   . LYS A 1 17 ? -1.006  11.250  -9.420  1.00 0.00 ? 324 LYS A CA   8  
ATOM   8546  C  C    . LYS A 1 17 ? -0.173  9.984   -9.440  1.00 0.00 ? 324 LYS A C    8  
ATOM   8547  O  O    . LYS A 1 17 ? 0.532   9.703   -10.406 1.00 0.00 ? 324 LYS A O    8  
ATOM   8548  C  CB   . LYS A 1 17 ? -0.314  12.371  -10.198 1.00 0.00 ? 324 LYS A CB   8  
ATOM   8549  C  CG   . LYS A 1 17 ? -1.278  13.402  -10.780 1.00 0.00 ? 324 LYS A CG   8  
ATOM   8550  C  CD   . LYS A 1 17 ? -1.908  12.959  -12.110 1.00 0.00 ? 324 LYS A CD   8  
ATOM   8551  C  CE   . LYS A 1 17 ? -2.898  11.803  -11.960 1.00 0.00 ? 324 LYS A CE   8  
ATOM   8552  N  NZ   . LYS A 1 17 ? -2.259  10.470  -12.173 1.00 0.00 ? 324 LYS A NZ   8  
ATOM   8553  H  H    . LYS A 1 17 ? -0.616  11.647  -7.371  1.00 0.00 ? 324 LYS A H    8  
ATOM   8554  H  HA   . LYS A 1 17 ? -1.942  11.029  -9.898  1.00 0.00 ? 324 LYS A HA   8  
ATOM   8555  H  HB2  . LYS A 1 17 ? 0.368   12.891  -9.527  1.00 0.00 ? 324 LYS A HB2  8  
ATOM   8556  H  HB3  . LYS A 1 17 ? 0.248   11.930  -11.019 1.00 0.00 ? 324 LYS A HB3  8  
ATOM   8557  H  HG2  . LYS A 1 17 ? -2.069  13.574  -10.067 1.00 0.00 ? 324 LYS A HG2  8  
ATOM   8558  H  HG3  . LYS A 1 17 ? -0.738  14.324  -10.943 1.00 0.00 ? 324 LYS A HG3  8  
ATOM   8559  H  HD2  . LYS A 1 17 ? -2.430  13.800  -12.539 1.00 0.00 ? 324 LYS A HD2  8  
ATOM   8560  H  HD3  . LYS A 1 17 ? -1.116  12.653  -12.779 1.00 0.00 ? 324 LYS A HD3  8  
ATOM   8561  H  HE2  . LYS A 1 17 ? -3.322  11.834  -10.968 1.00 0.00 ? 324 LYS A HE2  8  
ATOM   8562  H  HE3  . LYS A 1 17 ? -3.688  11.932  -12.688 1.00 0.00 ? 324 LYS A HE3  8  
ATOM   8563  H  HZ1  . LYS A 1 17 ? -2.922  9.706   -11.923 1.00 0.00 ? 324 LYS A HZ1  8  
ATOM   8564  H  HZ2  . LYS A 1 17 ? -1.408  10.377  -11.583 1.00 0.00 ? 324 LYS A HZ2  8  
ATOM   8565  H  HZ3  . LYS A 1 17 ? -1.983  10.356  -13.170 1.00 0.00 ? 324 LYS A HZ3  8  
ATOM   8566  N  N    . LEU A 1 18 ? -0.269  9.227   -8.371  1.00 0.00 ? 325 LEU A N    8  
ATOM   8567  C  CA   . LEU A 1 18 ? 0.211   7.861   -8.366  1.00 0.00 ? 325 LEU A CA   8  
ATOM   8568  C  C    . LEU A 1 18 ? -0.971  6.952   -8.078  1.00 0.00 ? 325 LEU A C    8  
ATOM   8569  O  O    . LEU A 1 18 ? -1.207  6.532   -6.945  1.00 0.00 ? 325 LEU A O    8  
ATOM   8570  C  CB   . LEU A 1 18 ? 1.363   7.648   -7.368  1.00 0.00 ? 325 LEU A CB   8  
ATOM   8571  C  CG   . LEU A 1 18 ? 1.145   8.192   -5.953  1.00 0.00 ? 325 LEU A CG   8  
ATOM   8572  C  CD1  . LEU A 1 18 ? 1.330   7.092   -4.922  1.00 0.00 ? 325 LEU A CD1  8  
ATOM   8573  C  CD2  . LEU A 1 18 ? 2.110   9.334   -5.676  1.00 0.00 ? 325 LEU A CD2  8  
ATOM   8574  H  H    . LEU A 1 18 ? -0.697  9.588   -7.570  1.00 0.00 ? 325 LEU A H    8  
ATOM   8575  H  HA   . LEU A 1 18 ? 0.568   7.645   -9.365  1.00 0.00 ? 325 LEU A HA   8  
ATOM   8576  H  HB2  . LEU A 1 18 ? 1.542   6.577   -7.289  1.00 0.00 ? 325 LEU A HB2  8  
ATOM   8577  H  HB3  . LEU A 1 18 ? 2.253   8.127   -7.779  1.00 0.00 ? 325 LEU A HB3  8  
ATOM   8578  H  HG   . LEU A 1 18 ? 0.138   8.573   -5.865  1.00 0.00 ? 325 LEU A HG   8  
ATOM   8579  H  HD11 . LEU A 1 18 ? 2.334   6.699   -4.992  1.00 0.00 ? 325 LEU A HD11 8  
ATOM   8580  H  HD12 . LEU A 1 18 ? 0.619   6.301   -5.109  1.00 0.00 ? 325 LEU A HD12 8  
ATOM   8581  H  HD13 . LEU A 1 18 ? 1.169   7.494   -3.933  1.00 0.00 ? 325 LEU A HD13 8  
ATOM   8582  H  HD21 . LEU A 1 18 ? 3.125   8.980   -5.779  1.00 0.00 ? 325 LEU A HD21 8  
ATOM   8583  H  HD22 . LEU A 1 18 ? 1.956   9.700   -4.671  1.00 0.00 ? 325 LEU A HD22 8  
ATOM   8584  H  HD23 . LEU A 1 18 ? 1.934   10.133  -6.382  1.00 0.00 ? 325 LEU A HD23 8  
ATOM   8585  N  N    . THR A 1 19 ? -1.755  6.714   -9.118  1.00 0.00 ? 326 THR A N    8  
ATOM   8586  C  CA   . THR A 1 19 ? -3.010  6.005   -8.991  1.00 0.00 ? 326 THR A CA   8  
ATOM   8587  C  C    . THR A 1 19 ? -2.799  4.495   -8.992  1.00 0.00 ? 326 THR A C    8  
ATOM   8588  O  O    . THR A 1 19 ? -1.934  3.975   -9.694  1.00 0.00 ? 326 THR A O    8  
ATOM   8589  C  CB   . THR A 1 19 ? -3.966  6.402   -10.140 1.00 0.00 ? 326 THR A CB   8  
ATOM   8590  O  OG1  . THR A 1 19 ? -4.056  7.835   -10.224 1.00 0.00 ? 326 THR A OG1  8  
ATOM   8591  C  CG2  . THR A 1 19 ? -5.357  5.823   -9.927  1.00 0.00 ? 326 THR A CG2  8  
ATOM   8592  H  H    . THR A 1 19 ? -1.477  7.029   -10.005 1.00 0.00 ? 326 THR A H    8  
ATOM   8593  H  HA   . THR A 1 19 ? -3.467  6.295   -8.058  1.00 0.00 ? 326 THR A HA   8  
ATOM   8594  H  HB   . THR A 1 19 ? -3.569  6.019   -11.070 1.00 0.00 ? 326 THR A HB   8  
ATOM   8595  H  HG1  . THR A 1 19 ? -4.982  8.094   -10.237 1.00 0.00 ? 326 THR A HG1  8  
ATOM   8596  H  HG21 . THR A 1 19 ? -5.997  6.108   -10.750 1.00 0.00 ? 326 THR A HG21 8  
ATOM   8597  H  HG22 . THR A 1 19 ? -5.769  6.204   -9.004  1.00 0.00 ? 326 THR A HG22 8  
ATOM   8598  H  HG23 . THR A 1 19 ? -5.296  4.746   -9.877  1.00 0.00 ? 326 THR A HG23 8  
ATOM   8599  N  N    . CYS A 1 20 ? -3.601  3.803   -8.194  1.00 0.00 ? 327 CYS A N    8  
ATOM   8600  C  CA   . CYS A 1 20 ? -3.568  2.354   -8.138  1.00 0.00 ? 327 CYS A CA   8  
ATOM   8601  C  C    . CYS A 1 20 ? -4.329  1.782   -9.319  1.00 0.00 ? 327 CYS A C    8  
ATOM   8602  O  O    . CYS A 1 20 ? -5.561  1.814   -9.337  1.00 0.00 ? 327 CYS A O    8  
ATOM   8603  C  CB   . CYS A 1 20 ? -4.185  1.867   -6.825  1.00 0.00 ? 327 CYS A CB   8  
ATOM   8604  S  SG   . CYS A 1 20 ? -4.521  0.085   -6.757  1.00 0.00 ? 327 CYS A SG   8  
ATOM   8605  H  H    . CYS A 1 20 ? -4.234  4.285   -7.627  1.00 0.00 ? 327 CYS A H    8  
ATOM   8606  H  HA   . CYS A 1 20 ? -2.536  2.037   -8.189  1.00 0.00 ? 327 CYS A HA   8  
ATOM   8607  H  HB2  . CYS A 1 20 ? -3.516  2.103   -6.012  1.00 0.00 ? 327 CYS A HB2  8  
ATOM   8608  H  HB3  . CYS A 1 20 ? -5.124  2.382   -6.668  1.00 0.00 ? 327 CYS A HB3  8  
ATOM   8609  N  N    . TYR A 1 21 ? -3.594  1.269   -10.302 1.00 0.00 ? 328 TYR A N    8  
ATOM   8610  C  CA   . TYR A 1 21 ? -4.192  0.787   -11.545 1.00 0.00 ? 328 TYR A CA   8  
ATOM   8611  C  C    . TYR A 1 21 ? -5.235  -0.297  -11.284 1.00 0.00 ? 328 TYR A C    8  
ATOM   8612  O  O    . TYR A 1 21 ? -6.250  -0.369  -11.976 1.00 0.00 ? 328 TYR A O    8  
ATOM   8613  C  CB   . TYR A 1 21 ? -3.116  0.278   -12.519 1.00 0.00 ? 328 TYR A CB   8  
ATOM   8614  C  CG   . TYR A 1 21 ? -2.335  -0.933  -12.038 1.00 0.00 ? 328 TYR A CG   8  
ATOM   8615  C  CD1  . TYR A 1 21 ? -1.241  -0.791  -11.194 1.00 0.00 ? 328 TYR A CD1  8  
ATOM   8616  C  CD2  . TYR A 1 21 ? -2.681  -2.217  -12.451 1.00 0.00 ? 328 TYR A CD2  8  
ATOM   8617  C  CE1  . TYR A 1 21 ? -0.516  -1.891  -10.774 1.00 0.00 ? 328 TYR A CE1  8  
ATOM   8618  C  CE2  . TYR A 1 21 ? -1.962  -3.322  -12.030 1.00 0.00 ? 328 TYR A CE2  8  
ATOM   8619  C  CZ   . TYR A 1 21 ? -0.878  -3.153  -11.194 1.00 0.00 ? 328 TYR A CZ   8  
ATOM   8620  O  OH   . TYR A 1 21 ? -0.156  -4.251  -10.780 1.00 0.00 ? 328 TYR A OH   8  
ATOM   8621  H  H    . TYR A 1 21 ? -2.616  1.227   -10.190 1.00 0.00 ? 328 TYR A H    8  
ATOM   8622  H  HA   . TYR A 1 21 ? -4.693  1.629   -12.002 1.00 0.00 ? 328 TYR A HA   8  
ATOM   8623  H  HB2  . TYR A 1 21 ? -3.589  0.010   -13.451 1.00 0.00 ? 328 TYR A HB2  8  
ATOM   8624  H  HB3  . TYR A 1 21 ? -2.409  1.075   -12.702 1.00 0.00 ? 328 TYR A HB3  8  
ATOM   8625  H  HD1  . TYR A 1 21 ? -0.960  0.197   -10.864 1.00 0.00 ? 328 TYR A HD1  8  
ATOM   8626  H  HD2  . TYR A 1 21 ? -3.531  -2.348  -13.106 1.00 0.00 ? 328 TYR A HD2  8  
ATOM   8627  H  HE1  . TYR A 1 21 ? 0.331   -1.758  -10.116 1.00 0.00 ? 328 TYR A HE1  8  
ATOM   8628  H  HE2  . TYR A 1 21 ? -2.248  -4.308  -12.360 1.00 0.00 ? 328 TYR A HE2  8  
ATOM   8629  H  HH   . TYR A 1 21 ? -0.106  -4.899  -11.506 1.00 0.00 ? 328 TYR A HH   8  
ATOM   8630  N  N    . LEU A 1 22 ? -5.000  -1.120  -10.272 1.00 0.00 ? 329 LEU A N    8  
ATOM   8631  C  CA   . LEU A 1 22 ? -5.954  -2.155  -9.916  1.00 0.00 ? 329 LEU A CA   8  
ATOM   8632  C  C    . LEU A 1 22 ? -7.044  -1.560  -9.023  1.00 0.00 ? 329 LEU A C    8  
ATOM   8633  O  O    . LEU A 1 22 ? -6.944  -1.629  -7.786  1.00 0.00 ? 329 LEU A O    8  
ATOM   8634  C  CB   . LEU A 1 22 ? -5.248  -3.327  -9.222  1.00 0.00 ? 329 LEU A CB   8  
ATOM   8635  C  CG   . LEU A 1 22 ? -5.819  -4.719  -9.534  1.00 0.00 ? 329 LEU A CG   8  
ATOM   8636  C  CD1  . LEU A 1 22 ? -4.976  -5.803  -8.882  1.00 0.00 ? 329 LEU A CD1  8  
ATOM   8637  C  CD2  . LEU A 1 22 ? -7.264  -4.835  -9.073  1.00 0.00 ? 329 LEU A CD2  8  
ATOM   8638  H  H    . LEU A 1 22 ? -4.170  -1.031  -9.763  1.00 0.00 ? 329 LEU A H    8  
ATOM   8639  H  HA   . LEU A 1 22 ? -6.412  -2.510  -10.828 1.00 0.00 ? 329 LEU A HA   8  
ATOM   8640  H  HB2  . LEU A 1 22 ? -4.208  -3.315  -9.511  1.00 0.00 ? 329 LEU A HB2  8  
ATOM   8641  H  HB3  . LEU A 1 22 ? -5.308  -3.172  -8.155  1.00 0.00 ? 329 LEU A HB3  8  
ATOM   8642  H  HG   . LEU A 1 22 ? -5.795  -4.878  -10.604 1.00 0.00 ? 329 LEU A HG   8  
ATOM   8643  H  HD11 . LEU A 1 22 ? -5.359  -6.774  -9.162  1.00 0.00 ? 329 LEU A HD11 8  
ATOM   8644  H  HD12 . LEU A 1 22 ? -5.022  -5.697  -7.809  1.00 0.00 ? 329 LEU A HD12 8  
ATOM   8645  H  HD13 . LEU A 1 22 ? -3.951  -5.711  -9.209  1.00 0.00 ? 329 LEU A HD13 8  
ATOM   8646  H  HD21 . LEU A 1 22 ? -7.316  -4.663  -8.008  1.00 0.00 ? 329 LEU A HD21 8  
ATOM   8647  H  HD22 . LEU A 1 22 ? -7.635  -5.824  -9.296  1.00 0.00 ? 329 LEU A HD22 8  
ATOM   8648  H  HD23 . LEU A 1 22 ? -7.867  -4.100  -9.586  1.00 0.00 ? 329 LEU A HD23 8  
ATOM   8649  N  N    . CYS A 1 23 ? -8.000  -0.896  -9.698  1.00 0.00 ? 330 CYS A N    8  
ATOM   8650  C  CA   . CYS A 1 23 ? -9.235  -0.299  -9.133  1.00 0.00 ? 330 CYS A CA   8  
ATOM   8651  C  C    . CYS A 1 23 ? -9.380  1.136   -9.630  1.00 0.00 ? 330 CYS A C    8  
ATOM   8652  O  O    . CYS A 1 23 ? -10.494 1.645   -9.764  1.00 0.00 ? 330 CYS A O    8  
ATOM   8653  C  CB   . CYS A 1 23 ? -9.319  -0.327  -7.600  1.00 0.00 ? 330 CYS A CB   8  
ATOM   8654  S  SG   . CYS A 1 23 ? -8.036  0.618   -6.739  1.00 0.00 ? 330 CYS A SG   8  
ATOM   8655  H  H    . CYS A 1 23 ? -7.863  -0.790  -10.667 1.00 0.00 ? 330 CYS A H    8  
ATOM   8656  H  HA   . CYS A 1 23 ? -10.064 -0.868  -9.532  1.00 0.00 ? 330 CYS A HA   8  
ATOM   8657  H  HB2  . CYS A 1 23 ? -10.272 0.077   -7.297  1.00 0.00 ? 330 CYS A HB2  8  
ATOM   8658  H  HB3  . CYS A 1 23 ? -9.250  -1.353  -7.265  1.00 0.00 ? 330 CYS A HB3  8  
ATOM   8659  N  N    . LYS A 1 24 ? -8.234  1.783   -9.865  1.00 0.00 ? 331 LYS A N    8  
ATOM   8660  C  CA   . LYS A 1 24 ? -8.166  3.099   -10.491 1.00 0.00 ? 331 LYS A CA   8  
ATOM   8661  C  C    . LYS A 1 24 ? -8.639  4.155   -9.507  1.00 0.00 ? 331 LYS A C    8  
ATOM   8662  O  O    . LYS A 1 24 ? -9.195  5.188   -9.881  1.00 0.00 ? 331 LYS A O    8  
ATOM   8663  C  CB   . LYS A 1 24 ? -8.976  3.129   -11.797 1.00 0.00 ? 331 LYS A CB   8  
ATOM   8664  C  CG   . LYS A 1 24 ? -8.534  4.215   -12.765 1.00 0.00 ? 331 LYS A CG   8  
ATOM   8665  C  CD   . LYS A 1 24 ? -9.116  3.989   -14.151 1.00 0.00 ? 331 LYS A CD   8  
ATOM   8666  C  CE   . LYS A 1 24 ? -8.574  4.989   -15.155 1.00 0.00 ? 331 LYS A CE   8  
ATOM   8667  N  NZ   . LYS A 1 24 ? -9.026  4.681   -16.537 1.00 0.00 ? 331 LYS A NZ   8  
ATOM   8668  H  H    . LYS A 1 24 ? -7.401  1.379   -9.566  1.00 0.00 ? 331 LYS A H    8  
ATOM   8669  H  HA   . LYS A 1 24 ? -7.126  3.291   -10.722 1.00 0.00 ? 331 LYS A HA   8  
ATOM   8670  H  HB2  . LYS A 1 24 ? -8.876  2.174   -12.292 1.00 0.00 ? 331 LYS A HB2  8  
ATOM   8671  H  HB3  . LYS A 1 24 ? -10.016 3.293   -11.558 1.00 0.00 ? 331 LYS A HB3  8  
ATOM   8672  H  HG2  . LYS A 1 24 ? -8.869  5.173   -12.395 1.00 0.00 ? 331 LYS A HG2  8  
ATOM   8673  H  HG3  . LYS A 1 24 ? -7.456  4.208   -12.831 1.00 0.00 ? 331 LYS A HG3  8  
ATOM   8674  H  HD2  . LYS A 1 24 ? -8.863  2.993   -14.480 1.00 0.00 ? 331 LYS A HD2  8  
ATOM   8675  H  HD3  . LYS A 1 24 ? -10.190 4.091   -14.098 1.00 0.00 ? 331 LYS A HD3  8  
ATOM   8676  H  HE2  . LYS A 1 24 ? -8.917  5.975   -14.884 1.00 0.00 ? 331 LYS A HE2  8  
ATOM   8677  H  HE3  . LYS A 1 24 ? -7.495  4.963   -15.125 1.00 0.00 ? 331 LYS A HE3  8  
ATOM   8678  H  HZ1  . LYS A 1 24 ? -8.664  5.396   -17.200 1.00 0.00 ? 331 LYS A HZ1  8  
ATOM   8679  H  HZ2  . LYS A 1 24 ? -10.066 4.680   -16.582 1.00 0.00 ? 331 LYS A HZ2  8  
ATOM   8680  H  HZ3  . LYS A 1 24 ? -8.679  3.746   -16.830 1.00 0.00 ? 331 LYS A HZ3  8  
ATOM   8681  N  N    . GLN A 1 25 ? -8.369  3.895   -8.234  1.00 0.00 ? 332 GLN A N    8  
ATOM   8682  C  CA   . GLN A 1 25 ? -8.793  4.776   -7.172  1.00 0.00 ? 332 GLN A CA   8  
ATOM   8683  C  C    . GLN A 1 25 ? -7.625  5.096   -6.247  1.00 0.00 ? 332 GLN A C    8  
ATOM   8684  O  O    . GLN A 1 25 ? -7.148  4.233   -5.511  1.00 0.00 ? 332 GLN A O    8  
ATOM   8685  C  CB   . GLN A 1 25 ? -9.931  4.144   -6.369  1.00 0.00 ? 332 GLN A CB   8  
ATOM   8686  C  CG   . GLN A 1 25 ? -11.162 3.824   -7.203  1.00 0.00 ? 332 GLN A CG   8  
ATOM   8687  C  CD   . GLN A 1 25 ? -12.281 3.192   -6.397  1.00 0.00 ? 332 GLN A CD   8  
ATOM   8688  O  OE1  . GLN A 1 25 ? -13.457 3.364   -6.713  1.00 0.00 ? 332 GLN A OE1  8  
ATOM   8689  N  NE2  . GLN A 1 25 ? -11.930 2.445   -5.361  1.00 0.00 ? 332 GLN A NE2  8  
ATOM   8690  H  H    . GLN A 1 25 ? -7.855  3.099   -8.011  1.00 0.00 ? 332 GLN A H    8  
ATOM   8691  H  HA   . GLN A 1 25 ? -9.139  5.679   -7.630  1.00 0.00 ? 332 GLN A HA   8  
ATOM   8692  H  HB2  . GLN A 1 25 ? -9.574  3.227   -5.928  1.00 0.00 ? 332 GLN A HB2  8  
ATOM   8693  H  HB3  . GLN A 1 25 ? -10.223 4.824   -5.581  1.00 0.00 ? 332 GLN A HB3  8  
ATOM   8694  H  HG2  . GLN A 1 25 ? -11.531 4.739   -7.642  1.00 0.00 ? 332 GLN A HG2  8  
ATOM   8695  H  HG3  . GLN A 1 25 ? -10.876 3.140   -7.990  1.00 0.00 ? 332 GLN A HG3  8  
ATOM   8696  H  HE21 . GLN A 1 25 ? -10.979 2.337   -5.168  1.00 0.00 ? 332 GLN A HE21 8  
ATOM   8697  H  HE22 . GLN A 1 25 ? -12.641 2.027   -4.829  1.00 0.00 ? 332 GLN A HE22 8  
ATOM   8698  N  N    . LYS A 1 26 ? -7.152  6.326   -6.303  1.00 0.00 ? 333 LYS A N    8  
ATOM   8699  C  CA   . LYS A 1 26 ? -6.060  6.762   -5.440  1.00 0.00 ? 333 LYS A CA   8  
ATOM   8700  C  C    . LYS A 1 26 ? -6.616  7.316   -4.128  1.00 0.00 ? 333 LYS A C    8  
ATOM   8701  O  O    . LYS A 1 26 ? -6.881  8.509   -4.010  1.00 0.00 ? 333 LYS A O    8  
ATOM   8702  C  CB   . LYS A 1 26 ? -5.197  7.819   -6.154  1.00 0.00 ? 333 LYS A CB   8  
ATOM   8703  C  CG   . LYS A 1 26 ? -3.776  7.970   -5.604  1.00 0.00 ? 333 LYS A CG   8  
ATOM   8704  C  CD   . LYS A 1 26 ? -3.736  8.652   -4.241  1.00 0.00 ? 333 LYS A CD   8  
ATOM   8705  C  CE   . LYS A 1 26 ? -2.306  8.809   -3.738  1.00 0.00 ? 333 LYS A CE   8  
ATOM   8706  N  NZ   . LYS A 1 26 ? -2.249  9.479   -2.409  1.00 0.00 ? 333 LYS A NZ   8  
ATOM   8707  H  H    . LYS A 1 26 ? -7.541  6.956   -6.943  1.00 0.00 ? 333 LYS A H    8  
ATOM   8708  H  HA   . LYS A 1 26 ? -5.448  5.898   -5.221  1.00 0.00 ? 333 LYS A HA   8  
ATOM   8709  H  HB2  . LYS A 1 26 ? -5.124  7.556   -7.199  1.00 0.00 ? 333 LYS A HB2  8  
ATOM   8710  H  HB3  . LYS A 1 26 ? -5.690  8.776   -6.074  1.00 0.00 ? 333 LYS A HB3  8  
ATOM   8711  H  HG2  . LYS A 1 26 ? -3.337  6.989   -5.509  1.00 0.00 ? 333 LYS A HG2  8  
ATOM   8712  H  HG3  . LYS A 1 26 ? -3.194  8.554   -6.303  1.00 0.00 ? 333 LYS A HG3  8  
ATOM   8713  H  HD2  . LYS A 1 26 ? -4.187  9.630   -4.324  1.00 0.00 ? 333 LYS A HD2  8  
ATOM   8714  H  HD3  . LYS A 1 26 ? -4.293  8.056   -3.533  1.00 0.00 ? 333 LYS A HD3  8  
ATOM   8715  H  HE2  . LYS A 1 26 ? -1.858  7.829   -3.656  1.00 0.00 ? 333 LYS A HE2  8  
ATOM   8716  H  HE3  . LYS A 1 26 ? -1.750  9.398   -4.453  1.00 0.00 ? 333 LYS A HE3  8  
ATOM   8717  H  HZ1  . LYS A 1 26 ? -2.675  10.423  -2.464  1.00 0.00 ? 333 LYS A HZ1  8  
ATOM   8718  H  HZ2  . LYS A 1 26 ? -1.258  9.578   -2.101  1.00 0.00 ? 333 LYS A HZ2  8  
ATOM   8719  H  HZ3  . LYS A 1 26 ? -2.761  8.917   -1.698  1.00 0.00 ? 333 LYS A HZ3  8  
ATOM   8720  N  N    . GLY A 1 27 ? -6.832  6.432   -3.159  1.00 0.00 ? 334 GLY A N    8  
ATOM   8721  C  CA   . GLY A 1 27 ? -7.244  6.873   -1.837  1.00 0.00 ? 334 GLY A CA   8  
ATOM   8722  C  C    . GLY A 1 27 ? -8.282  5.969   -1.198  1.00 0.00 ? 334 GLY A C    8  
ATOM   8723  O  O    . GLY A 1 27 ? -9.477  6.253   -1.252  1.00 0.00 ? 334 GLY A O    8  
ATOM   8724  H  H    . GLY A 1 27 ? -6.739  5.481   -3.348  1.00 0.00 ? 334 GLY A H    8  
ATOM   8725  H  HA2  . GLY A 1 27 ? -6.376  6.905   -1.196  1.00 0.00 ? 334 GLY A HA2  8  
ATOM   8726  H  HA3  . GLY A 1 27 ? -7.653  7.869   -1.915  1.00 0.00 ? 334 GLY A HA3  8  
ATOM   8727  N  N    . VAL A 1 28 ? -7.830  4.873   -0.594  1.00 0.00 ? 335 VAL A N    8  
ATOM   8728  C  CA   . VAL A 1 28 ? -8.724  3.996   0.159   1.00 0.00 ? 335 VAL A CA   8  
ATOM   8729  C  C    . VAL A 1 28 ? -8.102  3.627   1.504   1.00 0.00 ? 335 VAL A C    8  
ATOM   8730  O  O    . VAL A 1 28 ? -8.808  3.464   2.498   1.00 0.00 ? 335 VAL A O    8  
ATOM   8731  C  CB   . VAL A 1 28 ? -9.103  2.701   -0.608  1.00 0.00 ? 335 VAL A CB   8  
ATOM   8732  C  CG1  . VAL A 1 28 ? -9.757  3.025   -1.945  1.00 0.00 ? 335 VAL A CG1  8  
ATOM   8733  C  CG2  . VAL A 1 28 ? -7.897  1.796   -0.806  1.00 0.00 ? 335 VAL A CG2  8  
ATOM   8734  H  H    . VAL A 1 28 ? -6.878  4.664   -0.636  1.00 0.00 ? 335 VAL A H    8  
ATOM   8735  H  HA   . VAL A 1 28 ? -9.633  4.550   0.346   1.00 0.00 ? 335 VAL A HA   8  
ATOM   8736  H  HB   . VAL A 1 28 ? -9.825  2.164   -0.011  1.00 0.00 ? 335 VAL A HB   8  
ATOM   8737  H  HG11 . VAL A 1 28 ? -10.010 2.107   -2.453  1.00 0.00 ? 335 VAL A HG11 8  
ATOM   8738  H  HG12 . VAL A 1 28 ? -9.072  3.596   -2.552  1.00 0.00 ? 335 VAL A HG12 8  
ATOM   8739  H  HG13 . VAL A 1 28 ? -10.655 3.601   -1.775  1.00 0.00 ? 335 VAL A HG13 8  
ATOM   8740  H  HG21 . VAL A 1 28 ? -8.199  0.904   -1.334  1.00 0.00 ? 335 VAL A HG21 8  
ATOM   8741  H  HG22 . VAL A 1 28 ? -7.489  1.525   0.156   1.00 0.00 ? 335 VAL A HG22 8  
ATOM   8742  H  HG23 . VAL A 1 28 ? -7.145  2.317   -1.381  1.00 0.00 ? 335 VAL A HG23 8  
ATOM   8743  N  N    . GLY A 1 29 ? -6.777  3.497   1.530   1.00 0.00 ? 336 GLY A N    8  
ATOM   8744  C  CA   . GLY A 1 29 ? -6.086  3.204   2.769   1.00 0.00 ? 336 GLY A CA   8  
ATOM   8745  C  C    . GLY A 1 29 ? -4.578  3.233   2.607   1.00 0.00 ? 336 GLY A C    8  
ATOM   8746  O  O    . GLY A 1 29 ? -3.923  4.174   3.049   1.00 0.00 ? 336 GLY A O    8  
ATOM   8747  H  H    . GLY A 1 29 ? -6.268  3.585   0.702   1.00 0.00 ? 336 GLY A H    8  
ATOM   8748  H  HA2  . GLY A 1 29 ? -6.371  3.949   3.513   1.00 0.00 ? 336 GLY A HA2  8  
ATOM   8749  H  HA3  . GLY A 1 29 ? -6.384  2.210   3.109   1.00 0.00 ? 336 GLY A HA3  8  
ATOM   8750  N  N    . ALA A 1 30 ? -4.028  2.219   1.949   1.00 0.00 ? 337 ALA A N    8  
ATOM   8751  C  CA   . ALA A 1 30 ? -2.581  2.106   1.800   1.00 0.00 ? 337 ALA A CA   8  
ATOM   8752  C  C    . ALA A 1 30 ? -2.206  1.819   0.353   1.00 0.00 ? 337 ALA A C    8  
ATOM   8753  O  O    . ALA A 1 30 ? -2.922  1.106   -0.353  1.00 0.00 ? 337 ALA A O    8  
ATOM   8754  C  CB   . ALA A 1 30 ? -2.040  1.019   2.718   1.00 0.00 ? 337 ALA A CB   8  
ATOM   8755  H  H    . ALA A 1 30 ? -4.604  1.534   1.545   1.00 0.00 ? 337 ALA A H    8  
ATOM   8756  H  HA   . ALA A 1 30 ? -2.142  3.048   2.097   1.00 0.00 ? 337 ALA A HA   8  
ATOM   8757  H  HB1  . ALA A 1 30 ? -2.314  1.240   3.738   1.00 0.00 ? 337 ALA A HB1  8  
ATOM   8758  H  HB2  . ALA A 1 30 ? -0.965  0.980   2.633   1.00 0.00 ? 337 ALA A HB2  8  
ATOM   8759  H  HB3  . ALA A 1 30 ? -2.459  0.065   2.431   1.00 0.00 ? 337 ALA A HB3  8  
ATOM   8760  N  N    . SER A 1 31 ? -1.091  2.384   -0.091  1.00 0.00 ? 338 SER A N    8  
ATOM   8761  C  CA   . SER A 1 31 ? -0.643  2.197   -1.462  1.00 0.00 ? 338 SER A CA   8  
ATOM   8762  C  C    . SER A 1 31 ? 0.868   1.984   -1.512  1.00 0.00 ? 338 SER A C    8  
ATOM   8763  O  O    . SER A 1 31 ? 1.627   2.698   -0.856  1.00 0.00 ? 338 SER A O    8  
ATOM   8764  C  CB   . SER A 1 31 ? -1.037  3.407   -2.315  1.00 0.00 ? 338 SER A CB   8  
ATOM   8765  O  OG   . SER A 1 31 ? -2.412  3.729   -2.141  1.00 0.00 ? 338 SER A OG   8  
ATOM   8766  H  H    . SER A 1 31 ? -0.548  2.927   0.518   1.00 0.00 ? 338 SER A H    8  
ATOM   8767  H  HA   . SER A 1 31 ? -1.131  1.318   -1.852  1.00 0.00 ? 338 SER A HA   8  
ATOM   8768  H  HB2  . SER A 1 31 ? -0.441  4.258   -2.026  1.00 0.00 ? 338 SER A HB2  8  
ATOM   8769  H  HB3  . SER A 1 31 ? -0.863  3.183   -3.357  1.00 0.00 ? 338 SER A HB3  8  
ATOM   8770  H  HG   . SER A 1 31 ? -2.513  4.235   -1.330  1.00 0.00 ? 338 SER A HG   8  
ATOM   8771  N  N    . ILE A 1 32 ? 1.287   0.989   -2.278  1.00 0.00 ? 339 ILE A N    8  
ATOM   8772  C  CA   . ILE A 1 32 ? 2.699   0.704   -2.487  1.00 0.00 ? 339 ILE A CA   8  
ATOM   8773  C  C    . ILE A 1 32 ? 3.082   1.097   -3.916  1.00 0.00 ? 339 ILE A C    8  
ATOM   8774  O  O    . ILE A 1 32 ? 2.251   1.027   -4.822  1.00 0.00 ? 339 ILE A O    8  
ATOM   8775  C  CB   . ILE A 1 32 ? 3.012   -0.796  -2.224  1.00 0.00 ? 339 ILE A CB   8  
ATOM   8776  C  CG1  . ILE A 1 32 ? 4.488   -1.117  -2.483  1.00 0.00 ? 339 ILE A CG1  8  
ATOM   8777  C  CG2  . ILE A 1 32 ? 2.121   -1.698  -3.066  1.00 0.00 ? 339 ILE A CG2  8  
ATOM   8778  C  CD1  . ILE A 1 32 ? 5.440   -0.467  -1.504  1.00 0.00 ? 339 ILE A CD1  8  
ATOM   8779  H  H    . ILE A 1 32 ? 0.619   0.432   -2.742  1.00 0.00 ? 339 ILE A H    8  
ATOM   8780  H  HA   . ILE A 1 32 ? 3.268   1.304   -1.791  1.00 0.00 ? 339 ILE A HA   8  
ATOM   8781  H  HB   . ILE A 1 32 ? 2.793   -1.000  -1.186  1.00 0.00 ? 339 ILE A HB   8  
ATOM   8782  H  HG12 . ILE A 1 32 ? 4.633   -2.192  -2.416  1.00 0.00 ? 339 ILE A HG12 8  
ATOM   8783  H  HG13 . ILE A 1 32 ? 4.753   -0.773  -3.483  1.00 0.00 ? 339 ILE A HG13 8  
ATOM   8784  H  HG21 . ILE A 1 32 ? 1.087   -1.532  -2.801  1.00 0.00 ? 339 ILE A HG21 8  
ATOM   8785  H  HG22 . ILE A 1 32 ? 2.379   -2.731  -2.885  1.00 0.00 ? 339 ILE A HG22 8  
ATOM   8786  H  HG23 . ILE A 1 32 ? 2.265   -1.470  -4.113  1.00 0.00 ? 339 ILE A HG23 8  
ATOM   8787  H  HD11 . ILE A 1 32 ? 5.193   -0.781  -0.501  1.00 0.00 ? 339 ILE A HD11 8  
ATOM   8788  H  HD12 . ILE A 1 32 ? 5.357   0.608   -1.577  1.00 0.00 ? 339 ILE A HD12 8  
ATOM   8789  H  HD13 . ILE A 1 32 ? 6.452   -0.768  -1.736  1.00 0.00 ? 339 ILE A HD13 8  
ATOM   8790  N  N    . GLN A 1 33 ? 4.323   1.523   -4.119  1.00 0.00 ? 340 GLN A N    8  
ATOM   8791  C  CA   . GLN A 1 33 ? 4.736   2.047   -5.405  1.00 0.00 ? 340 GLN A CA   8  
ATOM   8792  C  C    . GLN A 1 33 ? 5.806   1.173   -6.038  1.00 0.00 ? 340 GLN A C    8  
ATOM   8793  O  O    . GLN A 1 33 ? 6.802   0.821   -5.403  1.00 0.00 ? 340 GLN A O    8  
ATOM   8794  C  CB   . GLN A 1 33 ? 5.264   3.474   -5.260  1.00 0.00 ? 340 GLN A CB   8  
ATOM   8795  C  CG   . GLN A 1 33 ? 5.413   4.201   -6.586  1.00 0.00 ? 340 GLN A CG   8  
ATOM   8796  C  CD   . GLN A 1 33 ? 6.128   5.497   -6.478  1.00 0.00 ? 340 GLN A CD   8  
ATOM   8797  O  OE1  . GLN A 1 33 ? 6.940   5.720   -5.581  1.00 0.00 ? 340 GLN A OE1  8  
ATOM   8798  N  NE2  . GLN A 1 33 ? 5.868   6.341   -7.432  1.00 0.00 ? 340 GLN A NE2  8  
ATOM   8799  H  H    . GLN A 1 33 ? 4.978   1.464   -3.401  1.00 0.00 ? 340 GLN A H    8  
ATOM   8800  H  HA   . GLN A 1 33 ? 3.872   2.060   -6.050  1.00 0.00 ? 340 GLN A HA   8  
ATOM   8801  H  HB2  . GLN A 1 33 ? 4.582   4.038   -4.638  1.00 0.00 ? 340 GLN A HB2  8  
ATOM   8802  H  HB3  . GLN A 1 33 ? 6.232   3.440   -4.780  1.00 0.00 ? 340 GLN A HB3  8  
ATOM   8803  H  HG2  . GLN A 1 33 ? 5.986   3.605   -7.273  1.00 0.00 ? 340 GLN A HG2  8  
ATOM   8804  H  HG3  . GLN A 1 33 ? 4.419   4.392   -6.992  1.00 0.00 ? 340 GLN A HG3  8  
ATOM   8805  H  HE21 . GLN A 1 33 ? 5.226   6.078   -8.124  1.00 0.00 ? 340 GLN A HE21 8  
ATOM   8806  H  HE22 . GLN A 1 33 ? 6.368   7.148   -7.450  1.00 0.00 ? 340 GLN A HE22 8  
ATOM   8807  N  N    . CYS A 1 34 ? 5.579   0.823   -7.288  1.00 0.00 ? 341 CYS A N    8  
ATOM   8808  C  CA   . CYS A 1 34 ? 6.560   0.107   -8.081  1.00 0.00 ? 341 CYS A CA   8  
ATOM   8809  C  C    . CYS A 1 34 ? 7.578   1.067   -8.661  1.00 0.00 ? 341 CYS A C    8  
ATOM   8810  O  O    . CYS A 1 34 ? 7.254   2.211   -8.989  1.00 0.00 ? 341 CYS A O    8  
ATOM   8811  C  CB   . CYS A 1 34 ? 5.904   -0.649  -9.228  1.00 0.00 ? 341 CYS A CB   8  
ATOM   8812  S  SG   . CYS A 1 34 ? 7.080   -1.267  -10.469 1.00 0.00 ? 341 CYS A SG   8  
ATOM   8813  H  H    . CYS A 1 34 ? 4.716   1.059   -7.689  1.00 0.00 ? 341 CYS A H    8  
ATOM   8814  H  HA   . CYS A 1 34 ? 7.065   -0.595  -7.436  1.00 0.00 ? 341 CYS A HA   8  
ATOM   8815  H  HB2  . CYS A 1 34 ? 5.369   -1.498  -8.831  1.00 0.00 ? 341 CYS A HB2  8  
ATOM   8816  H  HB3  . CYS A 1 34 ? 5.209   0.007   -9.730  1.00 0.00 ? 341 CYS A HB3  8  
ATOM   8817  N  N    . HIS A 1 35 ? 8.782   0.565   -8.861  1.00 0.00 ? 342 HIS A N    8  
ATOM   8818  C  CA   . HIS A 1 35 ? 9.879   1.386   -9.337  1.00 0.00 ? 342 HIS A CA   8  
ATOM   8819  C  C    . HIS A 1 35 ? 10.869  0.532   -10.129 1.00 0.00 ? 342 HIS A C    8  
ATOM   8820  O  O    . HIS A 1 35 ? 10.566  -0.608  -10.475 1.00 0.00 ? 342 HIS A O    8  
ATOM   8821  C  CB   . HIS A 1 35 ? 10.575  2.106   -8.159  1.00 0.00 ? 342 HIS A CB   8  
ATOM   8822  C  CG   . HIS A 1 35 ? 11.489  1.244   -7.331  1.00 0.00 ? 342 HIS A CG   8  
ATOM   8823  N  ND1  . HIS A 1 35 ? 12.703  1.686   -6.861  1.00 0.00 ? 342 HIS A ND1  8  
ATOM   8824  C  CD2  . HIS A 1 35 ? 11.377  -0.037  -6.919  1.00 0.00 ? 342 HIS A CD2  8  
ATOM   8825  C  CE1  . HIS A 1 35 ? 13.301  0.712   -6.207  1.00 0.00 ? 342 HIS A CE1  8  
ATOM   8826  N  NE2  . HIS A 1 35 ? 12.519  -0.349  -6.224  1.00 0.00 ? 342 HIS A NE2  8  
ATOM   8827  H  H    . HIS A 1 35 ? 8.919   -0.401  -8.725  1.00 0.00 ? 342 HIS A H    8  
ATOM   8828  H  HA   . HIS A 1 35 ? 9.462   2.130   -10.000 1.00 0.00 ? 342 HIS A HA   8  
ATOM   8829  H  HB2  . HIS A 1 35 ? 11.177  2.922   -8.556  1.00 0.00 ? 342 HIS A HB2  8  
ATOM   8830  H  HB3  . HIS A 1 35 ? 9.805   2.506   -7.494  1.00 0.00 ? 342 HIS A HB3  8  
ATOM   8831  H  HD1  . HIS A 1 35 ? 13.064  2.593   -6.969  1.00 0.00 ? 342 HIS A HD1  8  
ATOM   8832  H  HD2  . HIS A 1 35 ? 10.538  -0.698  -7.101  1.00 0.00 ? 342 HIS A HD2  8  
ATOM   8833  H  HE1  . HIS A 1 35 ? 14.270  0.772   -5.738  1.00 0.00 ? 342 HIS A HE1  8  
ATOM   8834  H  HE2  . HIS A 1 35 ? 12.827  -1.265  -6.042  1.00 0.00 ? 342 HIS A HE2  8  
ATOM   8835  N  N    . LYS A 1 36 ? 12.027  1.112   -10.408 1.00 0.00 ? 343 LYS A N    8  
ATOM   8836  C  CA   . LYS A 1 36 ? 13.125  0.466   -11.131 1.00 0.00 ? 343 LYS A CA   8  
ATOM   8837  C  C    . LYS A 1 36 ? 14.161  1.540   -11.472 1.00 0.00 ? 343 LYS A C    8  
ATOM   8838  O  O    . LYS A 1 36 ? 15.068  1.808   -10.685 1.00 0.00 ? 343 LYS A O    8  
ATOM   8839  C  CB   . LYS A 1 36 ? 12.624  -0.241  -12.403 1.00 0.00 ? 343 LYS A CB   8  
ATOM   8840  C  CG   . LYS A 1 36 ? 13.690  -1.031  -13.147 1.00 0.00 ? 343 LYS A CG   8  
ATOM   8841  C  CD   . LYS A 1 36 ? 13.995  -2.341  -12.438 1.00 0.00 ? 343 LYS A CD   8  
ATOM   8842  C  CE   . LYS A 1 36 ? 14.926  -3.215  -13.261 1.00 0.00 ? 343 LYS A CE   8  
ATOM   8843  N  NZ   . LYS A 1 36 ? 16.305  -2.664  -13.326 1.00 0.00 ? 343 LYS A NZ   8  
ATOM   8844  H  H    . LYS A 1 36 ? 12.159  2.022   -10.098 1.00 0.00 ? 343 LYS A H    8  
ATOM   8845  H  HA   . LYS A 1 36 ? 13.577  -0.259  -10.470 1.00 0.00 ? 343 LYS A HA   8  
ATOM   8846  H  HB2  . LYS A 1 36 ? 11.844  -0.931  -12.119 1.00 0.00 ? 343 LYS A HB2  8  
ATOM   8847  H  HB3  . LYS A 1 36 ? 12.204  0.488   -13.075 1.00 0.00 ? 343 LYS A HB3  8  
ATOM   8848  H  HG2  . LYS A 1 36 ? 13.329  -1.250  -14.151 1.00 0.00 ? 343 LYS A HG2  8  
ATOM   8849  H  HG3  . LYS A 1 36 ? 14.602  -0.433  -13.196 1.00 0.00 ? 343 LYS A HG3  8  
ATOM   8850  H  HD2  . LYS A 1 36 ? 14.475  -2.122  -11.485 1.00 0.00 ? 343 LYS A HD2  8  
ATOM   8851  H  HD3  . LYS A 1 36 ? 13.060  -2.877  -12.276 1.00 0.00 ? 343 LYS A HD3  8  
ATOM   8852  H  HE2  . LYS A 1 36 ? 14.962  -4.198  -12.819 1.00 0.00 ? 343 LYS A HE2  8  
ATOM   8853  H  HE3  . LYS A 1 36 ? 14.531  -3.288  -14.264 1.00 0.00 ? 343 LYS A HE3  8  
ATOM   8854  H  HZ1  . LYS A 1 36 ? 16.699  -2.574  -12.369 1.00 0.00 ? 343 LYS A HZ1  8  
ATOM   8855  H  HZ2  . LYS A 1 36 ? 16.297  -1.726  -13.776 1.00 0.00 ? 343 LYS A HZ2  8  
ATOM   8856  H  HZ3  . LYS A 1 36 ? 16.917  -3.296  -13.881 1.00 0.00 ? 343 LYS A HZ3  8  
ATOM   8857  N  N    . ALA A 1 37 ? 14.004  2.164   -12.631 1.00 0.00 ? 344 ALA A N    8  
ATOM   8858  C  CA   . ALA A 1 37 ? 14.711  3.388   -12.956 1.00 0.00 ? 344 ALA A CA   8  
ATOM   8859  C  C    . ALA A 1 37 ? 13.690  4.442   -13.342 1.00 0.00 ? 344 ALA A C    8  
ATOM   8860  O  O    . ALA A 1 37 ? 13.708  5.566   -12.838 1.00 0.00 ? 344 ALA A O    8  
ATOM   8861  C  CB   . ALA A 1 37 ? 15.707  3.167   -14.086 1.00 0.00 ? 344 ALA A CB   8  
ATOM   8862  H  H    . ALA A 1 37 ? 13.408  1.784   -13.299 1.00 0.00 ? 344 ALA A H    8  
ATOM   8863  H  HA   . ALA A 1 37 ? 15.248  3.715   -12.076 1.00 0.00 ? 344 ALA A HA   8  
ATOM   8864  H  HB1  . ALA A 1 37 ? 16.234  4.088   -14.287 1.00 0.00 ? 344 ALA A HB1  8  
ATOM   8865  H  HB2  . ALA A 1 37 ? 15.179  2.858   -14.975 1.00 0.00 ? 344 ALA A HB2  8  
ATOM   8866  H  HB3  . ALA A 1 37 ? 16.414  2.402   -13.800 1.00 0.00 ? 344 ALA A HB3  8  
ATOM   8867  N  N    . ASN A 1 38 ? 12.785  4.050   -14.231 1.00 0.00 ? 345 ASN A N    8  
ATOM   8868  C  CA   . ASN A 1 38 ? 11.679  4.900   -14.646 1.00 0.00 ? 345 ASN A CA   8  
ATOM   8869  C  C    . ASN A 1 38 ? 10.357  4.158   -14.482 1.00 0.00 ? 345 ASN A C    8  
ATOM   8870  O  O    . ASN A 1 38 ? 10.006  3.308   -15.302 1.00 0.00 ? 345 ASN A O    8  
ATOM   8871  C  CB   . ASN A 1 38 ? 11.854  5.336   -16.104 1.00 0.00 ? 345 ASN A CB   8  
ATOM   8872  C  CG   . ASN A 1 38 ? 13.053  6.240   -16.301 1.00 0.00 ? 345 ASN A CG   8  
ATOM   8873  O  OD1  . ASN A 1 38 ? 13.371  7.066   -15.446 1.00 0.00 ? 345 ASN A OD1  8  
ATOM   8874  N  ND2  . ASN A 1 38 ? 13.736  6.082   -17.420 1.00 0.00 ? 345 ASN A ND2  8  
ATOM   8875  H  H    . ASN A 1 38 ? 12.873  3.163   -14.639 1.00 0.00 ? 345 ASN A H    8  
ATOM   8876  H  HA   . ASN A 1 38 ? 11.673  5.774   -14.013 1.00 0.00 ? 345 ASN A HA   8  
ATOM   8877  H  HB2  . ASN A 1 38 ? 11.985  4.460   -16.723 1.00 0.00 ? 345 ASN A HB2  8  
ATOM   8878  H  HB3  . ASN A 1 38 ? 10.970  5.866   -16.422 1.00 0.00 ? 345 ASN A HB3  8  
ATOM   8879  H  HD21 . ASN A 1 38 ? 13.436  5.397   -18.055 1.00 0.00 ? 345 ASN A HD21 8  
ATOM   8880  H  HD22 . ASN A 1 38 ? 14.520  6.650   -17.567 1.00 0.00 ? 345 ASN A HD22 8  
ATOM   8881  N  N    . CYS A 1 39 ? 9.647   4.464   -13.400 1.00 0.00 ? 346 CYS A N    8  
ATOM   8882  C  CA   . CYS A 1 39 ? 8.362   3.842   -13.100 1.00 0.00 ? 346 CYS A CA   8  
ATOM   8883  C  C    . CYS A 1 39 ? 7.803   4.426   -11.811 1.00 0.00 ? 346 CYS A C    8  
ATOM   8884  O  O    . CYS A 1 39 ? 8.539   4.623   -10.846 1.00 0.00 ? 346 CYS A O    8  
ATOM   8885  C  CB   . CYS A 1 39 ? 8.509   2.321   -12.962 1.00 0.00 ? 346 CYS A CB   8  
ATOM   8886  S  SG   . CYS A 1 39 ? 6.942   1.418   -12.807 1.00 0.00 ? 346 CYS A SG   8  
ATOM   8887  H  H    . CYS A 1 39 ? 9.995   5.143   -12.780 1.00 0.00 ? 346 CYS A H    8  
ATOM   8888  H  HA   . CYS A 1 39 ? 7.684   4.064   -13.912 1.00 0.00 ? 346 CYS A HA   8  
ATOM   8889  H  HB2  . CYS A 1 39 ? 9.018   1.940   -13.833 1.00 0.00 ? 346 CYS A HB2  8  
ATOM   8890  H  HB3  . CYS A 1 39 ? 9.102   2.106   -12.084 1.00 0.00 ? 346 CYS A HB3  8  
ATOM   8891  N  N    . TYR A 1 40 ? 6.507   4.701   -11.801 1.00 0.00 ? 347 TYR A N    8  
ATOM   8892  C  CA   . TYR A 1 40 ? 5.861   5.287   -10.636 1.00 0.00 ? 347 TYR A CA   8  
ATOM   8893  C  C    . TYR A 1 40 ? 4.525   4.597   -10.375 1.00 0.00 ? 347 TYR A C    8  
ATOM   8894  O  O    . TYR A 1 40 ? 3.622   5.173   -9.767  1.00 0.00 ? 347 TYR A O    8  
ATOM   8895  C  CB   . TYR A 1 40 ? 5.657   6.795   -10.854 1.00 0.00 ? 347 TYR A CB   8  
ATOM   8896  C  CG   . TYR A 1 40 ? 4.590   7.148   -11.875 1.00 0.00 ? 347 TYR A CG   8  
ATOM   8897  C  CD1  . TYR A 1 40 ? 4.703   6.759   -13.205 1.00 0.00 ? 347 TYR A CD1  8  
ATOM   8898  C  CD2  . TYR A 1 40 ? 3.469   7.879   -11.501 1.00 0.00 ? 347 TYR A CD2  8  
ATOM   8899  C  CE1  . TYR A 1 40 ? 3.730   7.086   -14.130 1.00 0.00 ? 347 TYR A CE1  8  
ATOM   8900  C  CE2  . TYR A 1 40 ? 2.493   8.209   -12.420 1.00 0.00 ? 347 TYR A CE2  8  
ATOM   8901  C  CZ   . TYR A 1 40 ? 2.626   7.811   -13.732 1.00 0.00 ? 347 TYR A CZ   8  
ATOM   8902  O  OH   . TYR A 1 40 ? 1.653   8.142   -14.649 1.00 0.00 ? 347 TYR A OH   8  
ATOM   8903  H  H    . TYR A 1 40 ? 5.973   4.514   -12.599 1.00 0.00 ? 347 TYR A H    8  
ATOM   8904  H  HA   . TYR A 1 40 ? 6.507   5.136   -9.784  1.00 0.00 ? 347 TYR A HA   8  
ATOM   8905  H  HB2  . TYR A 1 40 ? 5.374   7.249   -9.917  1.00 0.00 ? 347 TYR A HB2  8  
ATOM   8906  H  HB3  . TYR A 1 40 ? 6.588   7.229   -11.187 1.00 0.00 ? 347 TYR A HB3  8  
ATOM   8907  H  HD1  . TYR A 1 40 ? 5.567   6.189   -13.512 1.00 0.00 ? 347 TYR A HD1  8  
ATOM   8908  H  HD2  . TYR A 1 40 ? 3.366   8.191   -10.472 1.00 0.00 ? 347 TYR A HD2  8  
ATOM   8909  H  HE1  . TYR A 1 40 ? 3.837   6.774   -15.158 1.00 0.00 ? 347 TYR A HE1  8  
ATOM   8910  H  HE2  . TYR A 1 40 ? 1.630   8.777   -12.107 1.00 0.00 ? 347 TYR A HE2  8  
ATOM   8911  H  HH   . TYR A 1 40 ? 1.404   7.354   -15.148 1.00 0.00 ? 347 TYR A HH   8  
ATOM   8912  N  N    . THR A 1 41 ? 4.428   3.346   -10.801 1.00 0.00 ? 348 THR A N    8  
ATOM   8913  C  CA   . THR A 1 41 ? 3.164   2.621   -10.760 1.00 0.00 ? 348 THR A CA   8  
ATOM   8914  C  C    . THR A 1 41 ? 2.770   2.296   -9.325  1.00 0.00 ? 348 THR A C    8  
ATOM   8915  O  O    . THR A 1 41 ? 3.412   1.474   -8.675  1.00 0.00 ? 348 THR A O    8  
ATOM   8916  C  CB   . THR A 1 41 ? 3.242   1.302   -11.548 1.00 0.00 ? 348 THR A CB   8  
ATOM   8917  O  OG1  . THR A 1 41 ? 4.050   1.469   -12.718 1.00 0.00 ? 348 THR A OG1  8  
ATOM   8918  C  CG2  . THR A 1 41 ? 1.853   0.833   -11.955 1.00 0.00 ? 348 THR A CG2  8  
ATOM   8919  H  H    . THR A 1 41 ? 5.234   2.886   -11.119 1.00 0.00 ? 348 THR A H    8  
ATOM   8920  H  HA   . THR A 1 41 ? 2.401   3.244   -11.205 1.00 0.00 ? 348 THR A HA   8  
ATOM   8921  H  HB   . THR A 1 41 ? 3.686   0.549   -10.915 1.00 0.00 ? 348 THR A HB   8  
ATOM   8922  H  HG1  . THR A 1 41 ? 3.520   1.870   -13.419 1.00 0.00 ? 348 THR A HG1  8  
ATOM   8923  H  HG21 . THR A 1 41 ? 1.245   0.696   -11.072 1.00 0.00 ? 348 THR A HG21 8  
ATOM   8924  H  HG22 . THR A 1 41 ? 1.930   -0.102  -12.488 1.00 0.00 ? 348 THR A HG22 8  
ATOM   8925  H  HG23 . THR A 1 41 ? 1.395   1.574   -12.594 1.00 0.00 ? 348 THR A HG23 8  
ATOM   8926  N  N    . ALA A 1 42 ? 1.720   2.931   -8.838  1.00 0.00 ? 349 ALA A N    8  
ATOM   8927  C  CA   . ALA A 1 42 ? 1.259   2.686   -7.485  1.00 0.00 ? 349 ALA A CA   8  
ATOM   8928  C  C    . ALA A 1 42 ? 0.071   1.745   -7.485  1.00 0.00 ? 349 ALA A C    8  
ATOM   8929  O  O    . ALA A 1 42 ? -0.687  1.678   -8.455  1.00 0.00 ? 349 ALA A O    8  
ATOM   8930  C  CB   . ALA A 1 42 ? 0.903   3.992   -6.799  1.00 0.00 ? 349 ALA A CB   8  
ATOM   8931  H  H    . ALA A 1 42 ? 1.238   3.571   -9.402  1.00 0.00 ? 349 ALA A H    8  
ATOM   8932  H  HA   . ALA A 1 42 ? 2.068   2.227   -6.936  1.00 0.00 ? 349 ALA A HA   8  
ATOM   8933  H  HB1  . ALA A 1 42 ? 1.767   4.639   -6.784  1.00 0.00 ? 349 ALA A HB1  8  
ATOM   8934  H  HB2  . ALA A 1 42 ? 0.586   3.792   -5.786  1.00 0.00 ? 349 ALA A HB2  8  
ATOM   8935  H  HB3  . ALA A 1 42 ? 0.101   4.474   -7.338  1.00 0.00 ? 349 ALA A HB3  8  
ATOM   8936  N  N    . PHE A 1 43 ? -0.067  0.993   -6.409  1.00 0.00 ? 350 PHE A N    8  
ATOM   8937  C  CA   . PHE A 1 43 ? -1.181  0.078   -6.244  1.00 0.00 ? 350 PHE A CA   8  
ATOM   8938  C  C    . PHE A 1 43 ? -1.376  -0.258  -4.773  1.00 0.00 ? 350 PHE A C    8  
ATOM   8939  O  O    . PHE A 1 43 ? -0.455  -0.148  -3.974  1.00 0.00 ? 350 PHE A O    8  
ATOM   8940  C  CB   . PHE A 1 43 ? -0.993  -1.194  -7.089  1.00 0.00 ? 350 PHE A CB   8  
ATOM   8941  C  CG   . PHE A 1 43 ? 0.385   -1.802  -7.033  1.00 0.00 ? 350 PHE A CG   8  
ATOM   8942  C  CD1  . PHE A 1 43 ? 1.434   -1.238  -7.740  1.00 0.00 ? 350 PHE A CD1  8  
ATOM   8943  C  CD2  . PHE A 1 43 ? 0.623   -2.946  -6.293  1.00 0.00 ? 350 PHE A CD2  8  
ATOM   8944  C  CE1  . PHE A 1 43 ? 2.692   -1.797  -7.709  1.00 0.00 ? 350 PHE A CE1  8  
ATOM   8945  C  CE2  . PHE A 1 43 ? 1.885   -3.511  -6.257  1.00 0.00 ? 350 PHE A CE2  8  
ATOM   8946  C  CZ   . PHE A 1 43 ? 2.920   -2.936  -6.967  1.00 0.00 ? 350 PHE A CZ   8  
ATOM   8947  H  H    . PHE A 1 43 ? 0.616   1.047   -5.700  1.00 0.00 ? 350 PHE A H    8  
ATOM   8948  H  HA   . PHE A 1 43 ? -2.066  0.590   -6.590  1.00 0.00 ? 350 PHE A HA   8  
ATOM   8949  H  HB2  . PHE A 1 43 ? -1.691  -1.943  -6.752  1.00 0.00 ? 350 PHE A HB2  8  
ATOM   8950  H  HB3  . PHE A 1 43 ? -1.204  -0.956  -8.122  1.00 0.00 ? 350 PHE A HB3  8  
ATOM   8951  H  HD1  . PHE A 1 43 ? 1.259   -0.344  -8.319  1.00 0.00 ? 350 PHE A HD1  8  
ATOM   8952  H  HD2  . PHE A 1 43 ? -0.187  -3.395  -5.738  1.00 0.00 ? 350 PHE A HD2  8  
ATOM   8953  H  HE1  . PHE A 1 43 ? 3.497   -1.346  -8.265  1.00 0.00 ? 350 PHE A HE1  8  
ATOM   8954  H  HE2  . PHE A 1 43 ? 2.060   -4.405  -5.680  1.00 0.00 ? 350 PHE A HE2  8  
ATOM   8955  H  HZ   . PHE A 1 43 ? 3.904   -3.377  -6.940  1.00 0.00 ? 350 PHE A HZ   8  
ATOM   8956  N  N    . HIS A 1 44 ? -2.589  -0.638  -4.412  1.00 0.00 ? 351 HIS A N    8  
ATOM   8957  C  CA   . HIS A 1 44 ? -2.915  -0.890  -3.013  1.00 0.00 ? 351 HIS A CA   8  
ATOM   8958  C  C    . HIS A 1 44 ? -2.343  -2.219  -2.552  1.00 0.00 ? 351 HIS A C    8  
ATOM   8959  O  O    . HIS A 1 44 ? -2.190  -3.143  -3.351  1.00 0.00 ? 351 HIS A O    8  
ATOM   8960  C  CB   . HIS A 1 44 ? -4.427  -0.887  -2.792  1.00 0.00 ? 351 HIS A CB   8  
ATOM   8961  C  CG   . HIS A 1 44 ? -5.080  0.412   -3.116  1.00 0.00 ? 351 HIS A CG   8  
ATOM   8962  N  ND1  . HIS A 1 44 ? -6.029  0.554   -4.114  1.00 0.00 ? 351 HIS A ND1  8  
ATOM   8963  C  CD2  . HIS A 1 44 ? -4.928  1.633   -2.557  1.00 0.00 ? 351 HIS A CD2  8  
ATOM   8964  C  CE1  . HIS A 1 44 ? -6.427  1.819   -4.143  1.00 0.00 ? 351 HIS A CE1  8  
ATOM   8965  N  NE2  . HIS A 1 44 ? -5.774  2.491   -3.214  1.00 0.00 ? 351 HIS A NE2  8  
ATOM   8966  H  H    . HIS A 1 44 ? -3.271  -0.765  -5.102  1.00 0.00 ? 351 HIS A H    8  
ATOM   8967  H  HA   . HIS A 1 44 ? -2.476  -0.100  -2.426  1.00 0.00 ? 351 HIS A HA   8  
ATOM   8968  H  HB2  . HIS A 1 44 ? -4.878  -1.649  -3.408  1.00 0.00 ? 351 HIS A HB2  8  
ATOM   8969  H  HB3  . HIS A 1 44 ? -4.629  -1.104  -1.754  1.00 0.00 ? 351 HIS A HB3  8  
ATOM   8970  H  HD2  . HIS A 1 44 ? -4.276  1.882   -1.728  1.00 0.00 ? 351 HIS A HD2  8  
ATOM   8971  H  HE1  . HIS A 1 44 ? -7.166  2.230   -4.814  1.00 0.00 ? 351 HIS A HE1  8  
ATOM   8972  H  HE2  . HIS A 1 44 ? -5.716  3.466   -3.177  1.00 0.00 ? 351 HIS A HE2  8  
ATOM   8973  N  N    . VAL A 1 45 ? -2.054  -2.315  -1.261  1.00 0.00 ? 352 VAL A N    8  
ATOM   8974  C  CA   . VAL A 1 45 ? -1.538  -3.546  -0.685  1.00 0.00 ? 352 VAL A CA   8  
ATOM   8975  C  C    . VAL A 1 45 ? -2.565  -4.662  -0.855  1.00 0.00 ? 352 VAL A C    8  
ATOM   8976  O  O    . VAL A 1 45 ? -2.217  -5.803  -1.161  1.00 0.00 ? 352 VAL A O    8  
ATOM   8977  C  CB   . VAL A 1 45 ? -1.199  -3.370  0.812   1.00 0.00 ? 352 VAL A CB   8  
ATOM   8978  C  CG1  . VAL A 1 45 ? -0.567  -4.632  1.383   1.00 0.00 ? 352 VAL A CG1  8  
ATOM   8979  C  CG2  . VAL A 1 45 ? -0.281  -2.172  1.013   1.00 0.00 ? 352 VAL A CG2  8  
ATOM   8980  H  H    . VAL A 1 45 ? -2.198  -1.540  -0.676  1.00 0.00 ? 352 VAL A H    8  
ATOM   8981  H  HA   . VAL A 1 45 ? -0.633  -3.813  -1.216  1.00 0.00 ? 352 VAL A HA   8  
ATOM   8982  H  HB   . VAL A 1 45 ? -2.117  -3.184  1.345   1.00 0.00 ? 352 VAL A HB   8  
ATOM   8983  H  HG11 . VAL A 1 45 ? -0.363  -4.488  2.433   1.00 0.00 ? 352 VAL A HG11 8  
ATOM   8984  H  HG12 . VAL A 1 45 ? 0.356   -4.840  0.862   1.00 0.00 ? 352 VAL A HG12 8  
ATOM   8985  H  HG13 . VAL A 1 45 ? -1.247  -5.462  1.259   1.00 0.00 ? 352 VAL A HG13 8  
ATOM   8986  H  HG21 . VAL A 1 45 ? -0.771  -1.280  0.652   1.00 0.00 ? 352 VAL A HG21 8  
ATOM   8987  H  HG22 . VAL A 1 45 ? 0.637   -2.325  0.465   1.00 0.00 ? 352 VAL A HG22 8  
ATOM   8988  H  HG23 . VAL A 1 45 ? -0.060  -2.061  2.064   1.00 0.00 ? 352 VAL A HG23 8  
ATOM   8989  N  N    . THR A 1 46 ? -3.837  -4.312  -0.679  1.00 0.00 ? 353 THR A N    8  
ATOM   8990  C  CA   . THR A 1 46 ? -4.930  -5.254  -0.878  1.00 0.00 ? 353 THR A CA   8  
ATOM   8991  C  C    . THR A 1 46 ? -4.964  -5.752  -2.325  1.00 0.00 ? 353 THR A C    8  
ATOM   8992  O  O    . THR A 1 46 ? -5.260  -6.915  -2.579  1.00 0.00 ? 353 THR A O    8  
ATOM   8993  C  CB   . THR A 1 46 ? -6.301  -4.633  -0.504  1.00 0.00 ? 353 THR A CB   8  
ATOM   8994  O  OG1  . THR A 1 46 ? -7.352  -5.585  -0.706  1.00 0.00 ? 353 THR A OG1  8  
ATOM   8995  C  CG2  . THR A 1 46 ? -6.592  -3.383  -1.324  1.00 0.00 ? 353 THR A CG2  8  
ATOM   8996  H  H    . THR A 1 46 ? -4.043  -3.397  -0.389  1.00 0.00 ? 353 THR A H    8  
ATOM   8997  H  HA   . THR A 1 46 ? -4.756  -6.099  -0.226  1.00 0.00 ? 353 THR A HA   8  
ATOM   8998  H  HB   . THR A 1 46 ? -6.278  -4.357  0.540   1.00 0.00 ? 353 THR A HB   8  
ATOM   8999  H  HG1  . THR A 1 46 ? -7.496  -6.078  0.112   1.00 0.00 ? 353 THR A HG1  8  
ATOM   9000  H  HG21 . THR A 1 46 ? -7.548  -2.974  -1.031  1.00 0.00 ? 353 THR A HG21 8  
ATOM   9001  H  HG22 . THR A 1 46 ? -6.617  -3.639  -2.372  1.00 0.00 ? 353 THR A HG22 8  
ATOM   9002  H  HG23 . THR A 1 46 ? -5.819  -2.651  -1.151  1.00 0.00 ? 353 THR A HG23 8  
ATOM   9003  N  N    . CYS A 1 47 ? -4.621  -4.878  -3.264  1.00 0.00 ? 354 CYS A N    8  
ATOM   9004  C  CA   . CYS A 1 47 ? -4.636  -5.232  -4.676  1.00 0.00 ? 354 CYS A CA   8  
ATOM   9005  C  C    . CYS A 1 47 ? -3.468  -6.157  -5.010  1.00 0.00 ? 354 CYS A C    8  
ATOM   9006  O  O    . CYS A 1 47 ? -3.627  -7.140  -5.731  1.00 0.00 ? 354 CYS A O    8  
ATOM   9007  C  CB   . CYS A 1 47 ? -4.564  -3.969  -5.541  1.00 0.00 ? 354 CYS A CB   8  
ATOM   9008  S  SG   . CYS A 1 47 ? -5.974  -2.840  -5.361  1.00 0.00 ? 354 CYS A SG   8  
ATOM   9009  H  H    . CYS A 1 47 ? -4.341  -3.981  -3.000  1.00 0.00 ? 354 CYS A H    8  
ATOM   9010  H  HA   . CYS A 1 47 ? -5.562  -5.750  -4.881  1.00 0.00 ? 354 CYS A HA   8  
ATOM   9011  H  HB2  . CYS A 1 47 ? -3.676  -3.418  -5.278  1.00 0.00 ? 354 CYS A HB2  8  
ATOM   9012  H  HB3  . CYS A 1 47 ? -4.502  -4.257  -6.579  1.00 0.00 ? 354 CYS A HB3  8  
ATOM   9013  N  N    . ALA A 1 48 ? -2.303  -5.844  -4.460  1.00 0.00 ? 355 ALA A N    8  
ATOM   9014  C  CA   . ALA A 1 48 ? -1.091  -6.602  -4.739  1.00 0.00 ? 355 ALA A CA   8  
ATOM   9015  C  C    . ALA A 1 48 ? -1.169  -8.018  -4.185  1.00 0.00 ? 355 ALA A C    8  
ATOM   9016  O  O    . ALA A 1 48 ? -0.839  -8.984  -4.875  1.00 0.00 ? 355 ALA A O    8  
ATOM   9017  C  CB   . ALA A 1 48 ? 0.114   -5.886  -4.165  1.00 0.00 ? 355 ALA A CB   8  
ATOM   9018  H  H    . ALA A 1 48 ? -2.252  -5.075  -3.848  1.00 0.00 ? 355 ALA A H    8  
ATOM   9019  H  HA   . ALA A 1 48 ? -0.974  -6.655  -5.811  1.00 0.00 ? 355 ALA A HA   8  
ATOM   9020  H  HB1  . ALA A 1 48 ? 1.011   -6.429  -4.427  1.00 0.00 ? 355 ALA A HB1  8  
ATOM   9021  H  HB2  . ALA A 1 48 ? 0.025   -5.836  -3.090  1.00 0.00 ? 355 ALA A HB2  8  
ATOM   9022  H  HB3  . ALA A 1 48 ? 0.167   -4.889  -4.570  1.00 0.00 ? 355 ALA A HB3  8  
ATOM   9023  N  N    . GLN A 1 49 ? -1.616  -8.140  -2.939  1.00 0.00 ? 356 GLN A N    8  
ATOM   9024  C  CA   . GLN A 1 49 ? -1.697  -9.442  -2.287  1.00 0.00 ? 356 GLN A CA   8  
ATOM   9025  C  C    . GLN A 1 49 ? -2.825  -10.272 -2.893  1.00 0.00 ? 356 GLN A C    8  
ATOM   9026  O  O    . GLN A 1 49 ? -2.806  -11.502 -2.836  1.00 0.00 ? 356 GLN A O    8  
ATOM   9027  C  CB   . GLN A 1 49 ? -1.908  -9.275  -0.778  1.00 0.00 ? 356 GLN A CB   8  
ATOM   9028  C  CG   . GLN A 1 49 ? -3.260  -8.689  -0.409  1.00 0.00 ? 356 GLN A CG   8  
ATOM   9029  C  CD   . GLN A 1 49 ? -3.381  -8.398  1.070   1.00 0.00 ? 356 GLN A CD   8  
ATOM   9030  O  OE1  . GLN A 1 49 ? -3.787  -9.253  1.855   1.00 0.00 ? 356 GLN A OE1  8  
ATOM   9031  N  NE2  . GLN A 1 49 ? -3.035  -7.182  1.456   1.00 0.00 ? 356 GLN A NE2  8  
ATOM   9032  H  H    . GLN A 1 49 ? -1.893  -7.336  -2.447  1.00 0.00 ? 356 GLN A H    8  
ATOM   9033  H  HA   . GLN A 1 49 ? -0.761  -9.953  -2.456  1.00 0.00 ? 356 GLN A HA   8  
ATOM   9034  H  HB2  . GLN A 1 49 ? -1.823  -10.251 -0.303  1.00 0.00 ? 356 GLN A HB2  8  
ATOM   9035  H  HB3  . GLN A 1 49 ? -1.135  -8.613  -0.390  1.00 0.00 ? 356 GLN A HB3  8  
ATOM   9036  H  HG2  . GLN A 1 49 ? -3.396  -7.755  -0.954  1.00 0.00 ? 356 GLN A HG2  8  
ATOM   9037  H  HG3  . GLN A 1 49 ? -4.037  -9.402  -0.687  1.00 0.00 ? 356 GLN A HG3  8  
ATOM   9038  H  HE21 . GLN A 1 49 ? -2.725  -6.550  0.773   1.00 0.00 ? 356 GLN A HE21 8  
ATOM   9039  H  HE22 . GLN A 1 49 ? -3.108  -6.960  2.411   1.00 0.00 ? 356 GLN A HE22 8  
ATOM   9040  N  N    . LYS A 1 50 ? -3.796  -9.585  -3.483  1.00 0.00 ? 357 LYS A N    8  
ATOM   9041  C  CA   . LYS A 1 50 ? -4.937  -10.240 -4.102  1.00 0.00 ? 357 LYS A CA   8  
ATOM   9042  C  C    . LYS A 1 50 ? -4.552  -10.765 -5.480  1.00 0.00 ? 357 LYS A C    8  
ATOM   9043  O  O    . LYS A 1 50 ? -4.983  -11.843 -5.891  1.00 0.00 ? 357 LYS A O    8  
ATOM   9044  C  CB   . LYS A 1 50 ? -6.094  -9.246  -4.207  1.00 0.00 ? 357 LYS A CB   8  
ATOM   9045  C  CG   . LYS A 1 50 ? -7.466  -9.883  -4.347  1.00 0.00 ? 357 LYS A CG   8  
ATOM   9046  C  CD   . LYS A 1 50 ? -8.569  -8.839  -4.223  1.00 0.00 ? 357 LYS A CD   8  
ATOM   9047  C  CE   . LYS A 1 50 ? -8.462  -8.065  -2.914  1.00 0.00 ? 357 LYS A CE   8  
ATOM   9048  N  NZ   . LYS A 1 50 ? -9.635  -7.180  -2.687  1.00 0.00 ? 357 LYS A NZ   8  
ATOM   9049  H  H    . LYS A 1 50 ? -3.745  -8.607  -3.498  1.00 0.00 ? 357 LYS A H    8  
ATOM   9050  H  HA   . LYS A 1 50 ? -5.234  -11.068 -3.477  1.00 0.00 ? 357 LYS A HA   8  
ATOM   9051  H  HB2  . LYS A 1 50 ? -6.100  -8.634  -3.318  1.00 0.00 ? 357 LYS A HB2  8  
ATOM   9052  H  HB3  . LYS A 1 50 ? -5.929  -8.610  -5.065  1.00 0.00 ? 357 LYS A HB3  8  
ATOM   9053  H  HG2  . LYS A 1 50 ? -7.537  -10.357 -5.322  1.00 0.00 ? 357 LYS A HG2  8  
ATOM   9054  H  HG3  . LYS A 1 50 ? -7.590  -10.623 -3.560  1.00 0.00 ? 357 LYS A HG3  8  
ATOM   9055  H  HD2  . LYS A 1 50 ? -8.490  -8.145  -5.048  1.00 0.00 ? 357 LYS A HD2  8  
ATOM   9056  H  HD3  . LYS A 1 50 ? -9.526  -9.337  -4.260  1.00 0.00 ? 357 LYS A HD3  8  
ATOM   9057  H  HE2  . LYS A 1 50 ? -8.390  -8.768  -2.100  1.00 0.00 ? 357 LYS A HE2  8  
ATOM   9058  H  HE3  . LYS A 1 50 ? -7.568  -7.458  -2.943  1.00 0.00 ? 357 LYS A HE3  8  
ATOM   9059  H  HZ1  . LYS A 1 50 ? -10.502 -7.751  -2.621  1.00 0.00 ? 357 LYS A HZ1  8  
ATOM   9060  H  HZ2  . LYS A 1 50 ? -9.737  -6.507  -3.472  1.00 0.00 ? 357 LYS A HZ2  8  
ATOM   9061  H  HZ3  . LYS A 1 50 ? -9.518  -6.647  -1.802  1.00 0.00 ? 357 LYS A HZ3  8  
ATOM   9062  N  N    . ALA A 1 51 ? -3.731  -9.995  -6.187  1.00 0.00 ? 358 ALA A N    8  
ATOM   9063  C  CA   . ALA A 1 51 ? -3.232  -10.405 -7.492  1.00 0.00 ? 358 ALA A CA   8  
ATOM   9064  C  C    . ALA A 1 51 ? -2.164  -11.483 -7.344  1.00 0.00 ? 358 ALA A C    8  
ATOM   9065  O  O    . ALA A 1 51 ? -2.228  -12.530 -7.990  1.00 0.00 ? 358 ALA A O    8  
ATOM   9066  C  CB   . ALA A 1 51 ? -2.680  -9.206  -8.253  1.00 0.00 ? 358 ALA A CB   8  
ATOM   9067  H  H    . ALA A 1 51 ? -3.461  -9.122  -5.822  1.00 0.00 ? 358 ALA A H    8  
ATOM   9068  H  HA   . ALA A 1 51 ? -4.062  -10.809 -8.052  1.00 0.00 ? 358 ALA A HA   8  
ATOM   9069  H  HB1  . ALA A 1 51 ? -3.454  -8.459  -8.358  1.00 0.00 ? 358 ALA A HB1  8  
ATOM   9070  H  HB2  . ALA A 1 51 ? -2.350  -9.522  -9.231  1.00 0.00 ? 358 ALA A HB2  8  
ATOM   9071  H  HB3  . ALA A 1 51 ? -1.847  -8.787  -7.711  1.00 0.00 ? 358 ALA A HB3  8  
ATOM   9072  N  N    . GLY A 1 52 ? -1.195  -11.227 -6.476  1.00 0.00 ? 359 GLY A N    8  
ATOM   9073  C  CA   . GLY A 1 52 ? -0.123  -12.177 -6.256  1.00 0.00 ? 359 GLY A CA   8  
ATOM   9074  C  C    . GLY A 1 52 ? 1.126   -11.821 -7.035  1.00 0.00 ? 359 GLY A C    8  
ATOM   9075  O  O    . GLY A 1 52 ? 1.715   -12.675 -7.698  1.00 0.00 ? 359 GLY A O    8  
ATOM   9076  H  H    . GLY A 1 52 ? -1.209  -10.382 -5.976  1.00 0.00 ? 359 GLY A H    8  
ATOM   9077  H  HA2  . GLY A 1 52 ? 0.114   -12.196 -5.203  1.00 0.00 ? 359 GLY A HA2  8  
ATOM   9078  H  HA3  . GLY A 1 52 ? -0.457  -13.158 -6.558  1.00 0.00 ? 359 GLY A HA3  8  
ATOM   9079  N  N    . LEU A 1 53 ? 1.530   -10.561 -6.962  1.00 0.00 ? 360 LEU A N    8  
ATOM   9080  C  CA   . LEU A 1 53 ? 2.723   -10.103 -7.664  1.00 0.00 ? 360 LEU A CA   8  
ATOM   9081  C  C    . LEU A 1 53 ? 3.947   -10.165 -6.749  1.00 0.00 ? 360 LEU A C    8  
ATOM   9082  O  O    . LEU A 1 53 ? 3.859   -10.645 -5.616  1.00 0.00 ? 360 LEU A O    8  
ATOM   9083  C  CB   . LEU A 1 53 ? 2.507   -8.687  -8.228  1.00 0.00 ? 360 LEU A CB   8  
ATOM   9084  C  CG   . LEU A 1 53 ? 1.944   -7.648  -7.249  1.00 0.00 ? 360 LEU A CG   8  
ATOM   9085  C  CD1  . LEU A 1 53 ? 3.026   -7.125  -6.316  1.00 0.00 ? 360 LEU A CD1  8  
ATOM   9086  C  CD2  . LEU A 1 53 ? 1.299   -6.504  -8.014  1.00 0.00 ? 360 LEU A CD2  8  
ATOM   9087  H  H    . LEU A 1 53 ? 1.020   -9.927  -6.417  1.00 0.00 ? 360 LEU A H    8  
ATOM   9088  H  HA   . LEU A 1 53 ? 2.885   -10.781 -8.490  1.00 0.00 ? 360 LEU A HA   8  
ATOM   9089  H  HB2  . LEU A 1 53 ? 3.471   -8.319  -8.588  1.00 0.00 ? 360 LEU A HB2  8  
ATOM   9090  H  HB3  . LEU A 1 53 ? 1.813   -8.766  -9.070  1.00 0.00 ? 360 LEU A HB3  8  
ATOM   9091  H  HG   . LEU A 1 53 ? 1.180   -8.114  -6.643  1.00 0.00 ? 360 LEU A HG   8  
ATOM   9092  H  HD11 . LEU A 1 53 ? 3.441   -7.947  -5.751  1.00 0.00 ? 360 LEU A HD11 8  
ATOM   9093  H  HD12 . LEU A 1 53 ? 2.601   -6.401  -5.639  1.00 0.00 ? 360 LEU A HD12 8  
ATOM   9094  H  HD13 . LEU A 1 53 ? 3.808   -6.659  -6.898  1.00 0.00 ? 360 LEU A HD13 8  
ATOM   9095  H  HD21 . LEU A 1 53 ? 2.033   -6.046  -8.661  1.00 0.00 ? 360 LEU A HD21 8  
ATOM   9096  H  HD22 . LEU A 1 53 ? 0.927   -5.769  -7.316  1.00 0.00 ? 360 LEU A HD22 8  
ATOM   9097  H  HD23 . LEU A 1 53 ? 0.482   -6.883  -8.609  1.00 0.00 ? 360 LEU A HD23 8  
ATOM   9098  N  N    . TYR A 1 54 ? 5.084   -9.686  -7.236  1.00 0.00 ? 361 TYR A N    8  
ATOM   9099  C  CA   . TYR A 1 54 ? 6.327   -9.782  -6.485  1.00 0.00 ? 361 TYR A CA   8  
ATOM   9100  C  C    . TYR A 1 54 ? 6.450   -8.658  -5.461  1.00 0.00 ? 361 TYR A C    8  
ATOM   9101  O  O    . TYR A 1 54 ? 6.399   -7.474  -5.801  1.00 0.00 ? 361 TYR A O    8  
ATOM   9102  C  CB   . TYR A 1 54 ? 7.535   -9.764  -7.425  1.00 0.00 ? 361 TYR A CB   8  
ATOM   9103  C  CG   . TYR A 1 54 ? 8.860   -9.910  -6.705  1.00 0.00 ? 361 TYR A CG   8  
ATOM   9104  C  CD1  . TYR A 1 54 ? 9.347   -11.162 -6.351  1.00 0.00 ? 361 TYR A CD1  8  
ATOM   9105  C  CD2  . TYR A 1 54 ? 9.618   -8.795  -6.376  1.00 0.00 ? 361 TYR A CD2  8  
ATOM   9106  C  CE1  . TYR A 1 54 ? 10.551  -11.296 -5.684  1.00 0.00 ? 361 TYR A CE1  8  
ATOM   9107  C  CE2  . TYR A 1 54 ? 10.822  -8.919  -5.712  1.00 0.00 ? 361 TYR A CE2  8  
ATOM   9108  C  CZ   . TYR A 1 54 ? 11.286  -10.172 -5.369  1.00 0.00 ? 361 TYR A CZ   8  
ATOM   9109  O  OH   . TYR A 1 54 ? 12.486  -10.297 -4.703  1.00 0.00 ? 361 TYR A OH   8  
ATOM   9110  H  H    . TYR A 1 54 ? 5.086   -9.246  -8.112  1.00 0.00 ? 361 TYR A H    8  
ATOM   9111  H  HA   . TYR A 1 54 ? 6.316   -10.724 -5.957  1.00 0.00 ? 361 TYR A HA   8  
ATOM   9112  H  HB2  . TYR A 1 54 ? 7.448   -10.578 -8.129  1.00 0.00 ? 361 TYR A HB2  8  
ATOM   9113  H  HB3  . TYR A 1 54 ? 7.550   -8.828  -7.964  1.00 0.00 ? 361 TYR A HB3  8  
ATOM   9114  H  HD1  . TYR A 1 54 ? 8.769   -12.040 -6.599  1.00 0.00 ? 361 TYR A HD1  8  
ATOM   9115  H  HD2  . TYR A 1 54 ? 9.252   -7.815  -6.643  1.00 0.00 ? 361 TYR A HD2  8  
ATOM   9116  H  HE1  . TYR A 1 54 ? 10.914  -12.278 -5.418  1.00 0.00 ? 361 TYR A HE1  8  
ATOM   9117  H  HE2  . TYR A 1 54 ? 11.395  -8.038  -5.466  1.00 0.00 ? 361 TYR A HE2  8  
ATOM   9118  H  HH   . TYR A 1 54 ? 12.982  -11.036 -5.076  1.00 0.00 ? 361 TYR A HH   8  
ATOM   9119  N  N    . MET A 1 55 ? 6.607   -9.050  -4.206  1.00 0.00 ? 362 MET A N    8  
ATOM   9120  C  CA   . MET A 1 55 ? 6.867   -8.111  -3.129  1.00 0.00 ? 362 MET A CA   8  
ATOM   9121  C  C    . MET A 1 55 ? 8.153   -8.485  -2.412  1.00 0.00 ? 362 MET A C    8  
ATOM   9122  O  O    . MET A 1 55 ? 8.350   -9.640  -2.035  1.00 0.00 ? 362 MET A O    8  
ATOM   9123  C  CB   . MET A 1 55 ? 5.710   -8.076  -2.129  1.00 0.00 ? 362 MET A CB   8  
ATOM   9124  C  CG   . MET A 1 55 ? 4.620   -7.081  -2.483  1.00 0.00 ? 362 MET A CG   8  
ATOM   9125  S  SD   . MET A 1 55 ? 3.359   -6.959  -1.200  1.00 0.00 ? 362 MET A SD   8  
ATOM   9126  C  CE   . MET A 1 55 ? 2.514   -5.463  -1.703  1.00 0.00 ? 362 MET A CE   8  
ATOM   9127  H  H    . MET A 1 55 ? 6.550   -10.005 -3.996  1.00 0.00 ? 362 MET A H    8  
ATOM   9128  H  HA   . MET A 1 55 ? 6.986   -7.130  -3.568  1.00 0.00 ? 362 MET A HA   8  
ATOM   9129  H  HB2  . MET A 1 55 ? 5.266   -9.059  -2.078  1.00 0.00 ? 362 MET A HB2  8  
ATOM   9130  H  HB3  . MET A 1 55 ? 6.101   -7.816  -1.157  1.00 0.00 ? 362 MET A HB3  8  
ATOM   9131  H  HG2  . MET A 1 55 ? 5.069   -6.110  -2.622  1.00 0.00 ? 362 MET A HG2  8  
ATOM   9132  H  HG3  . MET A 1 55 ? 4.150   -7.394  -3.404  1.00 0.00 ? 362 MET A HG3  8  
ATOM   9133  H  HE1  . MET A 1 55 ? 3.205   -4.633  -1.675  1.00 0.00 ? 362 MET A HE1  8  
ATOM   9134  H  HE2  . MET A 1 55 ? 1.692   -5.270  -1.030  1.00 0.00 ? 362 MET A HE2  8  
ATOM   9135  H  HE3  . MET A 1 55 ? 2.138   -5.583  -2.708  1.00 0.00 ? 362 MET A HE3  8  
ATOM   9136  N  N    . LYS A 1 56 ? 9.029   -7.513  -2.250  1.00 0.00 ? 363 LYS A N    8  
ATOM   9137  C  CA   . LYS A 1 56 ? 10.280  -7.714  -1.547  1.00 0.00 ? 363 LYS A CA   8  
ATOM   9138  C  C    . LYS A 1 56 ? 10.193  -7.072  -0.165  1.00 0.00 ? 363 LYS A C    8  
ATOM   9139  O  O    . LYS A 1 56 ? 9.573   -6.023  -0.003  1.00 0.00 ? 363 LYS A O    8  
ATOM   9140  C  CB   . LYS A 1 56 ? 11.428  -7.096  -2.346  1.00 0.00 ? 363 LYS A CB   8  
ATOM   9141  C  CG   . LYS A 1 56 ? 12.800  -7.590  -1.930  1.00 0.00 ? 363 LYS A CG   8  
ATOM   9142  C  CD   . LYS A 1 56 ? 13.899  -6.837  -2.658  1.00 0.00 ? 363 LYS A CD   8  
ATOM   9143  C  CE   . LYS A 1 56 ? 15.264  -7.448  -2.390  1.00 0.00 ? 363 LYS A CE   8  
ATOM   9144  N  NZ   . LYS A 1 56 ? 16.365  -6.539  -2.798  1.00 0.00 ? 363 LYS A NZ   8  
ATOM   9145  H  H    . LYS A 1 56 ? 8.831   -6.622  -2.620  1.00 0.00 ? 363 LYS A H    8  
ATOM   9146  H  HA   . LYS A 1 56 ? 10.446  -8.776  -1.439  1.00 0.00 ? 363 LYS A HA   8  
ATOM   9147  H  HB2  . LYS A 1 56 ? 11.287  -7.339  -3.401  1.00 0.00 ? 363 LYS A HB2  8  
ATOM   9148  H  HB3  . LYS A 1 56 ? 11.401  -6.013  -2.210  1.00 0.00 ? 363 LYS A HB3  8  
ATOM   9149  H  HG2  . LYS A 1 56 ? 12.919  -7.444  -0.866  1.00 0.00 ? 363 LYS A HG2  8  
ATOM   9150  H  HG3  . LYS A 1 56 ? 12.880  -8.641  -2.163  1.00 0.00 ? 363 LYS A HG3  8  
ATOM   9151  H  HD2  . LYS A 1 56 ? 13.705  -6.869  -3.720  1.00 0.00 ? 363 LYS A HD2  8  
ATOM   9152  H  HD3  . LYS A 1 56 ? 13.902  -5.810  -2.322  1.00 0.00 ? 363 LYS A HD3  8  
ATOM   9153  H  HE2  . LYS A 1 56 ? 15.352  -7.652  -1.333  1.00 0.00 ? 363 LYS A HE2  8  
ATOM   9154  H  HE3  . LYS A 1 56 ? 15.346  -8.372  -2.943  1.00 0.00 ? 363 LYS A HE3  8  
ATOM   9155  H  HZ1  . LYS A 1 56 ? 16.327  -5.657  -2.240  1.00 0.00 ? 363 LYS A HZ1  8  
ATOM   9156  H  HZ2  . LYS A 1 56 ? 16.285  -6.302  -3.807  1.00 0.00 ? 363 LYS A HZ2  8  
ATOM   9157  H  HZ3  . LYS A 1 56 ? 17.285  -6.995  -2.635  1.00 0.00 ? 363 LYS A HZ3  8  
ATOM   9158  N  N    . MET A 1 57 ? 10.818  -7.692  0.822   1.00 0.00 ? 364 MET A N    8  
ATOM   9159  C  CA   . MET A 1 57 ? 10.759  -7.205  2.189   1.00 0.00 ? 364 MET A CA   8  
ATOM   9160  C  C    . MET A 1 57 ? 12.154  -7.247  2.777   1.00 0.00 ? 364 MET A C    8  
ATOM   9161  O  O    . MET A 1 57 ? 12.677  -8.320  3.079   1.00 0.00 ? 364 MET A O    8  
ATOM   9162  C  CB   . MET A 1 57 ? 9.818   -8.045  3.068   1.00 0.00 ? 364 MET A CB   8  
ATOM   9163  C  CG   . MET A 1 57 ? 8.336   -7.938  2.737   1.00 0.00 ? 364 MET A CG   8  
ATOM   9164  S  SD   . MET A 1 57 ? 7.860   -8.915  1.299   1.00 0.00 ? 364 MET A SD   8  
ATOM   9165  C  CE   . MET A 1 57 ? 6.080   -8.720  1.333   1.00 0.00 ? 364 MET A CE   8  
ATOM   9166  H  H    . MET A 1 57 ? 11.374  -8.470  0.623   1.00 0.00 ? 364 MET A H    8  
ATOM   9167  H  HA   . MET A 1 57 ? 10.414  -6.181  2.167   1.00 0.00 ? 364 MET A HA   8  
ATOM   9168  H  HB2  . MET A 1 57 ? 10.095  -9.076  2.967   1.00 0.00 ? 364 MET A HB2  8  
ATOM   9169  H  HB3  . MET A 1 57 ? 9.954   -7.747  4.098   1.00 0.00 ? 364 MET A HB3  8  
ATOM   9170  H  HG2  . MET A 1 57 ? 7.768   -8.283  3.589   1.00 0.00 ? 364 MET A HG2  8  
ATOM   9171  H  HG3  . MET A 1 57 ? 8.100   -6.905  2.544   1.00 0.00 ? 364 MET A HG3  8  
ATOM   9172  H  HE1  . MET A 1 57 ? 5.832   -7.678  1.205   1.00 0.00 ? 364 MET A HE1  8  
ATOM   9173  H  HE2  . MET A 1 57 ? 5.697   -9.069  2.278   1.00 0.00 ? 364 MET A HE2  8  
ATOM   9174  H  HE3  . MET A 1 57 ? 5.641   -9.297  0.530   1.00 0.00 ? 364 MET A HE3  8  
ATOM   9175  N  N    . GLU A 1 58 ? 12.762  -6.092  2.917   1.00 0.00 ? 365 GLU A N    8  
ATOM   9176  C  CA   . GLU A 1 58 ? 14.113  -6.012  3.428   1.00 0.00 ? 365 GLU A CA   8  
ATOM   9177  C  C    . GLU A 1 58 ? 14.152  -5.225  4.729   1.00 0.00 ? 365 GLU A C    8  
ATOM   9178  O  O    . GLU A 1 58 ? 13.719  -4.072  4.777   1.00 0.00 ? 365 GLU A O    8  
ATOM   9179  C  CB   . GLU A 1 58 ? 15.014  -5.350  2.397   1.00 0.00 ? 365 GLU A CB   8  
ATOM   9180  C  CG   . GLU A 1 58 ? 15.255  -6.172  1.149   1.00 0.00 ? 365 GLU A CG   8  
ATOM   9181  C  CD   . GLU A 1 58 ? 16.221  -5.495  0.199   1.00 0.00 ? 365 GLU A CD   8  
ATOM   9182  O  OE1  . GLU A 1 58 ? 17.440  -5.716  0.327   1.00 0.00 ? 365 GLU A OE1  8  
ATOM   9183  O  OE2  . GLU A 1 58 ? 15.770  -4.743  -0.690  1.00 0.00 ? 365 GLU A OE2  8  
ATOM   9184  H  H    . GLU A 1 58 ? 12.294  -5.263  2.668   1.00 0.00 ? 365 GLU A H    8  
ATOM   9185  H  HA   . GLU A 1 58 ? 14.462  -7.018  3.611   1.00 0.00 ? 365 GLU A HA   8  
ATOM   9186  H  HB2  . GLU A 1 58 ? 14.551  -4.427  2.093   1.00 0.00 ? 365 GLU A HB2  8  
ATOM   9187  H  HB3  . GLU A 1 58 ? 15.967  -5.134  2.851   1.00 0.00 ? 365 GLU A HB3  8  
ATOM   9188  H  HG2  . GLU A 1 58 ? 15.661  -7.131  1.434   1.00 0.00 ? 365 GLU A HG2  8  
ATOM   9189  H  HG3  . GLU A 1 58 ? 14.313  -6.315  0.641   1.00 0.00 ? 365 GLU A HG3  8  
ATOM   9190  N  N    . PRO A 1 59 ? 14.656  -5.837  5.805   1.00 0.00 ? 366 PRO A N    8  
ATOM   9191  C  CA   . PRO A 1 59 ? 14.817  -5.164  7.084   1.00 0.00 ? 366 PRO A CA   8  
ATOM   9192  C  C    . PRO A 1 59 ? 16.102  -4.344  7.127   1.00 0.00 ? 366 PRO A C    8  
ATOM   9193  O  O    . PRO A 1 59 ? 17.205  -4.890  7.057   1.00 0.00 ? 366 PRO A O    8  
ATOM   9194  C  CB   . PRO A 1 59 ? 14.865  -6.320  8.081   1.00 0.00 ? 366 PRO A CB   8  
ATOM   9195  C  CG   . PRO A 1 59 ? 15.442  -7.466  7.315   1.00 0.00 ? 366 PRO A CG   8  
ATOM   9196  C  CD   . PRO A 1 59 ? 15.109  -7.239  5.858   1.00 0.00 ? 366 PRO A CD   8  
ATOM   9197  H  HA   . PRO A 1 59 ? 13.973  -4.524  7.304   1.00 0.00 ? 366 PRO A HA   8  
ATOM   9198  H  HB2  . PRO A 1 59 ? 15.490  -6.048  8.917   1.00 0.00 ? 366 PRO A HB2  8  
ATOM   9199  H  HB3  . PRO A 1 59 ? 13.867  -6.542  8.426   1.00 0.00 ? 366 PRO A HB3  8  
ATOM   9200  H  HG2  . PRO A 1 59 ? 16.513  -7.491  7.451   1.00 0.00 ? 366 PRO A HG2  8  
ATOM   9201  H  HG3  . PRO A 1 59 ? 15.001  -8.392  7.658   1.00 0.00 ? 366 PRO A HG3  8  
ATOM   9202  H  HD2  . PRO A 1 59 ? 15.987  -7.381  5.246   1.00 0.00 ? 366 PRO A HD2  8  
ATOM   9203  H  HD3  . PRO A 1 59 ? 14.321  -7.909  5.547   1.00 0.00 ? 366 PRO A HD3  8  
ATOM   9204  N  N    . VAL A 1 60 ? 15.959  -3.035  7.225   1.00 0.00 ? 367 VAL A N    8  
ATOM   9205  C  CA   . VAL A 1 60 ? 17.107  -2.147  7.223   1.00 0.00 ? 367 VAL A CA   8  
ATOM   9206  C  C    . VAL A 1 60 ? 17.453  -1.698  8.635   1.00 0.00 ? 367 VAL A C    8  
ATOM   9207  O  O    . VAL A 1 60 ? 16.598  -1.216  9.382   1.00 0.00 ? 367 VAL A O    8  
ATOM   9208  C  CB   . VAL A 1 60 ? 16.894  -0.916  6.314   1.00 0.00 ? 367 VAL A CB   8  
ATOM   9209  C  CG1  . VAL A 1 60 ? 17.109  -1.292  4.856   1.00 0.00 ? 367 VAL A CG1  8  
ATOM   9210  C  CG2  . VAL A 1 60 ? 15.508  -0.325  6.503   1.00 0.00 ? 367 VAL A CG2  8  
ATOM   9211  H  H    . VAL A 1 60 ? 15.059  -2.655  7.328   1.00 0.00 ? 367 VAL A H    8  
ATOM   9212  H  HA   . VAL A 1 60 ? 17.946  -2.706  6.831   1.00 0.00 ? 367 VAL A HA   8  
ATOM   9213  H  HB   . VAL A 1 60 ? 17.621  -0.162  6.583   1.00 0.00 ? 367 VAL A HB   8  
ATOM   9214  H  HG11 . VAL A 1 60 ? 18.134  -1.599  4.710   1.00 0.00 ? 367 VAL A HG11 8  
ATOM   9215  H  HG12 . VAL A 1 60 ? 16.893  -0.441  4.228   1.00 0.00 ? 367 VAL A HG12 8  
ATOM   9216  H  HG13 . VAL A 1 60 ? 16.449  -2.108  4.596   1.00 0.00 ? 367 VAL A HG13 8  
ATOM   9217  H  HG21 . VAL A 1 60 ? 15.374  -0.051  7.538   1.00 0.00 ? 367 VAL A HG21 8  
ATOM   9218  H  HG22 . VAL A 1 60 ? 14.762  -1.057  6.226   1.00 0.00 ? 367 VAL A HG22 8  
ATOM   9219  H  HG23 . VAL A 1 60 ? 15.400  0.551   5.881   1.00 0.00 ? 367 VAL A HG23 8  
ATOM   9220  N  N    . LYS A 1 61 ? 18.707  -1.886  8.996   1.00 0.00 ? 368 LYS A N    8  
ATOM   9221  C  CA   . LYS A 1 61 ? 19.191  -1.508  10.308  1.00 0.00 ? 368 LYS A CA   8  
ATOM   9222  C  C    . LYS A 1 61 ? 19.854  -0.142  10.259  1.00 0.00 ? 368 LYS A C    8  
ATOM   9223  O  O    . LYS A 1 61 ? 20.990  -0.008  9.797   1.00 0.00 ? 368 LYS A O    8  
ATOM   9224  C  CB   . LYS A 1 61 ? 20.180  -2.553  10.826  1.00 0.00 ? 368 LYS A CB   8  
ATOM   9225  C  CG   . LYS A 1 61 ? 19.528  -3.852  11.277  1.00 0.00 ? 368 LYS A CG   8  
ATOM   9226  C  CD   . LYS A 1 61 ? 18.868  -3.708  12.642  1.00 0.00 ? 368 LYS A CD   8  
ATOM   9227  C  CE   . LYS A 1 61 ? 19.896  -3.443  13.731  1.00 0.00 ? 368 LYS A CE   8  
ATOM   9228  N  NZ   . LYS A 1 61 ? 19.284  -3.365  15.082  1.00 0.00 ? 368 LYS A NZ   8  
ATOM   9229  H  H    . LYS A 1 61 ? 19.334  -2.289  8.357   1.00 0.00 ? 368 LYS A H    8  
ATOM   9230  H  HA   . LYS A 1 61 ? 18.343  -1.461  10.977  1.00 0.00 ? 368 LYS A HA   8  
ATOM   9231  H  HB2  . LYS A 1 61 ? 20.882  -2.785  10.038  1.00 0.00 ? 368 LYS A HB2  8  
ATOM   9232  H  HB3  . LYS A 1 61 ? 20.721  -2.135  11.663  1.00 0.00 ? 368 LYS A HB3  8  
ATOM   9233  H  HG2  . LYS A 1 61 ? 18.777  -4.134  10.554  1.00 0.00 ? 368 LYS A HG2  8  
ATOM   9234  H  HG3  . LYS A 1 61 ? 20.283  -4.622  11.332  1.00 0.00 ? 368 LYS A HG3  8  
ATOM   9235  H  HD2  . LYS A 1 61 ? 18.173  -2.884  12.610  1.00 0.00 ? 368 LYS A HD2  8  
ATOM   9236  H  HD3  . LYS A 1 61 ? 18.337  -4.621  12.873  1.00 0.00 ? 368 LYS A HD3  8  
ATOM   9237  H  HE2  . LYS A 1 61 ? 20.620  -4.243  13.723  1.00 0.00 ? 368 LYS A HE2  8  
ATOM   9238  H  HE3  . LYS A 1 61 ? 20.393  -2.508  13.518  1.00 0.00 ? 368 LYS A HE3  8  
ATOM   9239  H  HZ1  . LYS A 1 61 ? 20.014  -3.149  15.791  1.00 0.00 ? 368 LYS A HZ1  8  
ATOM   9240  H  HZ2  . LYS A 1 61 ? 18.839  -4.270  15.329  1.00 0.00 ? 368 LYS A HZ2  8  
ATOM   9241  H  HZ3  . LYS A 1 61 ? 18.561  -2.618  15.111  1.00 0.00 ? 368 LYS A HZ3  8  
ATOM   9242  N  N    . GLU A 1 62 ? 19.137  0.872   10.707  1.00 0.00 ? 369 GLU A N    8  
ATOM   9243  C  CA   . GLU A 1 62 ? 19.701  2.205   10.817  1.00 0.00 ? 369 GLU A CA   8  
ATOM   9244  C  C    . GLU A 1 62 ? 20.307  2.407   12.192  1.00 0.00 ? 369 GLU A C    8  
ATOM   9245  O  O    . GLU A 1 62 ? 20.229  1.532   13.060  1.00 0.00 ? 369 GLU A O    8  
ATOM   9246  C  CB   . GLU A 1 62 ? 18.666  3.293   10.540  1.00 0.00 ? 369 GLU A CB   8  
ATOM   9247  C  CG   . GLU A 1 62 ? 18.755  3.878   9.144   1.00 0.00 ? 369 GLU A CG   8  
ATOM   9248  C  CD   . GLU A 1 62 ? 17.690  4.921   8.874   1.00 0.00 ? 369 GLU A CD   8  
ATOM   9249  O  OE1  . GLU A 1 62 ? 17.797  6.038   9.421   1.00 0.00 ? 369 GLU A OE1  8  
ATOM   9250  O  OE2  . GLU A 1 62 ? 16.742  4.632   8.115   1.00 0.00 ? 369 GLU A OE2  8  
ATOM   9251  H  H    . GLU A 1 62 ? 18.203  0.722   10.977  1.00 0.00 ? 369 GLU A H    8  
ATOM   9252  H  HA   . GLU A 1 62 ? 20.489  2.282   10.083  1.00 0.00 ? 369 GLU A HA   8  
ATOM   9253  H  HB2  . GLU A 1 62 ? 17.679  2.883   10.680  1.00 0.00 ? 369 GLU A HB2  8  
ATOM   9254  H  HB3  . GLU A 1 62 ? 18.811  4.094   11.249  1.00 0.00 ? 369 GLU A HB3  8  
ATOM   9255  H  HG2  . GLU A 1 62 ? 19.722  4.345   9.035   1.00 0.00 ? 369 GLU A HG2  8  
ATOM   9256  H  HG3  . GLU A 1 62 ? 18.655  3.082   8.422   1.00 0.00 ? 369 GLU A HG3  8  
ATOM   9257  N  N    . LEU A 1 63 ? 20.892  3.572   12.383  1.00 0.00 ? 370 LEU A N    8  
ATOM   9258  C  CA   . LEU A 1 63 ? 21.652  3.881   13.575  1.00 0.00 ? 370 LEU A CA   8  
ATOM   9259  C  C    . LEU A 1 63 ? 21.935  5.373   13.632  1.00 0.00 ? 370 LEU A C    8  
ATOM   9260  O  O    . LEU A 1 63 ? 23.039  5.834   13.334  1.00 0.00 ? 370 LEU A O    8  
ATOM   9261  C  CB   . LEU A 1 63 ? 22.967  3.106   13.615  1.00 0.00 ? 370 LEU A CB   8  
ATOM   9262  C  CG   . LEU A 1 63 ? 23.809  3.367   14.861  1.00 0.00 ? 370 LEU A CG   8  
ATOM   9263  C  CD1  . LEU A 1 63 ? 23.295  2.559   16.041  1.00 0.00 ? 370 LEU A CD1  8  
ATOM   9264  C  CD2  . LEU A 1 63 ? 25.275  3.065   14.599  1.00 0.00 ? 370 LEU A CD2  8  
ATOM   9265  H  H    . LEU A 1 63 ? 20.761  4.272   11.720  1.00 0.00 ? 370 LEU A H    8  
ATOM   9266  H  HA   . LEU A 1 63 ? 21.056  3.610   14.430  1.00 0.00 ? 370 LEU A HA   8  
ATOM   9267  H  HB2  . LEU A 1 63 ? 22.743  2.050   13.563  1.00 0.00 ? 370 LEU A HB2  8  
ATOM   9268  H  HB3  . LEU A 1 63 ? 23.551  3.378   12.749  1.00 0.00 ? 370 LEU A HB3  8  
ATOM   9269  H  HG   . LEU A 1 63 ? 23.715  4.415   15.116  1.00 0.00 ? 370 LEU A HG   8  
ATOM   9270  H  HD11 . LEU A 1 63 ? 22.272  2.834   16.249  1.00 0.00 ? 370 LEU A HD11 8  
ATOM   9271  H  HD12 . LEU A 1 63 ? 23.906  2.763   16.908  1.00 0.00 ? 370 LEU A HD12 8  
ATOM   9272  H  HD13 . LEU A 1 63 ? 23.345  1.506   15.805  1.00 0.00 ? 370 LEU A HD13 8  
ATOM   9273  H  HD21 . LEU A 1 63 ? 25.382  2.032   14.305  1.00 0.00 ? 370 LEU A HD21 8  
ATOM   9274  H  HD22 . LEU A 1 63 ? 25.843  3.246   15.498  1.00 0.00 ? 370 LEU A HD22 8  
ATOM   9275  H  HD23 . LEU A 1 63 ? 25.638  3.705   13.809  1.00 0.00 ? 370 LEU A HD23 8  
ATOM   9276  N  N    . THR A 1 64 ? 20.910  6.118   13.957  1.00 0.00 ? 371 THR A N    8  
ATOM   9277  C  CA   . THR A 1 64 ? 21.030  7.554   14.129  1.00 0.00 ? 371 THR A CA   8  
ATOM   9278  C  C    . THR A 1 64 ? 21.321  7.891   15.588  1.00 0.00 ? 371 THR A C    8  
ATOM   9279  O  O    . THR A 1 64 ? 21.414  6.994   16.431  1.00 0.00 ? 371 THR A O    8  
ATOM   9280  C  CB   . THR A 1 64 ? 19.750  8.274   13.664  1.00 0.00 ? 371 THR A CB   8  
ATOM   9281  O  OG1  . THR A 1 64 ? 18.592  7.598   14.176  1.00 0.00 ? 371 THR A OG1  8  
ATOM   9282  C  CG2  . THR A 1 64 ? 19.683  8.331   12.145  1.00 0.00 ? 371 THR A CG2  8  
ATOM   9283  H  H    . THR A 1 64 ? 20.042  5.691   14.089  1.00 0.00 ? 371 THR A H    8  
ATOM   9284  H  HA   . THR A 1 64 ? 21.855  7.895   13.519  1.00 0.00 ? 371 THR A HA   8  
ATOM   9285  H  HB   . THR A 1 64 ? 19.767  9.284   14.048  1.00 0.00 ? 371 THR A HB   8  
ATOM   9286  H  HG1  . THR A 1 64 ? 18.061  7.268   13.437  1.00 0.00 ? 371 THR A HG1  8  
ATOM   9287  H  HG21 . THR A 1 64 ? 20.542  8.865   11.766  1.00 0.00 ? 371 THR A HG21 8  
ATOM   9288  H  HG22 . THR A 1 64 ? 18.780  8.843   11.844  1.00 0.00 ? 371 THR A HG22 8  
ATOM   9289  H  HG23 . THR A 1 64 ? 19.678  7.328   11.745  1.00 0.00 ? 371 THR A HG23 8  
ATOM   9290  N  N    . GLY A 1 65 ? 21.487  9.177   15.877  1.00 0.00 ? 372 GLY A N    8  
ATOM   9291  C  CA   . GLY A 1 65 ? 21.743  9.610   17.236  1.00 0.00 ? 372 GLY A CA   8  
ATOM   9292  C  C    . GLY A 1 65 ? 20.663  9.154   18.197  1.00 0.00 ? 372 GLY A C    8  
ATOM   9293  O  O    . GLY A 1 65 ? 19.512  9.590   18.104  1.00 0.00 ? 372 GLY A O    8  
ATOM   9294  H  H    . GLY A 1 65 ? 21.439  9.842   15.157  1.00 0.00 ? 372 GLY A H    8  
ATOM   9295  H  HA2  . GLY A 1 65 ? 22.692  9.208   17.559  1.00 0.00 ? 372 GLY A HA2  8  
ATOM   9296  H  HA3  . GLY A 1 65 ? 21.796  10.688  17.256  1.00 0.00 ? 372 GLY A HA3  8  
ATOM   9297  N  N    . GLY A 1 66 ? 21.031  8.258   19.099  1.00 0.00 ? 373 GLY A N    8  
ATOM   9298  C  CA   . GLY A 1 66 ? 20.082  7.715   20.048  1.00 0.00 ? 373 GLY A CA   8  
ATOM   9299  C  C    . GLY A 1 66 ? 20.149  6.205   20.097  1.00 0.00 ? 373 GLY A C    8  
ATOM   9300  O  O    . GLY A 1 66 ? 19.894  5.596   21.137  1.00 0.00 ? 373 GLY A O    8  
ATOM   9301  H  H    . GLY A 1 66 ? 21.963  7.952   19.118  1.00 0.00 ? 373 GLY A H    8  
ATOM   9302  H  HA2  . GLY A 1 66 ? 20.299  8.110   21.029  1.00 0.00 ? 373 GLY A HA2  8  
ATOM   9303  H  HA3  . GLY A 1 66 ? 19.086  8.013   19.760  1.00 0.00 ? 373 GLY A HA3  8  
ATOM   9304  N  N    . GLY A 1 67 ? 20.507  5.600   18.975  1.00 0.00 ? 374 GLY A N    8  
ATOM   9305  C  CA   . GLY A 1 67 ? 20.607  4.160   18.909  1.00 0.00 ? 374 GLY A CA   8  
ATOM   9306  C  C    . GLY A 1 67 ? 20.196  3.623   17.556  1.00 0.00 ? 374 GLY A C    8  
ATOM   9307  O  O    . GLY A 1 67 ? 19.910  4.393   16.637  1.00 0.00 ? 374 GLY A O    8  
ATOM   9308  H  H    . GLY A 1 67 ? 20.707  6.140   18.176  1.00 0.00 ? 374 GLY A H    8  
ATOM   9309  H  HA2  . GLY A 1 67 ? 21.628  3.869   19.106  1.00 0.00 ? 374 GLY A HA2  8  
ATOM   9310  H  HA3  . GLY A 1 67 ? 19.968  3.730   19.666  1.00 0.00 ? 374 GLY A HA3  8  
ATOM   9311  N  N    . THR A 1 68 ? 20.169  2.306   17.427  1.00 0.00 ? 375 THR A N    8  
ATOM   9312  C  CA   . THR A 1 68 ? 19.769  1.674   16.182  1.00 0.00 ? 375 THR A CA   8  
ATOM   9313  C  C    . THR A 1 68 ? 18.264  1.818   15.973  1.00 0.00 ? 375 THR A C    8  
ATOM   9314  O  O    . THR A 1 68 ? 17.493  1.841   16.937  1.00 0.00 ? 375 THR A O    8  
ATOM   9315  C  CB   . THR A 1 68 ? 20.172  0.181   16.153  1.00 0.00 ? 375 THR A CB   8  
ATOM   9316  O  OG1  . THR A 1 68 ? 19.795  -0.412  14.903  1.00 0.00 ? 375 THR A OG1  8  
ATOM   9317  C  CG2  . THR A 1 68 ? 19.531  -0.588  17.302  1.00 0.00 ? 375 THR A CG2  8  
ATOM   9318  H  H    . THR A 1 68 ? 20.417  1.745   18.190  1.00 0.00 ? 375 THR A H    8  
ATOM   9319  H  HA   . THR A 1 68 ? 20.281  2.178   15.376  1.00 0.00 ? 375 THR A HA   8  
ATOM   9320  H  HB   . THR A 1 68 ? 21.245  0.116   16.256  1.00 0.00 ? 375 THR A HB   8  
ATOM   9321  H  HG1  . THR A 1 68 ? 20.081  0.166   14.177  1.00 0.00 ? 375 THR A HG1  8  
ATOM   9322  H  HG21 . THR A 1 68 ? 19.856  -0.167  18.242  1.00 0.00 ? 375 THR A HG21 8  
ATOM   9323  H  HG22 . THR A 1 68 ? 19.827  -1.624  17.249  1.00 0.00 ? 375 THR A HG22 8  
ATOM   9324  H  HG23 . THR A 1 68 ? 18.456  -0.515  17.227  1.00 0.00 ? 375 THR A HG23 8  
ATOM   9325  N  N    . THR A 1 69 ? 17.844  1.928   14.721  1.00 0.00 ? 376 THR A N    8  
ATOM   9326  C  CA   . THR A 1 69 ? 16.457  2.054   14.414  1.00 0.00 ? 376 THR A CA   8  
ATOM   9327  C  C    . THR A 1 69 ? 16.074  0.966   13.437  1.00 0.00 ? 376 THR A C    8  
ATOM   9328  O  O    . THR A 1 69 ? 16.637  0.827   12.348  1.00 0.00 ? 376 THR A O    8  
ATOM   9329  C  CB   . THR A 1 69 ? 16.108  3.447   13.846  1.00 0.00 ? 376 THR A CB   8  
ATOM   9330  O  OG1  . THR A 1 69 ? 16.669  3.617   12.549  1.00 0.00 ? 376 THR A OG1  8  
ATOM   9331  C  CG2  . THR A 1 69 ? 16.648  4.534   14.749  1.00 0.00 ? 376 THR A CG2  8  
ATOM   9332  H  H    . THR A 1 69 ? 18.476  1.881   13.990  1.00 0.00 ? 376 THR A H    8  
ATOM   9333  H  HA   . THR A 1 69 ? 15.900  1.909   15.331  1.00 0.00 ? 376 THR A HA   8  
ATOM   9334  H  HB   . THR A 1 69 ? 15.034  3.545   13.789  1.00 0.00 ? 376 THR A HB   8  
ATOM   9335  H  HG1  . THR A 1 69 ? 15.964  3.598   11.890  1.00 0.00 ? 376 THR A HG1  8  
ATOM   9336  H  HG21 . THR A 1 69 ? 16.211  5.482   14.476  1.00 0.00 ? 376 THR A HG21 8  
ATOM   9337  H  HG22 . THR A 1 69 ? 17.726  4.584   14.640  1.00 0.00 ? 376 THR A HG22 8  
ATOM   9338  H  HG23 . THR A 1 69 ? 16.398  4.298   15.773  1.00 0.00 ? 376 THR A HG23 8  
ATOM   9339  N  N    . PHE A 1 70 ? 15.148  0.178   13.880  1.00 0.00 ? 377 PHE A N    8  
ATOM   9340  C  CA   . PHE A 1 70 ? 14.627  -0.925  13.112  1.00 0.00 ? 377 PHE A CA   8  
ATOM   9341  C  C    . PHE A 1 70 ? 13.571  -0.436  12.132  1.00 0.00 ? 377 PHE A C    8  
ATOM   9342  O  O    . PHE A 1 70 ? 12.506  0.042   12.526  1.00 0.00 ? 377 PHE A O    8  
ATOM   9343  C  CB   . PHE A 1 70 ? 14.061  -1.972  14.071  1.00 0.00 ? 377 PHE A CB   8  
ATOM   9344  C  CG   . PHE A 1 70 ? 13.243  -3.033  13.405  1.00 0.00 ? 377 PHE A CG   8  
ATOM   9345  C  CD1  . PHE A 1 70 ? 13.844  -4.121  12.801  1.00 0.00 ? 377 PHE A CD1  8  
ATOM   9346  C  CD2  . PHE A 1 70 ? 11.869  -2.934  13.396  1.00 0.00 ? 377 PHE A CD2  8  
ATOM   9347  C  CE1  . PHE A 1 70 ? 13.080  -5.101  12.193  1.00 0.00 ? 377 PHE A CE1  8  
ATOM   9348  C  CE2  . PHE A 1 70 ? 11.094  -3.905  12.791  1.00 0.00 ? 377 PHE A CE2  8  
ATOM   9349  C  CZ   . PHE A 1 70 ? 11.701  -4.992  12.187  1.00 0.00 ? 377 PHE A CZ   8  
ATOM   9350  H  H    . PHE A 1 70 ? 14.814  0.335   14.774  1.00 0.00 ? 377 PHE A H    8  
ATOM   9351  H  HA   . PHE A 1 70 ? 15.446  -1.360  12.557  1.00 0.00 ? 377 PHE A HA   8  
ATOM   9352  H  HB2  . PHE A 1 70 ? 14.888  -2.466  14.581  1.00 0.00 ? 377 PHE A HB2  8  
ATOM   9353  H  HB3  . PHE A 1 70 ? 13.424  -1.469  14.801  1.00 0.00 ? 377 PHE A HB3  8  
ATOM   9354  H  HD1  . PHE A 1 70 ? 14.921  -4.201  12.807  1.00 0.00 ? 377 PHE A HD1  8  
ATOM   9355  H  HD2  . PHE A 1 70 ? 11.406  -2.079  13.868  1.00 0.00 ? 377 PHE A HD2  8  
ATOM   9356  H  HE1  . PHE A 1 70 ? 13.557  -5.948  11.722  1.00 0.00 ? 377 PHE A HE1  8  
ATOM   9357  H  HE2  . PHE A 1 70 ? 10.017  -3.816  12.789  1.00 0.00 ? 377 PHE A HE2  8  
ATOM   9358  H  HZ   . PHE A 1 70 ? 11.100  -5.755  11.714  1.00 0.00 ? 377 PHE A HZ   8  
ATOM   9359  N  N    . SER A 1 71 ? 13.890  -0.514  10.855  1.00 0.00 ? 378 SER A N    8  
ATOM   9360  C  CA   . SER A 1 71 ? 12.960  -0.132  9.815   1.00 0.00 ? 378 SER A CA   8  
ATOM   9361  C  C    . SER A 1 71 ? 12.897  -1.217  8.749   1.00 0.00 ? 378 SER A C    8  
ATOM   9362  O  O    . SER A 1 71 ? 13.804  -2.042  8.641   1.00 0.00 ? 378 SER A O    8  
ATOM   9363  C  CB   . SER A 1 71 ? 13.386  1.204   9.205   1.00 0.00 ? 378 SER A CB   8  
ATOM   9364  O  OG   . SER A 1 71 ? 13.443  2.213   10.201  1.00 0.00 ? 378 SER A OG   8  
ATOM   9365  H  H    . SER A 1 71 ? 14.783  -0.838  10.600  1.00 0.00 ? 378 SER A H    8  
ATOM   9366  H  HA   . SER A 1 71 ? 11.984  -0.022  10.264  1.00 0.00 ? 378 SER A HA   8  
ATOM   9367  H  HB2  . SER A 1 71 ? 14.366  1.099   8.758   1.00 0.00 ? 378 SER A HB2  8  
ATOM   9368  H  HB3  . SER A 1 71 ? 12.674  1.499   8.448   1.00 0.00 ? 378 SER A HB3  8  
ATOM   9369  H  HG   . SER A 1 71 ? 13.404  1.799   11.073  1.00 0.00 ? 378 SER A HG   8  
ATOM   9370  N  N    . VAL A 1 72 ? 11.826  -1.234  7.981   1.00 0.00 ? 379 VAL A N    8  
ATOM   9371  C  CA   . VAL A 1 72 ? 11.702  -2.180  6.889   1.00 0.00 ? 379 VAL A CA   8  
ATOM   9372  C  C    . VAL A 1 72 ? 11.442  -1.431  5.596   1.00 0.00 ? 379 VAL A C    8  
ATOM   9373  O  O    . VAL A 1 72 ? 10.672  -0.473  5.564   1.00 0.00 ? 379 VAL A O    8  
ATOM   9374  C  CB   . VAL A 1 72 ? 10.556  -3.187  7.109   1.00 0.00 ? 379 VAL A CB   8  
ATOM   9375  C  CG1  . VAL A 1 72 ? 10.670  -4.357  6.144   1.00 0.00 ? 379 VAL A CG1  8  
ATOM   9376  C  CG2  . VAL A 1 72 ? 10.519  -3.677  8.550   1.00 0.00 ? 379 VAL A CG2  8  
ATOM   9377  H  H    . VAL A 1 72 ? 11.099  -0.593  8.147   1.00 0.00 ? 379 VAL A H    8  
ATOM   9378  H  HA   . VAL A 1 72 ? 12.631  -2.724  6.806   1.00 0.00 ? 379 VAL A HA   8  
ATOM   9379  H  HB   . VAL A 1 72 ? 9.632   -2.680  6.898   1.00 0.00 ? 379 VAL A HB   8  
ATOM   9380  H  HG11 . VAL A 1 72 ? 9.855   -5.044  6.312   1.00 0.00 ? 379 VAL A HG11 8  
ATOM   9381  H  HG12 . VAL A 1 72 ? 11.609  -4.866  6.305   1.00 0.00 ? 379 VAL A HG12 8  
ATOM   9382  H  HG13 . VAL A 1 72 ? 10.629  -3.991  5.129   1.00 0.00 ? 379 VAL A HG13 8  
ATOM   9383  H  HG21 . VAL A 1 72 ? 10.371  -2.837  9.212   1.00 0.00 ? 379 VAL A HG21 8  
ATOM   9384  H  HG22 . VAL A 1 72 ? 11.453  -4.164  8.787   1.00 0.00 ? 379 VAL A HG22 8  
ATOM   9385  H  HG23 . VAL A 1 72 ? 9.707   -4.379  8.671   1.00 0.00 ? 379 VAL A HG23 8  
ATOM   9386  N  N    . ARG A 1 73 ? 12.094  -1.868  4.543   1.00 0.00 ? 380 ARG A N    8  
ATOM   9387  C  CA   . ARG A 1 73 ? 11.877  -1.298  3.227   1.00 0.00 ? 380 ARG A CA   8  
ATOM   9388  C  C    . ARG A 1 73 ? 11.212  -2.340  2.336   1.00 0.00 ? 380 ARG A C    8  
ATOM   9389  O  O    . ARG A 1 73 ? 11.863  -3.225  1.778   1.00 0.00 ? 380 ARG A O    8  
ATOM   9390  C  CB   . ARG A 1 73 ? 13.189  -0.776  2.609   1.00 0.00 ? 380 ARG A CB   8  
ATOM   9391  C  CG   . ARG A 1 73 ? 14.315  -1.796  2.564   1.00 0.00 ? 380 ARG A CG   8  
ATOM   9392  C  CD   . ARG A 1 73 ? 14.785  -2.061  1.140   1.00 0.00 ? 380 ARG A CD   8  
ATOM   9393  N  NE   . ARG A 1 73 ? 15.422  -0.892  0.537   1.00 0.00 ? 380 ARG A NE   8  
ATOM   9394  C  CZ   . ARG A 1 73 ? 16.208  -0.944  -0.539  1.00 0.00 ? 380 ARG A CZ   8  
ATOM   9395  N  NH1  . ARG A 1 73 ? 16.444  -2.105  -1.147  1.00 0.00 ? 380 ARG A NH1  8  
ATOM   9396  N  NH2  . ARG A 1 73 ? 16.761  0.168   -1.004  1.00 0.00 ? 380 ARG A NH2  8  
ATOM   9397  H  H    . ARG A 1 73 ? 12.721  -2.614  4.651   1.00 0.00 ? 380 ARG A H    8  
ATOM   9398  H  HA   . ARG A 1 73 ? 11.194  -0.469  3.345   1.00 0.00 ? 380 ARG A HA   8  
ATOM   9399  H  HB2  . ARG A 1 73 ? 12.992  -0.453  1.599   1.00 0.00 ? 380 ARG A HB2  8  
ATOM   9400  H  HB3  . ARG A 1 73 ? 13.528  0.075   3.185   1.00 0.00 ? 380 ARG A HB3  8  
ATOM   9401  H  HG2  . ARG A 1 73 ? 15.147  -1.426  3.142   1.00 0.00 ? 380 ARG A HG2  8  
ATOM   9402  H  HG3  . ARG A 1 73 ? 13.963  -2.722  2.993   1.00 0.00 ? 380 ARG A HG3  8  
ATOM   9403  H  HD2  . ARG A 1 73 ? 15.495  -2.874  1.153   1.00 0.00 ? 380 ARG A HD2  8  
ATOM   9404  H  HD3  . ARG A 1 73 ? 13.929  -2.342  0.542   1.00 0.00 ? 380 ARG A HD3  8  
ATOM   9405  H  HE   . ARG A 1 73 ? 15.261  -0.020  0.964   1.00 0.00 ? 380 ARG A HE   8  
ATOM   9406  H  HH11 . ARG A 1 73 ? 16.028  -2.959  -0.799  1.00 0.00 ? 380 ARG A HH11 8  
ATOM   9407  H  HH12 . ARG A 1 73 ? 17.036  -2.140  -1.955  1.00 0.00 ? 380 ARG A HH12 8  
ATOM   9408  H  HH21 . ARG A 1 73 ? 16.588  1.043   -0.550  1.00 0.00 ? 380 ARG A HH21 8  
ATOM   9409  H  HH22 . ARG A 1 73 ? 17.360  0.137   -1.811  1.00 0.00 ? 380 ARG A HH22 8  
ATOM   9410  N  N    . LYS A 1 74 ? 9.898   -2.265  2.255   1.00 0.00 ? 381 LYS A N    8  
ATOM   9411  C  CA   . LYS A 1 74 ? 9.143   -3.210  1.463   1.00 0.00 ? 381 LYS A CA   8  
ATOM   9412  C  C    . LYS A 1 74 ? 9.022   -2.691  0.040   1.00 0.00 ? 381 LYS A C    8  
ATOM   9413  O  O    . LYS A 1 74 ? 8.379   -1.673  -0.215  1.00 0.00 ? 381 LYS A O    8  
ATOM   9414  C  CB   . LYS A 1 74 ? 7.771   -3.449  2.094   1.00 0.00 ? 381 LYS A CB   8  
ATOM   9415  C  CG   . LYS A 1 74 ? 7.017   -4.620  1.491   1.00 0.00 ? 381 LYS A CG   8  
ATOM   9416  C  CD   . LYS A 1 74 ? 5.840   -5.038  2.361   1.00 0.00 ? 381 LYS A CD   8  
ATOM   9417  C  CE   . LYS A 1 74 ? 4.854   -3.900  2.586   1.00 0.00 ? 381 LYS A CE   8  
ATOM   9418  N  NZ   . LYS A 1 74 ? 3.741   -4.298  3.492   1.00 0.00 ? 381 LYS A NZ   8  
ATOM   9419  H  H    . LYS A 1 74 ? 9.425   -1.550  2.731   1.00 0.00 ? 381 LYS A H    8  
ATOM   9420  H  HA   . LYS A 1 74 ? 9.693   -4.143  1.448   1.00 0.00 ? 381 LYS A HA   8  
ATOM   9421  H  HB2  . LYS A 1 74 ? 7.901   -3.638  3.150   1.00 0.00 ? 381 LYS A HB2  8  
ATOM   9422  H  HB3  . LYS A 1 74 ? 7.171   -2.560  1.969   1.00 0.00 ? 381 LYS A HB3  8  
ATOM   9423  H  HG2  . LYS A 1 74 ? 6.650   -4.337  0.517   1.00 0.00 ? 381 LYS A HG2  8  
ATOM   9424  H  HG3  . LYS A 1 74 ? 7.698   -5.458  1.392   1.00 0.00 ? 381 LYS A HG3  8  
ATOM   9425  H  HD2  . LYS A 1 74 ? 5.325   -5.853  1.876   1.00 0.00 ? 381 LYS A HD2  8  
ATOM   9426  H  HD3  . LYS A 1 74 ? 6.217   -5.370  3.316   1.00 0.00 ? 381 LYS A HD3  8  
ATOM   9427  H  HE2  . LYS A 1 74 ? 5.380   -3.064  3.025   1.00 0.00 ? 381 LYS A HE2  8  
ATOM   9428  H  HE3  . LYS A 1 74 ? 4.443   -3.605  1.633   1.00 0.00 ? 381 LYS A HE3  8  
ATOM   9429  H  HZ1  . LYS A 1 74 ? 3.221   -5.104  3.091   1.00 0.00 ? 381 LYS A HZ1  8  
ATOM   9430  H  HZ2  . LYS A 1 74 ? 3.081   -3.503  3.617   1.00 0.00 ? 381 LYS A HZ2  8  
ATOM   9431  H  HZ3  . LYS A 1 74 ? 4.114   -4.570  4.424   1.00 0.00 ? 381 LYS A HZ3  8  
ATOM   9432  N  N    . THR A 1 75 ? 9.669   -3.384  -0.873  1.00 0.00 ? 382 THR A N    8  
ATOM   9433  C  CA   . THR A 1 75 ? 9.758   -2.940  -2.247  1.00 0.00 ? 382 THR A CA   8  
ATOM   9434  C  C    . THR A 1 75 ? 8.928   -3.832  -3.159  1.00 0.00 ? 382 THR A C    8  
ATOM   9435  O  O    . THR A 1 75 ? 9.163   -5.033  -3.247  1.00 0.00 ? 382 THR A O    8  
ATOM   9436  C  CB   . THR A 1 75 ? 11.221  -2.941  -2.719  1.00 0.00 ? 382 THR A CB   8  
ATOM   9437  O  OG1  . THR A 1 75 ? 12.011  -2.128  -1.840  1.00 0.00 ? 382 THR A OG1  8  
ATOM   9438  C  CG2  . THR A 1 75 ? 11.332  -2.424  -4.142  1.00 0.00 ? 382 THR A CG2  8  
ATOM   9439  H  H    . THR A 1 75 ? 10.078  -4.241  -0.620  1.00 0.00 ? 382 THR A H    8  
ATOM   9440  H  HA   . THR A 1 75 ? 9.381   -1.930  -2.300  1.00 0.00 ? 382 THR A HA   8  
ATOM   9441  H  HB   . THR A 1 75 ? 11.591  -3.956  -2.689  1.00 0.00 ? 382 THR A HB   8  
ATOM   9442  H  HG1  . THR A 1 75 ? 11.538  -2.006  -1.010  1.00 0.00 ? 382 THR A HG1  8  
ATOM   9443  H  HG21 . THR A 1 75 ? 12.367  -2.438  -4.453  1.00 0.00 ? 382 THR A HG21 8  
ATOM   9444  H  HG22 . THR A 1 75 ? 10.957  -1.411  -4.188  1.00 0.00 ? 382 THR A HG22 8  
ATOM   9445  H  HG23 . THR A 1 75 ? 10.750  -3.053  -4.798  1.00 0.00 ? 382 THR A HG23 8  
ATOM   9446  N  N    . ALA A 1 76 ? 7.954   -3.246  -3.829  1.00 0.00 ? 383 ALA A N    8  
ATOM   9447  C  CA   . ALA A 1 76 ? 7.095   -4.001  -4.720  1.00 0.00 ? 383 ALA A CA   8  
ATOM   9448  C  C    . ALA A 1 76 ? 7.217   -3.485  -6.143  1.00 0.00 ? 383 ALA A C    8  
ATOM   9449  O  O    . ALA A 1 76 ? 7.529   -2.314  -6.364  1.00 0.00 ? 383 ALA A O    8  
ATOM   9450  C  CB   . ALA A 1 76 ? 5.654   -3.924  -4.247  1.00 0.00 ? 383 ALA A CB   8  
ATOM   9451  H  H    . ALA A 1 76 ? 7.816   -2.281  -3.735  1.00 0.00 ? 383 ALA A H    8  
ATOM   9452  H  HA   . ALA A 1 76 ? 7.408   -5.034  -4.691  1.00 0.00 ? 383 ALA A HA   8  
ATOM   9453  H  HB1  . ALA A 1 76 ? 5.038   -4.566  -4.860  1.00 0.00 ? 383 ALA A HB1  8  
ATOM   9454  H  HB2  . ALA A 1 76 ? 5.304   -2.905  -4.328  1.00 0.00 ? 383 ALA A HB2  8  
ATOM   9455  H  HB3  . ALA A 1 76 ? 5.595   -4.242  -3.218  1.00 0.00 ? 383 ALA A HB3  8  
ATOM   9456  N  N    . TYR A 1 77 ? 6.992   -4.363  -7.102  1.00 0.00 ? 384 TYR A N    8  
ATOM   9457  C  CA   . TYR A 1 77 ? 6.981   -3.973  -8.501  1.00 0.00 ? 384 TYR A CA   8  
ATOM   9458  C  C    . TYR A 1 77 ? 5.658   -4.399  -9.116  1.00 0.00 ? 384 TYR A C    8  
ATOM   9459  O  O    . TYR A 1 77 ? 5.145   -5.472  -8.805  1.00 0.00 ? 384 TYR A O    8  
ATOM   9460  C  CB   . TYR A 1 77 ? 8.158   -4.603  -9.261  1.00 0.00 ? 384 TYR A CB   8  
ATOM   9461  C  CG   . TYR A 1 77 ? 9.514   -4.305  -8.652  1.00 0.00 ? 384 TYR A CG   8  
ATOM   9462  C  CD1  . TYR A 1 77 ? 10.210  -3.133  -8.949  1.00 0.00 ? 384 TYR A CD1  8  
ATOM   9463  C  CD2  . TYR A 1 77 ? 10.101  -5.205  -7.769  1.00 0.00 ? 384 TYR A CD2  8  
ATOM   9464  C  CE1  . TYR A 1 77 ? 11.443  -2.879  -8.385  1.00 0.00 ? 384 TYR A CE1  8  
ATOM   9465  C  CE2  . TYR A 1 77 ? 11.335  -4.950  -7.201  1.00 0.00 ? 384 TYR A CE2  8  
ATOM   9466  C  CZ   . TYR A 1 77 ? 12.000  -3.786  -7.513  1.00 0.00 ? 384 TYR A CZ   8  
ATOM   9467  O  OH   . TYR A 1 77 ? 13.224  -3.517  -6.945  1.00 0.00 ? 384 TYR A OH   8  
ATOM   9468  H  H    . TYR A 1 77 ? 6.818   -5.301  -6.866  1.00 0.00 ? 384 TYR A H    8  
ATOM   9469  H  HA   . TYR A 1 77 ? 7.060   -2.897  -8.548  1.00 0.00 ? 384 TYR A HA   8  
ATOM   9470  H  HB2  . TYR A 1 77 ? 8.034   -5.682  -9.273  1.00 0.00 ? 384 TYR A HB2  8  
ATOM   9471  H  HB3  . TYR A 1 77 ? 8.162   -4.221  -10.282 1.00 0.00 ? 384 TYR A HB3  8  
ATOM   9472  H  HD1  . TYR A 1 77 ? 9.781   -2.407  -9.632  1.00 0.00 ? 384 TYR A HD1  8  
ATOM   9473  H  HD2  . TYR A 1 77 ? 9.578   -6.115  -7.526  1.00 0.00 ? 384 TYR A HD2  8  
ATOM   9474  H  HE1  . TYR A 1 77 ? 11.967  -1.968  -8.627  1.00 0.00 ? 384 TYR A HE1  8  
ATOM   9475  H  HE2  . TYR A 1 77 ? 11.772  -5.663  -6.518  1.00 0.00 ? 384 TYR A HE2  8  
ATOM   9476  H  HH   . TYR A 1 77 ? 13.801  -4.280  -7.056  1.00 0.00 ? 384 TYR A HH   8  
ATOM   9477  N  N    . CYS A 1 78 ? 5.098   -3.546  -9.968  1.00 0.00 ? 385 CYS A N    8  
ATOM   9478  C  CA   . CYS A 1 78 ? 3.811   -3.855  -10.588 1.00 0.00 ? 385 CYS A CA   8  
ATOM   9479  C  C    . CYS A 1 78 ? 3.943   -5.102  -11.457 1.00 0.00 ? 385 CYS A C    8  
ATOM   9480  O  O    . CYS A 1 78 ? 4.993   -5.341  -12.047 1.00 0.00 ? 385 CYS A O    8  
ATOM   9481  C  CB   . CYS A 1 78 ? 3.265   -2.658  -11.401 1.00 0.00 ? 385 CYS A CB   8  
ATOM   9482  S  SG   . CYS A 1 78 ? 4.384   -1.959  -12.649 1.00 0.00 ? 385 CYS A SG   8  
ATOM   9483  H  H    . CYS A 1 78 ? 5.555   -2.703  -10.169 1.00 0.00 ? 385 CYS A H    8  
ATOM   9484  H  HA   . CYS A 1 78 ? 3.118   -4.074  -9.791  1.00 0.00 ? 385 CYS A HA   8  
ATOM   9485  H  HB2  . CYS A 1 78 ? 2.371   -2.973  -11.917 1.00 0.00 ? 385 CYS A HB2  8  
ATOM   9486  H  HB3  . CYS A 1 78 ? 3.007   -1.866  -10.712 1.00 0.00 ? 385 CYS A HB3  8  
ATOM   9487  N  N    . ASP A 1 79 ? 2.884   -5.903  -11.502 1.00 0.00 ? 386 ASP A N    8  
ATOM   9488  C  CA   . ASP A 1 79 ? 2.926   -7.198  -12.189 1.00 0.00 ? 386 ASP A CA   8  
ATOM   9489  C  C    . ASP A 1 79 ? 3.266   -7.047  -13.673 1.00 0.00 ? 386 ASP A C    8  
ATOM   9490  O  O    . ASP A 1 79 ? 3.804   -7.964  -14.293 1.00 0.00 ? 386 ASP A O    8  
ATOM   9491  C  CB   . ASP A 1 79 ? 1.597   -7.948  -12.013 1.00 0.00 ? 386 ASP A CB   8  
ATOM   9492  C  CG   . ASP A 1 79 ? 0.454   -7.357  -12.816 1.00 0.00 ? 386 ASP A CG   8  
ATOM   9493  O  OD1  . ASP A 1 79 ? -0.008  -6.242  -12.484 1.00 0.00 ? 386 ASP A OD1  8  
ATOM   9494  O  OD2  . ASP A 1 79 ? -0.016  -8.025  -13.760 1.00 0.00 ? 386 ASP A OD2  8  
ATOM   9495  H  H    . ASP A 1 79 ? 2.055   -5.627  -11.051 1.00 0.00 ? 386 ASP A H    8  
ATOM   9496  H  HA   . ASP A 1 79 ? 3.709   -7.779  -11.723 1.00 0.00 ? 386 ASP A HA   8  
ATOM   9497  H  HB2  . ASP A 1 79 ? 1.735   -8.979  -12.335 1.00 0.00 ? 386 ASP A HB2  8  
ATOM   9498  H  HB3  . ASP A 1 79 ? 1.320   -7.923  -10.957 1.00 0.00 ? 386 ASP A HB3  8  
ATOM   9499  N  N    . VAL A 1 80 ? 2.983   -5.878  -14.231 1.00 0.00 ? 387 VAL A N    8  
ATOM   9500  C  CA   . VAL A 1 80 ? 3.309   -5.588  -15.624 1.00 0.00 ? 387 VAL A CA   8  
ATOM   9501  C  C    . VAL A 1 80 ? 4.710   -4.967  -15.729 1.00 0.00 ? 387 VAL A C    8  
ATOM   9502  O  O    . VAL A 1 80 ? 5.088   -4.368  -16.733 1.00 0.00 ? 387 VAL A O    8  
ATOM   9503  C  CB   . VAL A 1 80 ? 2.240   -4.663  -16.247 1.00 0.00 ? 387 VAL A CB   8  
ATOM   9504  C  CG1  . VAL A 1 80 ? 2.239   -3.293  -15.580 1.00 0.00 ? 387 VAL A CG1  8  
ATOM   9505  C  CG2  . VAL A 1 80 ? 2.401   -4.535  -17.758 1.00 0.00 ? 387 VAL A CG2  8  
ATOM   9506  H  H    . VAL A 1 80 ? 2.532   -5.194  -13.694 1.00 0.00 ? 387 VAL A H    8  
ATOM   9507  H  HA   . VAL A 1 80 ? 3.303   -6.524  -16.165 1.00 0.00 ? 387 VAL A HA   8  
ATOM   9508  H  HB   . VAL A 1 80 ? 1.285   -5.121  -16.058 1.00 0.00 ? 387 VAL A HB   8  
ATOM   9509  H  HG11 . VAL A 1 80 ? 1.488   -2.669  -16.040 1.00 0.00 ? 387 VAL A HG11 8  
ATOM   9510  H  HG12 . VAL A 1 80 ? 3.210   -2.835  -15.698 1.00 0.00 ? 387 VAL A HG12 8  
ATOM   9511  H  HG13 . VAL A 1 80 ? 2.020   -3.405  -14.529 1.00 0.00 ? 387 VAL A HG13 8  
ATOM   9512  H  HG21 . VAL A 1 80 ? 1.672   -3.837  -18.141 1.00 0.00 ? 387 VAL A HG21 8  
ATOM   9513  H  HG22 . VAL A 1 80 ? 2.250   -5.500  -18.218 1.00 0.00 ? 387 VAL A HG22 8  
ATOM   9514  H  HG23 . VAL A 1 80 ? 3.395   -4.180  -17.985 1.00 0.00 ? 387 VAL A HG23 8  
ATOM   9515  N  N    . HIS A 1 81 ? 5.485   -5.123  -14.673 1.00 0.00 ? 388 HIS A N    8  
ATOM   9516  C  CA   . HIS A 1 81 ? 6.871   -4.689  -14.679 1.00 0.00 ? 388 HIS A CA   8  
ATOM   9517  C  C    . HIS A 1 81 ? 7.782   -5.905  -14.631 1.00 0.00 ? 388 HIS A C    8  
ATOM   9518  O  O    . HIS A 1 81 ? 8.981   -5.808  -14.881 1.00 0.00 ? 388 HIS A O    8  
ATOM   9519  C  CB   . HIS A 1 81 ? 7.152   -3.781  -13.477 1.00 0.00 ? 388 HIS A CB   8  
ATOM   9520  C  CG   . HIS A 1 81 ? 8.333   -2.878  -13.654 1.00 0.00 ? 388 HIS A CG   8  
ATOM   9521  N  ND1  . HIS A 1 81 ? 8.311   -1.542  -13.298 1.00 0.00 ? 388 HIS A ND1  8  
ATOM   9522  C  CD2  . HIS A 1 81 ? 9.569   -3.112  -14.151 1.00 0.00 ? 388 HIS A CD2  8  
ATOM   9523  C  CE1  . HIS A 1 81 ? 9.493   -1.004  -13.576 1.00 0.00 ? 388 HIS A CE1  8  
ATOM   9524  N  NE2  . HIS A 1 81 ? 10.267  -1.936  -14.093 1.00 0.00 ? 388 HIS A NE2  8  
ATOM   9525  H  H    . HIS A 1 81 ? 5.114   -5.538  -13.860 1.00 0.00 ? 388 HIS A H    8  
ATOM   9526  H  HA   . HIS A 1 81 ? 7.052   -4.144  -15.593 1.00 0.00 ? 388 HIS A HA   8  
ATOM   9527  H  HB2  . HIS A 1 81 ? 6.288   -3.161  -13.295 1.00 0.00 ? 388 HIS A HB2  8  
ATOM   9528  H  HB3  . HIS A 1 81 ? 7.334   -4.396  -12.609 1.00 0.00 ? 388 HIS A HB3  8  
ATOM   9529  H  HD2  . HIS A 1 81 ? 9.937   -4.056  -14.528 1.00 0.00 ? 388 HIS A HD2  8  
ATOM   9530  H  HE1  . HIS A 1 81 ? 9.774   0.024   -13.403 1.00 0.00 ? 388 HIS A HE1  8  
ATOM   9531  H  HE2  . HIS A 1 81 ? 11.115  -1.765  -14.566 1.00 0.00 ? 388 HIS A HE2  8  
ATOM   9532  N  N    . THR A 1 82 ? 7.206   -7.048  -14.305 1.00 0.00 ? 389 THR A N    8  
ATOM   9533  C  CA   . THR A 1 82 ? 7.983   -8.256  -14.169 1.00 0.00 ? 389 THR A CA   8  
ATOM   9534  C  C    . THR A 1 82 ? 8.224   -8.901  -15.567 1.00 0.00 ? 389 THR A C    8  
ATOM   9535  O  O    . THR A 1 82 ? 9.177   -8.486  -16.233 1.00 0.00 ? 389 THR A O    8  
ATOM   9536  C  CB   . THR A 1 82 ? 7.332   -9.181  -13.116 1.00 0.00 ? 389 THR A CB   8  
ATOM   9537  O  OG1  . THR A 1 82 ? 6.963   -8.402  -11.970 1.00 0.00 ? 389 THR A OG1  8  
ATOM   9538  C  CG2  . THR A 1 82 ? 8.287   -10.282 -12.674 1.00 0.00 ? 389 THR A CG2  8  
ATOM   9539  H  H    . THR A 1 82 ? 6.240   -7.080  -14.149 1.00 0.00 ? 389 THR A H    8  
ATOM   9540  H  HA   . THR A 1 82 ? 8.948   -7.955  -13.782 1.00 0.00 ? 389 THR A HA   8  
ATOM   9541  H  HB   . THR A 1 82 ? 6.443   -9.618  -13.534 1.00 0.00 ? 389 THR A HB   8  
ATOM   9542  H  HG1  . THR A 1 82 ? 6.119   -8.720  -11.630 1.00 0.00 ? 389 THR A HG1  8  
ATOM   9543  H  HG21 . THR A 1 82 ? 8.657   -10.810 -13.539 1.00 0.00 ? 389 THR A HG21 8  
ATOM   9544  H  HG22 . THR A 1 82 ? 7.764   -10.971 -12.027 1.00 0.00 ? 389 THR A HG22 8  
ATOM   9545  H  HG23 . THR A 1 82 ? 9.116   -9.846  -12.137 1.00 0.00 ? 389 THR A HG23 8  
ATOM   9546  N  N    . PRO A 1 83 ? 7.439   -9.901  -16.083 1.00 0.00 ? 390 PRO A N    8  
ATOM   9547  C  CA   . PRO A 1 83 ? 7.541   -10.294 -17.484 1.00 0.00 ? 390 PRO A CA   8  
ATOM   9548  C  C    . PRO A 1 83 ? 6.249   -10.111 -18.309 1.00 0.00 ? 390 PRO A C    8  
ATOM   9549  O  O    . PRO A 1 83 ? 5.663   -11.103 -18.757 1.00 0.00 ? 390 PRO A O    8  
ATOM   9550  C  CB   . PRO A 1 83 ? 7.806   -11.779 -17.301 1.00 0.00 ? 390 PRO A CB   8  
ATOM   9551  C  CG   . PRO A 1 83 ? 6.898   -12.166 -16.164 1.00 0.00 ? 390 PRO A CG   8  
ATOM   9552  C  CD   . PRO A 1 83 ? 6.593   -10.890 -15.394 1.00 0.00 ? 390 PRO A CD   8  
ATOM   9553  H  HA   . PRO A 1 83 ? 8.376   -9.828  -17.990 1.00 0.00 ? 390 PRO A HA   8  
ATOM   9554  H  HB2  . PRO A 1 83 ? 7.562   -12.309 -18.210 1.00 0.00 ? 390 PRO A HB2  8  
ATOM   9555  H  HB3  . PRO A 1 83 ? 8.843   -11.937 -17.049 1.00 0.00 ? 390 PRO A HB3  8  
ATOM   9556  H  HG2  . PRO A 1 83 ? 5.986   -12.594 -16.553 1.00 0.00 ? 390 PRO A HG2  8  
ATOM   9557  H  HG3  . PRO A 1 83 ? 7.399   -12.877 -15.523 1.00 0.00 ? 390 PRO A HG3  8  
ATOM   9558  H  HD2  . PRO A 1 83 ? 5.546   -10.635 -15.470 1.00 0.00 ? 390 PRO A HD2  8  
ATOM   9559  H  HD3  . PRO A 1 83 ? 6.889   -11.011 -14.369 1.00 0.00 ? 390 PRO A HD3  8  
ATOM   9560  N  N    . PRO A 1 84 ? 5.764   -8.870  -18.531 1.00 0.00 ? 391 PRO A N    8  
ATOM   9561  C  CA   . PRO A 1 84 ? 4.695   -8.618  -19.511 1.00 0.00 ? 391 PRO A CA   8  
ATOM   9562  C  C    . PRO A 1 84 ? 5.137   -8.951  -20.938 1.00 0.00 ? 391 PRO A C    8  
ATOM   9563  O  O    . PRO A 1 84 ? 6.122   -9.667  -21.147 1.00 0.00 ? 391 PRO A O    8  
ATOM   9564  C  CB   . PRO A 1 84 ? 4.442   -7.113  -19.383 1.00 0.00 ? 391 PRO A CB   8  
ATOM   9565  C  CG   . PRO A 1 84 ? 5.703   -6.581  -18.805 1.00 0.00 ? 391 PRO A CG   8  
ATOM   9566  C  CD   . PRO A 1 84 ? 6.151   -7.631  -17.837 1.00 0.00 ? 391 PRO A CD   8  
ATOM   9567  H  HA   . PRO A 1 84 ? 3.795   -9.165  -19.271 1.00 0.00 ? 391 PRO A HA   8  
ATOM   9568  H  HB2  . PRO A 1 84 ? 4.243   -6.695  -20.359 1.00 0.00 ? 391 PRO A HB2  8  
ATOM   9569  H  HB3  . PRO A 1 84 ? 3.602   -6.939  -18.729 1.00 0.00 ? 391 PRO A HB3  8  
ATOM   9570  H  HG2  . PRO A 1 84 ? 6.439   -6.445  -19.584 1.00 0.00 ? 391 PRO A HG2  8  
ATOM   9571  H  HG3  . PRO A 1 84 ? 5.514   -5.649  -18.291 1.00 0.00 ? 391 PRO A HG3  8  
ATOM   9572  H  HD2  . PRO A 1 84 ? 7.218   -7.581  -17.679 1.00 0.00 ? 391 PRO A HD2  8  
ATOM   9573  H  HD3  . PRO A 1 84 ? 5.610   -7.528  -16.901 1.00 0.00 ? 391 PRO A HD3  8  
ATOM   9574  N  N    . GLY A 1 85 ? 4.412   -8.425  -21.916 1.00 0.00 ? 392 GLY A N    8  
ATOM   9575  C  CA   . GLY A 1 85 ? 4.760   -8.654  -23.304 1.00 0.00 ? 392 GLY A CA   8  
ATOM   9576  C  C    . GLY A 1 85 ? 6.159   -8.177  -23.632 1.00 0.00 ? 392 GLY A C    8  
ATOM   9577  O  O    . GLY A 1 85 ? 7.005   -8.959  -24.066 1.00 0.00 ? 392 GLY A O    8  
ATOM   9578  H  H    . GLY A 1 85 ? 3.627   -7.879  -21.694 1.00 0.00 ? 392 GLY A H    8  
ATOM   9579  H  HA2  . GLY A 1 85 ? 4.693   -9.710  -23.512 1.00 0.00 ? 392 GLY A HA2  8  
ATOM   9580  H  HA3  . GLY A 1 85 ? 4.056   -8.130  -23.931 1.00 0.00 ? 392 GLY A HA3  8  
ATOM   9581  N  N    . SER A 1 86 ? 6.412   -6.900  -23.411 1.00 0.00 ? 393 SER A N    8  
ATOM   9582  C  CA   . SER A 1 86 ? 7.716   -6.328  -23.690 1.00 0.00 ? 393 SER A CA   8  
ATOM   9583  C  C    . SER A 1 86 ? 7.999   -5.158  -22.754 1.00 0.00 ? 393 SER A C    8  
ATOM   9584  O  O    . SER A 1 86 ? 7.462   -4.065  -22.934 1.00 0.00 ? 393 SER A O    8  
ATOM   9585  C  CB   . SER A 1 86 ? 7.786   -5.875  -25.154 1.00 0.00 ? 393 SER A CB   8  
ATOM   9586  O  OG   . SER A 1 86 ? 9.067   -5.362  -25.490 1.00 0.00 ? 393 SER A OG   8  
ATOM   9587  H  H    . SER A 1 86 ? 5.700   -6.322  -23.060 1.00 0.00 ? 393 SER A H    8  
ATOM   9588  H  HA   . SER A 1 86 ? 8.457   -7.095  -23.524 1.00 0.00 ? 393 SER A HA   8  
ATOM   9589  H  HB2  . SER A 1 86 ? 7.577   -6.717  -25.796 1.00 0.00 ? 393 SER A HB2  8  
ATOM   9590  H  HB3  . SER A 1 86 ? 7.049   -5.104  -25.324 1.00 0.00 ? 393 SER A HB3  8  
ATOM   9591  H  HG   . SER A 1 86 ? 9.751   -5.876  -25.034 1.00 0.00 ? 393 SER A HG   8  
ATOM   9592  N  N    . THR A 1 87 ? 8.799   -5.401  -21.723 1.00 0.00 ? 394 THR A N    8  
ATOM   9593  C  CA   . THR A 1 87 ? 9.280   -4.321  -20.881 1.00 0.00 ? 394 THR A CA   8  
ATOM   9594  C  C    . THR A 1 87 ? 10.462  -3.631  -21.558 1.00 0.00 ? 394 THR A C    8  
ATOM   9595  O  O    . THR A 1 87 ? 10.261  -2.562  -22.171 1.00 0.00 ? 394 THR A O    8  
ATOM   9596  C  CB   . THR A 1 87 ? 9.704   -4.833  -19.493 1.00 0.00 ? 394 THR A CB   8  
ATOM   9597  O  OG1  . THR A 1 87 ? 8.666   -5.649  -18.942 1.00 0.00 ? 394 THR A OG1  8  
ATOM   9598  C  CG2  . THR A 1 87 ? 9.987   -3.672  -18.550 1.00 0.00 ? 394 THR A CG2  8  
ATOM   9599  O  OXT  . THR A 1 87 ? 11.579  -4.187  -21.509 1.00 0.00 ? 394 THR A OXT  8  
ATOM   9600  H  H    . THR A 1 87 ? 9.059   -6.328  -21.514 1.00 0.00 ? 394 THR A H    8  
ATOM   9601  H  HA   . THR A 1 87 ? 8.478   -3.608  -20.756 1.00 0.00 ? 394 THR A HA   8  
ATOM   9602  H  HB   . THR A 1 87 ? 10.604  -5.422  -19.599 1.00 0.00 ? 394 THR A HB   8  
ATOM   9603  H  HG1  . THR A 1 87 ? 7.813   -5.318  -19.237 1.00 0.00 ? 394 THR A HG1  8  
ATOM   9604  H  HG21 . THR A 1 87 ? 10.243  -4.056  -17.574 1.00 0.00 ? 394 THR A HG21 8  
ATOM   9605  H  HG22 . THR A 1 87 ? 9.107   -3.050  -18.472 1.00 0.00 ? 394 THR A HG22 8  
ATOM   9606  H  HG23 . THR A 1 87 ? 10.809  -3.088  -18.934 1.00 0.00 ? 394 THR A HG23 8  
HETATM 9607  ZN ZN   . ZN  B 2 .  ? -6.623  -0.781  -5.794  1.00 0.00 ? 401 ZN  A ZN   8  
HETATM 9608  ZN ZN   . ZN  C 2 .  ? 6.396   -0.703  -12.749 1.00 0.00 ? 402 ZN  A ZN   8  
ATOM   9609  N  N    . MET A 1 9  ? -15.463 9.552   9.077   1.00 0.00 ? 316 MET A N    9  
ATOM   9610  C  CA   . MET A 1 9  ? -14.979 9.424   10.469  1.00 0.00 ? 316 MET A CA   9  
ATOM   9611  C  C    . MET A 1 9  ? -13.610 8.751   10.499  1.00 0.00 ? 316 MET A C    9  
ATOM   9612  O  O    . MET A 1 9  ? -12.593 9.407   10.720  1.00 0.00 ? 316 MET A O    9  
ATOM   9613  C  CB   . MET A 1 9  ? -15.983 8.624   11.308  1.00 0.00 ? 316 MET A CB   9  
ATOM   9614  C  CG   . MET A 1 9  ? -15.606 8.471   12.780  1.00 0.00 ? 316 MET A CG   9  
ATOM   9615  S  SD   . MET A 1 9  ? -15.585 10.038  13.679  1.00 0.00 ? 316 MET A SD   9  
ATOM   9616  C  CE   . MET A 1 9  ? -13.869 10.532  13.514  1.00 0.00 ? 316 MET A CE   9  
ATOM   9617  H  H    . MET A 1 9  ? -16.384 10.031  9.059   1.00 0.00 ? 316 MET A H    9  
ATOM   9618  H  HA   . MET A 1 9  ? -14.885 10.417  10.882  1.00 0.00 ? 316 MET A HA   9  
ATOM   9619  H  HB2  . MET A 1 9  ? -16.940 9.118   11.261  1.00 0.00 ? 316 MET A HB2  9  
ATOM   9620  H  HB3  . MET A 1 9  ? -16.079 7.637   10.881  1.00 0.00 ? 316 MET A HB3  9  
ATOM   9621  H  HG2  . MET A 1 9  ? -16.323 7.816   13.253  1.00 0.00 ? 316 MET A HG2  9  
ATOM   9622  H  HG3  . MET A 1 9  ? -14.624 8.025   12.839  1.00 0.00 ? 316 MET A HG3  9  
ATOM   9623  H  HE1  . MET A 1 9  ? -13.613 10.605  12.468  1.00 0.00 ? 316 MET A HE1  9  
ATOM   9624  H  HE2  . MET A 1 9  ? -13.236 9.797   13.988  1.00 0.00 ? 316 MET A HE2  9  
ATOM   9625  H  HE3  . MET A 1 9  ? -13.723 11.491  13.988  1.00 0.00 ? 316 MET A HE3  9  
ATOM   9626  N  N    . ASN A 1 10 ? -13.581 7.448   10.257  1.00 0.00 ? 317 ASN A N    9  
ATOM   9627  C  CA   . ASN A 1 10 ? -12.341 6.692   10.320  1.00 0.00 ? 317 ASN A CA   9  
ATOM   9628  C  C    . ASN A 1 10 ? -11.946 6.190   8.936   1.00 0.00 ? 317 ASN A C    9  
ATOM   9629  O  O    . ASN A 1 10 ? -12.429 5.161   8.462   1.00 0.00 ? 317 ASN A O    9  
ATOM   9630  C  CB   . ASN A 1 10 ? -12.446 5.526   11.320  1.00 0.00 ? 317 ASN A CB   9  
ATOM   9631  C  CG   . ASN A 1 10 ? -13.600 4.570   11.042  1.00 0.00 ? 317 ASN A CG   9  
ATOM   9632  O  OD1  . ASN A 1 10 ? -14.658 4.965   10.541  1.00 0.00 ? 317 ASN A OD1  9  
ATOM   9633  N  ND2  . ASN A 1 10 ? -13.406 3.303   11.374  1.00 0.00 ? 317 ASN A ND2  9  
ATOM   9634  H  H    . ASN A 1 10 ? -14.412 6.980   10.017  1.00 0.00 ? 317 ASN A H    9  
ATOM   9635  H  HA   . ASN A 1 10 ? -11.572 7.368   10.662  1.00 0.00 ? 317 ASN A HA   9  
ATOM   9636  H  HB2  . ASN A 1 10 ? -11.529 4.957   11.290  1.00 0.00 ? 317 ASN A HB2  9  
ATOM   9637  H  HB3  . ASN A 1 10 ? -12.574 5.930   12.314  1.00 0.00 ? 317 ASN A HB3  9  
ATOM   9638  H  HD21 . ASN A 1 10 ? -12.546 3.056   11.775  1.00 0.00 ? 317 ASN A HD21 9  
ATOM   9639  H  HD22 . ASN A 1 10 ? -14.129 2.664   11.207  1.00 0.00 ? 317 ASN A HD22 9  
ATOM   9640  N  N    . ILE A 1 11 ? -11.086 6.948   8.276   1.00 0.00 ? 318 ILE A N    9  
ATOM   9641  C  CA   . ILE A 1 11 ? -10.611 6.592   6.951   1.00 0.00 ? 318 ILE A CA   9  
ATOM   9642  C  C    . ILE A 1 11 ? -9.098  6.735   6.868   1.00 0.00 ? 318 ILE A C    9  
ATOM   9643  O  O    . ILE A 1 11 ? -8.521  7.629   7.485   1.00 0.00 ? 318 ILE A O    9  
ATOM   9644  C  CB   . ILE A 1 11 ? -11.299 7.429   5.834   1.00 0.00 ? 318 ILE A CB   9  
ATOM   9645  C  CG1  . ILE A 1 11 ? -11.419 8.913   6.221   1.00 0.00 ? 318 ILE A CG1  9  
ATOM   9646  C  CG2  . ILE A 1 11 ? -12.670 6.856   5.508   1.00 0.00 ? 318 ILE A CG2  9  
ATOM   9647  C  CD1  . ILE A 1 11 ? -10.171 9.728   5.950   1.00 0.00 ? 318 ILE A CD1  9  
ATOM   9648  H  H    . ILE A 1 11 ? -10.748 7.769   8.697   1.00 0.00 ? 318 ILE A H    9  
ATOM   9649  H  HA   . ILE A 1 11 ? -10.862 5.554   6.791   1.00 0.00 ? 318 ILE A HA   9  
ATOM   9650  H  HB   . ILE A 1 11 ? -10.692 7.350   4.944   1.00 0.00 ? 318 ILE A HB   9  
ATOM   9651  H  HG12 . ILE A 1 11 ? -12.229 9.357   5.662   1.00 0.00 ? 318 ILE A HG12 9  
ATOM   9652  H  HG13 . ILE A 1 11 ? -11.638 8.983   7.276   1.00 0.00 ? 318 ILE A HG13 9  
ATOM   9653  H  HG21 . ILE A 1 11 ? -13.141 7.462   4.748   1.00 0.00 ? 318 ILE A HG21 9  
ATOM   9654  H  HG22 . ILE A 1 11 ? -13.281 6.856   6.398   1.00 0.00 ? 318 ILE A HG22 9  
ATOM   9655  H  HG23 . ILE A 1 11 ? -12.562 5.845   5.145   1.00 0.00 ? 318 ILE A HG23 9  
ATOM   9656  H  HD11 . ILE A 1 11 ? -9.349  9.327   6.523   1.00 0.00 ? 318 ILE A HD11 9  
ATOM   9657  H  HD12 . ILE A 1 11 ? -10.342 10.756  6.237   1.00 0.00 ? 318 ILE A HD12 9  
ATOM   9658  H  HD13 . ILE A 1 11 ? -9.935  9.682   4.898   1.00 0.00 ? 318 ILE A HD13 9  
ATOM   9659  N  N    . PRO A 1 12 ? -8.430  5.834   6.138   1.00 0.00 ? 319 PRO A N    9  
ATOM   9660  C  CA   . PRO A 1 12 ? -6.979  5.885   5.976   1.00 0.00 ? 319 PRO A CA   9  
ATOM   9661  C  C    . PRO A 1 12 ? -6.540  7.030   5.063   1.00 0.00 ? 319 PRO A C    9  
ATOM   9662  O  O    . PRO A 1 12 ? -6.849  7.036   3.869   1.00 0.00 ? 319 PRO A O    9  
ATOM   9663  C  CB   . PRO A 1 12 ? -6.640  4.531   5.349   1.00 0.00 ? 319 PRO A CB   9  
ATOM   9664  C  CG   . PRO A 1 12 ? -7.886  4.107   4.650   1.00 0.00 ? 319 PRO A CG   9  
ATOM   9665  C  CD   . PRO A 1 12 ? -9.033  4.693   5.429   1.00 0.00 ? 319 PRO A CD   9  
ATOM   9666  H  HA   . PRO A 1 12 ? -6.481  5.976   6.928   1.00 0.00 ? 319 PRO A HA   9  
ATOM   9667  H  HB2  . PRO A 1 12 ? -5.819  4.651   4.655   1.00 0.00 ? 319 PRO A HB2  9  
ATOM   9668  H  HB3  . PRO A 1 12 ? -6.365  3.832   6.124   1.00 0.00 ? 319 PRO A HB3  9  
ATOM   9669  H  HG2  . PRO A 1 12 ? -7.887  4.489   3.640   1.00 0.00 ? 319 PRO A HG2  9  
ATOM   9670  H  HG3  . PRO A 1 12 ? -7.953  3.030   4.642   1.00 0.00 ? 319 PRO A HG3  9  
ATOM   9671  H  HD2  . PRO A 1 12 ? -9.812  5.027   4.761   1.00 0.00 ? 319 PRO A HD2  9  
ATOM   9672  H  HD3  . PRO A 1 12 ? -9.420  3.967   6.130   1.00 0.00 ? 319 PRO A HD3  9  
ATOM   9673  N  N    . PRO A 1 13 ? -5.838  8.030   5.618   1.00 0.00 ? 320 PRO A N    9  
ATOM   9674  C  CA   . PRO A 1 13 ? -5.310  9.148   4.838   1.00 0.00 ? 320 PRO A CA   9  
ATOM   9675  C  C    . PRO A 1 13 ? -4.225  8.699   3.864   1.00 0.00 ? 320 PRO A C    9  
ATOM   9676  O  O    . PRO A 1 13 ? -3.057  8.574   4.229   1.00 0.00 ? 320 PRO A O    9  
ATOM   9677  C  CB   . PRO A 1 13 ? -4.737  10.094  5.898   1.00 0.00 ? 320 PRO A CB   9  
ATOM   9678  C  CG   . PRO A 1 13 ? -4.464  9.224   7.078   1.00 0.00 ? 320 PRO A CG   9  
ATOM   9679  C  CD   . PRO A 1 13 ? -5.520  8.157   7.052   1.00 0.00 ? 320 PRO A CD   9  
ATOM   9680  H  HA   . PRO A 1 13 ? -6.096  9.650   4.290   1.00 0.00 ? 320 PRO A HA   9  
ATOM   9681  H  HB2  . PRO A 1 13 ? -3.833  10.552  5.524   1.00 0.00 ? 320 PRO A HB2  9  
ATOM   9682  H  HB3  . PRO A 1 13 ? -5.463  10.858  6.133   1.00 0.00 ? 320 PRO A HB3  9  
ATOM   9683  H  HG2  . PRO A 1 13 ? -3.482  8.782   6.991   1.00 0.00 ? 320 PRO A HG2  9  
ATOM   9684  H  HG3  . PRO A 1 13 ? -4.540  9.802   7.986   1.00 0.00 ? 320 PRO A HG3  9  
ATOM   9685  H  HD2  . PRO A 1 13 ? -5.129  7.225   7.446   1.00 0.00 ? 320 PRO A HD2  9  
ATOM   9686  H  HD3  . PRO A 1 13 ? -6.392  8.476   7.612   1.00 0.00 ? 320 PRO A HD3  9  
ATOM   9687  N  N    . ALA A 1 14 ? -4.627  8.433   2.629   1.00 0.00 ? 321 ALA A N    9  
ATOM   9688  C  CA   . ALA A 1 14 ? -3.714  7.978   1.602   1.00 0.00 ? 321 ALA A CA   9  
ATOM   9689  C  C    . ALA A 1 14 ? -4.235  8.445   0.263   1.00 0.00 ? 321 ALA A C    9  
ATOM   9690  O  O    . ALA A 1 14 ? -3.932  7.872   -0.782  1.00 0.00 ? 321 ALA A O    9  
ATOM   9691  C  CB   . ALA A 1 14 ? -3.575  6.462   1.635   1.00 0.00 ? 321 ALA A CB   9  
ATOM   9692  H  H    . ALA A 1 14 ? -5.575  8.549   2.395   1.00 0.00 ? 321 ALA A H    9  
ATOM   9693  H  HA   . ALA A 1 14 ? -2.747  8.422   1.784   1.00 0.00 ? 321 ALA A HA   9  
ATOM   9694  H  HB1  . ALA A 1 14 ? -3.193  6.156   2.598   1.00 0.00 ? 321 ALA A HB1  9  
ATOM   9695  H  HB2  . ALA A 1 14 ? -2.892  6.145   0.860   1.00 0.00 ? 321 ALA A HB2  9  
ATOM   9696  H  HB3  . ALA A 1 14 ? -4.540  6.007   1.471   1.00 0.00 ? 321 ALA A HB3  9  
ATOM   9697  N  N    . ARG A 1 15 ? -5.021  9.514   0.310   1.00 0.00 ? 322 ARG A N    9  
ATOM   9698  C  CA   . ARG A 1 15 ? -5.622  10.061  -0.889  1.00 0.00 ? 322 ARG A CA   9  
ATOM   9699  C  C    . ARG A 1 15 ? -4.691  11.084  -1.533  1.00 0.00 ? 322 ARG A C    9  
ATOM   9700  O  O    . ARG A 1 15 ? -5.108  11.884  -2.371  1.00 0.00 ? 322 ARG A O    9  
ATOM   9701  C  CB   . ARG A 1 15 ? -6.984  10.695  -0.587  1.00 0.00 ? 322 ARG A CB   9  
ATOM   9702  C  CG   . ARG A 1 15 ? -6.946  11.798  0.460   1.00 0.00 ? 322 ARG A CG   9  
ATOM   9703  C  CD   . ARG A 1 15 ? -8.296  12.486  0.591   1.00 0.00 ? 322 ARG A CD   9  
ATOM   9704  N  NE   . ARG A 1 15 ? -9.377  11.534  0.852   1.00 0.00 ? 322 ARG A NE   9  
ATOM   9705  C  CZ   . ARG A 1 15 ? -10.666 11.868  0.918   1.00 0.00 ? 322 ARG A CZ   9  
ATOM   9706  N  NH1  . ARG A 1 15 ? -11.042 13.129  0.756   1.00 0.00 ? 322 ARG A NH1  9  
ATOM   9707  N  NH2  . ARG A 1 15 ? -11.582 10.937  1.144   1.00 0.00 ? 322 ARG A NH2  9  
ATOM   9708  H  H    . ARG A 1 15 ? -5.182  9.949   1.172   1.00 0.00 ? 322 ARG A H    9  
ATOM   9709  H  HA   . ARG A 1 15 ? -5.762  9.239   -1.565  1.00 0.00 ? 322 ARG A HA   9  
ATOM   9710  H  HB2  . ARG A 1 15 ? -7.379  11.115  -1.500  1.00 0.00 ? 322 ARG A HB2  9  
ATOM   9711  H  HB3  . ARG A 1 15 ? -7.656  9.925   -0.239  1.00 0.00 ? 322 ARG A HB3  9  
ATOM   9712  H  HG2  . ARG A 1 15 ? -6.679  11.366  1.414   1.00 0.00 ? 322 ARG A HG2  9  
ATOM   9713  H  HG3  . ARG A 1 15 ? -6.204  12.528  0.172   1.00 0.00 ? 322 ARG A HG3  9  
ATOM   9714  H  HD2  . ARG A 1 15 ? -8.247  13.191  1.407   1.00 0.00 ? 322 ARG A HD2  9  
ATOM   9715  H  HD3  . ARG A 1 15 ? -8.509  13.014  -0.327  1.00 0.00 ? 322 ARG A HD3  9  
ATOM   9716  H  HE   . ARG A 1 15 ? -9.128  10.589  0.978   1.00 0.00 ? 322 ARG A HE   9  
ATOM   9717  H  HH11 . ARG A 1 15 ? -10.360 13.843  0.585   1.00 0.00 ? 322 ARG A HH11 9  
ATOM   9718  H  HH12 . ARG A 1 15 ? -12.013 13.374  0.805   1.00 0.00 ? 322 ARG A HH12 9  
ATOM   9719  H  HH21 . ARG A 1 15 ? -11.309 9.978   1.267   1.00 0.00 ? 322 ARG A HH21 9  
ATOM   9720  H  HH22 . ARG A 1 15 ? -12.554 11.185  1.190   1.00 0.00 ? 322 ARG A HH22 9  
ATOM   9721  N  N    . TRP A 1 16 ? -3.424  11.033  -1.140  1.00 0.00 ? 323 TRP A N    9  
ATOM   9722  C  CA   . TRP A 1 16 ? -2.414  11.960  -1.632  1.00 0.00 ? 323 TRP A CA   9  
ATOM   9723  C  C    . TRP A 1 16 ? -1.925  11.560  -3.023  1.00 0.00 ? 323 TRP A C    9  
ATOM   9724  O  O    . TRP A 1 16 ? -0.747  11.248  -3.210  1.00 0.00 ? 323 TRP A O    9  
ATOM   9725  C  CB   . TRP A 1 16 ? -1.234  12.034  -0.648  1.00 0.00 ? 323 TRP A CB   9  
ATOM   9726  C  CG   . TRP A 1 16 ? -0.798  10.698  -0.100  1.00 0.00 ? 323 TRP A CG   9  
ATOM   9727  C  CD1  . TRP A 1 16 ? -0.563  9.545   -0.800  1.00 0.00 ? 323 TRP A CD1  9  
ATOM   9728  C  CD2  . TRP A 1 16 ? -0.526  10.389  1.272   1.00 0.00 ? 323 TRP A CD2  9  
ATOM   9729  N  NE1  . TRP A 1 16 ? -0.180  8.541   0.054   1.00 0.00 ? 323 TRP A NE1  9  
ATOM   9730  C  CE2  . TRP A 1 16 ? -0.147  9.035   1.331   1.00 0.00 ? 323 TRP A CE2  9  
ATOM   9731  C  CE3  . TRP A 1 16 ? -0.578  11.126  2.458   1.00 0.00 ? 323 TRP A CE3  9  
ATOM   9732  C  CZ2  . TRP A 1 16 ? 0.188   8.407   2.528   1.00 0.00 ? 323 TRP A CZ2  9  
ATOM   9733  C  CZ3  . TRP A 1 16 ? -0.241  10.501  3.644   1.00 0.00 ? 323 TRP A CZ3  9  
ATOM   9734  C  CH2  . TRP A 1 16 ? 0.134   9.153   3.672   1.00 0.00 ? 323 TRP A CH2  9  
ATOM   9735  H  H    . TRP A 1 16 ? -3.152  10.333  -0.511  1.00 0.00 ? 323 TRP A H    9  
ATOM   9736  H  HA   . TRP A 1 16 ? -2.873  12.935  -1.697  1.00 0.00 ? 323 TRP A HA   9  
ATOM   9737  H  HB2  . TRP A 1 16 ? -0.388  12.476  -1.150  1.00 0.00 ? 323 TRP A HB2  9  
ATOM   9738  H  HB3  . TRP A 1 16 ? -1.514  12.661  0.188   1.00 0.00 ? 323 TRP A HB3  9  
ATOM   9739  H  HD1  . TRP A 1 16 ? -0.680  9.451   -1.869  1.00 0.00 ? 323 TRP A HD1  9  
ATOM   9740  H  HE1  . TRP A 1 16 ? 0.041   7.622   -0.211  1.00 0.00 ? 323 TRP A HE1  9  
ATOM   9741  H  HE3  . TRP A 1 16 ? -0.864  12.167  2.456   1.00 0.00 ? 323 TRP A HE3  9  
ATOM   9742  H  HZ2  . TRP A 1 16 ? 0.482   7.368   2.565   1.00 0.00 ? 323 TRP A HZ2  9  
ATOM   9743  H  HZ3  . TRP A 1 16 ? -0.273  11.057  4.569   1.00 0.00 ? 323 TRP A HZ3  9  
ATOM   9744  H  HH2  . TRP A 1 16 ? 0.385   8.706   4.623   1.00 0.00 ? 323 TRP A HH2  9  
ATOM   9745  N  N    . LYS A 1 17 ? -2.841  11.574  -3.991  1.00 0.00 ? 324 LYS A N    9  
ATOM   9746  C  CA   . LYS A 1 17 ? -2.530  11.195  -5.366  1.00 0.00 ? 324 LYS A CA   9  
ATOM   9747  C  C    . LYS A 1 17 ? -2.125  9.720   -5.419  1.00 0.00 ? 324 LYS A C    9  
ATOM   9748  O  O    . LYS A 1 17 ? -2.584  8.927   -4.595  1.00 0.00 ? 324 LYS A O    9  
ATOM   9749  C  CB   . LYS A 1 17 ? -1.422  12.103  -5.921  1.00 0.00 ? 324 LYS A CB   9  
ATOM   9750  C  CG   . LYS A 1 17 ? -1.778  13.582  -5.833  1.00 0.00 ? 324 LYS A CG   9  
ATOM   9751  C  CD   . LYS A 1 17 ? -0.572  14.482  -6.040  1.00 0.00 ? 324 LYS A CD   9  
ATOM   9752  C  CE   . LYS A 1 17 ? 0.006   14.354  -7.439  1.00 0.00 ? 324 LYS A CE   9  
ATOM   9753  N  NZ   . LYS A 1 17 ? 1.157   15.271  -7.641  1.00 0.00 ? 324 LYS A NZ   9  
ATOM   9754  H  H    . LYS A 1 17 ? -3.758  11.844  -3.769  1.00 0.00 ? 324 LYS A H    9  
ATOM   9755  H  HA   . LYS A 1 17 ? -3.425  11.328  -5.955  1.00 0.00 ? 324 LYS A HA   9  
ATOM   9756  H  HB2  . LYS A 1 17 ? -0.511  11.936  -5.350  1.00 0.00 ? 324 LYS A HB2  9  
ATOM   9757  H  HB3  . LYS A 1 17 ? -1.253  11.856  -6.966  1.00 0.00 ? 324 LYS A HB3  9  
ATOM   9758  H  HG2  . LYS A 1 17 ? -2.513  13.808  -6.589  1.00 0.00 ? 324 LYS A HG2  9  
ATOM   9759  H  HG3  . LYS A 1 17 ? -2.198  13.779  -4.855  1.00 0.00 ? 324 LYS A HG3  9  
ATOM   9760  H  HD2  . LYS A 1 17 ? -0.870  15.506  -5.880  1.00 0.00 ? 324 LYS A HD2  9  
ATOM   9761  H  HD3  . LYS A 1 17 ? 0.189   14.214  -5.321  1.00 0.00 ? 324 LYS A HD3  9  
ATOM   9762  H  HE2  . LYS A 1 17 ? 0.335   13.337  -7.588  1.00 0.00 ? 324 LYS A HE2  9  
ATOM   9763  H  HE3  . LYS A 1 17 ? -0.764  14.592  -8.156  1.00 0.00 ? 324 LYS A HE3  9  
ATOM   9764  H  HZ1  . LYS A 1 17 ? 1.924   15.039  -6.977  1.00 0.00 ? 324 LYS A HZ1  9  
ATOM   9765  H  HZ2  . LYS A 1 17 ? 0.863   16.255  -7.484  1.00 0.00 ? 324 LYS A HZ2  9  
ATOM   9766  H  HZ3  . LYS A 1 17 ? 1.520   15.181  -8.611  1.00 0.00 ? 324 LYS A HZ3  9  
ATOM   9767  N  N    . LEU A 1 18 ? -1.290  9.360   -6.396  1.00 0.00 ? 325 LEU A N    9  
ATOM   9768  C  CA   . LEU A 1 18 ? -0.836  7.979   -6.574  1.00 0.00 ? 325 LEU A CA   9  
ATOM   9769  C  C    . LEU A 1 18 ? -2.035  7.064   -6.813  1.00 0.00 ? 325 LEU A C    9  
ATOM   9770  O  O    . LEU A 1 18 ? -2.481  6.342   -5.919  1.00 0.00 ? 325 LEU A O    9  
ATOM   9771  C  CB   . LEU A 1 18 ? -0.015  7.495   -5.366  1.00 0.00 ? 325 LEU A CB   9  
ATOM   9772  C  CG   . LEU A 1 18 ? 1.062   8.467   -4.874  1.00 0.00 ? 325 LEU A CG   9  
ATOM   9773  C  CD1  . LEU A 1 18 ? 1.803   7.874   -3.686  1.00 0.00 ? 325 LEU A CD1  9  
ATOM   9774  C  CD2  . LEU A 1 18 ? 2.034   8.807   -5.994  1.00 0.00 ? 325 LEU A CD2  9  
ATOM   9775  H  H    . LEU A 1 18 ? -0.975  10.042  -7.023  1.00 0.00 ? 325 LEU A H    9  
ATOM   9776  H  HA   . LEU A 1 18 ? -0.210  7.954   -7.454  1.00 0.00 ? 325 LEU A HA   9  
ATOM   9777  H  HB2  . LEU A 1 18 ? -0.702  7.305   -4.543  1.00 0.00 ? 325 LEU A HB2  9  
ATOM   9778  H  HB3  . LEU A 1 18 ? 0.480   6.561   -5.643  1.00 0.00 ? 325 LEU A HB3  9  
ATOM   9779  H  HG   . LEU A 1 18 ? 0.591   9.383   -4.548  1.00 0.00 ? 325 LEU A HG   9  
ATOM   9780  H  HD11 . LEU A 1 18 ? 2.567   8.563   -3.358  1.00 0.00 ? 325 LEU A HD11 9  
ATOM   9781  H  HD12 . LEU A 1 18 ? 2.262   6.941   -3.978  1.00 0.00 ? 325 LEU A HD12 9  
ATOM   9782  H  HD13 . LEU A 1 18 ? 1.108   7.697   -2.879  1.00 0.00 ? 325 LEU A HD13 9  
ATOM   9783  H  HD21 . LEU A 1 18 ? 2.780   9.496   -5.626  1.00 0.00 ? 325 LEU A HD21 9  
ATOM   9784  H  HD22 . LEU A 1 18 ? 1.496   9.261   -6.811  1.00 0.00 ? 325 LEU A HD22 9  
ATOM   9785  H  HD23 . LEU A 1 18 ? 2.517   7.904   -6.337  1.00 0.00 ? 325 LEU A HD23 9  
ATOM   9786  N  N    . THR A 1 19 ? -2.571  7.128   -8.022  1.00 0.00 ? 326 THR A N    9  
ATOM   9787  C  CA   . THR A 1 19 ? -3.776  6.396   -8.365  1.00 0.00 ? 326 THR A CA   9  
ATOM   9788  C  C    . THR A 1 19 ? -3.484  4.913   -8.567  1.00 0.00 ? 326 THR A C    9  
ATOM   9789  O  O    . THR A 1 19 ? -2.542  4.539   -9.264  1.00 0.00 ? 326 THR A O    9  
ATOM   9790  C  CB   . THR A 1 19 ? -4.429  6.972   -9.635  1.00 0.00 ? 326 THR A CB   9  
ATOM   9791  O  OG1  . THR A 1 19 ? -4.547  8.397   -9.509  1.00 0.00 ? 326 THR A OG1  9  
ATOM   9792  C  CG2  . THR A 1 19 ? -5.809  6.368   -9.870  1.00 0.00 ? 326 THR A CG2  9  
ATOM   9793  H  H    . THR A 1 19 ? -2.137  7.679   -8.706  1.00 0.00 ? 326 THR A H    9  
ATOM   9794  H  HA   . THR A 1 19 ? -4.473  6.503   -7.548  1.00 0.00 ? 326 THR A HA   9  
ATOM   9795  H  HB   . THR A 1 19 ? -3.800  6.738   -10.481 1.00 0.00 ? 326 THR A HB   9  
ATOM   9796  H  HG1  . THR A 1 19 ? -3.752  8.745   -9.086  1.00 0.00 ? 326 THR A HG1  9  
ATOM   9797  H  HG21 . THR A 1 19 ? -6.237  6.784   -10.770 1.00 0.00 ? 326 THR A HG21 9  
ATOM   9798  H  HG22 . THR A 1 19 ? -6.450  6.596   -9.031  1.00 0.00 ? 326 THR A HG22 9  
ATOM   9799  H  HG23 . THR A 1 19 ? -5.722  5.296   -9.977  1.00 0.00 ? 326 THR A HG23 9  
ATOM   9800  N  N    . CYS A 1 20 ? -4.315  4.082   -7.962  1.00 0.00 ? 327 CYS A N    9  
ATOM   9801  C  CA   . CYS A 1 20 ? -4.185  2.638   -8.059  1.00 0.00 ? 327 CYS A CA   9  
ATOM   9802  C  C    . CYS A 1 20 ? -4.764  2.164   -9.383  1.00 0.00 ? 327 CYS A C    9  
ATOM   9803  O  O    . CYS A 1 20 ? -5.975  2.234   -9.586  1.00 0.00 ? 327 CYS A O    9  
ATOM   9804  C  CB   . CYS A 1 20 ? -4.921  1.988   -6.875  1.00 0.00 ? 327 CYS A CB   9  
ATOM   9805  S  SG   . CYS A 1 20 ? -5.063  0.177   -6.925  1.00 0.00 ? 327 CYS A SG   9  
ATOM   9806  H  H    . CYS A 1 20 ? -5.049  4.457   -7.437  1.00 0.00 ? 327 CYS A H    9  
ATOM   9807  H  HA   . CYS A 1 20 ? -3.136  2.387   -8.016  1.00 0.00 ? 327 CYS A HA   9  
ATOM   9808  H  HB2  . CYS A 1 20 ? -4.402  2.241   -5.964  1.00 0.00 ? 327 CYS A HB2  9  
ATOM   9809  H  HB3  . CYS A 1 20 ? -5.922  2.393   -6.828  1.00 0.00 ? 327 CYS A HB3  9  
ATOM   9810  N  N    . TYR A 1 21 ? -3.905  1.693   -10.289 1.00 0.00 ? 328 TYR A N    9  
ATOM   9811  C  CA   . TYR A 1 21 ? -4.355  1.308   -11.623 1.00 0.00 ? 328 TYR A CA   9  
ATOM   9812  C  C    . TYR A 1 21 ? -5.231  0.063   -11.546 1.00 0.00 ? 328 TYR A C    9  
ATOM   9813  O  O    . TYR A 1 21 ? -6.103  -0.151  -12.386 1.00 0.00 ? 328 TYR A O    9  
ATOM   9814  C  CB   . TYR A 1 21 ? -3.168  1.091   -12.574 1.00 0.00 ? 328 TYR A CB   9  
ATOM   9815  C  CG   . TYR A 1 21 ? -2.337  -0.138  -12.285 1.00 0.00 ? 328 TYR A CG   9  
ATOM   9816  C  CD1  . TYR A 1 21 ? -1.360  -0.128  -11.300 1.00 0.00 ? 328 TYR A CD1  9  
ATOM   9817  C  CD2  . TYR A 1 21 ? -2.523  -1.304  -13.011 1.00 0.00 ? 328 TYR A CD2  9  
ATOM   9818  C  CE1  . TYR A 1 21 ? -0.593  -1.248  -11.045 1.00 0.00 ? 328 TYR A CE1  9  
ATOM   9819  C  CE2  . TYR A 1 21 ? -1.764  -2.427  -12.762 1.00 0.00 ? 328 TYR A CE2  9  
ATOM   9820  C  CZ   . TYR A 1 21 ? -0.798  -2.397  -11.780 1.00 0.00 ? 328 TYR A CZ   9  
ATOM   9821  O  OH   . TYR A 1 21 ? -0.039  -3.521  -11.535 1.00 0.00 ? 328 TYR A OH   9  
ATOM   9822  H  H    . TYR A 1 21 ? -2.951  1.602   -10.052 1.00 0.00 ? 328 TYR A H    9  
ATOM   9823  H  HA   . TYR A 1 21 ? -4.958  2.120   -12.005 1.00 0.00 ? 328 TYR A HA   9  
ATOM   9824  H  HB2  . TYR A 1 21 ? -3.538  1.004   -13.583 1.00 0.00 ? 328 TYR A HB2  9  
ATOM   9825  H  HB3  . TYR A 1 21 ? -2.515  1.951   -12.515 1.00 0.00 ? 328 TYR A HB3  9  
ATOM   9826  H  HD1  . TYR A 1 21 ? -1.203  0.775   -10.726 1.00 0.00 ? 328 TYR A HD1  9  
ATOM   9827  H  HD2  . TYR A 1 21 ? -3.280  -1.328  -13.781 1.00 0.00 ? 328 TYR A HD2  9  
ATOM   9828  H  HE1  . TYR A 1 21 ? 0.161   -1.220  -10.273 1.00 0.00 ? 328 TYR A HE1  9  
ATOM   9829  H  HE2  . TYR A 1 21 ? -1.927  -3.323  -13.335 1.00 0.00 ? 328 TYR A HE2  9  
ATOM   9830  H  HH   . TYR A 1 21 ? 0.045   -4.033  -12.350 1.00 0.00 ? 328 TYR A HH   9  
ATOM   9831  N  N    . LEU A 1 22 ? -5.002  -0.746  -10.522 1.00 0.00 ? 329 LEU A N    9  
ATOM   9832  C  CA   . LEU A 1 22 ? -5.879  -1.866  -10.224 1.00 0.00 ? 329 LEU A CA   9  
ATOM   9833  C  C    . LEU A 1 22 ? -7.002  -1.392  -9.305  1.00 0.00 ? 329 LEU A C    9  
ATOM   9834  O  O    . LEU A 1 22 ? -7.123  -1.869  -8.171  1.00 0.00 ? 329 LEU A O    9  
ATOM   9835  C  CB   . LEU A 1 22 ? -5.098  -3.005  -9.561  1.00 0.00 ? 329 LEU A CB   9  
ATOM   9836  C  CG   . LEU A 1 22 ? -4.030  -3.674  -10.431 1.00 0.00 ? 329 LEU A CG   9  
ATOM   9837  C  CD1  . LEU A 1 22 ? -3.250  -4.698  -9.622  1.00 0.00 ? 329 LEU A CD1  9  
ATOM   9838  C  CD2  . LEU A 1 22 ? -4.665  -4.336  -11.645 1.00 0.00 ? 329 LEU A CD2  9  
ATOM   9839  H  H    . LEU A 1 22 ? -4.222  -0.584  -9.953  1.00 0.00 ? 329 LEU A H    9  
ATOM   9840  H  HA   . LEU A 1 22 ? -6.306  -2.213  -11.152 1.00 0.00 ? 329 LEU A HA   9  
ATOM   9841  H  HB2  . LEU A 1 22 ? -4.615  -2.613  -8.679  1.00 0.00 ? 329 LEU A HB2  9  
ATOM   9842  H  HB3  . LEU A 1 22 ? -5.803  -3.762  -9.255  1.00 0.00 ? 329 LEU A HB3  9  
ATOM   9843  H  HG   . LEU A 1 22 ? -3.335  -2.925  -10.782 1.00 0.00 ? 329 LEU A HG   9  
ATOM   9844  H  HD11 . LEU A 1 22 ? -2.519  -5.180  -10.258 1.00 0.00 ? 329 LEU A HD11 9  
ATOM   9845  H  HD12 . LEU A 1 22 ? -3.930  -5.441  -9.231  1.00 0.00 ? 329 LEU A HD12 9  
ATOM   9846  H  HD13 . LEU A 1 22 ? -2.746  -4.206  -8.804  1.00 0.00 ? 329 LEU A HD13 9  
ATOM   9847  H  HD21 . LEU A 1 22 ? -3.900  -4.818  -12.233 1.00 0.00 ? 329 LEU A HD21 9  
ATOM   9848  H  HD22 . LEU A 1 22 ? -5.162  -3.588  -12.245 1.00 0.00 ? 329 LEU A HD22 9  
ATOM   9849  H  HD23 . LEU A 1 22 ? -5.384  -5.071  -11.317 1.00 0.00 ? 329 LEU A HD23 9  
ATOM   9850  N  N    . CYS A 1 23 ? -7.769  -0.413  -9.800  1.00 0.00 ? 330 CYS A N    9  
ATOM   9851  C  CA   . CYS A 1 23 ? -8.884  0.206   -9.073  1.00 0.00 ? 330 CYS A CA   9  
ATOM   9852  C  C    . CYS A 1 23 ? -9.464  1.365   -9.872  1.00 0.00 ? 330 CYS A C    9  
ATOM   9853  O  O    . CYS A 1 23 ? -10.668 1.418   -10.117 1.00 0.00 ? 330 CYS A O    9  
ATOM   9854  C  CB   . CYS A 1 23 ? -8.449  0.758   -7.710  1.00 0.00 ? 330 CYS A CB   9  
ATOM   9855  S  SG   . CYS A 1 23 ? -8.544  -0.420  -6.347  1.00 0.00 ? 330 CYS A SG   9  
ATOM   9856  H  H    . CYS A 1 23 ? -7.580  -0.097  -10.710 1.00 0.00 ? 330 CYS A H    9  
ATOM   9857  H  HA   . CYS A 1 23 ? -9.647  -0.543  -8.928  1.00 0.00 ? 330 CYS A HA   9  
ATOM   9858  H  HB2  . CYS A 1 23 ? -7.425  1.091   -7.779  1.00 0.00 ? 330 CYS A HB2  9  
ATOM   9859  H  HB3  . CYS A 1 23 ? -9.077  1.601   -7.460  1.00 0.00 ? 330 CYS A HB3  9  
ATOM   9860  N  N    . LYS A 1 24 ? -8.577  2.301   -10.242 1.00 0.00 ? 331 LYS A N    9  
ATOM   9861  C  CA   . LYS A 1 24 ? -8.953  3.571   -10.856 1.00 0.00 ? 331 LYS A CA   9  
ATOM   9862  C  C    . LYS A 1 24 ? -9.603  4.451   -9.804  1.00 0.00 ? 331 LYS A C    9  
ATOM   9863  O  O    . LYS A 1 24 ? -10.368 5.367   -10.101 1.00 0.00 ? 331 LYS A O    9  
ATOM   9864  C  CB   . LYS A 1 24 ? -9.855  3.379   -12.079 1.00 0.00 ? 331 LYS A CB   9  
ATOM   9865  C  CG   . LYS A 1 24 ? -9.107  2.852   -13.291 1.00 0.00 ? 331 LYS A CG   9  
ATOM   9866  C  CD   . LYS A 1 24 ? -10.009 2.744   -14.506 1.00 0.00 ? 331 LYS A CD   9  
ATOM   9867  C  CE   . LYS A 1 24 ? -9.222  2.335   -15.741 1.00 0.00 ? 331 LYS A CE   9  
ATOM   9868  N  NZ   . LYS A 1 24 ? -8.249  3.382   -16.159 1.00 0.00 ? 331 LYS A NZ   9  
ATOM   9869  H  H    . LYS A 1 24 ? -7.627  2.141   -10.067 1.00 0.00 ? 331 LYS A H    9  
ATOM   9870  H  HA   . LYS A 1 24 ? -8.037  4.053   -11.173 1.00 0.00 ? 331 LYS A HA   9  
ATOM   9871  H  HB2  . LYS A 1 24 ? -10.638 2.677   -11.830 1.00 0.00 ? 331 LYS A HB2  9  
ATOM   9872  H  HB3  . LYS A 1 24 ? -10.302 4.327   -12.341 1.00 0.00 ? 331 LYS A HB3  9  
ATOM   9873  H  HG2  . LYS A 1 24 ? -8.293  3.523   -13.520 1.00 0.00 ? 331 LYS A HG2  9  
ATOM   9874  H  HG3  . LYS A 1 24 ? -8.713  1.873   -13.060 1.00 0.00 ? 331 LYS A HG3  9  
ATOM   9875  H  HD2  . LYS A 1 24 ? -10.770 2.004   -14.313 1.00 0.00 ? 331 LYS A HD2  9  
ATOM   9876  H  HD3  . LYS A 1 24 ? -10.472 3.703   -14.684 1.00 0.00 ? 331 LYS A HD3  9  
ATOM   9877  H  HE2  . LYS A 1 24 ? -8.684  1.425   -15.522 1.00 0.00 ? 331 LYS A HE2  9  
ATOM   9878  H  HE3  . LYS A 1 24 ? -9.916  2.157   -16.548 1.00 0.00 ? 331 LYS A HE3  9  
ATOM   9879  H  HZ1  . LYS A 1 24 ? -7.614  3.623   -15.371 1.00 0.00 ? 331 LYS A HZ1  9  
ATOM   9880  H  HZ2  . LYS A 1 24 ? -8.754  4.242   -16.458 1.00 0.00 ? 331 LYS A HZ2  9  
ATOM   9881  H  HZ3  . LYS A 1 24 ? -7.675  3.038   -16.955 1.00 0.00 ? 331 LYS A HZ3  9  
ATOM   9882  N  N    . GLN A 1 25 ? -9.248  4.163   -8.560  1.00 0.00 ? 332 GLN A N    9  
ATOM   9883  C  CA   . GLN A 1 25 ? -9.747  4.893   -7.421  1.00 0.00 ? 332 GLN A CA   9  
ATOM   9884  C  C    . GLN A 1 25 ? -8.592  5.329   -6.534  1.00 0.00 ? 332 GLN A C    9  
ATOM   9885  O  O    . GLN A 1 25 ? -7.909  4.498   -5.923  1.00 0.00 ? 332 GLN A O    9  
ATOM   9886  C  CB   . GLN A 1 25 ? -10.722 4.043   -6.605  1.00 0.00 ? 332 GLN A CB   9  
ATOM   9887  C  CG   . GLN A 1 25 ? -11.966 3.619   -7.365  1.00 0.00 ? 332 GLN A CG   9  
ATOM   9888  C  CD   . GLN A 1 25 ? -12.966 2.896   -6.484  1.00 0.00 ? 332 GLN A CD   9  
ATOM   9889  O  OE1  . GLN A 1 25 ? -14.173 2.983   -6.704  1.00 0.00 ? 332 GLN A OE1  9  
ATOM   9890  N  NE2  . GLN A 1 25 ? -12.477 2.177   -5.486  1.00 0.00 ? 332 GLN A NE2  9  
ATOM   9891  H  H    . GLN A 1 25 ? -8.616  3.439   -8.409  1.00 0.00 ? 332 GLN A H    9  
ATOM   9892  H  HA   . GLN A 1 25 ? -10.255 5.761   -7.793  1.00 0.00 ? 332 GLN A HA   9  
ATOM   9893  H  HB2  . GLN A 1 25 ? -10.211 3.152   -6.275  1.00 0.00 ? 332 GLN A HB2  9  
ATOM   9894  H  HB3  . GLN A 1 25 ? -11.032 4.607   -5.738  1.00 0.00 ? 332 GLN A HB3  9  
ATOM   9895  H  HG2  . GLN A 1 25 ? -12.439 4.497   -7.776  1.00 0.00 ? 332 GLN A HG2  9  
ATOM   9896  H  HG3  . GLN A 1 25 ? -11.671 2.959   -8.168  1.00 0.00 ? 332 GLN A HG3  9  
ATOM   9897  H  HE21 . GLN A 1 25 ? -11.507 2.145   -5.368  1.00 0.00 ? 332 GLN A HE21 9  
ATOM   9898  H  HE22 . GLN A 1 25 ? -13.109 1.705   -4.900  1.00 0.00 ? 332 GLN A HE22 9  
ATOM   9899  N  N    . LYS A 1 26 ? -8.359  6.625   -6.493  1.00 0.00 ? 333 LYS A N    9  
ATOM   9900  C  CA   . LYS A 1 26 ? -7.355  7.198   -5.613  1.00 0.00 ? 333 LYS A CA   9  
ATOM   9901  C  C    . LYS A 1 26 ? -7.934  7.398   -4.215  1.00 0.00 ? 333 LYS A C    9  
ATOM   9902  O  O    . LYS A 1 26 ? -9.082  7.813   -4.066  1.00 0.00 ? 333 LYS A O    9  
ATOM   9903  C  CB   . LYS A 1 26 ? -6.852  8.536   -6.167  1.00 0.00 ? 333 LYS A CB   9  
ATOM   9904  C  CG   . LYS A 1 26 ? -7.962  9.548   -6.418  1.00 0.00 ? 333 LYS A CG   9  
ATOM   9905  C  CD   . LYS A 1 26 ? -7.412  10.926  -6.758  1.00 0.00 ? 333 LYS A CD   9  
ATOM   9906  C  CE   . LYS A 1 26 ? -6.516  10.891  -7.986  1.00 0.00 ? 333 LYS A CE   9  
ATOM   9907  N  NZ   . LYS A 1 26 ? -6.123  12.256  -8.427  1.00 0.00 ? 333 LYS A NZ   9  
ATOM   9908  H  H    . LYS A 1 26 ? -8.876  7.214   -7.077  1.00 0.00 ? 333 LYS A H    9  
ATOM   9909  H  HA   . LYS A 1 26 ? -6.529  6.505   -5.554  1.00 0.00 ? 333 LYS A HA   9  
ATOM   9910  H  HB2  . LYS A 1 26 ? -6.154  8.965   -5.465  1.00 0.00 ? 333 LYS A HB2  9  
ATOM   9911  H  HB3  . LYS A 1 26 ? -6.342  8.353   -7.102  1.00 0.00 ? 333 LYS A HB3  9  
ATOM   9912  H  HG2  . LYS A 1 26 ? -8.569  9.204   -7.242  1.00 0.00 ? 333 LYS A HG2  9  
ATOM   9913  H  HG3  . LYS A 1 26 ? -8.571  9.624   -5.530  1.00 0.00 ? 333 LYS A HG3  9  
ATOM   9914  H  HD2  . LYS A 1 26 ? -8.237  11.595  -6.948  1.00 0.00 ? 333 LYS A HD2  9  
ATOM   9915  H  HD3  . LYS A 1 26 ? -6.839  11.288  -5.918  1.00 0.00 ? 333 LYS A HD3  9  
ATOM   9916  H  HE2  . LYS A 1 26 ? -5.625  10.329  -7.750  1.00 0.00 ? 333 LYS A HE2  9  
ATOM   9917  H  HE3  . LYS A 1 26 ? -7.046  10.401  -8.789  1.00 0.00 ? 333 LYS A HE3  9  
ATOM   9918  H  HZ1  . LYS A 1 26 ? -5.471  12.197  -9.236  1.00 0.00 ? 333 LYS A HZ1  9  
ATOM   9919  H  HZ2  . LYS A 1 26 ? -5.649  12.765  -7.651  1.00 0.00 ? 333 LYS A HZ2  9  
ATOM   9920  H  HZ3  . LYS A 1 26 ? -6.964  12.793  -8.716  1.00 0.00 ? 333 LYS A HZ3  9  
ATOM   9921  N  N    . GLY A 1 27 ? -7.137  7.093   -3.201  1.00 0.00 ? 334 GLY A N    9  
ATOM   9922  C  CA   . GLY A 1 27 ? -7.574  7.283   -1.830  1.00 0.00 ? 334 GLY A CA   9  
ATOM   9923  C  C    . GLY A 1 27 ? -8.665  6.317   -1.410  1.00 0.00 ? 334 GLY A C    9  
ATOM   9924  O  O    . GLY A 1 27 ? -9.837  6.682   -1.347  1.00 0.00 ? 334 GLY A O    9  
ATOM   9925  H  H    . GLY A 1 27 ? -6.240  6.748   -3.382  1.00 0.00 ? 334 GLY A H    9  
ATOM   9926  H  HA2  . GLY A 1 27 ? -6.726  7.150   -1.175  1.00 0.00 ? 334 GLY A HA2  9  
ATOM   9927  H  HA3  . GLY A 1 27 ? -7.944  8.292   -1.722  1.00 0.00 ? 334 GLY A HA3  9  
ATOM   9928  N  N    . VAL A 1 28 ? -8.280  5.084   -1.116  1.00 0.00 ? 335 VAL A N    9  
ATOM   9929  C  CA   . VAL A 1 28 ? -9.224  4.084   -0.625  1.00 0.00 ? 335 VAL A CA   9  
ATOM   9930  C  C    . VAL A 1 28 ? -8.648  3.423   0.621   1.00 0.00 ? 335 VAL A C    9  
ATOM   9931  O  O    . VAL A 1 28 ? -9.096  3.679   1.736   1.00 0.00 ? 335 VAL A O    9  
ATOM   9932  C  CB   . VAL A 1 28 ? -9.539  2.999   -1.683  1.00 0.00 ? 335 VAL A CB   9  
ATOM   9933  C  CG1  . VAL A 1 28 ? -10.578 2.020   -1.156  1.00 0.00 ? 335 VAL A CG1  9  
ATOM   9934  C  CG2  . VAL A 1 28 ? -10.015 3.627   -2.985  1.00 0.00 ? 335 VAL A CG2  9  
ATOM   9935  H  H    . VAL A 1 28 ? -7.338  4.847   -1.204  1.00 0.00 ? 335 VAL A H    9  
ATOM   9936  H  HA   . VAL A 1 28 ? -10.143 4.590   -0.363  1.00 0.00 ? 335 VAL A HA   9  
ATOM   9937  H  HB   . VAL A 1 28 ? -8.631  2.449   -1.886  1.00 0.00 ? 335 VAL A HB   9  
ATOM   9938  H  HG11 . VAL A 1 28 ? -10.783 1.273   -1.908  1.00 0.00 ? 335 VAL A HG11 9  
ATOM   9939  H  HG12 . VAL A 1 28 ? -11.489 2.553   -0.922  1.00 0.00 ? 335 VAL A HG12 9  
ATOM   9940  H  HG13 . VAL A 1 28 ? -10.203 1.541   -0.263  1.00 0.00 ? 335 VAL A HG13 9  
ATOM   9941  H  HG21 . VAL A 1 28 ? -9.256  4.300   -3.360  1.00 0.00 ? 335 VAL A HG21 9  
ATOM   9942  H  HG22 . VAL A 1 28 ? -10.926 4.177   -2.808  1.00 0.00 ? 335 VAL A HG22 9  
ATOM   9943  H  HG23 . VAL A 1 28 ? -10.197 2.851   -3.714  1.00 0.00 ? 335 VAL A HG23 9  
ATOM   9944  N  N    . GLY A 1 29 ? -7.642  2.587   0.418   1.00 0.00 ? 336 GLY A N    9  
ATOM   9945  C  CA   . GLY A 1 29 ? -6.911  2.015   1.527   1.00 0.00 ? 336 GLY A CA   9  
ATOM   9946  C  C    . GLY A 1 29 ? -5.489  2.530   1.560   1.00 0.00 ? 336 GLY A C    9  
ATOM   9947  O  O    . GLY A 1 29 ? -5.268  3.739   1.582   1.00 0.00 ? 336 GLY A O    9  
ATOM   9948  H  H    . GLY A 1 29 ? -7.398  2.349   -0.494  1.00 0.00 ? 336 GLY A H    9  
ATOM   9949  H  HA2  . GLY A 1 29 ? -7.412  2.288   2.457   1.00 0.00 ? 336 GLY A HA2  9  
ATOM   9950  H  HA3  . GLY A 1 29 ? -6.893  0.930   1.418   1.00 0.00 ? 336 GLY A HA3  9  
ATOM   9951  N  N    . ALA A 1 30 ? -4.525  1.625   1.524   1.00 0.00 ? 337 ALA A N    9  
ATOM   9952  C  CA   . ALA A 1 30 ? -3.123  2.006   1.537   1.00 0.00 ? 337 ALA A CA   9  
ATOM   9953  C  C    . ALA A 1 30 ? -2.531  1.906   0.136   1.00 0.00 ? 337 ALA A C    9  
ATOM   9954  O  O    . ALA A 1 30 ? -2.723  0.904   -0.560  1.00 0.00 ? 337 ALA A O    9  
ATOM   9955  C  CB   . ALA A 1 30 ? -2.349  1.136   2.513   1.00 0.00 ? 337 ALA A CB   9  
ATOM   9956  H  H    . ALA A 1 30 ? -4.761  0.675   1.477   1.00 0.00 ? 337 ALA A H    9  
ATOM   9957  H  HA   . ALA A 1 30 ? -3.059  3.031   1.873   1.00 0.00 ? 337 ALA A HA   9  
ATOM   9958  H  HB1  . ALA A 1 30 ? -2.761  1.256   3.505   1.00 0.00 ? 337 ALA A HB1  9  
ATOM   9959  H  HB2  . ALA A 1 30 ? -1.311  1.434   2.515   1.00 0.00 ? 337 ALA A HB2  9  
ATOM   9960  H  HB3  . ALA A 1 30 ? -2.428  0.101   2.214   1.00 0.00 ? 337 ALA A HB3  9  
ATOM   9961  N  N    . SER A 1 31 ? -1.829  2.948   -0.278  1.00 0.00 ? 338 SER A N    9  
ATOM   9962  C  CA   . SER A 1 31 ? -1.244  2.995   -1.606  1.00 0.00 ? 338 SER A CA   9  
ATOM   9963  C  C    . SER A 1 31 ? 0.248   2.663   -1.568  1.00 0.00 ? 338 SER A C    9  
ATOM   9964  O  O    . SER A 1 31 ? 0.971   3.067   -0.652  1.00 0.00 ? 338 SER A O    9  
ATOM   9965  C  CB   . SER A 1 31 ? -1.477  4.376   -2.224  1.00 0.00 ? 338 SER A CB   9  
ATOM   9966  O  OG   . SER A 1 31 ? -1.264  5.408   -1.272  1.00 0.00 ? 338 SER A OG   9  
ATOM   9967  H  H    . SER A 1 31 ? -1.692  3.709   0.326   1.00 0.00 ? 338 SER A H    9  
ATOM   9968  H  HA   . SER A 1 31 ? -1.746  2.254   -2.212  1.00 0.00 ? 338 SER A HA   9  
ATOM   9969  H  HB2  . SER A 1 31 ? -0.793  4.518   -3.049  1.00 0.00 ? 338 SER A HB2  9  
ATOM   9970  H  HB3  . SER A 1 31 ? -2.492  4.439   -2.585  1.00 0.00 ? 338 SER A HB3  9  
ATOM   9971  H  HG   . SER A 1 31 ? -1.707  6.211   -1.568  1.00 0.00 ? 338 SER A HG   9  
ATOM   9972  N  N    . ILE A 1 32 ? 0.689   1.907   -2.561  1.00 0.00 ? 339 ILE A N    9  
ATOM   9973  C  CA   . ILE A 1 32 ? 2.089   1.559   -2.717  1.00 0.00 ? 339 ILE A CA   9  
ATOM   9974  C  C    . ILE A 1 32 ? 2.416   1.512   -4.206  1.00 0.00 ? 339 ILE A C    9  
ATOM   9975  O  O    . ILE A 1 32 ? 1.577   1.115   -5.015  1.00 0.00 ? 339 ILE A O    9  
ATOM   9976  C  CB   . ILE A 1 32 ? 2.421   0.203   -2.039  1.00 0.00 ? 339 ILE A CB   9  
ATOM   9977  C  CG1  . ILE A 1 32 ? 3.917   -0.104  -2.148  1.00 0.00 ? 339 ILE A CG1  9  
ATOM   9978  C  CG2  . ILE A 1 32 ? 1.593   -0.924  -2.646  1.00 0.00 ? 339 ILE A CG2  9  
ATOM   9979  C  CD1  . ILE A 1 32 ? 4.327   -1.381  -1.446  1.00 0.00 ? 339 ILE A CD1  9  
ATOM   9980  H  H    . ILE A 1 32 ? 0.046   1.573   -3.227  1.00 0.00 ? 339 ILE A H    9  
ATOM   9981  H  HA   . ILE A 1 32 ? 2.683   2.335   -2.251  1.00 0.00 ? 339 ILE A HA   9  
ATOM   9982  H  HB   . ILE A 1 32 ? 2.156   0.281   -0.995  1.00 0.00 ? 339 ILE A HB   9  
ATOM   9983  H  HG12 . ILE A 1 32 ? 4.182   -0.205  -3.197  1.00 0.00 ? 339 ILE A HG12 9  
ATOM   9984  H  HG13 . ILE A 1 32 ? 4.479   0.717   -1.703  1.00 0.00 ? 339 ILE A HG13 9  
ATOM   9985  H  HG21 . ILE A 1 32 ? 1.768   -0.966  -3.711  1.00 0.00 ? 339 ILE A HG21 9  
ATOM   9986  H  HG22 . ILE A 1 32 ? 0.545   -0.743  -2.460  1.00 0.00 ? 339 ILE A HG22 9  
ATOM   9987  H  HG23 . ILE A 1 32 ? 1.881   -1.862  -2.195  1.00 0.00 ? 339 ILE A HG23 9  
ATOM   9988  H  HD11 . ILE A 1 32 ? 5.391   -1.526  -1.556  1.00 0.00 ? 339 ILE A HD11 9  
ATOM   9989  H  HD12 . ILE A 1 32 ? 3.801   -2.216  -1.884  1.00 0.00 ? 339 ILE A HD12 9  
ATOM   9990  H  HD13 . ILE A 1 32 ? 4.079   -1.309  -0.398  1.00 0.00 ? 339 ILE A HD13 9  
ATOM   9991  N  N    . GLN A 1 33 ? 3.609   1.938   -4.578  1.00 0.00 ? 340 GLN A N    9  
ATOM   9992  C  CA   . GLN A 1 33 ? 3.955   2.037   -5.978  1.00 0.00 ? 340 GLN A CA   9  
ATOM   9993  C  C    . GLN A 1 33 ? 5.273   1.354   -6.284  1.00 0.00 ? 340 GLN A C    9  
ATOM   9994  O  O    . GLN A 1 33 ? 6.227   1.406   -5.505  1.00 0.00 ? 340 GLN A O    9  
ATOM   9995  C  CB   . GLN A 1 33 ? 3.983   3.497   -6.439  1.00 0.00 ? 340 GLN A CB   9  
ATOM   9996  C  CG   . GLN A 1 33 ? 4.458   4.483   -5.389  1.00 0.00 ? 340 GLN A CG   9  
ATOM   9997  C  CD   . GLN A 1 33 ? 4.485   5.882   -5.894  1.00 0.00 ? 340 GLN A CD   9  
ATOM   9998  O  OE1  . GLN A 1 33 ? 3.853   6.220   -6.890  1.00 0.00 ? 340 GLN A OE1  9  
ATOM   9999  N  NE2  . GLN A 1 33 ? 5.138   6.727   -5.150  1.00 0.00 ? 340 GLN A NE2  9  
ATOM   10000 H  H    . GLN A 1 33 ? 4.277   2.164   -3.906  1.00 0.00 ? 340 GLN A H    9  
ATOM   10001 H  HA   . GLN A 1 33 ? 3.181   1.525   -6.531  1.00 0.00 ? 340 GLN A HA   9  
ATOM   10002 H  HB2  . GLN A 1 33 ? 4.640   3.577   -7.292  1.00 0.00 ? 340 GLN A HB2  9  
ATOM   10003 H  HB3  . GLN A 1 33 ? 2.985   3.783   -6.741  1.00 0.00 ? 340 GLN A HB3  9  
ATOM   10004 H  HG2  . GLN A 1 33 ? 3.790   4.474   -4.541  1.00 0.00 ? 340 GLN A HG2  9  
ATOM   10005 H  HG3  . GLN A 1 33 ? 5.465   4.207   -5.079  1.00 0.00 ? 340 GLN A HG3  9  
ATOM   10006 H  HE21 . GLN A 1 33 ? 5.561   6.398   -4.335  1.00 0.00 ? 340 GLN A HE21 9  
ATOM   10007 H  HE22 . GLN A 1 33 ? 5.141   7.643   -5.419  1.00 0.00 ? 340 GLN A HE22 9  
ATOM   10008 N  N    . CYS A 1 34 ? 5.286   0.705   -7.431  1.00 0.00 ? 341 CYS A N    9  
ATOM   10009 C  CA   . CYS A 1 34 ? 6.450   -0.001  -7.937  1.00 0.00 ? 341 CYS A CA   9  
ATOM   10010 C  C    . CYS A 1 34 ? 7.594   0.952   -8.222  1.00 0.00 ? 341 CYS A C    9  
ATOM   10011 O  O    . CYS A 1 34 ? 7.382   2.116   -8.568  1.00 0.00 ? 341 CYS A O    9  
ATOM   10012 C  CB   . CYS A 1 34 ? 6.080   -0.743  -9.218  1.00 0.00 ? 341 CYS A CB   9  
ATOM   10013 S  SG   . CYS A 1 34 ? 7.482   -1.482  -10.103 1.00 0.00 ? 341 CYS A SG   9  
ATOM   10014 H  H    . CYS A 1 34 ? 4.462   0.705   -7.962  1.00 0.00 ? 341 CYS A H    9  
ATOM   10015 H  HA   . CYS A 1 34 ? 6.760   -0.716  -7.193  1.00 0.00 ? 341 CYS A HA   9  
ATOM   10016 H  HB2  . CYS A 1 34 ? 5.393   -1.538  -8.975  1.00 0.00 ? 341 CYS A HB2  9  
ATOM   10017 H  HB3  . CYS A 1 34 ? 5.597   -0.053  -9.892  1.00 0.00 ? 341 CYS A HB3  9  
ATOM   10018 N  N    . HIS A 1 35 ? 8.805   0.432   -8.115  1.00 0.00 ? 342 HIS A N    9  
ATOM   10019 C  CA   . HIS A 1 35 ? 9.994   1.218   -8.383  1.00 0.00 ? 342 HIS A CA   9  
ATOM   10020 C  C    . HIS A 1 35 ? 11.128  0.311   -8.846  1.00 0.00 ? 342 HIS A C    9  
ATOM   10021 O  O    . HIS A 1 35 ? 10.902  -0.848  -9.168  1.00 0.00 ? 342 HIS A O    9  
ATOM   10022 C  CB   . HIS A 1 35 ? 10.417  2.031   -7.143  1.00 0.00 ? 342 HIS A CB   9  
ATOM   10023 C  CG   . HIS A 1 35 ? 10.960  1.216   -6.000  1.00 0.00 ? 342 HIS A CG   9  
ATOM   10024 N  ND1  . HIS A 1 35 ? 12.262  1.322   -5.560  1.00 0.00 ? 342 HIS A ND1  9  
ATOM   10025 C  CD2  . HIS A 1 35 ? 10.367  0.311   -5.188  1.00 0.00 ? 342 HIS A CD2  9  
ATOM   10026 C  CE1  . HIS A 1 35 ? 12.446  0.521   -4.531  1.00 0.00 ? 342 HIS A CE1  9  
ATOM   10027 N  NE2  . HIS A 1 35 ? 11.311  -0.105  -4.280  1.00 0.00 ? 342 HIS A NE2  9  
ATOM   10028 H  H    . HIS A 1 35 ? 8.898   -0.518  -7.876  1.00 0.00 ? 342 HIS A H    9  
ATOM   10029 H  HA   . HIS A 1 35 ? 9.758   1.904   -9.184  1.00 0.00 ? 342 HIS A HA   9  
ATOM   10030 H  HB2  . HIS A 1 35 ? 11.198  2.733   -7.436  1.00 0.00 ? 342 HIS A HB2  9  
ATOM   10031 H  HB3  . HIS A 1 35 ? 9.547   2.580   -6.776  1.00 0.00 ? 342 HIS A HB3  9  
ATOM   10032 H  HD1  . HIS A 1 35 ? 12.952  1.907   -5.945  1.00 0.00 ? 342 HIS A HD1  9  
ATOM   10033 H  HD2  . HIS A 1 35 ? 9.346   -0.029  -5.251  1.00 0.00 ? 342 HIS A HD2  9  
ATOM   10034 H  HE1  . HIS A 1 35 ? 13.368  0.399   -3.983  1.00 0.00 ? 342 HIS A HE1  9  
ATOM   10035 H  HE2  . HIS A 1 35 ? 11.126  -0.617  -3.465  1.00 0.00 ? 342 HIS A HE2  9  
ATOM   10036 N  N    . LYS A 1 36 ? 12.318  0.881   -8.887  1.00 0.00 ? 343 LYS A N    9  
ATOM   10037 C  CA   . LYS A 1 36 ? 13.564  0.200   -9.233  1.00 0.00 ? 343 LYS A CA   9  
ATOM   10038 C  C    . LYS A 1 36 ? 14.621  1.272   -9.471  1.00 0.00 ? 343 LYS A C    9  
ATOM   10039 O  O    . LYS A 1 36 ? 15.555  1.436   -8.685  1.00 0.00 ? 343 LYS A O    9  
ATOM   10040 C  CB   . LYS A 1 36 ? 13.420  -0.681  -10.485 1.00 0.00 ? 343 LYS A CB   9  
ATOM   10041 C  CG   . LYS A 1 36 ? 14.710  -1.376  -10.899 1.00 0.00 ? 343 LYS A CG   9  
ATOM   10042 C  CD   . LYS A 1 36 ? 15.173  -2.379  -9.849  1.00 0.00 ? 343 LYS A CD   9  
ATOM   10043 C  CE   . LYS A 1 36 ? 16.542  -2.948  -10.189 1.00 0.00 ? 343 LYS A CE   9  
ATOM   10044 N  NZ   . LYS A 1 36 ? 16.537  -3.696  -11.473 1.00 0.00 ? 343 LYS A NZ   9  
ATOM   10045 H  H    . LYS A 1 36 ? 12.368  1.823   -8.667  1.00 0.00 ? 343 LYS A H    9  
ATOM   10046 H  HA   . LYS A 1 36 ? 13.855  -0.408  -8.390  1.00 0.00 ? 343 LYS A HA   9  
ATOM   10047 H  HB2  . LYS A 1 36 ? 12.674  -1.438  -10.292 1.00 0.00 ? 343 LYS A HB2  9  
ATOM   10048 H  HB3  . LYS A 1 36 ? 13.088  -0.064  -11.306 1.00 0.00 ? 343 LYS A HB3  9  
ATOM   10049 H  HG2  . LYS A 1 36 ? 14.537  -1.906  -11.834 1.00 0.00 ? 343 LYS A HG2  9  
ATOM   10050 H  HG3  . LYS A 1 36 ? 15.486  -0.621  -11.031 1.00 0.00 ? 343 LYS A HG3  9  
ATOM   10051 H  HD2  . LYS A 1 36 ? 15.234  -1.876  -8.885  1.00 0.00 ? 343 LYS A HD2  9  
ATOM   10052 H  HD3  . LYS A 1 36 ? 14.452  -3.196  -9.805  1.00 0.00 ? 343 LYS A HD3  9  
ATOM   10053 H  HE2  . LYS A 1 36 ? 17.246  -2.132  -10.264 1.00 0.00 ? 343 LYS A HE2  9  
ATOM   10054 H  HE3  . LYS A 1 36 ? 16.847  -3.613  -9.395  1.00 0.00 ? 343 LYS A HE3  9  
ATOM   10055 H  HZ1  . LYS A 1 36 ? 15.939  -4.543  -11.394 1.00 0.00 ? 343 LYS A HZ1  9  
ATOM   10056 H  HZ2  . LYS A 1 36 ? 17.504  -3.994  -11.717 1.00 0.00 ? 343 LYS A HZ2  9  
ATOM   10057 H  HZ3  . LYS A 1 36 ? 16.169  -3.100  -12.240 1.00 0.00 ? 343 LYS A HZ3  9  
ATOM   10058 N  N    . ALA A 1 37 ? 14.448  1.998   -10.565 1.00 0.00 ? 344 ALA A N    9  
ATOM   10059 C  CA   . ALA A 1 37 ? 15.180  3.230   -10.811 1.00 0.00 ? 344 ALA A CA   9  
ATOM   10060 C  C    . ALA A 1 37 ? 14.187  4.332   -11.154 1.00 0.00 ? 344 ALA A C    9  
ATOM   10061 O  O    . ALA A 1 37 ? 14.285  5.458   -10.668 1.00 0.00 ? 344 ALA A O    9  
ATOM   10062 C  CB   . ALA A 1 37 ? 16.190  3.049   -11.931 1.00 0.00 ? 344 ALA A CB   9  
ATOM   10063 H  H    . ALA A 1 37 ? 13.811  1.686   -11.243 1.00 0.00 ? 344 ALA A H    9  
ATOM   10064 H  HA   . ALA A 1 37 ? 15.710  3.495   -9.907  1.00 0.00 ? 344 ALA A HA   9  
ATOM   10065 H  HB1  . ALA A 1 37 ? 15.673  2.810   -12.846 1.00 0.00 ? 344 ALA A HB1  9  
ATOM   10066 H  HB2  . ALA A 1 37 ? 16.868  2.246   -11.678 1.00 0.00 ? 344 ALA A HB2  9  
ATOM   10067 H  HB3  . ALA A 1 37 ? 16.749  3.964   -12.062 1.00 0.00 ? 344 ALA A HB3  9  
ATOM   10068 N  N    . ASN A 1 38 ? 13.226  3.983   -12.001 1.00 0.00 ? 345 ASN A N    9  
ATOM   10069 C  CA   . ASN A 1 38 ? 12.095  4.850   -12.310 1.00 0.00 ? 345 ASN A CA   9  
ATOM   10070 C  C    . ASN A 1 38 ? 10.932  3.980   -12.773 1.00 0.00 ? 345 ASN A C    9  
ATOM   10071 O  O    . ASN A 1 38 ? 11.155  2.936   -13.386 1.00 0.00 ? 345 ASN A O    9  
ATOM   10072 C  CB   . ASN A 1 38 ? 12.455  5.885   -13.391 1.00 0.00 ? 345 ASN A CB   9  
ATOM   10073 C  CG   . ASN A 1 38 ? 12.615  5.280   -14.776 1.00 0.00 ? 345 ASN A CG   9  
ATOM   10074 O  OD1  . ASN A 1 38 ? 11.655  5.196   -15.541 1.00 0.00 ? 345 ASN A OD1  9  
ATOM   10075 N  ND2  . ASN A 1 38 ? 13.829  4.874   -15.113 1.00 0.00 ? 345 ASN A ND2  9  
ATOM   10076 H  H    . ASN A 1 38 ? 13.281  3.108   -12.447 1.00 0.00 ? 345 ASN A H    9  
ATOM   10077 H  HA   . ASN A 1 38 ? 11.809  5.360   -11.403 1.00 0.00 ? 345 ASN A HA   9  
ATOM   10078 H  HB2  . ASN A 1 38 ? 11.675  6.630   -13.436 1.00 0.00 ? 345 ASN A HB2  9  
ATOM   10079 H  HB3  . ASN A 1 38 ? 13.385  6.363   -13.119 1.00 0.00 ? 345 ASN A HB3  9  
ATOM   10080 H  HD21 . ASN A 1 38 ? 14.555  4.983   -14.463 1.00 0.00 ? 345 ASN A HD21 9  
ATOM   10081 H  HD22 . ASN A 1 38 ? 13.952  4.476   -15.999 1.00 0.00 ? 345 ASN A HD22 9  
ATOM   10082 N  N    . CYS A 1 39 ? 9.702   4.378   -12.456 1.00 0.00 ? 346 CYS A N    9  
ATOM   10083 C  CA   . CYS A 1 39 ? 8.542   3.573   -12.823 1.00 0.00 ? 346 CYS A CA   9  
ATOM   10084 C  C    . CYS A 1 39 ? 7.226   4.309   -12.552 1.00 0.00 ? 346 CYS A C    9  
ATOM   10085 O  O    . CYS A 1 39 ? 6.492   4.639   -13.484 1.00 0.00 ? 346 CYS A O    9  
ATOM   10086 C  CB   . CYS A 1 39 ? 8.572   2.254   -12.045 1.00 0.00 ? 346 CYS A CB   9  
ATOM   10087 S  SG   . CYS A 1 39 ? 7.456   0.985   -12.680 1.00 0.00 ? 346 CYS A SG   9  
ATOM   10088 H  H    . CYS A 1 39 ? 9.573   5.216   -11.966 1.00 0.00 ? 346 CYS A H    9  
ATOM   10089 H  HA   . CYS A 1 39 ? 8.608   3.357   -13.878 1.00 0.00 ? 346 CYS A HA   9  
ATOM   10090 H  HB2  . CYS A 1 39 ? 9.573   1.853   -12.075 1.00 0.00 ? 346 CYS A HB2  9  
ATOM   10091 H  HB3  . CYS A 1 39 ? 8.298   2.449   -11.017 1.00 0.00 ? 346 CYS A HB3  9  
ATOM   10092 N  N    . TYR A 1 40 ? 6.940   4.558   -11.272 1.00 0.00 ? 347 TYR A N    9  
ATOM   10093 C  CA   . TYR A 1 40 ? 5.682   5.183   -10.849 1.00 0.00 ? 347 TYR A CA   9  
ATOM   10094 C  C    . TYR A 1 40 ? 4.468   4.345   -11.280 1.00 0.00 ? 347 TYR A C    9  
ATOM   10095 O  O    . TYR A 1 40 ? 3.652   4.757   -12.105 1.00 0.00 ? 347 TYR A O    9  
ATOM   10096 C  CB   . TYR A 1 40 ? 5.579   6.625   -11.381 1.00 0.00 ? 347 TYR A CB   9  
ATOM   10097 C  CG   . TYR A 1 40 ? 4.264   7.311   -11.069 1.00 0.00 ? 347 TYR A CG   9  
ATOM   10098 C  CD1  . TYR A 1 40 ? 3.658   7.167   -9.829  1.00 0.00 ? 347 TYR A CD1  9  
ATOM   10099 C  CD2  . TYR A 1 40 ? 3.629   8.094   -12.023 1.00 0.00 ? 347 TYR A CD2  9  
ATOM   10100 C  CE1  . TYR A 1 40 ? 2.453   7.786   -9.547  1.00 0.00 ? 347 TYR A CE1  9  
ATOM   10101 C  CE2  . TYR A 1 40 ? 2.425   8.715   -11.748 1.00 0.00 ? 347 TYR A CE2  9  
ATOM   10102 C  CZ   . TYR A 1 40 ? 1.840   8.558   -10.511 1.00 0.00 ? 347 TYR A CZ   9  
ATOM   10103 O  OH   . TYR A 1 40 ? 0.638   9.176   -10.239 1.00 0.00 ? 347 TYR A OH   9  
ATOM   10104 H  H    . TYR A 1 40 ? 7.603   4.324   -10.586 1.00 0.00 ? 347 TYR A H    9  
ATOM   10105 H  HA   . TYR A 1 40 ? 5.695   5.221   -9.767  1.00 0.00 ? 347 TYR A HA   9  
ATOM   10106 H  HB2  . TYR A 1 40 ? 6.369   7.219   -10.947 1.00 0.00 ? 347 TYR A HB2  9  
ATOM   10107 H  HB3  . TYR A 1 40 ? 5.698   6.612   -12.455 1.00 0.00 ? 347 TYR A HB3  9  
ATOM   10108 H  HD1  . TYR A 1 40 ? 4.141   6.557   -9.078  1.00 0.00 ? 347 TYR A HD1  9  
ATOM   10109 H  HD2  . TYR A 1 40 ? 4.088   8.216   -12.992 1.00 0.00 ? 347 TYR A HD2  9  
ATOM   10110 H  HE1  . TYR A 1 40 ? 1.997   7.662   -8.577  1.00 0.00 ? 347 TYR A HE1  9  
ATOM   10111 H  HE2  . TYR A 1 40 ? 1.945   9.318   -12.505 1.00 0.00 ? 347 TYR A HE2  9  
ATOM   10112 H  HH   . TYR A 1 40 ? 0.054   9.085   -11.004 1.00 0.00 ? 347 TYR A HH   9  
ATOM   10113 N  N    . THR A 1 41 ? 4.392   3.133   -10.765 1.00 0.00 ? 348 THR A N    9  
ATOM   10114 C  CA   . THR A 1 41 ? 3.198   2.316   -10.928 1.00 0.00 ? 348 THR A CA   9  
ATOM   10115 C  C    . THR A 1 41 ? 2.487   2.194   -9.589  1.00 0.00 ? 348 THR A C    9  
ATOM   10116 O  O    . THR A 1 41 ? 2.945   1.455   -8.721  1.00 0.00 ? 348 THR A O    9  
ATOM   10117 C  CB   . THR A 1 41 ? 3.527   0.904   -11.449 1.00 0.00 ? 348 THR A CB   9  
ATOM   10118 O  OG1  . THR A 1 41 ? 4.631   0.951   -12.361 1.00 0.00 ? 348 THR A OG1  9  
ATOM   10119 C  CG2  . THR A 1 41 ? 2.321   0.303   -12.153 1.00 0.00 ? 348 THR A CG2  9  
ATOM   10120 H  H    . THR A 1 41 ? 5.141   2.793   -10.240 1.00 0.00 ? 348 THR A H    9  
ATOM   10121 H  HA   . THR A 1 41 ? 2.545   2.804   -11.636 1.00 0.00 ? 348 THR A HA   9  
ATOM   10122 H  HB   . THR A 1 41 ? 3.783   0.276   -10.609 1.00 0.00 ? 348 THR A HB   9  
ATOM   10123 H  HG1  . THR A 1 41 ? 4.621   1.795   -12.834 1.00 0.00 ? 348 THR A HG1  9  
ATOM   10124 H  HG21 . THR A 1 41 ? 1.493   0.245   -11.462 1.00 0.00 ? 348 THR A HG21 9  
ATOM   10125 H  HG22 . THR A 1 41 ? 2.567   -0.689  -12.503 1.00 0.00 ? 348 THR A HG22 9  
ATOM   10126 H  HG23 . THR A 1 41 ? 2.046   0.923   -12.993 1.00 0.00 ? 348 THR A HG23 9  
ATOM   10127 N  N    . ALA A 1 42 ? 1.380   2.897   -9.416  1.00 0.00 ? 349 ALA A N    9  
ATOM   10128 C  CA   . ALA A 1 42 ? 0.738   2.957   -8.112  1.00 0.00 ? 349 ALA A CA   9  
ATOM   10129 C  C    . ALA A 1 42 ? -0.450  2.008   -8.020  1.00 0.00 ? 349 ALA A C    9  
ATOM   10130 O  O    . ALA A 1 42 ? -1.271  1.917   -8.937  1.00 0.00 ? 349 ALA A O    9  
ATOM   10131 C  CB   . ALA A 1 42 ? 0.311   4.382   -7.801  1.00 0.00 ? 349 ALA A CB   9  
ATOM   10132 H  H    . ALA A 1 42 ? 0.984   3.378   -10.170 1.00 0.00 ? 349 ALA A H    9  
ATOM   10133 H  HA   . ALA A 1 42 ? 1.469   2.663   -7.374  1.00 0.00 ? 349 ALA A HA   9  
ATOM   10134 H  HB1  . ALA A 1 42 ? -0.448  4.691   -8.504  1.00 0.00 ? 349 ALA A HB1  9  
ATOM   10135 H  HB2  . ALA A 1 42 ? 1.166   5.038   -7.881  1.00 0.00 ? 349 ALA A HB2  9  
ATOM   10136 H  HB3  . ALA A 1 42 ? -0.086  4.428   -6.798  1.00 0.00 ? 349 ALA A HB3  9  
ATOM   10137 N  N    . PHE A 1 43 ? -0.510  1.288   -6.913  1.00 0.00 ? 350 PHE A N    9  
ATOM   10138 C  CA   . PHE A 1 43 ? -1.597  0.365   -6.636  1.00 0.00 ? 350 PHE A CA   9  
ATOM   10139 C  C    . PHE A 1 43 ? -1.804  0.245   -5.129  1.00 0.00 ? 350 PHE A C    9  
ATOM   10140 O  O    . PHE A 1 43 ? -1.226  1.004   -4.355  1.00 0.00 ? 350 PHE A O    9  
ATOM   10141 C  CB   . PHE A 1 43 ? -1.342  -1.012  -7.285  1.00 0.00 ? 350 PHE A CB   9  
ATOM   10142 C  CG   . PHE A 1 43 ? 0.036   -1.588  -7.066  1.00 0.00 ? 350 PHE A CG   9  
ATOM   10143 C  CD1  . PHE A 1 43 ? 1.132   -1.079  -7.748  1.00 0.00 ? 350 PHE A CD1  9  
ATOM   10144 C  CD2  . PHE A 1 43 ? 0.232   -2.654  -6.202  1.00 0.00 ? 350 PHE A CD2  9  
ATOM   10145 C  CE1  . PHE A 1 43 ? 2.391   -1.617  -7.572  1.00 0.00 ? 350 PHE A CE1  9  
ATOM   10146 C  CE2  . PHE A 1 43 ? 1.492   -3.194  -6.021  1.00 0.00 ? 350 PHE A CE2  9  
ATOM   10147 C  CZ   . PHE A 1 43 ? 2.572   -2.675  -6.707  1.00 0.00 ? 350 PHE A CZ   9  
ATOM   10148 H  H    . PHE A 1 43 ? 0.211   1.377   -6.247  1.00 0.00 ? 350 PHE A H    9  
ATOM   10149 H  HA   . PHE A 1 43 ? -2.495  0.786   -7.066  1.00 0.00 ? 350 PHE A HA   9  
ATOM   10150 H  HB2  . PHE A 1 43 ? -2.053  -1.719  -6.887  1.00 0.00 ? 350 PHE A HB2  9  
ATOM   10151 H  HB3  . PHE A 1 43 ? -1.498  -0.925  -8.350  1.00 0.00 ? 350 PHE A HB3  9  
ATOM   10152 H  HD1  . PHE A 1 43 ? 0.994   -0.250  -8.424  1.00 0.00 ? 350 PHE A HD1  9  
ATOM   10153 H  HD2  . PHE A 1 43 ? -0.611  -3.061  -5.663  1.00 0.00 ? 350 PHE A HD2  9  
ATOM   10154 H  HE1  . PHE A 1 43 ? 3.233   -1.210  -8.111  1.00 0.00 ? 350 PHE A HE1  9  
ATOM   10155 H  HE2  . PHE A 1 43 ? 1.633   -4.026  -5.351  1.00 0.00 ? 350 PHE A HE2  9  
ATOM   10156 H  HZ   . PHE A 1 43 ? 3.556   -3.098  -6.567  1.00 0.00 ? 350 PHE A HZ   9  
ATOM   10157 N  N    . HIS A 1 44 ? -2.651  -0.678  -4.709  1.00 0.00 ? 351 HIS A N    9  
ATOM   10158 C  CA   . HIS A 1 44 ? -2.939  -0.846  -3.288  1.00 0.00 ? 351 HIS A CA   9  
ATOM   10159 C  C    . HIS A 1 44 ? -2.218  -2.059  -2.728  1.00 0.00 ? 351 HIS A C    9  
ATOM   10160 O  O    . HIS A 1 44 ? -1.914  -3.000  -3.461  1.00 0.00 ? 351 HIS A O    9  
ATOM   10161 C  CB   . HIS A 1 44 ? -4.440  -1.004  -3.039  1.00 0.00 ? 351 HIS A CB   9  
ATOM   10162 C  CG   . HIS A 1 44 ? -5.234  0.259   -3.172  1.00 0.00 ? 351 HIS A CG   9  
ATOM   10163 N  ND1  . HIS A 1 44 ? -6.257  0.409   -4.092  1.00 0.00 ? 351 HIS A ND1  9  
ATOM   10164 C  CD2  . HIS A 1 44 ? -5.183  1.421   -2.475  1.00 0.00 ? 351 HIS A CD2  9  
ATOM   10165 C  CE1  . HIS A 1 44 ? -6.799  1.614   -3.946  1.00 0.00 ? 351 HIS A CE1  9  
ATOM   10166 N  NE2  . HIS A 1 44 ? -6.164  2.244   -2.975  1.00 0.00 ? 351 HIS A NE2  9  
ATOM   10167 H  H    . HIS A 1 44 ? -3.067  -1.276  -5.363  1.00 0.00 ? 351 HIS A H    9  
ATOM   10168 H  HA   . HIS A 1 44 ? -2.589  0.036   -2.773  1.00 0.00 ? 351 HIS A HA   9  
ATOM   10169 H  HB2  . HIS A 1 44 ? -4.838  -1.715  -3.747  1.00 0.00 ? 351 HIS A HB2  9  
ATOM   10170 H  HB3  . HIS A 1 44 ? -4.587  -1.381  -2.040  1.00 0.00 ? 351 HIS A HB3  9  
ATOM   10171 H  HD2  . HIS A 1 44 ? -4.500  1.655   -1.668  1.00 0.00 ? 351 HIS A HD2  9  
ATOM   10172 H  HE1  . HIS A 1 44 ? -7.626  2.007   -4.521  1.00 0.00 ? 351 HIS A HE1  9  
ATOM   10173 H  HE2  . HIS A 1 44 ? -6.225  3.209   -2.810  1.00 0.00 ? 351 HIS A HE2  9  
ATOM   10174 N  N    . VAL A 1 45 ? -1.966  -2.036  -1.426  1.00 0.00 ? 352 VAL A N    9  
ATOM   10175 C  CA   . VAL A 1 45 ? -1.349  -3.164  -0.736  1.00 0.00 ? 352 VAL A CA   9  
ATOM   10176 C  C    . VAL A 1 45 ? -2.215  -4.415  -0.880  1.00 0.00 ? 352 VAL A C    9  
ATOM   10177 O  O    . VAL A 1 45 ? -1.708  -5.521  -1.075  1.00 0.00 ? 352 VAL A O    9  
ATOM   10178 C  CB   . VAL A 1 45 ? -1.135  -2.858  0.762   1.00 0.00 ? 352 VAL A CB   9  
ATOM   10179 C  CG1  . VAL A 1 45 ? -0.447  -4.021  1.467   1.00 0.00 ? 352 VAL A CG1  9  
ATOM   10180 C  CG2  . VAL A 1 45 ? -0.331  -1.578  0.935   1.00 0.00 ? 352 VAL A CG2  9  
ATOM   10181 H  H    . VAL A 1 45 ? -2.192  -1.229  -0.911  1.00 0.00 ? 352 VAL A H    9  
ATOM   10182 H  HA   . VAL A 1 45 ? -0.386  -3.349  -1.190  1.00 0.00 ? 352 VAL A HA   9  
ATOM   10183 H  HB   . VAL A 1 45 ? -2.103  -2.714  1.219   1.00 0.00 ? 352 VAL A HB   9  
ATOM   10184 H  HG11 . VAL A 1 45 ? -0.291  -3.771  2.506   1.00 0.00 ? 352 VAL A HG11 9  
ATOM   10185 H  HG12 . VAL A 1 45 ? 0.505   -4.212  0.997   1.00 0.00 ? 352 VAL A HG12 9  
ATOM   10186 H  HG13 . VAL A 1 45 ? -1.066  -4.904  1.397   1.00 0.00 ? 352 VAL A HG13 9  
ATOM   10187 H  HG21 . VAL A 1 45 ? -0.867  -0.753  0.489   1.00 0.00 ? 352 VAL A HG21 9  
ATOM   10188 H  HG22 . VAL A 1 45 ? 0.628   -1.688  0.453   1.00 0.00 ? 352 VAL A HG22 9  
ATOM   10189 H  HG23 . VAL A 1 45 ? -0.185  -1.385  1.988   1.00 0.00 ? 352 VAL A HG23 9  
ATOM   10190 N  N    . THR A 1 46 ? -3.530  -4.228  -0.808  1.00 0.00 ? 353 THR A N    9  
ATOM   10191 C  CA   . THR A 1 46 ? -4.466  -5.333  -0.975  1.00 0.00 ? 353 THR A CA   9  
ATOM   10192 C  C    . THR A 1 46 ? -4.411  -5.880  -2.403  1.00 0.00 ? 353 THR A C    9  
ATOM   10193 O  O    . THR A 1 46 ? -4.626  -7.065  -2.625  1.00 0.00 ? 353 THR A O    9  
ATOM   10194 C  CB   . THR A 1 46 ? -5.919  -4.919  -0.626  1.00 0.00 ? 353 THR A CB   9  
ATOM   10195 O  OG1  . THR A 1 46 ? -6.809  -6.031  -0.784  1.00 0.00 ? 353 THR A OG1  9  
ATOM   10196 C  CG2  . THR A 1 46 ? -6.390  -3.772  -1.506  1.00 0.00 ? 353 THR A CG2  9  
ATOM   10197 H  H    . THR A 1 46 ? -3.876  -3.331  -0.622  1.00 0.00 ? 353 THR A H    9  
ATOM   10198 H  HA   . THR A 1 46 ? -4.168  -6.118  -0.294  1.00 0.00 ? 353 THR A HA   9  
ATOM   10199 H  HB   . THR A 1 46 ? -5.946  -4.592  0.404   1.00 0.00 ? 353 THR A HB   9  
ATOM   10200 H  HG1  . THR A 1 46 ? -6.894  -6.496  0.057   1.00 0.00 ? 353 THR A HG1  9  
ATOM   10201 H  HG21 . THR A 1 46 ? -6.362  -4.080  -2.541  1.00 0.00 ? 353 THR A HG21 9  
ATOM   10202 H  HG22 . THR A 1 46 ? -5.742  -2.922  -1.366  1.00 0.00 ? 353 THR A HG22 9  
ATOM   10203 H  HG23 . THR A 1 46 ? -7.401  -3.503  -1.238  1.00 0.00 ? 353 THR A HG23 9  
ATOM   10204 N  N    . CYS A 1 47 ? -4.086  -5.018  -3.367  1.00 0.00 ? 354 CYS A N    9  
ATOM   10205 C  CA   . CYS A 1 47 ? -4.028  -5.432  -4.763  1.00 0.00 ? 354 CYS A CA   9  
ATOM   10206 C  C    . CYS A 1 47 ? -2.839  -6.353  -5.004  1.00 0.00 ? 354 CYS A C    9  
ATOM   10207 O  O    . CYS A 1 47 ? -2.917  -7.277  -5.805  1.00 0.00 ? 354 CYS A O    9  
ATOM   10208 C  CB   . CYS A 1 47 ? -3.943  -4.215  -5.688  1.00 0.00 ? 354 CYS A CB   9  
ATOM   10209 S  SG   . CYS A 1 47 ? -5.391  -3.131  -5.626  1.00 0.00 ? 354 CYS A SG   9  
ATOM   10210 H  H    . CYS A 1 47 ? -3.862  -4.098  -3.131  1.00 0.00 ? 354 CYS A H    9  
ATOM   10211 H  HA   . CYS A 1 47 ? -4.936  -5.975  -4.984  1.00 0.00 ? 354 CYS A HA   9  
ATOM   10212 H  HB2  . CYS A 1 47 ? -3.082  -3.624  -5.411  1.00 0.00 ? 354 CYS A HB2  9  
ATOM   10213 H  HB3  . CYS A 1 47 ? -3.827  -4.554  -6.707  1.00 0.00 ? 354 CYS A HB3  9  
ATOM   10214 N  N    . ALA A 1 48 ? -1.748  -6.106  -4.291  1.00 0.00 ? 355 ALA A N    9  
ATOM   10215 C  CA   . ALA A 1 48 ? -0.551  -6.926  -4.425  1.00 0.00 ? 355 ALA A CA   9  
ATOM   10216 C  C    . ALA A 1 48 ? -0.799  -8.331  -3.900  1.00 0.00 ? 355 ALA A C    9  
ATOM   10217 O  O    . ALA A 1 48 ? -0.430  -9.320  -4.534  1.00 0.00 ? 355 ALA A O    9  
ATOM   10218 C  CB   . ALA A 1 48 ? 0.612   -6.281  -3.691  1.00 0.00 ? 355 ALA A CB   9  
ATOM   10219 H  H    . ALA A 1 48 ? -1.745  -5.352  -3.664  1.00 0.00 ? 355 ALA A H    9  
ATOM   10220 H  HA   . ALA A 1 48 ? -0.304  -6.987  -5.474  1.00 0.00 ? 355 ALA A HA   9  
ATOM   10221 H  HB1  . ALA A 1 48 ? 1.505   -6.871  -3.840  1.00 0.00 ? 355 ALA A HB1  9  
ATOM   10222 H  HB2  . ALA A 1 48 ? 0.387   -6.230  -2.636  1.00 0.00 ? 355 ALA A HB2  9  
ATOM   10223 H  HB3  . ALA A 1 48 ? 0.770   -5.285  -4.073  1.00 0.00 ? 355 ALA A HB3  9  
ATOM   10224 N  N    . GLN A 1 49 ? -1.446  -8.407  -2.747  1.00 0.00 ? 356 GLN A N    9  
ATOM   10225 C  CA   . GLN A 1 49 ? -1.780  -9.683  -2.130  1.00 0.00 ? 356 GLN A CA   9  
ATOM   10226 C  C    . GLN A 1 49 ? -2.889  -10.377 -2.912  1.00 0.00 ? 356 GLN A C    9  
ATOM   10227 O  O    . GLN A 1 49 ? -3.038  -11.596 -2.863  1.00 0.00 ? 356 GLN A O    9  
ATOM   10228 C  CB   . GLN A 1 49 ? -2.220  -9.466  -0.684  1.00 0.00 ? 356 GLN A CB   9  
ATOM   10229 C  CG   . GLN A 1 49 ? -1.172  -8.767  0.166   1.00 0.00 ? 356 GLN A CG   9  
ATOM   10230 C  CD   . GLN A 1 49 ? -1.689  -8.411  1.543   1.00 0.00 ? 356 GLN A CD   9  
ATOM   10231 O  OE1  . GLN A 1 49 ? -1.582  -9.196  2.484   1.00 0.00 ? 356 GLN A OE1  9  
ATOM   10232 N  NE2  . GLN A 1 49 ? -2.252  -7.222  1.669   1.00 0.00 ? 356 GLN A NE2  9  
ATOM   10233 H  H    . GLN A 1 49 ? -1.706  -7.578  -2.292  1.00 0.00 ? 356 GLN A H    9  
ATOM   10234 H  HA   . GLN A 1 49 ? -0.895  -10.303 -2.145  1.00 0.00 ? 356 GLN A HA   9  
ATOM   10235 H  HB2  . GLN A 1 49 ? -3.121  -8.855  -0.681  1.00 0.00 ? 356 GLN A HB2  9  
ATOM   10236 H  HB3  . GLN A 1 49 ? -2.434  -10.433 -0.233  1.00 0.00 ? 356 GLN A HB3  9  
ATOM   10237 H  HG2  . GLN A 1 49 ? -0.315  -9.429  0.280   1.00 0.00 ? 356 GLN A HG2  9  
ATOM   10238 H  HG3  . GLN A 1 49 ? -0.872  -7.848  -0.340  1.00 0.00 ? 356 GLN A HG3  9  
ATOM   10239 H  HE21 . GLN A 1 49 ? -2.300  -6.648  0.875   1.00 0.00 ? 356 GLN A HE21 9  
ATOM   10240 H  HE22 . GLN A 1 49 ? -2.605  -6.966  2.545   1.00 0.00 ? 356 GLN A HE22 9  
ATOM   10241 N  N    . LYS A 1 50 ? -3.666  -9.583  -3.630  1.00 0.00 ? 357 LYS A N    9  
ATOM   10242 C  CA   . LYS A 1 50 ? -4.792  -10.095 -4.390  1.00 0.00 ? 357 LYS A CA   9  
ATOM   10243 C  C    . LYS A 1 50 ? -4.334  -10.623 -5.746  1.00 0.00 ? 357 LYS A C    9  
ATOM   10244 O  O    . LYS A 1 50 ? -4.797  -11.665 -6.205  1.00 0.00 ? 357 LYS A O    9  
ATOM   10245 C  CB   . LYS A 1 50 ? -5.822  -8.983  -4.578  1.00 0.00 ? 357 LYS A CB   9  
ATOM   10246 C  CG   . LYS A 1 50 ? -7.239  -9.471  -4.826  1.00 0.00 ? 357 LYS A CG   9  
ATOM   10247 C  CD   . LYS A 1 50 ? -8.214  -8.302  -4.909  1.00 0.00 ? 357 LYS A CD   9  
ATOM   10248 C  CE   . LYS A 1 50 ? -8.177  -7.439  -3.652  1.00 0.00 ? 357 LYS A CE   9  
ATOM   10249 N  NZ   . LYS A 1 50 ? -8.520  -8.207  -2.422  1.00 0.00 ? 357 LYS A NZ   9  
ATOM   10250 H  H    . LYS A 1 50 ? -3.485  -8.620  -3.637  1.00 0.00 ? 357 LYS A H    9  
ATOM   10251 H  HA   . LYS A 1 50 ? -5.238  -10.900 -3.828  1.00 0.00 ? 357 LYS A HA   9  
ATOM   10252 H  HB2  . LYS A 1 50 ? -5.829  -8.370  -3.690  1.00 0.00 ? 357 LYS A HB2  9  
ATOM   10253 H  HB3  . LYS A 1 50 ? -5.524  -8.374  -5.419  1.00 0.00 ? 357 LYS A HB3  9  
ATOM   10254 H  HG2  . LYS A 1 50 ? -7.265  -10.017 -5.766  1.00 0.00 ? 357 LYS A HG2  9  
ATOM   10255 H  HG3  . LYS A 1 50 ? -7.536  -10.122 -4.006  1.00 0.00 ? 357 LYS A HG3  9  
ATOM   10256 H  HD2  . LYS A 1 50 ? -7.952  -7.690  -5.758  1.00 0.00 ? 357 LYS A HD2  9  
ATOM   10257 H  HD3  . LYS A 1 50 ? -9.213  -8.689  -5.038  1.00 0.00 ? 357 LYS A HD3  9  
ATOM   10258 H  HE2  . LYS A 1 50 ? -7.184  -7.030  -3.543  1.00 0.00 ? 357 LYS A HE2  9  
ATOM   10259 H  HE3  . LYS A 1 50 ? -8.884  -6.630  -3.768  1.00 0.00 ? 357 LYS A HE3  9  
ATOM   10260 H  HZ1  . LYS A 1 50 ? -8.511  -7.578  -1.592  1.00 0.00 ? 357 LYS A HZ1  9  
ATOM   10261 H  HZ2  . LYS A 1 50 ? -7.829  -8.968  -2.270  1.00 0.00 ? 357 LYS A HZ2  9  
ATOM   10262 H  HZ3  . LYS A 1 50 ? -9.466  -8.626  -2.514  1.00 0.00 ? 357 LYS A HZ3  9  
ATOM   10263 N  N    . ALA A 1 51 ? -3.421  -9.896  -6.381  1.00 0.00 ? 358 ALA A N    9  
ATOM   10264 C  CA   . ALA A 1 51 ? -2.915  -10.284 -7.693  1.00 0.00 ? 358 ALA A CA   9  
ATOM   10265 C  C    . ALA A 1 51 ? -1.860  -11.377 -7.578  1.00 0.00 ? 358 ALA A C    9  
ATOM   10266 O  O    . ALA A 1 51 ? -1.748  -12.239 -8.450  1.00 0.00 ? 358 ALA A O    9  
ATOM   10267 C  CB   . ALA A 1 51 ? -2.348  -9.076  -8.423  1.00 0.00 ? 358 ALA A CB   9  
ATOM   10268 H  H    . ALA A 1 51 ? -3.087  -9.067  -5.963  1.00 0.00 ? 358 ALA A H    9  
ATOM   10269 H  HA   . ALA A 1 51 ? -3.747  -10.663 -8.268  1.00 0.00 ? 358 ALA A HA   9  
ATOM   10270 H  HB1  . ALA A 1 51 ? -3.108  -8.313  -8.503  1.00 0.00 ? 358 ALA A HB1  9  
ATOM   10271 H  HB2  . ALA A 1 51 ? -2.027  -9.368  -9.412  1.00 0.00 ? 358 ALA A HB2  9  
ATOM   10272 H  HB3  . ALA A 1 51 ? -1.503  -8.686  -7.872  1.00 0.00 ? 358 ALA A HB3  9  
ATOM   10273 N  N    . GLY A 1 52 ? -1.091  -11.337 -6.500  1.00 0.00 ? 359 GLY A N    9  
ATOM   10274 C  CA   . GLY A 1 52 ? -0.041  -12.314 -6.303  1.00 0.00 ? 359 GLY A CA   9  
ATOM   10275 C  C    . GLY A 1 52 ? 1.214   -11.953 -7.067  1.00 0.00 ? 359 GLY A C    9  
ATOM   10276 O  O    . GLY A 1 52 ? 1.857   -12.811 -7.674  1.00 0.00 ? 359 GLY A O    9  
ATOM   10277 H  H    . GLY A 1 52 ? -1.237  -10.637 -5.828  1.00 0.00 ? 359 GLY A H    9  
ATOM   10278 H  HA2  . GLY A 1 52 ? 0.192   -12.373 -5.250  1.00 0.00 ? 359 GLY A HA2  9  
ATOM   10279 H  HA3  . GLY A 1 52 ? -0.392  -13.279 -6.641  1.00 0.00 ? 359 GLY A HA3  9  
ATOM   10280 N  N    . LEU A 1 53 ? 1.562   -10.675 -7.041  1.00 0.00 ? 360 LEU A N    9  
ATOM   10281 C  CA   . LEU A 1 53 ? 2.743   -10.191 -7.740  1.00 0.00 ? 360 LEU A CA   9  
ATOM   10282 C  C    . LEU A 1 53 ? 3.975   -10.277 -6.842  1.00 0.00 ? 360 LEU A C    9  
ATOM   10283 O  O    . LEU A 1 53 ? 3.912   -10.830 -5.742  1.00 0.00 ? 360 LEU A O    9  
ATOM   10284 C  CB   . LEU A 1 53 ? 2.512   -8.759  -8.254  1.00 0.00 ? 360 LEU A CB   9  
ATOM   10285 C  CG   . LEU A 1 53 ? 1.953   -7.754  -7.233  1.00 0.00 ? 360 LEU A CG   9  
ATOM   10286 C  CD1  . LEU A 1 53 ? 3.042   -7.248  -6.300  1.00 0.00 ? 360 LEU A CD1  9  
ATOM   10287 C  CD2  . LEU A 1 53 ? 1.281   -6.591  -7.950  1.00 0.00 ? 360 LEU A CD2  9  
ATOM   10288 H  H    . LEU A 1 53 ? 1.015   -10.043 -6.531  1.00 0.00 ? 360 LEU A H    9  
ATOM   10289 H  HA   . LEU A 1 53 ? 2.900   -10.839 -8.590  1.00 0.00 ? 360 LEU A HA   9  
ATOM   10290 H  HB2  . LEU A 1 53 ? 3.470   -8.372  -8.610  1.00 0.00 ? 360 LEU A HB2  9  
ATOM   10291 H  HB3  . LEU A 1 53 ? 1.810   -8.813  -9.090  1.00 0.00 ? 360 LEU A HB3  9  
ATOM   10292 H  HG   . LEU A 1 53 ? 1.204   -8.247  -6.628  1.00 0.00 ? 360 LEU A HG   9  
ATOM   10293 H  HD11 . LEU A 1 53 ? 3.826   -6.782  -6.879  1.00 0.00 ? 360 LEU A HD11 9  
ATOM   10294 H  HD12 . LEU A 1 53 ? 3.451   -8.077  -5.740  1.00 0.00 ? 360 LEU A HD12 9  
ATOM   10295 H  HD13 . LEU A 1 53 ? 2.622   -6.525  -5.617  1.00 0.00 ? 360 LEU A HD13 9  
ATOM   10296 H  HD21 . LEU A 1 53 ? 0.942   -5.867  -7.223  1.00 0.00 ? 360 LEU A HD21 9  
ATOM   10297 H  HD22 . LEU A 1 53 ? 0.437   -6.956  -8.515  1.00 0.00 ? 360 LEU A HD22 9  
ATOM   10298 H  HD23 . LEU A 1 53 ? 1.988   -6.124  -8.621  1.00 0.00 ? 360 LEU A HD23 9  
ATOM   10299 N  N    . TYR A 1 54 ? 5.093   -9.744  -7.314  1.00 0.00 ? 361 TYR A N    9  
ATOM   10300 C  CA   . TYR A 1 54 ? 6.340   -9.803  -6.564  1.00 0.00 ? 361 TYR A CA   9  
ATOM   10301 C  C    . TYR A 1 54 ? 6.369   -8.722  -5.487  1.00 0.00 ? 361 TYR A C    9  
ATOM   10302 O  O    . TYR A 1 54 ? 6.439   -7.528  -5.786  1.00 0.00 ? 361 TYR A O    9  
ATOM   10303 C  CB   . TYR A 1 54 ? 7.541   -9.648  -7.501  1.00 0.00 ? 361 TYR A CB   9  
ATOM   10304 C  CG   . TYR A 1 54 ? 8.876   -9.864  -6.820  1.00 0.00 ? 361 TYR A CG   9  
ATOM   10305 C  CD1  . TYR A 1 54 ? 9.563   -8.808  -6.232  1.00 0.00 ? 361 TYR A CD1  9  
ATOM   10306 C  CD2  . TYR A 1 54 ? 9.450   -11.128 -6.765  1.00 0.00 ? 361 TYR A CD2  9  
ATOM   10307 C  CE1  . TYR A 1 54 ? 10.782  -9.005  -5.611  1.00 0.00 ? 361 TYR A CE1  9  
ATOM   10308 C  CE2  . TYR A 1 54 ? 10.668  -11.332 -6.146  1.00 0.00 ? 361 TYR A CE2  9  
ATOM   10309 C  CZ   . TYR A 1 54 ? 11.329  -10.269 -5.570  1.00 0.00 ? 361 TYR A CZ   9  
ATOM   10310 O  OH   . TYR A 1 54 ? 12.544  -10.470 -4.952  1.00 0.00 ? 361 TYR A OH   9  
ATOM   10311 H  H    . TYR A 1 54 ? 5.079   -9.289  -8.181  1.00 0.00 ? 361 TYR A H    9  
ATOM   10312 H  HA   . TYR A 1 54 ? 6.389   -10.769 -6.085  1.00 0.00 ? 361 TYR A HA   9  
ATOM   10313 H  HB2  . TYR A 1 54 ? 7.458   -10.366 -8.302  1.00 0.00 ? 361 TYR A HB2  9  
ATOM   10314 H  HB3  . TYR A 1 54 ? 7.537   -8.651  -7.916  1.00 0.00 ? 361 TYR A HB3  9  
ATOM   10315 H  HD1  . TYR A 1 54 ? 9.132   -7.819  -6.264  1.00 0.00 ? 361 TYR A HD1  9  
ATOM   10316 H  HD2  . TYR A 1 54 ? 8.930   -11.960 -7.217  1.00 0.00 ? 361 TYR A HD2  9  
ATOM   10317 H  HE1  . TYR A 1 54 ? 11.301  -8.170  -5.162  1.00 0.00 ? 361 TYR A HE1  9  
ATOM   10318 H  HE2  . TYR A 1 54 ? 11.096  -12.322 -6.112  1.00 0.00 ? 361 TYR A HE2  9  
ATOM   10319 H  HH   . TYR A 1 54 ? 13.089  -11.051 -5.493  1.00 0.00 ? 361 TYR A HH   9  
ATOM   10320 N  N    . MET A 1 55 ? 6.317   -9.152  -4.238  1.00 0.00 ? 362 MET A N    9  
ATOM   10321 C  CA   . MET A 1 55 ? 6.341   -8.234  -3.112  1.00 0.00 ? 362 MET A CA   9  
ATOM   10322 C  C    . MET A 1 55 ? 7.419   -8.670  -2.126  1.00 0.00 ? 362 MET A C    9  
ATOM   10323 O  O    . MET A 1 55 ? 7.345   -9.762  -1.562  1.00 0.00 ? 362 MET A O    9  
ATOM   10324 C  CB   . MET A 1 55 ? 4.973   -8.205  -2.427  1.00 0.00 ? 362 MET A CB   9  
ATOM   10325 C  CG   . MET A 1 55 ? 4.766   -7.006  -1.515  1.00 0.00 ? 362 MET A CG   9  
ATOM   10326 S  SD   . MET A 1 55 ? 3.212   -7.090  -0.601  1.00 0.00 ? 362 MET A SD   9  
ATOM   10327 C  CE   . MET A 1 55 ? 3.205   -5.484  0.193   1.00 0.00 ? 362 MET A CE   9  
ATOM   10328 H  H    . MET A 1 55 ? 6.265   -10.119 -4.067  1.00 0.00 ? 362 MET A H    9  
ATOM   10329 H  HA   . MET A 1 55 ? 6.579   -7.248  -3.484  1.00 0.00 ? 362 MET A HA   9  
ATOM   10330 H  HB2  . MET A 1 55 ? 4.205   -8.187  -3.186  1.00 0.00 ? 362 MET A HB2  9  
ATOM   10331 H  HB3  . MET A 1 55 ? 4.861   -9.102  -1.837  1.00 0.00 ? 362 MET A HB3  9  
ATOM   10332 H  HG2  . MET A 1 55 ? 5.583   -6.955  -0.813  1.00 0.00 ? 362 MET A HG2  9  
ATOM   10333 H  HG3  . MET A 1 55 ? 4.761   -6.111  -2.120  1.00 0.00 ? 362 MET A HG3  9  
ATOM   10334 H  HE1  . MET A 1 55 ? 2.337   -5.403  0.832   1.00 0.00 ? 362 MET A HE1  9  
ATOM   10335 H  HE2  . MET A 1 55 ? 3.173   -4.710  -0.559  1.00 0.00 ? 362 MET A HE2  9  
ATOM   10336 H  HE3  . MET A 1 55 ? 4.100   -5.373  0.786   1.00 0.00 ? 362 MET A HE3  9  
ATOM   10337 N  N    . LYS A 1 56 ? 8.416   -7.823  -1.923  1.00 0.00 ? 363 LYS A N    9  
ATOM   10338 C  CA   . LYS A 1 56 ? 9.565   -8.183  -1.108  1.00 0.00 ? 363 LYS A CA   9  
ATOM   10339 C  C    . LYS A 1 56 ? 9.704   -7.230  0.074   1.00 0.00 ? 363 LYS A C    9  
ATOM   10340 O  O    . LYS A 1 56 ? 9.260   -6.079  0.017   1.00 0.00 ? 363 LYS A O    9  
ATOM   10341 C  CB   . LYS A 1 56 ? 10.839  -8.140  -1.959  1.00 0.00 ? 363 LYS A CB   9  
ATOM   10342 C  CG   . LYS A 1 56 ? 11.952  -9.040  -1.443  1.00 0.00 ? 363 LYS A CG   9  
ATOM   10343 C  CD   . LYS A 1 56 ? 13.234  -8.846  -2.235  1.00 0.00 ? 363 LYS A CD   9  
ATOM   10344 C  CE   . LYS A 1 56 ? 14.292  -9.867  -1.850  1.00 0.00 ? 363 LYS A CE   9  
ATOM   10345 N  NZ   . LYS A 1 56 ? 15.617  -9.533  -2.436  1.00 0.00 ? 363 LYS A NZ   9  
ATOM   10346 H  H    . LYS A 1 56 ? 8.377   -6.926  -2.322  1.00 0.00 ? 363 LYS A H    9  
ATOM   10347 H  HA   . LYS A 1 56 ? 9.416   -9.186  -0.740  1.00 0.00 ? 363 LYS A HA   9  
ATOM   10348 H  HB2  . LYS A 1 56 ? 10.592  -8.453  -2.974  1.00 0.00 ? 363 LYS A HB2  9  
ATOM   10349 H  HB3  . LYS A 1 56 ? 11.212  -7.114  -1.970  1.00 0.00 ? 363 LYS A HB3  9  
ATOM   10350 H  HG2  . LYS A 1 56 ? 12.140  -8.803  -0.406  1.00 0.00 ? 363 LYS A HG2  9  
ATOM   10351 H  HG3  . LYS A 1 56 ? 11.639  -10.069 -1.528  1.00 0.00 ? 363 LYS A HG3  9  
ATOM   10352 H  HD2  . LYS A 1 56 ? 13.014  -8.949  -3.286  1.00 0.00 ? 363 LYS A HD2  9  
ATOM   10353 H  HD3  . LYS A 1 56 ? 13.616  -7.854  -2.042  1.00 0.00 ? 363 LYS A HD3  9  
ATOM   10354 H  HE2  . LYS A 1 56 ? 14.379  -9.892  -0.774  1.00 0.00 ? 363 LYS A HE2  9  
ATOM   10355 H  HE3  . LYS A 1 56 ? 13.984  -10.838 -2.208  1.00 0.00 ? 363 LYS A HE3  9  
ATOM   10356 H  HZ1  . LYS A 1 56 ? 15.526  -9.349  -3.454  1.00 0.00 ? 363 LYS A HZ1  9  
ATOM   10357 H  HZ2  . LYS A 1 56 ? 16.283  -10.319 -2.291  1.00 0.00 ? 363 LYS A HZ2  9  
ATOM   10358 H  HZ3  . LYS A 1 56 ? 16.007  -8.680  -1.974  1.00 0.00 ? 363 LYS A HZ3  9  
ATOM   10359 N  N    . MET A 1 57 ? 10.327  -7.708  1.140   1.00 0.00 ? 364 MET A N    9  
ATOM   10360 C  CA   . MET A 1 57 ? 10.552  -6.911  2.333   1.00 0.00 ? 364 MET A CA   9  
ATOM   10361 C  C    . MET A 1 57 ? 11.891  -7.312  2.915   1.00 0.00 ? 364 MET A C    9  
ATOM   10362 O  O    . MET A 1 57 ? 12.039  -8.395  3.482   1.00 0.00 ? 364 MET A O    9  
ATOM   10363 C  CB   . MET A 1 57 ? 9.434   -7.115  3.365   1.00 0.00 ? 364 MET A CB   9  
ATOM   10364 C  CG   . MET A 1 57 ? 8.043   -6.844  2.821   1.00 0.00 ? 364 MET A CG   9  
ATOM   10365 S  SD   . MET A 1 57 ? 6.751   -6.994  4.068   1.00 0.00 ? 364 MET A SD   9  
ATOM   10366 C  CE   . MET A 1 57 ? 5.295   -6.726  3.061   1.00 0.00 ? 364 MET A CE   9  
ATOM   10367 H  H    . MET A 1 57 ? 10.687  -8.622  1.115   1.00 0.00 ? 364 MET A H    9  
ATOM   10368 H  HA   . MET A 1 57 ? 10.590  -5.872  2.041   1.00 0.00 ? 364 MET A HA   9  
ATOM   10369 H  HB2  . MET A 1 57 ? 9.466   -8.130  3.717   1.00 0.00 ? 364 MET A HB2  9  
ATOM   10370 H  HB3  . MET A 1 57 ? 9.605   -6.451  4.201   1.00 0.00 ? 364 MET A HB3  9  
ATOM   10371 H  HG2  . MET A 1 57 ? 8.020   -5.844  2.418   1.00 0.00 ? 364 MET A HG2  9  
ATOM   10372 H  HG3  . MET A 1 57 ? 7.842   -7.551  2.030   1.00 0.00 ? 364 MET A HG3  9  
ATOM   10373 H  HE1  . MET A 1 57 ? 4.410   -6.824  3.672   1.00 0.00 ? 364 MET A HE1  9  
ATOM   10374 H  HE2  . MET A 1 57 ? 5.267   -7.458  2.265   1.00 0.00 ? 364 MET A HE2  9  
ATOM   10375 H  HE3  . MET A 1 57 ? 5.330   -5.734  2.634   1.00 0.00 ? 364 MET A HE3  9  
ATOM   10376 N  N    . GLU A 1 58 ? 12.868  -6.452  2.746   1.00 0.00 ? 365 GLU A N    9  
ATOM   10377 C  CA   . GLU A 1 58 ? 14.238  -6.791  3.066   1.00 0.00 ? 365 GLU A CA   9  
ATOM   10378 C  C    . GLU A 1 58 ? 14.707  -6.078  4.328   1.00 0.00 ? 365 GLU A C    9  
ATOM   10379 O  O    . GLU A 1 58 ? 14.664  -4.859  4.405   1.00 0.00 ? 365 GLU A O    9  
ATOM   10380 C  CB   . GLU A 1 58 ? 15.117  -6.398  1.887   1.00 0.00 ? 365 GLU A CB   9  
ATOM   10381 C  CG   . GLU A 1 58 ? 14.789  -7.134  0.603   1.00 0.00 ? 365 GLU A CG   9  
ATOM   10382 C  CD   . GLU A 1 58 ? 15.628  -6.662  -0.565  1.00 0.00 ? 365 GLU A CD   9  
ATOM   10383 O  OE1  . GLU A 1 58 ? 15.397  -5.540  -1.057  1.00 0.00 ? 365 GLU A OE1  9  
ATOM   10384 O  OE2  . GLU A 1 58 ? 16.512  -7.423  -1.012  1.00 0.00 ? 365 GLU A OE2  9  
ATOM   10385 H  H    . GLU A 1 58 ? 12.667  -5.556  2.396   1.00 0.00 ? 365 GLU A H    9  
ATOM   10386 H  HA   . GLU A 1 58 ? 14.299  -7.856  3.213   1.00 0.00 ? 365 GLU A HA   9  
ATOM   10387 H  HB2  . GLU A 1 58 ? 14.981  -5.347  1.704   1.00 0.00 ? 365 GLU A HB2  9  
ATOM   10388 H  HB3  . GLU A 1 58 ? 16.146  -6.590  2.138   1.00 0.00 ? 365 GLU A HB3  9  
ATOM   10389 H  HG2  . GLU A 1 58 ? 14.966  -8.187  0.751   1.00 0.00 ? 365 GLU A HG2  9  
ATOM   10390 H  HG3  . GLU A 1 58 ? 13.746  -6.973  0.367   1.00 0.00 ? 365 GLU A HG3  9  
ATOM   10391 N  N    . PRO A 1 59 ? 15.153  -6.827  5.338   1.00 0.00 ? 366 PRO A N    9  
ATOM   10392 C  CA   . PRO A 1 59 ? 15.720  -6.259  6.549   1.00 0.00 ? 366 PRO A CA   9  
ATOM   10393 C  C    . PRO A 1 59 ? 17.243  -6.168  6.485   1.00 0.00 ? 366 PRO A C    9  
ATOM   10394 O  O    . PRO A 1 59 ? 17.930  -7.181  6.347   1.00 0.00 ? 366 PRO A O    9  
ATOM   10395 C  CB   . PRO A 1 59 ? 15.282  -7.266  7.608   1.00 0.00 ? 366 PRO A CB   9  
ATOM   10396 C  CG   . PRO A 1 59 ? 15.211  -8.583  6.895   1.00 0.00 ? 366 PRO A CG   9  
ATOM   10397 C  CD   . PRO A 1 59 ? 15.101  -8.292  5.411   1.00 0.00 ? 366 PRO A CD   9  
ATOM   10398 H  HA   . PRO A 1 59 ? 15.305  -5.286  6.772   1.00 0.00 ? 366 PRO A HA   9  
ATOM   10399 H  HB2  . PRO A 1 59 ? 16.008  -7.288  8.409   1.00 0.00 ? 366 PRO A HB2  9  
ATOM   10400 H  HB3  . PRO A 1 59 ? 14.317  -6.980  8.001   1.00 0.00 ? 366 PRO A HB3  9  
ATOM   10401 H  HG2  . PRO A 1 59 ? 16.107  -9.152  7.093   1.00 0.00 ? 366 PRO A HG2  9  
ATOM   10402 H  HG3  . PRO A 1 59 ? 14.342  -9.130  7.232   1.00 0.00 ? 366 PRO A HG3  9  
ATOM   10403 H  HD2  . PRO A 1 59 ? 15.930  -8.730  4.877   1.00 0.00 ? 366 PRO A HD2  9  
ATOM   10404 H  HD3  . PRO A 1 59 ? 14.164  -8.665  5.024   1.00 0.00 ? 366 PRO A HD3  9  
ATOM   10405 N  N    . VAL A 1 60 ? 17.775  -4.962  6.567   1.00 0.00 ? 367 VAL A N    9  
ATOM   10406 C  CA   . VAL A 1 60 ? 19.215  -4.789  6.567   1.00 0.00 ? 367 VAL A CA   9  
ATOM   10407 C  C    . VAL A 1 60 ? 19.691  -4.441  7.977   1.00 0.00 ? 367 VAL A C    9  
ATOM   10408 O  O    . VAL A 1 60 ? 19.105  -3.590  8.652   1.00 0.00 ? 367 VAL A O    9  
ATOM   10409 C  CB   . VAL A 1 60 ? 19.678  -3.733  5.525   1.00 0.00 ? 367 VAL A CB   9  
ATOM   10410 C  CG1  . VAL A 1 60 ? 19.384  -2.314  5.953   1.00 0.00 ? 367 VAL A CG1  9  
ATOM   10411 C  CG2  . VAL A 1 60 ? 21.148  -3.908  5.192   1.00 0.00 ? 367 VAL A CG2  9  
ATOM   10412 H  H    . VAL A 1 60 ? 17.189  -4.174  6.641   1.00 0.00 ? 367 VAL A H    9  
ATOM   10413 H  HA   . VAL A 1 60 ? 19.650  -5.741  6.293   1.00 0.00 ? 367 VAL A HA   9  
ATOM   10414 H  HB   . VAL A 1 60 ? 19.112  -3.898  4.630   1.00 0.00 ? 367 VAL A HB   9  
ATOM   10415 H  HG11 . VAL A 1 60 ? 18.320  -2.147  5.905   1.00 0.00 ? 367 VAL A HG11 9  
ATOM   10416 H  HG12 . VAL A 1 60 ? 19.887  -1.627  5.287   1.00 0.00 ? 367 VAL A HG12 9  
ATOM   10417 H  HG13 . VAL A 1 60 ? 19.735  -2.165  6.962   1.00 0.00 ? 367 VAL A HG13 9  
ATOM   10418 H  HG21 . VAL A 1 60 ? 21.737  -3.791  6.090   1.00 0.00 ? 367 VAL A HG21 9  
ATOM   10419 H  HG22 . VAL A 1 60 ? 21.443  -3.163  4.468   1.00 0.00 ? 367 VAL A HG22 9  
ATOM   10420 H  HG23 . VAL A 1 60 ? 21.308  -4.894  4.782   1.00 0.00 ? 367 VAL A HG23 9  
ATOM   10421 N  N    . LYS A 1 61 ? 20.716  -5.144  8.441   1.00 0.00 ? 368 LYS A N    9  
ATOM   10422 C  CA   . LYS A 1 61 ? 21.202  -4.963  9.799   1.00 0.00 ? 368 LYS A CA   9  
ATOM   10423 C  C    . LYS A 1 61 ? 22.307  -3.921  9.849   1.00 0.00 ? 368 LYS A C    9  
ATOM   10424 O  O    . LYS A 1 61 ? 23.369  -4.095  9.251   1.00 0.00 ? 368 LYS A O    9  
ATOM   10425 C  CB   . LYS A 1 61 ? 21.720  -6.282  10.374  1.00 0.00 ? 368 LYS A CB   9  
ATOM   10426 C  CG   . LYS A 1 61 ? 22.120  -6.177  11.839  1.00 0.00 ? 368 LYS A CG   9  
ATOM   10427 C  CD   . LYS A 1 61 ? 22.815  -7.435  12.337  1.00 0.00 ? 368 LYS A CD   9  
ATOM   10428 C  CE   . LYS A 1 61 ? 24.187  -7.611  11.699  1.00 0.00 ? 368 LYS A CE   9  
ATOM   10429 N  NZ   . LYS A 1 61 ? 24.920  -8.771  12.271  1.00 0.00 ? 368 LYS A NZ   9  
ATOM   10430 H  H    . LYS A 1 61 ? 21.154  -5.799  7.856   1.00 0.00 ? 368 LYS A H    9  
ATOM   10431 H  HA   . LYS A 1 61 ? 20.375  -4.618  10.403  1.00 0.00 ? 368 LYS A HA   9  
ATOM   10432 H  HB2  . LYS A 1 61 ? 20.947  -7.031  10.284  1.00 0.00 ? 368 LYS A HB2  9  
ATOM   10433 H  HB3  . LYS A 1 61 ? 22.583  -6.595  9.808   1.00 0.00 ? 368 LYS A HB3  9  
ATOM   10434 H  HG2  . LYS A 1 61 ? 22.792  -5.339  11.957  1.00 0.00 ? 368 LYS A HG2  9  
ATOM   10435 H  HG3  . LYS A 1 61 ? 21.231  -6.010  12.429  1.00 0.00 ? 368 LYS A HG3  9  
ATOM   10436 H  HD2  . LYS A 1 61 ? 22.933  -7.368  13.407  1.00 0.00 ? 368 LYS A HD2  9  
ATOM   10437 H  HD3  . LYS A 1 61 ? 22.203  -8.290  12.093  1.00 0.00 ? 368 LYS A HD3  9  
ATOM   10438 H  HE2  . LYS A 1 61 ? 24.059  -7.767  10.638  1.00 0.00 ? 368 LYS A HE2  9  
ATOM   10439 H  HE3  . LYS A 1 61 ? 24.765  -6.714  11.863  1.00 0.00 ? 368 LYS A HE3  9  
ATOM   10440 H  HZ1  . LYS A 1 61 ? 24.391  -9.651  12.105  1.00 0.00 ? 368 LYS A HZ1  9  
ATOM   10441 H  HZ2  . LYS A 1 61 ? 25.044  -8.644  13.296  1.00 0.00 ? 368 LYS A HZ2  9  
ATOM   10442 H  HZ3  . LYS A 1 61 ? 25.859  -8.858  11.832  1.00 0.00 ? 368 LYS A HZ3  9  
ATOM   10443 N  N    . GLU A 1 62 ? 22.048  -2.842  10.565  1.00 0.00 ? 369 GLU A N    9  
ATOM   10444 C  CA   . GLU A 1 62 ? 23.028  -1.788  10.755  1.00 0.00 ? 369 GLU A CA   9  
ATOM   10445 C  C    . GLU A 1 62 ? 23.338  -1.639  12.246  1.00 0.00 ? 369 GLU A C    9  
ATOM   10446 O  O    . GLU A 1 62 ? 22.760  -2.342  13.073  1.00 0.00 ? 369 GLU A O    9  
ATOM   10447 C  CB   . GLU A 1 62 ? 22.540  -0.480  10.127  1.00 0.00 ? 369 GLU A CB   9  
ATOM   10448 C  CG   . GLU A 1 62 ? 22.295  -0.602  8.629   1.00 0.00 ? 369 GLU A CG   9  
ATOM   10449 C  CD   . GLU A 1 62 ? 21.794  0.680   7.996   1.00 0.00 ? 369 GLU A CD   9  
ATOM   10450 O  OE1  . GLU A 1 62 ? 20.602  1.012   8.171   1.00 0.00 ? 369 GLU A OE1  9  
ATOM   10451 O  OE2  . GLU A 1 62 ? 22.586  1.357   7.305   1.00 0.00 ? 369 GLU A OE2  9  
ATOM   10452 H  H    . GLU A 1 62 ? 21.164  -2.749  10.986  1.00 0.00 ? 369 GLU A H    9  
ATOM   10453 H  HA   . GLU A 1 62 ? 23.933  -2.097  10.252  1.00 0.00 ? 369 GLU A HA   9  
ATOM   10454 H  HB2  . GLU A 1 62 ? 21.617  -0.186  10.602  1.00 0.00 ? 369 GLU A HB2  9  
ATOM   10455 H  HB3  . GLU A 1 62 ? 23.283  0.287   10.289  1.00 0.00 ? 369 GLU A HB3  9  
ATOM   10456 H  HG2  . GLU A 1 62 ? 23.223  -0.879  8.150   1.00 0.00 ? 369 GLU A HG2  9  
ATOM   10457 H  HG3  . GLU A 1 62 ? 21.562  -1.377  8.463   1.00 0.00 ? 369 GLU A HG3  9  
ATOM   10458 N  N    . LEU A 1 63 ? 24.250  -0.743  12.582  1.00 0.00 ? 370 LEU A N    9  
ATOM   10459 C  CA   . LEU A 1 63 ? 24.857  -0.710  13.916  1.00 0.00 ? 370 LEU A CA   9  
ATOM   10460 C  C    . LEU A 1 63 ? 25.509  0.635   14.180  1.00 0.00 ? 370 LEU A C    9  
ATOM   10461 O  O    . LEU A 1 63 ? 25.517  1.138   15.303  1.00 0.00 ? 370 LEU A O    9  
ATOM   10462 C  CB   . LEU A 1 63 ? 25.902  -1.827  14.033  1.00 0.00 ? 370 LEU A CB   9  
ATOM   10463 C  CG   . LEU A 1 63 ? 26.730  -1.841  15.324  1.00 0.00 ? 370 LEU A CG   9  
ATOM   10464 C  CD1  . LEU A 1 63 ? 25.861  -2.144  16.532  1.00 0.00 ? 370 LEU A CD1  9  
ATOM   10465 C  CD2  . LEU A 1 63 ? 27.854  -2.858  15.217  1.00 0.00 ? 370 LEU A CD2  9  
ATOM   10466 H  H    . LEU A 1 63 ? 24.473  -0.050  11.941  1.00 0.00 ? 370 LEU A H    9  
ATOM   10467 H  HA   . LEU A 1 63 ? 24.089  -0.864  14.642  1.00 0.00 ? 370 LEU A HA   9  
ATOM   10468 H  HB2  . LEU A 1 63 ? 25.388  -2.772  13.950  1.00 0.00 ? 370 LEU A HB2  9  
ATOM   10469 H  HB3  . LEU A 1 63 ? 26.583  -1.736  13.200  1.00 0.00 ? 370 LEU A HB3  9  
ATOM   10470 H  HG   . LEU A 1 63 ? 27.174  -0.867  15.469  1.00 0.00 ? 370 LEU A HG   9  
ATOM   10471 H  HD11 . LEU A 1 63 ? 25.060  -1.423  16.591  1.00 0.00 ? 370 LEU A HD11 9  
ATOM   10472 H  HD12 . LEU A 1 63 ? 26.461  -2.090  17.428  1.00 0.00 ? 370 LEU A HD12 9  
ATOM   10473 H  HD13 . LEU A 1 63 ? 25.448  -3.136  16.436  1.00 0.00 ? 370 LEU A HD13 9  
ATOM   10474 H  HD21 . LEU A 1 63 ? 28.494  -2.598  14.387  1.00 0.00 ? 370 LEU A HD21 9  
ATOM   10475 H  HD22 . LEU A 1 63 ? 27.437  -3.841  15.056  1.00 0.00 ? 370 LEU A HD22 9  
ATOM   10476 H  HD23 . LEU A 1 63 ? 28.430  -2.855  16.131  1.00 0.00 ? 370 LEU A HD23 9  
ATOM   10477 N  N    . THR A 1 64 ? 26.063  1.195   13.136  1.00 0.00 ? 371 THR A N    9  
ATOM   10478 C  CA   . THR A 1 64 ? 26.706  2.495   13.217  1.00 0.00 ? 371 THR A CA   9  
ATOM   10479 C  C    . THR A 1 64 ? 25.662  3.593   13.440  1.00 0.00 ? 371 THR A C    9  
ATOM   10480 O  O    . THR A 1 64 ? 24.620  3.629   12.775  1.00 0.00 ? 371 THR A O    9  
ATOM   10481 C  CB   . THR A 1 64 ? 27.561  2.794   11.957  1.00 0.00 ? 371 THR A CB   9  
ATOM   10482 O  OG1  . THR A 1 64 ? 28.206  4.069   12.084  1.00 0.00 ? 371 THR A OG1  9  
ATOM   10483 C  CG2  . THR A 1 64 ? 26.721  2.769   10.688  1.00 0.00 ? 371 THR A CG2  9  
ATOM   10484 H  H    . THR A 1 64 ? 26.046  0.715   12.295  1.00 0.00 ? 371 THR A H    9  
ATOM   10485 H  HA   . THR A 1 64 ? 27.365  2.478   14.073  1.00 0.00 ? 371 THR A HA   9  
ATOM   10486 H  HB   . THR A 1 64 ? 28.322  2.031   11.876  1.00 0.00 ? 371 THR A HB   9  
ATOM   10487 H  HG1  . THR A 1 64 ? 28.921  3.999   12.734  1.00 0.00 ? 371 THR A HG1  9  
ATOM   10488 H  HG21 . THR A 1 64 ? 25.961  3.532   10.746  1.00 0.00 ? 371 THR A HG21 9  
ATOM   10489 H  HG22 . THR A 1 64 ? 26.255  1.801   10.584  1.00 0.00 ? 371 THR A HG22 9  
ATOM   10490 H  HG23 . THR A 1 64 ? 27.355  2.957   9.834   1.00 0.00 ? 371 THR A HG23 9  
ATOM   10491 N  N    . GLY A 1 65 ? 25.935  4.461   14.403  1.00 0.00 ? 372 GLY A N    9  
ATOM   10492 C  CA   . GLY A 1 65 ? 25.005  5.515   14.745  1.00 0.00 ? 372 GLY A CA   9  
ATOM   10493 C  C    . GLY A 1 65 ? 24.618  5.476   16.208  1.00 0.00 ? 372 GLY A C    9  
ATOM   10494 O  O    . GLY A 1 65 ? 25.231  6.150   17.039  1.00 0.00 ? 372 GLY A O    9  
ATOM   10495 H  H    . GLY A 1 65 ? 26.784  4.387   14.892  1.00 0.00 ? 372 GLY A H    9  
ATOM   10496 H  HA2  . GLY A 1 65 ? 25.460  6.469   14.527  1.00 0.00 ? 372 GLY A HA2  9  
ATOM   10497 H  HA3  . GLY A 1 65 ? 24.114  5.405   14.146  1.00 0.00 ? 372 GLY A HA3  9  
ATOM   10498 N  N    . GLY A 1 66 ? 23.615  4.676   16.528  1.00 0.00 ? 373 GLY A N    9  
ATOM   10499 C  CA   . GLY A 1 66 ? 23.158  4.566   17.898  1.00 0.00 ? 373 GLY A CA   9  
ATOM   10500 C  C    . GLY A 1 66 ? 22.802  3.142   18.247  1.00 0.00 ? 373 GLY A C    9  
ATOM   10501 O  O    . GLY A 1 66 ? 21.674  2.855   18.655  1.00 0.00 ? 373 GLY A O    9  
ATOM   10502 H  H    . GLY A 1 66 ? 23.180  4.150   15.828  1.00 0.00 ? 373 GLY A H    9  
ATOM   10503 H  HA2  . GLY A 1 66 ? 23.941  4.907   18.559  1.00 0.00 ? 373 GLY A HA2  9  
ATOM   10504 H  HA3  . GLY A 1 66 ? 22.287  5.189   18.030  1.00 0.00 ? 373 GLY A HA3  9  
ATOM   10505 N  N    . GLY A 1 67 ? 23.762  2.247   18.073  1.00 0.00 ? 374 GLY A N    9  
ATOM   10506 C  CA   . GLY A 1 67 ? 23.521  0.844   18.317  1.00 0.00 ? 374 GLY A CA   9  
ATOM   10507 C  C    . GLY A 1 67 ? 22.981  0.153   17.088  1.00 0.00 ? 374 GLY A C    9  
ATOM   10508 O  O    . GLY A 1 67 ? 22.818  0.786   16.046  1.00 0.00 ? 374 GLY A O    9  
ATOM   10509 H  H    . GLY A 1 67 ? 24.647  2.544   17.768  1.00 0.00 ? 374 GLY A H    9  
ATOM   10510 H  HA2  . GLY A 1 67 ? 24.447  0.372   18.611  1.00 0.00 ? 374 GLY A HA2  9  
ATOM   10511 H  HA3  . GLY A 1 67 ? 22.804  0.743   19.119  1.00 0.00 ? 374 GLY A HA3  9  
ATOM   10512 N  N    . THR A 1 68 ? 22.711  -1.139  17.201  1.00 0.00 ? 375 THR A N    9  
ATOM   10513 C  CA   . THR A 1 68 ? 22.169  -1.904  16.091  1.00 0.00 ? 375 THR A CA   9  
ATOM   10514 C  C    . THR A 1 68 ? 20.837  -1.306  15.648  1.00 0.00 ? 375 THR A C    9  
ATOM   10515 O  O    . THR A 1 68 ? 19.974  -1.001  16.475  1.00 0.00 ? 375 THR A O    9  
ATOM   10516 C  CB   . THR A 1 68 ? 21.955  -3.378  16.497  1.00 0.00 ? 375 THR A CB   9  
ATOM   10517 O  OG1  . THR A 1 68 ? 23.142  -3.890  17.115  1.00 0.00 ? 375 THR A OG1  9  
ATOM   10518 C  CG2  . THR A 1 68 ? 21.600  -4.241  15.295  1.00 0.00 ? 375 THR A CG2  9  
ATOM   10519 H  H    . THR A 1 68 ? 22.869  -1.588  18.059  1.00 0.00 ? 375 THR A H    9  
ATOM   10520 H  HA   . THR A 1 68 ? 22.877  -1.861  15.262  1.00 0.00 ? 375 THR A HA   9  
ATOM   10521 H  HB   . THR A 1 68 ? 21.142  -3.424  17.207  1.00 0.00 ? 375 THR A HB   9  
ATOM   10522 H  HG1  . THR A 1 68 ? 23.873  -3.288  16.942  1.00 0.00 ? 375 THR A HG1  9  
ATOM   10523 H  HG21 . THR A 1 68 ? 22.416  -4.225  14.588  1.00 0.00 ? 375 THR A HG21 9  
ATOM   10524 H  HG22 . THR A 1 68 ? 20.708  -3.852  14.826  1.00 0.00 ? 375 THR A HG22 9  
ATOM   10525 H  HG23 . THR A 1 68 ? 21.423  -5.255  15.620  1.00 0.00 ? 375 THR A HG23 9  
ATOM   10526 N  N    . THR A 1 69 ? 20.673  -1.141  14.352  1.00 0.00 ? 376 THR A N    9  
ATOM   10527 C  CA   . THR A 1 69 ? 19.506  -0.526  13.813  1.00 0.00 ? 376 THR A CA   9  
ATOM   10528 C  C    . THR A 1 69 ? 18.902  -1.449  12.777  1.00 0.00 ? 376 THR A C    9  
ATOM   10529 O  O    . THR A 1 69 ? 19.548  -1.850  11.806  1.00 0.00 ? 376 THR A O    9  
ATOM   10530 C  CB   . THR A 1 69 ? 19.832  0.847   13.185  1.00 0.00 ? 376 THR A CB   9  
ATOM   10531 O  OG1  . THR A 1 69 ? 20.787  0.694   12.136  1.00 0.00 ? 376 THR A OG1  9  
ATOM   10532 C  CG2  . THR A 1 69 ? 20.405  1.797   14.220  1.00 0.00 ? 376 THR A CG2  9  
ATOM   10533 H  H    . THR A 1 69 ? 21.338  -1.484  13.736  1.00 0.00 ? 376 THR A H    9  
ATOM   10534 H  HA   . THR A 1 69 ? 18.797  -0.380  14.617  1.00 0.00 ? 376 THR A HA   9  
ATOM   10535 H  HB   . THR A 1 69 ? 18.928  1.275   12.785  1.00 0.00 ? 376 THR A HB   9  
ATOM   10536 H  HG1  . THR A 1 69 ? 20.456  1.119   11.336  1.00 0.00 ? 376 THR A HG1  9  
ATOM   10537 H  HG21 . THR A 1 69 ? 20.424  2.799   13.819  1.00 0.00 ? 376 THR A HG21 9  
ATOM   10538 H  HG22 . THR A 1 69 ? 21.416  1.487   14.466  1.00 0.00 ? 376 THR A HG22 9  
ATOM   10539 H  HG23 . THR A 1 69 ? 19.793  1.772   15.109  1.00 0.00 ? 376 THR A HG23 9  
ATOM   10540 N  N    . PHE A 1 70 ? 17.682  -1.824  13.032  1.00 0.00 ? 377 PHE A N    9  
ATOM   10541 C  CA   . PHE A 1 70 ? 16.919  -2.641  12.116  1.00 0.00 ? 377 PHE A CA   9  
ATOM   10542 C  C    . PHE A 1 70 ? 16.270  -1.760  11.057  1.00 0.00 ? 377 PHE A C    9  
ATOM   10543 O  O    . PHE A 1 70 ? 15.356  -0.987  11.352  1.00 0.00 ? 377 PHE A O    9  
ATOM   10544 C  CB   . PHE A 1 70 ? 15.852  -3.414  12.889  1.00 0.00 ? 377 PHE A CB   9  
ATOM   10545 C  CG   . PHE A 1 70 ? 15.483  -4.712  12.247  1.00 0.00 ? 377 PHE A CG   9  
ATOM   10546 C  CD1  . PHE A 1 70 ? 16.317  -5.803  12.372  1.00 0.00 ? 377 PHE A CD1  9  
ATOM   10547 C  CD2  . PHE A 1 70 ? 14.308  -4.843  11.530  1.00 0.00 ? 377 PHE A CD2  9  
ATOM   10548 C  CE1  . PHE A 1 70 ? 15.989  -7.013  11.793  1.00 0.00 ? 377 PHE A CE1  9  
ATOM   10549 C  CE2  . PHE A 1 70 ? 13.972  -6.049  10.945  1.00 0.00 ? 377 PHE A CE2  9  
ATOM   10550 C  CZ   . PHE A 1 70 ? 14.814  -7.137  11.078  1.00 0.00 ? 377 PHE A CZ   9  
ATOM   10551 H  H    . PHE A 1 70 ? 17.301  -1.577  13.885  1.00 0.00 ? 377 PHE A H    9  
ATOM   10552 H  HA   . PHE A 1 70 ? 17.593  -3.337  11.637  1.00 0.00 ? 377 PHE A HA   9  
ATOM   10553 H  HB2  . PHE A 1 70 ? 16.227  -3.634  13.888  1.00 0.00 ? 377 PHE A HB2  9  
ATOM   10554 H  HB3  . PHE A 1 70 ? 14.950  -2.803  12.955  1.00 0.00 ? 377 PHE A HB3  9  
ATOM   10555 H  HD1  . PHE A 1 70 ? 17.236  -5.698  12.932  1.00 0.00 ? 377 PHE A HD1  9  
ATOM   10556 H  HD2  . PHE A 1 70 ? 13.653  -3.991  11.428  1.00 0.00 ? 377 PHE A HD2  9  
ATOM   10557 H  HE1  . PHE A 1 70 ? 16.652  -7.860  11.899  1.00 0.00 ? 377 PHE A HE1  9  
ATOM   10558 H  HE2  . PHE A 1 70 ? 13.051  -6.142  10.387  1.00 0.00 ? 377 PHE A HE2  9  
ATOM   10559 H  HZ   . PHE A 1 70 ? 14.554  -8.082  10.623  1.00 0.00 ? 377 PHE A HZ   9  
ATOM   10560 N  N    . SER A 1 71 ? 16.757  -1.862  9.837   1.00 0.00 ? 378 SER A N    9  
ATOM   10561 C  CA   . SER A 1 71 ? 16.216  -1.085  8.738   1.00 0.00 ? 378 SER A CA   9  
ATOM   10562 C  C    . SER A 1 71 ? 15.438  -1.983  7.791   1.00 0.00 ? 378 SER A C    9  
ATOM   10563 O  O    . SER A 1 71 ? 15.991  -2.931  7.228   1.00 0.00 ? 378 SER A O    9  
ATOM   10564 C  CB   . SER A 1 71 ? 17.349  -0.391  7.987   1.00 0.00 ? 378 SER A CB   9  
ATOM   10565 O  OG   . SER A 1 71 ? 18.113  0.432   8.857   1.00 0.00 ? 378 SER A OG   9  
ATOM   10566 H  H    . SER A 1 71 ? 17.512  -2.468  9.669   1.00 0.00 ? 378 SER A H    9  
ATOM   10567 H  HA   . SER A 1 71 ? 15.552  -0.340  9.147   1.00 0.00 ? 378 SER A HA   9  
ATOM   10568 H  HB2  . SER A 1 71 ? 17.998  -1.140  7.559   1.00 0.00 ? 378 SER A HB2  9  
ATOM   10569 H  HB3  . SER A 1 71 ? 16.935  0.221   7.200   1.00 0.00 ? 378 SER A HB3  9  
ATOM   10570 H  HG   . SER A 1 71 ? 19.029  0.489   8.530   1.00 0.00 ? 378 SER A HG   9  
ATOM   10571 N  N    . VAL A 1 72 ? 14.156  -1.703  7.623   1.00 0.00 ? 379 VAL A N    9  
ATOM   10572 C  CA   . VAL A 1 72 ? 13.347  -2.483  6.710   1.00 0.00 ? 379 VAL A CA   9  
ATOM   10573 C  C    . VAL A 1 72 ? 13.256  -1.784  5.366   1.00 0.00 ? 379 VAL A C    9  
ATOM   10574 O  O    . VAL A 1 72 ? 12.976  -0.588  5.279   1.00 0.00 ? 379 VAL A O    9  
ATOM   10575 C  CB   . VAL A 1 72 ? 11.924  -2.736  7.231   1.00 0.00 ? 379 VAL A CB   9  
ATOM   10576 C  CG1  . VAL A 1 72 ? 11.269  -3.876  6.463   1.00 0.00 ? 379 VAL A CG1  9  
ATOM   10577 C  CG2  . VAL A 1 72 ? 11.924  -3.020  8.726   1.00 0.00 ? 379 VAL A CG2  9  
ATOM   10578 H  H    . VAL A 1 72 ? 13.750  -0.957  8.114   1.00 0.00 ? 379 VAL A H    9  
ATOM   10579 H  HA   . VAL A 1 72 ? 13.833  -3.439  6.574   1.00 0.00 ? 379 VAL A HA   9  
ATOM   10580 H  HB   . VAL A 1 72 ? 11.351  -1.846  7.049   1.00 0.00 ? 379 VAL A HB   9  
ATOM   10581 H  HG11 . VAL A 1 72 ? 11.169  -3.598  5.423   1.00 0.00 ? 379 VAL A HG11 9  
ATOM   10582 H  HG12 . VAL A 1 72 ? 10.293  -4.077  6.878   1.00 0.00 ? 379 VAL A HG12 9  
ATOM   10583 H  HG13 . VAL A 1 72 ? 11.884  -4.761  6.541   1.00 0.00 ? 379 VAL A HG13 9  
ATOM   10584 H  HG21 . VAL A 1 72 ? 12.508  -3.905  8.924   1.00 0.00 ? 379 VAL A HG21 9  
ATOM   10585 H  HG22 . VAL A 1 72 ? 10.909  -3.175  9.062   1.00 0.00 ? 379 VAL A HG22 9  
ATOM   10586 H  HG23 . VAL A 1 72 ? 12.353  -2.180  9.251   1.00 0.00 ? 379 VAL A HG23 9  
ATOM   10587 N  N    . ARG A 1 73 ? 13.491  -2.552  4.337   1.00 0.00 ? 380 ARG A N    9  
ATOM   10588 C  CA   . ARG A 1 73 ? 13.481  -2.072  2.972   1.00 0.00 ? 380 ARG A CA   9  
ATOM   10589 C  C    . ARG A 1 73 ? 12.335  -2.747  2.235   1.00 0.00 ? 380 ARG A C    9  
ATOM   10590 O  O    . ARG A 1 73 ? 12.461  -3.878  1.766   1.00 0.00 ? 380 ARG A O    9  
ATOM   10591 C  CB   . ARG A 1 73 ? 14.826  -2.406  2.315   1.00 0.00 ? 380 ARG A CB   9  
ATOM   10592 C  CG   . ARG A 1 73 ? 14.997  -1.889  0.899   1.00 0.00 ? 380 ARG A CG   9  
ATOM   10593 C  CD   . ARG A 1 73 ? 16.299  -2.399  0.300   1.00 0.00 ? 380 ARG A CD   9  
ATOM   10594 N  NE   . ARG A 1 73 ? 16.621  -1.752  -0.974  1.00 0.00 ? 380 ARG A NE   9  
ATOM   10595 C  CZ   . ARG A 1 73 ? 17.166  -2.382  -2.018  1.00 0.00 ? 380 ARG A CZ   9  
ATOM   10596 N  NH1  . ARG A 1 73 ? 17.321  -3.703  -2.007  1.00 0.00 ? 380 ARG A NH1  9  
ATOM   10597 N  NH2  . ARG A 1 73 ? 17.522  -1.690  -3.093  1.00 0.00 ? 380 ARG A NH2  9  
ATOM   10598 H  H    . ARG A 1 73 ? 13.670  -3.502  4.502   1.00 0.00 ? 380 ARG A H    9  
ATOM   10599 H  HA   . ARG A 1 73 ? 13.332  -1.004  2.980   1.00 0.00 ? 380 ARG A HA   9  
ATOM   10600 H  HB2  . ARG A 1 73 ? 15.617  -1.986  2.918   1.00 0.00 ? 380 ARG A HB2  9  
ATOM   10601 H  HB3  . ARG A 1 73 ? 14.940  -3.480  2.296   1.00 0.00 ? 380 ARG A HB3  9  
ATOM   10602 H  HG2  . ARG A 1 73 ? 14.170  -2.235  0.294   1.00 0.00 ? 380 ARG A HG2  9  
ATOM   10603 H  HG3  . ARG A 1 73 ? 15.012  -0.809  0.915   1.00 0.00 ? 380 ARG A HG3  9  
ATOM   10604 H  HD2  . ARG A 1 73 ? 17.101  -2.208  1.003   1.00 0.00 ? 380 ARG A HD2  9  
ATOM   10605 H  HD3  . ARG A 1 73 ? 16.211  -3.464  0.142   1.00 0.00 ? 380 ARG A HD3  9  
ATOM   10606 H  HE   . ARG A 1 73 ? 16.463  -0.783  -1.036  1.00 0.00 ? 380 ARG A HE   9  
ATOM   10607 H  HH11 . ARG A 1 73 ? 17.020  -4.242  -1.214  1.00 0.00 ? 380 ARG A HH11 9  
ATOM   10608 H  HH12 . ARG A 1 73 ? 17.753  -4.166  -2.783  1.00 0.00 ? 380 ARG A HH12 9  
ATOM   10609 H  HH21 . ARG A 1 73 ? 17.385  -0.697  -3.121  1.00 0.00 ? 380 ARG A HH21 9  
ATOM   10610 H  HH22 . ARG A 1 73 ? 17.942  -2.156  -3.878  1.00 0.00 ? 380 ARG A HH22 9  
ATOM   10611 N  N    . LYS A 1 74 ? 11.203  -2.069  2.168   1.00 0.00 ? 381 LYS A N    9  
ATOM   10612 C  CA   . LYS A 1 74 ? 10.006  -2.668  1.606   1.00 0.00 ? 381 LYS A CA   9  
ATOM   10613 C  C    . LYS A 1 74 ? 9.932   -2.383  0.112   1.00 0.00 ? 381 LYS A C    9  
ATOM   10614 O  O    . LYS A 1 74 ? 9.734   -1.241  -0.308  1.00 0.00 ? 381 LYS A O    9  
ATOM   10615 C  CB   . LYS A 1 74 ? 8.761   -2.140  2.322   1.00 0.00 ? 381 LYS A CB   9  
ATOM   10616 C  CG   . LYS A 1 74 ? 7.530   -3.008  2.118   1.00 0.00 ? 381 LYS A CG   9  
ATOM   10617 C  CD   . LYS A 1 74 ? 6.280   -2.407  2.757   1.00 0.00 ? 381 LYS A CD   9  
ATOM   10618 C  CE   . LYS A 1 74 ? 6.317   -2.445  4.285   1.00 0.00 ? 381 LYS A CE   9  
ATOM   10619 N  NZ   . LYS A 1 74 ? 7.056   -1.296  4.878   1.00 0.00 ? 381 LYS A NZ   9  
ATOM   10620 H  H    . LYS A 1 74 ? 11.172  -1.141  2.495   1.00 0.00 ? 381 LYS A H    9  
ATOM   10621 H  HA   . LYS A 1 74 ? 10.075  -3.736  1.754   1.00 0.00 ? 381 LYS A HA   9  
ATOM   10622 H  HB2  . LYS A 1 74 ? 8.967   -2.086  3.380   1.00 0.00 ? 381 LYS A HB2  9  
ATOM   10623 H  HB3  . LYS A 1 74 ? 8.542   -1.151  1.954   1.00 0.00 ? 381 LYS A HB3  9  
ATOM   10624 H  HG2  . LYS A 1 74 ? 7.358   -3.121  1.058   1.00 0.00 ? 381 LYS A HG2  9  
ATOM   10625 H  HG3  . LYS A 1 74 ? 7.716   -3.978  2.557   1.00 0.00 ? 381 LYS A HG3  9  
ATOM   10626 H  HD2  . LYS A 1 74 ? 6.193   -1.378  2.440   1.00 0.00 ? 381 LYS A HD2  9  
ATOM   10627 H  HD3  . LYS A 1 74 ? 5.418   -2.960  2.414   1.00 0.00 ? 381 LYS A HD3  9  
ATOM   10628 H  HE2  . LYS A 1 74 ? 5.302   -2.431  4.653   1.00 0.00 ? 381 LYS A HE2  9  
ATOM   10629 H  HE3  . LYS A 1 74 ? 6.794   -3.366  4.595   1.00 0.00 ? 381 LYS A HE3  9  
ATOM   10630 H  HZ1  . LYS A 1 74 ? 8.073   -1.381  4.685   1.00 0.00 ? 381 LYS A HZ1  9  
ATOM   10631 H  HZ2  . LYS A 1 74 ? 6.914   -1.278  5.911   1.00 0.00 ? 381 LYS A HZ2  9  
ATOM   10632 H  HZ3  . LYS A 1 74 ? 6.712   -0.401  4.478   1.00 0.00 ? 381 LYS A HZ3  9  
ATOM   10633 N  N    . THR A 1 75 ? 10.088  -3.428  -0.685  1.00 0.00 ? 382 THR A N    9  
ATOM   10634 C  CA   . THR A 1 75 ? 10.187  -3.276  -2.122  1.00 0.00 ? 382 THR A CA   9  
ATOM   10635 C  C    . THR A 1 75 ? 9.178   -4.158  -2.847  1.00 0.00 ? 382 THR A C    9  
ATOM   10636 O  O    . THR A 1 75 ? 9.254   -5.380  -2.790  1.00 0.00 ? 382 THR A O    9  
ATOM   10637 C  CB   . THR A 1 75 ? 11.603  -3.626  -2.612  1.00 0.00 ? 382 THR A CB   9  
ATOM   10638 O  OG1  . THR A 1 75 ? 12.571  -2.834  -1.911  1.00 0.00 ? 382 THR A OG1  9  
ATOM   10639 C  CG2  . THR A 1 75 ? 11.731  -3.382  -4.105  1.00 0.00 ? 382 THR A CG2  9  
ATOM   10640 H  H    . THR A 1 75 ? 10.121  -4.331  -0.297  1.00 0.00 ? 382 THR A H    9  
ATOM   10641 H  HA   . THR A 1 75 ? 9.990   -2.242  -2.364  1.00 0.00 ? 382 THR A HA   9  
ATOM   10642 H  HB   . THR A 1 75 ? 11.789  -4.674  -2.414  1.00 0.00 ? 382 THR A HB   9  
ATOM   10643 H  HG1  . THR A 1 75 ? 12.824  -3.283  -1.095  1.00 0.00 ? 382 THR A HG1  9  
ATOM   10644 H  HG21 . THR A 1 75 ? 11.527  -2.343  -4.319  1.00 0.00 ? 382 THR A HG21 9  
ATOM   10645 H  HG22 . THR A 1 75 ? 11.020  -4.003  -4.632  1.00 0.00 ? 382 THR A HG22 9  
ATOM   10646 H  HG23 . THR A 1 75 ? 12.731  -3.627  -4.427  1.00 0.00 ? 382 THR A HG23 9  
ATOM   10647 N  N    . ALA A 1 76 ? 8.235   -3.533  -3.524  1.00 0.00 ? 383 ALA A N    9  
ATOM   10648 C  CA   . ALA A 1 76 ? 7.285   -4.261  -4.343  1.00 0.00 ? 383 ALA A CA   9  
ATOM   10649 C  C    . ALA A 1 76 ? 7.329   -3.738  -5.768  1.00 0.00 ? 383 ALA A C    9  
ATOM   10650 O  O    . ALA A 1 76 ? 7.397   -2.526  -5.991  1.00 0.00 ? 383 ALA A O    9  
ATOM   10651 C  CB   . ALA A 1 76 ? 5.885   -4.142  -3.766  1.00 0.00 ? 383 ALA A CB   9  
ATOM   10652 H  H    . ALA A 1 76 ? 8.174   -2.557  -3.479  1.00 0.00 ? 383 ALA A H    9  
ATOM   10653 H  HA   . ALA A 1 76 ? 7.568   -5.303  -4.340  1.00 0.00 ? 383 ALA A HA   9  
ATOM   10654 H  HB1  . ALA A 1 76 ? 5.594   -3.102  -3.742  1.00 0.00 ? 383 ALA A HB1  9  
ATOM   10655 H  HB2  . ALA A 1 76 ? 5.871   -4.545  -2.763  1.00 0.00 ? 383 ALA A HB2  9  
ATOM   10656 H  HB3  . ALA A 1 76 ? 5.192   -4.694  -4.384  1.00 0.00 ? 383 ALA A HB3  9  
ATOM   10657 N  N    . TYR A 1 77 ? 7.320   -4.645  -6.729  1.00 0.00 ? 384 TYR A N    9  
ATOM   10658 C  CA   . TYR A 1 77 ? 7.297   -4.251  -8.123  1.00 0.00 ? 384 TYR A CA   9  
ATOM   10659 C  C    . TYR A 1 77 ? 5.953   -4.635  -8.720  1.00 0.00 ? 384 TYR A C    9  
ATOM   10660 O  O    . TYR A 1 77 ? 5.398   -5.682  -8.391  1.00 0.00 ? 384 TYR A O    9  
ATOM   10661 C  CB   . TYR A 1 77 ? 8.427   -4.918  -8.922  1.00 0.00 ? 384 TYR A CB   9  
ATOM   10662 C  CG   . TYR A 1 77 ? 9.817   -4.755  -8.327  1.00 0.00 ? 384 TYR A CG   9  
ATOM   10663 C  CD1  . TYR A 1 77 ? 10.493  -3.532  -8.343  1.00 0.00 ? 384 TYR A CD1  9  
ATOM   10664 C  CD2  . TYR A 1 77 ? 10.460  -5.844  -7.754  1.00 0.00 ? 384 TYR A CD2  9  
ATOM   10665 C  CE1  . TYR A 1 77 ? 11.761  -3.416  -7.805  1.00 0.00 ? 384 TYR A CE1  9  
ATOM   10666 C  CE2  . TYR A 1 77 ? 11.726  -5.730  -7.216  1.00 0.00 ? 384 TYR A CE2  9  
ATOM   10667 C  CZ   . TYR A 1 77 ? 12.372  -4.513  -7.243  1.00 0.00 ? 384 TYR A CZ   9  
ATOM   10668 O  OH   . TYR A 1 77 ? 13.634  -4.391  -6.709  1.00 0.00 ? 384 TYR A OH   9  
ATOM   10669 H  H    . TYR A 1 77 ? 7.306   -5.599  -6.494  1.00 0.00 ? 384 TYR A H    9  
ATOM   10670 H  HA   . TYR A 1 77 ? 7.410   -3.179  -8.170  1.00 0.00 ? 384 TYR A HA   9  
ATOM   10671 H  HB2  . TYR A 1 77 ? 8.224   -5.984  -8.985  1.00 0.00 ? 384 TYR A HB2  9  
ATOM   10672 H  HB3  . TYR A 1 77 ? 8.443   -4.490  -9.923  1.00 0.00 ? 384 TYR A HB3  9  
ATOM   10673 H  HD1  . TYR A 1 77 ? 10.022  -2.656  -8.781  1.00 0.00 ? 384 TYR A HD1  9  
ATOM   10674 H  HD2  . TYR A 1 77 ? 9.956   -6.797  -7.734  1.00 0.00 ? 384 TYR A HD2  9  
ATOM   10675 H  HE1  . TYR A 1 77 ? 12.268  -2.464  -7.827  1.00 0.00 ? 384 TYR A HE1  9  
ATOM   10676 H  HE2  . TYR A 1 77 ? 12.206  -6.591  -6.776  1.00 0.00 ? 384 TYR A HE2  9  
ATOM   10677 H  HH   . TYR A 1 77 ? 14.130  -5.207  -6.870  1.00 0.00 ? 384 TYR A HH   9  
ATOM   10678 N  N    . CYS A 1 78 ? 5.434   -3.784  -9.594  1.00 0.00 ? 385 CYS A N    9  
ATOM   10679 C  CA   . CYS A 1 78 ? 4.124   -4.009  -10.195 1.00 0.00 ? 385 CYS A CA   9  
ATOM   10680 C  C    . CYS A 1 78 ? 4.111   -5.282  -11.033 1.00 0.00 ? 385 CYS A C    9  
ATOM   10681 O  O    . CYS A 1 78 ? 5.139   -5.692  -11.573 1.00 0.00 ? 385 CYS A O    9  
ATOM   10682 C  CB   . CYS A 1 78 ? 3.693   -2.806  -11.050 1.00 0.00 ? 385 CYS A CB   9  
ATOM   10683 S  SG   . CYS A 1 78 ? 4.868   -2.328  -12.351 1.00 0.00 ? 385 CYS A SG   9  
ATOM   10684 H  H    . CYS A 1 78 ? 5.941   -2.981  -9.825  1.00 0.00 ? 385 CYS A H    9  
ATOM   10685 H  HA   . CYS A 1 78 ? 3.414   -4.127  -9.389  1.00 0.00 ? 385 CYS A HA   9  
ATOM   10686 H  HB2  . CYS A 1 78 ? 2.757   -3.039  -11.533 1.00 0.00 ? 385 CYS A HB2  9  
ATOM   10687 H  HB3  . CYS A 1 78 ? 3.553   -1.952  -10.405 1.00 0.00 ? 385 CYS A HB3  9  
ATOM   10688 N  N    . ASP A 1 79 ? 2.940   -5.895  -11.120 1.00 0.00 ? 386 ASP A N    9  
ATOM   10689 C  CA   . ASP A 1 79 ? 2.736   -7.119  -11.902 1.00 0.00 ? 386 ASP A CA   9  
ATOM   10690 C  C    . ASP A 1 79 ? 3.331   -7.010  -13.310 1.00 0.00 ? 386 ASP A C    9  
ATOM   10691 O  O    . ASP A 1 79 ? 4.060   -7.898  -13.758 1.00 0.00 ? 386 ASP A O    9  
ATOM   10692 C  CB   . ASP A 1 79 ? 1.234   -7.416  -11.978 1.00 0.00 ? 386 ASP A CB   9  
ATOM   10693 C  CG   . ASP A 1 79 ? 0.876   -8.415  -13.057 1.00 0.00 ? 386 ASP A CG   9  
ATOM   10694 O  OD1  . ASP A 1 79 ? 0.973   -9.635  -12.809 1.00 0.00 ? 386 ASP A OD1  9  
ATOM   10695 O  OD2  . ASP A 1 79 ? 0.467   -7.976  -14.155 1.00 0.00 ? 386 ASP A OD2  9  
ATOM   10696 H  H    . ASP A 1 79 ? 2.177   -5.523  -10.624 1.00 0.00 ? 386 ASP A H    9  
ATOM   10697 H  HA   . ASP A 1 79 ? 3.225   -7.929  -11.381 1.00 0.00 ? 386 ASP A HA   9  
ATOM   10698 H  HB2  . ASP A 1 79 ? 0.909   -7.825  -11.020 1.00 0.00 ? 386 ASP A HB2  9  
ATOM   10699 H  HB3  . ASP A 1 79 ? 0.702   -6.484  -12.182 1.00 0.00 ? 386 ASP A HB3  9  
ATOM   10700 N  N    . VAL A 1 80 ? 3.058   -5.894  -13.982 1.00 0.00 ? 387 VAL A N    9  
ATOM   10701 C  CA   . VAL A 1 80 ? 3.502   -5.694  -15.359 1.00 0.00 ? 387 VAL A CA   9  
ATOM   10702 C  C    . VAL A 1 80 ? 4.991   -5.316  -15.430 1.00 0.00 ? 387 VAL A C    9  
ATOM   10703 O  O    . VAL A 1 80 ? 5.553   -5.134  -16.511 1.00 0.00 ? 387 VAL A O    9  
ATOM   10704 C  CB   . VAL A 1 80 ? 2.640   -4.615  -16.063 1.00 0.00 ? 387 VAL A CB   9  
ATOM   10705 C  CG1  . VAL A 1 80 ? 2.919   -3.229  -15.494 1.00 0.00 ? 387 VAL A CG1  9  
ATOM   10706 C  CG2  . VAL A 1 80 ? 2.843   -4.640  -17.572 1.00 0.00 ? 387 VAL A CG2  9  
ATOM   10707 H  H    . VAL A 1 80 ? 2.530   -5.194  -13.545 1.00 0.00 ? 387 VAL A H    9  
ATOM   10708 H  HA   . VAL A 1 80 ? 3.361   -6.627  -15.885 1.00 0.00 ? 387 VAL A HA   9  
ATOM   10709 H  HB   . VAL A 1 80 ? 1.603   -4.846  -15.866 1.00 0.00 ? 387 VAL A HB   9  
ATOM   10710 H  HG11 . VAL A 1 80 ? 2.308   -2.499  -16.007 1.00 0.00 ? 387 VAL A HG11 9  
ATOM   10711 H  HG12 . VAL A 1 80 ? 3.962   -2.987  -15.635 1.00 0.00 ? 387 VAL A HG12 9  
ATOM   10712 H  HG13 . VAL A 1 80 ? 2.685   -3.218  -14.441 1.00 0.00 ? 387 VAL A HG13 9  
ATOM   10713 H  HG21 . VAL A 1 80 ? 2.254   -3.858  -18.027 1.00 0.00 ? 387 VAL A HG21 9  
ATOM   10714 H  HG22 . VAL A 1 80 ? 2.533   -5.598  -17.963 1.00 0.00 ? 387 VAL A HG22 9  
ATOM   10715 H  HG23 . VAL A 1 80 ? 3.888   -4.481  -17.796 1.00 0.00 ? 387 VAL A HG23 9  
ATOM   10716 N  N    . HIS A 1 81 ? 5.641   -5.206  -14.275 1.00 0.00 ? 388 HIS A N    9  
ATOM   10717 C  CA   . HIS A 1 81 ? 7.075   -4.935  -14.240 1.00 0.00 ? 388 HIS A CA   9  
ATOM   10718 C  C    . HIS A 1 81 ? 7.824   -6.228  -14.508 1.00 0.00 ? 388 HIS A C    9  
ATOM   10719 O  O    . HIS A 1 81 ? 8.895   -6.236  -15.106 1.00 0.00 ? 388 HIS A O    9  
ATOM   10720 C  CB   . HIS A 1 81 ? 7.494   -4.361  -12.887 1.00 0.00 ? 388 HIS A CB   9  
ATOM   10721 C  CG   . HIS A 1 81 ? 8.786   -3.607  -12.923 1.00 0.00 ? 388 HIS A CG   9  
ATOM   10722 N  ND1  . HIS A 1 81 ? 8.849   -2.232  -12.774 1.00 0.00 ? 388 HIS A ND1  9  
ATOM   10723 C  CD2  . HIS A 1 81 ? 10.064  -4.027  -13.087 1.00 0.00 ? 388 HIS A CD2  9  
ATOM   10724 C  CE1  . HIS A 1 81 ? 10.121  -1.848  -12.850 1.00 0.00 ? 388 HIS A CE1  9  
ATOM   10725 N  NE2  . HIS A 1 81 ? 10.871  -2.916  -13.040 1.00 0.00 ? 388 HIS A NE2  9  
ATOM   10726 H  H    . HIS A 1 81 ? 5.151   -5.330  -13.434 1.00 0.00 ? 388 HIS A H    9  
ATOM   10727 H  HA   . HIS A 1 81 ? 7.303   -4.223  -15.019 1.00 0.00 ? 388 HIS A HA   9  
ATOM   10728 H  HB2  . HIS A 1 81 ? 6.727   -3.686  -12.537 1.00 0.00 ? 388 HIS A HB2  9  
ATOM   10729 H  HB3  . HIS A 1 81 ? 7.602   -5.170  -12.179 1.00 0.00 ? 388 HIS A HB3  9  
ATOM   10730 H  HD2  . HIS A 1 81 ? 10.388  -5.049  -13.228 1.00 0.00 ? 388 HIS A HD2  9  
ATOM   10731 H  HE1  . HIS A 1 81 ? 10.481  -0.832  -12.770 1.00 0.00 ? 388 HIS A HE1  9  
ATOM   10732 H  HE2  . HIS A 1 81 ? 11.807  -2.889  -13.352 1.00 0.00 ? 388 HIS A HE2  9  
ATOM   10733 N  N    . THR A 1 82 ? 7.241   -7.314  -14.032 1.00 0.00 ? 389 THR A N    9  
ATOM   10734 C  CA   . THR A 1 82 ? 7.732   -8.647  -14.315 1.00 0.00 ? 389 THR A CA   9  
ATOM   10735 C  C    . THR A 1 82 ? 7.002   -9.187  -15.542 1.00 0.00 ? 389 THR A C    9  
ATOM   10736 O  O    . THR A 1 82 ? 6.209   -8.463  -16.138 1.00 0.00 ? 389 THR A O    9  
ATOM   10737 C  CB   . THR A 1 82 ? 7.486   -9.575  -13.104 1.00 0.00 ? 389 THR A CB   9  
ATOM   10738 O  OG1  . THR A 1 82 ? 6.095   -9.554  -12.740 1.00 0.00 ? 389 THR A OG1  9  
ATOM   10739 C  CG2  . THR A 1 82 ? 8.331   -9.146  -11.910 1.00 0.00 ? 389 THR A CG2  9  
ATOM   10740 H  H    . THR A 1 82 ? 6.440   -7.216  -13.477 1.00 0.00 ? 389 THR A H    9  
ATOM   10741 H  HA   . THR A 1 82 ? 8.793   -8.595  -14.515 1.00 0.00 ? 389 THR A HA   9  
ATOM   10742 H  HB   . THR A 1 82 ? 7.764   -10.582 -13.378 1.00 0.00 ? 389 THR A HB   9  
ATOM   10743 H  HG1  . THR A 1 82 ? 5.600   -9.016  -13.375 1.00 0.00 ? 389 THR A HG1  9  
ATOM   10744 H  HG21 . THR A 1 82 ? 9.376   -9.173  -12.179 1.00 0.00 ? 389 THR A HG21 9  
ATOM   10745 H  HG22 . THR A 1 82 ? 8.154   -9.820  -11.085 1.00 0.00 ? 389 THR A HG22 9  
ATOM   10746 H  HG23 . THR A 1 82 ? 8.061   -8.141  -11.618 1.00 0.00 ? 389 THR A HG23 9  
ATOM   10747 N  N    . PRO A 1 83 ? 7.282   -10.425 -15.979 1.00 0.00 ? 390 PRO A N    9  
ATOM   10748 C  CA   . PRO A 1 83 ? 6.459   -11.110 -16.977 1.00 0.00 ? 390 PRO A CA   9  
ATOM   10749 C  C    . PRO A 1 83 ? 5.192   -11.695 -16.346 1.00 0.00 ? 390 PRO A C    9  
ATOM   10750 O  O    . PRO A 1 83 ? 5.247   -12.760 -15.724 1.00 0.00 ? 390 PRO A O    9  
ATOM   10751 C  CB   . PRO A 1 83 ? 7.369   -12.243 -17.488 1.00 0.00 ? 390 PRO A CB   9  
ATOM   10752 C  CG   . PRO A 1 83 ? 8.705   -12.014 -16.857 1.00 0.00 ? 390 PRO A CG   9  
ATOM   10753 C  CD   . PRO A 1 83 ? 8.444   -11.238 -15.602 1.00 0.00 ? 390 PRO A CD   9  
ATOM   10754 H  HA   . PRO A 1 83 ? 6.191   -10.458 -17.798 1.00 0.00 ? 390 PRO A HA   9  
ATOM   10755 H  HB2  . PRO A 1 83 ? 6.954   -13.195 -17.190 1.00 0.00 ? 390 PRO A HB2  9  
ATOM   10756 H  HB3  . PRO A 1 83 ? 7.430   -12.196 -18.564 1.00 0.00 ? 390 PRO A HB3  9  
ATOM   10757 H  HG2  . PRO A 1 83 ? 9.169   -12.962 -16.624 1.00 0.00 ? 390 PRO A HG2  9  
ATOM   10758 H  HG3  . PRO A 1 83 ? 9.332   -11.443 -17.526 1.00 0.00 ? 390 PRO A HG3  9  
ATOM   10759 H  HD2  . PRO A 1 83 ? 8.206   -11.906 -14.787 1.00 0.00 ? 390 PRO A HD2  9  
ATOM   10760 H  HD3  . PRO A 1 83 ? 9.291   -10.616 -15.353 1.00 0.00 ? 390 PRO A HD3  9  
ATOM   10761 N  N    . PRO A 1 84 ? 4.036   -11.009 -16.466 1.00 0.00 ? 391 PRO A N    9  
ATOM   10762 C  CA   . PRO A 1 84 ? 2.781   -11.494 -15.889 1.00 0.00 ? 391 PRO A CA   9  
ATOM   10763 C  C    . PRO A 1 84 ? 2.238   -12.673 -16.682 1.00 0.00 ? 391 PRO A C    9  
ATOM   10764 O  O    . PRO A 1 84 ? 1.842   -13.699 -16.123 1.00 0.00 ? 391 PRO A O    9  
ATOM   10765 C  CB   . PRO A 1 84 ? 1.846   -10.289 -15.995 1.00 0.00 ? 391 PRO A CB   9  
ATOM   10766 C  CG   . PRO A 1 84 ? 2.374   -9.481  -17.132 1.00 0.00 ? 391 PRO A CG   9  
ATOM   10767 C  CD   . PRO A 1 84 ? 3.860   -9.726  -17.177 1.00 0.00 ? 391 PRO A CD   9  
ATOM   10768 H  HA   . PRO A 1 84 ? 2.901   -11.779 -14.854 1.00 0.00 ? 391 PRO A HA   9  
ATOM   10769 H  HB2  . PRO A 1 84 ? 0.839   -10.629 -16.185 1.00 0.00 ? 391 PRO A HB2  9  
ATOM   10770 H  HB3  . PRO A 1 84 ? 1.873   -9.730  -15.070 1.00 0.00 ? 391 PRO A HB3  9  
ATOM   10771 H  HG2  . PRO A 1 84 ? 1.917   -9.806  -18.055 1.00 0.00 ? 391 PRO A HG2  9  
ATOM   10772 H  HG3  . PRO A 1 84 ? 2.173   -8.433  -16.963 1.00 0.00 ? 391 PRO A HG3  9  
ATOM   10773 H  HD2  . PRO A 1 84 ? 4.196   -9.804  -18.200 1.00 0.00 ? 391 PRO A HD2  9  
ATOM   10774 H  HD3  . PRO A 1 84 ? 4.384   -8.928  -16.668 1.00 0.00 ? 391 PRO A HD3  9  
ATOM   10775 N  N    . GLY A 1 85 ? 2.238   -12.510 -17.990 1.00 0.00 ? 392 GLY A N    9  
ATOM   10776 C  CA   . GLY A 1 85 ? 1.894   -13.579 -18.886 1.00 0.00 ? 392 GLY A CA   9  
ATOM   10777 C  C    . GLY A 1 85 ? 2.910   -13.671 -19.997 1.00 0.00 ? 392 GLY A C    9  
ATOM   10778 O  O    . GLY A 1 85 ? 3.623   -12.697 -20.259 1.00 0.00 ? 392 GLY A O    9  
ATOM   10779 H  H    . GLY A 1 85 ? 2.485   -11.638 -18.359 1.00 0.00 ? 392 GLY A H    9  
ATOM   10780 H  HA2  . GLY A 1 85 ? 1.874   -14.512 -18.340 1.00 0.00 ? 392 GLY A HA2  9  
ATOM   10781 H  HA3  . GLY A 1 85 ? 0.920   -13.390 -19.312 1.00 0.00 ? 392 GLY A HA3  9  
ATOM   10782 N  N    . SER A 1 86 ? 2.988   -14.829 -20.634 1.00 0.00 ? 393 SER A N    9  
ATOM   10783 C  CA   . SER A 1 86 ? 3.943   -15.060 -21.709 1.00 0.00 ? 393 SER A CA   9  
ATOM   10784 C  C    . SER A 1 86 ? 5.390   -14.920 -21.206 1.00 0.00 ? 393 SER A C    9  
ATOM   10785 O  O    . SER A 1 86 ? 5.894   -15.807 -20.511 1.00 0.00 ? 393 SER A O    9  
ATOM   10786 C  CB   . SER A 1 86 ? 3.659   -14.111 -22.879 1.00 0.00 ? 393 SER A CB   9  
ATOM   10787 O  OG   . SER A 1 86 ? 2.325   -14.264 -23.339 1.00 0.00 ? 393 SER A OG   9  
ATOM   10788 H  H    . SER A 1 86 ? 2.380   -15.553 -20.375 1.00 0.00 ? 393 SER A H    9  
ATOM   10789 H  HA   . SER A 1 86 ? 3.803   -16.076 -22.049 1.00 0.00 ? 393 SER A HA   9  
ATOM   10790 H  HB2  . SER A 1 86 ? 3.797   -13.091 -22.556 1.00 0.00 ? 393 SER A HB2  9  
ATOM   10791 H  HB3  . SER A 1 86 ? 4.335   -14.328 -23.692 1.00 0.00 ? 393 SER A HB3  9  
ATOM   10792 H  HG   . SER A 1 86 ? 1.882   -13.409 -23.310 1.00 0.00 ? 393 SER A HG   9  
ATOM   10793 N  N    . THR A 1 87 ? 6.038   -13.800 -21.524 1.00 0.00 ? 394 THR A N    9  
ATOM   10794 C  CA   . THR A 1 87 ? 7.425   -13.559 -21.148 1.00 0.00 ? 394 THR A CA   9  
ATOM   10795 C  C    . THR A 1 87 ? 7.741   -12.076 -21.320 1.00 0.00 ? 394 THR A C    9  
ATOM   10796 O  O    . THR A 1 87 ? 7.573   -11.311 -20.354 1.00 0.00 ? 394 THR A O    9  
ATOM   10797 C  CB   . THR A 1 87 ? 8.418   -14.380 -22.007 1.00 0.00 ? 394 THR A CB   9  
ATOM   10798 O  OG1  . THR A 1 87 ? 8.041   -15.763 -22.029 1.00 0.00 ? 394 THR A OG1  9  
ATOM   10799 C  CG2  . THR A 1 87 ? 9.834   -14.255 -21.463 1.00 0.00 ? 394 THR A CG2  9  
ATOM   10800 O  OXT  . THR A 1 87 ? 8.109   -11.676 -22.439 1.00 0.00 ? 394 THR A OXT  9  
ATOM   10801 H  H    . THR A 1 87 ? 5.564   -13.097 -22.008 1.00 0.00 ? 394 THR A H    9  
ATOM   10802 H  HA   . THR A 1 87 ? 7.550   -13.834 -20.111 1.00 0.00 ? 394 THR A HA   9  
ATOM   10803 H  HB   . THR A 1 87 ? 8.402   -13.993 -23.017 1.00 0.00 ? 394 THR A HB   9  
ATOM   10804 H  HG1  . THR A 1 87 ? 7.327   -15.907 -21.393 1.00 0.00 ? 394 THR A HG1  9  
ATOM   10805 H  HG21 . THR A 1 87 ? 10.141  -13.220 -21.492 1.00 0.00 ? 394 THR A HG21 9  
ATOM   10806 H  HG22 . THR A 1 87 ? 10.507  -14.845 -22.067 1.00 0.00 ? 394 THR A HG22 9  
ATOM   10807 H  HG23 . THR A 1 87 ? 9.861   -14.610 -20.443 1.00 0.00 ? 394 THR A HG23 9  
HETATM 10808 ZN ZN   . ZN  B 2 .  ? -6.633  -1.169  -5.609  1.00 0.00 ? 401 ZN  A ZN   9  
HETATM 10809 ZN ZN   . ZN  C 2 .  ? 6.962   -1.138  -12.470 1.00 0.00 ? 402 ZN  A ZN   9  
ATOM   10810 N  N    . MET A 1 9  ? 11.083  20.860  1.099   1.00 0.00 ? 316 MET A N    10 
ATOM   10811 C  CA   . MET A 1 9  ? 12.093  21.617  1.877   1.00 0.00 ? 316 MET A CA   10 
ATOM   10812 C  C    . MET A 1 9  ? 11.465  22.190  3.147   1.00 0.00 ? 316 MET A C    10 
ATOM   10813 O  O    . MET A 1 9  ? 11.651  21.649  4.235   1.00 0.00 ? 316 MET A O    10 
ATOM   10814 C  CB   . MET A 1 9  ? 12.696  22.745  1.029   1.00 0.00 ? 316 MET A CB   10 
ATOM   10815 C  CG   . MET A 1 9  ? 13.769  23.549  1.750   1.00 0.00 ? 316 MET A CG   10 
ATOM   10816 S  SD   . MET A 1 9  ? 14.407  24.911  0.755   1.00 0.00 ? 316 MET A SD   10 
ATOM   10817 C  CE   . MET A 1 9  ? 15.624  25.600  1.875   1.00 0.00 ? 316 MET A CE   10 
ATOM   10818 H  H    . MET A 1 9  ? 10.307  21.488  0.811   1.00 0.00 ? 316 MET A H    10 
ATOM   10819 H  HA   . MET A 1 9  ? 12.878  20.930  2.162   1.00 0.00 ? 316 MET A HA   10 
ATOM   10820 H  HB2  . MET A 1 9  ? 13.137  22.314  0.142   1.00 0.00 ? 316 MET A HB2  10 
ATOM   10821 H  HB3  . MET A 1 9  ? 11.906  23.420  0.736   1.00 0.00 ? 316 MET A HB3  10 
ATOM   10822 H  HG2  . MET A 1 9  ? 13.346  23.955  2.655   1.00 0.00 ? 316 MET A HG2  10 
ATOM   10823 H  HG3  . MET A 1 9  ? 14.588  22.891  2.000   1.00 0.00 ? 316 MET A HG3  10 
ATOM   10824 H  HE1  . MET A 1 9  ? 16.372  24.853  2.098   1.00 0.00 ? 316 MET A HE1  10 
ATOM   10825 H  HE2  . MET A 1 9  ? 15.138  25.907  2.790   1.00 0.00 ? 316 MET A HE2  10 
ATOM   10826 H  HE3  . MET A 1 9  ? 16.097  26.455  1.414   1.00 0.00 ? 316 MET A HE3  10 
ATOM   10827 N  N    . ASN A 1 10 ? 10.714  23.278  3.005   1.00 0.00 ? 317 ASN A N    10 
ATOM   10828 C  CA   . ASN A 1 10 ? 10.039  23.886  4.148   1.00 0.00 ? 317 ASN A CA   10 
ATOM   10829 C  C    . ASN A 1 10 ? 8.631   23.322  4.278   1.00 0.00 ? 317 ASN A C    10 
ATOM   10830 O  O    . ASN A 1 10 ? 8.167   23.024  5.377   1.00 0.00 ? 317 ASN A O    10 
ATOM   10831 C  CB   . ASN A 1 10 ? 9.994   25.419  4.025   1.00 0.00 ? 317 ASN A CB   10 
ATOM   10832 C  CG   . ASN A 1 10 ? 9.260   25.906  2.784   1.00 0.00 ? 317 ASN A CG   10 
ATOM   10833 O  OD1  . ASN A 1 10 ? 9.302   25.272  1.729   1.00 0.00 ? 317 ASN A OD1  10 
ATOM   10834 N  ND2  . ASN A 1 10 ? 8.571   27.029  2.906   1.00 0.00 ? 317 ASN A ND2  10 
ATOM   10835 H  H    . ASN A 1 10 ? 10.607  23.682  2.116   1.00 0.00 ? 317 ASN A H    10 
ATOM   10836 H  HA   . ASN A 1 10 ? 10.597  23.622  5.035   1.00 0.00 ? 317 ASN A HA   10 
ATOM   10837 H  HB2  . ASN A 1 10 ? 9.496   25.825  4.891   1.00 0.00 ? 317 ASN A HB2  10 
ATOM   10838 H  HB3  . ASN A 1 10 ? 11.006  25.796  3.990   1.00 0.00 ? 317 ASN A HB3  10 
ATOM   10839 H  HD21 . ASN A 1 10 ? 8.568   27.481  3.780   1.00 0.00 ? 317 ASN A HD21 10 
ATOM   10840 H  HD22 . ASN A 1 10 ? 8.082   27.360  2.121   1.00 0.00 ? 317 ASN A HD22 10 
ATOM   10841 N  N    . ILE A 1 11 ? 7.964   23.168  3.146   1.00 0.00 ? 318 ILE A N    10 
ATOM   10842 C  CA   . ILE A 1 11 ? 6.654   22.547  3.107   1.00 0.00 ? 318 ILE A CA   10 
ATOM   10843 C  C    . ILE A 1 11 ? 6.766   21.201  2.412   1.00 0.00 ? 318 ILE A C    10 
ATOM   10844 O  O    . ILE A 1 11 ? 7.111   21.143  1.231   1.00 0.00 ? 318 ILE A O    10 
ATOM   10845 C  CB   . ILE A 1 11 ? 5.619   23.428  2.366   1.00 0.00 ? 318 ILE A CB   10 
ATOM   10846 C  CG1  . ILE A 1 11 ? 5.467   24.788  3.061   1.00 0.00 ? 318 ILE A CG1  10 
ATOM   10847 C  CG2  . ILE A 1 11 ? 4.270   22.723  2.275   1.00 0.00 ? 318 ILE A CG2  10 
ATOM   10848 C  CD1  . ILE A 1 11 ? 4.952   24.700  4.485   1.00 0.00 ? 318 ILE A CD1  10 
ATOM   10849 H  H    . ILE A 1 11 ? 8.365   23.485  2.309   1.00 0.00 ? 318 ILE A H    10 
ATOM   10850 H  HA   . ILE A 1 11 ? 6.321   22.394  4.121   1.00 0.00 ? 318 ILE A HA   10 
ATOM   10851 H  HB   . ILE A 1 11 ? 5.976   23.588  1.361   1.00 0.00 ? 318 ILE A HB   10 
ATOM   10852 H  HG12 . ILE A 1 11 ? 6.429   25.276  3.090   1.00 0.00 ? 318 ILE A HG12 10 
ATOM   10853 H  HG13 . ILE A 1 11 ? 4.777   25.397  2.496   1.00 0.00 ? 318 ILE A HG13 10 
ATOM   10854 H  HG21 . ILE A 1 11 ? 4.386   21.792  1.740   1.00 0.00 ? 318 ILE A HG21 10 
ATOM   10855 H  HG22 . ILE A 1 11 ? 3.569   23.356  1.750   1.00 0.00 ? 318 ILE A HG22 10 
ATOM   10856 H  HG23 . ILE A 1 11 ? 3.900   22.523  3.270   1.00 0.00 ? 318 ILE A HG23 10 
ATOM   10857 H  HD11 . ILE A 1 11 ? 4.843   25.695  4.889   1.00 0.00 ? 318 ILE A HD11 10 
ATOM   10858 H  HD12 . ILE A 1 11 ? 5.652   24.142  5.088   1.00 0.00 ? 318 ILE A HD12 10 
ATOM   10859 H  HD13 . ILE A 1 11 ? 3.994   24.203  4.492   1.00 0.00 ? 318 ILE A HD13 10 
ATOM   10860 N  N    . PRO A 1 12 ? 6.512   20.103  3.141   1.00 0.00 ? 319 PRO A N    10 
ATOM   10861 C  CA   . PRO A 1 12 ? 6.630   18.753  2.592   1.00 0.00 ? 319 PRO A CA   10 
ATOM   10862 C  C    . PRO A 1 12 ? 5.657   18.513  1.437   1.00 0.00 ? 319 PRO A C    10 
ATOM   10863 O  O    . PRO A 1 12 ? 4.437   18.568  1.623   1.00 0.00 ? 319 PRO A O    10 
ATOM   10864 C  CB   . PRO A 1 12 ? 6.300   17.837  3.778   1.00 0.00 ? 319 PRO A CB   10 
ATOM   10865 C  CG   . PRO A 1 12 ? 5.576   18.697  4.756   1.00 0.00 ? 319 PRO A CG   10 
ATOM   10866 C  CD   . PRO A 1 12 ? 6.098   20.091  4.555   1.00 0.00 ? 319 PRO A CD   10 
ATOM   10867 H  HA   . PRO A 1 12 ? 7.635   18.560  2.257   1.00 0.00 ? 319 PRO A HA   10 
ATOM   10868 H  HB2  . PRO A 1 12 ? 5.681   17.019  3.439   1.00 0.00 ? 319 PRO A HB2  10 
ATOM   10869 H  HB3  . PRO A 1 12 ? 7.217   17.449  4.199   1.00 0.00 ? 319 PRO A HB3  10 
ATOM   10870 H  HG2  . PRO A 1 12 ? 4.515   18.662  4.559   1.00 0.00 ? 319 PRO A HG2  10 
ATOM   10871 H  HG3  . PRO A 1 12 ? 5.783   18.361  5.761   1.00 0.00 ? 319 PRO A HG3  10 
ATOM   10872 H  HD2  . PRO A 1 12 ? 5.314   20.814  4.735   1.00 0.00 ? 319 PRO A HD2  10 
ATOM   10873 H  HD3  . PRO A 1 12 ? 6.939   20.278  5.206   1.00 0.00 ? 319 PRO A HD3  10 
ATOM   10874 N  N    . PRO A 1 13 ? 6.188   18.279  0.222   1.00 0.00 ? 320 PRO A N    10 
ATOM   10875 C  CA   . PRO A 1 13 ? 5.372   17.975  -0.953  1.00 0.00 ? 320 PRO A CA   10 
ATOM   10876 C  C    . PRO A 1 13 ? 4.479   16.763  -0.724  1.00 0.00 ? 320 PRO A C    10 
ATOM   10877 O  O    . PRO A 1 13 ? 4.932   15.723  -0.248  1.00 0.00 ? 320 PRO A O    10 
ATOM   10878 C  CB   . PRO A 1 13 ? 6.398   17.688  -2.060  1.00 0.00 ? 320 PRO A CB   10 
ATOM   10879 C  CG   . PRO A 1 13 ? 7.696   17.480  -1.355  1.00 0.00 ? 320 PRO A CG   10 
ATOM   10880 C  CD   . PRO A 1 13 ? 7.623   18.302  -0.102  1.00 0.00 ? 320 PRO A CD   10 
ATOM   10881 H  HA   . PRO A 1 13 ? 4.762   18.818  -1.235  1.00 0.00 ? 320 PRO A HA   10 
ATOM   10882 H  HB2  . PRO A 1 13 ? 6.103   16.804  -2.605  1.00 0.00 ? 320 PRO A HB2  10 
ATOM   10883 H  HB3  . PRO A 1 13 ? 6.447   18.531  -2.734  1.00 0.00 ? 320 PRO A HB3  10 
ATOM   10884 H  HG2  . PRO A 1 13 ? 7.817   16.435  -1.110  1.00 0.00 ? 320 PRO A HG2  10 
ATOM   10885 H  HG3  . PRO A 1 13 ? 8.512   17.816  -1.979  1.00 0.00 ? 320 PRO A HG3  10 
ATOM   10886 H  HD2  . PRO A 1 13 ? 8.208   17.844  0.686   1.00 0.00 ? 320 PRO A HD2  10 
ATOM   10887 H  HD3  . PRO A 1 13 ? 7.958   19.317  -0.293  1.00 0.00 ? 320 PRO A HD3  10 
ATOM   10888 N  N    . ALA A 1 14 ? 3.209   16.902  -1.069  1.00 0.00 ? 321 ALA A N    10 
ATOM   10889 C  CA   . ALA A 1 14 ? 2.236   15.849  -0.855  1.00 0.00 ? 321 ALA A CA   10 
ATOM   10890 C  C    . ALA A 1 14 ? 1.314   15.813  -2.049  1.00 0.00 ? 321 ALA A C    10 
ATOM   10891 O  O    . ALA A 1 14 ? 0.144   15.444  -1.953  1.00 0.00 ? 321 ALA A O    10 
ATOM   10892 C  CB   . ALA A 1 14 ? 1.459   16.095  0.430   1.00 0.00 ? 321 ALA A CB   10 
ATOM   10893 H  H    . ALA A 1 14 ? 2.914   17.729  -1.506  1.00 0.00 ? 321 ALA A H    10 
ATOM   10894 H  HA   . ALA A 1 14 ? 2.760   14.907  -0.776  1.00 0.00 ? 321 ALA A HA   10 
ATOM   10895 H  HB1  . ALA A 1 14 ? 2.144   16.126  1.265   1.00 0.00 ? 321 ALA A HB1  10 
ATOM   10896 H  HB2  . ALA A 1 14 ? 0.747   15.297  0.579   1.00 0.00 ? 321 ALA A HB2  10 
ATOM   10897 H  HB3  . ALA A 1 14 ? 0.934   17.037  0.361   1.00 0.00 ? 321 ALA A HB3  10 
ATOM   10898 N  N    . ARG A 1 15 ? 1.874   16.194  -3.188  1.00 0.00 ? 322 ARG A N    10 
ATOM   10899 C  CA   . ARG A 1 15 ? 1.102   16.339  -4.403  1.00 0.00 ? 322 ARG A CA   10 
ATOM   10900 C  C    . ARG A 1 15 ? 1.147   15.047  -5.208  1.00 0.00 ? 322 ARG A C    10 
ATOM   10901 O  O    . ARG A 1 15 ? 0.678   14.989  -6.345  1.00 0.00 ? 322 ARG A O    10 
ATOM   10902 C  CB   . ARG A 1 15 ? 1.650   17.494  -5.249  1.00 0.00 ? 322 ARG A CB   10 
ATOM   10903 C  CG   . ARG A 1 15 ? 1.869   18.780  -4.469  1.00 0.00 ? 322 ARG A CG   10 
ATOM   10904 C  CD   . ARG A 1 15 ? 0.577   19.297  -3.861  1.00 0.00 ? 322 ARG A CD   10 
ATOM   10905 N  NE   . ARG A 1 15 ? 0.803   20.489  -3.046  1.00 0.00 ? 322 ARG A NE   10 
ATOM   10906 C  CZ   . ARG A 1 15 ? -0.138  21.075  -2.310  1.00 0.00 ? 322 ARG A CZ   10 
ATOM   10907 N  NH1  . ARG A 1 15 ? -1.367  20.573  -2.269  1.00 0.00 ? 322 ARG A NH1  10 
ATOM   10908 N  NH2  . ARG A 1 15 ? 0.154   22.166  -1.613  1.00 0.00 ? 322 ARG A NH2  10 
ATOM   10909 H  H    . ARG A 1 15 ? 2.842   16.359  -3.216  1.00 0.00 ? 322 ARG A H    10 
ATOM   10910 H  HA   . ARG A 1 15 ? 0.088   16.557  -4.119  1.00 0.00 ? 322 ARG A HA   10 
ATOM   10911 H  HB2  . ARG A 1 15 ? 2.594   17.195  -5.676  1.00 0.00 ? 322 ARG A HB2  10 
ATOM   10912 H  HB3  . ARG A 1 15 ? 0.955   17.701  -6.050  1.00 0.00 ? 322 ARG A HB3  10 
ATOM   10913 H  HG2  . ARG A 1 15 ? 2.576   18.591  -3.676  1.00 0.00 ? 322 ARG A HG2  10 
ATOM   10914 H  HG3  . ARG A 1 15 ? 2.267   19.530  -5.136  1.00 0.00 ? 322 ARG A HG3  10 
ATOM   10915 H  HD2  . ARG A 1 15 ? -0.110  19.542  -4.658  1.00 0.00 ? 322 ARG A HD2  10 
ATOM   10916 H  HD3  . ARG A 1 15 ? 0.149   18.524  -3.241  1.00 0.00 ? 322 ARG A HD3  10 
ATOM   10917 H  HE   . ARG A 1 15 ? 1.708   20.875  -3.055  1.00 0.00 ? 322 ARG A HE   10 
ATOM   10918 H  HH11 . ARG A 1 15 ? -1.591  19.749  -2.792  1.00 0.00 ? 322 ARG A HH11 10 
ATOM   10919 H  HH12 . ARG A 1 15 ? -2.079  21.016  -1.715  1.00 0.00 ? 322 ARG A HH12 10 
ATOM   10920 H  HH21 . ARG A 1 15 ? 1.081   22.549  -1.643  1.00 0.00 ? 322 ARG A HH21 10 
ATOM   10921 H  HH22 . ARG A 1 15 ? -0.549  22.616  -1.057  1.00 0.00 ? 322 ARG A HH22 10 
ATOM   10922 N  N    . TRP A 1 16 ? 1.729   14.019  -4.613  1.00 0.00 ? 323 TRP A N    10 
ATOM   10923 C  CA   . TRP A 1 16 ? 1.908   12.749  -5.289  1.00 0.00 ? 323 TRP A CA   10 
ATOM   10924 C  C    . TRP A 1 16 ? 0.624   11.921  -5.301  1.00 0.00 ? 323 TRP A C    10 
ATOM   10925 O  O    . TRP A 1 16 ? 0.413   11.048  -4.456  1.00 0.00 ? 323 TRP A O    10 
ATOM   10926 C  CB   . TRP A 1 16 ? 3.066   11.954  -4.663  1.00 0.00 ? 323 TRP A CB   10 
ATOM   10927 C  CG   . TRP A 1 16 ? 3.150   12.038  -3.159  1.00 0.00 ? 323 TRP A CG   10 
ATOM   10928 C  CD1  . TRP A 1 16 ? 2.142   11.837  -2.257  1.00 0.00 ? 323 TRP A CD1  10 
ATOM   10929 C  CD2  . TRP A 1 16 ? 4.323   12.322  -2.387  1.00 0.00 ? 323 TRP A CD2  10 
ATOM   10930 N  NE1  . TRP A 1 16 ? 2.613   11.996  -0.978  1.00 0.00 ? 323 TRP A NE1  10 
ATOM   10931 C  CE2  . TRP A 1 16 ? 3.949   12.288  -1.029  1.00 0.00 ? 323 TRP A CE2  10 
ATOM   10932 C  CE3  . TRP A 1 16 ? 5.653   12.600  -2.710  1.00 0.00 ? 323 TRP A CE3  10 
ATOM   10933 C  CZ2  . TRP A 1 16 ? 4.858   12.522  -0.000  1.00 0.00 ? 323 TRP A CZ2  10 
ATOM   10934 C  CZ3  . TRP A 1 16 ? 6.554   12.836  -1.689  1.00 0.00 ? 323 TRP A CZ3  10 
ATOM   10935 C  CH2  . TRP A 1 16 ? 6.153   12.794  -0.347  1.00 0.00 ? 323 TRP A CH2  10 
ATOM   10936 H  H    . TRP A 1 16 ? 2.039   14.117  -3.691  1.00 0.00 ? 323 TRP A H    10 
ATOM   10937 H  HA   . TRP A 1 16 ? 2.168   12.971  -6.313  1.00 0.00 ? 323 TRP A HA   10 
ATOM   10938 H  HB2  . TRP A 1 16 ? 2.958   10.914  -4.925  1.00 0.00 ? 323 TRP A HB2  10 
ATOM   10939 H  HB3  . TRP A 1 16 ? 3.999   12.323  -5.066  1.00 0.00 ? 323 TRP A HB3  10 
ATOM   10940 H  HD1  . TRP A 1 16 ? 1.122   11.602  -2.528  1.00 0.00 ? 323 TRP A HD1  10 
ATOM   10941 H  HE1  . TRP A 1 16 ? 2.080   11.908  -0.158  1.00 0.00 ? 323 TRP A HE1  10 
ATOM   10942 H  HE3  . TRP A 1 16 ? 5.980   12.638  -3.740  1.00 0.00 ? 323 TRP A HE3  10 
ATOM   10943 H  HZ2  . TRP A 1 16 ? 4.563   12.494  1.039   1.00 0.00 ? 323 TRP A HZ2  10 
ATOM   10944 H  HZ3  . TRP A 1 16 ? 7.587   13.052  -1.921  1.00 0.00 ? 323 TRP A HZ3  10 
ATOM   10945 H  HH2  . TRP A 1 16 ? 6.891   12.982  0.419   1.00 0.00 ? 323 TRP A HH2  10 
ATOM   10946 N  N    . LYS A 1 17 ? -0.251  12.214  -6.249  1.00 0.00 ? 324 LYS A N    10 
ATOM   10947 C  CA   . LYS A 1 17 ? -1.426  11.392  -6.455  1.00 0.00 ? 324 LYS A CA   10 
ATOM   10948 C  C    . LYS A 1 17 ? -1.039  10.161  -7.264  1.00 0.00 ? 324 LYS A C    10 
ATOM   10949 O  O    . LYS A 1 17 ? -1.110  10.147  -8.494  1.00 0.00 ? 324 LYS A O    10 
ATOM   10950 C  CB   . LYS A 1 17 ? -2.561  12.172  -7.133  1.00 0.00 ? 324 LYS A CB   10 
ATOM   10951 C  CG   . LYS A 1 17 ? -2.164  12.863  -8.428  1.00 0.00 ? 324 LYS A CG   10 
ATOM   10952 C  CD   . LYS A 1 17 ? -3.386  13.392  -9.160  1.00 0.00 ? 324 LYS A CD   10 
ATOM   10953 C  CE   . LYS A 1 17 ? -3.016  14.014  -10.496 1.00 0.00 ? 324 LYS A CE   10 
ATOM   10954 N  NZ   . LYS A 1 17 ? -2.183  15.233  -10.332 1.00 0.00 ? 324 LYS A NZ   10 
ATOM   10955 H  H    . LYS A 1 17 ? -0.103  13.001  -6.815  1.00 0.00 ? 324 LYS A H    10 
ATOM   10956 H  HA   . LYS A 1 17 ? -1.764  11.064  -5.480  1.00 0.00 ? 324 LYS A HA   10 
ATOM   10957 H  HB2  . LYS A 1 17 ? -3.368  11.478  -7.360  1.00 0.00 ? 324 LYS A HB2  10 
ATOM   10958 H  HB3  . LYS A 1 17 ? -2.922  12.932  -6.442  1.00 0.00 ? 324 LYS A HB3  10 
ATOM   10959 H  HG2  . LYS A 1 17 ? -1.507  13.688  -8.199  1.00 0.00 ? 324 LYS A HG2  10 
ATOM   10960 H  HG3  . LYS A 1 17 ? -1.652  12.155  -9.063  1.00 0.00 ? 324 LYS A HG3  10 
ATOM   10961 H  HD2  . LYS A 1 17 ? -4.070  12.576  -9.334  1.00 0.00 ? 324 LYS A HD2  10 
ATOM   10962 H  HD3  . LYS A 1 17 ? -3.864  14.140  -8.546  1.00 0.00 ? 324 LYS A HD3  10 
ATOM   10963 H  HE2  . LYS A 1 17 ? -2.466  13.290  -11.077 1.00 0.00 ? 324 LYS A HE2  10 
ATOM   10964 H  HE3  . LYS A 1 17 ? -3.924  14.278  -11.020 1.00 0.00 ? 324 LYS A HE3  10 
ATOM   10965 H  HZ1  . LYS A 1 17 ? -2.687  15.935  -9.753  1.00 0.00 ? 324 LYS A HZ1  10 
ATOM   10966 H  HZ2  . LYS A 1 17 ? -1.977  15.651  -11.260 1.00 0.00 ? 324 LYS A HZ2  10 
ATOM   10967 H  HZ3  . LYS A 1 17 ? -1.283  14.996  -9.864  1.00 0.00 ? 324 LYS A HZ3  10 
ATOM   10968 N  N    . LEU A 1 18 ? -0.560  9.151   -6.564  1.00 0.00 ? 325 LEU A N    10 
ATOM   10969 C  CA   . LEU A 1 18 ? -0.119  7.923   -7.197  1.00 0.00 ? 325 LEU A CA   10 
ATOM   10970 C  C    . LEU A 1 18 ? -1.324  7.083   -7.601  1.00 0.00 ? 325 LEU A C    10 
ATOM   10971 O  O    . LEU A 1 18 ? -2.081  6.622   -6.747  1.00 0.00 ? 325 LEU A O    10 
ATOM   10972 C  CB   . LEU A 1 18 ? 0.792   7.149   -6.240  1.00 0.00 ? 325 LEU A CB   10 
ATOM   10973 C  CG   . LEU A 1 18 ? 1.981   7.945   -5.693  1.00 0.00 ? 325 LEU A CG   10 
ATOM   10974 C  CD1  . LEU A 1 18 ? 2.770   7.109   -4.698  1.00 0.00 ? 325 LEU A CD1  10 
ATOM   10975 C  CD2  . LEU A 1 18 ? 2.884   8.413   -6.826  1.00 0.00 ? 325 LEU A CD2  10 
ATOM   10976 H  H    . LEU A 1 18 ? -0.499  9.235   -5.590  1.00 0.00 ? 325 LEU A H    10 
ATOM   10977 H  HA   . LEU A 1 18 ? 0.440   8.186   -8.084  1.00 0.00 ? 325 LEU A HA   10 
ATOM   10978 H  HB2  . LEU A 1 18 ? 0.191   6.813   -5.397  1.00 0.00 ? 325 LEU A HB2  10 
ATOM   10979 H  HB3  . LEU A 1 18 ? 1.183   6.284   -6.770  1.00 0.00 ? 325 LEU A HB3  10 
ATOM   10980 H  HG   . LEU A 1 18 ? 1.613   8.819   -5.176  1.00 0.00 ? 325 LEU A HG   10 
ATOM   10981 H  HD11 . LEU A 1 18 ? 3.613   7.681   -4.338  1.00 0.00 ? 325 LEU A HD11 10 
ATOM   10982 H  HD12 . LEU A 1 18 ? 3.126   6.210   -5.183  1.00 0.00 ? 325 LEU A HD12 10 
ATOM   10983 H  HD13 . LEU A 1 18 ? 2.134   6.842   -3.868  1.00 0.00 ? 325 LEU A HD13 10 
ATOM   10984 H  HD21 . LEU A 1 18 ? 3.723   8.956   -6.418  1.00 0.00 ? 325 LEU A HD21 10 
ATOM   10985 H  HD22 . LEU A 1 18 ? 2.325   9.059   -7.487  1.00 0.00 ? 325 LEU A HD22 10 
ATOM   10986 H  HD23 . LEU A 1 18 ? 3.243   7.557   -7.379  1.00 0.00 ? 325 LEU A HD23 10 
ATOM   10987 N  N    . THR A 1 19 ? -1.509  6.914   -8.904  1.00 0.00 ? 326 THR A N    10 
ATOM   10988 C  CA   . THR A 1 19 ? -2.665  6.205   -9.426  1.00 0.00 ? 326 THR A CA   10 
ATOM   10989 C  C    . THR A 1 19 ? -2.515  4.697   -9.245  1.00 0.00 ? 326 THR A C    10 
ATOM   10990 O  O    . THR A 1 19 ? -1.521  4.100   -9.658  1.00 0.00 ? 326 THR A O    10 
ATOM   10991 C  CB   . THR A 1 19 ? -2.880  6.506   -10.918 1.00 0.00 ? 326 THR A CB   10 
ATOM   10992 O  OG1  . THR A 1 19 ? -2.753  7.915   -11.158 1.00 0.00 ? 326 THR A OG1  10 
ATOM   10993 C  CG2  . THR A 1 19 ? -4.252  6.034   -11.384 1.00 0.00 ? 326 THR A CG2  10 
ATOM   10994 H  H    . THR A 1 19 ? -0.849  7.271   -9.532  1.00 0.00 ? 326 THR A H    10 
ATOM   10995 H  HA   . THR A 1 19 ? -3.537  6.540   -8.882  1.00 0.00 ? 326 THR A HA   10 
ATOM   10996 H  HB   . THR A 1 19 ? -2.127  5.976   -11.479 1.00 0.00 ? 326 THR A HB   10 
ATOM   10997 H  HG1  . THR A 1 19 ? -1.834  8.178   -11.042 1.00 0.00 ? 326 THR A HG1  10 
ATOM   10998 H  HG21 . THR A 1 19 ? -4.342  4.970   -11.228 1.00 0.00 ? 326 THR A HG21 10 
ATOM   10999 H  HG22 . THR A 1 19 ? -4.371  6.254   -12.435 1.00 0.00 ? 326 THR A HG22 10 
ATOM   11000 H  HG23 . THR A 1 19 ? -5.019  6.546   -10.821 1.00 0.00 ? 326 THR A HG23 10 
ATOM   11001 N  N    . CYS A 1 20 ? -3.522  4.103   -8.639  1.00 0.00 ? 327 CYS A N    10 
ATOM   11002 C  CA   . CYS A 1 20 ? -3.560  2.670   -8.408  1.00 0.00 ? 327 CYS A CA   10 
ATOM   11003 C  C    . CYS A 1 20 ? -4.225  1.988   -9.591  1.00 0.00 ? 327 CYS A C    10 
ATOM   11004 O  O    . CYS A 1 20 ? -5.429  2.144   -9.801  1.00 0.00 ? 327 CYS A O    10 
ATOM   11005 C  CB   . CYS A 1 20 ? -4.328  2.374   -7.115  1.00 0.00 ? 327 CYS A CB   10 
ATOM   11006 S  SG   . CYS A 1 20 ? -4.646  0.615   -6.792  1.00 0.00 ? 327 CYS A SG   10 
ATOM   11007 H  H    . CYS A 1 20 ? -4.286  4.652   -8.365  1.00 0.00 ? 327 CYS A H    10 
ATOM   11008 H  HA   . CYS A 1 20 ? -2.544  2.313   -8.314  1.00 0.00 ? 327 CYS A HA   10 
ATOM   11009 H  HB2  . CYS A 1 20 ? -3.767  2.761   -6.278  1.00 0.00 ? 327 CYS A HB2  10 
ATOM   11010 H  HB3  . CYS A 1 20 ? -5.284  2.876   -7.157  1.00 0.00 ? 327 CYS A HB3  10 
ATOM   11011 N  N    . TYR A 1 21 ? -3.452  1.225   -10.359 1.00 0.00 ? 328 TYR A N    10 
ATOM   11012 C  CA   . TYR A 1 21 ? -3.973  0.642   -11.594 1.00 0.00 ? 328 TYR A CA   10 
ATOM   11013 C  C    . TYR A 1 21 ? -4.983  -0.453  -11.277 1.00 0.00 ? 328 TYR A C    10 
ATOM   11014 O  O    . TYR A 1 21 ? -5.837  -0.790  -12.095 1.00 0.00 ? 328 TYR A O    10 
ATOM   11015 C  CB   . TYR A 1 21 ? -2.844  0.115   -12.493 1.00 0.00 ? 328 TYR A CB   10 
ATOM   11016 C  CG   . TYR A 1 21 ? -2.127  -1.114  -11.977 1.00 0.00 ? 328 TYR A CG   10 
ATOM   11017 C  CD1  . TYR A 1 21 ? -1.117  -1.012  -11.030 1.00 0.00 ? 328 TYR A CD1  10 
ATOM   11018 C  CD2  . TYR A 1 21 ? -2.449  -2.378  -12.458 1.00 0.00 ? 328 TYR A CD2  10 
ATOM   11019 C  CE1  . TYR A 1 21 ? -0.449  -2.133  -10.577 1.00 0.00 ? 328 TYR A CE1  10 
ATOM   11020 C  CE2  . TYR A 1 21 ? -1.790  -3.503  -12.005 1.00 0.00 ? 328 TYR A CE2  10 
ATOM   11021 C  CZ   . TYR A 1 21 ? -0.790  -3.377  -11.068 1.00 0.00 ? 328 TYR A CZ   10 
ATOM   11022 O  OH   . TYR A 1 21 ? -0.127  -4.498  -10.621 1.00 0.00 ? 328 TYR A OH   10 
ATOM   11023 H  H    . TYR A 1 21 ? -2.524  1.044   -10.082 1.00 0.00 ? 328 TYR A H    10 
ATOM   11024 H  HA   . TYR A 1 21 ? -4.492  1.430   -12.123 1.00 0.00 ? 328 TYR A HA   10 
ATOM   11025 H  HB2  . TYR A 1 21 ? -3.258  -0.134  -13.457 1.00 0.00 ? 328 TYR A HB2  10 
ATOM   11026 H  HB3  . TYR A 1 21 ? -2.109  0.897   -12.620 1.00 0.00 ? 328 TYR A HB3  10 
ATOM   11027 H  HD1  . TYR A 1 21 ? -0.854  -0.039  -10.646 1.00 0.00 ? 328 TYR A HD1  10 
ATOM   11028 H  HD2  . TYR A 1 21 ? -3.236  -2.475  -13.192 1.00 0.00 ? 328 TYR A HD2  10 
ATOM   11029 H  HE1  . TYR A 1 21 ? 0.331   -2.031  -9.839  1.00 0.00 ? 328 TYR A HE1  10 
ATOM   11030 H  HE2  . TYR A 1 21 ? -2.058  -4.476  -12.390 1.00 0.00 ? 328 TYR A HE2  10 
ATOM   11031 H  HH   . TYR A 1 21 ? -0.192  -5.189  -11.287 1.00 0.00 ? 328 TYR A HH   10 
ATOM   11032 N  N    . LEU A 1 22 ? -4.879  -0.998  -10.077 1.00 0.00 ? 329 LEU A N    10 
ATOM   11033 C  CA   . LEU A 1 22 ? -5.890  -1.902  -9.562  1.00 0.00 ? 329 LEU A CA   10 
ATOM   11034 C  C    . LEU A 1 22 ? -6.802  -1.130  -8.617  1.00 0.00 ? 329 LEU A C    10 
ATOM   11035 O  O    . LEU A 1 22 ? -6.683  -1.246  -7.386  1.00 0.00 ? 329 LEU A O    10 
ATOM   11036 C  CB   . LEU A 1 22 ? -5.245  -3.096  -8.852  1.00 0.00 ? 329 LEU A CB   10 
ATOM   11037 C  CG   . LEU A 1 22 ? -4.399  -4.005  -9.750  1.00 0.00 ? 329 LEU A CG   10 
ATOM   11038 C  CD1  . LEU A 1 22 ? -3.700  -5.078  -8.931  1.00 0.00 ? 329 LEU A CD1  10 
ATOM   11039 C  CD2  . LEU A 1 22 ? -5.261  -4.644  -10.827 1.00 0.00 ? 329 LEU A CD2  10 
ATOM   11040 H  H    . LEU A 1 22 ? -4.103  -0.785  -9.525  1.00 0.00 ? 329 LEU A H    10 
ATOM   11041 H  HA   . LEU A 1 22 ? -6.475  -2.257  -10.398 1.00 0.00 ? 329 LEU A HA   10 
ATOM   11042 H  HB2  . LEU A 1 22 ? -4.616  -2.719  -8.060  1.00 0.00 ? 329 LEU A HB2  10 
ATOM   11043 H  HB3  . LEU A 1 22 ? -6.030  -3.693  -8.414  1.00 0.00 ? 329 LEU A HB3  10 
ATOM   11044 H  HG   . LEU A 1 22 ? -3.640  -3.411  -10.239 1.00 0.00 ? 329 LEU A HG   10 
ATOM   11045 H  HD11 . LEU A 1 22 ? -3.197  -5.765  -9.595  1.00 0.00 ? 329 LEU A HD11 10 
ATOM   11046 H  HD12 . LEU A 1 22 ? -4.430  -5.615  -8.342  1.00 0.00 ? 329 LEU A HD12 10 
ATOM   11047 H  HD13 . LEU A 1 22 ? -2.976  -4.617  -8.276  1.00 0.00 ? 329 LEU A HD13 10 
ATOM   11048 H  HD21 . LEU A 1 22 ? -6.065  -5.197  -10.362 1.00 0.00 ? 329 LEU A HD21 10 
ATOM   11049 H  HD22 . LEU A 1 22 ? -4.659  -5.316  -11.420 1.00 0.00 ? 329 LEU A HD22 10 
ATOM   11050 H  HD23 . LEU A 1 22 ? -5.674  -3.875  -11.462 1.00 0.00 ? 329 LEU A HD23 10 
ATOM   11051 N  N    . CYS A 1 23 ? -7.649  -0.290  -9.231  1.00 0.00 ? 330 CYS A N    10 
ATOM   11052 C  CA   . CYS A 1 23 ? -8.597  0.606   -8.552  1.00 0.00 ? 330 CYS A CA   10 
ATOM   11053 C  C    . CYS A 1 23 ? -9.072  1.678   -9.525  1.00 0.00 ? 330 CYS A C    10 
ATOM   11054 O  O    . CYS A 1 23 ? -10.253 2.023   -9.559  1.00 0.00 ? 330 CYS A O    10 
ATOM   11055 C  CB   . CYS A 1 23 ? -7.982  1.320   -7.343  1.00 0.00 ? 330 CYS A CB   10 
ATOM   11056 S  SG   . CYS A 1 23 ? -8.073  0.399   -5.792  1.00 0.00 ? 330 CYS A SG   10 
ATOM   11057 H  H    . CYS A 1 23 ? -7.646  -0.284  -10.215 1.00 0.00 ? 330 CYS A H    10 
ATOM   11058 H  HA   . CYS A 1 23 ? -9.444  0.020   -8.231  1.00 0.00 ? 330 CYS A HA   10 
ATOM   11059 H  HB2  . CYS A 1 23 ? -6.940  1.514   -7.544  1.00 0.00 ? 330 CYS A HB2  10 
ATOM   11060 H  HB3  . CYS A 1 23 ? -8.493  2.261   -7.195  1.00 0.00 ? 330 CYS A HB3  10 
ATOM   11061 N  N    . LYS A 1 24 ? -8.112  2.219   -10.283 1.00 0.00 ? 331 LYS A N    10 
ATOM   11062 C  CA   . LYS A 1 24 ? -8.343  3.321   -11.209 1.00 0.00 ? 331 LYS A CA   10 
ATOM   11063 C  C    . LYS A 1 24 ? -8.569  4.592   -10.403 1.00 0.00 ? 331 LYS A C    10 
ATOM   11064 O  O    . LYS A 1 24 ? -9.207  5.543   -10.848 1.00 0.00 ? 331 LYS A O    10 
ATOM   11065 C  CB   . LYS A 1 24 ? -9.516  3.032   -12.156 1.00 0.00 ? 331 LYS A CB   10 
ATOM   11066 C  CG   . LYS A 1 24 ? -9.577  3.966   -13.355 1.00 0.00 ? 331 LYS A CG   10 
ATOM   11067 C  CD   . LYS A 1 24 ? -10.701 3.594   -14.308 1.00 0.00 ? 331 LYS A CD   10 
ATOM   11068 C  CE   . LYS A 1 24 ? -12.061 3.692   -13.639 1.00 0.00 ? 331 LYS A CE   10 
ATOM   11069 N  NZ   . LYS A 1 24 ? -13.166 3.408   -14.590 1.00 0.00 ? 331 LYS A NZ   10 
ATOM   11070 H  H    . LYS A 1 24 ? -7.199  1.881   -10.191 1.00 0.00 ? 331 LYS A H    10 
ATOM   11071 H  HA   . LYS A 1 24 ? -7.441  3.445   -11.793 1.00 0.00 ? 331 LYS A HA   10 
ATOM   11072 H  HB2  . LYS A 1 24 ? -9.430  2.018   -12.519 1.00 0.00 ? 331 LYS A HB2  10 
ATOM   11073 H  HB3  . LYS A 1 24 ? -10.439 3.129   -11.604 1.00 0.00 ? 331 LYS A HB3  10 
ATOM   11074 H  HG2  . LYS A 1 24 ? -9.740  4.974   -13.004 1.00 0.00 ? 331 LYS A HG2  10 
ATOM   11075 H  HG3  . LYS A 1 24 ? -8.636  3.916   -13.885 1.00 0.00 ? 331 LYS A HG3  10 
ATOM   11076 H  HD2  . LYS A 1 24 ? -10.680 4.266   -15.153 1.00 0.00 ? 331 LYS A HD2  10 
ATOM   11077 H  HD3  . LYS A 1 24 ? -10.548 2.581   -14.648 1.00 0.00 ? 331 LYS A HD3  10 
ATOM   11078 H  HE2  . LYS A 1 24 ? -12.102 2.979   -12.831 1.00 0.00 ? 331 LYS A HE2  10 
ATOM   11079 H  HE3  . LYS A 1 24 ? -12.183 4.690   -13.243 1.00 0.00 ? 331 LYS A HE3  10 
ATOM   11080 H  HZ1  . LYS A 1 24 ? -13.058 2.455   -14.990 1.00 0.00 ? 331 LYS A HZ1  10 
ATOM   11081 H  HZ2  . LYS A 1 24 ? -13.158 4.101   -15.365 1.00 0.00 ? 331 LYS A HZ2  10 
ATOM   11082 H  HZ3  . LYS A 1 24 ? -14.080 3.464   -14.101 1.00 0.00 ? 331 LYS A HZ3  10 
ATOM   11083 N  N    . GLN A 1 25 ? -8.003  4.591   -9.202  1.00 0.00 ? 332 GLN A N    10 
ATOM   11084 C  CA   . GLN A 1 25 ? -8.078  5.712   -8.314  1.00 0.00 ? 332 GLN A CA   10 
ATOM   11085 C  C    . GLN A 1 25 ? -6.662  6.074   -7.891  1.00 0.00 ? 332 GLN A C    10 
ATOM   11086 O  O    . GLN A 1 25 ? -5.703  5.779   -8.597  1.00 0.00 ? 332 GLN A O    10 
ATOM   11087 C  CB   . GLN A 1 25 ? -8.941  5.363   -7.091  1.00 0.00 ? 332 GLN A CB   10 
ATOM   11088 C  CG   . GLN A 1 25 ? -10.327 4.846   -7.441  1.00 0.00 ? 332 GLN A CG   10 
ATOM   11089 C  CD   . GLN A 1 25 ? -11.184 4.566   -6.218  1.00 0.00 ? 332 GLN A CD   10 
ATOM   11090 O  OE1  . GLN A 1 25 ? -12.407 4.680   -6.266  1.00 0.00 ? 332 GLN A OE1  10 
ATOM   11091 N  NE2  . GLN A 1 25 ? -10.553 4.198   -5.110  1.00 0.00 ? 332 GLN A NE2  10 
ATOM   11092 H  H    . GLN A 1 25 ? -7.496  3.816   -8.912  1.00 0.00 ? 332 GLN A H    10 
ATOM   11093 H  HA   . GLN A 1 25 ? -8.516  6.531   -8.851  1.00 0.00 ? 332 GLN A HA   10 
ATOM   11094 H  HB2  . GLN A 1 25 ? -8.434  4.604   -6.514  1.00 0.00 ? 332 GLN A HB2  10 
ATOM   11095 H  HB3  . GLN A 1 25 ? -9.059  6.245   -6.483  1.00 0.00 ? 332 GLN A HB3  10 
ATOM   11096 H  HG2  . GLN A 1 25 ? -10.829 5.583   -8.047  1.00 0.00 ? 332 GLN A HG2  10 
ATOM   11097 H  HG3  . GLN A 1 25 ? -10.223 3.930   -8.005  1.00 0.00 ? 332 GLN A HG3  10 
ATOM   11098 H  HE21 . GLN A 1 25 ? -9.580  4.126   -5.133  1.00 0.00 ? 332 GLN A HE21 10 
ATOM   11099 H  HE22 . GLN A 1 25 ? -11.093 4.009   -4.314  1.00 0.00 ? 332 GLN A HE22 10 
ATOM   11100 N  N    . LYS A 1 26 ? -6.534  6.661   -6.729  1.00 0.00 ? 333 LYS A N    10 
ATOM   11101 C  CA   . LYS A 1 26 ? -5.241  7.109   -6.233  1.00 0.00 ? 333 LYS A CA   10 
ATOM   11102 C  C    . LYS A 1 26 ? -4.977  6.540   -4.841  1.00 0.00 ? 333 LYS A C    10 
ATOM   11103 O  O    . LYS A 1 26 ? -5.565  5.521   -4.457  1.00 0.00 ? 333 LYS A O    10 
ATOM   11104 C  CB   . LYS A 1 26 ? -5.189  8.644   -6.212  1.00 0.00 ? 333 LYS A CB   10 
ATOM   11105 C  CG   . LYS A 1 26 ? -6.272  9.288   -5.358  1.00 0.00 ? 333 LYS A CG   10 
ATOM   11106 C  CD   . LYS A 1 26 ? -6.131  10.801  -5.337  1.00 0.00 ? 333 LYS A CD   10 
ATOM   11107 C  CE   . LYS A 1 26 ? -7.218  11.450  -4.496  1.00 0.00 ? 333 LYS A CE   10 
ATOM   11108 N  NZ   . LYS A 1 26 ? -7.075  12.930  -4.444  1.00 0.00 ? 333 LYS A NZ   10 
ATOM   11109 H  H    . LYS A 1 26 ? -7.324  6.779   -6.179  1.00 0.00 ? 333 LYS A H    10 
ATOM   11110 H  HA   . LYS A 1 26 ? -4.483  6.741   -6.907  1.00 0.00 ? 333 LYS A HA   10 
ATOM   11111 H  HB2  . LYS A 1 26 ? -4.229  8.955   -5.830  1.00 0.00 ? 333 LYS A HB2  10 
ATOM   11112 H  HB3  . LYS A 1 26 ? -5.296  9.008   -7.222  1.00 0.00 ? 333 LYS A HB3  10 
ATOM   11113 H  HG2  . LYS A 1 26 ? -7.238  9.031   -5.765  1.00 0.00 ? 333 LYS A HG2  10 
ATOM   11114 H  HG3  . LYS A 1 26 ? -6.193  8.913   -4.348  1.00 0.00 ? 333 LYS A HG3  10 
ATOM   11115 H  HD2  . LYS A 1 26 ? -5.168  11.058  -4.923  1.00 0.00 ? 333 LYS A HD2  10 
ATOM   11116 H  HD3  . LYS A 1 26 ? -6.201  11.173  -6.349  1.00 0.00 ? 333 LYS A HD3  10 
ATOM   11117 H  HE2  . LYS A 1 26 ? -8.179  11.205  -4.923  1.00 0.00 ? 333 LYS A HE2  10 
ATOM   11118 H  HE3  . LYS A 1 26 ? -7.160  11.055  -3.492  1.00 0.00 ? 333 LYS A HE3  10 
ATOM   11119 H  HZ1  . LYS A 1 26 ? -7.838  13.344  -3.872  1.00 0.00 ? 333 LYS A HZ1  10 
ATOM   11120 H  HZ2  . LYS A 1 26 ? -7.119  13.330  -5.403  1.00 0.00 ? 333 LYS A HZ2  10 
ATOM   11121 H  HZ3  . LYS A 1 26 ? -6.162  13.188  -4.017  1.00 0.00 ? 333 LYS A HZ3  10 
ATOM   11122 N  N    . GLY A 1 27 ? -4.073  7.179   -4.106  1.00 0.00 ? 334 GLY A N    10 
ATOM   11123 C  CA   . GLY A 1 27 ? -3.805  6.783   -2.739  1.00 0.00 ? 334 GLY A CA   10 
ATOM   11124 C  C    . GLY A 1 27 ? -5.035  6.902   -1.863  1.00 0.00 ? 334 GLY A C    10 
ATOM   11125 O  O    . GLY A 1 27 ? -5.580  7.994   -1.691  1.00 0.00 ? 334 GLY A O    10 
ATOM   11126 H  H    . GLY A 1 27 ? -3.578  7.925   -4.499  1.00 0.00 ? 334 GLY A H    10 
ATOM   11127 H  HA2  . GLY A 1 27 ? -3.467  5.757   -2.732  1.00 0.00 ? 334 GLY A HA2  10 
ATOM   11128 H  HA3  . GLY A 1 27 ? -3.024  7.413   -2.337  1.00 0.00 ? 334 GLY A HA3  10 
ATOM   11129 N  N    . VAL A 1 28 ? -5.474  5.778   -1.315  1.00 0.00 ? 335 VAL A N    10 
ATOM   11130 C  CA   . VAL A 1 28 ? -6.683  5.734   -0.498  1.00 0.00 ? 335 VAL A CA   10 
ATOM   11131 C  C    . VAL A 1 28 ? -6.403  4.978   0.795   1.00 0.00 ? 335 VAL A C    10 
ATOM   11132 O  O    . VAL A 1 28 ? -6.261  5.579   1.860   1.00 0.00 ? 335 VAL A O    10 
ATOM   11133 C  CB   . VAL A 1 28 ? -7.864  5.063   -1.248  1.00 0.00 ? 335 VAL A CB   10 
ATOM   11134 C  CG1  . VAL A 1 28 ? -9.115  5.029   -0.381  1.00 0.00 ? 335 VAL A CG1  10 
ATOM   11135 C  CG2  . VAL A 1 28 ? -8.156  5.778   -2.560  1.00 0.00 ? 335 VAL A CG2  10 
ATOM   11136 H  H    . VAL A 1 28 ? -4.957  4.961   -1.441  1.00 0.00 ? 335 VAL A H    10 
ATOM   11137 H  HA   . VAL A 1 28 ? -6.961  6.751   -0.257  1.00 0.00 ? 335 VAL A HA   10 
ATOM   11138 H  HB   . VAL A 1 28 ? -7.586  4.044   -1.476  1.00 0.00 ? 335 VAL A HB   10 
ATOM   11139 H  HG11 . VAL A 1 28 ? -9.921  4.569   -0.933  1.00 0.00 ? 335 VAL A HG11 10 
ATOM   11140 H  HG12 . VAL A 1 28 ? -9.393  6.036   -0.111  1.00 0.00 ? 335 VAL A HG12 10 
ATOM   11141 H  HG13 . VAL A 1 28 ? -8.919  4.457   0.514   1.00 0.00 ? 335 VAL A HG13 10 
ATOM   11142 H  HG21 . VAL A 1 28 ? -7.279  5.749   -3.190  1.00 0.00 ? 335 VAL A HG21 10 
ATOM   11143 H  HG22 . VAL A 1 28 ? -8.421  6.806   -2.358  1.00 0.00 ? 335 VAL A HG22 10 
ATOM   11144 H  HG23 . VAL A 1 28 ? -8.977  5.288   -3.063  1.00 0.00 ? 335 VAL A HG23 10 
ATOM   11145 N  N    . GLY A 1 29 ? -6.313  3.660   0.695   1.00 0.00 ? 336 GLY A N    10 
ATOM   11146 C  CA   . GLY A 1 29 ? -5.949  2.858   1.841   1.00 0.00 ? 336 GLY A CA   10 
ATOM   11147 C  C    . GLY A 1 29 ? -4.466  2.562   1.852   1.00 0.00 ? 336 GLY A C    10 
ATOM   11148 O  O    . GLY A 1 29 ? -3.647  3.478   1.776   1.00 0.00 ? 336 GLY A O    10 
ATOM   11149 H  H    . GLY A 1 29 ? -6.504  3.227   -0.159  1.00 0.00 ? 336 GLY A H    10 
ATOM   11150 H  HA2  . GLY A 1 29 ? -6.208  3.401   2.751   1.00 0.00 ? 336 GLY A HA2  10 
ATOM   11151 H  HA3  . GLY A 1 29 ? -6.496  1.915   1.802   1.00 0.00 ? 336 GLY A HA3  10 
ATOM   11152 N  N    . ALA A 1 30 ? -4.118  1.287   1.905   1.00 0.00 ? 337 ALA A N    10 
ATOM   11153 C  CA   . ALA A 1 30 ? -2.722  0.880   1.950   1.00 0.00 ? 337 ALA A CA   10 
ATOM   11154 C  C    . ALA A 1 30 ? -2.124  0.942   0.558   1.00 0.00 ? 337 ALA A C    10 
ATOM   11155 O  O    . ALA A 1 30 ? -2.293  0.018   -0.240  1.00 0.00 ? 337 ALA A O    10 
ATOM   11156 C  CB   . ALA A 1 30 ? -2.589  -0.520  2.528   1.00 0.00 ? 337 ALA A CB   10 
ATOM   11157 H  H    . ALA A 1 30 ? -4.815  0.601   1.889   1.00 0.00 ? 337 ALA A H    10 
ATOM   11158 H  HA   . ALA A 1 30 ? -2.191  1.568   2.593   1.00 0.00 ? 337 ALA A HA   10 
ATOM   11159 H  HB1  . ALA A 1 30 ? -3.122  -1.220  1.903   1.00 0.00 ? 337 ALA A HB1  10 
ATOM   11160 H  HB2  . ALA A 1 30 ? -3.002  -0.539  3.524   1.00 0.00 ? 337 ALA A HB2  10 
ATOM   11161 H  HB3  . ALA A 1 30 ? -1.545  -0.796  2.566   1.00 0.00 ? 337 ALA A HB3  10 
ATOM   11162 N  N    . SER A 1 31 ? -1.455  2.038   0.259   1.00 0.00 ? 338 SER A N    10 
ATOM   11163 C  CA   . SER A 1 31 ? -0.934  2.271   -1.075  1.00 0.00 ? 338 SER A CA   10 
ATOM   11164 C  C    . SER A 1 31 ? 0.571   2.007   -1.126  1.00 0.00 ? 338 SER A C    10 
ATOM   11165 O  O    . SER A 1 31 ? 1.310   2.383   -0.216  1.00 0.00 ? 338 SER A O    10 
ATOM   11166 C  CB   . SER A 1 31 ? -1.252  3.705   -1.503  1.00 0.00 ? 338 SER A CB   10 
ATOM   11167 O  OG   . SER A 1 31 ? -2.625  4.005   -1.271  1.00 0.00 ? 338 SER A OG   10 
ATOM   11168 H  H    . SER A 1 31 ? -1.298  2.711   0.958   1.00 0.00 ? 338 SER A H    10 
ATOM   11169 H  HA   . SER A 1 31 ? -1.430  1.587   -1.747  1.00 0.00 ? 338 SER A HA   10 
ATOM   11170 H  HB2  . SER A 1 31 ? -0.644  4.394   -0.937  1.00 0.00 ? 338 SER A HB2  10 
ATOM   11171 H  HB3  . SER A 1 31 ? -1.043  3.820   -2.557  1.00 0.00 ? 338 SER A HB3  10 
ATOM   11172 H  HG   . SER A 1 31 ? -2.738  4.252   -0.343  1.00 0.00 ? 338 SER A HG   10 
ATOM   11173 N  N    . ILE A 1 32 ? 1.006   1.344   -2.189  1.00 0.00 ? 339 ILE A N    10 
ATOM   11174 C  CA   . ILE A 1 32 ? 2.408   1.015   -2.388  1.00 0.00 ? 339 ILE A CA   10 
ATOM   11175 C  C    . ILE A 1 32 ? 2.821   1.434   -3.801  1.00 0.00 ? 339 ILE A C    10 
ATOM   11176 O  O    . ILE A 1 32 ? 1.969   1.572   -4.684  1.00 0.00 ? 339 ILE A O    10 
ATOM   11177 C  CB   . ILE A 1 32 ? 2.659   -0.502  -2.169  1.00 0.00 ? 339 ILE A CB   10 
ATOM   11178 C  CG1  . ILE A 1 32 ? 4.152   -0.842  -2.238  1.00 0.00 ? 339 ILE A CG1  10 
ATOM   11179 C  CG2  . ILE A 1 32 ? 1.880   -1.328  -3.181  1.00 0.00 ? 339 ILE A CG2  10 
ATOM   11180 C  CD1  . ILE A 1 32 ? 4.970   -0.227  -1.120  1.00 0.00 ? 339 ILE A CD1  10 
ATOM   11181 H  H    . ILE A 1 32 ? 0.358   1.084   -2.883  1.00 0.00 ? 339 ILE A H    10 
ATOM   11182 H  HA   . ILE A 1 32 ? 2.991   1.572   -1.668  1.00 0.00 ? 339 ILE A HA   10 
ATOM   11183 H  HB   . ILE A 1 32 ? 2.291   -0.757  -1.187  1.00 0.00 ? 339 ILE A HB   10 
ATOM   11184 H  HG12 . ILE A 1 32 ? 4.270   -1.921  -2.178  1.00 0.00 ? 339 ILE A HG12 10 
ATOM   11185 H  HG13 . ILE A 1 32 ? 4.552   -0.480  -3.183  1.00 0.00 ? 339 ILE A HG13 10 
ATOM   11186 H  HG21 . ILE A 1 32 ? 2.056   -2.378  -2.999  1.00 0.00 ? 339 ILE A HG21 10 
ATOM   11187 H  HG22 . ILE A 1 32 ? 2.206   -1.076  -4.179  1.00 0.00 ? 339 ILE A HG22 10 
ATOM   11188 H  HG23 . ILE A 1 32 ? 0.825   -1.116  -3.081  1.00 0.00 ? 339 ILE A HG23 10 
ATOM   11189 H  HD11 . ILE A 1 32 ? 4.931   0.848   -1.197  1.00 0.00 ? 339 ILE A HD11 10 
ATOM   11190 H  HD12 . ILE A 1 32 ? 5.995   -0.558  -1.201  1.00 0.00 ? 339 ILE A HD12 10 
ATOM   11191 H  HD13 . ILE A 1 32 ? 4.565   -0.537  -0.167  1.00 0.00 ? 339 ILE A HD13 10 
ATOM   11192 N  N    . GLN A 1 33 ? 4.111   1.639   -4.023  1.00 0.00 ? 340 GLN A N    10 
ATOM   11193 C  CA   . GLN A 1 33 ? 4.578   2.199   -5.273  1.00 0.00 ? 340 GLN A CA   10 
ATOM   11194 C  C    . GLN A 1 33 ? 5.585   1.279   -5.950  1.00 0.00 ? 340 GLN A C    10 
ATOM   11195 O  O    . GLN A 1 33 ? 6.493   0.746   -5.311  1.00 0.00 ? 340 GLN A O    10 
ATOM   11196 C  CB   . GLN A 1 33 ? 5.207   3.569   -5.024  1.00 0.00 ? 340 GLN A CB   10 
ATOM   11197 C  CG   . GLN A 1 33 ? 5.456   4.363   -6.292  1.00 0.00 ? 340 GLN A CG   10 
ATOM   11198 C  CD   . GLN A 1 33 ? 6.092   5.680   -6.047  1.00 0.00 ? 340 GLN A CD   10 
ATOM   11199 O  OE1  . GLN A 1 33 ? 6.800   5.895   -5.062  1.00 0.00 ? 340 GLN A OE1  10 
ATOM   11200 N  NE2  . GLN A 1 33 ? 5.888   6.554   -6.984  1.00 0.00 ? 340 GLN A NE2  10 
ATOM   11201 H  H    . GLN A 1 33 ? 4.762   1.392   -3.344  1.00 0.00 ? 340 GLN A H    10 
ATOM   11202 H  HA   . GLN A 1 33 ? 3.724   2.319   -5.923  1.00 0.00 ? 340 GLN A HA   10 
ATOM   11203 H  HB2  . GLN A 1 33 ? 4.549   4.143   -4.388  1.00 0.00 ? 340 GLN A HB2  10 
ATOM   11204 H  HB3  . GLN A 1 33 ? 6.151   3.430   -4.519  1.00 0.00 ? 340 GLN A HB3  10 
ATOM   11205 H  HG2  . GLN A 1 33 ? 6.124   3.830   -6.943  1.00 0.00 ? 340 GLN A HG2  10 
ATOM   11206 H  HG3  . GLN A 1 33 ? 4.501   4.532   -6.789  1.00 0.00 ? 340 GLN A HG3  10 
ATOM   11207 H  HE21 . GLN A 1 33 ? 5.339   6.293   -7.750  1.00 0.00 ? 340 GLN A HE21 10 
ATOM   11208 H  HE22 . GLN A 1 33 ? 6.312   7.395   -6.898  1.00 0.00 ? 340 GLN A HE22 10 
ATOM   11209 N  N    . CYS A 1 34 ? 5.394   1.097   -7.242  1.00 0.00 ? 341 CYS A N    10 
ATOM   11210 C  CA   . CYS A 1 34 ? 6.332   0.368   -8.081  1.00 0.00 ? 341 CYS A CA   10 
ATOM   11211 C  C    . CYS A 1 34 ? 7.339   1.336   -8.675  1.00 0.00 ? 341 CYS A C    10 
ATOM   11212 O  O    . CYS A 1 34 ? 7.034   2.511   -8.884  1.00 0.00 ? 341 CYS A O    10 
ATOM   11213 C  CB   . CYS A 1 34 ? 5.587   -0.355  -9.207  1.00 0.00 ? 341 CYS A CB   10 
ATOM   11214 S  SG   . CYS A 1 34 ? 6.646   -0.967  -10.555 1.00 0.00 ? 341 CYS A SG   10 
ATOM   11215 H  H    . CYS A 1 34 ? 4.591   1.480   -7.652  1.00 0.00 ? 341 CYS A H    10 
ATOM   11216 H  HA   . CYS A 1 34 ? 6.848   -0.355  -7.468  1.00 0.00 ? 341 CYS A HA   10 
ATOM   11217 H  HB2  . CYS A 1 34 ? 5.069   -1.206  -8.794  1.00 0.00 ? 341 CYS A HB2  10 
ATOM   11218 H  HB3  . CYS A 1 34 ? 4.866   0.321   -9.635  1.00 0.00 ? 341 CYS A HB3  10 
ATOM   11219 N  N    . HIS A 1 35 ? 8.526   0.842   -8.981  1.00 0.00 ? 342 HIS A N    10 
ATOM   11220 C  CA   . HIS A 1 35 ? 9.572   1.706   -9.503  1.00 0.00 ? 342 HIS A CA   10 
ATOM   11221 C  C    . HIS A 1 35 ? 10.546  0.923   -10.377 1.00 0.00 ? 342 HIS A C    10 
ATOM   11222 O  O    . HIS A 1 35 ? 10.365  -0.268  -10.607 1.00 0.00 ? 342 HIS A O    10 
ATOM   11223 C  CB   . HIS A 1 35 ? 10.317  2.425   -8.356  1.00 0.00 ? 342 HIS A CB   10 
ATOM   11224 C  CG   . HIS A 1 35 ? 11.354  1.600   -7.647  1.00 0.00 ? 342 HIS A CG   10 
ATOM   11225 N  ND1  . HIS A 1 35 ? 12.707  1.832   -7.772  1.00 0.00 ? 342 HIS A ND1  10 
ATOM   11226 C  CD2  . HIS A 1 35 ? 11.234  0.548   -6.807  1.00 0.00 ? 342 HIS A CD2  10 
ATOM   11227 C  CE1  . HIS A 1 35 ? 13.371  0.957   -7.045  1.00 0.00 ? 342 HIS A CE1  10 
ATOM   11228 N  NE2  . HIS A 1 35 ? 12.505  0.166   -6.449  1.00 0.00 ? 342 HIS A NE2  10 
ATOM   11229 H  H    . HIS A 1 35 ? 8.686   -0.125  -8.886  1.00 0.00 ? 342 HIS A H    10 
ATOM   11230 H  HA   . HIS A 1 35 ? 9.092   2.451   -10.119 1.00 0.00 ? 342 HIS A HA   10 
ATOM   11231 H  HB2  . HIS A 1 35 ? 10.826  3.296   -8.764  1.00 0.00 ? 342 HIS A HB2  10 
ATOM   11232 H  HB3  . HIS A 1 35 ? 9.581   2.743   -7.612  1.00 0.00 ? 342 HIS A HB3  10 
ATOM   11233 H  HD1  . HIS A 1 35 ? 13.122  2.548   -8.302  1.00 0.00 ? 342 HIS A HD1  10 
ATOM   11234 H  HD2  . HIS A 1 35 ? 10.312  0.094   -6.476  1.00 0.00 ? 342 HIS A HD2  10 
ATOM   11235 H  HE1  . HIS A 1 35 ? 14.445  0.902   -6.953  1.00 0.00 ? 342 HIS A HE1  10 
ATOM   11236 H  HE2  . HIS A 1 35 ? 12.738  -0.688  -6.021  1.00 0.00 ? 342 HIS A HE2  10 
ATOM   11237 N  N    . LYS A 1 36 ? 11.543  1.635   -10.871 1.00 0.00 ? 343 LYS A N    10 
ATOM   11238 C  CA   . LYS A 1 36 ? 12.634  1.086   -11.676 1.00 0.00 ? 343 LYS A CA   10 
ATOM   11239 C  C    . LYS A 1 36 ? 13.447  2.241   -12.258 1.00 0.00 ? 343 LYS A C    10 
ATOM   11240 O  O    . LYS A 1 36 ? 14.501  2.595   -11.736 1.00 0.00 ? 343 LYS A O    10 
ATOM   11241 C  CB   . LYS A 1 36 ? 12.123  0.190   -12.814 1.00 0.00 ? 343 LYS A CB   10 
ATOM   11242 C  CG   . LYS A 1 36 ? 13.235  -0.473  -13.614 1.00 0.00 ? 343 LYS A CG   10 
ATOM   11243 C  CD   . LYS A 1 36 ? 14.043  -1.433  -12.758 1.00 0.00 ? 343 LYS A CD   10 
ATOM   11244 C  CE   . LYS A 1 36 ? 15.202  -2.025  -13.540 1.00 0.00 ? 343 LYS A CE   10 
ATOM   11245 N  NZ   . LYS A 1 36 ? 14.750  -2.879  -14.672 1.00 0.00 ? 343 LYS A NZ   10 
ATOM   11246 H  H    . LYS A 1 36 ? 11.558  2.583   -10.672 1.00 0.00 ? 343 LYS A H    10 
ATOM   11247 H  HA   . LYS A 1 36 ? 13.268  0.507   -11.023 1.00 0.00 ? 343 LYS A HA   10 
ATOM   11248 H  HB2  . LYS A 1 36 ? 11.502  -0.587  -12.393 1.00 0.00 ? 343 LYS A HB2  10 
ATOM   11249 H  HB3  . LYS A 1 36 ? 11.528  0.788   -13.491 1.00 0.00 ? 343 LYS A HB3  10 
ATOM   11250 H  HG2  . LYS A 1 36 ? 12.793  -1.031  -14.438 1.00 0.00 ? 343 LYS A HG2  10 
ATOM   11251 H  HG3  . LYS A 1 36 ? 13.899  0.303   -13.998 1.00 0.00 ? 343 LYS A HG3  10 
ATOM   11252 H  HD2  . LYS A 1 36 ? 14.439  -0.889  -11.902 1.00 0.00 ? 343 LYS A HD2  10 
ATOM   11253 H  HD3  . LYS A 1 36 ? 13.392  -2.241  -12.425 1.00 0.00 ? 343 LYS A HD3  10 
ATOM   11254 H  HE2  . LYS A 1 36 ? 15.799  -1.216  -13.933 1.00 0.00 ? 343 LYS A HE2  10 
ATOM   11255 H  HE3  . LYS A 1 36 ? 15.804  -2.619  -12.868 1.00 0.00 ? 343 LYS A HE3  10 
ATOM   11256 H  HZ1  . LYS A 1 36 ? 15.574  -3.255  -15.183 1.00 0.00 ? 343 LYS A HZ1  10 
ATOM   11257 H  HZ2  . LYS A 1 36 ? 14.170  -2.325  -15.334 1.00 0.00 ? 343 LYS A HZ2  10 
ATOM   11258 H  HZ3  . LYS A 1 36 ? 14.186  -3.677  -14.318 1.00 0.00 ? 343 LYS A HZ3  10 
ATOM   11259 N  N    . ALA A 1 37 ? 12.927  2.842   -13.320 1.00 0.00 ? 344 ALA A N    10 
ATOM   11260 C  CA   . ALA A 1 37 ? 13.558  4.000   -13.934 1.00 0.00 ? 344 ALA A CA   10 
ATOM   11261 C  C    . ALA A 1 37 ? 12.532  5.104   -14.163 1.00 0.00 ? 344 ALA A C    10 
ATOM   11262 O  O    . ALA A 1 37 ? 12.542  6.130   -13.484 1.00 0.00 ? 344 ALA A O    10 
ATOM   11263 C  CB   . ALA A 1 37 ? 14.223  3.605   -15.247 1.00 0.00 ? 344 ALA A CB   10 
ATOM   11264 H  H    . ALA A 1 37 ? 12.106  2.487   -