data_2LTQ
# 
_entry.id   2LTQ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LTQ         
RCSB  RCSB102821   
BMRB  18493        
WWPDB D_1000102821 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2LEG  PDB  'Similar refinement method' 
unspecified 2ZUQ  PDB  'The source of X-ray data'  
unspecified 18493 BMRB .                           
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LTQ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-05-30 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tang, M.'         1 
'Sperling, L.J.'   2 
'Schwieters, C.D.' 3 
'Nesbitt, A.E.'    4 
'Gennis, R.B.'     5 
'Rienstra, C.M.'   6 
# 
_citation.id                        primary 
_citation.title                     'Structure of the Disulfide Bond Generating Membrane Protein DsbB in the Lipid Bilayer.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            425 
_citation.page_first                1670 
_citation.page_last                 1682 
_citation.year                      2013 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23416557 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2013.02.009 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tang, M.'         1 
primary 'Nesbitt, A.E.'    2 
primary 'Sperling, L.J.'   3 
primary 'Berthold, D.A.'   4 
primary 'Schwieters, C.D.' 5 
primary 'Gennis, R.B.'     6 
primary 'Rienstra, C.M.'   7 
# 
_cell.entry_id           2LTQ 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2LTQ 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Disulfide bond formation protein B' 20106.982 2 ? C8A,C41S,C49V ? ? 
2 polymer     nat 'Fab fragment light chain'           26364.410 2 ? ?             ? ? 
3 polymer     nat 'Fab fragment heavy chain'           23666.453 2 ? ?             ? ? 
4 non-polymer syn UBIQUINONE-1                         250.290   2 ? ?             ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Disulfide oxidoreductase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR
;
;MLRFLNQASQGRGAWLLMAFTALALELTALWFQHVMLLKPSVLCIYERVALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR
;
A,D ? 
2 'polypeptide(L)' no no 
;MDSQAQVLILLLLWVSGTCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCF
LNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;MDSQAQVLILLLLWVSGTCGDIVMSQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTR
ESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCF
LNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
B,E ? 
3 'polypeptide(L)' no no 
;EVQLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISSGGGSTYYPDTVKGRFTISRDNAKNTLY
LQMSSLKSEDTAMYYCARPDYRSYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
;
;EVQLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWVRQTPEKRLEWVAYISSGGGSTYYPDTVKGRFTISRDNAKNTLY
LQMSSLKSEDTAMYYCARPDYRSYAMDYWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSVTLGCLVKGYFPEPVTLTW
NSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGP
;
C,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   LEU n 
1 3   ARG n 
1 4   PHE n 
1 5   LEU n 
1 6   ASN n 
1 7   GLN n 
1 8   ALA n 
1 9   SER n 
1 10  GLN n 
1 11  GLY n 
1 12  ARG n 
1 13  GLY n 
1 14  ALA n 
1 15  TRP n 
1 16  LEU n 
1 17  LEU n 
1 18  MET n 
1 19  ALA n 
1 20  PHE n 
1 21  THR n 
1 22  ALA n 
1 23  LEU n 
1 24  ALA n 
1 25  LEU n 
1 26  GLU n 
1 27  LEU n 
1 28  THR n 
1 29  ALA n 
1 30  LEU n 
1 31  TRP n 
1 32  PHE n 
1 33  GLN n 
1 34  HIS n 
1 35  VAL n 
1 36  MET n 
1 37  LEU n 
1 38  LEU n 
1 39  LYS n 
1 40  PRO n 
1 41  SER n 
1 42  VAL n 
1 43  LEU n 
1 44  CYS n 
1 45  ILE n 
1 46  TYR n 
1 47  GLU n 
1 48  ARG n 
1 49  VAL n 
1 50  ALA n 
1 51  LEU n 
1 52  PHE n 
1 53  GLY n 
1 54  VAL n 
1 55  LEU n 
1 56  GLY n 
1 57  ALA n 
1 58  ALA n 
1 59  LEU n 
1 60  ILE n 
1 61  GLY n 
1 62  ALA n 
1 63  ILE n 
1 64  ALA n 
1 65  PRO n 
1 66  LYS n 
1 67  THR n 
1 68  PRO n 
1 69  LEU n 
1 70  ARG n 
1 71  TYR n 
1 72  VAL n 
1 73  ALA n 
1 74  MET n 
1 75  VAL n 
1 76  ILE n 
1 77  TRP n 
1 78  LEU n 
1 79  TYR n 
1 80  SER n 
1 81  ALA n 
1 82  PHE n 
1 83  ARG n 
1 84  GLY n 
1 85  VAL n 
1 86  GLN n 
1 87  LEU n 
1 88  THR n 
1 89  TYR n 
1 90  GLU n 
1 91  HIS n 
1 92  THR n 
1 93  MET n 
1 94  LEU n 
1 95  GLN n 
1 96  LEU n 
1 97  TYR n 
1 98  PRO n 
1 99  SER n 
1 100 PRO n 
1 101 PHE n 
1 102 ALA n 
1 103 THR n 
1 104 CYS n 
1 105 ASP n 
1 106 PHE n 
1 107 MET n 
1 108 VAL n 
1 109 ARG n 
1 110 PHE n 
1 111 PRO n 
1 112 GLU n 
1 113 TRP n 
1 114 LEU n 
1 115 PRO n 
1 116 LEU n 
1 117 ASP n 
1 118 LYS n 
1 119 TRP n 
1 120 VAL n 
1 121 PRO n 
1 122 GLN n 
1 123 VAL n 
1 124 PHE n 
1 125 VAL n 
1 126 ALA n 
1 127 SER n 
1 128 GLY n 
1 129 ASP n 
1 130 CYS n 
1 131 ALA n 
1 132 GLU n 
1 133 ARG n 
1 134 GLN n 
1 135 TRP n 
1 136 ASP n 
1 137 PHE n 
1 138 LEU n 
1 139 GLY n 
1 140 LEU n 
1 141 GLU n 
1 142 MET n 
1 143 PRO n 
1 144 GLN n 
1 145 TRP n 
1 146 LEU n 
1 147 LEU n 
1 148 GLY n 
1 149 ILE n 
1 150 PHE n 
1 151 ILE n 
1 152 ALA n 
1 153 TYR n 
1 154 LEU n 
1 155 ILE n 
1 156 VAL n 
1 157 ALA n 
1 158 VAL n 
1 159 LEU n 
1 160 VAL n 
1 161 VAL n 
1 162 ILE n 
1 163 SER n 
1 164 GLN n 
1 165 PRO n 
1 166 PHE n 
1 167 LYS n 
1 168 ALA n 
1 169 LYS n 
1 170 LYS n 
1 171 ARG n 
1 172 ASP n 
1 173 LEU n 
1 174 PHE n 
1 175 GLY n 
1 176 ARG n 
2 1   MET n 
2 2   ASP n 
2 3   SER n 
2 4   GLN n 
2 5   ALA n 
2 6   GLN n 
2 7   VAL n 
2 8   LEU n 
2 9   ILE n 
2 10  LEU n 
2 11  LEU n 
2 12  LEU n 
2 13  LEU n 
2 14  TRP n 
2 15  VAL n 
2 16  SER n 
2 17  GLY n 
2 18  THR n 
2 19  CYS n 
2 20  GLY n 
2 21  ASP n 
2 22  ILE n 
2 23  VAL n 
2 24  MET n 
2 25  SER n 
2 26  GLN n 
2 27  SER n 
2 28  PRO n 
2 29  SER n 
2 30  SER n 
2 31  LEU n 
2 32  ALA n 
2 33  VAL n 
2 34  SER n 
2 35  ALA n 
2 36  GLY n 
2 37  GLU n 
2 38  LYS n 
2 39  VAL n 
2 40  THR n 
2 41  MET n 
2 42  SER n 
2 43  CYS n 
2 44  LYS n 
2 45  SER n 
2 46  SER n 
2 47  GLN n 
2 48  SER n 
2 49  LEU n 
2 50  LEU n 
2 51  ASN n 
2 52  SER n 
2 53  ARG n 
2 54  THR n 
2 55  ARG n 
2 56  LYS n 
2 57  ASN n 
2 58  TYR n 
2 59  LEU n 
2 60  ALA n 
2 61  TRP n 
2 62  TYR n 
2 63  GLN n 
2 64  GLN n 
2 65  LYS n 
2 66  PRO n 
2 67  GLY n 
2 68  GLN n 
2 69  SER n 
2 70  PRO n 
2 71  LYS n 
2 72  LEU n 
2 73  LEU n 
2 74  ILE n 
2 75  TYR n 
2 76  TRP n 
2 77  ALA n 
2 78  SER n 
2 79  THR n 
2 80  ARG n 
2 81  GLU n 
2 82  SER n 
2 83  GLY n 
2 84  VAL n 
2 85  PRO n 
2 86  ASP n 
2 87  ARG n 
2 88  PHE n 
2 89  THR n 
2 90  GLY n 
2 91  SER n 
2 92  GLY n 
2 93  SER n 
2 94  GLY n 
2 95  THR n 
2 96  ASP n 
2 97  PHE n 
2 98  THR n 
2 99  LEU n 
2 100 THR n 
2 101 ILE n 
2 102 SER n 
2 103 SER n 
2 104 VAL n 
2 105 GLN n 
2 106 ALA n 
2 107 GLU n 
2 108 ASP n 
2 109 LEU n 
2 110 ALA n 
2 111 VAL n 
2 112 TYR n 
2 113 TYR n 
2 114 CYS n 
2 115 LYS n 
2 116 GLN n 
2 117 SER n 
2 118 TYR n 
2 119 ASN n 
2 120 LEU n 
2 121 TYR n 
2 122 THR n 
2 123 PHE n 
2 124 GLY n 
2 125 GLY n 
2 126 GLY n 
2 127 THR n 
2 128 LYS n 
2 129 LEU n 
2 130 GLU n 
2 131 ILE n 
2 132 LYS n 
2 133 ARG n 
2 134 ALA n 
2 135 ASP n 
2 136 ALA n 
2 137 ALA n 
2 138 PRO n 
2 139 THR n 
2 140 VAL n 
2 141 SER n 
2 142 ILE n 
2 143 PHE n 
2 144 PRO n 
2 145 PRO n 
2 146 SER n 
2 147 SER n 
2 148 GLU n 
2 149 GLN n 
2 150 LEU n 
2 151 THR n 
2 152 SER n 
2 153 GLY n 
2 154 GLY n 
2 155 ALA n 
2 156 SER n 
2 157 VAL n 
2 158 VAL n 
2 159 CYS n 
2 160 PHE n 
2 161 LEU n 
2 162 ASN n 
2 163 ASN n 
2 164 PHE n 
2 165 TYR n 
2 166 PRO n 
2 167 LYS n 
2 168 ASP n 
2 169 ILE n 
2 170 ASN n 
2 171 VAL n 
2 172 LYS n 
2 173 TRP n 
2 174 LYS n 
2 175 ILE n 
2 176 ASP n 
2 177 GLY n 
2 178 SER n 
2 179 GLU n 
2 180 ARG n 
2 181 GLN n 
2 182 ASN n 
2 183 GLY n 
2 184 VAL n 
2 185 LEU n 
2 186 ASN n 
2 187 SER n 
2 188 TRP n 
2 189 THR n 
2 190 ASP n 
2 191 GLN n 
2 192 ASP n 
2 193 SER n 
2 194 LYS n 
2 195 ASP n 
2 196 SER n 
2 197 THR n 
2 198 TYR n 
2 199 SER n 
2 200 MET n 
2 201 SER n 
2 202 SER n 
2 203 THR n 
2 204 LEU n 
2 205 THR n 
2 206 LEU n 
2 207 THR n 
2 208 LYS n 
2 209 ASP n 
2 210 GLU n 
2 211 TYR n 
2 212 GLU n 
2 213 ARG n 
2 214 HIS n 
2 215 ASN n 
2 216 SER n 
2 217 TYR n 
2 218 THR n 
2 219 CYS n 
2 220 GLU n 
2 221 ALA n 
2 222 THR n 
2 223 HIS n 
2 224 LYS n 
2 225 THR n 
2 226 SER n 
2 227 THR n 
2 228 SER n 
2 229 PRO n 
2 230 ILE n 
2 231 VAL n 
2 232 LYS n 
2 233 SER n 
2 234 PHE n 
2 235 ASN n 
2 236 ARG n 
2 237 ASN n 
2 238 GLU n 
2 239 CYS n 
3 1   GLU n 
3 2   VAL n 
3 3   GLN n 
3 4   LEU n 
3 5   VAL n 
3 6   GLU n 
3 7   SER n 
3 8   GLY n 
3 9   GLY n 
3 10  GLY n 
3 11  LEU n 
3 12  VAL n 
3 13  LYS n 
3 14  PRO n 
3 15  GLY n 
3 16  GLY n 
3 17  SER n 
3 18  LEU n 
3 19  LYS n 
3 20  LEU n 
3 21  SER n 
3 22  CYS n 
3 23  ALA n 
3 24  ALA n 
3 25  SER n 
3 26  GLY n 
3 27  PHE n 
3 28  ALA n 
3 29  PHE n 
3 30  SER n 
3 31  SER n 
3 32  TYR n 
3 33  ASP n 
3 34  MET n 
3 35  SER n 
3 36  TRP n 
3 37  VAL n 
3 38  ARG n 
3 39  GLN n 
3 40  THR n 
3 41  PRO n 
3 42  GLU n 
3 43  LYS n 
3 44  ARG n 
3 45  LEU n 
3 46  GLU n 
3 47  TRP n 
3 48  VAL n 
3 49  ALA n 
3 50  TYR n 
3 51  ILE n 
3 52  SER n 
3 53  SER n 
3 54  GLY n 
3 55  GLY n 
3 56  GLY n 
3 57  SER n 
3 58  THR n 
3 59  TYR n 
3 60  TYR n 
3 61  PRO n 
3 62  ASP n 
3 63  THR n 
3 64  VAL n 
3 65  LYS n 
3 66  GLY n 
3 67  ARG n 
3 68  PHE n 
3 69  THR n 
3 70  ILE n 
3 71  SER n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  ALA n 
3 76  LYS n 
3 77  ASN n 
3 78  THR n 
3 79  LEU n 
3 80  TYR n 
3 81  LEU n 
3 82  GLN n 
3 83  MET n 
3 84  SER n 
3 85  SER n 
3 86  LEU n 
3 87  LYS n 
3 88  SER n 
3 89  GLU n 
3 90  ASP n 
3 91  THR n 
3 92  ALA n 
3 93  MET n 
3 94  TYR n 
3 95  TYR n 
3 96  CYS n 
3 97  ALA n 
3 98  ARG n 
3 99  PRO n 
3 100 ASP n 
3 101 TYR n 
3 102 ARG n 
3 103 SER n 
3 104 TYR n 
3 105 ALA n 
3 106 MET n 
3 107 ASP n 
3 108 TYR n 
3 109 TRP n 
3 110 GLY n 
3 111 GLN n 
3 112 GLY n 
3 113 THR n 
3 114 SER n 
3 115 VAL n 
3 116 THR n 
3 117 VAL n 
3 118 SER n 
3 119 SER n 
3 120 ALA n 
3 121 LYS n 
3 122 THR n 
3 123 THR n 
3 124 ALA n 
3 125 PRO n 
3 126 SER n 
3 127 VAL n 
3 128 TYR n 
3 129 PRO n 
3 130 LEU n 
3 131 ALA n 
3 132 PRO n 
3 133 VAL n 
3 134 CYS n 
3 135 GLY n 
3 136 ASP n 
3 137 THR n 
3 138 THR n 
3 139 GLY n 
3 140 SER n 
3 141 SER n 
3 142 VAL n 
3 143 THR n 
3 144 LEU n 
3 145 GLY n 
3 146 CYS n 
3 147 LEU n 
3 148 VAL n 
3 149 LYS n 
3 150 GLY n 
3 151 TYR n 
3 152 PHE n 
3 153 PRO n 
3 154 GLU n 
3 155 PRO n 
3 156 VAL n 
3 157 THR n 
3 158 LEU n 
3 159 THR n 
3 160 TRP n 
3 161 ASN n 
3 162 SER n 
3 163 GLY n 
3 164 SER n 
3 165 LEU n 
3 166 SER n 
3 167 SER n 
3 168 GLY n 
3 169 VAL n 
3 170 HIS n 
3 171 THR n 
3 172 PHE n 
3 173 PRO n 
3 174 ALA n 
3 175 VAL n 
3 176 LEU n 
3 177 GLN n 
3 178 SER n 
3 179 ASP n 
3 180 LEU n 
3 181 TYR n 
3 182 THR n 
3 183 LEU n 
3 184 SER n 
3 185 SER n 
3 186 SER n 
3 187 VAL n 
3 188 THR n 
3 189 VAL n 
3 190 THR n 
3 191 SER n 
3 192 SER n 
3 193 THR n 
3 194 TRP n 
3 195 PRO n 
3 196 SER n 
3 197 GLN n 
3 198 SER n 
3 199 ILE n 
3 200 THR n 
3 201 CYS n 
3 202 ASN n 
3 203 VAL n 
3 204 ALA n 
3 205 HIS n 
3 206 PRO n 
3 207 ALA n 
3 208 SER n 
3 209 SER n 
3 210 THR n 
3 211 LYS n 
3 212 VAL n 
3 213 ASP n 
3 214 LYS n 
3 215 LYS n 
3 216 ILE n 
3 217 GLU n 
3 218 PRO n 
3 219 ARG n 
3 220 GLY n 
3 221 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'b1185, dsbB, JW5182, roxB, ycgA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    K12 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     83333 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pqe70 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
2 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
'FAB FRAGMENT IS OBTAINED BY PAPAIN DIGESTION OF A SELECTED MONOCLONAL ANTIBODY' 
3 1 sample ? ? mouse 'Mus musculus' 10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
'FAB FRAGMENT IS OBTAINED BY PAPAIN DIGESTION OF A SELECTED MONOCLONAL ANTIBODY' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DSBB_ECOLI P0A6M2 1 
;MLRFLNQCSQGRGAWLLMAFTALALELTALWFQHVMLLKPCVLCIYERCALFGVLGAALIGAIAPKTPLRYVAMVIWLYS
AFRGVQLTYEHTMLQLYPSPFATCDFMVRFPEWLPLDKWVPQVFVASGDCAERQWDFLGLEMPQWLLGIFIAYLIVAVLV
VISQPFKAKKRDLFGR
;
1 ? 
2 PDB 2LTQ       2LTQ   2 ? ? ? 
3 PDB 2LTQ       2LTQ   3 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LTQ A 1 ? 176 ? P0A6M2 1 ? 176 ? 1 176 
2 1 2LTQ D 1 ? 176 ? P0A6M2 1 ? 176 ? 1 176 
3 2 2LTQ B 1 ? 239 ? 2LTQ   1 ? 239 ? 1 239 
4 2 2LTQ E 1 ? 239 ? 2LTQ   1 ? 239 ? 1 239 
5 3 2LTQ C 1 ? 221 ? 2LTQ   1 ? 221 ? 1 221 
6 3 2LTQ F 1 ? 221 ? 2LTQ   1 ? 221 ? 1 221 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LTQ ALA A 8  ? UNP P0A6M2 CYS 8  'ENGINEERED MUTATION' 8  1 
1 2LTQ SER A 41 ? UNP P0A6M2 CYS 41 'ENGINEERED MUTATION' 41 2 
1 2LTQ VAL A 49 ? UNP P0A6M2 CYS 49 'ENGINEERED MUTATION' 49 3 
2 2LTQ ALA D 8  ? UNP P0A6M2 CYS 8  'ENGINEERED MUTATION' 8  4 
2 2LTQ SER D 41 ? UNP P0A6M2 CYS 41 'ENGINEERED MUTATION' 41 5 
2 2LTQ VAL D 49 ? UNP P0A6M2 CYS 49 'ENGINEERED MUTATION' 49 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UQ1 non-polymer         . UBIQUINONE-1    ? 'C14 H18 O4'     250.290 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D CC DARR' 
1 2 2 '2D CC DARR' 
1 3 3 '2D CC DARR' 
1 4 1 '3D NCACX'   
1 5 1 '3D NCOCX'   
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.8 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         261 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'7 mg [U-100% 13C; U-100% 15N] DsbB, 2 mg DDM, 7 mg E. coli lipids, 90% H2O/10% D2O'  1 '90% H2O/10% D2O' 
'5 mg [2-13C-glycerol; U-15N] DsbB, 2 mg DDM, 7 mg E. coli lipids, 90% H2O/10% D2O'   2 '90% H2O/10% D2O' 
'4 mg [1,3-13C-glycerol; U-15N] DsbB, 2 mg DDM, 7 mg E. coli lipids, 90% H2O/10% D2O' 3 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
750 Varian INOVA 1 'Varian INOVA' 
500 Varian VXRS  2 'Varian VXRS'  
# 
_pdbx_nmr_refine.entry_id           2LTQ 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            
'JOINT CALCULATION OF DSBB C41S FAB WITH SOLID-STATE NMR RESTRAINTS AND X-RAY REFLECTIONS (X-RAY DATA ARE FROM PDB ID: 2ZUQ)' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   2LTQ 
_pdbx_nmr_details.text       'Chemical shifts assignments and CC correlations provide dihedral angle and distance restraints.' 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    0 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LTQ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   0.51 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    0 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   0.52 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LTQ 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Goddard                                             'chemical shift assignment' SPARKY     ? 1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ? 2 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ? 3 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH ? 4 
'Shen, Cornilescu, Delaglio and Bax'                'data analysis'             TALOS+     ? 5 
Varian                                              collection                  VNMRJ      ? 6 
# 
_exptl.entry_id          2LTQ 
_exptl.method            'SOLID-STATE NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  2LTQ 
_struct.title                     'High resolution structure of DsbB C41S by joint calculation with solid-state NMR and X-ray data' 
_struct.pdbx_descriptor           'Disulfide bond formation protein B, Fab fragment light chain, Fab fragment heavy chain' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LTQ 
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN, OXIDOREDUCTASE' 
_struct_keywords.text            
;MEMBRANE PROTEIN, OXIDOREDUCTASE, DISULFIDE BOND, REDOX-ACTIVE CENTER, CELL INNER MEMBRANE, CELL MEMBRANE, CHAPERONE, ELECTRON TRANSPORT, MEMBRANE, TRANSMEMBRANE, TRANSPORT
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  GLY A 11  ? THR A 28  ? GLY A 11  THR A 28  1 ? 18 
HELX_P HELX_P2  2  ALA A 29  ? TRP A 31  ? ALA A 29  TRP A 31  5 ? 3  
HELX_P HELX_P3  3  LEU A 43  ? ALA A 62  ? LEU A 43  ALA A 62  1 ? 20 
HELX_P HELX_P4  4  VAL A 72  ? TYR A 97  ? VAL A 72  TYR A 97  1 ? 26 
HELX_P HELX_P5  5  GLN A 144 ? ILE A 162 ? GLN A 144 ILE A 162 1 ? 19 
HELX_P HELX_P6  6  SER B 146 ? SER B 152 ? SER B 146 SER B 152 1 ? 7  
HELX_P HELX_P7  7  ASP B 209 ? HIS B 214 ? ASP B 209 HIS B 214 5 ? 6  
HELX_P HELX_P8  8  ASN B 237 ? CYS B 239 ? ASN B 237 CYS B 239 5 ? 3  
HELX_P HELX_P9  9  ALA C 28  ? TYR C 32  ? ALA C 28  TYR C 32  5 ? 5  
HELX_P HELX_P10 10 GLY D 13  ? TRP D 31  ? GLY D 13  TRP D 31  1 ? 19 
HELX_P HELX_P11 11 CYS D 44  ? GLY D 61  ? CYS D 44  GLY D 61  1 ? 18 
HELX_P HELX_P12 12 LEU D 69  ? TYR D 97  ? LEU D 69  TYR D 97  1 ? 29 
HELX_P HELX_P13 13 PRO D 115 ? TRP D 119 ? PRO D 115 TRP D 119 1 ? 5  
HELX_P HELX_P14 14 MET D 142 ? GLY D 148 ? MET D 142 GLY D 148 1 ? 7  
HELX_P HELX_P15 15 ILE D 151 ? ILE D 162 ? ILE D 151 ILE D 162 1 ? 12 
HELX_P HELX_P16 16 GLN E 105 ? LEU E 109 ? GLN E 105 LEU E 109 5 ? 5  
HELX_P HELX_P17 17 SER E 146 ? SER E 152 ? SER E 146 SER E 152 1 ? 7  
HELX_P HELX_P18 18 LYS E 208 ? GLU E 212 ? LYS E 208 GLU E 212 1 ? 5  
HELX_P HELX_P19 19 ALA F 28  ? TYR F 32  ? ALA F 28  TYR F 32  5 ? 5  
HELX_P HELX_P20 20 LYS F 87  ? THR F 91  ? LYS F 87  THR F 91  5 ? 5  
HELX_P HELX_P21 21 SER F 162 ? SER F 164 ? SER F 162 SER F 164 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 104 SG ? ? ? 1_555 A CYS 130 SG ? ? A CYS 104 A CYS 130 1_555 ? ? ? ? ? ? ? 2.010 ? 
disulf2  disulf ? ? B CYS 43  SG ? ? ? 1_555 B CYS 114 SG ? ? B CYS 43  B CYS 114 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf3  disulf ? ? B CYS 159 SG ? ? ? 1_555 B CYS 219 SG ? ? B CYS 159 B CYS 219 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf4  disulf ? ? B CYS 239 SG ? ? ? 1_555 C CYS 134 SG ? ? B CYS 239 C CYS 134 1_555 ? ? ? ? ? ? ? 1.944 ? 
disulf5  disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? C CYS 22  C CYS 96  1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf6  disulf ? ? C CYS 146 SG ? ? ? 1_555 C CYS 201 SG ? ? C CYS 146 C CYS 201 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf7  disulf ? ? D CYS 104 SG ? ? ? 1_555 D CYS 130 SG ? ? D CYS 104 D CYS 130 1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf8  disulf ? ? E CYS 43  SG ? ? ? 1_555 E CYS 114 SG ? ? E CYS 43  E CYS 114 1_555 ? ? ? ? ? ? ? 2.045 ? 
disulf9  disulf ? ? E CYS 159 SG ? ? ? 1_555 E CYS 219 SG ? ? E CYS 159 E CYS 219 1_555 ? ? ? ? ? ? ? 2.053 ? 
disulf10 disulf ? ? E CYS 239 SG ? ? ? 1_555 F CYS 134 SG ? ? E CYS 239 F CYS 134 1_555 ? ? ? ? ? ? ? 1.953 ? 
disulf11 disulf ? ? F CYS 22  SG ? ? ? 1_555 F CYS 96  SG ? ? F CYS 22  F CYS 96  1_555 ? ? ? ? ? ? ? 2.046 ? 
disulf12 disulf ? ? F CYS 146 SG ? ? ? 1_555 F CYS 201 SG ? ? F CYS 146 F CYS 201 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 1  -2.78  
2  TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 1  3.38   
3  PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 1  -7.55  
4  GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 1  -2.39  
5  SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 1  0.56   
6  ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 1  -22.66 
7  TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 1  2.62   
8  PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 1  -14.99 
9  GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 1  -5.21  
10 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 2  -2.78  
11 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 2  3.32   
12 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 2  -7.60  
13 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 2  -2.42  
14 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 2  0.57   
15 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 2  -22.65 
16 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 2  2.63   
17 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 2  -15.13 
18 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 2  -5.18  
19 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 3  -2.69  
20 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 3  3.34   
21 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 3  -7.59  
22 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 3  -2.38  
23 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 3  0.53   
24 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 3  -22.68 
25 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 3  2.51   
26 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 3  -15.11 
27 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 3  -5.18  
28 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 4  -2.75  
29 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 4  3.19   
30 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 4  -7.59  
31 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 4  -2.42  
32 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 4  0.56   
33 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 4  -22.69 
34 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 4  2.63   
35 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 4  -15.16 
36 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 4  -5.14  
37 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 5  -2.68  
38 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 5  3.35   
39 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 5  -7.54  
40 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 5  -2.42  
41 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 5  0.63   
42 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 5  -22.65 
43 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 5  2.55   
44 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 5  -15.10 
45 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 5  -5.16  
46 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 6  -2.72  
47 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 6  3.31   
48 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 6  -7.51  
49 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 6  -2.31  
50 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 6  0.51   
51 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 6  -22.61 
52 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 6  2.57   
53 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 6  -15.09 
54 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 6  -5.24  
55 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 7  -2.76  
56 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 7  3.26   
57 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 7  -7.61  
58 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 7  -2.45  
59 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 7  0.66   
60 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 7  -22.70 
61 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 7  2.53   
62 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 7  -15.15 
63 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 7  -5.12  
64 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 8  -2.75  
65 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 8  3.19   
66 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 8  -7.61  
67 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 8  -2.42  
68 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 8  0.43   
69 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 8  -22.60 
70 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 8  2.60   
71 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 8  -15.09 
72 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 8  -5.19  
73 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 9  -2.74  
74 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 9  3.20   
75 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 9  -7.60  
76 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 9  -2.39  
77 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 9  0.62   
78 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 9  -22.72 
79 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 9  2.59   
80 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 9  -15.07 
81 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 9  -5.12  
82 SER 27  B . ? SER 27  B PRO 28  B ? PRO 28  B 10 -2.67  
83 TYR 165 B . ? TYR 165 B PRO 166 B ? PRO 166 B 10 3.27   
84 PHE 152 C . ? PHE 152 C PRO 153 C ? PRO 153 C 10 -7.60  
85 GLU 154 C . ? GLU 154 C PRO 155 C ? PRO 155 C 10 -2.50  
86 SER 27  E . ? SER 27  E PRO 28  E ? PRO 28  E 10 0.64   
87 ARG 53  E . ? ARG 53  E THR 54  E ? THR 54  E 10 -22.65 
88 TYR 165 E . ? TYR 165 E PRO 166 E ? PRO 166 E 10 2.57   
89 PHE 152 F . ? PHE 152 F PRO 153 F ? PRO 153 F 10 -15.13 
90 GLU 154 F . ? GLU 154 F PRO 155 F ? PRO 155 F 10 -5.30  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 5 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 4 ? 
G ? 6 ? 
H ? 4 ? 
I ? 3 ? 
J ? 2 ? 
K ? 2 ? 
L ? 4 ? 
M ? 4 ? 
N ? 4 ? 
O ? 3 ? 
P ? 4 ? 
Q ? 2 ? 
R ? 5 ? 
S ? 4 ? 
T ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
N 1 2 ? anti-parallel 
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? parallel      
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
S 1 2 ? anti-parallel 
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
T 1 2 ? anti-parallel 
T 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 MET B 24  ? SER B 27  ? MET B 24  SER B 27  
A 2 VAL B 39  ? SER B 45  ? VAL B 39  SER B 45  
A 3 ASP B 96  ? ILE B 101 ? ASP B 96  ILE B 101 
A 4 PHE B 88  ? GLY B 92  ? PHE B 88  GLY B 92  
B 1 SER B 30  ? VAL B 33  ? SER B 30  VAL B 33  
B 2 LYS B 128 ? ILE B 131 ? LYS B 128 ILE B 131 
B 3 ALA B 110 ? GLN B 116 ? ALA B 110 GLN B 116 
B 4 LEU B 59  ? GLN B 64  ? LEU B 59  GLN B 64  
B 5 LYS B 71  ? ILE B 74  ? LYS B 71  ILE B 74  
C 1 SER B 30  ? VAL B 33  ? SER B 30  VAL B 33  
C 2 LYS B 128 ? ILE B 131 ? LYS B 128 ILE B 131 
C 3 ALA B 110 ? GLN B 116 ? ALA B 110 GLN B 116 
C 4 THR B 122 ? PHE B 123 ? THR B 122 PHE B 123 
D 1 THR B 139 ? PHE B 143 ? THR B 139 PHE B 143 
D 2 GLY B 154 ? ASN B 162 ? GLY B 154 ASN B 162 
D 3 SER B 201 ? THR B 207 ? SER B 201 THR B 207 
D 4 VAL B 184 ? LEU B 185 ? VAL B 184 LEU B 185 
E 1 LYS B 172 ? ILE B 175 ? LYS B 172 ILE B 175 
E 2 SER B 216 ? GLU B 220 ? SER B 216 GLU B 220 
E 3 VAL B 231 ? ASN B 235 ? VAL B 231 ASN B 235 
F 1 GLN C 3   ? SER C 7   ? GLN C 3   SER C 7   
F 2 GLY C 16  ? SER C 25  ? GLY C 16  SER C 25  
F 3 THR C 78  ? LEU C 86  ? THR C 78  LEU C 86  
F 4 PHE C 68  ? ASP C 73  ? PHE C 68  ASP C 73  
G 1 LEU C 11  ? VAL C 12  ? LEU C 11  VAL C 12  
G 2 SER C 114 ? VAL C 117 ? SER C 114 VAL C 117 
G 3 ALA C 92  ? ALA C 97  ? ALA C 92  ALA C 97  
G 4 MET C 34  ? GLN C 39  ? MET C 34  GLN C 39  
G 5 LEU C 45  ? ILE C 51  ? LEU C 45  ILE C 51  
G 6 THR C 58  ? TYR C 59  ? THR C 58  TYR C 59  
H 1 SER C 126 ? LEU C 130 ? SER C 126 LEU C 130 
H 2 SER C 141 ? TYR C 151 ? SER C 141 TYR C 151 
H 3 TYR C 181 ? THR C 190 ? TYR C 181 THR C 190 
H 4 VAL C 169 ? THR C 171 ? VAL C 169 THR C 171 
I 1 THR C 157 ? TRP C 160 ? THR C 157 TRP C 160 
I 2 THR C 200 ? HIS C 205 ? THR C 200 HIS C 205 
I 3 THR C 210 ? LYS C 215 ? THR C 210 LYS C 215 
J 1 MET E 24  ? SER E 27  ? MET E 24  SER E 27  
J 2 SER E 42  ? SER E 45  ? SER E 42  SER E 45  
K 1 LYS E 38  ? THR E 40  ? LYS E 38  THR E 40  
K 2 THR E 100 ? SER E 102 ? THR E 100 SER E 102 
L 1 LYS E 71  ? ILE E 74  ? LYS E 71  ILE E 74  
L 2 LEU E 59  ? GLN E 64  ? LEU E 59  GLN E 64  
L 3 VAL E 111 ? GLN E 116 ? VAL E 111 GLN E 116 
L 4 THR E 122 ? PHE E 123 ? THR E 122 PHE E 123 
M 1 LYS E 71  ? ILE E 74  ? LYS E 71  ILE E 74  
M 2 LEU E 59  ? GLN E 64  ? LEU E 59  GLN E 64  
M 3 VAL E 111 ? GLN E 116 ? VAL E 111 GLN E 116 
M 4 THR E 127 ? LYS E 128 ? THR E 127 LYS E 128 
N 1 THR E 139 ? PHE E 143 ? THR E 139 PHE E 143 
N 2 GLY E 154 ? PHE E 164 ? GLY E 154 PHE E 164 
N 3 TYR E 198 ? THR E 207 ? TYR E 198 THR E 207 
N 4 VAL E 184 ? TRP E 188 ? VAL E 184 TRP E 188 
O 1 LYS E 174 ? ILE E 175 ? LYS E 174 ILE E 175 
O 2 SER E 216 ? ALA E 221 ? SER E 216 ALA E 221 
O 3 ILE E 230 ? ASN E 235 ? ILE E 230 ASN E 235 
P 1 LEU F 4   ? SER F 7   ? LEU F 4   SER F 7   
P 2 LEU F 18  ? ALA F 24  ? LEU F 18  ALA F 24  
P 3 THR F 78  ? MET F 83  ? THR F 78  MET F 83  
P 4 PHE F 68  ? ASP F 73  ? PHE F 68  ASP F 73  
Q 1 LEU F 11  ? VAL F 12  ? LEU F 11  VAL F 12  
Q 2 THR F 116 ? VAL F 117 ? THR F 116 VAL F 117 
R 1 THR F 58  ? TYR F 59  ? THR F 58  TYR F 59  
R 2 LEU F 45  ? ILE F 51  ? LEU F 45  ILE F 51  
R 3 MET F 34  ? GLN F 39  ? MET F 34  GLN F 39  
R 4 MET F 93  ? PRO F 99  ? MET F 93  PRO F 99  
R 5 MET F 106 ? TRP F 109 ? MET F 106 TRP F 109 
S 1 SER F 126 ? LEU F 130 ? SER F 126 LEU F 130 
S 2 SER F 141 ? TYR F 151 ? SER F 141 TYR F 151 
S 3 TYR F 181 ? THR F 190 ? TYR F 181 THR F 190 
S 4 VAL F 169 ? THR F 171 ? VAL F 169 THR F 171 
T 1 THR F 157 ? TRP F 160 ? THR F 157 TRP F 160 
T 2 CYS F 201 ? HIS F 205 ? CYS F 201 HIS F 205 
T 3 THR F 210 ? LYS F 214 ? THR F 210 LYS F 214 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER B 25  ? N SER B 25  O LYS B 44  ? O LYS B 44  
A 2 3 N CYS B 43  ? N CYS B 43  O PHE B 97  ? O PHE B 97  
A 3 4 O THR B 98  ? O THR B 98  N SER B 91  ? N SER B 91  
B 1 2 N LEU B 31  ? N LEU B 31  O LYS B 128 ? O LYS B 128 
B 2 3 O LEU B 129 ? O LEU B 129 N ALA B 110 ? N ALA B 110 
B 3 4 O TYR B 113 ? O TYR B 113 N TYR B 62  ? N TYR B 62  
B 4 5 N GLN B 63  ? N GLN B 63  O LYS B 71  ? O LYS B 71  
C 1 2 N LEU B 31  ? N LEU B 31  O LYS B 128 ? O LYS B 128 
C 2 3 O LEU B 129 ? O LEU B 129 N ALA B 110 ? N ALA B 110 
C 3 4 N GLN B 116 ? N GLN B 116 O THR B 122 ? O THR B 122 
D 1 2 N PHE B 143 ? N PHE B 143 O VAL B 158 ? O VAL B 158 
D 2 3 N VAL B 157 ? N VAL B 157 O LEU B 204 ? O LEU B 204 
D 3 4 O THR B 203 ? O THR B 203 N LEU B 185 ? N LEU B 185 
E 1 2 N LYS B 172 ? N LYS B 172 O GLU B 220 ? O GLU B 220 
E 2 3 N TYR B 217 ? N TYR B 217 O PHE B 234 ? O PHE B 234 
F 1 2 N VAL C 5   ? N VAL C 5   O ALA C 23  ? O ALA C 23  
F 2 3 N LEU C 20  ? N LEU C 20  O LEU C 81  ? O LEU C 81  
F 3 4 O TYR C 80  ? O TYR C 80  N SER C 71  ? N SER C 71  
G 1 2 N VAL C 12  ? N VAL C 12  O THR C 116 ? O THR C 116 
G 2 3 O VAL C 115 ? O VAL C 115 N ALA C 92  ? N ALA C 92  
G 3 4 O TYR C 95  ? O TYR C 95  N VAL C 37  ? N VAL C 37  
G 4 5 N MET C 34  ? N MET C 34  O ILE C 51  ? O ILE C 51  
G 5 6 N TYR C 50  ? N TYR C 50  O TYR C 59  ? O TYR C 59  
H 1 2 N TYR C 128 ? N TYR C 128 O LEU C 147 ? O LEU C 147 
H 2 3 N VAL C 148 ? N VAL C 148 O LEU C 183 ? O LEU C 183 
H 3 4 O SER C 186 ? O SER C 186 N HIS C 170 ? N HIS C 170 
I 1 2 N THR C 159 ? N THR C 159 O ASN C 202 ? O ASN C 202 
I 2 3 N CYS C 201 ? N CYS C 201 O LYS C 214 ? O LYS C 214 
J 1 2 N SER E 27  ? N SER E 27  O SER E 42  ? O SER E 42  
K 1 2 N VAL E 39  ? N VAL E 39  O ILE E 101 ? O ILE E 101 
L 1 2 O LEU E 73  ? O LEU E 73  N TRP E 61  ? N TRP E 61  
L 2 3 N ALA E 60  ? N ALA E 60  O LYS E 115 ? O LYS E 115 
L 3 4 N GLN E 116 ? N GLN E 116 O THR E 122 ? O THR E 122 
M 1 2 O LEU E 73  ? O LEU E 73  N TRP E 61  ? N TRP E 61  
M 2 3 N ALA E 60  ? N ALA E 60  O LYS E 115 ? O LYS E 115 
M 3 4 N TYR E 112 ? N TYR E 112 O THR E 127 ? O THR E 127 
N 1 2 N THR E 139 ? N THR E 139 O ASN E 162 ? O ASN E 162 
N 2 3 N LEU E 161 ? N LEU E 161 O MET E 200 ? O MET E 200 
N 3 4 O THR E 203 ? O THR E 203 N LEU E 185 ? N LEU E 185 
O 1 2 N LYS E 174 ? N LYS E 174 O THR E 218 ? O THR E 218 
O 2 3 N TYR E 217 ? N TYR E 217 O PHE E 234 ? O PHE E 234 
P 1 2 N SER F 7   ? N SER F 7   O SER F 21  ? O SER F 21  
P 2 3 N LEU F 20  ? N LEU F 20  O LEU F 81  ? O LEU F 81  
P 3 4 O GLN F 82  ? O GLN F 82  N THR F 69  ? N THR F 69  
Q 1 2 N VAL F 12  ? N VAL F 12  O THR F 116 ? O THR F 116 
R 1 2 O TYR F 59  ? O TYR F 59  N TYR F 50  ? N TYR F 50  
R 2 3 O ILE F 51  ? O ILE F 51  N MET F 34  ? N MET F 34  
R 3 4 N VAL F 37  ? N VAL F 37  O TYR F 95  ? O TYR F 95  
R 4 5 N ARG F 98  ? N ARG F 98  O TYR F 108 ? O TYR F 108 
S 1 2 N TYR F 128 ? N TYR F 128 O LEU F 147 ? O LEU F 147 
S 2 3 N LEU F 144 ? N LEU F 144 O VAL F 187 ? O VAL F 187 
S 3 4 O SER F 186 ? O SER F 186 N HIS F 170 ? N HIS F 170 
T 1 2 N THR F 157 ? N THR F 157 O ALA F 204 ? O ALA F 204 
T 2 3 N CYS F 201 ? N CYS F 201 O LYS F 214 ? O LYS F 214 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE UQ1 A 201' 
AC2 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE UQ1 D 201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 ALA A 29  ? ALA A 29  . ? 1_555 ? 
2  AC1 10 LEU A 38  ? LEU A 38  . ? 1_555 ? 
3  AC1 10 PRO A 40  ? PRO A 40  . ? 1_555 ? 
4  AC1 10 SER A 41  ? SER A 41  . ? 1_555 ? 
5  AC1 10 CYS A 44  ? CYS A 44  . ? 1_555 ? 
6  AC1 10 GLU A 47  ? GLU A 47  . ? 1_555 ? 
7  AC1 10 ARG A 48  ? ARG A 48  . ? 1_555 ? 
8  AC1 10 HIS A 91  ? HIS A 91  . ? 1_555 ? 
9  AC1 10 MET A 142 ? MET A 142 . ? 1_555 ? 
10 AC1 10 PRO A 143 ? PRO A 143 . ? 1_555 ? 
11 AC2 3  LEU D 38  ? LEU D 38  . ? 1_555 ? 
12 AC2 3  PRO D 40  ? PRO D 40  . ? 1_555 ? 
13 AC2 3  CYS D 44  ? CYS D 44  . ? 1_555 ? 
# 
_atom_sites.entry_id                    2LTQ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N    . GLN A 1 10  ? -72.408  -6.752  -111.461 1.00 0.00 ? 10  GLN A N    1  
ATOM   2      C CA   . GLN A 1 10  ? -72.879  -8.022  -112.106 1.00 0.00 ? 10  GLN A CA   1  
ATOM   3      C C    . GLN A 1 10  ? -72.085  -8.285  -113.386 1.00 0.00 ? 10  GLN A C    1  
ATOM   4      O O    . GLN A 1 10  ? -72.582  -8.950  -114.302 1.00 0.00 ? 10  GLN A O    1  
ATOM   5      C CB   . GLN A 1 10  ? -74.370  -7.898  -112.427 1.00 0.00 ? 10  GLN A CB   1  
ATOM   6      C CG   . GLN A 1 10  ? -75.111  -9.236  -112.337 1.00 0.00 ? 10  GLN A CG   1  
ATOM   7      C CD   . GLN A 1 10  ? -74.321  -10.374 -112.947 1.00 0.00 ? 10  GLN A CD   1  
ATOM   8      O OE1  . GLN A 1 10  ? -73.379  -10.888 -112.321 1.00 0.00 ? 10  GLN A OE1  1  
ATOM   9      N NE2  . GLN A 1 10  ? -74.672  -10.799 -114.146 1.00 0.00 ? 10  GLN A NE2  1  
ATOM   10     H H    . GLN A 1 10  ? -73.182  -6.054  -111.457 1.00 0.00 ? 10  GLN A H    1  
ATOM   11     H HA   . GLN A 1 10  ? -72.719  -8.829  -111.421 1.00 0.00 ? 10  GLN A HA   1  
ATOM   12     H HB2  . GLN A 1 10  ? -74.821  -7.226  -111.722 1.00 0.00 ? 10  GLN A HB2  1  
ATOM   13     H HB3  . GLN A 1 10  ? -74.485  -7.504  -113.418 1.00 0.00 ? 10  GLN A HB3  1  
ATOM   14     H HG2  . GLN A 1 10  ? -75.323  -9.454  -111.310 1.00 0.00 ? 10  GLN A HG2  1  
ATOM   15     H HG3  . GLN A 1 10  ? -76.045  -9.137  -112.880 1.00 0.00 ? 10  GLN A HG3  1  
ATOM   16     H HE21 . GLN A 1 10  ? -75.428  -10.366 -114.614 1.00 0.00 ? 10  GLN A HE21 1  
ATOM   17     H HE22 . GLN A 1 10  ? -74.199  -11.538 -114.579 1.00 0.00 ? 10  GLN A HE22 1  
ATOM   18     N N    . GLY A 1 11  ? -70.854  -7.769  -113.421 1.00 0.00 ? 11  GLY A N    1  
ATOM   19     C CA   . GLY A 1 11  ? -69.972  -7.940  -114.580 1.00 0.00 ? 11  GLY A CA   1  
ATOM   20     C C    . GLY A 1 11  ? -68.496  -7.931  -114.171 1.00 0.00 ? 11  GLY A C    1  
ATOM   21     O O    . GLY A 1 11  ? -68.162  -7.718  -113.006 1.00 0.00 ? 11  GLY A O    1  
ATOM   22     H H    . GLY A 1 11  ? -70.537  -7.265  -112.650 1.00 0.00 ? 11  GLY A H    1  
ATOM   23     H HA2  . GLY A 1 11  ? -70.185  -8.878  -115.055 1.00 0.00 ? 11  GLY A HA2  1  
ATOM   24     H HA3  . GLY A 1 11  ? -70.148  -7.137  -115.280 1.00 0.00 ? 11  GLY A HA3  1  
ATOM   25     N N    . ARG A 1 12  ? -67.620  -8.100  -115.171 1.00 0.00 ? 12  ARG A N    1  
ATOM   26     C CA   . ARG A 1 12  ? -66.168  -8.092  -114.935 1.00 0.00 ? 12  ARG A CA   1  
ATOM   27     C C    . ARG A 1 12  ? -65.765  -6.761  -114.247 1.00 0.00 ? 12  ARG A C    1  
ATOM   28     O O    . ARG A 1 12  ? -64.974  -6.764  -113.302 1.00 0.00 ? 12  ARG A O    1  
ATOM   29     C CB   . ARG A 1 12  ? -65.395  -8.242  -116.284 1.00 0.00 ? 12  ARG A CB   1  
ATOM   30     C CG   . ARG A 1 12  ? -65.305  -9.709  -116.785 1.00 0.00 ? 12  ARG A CG   1  
ATOM   31     C CD   . ARG A 1 12  ? -64.978  -9.768  -118.314 1.00 0.00 ? 12  ARG A CD   1  
ATOM   32     N NE   . ARG A 1 12  ? -63.555  -9.483  -118.588 1.00 0.00 ? 12  ARG A NE   1  
ATOM   33     C CZ   . ARG A 1 12  ? -63.020  -9.449  -119.830 1.00 0.00 ? 12  ARG A CZ   1  
ATOM   34     N NH1  . ARG A 1 12  ? -63.751  -9.676  -120.902 1.00 0.00 ? 12  ARG A NH1  1  
ATOM   35     N NH2  . ARG A 1 12  ? -61.729  -9.182  -119.957 1.00 0.00 ? 12  ARG A NH2  1  
ATOM   36     H H    . ARG A 1 12  ? -67.958  -8.217  -116.076 1.00 0.00 ? 12  ARG A H    1  
ATOM   37     H HA   . ARG A 1 12  ? -65.900  -8.894  -114.290 1.00 0.00 ? 12  ARG A HA   1  
ATOM   38     H HB2  . ARG A 1 12  ? -65.889  -7.661  -117.029 1.00 0.00 ? 12  ARG A HB2  1  
ATOM   39     H HB3  . ARG A 1 12  ? -64.399  -7.869  -116.137 1.00 0.00 ? 12  ARG A HB3  1  
ATOM   40     H HG2  . ARG A 1 12  ? -64.519  -10.215 -116.247 1.00 0.00 ? 12  ARG A HG2  1  
ATOM   41     H HG3  . ARG A 1 12  ? -66.238  -10.208 -116.610 1.00 0.00 ? 12  ARG A HG3  1  
ATOM   42     H HD2  . ARG A 1 12  ? -65.213  -10.756 -118.670 1.00 0.00 ? 12  ARG A HD2  1  
ATOM   43     H HD3  . ARG A 1 12  ? -65.597  -9.052  -118.825 1.00 0.00 ? 12  ARG A HD3  1  
ATOM   44     H HE   . ARG A 1 12  ? -62.969  -9.313  -117.840 1.00 0.00 ? 12  ARG A HE   1  
ATOM   45     H HH11 . ARG A 1 12  ? -64.727  -9.882  -120.817 1.00 0.00 ? 12  ARG A HH11 1  
ATOM   46     H HH12 . ARG A 1 12  ? -63.329  -9.643  -121.813 1.00 0.00 ? 12  ARG A HH12 1  
ATOM   47     H HH21 . ARG A 1 12  ? -61.161  -9.011  -119.147 1.00 0.00 ? 12  ARG A HH21 1  
ATOM   48     H HH22 . ARG A 1 12  ? -61.310  -9.150  -120.867 1.00 0.00 ? 12  ARG A HH22 1  
ATOM   49     N N    . GLY A 1 13  ? -66.312  -5.641  -114.731 1.00 0.00 ? 13  GLY A N    1  
ATOM   50     C CA   . GLY A 1 13  ? -66.012  -4.325  -114.167 1.00 0.00 ? 13  GLY A CA   1  
ATOM   51     C C    . GLY A 1 13  ? -66.471  -4.209  -112.722 1.00 0.00 ? 13  GLY A C    1  
ATOM   52     O O    . GLY A 1 13  ? -65.688  -3.834  -111.854 1.00 0.00 ? 13  GLY A O    1  
ATOM   53     H H    . GLY A 1 13  ? -66.925  -5.703  -115.485 1.00 0.00 ? 13  GLY A H    1  
ATOM   54     H HA2  . GLY A 1 13  ? -64.951  -4.154  -114.213 1.00 0.00 ? 13  GLY A HA2  1  
ATOM   55     H HA3  . GLY A 1 13  ? -66.519  -3.571  -114.755 1.00 0.00 ? 13  GLY A HA3  1  
ATOM   56     N N    . ALA A 1 14  ? -67.737  -4.550  -112.485 1.00 0.00 ? 14  ALA A N    1  
ATOM   57     C CA   . ALA A 1 14  ? -68.329  -4.480  -111.141 1.00 0.00 ? 14  ALA A CA   1  
ATOM   58     C C    . ALA A 1 14  ? -67.550  -5.295  -110.093 1.00 0.00 ? 14  ALA A C    1  
ATOM   59     O O    . ALA A 1 14  ? -67.253  -4.794  -108.997 1.00 0.00 ? 14  ALA A O    1  
ATOM   60     C CB   . ALA A 1 14  ? -69.779  -4.971  -111.204 1.00 0.00 ? 14  ALA A CB   1  
ATOM   61     H H    . ALA A 1 14  ? -68.291  -4.848  -113.232 1.00 0.00 ? 14  ALA A H    1  
ATOM   62     H HA   . ALA A 1 14  ? -68.344  -3.455  -110.833 1.00 0.00 ? 14  ALA A HA   1  
ATOM   63     H HB1  . ALA A 1 14  ? -69.800  -6.032  -111.397 1.00 0.00 ? 14  ALA A HB1  1  
ATOM   64     H HB2  . ALA A 1 14  ? -70.299  -4.450  -111.997 1.00 0.00 ? 14  ALA A HB2  1  
ATOM   65     H HB3  . ALA A 1 14  ? -70.266  -4.764  -110.262 1.00 0.00 ? 14  ALA A HB3  1  
ATOM   66     N N    . TRP A 1 15  ? -67.155  -6.510  -110.480 1.00 0.00 ? 15  TRP A N    1  
ATOM   67     C CA   . TRP A 1 15  ? -66.374  -7.390  -109.615 1.00 0.00 ? 15  TRP A CA   1  
ATOM   68     C C    . TRP A 1 15  ? -64.957  -6.809  -109.486 1.00 0.00 ? 15  TRP A C    1  
ATOM   69     O O    . TRP A 1 15  ? -64.444  -6.712  -108.380 1.00 0.00 ? 15  TRP A O    1  
ATOM   70     C CB   . TRP A 1 15  ? -66.310  -8.825  -110.190 1.00 0.00 ? 15  TRP A CB   1  
ATOM   71     C CG   . TRP A 1 15  ? -67.313  -9.742  -109.553 1.00 0.00 ? 15  TRP A CG   1  
ATOM   72     C CD1  . TRP A 1 15  ? -67.105  -11.070 -109.282 1.00 0.00 ? 15  TRP A CD1  1  
ATOM   73     C CD2  . TRP A 1 15  ? -68.640  -9.448  -109.124 1.00 0.00 ? 15  TRP A CD2  1  
ATOM   74     N NE1  . TRP A 1 15  ? -68.237  -11.590 -108.709 1.00 0.00 ? 15  TRP A NE1  1  
ATOM   75     C CE2  . TRP A 1 15  ? -69.211  -10.647 -108.590 1.00 0.00 ? 15  TRP A CE2  1  
ATOM   76     C CE3  . TRP A 1 15  ? -69.421  -8.285  -109.132 1.00 0.00 ? 15  TRP A CE3  1  
ATOM   77     C CZ2  . TRP A 1 15  ? -70.489  -10.687 -108.094 1.00 0.00 ? 15  TRP A CZ2  1  
ATOM   78     C CZ3  . TRP A 1 15  ? -70.723  -8.336  -108.624 1.00 0.00 ? 15  TRP A CZ3  1  
ATOM   79     C CH2  . TRP A 1 15  ? -71.252  -9.538  -108.107 1.00 0.00 ? 15  TRP A CH2  1  
ATOM   80     H H    . TRP A 1 15  ? -67.373  -6.800  -111.377 1.00 0.00 ? 15  TRP A H    1  
ATOM   81     H HA   . TRP A 1 15  ? -66.811  -7.423  -108.639 1.00 0.00 ? 15  TRP A HA   1  
ATOM   82     H HB2  . TRP A 1 15  ? -66.510  -8.785  -111.239 1.00 0.00 ? 15  TRP A HB2  1  
ATOM   83     H HB3  . TRP A 1 15  ? -65.328  -9.216  -110.021 1.00 0.00 ? 15  TRP A HB3  1  
ATOM   84     H HD1  . TRP A 1 15  ? -66.207  -11.612 -109.480 1.00 0.00 ? 15  TRP A HD1  1  
ATOM   85     H HE1  . TRP A 1 15  ? -68.362  -12.531 -108.411 1.00 0.00 ? 15  TRP A HE1  1  
ATOM   86     H HE3  . TRP A 1 15  ? -69.029  -7.355  -109.524 1.00 0.00 ? 15  TRP A HE3  1  
ATOM   87     H HZ2  . TRP A 1 15  ? -70.898  -11.617 -107.696 1.00 0.00 ? 15  TRP A HZ2  1  
ATOM   88     H HZ3  . TRP A 1 15  ? -71.332  -7.450  -108.626 1.00 0.00 ? 15  TRP A HZ3  1  
ATOM   89     H HH2  . TRP A 1 15  ? -72.251  -9.561  -107.722 1.00 0.00 ? 15  TRP A HH2  1  
ATOM   90     N N    . LEU A 1 16  ? -64.328  -6.423  -110.611 1.00 0.00 ? 16  LEU A N    1  
ATOM   91     C CA   . LEU A 1 16  ? -62.956  -5.862  -110.563 1.00 0.00 ? 16  LEU A CA   1  
ATOM   92     C C    . LEU A 1 16  ? -62.876  -4.551  -109.732 1.00 0.00 ? 16  LEU A C    1  
ATOM   93     O O    . LEU A 1 16  ? -61.895  -4.345  -109.001 1.00 0.00 ? 16  LEU A O    1  
ATOM   94     C CB   . LEU A 1 16  ? -62.413  -5.577  -111.986 1.00 0.00 ? 16  LEU A CB   1  
ATOM   95     C CG   . LEU A 1 16  ? -61.621  -6.727  -112.666 1.00 0.00 ? 16  LEU A CG   1  
ATOM   96     C CD1  . LEU A 1 16  ? -60.338  -7.023  -111.906 1.00 0.00 ? 16  LEU A CD1  1  
ATOM   97     C CD2  . LEU A 1 16  ? -62.463  -7.988  -112.799 1.00 0.00 ? 16  LEU A CD2  1  
ATOM   98     H H    . LEU A 1 16  ? -64.775  -6.534  -111.475 1.00 0.00 ? 16  LEU A H    1  
ATOM   99     H HA   . LEU A 1 16  ? -62.334  -6.572  -110.090 1.00 0.00 ? 16  LEU A HA   1  
ATOM   100    H HB2  . LEU A 1 16  ? -63.231  -5.352  -112.619 1.00 0.00 ? 16  LEU A HB2  1  
ATOM   101    H HB3  . LEU A 1 16  ? -61.762  -4.728  -111.927 1.00 0.00 ? 16  LEU A HB3  1  
ATOM   102    H HG   . LEU A 1 16  ? -61.351  -6.382  -113.660 1.00 0.00 ? 16  LEU A HG   1  
ATOM   103    H HD11 . LEU A 1 16  ? -60.559  -7.667  -111.071 1.00 0.00 ? 16  LEU A HD11 1  
ATOM   104    H HD12 . LEU A 1 16  ? -59.906  -6.101  -111.553 1.00 0.00 ? 16  LEU A HD12 1  
ATOM   105    H HD13 . LEU A 1 16  ? -59.640  -7.518  -112.567 1.00 0.00 ? 16  LEU A HD13 1  
ATOM   106    H HD21 . LEU A 1 16  ? -63.050  -7.933  -113.705 1.00 0.00 ? 16  LEU A HD21 1  
ATOM   107    H HD22 . LEU A 1 16  ? -63.114  -8.078  -111.948 1.00 0.00 ? 16  LEU A HD22 1  
ATOM   108    H HD23 . LEU A 1 16  ? -61.812  -8.847  -112.854 1.00 0.00 ? 16  LEU A HD23 1  
ATOM   109    N N    . LEU A 1 17  ? -63.922  -3.730  -109.796 1.00 0.00 ? 17  LEU A N    1  
ATOM   110    C CA   . LEU A 1 17  ? -63.961  -2.491  -109.010 1.00 0.00 ? 17  LEU A CA   1  
ATOM   111    C C    . LEU A 1 17  ? -63.875  -2.862  -107.543 1.00 0.00 ? 17  LEU A C    1  
ATOM   112    O O    . LEU A 1 17  ? -63.006  -2.358  -106.834 1.00 0.00 ? 17  LEU A O    1  
ATOM   113    C CB   . LEU A 1 17  ? -65.287  -1.746  -109.299 1.00 0.00 ? 17  LEU A CB   1  
ATOM   114    C CG   . LEU A 1 17  ? -65.543  -0.469  -108.451 1.00 0.00 ? 17  LEU A CG   1  
ATOM   115    C CD1  . LEU A 1 17  ? -66.039  -0.827  -107.047 1.00 0.00 ? 17  LEU A CD1  1  
ATOM   116    C CD2  . LEU A 1 17  ? -64.303  0.421   -108.379 1.00 0.00 ? 17  LEU A CD2  1  
ATOM   117    H H    . LEU A 1 17  ? -64.685  -3.981  -110.343 1.00 0.00 ? 17  LEU A H    1  
ATOM   118    H HA   . LEU A 1 17  ? -63.136  -1.866  -109.278 1.00 0.00 ? 17  LEU A HA   1  
ATOM   119    H HB2  . LEU A 1 17  ? -65.284  -1.447  -110.324 1.00 0.00 ? 17  LEU A HB2  1  
ATOM   120    H HB3  . LEU A 1 17  ? -66.098  -2.426  -109.134 1.00 0.00 ? 17  LEU A HB3  1  
ATOM   121    H HG   . LEU A 1 17  ? -66.331  0.083   -108.945 1.00 0.00 ? 17  LEU A HG   1  
ATOM   122    H HD11 . LEU A 1 17  ? -66.662  -1.708  -107.095 1.00 0.00 ? 17  LEU A HD11 1  
ATOM   123    H HD12 . LEU A 1 17  ? -66.624  -0.003  -106.656 1.00 0.00 ? 17  LEU A HD12 1  
ATOM   124    H HD13 . LEU A 1 17  ? -65.201  -1.011  -106.400 1.00 0.00 ? 17  LEU A HD13 1  
ATOM   125    H HD21 . LEU A 1 17  ? -64.009  0.707   -109.380 1.00 0.00 ? 17  LEU A HD21 1  
ATOM   126    H HD22 . LEU A 1 17  ? -63.501  -0.111  -107.904 1.00 0.00 ? 17  LEU A HD22 1  
ATOM   127    H HD23 . LEU A 1 17  ? -64.537  1.311   -107.809 1.00 0.00 ? 17  LEU A HD23 1  
ATOM   128    N N    . MET A 1 18  ? -64.747  -3.773  -107.104 1.00 0.00 ? 18  MET A N    1  
ATOM   129    C CA   . MET A 1 18  ? -64.745  -4.190  -105.705 1.00 0.00 ? 18  MET A CA   1  
ATOM   130    C C    . MET A 1 18  ? -63.441  -4.884  -105.293 1.00 0.00 ? 18  MET A C    1  
ATOM   131    O O    . MET A 1 18  ? -62.903  -4.576  -104.229 1.00 0.00 ? 18  MET A O    1  
ATOM   132    C CB   . MET A 1 18  ? -65.968  -5.193  -105.429 1.00 0.00 ? 18  MET A CB   1  
ATOM   133    C CG   . MET A 1 18  ? -67.324  -4.464  -105.441 1.00 0.00 ? 18  MET A CG   1  
ATOM   134    S SD   . MET A 1 18  ? -67.772  -3.757  -103.827 1.00 0.00 ? 18  MET A SD   1  
ATOM   135    C CE   . MET A 1 18  ? -68.419  -2.155  -104.376 1.00 0.00 ? 18  MET A CE   1  
ATOM   136    H H    . MET A 1 18  ? -65.402  -4.151  -107.730 1.00 0.00 ? 18  MET A H    1  
ATOM   137    H HA   . MET A 1 18  ? -64.896  -3.351  -105.084 1.00 0.00 ? 18  MET A HA   1  
ATOM   138    H HB2  . MET A 1 18  ? -65.960  -5.923  -106.206 1.00 0.00 ? 18  MET A HB2  1  
ATOM   139    H HB3  . MET A 1 18  ? -65.793  -5.642  -104.485 1.00 0.00 ? 18  MET A HB3  1  
ATOM   140    H HG2  . MET A 1 18  ? -67.311  -3.687  -106.165 1.00 0.00 ? 18  MET A HG2  1  
ATOM   141    H HG3  . MET A 1 18  ? -68.066  -5.197  -105.712 1.00 0.00 ? 18  MET A HG3  1  
ATOM   142    H HE1  . MET A 1 18  ? -69.254  -2.309  -105.042 1.00 0.00 ? 18  MET A HE1  1  
ATOM   143    H HE2  . MET A 1 18  ? -67.644  -1.611  -104.886 1.00 0.00 ? 18  MET A HE2  1  
ATOM   144    H HE3  . MET A 1 18  ? -68.743  -1.591  -103.509 1.00 0.00 ? 18  MET A HE3  1  
ATOM   145    N N    . ALA A 1 19  ? -62.902  -5.745  -106.154 1.00 0.00 ? 19  ALA A N    1  
ATOM   146    C CA   . ALA A 1 19  ? -61.618  -6.391  -105.872 1.00 0.00 ? 19  ALA A CA   1  
ATOM   147    C C    . ALA A 1 19  ? -60.485  -5.349  -105.842 1.00 0.00 ? 19  ALA A C    1  
ATOM   148    O O    . ALA A 1 19  ? -59.638  -5.379  -104.948 1.00 0.00 ? 19  ALA A O    1  
ATOM   149    C CB   . ALA A 1 19  ? -61.316  -7.461  -106.929 1.00 0.00 ? 19  ALA A CB   1  
ATOM   150    H H    . ALA A 1 19  ? -63.354  -5.921  -106.999 1.00 0.00 ? 19  ALA A H    1  
ATOM   151    H HA   . ALA A 1 19  ? -61.665  -6.865  -104.915 1.00 0.00 ? 19  ALA A HA   1  
ATOM   152    H HB1  . ALA A 1 19  ? -60.537  -8.115  -106.562 1.00 0.00 ? 19  ALA A HB1  1  
ATOM   153    H HB2  . ALA A 1 19  ? -60.991  -6.994  -107.845 1.00 0.00 ? 19  ALA A HB2  1  
ATOM   154    H HB3  . ALA A 1 19  ? -62.209  -8.040  -107.116 1.00 0.00 ? 19  ALA A HB3  1  
ATOM   155    N N    . PHE A 1 20  ? -60.521  -4.388  -106.776 1.00 0.00 ? 20  PHE A N    1  
ATOM   156    C CA   . PHE A 1 20  ? -59.508  -3.324  -106.810 1.00 0.00 ? 20  PHE A CA   1  
ATOM   157    C C    . PHE A 1 20  ? -59.668  -2.472  -105.558 1.00 0.00 ? 20  PHE A C    1  
ATOM   158    O O    . PHE A 1 20  ? -58.728  -2.349  -104.775 1.00 0.00 ? 20  PHE A O    1  
ATOM   159    C CB   . PHE A 1 20  ? -59.669  -2.462  -108.092 1.00 0.00 ? 20  PHE A CB   1  
ATOM   160    C CG   . PHE A 1 20  ? -58.526  -1.456  -108.287 1.00 0.00 ? 20  PHE A CG   1  
ATOM   161    C CD1  . PHE A 1 20  ? -57.347  -1.837  -108.947 1.00 0.00 ? 20  PHE A CD1  1  
ATOM   162    C CD2  . PHE A 1 20  ? -58.663  -0.140  -107.835 1.00 0.00 ? 20  PHE A CD2  1  
ATOM   163    C CE1  . PHE A 1 20  ? -56.309  -0.908  -109.143 1.00 0.00 ? 20  PHE A CE1  1  
ATOM   164    C CE2  . PHE A 1 20  ? -57.624  0.788   -108.030 1.00 0.00 ? 20  PHE A CE2  1  
ATOM   165    C CZ   . PHE A 1 20  ? -56.446  0.403   -108.684 1.00 0.00 ? 20  PHE A CZ   1  
ATOM   166    H H    . PHE A 1 20  ? -61.249  -4.385  -107.424 1.00 0.00 ? 20  PHE A H    1  
ATOM   167    H HA   . PHE A 1 20  ? -58.531  -3.763  -106.807 1.00 0.00 ? 20  PHE A HA   1  
ATOM   168    H HB2  . PHE A 1 20  ? -59.689  -3.118  -108.942 1.00 0.00 ? 20  PHE A HB2  1  
ATOM   169    H HB3  . PHE A 1 20  ? -60.598  -1.925  -108.035 1.00 0.00 ? 20  PHE A HB3  1  
ATOM   170    H HD1  . PHE A 1 20  ? -57.235  -2.844  -109.303 1.00 0.00 ? 20  PHE A HD1  1  
ATOM   171    H HD2  . PHE A 1 20  ? -59.564  0.164   -107.333 1.00 0.00 ? 20  PHE A HD2  1  
ATOM   172    H HE1  . PHE A 1 20  ? -55.403  -1.212  -109.651 1.00 0.00 ? 20  PHE A HE1  1  
ATOM   173    H HE2  . PHE A 1 20  ? -57.737  1.802   -107.673 1.00 0.00 ? 20  PHE A HE2  1  
ATOM   174    H HZ   . PHE A 1 20  ? -55.647  1.117   -108.831 1.00 0.00 ? 20  PHE A HZ   1  
ATOM   175    N N    . THR A 1 21  ? -60.854  -1.868  -105.391 1.00 0.00 ? 21  THR A N    1  
ATOM   176    C CA   . THR A 1 21  ? -61.118  -0.979  -104.255 1.00 0.00 ? 21  THR A CA   1  
ATOM   177    C C    . THR A 1 21  ? -60.572  -1.571  -102.899 1.00 0.00 ? 21  THR A C    1  
ATOM   178    O O    . THR A 1 21  ? -59.919  -0.846  -102.151 1.00 0.00 ? 21  THR A O    1  
ATOM   179    C CB   . THR A 1 21  ? -62.615  -0.591  -104.148 1.00 0.00 ? 21  THR A CB   1  
ATOM   180    O OG1  . THR A 1 21  ? -63.437  -1.633  -104.632 1.00 0.00 ? 21  THR A OG1  1  
ATOM   181    C CG2  . THR A 1 21  ? -62.900  0.655   -104.980 1.00 0.00 ? 21  THR A CG2  1  
ATOM   182    H H    . THR A 1 21  ? -61.546  -1.991  -106.064 1.00 0.00 ? 21  THR A H    1  
ATOM   183    H HA   . THR A 1 21  ? -60.550  -0.099  -104.432 1.00 0.00 ? 21  THR A HA   1  
ATOM   184    H HB   . THR A 1 21  ? -62.862  -0.373  -103.122 1.00 0.00 ? 21  THR A HB   1  
ATOM   185    H HG1  . THR A 1 21  ? -63.291  -2.402  -104.081 1.00 0.00 ? 21  THR A HG1  1  
ATOM   186    H HG21 . THR A 1 21  ? -63.966  0.830   -104.992 1.00 0.00 ? 21  THR A HG21 1  
ATOM   187    H HG22 . THR A 1 21  ? -62.545  0.498   -105.982 1.00 0.00 ? 21  THR A HG22 1  
ATOM   188    H HG23 . THR A 1 21  ? -62.399  1.501   -104.542 1.00 0.00 ? 21  THR A HG23 1  
ATOM   189    N N    . ALA A 1 22  ? -60.813  -2.848  -102.675 1.00 0.00 ? 22  ALA A N    1  
ATOM   190    C CA   . ALA A 1 22  ? -60.308  -3.516  -101.473 1.00 0.00 ? 22  ALA A CA   1  
ATOM   191    C C    . ALA A 1 22  ? -58.789  -3.773  -101.512 1.00 0.00 ? 22  ALA A C    1  
ATOM   192    O O    . ALA A 1 22  ? -58.087  -3.421  -100.569 1.00 0.00 ? 22  ALA A O    1  
ATOM   193    C CB   . ALA A 1 22  ? -61.036  -4.840  -101.296 1.00 0.00 ? 22  ALA A CB   1  
ATOM   194    H H    . ALA A 1 22  ? -61.330  -3.358  -103.327 1.00 0.00 ? 22  ALA A H    1  
ATOM   195    H HA   . ALA A 1 22  ? -60.522  -2.905  -100.630 1.00 0.00 ? 22  ALA A HA   1  
ATOM   196    H HB1  . ALA A 1 22  ? -61.015  -5.108  -100.255 1.00 0.00 ? 22  ALA A HB1  1  
ATOM   197    H HB2  . ALA A 1 22  ? -60.552  -5.608  -101.876 1.00 0.00 ? 22  ALA A HB2  1  
ATOM   198    H HB3  . ALA A 1 22  ? -62.059  -4.729  -101.620 1.00 0.00 ? 22  ALA A HB3  1  
ATOM   199    N N    . LEU A 1 23  ? -58.270  -4.277  -102.633 1.00 0.00 ? 23  LEU A N    1  
ATOM   200    C CA   . LEU A 1 23  ? -56.818  -4.499  -102.750 1.00 0.00 ? 23  LEU A CA   1  
ATOM   201    C C    . LEU A 1 23  ? -56.131  -3.163  -102.518 1.00 0.00 ? 23  LEU A C    1  
ATOM   202    O O    . LEU A 1 23  ? -55.074  -3.105  -101.902 1.00 0.00 ? 23  LEU A O    1  
ATOM   203    C CB   . LEU A 1 23  ? -56.505  -5.039  -104.170 1.00 0.00 ? 23  LEU A CB   1  
ATOM   204    C CG   . LEU A 1 23  ? -55.010  -5.266  -104.511 1.00 0.00 ? 23  LEU A CG   1  
ATOM   205    C CD1  . LEU A 1 23  ? -54.318  -3.933  -104.688 1.00 0.00 ? 23  LEU A CD1  1  
ATOM   206    C CD2  . LEU A 1 23  ? -54.296  -6.103  -103.455 1.00 0.00 ? 23  LEU A CD2  1  
ATOM   207    H H    . LEU A 1 23  ? -58.858  -4.465  -103.389 1.00 0.00 ? 23  LEU A H    1  
ATOM   208    H HA   . LEU A 1 23  ? -56.492  -5.209  -102.022 1.00 0.00 ? 23  LEU A HA   1  
ATOM   209    H HB2  . LEU A 1 23  ? -56.994  -5.968  -104.286 1.00 0.00 ? 23  LEU A HB2  1  
ATOM   210    H HB3  . LEU A 1 23  ? -56.896  -4.337  -104.881 1.00 0.00 ? 23  LEU A HB3  1  
ATOM   211    H HG   . LEU A 1 23  ? -54.973  -5.797  -105.457 1.00 0.00 ? 23  LEU A HG   1  
ATOM   212    H HD11 . LEU A 1 23  ? -53.609  -4.005  -105.498 1.00 0.00 ? 23  LEU A HD11 1  
ATOM   213    H HD12 . LEU A 1 23  ? -53.808  -3.669  -103.778 1.00 0.00 ? 23  LEU A HD12 1  
ATOM   214    H HD13 . LEU A 1 23  ? -55.050  -3.174  -104.924 1.00 0.00 ? 23  LEU A HD13 1  
ATOM   215    H HD21 . LEU A 1 23  ? -54.166  -5.514  -102.563 1.00 0.00 ? 23  LEU A HD21 1  
ATOM   216    H HD22 . LEU A 1 23  ? -53.327  -6.400  -103.836 1.00 0.00 ? 23  LEU A HD22 1  
ATOM   217    H HD23 . LEU A 1 23  ? -54.880  -6.979  -103.234 1.00 0.00 ? 23  LEU A HD23 1  
ATOM   218    N N    . ALA A 1 24  ? -56.761  -2.095  -103.013 1.00 0.00 ? 24  ALA A N    1  
ATOM   219    C CA   . ALA A 1 24  ? -56.211  -0.750  -102.885 1.00 0.00 ? 24  ALA A CA   1  
ATOM   220    C C    . ALA A 1 24  ? -56.447  -0.174  -101.500 1.00 0.00 ? 24  ALA A C    1  
ATOM   221    O O    . ALA A 1 24  ? -55.496  0.168   -100.793 1.00 0.00 ? 24  ALA A O    1  
ATOM   222    C CB   . ALA A 1 24  ? -56.850  0.178   -103.943 1.00 0.00 ? 24  ALA A CB   1  
ATOM   223    H H    . ALA A 1 24  ? -57.617  -2.218  -103.460 1.00 0.00 ? 24  ALA A H    1  
ATOM   224    H HA   . ALA A 1 24  ? -55.153  -0.781  -103.075 1.00 0.00 ? 24  ALA A HA   1  
ATOM   225    H HB1  . ALA A 1 24  ? -56.649  1.211   -103.691 1.00 0.00 ? 24  ALA A HB1  1  
ATOM   226    H HB2  . ALA A 1 24  ? -57.917  0.017   -103.972 1.00 0.00 ? 24  ALA A HB2  1  
ATOM   227    H HB3  . ALA A 1 24  ? -56.428  -0.039  -104.916 1.00 0.00 ? 24  ALA A HB3  1  
ATOM   228    N N    . LEU A 1 25  ? -57.725  -0.111  -101.124 1.00 0.00 ? 25  LEU A N    1  
ATOM   229    C CA   . LEU A 1 25  ? -58.142  0.439   -99.826  1.00 0.00 ? 25  LEU A CA   1  
ATOM   230    C C    . LEU A 1 25  ? -57.508  -0.354  -98.713  1.00 0.00 ? 25  LEU A C    1  
ATOM   231    O O    . LEU A 1 25  ? -57.077  0.213   -97.716  1.00 0.00 ? 25  LEU A O    1  
ATOM   232    C CB   . LEU A 1 25  ? -59.688  0.371   -99.746  1.00 0.00 ? 25  LEU A CB   1  
ATOM   233    C CG   . LEU A 1 25  ? -60.304  0.985   -98.437  1.00 0.00 ? 25  LEU A CG   1  
ATOM   234    C CD1  . LEU A 1 25  ? -60.372  2.482   -98.606  1.00 0.00 ? 25  LEU A CD1  1  
ATOM   235    C CD2  . LEU A 1 25  ? -61.722  0.422   -98.206  1.00 0.00 ? 25  LEU A CD2  1  
ATOM   236    H H    . LEU A 1 25  ? -58.401  -0.451  -101.734 1.00 0.00 ? 25  LEU A H    1  
ATOM   237    H HA   . LEU A 1 25  ? -57.827  1.464   -99.770  1.00 0.00 ? 25  LEU A HA   1  
ATOM   238    H HB2  . LEU A 1 25  ? -60.089  0.916   -100.562 1.00 0.00 ? 25  LEU A HB2  1  
ATOM   239    H HB3  . LEU A 1 25  ? -59.978  -0.645  -99.798  1.00 0.00 ? 25  LEU A HB3  1  
ATOM   240    H HG   . LEU A 1 25  ? -59.691  0.742   -97.610  1.00 0.00 ? 25  LEU A HG   1  
ATOM   241    H HD11 . LEU A 1 25  ? -61.099  2.735   -99.363  1.00 0.00 ? 25  LEU A HD11 1  
ATOM   242    H HD12 . LEU A 1 25  ? -59.400  2.838   -98.906  1.00 0.00 ? 25  LEU A HD12 1  
ATOM   243    H HD13 . LEU A 1 25  ? -60.651  2.922   -97.669  1.00 0.00 ? 25  LEU A HD13 1  
ATOM   244    H HD21 . LEU A 1 25  ? -62.225  0.263   -99.146  1.00 0.00 ? 25  LEU A HD21 1  
ATOM   245    H HD22 . LEU A 1 25  ? -62.287  1.123   -97.607  1.00 0.00 ? 25  LEU A HD22 1  
ATOM   246    H HD23 . LEU A 1 25  ? -61.645  -0.517  -97.674  1.00 0.00 ? 25  LEU A HD23 1  
ATOM   247    N N    . GLU A 1 26  ? -57.459  -1.670  -98.877  1.00 0.00 ? 26  GLU A N    1  
ATOM   248    C CA   . GLU A 1 26  ? -56.902  -2.526  -97.848  1.00 0.00 ? 26  GLU A CA   1  
ATOM   249    C C    . GLU A 1 26  ? -55.348  -2.651  -97.862  1.00 0.00 ? 26  GLU A C    1  
ATOM   250    O O    . GLU A 1 26  ? -54.760  -2.897  -96.816  1.00 0.00 ? 26  GLU A O    1  
ATOM   251    C CB   . GLU A 1 26  ? -57.460  -3.962  -97.975  1.00 0.00 ? 26  GLU A CB   1  
ATOM   252    C CG   . GLU A 1 26  ? -58.956  -3.886  -97.902  1.00 0.00 ? 26  GLU A CG   1  
ATOM   253    C CD   . GLU A 1 26  ? -59.547  -5.238  -98.225  1.00 0.00 ? 26  GLU A CD   1  
ATOM   254    O OE1  . GLU A 1 26  ? -59.041  -5.869  -99.149  1.00 0.00 ? 26  GLU A OE1  1  
ATOM   255    O OE2  . GLU A 1 26  ? -60.499  -5.630  -97.541  1.00 0.00 ? 26  GLU A OE2  1  
ATOM   256    H H    . GLU A 1 26  ? -57.808  -2.068  -99.699  1.00 0.00 ? 26  GLU A H    1  
ATOM   257    H HA   . GLU A 1 26  ? -57.179  -2.154  -96.894  1.00 0.00 ? 26  GLU A HA   1  
ATOM   258    H HB2  . GLU A 1 26  ? -57.153  -4.377  -98.901  1.00 0.00 ? 26  GLU A HB2  1  
ATOM   259    H HB3  . GLU A 1 26  ? -57.086  -4.540  -97.155  1.00 0.00 ? 26  GLU A HB3  1  
ATOM   260    H HG2  . GLU A 1 26  ? -59.247  -3.603  -96.912  1.00 0.00 ? 26  GLU A HG2  1  
ATOM   261    H HG3  . GLU A 1 26  ? -59.308  -3.168  -98.614  1.00 0.00 ? 26  GLU A HG3  1  
ATOM   262    N N    . LEU A 1 27  ? -54.750  -2.417  -99.011  1.00 0.00 ? 27  LEU A N    1  
ATOM   263    C CA   . LEU A 1 27  ? -53.294  -2.458  -99.100  1.00 0.00 ? 27  LEU A CA   1  
ATOM   264    C C    . LEU A 1 27  ? -52.739  -1.163  -98.509  1.00 0.00 ? 27  LEU A C    1  
ATOM   265    O O    . LEU A 1 27  ? -51.731  -1.193  -97.806  1.00 0.00 ? 27  LEU A O    1  
ATOM   266    C CB   . LEU A 1 27  ? -52.860  -2.654  -100.581 1.00 0.00 ? 27  LEU A CB   1  
ATOM   267    C CG   . LEU A 1 27  ? -51.324  -2.621  -100.832 1.00 0.00 ? 27  LEU A CG   1  
ATOM   268    C CD1  . LEU A 1 27  ? -50.687  -3.949  -100.435 1.00 0.00 ? 27  LEU A CD1  1  
ATOM   269    C CD2  . LEU A 1 27  ? -51.026  -2.330  -102.327 1.00 0.00 ? 27  LEU A CD2  1  
ATOM   270    H H    . LEU A 1 27  ? -55.284  -2.173  -99.798  1.00 0.00 ? 27  LEU A H    1  
ATOM   271    H HA   . LEU A 1 27  ? -52.939  -3.284  -98.519  1.00 0.00 ? 27  LEU A HA   1  
ATOM   272    H HB2  . LEU A 1 27  ? -53.214  -3.608  -100.890 1.00 0.00 ? 27  LEU A HB2  1  
ATOM   273    H HB3  . LEU A 1 27  ? -53.314  -1.887  -101.158 1.00 0.00 ? 27  LEU A HB3  1  
ATOM   274    H HG   . LEU A 1 27  ? -50.896  -1.845  -100.249 1.00 0.00 ? 27  LEU A HG   1  
ATOM   275    H HD11 . LEU A 1 27  ? -51.033  -4.221  -99.449  1.00 0.00 ? 27  LEU A HD11 1  
ATOM   276    H HD12 . LEU A 1 27  ? -49.613  -3.833  -100.420 1.00 0.00 ? 27  LEU A HD12 1  
ATOM   277    H HD13 . LEU A 1 27  ? -50.956  -4.722  -101.138 1.00 0.00 ? 27  LEU A HD13 1  
ATOM   278    H HD21 . LEU A 1 27  ? -49.953  -2.354  -102.483 1.00 0.00 ? 27  LEU A HD21 1  
ATOM   279    H HD22 . LEU A 1 27  ? -51.397  -1.346  -102.581 1.00 0.00 ? 27  LEU A HD22 1  
ATOM   280    H HD23 . LEU A 1 27  ? -51.496  -3.066  -102.957 1.00 0.00 ? 27  LEU A HD23 1  
ATOM   281    N N    . THR A 1 28  ? -53.440  -0.036  -98.736  1.00 0.00 ? 28  THR A N    1  
ATOM   282    C CA   . THR A 1 28  ? -53.008  1.261   -98.194  1.00 0.00 ? 28  THR A CA   1  
ATOM   283    C C    . THR A 1 28  ? -52.657  1.084   -96.730  1.00 0.00 ? 28  THR A C    1  
ATOM   284    O O    . THR A 1 28  ? -51.894  1.859   -96.163  1.00 0.00 ? 28  THR A O    1  
ATOM   285    C CB   . THR A 1 28  ? -54.118  2.325   -98.300  1.00 0.00 ? 28  THR A CB   1  
ATOM   286    O OG1  . THR A 1 28  ? -55.374  1.725   -98.014  1.00 0.00 ? 28  THR A OG1  1  
ATOM   287    C CG2  . THR A 1 28  ? -54.150  2.968   -99.694  1.00 0.00 ? 28  THR A CG2  1  
ATOM   288    H H    . THR A 1 28  ? -54.275  -0.089  -99.238  1.00 0.00 ? 28  THR A H    1  
ATOM   289    H HA   . THR A 1 28  ? -52.129  1.606   -98.734  1.00 0.00 ? 28  THR A HA   1  
ATOM   290    H HB   . THR A 1 28  ? -53.928  3.097   -97.572  1.00 0.00 ? 28  THR A HB   1  
ATOM   291    H HG1  . THR A 1 28  ? -55.211  0.856   -97.634  1.00 0.00 ? 28  THR A HG1  1  
ATOM   292    H HG21 . THR A 1 28  ? -55.132  3.384   -99.875  1.00 0.00 ? 28  THR A HG21 1  
ATOM   293    H HG22 . THR A 1 28  ? -53.930  2.225   -100.443 1.00 0.00 ? 28  THR A HG22 1  
ATOM   294    H HG23 . THR A 1 28  ? -53.414  3.760   -99.745  1.00 0.00 ? 28  THR A HG23 1  
ATOM   295    N N    . ALA A 1 29  ? -53.226  0.030   -96.145  1.00 0.00 ? 29  ALA A N    1  
ATOM   296    C CA   . ALA A 1 29  ? -53.012  -0.296  -94.743  1.00 0.00 ? 29  ALA A CA   1  
ATOM   297    C C    . ALA A 1 29  ? -51.526  -0.240  -94.384  1.00 0.00 ? 29  ALA A C    1  
ATOM   298    O O    . ALA A 1 29  ? -51.173  0.128   -93.259  1.00 0.00 ? 29  ALA A O    1  
ATOM   299    C CB   . ALA A 1 29  ? -53.573  -1.697  -94.469  1.00 0.00 ? 29  ALA A CB   1  
ATOM   300    H H    . ALA A 1 29  ? -53.788  -0.557  -96.683  1.00 0.00 ? 29  ALA A H    1  
ATOM   301    H HA   . ALA A 1 29  ? -53.545  0.404   -94.128  1.00 0.00 ? 29  ALA A HA   1  
ATOM   302    H HB1  . ALA A 1 29  ? -52.948  -2.437  -94.943  1.00 0.00 ? 29  ALA A HB1  1  
ATOM   303    H HB2  . ALA A 1 29  ? -54.574  -1.764  -94.865  1.00 0.00 ? 29  ALA A HB2  1  
ATOM   304    H HB3  . ALA A 1 29  ? -53.597  -1.870  -93.404  1.00 0.00 ? 29  ALA A HB3  1  
ATOM   305    N N    . LEU A 1 30  ? -50.674  -0.640  -95.340  1.00 0.00 ? 30  LEU A N    1  
ATOM   306    C CA   . LEU A 1 30  ? -49.225  -0.684  -95.129  1.00 0.00 ? 30  LEU A CA   1  
ATOM   307    C C    . LEU A 1 30  ? -48.558  0.686   -95.244  1.00 0.00 ? 30  LEU A C    1  
ATOM   308    O O    . LEU A 1 30  ? -47.477  0.891   -94.688  1.00 0.00 ? 30  LEU A O    1  
ATOM   309    C CB   . LEU A 1 30  ? -48.557  -1.613  -96.161  1.00 0.00 ? 30  LEU A CB   1  
ATOM   310    C CG   . LEU A 1 30  ? -49.088  -3.053  -96.119  1.00 0.00 ? 30  LEU A CG   1  
ATOM   311    C CD1  . LEU A 1 30  ? -48.246  -3.917  -97.061  1.00 0.00 ? 30  LEU A CD1  1  
ATOM   312    C CD2  . LEU A 1 30  ? -49.016  -3.603  -94.705  1.00 0.00 ? 30  LEU A CD2  1  
ATOM   313    H H    . LEU A 1 30  ? -51.034  -0.929  -96.196  1.00 0.00 ? 30  LEU A H    1  
ATOM   314    H HA   . LEU A 1 30  ? -49.033  -1.066  -94.154  1.00 0.00 ? 30  LEU A HA   1  
ATOM   315    H HB2  . LEU A 1 30  ? -48.736  -1.228  -97.139  1.00 0.00 ? 30  LEU A HB2  1  
ATOM   316    H HB3  . LEU A 1 30  ? -47.503  -1.628  -95.964  1.00 0.00 ? 30  LEU A HB3  1  
ATOM   317    H HG   . LEU A 1 30  ? -50.100  -3.068  -96.463  1.00 0.00 ? 30  LEU A HG   1  
ATOM   318    H HD11 . LEU A 1 30  ? -48.446  -3.624  -98.082  1.00 0.00 ? 30  LEU A HD11 1  
ATOM   319    H HD12 . LEU A 1 30  ? -48.512  -4.953  -96.924  1.00 0.00 ? 30  LEU A HD12 1  
ATOM   320    H HD13 . LEU A 1 30  ? -47.199  -3.778  -96.844  1.00 0.00 ? 30  LEU A HD13 1  
ATOM   321    H HD21 . LEU A 1 30  ? -48.089  -3.305  -94.243  1.00 0.00 ? 30  LEU A HD21 1  
ATOM   322    H HD22 . LEU A 1 30  ? -49.081  -4.679  -94.732  1.00 0.00 ? 30  LEU A HD22 1  
ATOM   323    H HD23 . LEU A 1 30  ? -49.847  -3.207  -94.139  1.00 0.00 ? 30  LEU A HD23 1  
ATOM   324    N N    . TRP A 1 31  ? -49.241  1.613   -95.915  1.00 0.00 ? 31  TRP A N    1  
ATOM   325    C CA   . TRP A 1 31  ? -48.750  2.988   -96.103  1.00 0.00 ? 31  TRP A CA   1  
ATOM   326    C C    . TRP A 1 31  ? -48.899  3.786   -94.815  1.00 0.00 ? 31  TRP A C    1  
ATOM   327    O O    . TRP A 1 31  ? -49.703  3.444   -93.948  1.00 0.00 ? 31  TRP A O    1  
ATOM   328    C CB   . TRP A 1 31  ? -49.550  3.648   -97.248  1.00 0.00 ? 31  TRP A CB   1  
ATOM   329    C CG   . TRP A 1 31  ? -49.631  5.144   -97.146  1.00 0.00 ? 31  TRP A CG   1  
ATOM   330    C CD1  . TRP A 1 31  ? -48.593  6.023   -97.285  1.00 0.00 ? 31  TRP A CD1  1  
ATOM   331    C CD2  . TRP A 1 31  ? -50.811  5.938   -96.939  1.00 0.00 ? 31  TRP A CD2  1  
ATOM   332    N NE1  . TRP A 1 31  ? -49.074  7.304   -97.155  1.00 0.00 ? 31  TRP A NE1  1  
ATOM   333    C CE2  . TRP A 1 31  ? -50.424  7.313   -96.941  1.00 0.00 ? 31  TRP A CE2  1  
ATOM   334    C CE3  . TRP A 1 31  ? -52.169  5.630   -96.742  1.00 0.00 ? 31  TRP A CE3  1  
ATOM   335    C CZ2  . TRP A 1 31  ? -51.334  8.329   -96.757  1.00 0.00 ? 31  TRP A CZ2  1  
ATOM   336    C CZ3  . TRP A 1 31  ? -53.087  6.673   -96.556  1.00 0.00 ? 31  TRP A CZ3  1  
ATOM   337    C CH2  . TRP A 1 31  ? -52.666  8.017   -96.565  1.00 0.00 ? 31  TRP A CH2  1  
ATOM   338    H H    . TRP A 1 31  ? -50.115  1.372   -96.276  1.00 0.00 ? 31  TRP A H    1  
ATOM   339    H HA   . TRP A 1 31  ? -47.710  2.959   -96.387  1.00 0.00 ? 31  TRP A HA   1  
ATOM   340    H HB2  . TRP A 1 31  ? -49.088  3.401   -98.181  1.00 0.00 ? 31  TRP A HB2  1  
ATOM   341    H HB3  . TRP A 1 31  ? -50.550  3.253   -97.236  1.00 0.00 ? 31  TRP A HB3  1  
ATOM   342    H HD1  . TRP A 1 31  ? -47.571  5.760   -97.457  1.00 0.00 ? 31  TRP A HD1  1  
ATOM   343    H HE1  . TRP A 1 31  ? -48.535  8.136   -97.205  1.00 0.00 ? 31  TRP A HE1  1  
ATOM   344    H HE3  . TRP A 1 31  ? -52.505  4.599   -96.732  1.00 0.00 ? 31  TRP A HE3  1  
ATOM   345    H HZ2  . TRP A 1 31  ? -51.009  9.369   -96.762  1.00 0.00 ? 31  TRP A HZ2  1  
ATOM   346    H HZ3  . TRP A 1 31  ? -54.130  6.451   -96.406  1.00 0.00 ? 31  TRP A HZ3  1  
ATOM   347    H HH2  . TRP A 1 31  ? -53.381  8.803   -96.423  1.00 0.00 ? 31  TRP A HH2  1  
ATOM   348    N N    . PHE A 1 32  ? -48.122  4.866   -94.730  1.00 0.00 ? 32  PHE A N    1  
ATOM   349    C CA   . PHE A 1 32  ? -48.128  5.787   -93.583  1.00 0.00 ? 32  PHE A CA   1  
ATOM   350    C C    . PHE A 1 32  ? -47.843  5.087   -92.252  1.00 0.00 ? 32  PHE A C    1  
ATOM   351    O O    . PHE A 1 32  ? -47.444  5.751   -91.295  1.00 0.00 ? 32  PHE A O    1  
ATOM   352    C CB   . PHE A 1 32  ? -49.475  6.508   -93.513  1.00 0.00 ? 32  PHE A CB   1  
ATOM   353    C CG   . PHE A 1 32  ? -49.337  7.936   -93.024  1.00 0.00 ? 32  PHE A CG   1  
ATOM   354    C CD1  . PHE A 1 32  ? -48.770  8.905   -93.841  1.00 0.00 ? 32  PHE A CD1  1  
ATOM   355    C CD2  . PHE A 1 32  ? -49.796  8.283   -91.760  1.00 0.00 ? 32  PHE A CD2  1  
ATOM   356    C CE1  . PHE A 1 32  ? -48.656  10.219  -93.392  1.00 0.00 ? 32  PHE A CE1  1  
ATOM   357    C CE2  . PHE A 1 32  ? -49.682  9.596   -91.314  1.00 0.00 ? 32  PHE A CE2  1  
ATOM   358    C CZ   . PHE A 1 32  ? -49.110  10.564  -92.129  1.00 0.00 ? 32  PHE A CZ   1  
ATOM   359    H H    . PHE A 1 32  ? -47.533  5.072   -95.480  1.00 0.00 ? 32  PHE A H    1  
ATOM   360    H HA   . PHE A 1 32  ? -47.353  6.513   -93.750  1.00 0.00 ? 32  PHE A HA   1  
ATOM   361    H HB2  . PHE A 1 32  ? -49.911  6.524   -94.490  1.00 0.00 ? 32  PHE A HB2  1  
ATOM   362    H HB3  . PHE A 1 32  ? -50.120  5.971   -92.841  1.00 0.00 ? 32  PHE A HB3  1  
ATOM   363    H HD1  . PHE A 1 32  ? -48.417  8.645   -94.819  1.00 0.00 ? 32  PHE A HD1  1  
ATOM   364    H HD2  . PHE A 1 32  ? -50.239  7.539   -91.126  1.00 0.00 ? 32  PHE A HD2  1  
ATOM   365    H HE1  . PHE A 1 32  ? -48.211  10.966  -94.028  1.00 0.00 ? 32  PHE A HE1  1  
ATOM   366    H HE2  . PHE A 1 32  ? -50.036  9.861   -90.332  1.00 0.00 ? 32  PHE A HE2  1  
ATOM   367    H HZ   . PHE A 1 32  ? -49.021  11.578  -91.783  1.00 0.00 ? 32  PHE A HZ   1  
ATOM   368    N N    . GLN A 1 33  ? -48.034  3.765   -92.202  1.00 0.00 ? 33  GLN A N    1  
ATOM   369    C CA   . GLN A 1 33  ? -47.771  2.995   -90.977  1.00 0.00 ? 33  GLN A CA   1  
ATOM   370    C C    . GLN A 1 33  ? -46.547  3.505   -90.258  1.00 0.00 ? 33  GLN A C    1  
ATOM   371    O O    . GLN A 1 33  ? -46.480  3.438   -89.030  1.00 0.00 ? 33  GLN A O    1  
ATOM   372    C CB   . GLN A 1 33  ? -47.593  1.506   -91.287  1.00 0.00 ? 33  GLN A CB   1  
ATOM   373    C CG   . GLN A 1 33  ? -46.256  1.199   -91.955  1.00 0.00 ? 33  GLN A CG   1  
ATOM   374    C CD   . GLN A 1 33  ? -46.265  -0.236  -92.445  1.00 0.00 ? 33  GLN A CD   1  
ATOM   375    O OE1  . GLN A 1 33  ? -45.430  -0.600  -93.295  1.00 0.00 ? 33  GLN A OE1  1  
ATOM   376    N NE2  . GLN A 1 33  ? -47.178  -1.058  -91.959  1.00 0.00 ? 33  GLN A NE2  1  
ATOM   377    H H    . GLN A 1 33  ? -48.362  3.301   -92.994  1.00 0.00 ? 33  GLN A H    1  
ATOM   378    H HA   . GLN A 1 33  ? -48.613  3.095   -90.314  1.00 0.00 ? 33  GLN A HA   1  
ATOM   379    H HB2  . GLN A 1 33  ? -47.635  0.965   -90.364  1.00 0.00 ? 33  GLN A HB2  1  
ATOM   380    H HB3  . GLN A 1 33  ? -48.384  1.195   -91.930  1.00 0.00 ? 33  GLN A HB3  1  
ATOM   381    H HG2  . GLN A 1 33  ? -46.114  1.853   -92.783  1.00 0.00 ? 33  GLN A HG2  1  
ATOM   382    H HG3  . GLN A 1 33  ? -45.466  1.316   -91.239  1.00 0.00 ? 33  GLN A HG3  1  
ATOM   383    H HE21 . GLN A 1 33  ? -47.831  -0.723  -91.296  1.00 0.00 ? 33  GLN A HE21 1  
ATOM   384    H HE22 . GLN A 1 33  ? -47.220  -1.992  -92.244  1.00 0.00 ? 33  GLN A HE22 1  
ATOM   385    N N    . HIS A 1 34  ? -45.523  3.867   -91.028  1.00 0.00 ? 34  HIS A N    1  
ATOM   386    C CA   . HIS A 1 34  ? -44.254  4.282   -90.452  1.00 0.00 ? 34  HIS A CA   1  
ATOM   387    C C    . HIS A 1 34  ? -44.204  5.691   -89.817  1.00 0.00 ? 34  HIS A C    1  
ATOM   388    O O    . HIS A 1 34  ? -43.800  5.810   -88.651  1.00 0.00 ? 34  HIS A O    1  
ATOM   389    C CB   . HIS A 1 34  ? -43.149  4.123   -91.498  1.00 0.00 ? 34  HIS A CB   1  
ATOM   390    C CG   . HIS A 1 34  ? -43.555  3.179   -92.597  1.00 0.00 ? 34  HIS A CG   1  
ATOM   391    N ND1  . HIS A 1 34  ? -44.212  3.625   -93.743  1.00 0.00 ? 34  HIS A ND1  1  
ATOM   392    C CD2  . HIS A 1 34  ? -43.397  1.849   -92.752  1.00 0.00 ? 34  HIS A CD2  1  
ATOM   393    C CE1  . HIS A 1 34  ? -44.422  2.573   -94.521  1.00 0.00 ? 34  HIS A CE1  1  
ATOM   394    N NE2  . HIS A 1 34  ? -43.947  1.465   -93.964  1.00 0.00 ? 34  HIS A NE2  1  
ATOM   395    H H    . HIS A 1 34  ? -45.601  3.767   -91.998  1.00 0.00 ? 34  HIS A H    1  
ATOM   396    H HA   . HIS A 1 34  ? -44.055  3.595   -89.665  1.00 0.00 ? 34  HIS A HA   1  
ATOM   397    H HB2  . HIS A 1 34  ? -42.913  5.070   -91.926  1.00 0.00 ? 34  HIS A HB2  1  
ATOM   398    H HB3  . HIS A 1 34  ? -42.279  3.718   -91.005  1.00 0.00 ? 34  HIS A HB3  1  
ATOM   399    H HD1  . HIS A 1 34  ? -44.474  4.534   -93.929  1.00 0.00 ? 34  HIS A HD1  1  
ATOM   400    H HD2  . HIS A 1 34  ? -42.922  1.177   -92.038  1.00 0.00 ? 34  HIS A HD2  1  
ATOM   401    H HE1  . HIS A 1 34  ? -44.921  2.609   -95.493  1.00 0.00 ? 34  HIS A HE1  1  
ATOM   402    H HE2  . HIS A 1 34  ? -43.977  0.582   -94.323  1.00 0.00 ? 34  HIS A HE2  1  
ATOM   403    N N    . VAL A 1 35  ? -44.640  6.724   -90.538  1.00 0.00 ? 35  VAL A N    1  
ATOM   404    C CA   . VAL A 1 35  ? -44.648  8.076   -89.955  1.00 0.00 ? 35  VAL A CA   1  
ATOM   405    C C    . VAL A 1 35  ? -45.669  8.154   -88.828  1.00 0.00 ? 35  VAL A C    1  
ATOM   406    O O    . VAL A 1 35  ? -45.551  9.004   -87.942  1.00 0.00 ? 35  VAL A O    1  
ATOM   407    C CB   . VAL A 1 35  ? -44.894  9.213   -91.047  1.00 0.00 ? 35  VAL A CB   1  
ATOM   408    C CG1  . VAL A 1 35  ? -46.123  8.916   -91.897  1.00 0.00 ? 35  VAL A CG1  1  
ATOM   409    C CG2  . VAL A 1 35  ? -45.025  10.587  -90.363  1.00 0.00 ? 35  VAL A CG2  1  
ATOM   410    H H    . VAL A 1 35  ? -44.976  6.569   -91.441  1.00 0.00 ? 35  VAL A H    1  
ATOM   411    H HA   . VAL A 1 35  ? -43.682  8.255   -89.531  1.00 0.00 ? 35  VAL A HA   1  
ATOM   412    H HB   . VAL A 1 35  ? -44.040  9.237   -91.682  1.00 0.00 ? 35  VAL A HB   1  
ATOM   413    H HG11 . VAL A 1 35  ? -46.010  7.934   -92.340  1.00 0.00 ? 35  VAL A HG11 1  
ATOM   414    H HG12 . VAL A 1 35  ? -46.191  9.654   -92.685  1.00 0.00 ? 35  VAL A HG12 1  
ATOM   415    H HG13 . VAL A 1 35  ? -47.013  8.942   -91.296  1.00 0.00 ? 35  VAL A HG13 1  
ATOM   416    H HG21 . VAL A 1 35  ? -45.879  10.601  -89.710  1.00 0.00 ? 35  VAL A HG21 1  
ATOM   417    H HG22 . VAL A 1 35  ? -45.137  11.346  -91.125  1.00 0.00 ? 35  VAL A HG22 1  
ATOM   418    H HG23 . VAL A 1 35  ? -44.127  10.788  -89.792  1.00 0.00 ? 35  VAL A HG23 1  
ATOM   419    N N    . MET A 1 36  ? -46.671  7.269   -88.870  1.00 0.00 ? 36  MET A N    1  
ATOM   420    C CA   . MET A 1 36  ? -47.725  7.256   -87.864  1.00 0.00 ? 36  MET A CA   1  
ATOM   421    C C    . MET A 1 36  ? -47.131  7.009   -86.393  1.00 0.00 ? 36  MET A C    1  
ATOM   422    O O    . MET A 1 36  ? -47.748  7.446   -85.441  1.00 0.00 ? 36  MET A O    1  
ATOM   423    C CB   . MET A 1 36  ? -48.793  6.208   -88.197  1.00 0.00 ? 36  MET A CB   1  
ATOM   424    C CG   . MET A 1 36  ? -50.107  6.477   -87.435  1.00 0.00 ? 36  MET A CG   1  
ATOM   425    S SD   . MET A 1 36  ? -51.380  7.310   -88.447  1.00 0.00 ? 36  MET A SD   1  
ATOM   426    C CE   . MET A 1 36  ? -52.160  5.913   -89.300  1.00 0.00 ? 36  MET A CE   1  
ATOM   427    H H    . MET A 1 36  ? -46.708  6.625   -89.602  1.00 0.00 ? 36  MET A H    1  
ATOM   428    H HA   . MET A 1 36  ? -48.174  8.210   -87.839  1.00 0.00 ? 36  MET A HA   1  
ATOM   429    H HB2  . MET A 1 36  ? -48.977  6.245   -89.246  1.00 0.00 ? 36  MET A HB2  1  
ATOM   430    H HB3  . MET A 1 36  ? -48.436  5.228   -87.923  1.00 0.00 ? 36  MET A HB3  1  
ATOM   431    H HG2  . MET A 1 36  ? -50.503  5.543   -87.103  1.00 0.00 ? 36  MET A HG2  1  
ATOM   432    H HG3  . MET A 1 36  ? -49.892  7.096   -86.584  1.00 0.00 ? 36  MET A HG3  1  
ATOM   433    H HE1  . MET A 1 36  ? -52.753  5.343   -88.602  1.00 0.00 ? 36  MET A HE1  1  
ATOM   434    H HE2  . MET A 1 36  ? -51.404  5.287   -89.734  1.00 0.00 ? 36  MET A HE2  1  
ATOM   435    H HE3  . MET A 1 36  ? -52.800  6.300   -90.089  1.00 0.00 ? 36  MET A HE3  1  
ATOM   436    N N    . LEU A 1 37  ? -45.965  6.355   -86.379  1.00 0.00 ? 37  LEU A N    1  
ATOM   437    C CA   . LEU A 1 37  ? -45.175  6.023   -85.157  1.00 0.00 ? 37  LEU A CA   1  
ATOM   438    C C    . LEU A 1 37  ? -45.740  4.871   -84.096  1.00 0.00 ? 37  LEU A C    1  
ATOM   439    O O    . LEU A 1 37  ? -44.800  4.037   -83.906  1.00 0.00 ? 37  LEU A O    1  
ATOM   440    C CB   . LEU A 1 37  ? -45.402  7.257   -84.163  1.00 0.00 ? 37  LEU A CB   1  
ATOM   441    C CG   . LEU A 1 37  ? -44.334  7.510   -83.051  1.00 0.00 ? 37  LEU A CG   1  
ATOM   442    C CD1  . LEU A 1 37  ? -44.450  8.982   -82.584  1.00 0.00 ? 37  LEU A CD1  1  
ATOM   443    C CD2  . LEU A 1 37  ? -44.518  6.588   -81.839  1.00 0.00 ? 37  LEU A CD2  1  
ATOM   444    H H    . LEU A 1 37  ? -45.574  6.102   -87.222  1.00 0.00 ? 37  LEU A H    1  
ATOM   445    H HA   . LEU A 1 37  ? -44.167  5.985   -85.408  1.00 0.00 ? 37  LEU A HA   1  
ATOM   446    H HB2  . LEU A 1 37  ? -45.430  8.135   -84.742  1.00 0.00 ? 37  LEU A HB2  1  
ATOM   447    H HB3  . LEU A 1 37  ? -46.346  7.116   -83.682  1.00 0.00 ? 37  LEU A HB3  1  
ATOM   448    H HG   . LEU A 1 37  ? -43.371  7.378   -83.456  1.00 0.00 ? 37  LEU A HG   1  
ATOM   449    H HD11 . LEU A 1 37  ? -43.754  9.158   -81.778  1.00 0.00 ? 37  LEU A HD11 1  
ATOM   450    H HD12 . LEU A 1 37  ? -45.453  9.194   -82.250  1.00 0.00 ? 37  LEU A HD12 1  
ATOM   451    H HD13 . LEU A 1 37  ? -44.205  9.630   -83.416  1.00 0.00 ? 37  LEU A HD13 1  
ATOM   452    H HD21 . LEU A 1 37  ? -45.526  6.653   -81.465  1.00 0.00 ? 37  LEU A HD21 1  
ATOM   453    H HD22 . LEU A 1 37  ? -43.825  6.883   -81.061  1.00 0.00 ? 37  LEU A HD22 1  
ATOM   454    H HD23 . LEU A 1 37  ? -44.304  5.577   -82.142  1.00 0.00 ? 37  LEU A HD23 1  
ATOM   455    N N    . LEU A 1 38  ? -46.850  4.351   -84.814  1.00 0.00 ? 38  LEU A N    1  
ATOM   456    C CA   . LEU A 1 38  ? -47.486  2.988   -84.962  1.00 0.00 ? 38  LEU A CA   1  
ATOM   457    C C    . LEU A 1 38  ? -46.492  2.206   -85.976  1.00 0.00 ? 38  LEU A C    1  
ATOM   458    O O    . LEU A 1 38  ? -45.719  2.729   -86.809  1.00 0.00 ? 38  LEU A O    1  
ATOM   459    C CB   . LEU A 1 38  ? -48.868  3.153   -85.677  1.00 0.00 ? 38  LEU A CB   1  
ATOM   460    C CG   . LEU A 1 38  ? -49.148  2.168   -86.845  1.00 0.00 ? 38  LEU A CG   1  
ATOM   461    C CD1  . LEU A 1 38  ? -49.281  0.738   -86.342  1.00 0.00 ? 38  LEU A CD1  1  
ATOM   462    C CD2  . LEU A 1 38  ? -50.437  2.584   -87.558  1.00 0.00 ? 38  LEU A CD2  1  
ATOM   463    H H    . LEU A 1 38  ? -46.268  4.024   -85.376  1.00 0.00 ? 38  LEU A H    1  
ATOM   464    H HA   . LEU A 1 38  ? -47.533  2.439   -84.205  1.00 0.00 ? 38  LEU A HA   1  
ATOM   465    H HB2  . LEU A 1 38  ? -49.566  2.949   -84.900  1.00 0.00 ? 38  LEU A HB2  1  
ATOM   466    H HB3  . LEU A 1 38  ? -49.018  4.150   -86.040  1.00 0.00 ? 38  LEU A HB3  1  
ATOM   467    H HG   . LEU A 1 38  ? -48.351  2.212   -87.546  1.00 0.00 ? 38  LEU A HG   1  
ATOM   468    H HD11 . LEU A 1 38  ? -48.604  0.113   -86.907  1.00 0.00 ? 38  LEU A HD11 1  
ATOM   469    H HD12 . LEU A 1 38  ? -50.293  0.388   -86.483  1.00 0.00 ? 38  LEU A HD12 1  
ATOM   470    H HD13 . LEU A 1 38  ? -49.026  0.695   -85.298  1.00 0.00 ? 38  LEU A HD13 1  
ATOM   471    H HD21 . LEU A 1 38  ? -50.744  1.789   -88.221  1.00 0.00 ? 38  LEU A HD21 1  
ATOM   472    H HD22 . LEU A 1 38  ? -50.246  3.477   -88.127  1.00 0.00 ? 38  LEU A HD22 1  
ATOM   473    H HD23 . LEU A 1 38  ? -51.212  2.769   -86.832  1.00 0.00 ? 38  LEU A HD23 1  
ATOM   474    N N    . LYS A 1 39  ? -46.643  0.903   -85.851  1.00 0.00 ? 39  LYS A N    1  
ATOM   475    C CA   . LYS A 1 39  ? -45.891  -0.079  -86.617  1.00 0.00 ? 39  LYS A CA   1  
ATOM   476    C C    . LYS A 1 39  ? -46.490  -1.471  -86.385  1.00 0.00 ? 39  LYS A C    1  
ATOM   477    O O    . LYS A 1 39  ? -46.773  -2.174  -87.359  1.00 0.00 ? 39  LYS A O    1  
ATOM   478    C CB   . LYS A 1 39  ? -44.383  -0.041  -86.255  1.00 0.00 ? 39  LYS A CB   1  
ATOM   479    C CG   . LYS A 1 39  ? -43.809  -1.427  -85.868  1.00 0.00 ? 39  LYS A CG   1  
ATOM   480    C CD   . LYS A 1 39  ? -42.290  -1.318  -85.650  1.00 0.00 ? 39  LYS A CD   1  
ATOM   481    C CE   . LYS A 1 39  ? -41.748  -2.579  -84.949  1.00 0.00 ? 39  LYS A CE   1  
ATOM   482    N NZ   . LYS A 1 39  ? -41.493  -3.699  -85.919  1.00 0.00 ? 39  LYS A NZ   1  
ATOM   483    H H    . LYS A 1 39  ? -47.312  0.584   -85.210  1.00 0.00 ? 39  LYS A H    1  
ATOM   484    H HA   . LYS A 1 39  ? -46.003  0.179   -87.660  1.00 0.00 ? 39  LYS A HA   1  
ATOM   485    H HB2  . LYS A 1 39  ? -43.841  0.322   -87.103  1.00 0.00 ? 39  LYS A HB2  1  
ATOM   486    H HB3  . LYS A 1 39  ? -44.248  0.632   -85.432  1.00 0.00 ? 39  LYS A HB3  1  
ATOM   487    H HG2  . LYS A 1 39  ? -44.274  -1.762  -84.961  1.00 0.00 ? 39  LYS A HG2  1  
ATOM   488    H HG3  . LYS A 1 39  ? -43.999  -2.129  -86.659  1.00 0.00 ? 39  LYS A HG3  1  
ATOM   489    H HD2  . LYS A 1 39  ? -41.801  -1.197  -86.598  1.00 0.00 ? 39  LYS A HD2  1  
ATOM   490    H HD3  . LYS A 1 39  ? -42.084  -0.458  -85.026  1.00 0.00 ? 39  LYS A HD3  1  
ATOM   491    H HE2  . LYS A 1 39  ? -40.821  -2.327  -84.462  1.00 0.00 ? 39  LYS A HE2  1  
ATOM   492    H HE3  . LYS A 1 39  ? -42.458  -2.904  -84.211  1.00 0.00 ? 39  LYS A HE3  1  
ATOM   493    H HZ1  . LYS A 1 39  ? -40.751  -4.326  -85.533  1.00 0.00 ? 39  LYS A HZ1  1  
ATOM   494    H HZ2  . LYS A 1 39  ? -41.177  -3.317  -86.832  1.00 0.00 ? 39  LYS A HZ2  1  
ATOM   495    H HZ3  . LYS A 1 39  ? -42.364  -4.251  -86.053  1.00 0.00 ? 39  LYS A HZ3  1  
ATOM   496    N N    . PRO A 1 40  ? -46.709  -1.828  -85.113  1.00 0.00 ? 40  PRO A N    1  
ATOM   497    C CA   . PRO A 1 40  ? -47.234  -3.166  -84.656  1.00 0.00 ? 40  PRO A CA   1  
ATOM   498    C C    . PRO A 1 40  ? -48.684  -3.505  -85.065  1.00 0.00 ? 40  PRO A C    1  
ATOM   499    O O    . PRO A 1 40  ? -49.661  -2.922  -84.574  1.00 0.00 ? 40  PRO A O    1  
ATOM   500    C CB   . PRO A 1 40  ? -47.096  -3.092  -83.116  1.00 0.00 ? 40  PRO A CB   1  
ATOM   501    C CG   . PRO A 1 40  ? -46.291  -1.862  -82.813  1.00 0.00 ? 40  PRO A CG   1  
ATOM   502    C CD   . PRO A 1 40  ? -46.551  -0.929  -83.961  1.00 0.00 ? 40  PRO A CD   1  
ATOM   503    H HA   . PRO A 1 40  ? -46.587  -3.935  -85.010  1.00 0.00 ? 40  PRO A HA   1  
ATOM   504    H HB2  . PRO A 1 40  ? -48.076  -3.021  -82.656  1.00 0.00 ? 40  PRO A HB2  1  
ATOM   505    H HB3  . PRO A 1 40  ? -46.581  -3.967  -82.754  1.00 0.00 ? 40  PRO A HB3  1  
ATOM   506    H HG2  . PRO A 1 40  ? -46.612  -1.408  -81.883  1.00 0.00 ? 40  PRO A HG2  1  
ATOM   507    H HG3  . PRO A 1 40  ? -45.235  -2.091  -82.774  1.00 0.00 ? 40  PRO A HG3  1  
ATOM   508    H HD2  . PRO A 1 40  ? -47.478  -0.378  -83.799  1.00 0.00 ? 40  PRO A HD2  1  
ATOM   509    H HD3  . PRO A 1 40  ? -45.733  -0.263  -84.096  1.00 0.00 ? 40  PRO A HD3  1  
ATOM   510    N N    . SER A 1 41  ? -48.800  -4.525  -85.916  1.00 0.00 ? 41  SER A N    1  
ATOM   511    C CA   . SER A 1 41  ? -50.100  -5.004  -86.342  1.00 0.00 ? 41  SER A CA   1  
ATOM   512    C C    . SER A 1 41  ? -50.778  -5.694  -85.163  1.00 0.00 ? 41  SER A C    1  
ATOM   513    O O    . SER A 1 41  ? -51.978  -5.554  -84.964  1.00 0.00 ? 41  SER A O    1  
ATOM   514    C CB   . SER A 1 41  ? -49.961  -5.977  -87.513  1.00 0.00 ? 41  SER A CB   1  
ATOM   515    O OG   . SER A 1 41  ? -49.105  -5.425  -88.505  1.00 0.00 ? 41  SER A OG   1  
ATOM   516    H H    . SER A 1 41  ? -47.992  -4.970  -86.237  1.00 0.00 ? 41  SER A H    1  
ATOM   517    H HA   . SER A 1 41  ? -50.709  -4.176  -86.641  1.00 0.00 ? 41  SER A HA   1  
ATOM   518    H HB2  . SER A 1 41  ? -49.548  -6.902  -87.169  1.00 0.00 ? 41  SER A HB2  1  
ATOM   519    H HB3  . SER A 1 41  ? -50.935  -6.155  -87.937  1.00 0.00 ? 41  SER A HB3  1  
ATOM   520    H HG   . SER A 1 41  ? -49.596  -4.755  -88.984  1.00 0.00 ? 41  SER A HG   1  
ATOM   521    N N    . VAL A 1 42  ? -50.018  -6.535  -84.466  1.00 0.00 ? 42  VAL A N    1  
ATOM   522    C CA   . VAL A 1 42  ? -50.539  -7.327  -83.357  1.00 0.00 ? 42  VAL A CA   1  
ATOM   523    C C    . VAL A 1 42  ? -51.695  -8.205  -83.924  1.00 0.00 ? 42  VAL A C    1  
ATOM   524    O O    . VAL A 1 42  ? -51.610  -8.688  -85.072  1.00 0.00 ? 42  VAL A O    1  
ATOM   525    C CB   . VAL A 1 42  ? -50.945  -6.516  -82.048  1.00 0.00 ? 42  VAL A CB   1  
ATOM   526    C CG1  . VAL A 1 42  ? -49.708  -5.838  -81.390  1.00 0.00 ? 42  VAL A CG1  1  
ATOM   527    C CG2  . VAL A 1 42  ? -52.029  -5.457  -82.326  1.00 0.00 ? 42  VAL A CG2  1  
ATOM   528    H H    . VAL A 1 42  ? -49.094  -6.676  -84.754  1.00 0.00 ? 42  VAL A H    1  
ATOM   529    H HA   . VAL A 1 42  ? -49.745  -8.014  -83.079  1.00 0.00 ? 42  VAL A HA   1  
ATOM   530    H HB   . VAL A 1 42  ? -51.338  -7.224  -81.329  1.00 0.00 ? 42  VAL A HB   1  
ATOM   531    H HG11 . VAL A 1 42  ? -49.226  -5.180  -82.097  1.00 0.00 ? 42  VAL A HG11 1  
ATOM   532    H HG12 . VAL A 1 42  ? -49.003  -6.596  -81.070  1.00 0.00 ? 42  VAL A HG12 1  
ATOM   533    H HG13 . VAL A 1 42  ? -50.020  -5.263  -80.523  1.00 0.00 ? 42  VAL A HG13 1  
ATOM   534    H HG21 . VAL A 1 42  ? -51.621  -4.660  -82.922  1.00 0.00 ? 42  VAL A HG21 1  
ATOM   535    H HG22 . VAL A 1 42  ? -52.388  -5.050  -81.384  1.00 0.00 ? 42  VAL A HG22 1  
ATOM   536    H HG23 . VAL A 1 42  ? -52.856  -5.919  -82.845  1.00 0.00 ? 42  VAL A HG23 1  
ATOM   537    N N    . LEU A 1 43  ? -52.760  -8.382  -83.135  1.00 0.00 ? 43  LEU A N    1  
ATOM   538    C CA   . LEU A 1 43  ? -53.932  -9.201  -83.538  1.00 0.00 ? 43  LEU A CA   1  
ATOM   539    C C    . LEU A 1 43  ? -54.285  -8.926  -84.982  1.00 0.00 ? 43  LEU A C    1  
ATOM   540    O O    . LEU A 1 43  ? -54.733  -9.818  -85.693  1.00 0.00 ? 43  LEU A O    1  
ATOM   541    C CB   . LEU A 1 43  ? -55.124  -8.858  -82.587  1.00 0.00 ? 43  LEU A CB   1  
ATOM   542    C CG   . LEU A 1 43  ? -56.553  -9.071  -83.155  1.00 0.00 ? 43  LEU A CG   1  
ATOM   543    C CD1  . LEU A 1 43  ? -56.819  -10.527 -83.430  1.00 0.00 ? 43  LEU A CD1  1  
ATOM   544    C CD2  . LEU A 1 43  ? -57.581  -8.575  -82.127  1.00 0.00 ? 43  LEU A CD2  1  
ATOM   545    H H    . LEU A 1 43  ? -52.765  -7.945  -82.264  1.00 0.00 ? 43  LEU A H    1  
ATOM   546    H HA   . LEU A 1 43  ? -53.680  -10.243 -83.412  1.00 0.00 ? 43  LEU A HA   1  
ATOM   547    H HB2  . LEU A 1 43  ? -55.034  -9.460  -81.719  1.00 0.00 ? 43  LEU A HB2  1  
ATOM   548    H HB3  . LEU A 1 43  ? -55.029  -7.831  -82.323  1.00 0.00 ? 43  LEU A HB3  1  
ATOM   549    H HG   . LEU A 1 43  ? -56.676  -8.510  -84.048  1.00 0.00 ? 43  LEU A HG   1  
ATOM   550    H HD11 . LEU A 1 43  ? -57.770  -10.622 -83.930  1.00 0.00 ? 43  LEU A HD11 1  
ATOM   551    H HD12 . LEU A 1 43  ? -56.839  -11.080 -82.503  1.00 0.00 ? 43  LEU A HD12 1  
ATOM   552    H HD13 . LEU A 1 43  ? -56.036  -10.903 -84.064  1.00 0.00 ? 43  LEU A HD13 1  
ATOM   553    H HD21 . LEU A 1 43  ? -57.473  -7.509  -82.005  1.00 0.00 ? 43  LEU A HD21 1  
ATOM   554    H HD22 . LEU A 1 43  ? -57.423  -9.068  -81.182  1.00 0.00 ? 43  LEU A HD22 1  
ATOM   555    H HD23 . LEU A 1 43  ? -58.575  -8.797  -82.490  1.00 0.00 ? 43  LEU A HD23 1  
ATOM   556    N N    . CYS A 1 44  ? -54.088  -7.680  -85.395  1.00 0.00 ? 44  CYS A N    1  
ATOM   557    C CA   . CYS A 1 44  ? -54.424  -7.240  -86.741  1.00 0.00 ? 44  CYS A CA   1  
ATOM   558    C C    . CYS A 1 44  ? -53.957  -8.248  -87.887  1.00 0.00 ? 44  CYS A C    1  
ATOM   559    O O    . CYS A 1 44  ? -54.727  -8.443  -88.807  1.00 0.00 ? 44  CYS A O    1  
ATOM   560    C CB   . CYS A 1 44  ? -53.760  -5.794  -86.957  1.00 0.00 ? 44  CYS A CB   1  
ATOM   561    S SG   . CYS A 1 44  ? -54.274  -4.927  -88.460  1.00 0.00 ? 44  CYS A SG   1  
ATOM   562    H H    . CYS A 1 44  ? -53.725  -7.026  -84.767  1.00 0.00 ? 44  CYS A H    1  
ATOM   563    H HA   . CYS A 1 44  ? -55.464  -7.131  -86.820  1.00 0.00 ? 44  CYS A HA   1  
ATOM   564    H HB2  . CYS A 1 44  ? -54.067  -5.221  -86.123  1.00 0.00 ? 44  CYS A HB2  1  
ATOM   565    H HB3  . CYS A 1 44  ? -52.718  -5.927  -86.958  1.00 0.00 ? 44  CYS A HB3  1  
ATOM   566    H HG   . CYS A 1 44  ? -54.394  -5.555  -89.164  1.00 0.00 ? 44  CYS A HG   1  
ATOM   567    N N    . ILE A 1 45  ? -52.790  -8.867  -87.748  1.00 0.00 ? 45  ILE A N    1  
ATOM   568    C CA   . ILE A 1 45  ? -52.370  -9.818  -88.778  1.00 0.00 ? 45  ILE A CA   1  
ATOM   569    C C    . ILE A 1 45  ? -53.494  -10.885 -88.991  1.00 0.00 ? 45  ILE A C    1  
ATOM   570    O O    . ILE A 1 45  ? -53.893  -11.118 -90.123  1.00 0.00 ? 45  ILE A O    1  
ATOM   571    C CB   . ILE A 1 45  ? -51.017  -10.520 -88.519  1.00 0.00 ? 45  ILE A CB   1  
ATOM   572    C CG1  . ILE A 1 45  ? -51.164  -11.807 -87.557  1.00 0.00 ? 45  ILE A CG1  1  
ATOM   573    C CG2  . ILE A 1 45  ? -49.985  -9.566  -87.965  1.00 0.00 ? 45  ILE A CG2  1  
ATOM   574    C CD1  . ILE A 1 45  ? -51.718  -11.452 -86.188  1.00 0.00 ? 45  ILE A CD1  1  
ATOM   575    H H    . ILE A 1 45  ? -52.231  -8.704  -86.966  1.00 0.00 ? 45  ILE A H    1  
ATOM   576    H HA   . ILE A 1 45  ? -52.278  -9.296  -89.699  1.00 0.00 ? 45  ILE A HA   1  
ATOM   577    H HB   . ILE A 1 45  ? -50.647  -10.903 -89.453  1.00 0.00 ? 45  ILE A HB   1  
ATOM   578    H HG12 . ILE A 1 45  ? -51.817  -12.487 -88.049  1.00 0.00 ? 45  ILE A HG12 1  
ATOM   579    H HG13 . ILE A 1 45  ? -50.188  -12.236 -87.462  1.00 0.00 ? 45  ILE A HG13 1  
ATOM   580    H HG21 . ILE A 1 45  ? -49.044  -10.080 -87.828  1.00 0.00 ? 45  ILE A HG21 1  
ATOM   581    H HG22 . ILE A 1 45  ? -50.322  -9.164  -87.027  1.00 0.00 ? 45  ILE A HG22 1  
ATOM   582    H HG23 . ILE A 1 45  ? -49.856  -8.768  -88.681  1.00 0.00 ? 45  ILE A HG23 1  
ATOM   583    H HD11 . ILE A 1 45  ? -52.339  -12.274 -85.855  1.00 0.00 ? 45  ILE A HD11 1  
ATOM   584    H HD12 . ILE A 1 45  ? -52.304  -10.554 -86.234  1.00 0.00 ? 45  ILE A HD12 1  
ATOM   585    H HD13 . ILE A 1 45  ? -50.901  -11.320 -85.496  1.00 0.00 ? 45  ILE A HD13 1  
ATOM   586    N N    . TYR A 1 46  ? -54.003  -11.416 -87.894  1.00 0.00 ? 46  TYR A N    1  
ATOM   587    C CA   . TYR A 1 46  ? -55.080  -12.399 -87.959  1.00 0.00 ? 46  TYR A CA   1  
ATOM   588    C C    . TYR A 1 46  ? -56.237  -11.797 -88.767  1.00 0.00 ? 46  TYR A C    1  
ATOM   589    O O    . TYR A 1 46  ? -56.890  -12.492 -89.530  1.00 0.00 ? 46  TYR A O    1  
ATOM   590    C CB   . TYR A 1 46  ? -55.539  -12.721 -86.518  1.00 0.00 ? 46  TYR A CB   1  
ATOM   591    C CG   . TYR A 1 46  ? -55.749  -14.213 -86.245  1.00 0.00 ? 46  TYR A CG   1  
ATOM   592    C CD1  . TYR A 1 46  ? -56.839  -14.906 -86.786  1.00 0.00 ? 46  TYR A CD1  1  
ATOM   593    C CD2  . TYR A 1 46  ? -54.838  -14.891 -85.426  1.00 0.00 ? 46  TYR A CD2  1  
ATOM   594    C CE1  . TYR A 1 46  ? -57.009  -16.279 -86.506  1.00 0.00 ? 46  TYR A CE1  1  
ATOM   595    C CE2  . TYR A 1 46  ? -55.009  -16.247 -85.148  1.00 0.00 ? 46  TYR A CE2  1  
ATOM   596    C CZ   . TYR A 1 46  ? -56.078  -16.946 -85.683  1.00 0.00 ? 46  TYR A CZ   1  
ATOM   597    O OH   . TYR A 1 46  ? -56.206  -18.285 -85.381  1.00 0.00 ? 46  TYR A OH   1  
ATOM   598    H H    . TYR A 1 46  ? -53.675  -11.124 -87.021  1.00 0.00 ? 46  TYR A H    1  
ATOM   599    H HA   . TYR A 1 46  ? -54.735  -13.293 -88.441  1.00 0.00 ? 46  TYR A HA   1  
ATOM   600    H HB2  . TYR A 1 46  ? -54.788  -12.364 -85.843  1.00 0.00 ? 46  TYR A HB2  1  
ATOM   601    H HB3  . TYR A 1 46  ? -56.456  -12.201 -86.331  1.00 0.00 ? 46  TYR A HB3  1  
ATOM   602    H HD1  . TYR A 1 46  ? -57.549  -14.393 -87.407  1.00 0.00 ? 46  TYR A HD1  1  
ATOM   603    H HD2  . TYR A 1 46  ? -54.003  -14.367 -85.007  1.00 0.00 ? 46  TYR A HD2  1  
ATOM   604    H HE1  . TYR A 1 46  ? -57.845  -16.819 -86.935  1.00 0.00 ? 46  TYR A HE1  1  
ATOM   605    H HE2  . TYR A 1 46  ? -54.297  -16.762 -84.515  1.00 0.00 ? 46  TYR A HE2  1  
ATOM   606    H HH   . TYR A 1 46  ? -55.484  -18.513 -84.778  1.00 0.00 ? 46  TYR A HH   1  
ATOM   607    N N    . GLU A 1 47  ? -56.466  -10.497 -88.583  1.00 0.00 ? 47  GLU A N    1  
ATOM   608    C CA   . GLU A 1 47  ? -57.539  -9.773  -89.276  1.00 0.00 ? 47  GLU A CA   1  
ATOM   609    C C    . GLU A 1 47  ? -57.178  -9.349  -90.687  1.00 0.00 ? 47  GLU A C    1  
ATOM   610    O O    . GLU A 1 47  ? -58.076  -9.148  -91.505  1.00 0.00 ? 47  GLU A O    1  
ATOM   611    C CB   . GLU A 1 47  ? -57.926  -8.540  -88.472  1.00 0.00 ? 47  GLU A CB   1  
ATOM   612    C CG   . GLU A 1 47  ? -57.565  -7.244  -89.192  1.00 0.00 ? 47  GLU A CG   1  
ATOM   613    C CD   . GLU A 1 47  ? -57.804  -6.055  -88.276  1.00 0.00 ? 47  GLU A CD   1  
ATOM   614    O OE1  . GLU A 1 47  ? -58.973  -5.735  -88.022  1.00 0.00 ? 47  GLU A OE1  1  
ATOM   615    O OE2  . GLU A 1 47  ? -56.807  -5.472  -87.851  1.00 0.00 ? 47  GLU A OE2  1  
ATOM   616    H H    . GLU A 1 47  ? -55.897  -10.000 -87.964  1.00 0.00 ? 47  GLU A H    1  
ATOM   617    H HA   . GLU A 1 47  ? -58.403  -10.425 -89.321  1.00 0.00 ? 47  GLU A HA   1  
ATOM   618    H HB2  . GLU A 1 47  ? -58.983  -8.547  -88.318  1.00 0.00 ? 47  GLU A HB2  1  
ATOM   619    H HB3  . GLU A 1 47  ? -57.417  -8.565  -87.534  1.00 0.00 ? 47  GLU A HB3  1  
ATOM   620    H HG2  . GLU A 1 47  ? -56.531  -7.267  -89.470  1.00 0.00 ? 47  GLU A HG2  1  
ATOM   621    H HG3  . GLU A 1 47  ? -58.181  -7.143  -90.066  1.00 0.00 ? 47  GLU A HG3  1  
ATOM   622    N N    . ARG A 1 48  ? -55.885  -9.193  -90.965  1.00 0.00 ? 48  ARG A N    1  
ATOM   623    C CA   . ARG A 1 48  ? -55.485  -8.800  -92.301  1.00 0.00 ? 48  ARG A CA   1  
ATOM   624    C C    . ARG A 1 48  ? -56.019  -9.865  -93.226  1.00 0.00 ? 48  ARG A C    1  
ATOM   625    O O    . ARG A 1 48  ? -56.529  -9.564  -94.286  1.00 0.00 ? 48  ARG A O    1  
ATOM   626    C CB   . ARG A 1 48  ? -53.923  -8.791  -92.429  1.00 0.00 ? 48  ARG A CB   1  
ATOM   627    C CG   . ARG A 1 48  ? -53.351  -7.305  -92.425  1.00 0.00 ? 48  ARG A CG   1  
ATOM   628    C CD   . ARG A 1 48  ? -53.436  -6.687  -90.995  1.00 0.00 ? 48  ARG A CD   1  
ATOM   629    N NE   . ARG A 1 48  ? -52.229  -5.877  -90.736  1.00 0.00 ? 48  ARG A NE   1  
ATOM   630    C CZ   . ARG A 1 48  ? -52.222  -4.524  -90.697  1.00 0.00 ? 48  ARG A CZ   1  
ATOM   631    N NH1  . ARG A 1 48  ? -53.314  -3.815  -90.891  1.00 0.00 ? 48  ARG A NH1  1  
ATOM   632    N NH2  . ARG A 1 48  ? -51.090  -3.900  -90.447  1.00 0.00 ? 48  ARG A NH2  1  
ATOM   633    H H    . ARG A 1 48  ? -55.216  -9.376  -90.280  1.00 0.00 ? 48  ARG A H    1  
ATOM   634    H HA   . ARG A 1 48  ? -55.885  -7.841  -92.571  1.00 0.00 ? 48  ARG A HA   1  
ATOM   635    H HB2  . ARG A 1 48  ? -53.497  -9.304  -91.616  1.00 0.00 ? 48  ARG A HB2  1  
ATOM   636    H HB3  . ARG A 1 48  ? -53.637  -9.219  -93.359  1.00 0.00 ? 48  ARG A HB3  1  
ATOM   637    H HG2  . ARG A 1 48  ? -52.341  -7.375  -92.727  1.00 0.00 ? 48  ARG A HG2  1  
ATOM   638    H HG3  . ARG A 1 48  ? -53.930  -6.734  -93.100  1.00 0.00 ? 48  ARG A HG3  1  
ATOM   639    H HD2  . ARG A 1 48  ? -54.301  -6.064  -90.956  1.00 0.00 ? 48  ARG A HD2  1  
ATOM   640    H HD3  . ARG A 1 48  ? -53.501  -7.462  -90.271  1.00 0.00 ? 48  ARG A HD3  1  
ATOM   641    H HE   . ARG A 1 48  ? -51.393  -6.340  -90.570  1.00 0.00 ? 48  ARG A HE   1  
ATOM   642    H HH11 . ARG A 1 48  ? -54.187  -4.261  -91.077  1.00 0.00 ? 48  ARG A HH11 1  
ATOM   643    H HH12 . ARG A 1 48  ? -53.268  -2.810  -90.856  1.00 0.00 ? 48  ARG A HH12 1  
ATOM   644    H HH21 . ARG A 1 48  ? -50.247  -4.418  -90.291  1.00 0.00 ? 48  ARG A HH21 1  
ATOM   645    H HH22 . ARG A 1 48  ? -51.070  -2.899  -90.417  1.00 0.00 ? 48  ARG A HH22 1  
ATOM   646    N N    . VAL A 1 49  ? -55.957  -11.114 -92.749  1.00 0.00 ? 49  VAL A N    1  
ATOM   647    C CA   . VAL A 1 49  ? -56.456  -12.280 -93.497  1.00 0.00 ? 49  VAL A CA   1  
ATOM   648    C C    . VAL A 1 49  ? -57.864  -12.045 -94.091  1.00 0.00 ? 49  VAL A C    1  
ATOM   649    O O    . VAL A 1 49  ? -58.091  -12.355 -95.262  1.00 0.00 ? 49  VAL A O    1  
ATOM   650    C CB   . VAL A 1 49  ? -56.412  -13.519 -92.570  1.00 0.00 ? 49  VAL A CB   1  
ATOM   651    C CG1  . VAL A 1 49  ? -57.031  -14.757 -93.260  1.00 0.00 ? 49  VAL A CG1  1  
ATOM   652    C CG2  . VAL A 1 49  ? -54.957  -13.815 -92.157  1.00 0.00 ? 49  VAL A CG2  1  
ATOM   653    H H    . VAL A 1 49  ? -55.584  -11.256 -91.856  1.00 0.00 ? 49  VAL A H    1  
ATOM   654    H HA   . VAL A 1 49  ? -55.789  -12.445 -94.313  1.00 0.00 ? 49  VAL A HA   1  
ATOM   655    H HB   . VAL A 1 49  ? -56.982  -13.324 -91.691  1.00 0.00 ? 49  VAL A HB   1  
ATOM   656    H HG11 . VAL A 1 49  ? -58.103  -14.621 -93.330  1.00 0.00 ? 49  VAL A HG11 1  
ATOM   657    H HG12 . VAL A 1 49  ? -56.826  -15.642 -92.669  1.00 0.00 ? 49  VAL A HG12 1  
ATOM   658    H HG13 . VAL A 1 49  ? -56.618  -14.880 -94.246  1.00 0.00 ? 49  VAL A HG13 1  
ATOM   659    H HG21 . VAL A 1 49  ? -54.480  -12.888 -91.866  1.00 0.00 ? 49  VAL A HG21 1  
ATOM   660    H HG22 . VAL A 1 49  ? -54.415  -14.255 -92.978  1.00 0.00 ? 49  VAL A HG22 1  
ATOM   661    H HG23 . VAL A 1 49  ? -54.952  -14.496 -91.316  1.00 0.00 ? 49  VAL A HG23 1  
ATOM   662    N N    . ALA A 1 50  ? -58.783  -11.478 -93.318  1.00 0.00 ? 50  ALA A N    1  
ATOM   663    C CA   . ALA A 1 50  ? -60.133  -11.195 -93.824  1.00 0.00 ? 50  ALA A CA   1  
ATOM   664    C C    . ALA A 1 50  ? -60.115  -10.423 -95.160  1.00 0.00 ? 50  ALA A C    1  
ATOM   665    O O    . ALA A 1 50  ? -61.002  -10.628 -95.985  1.00 0.00 ? 50  ALA A O    1  
ATOM   666    C CB   . ALA A 1 50  ? -60.934  -10.425 -92.781  1.00 0.00 ? 50  ALA A CB   1  
ATOM   667    H H    . ALA A 1 50  ? -58.558  -11.244 -92.397  1.00 0.00 ? 50  ALA A H    1  
ATOM   668    H HA   . ALA A 1 50  ? -60.626  -12.127 -93.997  1.00 0.00 ? 50  ALA A HA   1  
ATOM   669    H HB1  . ALA A 1 50  ? -60.566  -9.417  -92.704  1.00 0.00 ? 50  ALA A HB1  1  
ATOM   670    H HB2  . ALA A 1 50  ? -60.837  -10.920 -91.825  1.00 0.00 ? 50  ALA A HB2  1  
ATOM   671    H HB3  . ALA A 1 50  ? -61.974  -10.412 -93.073  1.00 0.00 ? 50  ALA A HB3  1  
ATOM   672    N N    . LEU A 1 51  ? -59.099  -9.583  -95.393  1.00 0.00 ? 51  LEU A N    1  
ATOM   673    C CA   . LEU A 1 51  ? -58.994  -8.846  -96.677  1.00 0.00 ? 51  LEU A CA   1  
ATOM   674    C C    . LEU A 1 51  ? -58.787  -9.746  -97.901  1.00 0.00 ? 51  LEU A C    1  
ATOM   675    O O    . LEU A 1 51  ? -59.492  -9.584  -98.899  1.00 0.00 ? 51  LEU A O    1  
ATOM   676    C CB   . LEU A 1 51  ? -57.894  -7.747  -96.598  1.00 0.00 ? 51  LEU A CB   1  
ATOM   677    C CG   . LEU A 1 51  ? -56.515  -8.084  -97.231  1.00 0.00 ? 51  LEU A CG   1  
ATOM   678    C CD1  . LEU A 1 51  ? -56.525  -7.701  -98.699  1.00 0.00 ? 51  LEU A CD1  1  
ATOM   679    C CD2  . LEU A 1 51  ? -55.390  -7.288  -96.528  1.00 0.00 ? 51  LEU A CD2  1  
ATOM   680    H H    . LEU A 1 51  ? -58.415  -9.461  -94.708  1.00 0.00 ? 51  LEU A H    1  
ATOM   681    H HA   . LEU A 1 51  ? -59.929  -8.327  -96.817  1.00 0.00 ? 51  LEU A HA   1  
ATOM   682    H HB2  . LEU A 1 51  ? -58.269  -6.902  -97.116  1.00 0.00 ? 51  LEU A HB2  1  
ATOM   683    H HB3  . LEU A 1 51  ? -57.754  -7.509  -95.578  1.00 0.00 ? 51  LEU A HB3  1  
ATOM   684    H HG   . LEU A 1 51  ? -56.312  -9.116  -97.133  1.00 0.00 ? 51  LEU A HG   1  
ATOM   685    H HD11 . LEU A 1 51  ? -57.479  -7.974  -99.121  1.00 0.00 ? 51  LEU A HD11 1  
ATOM   686    H HD12 . LEU A 1 51  ? -55.738  -8.232  -99.202  1.00 0.00 ? 51  LEU A HD12 1  
ATOM   687    H HD13 . LEU A 1 51  ? -56.378  -6.636  -98.808  1.00 0.00 ? 51  LEU A HD13 1  
ATOM   688    H HD21 . LEU A 1 51  ? -55.651  -6.245  -96.468  1.00 0.00 ? 51  LEU A HD21 1  
ATOM   689    H HD22 . LEU A 1 51  ? -54.476  -7.399  -97.097  1.00 0.00 ? 51  LEU A HD22 1  
ATOM   690    H HD23 . LEU A 1 51  ? -55.244  -7.685  -95.536  1.00 0.00 ? 51  LEU A HD23 1  
ATOM   691    N N    . PHE A 1 52  ? -57.876  -10.715 -97.819  1.00 0.00 ? 52  PHE A N    1  
ATOM   692    C CA   . PHE A 1 52  ? -57.622  -11.627 -98.937  1.00 0.00 ? 52  PHE A CA   1  
ATOM   693    C C    . PHE A 1 52  ? -58.748  -12.657 -98.992  1.00 0.00 ? 52  PHE A C    1  
ATOM   694    O O    . PHE A 1 52  ? -59.027  -13.220 -100.035 1.00 0.00 ? 52  PHE A O    1  
ATOM   695    C CB   . PHE A 1 52  ? -56.274  -12.359 -98.825  1.00 0.00 ? 52  PHE A CB   1  
ATOM   696    C CG   . PHE A 1 52  ? -55.087  -11.405 -98.811  1.00 0.00 ? 52  PHE A CG   1  
ATOM   697    C CD1  . PHE A 1 52  ? -54.506  -10.981 -100.009 1.00 0.00 ? 52  PHE A CD1  1  
ATOM   698    C CD2  . PHE A 1 52  ? -54.556  -10.964 -97.595  1.00 0.00 ? 52  PHE A CD2  1  
ATOM   699    C CE1  . PHE A 1 52  ? -53.397  -10.114 -99.993  1.00 0.00 ? 52  PHE A CE1  1  
ATOM   700    C CE2  . PHE A 1 52  ? -53.449  -10.096 -97.580  1.00 0.00 ? 52  PHE A CE2  1  
ATOM   701    C CZ   . PHE A 1 52  ? -52.871  -9.670  -98.779  1.00 0.00 ? 52  PHE A CZ   1  
ATOM   702    H H    . PHE A 1 52  ? -57.380  -10.836 -96.984  1.00 0.00 ? 52  PHE A H    1  
ATOM   703    H HA   . PHE A 1 52  ? -57.637  -11.065 -99.855  1.00 0.00 ? 52  PHE A HA   1  
ATOM   704    H HB2  . PHE A 1 52  ? -56.264  -12.933 -97.924  1.00 0.00 ? 52  PHE A HB2  1  
ATOM   705    H HB3  . PHE A 1 52  ? -56.174  -13.021 -99.673  1.00 0.00 ? 52  PHE A HB3  1  
ATOM   706    H HD1  . PHE A 1 52  ? -54.907  -11.321 -100.946 1.00 0.00 ? 52  PHE A HD1  1  
ATOM   707    H HD2  . PHE A 1 52  ? -54.998  -11.284 -96.668  1.00 0.00 ? 52  PHE A HD2  1  
ATOM   708    H HE1  . PHE A 1 52  ? -52.958  -9.780  -100.925 1.00 0.00 ? 52  PHE A HE1  1  
ATOM   709    H HE2  . PHE A 1 52  ? -53.046  -9.755  -96.637  1.00 0.00 ? 52  PHE A HE2  1  
ATOM   710    H HZ   . PHE A 1 52  ? -52.016  -9.009  -98.767  1.00 0.00 ? 52  PHE A HZ   1  
ATOM   711    N N    . GLY A 1 53  ? -59.432  -12.843 -97.865  1.00 0.00 ? 53  GLY A N    1  
ATOM   712    C CA   . GLY A 1 53  ? -60.561  -13.750 -97.824  1.00 0.00 ? 53  GLY A CA   1  
ATOM   713    C C    . GLY A 1 53  ? -61.619  -13.192 -98.762  1.00 0.00 ? 53  GLY A C    1  
ATOM   714    O O    . GLY A 1 53  ? -61.993  -13.840 -99.729  1.00 0.00 ? 53  GLY A O    1  
ATOM   715    H H    . GLY A 1 53  ? -59.210  -12.319 -97.079  1.00 0.00 ? 53  GLY A H    1  
ATOM   716    H HA2  . GLY A 1 53  ? -60.277  -14.743 -98.138  1.00 0.00 ? 53  GLY A HA2  1  
ATOM   717    H HA3  . GLY A 1 53  ? -60.960  -13.784 -96.821  1.00 0.00 ? 53  GLY A HA3  1  
ATOM   718    N N    . VAL A 1 54  ? -62.064  -11.958 -98.478  1.00 0.00 ? 54  VAL A N    1  
ATOM   719    C CA   . VAL A 1 54  ? -63.071  -11.286 -99.315  1.00 0.00 ? 54  VAL A CA   1  
ATOM   720    C C    . VAL A 1 54  ? -62.515  -10.838 -100.666 1.00 0.00 ? 54  VAL A C    1  
ATOM   721    O O    . VAL A 1 54  ? -63.144  -11.078 -101.696 1.00 0.00 ? 54  VAL A O    1  
ATOM   722    C CB   . VAL A 1 54  ? -63.650  -10.058 -98.595  1.00 0.00 ? 54  VAL A CB   1  
ATOM   723    C CG1  . VAL A 1 54  ? -62.580  -8.999  -98.437  1.00 0.00 ? 54  VAL A CG1  1  
ATOM   724    C CG2  . VAL A 1 54  ? -64.804  -9.491  -99.402  1.00 0.00 ? 54  VAL A CG2  1  
ATOM   725    H H    . VAL A 1 54  ? -61.706  -11.495 -97.700  1.00 0.00 ? 54  VAL A H    1  
ATOM   726    H HA   . VAL A 1 54  ? -63.873  -11.975 -99.490  1.00 0.00 ? 54  VAL A HA   1  
ATOM   727    H HB   . VAL A 1 54  ? -64.007  -10.346 -97.627  1.00 0.00 ? 54  VAL A HB   1  
ATOM   728    H HG11 . VAL A 1 54  ? -61.664  -9.473  -98.134  1.00 0.00 ? 54  VAL A HG11 1  
ATOM   729    H HG12 . VAL A 1 54  ? -62.894  -8.292  -97.686  1.00 0.00 ? 54  VAL A HG12 1  
ATOM   730    H HG13 . VAL A 1 54  ? -62.434  -8.489  -99.378  1.00 0.00 ? 54  VAL A HG13 1  
ATOM   731    H HG21 . VAL A 1 54  ? -65.522  -9.056  -98.726  1.00 0.00 ? 54  VAL A HG21 1  
ATOM   732    H HG22 . VAL A 1 54  ? -65.270  -10.284 -99.963  1.00 0.00 ? 54  VAL A HG22 1  
ATOM   733    H HG23 . VAL A 1 54  ? -64.437  -8.736  -100.077 1.00 0.00 ? 54  VAL A HG23 1  
ATOM   734    N N    . LEU A 1 55  ? -61.308  -10.261 -100.668 1.00 0.00 ? 55  LEU A N    1  
ATOM   735    C CA   . LEU A 1 55  ? -60.664  -9.847  -101.927 1.00 0.00 ? 55  LEU A CA   1  
ATOM   736    C C    . LEU A 1 55  ? -60.406  -11.103 -102.733 1.00 0.00 ? 55  LEU A C    1  
ATOM   737    O O    . LEU A 1 55  ? -60.599  -11.101 -103.941 1.00 0.00 ? 55  LEU A O    1  
ATOM   738    C CB   . LEU A 1 55  ? -59.340  -9.132  -101.606 1.00 0.00 ? 55  LEU A CB   1  
ATOM   739    C CG   . LEU A 1 55  ? -58.504  -8.620  -102.796 1.00 0.00 ? 55  LEU A CG   1  
ATOM   740    C CD1  . LEU A 1 55  ? -57.686  -9.766  -103.368 1.00 0.00 ? 55  LEU A CD1  1  
ATOM   741    C CD2  . LEU A 1 55  ? -59.364  -7.998  -103.872 1.00 0.00 ? 55  LEU A CD2  1  
ATOM   742    H H    . LEU A 1 55  ? -60.833  -10.145 -99.823  1.00 0.00 ? 55  LEU A H    1  
ATOM   743    H HA   . LEU A 1 55  ? -61.319  -9.192  -102.464 1.00 0.00 ? 55  LEU A HA   1  
ATOM   744    H HB2  . LEU A 1 55  ? -59.558  -8.298  -101.000 1.00 0.00 ? 55  LEU A HB2  1  
ATOM   745    H HB3  . LEU A 1 55  ? -58.738  -9.819  -101.064 1.00 0.00 ? 55  LEU A HB3  1  
ATOM   746    H HG   . LEU A 1 55  ? -57.818  -7.864  -102.410 1.00 0.00 ? 55  LEU A HG   1  
ATOM   747    H HD11 . LEU A 1 55  ? -57.232  -10.322 -102.557 1.00 0.00 ? 55  LEU A HD11 1  
ATOM   748    H HD12 . LEU A 1 55  ? -56.914  -9.375  -104.007 1.00 0.00 ? 55  LEU A HD12 1  
ATOM   749    H HD13 . LEU A 1 55  ? -58.330  -10.416 -103.928 1.00 0.00 ? 55  LEU A HD13 1  
ATOM   750    H HD21 . LEU A 1 55  ? -58.725  -7.517  -104.601 1.00 0.00 ? 55  LEU A HD21 1  
ATOM   751    H HD22 . LEU A 1 55  ? -60.017  -7.266  -103.426 1.00 0.00 ? 55  LEU A HD22 1  
ATOM   752    H HD23 . LEU A 1 55  ? -59.941  -8.768  -104.349 1.00 0.00 ? 55  LEU A HD23 1  
ATOM   753    N N    . GLY A 1 56  ? -59.963  -12.172 -102.051 1.00 0.00 ? 56  GLY A N    1  
ATOM   754    C CA   . GLY A 1 56  ? -59.680  -13.455 -102.709 1.00 0.00 ? 56  GLY A CA   1  
ATOM   755    C C    . GLY A 1 56  ? -60.868  -13.871 -103.562 1.00 0.00 ? 56  GLY A C    1  
ATOM   756    O O    . GLY A 1 56  ? -60.715  -14.146 -104.745 1.00 0.00 ? 56  GLY A O    1  
ATOM   757    H H    . GLY A 1 56  ? -59.826  -12.097 -101.089 1.00 0.00 ? 56  GLY A H    1  
ATOM   758    H HA2  . GLY A 1 56  ? -58.809  -13.352 -103.333 1.00 0.00 ? 56  GLY A HA2  1  
ATOM   759    H HA3  . GLY A 1 56  ? -59.501  -14.206 -101.957 1.00 0.00 ? 56  GLY A HA3  1  
ATOM   760    N N    . ALA A 1 57  ? -62.043  -13.881 -102.935 1.00 0.00 ? 57  ALA A N    1  
ATOM   761    C CA   . ALA A 1 57  ? -63.312  -14.220 -103.604 1.00 0.00 ? 57  ALA A CA   1  
ATOM   762    C C    . ALA A 1 57  ? -63.610  -13.320 -104.814 1.00 0.00 ? 57  ALA A C    1  
ATOM   763    O O    . ALA A 1 57  ? -63.920  -13.833 -105.898 1.00 0.00 ? 57  ALA A O    1  
ATOM   764    C CB   . ALA A 1 57  ? -64.442  -14.110 -102.594 1.00 0.00 ? 57  ALA A CB   1  
ATOM   765    H H    . ALA A 1 57  ? -62.063  -13.653 -101.988 1.00 0.00 ? 57  ALA A H    1  
ATOM   766    H HA   . ALA A 1 57  ? -63.259  -15.226 -103.941 1.00 0.00 ? 57  ALA A HA   1  
ATOM   767    H HB1  . ALA A 1 57  ? -64.472  -13.115 -102.181 1.00 0.00 ? 57  ALA A HB1  1  
ATOM   768    H HB2  . ALA A 1 57  ? -64.272  -14.824 -101.804 1.00 0.00 ? 57  ALA A HB2  1  
ATOM   769    H HB3  . ALA A 1 57  ? -65.375  -14.329 -103.085 1.00 0.00 ? 57  ALA A HB3  1  
ATOM   770    N N    . ALA A 1 58  ? -63.545  -12.001 -104.603 1.00 0.00 ? 58  ALA A N    1  
ATOM   771    C CA   . ALA A 1 58  ? -63.795  -11.017 -105.667 1.00 0.00 ? 58  ALA A CA   1  
ATOM   772    C C    . ALA A 1 58  ? -62.773  -11.138 -106.798 1.00 0.00 ? 58  ALA A C    1  
ATOM   773    O O    . ALA A 1 58  ? -63.151  -11.208 -107.967 1.00 0.00 ? 58  ALA A O    1  
ATOM   774    C CB   . ALA A 1 58  ? -63.768  -9.601  -105.085 1.00 0.00 ? 58  ALA A CB   1  
ATOM   775    H H    . ALA A 1 58  ? -63.347  -11.683 -103.704 1.00 0.00 ? 58  ALA A H    1  
ATOM   776    H HA   . ALA A 1 58  ? -64.765  -11.196 -106.073 1.00 0.00 ? 58  ALA A HA   1  
ATOM   777    H HB1  . ALA A 1 58  ? -62.797  -9.392  -104.665 1.00 0.00 ? 58  ALA A HB1  1  
ATOM   778    H HB2  . ALA A 1 58  ? -64.520  -9.524  -104.312 1.00 0.00 ? 58  ALA A HB2  1  
ATOM   779    H HB3  . ALA A 1 58  ? -63.985  -8.890  -105.868 1.00 0.00 ? 58  ALA A HB3  1  
ATOM   780    N N    . LEU A 1 59  ? -61.497  -11.212 -106.425 1.00 0.00 ? 59  LEU A N    1  
ATOM   781    C CA   . LEU A 1 59  ? -60.385  -11.366 -107.392 1.00 0.00 ? 59  LEU A CA   1  
ATOM   782    C C    . LEU A 1 59  ? -60.423  -12.755 -108.063 1.00 0.00 ? 59  LEU A C    1  
ATOM   783    O O    . LEU A 1 59  ? -60.139  -12.849 -109.252 1.00 0.00 ? 59  LEU A O    1  
ATOM   784    C CB   . LEU A 1 59  ? -59.068  -11.121 -106.634 1.00 0.00 ? 59  LEU A CB   1  
ATOM   785    C CG   . LEU A 1 59  ? -57.820  -10.726 -107.458 1.00 0.00 ? 59  LEU A CG   1  
ATOM   786    C CD1  . LEU A 1 59  ? -57.452  -11.834 -108.417 1.00 0.00 ? 59  LEU A CD1  1  
ATOM   787    C CD2  . LEU A 1 59  ? -58.017  -9.405  -108.203 1.00 0.00 ? 59  LEU A CD2  1  
ATOM   788    H H    . LEU A 1 59  ? -61.288  -11.179 -105.473 1.00 0.00 ? 59  LEU A H    1  
ATOM   789    H HA   . LEU A 1 59  ? -60.510  -10.628 -108.143 1.00 0.00 ? 59  LEU A HA   1  
ATOM   790    H HB2  . LEU A 1 59  ? -59.237  -10.337 -105.952 1.00 0.00 ? 59  LEU A HB2  1  
ATOM   791    H HB3  . LEU A 1 59  ? -58.833  -12.017 -106.104 1.00 0.00 ? 59  LEU A HB3  1  
ATOM   792    H HG   . LEU A 1 59  ? -57.001  -10.604 -106.750 1.00 0.00 ? 59  LEU A HG   1  
ATOM   793    H HD11 . LEU A 1 59  ? -58.002  -11.709 -109.331 1.00 0.00 ? 59  LEU A HD11 1  
ATOM   794    H HD12 . LEU A 1 59  ? -57.694  -12.787 -107.971 1.00 0.00 ? 59  LEU A HD12 1  
ATOM   795    H HD13 . LEU A 1 59  ? -56.392  -11.792 -108.619 1.00 0.00 ? 59  LEU A HD13 1  
ATOM   796    H HD21 . LEU A 1 59  ? -57.051  -9.003  -108.482 1.00 0.00 ? 59  LEU A HD21 1  
ATOM   797    H HD22 . LEU A 1 59  ? -58.525  -8.702  -107.563 1.00 0.00 ? 59  LEU A HD22 1  
ATOM   798    H HD23 . LEU A 1 59  ? -58.602  -9.581  -109.090 1.00 0.00 ? 59  LEU A HD23 1  
ATOM   799    N N    . ILE A 1 60  ? -60.770  -13.818 -107.327 1.00 0.00 ? 60  ILE A N    1  
ATOM   800    C CA   . ILE A 1 60  ? -60.878  -15.153 -107.946 1.00 0.00 ? 60  ILE A CA   1  
ATOM   801    C C    . ILE A 1 60  ? -62.164  -15.288 -108.779 1.00 0.00 ? 60  ILE A C    1  
ATOM   802    O O    . ILE A 1 60  ? -62.120  -15.734 -109.933 1.00 0.00 ? 60  ILE A O    1  
ATOM   803    C CB   . ILE A 1 60  ? -60.847  -16.294 -106.854 1.00 0.00 ? 60  ILE A CB   1  
ATOM   804    C CG1  . ILE A 1 60  ? -59.378  -16.381 -106.318 1.00 0.00 ? 60  ILE A CG1  1  
ATOM   805    C CG2  . ILE A 1 60  ? -61.238  -17.627 -107.468 1.00 0.00 ? 60  ILE A CG2  1  
ATOM   806    C CD1  . ILE A 1 60  ? -59.285  -17.308 -105.071 1.00 0.00 ? 60  ILE A CD1  1  
ATOM   807    H H    . ILE A 1 60  ? -60.973  -13.703 -106.381 1.00 0.00 ? 60  ILE A H    1  
ATOM   808    H HA   . ILE A 1 60  ? -60.047  -15.295 -108.599 1.00 0.00 ? 60  ILE A HA   1  
ATOM   809    H HB   . ILE A 1 60  ? -61.506  -16.041 -106.061 1.00 0.00 ? 60  ILE A HB   1  
ATOM   810    H HG12 . ILE A 1 60  ? -58.759  -16.784 -107.082 1.00 0.00 ? 60  ILE A HG12 1  
ATOM   811    H HG13 . ILE A 1 60  ? -59.061  -15.404 -106.045 1.00 0.00 ? 60  ILE A HG13 1  
ATOM   812    H HG21 . ILE A 1 60  ? -60.790  -17.732 -108.445 1.00 0.00 ? 60  ILE A HG21 1  
ATOM   813    H HG22 . ILE A 1 60  ? -62.312  -17.666 -107.555 1.00 0.00 ? 60  ILE A HG22 1  
ATOM   814    H HG23 . ILE A 1 60  ? -60.897  -18.425 -106.826 1.00 0.00 ? 60  ILE A HG23 1  
ATOM   815    H HD11 . ILE A 1 60  ? -58.262  -17.643 -104.991 1.00 0.00 ? 60  ILE A HD11 1  
ATOM   816    H HD12 . ILE A 1 60  ? -59.940  -18.148 -105.193 1.00 0.00 ? 60  ILE A HD12 1  
ATOM   817    H HD13 . ILE A 1 60  ? -59.554  -16.744 -104.198 1.00 0.00 ? 60  ILE A HD13 1  
ATOM   818    N N    . GLY A 1 61  ? -63.280  -14.813 -108.215 1.00 0.00 ? 61  GLY A N    1  
ATOM   819    C CA   . GLY A 1 61  ? -64.566  -14.822 -108.909 1.00 0.00 ? 61  GLY A CA   1  
ATOM   820    C C    . GLY A 1 61  ? -64.562  -13.764 -110.003 1.00 0.00 ? 61  GLY A C    1  
ATOM   821    O O    . GLY A 1 61  ? -65.313  -13.854 -110.974 1.00 0.00 ? 61  GLY A O    1  
ATOM   822    H H    . GLY A 1 61  ? -63.225  -14.411 -107.328 1.00 0.00 ? 61  GLY A H    1  
ATOM   823    H HA2  . GLY A 1 61  ? -64.761  -15.790 -109.338 1.00 0.00 ? 61  GLY A HA2  1  
ATOM   824    H HA3  . GLY A 1 61  ? -65.353  -14.576 -108.205 1.00 0.00 ? 61  GLY A HA3  1  
ATOM   825    N N    . ALA A 1 62  ? -63.637  -12.806 -109.861 1.00 0.00 ? 62  ALA A N    1  
ATOM   826    C CA   . ALA A 1 62  ? -63.485  -11.717 -110.825 1.00 0.00 ? 62  ALA A CA   1  
ATOM   827    C C    . ALA A 1 62  ? -63.397  -12.258 -112.258 1.00 0.00 ? 62  ALA A C    1  
ATOM   828    O O    . ALA A 1 62  ? -63.753  -11.544 -113.187 1.00 0.00 ? 62  ALA A O    1  
ATOM   829    C CB   . ALA A 1 62  ? -62.256  -10.860 -110.470 1.00 0.00 ? 62  ALA A CB   1  
ATOM   830    H H    . ALA A 1 62  ? -63.032  -12.853 -109.100 1.00 0.00 ? 62  ALA A H    1  
ATOM   831    H HA   . ALA A 1 62  ? -64.351  -11.085 -110.773 1.00 0.00 ? 62  ALA A HA   1  
ATOM   832    H HB1  . ALA A 1 62  ? -62.566  -10.025 -109.851 1.00 0.00 ? 62  ALA A HB1  1  
ATOM   833    H HB2  . ALA A 1 62  ? -61.804  -10.482 -111.371 1.00 0.00 ? 62  ALA A HB2  1  
ATOM   834    H HB3  . ALA A 1 62  ? -61.545  -11.452 -109.936 1.00 0.00 ? 62  ALA A HB3  1  
ATOM   835    N N    . ILE A 1 63  ? -62.900  -13.500 -112.437 1.00 0.00 ? 63  ILE A N    1  
ATOM   836    C CA   . ILE A 1 63  ? -62.772  -14.082 -113.788 1.00 0.00 ? 63  ILE A CA   1  
ATOM   837    C C    . ILE A 1 63  ? -63.866  -13.554 -114.716 1.00 0.00 ? 63  ILE A C    1  
ATOM   838    O O    . ILE A 1 63  ? -63.648  -13.421 -115.928 1.00 0.00 ? 63  ILE A O    1  
ATOM   839    C CB   . ILE A 1 63  ? -62.727  -15.682 -113.781 1.00 0.00 ? 63  ILE A CB   1  
ATOM   840    C CG1  . ILE A 1 63  ? -63.870  -16.235 -112.815 1.00 0.00 ? 63  ILE A CG1  1  
ATOM   841    C CG2  . ILE A 1 63  ? -61.395  -16.204 -113.270 1.00 0.00 ? 63  ILE A CG2  1  
ATOM   842    C CD1  . ILE A 1 63  ? -63.767  -17.744 -112.647 1.00 0.00 ? 63  ILE A CD1  1  
ATOM   843    H H    . ILE A 1 63  ? -62.594  -14.002 -111.661 1.00 0.00 ? 63  ILE A H    1  
ATOM   844    H HA   . ILE A 1 63  ? -61.842  -13.761 -114.184 1.00 0.00 ? 63  ILE A HA   1  
ATOM   845    H HB   . ILE A 1 63  ? -62.914  -16.040 -114.765 1.00 0.00 ? 63  ILE A HB   1  
ATOM   846    H HG12 . ILE A 1 63  ? -63.743  -15.766 -111.874 1.00 0.00 ? 63  ILE A HG12 1  
ATOM   847    H HG13 . ILE A 1 63  ? -64.799  -15.981 -113.255 1.00 0.00 ? 63  ILE A HG13 1  
ATOM   848    H HG21 . ILE A 1 63  ? -60.599  -15.628 -113.704 1.00 0.00 ? 63  ILE A HG21 1  
ATOM   849    H HG22 . ILE A 1 63  ? -61.293  -17.242 -113.561 1.00 0.00 ? 63  ILE A HG22 1  
ATOM   850    H HG23 . ILE A 1 63  ? -61.353  -16.132 -112.191 1.00 0.00 ? 63  ILE A HG23 1  
ATOM   851    H HD11 . ILE A 1 63  ? -63.317  -17.960 -111.689 1.00 0.00 ? 63  ILE A HD11 1  
ATOM   852    H HD12 . ILE A 1 63  ? -63.178  -18.184 -113.433 1.00 0.00 ? 63  ILE A HD12 1  
ATOM   853    H HD13 . ILE A 1 63  ? -64.768  -18.149 -112.670 1.00 0.00 ? 63  ILE A HD13 1  
ATOM   854    N N    . ALA A 1 64  ? -65.048  -13.329 -114.129 1.00 0.00 ? 64  ALA A N    1  
ATOM   855    C CA   . ALA A 1 64  ? -66.225  -12.824 -114.828 1.00 0.00 ? 64  ALA A CA   1  
ATOM   856    C C    . ALA A 1 64  ? -67.488  -13.369 -114.126 1.00 0.00 ? 64  ALA A C    1  
ATOM   857    O O    . ALA A 1 64  ? -67.731  -14.580 -114.128 1.00 0.00 ? 64  ALA A O    1  
ATOM   858    C CB   . ALA A 1 64  ? -66.182  -13.226 -116.315 1.00 0.00 ? 64  ALA A CB   1  
ATOM   859    H H    . ALA A 1 64  ? -65.135  -13.550 -113.184 1.00 0.00 ? 64  ALA A H    1  
ATOM   860    H HA   . ALA A 1 64  ? -66.243  -11.755 -114.777 1.00 0.00 ? 64  ALA A HA   1  
ATOM   861    H HB1  . ALA A 1 64  ? -67.181  -13.258 -116.716 1.00 0.00 ? 64  ALA A HB1  1  
ATOM   862    H HB2  . ALA A 1 64  ? -65.718  -14.193 -116.419 1.00 0.00 ? 64  ALA A HB2  1  
ATOM   863    H HB3  . ALA A 1 64  ? -65.598  -12.493 -116.864 1.00 0.00 ? 64  ALA A HB3  1  
ATOM   864    N N    . PRO A 1 65  ? -68.269  -12.463 -113.540 1.00 0.00 ? 65  PRO A N    1  
ATOM   865    C CA   . PRO A 1 65  ? -69.521  -12.775 -112.822 1.00 0.00 ? 65  PRO A CA   1  
ATOM   866    C C    . PRO A 1 65  ? -70.948  -13.038 -113.516 1.00 0.00 ? 65  PRO A C    1  
ATOM   867    O O    . PRO A 1 65  ? -71.562  -12.004 -113.795 1.00 0.00 ? 65  PRO A O    1  
ATOM   868    C CB   . PRO A 1 65  ? -69.651  -11.623 -111.825 1.00 0.00 ? 65  PRO A CB   1  
ATOM   869    C CG   . PRO A 1 65  ? -69.112  -10.461 -112.573 1.00 0.00 ? 65  PRO A CG   1  
ATOM   870    C CD   . PRO A 1 65  ? -67.999  -11.017 -113.462 1.00 0.00 ? 65  PRO A CD   1  
ATOM   871    H HA   . PRO A 1 65  ? -69.381  -13.679 -112.238 1.00 0.00 ? 65  PRO A HA   1  
ATOM   872    H HB2  . PRO A 1 65  ? -70.692  -11.465 -111.554 1.00 0.00 ? 65  PRO A HB2  1  
ATOM   873    H HB3  . PRO A 1 65  ? -69.058  -11.808 -110.938 1.00 0.00 ? 65  PRO A HB3  1  
ATOM   874    H HG2  . PRO A 1 65  ? -69.891  -10.026 -113.177 1.00 0.00 ? 65  PRO A HG2  1  
ATOM   875    H HG3  . PRO A 1 65  ? -68.709  -9.731  -111.893 1.00 0.00 ? 65  PRO A HG3  1  
ATOM   876    H HD2  . PRO A 1 65  ? -68.043  -10.586 -114.459 1.00 0.00 ? 65  PRO A HD2  1  
ATOM   877    H HD3  . PRO A 1 65  ? -67.029  -10.839 -113.014 1.00 0.00 ? 65  PRO A HD3  1  
ATOM   878    N N    . LYS A 1 66  ? -70.843  -13.833 -114.685 1.00 0.00 ? 66  LYS A N    1  
ATOM   879    C CA   . LYS A 1 66  ? -71.466  -14.196 -115.780 1.00 0.00 ? 66  LYS A CA   1  
ATOM   880    C C    . LYS A 1 66  ? -71.170  -15.630 -116.209 1.00 0.00 ? 66  LYS A C    1  
ATOM   881    O O    . LYS A 1 66  ? -71.302  -16.527 -115.392 1.00 0.00 ? 66  LYS A O    1  
ATOM   882    C CB   . LYS A 1 66  ? -70.508  -13.248 -116.723 1.00 0.00 ? 66  LYS A CB   1  
ATOM   883    C CG   . LYS A 1 66  ? -71.156  -12.920 -118.080 1.00 0.00 ? 66  LYS A CG   1  
ATOM   884    C CD   . LYS A 1 66  ? -70.143  -12.332 -119.104 1.00 0.00 ? 66  LYS A CD   1  
ATOM   885    C CE   . LYS A 1 66  ? -69.825  -10.832 -118.840 1.00 0.00 ? 66  LYS A CE   1  
ATOM   886    N NZ   . LYS A 1 66  ? -70.922  -9.873  -119.246 1.00 0.00 ? 66  LYS A NZ   1  
ATOM   887    H H    . LYS A 1 66  ? -70.094  -13.659 -114.896 1.00 0.00 ? 66  LYS A H    1  
ATOM   888    H HA   . LYS A 1 66  ? -72.404  -13.906 -115.883 1.00 0.00 ? 66  LYS A HA   1  
ATOM   889    H HB2  . LYS A 1 66  ? -70.319  -12.319 -116.205 1.00 0.00 ? 66  LYS A HB2  1  
ATOM   890    H HB3  . LYS A 1 66  ? -69.554  -13.733 -116.897 1.00 0.00 ? 66  LYS A HB3  1  
ATOM   891    H HG2  . LYS A 1 66  ? -71.567  -13.823 -118.492 1.00 0.00 ? 66  LYS A HG2  1  
ATOM   892    H HG3  . LYS A 1 66  ? -71.941  -12.208 -117.924 1.00 0.00 ? 66  LYS A HG3  1  
ATOM   893    H HD2  . LYS A 1 66  ? -69.215  -12.888 -119.041 1.00 0.00 ? 66  LYS A HD2  1  
ATOM   894    H HD3  . LYS A 1 66  ? -70.546  -12.445 -120.097 1.00 0.00 ? 66  LYS A HD3  1  
ATOM   895    H HE2  . LYS A 1 66  ? -69.638  -10.705 -117.798 1.00 0.00 ? 66  LYS A HE2  1  
ATOM   896    H HE3  . LYS A 1 66  ? -68.931  -10.583 -119.391 1.00 0.00 ? 66  LYS A HE3  1  
ATOM   897    H HZ1  . LYS A 1 66  ? -71.495  -9.627  -118.411 1.00 0.00 ? 66  LYS A HZ1  1  
ATOM   898    H HZ2  . LYS A 1 66  ? -71.525  -10.293 -119.973 1.00 0.00 ? 66  LYS A HZ2  1  
ATOM   899    H HZ3  . LYS A 1 66  ? -70.487  -8.995  -119.620 1.00 0.00 ? 66  LYS A HZ3  1  
ATOM   900    N N    . THR A 1 67  ? -70.686  -15.806 -117.466 1.00 0.00 ? 67  THR A N    1  
ATOM   901    C CA   . THR A 1 67  ? -70.399  -17.141 -118.042 1.00 0.00 ? 67  THR A CA   1  
ATOM   902    C C    . THR A 1 67  ? -69.892  -18.074 -116.934 1.00 0.00 ? 67  THR A C    1  
ATOM   903    O O    . THR A 1 67  ? -70.395  -19.212 -116.797 1.00 0.00 ? 67  THR A O    1  
ATOM   904    C CB   . THR A 1 67  ? -69.376  -17.022 -119.240 1.00 0.00 ? 67  THR A CB   1  
ATOM   905    O OG1  . THR A 1 67  ? -69.062  -15.649 -119.482 1.00 0.00 ? 67  THR A OG1  1  
ATOM   906    C CG2  . THR A 1 67  ? -69.958  -17.629 -120.543 1.00 0.00 ? 67  THR A CG2  1  
ATOM   907    H H    . THR A 1 67  ? -70.529  -15.025 -118.001 1.00 0.00 ? 67  THR A H    1  
ATOM   908    H HA   . THR A 1 67  ? -71.312  -17.556 -118.429 1.00 0.00 ? 67  THR A HA   1  
ATOM   909    H HB   . THR A 1 67  ? -68.473  -17.555 -118.993 1.00 0.00 ? 67  THR A HB   1  
ATOM   910    H HG1  . THR A 1 67  ? -68.478  -15.602 -120.246 1.00 0.00 ? 67  THR A HG1  1  
ATOM   911    H HG21 . THR A 1 67  ? -70.102  -18.693 -120.415 1.00 0.00 ? 67  THR A HG21 1  
ATOM   912    H HG22 . THR A 1 67  ? -69.270  -17.458 -121.360 1.00 0.00 ? 67  THR A HG22 1  
ATOM   913    H HG23 . THR A 1 67  ? -70.905  -17.163 -120.770 1.00 0.00 ? 67  THR A HG23 1  
ATOM   914    N N    . PRO A 1 68  ? -68.917  -17.659 -116.143 1.00 0.00 ? 68  PRO A N    1  
ATOM   915    C CA   . PRO A 1 68  ? -68.442  -18.515 -115.061 1.00 0.00 ? 68  PRO A CA   1  
ATOM   916    C C    . PRO A 1 68  ? -69.500  -18.665 -113.833 1.00 0.00 ? 68  PRO A C    1  
ATOM   917    O O    . PRO A 1 68  ? -69.824  -17.683 -113.190 1.00 0.00 ? 68  PRO A O    1  
ATOM   918    C CB   . PRO A 1 68  ? -67.147  -17.791 -114.516 1.00 0.00 ? 68  PRO A CB   1  
ATOM   919    C CG   . PRO A 1 68  ? -66.800  -16.816 -115.686 1.00 0.00 ? 68  PRO A CG   1  
ATOM   920    C CD   . PRO A 1 68  ? -68.147  -16.390 -116.235 1.00 0.00 ? 68  PRO A CD   1  
ATOM   921    H HA   . PRO A 1 68  ? -68.177  -19.473 -115.421 1.00 0.00 ? 68  PRO A HA   1  
ATOM   922    H HB2  . PRO A 1 68  ? -67.367  -17.238 -113.636 1.00 0.00 ? 68  PRO A HB2  1  
ATOM   923    H HB3  . PRO A 1 68  ? -66.369  -18.494 -114.397 1.00 0.00 ? 68  PRO A HB3  1  
ATOM   924    H HG2  . PRO A 1 68  ? -66.248  -16.009 -115.281 1.00 0.00 ? 68  PRO A HG2  1  
ATOM   925    H HG3  . PRO A 1 68  ? -66.251  -17.359 -116.428 1.00 0.00 ? 68  PRO A HG3  1  
ATOM   926    H HD2  . PRO A 1 68  ? -68.579  -15.599 -115.650 1.00 0.00 ? 68  PRO A HD2  1  
ATOM   927    H HD3  . PRO A 1 68  ? -68.032  -16.100 -117.261 1.00 0.00 ? 68  PRO A HD3  1  
ATOM   928    N N    . LEU A 1 69  ? -69.932  -19.901 -113.675 1.00 0.00 ? 69  LEU A N    1  
ATOM   929    C CA   . LEU A 1 69  ? -70.915  -20.287 -112.646 1.00 0.00 ? 69  LEU A CA   1  
ATOM   930    C C    . LEU A 1 69  ? -70.284  -20.305 -111.251 1.00 0.00 ? 69  LEU A C    1  
ATOM   931    O O    . LEU A 1 69  ? -70.995  -20.466 -110.262 1.00 0.00 ? 69  LEU A O    1  
ATOM   932    C CB   . LEU A 1 69  ? -71.419  -21.693 -113.038 1.00 0.00 ? 69  LEU A CB   1  
ATOM   933    C CG   . LEU A 1 69  ? -72.835  -22.162 -112.617 1.00 0.00 ? 69  LEU A CG   1  
ATOM   934    C CD1  . LEU A 1 69  ? -73.113  -22.011 -111.132 1.00 0.00 ? 69  LEU A CD1  1  
ATOM   935    C CD2  . LEU A 1 69  ? -73.870  -21.421 -113.432 1.00 0.00 ? 69  LEU A CD2  1  
ATOM   936    H H    . LEU A 1 69  ? -69.604  -20.602 -114.283 1.00 0.00 ? 69  LEU A H    1  
ATOM   937    H HA   . LEU A 1 69  ? -71.701  -19.582 -112.663 1.00 0.00 ? 69  LEU A HA   1  
ATOM   938    H HB2  . LEU A 1 69  ? -71.424  -21.723 -114.097 1.00 0.00 ? 69  LEU A HB2  1  
ATOM   939    H HB3  . LEU A 1 69  ? -70.720  -22.393 -112.669 1.00 0.00 ? 69  LEU A HB3  1  
ATOM   940    H HG   . LEU A 1 69  ? -72.897  -23.223 -112.869 1.00 0.00 ? 69  LEU A HG   1  
ATOM   941    H HD11 . LEU A 1 69  ? -72.263  -22.347 -110.568 1.00 0.00 ? 69  LEU A HD11 1  
ATOM   942    H HD12 . LEU A 1 69  ? -73.978  -22.613 -110.872 1.00 0.00 ? 69  LEU A HD12 1  
ATOM   943    H HD13 . LEU A 1 69  ? -73.318  -20.979 -110.919 1.00 0.00 ? 69  LEU A HD13 1  
ATOM   944    H HD21 . LEU A 1 69  ? -73.967  -21.891 -114.401 1.00 0.00 ? 69  LEU A HD21 1  
ATOM   945    H HD22 . LEU A 1 69  ? -73.553  -20.401 -113.560 1.00 0.00 ? 69  LEU A HD22 1  
ATOM   946    H HD23 . LEU A 1 69  ? -74.816  -21.449 -112.922 1.00 0.00 ? 69  LEU A HD23 1  
ATOM   947    N N    . ARG A 1 70  ? -68.960  -20.157 -111.194 1.00 0.00 ? 70  ARG A N    1  
ATOM   948    C CA   . ARG A 1 70  ? -68.191  -20.162 -109.945 1.00 0.00 ? 70  ARG A CA   1  
ATOM   949    C C    . ARG A 1 70  ? -68.726  -19.056 -108.920 1.00 0.00 ? 70  ARG A C    1  
ATOM   950    O O    . ARG A 1 70  ? -68.029  -18.738 -107.982 1.00 0.00 ? 70  ARG A O    1  
ATOM   951    C CB   . ARG A 1 70  ? -66.695  -19.959 -110.214 1.00 0.00 ? 70  ARG A CB   1  
ATOM   952    C CG   . ARG A 1 70  ? -65.859  -19.907 -108.910 1.00 0.00 ? 70  ARG A CG   1  
ATOM   953    C CD   . ARG A 1 70  ? -64.373  -20.389 -109.164 1.00 0.00 ? 70  ARG A CD   1  
ATOM   954    N NE   . ARG A 1 70  ? -63.602  -20.294 -107.910 1.00 0.00 ? 70  ARG A NE   1  
ATOM   955    C CZ   . ARG A 1 70  ? -62.450  -20.959 -107.699 1.00 0.00 ? 70  ARG A CZ   1  
ATOM   956    N NH1  . ARG A 1 70  ? -61.939  -21.754 -108.611 1.00 0.00 ? 70  ARG A NH1  1  
ATOM   957    N NH2  . ARG A 1 70  ? -61.828  -20.806 -106.546 1.00 0.00 ? 70  ARG A NH2  1  
ATOM   958    H H    . ARG A 1 70  ? -68.471  -20.012 -112.028 1.00 0.00 ? 70  ARG A H    1  
ATOM   959    H HA   . ARG A 1 70  ? -68.340  -21.107 -109.463 1.00 0.00 ? 70  ARG A HA   1  
ATOM   960    H HB2  . ARG A 1 70  ? -66.360  -20.774 -110.814 1.00 0.00 ? 70  ARG A HB2  1  
ATOM   961    H HB3  . ARG A 1 70  ? -66.564  -19.035 -110.747 1.00 0.00 ? 70  ARG A HB3  1  
ATOM   962    H HG2  . ARG A 1 70  ? -65.816  -18.897 -108.556 1.00 0.00 ? 70  ARG A HG2  1  
ATOM   963    H HG3  . ARG A 1 70  ? -66.296  -20.541 -108.173 1.00 0.00 ? 70  ARG A HG3  1  
ATOM   964    H HD2  . ARG A 1 70  ? -64.397  -21.403 -109.498 1.00 0.00 ? 70  ARG A HD2  1  
ATOM   965    H HD3  . ARG A 1 70  ? -63.932  -19.759 -109.912 1.00 0.00 ? 70  ARG A HD3  1  
ATOM   966    H HE   . ARG A 1 70  ? -63.934  -19.722 -107.203 1.00 0.00 ? 70  ARG A HE   1  
ATOM   967    H HH11 . ARG A 1 70  ? -62.401  -21.882 -109.489 1.00 0.00 ? 70  ARG A HH11 1  
ATOM   968    H HH12 . ARG A 1 70  ? -61.079  -22.239 -108.427 1.00 0.00 ? 70  ARG A HH12 1  
ATOM   969    H HH21 . ARG A 1 70  ? -62.208  -20.204 -105.839 1.00 0.00 ? 70  ARG A HH21 1  
ATOM   970    H HH22 . ARG A 1 70  ? -60.971  -21.294 -106.372 1.00 0.00 ? 70  ARG A HH22 1  
ATOM   971    N N    . TYR A 1 71  ? -69.924  -18.572 -109.190 1.00 0.00 ? 71  TYR A N    1  
ATOM   972    C CA   . TYR A 1 71  ? -70.563  -17.564 -108.346 1.00 0.00 ? 71  TYR A CA   1  
ATOM   973    C C    . TYR A 1 71  ? -70.302  -17.817 -106.854 1.00 0.00 ? 71  TYR A C    1  
ATOM   974    O O    . TYR A 1 71  ? -70.408  -16.901 -106.032 1.00 0.00 ? 71  TYR A O    1  
ATOM   975    C CB   . TYR A 1 71  ? -72.096  -17.597 -108.564 1.00 0.00 ? 71  TYR A CB   1  
ATOM   976    C CG   . TYR A 1 71  ? -72.494  -17.628 -110.042 1.00 0.00 ? 71  TYR A CG   1  
ATOM   977    C CD1  . TYR A 1 71  ? -71.822  -16.847 -110.979 1.00 0.00 ? 71  TYR A CD1  1  
ATOM   978    C CD2  . TYR A 1 71  ? -73.561  -18.447 -110.460 1.00 0.00 ? 71  TYR A CD2  1  
ATOM   979    C CE1  . TYR A 1 71  ? -72.202  -16.877 -112.325 1.00 0.00 ? 71  TYR A CE1  1  
ATOM   980    C CE2  . TYR A 1 71  ? -73.937  -18.474 -111.807 1.00 0.00 ? 71  TYR A CE2  1  
ATOM   981    C CZ   . TYR A 1 71  ? -73.257  -17.688 -112.739 1.00 0.00 ? 71  TYR A CZ   1  
ATOM   982    O OH   . TYR A 1 71  ? -73.620  -17.721 -114.063 1.00 0.00 ? 71  TYR A OH   1  
ATOM   983    H H    . TYR A 1 71  ? -70.418  -18.919 -109.957 1.00 0.00 ? 71  TYR A H    1  
ATOM   984    H HA   . TYR A 1 71  ? -70.198  -16.594 -108.599 1.00 0.00 ? 71  TYR A HA   1  
ATOM   985    H HB2  . TYR A 1 71  ? -72.489  -18.473 -108.094 1.00 0.00 ? 71  TYR A HB2  1  
ATOM   986    H HB3  . TYR A 1 71  ? -72.527  -16.723 -108.108 1.00 0.00 ? 71  TYR A HB3  1  
ATOM   987    H HD1  . TYR A 1 71  ? -71.012  -16.219 -110.671 1.00 0.00 ? 71  TYR A HD1  1  
ATOM   988    H HD2  . TYR A 1 71  ? -74.091  -19.050 -109.748 1.00 0.00 ? 71  TYR A HD2  1  
ATOM   989    H HE1  . TYR A 1 71  ? -71.674  -16.267 -113.047 1.00 0.00 ? 71  TYR A HE1  1  
ATOM   990    H HE2  . TYR A 1 71  ? -74.756  -19.105 -112.126 1.00 0.00 ? 71  TYR A HE2  1  
ATOM   991    H HH   . TYR A 1 71  ? -72.842  -17.940 -114.579 1.00 0.00 ? 71  TYR A HH   1  
ATOM   992    N N    . VAL A 1 72  ? -69.903  -19.049 -106.523 1.00 0.00 ? 72  VAL A N    1  
ATOM   993    C CA   . VAL A 1 72  ? -69.629  -19.408 -105.147 1.00 0.00 ? 72  VAL A CA   1  
ATOM   994    C C    . VAL A 1 72  ? -68.883  -18.272 -104.501 1.00 0.00 ? 72  VAL A C    1  
ATOM   995    O O    . VAL A 1 72  ? -68.910  -18.114 -103.293 1.00 0.00 ? 72  VAL A O    1  
ATOM   996    C CB   . VAL A 1 72  ? -68.795  -20.731 -105.060 1.00 0.00 ? 72  VAL A CB   1  
ATOM   997    C CG1  . VAL A 1 72  ? -69.317  -21.752 -106.057 1.00 0.00 ? 72  VAL A CG1  1  
ATOM   998    C CG2  . VAL A 1 72  ? -67.337  -20.419 -105.341 1.00 0.00 ? 72  VAL A CG2  1  
ATOM   999    H H    . VAL A 1 72  ? -69.774  -19.706 -107.228 1.00 0.00 ? 72  VAL A H    1  
ATOM   1000   H HA   . VAL A 1 72  ? -70.562  -19.566 -104.615 1.00 0.00 ? 72  VAL A HA   1  
ATOM   1001   H HB   . VAL A 1 72  ? -68.893  -21.124 -104.069 1.00 0.00 ? 72  VAL A HB   1  
ATOM   1002   H HG11 . VAL A 1 72  ? -69.019  -21.474 -107.054 1.00 0.00 ? 72  VAL A HG11 1  
ATOM   1003   H HG12 . VAL A 1 72  ? -70.393  -21.797 -105.996 1.00 0.00 ? 72  VAL A HG12 1  
ATOM   1004   H HG13 . VAL A 1 72  ? -68.900  -22.717 -105.811 1.00 0.00 ? 72  VAL A HG13 1  
ATOM   1005   H HG21 . VAL A 1 72  ? -66.889  -20.010 -104.446 1.00 0.00 ? 72  VAL A HG21 1  
ATOM   1006   H HG22 . VAL A 1 72  ? -67.265  -19.700 -106.138 1.00 0.00 ? 72  VAL A HG22 1  
ATOM   1007   H HG23 . VAL A 1 72  ? -66.831  -21.325 -105.618 1.00 0.00 ? 72  VAL A HG23 1  
ATOM   1008   N N    . ALA A 1 73  ? -68.202  -17.486 -105.347 1.00 0.00 ? 73  ALA A N    1  
ATOM   1009   C CA   . ALA A 1 73  ? -67.456  -16.313 -104.886 1.00 0.00 ? 73  ALA A CA   1  
ATOM   1010   C C    . ALA A 1 73  ? -68.235  -15.506 -103.839 1.00 0.00 ? 73  ALA A C    1  
ATOM   1011   O O    . ALA A 1 73  ? -67.634  -14.879 -102.973 1.00 0.00 ? 73  ALA A O    1  
ATOM   1012   C CB   . ALA A 1 73  ? -67.077  -15.426 -106.074 1.00 0.00 ? 73  ALA A CB   1  
ATOM   1013   H H    . ALA A 1 73  ? -68.214  -17.697 -106.305 1.00 0.00 ? 73  ALA A H    1  
ATOM   1014   H HA   . ALA A 1 73  ? -66.557  -16.657 -104.434 1.00 0.00 ? 73  ALA A HA   1  
ATOM   1015   H HB1  . ALA A 1 73  ? -66.488  -14.593 -105.722 1.00 0.00 ? 73  ALA A HB1  1  
ATOM   1016   H HB2  . ALA A 1 73  ? -67.966  -15.063 -106.562 1.00 0.00 ? 73  ALA A HB2  1  
ATOM   1017   H HB3  . ALA A 1 73  ? -66.492  -16.008 -106.773 1.00 0.00 ? 73  ALA A HB3  1  
ATOM   1018   N N    . MET A 1 74  ? -69.559  -15.543 -103.930 1.00 0.00 ? 74  MET A N    1  
ATOM   1019   C CA   . MET A 1 74  ? -70.396  -14.832 -103.007 1.00 0.00 ? 74  MET A CA   1  
ATOM   1020   C C    . MET A 1 74  ? -70.271  -15.413 -101.493 1.00 0.00 ? 74  MET A C    1  
ATOM   1021   O O    . MET A 1 74  ? -70.121  -14.629 -100.589 1.00 0.00 ? 74  MET A O    1  
ATOM   1022   C CB   . MET A 1 74  ? -71.978  -14.995 -103.380 1.00 0.00 ? 74  MET A CB   1  
ATOM   1023   C CG   . MET A 1 74  ? -72.220  -15.061 -104.926 1.00 0.00 ? 74  MET A CG   1  
ATOM   1024   S SD   . MET A 1 74  ? -72.752  -16.707 -105.517 1.00 0.00 ? 74  MET A SD   1  
ATOM   1025   C CE   . MET A 1 74  ? -74.544  -16.594 -105.352 1.00 0.00 ? 74  MET A CE   1  
ATOM   1026   H H    . MET A 1 74  ? -69.969  -16.066 -104.639 1.00 0.00 ? 74  MET A H    1  
ATOM   1027   H HA   . MET A 1 74  ? -70.170  -13.812 -102.962 1.00 0.00 ? 74  MET A HA   1  
ATOM   1028   H HB2  . MET A 1 74  ? -72.332  -15.864 -102.919 1.00 0.00 ? 74  MET A HB2  1  
ATOM   1029   H HB3  . MET A 1 74  ? -72.448  -14.123 -102.984 1.00 0.00 ? 74  MET A HB3  1  
ATOM   1030   H HG2  . MET A 1 74  ? -72.998  -14.363 -105.142 1.00 0.00 ? 74  MET A HG2  1  
ATOM   1031   H HG3  . MET A 1 74  ? -71.329  -14.781 -105.434 1.00 0.00 ? 74  MET A HG3  1  
ATOM   1032   H HE1  . MET A 1 74  ? -74.968  -16.170 -106.250 1.00 0.00 ? 74  MET A HE1  1  
ATOM   1033   H HE2  . MET A 1 74  ? -74.788  -15.978 -104.508 1.00 0.00 ? 74  MET A HE2  1  
ATOM   1034   H HE3  . MET A 1 74  ? -74.941  -17.591 -105.199 1.00 0.00 ? 74  MET A HE3  1  
ATOM   1035   N N    . VAL A 1 75  ? -70.423  -16.712 -101.390 1.00 0.00 ? 75  VAL A N    1  
ATOM   1036   C CA   . VAL A 1 75  ? -70.351  -17.356 -100.096 1.00 0.00 ? 75  VAL A CA   1  
ATOM   1037   C C    . VAL A 1 75  ? -68.982  -17.141 -99.448  1.00 0.00 ? 75  VAL A C    1  
ATOM   1038   O O    . VAL A 1 75  ? -68.902  -16.706 -98.303  1.00 0.00 ? 75  VAL A O    1  
ATOM   1039   C CB   . VAL A 1 75  ? -70.646  -18.903 -100.266 1.00 0.00 ? 75  VAL A CB   1  
ATOM   1040   C CG1  . VAL A 1 75  ? -70.998  -19.514 -98.919  1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1041   C CG2  . VAL A 1 75  ? -71.790  -19.117 -101.257 1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1042   H H    . VAL A 1 75  ? -70.630  -17.240 -102.186 1.00 0.00 ? 75  VAL A H    1  
ATOM   1043   H HA   . VAL A 1 75  ? -71.102  -16.934 -99.471  1.00 0.00 ? 75  VAL A HA   1  
ATOM   1044   H HB   . VAL A 1 75  ? -69.767  -19.375 -100.636 1.00 0.00 ? 75  VAL A HB   1  
ATOM   1045   H HG11 . VAL A 1 75  ? -71.872  -19.032 -98.512  1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1046   H HG12 . VAL A 1 75  ? -70.165  -19.389 -98.248  1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1047   H HG13 . VAL A 1 75  ? -71.198  -20.567 -99.058  1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1048   H HG21 . VAL A 1 75  ? -72.452  -18.267 -101.253 1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1049   H HG22 . VAL A 1 75  ? -72.339  -20.003 -100.982 1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1050   H HG23 . VAL A 1 75  ? -71.375  -19.247 -102.247 1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1051   N N    . ILE A 1 76  ? -67.917  -17.396 -100.195 1.00 0.00 ? 76  ILE A N    1  
ATOM   1052   C CA   . ILE A 1 76  ? -66.583  -17.180 -99.671  1.00 0.00 ? 76  ILE A CA   1  
ATOM   1053   C C    . ILE A 1 76  ? -66.368  -15.654 -99.325  1.00 0.00 ? 76  ILE A C    1  
ATOM   1054   O O    . ILE A 1 76  ? -65.783  -15.360 -98.298  1.00 0.00 ? 76  ILE A O    1  
ATOM   1055   C CB   . ILE A 1 76  ? -65.498  -17.773 -100.678 1.00 0.00 ? 76  ILE A CB   1  
ATOM   1056   C CG1  . ILE A 1 76  ? -64.058  -17.416 -100.186 1.00 0.00 ? 76  ILE A CG1  1  
ATOM   1057   C CG2  . ILE A 1 76  ? -65.708  -17.298 -102.097 1.00 0.00 ? 76  ILE A CG2  1  
ATOM   1058   C CD1  . ILE A 1 76  ? -63.001  -18.017 -101.121 1.00 0.00 ? 76  ILE A CD1  1  
ATOM   1059   H H    . ILE A 1 76  ? -68.036  -17.729 -101.106 1.00 0.00 ? 76  ILE A H    1  
ATOM   1060   H HA   . ILE A 1 76  ? -66.492  -17.711 -98.757  1.00 0.00 ? 76  ILE A HA   1  
ATOM   1061   H HB   . ILE A 1 76  ? -65.606  -18.832 -100.643 1.00 0.00 ? 76  ILE A HB   1  
ATOM   1062   H HG12 . ILE A 1 76  ? -63.954  -16.358 -100.169 1.00 0.00 ? 76  ILE A HG12 1  
ATOM   1063   H HG13 . ILE A 1 76  ? -63.931  -17.823 -99.205  1.00 0.00 ? 76  ILE A HG13 1  
ATOM   1064   H HG21 . ILE A 1 76  ? -66.363  -17.998 -102.599 1.00 0.00 ? 76  ILE A HG21 1  
ATOM   1065   H HG22 . ILE A 1 76  ? -64.761  -17.269 -102.616 1.00 0.00 ? 76  ILE A HG22 1  
ATOM   1066   H HG23 . ILE A 1 76  ? -66.149  -16.321 -102.103 1.00 0.00 ? 76  ILE A HG23 1  
ATOM   1067   H HD11 . ILE A 1 76  ? -62.878  -17.373 -101.982 1.00 0.00 ? 76  ILE A HD11 1  
ATOM   1068   H HD12 . ILE A 1 76  ? -63.305  -18.998 -101.447 1.00 0.00 ? 76  ILE A HD12 1  
ATOM   1069   H HD13 . ILE A 1 76  ? -62.067  -18.083 -100.587 1.00 0.00 ? 76  ILE A HD13 1  
ATOM   1070   N N    . TRP A 1 77  ? -66.955  -14.775 -100.146 1.00 0.00 ? 77  TRP A N    1  
ATOM   1071   C CA   . TRP A 1 77  ? -66.946  -13.300 -99.905  1.00 0.00 ? 77  TRP A CA   1  
ATOM   1072   C C    . TRP A 1 77  ? -67.774  -13.027 -98.658  1.00 0.00 ? 77  TRP A C    1  
ATOM   1073   O O    . TRP A 1 77  ? -67.385  -12.244 -97.791  1.00 0.00 ? 77  TRP A O    1  
ATOM   1074   C CB   . TRP A 1 77  ? -67.552  -12.595 -101.171 1.00 0.00 ? 77  TRP A CB   1  
ATOM   1075   C CG   . TRP A 1 77  ? -67.982  -11.114 -101.059 1.00 0.00 ? 77  TRP A CG   1  
ATOM   1076   C CD1  . TRP A 1 77  ? -68.700  -10.521 -100.050 1.00 0.00 ? 77  TRP A CD1  1  
ATOM   1077   C CD2  . TRP A 1 77  ? -67.802  -10.077 -102.058 1.00 0.00 ? 77  TRP A CD2  1  
ATOM   1078   N NE1  . TRP A 1 77  ? -68.934  -9.198  -100.359 1.00 0.00 ? 77  TRP A NE1  1  
ATOM   1079   C CE2  . TRP A 1 77  ? -68.405  -8.870  -101.570 1.00 0.00 ? 77  TRP A CE2  1  
ATOM   1080   C CE3  . TRP A 1 77  ? -67.172  -10.041 -103.312 1.00 0.00 ? 77  TRP A CE3  1  
ATOM   1081   C CZ2  . TRP A 1 77  ? -68.384  -7.705  -102.289 1.00 0.00 ? 77  TRP A CZ2  1  
ATOM   1082   C CZ3  . TRP A 1 77  ? -67.156  -8.845  -104.030 1.00 0.00 ? 77  TRP A CZ3  1  
ATOM   1083   C CH2  . TRP A 1 77  ? -67.761  -7.684  -103.516 1.00 0.00 ? 77  TRP A CH2  1  
ATOM   1084   H H    . TRP A 1 77  ? -67.451  -15.119 -100.906 1.00 0.00 ? 77  TRP A H    1  
ATOM   1085   H HA   . TRP A 1 77  ? -65.941  -12.964 -99.754  1.00 0.00 ? 77  TRP A HA   1  
ATOM   1086   H HB2  . TRP A 1 77  ? -66.814  -12.653 -101.943 1.00 0.00 ? 77  TRP A HB2  1  
ATOM   1087   H HB3  . TRP A 1 77  ? -68.407  -13.169 -101.477 1.00 0.00 ? 77  TRP A HB3  1  
ATOM   1088   H HD1  . TRP A 1 77  ? -69.020  -11.002 -99.157  1.00 0.00 ? 77  TRP A HD1  1  
ATOM   1089   H HE1  . TRP A 1 77  ? -69.419  -8.540  -99.787  1.00 0.00 ? 77  TRP A HE1  1  
ATOM   1090   H HE3  . TRP A 1 77  ? -66.702  -10.930 -103.724 1.00 0.00 ? 77  TRP A HE3  1  
ATOM   1091   H HZ2  . TRP A 1 77  ? -68.850  -6.802  -101.892 1.00 0.00 ? 77  TRP A HZ2  1  
ATOM   1092   H HZ3  . TRP A 1 77  ? -66.674  -8.803  -104.990 1.00 0.00 ? 77  TRP A HZ3  1  
ATOM   1093   H HH2  . TRP A 1 77  ? -67.736  -6.779  -104.080 1.00 0.00 ? 77  TRP A HH2  1  
ATOM   1094   N N    . LEU A 1 78  ? -68.922  -13.695 -98.573  1.00 0.00 ? 78  LEU A N    1  
ATOM   1095   C CA   . LEU A 1 78  ? -69.802  -13.531 -97.416  1.00 0.00 ? 78  LEU A CA   1  
ATOM   1096   C C    . LEU A 1 78  ? -69.048  -14.000 -96.197  1.00 0.00 ? 78  LEU A C    1  
ATOM   1097   O O    . LEU A 1 78  ? -69.007  -13.287 -95.200  1.00 0.00 ? 78  LEU A O    1  
ATOM   1098   C CB   . LEU A 1 78  ? -71.076  -14.379 -97.648  1.00 0.00 ? 78  LEU A CB   1  
ATOM   1099   C CG   . LEU A 1 78  ? -72.271  -14.213 -96.629  1.00 0.00 ? 78  LEU A CG   1  
ATOM   1100   C CD1  . LEU A 1 78  ? -71.776  -14.464 -95.239  1.00 0.00 ? 78  LEU A CD1  1  
ATOM   1101   C CD2  . LEU A 1 78  ? -72.917  -12.840 -96.708  1.00 0.00 ? 78  LEU A CD2  1  
ATOM   1102   H H    . LEU A 1 78  ? -69.173  -14.301 -99.291  1.00 0.00 ? 78  LEU A H    1  
ATOM   1103   H HA   . LEU A 1 78  ? -70.052  -12.502 -97.315  1.00 0.00 ? 78  LEU A HA   1  
ATOM   1104   H HB2  . LEU A 1 78  ? -71.460  -14.146 -98.592  1.00 0.00 ? 78  LEU A HB2  1  
ATOM   1105   H HB3  . LEU A 1 78  ? -70.789  -15.407 -97.608  1.00 0.00 ? 78  LEU A HB3  1  
ATOM   1106   H HG   . LEU A 1 78  ? -73.011  -14.969 -96.892  1.00 0.00 ? 78  LEU A HG   1  
ATOM   1107   H HD11 . LEU A 1 78  ? -72.615  -14.672 -94.599  1.00 0.00 ? 78  LEU A HD11 1  
ATOM   1108   H HD12 . LEU A 1 78  ? -71.256  -13.588 -94.888  1.00 0.00 ? 78  LEU A HD12 1  
ATOM   1109   H HD13 . LEU A 1 78  ? -71.105  -15.310 -95.245  1.00 0.00 ? 78  LEU A HD13 1  
ATOM   1110   H HD21 . LEU A 1 78  ? -73.861  -12.868 -96.179  1.00 0.00 ? 78  LEU A HD21 1  
ATOM   1111   H HD22 . LEU A 1 78  ? -73.088  -12.569 -97.735  1.00 0.00 ? 78  LEU A HD22 1  
ATOM   1112   H HD23 . LEU A 1 78  ? -72.266  -12.120 -96.241  1.00 0.00 ? 78  LEU A HD23 1  
ATOM   1113   N N    . TYR A 1 79  ? -68.479  -15.213 -96.273  1.00 0.00 ? 79  TYR A N    1  
ATOM   1114   C CA   . TYR A 1 79  ? -67.744  -15.799 -95.135  1.00 0.00 ? 79  TYR A CA   1  
ATOM   1115   C C    . TYR A 1 79  ? -66.641  -14.887 -94.632  1.00 0.00 ? 79  TYR A C    1  
ATOM   1116   O O    . TYR A 1 79  ? -66.631  -14.539 -93.460  1.00 0.00 ? 79  TYR A O    1  
ATOM   1117   C CB   . TYR A 1 79  ? -67.162  -17.159 -95.542  1.00 0.00 ? 79  TYR A CB   1  
ATOM   1118   C CG   . TYR A 1 79  ? -66.184  -17.705 -94.507  1.00 0.00 ? 79  TYR A CG   1  
ATOM   1119   C CD1  . TYR A 1 79  ? -66.641  -18.454 -93.422  1.00 0.00 ? 79  TYR A CD1  1  
ATOM   1120   C CD2  . TYR A 1 79  ? -64.814  -17.469 -94.660  1.00 0.00 ? 79  TYR A CD2  1  
ATOM   1121   C CE1  . TYR A 1 79  ? -65.735  -18.957 -92.490  1.00 0.00 ? 79  TYR A CE1  1  
ATOM   1122   C CE2  . TYR A 1 79  ? -63.911  -17.974 -93.727  1.00 0.00 ? 79  TYR A CE2  1  
ATOM   1123   C CZ   . TYR A 1 79  ? -64.370  -18.717 -92.641  1.00 0.00 ? 79  TYR A CZ   1  
ATOM   1124   O OH   . TYR A 1 79  ? -63.475  -19.211 -91.719  1.00 0.00 ? 79  TYR A OH   1  
ATOM   1125   H H    . TYR A 1 79  ? -68.585  -15.733 -97.091  1.00 0.00 ? 79  TYR A H    1  
ATOM   1126   H HA   . TYR A 1 79  ? -68.451  -15.949 -94.347  1.00 0.00 ? 79  TYR A HA   1  
ATOM   1127   H HB2  . TYR A 1 79  ? -67.971  -17.857 -95.655  1.00 0.00 ? 79  TYR A HB2  1  
ATOM   1128   H HB3  . TYR A 1 79  ? -66.653  -17.046 -96.474  1.00 0.00 ? 79  TYR A HB3  1  
ATOM   1129   H HD1  . TYR A 1 79  ? -67.689  -18.641 -93.298  1.00 0.00 ? 79  TYR A HD1  1  
ATOM   1130   H HD2  . TYR A 1 79  ? -64.453  -16.902 -95.495  1.00 0.00 ? 79  TYR A HD2  1  
ATOM   1131   H HE1  . TYR A 1 79  ? -66.095  -19.537 -91.651  1.00 0.00 ? 79  TYR A HE1  1  
ATOM   1132   H HE2  . TYR A 1 79  ? -62.852  -17.784 -93.843  1.00 0.00 ? 79  TYR A HE2  1  
ATOM   1133   H HH   . TYR A 1 79  ? -63.873  -19.138 -90.849  1.00 0.00 ? 79  TYR A HH   1  
ATOM   1134   N N    . SER A 1 80  ? -65.710  -14.538 -95.507  1.00 0.00 ? 80  SER A N    1  
ATOM   1135   C CA   . SER A 1 80  ? -64.582  -13.675 -95.137  1.00 0.00 ? 80  SER A CA   1  
ATOM   1136   C C    . SER A 1 80  ? -64.980  -12.268 -94.638  1.00 0.00 ? 80  SER A C    1  
ATOM   1137   O O    . SER A 1 80  ? -64.334  -11.733 -93.728  1.00 0.00 ? 80  SER A O    1  
ATOM   1138   C CB   . SER A 1 80  ? -63.587  -13.575 -96.302  1.00 0.00 ? 80  SER A CB   1  
ATOM   1139   O OG   . SER A 1 80  ? -64.232  -13.239 -97.527  1.00 0.00 ? 80  SER A OG   1  
ATOM   1140   H H    . SER A 1 80  ? -65.757  -14.895 -96.415  1.00 0.00 ? 80  SER A H    1  
ATOM   1141   H HA   . SER A 1 80  ? -64.076  -14.159 -94.328  1.00 0.00 ? 80  SER A HA   1  
ATOM   1142   H HB2  . SER A 1 80  ? -62.861  -12.817 -96.077  1.00 0.00 ? 80  SER A HB2  1  
ATOM   1143   H HB3  . SER A 1 80  ? -63.086  -14.528 -96.402  1.00 0.00 ? 80  SER A HB3  1  
ATOM   1144   H HG   . SER A 1 80  ? -63.593  -13.371 -98.239  1.00 0.00 ? 80  SER A HG   1  
ATOM   1145   N N    . ALA A 1 81  ? -66.061  -11.708 -95.167  1.00 0.00 ? 81  ALA A N    1  
ATOM   1146   C CA   . ALA A 1 81  ? -66.525  -10.404 -94.701  1.00 0.00 ? 81  ALA A CA   1  
ATOM   1147   C C    . ALA A 1 81  ? -67.010  -10.527 -93.256  1.00 0.00 ? 81  ALA A C    1  
ATOM   1148   O O    . ALA A 1 81  ? -66.621  -9.731  -92.396  1.00 0.00 ? 81  ALA A O    1  
ATOM   1149   C CB   . ALA A 1 81  ? -67.661  -9.877  -95.584  1.00 0.00 ? 81  ALA A CB   1  
ATOM   1150   H H    . ALA A 1 81  ? -66.565  -12.186 -95.851  1.00 0.00 ? 81  ALA A H    1  
ATOM   1151   H HA   . ALA A 1 81  ? -65.716  -9.704  -94.729  1.00 0.00 ? 81  ALA A HA   1  
ATOM   1152   H HB1  . ALA A 1 81  ? -68.577  -10.398 -95.354  1.00 0.00 ? 81  ALA A HB1  1  
ATOM   1153   H HB2  . ALA A 1 81  ? -67.408  -10.032 -96.622  1.00 0.00 ? 81  ALA A HB2  1  
ATOM   1154   H HB3  . ALA A 1 81  ? -67.793  -8.819  -95.401  1.00 0.00 ? 81  ALA A HB3  1  
ATOM   1155   N N    . PHE A 1 82  ? -67.814  -11.565 -92.990  1.00 0.00 ? 82  PHE A N    1  
ATOM   1156   C CA   . PHE A 1 82  ? -68.327  -11.825 -91.636  1.00 0.00 ? 82  PHE A CA   1  
ATOM   1157   C C    . PHE A 1 82  ? -67.196  -12.178 -90.685  1.00 0.00 ? 82  PHE A C    1  
ATOM   1158   O O    . PHE A 1 82  ? -67.017  -11.524 -89.664  1.00 0.00 ? 82  PHE A O    1  
ATOM   1159   C CB   . PHE A 1 82  ? -69.330  -12.990 -91.688  1.00 0.00 ? 82  PHE A CB   1  
ATOM   1160   C CG   . PHE A 1 82  ? -69.543  -13.634 -90.332  1.00 0.00 ? 82  PHE A CG   1  
ATOM   1161   C CD1  . PHE A 1 82  ? -70.206  -12.941 -89.323  1.00 0.00 ? 82  PHE A CD1  1  
ATOM   1162   C CD2  . PHE A 1 82  ? -69.081  -14.932 -90.106  1.00 0.00 ? 82  PHE A CD2  1  
ATOM   1163   C CE1  . PHE A 1 82  ? -70.407  -13.541 -88.086  1.00 0.00 ? 82  PHE A CE1  1  
ATOM   1164   C CE2  . PHE A 1 82  ? -69.281  -15.532 -88.870  1.00 0.00 ? 82  PHE A CE2  1  
ATOM   1165   C CZ   . PHE A 1 82  ? -69.943  -14.837 -87.858  1.00 0.00 ? 82  PHE A CZ   1  
ATOM   1166   H H    . PHE A 1 82  ? -68.047  -12.177 -93.714  1.00 0.00 ? 82  PHE A H    1  
ATOM   1167   H HA   . PHE A 1 82  ? -68.838  -10.950 -91.273  1.00 0.00 ? 82  PHE A HA   1  
ATOM   1168   H HB2  . PHE A 1 82  ? -70.274  -12.613 -92.027  1.00 0.00 ? 82  PHE A HB2  1  
ATOM   1169   H HB3  . PHE A 1 82  ? -68.970  -13.731 -92.378  1.00 0.00 ? 82  PHE A HB3  1  
ATOM   1170   H HD1  . PHE A 1 82  ? -70.567  -11.946 -89.497  1.00 0.00 ? 82  PHE A HD1  1  
ATOM   1171   H HD2  . PHE A 1 82  ? -68.573  -15.470 -90.886  1.00 0.00 ? 82  PHE A HD2  1  
ATOM   1172   H HE1  . PHE A 1 82  ? -70.922  -12.999 -87.305  1.00 0.00 ? 82  PHE A HE1  1  
ATOM   1173   H HE2  . PHE A 1 82  ? -68.923  -16.536 -88.696  1.00 0.00 ? 82  PHE A HE2  1  
ATOM   1174   H HZ   . PHE A 1 82  ? -70.093  -15.301 -86.898  1.00 0.00 ? 82  PHE A HZ   1  
ATOM   1175   N N    . ARG A 1 83  ? -66.393  -13.168 -91.083  1.00 0.00 ? 83  ARG A N    1  
ATOM   1176   C CA   . ARG A 1 83  ? -65.254  -13.599 -90.285  1.00 0.00 ? 83  ARG A CA   1  
ATOM   1177   C C    . ARG A 1 83  ? -64.441  -12.365 -89.897  1.00 0.00 ? 83  ARG A C    1  
ATOM   1178   O O    . ARG A 1 83  ? -63.950  -12.267 -88.778  1.00 0.00 ? 83  ARG A O    1  
ATOM   1179   C CB   . ARG A 1 83  ? -64.391  -14.598 -91.098  1.00 0.00 ? 83  ARG A CB   1  
ATOM   1180   C CG   . ARG A 1 83  ? -64.204  -15.946 -90.370  1.00 0.00 ? 83  ARG A CG   1  
ATOM   1181   C CD   . ARG A 1 83  ? -63.050  -15.813 -89.305  1.00 0.00 ? 83  ARG A CD   1  
ATOM   1182   N NE   . ARG A 1 83  ? -62.973  -16.993 -88.434  1.00 0.00 ? 83  ARG A NE   1  
ATOM   1183   C CZ   . ARG A 1 83  ? -61.808  -17.601 -88.118  1.00 0.00 ? 83  ARG A CZ   1  
ATOM   1184   N NH1  . ARG A 1 83  ? -60.654  -17.187 -88.613  1.00 0.00 ? 83  ARG A NH1  1  
ATOM   1185   N NH2  . ARG A 1 83  ? -61.837  -18.643 -87.304  1.00 0.00 ? 83  ARG A NH2  1  
ATOM   1186   H H    . ARG A 1 83  ? -66.567  -13.600 -91.937  1.00 0.00 ? 83  ARG A H    1  
ATOM   1187   H HA   . ARG A 1 83  ? -65.594  -14.073 -89.396  1.00 0.00 ? 83  ARG A HA   1  
ATOM   1188   H HB2  . ARG A 1 83  ? -64.873  -14.794 -92.034  1.00 0.00 ? 83  ARG A HB2  1  
ATOM   1189   H HB3  . ARG A 1 83  ? -63.425  -14.164 -91.278  1.00 0.00 ? 83  ARG A HB3  1  
ATOM   1190   H HG2  . ARG A 1 83  ? -65.116  -16.226 -89.884  1.00 0.00 ? 83  ARG A HG2  1  
ATOM   1191   H HG3  . ARG A 1 83  ? -63.925  -16.694 -91.093  1.00 0.00 ? 83  ARG A HG3  1  
ATOM   1192   H HD2  . ARG A 1 83  ? -62.126  -15.690 -89.821  1.00 0.00 ? 83  ARG A HD2  1  
ATOM   1193   H HD3  . ARG A 1 83  ? -63.255  -14.944 -88.709  1.00 0.00 ? 83  ARG A HD3  1  
ATOM   1194   H HE   . ARG A 1 83  ? -63.790  -17.341 -88.052  1.00 0.00 ? 83  ARG A HE   1  
ATOM   1195   H HH11 . ARG A 1 83  ? -60.618  -16.408 -89.239  1.00 0.00 ? 83  ARG A HH11 1  
ATOM   1196   H HH12 . ARG A 1 83  ? -59.804  -17.660 -88.362  1.00 0.00 ? 83  ARG A HH12 1  
ATOM   1197   H HH21 . ARG A 1 83  ? -62.709  -18.975 -86.932  1.00 0.00 ? 83  ARG A HH21 1  
ATOM   1198   H HH22 . ARG A 1 83  ? -60.987  -19.111 -87.059  1.00 0.00 ? 83  ARG A HH22 1  
ATOM   1199   N N    . GLY A 1 84  ? -64.343  -11.399 -90.797  1.00 0.00 ? 84  GLY A N    1  
ATOM   1200   C CA   . GLY A 1 84  ? -63.608  -10.185 -90.487  1.00 0.00 ? 84  GLY A CA   1  
ATOM   1201   C C    . GLY A 1 84  ? -64.280  -9.403  -89.365  1.00 0.00 ? 84  GLY A C    1  
ATOM   1202   O O    . GLY A 1 84  ? -63.600  -8.889  -88.477  1.00 0.00 ? 84  GLY A O    1  
ATOM   1203   H H    . GLY A 1 84  ? -64.791  -11.488 -91.663  1.00 0.00 ? 84  GLY A H    1  
ATOM   1204   H HA2  . GLY A 1 84  ? -62.606  -10.443 -90.179  1.00 0.00 ? 84  GLY A HA2  1  
ATOM   1205   H HA3  . GLY A 1 84  ? -63.559  -9.568  -91.370  1.00 0.00 ? 84  GLY A HA3  1  
ATOM   1206   N N    . VAL A 1 85  ? -65.612  -9.297  -89.423  1.00 0.00 ? 85  VAL A N    1  
ATOM   1207   C CA   . VAL A 1 85  ? -66.341  -8.530  -88.413  1.00 0.00 ? 85  VAL A CA   1  
ATOM   1208   C C    . VAL A 1 85  ? -66.132  -9.101  -87.021  1.00 0.00 ? 85  VAL A C    1  
ATOM   1209   O O    . VAL A 1 85  ? -65.874  -8.341  -86.096  1.00 0.00 ? 85  VAL A O    1  
ATOM   1210   C CB   . VAL A 1 85  ? -67.848  -8.400  -88.769  1.00 0.00 ? 85  VAL A CB   1  
ATOM   1211   C CG1  . VAL A 1 85  ? -68.698  -9.425  -88.015  1.00 0.00 ? 85  VAL A CG1  1  
ATOM   1212   C CG2  . VAL A 1 85  ? -68.321  -6.990  -88.419  1.00 0.00 ? 85  VAL A CG2  1  
ATOM   1213   H H    . VAL A 1 85  ? -66.094  -9.721  -90.158  1.00 0.00 ? 85  VAL A H    1  
ATOM   1214   H HA   . VAL A 1 85  ? -65.920  -7.543  -88.414  1.00 0.00 ? 85  VAL A HA   1  
ATOM   1215   H HB   . VAL A 1 85  ? -67.974  -8.552  -89.824  1.00 0.00 ? 85  VAL A HB   1  
ATOM   1216   H HG11 . VAL A 1 85  ? -68.238  -10.395 -88.096  1.00 0.00 ? 85  VAL A HG11 1  
ATOM   1217   H HG12 . VAL A 1 85  ? -69.686  -9.458  -88.447  1.00 0.00 ? 85  VAL A HG12 1  
ATOM   1218   H HG13 . VAL A 1 85  ? -68.769  -9.145  -86.974  1.00 0.00 ? 85  VAL A HG13 1  
ATOM   1219   H HG21 . VAL A 1 85  ? -68.000  -6.741  -87.420  1.00 0.00 ? 85  VAL A HG21 1  
ATOM   1220   H HG22 . VAL A 1 85  ? -69.394  -6.948  -88.480  1.00 0.00 ? 85  VAL A HG22 1  
ATOM   1221   H HG23 . VAL A 1 85  ? -67.889  -6.290  -89.121  1.00 0.00 ? 85  VAL A HG23 1  
ATOM   1222   N N    . GLN A 1 86  ? -66.269  -10.426 -86.875  1.00 0.00 ? 86  GLN A N    1  
ATOM   1223   C CA   . GLN A 1 86  ? -66.111  -11.074 -85.563  1.00 0.00 ? 86  GLN A CA   1  
ATOM   1224   C C    . GLN A 1 86  ? -64.741  -10.823 -84.908  1.00 0.00 ? 86  GLN A C    1  
ATOM   1225   O O    . GLN A 1 86  ? -64.684  -10.373 -83.746  1.00 0.00 ? 86  GLN A O    1  
ATOM   1226   C CB   . GLN A 1 86  ? -66.473  -12.582 -85.608  1.00 0.00 ? 86  GLN A CB   1  
ATOM   1227   C CG   . GLN A 1 86  ? -65.688  -13.400 -86.698  1.00 0.00 ? 86  GLN A CG   1  
ATOM   1228   C CD   . GLN A 1 86  ? -66.387  -14.723 -87.020  1.00 0.00 ? 86  GLN A CD   1  
ATOM   1229   O OE1  . GLN A 1 86  ? -67.589  -14.913 -86.746  1.00 0.00 ? 86  GLN A OE1  1  
ATOM   1230   N NE2  . GLN A 1 86  ? -65.662  -15.648 -87.616  1.00 0.00 ? 86  GLN A NE2  1  
ATOM   1231   H H    . GLN A 1 86  ? -66.503  -10.966 -87.654  1.00 0.00 ? 86  GLN A H    1  
ATOM   1232   H HA   . GLN A 1 86  ? -66.844  -10.621 -84.920  1.00 0.00 ? 86  GLN A HA   1  
ATOM   1233   H HB2  . GLN A 1 86  ? -66.253  -13.014 -84.662  1.00 0.00 ? 86  GLN A HB2  1  
ATOM   1234   H HB3  . GLN A 1 86  ? -67.516  -12.672 -85.821  1.00 0.00 ? 86  GLN A HB3  1  
ATOM   1235   H HG2  . GLN A 1 86  ? -65.646  -12.818 -87.575  1.00 0.00 ? 86  GLN A HG2  1  
ATOM   1236   H HG3  . GLN A 1 86  ? -64.700  -13.607 -86.328  1.00 0.00 ? 86  GLN A HG3  1  
ATOM   1237   H HE21 . GLN A 1 86  ? -64.713  -15.459 -87.819  1.00 0.00 ? 86  GLN A HE21 1  
ATOM   1238   H HE22 . GLN A 1 86  ? -66.046  -16.509 -87.866  1.00 0.00 ? 86  GLN A HE22 1  
ATOM   1239   N N    . LEU A 1 87  ? -63.667  -10.997 -85.687  1.00 0.00 ? 87  LEU A N    1  
ATOM   1240   C CA   . LEU A 1 87  ? -62.310  -10.722 -85.205  1.00 0.00 ? 87  LEU A CA   1  
ATOM   1241   C C    . LEU A 1 87  ? -62.071  -9.192  -85.000  1.00 0.00 ? 87  LEU A C    1  
ATOM   1242   O O    . LEU A 1 87  ? -61.527  -8.798  -83.965  1.00 0.00 ? 87  LEU A O    1  
ATOM   1243   C CB   . LEU A 1 87  ? -61.226  -11.283 -86.150  1.00 0.00 ? 87  LEU A CB   1  
ATOM   1244   C CG   . LEU A 1 87  ? -61.334  -12.800 -86.466  1.00 0.00 ? 87  LEU A CG   1  
ATOM   1245   C CD1  . LEU A 1 87  ? -59.979  -13.269 -87.018  1.00 0.00 ? 87  LEU A CD1  1  
ATOM   1246   C CD2  . LEU A 1 87  ? -61.714  -13.646 -85.245  1.00 0.00 ? 87  LEU A CD2  1  
ATOM   1247   H H    . LEU A 1 87  ? -63.803  -11.268 -86.615  1.00 0.00 ? 87  LEU A H    1  
ATOM   1248   H HA   . LEU A 1 87  ? -62.184  -11.176 -84.252  1.00 0.00 ? 87  LEU A HA   1  
ATOM   1249   H HB2  . LEU A 1 87  ? -61.284  -10.766 -87.082  1.00 0.00 ? 87  LEU A HB2  1  
ATOM   1250   H HB3  . LEU A 1 87  ? -60.273  -11.096 -85.700  1.00 0.00 ? 87  LEU A HB3  1  
ATOM   1251   H HG   . LEU A 1 87  ? -62.067  -12.935 -87.237  1.00 0.00 ? 87  LEU A HG   1  
ATOM   1252   H HD11 . LEU A 1 87  ? -59.614  -12.543 -87.735  1.00 0.00 ? 87  LEU A HD11 1  
ATOM   1253   H HD12 . LEU A 1 87  ? -60.105  -14.221 -87.506  1.00 0.00 ? 87  LEU A HD12 1  
ATOM   1254   H HD13 . LEU A 1 87  ? -59.269  -13.363 -86.212  1.00 0.00 ? 87  LEU A HD13 1  
ATOM   1255   H HD21 . LEU A 1 87  ? -62.716  -13.391 -84.936  1.00 0.00 ? 87  LEU A HD21 1  
ATOM   1256   H HD22 . LEU A 1 87  ? -61.026  -13.467 -84.438  1.00 0.00 ? 87  LEU A HD22 1  
ATOM   1257   H HD23 . LEU A 1 87  ? -61.684  -14.697 -85.517  1.00 0.00 ? 87  LEU A HD23 1  
ATOM   1258   N N    . THR A 1 88  ? -62.512  -8.331  -85.940  1.00 0.00 ? 88  THR A N    1  
ATOM   1259   C CA   . THR A 1 88  ? -62.341  -6.859  -85.766  1.00 0.00 ? 88  THR A CA   1  
ATOM   1260   C C    . THR A 1 88  ? -63.161  -6.330  -84.606  1.00 0.00 ? 88  THR A C    1  
ATOM   1261   O O    . THR A 1 88  ? -62.719  -5.422  -83.917  1.00 0.00 ? 88  THR A O    1  
ATOM   1262   C CB   . THR A 1 88  ? -62.707  -6.046  -87.020  1.00 0.00 ? 88  THR A CB   1  
ATOM   1263   O OG1  . THR A 1 88  ? -61.852  -4.898  -87.104  1.00 0.00 ? 88  THR A OG1  1  
ATOM   1264   C CG2  . THR A 1 88  ? -64.183  -5.594  -86.991  1.00 0.00 ? 88  THR A CG2  1  
ATOM   1265   H H    . THR A 1 88  ? -62.960  -8.678  -86.733  1.00 0.00 ? 88  THR A H    1  
ATOM   1266   H HA   . THR A 1 88  ? -61.304  -6.683  -85.539  1.00 0.00 ? 88  THR A HA   1  
ATOM   1267   H HB   . THR A 1 88  ? -62.558  -6.648  -87.884  1.00 0.00 ? 88  THR A HB   1  
ATOM   1268   H HG1  . THR A 1 88  ? -60.952  -5.191  -86.925  1.00 0.00 ? 88  THR A HG1  1  
ATOM   1269   H HG21 . THR A 1 88  ? -64.800  -6.425  -86.690  1.00 0.00 ? 88  THR A HG21 1  
ATOM   1270   H HG22 . THR A 1 88  ? -64.472  -5.274  -87.979  1.00 0.00 ? 88  THR A HG22 1  
ATOM   1271   H HG23 . THR A 1 88  ? -64.308  -4.779  -86.295  1.00 0.00 ? 88  THR A HG23 1  
ATOM   1272   N N    . TYR A 1 89  ? -64.369  -6.851  -84.435  1.00 0.00 ? 89  TYR A N    1  
ATOM   1273   C CA   . TYR A 1 89  ? -65.247  -6.393  -83.351  1.00 0.00 ? 89  TYR A CA   1  
ATOM   1274   C C    . TYR A 1 89  ? -64.594  -6.587  -81.976  1.00 0.00 ? 89  TYR A C    1  
ATOM   1275   O O    . TYR A 1 89  ? -64.527  -5.636  -81.185  1.00 0.00 ? 89  TYR A O    1  
ATOM   1276   C CB   . TYR A 1 89  ? -66.561  -7.167  -83.424  1.00 0.00 ? 89  TYR A CB   1  
ATOM   1277   C CG   . TYR A 1 89  ? -67.372  -7.064  -82.143  1.00 0.00 ? 89  TYR A CG   1  
ATOM   1278   C CD1  . TYR A 1 89  ? -68.170  -5.948  -81.901  1.00 0.00 ? 89  TYR A CD1  1  
ATOM   1279   C CD2  . TYR A 1 89  ? -67.338  -8.113  -81.217  1.00 0.00 ? 89  TYR A CD2  1  
ATOM   1280   C CE1  . TYR A 1 89  ? -68.936  -5.872  -80.730  1.00 0.00 ? 89  TYR A CE1  1  
ATOM   1281   C CE2  . TYR A 1 89  ? -68.101  -8.038  -80.046  1.00 0.00 ? 89  TYR A CE2  1  
ATOM   1282   C CZ   . TYR A 1 89  ? -68.901  -6.916  -79.799  1.00 0.00 ? 89  TYR A CZ   1  
ATOM   1283   O OH   . TYR A 1 89  ? -69.651  -6.839  -78.642  1.00 0.00 ? 89  TYR A OH   1  
ATOM   1284   H H    . TYR A 1 89  ? -64.692  -7.531  -85.061  1.00 0.00 ? 89  TYR A H    1  
ATOM   1285   H HA   . TYR A 1 89  ? -65.444  -5.355  -83.496  1.00 0.00 ? 89  TYR A HA   1  
ATOM   1286   H HB2  . TYR A 1 89  ? -67.148  -6.765  -84.229  1.00 0.00 ? 89  TYR A HB2  1  
ATOM   1287   H HB3  . TYR A 1 89  ? -66.347  -8.199  -83.619  1.00 0.00 ? 89  TYR A HB3  1  
ATOM   1288   H HD1  . TYR A 1 89  ? -68.199  -5.145  -82.612  1.00 0.00 ? 89  TYR A HD1  1  
ATOM   1289   H HD2  . TYR A 1 89  ? -66.725  -8.975  -81.400  1.00 0.00 ? 89  TYR A HD2  1  
ATOM   1290   H HE1  . TYR A 1 89  ? -69.551  -5.000  -80.544  1.00 0.00 ? 89  TYR A HE1  1  
ATOM   1291   H HE2  . TYR A 1 89  ? -68.070  -8.850  -79.332  1.00 0.00 ? 89  TYR A HE2  1  
ATOM   1292   H HH   . TYR A 1 89  ? -69.082  -6.506  -77.942  1.00 0.00 ? 89  TYR A HH   1  
ATOM   1293   N N    . GLU A 1 90  ? -64.095  -7.800  -81.703  1.00 0.00 ? 90  GLU A N    1  
ATOM   1294   C CA   . GLU A 1 90  ? -63.428  -8.058  -80.430  1.00 0.00 ? 90  GLU A CA   1  
ATOM   1295   C C    . GLU A 1 90  ? -62.281  -7.085  -80.256  1.00 0.00 ? 90  GLU A C    1  
ATOM   1296   O O    . GLU A 1 90  ? -62.099  -6.529  -79.178  1.00 0.00 ? 90  GLU A O    1  
ATOM   1297   C CB   . GLU A 1 90  ? -62.943  -9.518  -80.279  1.00 0.00 ? 90  GLU A CB   1  
ATOM   1298   C CG   . GLU A 1 90  ? -62.230  -10.094 -81.505  1.00 0.00 ? 90  GLU A CG   1  
ATOM   1299   C CD   . GLU A 1 90  ? -61.901  -11.591 -81.264  1.00 0.00 ? 90  GLU A CD   1  
ATOM   1300   O OE1  . GLU A 1 90  ? -61.469  -11.927 -80.148  1.00 0.00 ? 90  GLU A OE1  1  
ATOM   1301   O OE2  . GLU A 1 90  ? -62.090  -12.379 -82.209  1.00 0.00 ? 90  GLU A OE2  1  
ATOM   1302   H H    . GLU A 1 90  ? -64.182  -8.518  -82.363  1.00 0.00 ? 90  GLU A H    1  
ATOM   1303   H HA   . GLU A 1 90  ? -64.130  -7.869  -79.632  1.00 0.00 ? 90  GLU A HA   1  
ATOM   1304   H HB2  . GLU A 1 90  ? -62.262  -9.560  -79.459  1.00 0.00 ? 90  GLU A HB2  1  
ATOM   1305   H HB3  . GLU A 1 90  ? -63.799  -10.124 -80.065  1.00 0.00 ? 90  GLU A HB3  1  
ATOM   1306   H HG2  . GLU A 1 90  ? -62.867  -10.012 -82.360  1.00 0.00 ? 90  GLU A HG2  1  
ATOM   1307   H HG3  . GLU A 1 90  ? -61.315  -9.559  -81.669  1.00 0.00 ? 90  GLU A HG3  1  
ATOM   1308   N N    . HIS A 1 91  ? -61.581  -6.806  -81.342  1.00 0.00 ? 91  HIS A N    1  
ATOM   1309   C CA   . HIS A 1 91  ? -60.501  -5.826  -81.301  1.00 0.00 ? 91  HIS A CA   1  
ATOM   1310   C C    . HIS A 1 91  ? -61.029  -4.437  -80.920  1.00 0.00 ? 91  HIS A C    1  
ATOM   1311   O O    . HIS A 1 91  ? -60.337  -3.695  -80.218  1.00 0.00 ? 91  HIS A O    1  
ATOM   1312   C CB   . HIS A 1 91  ? -59.811  -5.756  -82.658  1.00 0.00 ? 91  HIS A CB   1  
ATOM   1313   C CG   . HIS A 1 91  ? -58.509  -5.028  -82.567  1.00 0.00 ? 91  HIS A CG   1  
ATOM   1314   N ND1  . HIS A 1 91  ? -57.811  -4.651  -83.715  1.00 0.00 ? 91  HIS A ND1  1  
ATOM   1315   C CD2  . HIS A 1 91  ? -57.766  -4.613  -81.526  1.00 0.00 ? 91  HIS A CD2  1  
ATOM   1316   C CE1  . HIS A 1 91  ? -56.703  -4.039  -83.327  1.00 0.00 ? 91  HIS A CE1  1  
ATOM   1317   N NE2  . HIS A 1 91  ? -56.624  -3.989  -82.002  1.00 0.00 ? 91  HIS A NE2  1  
ATOM   1318   H H    . HIS A 1 91  ? -61.814  -7.238  -82.191  1.00 0.00 ? 91  HIS A H    1  
ATOM   1319   H HA   . HIS A 1 91  ? -59.794  -6.132  -80.567  1.00 0.00 ? 91  HIS A HA   1  
ATOM   1320   H HB2  . HIS A 1 91  ? -59.616  -6.751  -82.997  1.00 0.00 ? 91  HIS A HB2  1  
ATOM   1321   H HB3  . HIS A 1 91  ? -60.450  -5.249  -83.355  1.00 0.00 ? 91  HIS A HB3  1  
ATOM   1322   H HD1  . HIS A 1 91  ? -58.079  -4.824  -84.627  1.00 0.00 ? 91  HIS A HD1  1  
ATOM   1323   H HD2  . HIS A 1 91  ? -58.006  -4.759  -80.474  1.00 0.00 ? 91  HIS A HD2  1  
ATOM   1324   H HE1  . HIS A 1 91  ? -55.953  -3.621  -84.005  1.00 0.00 ? 91  HIS A HE1  1  
ATOM   1325   H HE2  . HIS A 1 91  ? -55.928  -3.598  -81.480  1.00 0.00 ? 91  HIS A HE2  1  
ATOM   1326   N N    . THR A 1 92  ? -62.227  -4.077  -81.393  1.00 0.00 ? 92  THR A N    1  
ATOM   1327   C CA   . THR A 1 92  ? -62.785  -2.772  -81.062  1.00 0.00 ? 92  THR A CA   1  
ATOM   1328   C C    . THR A 1 92  ? -63.151  -2.779  -79.599  1.00 0.00 ? 92  THR A C    1  
ATOM   1329   O O    . THR A 1 92  ? -62.784  -1.868  -78.863  1.00 0.00 ? 92  THR A O    1  
ATOM   1330   C CB   . THR A 1 92  ? -63.997  -2.431  -81.959  1.00 0.00 ? 92  THR A CB   1  
ATOM   1331   O OG1  . THR A 1 92  ? -63.603  -2.542  -83.321  1.00 0.00 ? 92  THR A OG1  1  
ATOM   1332   C CG2  . THR A 1 92  ? -64.473  -1.000  -81.716  1.00 0.00 ? 92  THR A CG2  1  
ATOM   1333   H H    . THR A 1 92  ? -62.730  -4.694  -81.954  1.00 0.00 ? 92  THR A H    1  
ATOM   1334   H HA   . THR A 1 92  ? -62.026  -2.025  -81.216  1.00 0.00 ? 92  THR A HA   1  
ATOM   1335   H HB   . THR A 1 92  ? -64.807  -3.111  -81.755  1.00 0.00 ? 92  THR A HB   1  
ATOM   1336   H HG1  . THR A 1 92  ? -63.104  -3.354  -83.420  1.00 0.00 ? 92  THR A HG1  1  
ATOM   1337   H HG21 . THR A 1 92  ? -63.830  -0.315  -82.248  1.00 0.00 ? 92  THR A HG21 1  
ATOM   1338   H HG22 . THR A 1 92  ? -64.445  -0.783  -80.662  1.00 0.00 ? 92  THR A HG22 1  
ATOM   1339   H HG23 . THR A 1 92  ? -65.486  -0.897  -82.082  1.00 0.00 ? 92  THR A HG23 1  
ATOM   1340   N N    . MET A 1 93  ? -63.783  -3.877  -79.177  1.00 0.00 ? 93  MET A N    1  
ATOM   1341   C CA   . MET A 1 93  ? -64.174  -4.058  -77.792  1.00 0.00 ? 93  MET A CA   1  
ATOM   1342   C C    . MET A 1 93  ? -62.934  -3.970  -76.847  1.00 0.00 ? 93  MET A C    1  
ATOM   1343   O O    . MET A 1 93  ? -63.008  -3.305  -75.822  1.00 0.00 ? 93  MET A O    1  
ATOM   1344   C CB   . MET A 1 93  ? -64.833  -5.467  -77.595  1.00 0.00 ? 93  MET A CB   1  
ATOM   1345   C CG   . MET A 1 93  ? -66.173  -5.547  -78.365  1.00 0.00 ? 93  MET A CG   1  
ATOM   1346   S SD   . MET A 1 93  ? -67.129  -4.033  -78.090  1.00 0.00 ? 93  MET A SD   1  
ATOM   1347   C CE   . MET A 1 93  ? -67.576  -4.171  -76.341  1.00 0.00 ? 93  MET A CE   1  
ATOM   1348   H H    . MET A 1 93  ? -63.959  -4.590  -79.815  1.00 0.00 ? 93  MET A H    1  
ATOM   1349   H HA   . MET A 1 93  ? -64.859  -3.312  -77.492  1.00 0.00 ? 93  MET A HA   1  
ATOM   1350   H HB2  . MET A 1 93  ? -64.179  -6.214  -77.977  1.00 0.00 ? 93  MET A HB2  1  
ATOM   1351   H HB3  . MET A 1 93  ? -65.023  -5.616  -76.561  1.00 0.00 ? 93  MET A HB3  1  
ATOM   1352   H HG2  . MET A 1 93  ? -65.968  -5.667  -79.415  1.00 0.00 ? 93  MET A HG2  1  
ATOM   1353   H HG3  . MET A 1 93  ? -66.714  -6.403  -77.998  1.00 0.00 ? 93  MET A HG3  1  
ATOM   1354   H HE1  . MET A 1 93  ? -68.142  -3.288  -76.058  1.00 0.00 ? 93  MET A HE1  1  
ATOM   1355   H HE2  . MET A 1 93  ? -66.688  -4.232  -75.739  1.00 0.00 ? 93  MET A HE2  1  
ATOM   1356   H HE3  . MET A 1 93  ? -68.180  -5.051  -76.193  1.00 0.00 ? 93  MET A HE3  1  
ATOM   1357   N N    . LEU A 1 94  ? -61.865  -4.637  -77.228  1.00 0.00 ? 94  LEU A N    1  
ATOM   1358   C CA   . LEU A 1 94  ? -60.641  -4.630  -76.447  1.00 0.00 ? 94  LEU A CA   1  
ATOM   1359   C C    . LEU A 1 94  ? -60.081  -3.214  -76.179  1.00 0.00 ? 94  LEU A C    1  
ATOM   1360   O O    . LEU A 1 94  ? -59.168  -3.083  -75.378  1.00 0.00 ? 94  LEU A O    1  
ATOM   1361   C CB   . LEU A 1 94  ? -59.579  -5.464  -77.171  1.00 0.00 ? 94  LEU A CB   1  
ATOM   1362   C CG   . LEU A 1 94  ? -59.487  -6.917  -76.659  1.00 0.00 ? 94  LEU A CG   1  
ATOM   1363   C CD1  . LEU A 1 94  ? -60.778  -7.671  -76.957  1.00 0.00 ? 94  LEU A CD1  1  
ATOM   1364   C CD2  . LEU A 1 94  ? -58.273  -7.634  -77.313  1.00 0.00 ? 94  LEU A CD2  1  
ATOM   1365   H H    . LEU A 1 94  ? -61.888  -5.161  -78.055  1.00 0.00 ? 94  LEU A H    1  
ATOM   1366   H HA   . LEU A 1 94  ? -60.857  -5.081  -75.505  1.00 0.00 ? 94  LEU A HA   1  
ATOM   1367   H HB2  . LEU A 1 94  ? -59.828  -5.490  -78.208  1.00 0.00 ? 94  LEU A HB2  1  
ATOM   1368   H HB3  . LEU A 1 94  ? -58.631  -4.997  -77.034  1.00 0.00 ? 94  LEU A HB3  1  
ATOM   1369   H HG   . LEU A 1 94  ? -59.336  -6.898  -75.604  1.00 0.00 ? 94  LEU A HG   1  
ATOM   1370   H HD11 . LEU A 1 94  ? -61.617  -7.001  -76.826  1.00 0.00 ? 94  LEU A HD11 1  
ATOM   1371   H HD12 . LEU A 1 94  ? -60.869  -8.496  -76.265  1.00 0.00 ? 94  LEU A HD12 1  
ATOM   1372   H HD13 . LEU A 1 94  ? -60.769  -8.045  -77.967  1.00 0.00 ? 94  LEU A HD13 1  
ATOM   1373   H HD21 . LEU A 1 94  ? -58.378  -8.703  -77.189  1.00 0.00 ? 94  LEU A HD21 1  
ATOM   1374   H HD22 . LEU A 1 94  ? -57.361  -7.310  -76.823  1.00 0.00 ? 94  LEU A HD22 1  
ATOM   1375   H HD23 . LEU A 1 94  ? -58.216  -7.396  -78.363  1.00 0.00 ? 94  LEU A HD23 1  
ATOM   1376   N N    . GLN A 1 95  ? -60.693  -2.174  -76.755  1.00 0.00 ? 95  GLN A N    1  
ATOM   1377   C CA   . GLN A 1 95  ? -60.277  -0.784  -76.478  1.00 0.00 ? 95  GLN A CA   1  
ATOM   1378   C C    . GLN A 1 95  ? -61.341  -0.089  -75.629  1.00 0.00 ? 95  GLN A C    1  
ATOM   1379   O O    . GLN A 1 95  ? -61.042  0.452   -74.574  1.00 0.00 ? 95  GLN A O    1  
ATOM   1380   C CB   . GLN A 1 95  ? -60.099  0.073   -77.716  1.00 0.00 ? 95  GLN A CB   1  
ATOM   1381   C CG   . GLN A 1 95  ? -59.669  -0.731  -78.908  1.00 0.00 ? 95  GLN A CG   1  
ATOM   1382   C CD   . GLN A 1 95  ? -58.527  -1.618  -78.550  1.00 0.00 ? 95  GLN A CD   1  
ATOM   1383   O OE1  . GLN A 1 95  ? -58.714  -2.830  -78.384  1.00 0.00 ? 95  GLN A OE1  1  
ATOM   1384   N NE2  . GLN A 1 95  ? -57.348  -1.070  -78.424  1.00 0.00 ? 95  GLN A NE2  1  
ATOM   1385   H H    . GLN A 1 95  ? -61.454  -2.340  -77.325  1.00 0.00 ? 95  GLN A H    1  
ATOM   1386   H HA   . GLN A 1 95  ? -59.364  -0.789  -75.921  1.00 0.00 ? 95  GLN A HA   1  
ATOM   1387   H HB2  . GLN A 1 95  ? -61.029  0.553   -77.959  1.00 0.00 ? 95  GLN A HB2  1  
ATOM   1388   H HB3  . GLN A 1 95  ? -59.354  0.821   -77.507  1.00 0.00 ? 95  GLN A HB3  1  
ATOM   1389   H HG2  . GLN A 1 95  ? -60.490  -1.315  -79.260  1.00 0.00 ? 95  GLN A HG2  1  
ATOM   1390   H HG3  . GLN A 1 95  ? -59.344  -0.045  -79.678  1.00 0.00 ? 95  GLN A HG3  1  
ATOM   1391   H HE21 . GLN A 1 95  ? -57.249  -0.097  -78.566  1.00 0.00 ? 95  GLN A HE21 1  
ATOM   1392   H HE22 . GLN A 1 95  ? -56.568  -1.608  -78.198  1.00 0.00 ? 95  GLN A HE22 1  
ATOM   1393   N N    . LEU A 1 96  ? -62.578  -0.111  -76.101  1.00 0.00 ? 96  LEU A N    1  
ATOM   1394   C CA   . LEU A 1 96  ? -63.672  0.514   -75.364  1.00 0.00 ? 96  LEU A CA   1  
ATOM   1395   C C    . LEU A 1 96  ? -64.037  -0.392  -74.174  1.00 0.00 ? 96  LEU A C    1  
ATOM   1396   O O    . LEU A 1 96  ? -65.105  -0.260  -73.561  1.00 0.00 ? 96  LEU A O    1  
ATOM   1397   C CB   . LEU A 1 96  ? -64.899  0.685   -76.279  1.00 0.00 ? 96  LEU A CB   1  
ATOM   1398   C CG   . LEU A 1 96  ? -64.826  1.946   -77.144  1.00 0.00 ? 96  LEU A CG   1  
ATOM   1399   C CD1  . LEU A 1 96  ? -63.487  1.974   -77.870  1.00 0.00 ? 96  LEU A CD1  1  
ATOM   1400   C CD2  . LEU A 1 96  ? -66.024  1.963   -78.129  1.00 0.00 ? 96  LEU A CD2  1  
ATOM   1401   H H    . LEU A 1 96  ? -62.760  -0.549  -76.961  1.00 0.00 ? 96  LEU A H    1  
ATOM   1402   H HA   . LEU A 1 96  ? -63.360  1.465   -74.976  1.00 0.00 ? 96  LEU A HA   1  
ATOM   1403   H HB2  . LEU A 1 96  ? -64.963  -0.166  -76.918  1.00 0.00 ? 96  LEU A HB2  1  
ATOM   1404   H HB3  . LEU A 1 96  ? -65.772  0.746   -75.663  1.00 0.00 ? 96  LEU A HB3  1  
ATOM   1405   H HG   . LEU A 1 96  ? -64.897  2.807   -76.516  1.00 0.00 ? 96  LEU A HG   1  
ATOM   1406   H HD11 . LEU A 1 96  ? -62.706  2.135   -77.134  1.00 0.00 ? 96  LEU A HD11 1  
ATOM   1407   H HD12 . LEU A 1 96  ? -63.474  2.778   -78.585  1.00 0.00 ? 96  LEU A HD12 1  
ATOM   1408   H HD13 . LEU A 1 96  ? -63.316  1.035   -78.369  1.00 0.00 ? 96  LEU A HD13 1  
ATOM   1409   H HD21 . LEU A 1 96  ? -66.088  2.936   -78.599  1.00 0.00 ? 96  LEU A HD21 1  
ATOM   1410   H HD22 . LEU A 1 96  ? -66.941  1.779   -77.577  1.00 0.00 ? 96  LEU A HD22 1  
ATOM   1411   H HD23 . LEU A 1 96  ? -65.901  1.205   -78.881  1.00 0.00 ? 96  LEU A HD23 1  
ATOM   1412   N N    . TYR A 1 97  ? -63.179  -1.377  -73.960  1.00 0.00 ? 97  TYR A N    1  
ATOM   1413   C CA   . TYR A 1 97  ? -63.359  -2.380  -72.932  1.00 0.00 ? 97  TYR A CA   1  
ATOM   1414   C C    . TYR A 1 97  ? -62.100  -3.240  -72.979  1.00 0.00 ? 97  TYR A C    1  
ATOM   1415   O O    . TYR A 1 97  ? -62.106  -4.272  -73.681  1.00 0.00 ? 97  TYR A O    1  
ATOM   1416   C CB   . TYR A 1 97  ? -64.578  -3.252  -73.364  1.00 0.00 ? 97  TYR A CB   1  
ATOM   1417   C CG   . TYR A 1 97  ? -65.768  -3.321  -72.376  1.00 0.00 ? 97  TYR A CG   1  
ATOM   1418   C CD1  . TYR A 1 97  ? -65.567  -3.531  -71.000  1.00 0.00 ? 97  TYR A CD1  1  
ATOM   1419   C CD2  . TYR A 1 97  ? -67.097  -3.175  -72.874  1.00 0.00 ? 97  TYR A CD2  1  
ATOM   1420   C CE1  . TYR A 1 97  ? -66.668  -3.592  -70.121  1.00 0.00 ? 97  TYR A CE1  1  
ATOM   1421   C CE2  . TYR A 1 97  ? -68.198  -3.241  -71.994  1.00 0.00 ? 97  TYR A CE2  1  
ATOM   1422   C CZ   . TYR A 1 97  ? -67.984  -3.440  -70.615  1.00 0.00 ? 97  TYR A CZ   1  
ATOM   1423   O OH   . TYR A 1 97  ? -69.063  -3.488  -69.749  1.00 0.00 ? 97  TYR A OH   1  
ATOM   1424   H H    . TYR A 1 97  ? -62.411  -1.465  -74.554  1.00 0.00 ? 97  TYR A H    1  
ATOM   1425   H HA   . TYR A 1 97  ? -63.498  -1.952  -71.961  1.00 0.00 ? 97  TYR A HA   1  
ATOM   1426   H HB2  . TYR A 1 97  ? -64.951  -2.847  -74.281  1.00 0.00 ? 97  TYR A HB2  1  
ATOM   1427   H HB3  . TYR A 1 97  ? -64.226  -4.249  -73.551  1.00 0.00 ? 97  TYR A HB3  1  
ATOM   1428   H HD1  . TYR A 1 97  ? -64.572  -3.645  -70.614  1.00 0.00 ? 97  TYR A HD1  1  
ATOM   1429   H HD2  . TYR A 1 97  ? -67.266  -3.020  -73.924  1.00 0.00 ? 97  TYR A HD2  1  
ATOM   1430   H HE1  . TYR A 1 97  ? -66.496  -3.743  -69.059  1.00 0.00 ? 97  TYR A HE1  1  
ATOM   1431   H HE2  . TYR A 1 97  ? -69.210  -3.117  -72.378  1.00 0.00 ? 97  TYR A HE2  1  
ATOM   1432   H HH   . TYR A 1 97  ? -68.824  -4.032  -68.997  1.00 0.00 ? 97  TYR A HH   1  
ATOM   1433   N N    . PRO A 1 98  ? -61.008  -2.898  -72.318  1.00 0.00 ? 98  PRO A N    1  
ATOM   1434   C CA   . PRO A 1 98  ? -59.801  -3.725  -72.410  1.00 0.00 ? 98  PRO A CA   1  
ATOM   1435   C C    . PRO A 1 98  ? -59.848  -4.784  -71.337  1.00 0.00 ? 98  PRO A C    1  
ATOM   1436   O O    . PRO A 1 98  ? -60.700  -4.710  -70.461  1.00 0.00 ? 98  PRO A O    1  
ATOM   1437   C CB   . PRO A 1 98  ? -58.651  -2.758  -72.171  1.00 0.00 ? 98  PRO A CB   1  
ATOM   1438   C CG   . PRO A 1 98  ? -59.225  -1.626  -71.365  1.00 0.00 ? 98  PRO A CG   1  
ATOM   1439   C CD   . PRO A 1 98  ? -60.776  -1.753  -71.395  1.00 0.00 ? 98  PRO A CD   1  
ATOM   1440   H HA   . PRO A 1 98  ? -59.728  -4.164  -73.402  1.00 0.00 ? 98  PRO A HA   1  
ATOM   1441   H HB2  . PRO A 1 98  ? -57.861  -3.255  -71.616  1.00 0.00 ? 98  PRO A HB2  1  
ATOM   1442   H HB3  . PRO A 1 98  ? -58.265  -2.387  -73.108  1.00 0.00 ? 98  PRO A HB3  1  
ATOM   1443   H HG2  . PRO A 1 98  ? -58.857  -1.686  -70.347  1.00 0.00 ? 98  PRO A HG2  1  
ATOM   1444   H HG3  . PRO A 1 98  ? -58.926  -0.685  -71.800  1.00 0.00 ? 98  PRO A HG3  1  
ATOM   1445   H HD2  . PRO A 1 98  ? -61.152  -1.982  -70.397  1.00 0.00 ? 98  PRO A HD2  1  
ATOM   1446   H HD3  . PRO A 1 98  ? -61.233  -0.856  -71.775  1.00 0.00 ? 98  PRO A HD3  1  
ATOM   1447   N N    . SER A 1 99  ? -59.029  -5.828  -71.451  1.00 0.00 ? 99  SER A N    1  
ATOM   1448   C CA   . SER A 1 99  ? -59.083  -6.924  -70.470  1.00 0.00 ? 99  SER A CA   1  
ATOM   1449   C C    . SER A 1 99  ? -58.044  -6.811  -69.365  1.00 0.00 ? 99  SER A C    1  
ATOM   1450   O O    . SER A 1 99  ? -57.060  -6.112  -69.531  1.00 0.00 ? 99  SER A O    1  
ATOM   1451   C CB   . SER A 1 99  ? -58.911  -8.263  -71.202  1.00 0.00 ? 99  SER A CB   1  
ATOM   1452   O OG   . SER A 1 99  ? -58.074  -9.140  -70.452  1.00 0.00 ? 99  SER A OG   1  
ATOM   1453   H H    . SER A 1 99  ? -58.435  -5.889  -72.225  1.00 0.00 ? 99  SER A H    1  
ATOM   1454   H HA   . SER A 1 99  ? -60.061  -6.905  -70.021  1.00 0.00 ? 99  SER A HA   1  
ATOM   1455   H HB2  . SER A 1 99  ? -59.875  -8.729  -71.321  1.00 0.00 ? 99  SER A HB2  1  
ATOM   1456   H HB3  . SER A 1 99  ? -58.480  -8.086  -72.172  1.00 0.00 ? 99  SER A HB3  1  
ATOM   1457   H HG   . SER A 1 99  ? -58.496  -10.004 -70.432  1.00 0.00 ? 99  SER A HG   1  
ATOM   1458   N N    . PRO A 1 100 ? -58.278  -7.511  -68.265  1.00 0.00 ? 100 PRO A N    1  
ATOM   1459   C CA   . PRO A 1 100 ? -57.393  -7.541  -67.067  1.00 0.00 ? 100 PRO A CA   1  
ATOM   1460   C C    . PRO A 1 100 ? -56.000  -8.060  -67.348  1.00 0.00 ? 100 PRO A C    1  
ATOM   1461   O O    . PRO A 1 100 ? -55.106  -7.835  -66.540  1.00 0.00 ? 100 PRO A O    1  
ATOM   1462   C CB   . PRO A 1 100 ? -58.127  -8.479  -66.134  1.00 0.00 ? 100 PRO A CB   1  
ATOM   1463   C CG   . PRO A 1 100 ? -58.894  -9.334  -67.035  1.00 0.00 ? 100 PRO A CG   1  
ATOM   1464   C CD   . PRO A 1 100 ? -59.438  -8.363  -68.036  1.00 0.00 ? 100 PRO A CD   1  
ATOM   1465   H HA   . PRO A 1 100 ? -57.344  -6.569  -66.628  1.00 0.00 ? 100 PRO A HA   1  
ATOM   1466   H HB2  . PRO A 1 100 ? -57.436  -9.070  -65.560  1.00 0.00 ? 100 PRO A HB2  1  
ATOM   1467   H HB3  . PRO A 1 100 ? -58.799  -7.928  -65.494  1.00 0.00 ? 100 PRO A HB3  1  
ATOM   1468   H HG2  . PRO A 1 100 ? -58.237  -10.043 -67.517  1.00 0.00 ? 100 PRO A HG2  1  
ATOM   1469   H HG3  . PRO A 1 100 ? -59.682  -9.825  -66.513  1.00 0.00 ? 100 PRO A HG3  1  
ATOM   1470   H HD2  . PRO A 1 100 ? -59.741  -8.874  -68.926  1.00 0.00 ? 100 PRO A HD2  1  
ATOM   1471   H HD3  . PRO A 1 100 ? -60.253  -7.786  -67.616  1.00 0.00 ? 100 PRO A HD3  1  
ATOM   1472   N N    . PHE A 1 101 ? -55.837  -8.778  -68.460  1.00 0.00 ? 101 PHE A N    1  
ATOM   1473   C CA   . PHE A 1 101 ? -54.528  -9.348  -68.824  1.00 0.00 ? 101 PHE A CA   1  
ATOM   1474   C C    . PHE A 1 101 ? -53.599  -8.367  -69.544  1.00 0.00 ? 101 PHE A C    1  
ATOM   1475   O O    . PHE A 1 101 ? -53.242  -8.557  -70.706  1.00 0.00 ? 101 PHE A O    1  
ATOM   1476   C CB   . PHE A 1 101 ? -54.741  -10.623 -69.643  1.00 0.00 ? 101 PHE A CB   1  
ATOM   1477   C CG   . PHE A 1 101 ? -54.471  -10.438 -71.099  1.00 0.00 ? 101 PHE A CG   1  
ATOM   1478   C CD1  . PHE A 1 101 ? -55.236  -9.555  -71.833  1.00 0.00 ? 101 PHE A CD1  1  
ATOM   1479   C CD2  . PHE A 1 101 ? -53.484  -11.183 -71.710  1.00 0.00 ? 101 PHE A CD2  1  
ATOM   1480   C CE1  . PHE A 1 101 ? -55.004  -9.414  -73.191  1.00 0.00 ? 101 PHE A CE1  1  
ATOM   1481   C CE2  . PHE A 1 101 ? -53.248  -11.038 -73.062  1.00 0.00 ? 101 PHE A CE2  1  
ATOM   1482   C CZ   . PHE A 1 101 ? -54.014  -10.160 -73.808  1.00 0.00 ? 101 PHE A CZ   1  
ATOM   1483   H H    . PHE A 1 101 ? -56.611  -8.945  -69.029  1.00 0.00 ? 101 PHE A H    1  
ATOM   1484   H HA   . PHE A 1 101 ? -54.036  -9.627  -67.923  1.00 0.00 ? 101 PHE A HA   1  
ATOM   1485   H HB2  . PHE A 1 101 ? -54.085  -11.389 -69.266  1.00 0.00 ? 101 PHE A HB2  1  
ATOM   1486   H HB3  . PHE A 1 101 ? -55.763  -10.945 -69.530  1.00 0.00 ? 101 PHE A HB3  1  
ATOM   1487   H HD1  . PHE A 1 101 ? -55.989  -8.966  -71.356  1.00 0.00 ? 101 PHE A HD1  1  
ATOM   1488   H HD2  . PHE A 1 101 ? -52.897  -11.873 -71.137  1.00 0.00 ? 101 PHE A HD2  1  
ATOM   1489   H HE1  . PHE A 1 101 ? -55.614  -8.745  -73.770  1.00 0.00 ? 101 PHE A HE1  1  
ATOM   1490   H HE2  . PHE A 1 101 ? -52.480  -11.621 -73.536  1.00 0.00 ? 101 PHE A HE2  1  
ATOM   1491   H HZ   . PHE A 1 101 ? -53.830  -10.044 -74.861  1.00 0.00 ? 101 PHE A HZ   1  
ATOM   1492   N N    . ALA A 1 102 ? -53.197  -7.309  -68.846  1.00 0.00 ? 102 ALA A N    1  
ATOM   1493   C CA   . ALA A 1 102 ? -52.320  -6.340  -69.464  1.00 0.00 ? 102 ALA A CA   1  
ATOM   1494   C C    . ALA A 1 102 ? -51.195  -7.088  -70.180  1.00 0.00 ? 102 ALA A C    1  
ATOM   1495   O O    . ALA A 1 102 ? -50.617  -6.597  -71.144  1.00 0.00 ? 102 ALA A O    1  
ATOM   1496   C CB   . ALA A 1 102 ? -51.748  -5.356  -68.415  1.00 0.00 ? 102 ALA A CB   1  
ATOM   1497   H H    . ALA A 1 102 ? -53.494  -7.189  -67.923  1.00 0.00 ? 102 ALA A H    1  
ATOM   1498   H HA   . ALA A 1 102 ? -52.890  -5.781  -70.197  1.00 0.00 ? 102 ALA A HA   1  
ATOM   1499   H HB1  . ALA A 1 102 ? -51.128  -5.893  -67.715  1.00 0.00 ? 102 ALA A HB1  1  
ATOM   1500   H HB2  . ALA A 1 102 ? -52.560  -4.879  -67.884  1.00 0.00 ? 102 ALA A HB2  1  
ATOM   1501   H HB3  . ALA A 1 102 ? -51.156  -4.598  -68.912  1.00 0.00 ? 102 ALA A HB3  1  
ATOM   1502   N N    . THR A 1 103 ? -50.907  -8.291  -69.653  1.00 0.00 ? 103 THR A N    1  
ATOM   1503   C CA   . THR A 1 103 ? -49.867  -9.137  -70.170  1.00 0.00 ? 103 THR A CA   1  
ATOM   1504   C C    . THR A 1 103 ? -50.383  -9.544  -71.687  1.00 0.00 ? 103 THR A C    1  
ATOM   1505   O O    . THR A 1 103 ? -51.535  -9.312  -71.961  1.00 0.00 ? 103 THR A O    1  
ATOM   1506   C CB   . THR A 1 103 ? -49.693  -10.462 -69.410  1.00 0.00 ? 103 THR A CB   1  
ATOM   1507   O OG1  . THR A 1 103 ? -50.154  -10.293 -68.077  1.00 0.00 ? 103 THR A OG1  1  
ATOM   1508   C CG2  . THR A 1 103 ? -48.212  -10.879 -69.402  1.00 0.00 ? 103 THR A CG2  1  
ATOM   1509   H H    . THR A 1 103 ? -51.417  -8.609  -68.901  1.00 0.00 ? 103 THR A H    1  
ATOM   1510   H HA   . THR A 1 103 ? -48.950  -8.609  -70.291  1.00 0.00 ? 103 THR A HA   1  
ATOM   1511   H HB   . THR A 1 103 ? -50.266  -11.253 -69.887  1.00 0.00 ? 103 THR A HB   1  
ATOM   1512   H HG1  . THR A 1 103 ? -50.388  -9.370  -67.957  1.00 0.00 ? 103 THR A HG1  1  
ATOM   1513   H HG21 . THR A 1 103 ? -47.601  -10.029 -69.139  1.00 0.00 ? 103 THR A HG21 1  
ATOM   1514   H HG22 . THR A 1 103 ? -47.926  -11.240 -70.379  1.00 0.00 ? 103 THR A HG22 1  
ATOM   1515   H HG23 . THR A 1 103 ? -48.067  -11.663 -68.673  1.00 0.00 ? 103 THR A HG23 1  
ATOM   1516   N N    . CYS A 1 104 ? -49.465  -10.052 -72.440  1.00 0.00 ? 104 CYS A N    1  
ATOM   1517   C CA   . CYS A 1 104 ? -49.816  -10.385 -73.759  1.00 0.00 ? 104 CYS A CA   1  
ATOM   1518   C C    . CYS A 1 104 ? -49.818  -12.002 -73.947  1.00 0.00 ? 104 CYS A C    1  
ATOM   1519   O O    . CYS A 1 104 ? -49.228  -12.694 -73.139  1.00 0.00 ? 104 CYS A O    1  
ATOM   1520   C CB   . CYS A 1 104 ? -48.713  -9.773  -74.794  1.00 0.00 ? 104 CYS A CB   1  
ATOM   1521   S SG   . CYS A 1 104 ? -48.340  -8.070  -74.379  1.00 0.00 ? 104 CYS A SG   1  
ATOM   1522   H H    . CYS A 1 104 ? -48.537  -10.174 -72.107  1.00 0.00 ? 104 CYS A H    1  
ATOM   1523   H HA   . CYS A 1 104 ? -50.765  -10.024 -74.036  1.00 0.00 ? 104 CYS A HA   1  
ATOM   1524   H HB2  . CYS A 1 104 ? -47.840  -10.356 -74.710  1.00 0.00 ? 104 CYS A HB2  1  
ATOM   1525   H HB3  . CYS A 1 104 ? -49.137  -9.837  -75.763  1.00 0.00 ? 104 CYS A HB3  1  
ATOM   1526   N N    . ASP A 1 105 ? -50.523  -12.434 -74.973  1.00 0.00 ? 105 ASP A N    1  
ATOM   1527   C CA   . ASP A 1 105 ? -50.660  -13.865 -75.194  1.00 0.00 ? 105 ASP A CA   1  
ATOM   1528   C C    . ASP A 1 105 ? -49.310  -14.597 -75.199  1.00 0.00 ? 105 ASP A C    1  
ATOM   1529   O O    . ASP A 1 105 ? -48.251  -13.982 -75.340  1.00 0.00 ? 105 ASP A O    1  
ATOM   1530   C CB   . ASP A 1 105 ? -51.440  -14.160 -76.539  1.00 0.00 ? 105 ASP A CB   1  
ATOM   1531   C CG   . ASP A 1 105 ? -51.049  -13.195 -77.664  1.00 0.00 ? 105 ASP A CG   1  
ATOM   1532   O OD1  . ASP A 1 105 ? -49.927  -12.685 -77.639  1.00 0.00 ? 105 ASP A OD1  1  
ATOM   1533   O OD2  . ASP A 1 105 ? -51.888  -12.991 -78.552  1.00 0.00 ? 105 ASP A OD2  1  
ATOM   1534   H H    . ASP A 1 105 ? -50.980  -11.795 -75.566  1.00 0.00 ? 105 ASP A H    1  
ATOM   1535   H HA   . ASP A 1 105 ? -51.258  -14.270 -74.402  1.00 0.00 ? 105 ASP A HA   1  
ATOM   1536   H HB2  . ASP A 1 105 ? -51.222  -15.166 -76.840  1.00 0.00 ? 105 ASP A HB2  1  
ATOM   1537   H HB3  . ASP A 1 105 ? -52.493  -14.065 -76.335  1.00 0.00 ? 105 ASP A HB3  1  
ATOM   1538   N N    . PHE A 1 106 ? -49.373  -15.904 -74.882  1.00 0.00 ? 106 PHE A N    1  
ATOM   1539   C CA   . PHE A 1 106 ? -48.195  -16.740 -74.759  1.00 0.00 ? 106 PHE A CA   1  
ATOM   1540   C C    . PHE A 1 106 ? -47.453  -16.336 -73.462  1.00 0.00 ? 106 PHE A C    1  
ATOM   1541   O O    . PHE A 1 106 ? -46.233  -16.230 -73.440  1.00 0.00 ? 106 PHE A O    1  
ATOM   1542   C CB   . PHE A 1 106 ? -47.277  -16.615 -75.990  1.00 0.00 ? 106 PHE A CB   1  
ATOM   1543   C CG   . PHE A 1 106 ? -48.061  -16.247 -77.248  1.00 0.00 ? 106 PHE A CG   1  
ATOM   1544   C CD1  . PHE A 1 106 ? -49.190  -16.975 -77.625  1.00 0.00 ? 106 PHE A CD1  1  
ATOM   1545   C CD2  . PHE A 1 106 ? -47.620  -15.197 -78.060  1.00 0.00 ? 106 PHE A CD2  1  
ATOM   1546   C CE1  . PHE A 1 106 ? -49.882  -16.652 -78.802  1.00 0.00 ? 106 PHE A CE1  1  
ATOM   1547   C CE2  . PHE A 1 106 ? -48.315  -14.874 -79.231  1.00 0.00 ? 106 PHE A CE2  1  
ATOM   1548   C CZ   . PHE A 1 106 ? -49.443  -15.602 -79.604  1.00 0.00 ? 106 PHE A CZ   1  
ATOM   1549   H H    . PHE A 1 106 ? -50.241  -16.284 -74.670  1.00 0.00 ? 106 PHE A H    1  
ATOM   1550   H HA   . PHE A 1 106 ? -48.507  -17.776 -74.665  1.00 0.00 ? 106 PHE A HA   1  
ATOM   1551   H HB2  . PHE A 1 106 ? -46.543  -15.857 -75.807  1.00 0.00 ? 106 PHE A HB2  1  
ATOM   1552   H HB3  . PHE A 1 106 ? -46.784  -17.559 -76.159  1.00 0.00 ? 106 PHE A HB3  1  
ATOM   1553   H HD1  . PHE A 1 106 ? -49.537  -17.781 -77.007  1.00 0.00 ? 106 PHE A HD1  1  
ATOM   1554   H HD2  . PHE A 1 106 ? -46.749  -14.632 -77.783  1.00 0.00 ? 106 PHE A HD2  1  
ATOM   1555   H HE1  . PHE A 1 106 ? -50.752  -17.222 -79.091  1.00 0.00 ? 106 PHE A HE1  1  
ATOM   1556   H HE2  . PHE A 1 106 ? -47.973  -14.059 -79.849  1.00 0.00 ? 106 PHE A HE2  1  
ATOM   1557   H HZ   . PHE A 1 106 ? -49.975  -15.352 -80.508  1.00 0.00 ? 106 PHE A HZ   1  
ATOM   1558   N N    . MET A 1 107 ? -48.221  -16.260 -72.340  1.00 0.00 ? 107 MET A N    1  
ATOM   1559   C CA   . MET A 1 107 ? -47.607  -15.962 -71.004  1.00 0.00 ? 107 MET A CA   1  
ATOM   1560   C C    . MET A 1 107 ? -48.409  -16.527 -69.768  1.00 0.00 ? 107 MET A C    1  
ATOM   1561   O O    . MET A 1 107 ? -48.161  -16.123 -68.614  1.00 0.00 ? 107 MET A O    1  
ATOM   1562   C CB   . MET A 1 107 ? -47.272  -14.463 -70.863  1.00 0.00 ? 107 MET A CB   1  
ATOM   1563   C CG   . MET A 1 107 ? -46.737  -14.032 -69.454  1.00 0.00 ? 107 MET A CG   1  
ATOM   1564   S SD   . MET A 1 107 ? -45.524  -15.186 -68.731  1.00 0.00 ? 107 MET A SD   1  
ATOM   1565   C CE   . MET A 1 107 ? -45.933  -15.038 -66.967  1.00 0.00 ? 107 MET A CE   1  
ATOM   1566   H H    . MET A 1 107 ? -49.157  -16.451 -72.421  1.00 0.00 ? 107 MET A H    1  
ATOM   1567   H HA   . MET A 1 107 ? -46.694  -16.494 -71.024  1.00 0.00 ? 107 MET A HA   1  
ATOM   1568   H HB2  . MET A 1 107 ? -46.520  -14.228 -71.592  1.00 0.00 ? 107 MET A HB2  1  
ATOM   1569   H HB3  . MET A 1 107 ? -48.154  -13.884 -71.078  1.00 0.00 ? 107 MET A HB3  1  
ATOM   1570   H HG2  . MET A 1 107 ? -46.250  -13.071 -69.571  1.00 0.00 ? 107 MET A HG2  1  
ATOM   1571   H HG3  . MET A 1 107 ? -47.569  -13.917 -68.792  1.00 0.00 ? 107 MET A HG3  1  
ATOM   1572   H HE1  . MET A 1 107 ? -45.440  -15.832 -66.424  1.00 0.00 ? 107 MET A HE1  1  
ATOM   1573   H HE2  . MET A 1 107 ? -46.994  -15.127 -66.832  1.00 0.00 ? 107 MET A HE2  1  
ATOM   1574   H HE3  . MET A 1 107 ? -45.596  -14.082 -66.596  1.00 0.00 ? 107 MET A HE3  1  
ATOM   1575   N N    . VAL A 1 108 ? -49.327  -17.474 -70.037  1.00 0.00 ? 108 VAL A N    1  
ATOM   1576   C CA   . VAL A 1 108 ? -50.160  -18.128 -68.997  1.00 0.00 ? 108 VAL A CA   1  
ATOM   1577   C C    . VAL A 1 108 ? -49.821  -19.626 -68.875  1.00 0.00 ? 108 VAL A C    1  
ATOM   1578   O O    . VAL A 1 108 ? -48.845  -19.972 -68.209  1.00 0.00 ? 108 VAL A O    1  
ATOM   1579   C CB   . VAL A 1 108 ? -51.721  -17.995 -69.360  1.00 0.00 ? 108 VAL A CB   1  
ATOM   1580   C CG1  . VAL A 1 108 ? -52.581  -18.849 -68.405  1.00 0.00 ? 108 VAL A CG1  1  
ATOM   1581   C CG2  . VAL A 1 108 ? -52.168  -16.516 -69.329  1.00 0.00 ? 108 VAL A CG2  1  
ATOM   1582   H H    . VAL A 1 108 ? -49.445  -17.730 -70.961  1.00 0.00 ? 108 VAL A H    1  
ATOM   1583   H HA   . VAL A 1 108 ? -49.987  -17.660 -68.064  1.00 0.00 ? 108 VAL A HA   1  
ATOM   1584   H HB   . VAL A 1 108 ? -51.863  -18.374 -70.346  1.00 0.00 ? 108 VAL A HB   1  
ATOM   1585   H HG11 . VAL A 1 108 ? -52.299  -18.674 -67.381  1.00 0.00 ? 108 VAL A HG11 1  
ATOM   1586   H HG12 . VAL A 1 108 ? -52.439  -19.897 -68.643  1.00 0.00 ? 108 VAL A HG12 1  
ATOM   1587   H HG13 . VAL A 1 108 ? -53.625  -18.597 -68.542  1.00 0.00 ? 108 VAL A HG13 1  
ATOM   1588   H HG21 . VAL A 1 108 ? -51.404  -15.899 -69.783  1.00 0.00 ? 108 VAL A HG21 1  
ATOM   1589   H HG22 . VAL A 1 108 ? -52.339  -16.193 -68.317  1.00 0.00 ? 108 VAL A HG22 1  
ATOM   1590   H HG23 . VAL A 1 108 ? -53.086  -16.416 -69.899  1.00 0.00 ? 108 VAL A HG23 1  
ATOM   1591   N N    . LEU A 1 114 ? -49.544  -19.357 -90.018  1.00 0.00 ? 114 LEU A N    1  
ATOM   1592   C CA   . LEU A 1 114 ? -48.801  -19.947 -91.155  1.00 0.00 ? 114 LEU A CA   1  
ATOM   1593   C C    . LEU A 1 114 ? -48.119  -18.834 -91.981  1.00 0.00 ? 114 LEU A C    1  
ATOM   1594   O O    . LEU A 1 114 ? -48.518  -18.572 -93.129  1.00 0.00 ? 114 LEU A O    1  
ATOM   1595   C CB   . LEU A 1 114 ? -49.755  -20.759 -92.064  1.00 0.00 ? 114 LEU A CB   1  
ATOM   1596   C CG   . LEU A 1 114 ? -50.070  -22.219 -91.624  1.00 0.00 ? 114 LEU A CG   1  
ATOM   1597   C CD1  . LEU A 1 114 ? -48.945  -23.190 -91.978  1.00 0.00 ? 114 LEU A CD1  1  
ATOM   1598   C CD2  . LEU A 1 114 ? -50.385  -22.308 -90.140  1.00 0.00 ? 114 LEU A CD2  1  
ATOM   1599   H H    . LEU A 1 114 ? -50.367  -19.952 -89.809  1.00 0.00 ? 114 LEU A H    1  
ATOM   1600   H HA   . LEU A 1 114 ? -48.048  -20.579 -90.771  1.00 0.00 ? 114 LEU A HA   1  
ATOM   1601   H HB2  . LEU A 1 114 ? -50.686  -20.247 -92.113  1.00 0.00 ? 114 LEU A HB2  1  
ATOM   1602   H HB3  . LEU A 1 114 ? -49.319  -20.795 -93.041  1.00 0.00 ? 114 LEU A HB3  1  
ATOM   1603   H HG   . LEU A 1 114 ? -50.947  -22.527 -92.177  1.00 0.00 ? 114 LEU A HG   1  
ATOM   1604   H HD11 . LEU A 1 114 ? -49.106  -24.124 -91.454  1.00 0.00 ? 114 LEU A HD11 1  
ATOM   1605   H HD12 . LEU A 1 114 ? -47.999  -22.771 -91.688  1.00 0.00 ? 114 LEU A HD12 1  
ATOM   1606   H HD13 . LEU A 1 114 ? -48.953  -23.376 -93.043  1.00 0.00 ? 114 LEU A HD13 1  
ATOM   1607   H HD21 . LEU A 1 114 ? -50.678  -23.323 -89.902  1.00 0.00 ? 114 LEU A HD21 1  
ATOM   1608   H HD22 . LEU A 1 114 ? -51.198  -21.638 -89.909  1.00 0.00 ? 114 LEU A HD22 1  
ATOM   1609   H HD23 . LEU A 1 114 ? -49.515  -22.041 -89.570  1.00 0.00 ? 114 LEU A HD23 1  
ATOM   1610   N N    . PRO A 1 115 ? -47.117  -18.188 -91.406  1.00 0.00 ? 115 PRO A N    1  
ATOM   1611   C CA   . PRO A 1 115 ? -46.340  -17.132 -92.101  1.00 0.00 ? 115 PRO A CA   1  
ATOM   1612   C C    . PRO A 1 115 ? -45.342  -17.637 -93.133  1.00 0.00 ? 115 PRO A C    1  
ATOM   1613   O O    . PRO A 1 115 ? -45.500  -18.716 -93.690  1.00 0.00 ? 115 PRO A O    1  
ATOM   1614   C CB   . PRO A 1 115 ? -45.597  -16.400 -90.949  1.00 0.00 ? 115 PRO A CB   1  
ATOM   1615   C CG   . PRO A 1 115 ? -45.435  -17.519 -89.872  1.00 0.00 ? 115 PRO A CG   1  
ATOM   1616   C CD   . PRO A 1 115 ? -46.689  -18.347 -89.996  1.00 0.00 ? 115 PRO A CD   1  
ATOM   1617   H HA   . PRO A 1 115 ? -47.012  -16.436 -92.543  1.00 0.00 ? 115 PRO A HA   1  
ATOM   1618   H HB2  . PRO A 1 115 ? -44.639  -16.073 -91.256  1.00 0.00 ? 115 PRO A HB2  1  
ATOM   1619   H HB3  . PRO A 1 115 ? -46.198  -15.622 -90.544  1.00 0.00 ? 115 PRO A HB3  1  
ATOM   1620   H HG2  . PRO A 1 115 ? -44.562  -18.092 -90.111  1.00 0.00 ? 115 PRO A HG2  1  
ATOM   1621   H HG3  . PRO A 1 115 ? -45.366  -17.055 -88.917  1.00 0.00 ? 115 PRO A HG3  1  
ATOM   1622   H HD2  . PRO A 1 115 ? -46.468  -19.365 -89.754  1.00 0.00 ? 115 PRO A HD2  1  
ATOM   1623   H HD3  . PRO A 1 115 ? -47.465  -17.950 -89.350  1.00 0.00 ? 115 PRO A HD3  1  
ATOM   1624   N N    . LEU A 1 116 ? -44.259  -16.872 -93.303  1.00 0.00 ? 116 LEU A N    1  
ATOM   1625   C CA   . LEU A 1 116 ? -43.205  -17.238 -94.239  1.00 0.00 ? 116 LEU A CA   1  
ATOM   1626   C C    . LEU A 1 116 ? -43.800  -17.368 -95.632  1.00 0.00 ? 116 LEU A C    1  
ATOM   1627   O O    . LEU A 1 116 ? -44.937  -17.829 -95.793  1.00 0.00 ? 116 LEU A O    1  
ATOM   1628   C CB   . LEU A 1 116 ? -42.594  -18.571 -93.714  1.00 0.00 ? 116 LEU A CB   1  
ATOM   1629   C CG   . LEU A 1 116 ? -41.417  -19.190 -94.507  1.00 0.00 ? 116 LEU A CG   1  
ATOM   1630   C CD1  . LEU A 1 116 ? -40.192  -18.285 -94.575  1.00 0.00 ? 116 LEU A CD1  1  
ATOM   1631   C CD2  . LEU A 1 116 ? -41.041  -20.492 -93.795  1.00 0.00 ? 116 LEU A CD2  1  
ATOM   1632   H H    . LEU A 1 116 ? -44.162  -16.062 -92.764  1.00 0.00 ? 116 LEU A H    1  
ATOM   1633   H HA   . LEU A 1 116 ? -42.452  -16.469 -94.222  1.00 0.00 ? 116 LEU A HA   1  
ATOM   1634   H HB2  . LEU A 1 116 ? -42.249  -18.404 -92.725  1.00 0.00 ? 116 LEU A HB2  1  
ATOM   1635   H HB3  . LEU A 1 116 ? -43.378  -19.295 -93.694  1.00 0.00 ? 116 LEU A HB3  1  
ATOM   1636   H HG   . LEU A 1 116 ? -41.733  -19.430 -95.491  1.00 0.00 ? 116 LEU A HG   1  
ATOM   1637   H HD11 . LEU A 1 116 ? -40.456  -17.387 -95.106  1.00 0.00 ? 116 LEU A HD11 1  
ATOM   1638   H HD12 . LEU A 1 116 ? -39.402  -18.801 -95.109  1.00 0.00 ? 116 LEU A HD12 1  
ATOM   1639   H HD13 . LEU A 1 116 ? -39.853  -18.040 -93.583  1.00 0.00 ? 116 LEU A HD13 1  
ATOM   1640   H HD21 . LEU A 1 116 ? -41.868  -21.183 -93.874  1.00 0.00 ? 116 LEU A HD21 1  
ATOM   1641   H HD22 . LEU A 1 116 ? -40.837  -20.293 -92.753  1.00 0.00 ? 116 LEU A HD22 1  
ATOM   1642   H HD23 . LEU A 1 116 ? -40.170  -20.914 -94.264  1.00 0.00 ? 116 LEU A HD23 1  
ATOM   1643   N N    . ASP A 1 117 ? -42.995  -16.960 -96.629  1.00 0.00 ? 117 ASP A N    1  
ATOM   1644   C CA   . ASP A 1 117 ? -43.400  -17.022 -98.050  1.00 0.00 ? 117 ASP A CA   1  
ATOM   1645   C C    . ASP A 1 117 ? -42.323  -16.490 -99.038  1.00 0.00 ? 117 ASP A C    1  
ATOM   1646   O O    . ASP A 1 117 ? -41.696  -15.464 -98.802  1.00 0.00 ? 117 ASP A O    1  
ATOM   1647   C CB   . ASP A 1 117 ? -44.705  -16.241 -98.278  1.00 0.00 ? 117 ASP A CB   1  
ATOM   1648   C CG   . ASP A 1 117 ? -44.793  -14.932 -97.447  1.00 0.00 ? 117 ASP A CG   1  
ATOM   1649   O OD1  . ASP A 1 117 ? -44.934  -15.021 -96.225  1.00 0.00 ? 117 ASP A OD1  1  
ATOM   1650   O OD2  . ASP A 1 117 ? -44.753  -13.857 -98.055  1.00 0.00 ? 117 ASP A OD2  1  
ATOM   1651   H H    . ASP A 1 117 ? -42.112  -16.640 -96.401  1.00 0.00 ? 117 ASP A H    1  
ATOM   1652   H HA   . ASP A 1 117 ? -43.579  -18.050 -98.292  1.00 0.00 ? 117 ASP A HA   1  
ATOM   1653   H HB2  . ASP A 1 117 ? -44.782  -15.988 -99.325  1.00 0.00 ? 117 ASP A HB2  1  
ATOM   1654   H HB3  . ASP A 1 117 ? -45.533  -16.879 -98.014  1.00 0.00 ? 117 ASP A HB3  1  
ATOM   1655   N N    . LYS A 1 118 ? -42.052  -17.283 -100.092 1.00 0.00 ? 118 LYS A N    1  
ATOM   1656   C CA   . LYS A 1 118 ? -40.997  -16.965 -101.070 1.00 0.00 ? 118 LYS A CA   1  
ATOM   1657   C C    . LYS A 1 118 ? -40.805  -15.469 -101.377 1.00 0.00 ? 118 LYS A C    1  
ATOM   1658   O O    . LYS A 1 118 ? -39.670  -15.064 -101.660 1.00 0.00 ? 118 LYS A O    1  
ATOM   1659   C CB   . LYS A 1 118 ? -41.164  -17.777 -102.369 1.00 0.00 ? 118 LYS A CB   1  
ATOM   1660   C CG   . LYS A 1 118 ? -40.466  -19.152 -102.289 1.00 0.00 ? 118 LYS A CG   1  
ATOM   1661   C CD   . LYS A 1 118 ? -41.212  -20.081 -101.331 1.00 0.00 ? 118 LYS A CD   1  
ATOM   1662   C CE   . LYS A 1 118 ? -40.435  -21.393 -101.109 1.00 0.00 ? 118 LYS A CE   1  
ATOM   1663   N NZ   . LYS A 1 118 ? -40.288  -22.202 -102.361 1.00 0.00 ? 118 LYS A NZ   1  
ATOM   1664   H H    . LYS A 1 118 ? -42.523  -18.134 -100.168 1.00 0.00 ? 118 LYS A H    1  
ATOM   1665   H HA   . LYS A 1 118 ? -40.097  -17.282 -100.600 1.00 0.00 ? 118 LYS A HA   1  
ATOM   1666   H HB2  . LYS A 1 118 ? -42.198  -17.930 -102.565 1.00 0.00 ? 118 LYS A HB2  1  
ATOM   1667   H HB3  . LYS A 1 118 ? -40.716  -17.225 -103.178 1.00 0.00 ? 118 LYS A HB3  1  
ATOM   1668   H HG2  . LYS A 1 118 ? -40.475  -19.590 -103.276 1.00 0.00 ? 118 LYS A HG2  1  
ATOM   1669   H HG3  . LYS A 1 118 ? -39.456  -19.024 -101.960 1.00 0.00 ? 118 LYS A HG3  1  
ATOM   1670   H HD2  . LYS A 1 118 ? -41.317  -19.585 -100.378 1.00 0.00 ? 118 LYS A HD2  1  
ATOM   1671   H HD3  . LYS A 1 118 ? -42.182  -20.304 -101.728 1.00 0.00 ? 118 LYS A HD3  1  
ATOM   1672   H HE2  . LYS A 1 118 ? -39.460  -21.160 -100.734 1.00 0.00 ? 118 LYS A HE2  1  
ATOM   1673   H HE3  . LYS A 1 118 ? -40.968  -21.977 -100.376 1.00 0.00 ? 118 LYS A HE3  1  
ATOM   1674   H HZ1  . LYS A 1 118 ? -41.195  -22.258 -102.859 1.00 0.00 ? 118 LYS A HZ1  1  
ATOM   1675   H HZ2  . LYS A 1 118 ? -39.975  -23.168 -102.104 1.00 0.00 ? 118 LYS A HZ2  1  
ATOM   1676   H HZ3  . LYS A 1 118 ? -39.575  -21.767 -102.977 1.00 0.00 ? 118 LYS A HZ3  1  
ATOM   1677   N N    . TRP A 1 119 ? -41.897  -14.698 -101.437 1.00 0.00 ? 119 TRP A N    1  
ATOM   1678   C CA   . TRP A 1 119 ? -41.820  -13.263 -101.797 1.00 0.00 ? 119 TRP A CA   1  
ATOM   1679   C C    . TRP A 1 119 ? -41.317  -12.296 -100.677 1.00 0.00 ? 119 TRP A C    1  
ATOM   1680   O O    . TRP A 1 119 ? -40.141  -11.938 -100.681 1.00 0.00 ? 119 TRP A O    1  
ATOM   1681   C CB   . TRP A 1 119 ? -43.187  -12.771 -102.364 1.00 0.00 ? 119 TRP A CB   1  
ATOM   1682   C CG   . TRP A 1 119 ? -43.436  -13.205 -103.824 1.00 0.00 ? 119 TRP A CG   1  
ATOM   1683   C CD1  . TRP A 1 119 ? -42.950  -14.332 -104.451 1.00 0.00 ? 119 TRP A CD1  1  
ATOM   1684   C CD2  . TRP A 1 119 ? -44.240  -12.525 -104.827 1.00 0.00 ? 119 TRP A CD2  1  
ATOM   1685   N NE1  . TRP A 1 119 ? -43.406  -14.371 -105.753 1.00 0.00 ? 119 TRP A NE1  1  
ATOM   1686   C CE2  . TRP A 1 119 ? -44.196  -13.295 -106.040 1.00 0.00 ? 119 TRP A CE2  1  
ATOM   1687   C CE3  . TRP A 1 119 ? -44.996  -11.337 -104.826 1.00 0.00 ? 119 TRP A CE3  1  
ATOM   1688   C CZ2  . TRP A 1 119 ? -44.864  -12.905 -107.180 1.00 0.00 ? 119 TRP A CZ2  1  
ATOM   1689   C CZ3  . TRP A 1 119 ? -45.670  -10.952 -105.993 1.00 0.00 ? 119 TRP A CZ3  1  
ATOM   1690   C CH2  . TRP A 1 119 ? -45.601  -11.738 -107.164 1.00 0.00 ? 119 TRP A CH2  1  
ATOM   1691   H H    . TRP A 1 119 ? -42.766  -15.116 -101.306 1.00 0.00 ? 119 TRP A H    1  
ATOM   1692   H HA   . TRP A 1 119 ? -41.108  -13.196 -102.575 1.00 0.00 ? 119 TRP A HA   1  
ATOM   1693   H HB2  . TRP A 1 119 ? -43.981  -13.149 -101.755 1.00 0.00 ? 119 TRP A HB2  1  
ATOM   1694   H HB3  . TRP A 1 119 ? -43.199  -11.689 -102.322 1.00 0.00 ? 119 TRP A HB3  1  
ATOM   1695   H HD1  . TRP A 1 119 ? -42.316  -15.065 -103.999 1.00 0.00 ? 119 TRP A HD1  1  
ATOM   1696   H HE1  . TRP A 1 119 ? -43.202  -15.080 -106.422 1.00 0.00 ? 119 TRP A HE1  1  
ATOM   1697   H HE3  . TRP A 1 119 ? -45.059  -10.721 -103.933 1.00 0.00 ? 119 TRP A HE3  1  
ATOM   1698   H HZ2  . TRP A 1 119 ? -44.812  -13.510 -108.087 1.00 0.00 ? 119 TRP A HZ2  1  
ATOM   1699   H HZ3  . TRP A 1 119 ? -46.251  -10.045 -106.003 1.00 0.00 ? 119 TRP A HZ3  1  
ATOM   1700   H HH2  . TRP A 1 119 ? -46.123  -11.428 -108.047 1.00 0.00 ? 119 TRP A HH2  1  
ATOM   1701   N N    . VAL A 1 120 ? -42.166  -12.044 -99.666  1.00 0.00 ? 120 VAL A N    1  
ATOM   1702   C CA   . VAL A 1 120 ? -41.794  -11.276 -98.468  1.00 0.00 ? 120 VAL A CA   1  
ATOM   1703   C C    . VAL A 1 120 ? -42.891  -11.434 -97.410  1.00 0.00 ? 120 VAL A C    1  
ATOM   1704   O O    . VAL A 1 120 ? -44.091  -11.456 -97.727  1.00 0.00 ? 120 VAL A O    1  
ATOM   1705   C CB   . VAL A 1 120 ? -41.475  -9.729  -98.690  1.00 0.00 ? 120 VAL A CB   1  
ATOM   1706   C CG1  . VAL A 1 120 ? -40.089  -9.563  -99.306  1.00 0.00 ? 120 VAL A CG1  1  
ATOM   1707   C CG2  . VAL A 1 120 ? -42.515  -9.090  -99.584  1.00 0.00 ? 120 VAL A CG2  1  
ATOM   1708   H H    . VAL A 1 120 ? -43.016  -12.493 -99.681  1.00 0.00 ? 120 VAL A H    1  
ATOM   1709   H HA   . VAL A 1 120 ? -40.926  -11.729 -98.094  1.00 0.00 ? 120 VAL A HA   1  
ATOM   1710   H HB   . VAL A 1 120 ? -41.482  -9.250  -97.725  1.00 0.00 ? 120 VAL A HB   1  
ATOM   1711   H HG11 . VAL A 1 120 ? -39.411  -10.294 -98.895  1.00 0.00 ? 120 VAL A HG11 1  
ATOM   1712   H HG12 . VAL A 1 120 ? -39.723  -8.570  -99.080  1.00 0.00 ? 120 VAL A HG12 1  
ATOM   1713   H HG13 . VAL A 1 120 ? -40.152  -9.686  -100.375 1.00 0.00 ? 120 VAL A HG13 1  
ATOM   1714   H HG21 . VAL A 1 120 ? -42.478  -9.544  -100.561 1.00 0.00 ? 120 VAL A HG21 1  
ATOM   1715   H HG22 . VAL A 1 120 ? -42.302  -8.035  -99.665  1.00 0.00 ? 120 VAL A HG22 1  
ATOM   1716   H HG23 . VAL A 1 120 ? -43.492  -9.231  -99.153  1.00 0.00 ? 120 VAL A HG23 1  
ATOM   1717   N N    . PRO A 1 121 ? -42.509  -11.581 -96.155  1.00 0.00 ? 121 PRO A N    1  
ATOM   1718   C CA   . PRO A 1 121 ? -43.487  -11.721 -95.077  1.00 0.00 ? 121 PRO A CA   1  
ATOM   1719   C C    . PRO A 1 121 ? -44.170  -10.369 -94.684  1.00 0.00 ? 121 PRO A C    1  
ATOM   1720   O O    . PRO A 1 121 ? -45.107  -10.379 -93.903  1.00 0.00 ? 121 PRO A O    1  
ATOM   1721   C CB   . PRO A 1 121 ? -42.654  -12.291 -93.888  1.00 0.00 ? 121 PRO A CB   1  
ATOM   1722   C CG   . PRO A 1 121 ? -41.345  -12.693 -94.480  1.00 0.00 ? 121 PRO A CG   1  
ATOM   1723   C CD   . PRO A 1 121 ? -41.122  -11.765 -95.658  1.00 0.00 ? 121 PRO A CD   1  
ATOM   1724   H HA   . PRO A 1 121 ? -44.237  -12.427 -95.357  1.00 0.00 ? 121 PRO A HA   1  
ATOM   1725   H HB2  . PRO A 1 121 ? -42.523  -11.526 -93.142  1.00 0.00 ? 121 PRO A HB2  1  
ATOM   1726   H HB3  . PRO A 1 121 ? -43.162  -13.144 -93.483  1.00 0.00 ? 121 PRO A HB3  1  
ATOM   1727   H HG2  . PRO A 1 121 ? -40.559  -12.578 -93.756  1.00 0.00 ? 121 PRO A HG2  1  
ATOM   1728   H HG3  . PRO A 1 121 ? -41.387  -13.716 -94.828  1.00 0.00 ? 121 PRO A HG3  1  
ATOM   1729   H HD2  . PRO A 1 121 ? -40.670  -10.841 -95.344  1.00 0.00 ? 121 PRO A HD2  1  
ATOM   1730   H HD3  . PRO A 1 121 ? -40.525  -12.264 -96.399  1.00 0.00 ? 121 PRO A HD3  1  
ATOM   1731   N N    . GLN A 1 122 ? -43.617  -9.278  -95.213  1.00 0.00 ? 122 GLN A N    1  
ATOM   1732   C CA   . GLN A 1 122 ? -44.045  -7.914  -94.868  1.00 0.00 ? 122 GLN A CA   1  
ATOM   1733   C C    . GLN A 1 122 ? -45.588  -7.738  -94.580  1.00 0.00 ? 122 GLN A C    1  
ATOM   1734   O O    . GLN A 1 122 ? -45.917  -7.350  -93.452  1.00 0.00 ? 122 GLN A O    1  
ATOM   1735   C CB   . GLN A 1 122 ? -43.629  -6.969  -96.020  1.00 0.00 ? 122 GLN A CB   1  
ATOM   1736   C CG   . GLN A 1 122 ? -44.395  -5.637  -96.025  1.00 0.00 ? 122 GLN A CG   1  
ATOM   1737   C CD   . GLN A 1 122 ? -44.334  -4.902  -94.694  1.00 0.00 ? 122 GLN A CD   1  
ATOM   1738   O OE1  . GLN A 1 122 ? -44.472  -5.515  -93.623  1.00 0.00 ? 122 GLN A OE1  1  
ATOM   1739   N NE2  . GLN A 1 122 ? -44.150  -3.592  -94.724  1.00 0.00 ? 122 GLN A NE2  1  
ATOM   1740   H H    . GLN A 1 122 ? -42.815  -9.383  -95.757  1.00 0.00 ? 122 GLN A H    1  
ATOM   1741   H HA   . GLN A 1 122 ? -43.520  -7.625  -94.009  1.00 0.00 ? 122 GLN A HA   1  
ATOM   1742   H HB2  . GLN A 1 122 ? -42.583  -6.759  -95.911  1.00 0.00 ? 122 GLN A HB2  1  
ATOM   1743   H HB3  . GLN A 1 122 ? -43.795  -7.460  -96.965  1.00 0.00 ? 122 GLN A HB3  1  
ATOM   1744   H HG2  . GLN A 1 122 ? -43.955  -5.000  -96.781  1.00 0.00 ? 122 GLN A HG2  1  
ATOM   1745   H HG3  . GLN A 1 122 ? -45.420  -5.824  -96.281  1.00 0.00 ? 122 GLN A HG3  1  
ATOM   1746   H HE21 . GLN A 1 122 ? -44.053  -3.134  -95.595  1.00 0.00 ? 122 GLN A HE21 1  
ATOM   1747   H HE22 . GLN A 1 122 ? -44.112  -3.068  -93.899  1.00 0.00 ? 122 GLN A HE22 1  
ATOM   1748   N N    . VAL A 1 123 ? -46.443  -8.045  -95.531  1.00 0.00 ? 123 VAL A N    1  
ATOM   1749   C CA   . VAL A 1 123 ? -47.892  -7.896  -95.316  1.00 0.00 ? 123 VAL A CA   1  
ATOM   1750   C C    . VAL A 1 123 ? -48.329  -8.322  -93.900  1.00 0.00 ? 123 VAL A C    1  
ATOM   1751   O O    . VAL A 1 123 ? -49.282  -7.749  -93.350  1.00 0.00 ? 123 VAL A O    1  
ATOM   1752   C CB   . VAL A 1 123 ? -48.703  -8.713  -96.447  1.00 0.00 ? 123 VAL A CB   1  
ATOM   1753   C CG1  . VAL A 1 123 ? -50.192  -8.682  -96.147  1.00 0.00 ? 123 VAL A CG1  1  
ATOM   1754   C CG2  . VAL A 1 123 ? -48.430  -8.088  -97.811  1.00 0.00 ? 123 VAL A CG2  1  
ATOM   1755   H H    . VAL A 1 123 ? -46.106  -8.358  -96.397  1.00 0.00 ? 123 VAL A H    1  
ATOM   1756   H HA   . VAL A 1 123 ? -48.142  -6.874  -95.435  1.00 0.00 ? 123 VAL A HA   1  
ATOM   1757   H HB   . VAL A 1 123 ? -48.366  -9.717  -96.443  1.00 0.00 ? 123 VAL A HB   1  
ATOM   1758   H HG11 . VAL A 1 123 ? -50.363  -9.044  -95.146  1.00 0.00 ? 123 VAL A HG11 1  
ATOM   1759   H HG12 . VAL A 1 123 ? -50.694  -9.329  -96.851  1.00 0.00 ? 123 VAL A HG12 1  
ATOM   1760   H HG13 . VAL A 1 123 ? -50.572  -7.679  -96.241  1.00 0.00 ? 123 VAL A HG13 1  
ATOM   1761   H HG21 . VAL A 1 123 ? -47.364  -7.986  -97.950  1.00 0.00 ? 123 VAL A HG21 1  
ATOM   1762   H HG22 . VAL A 1 123 ? -48.900  -7.121  -97.879  1.00 0.00 ? 123 VAL A HG22 1  
ATOM   1763   H HG23 . VAL A 1 123 ? -48.830  -8.742  -98.571  1.00 0.00 ? 123 VAL A HG23 1  
ATOM   1764   N N    . PHE A 1 124 ? -47.619  -9.289  -93.301  1.00 0.00 ? 124 PHE A N    1  
ATOM   1765   C CA   . PHE A 1 124 ? -47.921  -9.725  -91.922  1.00 0.00 ? 124 PHE A CA   1  
ATOM   1766   C C    . PHE A 1 124 ? -46.712  -9.559  -90.976  1.00 0.00 ? 124 PHE A C    1  
ATOM   1767   O O    . PHE A 1 124 ? -45.589  -9.910  -91.318  1.00 0.00 ? 124 PHE A O    1  
ATOM   1768   C CB   . PHE A 1 124 ? -48.445  -11.166 -91.897  1.00 0.00 ? 124 PHE A CB   1  
ATOM   1769   C CG   . PHE A 1 124 ? -47.473  -12.173 -92.484  1.00 0.00 ? 124 PHE A CG   1  
ATOM   1770   C CD1  . PHE A 1 124 ? -46.371  -12.606 -91.744  1.00 0.00 ? 124 PHE A CD1  1  
ATOM   1771   C CD2  . PHE A 1 124 ? -47.700  -12.695 -93.758  1.00 0.00 ? 124 PHE A CD2  1  
ATOM   1772   C CE1  . PHE A 1 124 ? -45.489  -13.551 -92.282  1.00 0.00 ? 124 PHE A CE1  1  
ATOM   1773   C CE2  . PHE A 1 124 ? -46.818  -13.639 -94.296  1.00 0.00 ? 124 PHE A CE2  1  
ATOM   1774   C CZ   . PHE A 1 124 ? -45.710  -14.066 -93.558  1.00 0.00 ? 124 PHE A CZ   1  
ATOM   1775   H H    . PHE A 1 124 ? -46.880  -9.693  -93.783  1.00 0.00 ? 124 PHE A H    1  
ATOM   1776   H HA   . PHE A 1 124 ? -48.700  -9.090  -91.541  1.00 0.00 ? 124 PHE A HA   1  
ATOM   1777   H HB2  . PHE A 1 124 ? -48.646  -11.438 -90.880  1.00 0.00 ? 124 PHE A HB2  1  
ATOM   1778   H HB3  . PHE A 1 124 ? -49.362  -11.195 -92.461  1.00 0.00 ? 124 PHE A HB3  1  
ATOM   1779   H HD1  . PHE A 1 124 ? -46.194  -12.212 -90.763  1.00 0.00 ? 124 PHE A HD1  1  
ATOM   1780   H HD2  . PHE A 1 124 ? -48.553  -12.373 -94.327  1.00 0.00 ? 124 PHE A HD2  1  
ATOM   1781   H HE1  . PHE A 1 124 ? -44.637  -13.878 -91.704  1.00 0.00 ? 124 PHE A HE1  1  
ATOM   1782   H HE2  . PHE A 1 124 ? -46.996  -14.036 -95.285  1.00 0.00 ? 124 PHE A HE2  1  
ATOM   1783   H HZ   . PHE A 1 124 ? -45.030  -14.788 -93.972  1.00 0.00 ? 124 PHE A HZ   1  
ATOM   1784   N N    . VAL A 1 125 ? -46.989  -9.083  -89.750  1.00 0.00 ? 125 VAL A N    1  
ATOM   1785   C CA   . VAL A 1 125 ? -45.952  -8.905  -88.737  1.00 0.00 ? 125 VAL A CA   1  
ATOM   1786   C C    . VAL A 1 125 ? -46.582  -8.714  -87.349  1.00 0.00 ? 125 VAL A C    1  
ATOM   1787   O O    . VAL A 1 125 ? -47.743  -8.322  -87.227  1.00 0.00 ? 125 VAL A O    1  
ATOM   1788   C CB   . VAL A 1 125 ? -44.982  -7.680  -89.054  1.00 0.00 ? 125 VAL A CB   1  
ATOM   1789   C CG1  . VAL A 1 125 ? -43.854  -8.112  -90.013  1.00 0.00 ? 125 VAL A CG1  1  
ATOM   1790   C CG2  . VAL A 1 125 ? -45.769  -6.500  -89.634  1.00 0.00 ? 125 VAL A CG2  1  
ATOM   1791   H H    . VAL A 1 125 ? -47.918  -8.890  -89.517  1.00 0.00 ? 125 VAL A H    1  
ATOM   1792   H HA   . VAL A 1 125 ? -45.356  -9.790  -88.714  1.00 0.00 ? 125 VAL A HA   1  
ATOM   1793   H HB   . VAL A 1 125 ? -44.530  -7.378  -88.133  1.00 0.00 ? 125 VAL A HB   1  
ATOM   1794   H HG11 . VAL A 1 125 ? -43.040  -7.401  -89.942  1.00 0.00 ? 125 VAL A HG11 1  
ATOM   1795   H HG12 . VAL A 1 125 ? -44.215  -8.141  -91.026  1.00 0.00 ? 125 VAL A HG12 1  
ATOM   1796   H HG13 . VAL A 1 125 ? -43.489  -9.092  -89.730  1.00 0.00 ? 125 VAL A HG13 1  
ATOM   1797   H HG21 . VAL A 1 125 ? -46.368  -6.823  -90.467  1.00 0.00 ? 125 VAL A HG21 1  
ATOM   1798   H HG22 . VAL A 1 125 ? -45.075  -5.737  -89.959  1.00 0.00 ? 125 VAL A HG22 1  
ATOM   1799   H HG23 . VAL A 1 125 ? -46.410  -6.090  -88.863  1.00 0.00 ? 125 VAL A HG23 1  
ATOM   1800   N N    . ALA A 1 126 ? -45.829  -9.092  -86.310  1.00 0.00 ? 126 ALA A N    1  
ATOM   1801   C CA   . ALA A 1 126 ? -46.326  -9.012  -84.940  1.00 0.00 ? 126 ALA A CA   1  
ATOM   1802   C C    . ALA A 1 126 ? -45.251  -8.604  -83.932  1.00 0.00 ? 126 ALA A C    1  
ATOM   1803   O O    . ALA A 1 126 ? -45.584  -8.260  -82.798  1.00 0.00 ? 126 ALA A O    1  
ATOM   1804   C CB   . ALA A 1 126 ? -46.885  -10.376 -84.559  1.00 0.00 ? 126 ALA A CB   1  
ATOM   1805   H H    . ALA A 1 126 ? -44.945  -9.464  -86.479  1.00 0.00 ? 126 ALA A H    1  
ATOM   1806   H HA   . ALA A 1 126 ? -47.123  -8.294  -84.887  1.00 0.00 ? 126 ALA A HA   1  
ATOM   1807   H HB1  . ALA A 1 126 ? -46.101  -11.117 -84.616  1.00 0.00 ? 126 ALA A HB1  1  
ATOM   1808   H HB2  . ALA A 1 126 ? -47.678  -10.637 -85.244  1.00 0.00 ? 126 ALA A HB2  1  
ATOM   1809   H HB3  . ALA A 1 126 ? -47.273  -10.338 -83.554  1.00 0.00 ? 126 ALA A HB3  1  
ATOM   1810   N N    . SER A 1 127 ? -43.972  -8.644  -84.326  1.00 0.00 ? 127 SER A N    1  
ATOM   1811   C CA   . SER A 1 127 ? -42.892  -8.282  -83.379  1.00 0.00 ? 127 SER A CA   1  
ATOM   1812   C C    . SER A 1 127 ? -42.757  -6.762  -83.169  1.00 0.00 ? 127 SER A C    1  
ATOM   1813   O O    . SER A 1 127 ? -42.393  -5.999  -84.066  1.00 0.00 ? 127 SER A O    1  
ATOM   1814   C CB   . SER A 1 127 ? -41.546  -8.937  -83.792  1.00 0.00 ? 127 SER A CB   1  
ATOM   1815   O OG   . SER A 1 127 ? -40.532  -8.708  -82.811  1.00 0.00 ? 127 SER A OG   1  
ATOM   1816   H H    . SER A 1 127 ? -43.760  -8.925  -85.239  1.00 0.00 ? 127 SER A H    1  
ATOM   1817   H HA   . SER A 1 127 ? -43.168  -8.695  -82.437  1.00 0.00 ? 127 SER A HA   1  
ATOM   1818   H HB2  . SER A 1 127 ? -41.692  -9.999  -83.872  1.00 0.00 ? 127 SER A HB2  1  
ATOM   1819   H HB3  . SER A 1 127 ? -41.229  -8.549  -84.741  1.00 0.00 ? 127 SER A HB3  1  
ATOM   1820   H HG   . SER A 1 127 ? -40.357  -7.767  -82.776  1.00 0.00 ? 127 SER A HG   1  
ATOM   1821   N N    . GLY A 1 128 ? -43.020  -6.352  -81.924  1.00 0.00 ? 128 GLY A N    1  
ATOM   1822   C CA   . GLY A 1 128 ? -42.915  -4.951  -81.531  1.00 0.00 ? 128 GLY A CA   1  
ATOM   1823   C C    . GLY A 1 128 ? -43.298  -4.800  -80.065  1.00 0.00 ? 128 GLY A C    1  
ATOM   1824   O O    . GLY A 1 128 ? -42.429  -4.749  -79.205  1.00 0.00 ? 128 GLY A O    1  
ATOM   1825   H H    . GLY A 1 128 ? -43.277  -7.016  -81.250  1.00 0.00 ? 128 GLY A H    1  
ATOM   1826   H HA2  . GLY A 1 128 ? -41.892  -4.628  -81.666  1.00 0.00 ? 128 GLY A HA2  1  
ATOM   1827   H HA3  . GLY A 1 128 ? -43.567  -4.345  -82.136  1.00 0.00 ? 128 GLY A HA3  1  
ATOM   1828   N N    . ASP A 1 129 ? -44.618  -4.668  -79.823  1.00 0.00 ? 129 ASP A N    1  
ATOM   1829   C CA   . ASP A 1 129 ? -45.158  -4.493  -78.462  1.00 0.00 ? 129 ASP A CA   1  
ATOM   1830   C C    . ASP A 1 129 ? -46.685  -4.727  -78.359  1.00 0.00 ? 129 ASP A C    1  
ATOM   1831   O O    . ASP A 1 129 ? -47.364  -5.020  -79.343  1.00 0.00 ? 129 ASP A O    1  
ATOM   1832   C CB   . ASP A 1 129 ? -44.796  -3.092  -77.951  1.00 0.00 ? 129 ASP A CB   1  
ATOM   1833   C CG   . ASP A 1 129 ? -45.473  -1.981  -78.761  1.00 0.00 ? 129 ASP A CG   1  
ATOM   1834   O OD1  . ASP A 1 129 ? -45.235  -1.931  -79.963  1.00 0.00 ? 129 ASP A OD1  1  
ATOM   1835   O OD2  . ASP A 1 129 ? -46.208  -1.182  -78.158  1.00 0.00 ? 129 ASP A OD2  1  
ATOM   1836   H H    . ASP A 1 129 ? -45.224  -4.672  -80.579  1.00 0.00 ? 129 ASP A H    1  
ATOM   1837   H HA   . ASP A 1 129 ? -44.693  -5.204  -77.812  1.00 0.00 ? 129 ASP A HA   1  
ATOM   1838   H HB2  . ASP A 1 129 ? -45.093  -3.009  -76.925  1.00 0.00 ? 129 ASP A HB2  1  
ATOM   1839   H HB3  . ASP A 1 129 ? -43.725  -2.973  -78.024  1.00 0.00 ? 129 ASP A HB3  1  
ATOM   1840   N N    . CYS A 1 130 ? -47.202  -4.518  -77.131  1.00 0.00 ? 130 CYS A N    1  
ATOM   1841   C CA   . CYS A 1 130 ? -48.635  -4.673  -76.846  1.00 0.00 ? 130 CYS A CA   1  
ATOM   1842   C C    . CYS A 1 130 ? -49.362  -3.336  -76.944  1.00 0.00 ? 130 CYS A C    1  
ATOM   1843   O O    . CYS A 1 130 ? -48.774  -2.288  -77.201  1.00 0.00 ? 130 CYS A O    1  
ATOM   1844   C CB   . CYS A 1 130 ? -48.865  -5.317  -75.467  1.00 0.00 ? 130 CYS A CB   1  
ATOM   1845   S SG   . CYS A 1 130 ? -49.512  -7.007  -75.619  1.00 0.00 ? 130 CYS A SG   1  
ATOM   1846   H H    . CYS A 1 130 ? -46.604  -4.244  -76.423  1.00 0.00 ? 130 CYS A H    1  
ATOM   1847   H HA   . CYS A 1 130 ? -49.069  -5.287  -77.587  1.00 0.00 ? 130 CYS A HA   1  
ATOM   1848   H HB2  . CYS A 1 130 ? -47.937  -5.357  -74.940  1.00 0.00 ? 130 CYS A HB2  1  
ATOM   1849   H HB3  . CYS A 1 130 ? -49.572  -4.729  -74.913  1.00 0.00 ? 130 CYS A HB3  1  
ATOM   1850   N N    . ALA A 1 131 ? -50.629  -3.376  -76.524  1.00 0.00 ? 131 ALA A N    1  
ATOM   1851   C CA   . ALA A 1 131 ? -51.422  -2.191  -76.445  1.00 0.00 ? 131 ALA A CA   1  
ATOM   1852   C C    . ALA A 1 131 ? -50.638  -1.404  -75.424  1.00 0.00 ? 131 ALA A C    1  
ATOM   1853   O O    . ALA A 1 131 ? -50.535  -1.825  -74.263  1.00 0.00 ? 131 ALA A O    1  
ATOM   1854   C CB   . ALA A 1 131 ? -52.810  -2.531  -75.910  1.00 0.00 ? 131 ALA A CB   1  
ATOM   1855   H H    . ALA A 1 131 ? -50.969  -4.209  -76.173  1.00 0.00 ? 131 ALA A H    1  
ATOM   1856   H HA   . ALA A 1 131 ? -51.495  -1.654  -77.381  1.00 0.00 ? 131 ALA A HA   1  
ATOM   1857   H HB1  . ALA A 1 131 ? -53.142  -1.742  -75.253  1.00 0.00 ? 131 ALA A HB1  1  
ATOM   1858   H HB2  . ALA A 1 131 ? -52.759  -3.461  -75.360  1.00 0.00 ? 131 ALA A HB2  1  
ATOM   1859   H HB3  . ALA A 1 131 ? -53.499  -2.634  -76.731  1.00 0.00 ? 131 ALA A HB3  1  
ATOM   1860   N N    . GLU A 1 132 ? -50.007  -0.323  -75.850  1.00 0.00 ? 132 GLU A N    1  
ATOM   1861   C CA   . GLU A 1 132 ? -49.175  0.436   -74.935  1.00 0.00 ? 132 GLU A CA   1  
ATOM   1862   C C    . GLU A 1 132 ? -49.536  1.917   -75.036  1.00 0.00 ? 132 GLU A C    1  
ATOM   1863   O O    . GLU A 1 132 ? -50.571  2.343   -74.519  1.00 0.00 ? 132 GLU A O    1  
ATOM   1864   C CB   . GLU A 1 132 ? -47.654  0.209   -75.239  1.00 0.00 ? 132 GLU A CB   1  
ATOM   1865   C CG   . GLU A 1 132 ? -47.194  -1.275  -75.040  1.00 0.00 ? 132 GLU A CG   1  
ATOM   1866   C CD   . GLU A 1 132 ? -46.369  -1.517  -73.738  1.00 0.00 ? 132 GLU A CD   1  
ATOM   1867   O OE1  . GLU A 1 132 ? -46.370  -0.653  -72.854  1.00 0.00 ? 132 GLU A OE1  1  
ATOM   1868   O OE2  . GLU A 1 132 ? -45.772  -2.601  -73.635  1.00 0.00 ? 132 GLU A OE2  1  
ATOM   1869   H H    . GLU A 1 132 ? -50.091  -0.047  -76.789  1.00 0.00 ? 132 GLU A H    1  
ATOM   1870   H HA   . GLU A 1 132 ? -49.364  0.113   -73.932  1.00 0.00 ? 132 GLU A HA   1  
ATOM   1871   H HB2  . GLU A 1 132 ? -47.470  0.482   -76.260  1.00 0.00 ? 132 GLU A HB2  1  
ATOM   1872   H HB3  . GLU A 1 132 ? -47.084  0.838   -74.592  1.00 0.00 ? 132 GLU A HB3  1  
ATOM   1873   H HG2  . GLU A 1 132 ? -48.047  -1.914  -75.020  1.00 0.00 ? 132 GLU A HG2  1  
ATOM   1874   H HG3  . GLU A 1 132 ? -46.571  -1.547  -75.886  1.00 0.00 ? 132 GLU A HG3  1  
ATOM   1875   N N    . ARG A 1 133 ? -48.682  2.684   -75.691  1.00 0.00 ? 133 ARG A N    1  
ATOM   1876   C CA   . ARG A 1 133 ? -48.908  4.125   -75.838  1.00 0.00 ? 133 ARG A CA   1  
ATOM   1877   C C    . ARG A 1 133 ? -50.023  4.388   -76.836  1.00 0.00 ? 133 ARG A C    1  
ATOM   1878   O O    . ARG A 1 133 ? -50.964  5.113   -76.525  1.00 0.00 ? 133 ARG A O    1  
ATOM   1879   C CB   . ARG A 1 133 ? -47.588  4.811   -76.305  1.00 0.00 ? 133 ARG A CB   1  
ATOM   1880   C CG   . ARG A 1 133 ? -47.344  6.221   -75.670  1.00 0.00 ? 133 ARG A CG   1  
ATOM   1881   C CD   . ARG A 1 133 ? -45.827  6.657   -75.728  1.00 0.00 ? 133 ARG A CD   1  
ATOM   1882   N NE   . ARG A 1 133 ? -45.504  7.543   -76.877  1.00 0.00 ? 133 ARG A NE   1  
ATOM   1883   C CZ   . ARG A 1 133 ? -44.663  8.606   -76.799  1.00 0.00 ? 133 ARG A CZ   1  
ATOM   1884   N NH1  . ARG A 1 133 ? -44.086  8.952   -75.669  1.00 0.00 ? 133 ARG A NH1  1  
ATOM   1885   N NH2  . ARG A 1 133 ? -44.436  9.314   -77.895  1.00 0.00 ? 133 ARG A NH2  1  
ATOM   1886   H H    . ARG A 1 133 ? -47.881  2.282   -76.070  1.00 0.00 ? 133 ARG A H    1  
ATOM   1887   H HA   . ARG A 1 133 ? -49.199  4.512   -74.895  1.00 0.00 ? 133 ARG A HA   1  
ATOM   1888   H HB2  . ARG A 1 133 ? -46.779  4.178   -76.044  1.00 0.00 ? 133 ARG A HB2  1  
ATOM   1889   H HB3  . ARG A 1 133 ? -47.633  4.927   -77.368  1.00 0.00 ? 133 ARG A HB3  1  
ATOM   1890   H HG2  . ARG A 1 133 ? -47.928  6.942   -76.193  1.00 0.00 ? 133 ARG A HG2  1  
ATOM   1891   H HG3  . ARG A 1 133 ? -47.642  6.191   -74.636  1.00 0.00 ? 133 ARG A HG3  1  
ATOM   1892   H HD2  . ARG A 1 133 ? -45.597  7.180   -74.823  1.00 0.00 ? 133 ARG A HD2  1  
ATOM   1893   H HD3  . ARG A 1 133 ? -45.217  5.776   -75.790  1.00 0.00 ? 133 ARG A HD3  1  
ATOM   1894   H HE   . ARG A 1 133 ? -45.898  7.348   -77.732  1.00 0.00 ? 133 ARG A HE   1  
ATOM   1895   H HH11 . ARG A 1 133 ? -44.257  8.434   -74.832  1.00 0.00 ? 133 ARG A HH11 1  
ATOM   1896   H HH12 . ARG A 1 133 ? -43.470  9.746   -75.644  1.00 0.00 ? 133 ARG A HH12 1  
ATOM   1897   H HH21 . ARG A 1 133 ? -44.879  9.067   -78.761  1.00 0.00 ? 133 ARG A HH21 1  
ATOM   1898   H HH22 . ARG A 1 133 ? -43.822  10.104  -77.863  1.00 0.00 ? 133 ARG A HH22 1  
ATOM   1899   N N    . GLN A 1 134 ? -49.931  3.744   -78.000  1.00 0.00 ? 134 GLN A N    1  
ATOM   1900   C CA   . GLN A 1 134 ? -50.941  3.876   -79.026  1.00 0.00 ? 134 GLN A CA   1  
ATOM   1901   C C    . GLN A 1 134 ? -51.880  5.023   -78.700  1.00 0.00 ? 134 GLN A C    1  
ATOM   1902   O O    . GLN A 1 134 ? -52.789  4.859   -77.881  1.00 0.00 ? 134 GLN A O    1  
ATOM   1903   C CB   . GLN A 1 134 ? -51.761  2.567   -79.141  1.00 0.00 ? 134 GLN A CB   1  
ATOM   1904   C CG   . GLN A 1 134 ? -51.531  1.587   -77.974  1.00 0.00 ? 134 GLN A CG   1  
ATOM   1905   C CD   . GLN A 1 134 ? -52.203  2.015   -76.673  1.00 0.00 ? 134 GLN A CD   1  
ATOM   1906   O OE1  . GLN A 1 134 ? -52.721  3.135   -76.545  1.00 0.00 ? 134 GLN A OE1  1  
ATOM   1907   N NE2  . GLN A 1 134 ? -52.213  1.136   -75.687  1.00 0.00 ? 134 GLN A NE2  1  
ATOM   1908   H H    . GLN A 1 134 ? -49.170  3.161   -78.155  1.00 0.00 ? 134 GLN A H    1  
ATOM   1909   H HA   . GLN A 1 134 ? -50.473  4.068   -79.988  1.00 0.00 ? 134 GLN A HA   1  
ATOM   1910   H HB2  . GLN A 1 134 ? -52.799  2.808   -79.182  1.00 0.00 ? 134 GLN A HB2  1  
ATOM   1911   H HB3  . GLN A 1 134 ? -51.478  2.067   -80.056  1.00 0.00 ? 134 GLN A HB3  1  
ATOM   1912   H HG2  . GLN A 1 134 ? -51.945  0.625   -78.259  1.00 0.00 ? 134 GLN A HG2  1  
ATOM   1913   H HG3  . GLN A 1 134 ? -50.481  1.471   -77.803  1.00 0.00 ? 134 GLN A HG3  1  
ATOM   1914   H HE21 . GLN A 1 134 ? -51.798  0.249   -75.825  1.00 0.00 ? 134 GLN A HE21 1  
ATOM   1915   H HE22 . GLN A 1 134 ? -52.623  1.345   -74.826  1.00 0.00 ? 134 GLN A HE22 1  
ATOM   1916   N N    . TRP A 1 135 ? -51.669  6.177   -79.331  1.00 0.00 ? 135 TRP A N    1  
ATOM   1917   C CA   . TRP A 1 135 ? -52.551  7.322   -79.088  1.00 0.00 ? 135 TRP A CA   1  
ATOM   1918   C C    . TRP A 1 135 ? -53.204  7.802   -80.402  1.00 0.00 ? 135 TRP A C    1  
ATOM   1919   O O    . TRP A 1 135 ? -54.187  8.558   -80.400  1.00 0.00 ? 135 TRP A O    1  
ATOM   1920   C CB   . TRP A 1 135 ? -51.872  8.468   -78.287  1.00 0.00 ? 135 TRP A CB   1  
ATOM   1921   C CG   . TRP A 1 135 ? -50.519  8.924   -78.783  1.00 0.00 ? 135 TRP A CG   1  
ATOM   1922   C CD1  . TRP A 1 135 ? -49.408  8.147   -78.978  1.00 0.00 ? 135 TRP A CD1  1  
ATOM   1923   C CD2  . TRP A 1 135 ? -50.112  10.279  -79.073  1.00 0.00 ? 135 TRP A CD2  1  
ATOM   1924   N NE1  . TRP A 1 135 ? -48.366  8.942   -79.399  1.00 0.00 ? 135 TRP A NE1  1  
ATOM   1925   C CE2  . TRP A 1 135 ? -48.736  10.256  -79.476  1.00 0.00 ? 135 TRP A CE2  1  
ATOM   1926   C CE3  . TRP A 1 135 ? -50.777  11.522  -79.051  1.00 0.00 ? 135 TRP A CE3  1  
ATOM   1927   C CZ2  . TRP A 1 135 ? -48.056  11.402  -79.834  1.00 0.00 ? 135 TRP A CZ2  1  
ATOM   1928   C CZ3  . TRP A 1 135 ? -50.073  12.684  -79.418  1.00 0.00 ? 135 TRP A CZ3  1  
ATOM   1929   C CH2  . TRP A 1 135 ? -48.716  12.617  -79.809  1.00 0.00 ? 135 TRP A CH2  1  
ATOM   1930   H H    . TRP A 1 135 ? -50.931  6.249   -79.969  1.00 0.00 ? 135 TRP A H    1  
ATOM   1931   H HA   . TRP A 1 135 ? -53.362  6.960   -78.474  1.00 0.00 ? 135 TRP A HA   1  
ATOM   1932   H HB2  . TRP A 1 135 ? -52.528  9.317   -78.304  1.00 0.00 ? 135 TRP A HB2  1  
ATOM   1933   H HB3  . TRP A 1 135 ? -51.771  8.134   -77.267  1.00 0.00 ? 135 TRP A HB3  1  
ATOM   1934   H HD1  . TRP A 1 135 ? -49.360  7.088   -78.843  1.00 0.00 ? 135 TRP A HD1  1  
ATOM   1935   H HE1  . TRP A 1 135 ? -47.450  8.630   -79.625  1.00 0.00 ? 135 TRP A HE1  1  
ATOM   1936   H HE3  . TRP A 1 135 ? -51.821  11.586  -78.751  1.00 0.00 ? 135 TRP A HE3  1  
ATOM   1937   H HZ2  . TRP A 1 135 ? -47.009  11.352  -80.137  1.00 0.00 ? 135 TRP A HZ2  1  
ATOM   1938   H HZ3  . TRP A 1 135 ? -50.570  13.640  -79.405  1.00 0.00 ? 135 TRP A HZ3  1  
ATOM   1939   H HH2  . TRP A 1 135 ? -48.193  13.511  -80.087  1.00 0.00 ? 135 TRP A HH2  1  
ATOM   1940   N N    . ASP A 1 136 ? -52.674  7.283   -81.510  1.00 0.00 ? 136 ASP A N    1  
ATOM   1941   C CA   . ASP A 1 136 ? -53.177  7.592   -82.840  1.00 0.00 ? 136 ASP A CA   1  
ATOM   1942   C C    . ASP A 1 136 ? -53.251  9.106   -82.998  1.00 0.00 ? 136 ASP A C    1  
ATOM   1943   O O    . ASP A 1 136 ? -52.372  9.721   -83.603  1.00 0.00 ? 136 ASP A O    1  
ATOM   1944   C CB   . ASP A 1 136 ? -54.561  6.925   -83.024  1.00 0.00 ? 136 ASP A CB   1  
ATOM   1945   C CG   . ASP A 1 136 ? -55.154  7.166   -84.439  1.00 0.00 ? 136 ASP A CG   1  
ATOM   1946   O OD1  . ASP A 1 136 ? -55.795  8.209   -84.625  1.00 0.00 ? 136 ASP A OD1  1  
ATOM   1947   O OD2  . ASP A 1 136 ? -54.981  6.301   -85.311  1.00 0.00 ? 136 ASP A OD2  1  
ATOM   1948   H H    . ASP A 1 136 ? -51.926  6.670   -81.422  1.00 0.00 ? 136 ASP A H    1  
ATOM   1949   H HA   . ASP A 1 136 ? -52.496  7.185   -83.571  1.00 0.00 ? 136 ASP A HA   1  
ATOM   1950   H HB2  . ASP A 1 136 ? -54.459  5.861   -82.858  1.00 0.00 ? 136 ASP A HB2  1  
ATOM   1951   H HB3  . ASP A 1 136 ? -55.230  7.330   -82.287  1.00 0.00 ? 136 ASP A HB3  1  
ATOM   1952   N N    . PHE A 1 137 ? -54.378  9.662   -82.554  1.00 0.00 ? 137 PHE A N    1  
ATOM   1953   C CA   . PHE A 1 137 ? -54.688  11.115  -82.640  1.00 0.00 ? 137 PHE A CA   1  
ATOM   1954   C C    . PHE A 1 137 ? -55.103  11.561  -84.070  1.00 0.00 ? 137 PHE A C    1  
ATOM   1955   O O    . PHE A 1 137 ? -55.535  12.709  -84.257  1.00 0.00 ? 137 PHE A O    1  
ATOM   1956   C CB   . PHE A 1 137 ? -53.507  11.972  -82.163  1.00 0.00 ? 137 PHE A CB   1  
ATOM   1957   C CG   . PHE A 1 137 ? -53.909  13.437  -81.923  1.00 0.00 ? 137 PHE A CG   1  
ATOM   1958   C CD1  . PHE A 1 137 ? -54.372  13.845  -80.665  1.00 0.00 ? 137 PHE A CD1  1  
ATOM   1959   C CD2  . PHE A 1 137 ? -53.806  14.383  -82.953  1.00 0.00 ? 137 PHE A CD2  1  
ATOM   1960   C CE1  . PHE A 1 137 ? -54.732  15.189  -80.441  1.00 0.00 ? 137 PHE A CE1  1  
ATOM   1961   C CE2  . PHE A 1 137 ? -54.168  15.727  -82.728  1.00 0.00 ? 137 PHE A CE2  1  
ATOM   1962   C CZ   . PHE A 1 137 ? -54.634  16.128  -81.474  1.00 0.00 ? 137 PHE A CZ   1  
ATOM   1963   H H    . PHE A 1 137 ? -55.051  9.072   -82.174  1.00 0.00 ? 137 PHE A H    1  
ATOM   1964   H HA   . PHE A 1 137 ? -55.514  11.283  -81.995  1.00 0.00 ? 137 PHE A HA   1  
ATOM   1965   H HB2  . PHE A 1 137 ? -53.145  11.564  -81.243  1.00 0.00 ? 137 PHE A HB2  1  
ATOM   1966   H HB3  . PHE A 1 137 ? -52.728  11.941  -82.902  1.00 0.00 ? 137 PHE A HB3  1  
ATOM   1967   H HD1  . PHE A 1 137 ? -54.452  13.129  -79.867  1.00 0.00 ? 137 PHE A HD1  1  
ATOM   1968   H HD2  . PHE A 1 137 ? -53.443  14.082  -83.919  1.00 0.00 ? 137 PHE A HD2  1  
ATOM   1969   H HE1  . PHE A 1 137 ? -55.091  15.496  -79.468  1.00 0.00 ? 137 PHE A HE1  1  
ATOM   1970   H HE2  . PHE A 1 137 ? -54.094  16.448  -83.531  1.00 0.00 ? 137 PHE A HE2  1  
ATOM   1971   H HZ   . PHE A 1 137 ? -54.912  17.158  -81.302  1.00 0.00 ? 137 PHE A HZ   1  
ATOM   1972   N N    . LEU A 1 138 ? -55.090  10.607  -85.010  1.00 0.00 ? 138 LEU A N    1  
ATOM   1973   C CA   . LEU A 1 138 ? -55.481  10.831  -86.441  1.00 0.00 ? 138 LEU A CA   1  
ATOM   1974   C C    . LEU A 1 138 ? -57.001  10.962  -86.612  1.00 0.00 ? 138 LEU A C    1  
ATOM   1975   O O    . LEU A 1 138 ? -57.761  9.989   -86.618  1.00 0.00 ? 138 LEU A O    1  
ATOM   1976   C CB   . LEU A 1 138 ? -54.884  9.658   -87.287  1.00 0.00 ? 138 LEU A CB   1  
ATOM   1977   C CG   . LEU A 1 138 ? -55.176  9.613   -88.820  1.00 0.00 ? 138 LEU A CG   1  
ATOM   1978   C CD1  . LEU A 1 138 ? -54.197  10.463  -89.664  1.00 0.00 ? 138 LEU A CD1  1  
ATOM   1979   C CD2  . LEU A 1 138 ? -55.069  8.127   -89.227  1.00 0.00 ? 138 LEU A CD2  1  
ATOM   1980   H H    . LEU A 1 138 ? -54.827  9.724   -84.728  1.00 0.00 ? 138 LEU A H    1  
ATOM   1981   H HA   . LEU A 1 138 ? -55.042  11.723  -86.762  1.00 0.00 ? 138 LEU A HA   1  
ATOM   1982   H HB2  . LEU A 1 138 ? -53.839  9.712   -87.180  1.00 0.00 ? 138 LEU A HB2  1  
ATOM   1983   H HB3  . LEU A 1 138 ? -55.241  8.745   -86.866  1.00 0.00 ? 138 LEU A HB3  1  
ATOM   1984   H HG   . LEU A 1 138 ? -56.158  9.937   -89.014  1.00 0.00 ? 138 LEU A HG   1  
ATOM   1985   H HD11 . LEU A 1 138 ? -54.076  11.429  -89.201  1.00 0.00 ? 138 LEU A HD11 1  
ATOM   1986   H HD12 . LEU A 1 138 ? -54.617  10.596  -90.658  1.00 0.00 ? 138 LEU A HD12 1  
ATOM   1987   H HD13 . LEU A 1 138 ? -53.238  9.976   -89.750  1.00 0.00 ? 138 LEU A HD13 1  
ATOM   1988   H HD21 . LEU A 1 138 ? -54.169  7.692   -88.815  1.00 0.00 ? 138 LEU A HD21 1  
ATOM   1989   H HD22 . LEU A 1 138 ? -55.061  8.043   -90.296  1.00 0.00 ? 138 LEU A HD22 1  
ATOM   1990   H HD23 . LEU A 1 138 ? -55.930  7.604   -88.826  1.00 0.00 ? 138 LEU A HD23 1  
ATOM   1991   N N    . GLY A 1 139 ? -57.425  12.214  -86.798  1.00 0.00 ? 139 GLY A N    1  
ATOM   1992   C CA   . GLY A 1 139 ? -58.836  12.529  -87.024  1.00 0.00 ? 139 GLY A CA   1  
ATOM   1993   C C    . GLY A 1 139 ? -59.772  11.774  -86.081  1.00 0.00 ? 139 GLY A C    1  
ATOM   1994   O O    . GLY A 1 139 ? -60.214  12.315  -85.067  1.00 0.00 ? 139 GLY A O    1  
ATOM   1995   H H    . GLY A 1 139 ? -56.765  12.945  -86.813  1.00 0.00 ? 139 GLY A H    1  
ATOM   1996   H HA2  . GLY A 1 139 ? -58.982  13.585  -86.876  1.00 0.00 ? 139 GLY A HA2  1  
ATOM   1997   H HA3  . GLY A 1 139 ? -59.091  12.276  -88.039  1.00 0.00 ? 139 GLY A HA3  1  
ATOM   1998   N N    . LEU A 1 140 ? -60.063  10.522  -86.432  1.00 0.00 ? 140 LEU A N    1  
ATOM   1999   C CA   . LEU A 1 140 ? -60.939  9.673   -85.619  1.00 0.00 ? 140 LEU A CA   1  
ATOM   2000   C C    . LEU A 1 140 ? -60.421  8.235   -85.710  1.00 0.00 ? 140 LEU A C    1  
ATOM   2001   O O    . LEU A 1 140 ? -60.990  7.395   -86.414  1.00 0.00 ? 140 LEU A O    1  
ATOM   2002   C CB   . LEU A 1 140 ? -62.388  9.734   -86.150  1.00 0.00 ? 140 LEU A CB   1  
ATOM   2003   C CG   . LEU A 1 140 ? -63.479  10.218  -85.152  1.00 0.00 ? 140 LEU A CG   1  
ATOM   2004   C CD1  . LEU A 1 140 ? -63.733  9.242   -83.997  1.00 0.00 ? 140 LEU A CD1  1  
ATOM   2005   C CD2  . LEU A 1 140 ? -63.141  11.593  -84.607  1.00 0.00 ? 140 LEU A CD2  1  
ATOM   2006   H H    . LEU A 1 140 ? -59.670  10.160  -87.249  1.00 0.00 ? 140 LEU A H    1  
ATOM   2007   H HA   . LEU A 1 140 ? -60.897  9.994   -84.608  1.00 0.00 ? 140 LEU A HA   1  
ATOM   2008   H HB2  . LEU A 1 140 ? -62.403  10.419  -86.970  1.00 0.00 ? 140 LEU A HB2  1  
ATOM   2009   H HB3  . LEU A 1 140 ? -62.663  8.768   -86.496  1.00 0.00 ? 140 LEU A HB3  1  
ATOM   2010   H HG   . LEU A 1 140 ? -64.398  10.295  -85.717  1.00 0.00 ? 140 LEU A HG   1  
ATOM   2011   H HD11 . LEU A 1 140 ? -62.916  9.289   -83.299  1.00 0.00 ? 140 LEU A HD11 1  
ATOM   2012   H HD12 . LEU A 1 140 ? -63.836  8.241   -84.378  1.00 0.00 ? 140 LEU A HD12 1  
ATOM   2013   H HD13 . LEU A 1 140 ? -64.653  9.528   -83.492  1.00 0.00 ? 140 LEU A HD13 1  
ATOM   2014   H HD21 . LEU A 1 140 ? -62.576  12.143  -85.343  1.00 0.00 ? 140 LEU A HD21 1  
ATOM   2015   H HD22 . LEU A 1 140 ? -62.560  11.492  -83.705  1.00 0.00 ? 140 LEU A HD22 1  
ATOM   2016   H HD23 . LEU A 1 140 ? -64.058  12.123  -84.390  1.00 0.00 ? 140 LEU A HD23 1  
ATOM   2017   N N    . GLU A 1 141 ? -59.355  7.960   -84.965  1.00 0.00 ? 141 GLU A N    1  
ATOM   2018   C CA   . GLU A 1 141 ? -58.751  6.633   -84.944  1.00 0.00 ? 141 GLU A CA   1  
ATOM   2019   C C    . GLU A 1 141 ? -58.766  6.010   -86.328  1.00 0.00 ? 141 GLU A C    1  
ATOM   2020   O O    . GLU A 1 141 ? -58.982  6.705   -87.320  1.00 0.00 ? 141 GLU A O    1  
ATOM   2021   C CB   . GLU A 1 141 ? -59.462  5.714   -83.930  1.00 0.00 ? 141 GLU A CB   1  
ATOM   2022   C CG   . GLU A 1 141 ? -60.980  5.572   -84.185  1.00 0.00 ? 141 GLU A CG   1  
ATOM   2023   C CD   . GLU A 1 141 ? -61.300  4.865   -85.515  1.00 0.00 ? 141 GLU A CD   1  
ATOM   2024   O OE1  . GLU A 1 141 ? -60.705  3.821   -85.781  1.00 0.00 ? 141 GLU A OE1  1  
ATOM   2025   O OE2  . GLU A 1 141 ? -62.153  5.383   -86.248  1.00 0.00 ? 141 GLU A OE2  1  
ATOM   2026   H H    . GLU A 1 141 ? -58.964  8.669   -84.415  1.00 0.00 ? 141 GLU A H    1  
ATOM   2027   H HA   . GLU A 1 141 ? -57.719  6.733   -84.635  1.00 0.00 ? 141 GLU A HA   1  
ATOM   2028   H HB2  . GLU A 1 141 ? -59.017  4.750   -83.965  1.00 0.00 ? 141 GLU A HB2  1  
ATOM   2029   H HB3  . GLU A 1 141 ? -59.322  6.130   -82.942  1.00 0.00 ? 141 GLU A HB3  1  
ATOM   2030   H HG2  . GLU A 1 141 ? -61.400  4.987   -83.378  1.00 0.00 ? 141 GLU A HG2  1  
ATOM   2031   H HG3  . GLU A 1 141 ? -61.430  6.542   -84.181  1.00 0.00 ? 141 GLU A HG3  1  
ATOM   2032   N N    . MET A 1 142 ? -58.582  4.701   -86.390  1.00 0.00 ? 142 MET A N    1  
ATOM   2033   C CA   . MET A 1 142 ? -58.619  3.995   -87.650  1.00 0.00 ? 142 MET A CA   1  
ATOM   2034   C C    . MET A 1 142 ? -58.627  2.504   -87.421  1.00 0.00 ? 142 MET A C    1  
ATOM   2035   O O    . MET A 1 142 ? -59.273  1.778   -88.193  1.00 0.00 ? 142 MET A O    1  
ATOM   2036   C CB   . MET A 1 142 ? -57.490  4.408   -88.589  1.00 0.00 ? 142 MET A CB   1  
ATOM   2037   C CG   . MET A 1 142 ? -56.129  4.037   -88.026  1.00 0.00 ? 142 MET A CG   1  
ATOM   2038   S SD   . MET A 1 142 ? -55.822  2.256   -88.136  1.00 0.00 ? 142 MET A SD   1  
ATOM   2039   C CE   . MET A 1 142 ? -54.143  2.295   -88.822  1.00 0.00 ? 142 MET A CE   1  
ATOM   2040   H H    . MET A 1 142 ? -58.444  4.196   -85.564  1.00 0.00 ? 142 MET A H    1  
ATOM   2041   H HA   . MET A 1 142 ? -59.549  4.254   -88.128  1.00 0.00 ? 142 MET A HA   1  
ATOM   2042   H HB2  . MET A 1 142 ? -57.625  3.930   -89.540  1.00 0.00 ? 142 MET A HB2  1  
ATOM   2043   H HB3  . MET A 1 142 ? -57.525  5.480   -88.718  1.00 0.00 ? 142 MET A HB3  1  
ATOM   2044   H HG2  . MET A 1 142 ? -55.383  4.553   -88.591  1.00 0.00 ? 142 MET A HG2  1  
ATOM   2045   H HG3  . MET A 1 142 ? -56.087  4.346   -87.006  1.00 0.00 ? 142 MET A HG3  1  
ATOM   2046   H HE1  . MET A 1 142 ? -53.605  1.419   -88.490  1.00 0.00 ? 142 MET A HE1  1  
ATOM   2047   H HE2  . MET A 1 142 ? -53.624  3.176   -88.487  1.00 0.00 ? 142 MET A HE2  1  
ATOM   2048   H HE3  . MET A 1 142 ? -54.200  2.299   -89.902  1.00 0.00 ? 142 MET A HE3  1  
ATOM   2049   N N    . PRO A 1 143 ? -58.008  1.986   -86.363  1.00 0.00 ? 143 PRO A N    1  
ATOM   2050   C CA   . PRO A 1 143 ? -58.052  0.541   -86.140  1.00 0.00 ? 143 PRO A CA   1  
ATOM   2051   C C    . PRO A 1 143 ? -59.464  0.083   -85.776  1.00 0.00 ? 143 PRO A C    1  
ATOM   2052   O O    . PRO A 1 143 ? -59.648  -1.056  -85.353  1.00 0.00 ? 143 PRO A O    1  
ATOM   2053   C CB   . PRO A 1 143 ? -57.085  0.306   -84.975  1.00 0.00 ? 143 PRO A CB   1  
ATOM   2054   C CG   . PRO A 1 143 ? -57.057  1.587   -84.213  1.00 0.00 ? 143 PRO A CG   1  
ATOM   2055   C CD   . PRO A 1 143 ? -57.235  2.675   -85.272  1.00 0.00 ? 143 PRO A CD   1  
ATOM   2056   H HA   . PRO A 1 143 ? -57.707  0.022   -87.014  1.00 0.00 ? 143 PRO A HA   1  
ATOM   2057   H HB2  . PRO A 1 143 ? -57.442  -0.499  -84.352  1.00 0.00 ? 143 PRO A HB2  1  
ATOM   2058   H HB3  . PRO A 1 143 ? -56.098  0.083   -85.352  1.00 0.00 ? 143 PRO A HB3  1  
ATOM   2059   H HG2  . PRO A 1 143 ? -57.867  1.616   -83.488  1.00 0.00 ? 143 PRO A HG2  1  
ATOM   2060   H HG3  . PRO A 1 143 ? -56.107  1.713   -83.708  1.00 0.00 ? 143 PRO A HG3  1  
ATOM   2061   H HD2  . PRO A 1 143 ? -57.797  3.477   -84.856  1.00 0.00 ? 143 PRO A HD2  1  
ATOM   2062   H HD3  . PRO A 1 143 ? -56.278  3.000   -85.621  1.00 0.00 ? 143 PRO A HD3  1  
ATOM   2063   N N    . GLN A 1 144 ? -60.451  0.972   -85.939  1.00 0.00 ? 144 GLN A N    1  
ATOM   2064   C CA   . GLN A 1 144 ? -61.838  0.647   -85.602  1.00 0.00 ? 144 GLN A CA   1  
ATOM   2065   C C    . GLN A 1 144 ? -62.791  1.075   -86.715  1.00 0.00 ? 144 GLN A C    1  
ATOM   2066   O O    . GLN A 1 144 ? -63.894  0.526   -86.834  1.00 0.00 ? 144 GLN A O    1  
ATOM   2067   C CB   . GLN A 1 144 ? -62.196  1.335   -84.270  1.00 0.00 ? 144 GLN A CB   1  
ATOM   2068   C CG   . GLN A 1 144 ? -63.652  1.826   -84.223  1.00 0.00 ? 144 GLN A CG   1  
ATOM   2069   C CD   . GLN A 1 144 ? -63.816  3.187   -84.881  1.00 0.00 ? 144 GLN A CD   1  
ATOM   2070   O OE1  . GLN A 1 144 ? -64.022  3.275   -86.104  1.00 0.00 ? 144 GLN A OE1  1  
ATOM   2071   N NE2  . GLN A 1 144 ? -63.752  4.256   -84.111  1.00 0.00 ? 144 GLN A NE2  1  
ATOM   2072   H H    . GLN A 1 144 ? -60.243  1.854   -86.297  1.00 0.00 ? 144 GLN A H    1  
ATOM   2073   H HA   . GLN A 1 144 ? -61.915  -0.418  -85.465  1.00 0.00 ? 144 GLN A HA   1  
ATOM   2074   H HB2  . GLN A 1 144 ? -62.063  0.620   -83.471  1.00 0.00 ? 144 GLN A HB2  1  
ATOM   2075   H HB3  . GLN A 1 144 ? -61.536  2.164   -84.113  1.00 0.00 ? 144 GLN A HB3  1  
ATOM   2076   H HG2  . GLN A 1 144 ? -64.285  1.118   -84.706  1.00 0.00 ? 144 GLN A HG2  1  
ATOM   2077   H HG3  . GLN A 1 144 ? -63.944  1.916   -83.186  1.00 0.00 ? 144 GLN A HG3  1  
ATOM   2078   H HE21 . GLN A 1 144 ? -63.594  4.146   -83.141  1.00 0.00 ? 144 GLN A HE21 1  
ATOM   2079   H HE22 . GLN A 1 144 ? -63.863  5.154   -84.481  1.00 0.00 ? 144 GLN A HE22 1  
ATOM   2080   N N    . TRP A 1 145 ? -62.329  2.000   -87.565  1.00 0.00 ? 145 TRP A N    1  
ATOM   2081   C CA   . TRP A 1 145 ? -63.133  2.451   -88.708  1.00 0.00 ? 145 TRP A CA   1  
ATOM   2082   C C    . TRP A 1 145 ? -63.442  1.183   -89.503  1.00 0.00 ? 145 TRP A C    1  
ATOM   2083   O O    . TRP A 1 145 ? -64.504  1.063   -90.092  1.00 0.00 ? 145 TRP A O    1  
ATOM   2084   C CB   . TRP A 1 145 ? -62.341  3.432   -89.618  1.00 0.00 ? 145 TRP A CB   1  
ATOM   2085   C CG   . TRP A 1 145 ? -62.808  4.878   -89.582  1.00 0.00 ? 145 TRP A CG   1  
ATOM   2086   C CD1  . TRP A 1 145 ? -64.092  5.323   -89.456  1.00 0.00 ? 145 TRP A CD1  1  
ATOM   2087   C CD2  . TRP A 1 145 ? -61.985  6.066   -89.691  1.00 0.00 ? 145 TRP A CD2  1  
ATOM   2088   N NE1  . TRP A 1 145 ? -64.104  6.698   -89.477  1.00 0.00 ? 145 TRP A NE1  1  
ATOM   2089   C CE2  . TRP A 1 145 ? -62.845  7.210   -89.616  1.00 0.00 ? 145 TRP A CE2  1  
ATOM   2090   C CE3  . TRP A 1 145 ? -60.604  6.290   -89.840  1.00 0.00 ? 145 TRP A CE3  1  
ATOM   2091   C CZ2  . TRP A 1 145 ? -62.361  8.500   -89.686  1.00 0.00 ? 145 TRP A CZ2  1  
ATOM   2092   C CZ3  . TRP A 1 145 ? -60.124  7.608   -89.910  1.00 0.00 ? 145 TRP A CZ3  1  
ATOM   2093   C CH2  . TRP A 1 145 ? -61.004  8.706   -89.832  1.00 0.00 ? 145 TRP A CH2  1  
ATOM   2094   H H    . TRP A 1 145 ? -61.428  2.345   -87.443  1.00 0.00 ? 145 TRP A H    1  
ATOM   2095   H HA   . TRP A 1 145 ? -64.049  2.894   -88.376  1.00 0.00 ? 145 TRP A HA   1  
ATOM   2096   H HB2  . TRP A 1 145 ? -61.319  3.413   -89.317  1.00 0.00 ? 145 TRP A HB2  1  
ATOM   2097   H HB3  . TRP A 1 145 ? -62.414  3.075   -90.630  1.00 0.00 ? 145 TRP A HB3  1  
ATOM   2098   H HD1  . TRP A 1 145 ? -64.955  4.701   -89.357  1.00 0.00 ? 145 TRP A HD1  1  
ATOM   2099   H HE1  . TRP A 1 145 ? -64.912  7.274   -89.401  1.00 0.00 ? 145 TRP A HE1  1  
ATOM   2100   H HE3  . TRP A 1 145 ? -59.913  5.455   -89.905  1.00 0.00 ? 145 TRP A HE3  1  
ATOM   2101   H HZ2  . TRP A 1 145 ? -63.040  9.351   -89.624  1.00 0.00 ? 145 TRP A HZ2  1  
ATOM   2102   H HZ3  . TRP A 1 145 ? -59.071  7.790   -90.027  1.00 0.00 ? 145 TRP A HZ3  1  
ATOM   2103   H HH2  . TRP A 1 145 ? -60.621  9.706   -89.890  1.00 0.00 ? 145 TRP A HH2  1  
ATOM   2104   N N    . LEU A 1 146 ? -62.464  0.259   -89.493  1.00 0.00 ? 146 LEU A N    1  
ATOM   2105   C CA   . LEU A 1 146 ? -62.540  -1.033  -90.201  1.00 0.00 ? 146 LEU A CA   1  
ATOM   2106   C C    . LEU A 1 146 ? -63.829  -1.826  -89.954  1.00 0.00 ? 146 LEU A C    1  
ATOM   2107   O O    . LEU A 1 146 ? -64.255  -2.537  -90.857  1.00 0.00 ? 146 LEU A O    1  
ATOM   2108   C CB   . LEU A 1 146 ? -61.373  -1.925  -89.786  1.00 0.00 ? 146 LEU A CB   1  
ATOM   2109   C CG   . LEU A 1 146 ? -60.049  -1.685  -90.618  1.00 0.00 ? 146 LEU A CG   1  
ATOM   2110   C CD1  . LEU A 1 146 ? -60.112  -2.449  -91.936  1.00 0.00 ? 146 LEU A CD1  1  
ATOM   2111   C CD2  . LEU A 1 146 ? -59.753  -0.187  -90.821  1.00 0.00 ? 146 LEU A CD2  1  
ATOM   2112   H H    . LEU A 1 146 ? -61.646  0.462   -89.003  1.00 0.00 ? 146 LEU A H    1  
ATOM   2113   H HA   . LEU A 1 146 ? -62.475  -0.845  -91.238  1.00 0.00 ? 146 LEU A HA   1  
ATOM   2114   H HB2  . LEU A 1 146 ? -61.129  -1.751  -88.767  1.00 0.00 ? 146 LEU A HB2  1  
ATOM   2115   H HB3  . LEU A 1 146 ? -61.649  -2.955  -89.922  1.00 0.00 ? 146 LEU A HB3  1  
ATOM   2116   H HG   . LEU A 1 146 ? -59.261  -2.115  -90.034  1.00 0.00 ? 146 LEU A HG   1  
ATOM   2117   H HD11 . LEU A 1 146 ? -61.129  -2.735  -92.160  1.00 0.00 ? 146 LEU A HD11 1  
ATOM   2118   H HD12 . LEU A 1 146 ? -59.504  -3.344  -91.846  1.00 0.00 ? 146 LEU A HD12 1  
ATOM   2119   H HD13 . LEU A 1 146 ? -59.726  -1.833  -92.726  1.00 0.00 ? 146 LEU A HD13 1  
ATOM   2120   H HD21 . LEU A 1 146 ? -59.949  0.355   -89.907  1.00 0.00 ? 146 LEU A HD21 1  
ATOM   2121   H HD22 . LEU A 1 146 ? -60.359  0.211   -91.616  1.00 0.00 ? 146 LEU A HD22 1  
ATOM   2122   H HD23 . LEU A 1 146 ? -58.704  -0.076  -91.080  1.00 0.00 ? 146 LEU A HD23 1  
ATOM   2123   N N    . LEU A 1 147 ? -64.463  -1.656  -88.803  1.00 0.00 ? 147 LEU A N    1  
ATOM   2124   C CA   . LEU A 1 147 ? -65.747  -2.347  -88.524  1.00 0.00 ? 147 LEU A CA   1  
ATOM   2125   C C    . LEU A 1 147 ? -66.791  -1.887  -89.533  1.00 0.00 ? 147 LEU A C    1  
ATOM   2126   O O    . LEU A 1 147 ? -67.537  -2.710  -90.056  1.00 0.00 ? 147 LEU A O    1  
ATOM   2127   C CB   . LEU A 1 147 ? -66.128  -2.020  -87.060  1.00 0.00 ? 147 LEU A CB   1  
ATOM   2128   C CG   . LEU A 1 147 ? -67.621  -1.903  -86.613  1.00 0.00 ? 147 LEU A CG   1  
ATOM   2129   C CD1  . LEU A 1 147 ? -68.072  -0.436  -86.736  1.00 0.00 ? 147 LEU A CD1  1  
ATOM   2130   C CD2  . LEU A 1 147 ? -68.586  -2.828  -87.334  1.00 0.00 ? 147 LEU A CD2  1  
ATOM   2131   H H    . LEU A 1 147 ? -64.092  -1.040  -88.142  1.00 0.00 ? 147 LEU A H    1  
ATOM   2132   H HA   . LEU A 1 147 ? -65.590  -3.395  -88.632  1.00 0.00 ? 147 LEU A HA   1  
ATOM   2133   H HB2  . LEU A 1 147 ? -65.667  -2.735  -86.424  1.00 0.00 ? 147 LEU A HB2  1  
ATOM   2134   H HB3  . LEU A 1 147 ? -65.697  -1.083  -86.875  1.00 0.00 ? 147 LEU A HB3  1  
ATOM   2135   H HG   . LEU A 1 147 ? -67.641  -2.142  -85.554  1.00 0.00 ? 147 LEU A HG   1  
ATOM   2136   H HD11 . LEU A 1 147 ? -69.146  -0.395  -86.792  1.00 0.00 ? 147 LEU A HD11 1  
ATOM   2137   H HD12 . LEU A 1 147 ? -67.641  0.001   -87.623  1.00 0.00 ? 147 LEU A HD12 1  
ATOM   2138   H HD13 . LEU A 1 147 ? -67.735  0.116   -85.865  1.00 0.00 ? 147 LEU A HD13 1  
ATOM   2139   H HD21 . LEU A 1 147 ? -69.096  -2.285  -88.111  1.00 0.00 ? 147 LEU A HD21 1  
ATOM   2140   H HD22 . LEU A 1 147 ? -69.316  -3.195  -86.616  1.00 0.00 ? 147 LEU A HD22 1  
ATOM   2141   H HD23 . LEU A 1 147 ? -68.047  -3.655  -87.751  1.00 0.00 ? 147 LEU A HD23 1  
ATOM   2142   N N    . GLY A 1 148 ? -66.838  -0.583  -89.812  1.00 0.00 ? 148 GLY A N    1  
ATOM   2143   C CA   . GLY A 1 148 ? -67.797  -0.034  -90.777  1.00 0.00 ? 148 GLY A CA   1  
ATOM   2144   C C    . GLY A 1 148 ? -67.480  -0.457  -92.206  1.00 0.00 ? 148 GLY A C    1  
ATOM   2145   O O    . GLY A 1 148 ? -68.381  -0.803  -92.968  1.00 0.00 ? 148 GLY A O    1  
ATOM   2146   H H    . GLY A 1 148 ? -66.220  0.024   -89.362  1.00 0.00 ? 148 GLY A H    1  
ATOM   2147   H HA2  . GLY A 1 148 ? -68.784  -0.376  -90.528  1.00 0.00 ? 148 GLY A HA2  1  
ATOM   2148   H HA3  . GLY A 1 148 ? -67.766  1.042   -90.722  1.00 0.00 ? 148 GLY A HA3  1  
ATOM   2149   N N    . ILE A 1 149 ? -66.195  -0.430  -92.550  1.00 0.00 ? 149 ILE A N    1  
ATOM   2150   C CA   . ILE A 1 149 ? -65.772  -0.799  -93.896  1.00 0.00 ? 149 ILE A CA   1  
ATOM   2151   C C    . ILE A 1 149 ? -66.163  -2.297  -94.219  1.00 0.00 ? 149 ILE A C    1  
ATOM   2152   O O    . ILE A 1 149 ? -66.685  -2.561  -95.304  1.00 0.00 ? 149 ILE A O    1  
ATOM   2153   C CB   . ILE A 1 149 ? -64.189  -0.567  -94.081  1.00 0.00 ? 149 ILE A CB   1  
ATOM   2154   C CG1  . ILE A 1 149 ? -63.916  0.979   -94.162  1.00 0.00 ? 149 ILE A CG1  1  
ATOM   2155   C CG2  . ILE A 1 149 ? -63.678  -1.226  -95.350  1.00 0.00 ? 149 ILE A CG2  1  
ATOM   2156   C CD1  . ILE A 1 149 ? -62.365  1.296   -93.940  1.00 0.00 ? 149 ILE A CD1  1  
ATOM   2157   H H    . ILE A 1 149 ? -65.534  -0.150  -91.889  1.00 0.00 ? 149 ILE A H    1  
ATOM   2158   H HA   . ILE A 1 149 ? -66.286  -0.185  -94.585  1.00 0.00 ? 149 ILE A HA   1  
ATOM   2159   H HB   . ILE A 1 149 ? -63.683  -0.964  -93.245  1.00 0.00 ? 149 ILE A HB   1  
ATOM   2160   H HG12 . ILE A 1 149 ? -64.178  1.335   -95.124  1.00 0.00 ? 149 ILE A HG12 1  
ATOM   2161   H HG13 . ILE A 1 149 ? -64.462  1.466   -93.400  1.00 0.00 ? 149 ILE A HG13 1  
ATOM   2162   H HG21 . ILE A 1 149 ? -64.344  -1.028  -96.175  1.00 0.00 ? 149 ILE A HG21 1  
ATOM   2163   H HG22 . ILE A 1 149 ? -63.616  -2.288  -95.179  1.00 0.00 ? 149 ILE A HG22 1  
ATOM   2164   H HG23 . ILE A 1 149 ? -62.694  -0.840  -95.580  1.00 0.00 ? 149 ILE A HG23 1  
ATOM   2165   H HD11 . ILE A 1 149 ? -61.786  0.434   -94.183  1.00 0.00 ? 149 ILE A HD11 1  
ATOM   2166   H HD12 . ILE A 1 149 ? -62.229  1.575   -92.912  1.00 0.00 ? 149 ILE A HD12 1  
ATOM   2167   H HD13 . ILE A 1 149 ? -62.114  2.120   -94.585  1.00 0.00 ? 149 ILE A HD13 1  
ATOM   2168   N N    . PHE A 1 150 ? -65.911  -3.206  -93.276  1.00 0.00 ? 150 PHE A N    1  
ATOM   2169   C CA   . PHE A 1 150 ? -66.258  -4.620  -93.468  1.00 0.00 ? 150 PHE A CA   1  
ATOM   2170   C C    . PHE A 1 150 ? -67.760  -4.793  -93.438  1.00 0.00 ? 150 PHE A C    1  
ATOM   2171   O O    . PHE A 1 150 ? -68.292  -5.661  -94.118  1.00 0.00 ? 150 PHE A O    1  
ATOM   2172   C CB   . PHE A 1 150 ? -65.638  -5.520  -92.382  1.00 0.00 ? 150 PHE A CB   1  
ATOM   2173   C CG   . PHE A 1 150 ? -64.251  -6.025  -92.756  1.00 0.00 ? 150 PHE A CG   1  
ATOM   2174   C CD1  . PHE A 1 150 ? -64.102  -7.215  -93.468  1.00 0.00 ? 150 PHE A CD1  1  
ATOM   2175   C CD2  . PHE A 1 150 ? -63.122  -5.319  -92.362  1.00 0.00 ? 150 PHE A CD2  1  
ATOM   2176   C CE1  . PHE A 1 150 ? -62.820  -7.694  -93.792  1.00 0.00 ? 150 PHE A CE1  1  
ATOM   2177   C CE2  . PHE A 1 150 ? -61.843  -5.795  -92.682  1.00 0.00 ? 150 PHE A CE2  1  
ATOM   2178   C CZ   . PHE A 1 150 ? -61.691  -6.982  -93.400  1.00 0.00 ? 150 PHE A CZ   1  
ATOM   2179   H H    . PHE A 1 150 ? -65.492  -2.927  -92.442  1.00 0.00 ? 150 PHE A H    1  
ATOM   2180   H HA   . PHE A 1 150 ? -65.902  -4.932  -94.431  1.00 0.00 ? 150 PHE A HA   1  
ATOM   2181   H HB2  . PHE A 1 150 ? -65.561  -4.962  -91.472  1.00 0.00 ? 150 PHE A HB2  1  
ATOM   2182   H HB3  . PHE A 1 150 ? -66.282  -6.371  -92.225  1.00 0.00 ? 150 PHE A HB3  1  
ATOM   2183   H HD1  . PHE A 1 150 ? -64.970  -7.766  -93.770  1.00 0.00 ? 150 PHE A HD1  1  
ATOM   2184   H HD2  . PHE A 1 150 ? -63.227  -4.405  -91.811  1.00 0.00 ? 150 PHE A HD2  1  
ATOM   2185   H HE1  . PHE A 1 150 ? -62.713  -8.614  -94.349  1.00 0.00 ? 150 PHE A HE1  1  
ATOM   2186   H HE2  . PHE A 1 150 ? -60.974  -5.236  -92.372  1.00 0.00 ? 150 PHE A HE2  1  
ATOM   2187   H HZ   . PHE A 1 150 ? -60.704  -7.345  -93.648  1.00 0.00 ? 150 PHE A HZ   1  
ATOM   2188   N N    . ILE A 1 151 ? -68.439  -3.925  -92.694  1.00 0.00 ? 151 ILE A N    1  
ATOM   2189   C CA   . ILE A 1 151 ? -69.878  -4.002  -92.652  1.00 0.00 ? 151 ILE A CA   1  
ATOM   2190   C C    . ILE A 1 151 ? -70.364  -3.724  -94.122  1.00 0.00 ? 151 ILE A C    1  
ATOM   2191   O O    . ILE A 1 151 ? -71.227  -4.416  -94.596  1.00 0.00 ? 151 ILE A O    1  
ATOM   2192   C CB   . ILE A 1 151 ? -70.494  -2.939  -91.673  1.00 0.00 ? 151 ILE A CB   1  
ATOM   2193   C CG1  . ILE A 1 151 ? -71.553  -3.671  -90.714  1.00 0.00 ? 151 ILE A CG1  1  
ATOM   2194   C CG2  . ILE A 1 151 ? -71.259  -1.861  -92.435  1.00 0.00 ? 151 ILE A CG2  1  
ATOM   2195   C CD1  . ILE A 1 151 ? -70.844  -4.589  -89.666  1.00 0.00 ? 151 ILE A CD1  1  
ATOM   2196   H H    . ILE A 1 151 ? -67.963  -3.226  -92.209  1.00 0.00 ? 151 ILE A H    1  
ATOM   2197   H HA   . ILE A 1 151 ? -70.199  -4.978  -92.387  1.00 0.00 ? 151 ILE A HA   1  
ATOM   2198   H HB   . ILE A 1 151 ? -69.731  -2.511  -91.085  1.00 0.00 ? 151 ILE A HB   1  
ATOM   2199   H HG12 . ILE A 1 151 ? -72.084  -2.918  -90.199  1.00 0.00 ? 151 ILE A HG12 1  
ATOM   2200   H HG13 . ILE A 1 151 ? -72.193  -4.262  -91.316  1.00 0.00 ? 151 ILE A HG13 1  
ATOM   2201   H HG21 . ILE A 1 151 ? -70.585  -1.393  -93.129  1.00 0.00 ? 151 ILE A HG21 1  
ATOM   2202   H HG22 . ILE A 1 151 ? -71.631  -1.129  -91.742  1.00 0.00 ? 151 ILE A HG22 1  
ATOM   2203   H HG23 . ILE A 1 151 ? -72.089  -2.299  -92.976  1.00 0.00 ? 151 ILE A HG23 1  
ATOM   2204   H HD11 . ILE A 1 151 ? -69.918  -4.952  -90.059  1.00 0.00 ? 151 ILE A HD11 1  
ATOM   2205   H HD12 . ILE A 1 151 ? -71.513  -5.411  -89.462  1.00 0.00 ? 151 ILE A HD12 1  
ATOM   2206   H HD13 . ILE A 1 151 ? -70.680  -4.020  -88.770  1.00 0.00 ? 151 ILE A HD13 1  
ATOM   2207   N N    . ALA A 1 152 ? -69.713  -2.751  -94.754  1.00 0.00 ? 152 ALA A N    1  
ATOM   2208   C CA   . ALA A 1 152 ? -70.035  -2.390  -96.144  1.00 0.00 ? 152 ALA A CA   1  
ATOM   2209   C C    . ALA A 1 152 ? -69.918  -3.566  -97.149  1.00 0.00 ? 152 ALA A C    1  
ATOM   2210   O O    . ALA A 1 152 ? -70.855  -3.817  -97.914  1.00 0.00 ? 152 ALA A O    1  
ATOM   2211   C CB   . ALA A 1 152 ? -69.138  -1.228  -96.601  1.00 0.00 ? 152 ALA A CB   1  
ATOM   2212   H H    . ALA A 1 152 ? -68.991  -2.275  -94.290  1.00 0.00 ? 152 ALA A H    1  
ATOM   2213   H HA   . ALA A 1 152 ? -71.045  -2.046  -96.169  1.00 0.00 ? 152 ALA A HA   1  
ATOM   2214   H HB1  . ALA A 1 152 ? -69.601  -0.734  -97.445  1.00 0.00 ? 152 ALA A HB1  1  
ATOM   2215   H HB2  . ALA A 1 152 ? -68.168  -1.600  -96.891  1.00 0.00 ? 152 ALA A HB2  1  
ATOM   2216   H HB3  . ALA A 1 152 ? -69.027  -0.520  -95.792  1.00 0.00 ? 152 ALA A HB3  1  
ATOM   2217   N N    . TYR A 1 153 ? -68.802  -4.292  -97.120  1.00 0.00 ? 153 TYR A N    1  
ATOM   2218   C CA   . TYR A 1 153 ? -68.612  -5.431  -98.011  1.00 0.00 ? 153 TYR A CA   1  
ATOM   2219   C C    . TYR A 1 153 ? -69.654  -6.487  -97.653  1.00 0.00 ? 153 TYR A C    1  
ATOM   2220   O O    . TYR A 1 153 ? -70.346  -7.003  -98.516  1.00 0.00 ? 153 TYR A O    1  
ATOM   2221   C CB   . TYR A 1 153 ? -67.214  -6.052  -97.812  1.00 0.00 ? 153 TYR A CB   1  
ATOM   2222   C CG   . TYR A 1 153 ? -66.061  -5.252  -98.422  1.00 0.00 ? 153 TYR A CG   1  
ATOM   2223   C CD1  . TYR A 1 153 ? -66.194  -3.915  -98.777  1.00 0.00 ? 153 TYR A CD1  1  
ATOM   2224   C CD2  . TYR A 1 153 ? -64.831  -5.886  -98.598  1.00 0.00 ? 153 TYR A CD2  1  
ATOM   2225   C CE1  . TYR A 1 153 ? -65.103  -3.215  -99.313  1.00 0.00 ? 153 TYR A CE1  1  
ATOM   2226   C CE2  . TYR A 1 153 ? -63.751  -5.190  -99.133  1.00 0.00 ? 153 TYR A CE2  1  
ATOM   2227   C CZ   . TYR A 1 153 ? -63.880  -3.860  -99.488  1.00 0.00 ? 153 TYR A CZ   1  
ATOM   2228   O OH   . TYR A 1 153 ? -62.800  -3.193  -100.017 1.00 0.00 ? 153 TYR A OH   1  
ATOM   2229   H H    . TYR A 1 153 ? -68.110  -4.072  -96.475  1.00 0.00 ? 153 TYR A H    1  
ATOM   2230   H HA   . TYR A 1 153 ? -68.740  -5.139  -99.037  1.00 0.00 ? 153 TYR A HA   1  
ATOM   2231   H HB2  . TYR A 1 153 ? -67.033  -6.132  -96.760  1.00 0.00 ? 153 TYR A HB2  1  
ATOM   2232   H HB3  . TYR A 1 153 ? -67.219  -7.035  -98.245  1.00 0.00 ? 153 TYR A HB3  1  
ATOM   2233   H HD1  . TYR A 1 153 ? -67.129  -3.418  -98.643  1.00 0.00 ? 153 TYR A HD1  1  
ATOM   2234   H HD2  . TYR A 1 153 ? -64.712  -6.913  -98.322  1.00 0.00 ? 153 TYR A HD2  1  
ATOM   2235   H HE1  . TYR A 1 153 ? -65.210  -2.174  -99.582  1.00 0.00 ? 153 TYR A HE1  1  
ATOM   2236   H HE2  . TYR A 1 153 ? -62.807  -5.689  -99.262  1.00 0.00 ? 153 TYR A HE2  1  
ATOM   2237   H HH   . TYR A 1 153 ? -62.638  -2.417  -99.479  1.00 0.00 ? 153 TYR A HH   1  
ATOM   2238   N N    . LEU A 1 154 ? -69.767  -6.763  -96.350  1.00 0.00 ? 154 LEU A N    1  
ATOM   2239   C CA   . LEU A 1 154 ? -70.746  -7.737  -95.832  1.00 0.00 ? 154 LEU A CA   1  
ATOM   2240   C C    . LEU A 1 154 ? -72.141  -7.266  -96.162  1.00 0.00 ? 154 LEU A C    1  
ATOM   2241   O O    . LEU A 1 154 ? -72.998  -8.058  -96.564  1.00 0.00 ? 154 LEU A O    1  
ATOM   2242   C CB   . LEU A 1 154 ? -70.551  -7.871  -94.303  1.00 0.00 ? 154 LEU A CB   1  
ATOM   2243   C CG   . LEU A 1 154 ? -71.793  -8.397  -93.536  1.00 0.00 ? 154 LEU A CG   1  
ATOM   2244   C CD1  . LEU A 1 154 ? -71.334  -9.304  -92.383  1.00 0.00 ? 154 LEU A CD1  1  
ATOM   2245   C CD2  . LEU A 1 154 ? -72.605  -7.223  -92.977  1.00 0.00 ? 154 LEU A CD2  1  
ATOM   2246   H H    . LEU A 1 154 ? -69.187  -6.294  -95.721  1.00 0.00 ? 154 LEU A H    1  
ATOM   2247   H HA   . LEU A 1 154 ? -70.563  -8.691  -96.301  1.00 0.00 ? 154 LEU A HA   1  
ATOM   2248   H HB2  . LEU A 1 154 ? -69.754  -8.558  -94.134  1.00 0.00 ? 154 LEU A HB2  1  
ATOM   2249   H HB3  . LEU A 1 154 ? -70.284  -6.912  -93.919  1.00 0.00 ? 154 LEU A HB3  1  
ATOM   2250   H HG   . LEU A 1 154 ? -72.405  -8.967  -94.186  1.00 0.00 ? 154 LEU A HG   1  
ATOM   2251   H HD11 . LEU A 1 154 ? -72.125  -9.398  -91.659  1.00 0.00 ? 154 LEU A HD11 1  
ATOM   2252   H HD12 . LEU A 1 154 ? -70.456  -8.886  -91.911  1.00 0.00 ? 154 LEU A HD12 1  
ATOM   2253   H HD13 . LEU A 1 154 ? -71.095  -10.277 -92.787  1.00 0.00 ? 154 LEU A HD13 1  
ATOM   2254   H HD21 . LEU A 1 154 ? -72.263  -6.969  -91.985  1.00 0.00 ? 154 LEU A HD21 1  
ATOM   2255   H HD22 . LEU A 1 154 ? -73.645  -7.508  -92.940  1.00 0.00 ? 154 LEU A HD22 1  
ATOM   2256   H HD23 . LEU A 1 154 ? -72.486  -6.373  -93.627  1.00 0.00 ? 154 LEU A HD23 1  
ATOM   2257   N N    . ILE A 1 155 ? -72.387  -5.983  -95.945  1.00 0.00 ? 155 ILE A N    1  
ATOM   2258   C CA   . ILE A 1 155 ? -73.689  -5.460  -96.191  1.00 0.00 ? 155 ILE A CA   1  
ATOM   2259   C C    . ILE A 1 155 ? -74.020  -5.414  -97.846  1.00 0.00 ? 155 ILE A C    1  
ATOM   2260   O O    . ILE A 1 155 ? -75.144  -5.678  -98.178  1.00 0.00 ? 155 ILE A O    1  
ATOM   2261   C CB   . ILE A 1 155 ? -73.906  -4.000  -95.548  1.00 0.00 ? 155 ILE A CB   1  
ATOM   2262   C CG1  . ILE A 1 155 ? -74.653  -4.244  -94.181  1.00 0.00 ? 155 ILE A CG1  1  
ATOM   2263   C CG2  . ILE A 1 155 ? -74.687  -3.082  -96.482  1.00 0.00 ? 155 ILE A CG2  1  
ATOM   2264   C CD1  . ILE A 1 155 ? -74.840  -2.953  -93.377  1.00 0.00 ? 155 ILE A CD1  1  
ATOM   2265   H H    . ILE A 1 155 ? -71.685  -5.408  -95.581  1.00 0.00 ? 155 ILE A H    1  
ATOM   2266   H HA   . ILE A 1 155 ? -74.406  -6.113  -95.810  1.00 0.00 ? 155 ILE A HA   1  
ATOM   2267   H HB   . ILE A 1 155 ? -72.957  -3.603  -95.360  1.00 0.00 ? 155 ILE A HB   1  
ATOM   2268   H HG12 . ILE A 1 155 ? -75.610  -4.667  -94.384  1.00 0.00 ? 155 ILE A HG12 1  
ATOM   2269   H HG13 . ILE A 1 155 ? -74.070  -4.933  -93.607  1.00 0.00 ? 155 ILE A HG13 1  
ATOM   2270   H HG21 . ILE A 1 155 ? -74.078  -2.878  -97.356  1.00 0.00 ? 155 ILE A HG21 1  
ATOM   2271   H HG22 . ILE A 1 155 ? -74.893  -2.160  -95.968  1.00 0.00 ? 155 ILE A HG22 1  
ATOM   2272   H HG23 . ILE A 1 155 ? -75.613  -3.542  -96.795  1.00 0.00 ? 155 ILE A HG23 1  
ATOM   2273   H HD11 . ILE A 1 155 ? -74.226  -2.997  -92.486  1.00 0.00 ? 155 ILE A HD11 1  
ATOM   2274   H HD12 . ILE A 1 155 ? -75.881  -2.877  -93.081  1.00 0.00 ? 155 ILE A HD12 1  
ATOM   2275   H HD13 . ILE A 1 155 ? -74.569  -2.095  -93.964  1.00 0.00 ? 155 ILE A HD13 1  
ATOM   2276   N N    . VAL A 1 156 ? -72.964  -5.251  -98.615  1.00 0.00 ? 156 VAL A N    1  
ATOM   2277   C CA   . VAL A 1 156 ? -73.105  -5.329  -100.062 1.00 0.00 ? 156 VAL A CA   1  
ATOM   2278   C C    . VAL A 1 156 ? -73.395  -6.801  -100.374 1.00 0.00 ? 156 VAL A C    1  
ATOM   2279   O O    . VAL A 1 156 ? -74.384  -7.104  -101.025 1.00 0.00 ? 156 VAL A O    1  
ATOM   2280   C CB   . VAL A 1 156 ? -71.800  -4.844  -100.791 1.00 0.00 ? 156 VAL A CB   1  
ATOM   2281   C CG1  . VAL A 1 156 ? -71.646  -5.496  -102.186 1.00 0.00 ? 156 VAL A CG1  1  
ATOM   2282   C CG2  . VAL A 1 156 ? -71.805  -3.310  -100.922 1.00 0.00 ? 156 VAL A CG2  1  
ATOM   2283   H H    . VAL A 1 156 ? -72.080  -5.169  -98.214  1.00 0.00 ? 156 VAL A H    1  
ATOM   2284   H HA   . VAL A 1 156 ? -73.940  -4.739  -100.388 1.00 0.00 ? 156 VAL A HA   1  
ATOM   2285   H HB   . VAL A 1 156 ? -70.957  -5.129  -100.200 1.00 0.00 ? 156 VAL A HB   1  
ATOM   2286   H HG11 . VAL A 1 156 ? -71.310  -6.519  -102.060 1.00 0.00 ? 156 VAL A HG11 1  
ATOM   2287   H HG12 . VAL A 1 156 ? -70.912  -4.953  -102.765 1.00 0.00 ? 156 VAL A HG12 1  
ATOM   2288   H HG13 . VAL A 1 156 ? -72.590  -5.492  -102.708 1.00 0.00 ? 156 VAL A HG13 1  
ATOM   2289   H HG21 . VAL A 1 156 ? -70.784  -2.958  -100.989 1.00 0.00 ? 156 VAL A HG21 1  
ATOM   2290   H HG22 . VAL A 1 156 ? -72.273  -2.879  -100.047 1.00 0.00 ? 156 VAL A HG22 1  
ATOM   2291   H HG23 . VAL A 1 156 ? -72.347  -3.014  -101.804 1.00 0.00 ? 156 VAL A HG23 1  
ATOM   2292   N N    . ALA A 1 157 ? -72.567  -7.706  -99.818  1.00 0.00 ? 157 ALA A N    1  
ATOM   2293   C CA   . ALA A 1 157 ? -72.737  -9.155  -100.008 1.00 0.00 ? 157 ALA A CA   1  
ATOM   2294   C C    . ALA A 1 157 ? -74.112  -9.673  -99.562  1.00 0.00 ? 157 ALA A C    1  
ATOM   2295   O O    . ALA A 1 157 ? -74.786  -10.356 -100.334 1.00 0.00 ? 157 ALA A O    1  
ATOM   2296   C CB   . ALA A 1 157 ? -71.633  -9.902  -99.256  1.00 0.00 ? 157 ALA A CB   1  
ATOM   2297   H H    . ALA A 1 157 ? -71.839  -7.390  -99.257  1.00 0.00 ? 157 ALA A H    1  
ATOM   2298   H HA   . ALA A 1 157 ? -72.626  -9.377  -101.046 1.00 0.00 ? 157 ALA A HA   1  
ATOM   2299   H HB1  . ALA A 1 157 ? -70.853  -9.211  -98.985  1.00 0.00 ? 157 ALA A HB1  1  
ATOM   2300   H HB2  . ALA A 1 157 ? -71.229  -10.672 -99.898  1.00 0.00 ? 157 ALA A HB2  1  
ATOM   2301   H HB3  . ALA A 1 157 ? -72.037  -10.356 -98.365  1.00 0.00 ? 157 ALA A HB3  1  
ATOM   2302   N N    . VAL A 1 158 ? -74.550  -9.344  -98.346  1.00 0.00 ? 158 VAL A N    1  
ATOM   2303   C CA   . VAL A 1 158 ? -75.851  -9.839  -97.918  1.00 0.00 ? 158 VAL A CA   1  
ATOM   2304   C C    . VAL A 1 158 ? -76.893  -9.330  -98.913  1.00 0.00 ? 158 VAL A C    1  
ATOM   2305   O O    . VAL A 1 158 ? -77.751  -10.096 -99.339  1.00 0.00 ? 158 VAL A O    1  
ATOM   2306   C CB   . VAL A 1 158 ? -76.162  -9.441  -96.436  1.00 0.00 ? 158 VAL A CB   1  
ATOM   2307   C CG1  . VAL A 1 158 ? -77.646  -9.669  -96.098  1.00 0.00 ? 158 VAL A CG1  1  
ATOM   2308   C CG2  . VAL A 1 158 ? -75.287  -10.286 -95.492  1.00 0.00 ? 158 VAL A CG2  1  
ATOM   2309   H H    . VAL A 1 158 ? -74.004  -8.786  -97.761  1.00 0.00 ? 158 VAL A H    1  
ATOM   2310   H HA   . VAL A 1 158 ? -75.839  -10.904 -97.987  1.00 0.00 ? 158 VAL A HA   1  
ATOM   2311   H HB   . VAL A 1 158 ? -75.928  -8.408  -96.290  1.00 0.00 ? 158 VAL A HB   1  
ATOM   2312   H HG11 . VAL A 1 158 ? -77.761  -9.789  -95.027  1.00 0.00 ? 158 VAL A HG11 1  
ATOM   2313   H HG12 . VAL A 1 158 ? -78.010  -10.551 -96.598  1.00 0.00 ? 158 VAL A HG12 1  
ATOM   2314   H HG13 . VAL A 1 158 ? -78.218  -8.808  -96.420  1.00 0.00 ? 158 VAL A HG13 1  
ATOM   2315   H HG21 . VAL A 1 158 ? -75.651  -11.301 -95.462  1.00 0.00 ? 158 VAL A HG21 1  
ATOM   2316   H HG22 . VAL A 1 158 ? -75.326  -9.860  -94.498  1.00 0.00 ? 158 VAL A HG22 1  
ATOM   2317   H HG23 . VAL A 1 158 ? -74.267  -10.277 -95.845  1.00 0.00 ? 158 VAL A HG23 1  
ATOM   2318   N N    . LEU A 1 159 ? -76.865  -8.022  -99.202  1.00 0.00 ? 159 LEU A N    1  
ATOM   2319   C CA   . LEU A 1 159 ? -77.856  -7.380  -100.106 1.00 0.00 ? 159 LEU A CA   1  
ATOM   2320   C C    . LEU A 1 159 ? -77.984  -7.961  -101.517 1.00 0.00 ? 159 LEU A C    1  
ATOM   2321   O O    . LEU A 1 159 ? -79.098  -8.013  -102.054 1.00 0.00 ? 159 LEU A O    1  
ATOM   2322   C CB   . LEU A 1 159 ? -77.623  -5.831  -100.116 1.00 0.00 ? 159 LEU A CB   1  
ATOM   2323   C CG   . LEU A 1 159 ? -77.599  -5.158  -101.524 1.00 0.00 ? 159 LEU A CG   1  
ATOM   2324   C CD1  . LEU A 1 159 ? -79.009  -5.083  -102.126 1.00 0.00 ? 159 LEU A CD1  1  
ATOM   2325   C CD2  . LEU A 1 159 ? -76.968  -3.734  -101.441 1.00 0.00 ? 159 LEU A CD2  1  
ATOM   2326   H H    . LEU A 1 159 ? -76.204  -7.466  -98.746  1.00 0.00 ? 159 LEU A H    1  
ATOM   2327   H HA   . LEU A 1 159 ? -78.796  -7.546  -99.610  1.00 0.00 ? 159 LEU A HA   1  
ATOM   2328   H HB2  . LEU A 1 159 ? -78.416  -5.386  -99.558  1.00 0.00 ? 159 LEU A HB2  1  
ATOM   2329   H HB3  . LEU A 1 159 ? -76.698  -5.636  -99.636  1.00 0.00 ? 159 LEU A HB3  1  
ATOM   2330   H HG   . LEU A 1 159 ? -76.992  -5.742  -102.163 1.00 0.00 ? 159 LEU A HG   1  
ATOM   2331   H HD11 . LEU A 1 159 ? -79.437  -4.103  -101.986 1.00 0.00 ? 159 LEU A HD11 1  
ATOM   2332   H HD12 . LEU A 1 159 ? -79.642  -5.821  -101.658 1.00 0.00 ? 159 LEU A HD12 1  
ATOM   2333   H HD13 . LEU A 1 159 ? -78.941  -5.296  -103.187 1.00 0.00 ? 159 LEU A HD13 1  
ATOM   2334   H HD21 . LEU A 1 159 ? -75.907  -3.828  -101.244 1.00 0.00 ? 159 LEU A HD21 1  
ATOM   2335   H HD22 . LEU A 1 159 ? -77.429  -3.156  -100.660 1.00 0.00 ? 159 LEU A HD22 1  
ATOM   2336   H HD23 . LEU A 1 159 ? -77.106  -3.231  -102.392 1.00 0.00 ? 159 LEU A HD23 1  
ATOM   2337   N N    . VAL A 1 160 ? -76.871  -8.435  -102.084 1.00 0.00 ? 160 VAL A N    1  
ATOM   2338   C CA   . VAL A 1 160 ? -76.889  -9.045  -103.430 1.00 0.00 ? 160 VAL A CA   1  
ATOM   2339   C C    . VAL A 1 160 ? -77.461  -10.475 -103.370 1.00 0.00 ? 160 VAL A C    1  
ATOM   2340   O O    . VAL A 1 160 ? -78.213  -10.885 -104.268 1.00 0.00 ? 160 VAL A O    1  
ATOM   2341   C CB   . VAL A 1 160 ? -75.464  -9.023  -104.129 1.00 0.00 ? 160 VAL A CB   1  
ATOM   2342   C CG1  . VAL A 1 160 ? -74.358  -9.530  -103.195 1.00 0.00 ? 160 VAL A CG1  1  
ATOM   2343   C CG2  . VAL A 1 160 ? -75.457  -9.884  -105.414 1.00 0.00 ? 160 VAL A CG2  1  
ATOM   2344   H H    . VAL A 1 160 ? -76.042  -8.401  -101.581 1.00 0.00 ? 160 VAL A H    1  
ATOM   2345   H HA   . VAL A 1 160 ? -77.554  -8.456  -104.035 1.00 0.00 ? 160 VAL A HA   1  
ATOM   2346   H HB   . VAL A 1 160 ? -75.237  -8.008  -104.410 1.00 0.00 ? 160 VAL A HB   1  
ATOM   2347   H HG11 . VAL A 1 160 ? -73.460  -9.740  -103.767 1.00 0.00 ? 160 VAL A HG11 1  
ATOM   2348   H HG12 . VAL A 1 160 ? -74.681  -10.429 -102.698 1.00 0.00 ? 160 VAL A HG12 1  
ATOM   2349   H HG13 . VAL A 1 160 ? -74.143  -8.769  -102.467 1.00 0.00 ? 160 VAL A HG13 1  
ATOM   2350   H HG21 . VAL A 1 160 ? -76.423  -9.839  -105.887 1.00 0.00 ? 160 VAL A HG21 1  
ATOM   2351   H HG22 . VAL A 1 160 ? -75.219  -10.907 -105.167 1.00 0.00 ? 160 VAL A HG22 1  
ATOM   2352   H HG23 . VAL A 1 160 ? -74.705  -9.499  -106.098 1.00 0.00 ? 160 VAL A HG23 1  
ATOM   2353   N N    . VAL A 1 161 ? -77.205  -11.210 -102.268 1.00 0.00 ? 161 VAL A N    1  
ATOM   2354   C CA   . VAL A 1 161 ? -77.766  -12.565 -102.143 1.00 0.00 ? 161 VAL A CA   1  
ATOM   2355   C C    . VAL A 1 161 ? -78.983  -12.564 -101.208 1.00 0.00 ? 161 VAL A C    1  
ATOM   2356   O O    . VAL A 1 161 ? -79.725  -13.546 -101.145 1.00 0.00 ? 161 VAL A O    1  
ATOM   2357   C CB   . VAL A 1 161 ? -76.723  -13.652 -101.716 1.00 0.00 ? 161 VAL A CB   1  
ATOM   2358   C CG1  . VAL A 1 161 ? -75.553  -13.642 -102.677 1.00 0.00 ? 161 VAL A CG1  1  
ATOM   2359   C CG2  . VAL A 1 161 ? -76.201  -13.422 -100.312 1.00 0.00 ? 161 VAL A CG2  1  
ATOM   2360   H H    . VAL A 1 161 ? -76.684  -10.816 -101.543 1.00 0.00 ? 161 VAL A H    1  
ATOM   2361   H HA   . VAL A 1 161 ? -78.128  -12.852 -103.104 1.00 0.00 ? 161 VAL A HA   1  
ATOM   2362   H HB   . VAL A 1 161 ? -77.196  -14.622 -101.767 1.00 0.00 ? 161 VAL A HB   1  
ATOM   2363   H HG11 . VAL A 1 161 ? -75.919  -13.743 -103.685 1.00 0.00 ? 161 VAL A HG11 1  
ATOM   2364   H HG12 . VAL A 1 161 ? -74.896  -14.467 -102.443 1.00 0.00 ? 161 VAL A HG12 1  
ATOM   2365   H HG13 . VAL A 1 161 ? -75.018  -12.713 -102.575 1.00 0.00 ? 161 VAL A HG13 1  
ATOM   2366   H HG21 . VAL A 1 161 ? -77.008  -13.542 -99.610  1.00 0.00 ? 161 VAL A HG21 1  
ATOM   2367   H HG22 . VAL A 1 161 ? -75.795  -12.429 -100.240 1.00 0.00 ? 161 VAL A HG22 1  
ATOM   2368   H HG23 . VAL A 1 161 ? -75.425  -14.147 -100.098 1.00 0.00 ? 161 VAL A HG23 1  
ATOM   2369   N N    . ILE A 1 162 ? -79.190  -11.475 -100.479 1.00 0.00 ? 162 ILE A N    1  
ATOM   2370   C CA   . ILE A 1 162 ? -80.311  -11.375 -99.536  1.00 0.00 ? 162 ILE A CA   1  
ATOM   2371   C C    . ILE A 1 162 ? -80.627  -12.755 -98.900  1.00 0.00 ? 162 ILE A C    1  
ATOM   2372   O O    . ILE A 1 162 ? -81.218  -12.815 -97.817  1.00 0.00 ? 162 ILE A O    1  
ATOM   2373   C CB   . ILE A 1 162 ? -81.574  -10.763 -100.186 1.00 0.00 ? 162 ILE A CB   1  
ATOM   2374   C CG1  . ILE A 1 162 ? -81.788  -11.281 -101.613 1.00 0.00 ? 162 ILE A CG1  1  
ATOM   2375   C CG2  . ILE A 1 162 ? -81.471  -9.240  -100.211 1.00 0.00 ? 162 ILE A CG2  1  
ATOM   2376   C CD1  . ILE A 1 162 ? -80.903  -10.561 -102.631 1.00 0.00 ? 162 ILE A CD1  1  
ATOM   2377   H H    . ILE A 1 162 ? -78.571  -10.715 -100.559 1.00 0.00 ? 162 ILE A H    1  
ATOM   2378   H HA   . ILE A 1 162 ? -79.994  -10.729 -98.746  1.00 0.00 ? 162 ILE A HA   1  
ATOM   2379   H HB   . ILE A 1 162 ? -82.431  -11.035 -99.590  1.00 0.00 ? 162 ILE A HB   1  
ATOM   2380   H HG12 . ILE A 1 162 ? -81.566  -12.323 -101.639 1.00 0.00 ? 162 ILE A HG12 1  
ATOM   2381   H HG13 . ILE A 1 162 ? -82.821  -11.124 -101.881 1.00 0.00 ? 162 ILE A HG13 1  
ATOM   2382   H HG21 . ILE A 1 162 ? -80.499  -8.954  -100.571 1.00 0.00 ? 162 ILE A HG21 1  
ATOM   2383   H HG22 . ILE A 1 162 ? -81.618  -8.857  -99.215  1.00 0.00 ? 162 ILE A HG22 1  
ATOM   2384   H HG23 . ILE A 1 162 ? -82.232  -8.842  -100.868 1.00 0.00 ? 162 ILE A HG23 1  
ATOM   2385   H HD11 . ILE A 1 162 ? -81.468  -9.766  -103.096 1.00 0.00 ? 162 ILE A HD11 1  
ATOM   2386   H HD12 . ILE A 1 162 ? -80.596  -11.271 -103.386 1.00 0.00 ? 162 ILE A HD12 1  
ATOM   2387   H HD13 . ILE A 1 162 ? -80.038  -10.154 -102.145 1.00 0.00 ? 162 ILE A HD13 1  
ATOM   2388   N N    . ASP B 2 21  ? -48.214  -8.199  -57.509  1.00 0.00 ? 21  ASP B N    1  
ATOM   2389   C CA   . ASP B 2 21  ? -49.439  -7.656  -58.187  1.00 0.00 ? 21  ASP B CA   1  
ATOM   2390   C C    . ASP B 2 21  ? -49.680  -6.214  -57.763  1.00 0.00 ? 21  ASP B C    1  
ATOM   2391   O O    . ASP B 2 21  ? -48.797  -5.567  -57.195  1.00 0.00 ? 21  ASP B O    1  
ATOM   2392   C CB   . ASP B 2 21  ? -50.676  -8.515  -57.862  1.00 0.00 ? 21  ASP B CB   1  
ATOM   2393   C CG   . ASP B 2 21  ? -50.443  -10.020 -58.101  1.00 0.00 ? 21  ASP B CG   1  
ATOM   2394   O OD1  . ASP B 2 21  ? -49.438  -10.404 -58.770  1.00 0.00 ? 21  ASP B OD1  1  
ATOM   2395   O OD2  . ASP B 2 21  ? -51.286  -10.820 -57.617  1.00 0.00 ? 21  ASP B OD2  1  
ATOM   2396   H H    . ASP B 2 21  ? -47.511  -7.440  -57.401  1.00 0.00 ? 21  ASP B H    1  
ATOM   2397   H HA   . ASP B 2 21  ? -49.275  -7.675  -59.255  1.00 0.00 ? 21  ASP B HA   1  
ATOM   2398   H HB2  . ASP B 2 21  ? -50.938  -8.366  -56.826  1.00 0.00 ? 21  ASP B HB2  1  
ATOM   2399   H HB3  . ASP B 2 21  ? -51.499  -8.185  -58.479  1.00 0.00 ? 21  ASP B HB3  1  
ATOM   2400   N N    . ILE B 2 22  ? -50.867  -5.703  -58.048  1.00 0.00 ? 22  ILE B N    1  
ATOM   2401   C CA   . ILE B 2 22  ? -51.277  -4.450  -57.466  1.00 0.00 ? 22  ILE B CA   1  
ATOM   2402   C C    . ILE B 2 22  ? -51.717  -4.766  -56.028  1.00 0.00 ? 22  ILE B C    1  
ATOM   2403   O O    . ILE B 2 22  ? -52.285  -5.831  -55.778  1.00 0.00 ? 22  ILE B O    1  
ATOM   2404   C CB   . ILE B 2 22  ? -52.395  -3.839  -58.305  1.00 0.00 ? 22  ILE B CB   1  
ATOM   2405   C CG1  . ILE B 2 22  ? -51.829  -3.364  -59.635  1.00 0.00 ? 22  ILE B CG1  1  
ATOM   2406   C CG2  . ILE B 2 22  ? -53.068  -2.686  -57.586  1.00 0.00 ? 22  ILE B CG2  1  
ATOM   2407   C CD1  . ILE B 2 22  ? -52.869  -3.070  -60.658  1.00 0.00 ? 22  ILE B CD1  1  
ATOM   2408   H H    . ILE B 2 22  ? -51.530  -6.257  -58.511  1.00 0.00 ? 22  ILE B H    1  
ATOM   2409   H HA   . ILE B 2 22  ? -50.431  -3.776  -57.440  1.00 0.00 ? 22  ILE B HA   1  
ATOM   2410   H HB   . ILE B 2 22  ? -53.135  -4.602  -58.498  1.00 0.00 ? 22  ILE B HB   1  
ATOM   2411   H HG12 . ILE B 2 22  ? -51.255  -2.466  -59.465  1.00 0.00 ? 22  ILE B HG12 1  
ATOM   2412   H HG13 . ILE B 2 22  ? -51.166  -4.127  -60.019  1.00 0.00 ? 22  ILE B HG13 1  
ATOM   2413   H HG21 . ILE B 2 22  ? -54.030  -3.006  -57.214  1.00 0.00 ? 22  ILE B HG21 1  
ATOM   2414   H HG22 . ILE B 2 22  ? -53.203  -1.863  -58.272  1.00 0.00 ? 22  ILE B HG22 1  
ATOM   2415   H HG23 . ILE B 2 22  ? -52.450  -2.368  -56.759  1.00 0.00 ? 22  ILE B HG23 1  
ATOM   2416   H HD11 . ILE B 2 22  ? -52.773  -3.765  -61.479  1.00 0.00 ? 22  ILE B HD11 1  
ATOM   2417   H HD12 . ILE B 2 22  ? -52.740  -2.061  -61.023  1.00 0.00 ? 22  ILE B HD12 1  
ATOM   2418   H HD13 . ILE B 2 22  ? -53.849  -3.171  -60.216  1.00 0.00 ? 22  ILE B HD13 1  
ATOM   2419   N N    . VAL B 2 23  ? -51.403  -3.879  -55.082  1.00 0.00 ? 23  VAL B N    1  
ATOM   2420   C CA   . VAL B 2 23  ? -51.980  -3.955  -53.730  1.00 0.00 ? 23  VAL B CA   1  
ATOM   2421   C C    . VAL B 2 23  ? -52.959  -2.830  -53.388  1.00 0.00 ? 23  VAL B C    1  
ATOM   2422   O O    . VAL B 2 23  ? -52.605  -1.642  -53.329  1.00 0.00 ? 23  VAL B O    1  
ATOM   2423   C CB   . VAL B 2 23  ? -50.937  -4.119  -52.595  1.00 0.00 ? 23  VAL B CB   1  
ATOM   2424   C CG1  . VAL B 2 23  ? -50.958  -5.524  -52.095  1.00 0.00 ? 23  VAL B CG1  1  
ATOM   2425   C CG2  . VAL B 2 23  ? -49.535  -3.736  -53.043  1.00 0.00 ? 23  VAL B CG2  1  
ATOM   2426   H H    . VAL B 2 23  ? -50.907  -3.073  -55.338  1.00 0.00 ? 23  VAL B H    1  
ATOM   2427   H HA   . VAL B 2 23  ? -52.570  -4.862  -53.723  1.00 0.00 ? 23  VAL B HA   1  
ATOM   2428   H HB   . VAL B 2 23  ? -51.227  -3.470  -51.779  1.00 0.00 ? 23  VAL B HB   1  
ATOM   2429   H HG11 . VAL B 2 23  ? -50.677  -5.540  -51.053  1.00 0.00 ? 23  VAL B HG11 1  
ATOM   2430   H HG12 . VAL B 2 23  ? -50.261  -6.120  -52.667  1.00 0.00 ? 23  VAL B HG12 1  
ATOM   2431   H HG13 . VAL B 2 23  ? -51.953  -5.930  -52.204  1.00 0.00 ? 23  VAL B HG13 1  
ATOM   2432   H HG21 . VAL B 2 23  ? -49.584  -2.851  -53.661  1.00 0.00 ? 23  VAL B HG21 1  
ATOM   2433   H HG22 . VAL B 2 23  ? -49.104  -4.547  -53.611  1.00 0.00 ? 23  VAL B HG22 1  
ATOM   2434   H HG23 . VAL B 2 23  ? -48.922  -3.536  -52.177  1.00 0.00 ? 23  VAL B HG23 1  
ATOM   2435   N N    . MET B 2 24  ? -54.206  -3.232  -53.179  1.00 0.00 ? 24  MET B N    1  
ATOM   2436   C CA   . MET B 2 24  ? -55.236  -2.357  -52.647  1.00 0.00 ? 24  MET B CA   1  
ATOM   2437   C C    . MET B 2 24  ? -55.191  -2.422  -51.139  1.00 0.00 ? 24  MET B C    1  
ATOM   2438   O O    . MET B 2 24  ? -55.033  -3.490  -50.545  1.00 0.00 ? 24  MET B O    1  
ATOM   2439   C CB   . MET B 2 24  ? -56.631  -2.754  -53.136  1.00 0.00 ? 24  MET B CB   1  
ATOM   2440   C CG   . MET B 2 24  ? -56.729  -3.020  -54.641  1.00 0.00 ? 24  MET B CG   1  
ATOM   2441   S SD   . MET B 2 24  ? -56.020  -1.738  -55.684  1.00 0.00 ? 24  MET B SD   1  
ATOM   2442   C CE   . MET B 2 24  ? -57.385  -0.587  -55.594  1.00 0.00 ? 24  MET B CE   1  
ATOM   2443   H H    . MET B 2 24  ? -54.405  -4.188  -53.259  1.00 0.00 ? 24  MET B H    1  
ATOM   2444   H HA   . MET B 2 24  ? -55.030  -1.343  -52.959  1.00 0.00 ? 24  MET B HA   1  
ATOM   2445   H HB2  . MET B 2 24  ? -56.934  -3.649  -52.615  1.00 0.00 ? 24  MET B HB2  1  
ATOM   2446   H HB3  . MET B 2 24  ? -57.320  -1.962  -52.880  1.00 0.00 ? 24  MET B HB3  1  
ATOM   2447   H HG2  . MET B 2 24  ? -56.206  -3.939  -54.851  1.00 0.00 ? 24  MET B HG2  1  
ATOM   2448   H HG3  . MET B 2 24  ? -57.769  -3.155  -54.902  1.00 0.00 ? 24  MET B HG3  1  
ATOM   2449   H HE1  . MET B 2 24  ? -58.084  -0.796  -56.392  1.00 0.00 ? 24  MET B HE1  1  
ATOM   2450   H HE2  . MET B 2 24  ? -57.015  0.421   -55.698  1.00 0.00 ? 24  MET B HE2  1  
ATOM   2451   H HE3  . MET B 2 24  ? -57.880  -0.690  -54.638  1.00 0.00 ? 24  MET B HE3  1  
ATOM   2452   N N    . SER B 2 25  ? -55.339  -1.248  -50.545  1.00 0.00 ? 25  SER B N    1  
ATOM   2453   C CA   . SER B 2 25  ? -55.232  -1.050  -49.126  1.00 0.00 ? 25  SER B CA   1  
ATOM   2454   C C    . SER B 2 25  ? -56.156  0.100   -48.771  1.00 0.00 ? 25  SER B C    1  
ATOM   2455   O O    . SER B 2 25  ? -55.932  1.233   -49.198  1.00 0.00 ? 25  SER B O    1  
ATOM   2456   C CB   . SER B 2 25  ? -53.803  -0.661  -48.807  1.00 0.00 ? 25  SER B CB   1  
ATOM   2457   O OG   . SER B 2 25  ? -53.377  0.337   -49.709  1.00 0.00 ? 25  SER B OG   1  
ATOM   2458   H H    . SER B 2 25  ? -55.463  -0.458  -51.112  1.00 0.00 ? 25  SER B H    1  
ATOM   2459   H HA   . SER B 2 25  ? -55.510  -1.945  -48.592  1.00 0.00 ? 25  SER B HA   1  
ATOM   2460   H HB2  . SER B 2 25  ? -53.750  -0.275  -47.802  1.00 0.00 ? 25  SER B HB2  1  
ATOM   2461   H HB3  . SER B 2 25  ? -53.167  -1.532  -48.889  1.00 0.00 ? 25  SER B HB3  1  
ATOM   2462   H HG   . SER B 2 25  ? -52.790  0.932   -49.238  1.00 0.00 ? 25  SER B HG   1  
ATOM   2463   N N    . GLN B 2 26  ? -57.200  -0.196  -48.001  1.00 0.00 ? 26  GLN B N    1  
ATOM   2464   C CA   . GLN B 2 26  ? -58.146  0.814   -47.529  1.00 0.00 ? 26  GLN B CA   1  
ATOM   2465   C C    . GLN B 2 26  ? -57.841  1.238   -46.087  1.00 0.00 ? 26  GLN B C    1  
ATOM   2466   O O    . GLN B 2 26  ? -57.317  0.456   -45.305  1.00 0.00 ? 26  GLN B O    1  
ATOM   2467   C CB   . GLN B 2 26  ? -59.571  0.272   -47.617  1.00 0.00 ? 26  GLN B CB   1  
ATOM   2468   C CG   . GLN B 2 26  ? -59.953  -0.239  -48.989  1.00 0.00 ? 26  GLN B CG   1  
ATOM   2469   C CD   . GLN B 2 26  ? -60.906  -1.427  -48.940  1.00 0.00 ? 26  GLN B CD   1  
ATOM   2470   O OE1  . GLN B 2 26  ? -61.866  -1.503  -49.705  1.00 0.00 ? 26  GLN B OE1  1  
ATOM   2471   N NE2  . GLN B 2 26  ? -60.631  -2.366  -48.051  1.00 0.00 ? 26  GLN B NE2  1  
ATOM   2472   H H    . GLN B 2 26  ? -57.318  -1.124  -47.708  1.00 0.00 ? 26  GLN B H    1  
ATOM   2473   H HA   . GLN B 2 26  ? -58.069  1.682   -48.166  1.00 0.00 ? 26  GLN B HA   1  
ATOM   2474   H HB2  . GLN B 2 26  ? -59.648  -0.557  -46.929  1.00 0.00 ? 26  GLN B HB2  1  
ATOM   2475   H HB3  . GLN B 2 26  ? -60.267  1.037   -47.310  1.00 0.00 ? 26  GLN B HB3  1  
ATOM   2476   H HG2  . GLN B 2 26  ? -60.426  0.560   -49.539  1.00 0.00 ? 26  GLN B HG2  1  
ATOM   2477   H HG3  . GLN B 2 26  ? -59.054  -0.534  -49.512  1.00 0.00 ? 26  GLN B HG3  1  
ATOM   2478   H HE21 . GLN B 2 26  ? -59.849  -2.274  -47.467  1.00 0.00 ? 26  GLN B HE21 1  
ATOM   2479   H HE22 . GLN B 2 26  ? -61.207  -3.155  -47.978  1.00 0.00 ? 26  GLN B HE22 1  
ATOM   2480   N N    . SER B 2 27  ? -58.140  2.486   -45.753  1.00 0.00 ? 27  SER B N    1  
ATOM   2481   C CA   . SER B 2 27  ? -58.177  2.921   -44.358  1.00 0.00 ? 27  SER B CA   1  
ATOM   2482   C C    . SER B 2 27  ? -59.504  3.630   -44.153  1.00 0.00 ? 27  SER B C    1  
ATOM   2483   O O    . SER B 2 27  ? -59.998  4.264   -45.083  1.00 0.00 ? 27  SER B O    1  
ATOM   2484   C CB   . SER B 2 27  ? -57.015  3.866   -44.024  1.00 0.00 ? 27  SER B CB   1  
ATOM   2485   O OG   . SER B 2 27  ? -57.324  5.227   -44.323  1.00 0.00 ? 27  SER B OG   1  
ATOM   2486   H H    . SER B 2 27  ? -58.531  3.071   -46.435  1.00 0.00 ? 27  SER B H    1  
ATOM   2487   H HA   . SER B 2 27  ? -58.135  2.053   -43.714  1.00 0.00 ? 27  SER B HA   1  
ATOM   2488   H HB2  . SER B 2 27  ? -56.790  3.790   -42.974  1.00 0.00 ? 27  SER B HB2  1  
ATOM   2489   H HB3  . SER B 2 27  ? -56.143  3.558   -44.588  1.00 0.00 ? 27  SER B HB3  1  
ATOM   2490   H HG   . SER B 2 27  ? -56.536  5.752   -44.167  1.00 0.00 ? 27  SER B HG   1  
ATOM   2491   N N    . PRO B 2 28  ? -60.102  3.523   -42.954  1.00 0.00 ? 28  PRO B N    1  
ATOM   2492   C CA   . PRO B 2 28  ? -59.671  2.754   -41.799  1.00 0.00 ? 28  PRO B CA   1  
ATOM   2493   C C    . PRO B 2 28  ? -60.296  1.367   -41.834  1.00 0.00 ? 28  PRO B C    1  
ATOM   2494   O O    . PRO B 2 28  ? -61.086  1.067   -42.739  1.00 0.00 ? 28  PRO B O    1  
ATOM   2495   C CB   . PRO B 2 28  ? -60.302  3.526   -40.661  1.00 0.00 ? 28  PRO B CB   1  
ATOM   2496   C CG   . PRO B 2 28  ? -61.639  3.949   -41.248  1.00 0.00 ? 28  PRO B CG   1  
ATOM   2497   C CD   . PRO B 2 28  ? -61.372  4.231   -42.691  1.00 0.00 ? 28  PRO B CD   1  
ATOM   2498   H HA   . PRO B 2 28  ? -58.600  2.724   -41.699  1.00 0.00 ? 28  PRO B HA   1  
ATOM   2499   H HB2  . PRO B 2 28  ? -60.440  2.887   -39.798  1.00 0.00 ? 28  PRO B HB2  1  
ATOM   2500   H HB3  . PRO B 2 28  ? -59.715  4.394   -40.411  1.00 0.00 ? 28  PRO B HB3  1  
ATOM   2501   H HG2  . PRO B 2 28  ? -62.361  3.150   -41.147  1.00 0.00 ? 28  PRO B HG2  1  
ATOM   2502   H HG3  . PRO B 2 28  ? -61.997  4.842   -40.759  1.00 0.00 ? 28  PRO B HG3  1  
ATOM   2503   H HD2  . PRO B 2 28  ? -62.169  3.836   -43.307  1.00 0.00 ? 28  PRO B HD2  1  
ATOM   2504   H HD3  . PRO B 2 28  ? -61.248  5.289   -42.856  1.00 0.00 ? 28  PRO B HD3  1  
ATOM   2505   N N    . SER B 2 29  ? -59.981  0.541   -40.841  1.00 0.00 ? 29  SER B N    1  
ATOM   2506   C CA   . SER B 2 29  ? -60.649  -0.741  -40.681  1.00 0.00 ? 29  SER B CA   1  
ATOM   2507   C C    . SER B 2 29  ? -62.137  -0.558  -40.400  1.00 0.00 ? 29  SER B C    1  
ATOM   2508   O O    . SER B 2 29  ? -62.983  -1.219  -41.018  1.00 0.00 ? 29  SER B O    1  
ATOM   2509   C CB   . SER B 2 29  ? -60.019  -1.496  -39.536  1.00 0.00 ? 29  SER B CB   1  
ATOM   2510   O OG   . SER B 2 29  ? -58.620  -1.320  -39.576  1.00 0.00 ? 29  SER B OG   1  
ATOM   2511   H H    . SER B 2 29  ? -59.369  0.850   -40.140  1.00 0.00 ? 29  SER B H    1  
ATOM   2512   H HA   . SER B 2 29  ? -60.529  -1.317  -41.586  1.00 0.00 ? 29  SER B HA   1  
ATOM   2513   H HB2  . SER B 2 29  ? -60.392  -1.103  -38.605  1.00 0.00 ? 29  SER B HB2  1  
ATOM   2514   H HB3  . SER B 2 29  ? -60.268  -2.546  -39.608  1.00 0.00 ? 29  SER B HB3  1  
ATOM   2515   H HG   . SER B 2 29  ? -58.375  -0.725  -38.864  1.00 0.00 ? 29  SER B HG   1  
ATOM   2516   N N    . SER B 2 30  ? -62.452  0.357   -39.484  1.00 0.00 ? 30  SER B N    1  
ATOM   2517   C CA   . SER B 2 30  ? -63.835  0.569   -39.053  1.00 0.00 ? 30  SER B CA   1  
ATOM   2518   C C    . SER B 2 30  ? -64.269  2.030   -38.989  1.00 0.00 ? 30  SER B C    1  
ATOM   2519   O O    . SER B 2 30  ? -63.460  2.922   -38.732  1.00 0.00 ? 30  SER B O    1  
ATOM   2520   C CB   . SER B 2 30  ? -64.048  -0.064  -37.685  1.00 0.00 ? 30  SER B CB   1  
ATOM   2521   O OG   . SER B 2 30  ? -62.944  0.230   -36.845  1.00 0.00 ? 30  SER B OG   1  
ATOM   2522   H H    . SER B 2 30  ? -61.733  0.858   -39.044  1.00 0.00 ? 30  SER B H    1  
ATOM   2523   H HA   . SER B 2 30  ? -64.482  0.061   -39.751  1.00 0.00 ? 30  SER B HA   1  
ATOM   2524   H HB2  . SER B 2 30  ? -64.945  0.332   -37.239  1.00 0.00 ? 30  SER B HB2  1  
ATOM   2525   H HB3  . SER B 2 30  ? -64.151  -1.136  -37.799  1.00 0.00 ? 30  SER B HB3  1  
ATOM   2526   H HG   . SER B 2 30  ? -63.283  0.455   -35.976  1.00 0.00 ? 30  SER B HG   1  
ATOM   2527   N N    . LEU B 2 31  ? -65.566  2.244   -39.210  1.00 0.00 ? 31  LEU B N    1  
ATOM   2528   C CA   . LEU B 2 31  ? -66.216  3.543   -39.051  1.00 0.00 ? 31  LEU B CA   1  
ATOM   2529   C C    . LEU B 2 31  ? -67.523  3.431   -38.282  1.00 0.00 ? 31  LEU B C    1  
ATOM   2530   O O    . LEU B 2 31  ? -68.359  2.568   -38.556  1.00 0.00 ? 31  LEU B O    1  
ATOM   2531   C CB   . LEU B 2 31  ? -66.525  4.158   -40.408  1.00 0.00 ? 31  LEU B CB   1  
ATOM   2532   C CG   . LEU B 2 31  ? -65.416  4.735   -41.274  1.00 0.00 ? 31  LEU B CG   1  
ATOM   2533   C CD1  . LEU B 2 31  ? -66.081  5.439   -42.455  1.00 0.00 ? 31  LEU B CD1  1  
ATOM   2534   C CD2  . LEU B 2 31  ? -64.507  5.697   -40.492  1.00 0.00 ? 31  LEU B CD2  1  
ATOM   2535   H H    . LEU B 2 31  ? -66.134  1.468   -39.397  1.00 0.00 ? 31  LEU B H    1  
ATOM   2536   H HA   . LEU B 2 31  ? -65.550  4.203   -38.517  1.00 0.00 ? 31  LEU B HA   1  
ATOM   2537   H HB2  . LEU B 2 31  ? -67.009  3.400   -40.996  1.00 0.00 ? 31  LEU B HB2  1  
ATOM   2538   H HB3  . LEU B 2 31  ? -67.253  4.942   -40.239  1.00 0.00 ? 31  LEU B HB3  1  
ATOM   2539   H HG   . LEU B 2 31  ? -64.820  3.915   -41.656  1.00 0.00 ? 31  LEU B HG   1  
ATOM   2540   H HD11 . LEU B 2 31  ? -66.904  4.840   -42.814  1.00 0.00 ? 31  LEU B HD11 1  
ATOM   2541   H HD12 . LEU B 2 31  ? -65.359  5.572   -43.247  1.00 0.00 ? 31  LEU B HD12 1  
ATOM   2542   H HD13 . LEU B 2 31  ? -66.448  6.404   -42.138  1.00 0.00 ? 31  LEU B HD13 1  
ATOM   2543   H HD21 . LEU B 2 31  ? -63.786  6.137   -41.165  1.00 0.00 ? 31  LEU B HD21 1  
ATOM   2544   H HD22 . LEU B 2 31  ? -63.990  5.153   -39.716  1.00 0.00 ? 31  LEU B HD22 1  
ATOM   2545   H HD23 . LEU B 2 31  ? -65.107  6.477   -40.047  1.00 0.00 ? 31  LEU B HD23 1  
ATOM   2546   N N    . ALA B 2 32  ? -67.700  4.318   -37.321  1.00 0.00 ? 32  ALA B N    1  
ATOM   2547   C CA   . ALA B 2 32  ? -68.991  4.475   -36.686  1.00 0.00 ? 32  ALA B CA   1  
ATOM   2548   C C    . ALA B 2 32  ? -69.640  5.749   -37.221  1.00 0.00 ? 32  ALA B C    1  
ATOM   2549   O O    . ALA B 2 32  ? -68.944  6.699   -37.595  1.00 0.00 ? 32  ALA B O    1  
ATOM   2550   C CB   . ALA B 2 32  ? -68.830  4.538   -35.176  1.00 0.00 ? 32  ALA B CB   1  
ATOM   2551   H H    . ALA B 2 32  ? -67.002  4.984   -37.153  1.00 0.00 ? 32  ALA B H    1  
ATOM   2552   H HA   . ALA B 2 32  ? -69.613  3.629   -36.941  1.00 0.00 ? 32  ALA B HA   1  
ATOM   2553   H HB1  . ALA B 2 32  ? -69.422  5.352   -34.785  1.00 0.00 ? 32  ALA B HB1  1  
ATOM   2554   H HB2  . ALA B 2 32  ? -67.791  4.698   -34.931  1.00 0.00 ? 32  ALA B HB2  1  
ATOM   2555   H HB3  . ALA B 2 32  ? -69.164  3.608   -34.739  1.00 0.00 ? 32  ALA B HB3  1  
ATOM   2556   N N    . VAL B 2 33  ? -70.969  5.760   -37.274  1.00 0.00 ? 33  VAL B N    1  
ATOM   2557   C CA   . VAL B 2 33  ? -71.727  6.966   -37.652  1.00 0.00 ? 33  VAL B CA   1  
ATOM   2558   C C    . VAL B 2 33  ? -73.214  6.878   -37.237  1.00 0.00 ? 33  VAL B C    1  
ATOM   2559   O O    . VAL B 2 33  ? -73.822  5.797   -37.259  1.00 0.00 ? 33  VAL B O    1  
ATOM   2560   C CB   . VAL B 2 33  ? -71.519  7.361   -39.164  1.00 0.00 ? 33  VAL B CB   1  
ATOM   2561   C CG1  . VAL B 2 33  ? -72.837  7.401   -39.934  1.00 0.00 ? 33  VAL B CG1  1  
ATOM   2562   C CG2  . VAL B 2 33  ? -70.785  8.698   -39.272  1.00 0.00 ? 33  VAL B CG2  1  
ATOM   2563   H H    . VAL B 2 33  ? -71.461  4.967   -36.975  1.00 0.00 ? 33  VAL B H    1  
ATOM   2564   H HA   . VAL B 2 33  ? -71.306  7.773   -37.064  1.00 0.00 ? 33  VAL B HA   1  
ATOM   2565   H HB   . VAL B 2 33  ? -70.899  6.599   -39.618  1.00 0.00 ? 33  VAL B HB   1  
ATOM   2566   H HG11 . VAL B 2 33  ? -73.660  7.274   -39.246  1.00 0.00 ? 33  VAL B HG11 1  
ATOM   2567   H HG12 . VAL B 2 33  ? -72.851  6.605   -40.664  1.00 0.00 ? 33  VAL B HG12 1  
ATOM   2568   H HG13 . VAL B 2 33  ? -72.931  8.352   -40.436  1.00 0.00 ? 33  VAL B HG13 1  
ATOM   2569   H HG21 . VAL B 2 33  ? -70.073  8.653   -40.082  1.00 0.00 ? 33  VAL B HG21 1  
ATOM   2570   H HG22 . VAL B 2 33  ? -70.265  8.899   -38.347  1.00 0.00 ? 33  VAL B HG22 1  
ATOM   2571   H HG23 . VAL B 2 33  ? -71.498  9.486   -39.462  1.00 0.00 ? 33  VAL B HG23 1  
ATOM   2572   N N    . SER B 2 34  ? -73.774  8.012   -36.824  1.00 0.00 ? 34  SER B N    1  
ATOM   2573   C CA   . SER B 2 34  ? -75.175  8.074   -36.454  1.00 0.00 ? 34  SER B CA   1  
ATOM   2574   C C    . SER B 2 34  ? -75.993  8.137   -37.733  1.00 0.00 ? 34  SER B C    1  
ATOM   2575   O O    . SER B 2 34  ? -75.641  8.848   -38.677  1.00 0.00 ? 34  SER B O    1  
ATOM   2576   C CB   . SER B 2 34  ? -75.435  9.274   -35.545  1.00 0.00 ? 34  SER B CB   1  
ATOM   2577   O OG   . SER B 2 34  ? -74.419  9.398   -34.551  1.00 0.00 ? 34  SER B OG   1  
ATOM   2578   H H    . SER B 2 34  ? -73.236  8.831   -36.801  1.00 0.00 ? 34  SER B H    1  
ATOM   2579   H HA   . SER B 2 34  ? -75.433  7.168   -35.923  1.00 0.00 ? 34  SER B HA   1  
ATOM   2580   H HB2  . SER B 2 34  ? -75.450  10.172  -36.138  1.00 0.00 ? 34  SER B HB2  1  
ATOM   2581   H HB3  . SER B 2 34  ? -76.400  9.152   -35.069  1.00 0.00 ? 34  SER B HB3  1  
ATOM   2582   H HG   . SER B 2 34  ? -74.236  10.333  -34.428  1.00 0.00 ? 34  SER B HG   1  
ATOM   2583   N N    . ALA B 2 35  ? -77.078  7.366   -37.749  1.00 0.00 ? 35  ALA B N    1  
ATOM   2584   C CA   . ALA B 2 35  ? -77.843  7.070   -38.975  1.00 0.00 ? 35  ALA B CA   1  
ATOM   2585   C C    . ALA B 2 35  ? -78.332  8.293   -39.756  1.00 0.00 ? 35  ALA B C    1  
ATOM   2586   O O    . ALA B 2 35  ? -79.401  8.827   -39.471  1.00 0.00 ? 35  ALA B O    1  
ATOM   2587   C CB   . ALA B 2 35  ? -79.024  6.126   -38.663  1.00 0.00 ? 35  ALA B CB   1  
ATOM   2588   H H    . ALA B 2 35  ? -77.270  6.830   -36.951  1.00 0.00 ? 35  ALA B H    1  
ATOM   2589   H HA   . ALA B 2 35  ? -77.179  6.529   -39.631  1.00 0.00 ? 35  ALA B HA   1  
ATOM   2590   H HB1  . ALA B 2 35  ? -78.908  5.209   -39.221  1.00 0.00 ? 35  ALA B HB1  1  
ATOM   2591   H HB2  . ALA B 2 35  ? -79.951  6.604   -38.945  1.00 0.00 ? 35  ALA B HB2  1  
ATOM   2592   H HB3  . ALA B 2 35  ? -79.039  5.906   -37.606  1.00 0.00 ? 35  ALA B HB3  1  
ATOM   2593   N N    . GLY B 2 36  ? -77.550  8.734   -40.736  1.00 0.00 ? 36  GLY B N    1  
ATOM   2594   C CA   . GLY B 2 36  ? -77.990  9.799   -41.632  1.00 0.00 ? 36  GLY B CA   1  
ATOM   2595   C C    . GLY B 2 36  ? -76.879  10.750  -41.999  1.00 0.00 ? 36  GLY B C    1  
ATOM   2596   O O    . GLY B 2 36  ? -77.126  11.835  -42.533  1.00 0.00 ? 36  GLY B O    1  
ATOM   2597   H H    . GLY B 2 36  ? -76.706  8.271   -40.920  1.00 0.00 ? 36  GLY B H    1  
ATOM   2598   H HA2  . GLY B 2 36  ? -78.379  9.355   -42.536  1.00 0.00 ? 36  GLY B HA2  1  
ATOM   2599   H HA3  . GLY B 2 36  ? -78.781  10.355  -41.149  1.00 0.00 ? 36  GLY B HA3  1  
ATOM   2600   N N    . GLU B 2 37  ? -75.649  10.322  -41.741  1.00 0.00 ? 37  GLU B N    1  
ATOM   2601   C CA   . GLU B 2 37  ? -74.481  11.171  -41.942  1.00 0.00 ? 37  GLU B CA   1  
ATOM   2602   C C    . GLU B 2 37  ? -73.739  10.956  -43.267  1.00 0.00 ? 37  GLU B C    1  
ATOM   2603   O O    . GLU B 2 37  ? -74.119  10.104  -44.077  1.00 0.00 ? 37  GLU B O    1  
ATOM   2604   C CB   . GLU B 2 37  ? -73.537  11.009  -40.759  1.00 0.00 ? 37  GLU B CB   1  
ATOM   2605   C CG   . GLU B 2 37  ? -74.197  11.361  -39.439  1.00 0.00 ? 37  GLU B CG   1  
ATOM   2606   C CD   . GLU B 2 37  ? -73.186  11.629  -38.362  1.00 0.00 ? 37  GLU B CD   1  
ATOM   2607   O OE1  . GLU B 2 37  ? -72.505  12.681  -38.440  1.00 0.00 ? 37  GLU B OE1  1  
ATOM   2608   O OE2  . GLU B 2 37  ? -73.065  10.782  -37.447  1.00 0.00 ? 37  GLU B OE2  1  
ATOM   2609   H H    . GLU B 2 37  ? -75.529  9.437   -41.339  1.00 0.00 ? 37  GLU B H    1  
ATOM   2610   H HA   . GLU B 2 37  ? -74.825  12.194  -41.934  1.00 0.00 ? 37  GLU B HA   1  
ATOM   2611   H HB2  . GLU B 2 37  ? -73.202  9.984   -40.717  1.00 0.00 ? 37  GLU B HB2  1  
ATOM   2612   H HB3  . GLU B 2 37  ? -72.680  11.651  -40.905  1.00 0.00 ? 37  GLU B HB3  1  
ATOM   2613   H HG2  . GLU B 2 37  ? -74.807  12.241  -39.574  1.00 0.00 ? 37  GLU B HG2  1  
ATOM   2614   H HG3  . GLU B 2 37  ? -74.829  10.539  -39.133  1.00 0.00 ? 37  GLU B HG3  1  
ATOM   2615   N N    . LYS B 2 38  ? -72.703  11.764  -43.491  1.00 0.00 ? 38  LYS B N    1  
ATOM   2616   C CA   . LYS B 2 38  ? -71.788  11.568  -44.616  1.00 0.00 ? 38  LYS B CA   1  
ATOM   2617   C C    . LYS B 2 38  ? -70.525  10.851  -44.141  1.00 0.00 ? 38  LYS B C    1  
ATOM   2618   O O    . LYS B 2 38  ? -69.926  11.222  -43.129  1.00 0.00 ? 38  LYS B O    1  
ATOM   2619   C CB   . LYS B 2 38  ? -71.425  12.893  -45.274  1.00 0.00 ? 38  LYS B CB   1  
ATOM   2620   C CG   . LYS B 2 38  ? -71.065  12.771  -46.730  1.00 0.00 ? 38  LYS B CG   1  
ATOM   2621   C CD   . LYS B 2 38  ? -71.628  13.948  -47.524  1.00 0.00 ? 38  LYS B CD   1  
ATOM   2622   C CE   . LYS B 2 38  ? -71.800  13.615  -49.024  1.00 0.00 ? 38  LYS B CE   1  
ATOM   2623   N NZ   . LYS B 2 38  ? -72.798  14.463  -49.780  1.00 0.00 ? 38  LYS B NZ   1  
ATOM   2624   H H    . LYS B 2 38  ? -72.478  12.437  -42.815  1.00 0.00 ? 38  LYS B H    1  
ATOM   2625   H HA   . LYS B 2 38  ? -72.279  10.943  -45.349  1.00 0.00 ? 38  LYS B HA   1  
ATOM   2626   H HB2  . LYS B 2 38  ? -72.265  13.564  -45.186  1.00 0.00 ? 38  LYS B HB2  1  
ATOM   2627   H HB3  . LYS B 2 38  ? -70.586  13.321  -44.743  1.00 0.00 ? 38  LYS B HB3  1  
ATOM   2628   H HG2  . LYS B 2 38  ? -69.990  12.756  -46.830  1.00 0.00 ? 38  LYS B HG2  1  
ATOM   2629   H HG3  . LYS B 2 38  ? -71.472  11.851  -47.122  1.00 0.00 ? 38  LYS B HG3  1  
ATOM   2630   H HD2  . LYS B 2 38  ? -72.589  14.220  -47.114  1.00 0.00 ? 38  LYS B HD2  1  
ATOM   2631   H HD3  . LYS B 2 38  ? -70.956  14.788  -47.427  1.00 0.00 ? 38  LYS B HD3  1  
ATOM   2632   H HE2  . LYS B 2 38  ? -70.842  13.724  -49.506  1.00 0.00 ? 38  LYS B HE2  1  
ATOM   2633   H HE3  . LYS B 2 38  ? -72.099  12.579  -49.104  1.00 0.00 ? 38  LYS B HE3  1  
ATOM   2634   H HZ1  . LYS B 2 38  ? -72.579  14.436  -50.796  1.00 0.00 ? 38  LYS B HZ1  1  
ATOM   2635   H HZ2  . LYS B 2 38  ? -72.746  15.445  -49.440  1.00 0.00 ? 38  LYS B HZ2  1  
ATOM   2636   H HZ3  . LYS B 2 38  ? -73.757  14.093  -49.624  1.00 0.00 ? 38  LYS B HZ3  1  
ATOM   2637   N N    . VAL B 2 39  ? -70.156  9.795   -44.864  1.00 0.00 ? 39  VAL B N    1  
ATOM   2638   C CA   . VAL B 2 39  ? -68.937  9.032   -44.602  1.00 0.00 ? 39  VAL B CA   1  
ATOM   2639   C C    . VAL B 2 39  ? -68.212  8.862   -45.905  1.00 0.00 ? 39  VAL B C    1  
ATOM   2640   O O    . VAL B 2 39  ? -68.838  8.593   -46.943  1.00 0.00 ? 39  VAL B O    1  
ATOM   2641   C CB   . VAL B 2 39  ? -69.208  7.622   -44.047  1.00 0.00 ? 39  VAL B CB   1  
ATOM   2642   C CG1  . VAL B 2 39  ? -69.158  7.635   -42.536  1.00 0.00 ? 39  VAL B CG1  1  
ATOM   2643   C CG2  . VAL B 2 39  ? -70.542  7.032   -44.602  1.00 0.00 ? 39  VAL B CG2  1  
ATOM   2644   H H    . VAL B 2 39  ? -70.704  9.546   -45.637  1.00 0.00 ? 39  VAL B H    1  
ATOM   2645   H HA   . VAL B 2 39  ? -68.312  9.578   -43.911  1.00 0.00 ? 39  VAL B HA   1  
ATOM   2646   H HB   . VAL B 2 39  ? -68.400  6.986   -44.385  1.00 0.00 ? 39  VAL B HB   1  
ATOM   2647   H HG11 . VAL B 2 39  ? -69.361  6.643   -42.161  1.00 0.00 ? 39  VAL B HG11 1  
ATOM   2648   H HG12 . VAL B 2 39  ? -69.900  8.323   -42.158  1.00 0.00 ? 39  VAL B HG12 1  
ATOM   2649   H HG13 . VAL B 2 39  ? -68.177  7.949   -42.212  1.00 0.00 ? 39  VAL B HG13 1  
ATOM   2650   H HG21 . VAL B 2 39  ? -70.945  6.323   -43.894  1.00 0.00 ? 39  VAL B HG21 1  
ATOM   2651   H HG22 . VAL B 2 39  ? -70.352  6.533   -45.541  1.00 0.00 ? 39  VAL B HG22 1  
ATOM   2652   H HG23 . VAL B 2 39  ? -71.253  7.830   -44.757  1.00 0.00 ? 39  VAL B HG23 1  
ATOM   2653   N N    . THR B 2 40  ? -66.895  9.021   -45.842  1.00 0.00 ? 40  THR B N    1  
ATOM   2654   C CA   . THR B 2 40  ? -66.051  8.921   -47.013  1.00 0.00 ? 40  THR B CA   1  
ATOM   2655   C C    . THR B 2 40  ? -64.811  8.103   -46.662  1.00 0.00 ? 40  THR B C    1  
ATOM   2656   O O    . THR B 2 40  ? -63.788  8.668   -46.259  1.00 0.00 ? 40  THR B O    1  
ATOM   2657   C CB   . THR B 2 40  ? -65.616  10.322  -47.529  1.00 0.00 ? 40  THR B CB   1  
ATOM   2658   O OG1  . THR B 2 40  ? -64.927  11.007  -46.488  1.00 0.00 ? 40  THR B OG1  1  
ATOM   2659   C CG2  . THR B 2 40  ? -66.790  11.185  -47.938  1.00 0.00 ? 40  THR B CG2  1  
ATOM   2660   H H    . THR B 2 40  ? -66.484  9.234   -44.978  1.00 0.00 ? 40  THR B H    1  
ATOM   2661   H HA   . THR B 2 40  ? -66.596  8.414   -47.795  1.00 0.00 ? 40  THR B HA   1  
ATOM   2662   H HB   . THR B 2 40  ? -64.954  10.199  -48.373  1.00 0.00 ? 40  THR B HB   1  
ATOM   2663   H HG1  . THR B 2 40  ? -65.436  11.789  -46.261  1.00 0.00 ? 40  THR B HG1  1  
ATOM   2664   H HG21 . THR B 2 40  ? -67.686  10.830  -47.450  1.00 0.00 ? 40  THR B HG21 1  
ATOM   2665   H HG22 . THR B 2 40  ? -66.919  11.134  -49.009  1.00 0.00 ? 40  THR B HG22 1  
ATOM   2666   H HG23 . THR B 2 40  ? -66.604  12.208  -47.646  1.00 0.00 ? 40  THR B HG23 1  
ATOM   2667   N N    . MET B 2 41  ? -64.883  6.778   -46.792  1.00 0.00 ? 41  MET B N    1  
ATOM   2668   C CA   . MET B 2 41  ? -63.670  5.977   -46.596  1.00 0.00 ? 41  MET B CA   1  
ATOM   2669   C C    . MET B 2 41  ? -62.793  5.940   -47.872  1.00 0.00 ? 41  MET B C    1  
ATOM   2670   O O    . MET B 2 41  ? -63.263  6.284   -48.978  1.00 0.00 ? 41  MET B O    1  
ATOM   2671   C CB   . MET B 2 41  ? -63.962  4.584   -46.004  1.00 0.00 ? 41  MET B CB   1  
ATOM   2672   C CG   . MET B 2 41  ? -64.335  3.477   -46.993  1.00 0.00 ? 41  MET B CG   1  
ATOM   2673   S SD   . MET B 2 41  ? -66.072  2.977   -46.886  1.00 0.00 ? 41  MET B SD   1  
ATOM   2674   C CE   . MET B 2 41  ? -66.840  4.379   -47.679  1.00 0.00 ? 41  MET B CE   1  
ATOM   2675   H H    . MET B 2 41  ? -65.710  6.356   -47.104  1.00 0.00 ? 41  MET B H    1  
ATOM   2676   H HA   . MET B 2 41  ? -63.085  6.509   -45.855  1.00 0.00 ? 41  MET B HA   1  
ATOM   2677   H HB2  . MET B 2 41  ? -63.086  4.260   -45.466  1.00 0.00 ? 41  MET B HB2  1  
ATOM   2678   H HB3  . MET B 2 41  ? -64.769  4.690   -45.291  1.00 0.00 ? 41  MET B HB3  1  
ATOM   2679   H HG2  . MET B 2 41  ? -64.143  3.830   -47.994  1.00 0.00 ? 41  MET B HG2  1  
ATOM   2680   H HG3  . MET B 2 41  ? -63.707  2.617   -46.804  1.00 0.00 ? 41  MET B HG3  1  
ATOM   2681   H HE1  . MET B 2 41  ? -67.895  4.391   -47.445  1.00 0.00 ? 41  MET B HE1  1  
ATOM   2682   H HE2  . MET B 2 41  ? -66.711  4.304   -48.747  1.00 0.00 ? 41  MET B HE2  1  
ATOM   2683   H HE3  . MET B 2 41  ? -66.377  5.290   -47.326  1.00 0.00 ? 41  MET B HE3  1  
ATOM   2684   N N    . SER B 2 42  ? -61.529  5.544   -47.715  1.00 0.00 ? 42  SER B N    1  
ATOM   2685   C CA   . SER B 2 42  ? -60.565  5.678   -48.795  1.00 0.00 ? 42  SER B CA   1  
ATOM   2686   C C    . SER B 2 42  ? -59.923  4.385   -49.221  1.00 0.00 ? 42  SER B C    1  
ATOM   2687   O O    . SER B 2 42  ? -59.562  3.577   -48.384  1.00 0.00 ? 42  SER B O    1  
ATOM   2688   C CB   . SER B 2 42  ? -59.455  6.649   -48.412  1.00 0.00 ? 42  SER B CB   1  
ATOM   2689   O OG   . SER B 2 42  ? -58.482  6.710   -49.450  1.00 0.00 ? 42  SER B OG   1  
ATOM   2690   H H    . SER B 2 42  ? -61.213  5.296   -46.821  1.00 0.00 ? 42  SER B H    1  
ATOM   2691   H HA   . SER B 2 42  ? -61.078  6.092   -49.649  1.00 0.00 ? 42  SER B HA   1  
ATOM   2692   H HB2  . SER B 2 42  ? -59.871  7.631   -48.263  1.00 0.00 ? 42  SER B HB2  1  
ATOM   2693   H HB3  . SER B 2 42  ? -58.992  6.316   -47.492  1.00 0.00 ? 42  SER B HB3  1  
ATOM   2694   H HG   . SER B 2 42  ? -57.678  7.085   -49.081  1.00 0.00 ? 42  SER B HG   1  
ATOM   2695   N N    . CYS B 2 43  ? -59.746  4.245   -50.536  1.00 0.00 ? 43  CYS B N    1  
ATOM   2696   C CA   . CYS B 2 43  ? -59.048  3.128   -51.149  1.00 0.00 ? 43  CYS B CA   1  
ATOM   2697   C C    . CYS B 2 43  ? -57.863  3.638   -51.948  1.00 0.00 ? 43  CYS B C    1  
ATOM   2698   O O    . CYS B 2 43  ? -58.029  4.437   -52.860  1.00 0.00 ? 43  CYS B O    1  
ATOM   2699   C CB   . CYS B 2 43  ? -60.000  2.372   -52.071  1.00 0.00 ? 43  CYS B CB   1  
ATOM   2700   S SG   . CYS B 2 43  ? -59.229  1.164   -53.151  1.00 0.00 ? 43  CYS B SG   1  
ATOM   2701   H H    . CYS B 2 43  ? -60.042  4.975   -51.118  1.00 0.00 ? 43  CYS B H    1  
ATOM   2702   H HA   . CYS B 2 43  ? -58.697  2.459   -50.377  1.00 0.00 ? 43  CYS B HA   1  
ATOM   2703   H HB2  . CYS B 2 43  ? -60.724  1.857   -51.462  1.00 0.00 ? 43  CYS B HB2  1  
ATOM   2704   H HB3  . CYS B 2 43  ? -60.526  3.096   -52.679  1.00 0.00 ? 43  CYS B HB3  1  
ATOM   2705   N N    . LYS B 2 44  ? -56.669  3.169   -51.605  1.00 0.00 ? 44  LYS B N    1  
ATOM   2706   C CA   . LYS B 2 44  ? -55.455  3.509   -52.341  1.00 0.00 ? 44  LYS B CA   1  
ATOM   2707   C C    . LYS B 2 44  ? -54.770  2.286   -52.951  1.00 0.00 ? 44  LYS B C    1  
ATOM   2708   O O    . LYS B 2 44  ? -54.537  1.286   -52.273  1.00 0.00 ? 44  LYS B O    1  
ATOM   2709   C CB   . LYS B 2 44  ? -54.497  4.301   -51.453  1.00 0.00 ? 44  LYS B CB   1  
ATOM   2710   C CG   . LYS B 2 44  ? -54.984  5.748   -51.231  1.00 0.00 ? 44  LYS B CG   1  
ATOM   2711   C CD   . LYS B 2 44  ? -53.969  6.670   -50.504  1.00 0.00 ? 44  LYS B CD   1  
ATOM   2712   C CE   . LYS B 2 44  ? -52.628  6.862   -51.276  1.00 0.00 ? 44  LYS B CE   1  
ATOM   2713   N NZ   . LYS B 2 44  ? -52.740  7.027   -52.776  1.00 0.00 ? 44  LYS B NZ   1  
ATOM   2714   H H    . LYS B 2 44  ? -56.609  2.529   -50.865  1.00 0.00 ? 44  LYS B H    1  
ATOM   2715   H HA   . LYS B 2 44  ? -55.745  4.153   -53.158  1.00 0.00 ? 44  LYS B HA   1  
ATOM   2716   H HB2  . LYS B 2 44  ? -54.416  3.807   -50.496  1.00 0.00 ? 44  LYS B HB2  1  
ATOM   2717   H HB3  . LYS B 2 44  ? -53.524  4.325   -51.920  1.00 0.00 ? 44  LYS B HB3  1  
ATOM   2718   H HG2  . LYS B 2 44  ? -55.207  6.184   -52.192  1.00 0.00 ? 44  LYS B HG2  1  
ATOM   2719   H HG3  . LYS B 2 44  ? -55.896  5.715   -50.652  1.00 0.00 ? 44  LYS B HG3  1  
ATOM   2720   H HD2  . LYS B 2 44  ? -54.423  7.638   -50.362  1.00 0.00 ? 44  LYS B HD2  1  
ATOM   2721   H HD3  . LYS B 2 44  ? -53.753  6.245   -49.533  1.00 0.00 ? 44  LYS B HD3  1  
ATOM   2722   H HE2  . LYS B 2 44  ? -52.138  7.738   -50.885  1.00 0.00 ? 44  LYS B HE2  1  
ATOM   2723   H HE3  . LYS B 2 44  ? -51.998  6.006   -51.070  1.00 0.00 ? 44  LYS B HE3  1  
ATOM   2724   H HZ1  . LYS B 2 44  ? -53.567  6.500   -53.122  1.00 0.00 ? 44  LYS B HZ1  1  
ATOM   2725   H HZ2  . LYS B 2 44  ? -51.879  6.660   -53.230  1.00 0.00 ? 44  LYS B HZ2  1  
ATOM   2726   H HZ3  . LYS B 2 44  ? -52.852  8.034   -53.007  1.00 0.00 ? 44  LYS B HZ3  1  
ATOM   2727   N N    . SER B 2 45  ? -54.462  2.360   -54.240  1.00 0.00 ? 45  SER B N    1  
ATOM   2728   C CA   . SER B 2 45  ? -53.799  1.252   -54.917  1.00 0.00 ? 45  SER B CA   1  
ATOM   2729   C C    . SER B 2 45  ? -52.318  1.530   -55.176  1.00 0.00 ? 45  SER B C    1  
ATOM   2730   O O    . SER B 2 45  ? -51.917  2.676   -55.362  1.00 0.00 ? 45  SER B O    1  
ATOM   2731   C CB   . SER B 2 45  ? -54.536  0.888   -56.213  1.00 0.00 ? 45  SER B CB   1  
ATOM   2732   O OG   . SER B 2 45  ? -54.036  1.566   -57.351  1.00 0.00 ? 45  SER B OG   1  
ATOM   2733   H H    . SER B 2 45  ? -54.678  3.174   -54.742  1.00 0.00 ? 45  SER B H    1  
ATOM   2734   H HA   . SER B 2 45  ? -53.855  0.395   -54.261  1.00 0.00 ? 45  SER B HA   1  
ATOM   2735   H HB2  . SER B 2 45  ? -54.441  -0.169  -56.383  1.00 0.00 ? 45  SER B HB2  1  
ATOM   2736   H HB3  . SER B 2 45  ? -55.587  1.120   -56.087  1.00 0.00 ? 45  SER B HB3  1  
ATOM   2737   H HG   . SER B 2 45  ? -53.102  1.737   -57.208  1.00 0.00 ? 45  SER B HG   1  
ATOM   2738   N N    . SER B 2 46  ? -51.519  0.466   -55.182  1.00 0.00 ? 46  SER B N    1  
ATOM   2739   C CA   . SER B 2 46  ? -50.072  0.577   -55.342  1.00 0.00 ? 46  SER B CA   1  
ATOM   2740   C C    . SER B 2 46  ? -49.648  1.060   -56.723  1.00 0.00 ? 46  SER B C    1  
ATOM   2741   O O    . SER B 2 46  ? -48.568  1.643   -56.883  1.00 0.00 ? 46  SER B O    1  
ATOM   2742   C CB   . SER B 2 46  ? -49.393  -0.758  -55.033  1.00 0.00 ? 46  SER B CB   1  
ATOM   2743   O OG   . SER B 2 46  ? -49.871  -1.812  -55.853  1.00 0.00 ? 46  SER B OG   1  
ATOM   2744   H H    . SER B 2 46  ? -51.910  -0.418  -55.025  1.00 0.00 ? 46  SER B H    1  
ATOM   2745   H HA   . SER B 2 46  ? -49.718  1.297   -54.621  1.00 0.00 ? 46  SER B HA   1  
ATOM   2746   H HB2  . SER B 2 46  ? -48.334  -0.657  -55.192  1.00 0.00 ? 46  SER B HB2  1  
ATOM   2747   H HB3  . SER B 2 46  ? -49.564  -1.001  -53.991  1.00 0.00 ? 46  SER B HB3  1  
ATOM   2748   H HG   . SER B 2 46  ? -49.392  -1.782  -56.684  1.00 0.00 ? 46  SER B HG   1  
ATOM   2749   N N    . GLN B 2 47  ? -50.515  0.819   -57.703  1.00 0.00 ? 47  GLN B N    1  
ATOM   2750   C CA   . GLN B 2 47  ? -50.238  1.069   -59.106  1.00 0.00 ? 47  GLN B CA   1  
ATOM   2751   C C    . GLN B 2 47  ? -51.280  1.999   -59.637  1.00 0.00 ? 47  GLN B C    1  
ATOM   2752   O O    . GLN B 2 47  ? -52.460  1.826   -59.326  1.00 0.00 ? 47  GLN B O    1  
ATOM   2753   C CB   . GLN B 2 47  ? -50.412  -0.220  -59.863  1.00 0.00 ? 47  GLN B CB   1  
ATOM   2754   C CG   . GLN B 2 47  ? -49.168  -0.828  -60.360  1.00 0.00 ? 47  GLN B CG   1  
ATOM   2755   C CD   . GLN B 2 47  ? -49.337  -1.236  -61.793  1.00 0.00 ? 47  GLN B CD   1  
ATOM   2756   O OE1  . GLN B 2 47  ? -50.006  -0.530  -62.574  1.00 0.00 ? 47  GLN B OE1  1  
ATOM   2757   N NE2  . GLN B 2 47  ? -48.753  -2.383  -62.163  1.00 0.00 ? 47  GLN B NE2  1  
ATOM   2758   H H    . GLN B 2 47  ? -51.350  0.359   -57.475  1.00 0.00 ? 47  GLN B H    1  
ATOM   2759   H HA   . GLN B 2 47  ? -49.246  1.464   -59.249  1.00 0.00 ? 47  GLN B HA   1  
ATOM   2760   H HB2  . GLN B 2 47  ? -50.900  -0.932  -59.218  1.00 0.00 ? 47  GLN B HB2  1  
ATOM   2761   H HB3  . GLN B 2 47  ? -51.062  -0.027  -60.706  1.00 0.00 ? 47  GLN B HB3  1  
ATOM   2762   H HG2  . GLN B 2 47  ? -48.363  -0.111  -60.283  1.00 0.00 ? 47  GLN B HG2  1  
ATOM   2763   H HG3  . GLN B 2 47  ? -48.932  -1.698  -59.767  1.00 0.00 ? 47  GLN B HG3  1  
ATOM   2764   H HE21 . GLN B 2 47  ? -48.247  -2.908  -61.509  1.00 0.00 ? 47  GLN B HE21 1  
ATOM   2765   H HE22 . GLN B 2 47  ? -48.832  -2.696  -63.088  1.00 0.00 ? 47  GLN B HE22 1  
ATOM   2766   N N    . SER B 2 48  ? -50.892  2.969   -60.461  1.00 0.00 ? 48  SER B N    1  
ATOM   2767   C CA   . SER B 2 48  ? -51.918  3.855   -61.004  1.00 0.00 ? 48  SER B CA   1  
ATOM   2768   C C    . SER B 2 48  ? -52.923  3.066   -61.822  1.00 0.00 ? 48  SER B C    1  
ATOM   2769   O O    . SER B 2 48  ? -52.559  2.107   -62.493  1.00 0.00 ? 48  SER B O    1  
ATOM   2770   C CB   . SER B 2 48  ? -51.347  4.973   -61.846  1.00 0.00 ? 48  SER B CB   1  
ATOM   2771   O OG   . SER B 2 48  ? -52.422  5.807   -62.261  1.00 0.00 ? 48  SER B OG   1  
ATOM   2772   H H    . SER B 2 48  ? -49.951  3.072   -60.713  1.00 0.00 ? 48  SER B H    1  
ATOM   2773   H HA   . SER B 2 48  ? -52.446  4.298   -60.170  1.00 0.00 ? 48  SER B HA   1  
ATOM   2774   H HB2  . SER B 2 48  ? -50.648  5.551   -61.262  1.00 0.00 ? 48  SER B HB2  1  
ATOM   2775   H HB3  . SER B 2 48  ? -50.842  4.558   -62.708  1.00 0.00 ? 48  SER B HB3  1  
ATOM   2776   H HG   . SER B 2 48  ? -52.760  6.263   -61.487  1.00 0.00 ? 48  SER B HG   1  
ATOM   2777   N N    . LEU B 2 49  ? -54.180  3.475   -61.767  1.00 0.00 ? 49  LEU B N    1  
ATOM   2778   C CA   . LEU B 2 49  ? -55.253  2.731   -62.423  1.00 0.00 ? 49  LEU B CA   1  
ATOM   2779   C C    . LEU B 2 49  ? -55.832  3.416   -63.684  1.00 0.00 ? 49  LEU B C    1  
ATOM   2780   O O    . LEU B 2 49  ? -56.931  3.080   -64.133  1.00 0.00 ? 49  LEU B O    1  
ATOM   2781   C CB   . LEU B 2 49  ? -56.354  2.429   -61.399  1.00 0.00 ? 49  LEU B CB   1  
ATOM   2782   C CG   . LEU B 2 49  ? -56.374  1.156   -60.547  1.00 0.00 ? 49  LEU B CG   1  
ATOM   2783   C CD1  . LEU B 2 49  ? -55.035  0.462   -60.367  1.00 0.00 ? 49  LEU B CD1  1  
ATOM   2784   C CD2  . LEU B 2 49  ? -56.980  1.496   -59.207  1.00 0.00 ? 49  LEU B CD2  1  
ATOM   2785   H H    . LEU B 2 49  ? -54.406  4.253   -61.215  1.00 0.00 ? 49  LEU B H    1  
ATOM   2786   H HA   . LEU B 2 49  ? -54.840  1.784   -62.736  1.00 0.00 ? 49  LEU B HA   1  
ATOM   2787   H HB2  . LEU B 2 49  ? -56.366  3.250   -60.706  1.00 0.00 ? 49  LEU B HB2  1  
ATOM   2788   H HB3  . LEU B 2 49  ? -57.292  2.468   -61.943  1.00 0.00 ? 49  LEU B HB3  1  
ATOM   2789   H HG   . LEU B 2 49  ? -57.037  0.455   -61.031  1.00 0.00 ? 49  LEU B HG   1  
ATOM   2790   H HD11 . LEU B 2 49  ? -54.852  -0.191  -61.208  1.00 0.00 ? 49  LEU B HD11 1  
ATOM   2791   H HD12 . LEU B 2 49  ? -55.049  -0.119  -59.457  1.00 0.00 ? 49  LEU B HD12 1  
ATOM   2792   H HD13 . LEU B 2 49  ? -54.250  1.202   -60.309  1.00 0.00 ? 49  LEU B HD13 1  
ATOM   2793   H HD21 . LEU B 2 49  ? -57.094  0.595   -58.623  1.00 0.00 ? 49  LEU B HD21 1  
ATOM   2794   H HD22 . LEU B 2 49  ? -57.948  1.954   -59.355  1.00 0.00 ? 49  LEU B HD22 1  
ATOM   2795   H HD23 . LEU B 2 49  ? -56.333  2.184   -58.683  1.00 0.00 ? 49  LEU B HD23 1  
ATOM   2796   N N    . LEU B 2 50  ? -55.091  4.368   -64.252  1.00 0.00 ? 50  LEU B N    1  
ATOM   2797   C CA   . LEU B 2 50  ? -55.548  5.115   -65.435  1.00 0.00 ? 50  LEU B CA   1  
ATOM   2798   C C    . LEU B 2 50  ? -55.034  4.519   -66.751  1.00 0.00 ? 50  LEU B C    1  
ATOM   2799   O O    . LEU B 2 50  ? -53.858  4.150   -66.869  1.00 0.00 ? 50  LEU B O    1  
ATOM   2800   C CB   . LEU B 2 50  ? -55.097  6.583   -65.356  1.00 0.00 ? 50  LEU B CB   1  
ATOM   2801   C CG   . LEU B 2 50  ? -56.083  7.743   -65.594  1.00 0.00 ? 50  LEU B CG   1  
ATOM   2802   C CD1  . LEU B 2 50  ? -55.444  8.820   -66.450  1.00 0.00 ? 50  LEU B CD1  1  
ATOM   2803   C CD2  . LEU B 2 50  ? -57.389  7.311   -66.225  1.00 0.00 ? 50  LEU B CD2  1  
ATOM   2804   H H    . LEU B 2 50  ? -54.224  4.593   -63.856  1.00 0.00 ? 50  LEU B H    1  
ATOM   2805   H HA   . LEU B 2 50  ? -56.627  5.095   -65.452  1.00 0.00 ? 50  LEU B HA   1  
ATOM   2806   H HB2  . LEU B 2 50  ? -54.686  6.732   -64.374  1.00 0.00 ? 50  LEU B HB2  1  
ATOM   2807   H HB3  . LEU B 2 50  ? -54.281  6.696   -66.060  1.00 0.00 ? 50  LEU B HB3  1  
ATOM   2808   H HG   . LEU B 2 50  ? -56.304  8.183   -64.630  1.00 0.00 ? 50  LEU B HG   1  
ATOM   2809   H HD11 . LEU B 2 50  ? -54.434  8.998   -66.110  1.00 0.00 ? 50  LEU B HD11 1  
ATOM   2810   H HD12 . LEU B 2 50  ? -56.018  9.731   -66.369  1.00 0.00 ? 50  LEU B HD12 1  
ATOM   2811   H HD13 . LEU B 2 50  ? -55.425  8.496   -67.480  1.00 0.00 ? 50  LEU B HD13 1  
ATOM   2812   H HD21 . LEU B 2 50  ? -57.521  6.248   -66.089  1.00 0.00 ? 50  LEU B HD21 1  
ATOM   2813   H HD22 . LEU B 2 50  ? -57.372  7.540   -67.280  1.00 0.00 ? 50  LEU B HD22 1  
ATOM   2814   H HD23 . LEU B 2 50  ? -58.207  7.837   -65.755  1.00 0.00 ? 50  LEU B HD23 1  
ATOM   2815   N N    . ASN B 2 51  ? -55.915  4.432   -67.739  1.00 0.00 ? 51  ASN B N    1  
ATOM   2816   C CA   . ASN B 2 51  ? -55.479  4.205   -69.108  1.00 0.00 ? 51  ASN B CA   1  
ATOM   2817   C C    . ASN B 2 51  ? -55.095  5.521   -69.774  1.00 0.00 ? 51  ASN B C    1  
ATOM   2818   O O    . ASN B 2 51  ? -55.619  6.586   -69.432  1.00 0.00 ? 51  ASN B O    1  
ATOM   2819   C CB   . ASN B 2 51  ? -56.575  3.514   -69.925  1.00 0.00 ? 51  ASN B CB   1  
ATOM   2820   C CG   . ASN B 2 51  ? -56.360  2.025   -70.035  1.00 0.00 ? 51  ASN B CG   1  
ATOM   2821   O OD1  . ASN B 2 51  ? -57.203  1.225   -69.613  1.00 0.00 ? 51  ASN B OD1  1  
ATOM   2822   N ND2  . ASN B 2 51  ? -55.213  1.636   -70.587  1.00 0.00 ? 51  ASN B ND2  1  
ATOM   2823   H H    . ASN B 2 51  ? -56.832  4.741   -67.582  1.00 0.00 ? 51  ASN B H    1  
ATOM   2824   H HA   . ASN B 2 51  ? -54.610  3.564   -69.089  1.00 0.00 ? 51  ASN B HA   1  
ATOM   2825   H HB2  . ASN B 2 51  ? -57.528  3.693   -69.453  1.00 0.00 ? 51  ASN B HB2  1  
ATOM   2826   H HB3  . ASN B 2 51  ? -56.592  3.942   -70.918  1.00 0.00 ? 51  ASN B HB3  1  
ATOM   2827   H HD21 . ASN B 2 51  ? -54.566  2.305   -70.895  1.00 0.00 ? 51  ASN B HD21 1  
ATOM   2828   H HD22 . ASN B 2 51  ? -55.015  0.682   -70.684  1.00 0.00 ? 51  ASN B HD22 1  
ATOM   2829   N N    . SER B 2 52  ? -54.172  5.456   -70.722  1.00 0.00 ? 52  SER B N    1  
ATOM   2830   C CA   . SER B 2 52  ? -53.953  6.601   -71.598  1.00 0.00 ? 52  SER B CA   1  
ATOM   2831   C C    . SER B 2 52  ? -55.249  6.875   -72.377  1.00 0.00 ? 52  SER B C    1  
ATOM   2832   O O    . SER B 2 52  ? -55.805  7.960   -72.250  1.00 0.00 ? 52  SER B O    1  
ATOM   2833   C CB   . SER B 2 52  ? -52.739  6.395   -72.526  1.00 0.00 ? 52  SER B CB   1  
ATOM   2834   O OG   . SER B 2 52  ? -52.638  5.051   -72.978  1.00 0.00 ? 52  SER B OG   1  
ATOM   2835   H H    . SER B 2 52  ? -53.778  4.589   -70.954  1.00 0.00 ? 52  SER B H    1  
ATOM   2836   H HA   . SER B 2 52  ? -53.758  7.462   -70.971  1.00 0.00 ? 52  SER B HA   1  
ATOM   2837   H HB2  . SER B 2 52  ? -52.837  7.038   -73.383  1.00 0.00 ? 52  SER B HB2  1  
ATOM   2838   H HB3  . SER B 2 52  ? -51.839  6.668   -71.988  1.00 0.00 ? 52  SER B HB3  1  
ATOM   2839   H HG   . SER B 2 52  ? -52.467  4.493   -72.215  1.00 0.00 ? 52  SER B HG   1  
ATOM   2840   N N    . ARG B 2 53  ? -55.746  5.887   -73.128  1.00 0.00 ? 53  ARG B N    1  
ATOM   2841   C CA   . ARG B 2 53  ? -57.012  6.032   -73.849  1.00 0.00 ? 53  ARG B CA   1  
ATOM   2842   C C    . ARG B 2 53  ? -58.243  5.898   -72.941  1.00 0.00 ? 53  ARG B C    1  
ATOM   2843   O O    . ARG B 2 53  ? -58.504  4.850   -72.317  1.00 0.00 ? 53  ARG B O    1  
ATOM   2844   C CB   . ARG B 2 53  ? -57.083  5.129   -75.088  1.00 0.00 ? 53  ARG B CB   1  
ATOM   2845   C CG   . ARG B 2 53  ? -56.155  3.935   -75.052  1.00 0.00 ? 53  ARG B CG   1  
ATOM   2846   C CD   . ARG B 2 53  ? -56.426  2.946   -76.154  1.00 0.00 ? 53  ARG B CD   1  
ATOM   2847   N NE   . ARG B 2 53  ? -55.537  1.803   -75.990  1.00 0.00 ? 53  ARG B NE   1  
ATOM   2848   C CZ   . ARG B 2 53  ? -54.903  1.170   -76.979  1.00 0.00 ? 53  ARG B CZ   1  
ATOM   2849   N NH1  . ARG B 2 53  ? -55.049  1.549   -78.250  1.00 0.00 ? 53  ARG B NH1  1  
ATOM   2850   N NH2  . ARG B 2 53  ? -54.106  0.143   -76.692  1.00 0.00 ? 53  ARG B NH2  1  
ATOM   2851   H H    . ARG B 2 53  ? -55.275  5.028   -73.160  1.00 0.00 ? 53  ARG B H    1  
ATOM   2852   H HA   . ARG B 2 53  ? -57.027  7.051   -74.214  1.00 0.00 ? 53  ARG B HA   1  
ATOM   2853   H HB2  . ARG B 2 53  ? -58.094  4.768   -75.191  1.00 0.00 ? 53  ARG B HB2  1  
ATOM   2854   H HB3  . ARG B 2 53  ? -56.845  5.726   -75.957  1.00 0.00 ? 53  ARG B HB3  1  
ATOM   2855   H HG2  . ARG B 2 53  ? -55.138  4.284   -75.144  1.00 0.00 ? 53  ARG B HG2  1  
ATOM   2856   H HG3  . ARG B 2 53  ? -56.266  3.438   -74.099  1.00 0.00 ? 53  ARG B HG3  1  
ATOM   2857   H HD2  . ARG B 2 53  ? -57.453  2.616   -76.100  1.00 0.00 ? 53  ARG B HD2  1  
ATOM   2858   H HD3  . ARG B 2 53  ? -56.245  3.412   -77.111  1.00 0.00 ? 53  ARG B HD3  1  
ATOM   2859   H HE   . ARG B 2 53  ? -55.389  1.476   -75.078  1.00 0.00 ? 53  ARG B HE   1  
ATOM   2860   H HH11 . ARG B 2 53  ? -55.643  2.322   -78.476  1.00 0.00 ? 53  ARG B HH11 1  
ATOM   2861   H HH12 . ARG B 2 53  ? -54.565  1.061   -78.976  1.00 0.00 ? 53  ARG B HH12 1  
ATOM   2862   H HH21 . ARG B 2 53  ? -53.988  -0.148  -75.742  1.00 0.00 ? 53  ARG B HH21 1  
ATOM   2863   H HH22 . ARG B 2 53  ? -53.626  -0.338  -77.425  1.00 0.00 ? 53  ARG B HH22 1  
ATOM   2864   N N    . THR B 2 54  ? -58.987  7.001   -72.905  1.00 0.00 ? 54  THR B N    1  
ATOM   2865   C CA   . THR B 2 54  ? -60.071  7.302   -71.940  1.00 0.00 ? 54  THR B CA   1  
ATOM   2866   C C    . THR B 2 54  ? -59.593  7.379   -70.516  1.00 0.00 ? 54  THR B C    1  
ATOM   2867   O O    . THR B 2 54  ? -58.973  6.440   -70.012  1.00 0.00 ? 54  THR B O    1  
ATOM   2868   C CB   . THR B 2 54  ? -61.281  6.304   -71.969  1.00 0.00 ? 54  THR B CB   1  
ATOM   2869   O OG1  . THR B 2 54  ? -61.742  6.109   -73.318  1.00 0.00 ? 54  THR B OG1  1  
ATOM   2870   C CG2  . THR B 2 54  ? -62.437  6.848   -71.117  1.00 0.00 ? 54  THR B CG2  1  
ATOM   2871   H H    . THR B 2 54  ? -58.678  7.751   -73.456  1.00 0.00 ? 54  THR B H    1  
ATOM   2872   H HA   . THR B 2 54  ? -60.458  8.277   -72.198  1.00 0.00 ? 54  THR B HA   1  
ATOM   2873   H HB   . THR B 2 54  ? -60.964  5.355   -71.564  1.00 0.00 ? 54  THR B HB   1  
ATOM   2874   H HG1  . THR B 2 54  ? -62.693  5.980   -73.291  1.00 0.00 ? 54  THR B HG1  1  
ATOM   2875   H HG21 . THR B 2 54  ? -63.246  6.133   -71.110  1.00 0.00 ? 54  THR B HG21 1  
ATOM   2876   H HG22 . THR B 2 54  ? -62.784  7.781   -71.535  1.00 0.00 ? 54  THR B HG22 1  
ATOM   2877   H HG23 . THR B 2 54  ? -62.093  7.012   -70.106  1.00 0.00 ? 54  THR B HG23 1  
ATOM   2878   N N    . ARG B 2 55  ? -59.906  8.495   -69.868  1.00 0.00 ? 55  ARG B N    1  
ATOM   2879   C CA   . ARG B 2 55  ? -59.935  8.516   -68.403  1.00 0.00 ? 55  ARG B CA   1  
ATOM   2880   C C    . ARG B 2 55  ? -60.878  7.391   -68.008  1.00 0.00 ? 55  ARG B C    1  
ATOM   2881   O O    . ARG B 2 55  ? -62.105  7.513   -68.131  1.00 0.00 ? 55  ARG B O    1  
ATOM   2882   C CB   . ARG B 2 55  ? -60.438  9.855   -67.831  1.00 0.00 ? 55  ARG B CB   1  
ATOM   2883   C CG   . ARG B 2 55  ? -59.347  10.824  -67.312  1.00 0.00 ? 55  ARG B CG   1  
ATOM   2884   C CD   . ARG B 2 55  ? -59.939  12.189  -66.945  1.00 0.00 ? 55  ARG B CD   1  
ATOM   2885   N NE   . ARG B 2 55  ? -60.956  12.616  -67.915  1.00 0.00 ? 55  ARG B NE   1  
ATOM   2886   C CZ   . ARG B 2 55  ? -61.483  13.840  -67.991  1.00 0.00 ? 55  ARG B CZ   1  
ATOM   2887   N NH1  . ARG B 2 55  ? -61.091  14.801  -67.153  1.00 0.00 ? 55  ARG B NH1  1  
ATOM   2888   N NH2  . ARG B 2 55  ? -62.410  14.109  -68.915  1.00 0.00 ? 55  ARG B NH2  1  
ATOM   2889   H H    . ARG B 2 55  ? -60.408  9.185   -70.349  1.00 0.00 ? 55  ARG B H    1  
ATOM   2890   H HA   . ARG B 2 55  ? -58.945  8.303   -68.022  1.00 0.00 ? 55  ARG B HA   1  
ATOM   2891   H HB2  . ARG B 2 55  ? -60.990  10.363  -68.606  1.00 0.00 ? 55  ARG B HB2  1  
ATOM   2892   H HB3  . ARG B 2 55  ? -61.120  9.639   -67.020  1.00 0.00 ? 55  ARG B HB3  1  
ATOM   2893   H HG2  . ARG B 2 55  ? -58.882  10.396  -66.438  1.00 0.00 ? 55  ARG B HG2  1  
ATOM   2894   H HG3  . ARG B 2 55  ? -58.600  10.958  -68.081  1.00 0.00 ? 55  ARG B HG3  1  
ATOM   2895   H HD2  . ARG B 2 55  ? -60.392  12.126  -65.968  1.00 0.00 ? 55  ARG B HD2  1  
ATOM   2896   H HD3  . ARG B 2 55  ? -59.144  12.921  -66.917  1.00 0.00 ? 55  ARG B HD3  1  
ATOM   2897   H HE   . ARG B 2 55  ? -61.275  11.947  -68.556  1.00 0.00 ? 55  ARG B HE   1  
ATOM   2898   H HH11 . ARG B 2 55  ? -60.396  14.607  -66.460  1.00 0.00 ? 55  ARG B HH11 1  
ATOM   2899   H HH12 . ARG B 2 55  ? -61.491  15.715  -67.217  1.00 0.00 ? 55  ARG B HH12 1  
ATOM   2900   H HH21 . ARG B 2 55  ? -62.707  13.394  -69.548  1.00 0.00 ? 55  ARG B HH21 1  
ATOM   2901   H HH22 . ARG B 2 55  ? -62.806  15.025  -68.974  1.00 0.00 ? 55  ARG B HH22 1  
ATOM   2902   N N    . LYS B 2 56  ? -60.286  6.279   -67.596  1.00 0.00 ? 56  LYS B N    1  
ATOM   2903   C CA   . LYS B 2 56  ? -61.020  5.080   -67.243  1.00 0.00 ? 56  LYS B CA   1  
ATOM   2904   C C    . LYS B 2 56  ? -60.262  4.504   -66.080  1.00 0.00 ? 56  LYS B C    1  
ATOM   2905   O O    . LYS B 2 56  ? -59.134  4.013   -66.250  1.00 0.00 ? 56  LYS B O    1  
ATOM   2906   C CB   . LYS B 2 56  ? -61.041  4.101   -68.425  1.00 0.00 ? 56  LYS B CB   1  
ATOM   2907   C CG   . LYS B 2 56  ? -62.346  4.079   -69.184  1.00 0.00 ? 56  LYS B CG   1  
ATOM   2908   C CD   . LYS B 2 56  ? -63.531  3.865   -68.252  1.00 0.00 ? 56  LYS B CD   1  
ATOM   2909   C CE   . LYS B 2 56  ? -64.855  4.080   -68.973  1.00 0.00 ? 56  LYS B CE   1  
ATOM   2910   N NZ   . LYS B 2 56  ? -65.124  5.533   -69.262  1.00 0.00 ? 56  LYS B NZ   1  
ATOM   2911   H H    . LYS B 2 56  ? -59.306  6.253   -67.571  1.00 0.00 ? 56  LYS B H    1  
ATOM   2912   H HA   . LYS B 2 56  ? -62.027  5.333   -66.944  1.00 0.00 ? 56  LYS B HA   1  
ATOM   2913   H HB2  . LYS B 2 56  ? -60.254  4.372   -69.111  1.00 0.00 ? 56  LYS B HB2  1  
ATOM   2914   H HB3  . LYS B 2 56  ? -60.839  3.107   -68.050  1.00 0.00 ? 56  LYS B HB3  1  
ATOM   2915   H HG2  . LYS B 2 56  ? -62.469  5.019   -69.700  1.00 0.00 ? 56  LYS B HG2  1  
ATOM   2916   H HG3  . LYS B 2 56  ? -62.319  3.279   -69.910  1.00 0.00 ? 56  LYS B HG3  1  
ATOM   2917   H HD2  . LYS B 2 56  ? -63.500  2.857   -67.867  1.00 0.00 ? 56  LYS B HD2  1  
ATOM   2918   H HD3  . LYS B 2 56  ? -63.461  4.560   -67.428  1.00 0.00 ? 56  LYS B HD3  1  
ATOM   2919   H HE2  . LYS B 2 56  ? -64.837  3.538   -69.905  1.00 0.00 ? 56  LYS B HE2  1  
ATOM   2920   H HE3  . LYS B 2 56  ? -65.653  3.690   -68.358  1.00 0.00 ? 56  LYS B HE3  1  
ATOM   2921   H HZ1  . LYS B 2 56  ? -64.365  6.115   -68.856  1.00 0.00 ? 56  LYS B HZ1  1  
ATOM   2922   H HZ2  . LYS B 2 56  ? -66.035  5.807   -68.841  1.00 0.00 ? 56  LYS B HZ2  1  
ATOM   2923   H HZ3  . LYS B 2 56  ? -65.159  5.681   -70.291  1.00 0.00 ? 56  LYS B HZ3  1  
ATOM   2924   N N    . ASN B 2 57  ? -60.838  4.591   -64.887  1.00 0.00 ? 57  ASN B N    1  
ATOM   2925   C CA   . ASN B 2 57  ? -60.016  4.304   -63.724  1.00 0.00 ? 57  ASN B CA   1  
ATOM   2926   C C    . ASN B 2 57  ? -60.093  2.930   -63.098  1.00 0.00 ? 57  ASN B C    1  
ATOM   2927   O O    . ASN B 2 57  ? -59.531  2.708   -62.023  1.00 0.00 ? 57  ASN B O    1  
ATOM   2928   C CB   . ASN B 2 57  ? -60.002  5.441   -62.699  1.00 0.00 ? 57  ASN B CB   1  
ATOM   2929   C CG   . ASN B 2 57  ? -58.694  6.229   -62.743  1.00 0.00 ? 57  ASN B CG   1  
ATOM   2930   O OD1  . ASN B 2 57  ? -58.691  7.458   -62.786  1.00 0.00 ? 57  ASN B OD1  1  
ATOM   2931   N ND2  . ASN B 2 57  ? -57.576  5.514   -62.756  1.00 0.00 ? 57  ASN B ND2  1  
ATOM   2932   H H    . ASN B 2 57  ? -61.716  5.015   -64.787  1.00 0.00 ? 57  ASN B H    1  
ATOM   2933   H HA   . ASN B 2 57  ? -59.015  4.320   -64.134  1.00 0.00 ? 57  ASN B HA   1  
ATOM   2934   H HB2  . ASN B 2 57  ? -60.822  6.112   -62.905  1.00 0.00 ? 57  ASN B HB2  1  
ATOM   2935   H HB3  . ASN B 2 57  ? -60.129  5.024   -61.711  1.00 0.00 ? 57  ASN B HB3  1  
ATOM   2936   H HD21 . ASN B 2 57  ? -57.621  4.535   -62.738  1.00 0.00 ? 57  ASN B HD21 1  
ATOM   2937   H HD22 . ASN B 2 57  ? -56.707  5.965   -62.784  1.00 0.00 ? 57  ASN B HD22 1  
ATOM   2938   N N    . TYR B 2 58  ? -60.754  2.001   -63.789  1.00 0.00 ? 58  TYR B N    1  
ATOM   2939   C CA   . TYR B 2 58  ? -60.602  0.549   -63.543  1.00 0.00 ? 58  TYR B CA   1  
ATOM   2940   C C    . TYR B 2 58  ? -60.588  0.050   -62.073  1.00 0.00 ? 58  TYR B C    1  
ATOM   2941   O O    . TYR B 2 58  ? -59.969  -0.960  -61.722  1.00 0.00 ? 58  TYR B O    1  
ATOM   2942   C CB   . TYR B 2 58  ? -59.465  0.012   -64.423  1.00 0.00 ? 58  TYR B CB   1  
ATOM   2943   C CG   . TYR B 2 58  ? -59.878  0.157   -65.870  1.00 0.00 ? 58  TYR B CG   1  
ATOM   2944   C CD1  . TYR B 2 58  ? -61.181  -0.193  -66.261  1.00 0.00 ? 58  TYR B CD1  1  
ATOM   2945   C CD2  . TYR B 2 58  ? -59.018  0.688   -66.834  1.00 0.00 ? 58  TYR B CD2  1  
ATOM   2946   C CE1  . TYR B 2 58  ? -61.605  -0.055  -67.566  1.00 0.00 ? 58  TYR B CE1  1  
ATOM   2947   C CE2  . TYR B 2 58  ? -59.431  0.832   -68.157  1.00 0.00 ? 58  TYR B CE2  1  
ATOM   2948   C CZ   . TYR B 2 58  ? -60.730  0.459   -68.515  1.00 0.00 ? 58  TYR B CZ   1  
ATOM   2949   O OH   . TYR B 2 58  ? -61.196  0.587   -69.807  1.00 0.00 ? 58  TYR B OH   1  
ATOM   2950   H H    . TYR B 2 58  ? -61.151  2.272   -64.643  1.00 0.00 ? 58  TYR B H    1  
ATOM   2951   H HA   . TYR B 2 58  ? -61.501  0.114   -63.956  1.00 0.00 ? 58  TYR B HA   1  
ATOM   2952   H HB2  . TYR B 2 58  ? -58.565  0.581   -64.241  1.00 0.00 ? 58  TYR B HB2  1  
ATOM   2953   H HB3  . TYR B 2 58  ? -59.290  -1.029  -64.199  1.00 0.00 ? 58  TYR B HB3  1  
ATOM   2954   H HD1  . TYR B 2 58  ? -61.863  -0.593  -65.525  1.00 0.00 ? 58  TYR B HD1  1  
ATOM   2955   H HD2  . TYR B 2 58  ? -58.012  0.965   -66.556  1.00 0.00 ? 58  TYR B HD2  1  
ATOM   2956   H HE1  . TYR B 2 58  ? -62.608  -0.341  -67.847  1.00 0.00 ? 58  TYR B HE1  1  
ATOM   2957   H HE2  . TYR B 2 58  ? -58.759  1.244   -68.895  1.00 0.00 ? 58  TYR B HE2  1  
ATOM   2958   H HH   . TYR B 2 58  ? -60.655  1.241   -70.255  1.00 0.00 ? 58  TYR B HH   1  
ATOM   2959   N N    . LEU B 2 59  ? -61.321  0.772   -61.235  1.00 0.00 ? 59  LEU B N    1  
ATOM   2960   C CA   . LEU B 2 59  ? -61.486  0.393   -59.864  1.00 0.00 ? 59  LEU B CA   1  
ATOM   2961   C C    . LEU B 2 59  ? -62.963  0.230   -59.618  1.00 0.00 ? 59  LEU B C    1  
ATOM   2962   O O    . LEU B 2 59  ? -63.758  1.050   -60.079  1.00 0.00 ? 59  LEU B O    1  
ATOM   2963   C CB   . LEU B 2 59  ? -60.931  1.469   -58.937  1.00 0.00 ? 59  LEU B CB   1  
ATOM   2964   C CG   . LEU B 2 59  ? -61.140  1.181   -57.443  1.00 0.00 ? 59  LEU B CG   1  
ATOM   2965   C CD1  . LEU B 2 59  ? -59.987  1.711   -56.660  1.00 0.00 ? 59  LEU B CD1  1  
ATOM   2966   C CD2  . LEU B 2 59  ? -62.447  1.741   -56.891  1.00 0.00 ? 59  LEU B CD2  1  
ATOM   2967   H H    . LEU B 2 59  ? -61.811  1.549   -61.577  1.00 0.00 ? 59  LEU B H    1  
ATOM   2968   H HA   . LEU B 2 59  ? -60.980  -0.542  -59.681  1.00 0.00 ? 59  LEU B HA   1  
ATOM   2969   H HB2  . LEU B 2 59  ? -59.872  1.566   -59.119  1.00 0.00 ? 59  LEU B HB2  1  
ATOM   2970   H HB3  . LEU B 2 59  ? -61.407  2.409   -59.178  1.00 0.00 ? 59  LEU B HB3  1  
ATOM   2971   H HG   . LEU B 2 59  ? -61.153  0.106   -57.317  1.00 0.00 ? 59  LEU B HG   1  
ATOM   2972   H HD11 . LEU B 2 59  ? -60.254  1.764   -55.616  1.00 0.00 ? 59  LEU B HD11 1  
ATOM   2973   H HD12 . LEU B 2 59  ? -59.733  2.699   -57.018  1.00 0.00 ? 59  LEU B HD12 1  
ATOM   2974   H HD13 . LEU B 2 59  ? -59.138  1.055   -56.781  1.00 0.00 ? 59  LEU B HD13 1  
ATOM   2975   H HD21 . LEU B 2 59  ? -62.231  2.517   -56.172  1.00 0.00 ? 59  LEU B HD21 1  
ATOM   2976   H HD22 . LEU B 2 59  ? -63.003  0.950   -56.410  1.00 0.00 ? 59  LEU B HD22 1  
ATOM   2977   H HD23 . LEU B 2 59  ? -63.033  2.152   -57.700  1.00 0.00 ? 59  LEU B HD23 1  
ATOM   2978   N N    . ALA B 2 60  ? -63.321  -0.819  -58.880  1.00 0.00 ? 60  ALA B N    1  
ATOM   2979   C CA   . ALA B 2 60  ? -64.674  -0.968  -58.389  1.00 0.00 ? 60  ALA B CA   1  
ATOM   2980   C C    . ALA B 2 60  ? -64.766  -0.954  -56.849  1.00 0.00 ? 60  ALA B C    1  
ATOM   2981   O O    . ALA B 2 60  ? -63.779  -1.234  -56.145  1.00 0.00 ? 60  ALA B O    1  
ATOM   2982   C CB   . ALA B 2 60  ? -65.286  -2.215  -58.952  1.00 0.00 ? 60  ALA B CB   1  
ATOM   2983   H H    . ALA B 2 60  ? -62.625  -1.422  -58.543  1.00 0.00 ? 60  ALA B H    1  
ATOM   2984   H HA   . ALA B 2 60  ? -65.247  -0.129  -58.756  1.00 0.00 ? 60  ALA B HA   1  
ATOM   2985   H HB1  . ALA B 2 60  ? -65.833  -2.730  -58.176  1.00 0.00 ? 60  ALA B HB1  1  
ATOM   2986   H HB2  . ALA B 2 60  ? -64.505  -2.859  -59.330  1.00 0.00 ? 60  ALA B HB2  1  
ATOM   2987   H HB3  . ALA B 2 60  ? -65.960  -1.955  -59.754  1.00 0.00 ? 60  ALA B HB3  1  
ATOM   2988   N N    . TRP B 2 61  ? -65.959  -0.600  -56.354  1.00 0.00 ? 61  TRP B N    1  
ATOM   2989   C CA   . TRP B 2 61  ? -66.312  -0.660  -54.939  1.00 0.00 ? 61  TRP B CA   1  
ATOM   2990   C C    . TRP B 2 61  ? -67.421  -1.664  -54.765  1.00 0.00 ? 61  TRP B C    1  
ATOM   2991   O O    . TRP B 2 61  ? -68.474  -1.513  -55.382  1.00 0.00 ? 61  TRP B O    1  
ATOM   2992   C CB   . TRP B 2 61  ? -66.856  0.682   -54.476  1.00 0.00 ? 61  TRP B CB   1  
ATOM   2993   C CG   . TRP B 2 61  ? -65.828  1.705   -54.286  1.00 0.00 ? 61  TRP B CG   1  
ATOM   2994   C CD1  . TRP B 2 61  ? -65.464  2.651   -55.171  1.00 0.00 ? 61  TRP B CD1  1  
ATOM   2995   C CD2  . TRP B 2 61  ? -65.012  1.891   -53.136  1.00 0.00 ? 61  TRP B CD2  1  
ATOM   2996   N NE1  . TRP B 2 61  ? -64.469  3.424   -54.650  1.00 0.00 ? 61  TRP B NE1  1  
ATOM   2997   C CE2  . TRP B 2 61  ? -64.173  2.973   -53.396  1.00 0.00 ? 61  TRP B CE2  1  
ATOM   2998   C CE3  . TRP B 2 61  ? -64.903  1.234   -51.914  1.00 0.00 ? 61  TRP B CE3  1  
ATOM   2999   C CZ2  . TRP B 2 61  ? -63.234  3.426   -52.480  1.00 0.00 ? 61  TRP B CZ2  1  
ATOM   3000   C CZ3  . TRP B 2 61  ? -63.974  1.684   -51.002  1.00 0.00 ? 61  TRP B CZ3  1  
ATOM   3001   C CH2  . TRP B 2 61  ? -63.150  2.768   -51.289  1.00 0.00 ? 61  TRP B CH2  1  
ATOM   3002   H H    . TRP B 2 61  ? -66.670  -0.378  -56.992  1.00 0.00 ? 61  TRP B H    1  
ATOM   3003   H HA   . TRP B 2 61  ? -65.454  -0.937  -54.347  1.00 0.00 ? 61  TRP B HA   1  
ATOM   3004   H HB2  . TRP B 2 61  ? -67.559  1.041   -55.210  1.00 0.00 ? 61  TRP B HB2  1  
ATOM   3005   H HB3  . TRP B 2 61  ? -67.380  0.535   -53.542  1.00 0.00 ? 61  TRP B HB3  1  
ATOM   3006   H HD1  . TRP B 2 61  ? -65.898  2.781   -56.151  1.00 0.00 ? 61  TRP B HD1  1  
ATOM   3007   H HE1  . TRP B 2 61  ? -64.026  4.181   -55.087  1.00 0.00 ? 61  TRP B HE1  1  
ATOM   3008   H HE3  . TRP B 2 61  ? -65.538  0.392   -51.682  1.00 0.00 ? 61  TRP B HE3  1  
ATOM   3009   H HZ2  . TRP B 2 61  ? -62.594  4.267   -52.702  1.00 0.00 ? 61  TRP B HZ2  1  
ATOM   3010   H HZ3  . TRP B 2 61  ? -63.882  1.185   -50.049  1.00 0.00 ? 61  TRP B HZ3  1  
ATOM   3011   H HH2  . TRP B 2 61  ? -62.432  3.096   -50.553  1.00 0.00 ? 61  TRP B HH2  1  
ATOM   3012   N N    . TYR B 2 62  ? -67.210  -2.670  -53.925  1.00 0.00 ? 62  TYR B N    1  
ATOM   3013   C CA   . TYR B 2 62  ? -68.263  -3.645  -53.622  1.00 0.00 ? 62  TYR B CA   1  
ATOM   3014   C C    . TYR B 2 62  ? -68.655  -3.519  -52.171  1.00 0.00 ? 62  TYR B C    1  
ATOM   3015   O O    . TYR B 2 62  ? -67.793  -3.481  -51.291  1.00 0.00 ? 62  TYR B O    1  
ATOM   3016   C CB   . TYR B 2 62  ? -67.806  -5.092  -53.883  1.00 0.00 ? 62  TYR B CB   1  
ATOM   3017   C CG   . TYR B 2 62  ? -67.457  -5.402  -55.310  1.00 0.00 ? 62  TYR B CG   1  
ATOM   3018   C CD1  . TYR B 2 62  ? -66.300  -4.904  -55.875  1.00 0.00 ? 62  TYR B CD1  1  
ATOM   3019   C CD2  . TYR B 2 62  ? -68.280  -6.195  -56.091  1.00 0.00 ? 62  TYR B CD2  1  
ATOM   3020   C CE1  . TYR B 2 62  ? -65.968  -5.168  -57.186  1.00 0.00 ? 62  TYR B CE1  1  
ATOM   3021   C CE2  . TYR B 2 62  ? -67.956  -6.479  -57.431  1.00 0.00 ? 62  TYR B CE2  1  
ATOM   3022   C CZ   . TYR B 2 62  ? -66.788  -5.961  -57.973  1.00 0.00 ? 62  TYR B CZ   1  
ATOM   3023   O OH   . TYR B 2 62  ? -66.424  -6.218  -59.285  1.00 0.00 ? 62  TYR B OH   1  
ATOM   3024   H H    . TYR B 2 62  ? -66.353  -2.728  -53.453  1.00 0.00 ? 62  TYR B H    1  
ATOM   3025   H HA   . TYR B 2 62  ? -69.125  -3.432  -54.238  1.00 0.00 ? 62  TYR B HA   1  
ATOM   3026   H HB2  . TYR B 2 62  ? -66.937  -5.289  -53.277  1.00 0.00 ? 62  TYR B HB2  1  
ATOM   3027   H HB3  . TYR B 2 62  ? -68.597  -5.759  -53.567  1.00 0.00 ? 62  TYR B HB3  1  
ATOM   3028   H HD1  . TYR B 2 62  ? -65.647  -4.284  -55.280  1.00 0.00 ? 62  TYR B HD1  1  
ATOM   3029   H HD2  . TYR B 2 62  ? -69.188  -6.597  -55.667  1.00 0.00 ? 62  TYR B HD2  1  
ATOM   3030   H HE1  . TYR B 2 62  ? -65.056  -4.764  -57.600  1.00 0.00 ? 62  TYR B HE1  1  
ATOM   3031   H HE2  . TYR B 2 62  ? -68.607  -7.099  -58.030  1.00 0.00 ? 62  TYR B HE2  1  
ATOM   3032   H HH   . TYR B 2 62  ? -65.724  -5.606  -59.524  1.00 0.00 ? 62  TYR B HH   1  
ATOM   3033   N N    . GLN B 2 63  ? -69.952  -3.451  -51.915  1.00 0.00 ? 63  GLN B N    1  
ATOM   3034   C CA   . GLN B 2 63  ? -70.421  -3.518  -50.548  1.00 0.00 ? 63  GLN B CA   1  
ATOM   3035   C C    . GLN B 2 63  ? -70.783  -4.960  -50.261  1.00 0.00 ? 63  GLN B C    1  
ATOM   3036   O O    . GLN B 2 63  ? -71.218  -5.681  -51.170  1.00 0.00 ? 63  GLN B O    1  
ATOM   3037   C CB   . GLN B 2 63  ? -71.624  -2.613  -50.329  1.00 0.00 ? 63  GLN B CB   1  
ATOM   3038   C CG   . GLN B 2 63  ? -72.962  -3.152  -50.824  1.00 0.00 ? 63  GLN B CG   1  
ATOM   3039   C CD   . GLN B 2 63  ? -74.073  -2.933  -49.802  1.00 0.00 ? 63  GLN B CD   1  
ATOM   3040   O OE1  . GLN B 2 63  ? -75.217  -2.613  -50.156  1.00 0.00 ? 63  GLN B OE1  1  
ATOM   3041   N NE2  . GLN B 2 63  ? -73.735  -3.092  -48.518  1.00 0.00 ? 63  GLN B NE2  1  
ATOM   3042   H H    . GLN B 2 63  ? -70.596  -3.483  -52.653  1.00 0.00 ? 63  GLN B H    1  
ATOM   3043   H HA   . GLN B 2 63  ? -69.622  -3.216  -49.886  1.00 0.00 ? 63  GLN B HA   1  
ATOM   3044   H HB2  . GLN B 2 63  ? -71.714  -2.423  -49.272  1.00 0.00 ? 63  GLN B HB2  1  
ATOM   3045   H HB3  . GLN B 2 63  ? -71.429  -1.672  -50.825  1.00 0.00 ? 63  GLN B HB3  1  
ATOM   3046   H HG2  . GLN B 2 63  ? -73.226  -2.649  -51.742  1.00 0.00 ? 63  GLN B HG2  1  
ATOM   3047   H HG3  . GLN B 2 63  ? -72.865  -4.210  -51.019  1.00 0.00 ? 63  GLN B HG3  1  
ATOM   3048   H HE21 . GLN B 2 63  ? -72.816  -3.336  -48.280  1.00 0.00 ? 63  GLN B HE21 1  
ATOM   3049   H HE22 . GLN B 2 63  ? -74.406  -2.966  -47.815  1.00 0.00 ? 63  GLN B HE22 1  
ATOM   3050   N N    . GLN B 2 64  ? -70.606  -5.382  -49.007  1.00 0.00 ? 64  GLN B N    1  
ATOM   3051   C CA   . GLN B 2 64  ? -70.924  -6.757  -48.611  1.00 0.00 ? 64  GLN B CA   1  
ATOM   3052   C C    . GLN B 2 64  ? -71.575  -6.768  -47.265  1.00 0.00 ? 64  GLN B C    1  
ATOM   3053   O O    . GLN B 2 64  ? -70.913  -6.494  -46.274  1.00 0.00 ? 64  GLN B O    1  
ATOM   3054   C CB   . GLN B 2 64  ? -69.666  -7.616  -48.551  1.00 0.00 ? 64  GLN B CB   1  
ATOM   3055   C CG   . GLN B 2 64  ? -69.939  -9.091  -48.322  1.00 0.00 ? 64  GLN B CG   1  
ATOM   3056   C CD   . GLN B 2 64  ? -68.726  -9.832  -47.800  1.00 0.00 ? 64  GLN B CD   1  
ATOM   3057   O OE1  . GLN B 2 64  ? -68.017  -9.354  -46.908  1.00 0.00 ? 64  GLN B OE1  1  
ATOM   3058   N NE2  . GLN B 2 64  ? -68.475  -11.008 -48.357  1.00 0.00 ? 64  GLN B NE2  1  
ATOM   3059   H H    . GLN B 2 64  ? -70.256  -4.759  -48.336  1.00 0.00 ? 64  GLN B H    1  
ATOM   3060   H HA   . GLN B 2 64  ? -71.603  -7.182  -49.334  1.00 0.00 ? 64  GLN B HA   1  
ATOM   3061   H HB2  . GLN B 2 64  ? -69.131  -7.509  -49.481  1.00 0.00 ? 64  GLN B HB2  1  
ATOM   3062   H HB3  . GLN B 2 64  ? -69.039  -7.250  -47.750  1.00 0.00 ? 64  GLN B HB3  1  
ATOM   3063   H HG2  . GLN B 2 64  ? -70.744  -9.194  -47.611  1.00 0.00 ? 64  GLN B HG2  1  
ATOM   3064   H HG3  . GLN B 2 64  ? -70.243  -9.535  -49.259  1.00 0.00 ? 64  GLN B HG3  1  
ATOM   3065   H HE21 . GLN B 2 64  ? -69.061  -11.351 -49.064  1.00 0.00 ? 64  GLN B HE21 1  
ATOM   3066   H HE22 . GLN B 2 64  ? -67.703  -11.535 -48.062  1.00 0.00 ? 64  GLN B HE22 1  
ATOM   3067   N N    . LYS B 2 65  ? -72.862  -7.109  -47.230  1.00 0.00 ? 65  LYS B N    1  
ATOM   3068   C CA   . LYS B 2 65  ? -73.629  -7.108  -45.981  1.00 0.00 ? 65  LYS B CA   1  
ATOM   3069   C C    . LYS B 2 65  ? -73.290  -8.308  -45.085  1.00 0.00 ? 65  LYS B C    1  
ATOM   3070   O O    . LYS B 2 65  ? -72.755  -9.298  -45.572  1.00 0.00 ? 65  LYS B O    1  
ATOM   3071   C CB   . LYS B 2 65  ? -75.118  -7.002  -46.282  1.00 0.00 ? 65  LYS B CB   1  
ATOM   3072   C CG   . LYS B 2 65  ? -75.568  -5.570  -46.506  1.00 0.00 ? 65  LYS B CG   1  
ATOM   3073   C CD   . LYS B 2 65  ? -76.597  -5.478  -47.644  1.00 0.00 ? 65  LYS B CD   1  
ATOM   3074   C CE   . LYS B 2 65  ? -77.299  -4.116  -47.657  1.00 0.00 ? 65  LYS B CE   1  
ATOM   3075   N NZ   . LYS B 2 65  ? -78.011  -3.839  -48.936  1.00 0.00 ? 65  LYS B NZ   1  
ATOM   3076   H H    . LYS B 2 65  ? -73.318  -7.332  -48.068  1.00 0.00 ? 65  LYS B H    1  
ATOM   3077   H HA   . LYS B 2 65  ? -73.345  -6.218  -45.436  1.00 0.00 ? 65  LYS B HA   1  
ATOM   3078   H HB2  . LYS B 2 65  ? -75.340  -7.580  -47.165  1.00 0.00 ? 65  LYS B HB2  1  
ATOM   3079   H HB3  . LYS B 2 65  ? -75.668  -7.414  -45.448  1.00 0.00 ? 65  LYS B HB3  1  
ATOM   3080   H HG2  . LYS B 2 65  ? -76.003  -5.183  -45.597  1.00 0.00 ? 65  LYS B HG2  1  
ATOM   3081   H HG3  . LYS B 2 65  ? -74.707  -4.973  -46.768  1.00 0.00 ? 65  LYS B HG3  1  
ATOM   3082   H HD2  . LYS B 2 65  ? -76.090  -5.619  -48.587  1.00 0.00 ? 65  LYS B HD2  1  
ATOM   3083   H HD3  . LYS B 2 65  ? -77.335  -6.257  -47.520  1.00 0.00 ? 65  LYS B HD3  1  
ATOM   3084   H HE2  . LYS B 2 65  ? -78.015  -4.086  -46.851  1.00 0.00 ? 65  LYS B HE2  1  
ATOM   3085   H HE3  . LYS B 2 65  ? -76.559  -3.345  -47.492  1.00 0.00 ? 65  LYS B HE3  1  
ATOM   3086   H HZ1  . LYS B 2 65  ? -78.949  -4.285  -48.914  1.00 0.00 ? 65  LYS B HZ1  1  
ATOM   3087   H HZ2  . LYS B 2 65  ? -77.460  -4.225  -49.730  1.00 0.00 ? 65  LYS B HZ2  1  
ATOM   3088   H HZ3  . LYS B 2 65  ? -78.121  -2.812  -49.057  1.00 0.00 ? 65  LYS B HZ3  1  
ATOM   3089   N N    . PRO B 2 66  ? -73.565  -8.215  -43.766  1.00 0.00 ? 66  PRO B N    1  
ATOM   3090   C CA   . PRO B 2 66  ? -73.184  -9.312  -42.875  1.00 0.00 ? 66  PRO B CA   1  
ATOM   3091   C C    . PRO B 2 66  ? -73.733  -10.670 -43.340  1.00 0.00 ? 66  PRO B C    1  
ATOM   3092   O O    . PRO B 2 66  ? -74.959  -10.861 -43.416  1.00 0.00 ? 66  PRO B O    1  
ATOM   3093   C CB   . PRO B 2 66  ? -73.799  -8.902  -41.529  1.00 0.00 ? 66  PRO B CB   1  
ATOM   3094   C CG   . PRO B 2 66  ? -74.853  -7.906  -41.873  1.00 0.00 ? 66  PRO B CG   1  
ATOM   3095   C CD   . PRO B 2 66  ? -74.276  -7.158  -43.027  1.00 0.00 ? 66  PRO B CD   1  
ATOM   3096   H HA   . PRO B 2 66  ? -72.113  -9.358  -42.777  1.00 0.00 ? 66  PRO B HA   1  
ATOM   3097   H HB2  . PRO B 2 66  ? -74.235  -9.761  -41.038  1.00 0.00 ? 66  PRO B HB2  1  
ATOM   3098   H HB3  . PRO B 2 66  ? -73.052  -8.446  -40.898  1.00 0.00 ? 66  PRO B HB3  1  
ATOM   3099   H HG2  . PRO B 2 66  ? -75.768  -8.407  -42.158  1.00 0.00 ? 66  PRO B HG2  1  
ATOM   3100   H HG3  . PRO B 2 66  ? -75.026  -7.234  -41.047  1.00 0.00 ? 66  PRO B HG3  1  
ATOM   3101   H HD2  . PRO B 2 66  ? -75.061  -6.721  -43.631  1.00 0.00 ? 66  PRO B HD2  1  
ATOM   3102   H HD3  . PRO B 2 66  ? -73.581  -6.405  -42.691  1.00 0.00 ? 66  PRO B HD3  1  
ATOM   3103   N N    . GLY B 2 67  ? -72.812  -11.586 -43.660  1.00 0.00 ? 67  GLY B N    1  
ATOM   3104   C CA   . GLY B 2 67  ? -73.152  -12.910 -44.158  1.00 0.00 ? 67  GLY B CA   1  
ATOM   3105   C C    . GLY B 2 67  ? -73.960  -12.753 -45.420  1.00 0.00 ? 67  GLY B C    1  
ATOM   3106   O O    . GLY B 2 67  ? -75.142  -13.083 -45.460  1.00 0.00 ? 67  GLY B O    1  
ATOM   3107   H H    . GLY B 2 67  ? -71.865  -11.346 -43.581  1.00 0.00 ? 67  GLY B H    1  
ATOM   3108   H HA2  . GLY B 2 67  ? -72.247  -13.462 -44.368  1.00 0.00 ? 67  GLY B HA2  1  
ATOM   3109   H HA3  . GLY B 2 67  ? -73.737  -13.436 -43.420  1.00 0.00 ? 67  GLY B HA3  1  
ATOM   3110   N N    . GLN B 2 68  ? -73.310  -12.197 -46.436  1.00 0.00 ? 68  GLN B N    1  
ATOM   3111   C CA   . GLN B 2 68  ? -73.865  -12.081 -47.792  1.00 0.00 ? 68  GLN B CA   1  
ATOM   3112   C C    . GLN B 2 68  ? -72.785  -11.998 -48.845  1.00 0.00 ? 68  GLN B C    1  
ATOM   3113   O O    . GLN B 2 68  ? -71.650  -11.578 -48.590  1.00 0.00 ? 68  GLN B O    1  
ATOM   3114   C CB   . GLN B 2 68  ? -74.732  -10.847 -47.938  1.00 0.00 ? 68  GLN B CB   1  
ATOM   3115   C CG   . GLN B 2 68  ? -76.177  -11.120 -47.768  1.00 0.00 ? 68  GLN B CG   1  
ATOM   3116   C CD   . GLN B 2 68  ? -76.862  -9.959  -47.125  1.00 0.00 ? 68  GLN B CD   1  
ATOM   3117   O OE1  . GLN B 2 68  ? -76.537  -9.571  -45.991  1.00 0.00 ? 68  GLN B OE1  1  
ATOM   3118   N NE2  . GLN B 2 68  ? -77.813  -9.372  -47.842  1.00 0.00 ? 68  GLN B NE2  1  
ATOM   3119   H H    . GLN B 2 68  ? -72.377  -11.932 -46.296  1.00 0.00 ? 68  GLN B H    1  
ATOM   3120   H HA   . GLN B 2 68  ? -74.474  -12.950 -47.990  1.00 0.00 ? 68  GLN B HA   1  
ATOM   3121   H HB2  . GLN B 2 68  ? -74.430  -10.119 -47.202  1.00 0.00 ? 68  GLN B HB2  1  
ATOM   3122   H HB3  . GLN B 2 68  ? -74.569  -10.429 -48.922  1.00 0.00 ? 68  GLN B HB3  1  
ATOM   3123   H HG2  . GLN B 2 68  ? -76.643  -11.382 -48.702  1.00 0.00 ? 68  GLN B HG2  1  
ATOM   3124   H HG3  . GLN B 2 68  ? -76.257  -11.957 -47.092  1.00 0.00 ? 68  GLN B HG3  1  
ATOM   3125   H HE21 . GLN B 2 68  ? -78.028  -9.706  -48.738  1.00 0.00 ? 68  GLN B HE21 1  
ATOM   3126   H HE22 . GLN B 2 68  ? -78.299  -8.604  -47.476  1.00 0.00 ? 68  GLN B HE22 1  
ATOM   3127   N N    . SER B 2 69  ? -73.152  -12.389 -50.049  1.00 0.00 ? 69  SER B N    1  
ATOM   3128   C CA   . SER B 2 69  ? -72.268  -12.186 -51.165  1.00 0.00 ? 69  SER B CA   1  
ATOM   3129   C C    . SER B 2 69  ? -72.119  -10.668 -51.389  1.00 0.00 ? 69  SER B C    1  
ATOM   3130   O O    . SER B 2 69  ? -73.105  -9.917  -51.266  1.00 0.00 ? 69  SER B O    1  
ATOM   3131   C CB   . SER B 2 69  ? -72.826  -12.905 -52.388  1.00 0.00 ? 69  SER B CB   1  
ATOM   3132   O OG   . SER B 2 69  ? -73.058  -14.269 -52.076  1.00 0.00 ? 69  SER B OG   1  
ATOM   3133   H H    . SER B 2 69  ? -74.068  -12.703 -50.202  1.00 0.00 ? 69  SER B H    1  
ATOM   3134   H HA   . SER B 2 69  ? -71.299  -12.600 -50.922  1.00 0.00 ? 69  SER B HA   1  
ATOM   3135   H HB2  . SER B 2 69  ? -73.755  -12.447 -52.684  1.00 0.00 ? 69  SER B HB2  1  
ATOM   3136   H HB3  . SER B 2 69  ? -72.116  -12.828 -53.202  1.00 0.00 ? 69  SER B HB3  1  
ATOM   3137   H HG   . SER B 2 69  ? -72.222  -14.659 -51.809  1.00 0.00 ? 69  SER B HG   1  
ATOM   3138   N N    . PRO B 2 70  ? -70.883  -10.203 -51.668  1.00 0.00 ? 70  PRO B N    1  
ATOM   3139   C CA   . PRO B 2 70  ? -70.699  -8.797  -52.005  1.00 0.00 ? 70  PRO B CA   1  
ATOM   3140   C C    . PRO B 2 70  ? -71.678  -8.344  -53.101  1.00 0.00 ? 70  PRO B C    1  
ATOM   3141   O O    . PRO B 2 70  ? -72.090  -9.163  -53.919  1.00 0.00 ? 70  PRO B O    1  
ATOM   3142   C CB   . PRO B 2 70  ? -69.266  -8.769  -52.516  1.00 0.00 ? 70  PRO B CB   1  
ATOM   3143   C CG   . PRO B 2 70  ? -68.581  -9.852  -51.756  1.00 0.00 ? 70  PRO B CG   1  
ATOM   3144   C CD   . PRO B 2 70  ? -69.600  -10.929 -51.614  1.00 0.00 ? 70  PRO B CD   1  
ATOM   3145   H HA   . PRO B 2 70  ? -70.788  -8.177  -51.129  1.00 0.00 ? 70  PRO B HA   1  
ATOM   3146   H HB2  . PRO B 2 70  ? -69.240  -8.973  -53.578  1.00 0.00 ? 70  PRO B HB2  1  
ATOM   3147   H HB3  . PRO B 2 70  ? -68.806  -7.817  -52.301  1.00 0.00 ? 70  PRO B HB3  1  
ATOM   3148   H HG2  . PRO B 2 70  ? -67.723  -10.212 -52.307  1.00 0.00 ? 70  PRO B HG2  1  
ATOM   3149   H HG3  . PRO B 2 70  ? -68.283  -9.498  -50.782  1.00 0.00 ? 70  PRO B HG3  1  
ATOM   3150   H HD2  . PRO B 2 70  ? -69.522  -11.634 -52.431  1.00 0.00 ? 70  PRO B HD2  1  
ATOM   3151   H HD3  . PRO B 2 70  ? -69.497  -11.429 -50.665  1.00 0.00 ? 70  PRO B HD3  1  
ATOM   3152   N N    . LYS B 2 71  ? -72.068  -7.070  -53.089  1.00 0.00 ? 71  LYS B N    1  
ATOM   3153   C CA   . LYS B 2 71  ? -72.885  -6.471  -54.170  1.00 0.00 ? 71  LYS B CA   1  
ATOM   3154   C C    . LYS B 2 71  ? -72.079  -5.407  -54.928  1.00 0.00 ? 71  LYS B C    1  
ATOM   3155   O O    . LYS B 2 71  ? -71.314  -4.651  -54.318  1.00 0.00 ? 71  LYS B O    1  
ATOM   3156   C CB   . LYS B 2 71  ? -74.155  -5.796  -53.620  1.00 0.00 ? 71  LYS B CB   1  
ATOM   3157   C CG   . LYS B 2 71  ? -74.952  -6.564  -52.537  1.00 0.00 ? 71  LYS B CG   1  
ATOM   3158   C CD   . LYS B 2 71  ? -75.995  -5.649  -51.825  1.00 0.00 ? 71  LYS B CD   1  
ATOM   3159   C CE   . LYS B 2 71  ? -77.055  -5.072  -52.810  1.00 0.00 ? 71  LYS B CE   1  
ATOM   3160   N NZ   . LYS B 2 71  ? -77.892  -3.928  -52.277  1.00 0.00 ? 71  LYS B NZ   1  
ATOM   3161   H H    . LYS B 2 71  ? -71.720  -6.482  -52.387  1.00 0.00 ? 71  LYS B H    1  
ATOM   3162   H HA   . LYS B 2 71  ? -73.175  -7.249  -54.862  1.00 0.00 ? 71  LYS B HA   1  
ATOM   3163   H HB2  . LYS B 2 71  ? -73.868  -4.846  -53.199  1.00 0.00 ? 71  LYS B HB2  1  
ATOM   3164   H HB3  . LYS B 2 71  ? -74.815  -5.603  -54.455  1.00 0.00 ? 71  LYS B HB3  1  
ATOM   3165   H HG2  . LYS B 2 71  ? -75.469  -7.391  -53.001  1.00 0.00 ? 71  LYS B HG2  1  
ATOM   3166   H HG3  . LYS B 2 71  ? -74.262  -6.949  -51.801  1.00 0.00 ? 71  LYS B HG3  1  
ATOM   3167   H HD2  . LYS B 2 71  ? -76.498  -6.213  -51.054  1.00 0.00 ? 71  LYS B HD2  1  
ATOM   3168   H HD3  . LYS B 2 71  ? -75.468  -4.825  -51.365  1.00 0.00 ? 71  LYS B HD3  1  
ATOM   3169   H HE2  . LYS B 2 71  ? -76.543  -4.725  -53.692  1.00 0.00 ? 71  LYS B HE2  1  
ATOM   3170   H HE3  . LYS B 2 71  ? -77.716  -5.878  -53.100  1.00 0.00 ? 71  LYS B HE3  1  
ATOM   3171   H HZ1  . LYS B 2 71  ? -78.340  -3.427  -53.071  1.00 0.00 ? 71  LYS B HZ1  1  
ATOM   3172   H HZ2  . LYS B 2 71  ? -77.284  -3.270  -51.750  1.00 0.00 ? 71  LYS B HZ2  1  
ATOM   3173   H HZ3  . LYS B 2 71  ? -78.629  -4.302  -51.646  1.00 0.00 ? 71  LYS B HZ3  1  
ATOM   3174   N N    . LEU B 2 72  ? -72.249  -5.332  -56.243  1.00 0.00 ? 72  LEU B N    1  
ATOM   3175   C CA   . LEU B 2 72  ? -71.572  -4.291  -57.018  1.00 0.00 ? 72  LEU B CA   1  
ATOM   3176   C C    . LEU B 2 72  ? -72.207  -2.940  -56.719  1.00 0.00 ? 72  LEU B C    1  
ATOM   3177   O O    . LEU B 2 72  ? -73.423  -2.829  -56.588  1.00 0.00 ? 72  LEU B O    1  
ATOM   3178   C CB   . LEU B 2 72  ? -71.626  -4.601  -58.511  1.00 0.00 ? 72  LEU B CB   1  
ATOM   3179   C CG   . LEU B 2 72  ? -71.082  -3.558  -59.492  1.00 0.00 ? 72  LEU B CG   1  
ATOM   3180   C CD1  . LEU B 2 72  ? -69.621  -3.167  -59.208  1.00 0.00 ? 72  LEU B CD1  1  
ATOM   3181   C CD2  . LEU B 2 72  ? -71.263  -4.061  -60.912  1.00 0.00 ? 72  LEU B CD2  1  
ATOM   3182   H H    . LEU B 2 72  ? -72.871  -5.945  -56.689  1.00 0.00 ? 72  LEU B H    1  
ATOM   3183   H HA   . LEU B 2 72  ? -70.537  -4.256  -56.710  1.00 0.00 ? 72  LEU B HA   1  
ATOM   3184   H HB2  . LEU B 2 72  ? -71.075  -5.511  -58.676  1.00 0.00 ? 72  LEU B HB2  1  
ATOM   3185   H HB3  . LEU B 2 72  ? -72.660  -4.794  -58.766  1.00 0.00 ? 72  LEU B HB3  1  
ATOM   3186   H HG   . LEU B 2 72  ? -71.682  -2.666  -59.379  1.00 0.00 ? 72  LEU B HG   1  
ATOM   3187   H HD11 . LEU B 2 72  ? -69.598  -2.309  -58.552  1.00 0.00 ? 72  LEU B HD11 1  
ATOM   3188   H HD12 . LEU B 2 72  ? -69.126  -2.923  -60.137  1.00 0.00 ? 72  LEU B HD12 1  
ATOM   3189   H HD13 . LEU B 2 72  ? -69.112  -3.995  -58.736  1.00 0.00 ? 72  LEU B HD13 1  
ATOM   3190   H HD21 . LEU B 2 72  ? -72.190  -3.680  -61.314  1.00 0.00 ? 72  LEU B HD21 1  
ATOM   3191   H HD22 . LEU B 2 72  ? -71.288  -5.141  -60.911  1.00 0.00 ? 72  LEU B HD22 1  
ATOM   3192   H HD23 . LEU B 2 72  ? -70.439  -3.721  -61.522  1.00 0.00 ? 72  LEU B HD23 1  
ATOM   3193   N N    . LEU B 2 73  ? -71.376  -1.913  -56.614  1.00 0.00 ? 73  LEU B N    1  
ATOM   3194   C CA   . LEU B 2 73  ? -71.812  -0.626  -56.073  1.00 0.00 ? 73  LEU B CA   1  
ATOM   3195   C C    . LEU B 2 73  ? -71.458  0.525   -56.997  1.00 0.00 ? 73  LEU B C    1  
ATOM   3196   O O    . LEU B 2 73  ? -72.300  1.347   -57.360  1.00 0.00 ? 73  LEU B O    1  
ATOM   3197   C CB   . LEU B 2 73  ? -71.133  -0.419  -54.735  1.00 0.00 ? 73  LEU B CB   1  
ATOM   3198   C CG   . LEU B 2 73  ? -71.871  0.359   -53.681  1.00 0.00 ? 73  LEU B CG   1  
ATOM   3199   C CD1  . LEU B 2 73  ? -73.272  -0.133  -53.590  1.00 0.00 ? 73  LEU B CD1  1  
ATOM   3200   C CD2  . LEU B 2 73  ? -71.138  0.115   -52.395  1.00 0.00 ? 73  LEU B CD2  1  
ATOM   3201   H H    . LEU B 2 73  ? -70.416  -2.070  -56.735  1.00 0.00 ? 73  LEU B H    1  
ATOM   3202   H HA   . LEU B 2 73  ? -72.880  -0.646  -55.923  1.00 0.00 ? 73  LEU B HA   1  
ATOM   3203   H HB2  . LEU B 2 73  ? -70.916  -1.390  -54.323  1.00 0.00 ? 73  LEU B HB2  1  
ATOM   3204   H HB3  . LEU B 2 73  ? -70.189  0.077   -54.922  1.00 0.00 ? 73  LEU B HB3  1  
ATOM   3205   H HG   . LEU B 2 73  ? -71.859  1.412   -53.918  1.00 0.00 ? 73  LEU B HG   1  
ATOM   3206   H HD11 . LEU B 2 73  ? -73.908  0.656   -53.219  1.00 0.00 ? 73  LEU B HD11 1  
ATOM   3207   H HD12 . LEU B 2 73  ? -73.313  -0.977  -52.915  1.00 0.00 ? 73  LEU B HD12 1  
ATOM   3208   H HD13 . LEU B 2 73  ? -73.612  -0.437  -54.568  1.00 0.00 ? 73  LEU B HD13 1  
ATOM   3209   H HD21 . LEU B 2 73  ? -71.768  -0.450  -51.724  1.00 0.00 ? 73  LEU B HD21 1  
ATOM   3210   H HD22 . LEU B 2 73  ? -70.884  1.061   -51.941  1.00 0.00 ? 73  LEU B HD22 1  
ATOM   3211   H HD23 . LEU B 2 73  ? -70.236  -0.443  -52.595  1.00 0.00 ? 73  LEU B HD23 1  
ATOM   3212   N N    . ILE B 2 74  ? -70.187  0.565   -57.370  1.00 0.00 ? 74  ILE B N    1  
ATOM   3213   C CA   . ILE B 2 74  ? -69.670  1.563   -58.274  1.00 0.00 ? 74  ILE B CA   1  
ATOM   3214   C C    . ILE B 2 74  ? -68.669  0.853   -59.155  1.00 0.00 ? 74  ILE B C    1  
ATOM   3215   O O    . ILE B 2 74  ? -67.805  0.139   -58.640  1.00 0.00 ? 74  ILE B O    1  
ATOM   3216   C CB   . ILE B 2 74  ? -68.977  2.701   -57.474  1.00 0.00 ? 74  ILE B CB   1  
ATOM   3217   C CG1  . ILE B 2 74  ? -70.027  3.670   -56.915  1.00 0.00 ? 74  ILE B CG1  1  
ATOM   3218   C CG2  . ILE B 2 74  ? -67.967  3.466   -58.332  1.00 0.00 ? 74  ILE B CG2  1  
ATOM   3219   C CD1  . ILE B 2 74  ? -69.575  4.455   -55.704  1.00 0.00 ? 74  ILE B CD1  1  
ATOM   3220   H H    . ILE B 2 74  ? -69.578  -0.126  -57.037  1.00 0.00 ? 74  ILE B H    1  
ATOM   3221   H HA   . ILE B 2 74  ? -70.470  1.967   -58.876  1.00 0.00 ? 74  ILE B HA   1  
ATOM   3222   H HB   . ILE B 2 74  ? -68.446  2.256   -56.645  1.00 0.00 ? 74  ILE B HB   1  
ATOM   3223   H HG12 . ILE B 2 74  ? -70.293  4.371   -57.690  1.00 0.00 ? 74  ILE B HG12 1  
ATOM   3224   H HG13 . ILE B 2 74  ? -70.908  3.102   -56.651  1.00 0.00 ? 74  ILE B HG13 1  
ATOM   3225   H HG21 . ILE B 2 74  ? -67.237  2.776   -58.729  1.00 0.00 ? 74  ILE B HG21 1  
ATOM   3226   H HG22 . ILE B 2 74  ? -67.469  4.208   -57.726  1.00 0.00 ? 74  ILE B HG22 1  
ATOM   3227   H HG23 . ILE B 2 74  ? -68.483  3.954   -59.146  1.00 0.00 ? 74  ILE B HG23 1  
ATOM   3228   H HD11 . ILE B 2 74  ? -69.600  3.818   -54.832  1.00 0.00 ? 74  ILE B HD11 1  
ATOM   3229   H HD12 . ILE B 2 74  ? -70.234  5.297   -55.554  1.00 0.00 ? 74  ILE B HD12 1  
ATOM   3230   H HD13 . ILE B 2 74  ? -68.567  4.809   -55.860  1.00 0.00 ? 74  ILE B HD13 1  
ATOM   3231   N N    . TYR B 2 75  ? -68.787  1.014   -60.470  1.00 0.00 ? 75  TYR B N    1  
ATOM   3232   C CA   . TYR B 2 75  ? -67.669  0.624   -61.314  1.00 0.00 ? 75  TYR B CA   1  
ATOM   3233   C C    . TYR B 2 75  ? -66.909  1.787   -61.950  1.00 0.00 ? 75  TYR B C    1  
ATOM   3234   O O    . TYR B 2 75  ? -67.246  2.963   -61.756  1.00 0.00 ? 75  TYR B O    1  
ATOM   3235   C CB   . TYR B 2 75  ? -68.035  -0.444  -62.330  1.00 0.00 ? 75  TYR B CB   1  
ATOM   3236   C CG   . TYR B 2 75  ? -69.166  -0.143  -63.274  1.00 0.00 ? 75  TYR B CG   1  
ATOM   3237   C CD1  . TYR B 2 75  ? -68.990  0.690   -64.368  1.00 0.00 ? 75  TYR B CD1  1  
ATOM   3238   C CD2  . TYR B 2 75  ? -70.398  -0.759  -63.113  1.00 0.00 ? 75  TYR B CD2  1  
ATOM   3239   C CE1  . TYR B 2 75  ? -70.033  0.932   -65.260  1.00 0.00 ? 75  TYR B CE1  1  
ATOM   3240   C CE2  . TYR B 2 75  ? -71.446  -0.535  -63.991  1.00 0.00 ? 75  TYR B CE2  1  
ATOM   3241   C CZ   . TYR B 2 75  ? -71.260  0.314   -65.061  1.00 0.00 ? 75  TYR B CZ   1  
ATOM   3242   O OH   . TYR B 2 75  ? -72.307  0.536   -65.927  1.00 0.00 ? 75  TYR B OH   1  
ATOM   3243   H H    . TYR B 2 75  ? -69.504  1.575   -60.833  1.00 0.00 ? 75  TYR B H    1  
ATOM   3244   H HA   . TYR B 2 75  ? -66.960  0.159   -60.643  1.00 0.00 ? 75  TYR B HA   1  
ATOM   3245   H HB2  . TYR B 2 75  ? -67.161  -0.653  -62.924  1.00 0.00 ? 75  TYR B HB2  1  
ATOM   3246   H HB3  . TYR B 2 75  ? -68.283  -1.343  -61.782  1.00 0.00 ? 75  TYR B HB3  1  
ATOM   3247   H HD1  . TYR B 2 75  ? -68.039  1.181   -64.516  1.00 0.00 ? 75  TYR B HD1  1  
ATOM   3248   H HD2  . TYR B 2 75  ? -70.547  -1.425  -62.275  1.00 0.00 ? 75  TYR B HD2  1  
ATOM   3249   H HE1  . TYR B 2 75  ? -69.884  1.583   -66.108  1.00 0.00 ? 75  TYR B HE1  1  
ATOM   3250   H HE2  . TYR B 2 75  ? -72.400  -1.017  -63.836  1.00 0.00 ? 75  TYR B HE2  1  
ATOM   3251   H HH   . TYR B 2 75  ? -72.791  1.305   -65.617  1.00 0.00 ? 75  TYR B HH   1  
ATOM   3252   N N    . TRP B 2 76  ? -65.858  1.439   -62.684  1.00 0.00 ? 76  TRP B N    1  
ATOM   3253   C CA   . TRP B 2 76  ? -64.950  2.406   -63.309  1.00 0.00 ? 76  TRP B CA   1  
ATOM   3254   C C    . TRP B 2 76  ? -64.301  3.429   -62.385  1.00 0.00 ? 76  TRP B C    1  
ATOM   3255   O O    . TRP B 2 76  ? -63.107  3.679   -62.512  1.00 0.00 ? 76  TRP B O    1  
ATOM   3256   C CB   . TRP B 2 76  ? -65.570  3.035   -64.548  1.00 0.00 ? 76  TRP B CB   1  
ATOM   3257   C CG   . TRP B 2 76  ? -65.581  2.063   -65.689  1.00 0.00 ? 76  TRP B CG   1  
ATOM   3258   C CD1  . TRP B 2 76  ? -64.647  1.086   -65.956  1.00 0.00 ? 76  TRP B CD1  1  
ATOM   3259   C CD2  . TRP B 2 76  ? -66.556  1.973   -66.726  1.00 0.00 ? 76  TRP B CD2  1  
ATOM   3260   N NE1  . TRP B 2 76  ? -64.992  0.397   -67.092  1.00 0.00 ? 76  TRP B NE1  1  
ATOM   3261   C CE2  . TRP B 2 76  ? -66.158  0.921   -67.587  1.00 0.00 ? 76  TRP B CE2  1  
ATOM   3262   C CE3  . TRP B 2 76  ? -67.728  2.679   -67.017  1.00 0.00 ? 76  TRP B CE3  1  
ATOM   3263   C CZ2  . TRP B 2 76  ? -66.891  0.563   -68.714  1.00 0.00 ? 76  TRP B CZ2  1  
ATOM   3264   C CZ3  . TRP B 2 76  ? -68.459  2.312   -68.138  1.00 0.00 ? 76  TRP B CZ3  1  
ATOM   3265   C CH2  . TRP B 2 76  ? -68.036  1.262   -68.973  1.00 0.00 ? 76  TRP B CH2  1  
ATOM   3266   H H    . TRP B 2 76  ? -65.648  0.486   -62.768  1.00 0.00 ? 76  TRP B H    1  
ATOM   3267   H HA   . TRP B 2 76  ? -64.126  1.809   -63.676  1.00 0.00 ? 76  TRP B HA   1  
ATOM   3268   H HB2  . TRP B 2 76  ? -66.584  3.332   -64.326  1.00 0.00 ? 76  TRP B HB2  1  
ATOM   3269   H HB3  . TRP B 2 76  ? -64.998  3.907   -64.828  1.00 0.00 ? 76  TRP B HB3  1  
ATOM   3270   H HD1  . TRP B 2 76  ? -63.772  0.888   -65.355  1.00 0.00 ? 76  TRP B HD1  1  
ATOM   3271   H HE1  . TRP B 2 76  ? -64.500  -0.346  -67.499  1.00 0.00 ? 76  TRP B HE1  1  
ATOM   3272   H HE3  . TRP B 2 76  ? -68.059  3.486   -66.381  1.00 0.00 ? 76  TRP B HE3  1  
ATOM   3273   H HZ2  . TRP B 2 76  ? -66.570  -0.243  -69.358  1.00 0.00 ? 76  TRP B HZ2  1  
ATOM   3274   H HZ3  . TRP B 2 76  ? -69.370  2.843   -68.374  1.00 0.00 ? 76  TRP B HZ3  1  
ATOM   3275   H HH2  . TRP B 2 76  ? -68.629  1.002   -69.837  1.00 0.00 ? 76  TRP B HH2  1  
ATOM   3276   N N    . ALA B 2 77  ? -65.078  4.017   -61.481  1.00 0.00 ? 77  ALA B N    1  
ATOM   3277   C CA   . ALA B 2 77  ? -64.563  4.683   -60.267  1.00 0.00 ? 77  ALA B CA   1  
ATOM   3278   C C    . ALA B 2 77  ? -65.600  5.641   -59.775  1.00 0.00 ? 77  ALA B C    1  
ATOM   3279   O O    . ALA B 2 77  ? -65.756  5.842   -58.556  1.00 0.00 ? 77  ALA B O    1  
ATOM   3280   C CB   . ALA B 2 77  ? -63.279  5.441   -60.527  1.00 0.00 ? 77  ALA B CB   1  
ATOM   3281   H H    . ALA B 2 77  ? -66.024  3.762   -61.477  1.00 0.00 ? 77  ALA B H    1  
ATOM   3282   H HA   . ALA B 2 77  ? -64.385  3.936   -59.505  1.00 0.00 ? 77  ALA B HA   1  
ATOM   3283   H HB1  . ALA B 2 77  ? -63.059  6.079   -59.683  1.00 0.00 ? 77  ALA B HB1  1  
ATOM   3284   H HB2  . ALA B 2 77  ? -63.392  6.046   -61.415  1.00 0.00 ? 77  ALA B HB2  1  
ATOM   3285   H HB3  . ALA B 2 77  ? -62.469  4.741   -60.669  1.00 0.00 ? 77  ALA B HB3  1  
ATOM   3286   N N    . SER B 2 78  ? -66.279  6.228   -60.772  1.00 0.00 ? 78  SER B N    1  
ATOM   3287   C CA   . SER B 2 78  ? -67.324  7.240   -60.621  1.00 0.00 ? 78  SER B CA   1  
ATOM   3288   C C    . SER B 2 78  ? -68.697  6.620   -60.769  1.00 0.00 ? 78  SER B C    1  
ATOM   3289   O O    . SER B 2 78  ? -69.548  6.807   -59.903  1.00 0.00 ? 78  SER B O    1  
ATOM   3290   C CB   . SER B 2 78  ? -67.166  8.331   -61.688  1.00 0.00 ? 78  SER B CB   1  
ATOM   3291   O OG   . SER B 2 78  ? -66.131  9.244   -61.360  1.00 0.00 ? 78  SER B OG   1  
ATOM   3292   H H    . SER B 2 78  ? -66.034  5.975   -61.687  1.00 0.00 ? 78  SER B H    1  
ATOM   3293   H HA   . SER B 2 78  ? -67.242  7.691   -59.644  1.00 0.00 ? 78  SER B HA   1  
ATOM   3294   H HB2  . SER B 2 78  ? -66.946  7.879   -62.638  1.00 0.00 ? 78  SER B HB2  1  
ATOM   3295   H HB3  . SER B 2 78  ? -68.104  8.866   -61.767  1.00 0.00 ? 78  SER B HB3  1  
ATOM   3296   H HG   . SER B 2 78  ? -65.309  8.902   -61.719  1.00 0.00 ? 78  SER B HG   1  
ATOM   3297   N N    . THR B 2 79  ? -68.887  5.863   -61.855  1.00 0.00 ? 79  THR B N    1  
ATOM   3298   C CA   . THR B 2 79  ? -70.221  5.417   -62.304  1.00 0.00 ? 79  THR B CA   1  
ATOM   3299   C C    . THR B 2 79  ? -70.915  4.390   -61.397  1.00 0.00 ? 79  THR B C    1  
ATOM   3300   O O    . THR B 2 79  ? -70.368  3.319   -61.115  1.00 0.00 ? 79  THR B O    1  
ATOM   3301   C CB   . THR B 2 79  ? -70.240  4.922   -63.796  1.00 0.00 ? 79  THR B CB   1  
ATOM   3302   O OG1  . THR B 2 79  ? -70.529  3.520   -63.858  1.00 0.00 ? 79  THR B OG1  1  
ATOM   3303   C CG2  . THR B 2 79  ? -68.932  5.241   -64.540  1.00 0.00 ? 79  THR B CG2  1  
ATOM   3304   H H    . THR B 2 79  ? -68.136  5.753   -62.474  1.00 0.00 ? 79  THR B H    1  
ATOM   3305   H HA   . THR B 2 79  ? -70.845  6.299   -62.276  1.00 0.00 ? 79  THR B HA   1  
ATOM   3306   H HB   . THR B 2 79  ? -71.044  5.442   -64.301  1.00 0.00 ? 79  THR B HB   1  
ATOM   3307   H HG1  . THR B 2 79  ? -70.152  3.105   -63.078  1.00 0.00 ? 79  THR B HG1  1  
ATOM   3308   H HG21 . THR B 2 79  ? -68.178  4.517   -64.269  1.00 0.00 ? 79  THR B HG21 1  
ATOM   3309   H HG22 . THR B 2 79  ? -68.595  6.230   -64.267  1.00 0.00 ? 79  THR B HG22 1  
ATOM   3310   H HG23 . THR B 2 79  ? -69.104  5.201   -65.606  1.00 0.00 ? 79  THR B HG23 1  
ATOM   3311   N N    . ARG B 2 80  ? -72.129  4.738   -60.966  1.00 0.00 ? 80  ARG B N    1  
ATOM   3312   C CA   . ARG B 2 80  ? -72.939  3.897   -60.095  1.00 0.00 ? 80  ARG B CA   1  
ATOM   3313   C C    . ARG B 2 80  ? -73.687  2.836   -60.883  1.00 0.00 ? 80  ARG B C    1  
ATOM   3314   O O    . ARG B 2 80  ? -73.821  2.929   -62.105  1.00 0.00 ? 80  ARG B O    1  
ATOM   3315   C CB   . ARG B 2 80  ? -73.924  4.744   -59.308  1.00 0.00 ? 80  ARG B CB   1  
ATOM   3316   C CG   . ARG B 2 80  ? -73.276  5.546   -58.221  1.00 0.00 ? 80  ARG B CG   1  
ATOM   3317   C CD   . ARG B 2 80  ? -74.280  6.439   -57.541  1.00 0.00 ? 80  ARG B CD   1  
ATOM   3318   N NE   . ARG B 2 80  ? -73.701  7.760   -57.321  1.00 0.00 ? 80  ARG B NE   1  
ATOM   3319   C CZ   . ARG B 2 80  ? -73.844  8.793   -58.147  1.00 0.00 ? 80  ARG B CZ   1  
ATOM   3320   N NH1  . ARG B 2 80  ? -74.573  8.679   -59.256  1.00 0.00 ? 80  ARG B NH1  1  
ATOM   3321   N NH2  . ARG B 2 80  ? -73.257  9.946   -57.861  1.00 0.00 ? 80  ARG B NH2  1  
ATOM   3322   H H    . ARG B 2 80  ? -72.493  5.604   -61.247  1.00 0.00 ? 80  ARG B H    1  
ATOM   3323   H HA   . ARG B 2 80  ? -72.283  3.401   -59.395  1.00 0.00 ? 80  ARG B HA   1  
ATOM   3324   H HB2  . ARG B 2 80  ? -74.419  5.421   -59.986  1.00 0.00 ? 80  ARG B HB2  1  
ATOM   3325   H HB3  . ARG B 2 80  ? -74.666  4.092   -58.867  1.00 0.00 ? 80  ARG B HB3  1  
ATOM   3326   H HG2  . ARG B 2 80  ? -72.846  4.875   -57.492  1.00 0.00 ? 80  ARG B HG2  1  
ATOM   3327   H HG3  . ARG B 2 80  ? -72.492  6.155   -58.648  1.00 0.00 ? 80  ARG B HG3  1  
ATOM   3328   H HD2  . ARG B 2 80  ? -75.157  6.533   -58.164  1.00 0.00 ? 80  ARG B HD2  1  
ATOM   3329   H HD3  . ARG B 2 80  ? -74.560  6.006   -56.592  1.00 0.00 ? 80  ARG B HD3  1  
ATOM   3330   H HE   . ARG B 2 80  ? -73.163  7.893   -56.512  1.00 0.00 ? 80  ARG B HE   1  
ATOM   3331   H HH11 . ARG B 2 80  ? -75.019  7.811   -59.474  1.00 0.00 ? 80  ARG B HH11 1  
ATOM   3332   H HH12 . ARG B 2 80  ? -74.674  9.461   -59.871  1.00 0.00 ? 80  ARG B HH12 1  
ATOM   3333   H HH21 . ARG B 2 80  ? -72.710  10.035  -57.028  1.00 0.00 ? 80  ARG B HH21 1  
ATOM   3334   H HH22 . ARG B 2 80  ? -73.360  10.727  -58.477  1.00 0.00 ? 80  ARG B HH22 1  
ATOM   3335   N N    . GLU B 2 81  ? -74.186  1.826   -60.178  1.00 0.00 ? 81  GLU B N    1  
ATOM   3336   C CA   . GLU B 2 81  ? -74.763  0.665   -60.847  1.00 0.00 ? 81  GLU B CA   1  
ATOM   3337   C C    . GLU B 2 81  ? -76.268  0.491   -60.583  1.00 0.00 ? 81  GLU B C    1  
ATOM   3338   O O    . GLU B 2 81  ? -76.766  0.835   -59.509  1.00 0.00 ? 81  GLU B O    1  
ATOM   3339   C CB   . GLU B 2 81  ? -73.967  -0.578  -60.469  1.00 0.00 ? 81  GLU B CB   1  
ATOM   3340   C CG   . GLU B 2 81  ? -73.971  -1.649  -61.524  1.00 0.00 ? 81  GLU B CG   1  
ATOM   3341   C CD   . GLU B 2 81  ? -74.890  -2.797  -61.166  1.00 0.00 ? 81  GLU B CD   1  
ATOM   3342   O OE1  . GLU B 2 81  ? -75.619  -2.698  -60.143  1.00 0.00 ? 81  GLU B OE1  1  
ATOM   3343   O OE2  . GLU B 2 81  ? -74.878  -3.805  -61.910  1.00 0.00 ? 81  GLU B OE2  1  
ATOM   3344   H H    . GLU B 2 81  ? -74.057  1.807   -59.207  1.00 0.00 ? 81  GLU B H    1  
ATOM   3345   H HA   . GLU B 2 81  ? -74.641  0.814   -61.910  1.00 0.00 ? 81  GLU B HA   1  
ATOM   3346   H HB2  . GLU B 2 81  ? -72.945  -0.289  -60.283  1.00 0.00 ? 81  GLU B HB2  1  
ATOM   3347   H HB3  . GLU B 2 81  ? -74.380  -0.986  -59.557  1.00 0.00 ? 81  GLU B HB3  1  
ATOM   3348   H HG2  . GLU B 2 81  ? -74.296  -1.219  -62.460  1.00 0.00 ? 81  GLU B HG2  1  
ATOM   3349   H HG3  . GLU B 2 81  ? -72.966  -2.028  -61.643  1.00 0.00 ? 81  GLU B HG3  1  
ATOM   3350   N N    . SER B 2 82  ? -76.976  -0.033  -61.588  1.00 0.00 ? 82  SER B N    1  
ATOM   3351   C CA   . SER B 2 82  ? -78.439  -0.205  -61.579  1.00 0.00 ? 82  SER B CA   1  
ATOM   3352   C C    . SER B 2 82  ? -79.050  -0.320  -60.186  1.00 0.00 ? 82  SER B C    1  
ATOM   3353   O O    . SER B 2 82  ? -78.981  -1.375  -59.548  1.00 0.00 ? 82  SER B O    1  
ATOM   3354   C CB   . SER B 2 82  ? -78.835  -1.426  -62.418  1.00 0.00 ? 82  SER B CB   1  
ATOM   3355   O OG   . SER B 2 82  ? -78.356  -1.311  -63.747  1.00 0.00 ? 82  SER B OG   1  
ATOM   3356   H H    . SER B 2 82  ? -76.495  -0.267  -62.409  1.00 0.00 ? 82  SER B H    1  
ATOM   3357   H HA   . SER B 2 82  ? -78.870  0.664   -62.051  1.00 0.00 ? 82  SER B HA   1  
ATOM   3358   H HB2  . SER B 2 82  ? -78.419  -2.314  -61.975  1.00 0.00 ? 82  SER B HB2  1  
ATOM   3359   H HB3  . SER B 2 82  ? -79.915  -1.511  -62.424  1.00 0.00 ? 82  SER B HB3  1  
ATOM   3360   H HG   . SER B 2 82  ? -77.691  -0.619  -63.764  1.00 0.00 ? 82  SER B HG   1  
ATOM   3361   N N    . GLY B 2 83  ? -79.641  0.773   -59.718  1.00 0.00 ? 83  GLY B N    1  
ATOM   3362   C CA   . GLY B 2 83  ? -80.276  0.797   -58.404  1.00 0.00 ? 83  GLY B CA   1  
ATOM   3363   C C    . GLY B 2 83  ? -79.329  1.120   -57.257  1.00 0.00 ? 83  GLY B C    1  
ATOM   3364   O O    . GLY B 2 83  ? -79.538  0.682   -56.122  1.00 0.00 ? 83  GLY B O    1  
ATOM   3365   H H    . GLY B 2 83  ? -79.658  1.581   -60.272  1.00 0.00 ? 83  GLY B H    1  
ATOM   3366   H HA2  . GLY B 2 83  ? -81.067  1.532   -58.414  1.00 0.00 ? 83  GLY B HA2  1  
ATOM   3367   H HA3  . GLY B 2 83  ? -80.714  -0.174  -58.222  1.00 0.00 ? 83  GLY B HA3  1  
ATOM   3368   N N    . VAL B 2 84  ? -78.273  1.871   -57.549  1.00 0.00 ? 84  VAL B N    1  
ATOM   3369   C CA   . VAL B 2 84  ? -77.461  2.455   -56.500  1.00 0.00 ? 84  VAL B CA   1  
ATOM   3370   C C    . VAL B 2 84  ? -78.034  3.834   -56.230  1.00 0.00 ? 84  VAL B C    1  
ATOM   3371   O O    . VAL B 2 84  ? -78.106  4.663   -57.137  1.00 0.00 ? 84  VAL B O    1  
ATOM   3372   C CB   . VAL B 2 84  ? -75.975  2.572   -56.900  1.00 0.00 ? 84  VAL B CB   1  
ATOM   3373   C CG1  . VAL B 2 84  ? -75.214  3.479   -55.922  1.00 0.00 ? 84  VAL B CG1  1  
ATOM   3374   C CG2  . VAL B 2 84  ? -75.341  1.206   -56.936  1.00 0.00 ? 84  VAL B CG2  1  
ATOM   3375   H H    . VAL B 2 84  ? -78.149  2.177   -58.472  1.00 0.00 ? 84  VAL B H    1  
ATOM   3376   H HA   . VAL B 2 84  ? -77.548  1.853   -55.607  1.00 0.00 ? 84  VAL B HA   1  
ATOM   3377   H HB   . VAL B 2 84  ? -75.920  3.010   -57.887  1.00 0.00 ? 84  VAL B HB   1  
ATOM   3378   H HG11 . VAL B 2 84  ? -75.267  4.502   -56.265  1.00 0.00 ? 84  VAL B HG11 1  
ATOM   3379   H HG12 . VAL B 2 84  ? -74.181  3.169   -55.872  1.00 0.00 ? 84  VAL B HG12 1  
ATOM   3380   H HG13 . VAL B 2 84  ? -75.660  3.405   -54.941  1.00 0.00 ? 84  VAL B HG13 1  
ATOM   3381   H HG21 . VAL B 2 84  ? -76.099  0.453   -56.785  1.00 0.00 ? 84  VAL B HG21 1  
ATOM   3382   H HG22 . VAL B 2 84  ? -74.599  1.133   -56.154  1.00 0.00 ? 84  VAL B HG22 1  
ATOM   3383   H HG23 . VAL B 2 84  ? -74.869  1.053   -57.895  1.00 0.00 ? 84  VAL B HG23 1  
ATOM   3384   N N    . PRO B 2 85  ? -78.465  4.077   -54.987  1.00 0.00 ? 85  PRO B N    1  
ATOM   3385   C CA   . PRO B 2 85  ? -78.887  5.422   -54.586  1.00 0.00 ? 85  PRO B CA   1  
ATOM   3386   C C    . PRO B 2 85  ? -77.740  6.439   -54.662  1.00 0.00 ? 85  PRO B C    1  
ATOM   3387   O O    . PRO B 2 85  ? -76.627  6.177   -54.179  1.00 0.00 ? 85  PRO B O    1  
ATOM   3388   C CB   . PRO B 2 85  ? -79.358  5.234   -53.138  1.00 0.00 ? 85  PRO B CB   1  
ATOM   3389   C CG   . PRO B 2 85  ? -79.647  3.762   -53.010  1.00 0.00 ? 85  PRO B CG   1  
ATOM   3390   C CD   . PRO B 2 85  ? -78.651  3.087   -53.912  1.00 0.00 ? 85  PRO B CD   1  
ATOM   3391   H HA   . PRO B 2 85  ? -79.716  5.749   -55.191  1.00 0.00 ? 85  PRO B HA   1  
ATOM   3392   H HB2  . PRO B 2 85  ? -78.576  5.528   -52.450  1.00 0.00 ? 85  PRO B HB2  1  
ATOM   3393   H HB3  . PRO B 2 85  ? -80.255  5.804   -52.956  1.00 0.00 ? 85  PRO B HB3  1  
ATOM   3394   H HG2  . PRO B 2 85  ? -79.511  3.442   -51.986  1.00 0.00 ? 85  PRO B HG2  1  
ATOM   3395   H HG3  . PRO B 2 85  ? -80.650  3.546   -53.343  1.00 0.00 ? 85  PRO B HG3  1  
ATOM   3396   H HD2  . PRO B 2 85  ? -77.722  2.907   -53.386  1.00 0.00 ? 85  PRO B HD2  1  
ATOM   3397   H HD3  . PRO B 2 85  ? -79.053  2.170   -54.313  1.00 0.00 ? 85  PRO B HD3  1  
ATOM   3398   N N    . ASP B 2 86  ? -78.037  7.586   -55.279  1.00 0.00 ? 86  ASP B N    1  
ATOM   3399   C CA   . ASP B 2 86  ? -77.076  8.675   -55.552  1.00 0.00 ? 86  ASP B CA   1  
ATOM   3400   C C    . ASP B 2 86  ? -76.080  8.884   -54.415  1.00 0.00 ? 86  ASP B C    1  
ATOM   3401   O O    . ASP B 2 86  ? -74.956  9.340   -54.642  1.00 0.00 ? 86  ASP B O    1  
ATOM   3402   C CB   . ASP B 2 86  ? -77.819  9.998   -55.833  1.00 0.00 ? 86  ASP B CB   1  
ATOM   3403   C CG   . ASP B 2 86  ? -79.056  9.816   -56.734  1.00 0.00 ? 86  ASP B CG   1  
ATOM   3404   O OD1  . ASP B 2 86  ? -79.902  8.918   -56.465  1.00 0.00 ? 86  ASP B OD1  1  
ATOM   3405   O OD2  . ASP B 2 86  ? -79.184  10.589  -57.716  1.00 0.00 ? 86  ASP B OD2  1  
ATOM   3406   H H    . ASP B 2 86  ? -78.948  7.689   -55.626  1.00 0.00 ? 86  ASP B H    1  
ATOM   3407   H HA   . ASP B 2 86  ? -76.519  8.413   -56.439  1.00 0.00 ? 86  ASP B HA   1  
ATOM   3408   H HB2  . ASP B 2 86  ? -78.137  10.423  -54.893  1.00 0.00 ? 86  ASP B HB2  1  
ATOM   3409   H HB3  . ASP B 2 86  ? -77.136  10.685  -56.311  1.00 0.00 ? 86  ASP B HB3  1  
ATOM   3410   N N    . ARG B 2 87  ? -76.516  8.521   -53.204  1.00 0.00 ? 87  ARG B N    1  
ATOM   3411   C CA   . ARG B 2 87  ? -75.805  8.788   -51.954  1.00 0.00 ? 87  ARG B CA   1  
ATOM   3412   C C    . ARG B 2 87  ? -74.414  8.162   -51.871  1.00 0.00 ? 87  ARG B C    1  
ATOM   3413   O O    . ARG B 2 87  ? -73.484  8.758   -51.307  1.00 0.00 ? 87  ARG B O    1  
ATOM   3414   C CB   . ARG B 2 87  ? -76.655  8.363   -50.758  1.00 0.00 ? 87  ARG B CB   1  
ATOM   3415   C CG   . ARG B 2 87  ? -77.149  6.944   -50.822  1.00 0.00 ? 87  ARG B CG   1  
ATOM   3416   C CD   . ARG B 2 87  ? -78.462  6.786   -50.062  1.00 0.00 ? 87  ARG B CD   1  
ATOM   3417   N NE   . ARG B 2 87  ? -78.709  5.385   -49.745  1.00 0.00 ? 87  ARG B NE   1  
ATOM   3418   C CZ   . ARG B 2 87  ? -78.142  4.748   -48.726  1.00 0.00 ? 87  ARG B CZ   1  
ATOM   3419   N NH1  . ARG B 2 87  ? -77.304  5.380   -47.912  1.00 0.00 ? 87  ARG B NH1  1  
ATOM   3420   N NH2  . ARG B 2 87  ? -78.408  3.468   -48.522  1.00 0.00 ? 87  ARG B NH2  1  
ATOM   3421   H H    . ARG B 2 87  ? -77.422  8.153   -53.140  1.00 0.00 ? 87  ARG B H    1  
ATOM   3422   H HA   . ARG B 2 87  ? -75.675  9.858   -51.886  1.00 0.00 ? 87  ARG B HA   1  
ATOM   3423   H HB2  . ARG B 2 87  ? -76.066  8.476   -49.862  1.00 0.00 ? 87  ARG B HB2  1  
ATOM   3424   H HB3  . ARG B 2 87  ? -77.507  9.025   -50.693  1.00 0.00 ? 87  ARG B HB3  1  
ATOM   3425   H HG2  . ARG B 2 87  ? -77.301  6.667   -51.855  1.00 0.00 ? 87  ARG B HG2  1  
ATOM   3426   H HG3  . ARG B 2 87  ? -76.407  6.291   -50.386  1.00 0.00 ? 87  ARG B HG3  1  
ATOM   3427   H HD2  . ARG B 2 87  ? -78.411  7.351   -49.144  1.00 0.00 ? 87  ARG B HD2  1  
ATOM   3428   H HD3  . ARG B 2 87  ? -79.272  7.166   -50.668  1.00 0.00 ? 87  ARG B HD3  1  
ATOM   3429   H HE   . ARG B 2 87  ? -79.324  4.883   -50.320  1.00 0.00 ? 87  ARG B HE   1  
ATOM   3430   H HH11 . ARG B 2 87  ? -77.095  6.347   -48.062  1.00 0.00 ? 87  ARG B HH11 1  
ATOM   3431   H HH12 . ARG B 2 87  ? -76.883  4.890   -47.148  1.00 0.00 ? 87  ARG B HH12 1  
ATOM   3432   H HH21 . ARG B 2 87  ? -79.035  2.984   -49.133  1.00 0.00 ? 87  ARG B HH21 1  
ATOM   3433   H HH22 . ARG B 2 87  ? -77.983  2.985   -47.757  1.00 0.00 ? 87  ARG B HH22 1  
ATOM   3434   N N    . PHE B 2 88  ? -74.267  6.959   -52.419  1.00 0.00 ? 88  PHE B N    1  
ATOM   3435   C CA   . PHE B 2 88  ? -72.940  6.377   -52.563  1.00 0.00 ? 88  PHE B CA   1  
ATOM   3436   C C    . PHE B 2 88  ? -72.337  7.119   -53.725  1.00 0.00 ? 88  PHE B C    1  
ATOM   3437   O O    . PHE B 2 88  ? -72.962  7.196   -54.788  1.00 0.00 ? 88  PHE B O    1  
ATOM   3438   C CB   . PHE B 2 88  ? -73.021  4.876   -52.860  1.00 0.00 ? 88  PHE B CB   1  
ATOM   3439   C CG   . PHE B 2 88  ? -73.901  4.129   -51.910  1.00 0.00 ? 88  PHE B CG   1  
ATOM   3440   C CD1  . PHE B 2 88  ? -73.445  3.794   -50.645  1.00 0.00 ? 88  PHE B CD1  1  
ATOM   3441   C CD2  . PHE B 2 88  ? -75.194  3.790   -52.270  1.00 0.00 ? 88  PHE B CD2  1  
ATOM   3442   C CE1  . PHE B 2 88  ? -74.248  3.122   -49.757  1.00 0.00 ? 88  PHE B CE1  1  
ATOM   3443   C CE2  . PHE B 2 88  ? -76.009  3.118   -51.389  1.00 0.00 ? 88  PHE B CE2  1  
ATOM   3444   C CZ   . PHE B 2 88  ? -75.531  2.783   -50.124  1.00 0.00 ? 88  PHE B CZ   1  
ATOM   3445   H H    . PHE B 2 88  ? -75.035  6.524   -52.846  1.00 0.00 ? 88  PHE B H    1  
ATOM   3446   H HA   . PHE B 2 88  ? -72.359  6.554   -51.669  1.00 0.00 ? 88  PHE B HA   1  
ATOM   3447   H HB2  . PHE B 2 88  ? -73.404  4.741   -53.859  1.00 0.00 ? 88  PHE B HB2  1  
ATOM   3448   H HB3  . PHE B 2 88  ? -72.024  4.462   -52.814  1.00 0.00 ? 88  PHE B HB3  1  
ATOM   3449   H HD1  . PHE B 2 88  ? -72.439  4.060   -50.355  1.00 0.00 ? 88  PHE B HD1  1  
ATOM   3450   H HD2  . PHE B 2 88  ? -75.562  4.044   -53.253  1.00 0.00 ? 88  PHE B HD2  1  
ATOM   3451   H HE1  . PHE B 2 88  ? -73.877  2.863   -48.776  1.00 0.00 ? 88  PHE B HE1  1  
ATOM   3452   H HE2  . PHE B 2 88  ? -77.017  2.856   -51.675  1.00 0.00 ? 88  PHE B HE2  1  
ATOM   3453   H HZ   . PHE B 2 88  ? -76.168  2.255   -49.429  1.00 0.00 ? 88  PHE B HZ   1  
ATOM   3454   N N    . THR B 2 89  ? -71.161  7.707   -53.520  1.00 0.00 ? 89  THR B N    1  
ATOM   3455   C CA   . THR B 2 89  ? -70.456  8.382   -54.616  1.00 0.00 ? 89  THR B CA   1  
ATOM   3456   C C    . THR B 2 89  ? -69.021  7.903   -54.713  1.00 0.00 ? 89  THR B C    1  
ATOM   3457   O O    . THR B 2 89  ? -68.375  7.612   -53.697  1.00 0.00 ? 89  THR B O    1  
ATOM   3458   C CB   . THR B 2 89  ? -70.459  9.922   -54.479  1.00 0.00 ? 89  THR B CB   1  
ATOM   3459   O OG1  . THR B 2 89  ? -71.363  10.325  -53.435  1.00 0.00 ? 89  THR B OG1  1  
ATOM   3460   C CG2  . THR B 2 89  ? -70.848  10.580  -55.818  1.00 0.00 ? 89  THR B CG2  1  
ATOM   3461   H H    . THR B 2 89  ? -70.735  7.640   -52.640  1.00 0.00 ? 89  THR B H    1  
ATOM   3462   H HA   . THR B 2 89  ? -70.956  8.126   -55.539  1.00 0.00 ? 89  THR B HA   1  
ATOM   3463   H HB   . THR B 2 89  ? -69.463  10.245  -54.214  1.00 0.00 ? 89  THR B HB   1  
ATOM   3464   H HG1  . THR B 2 89  ? -70.909  10.962  -52.879  1.00 0.00 ? 89  THR B HG1  1  
ATOM   3465   H HG21 . THR B 2 89  ? -71.916  10.739  -55.843  1.00 0.00 ? 89  THR B HG21 1  
ATOM   3466   H HG22 . THR B 2 89  ? -70.561  9.934   -56.634  1.00 0.00 ? 89  THR B HG22 1  
ATOM   3467   H HG23 . THR B 2 89  ? -70.340  11.528  -55.914  1.00 0.00 ? 89  THR B HG23 1  
ATOM   3468   N N    . GLY B 2 90  ? -68.525  7.813   -55.941  1.00 0.00 ? 90  GLY B N    1  
ATOM   3469   C CA   . GLY B 2 90  ? -67.160  7.359   -56.172  1.00 0.00 ? 90  GLY B CA   1  
ATOM   3470   C C    . GLY B 2 90  ? -66.339  8.473   -56.757  1.00 0.00 ? 90  GLY B C    1  
ATOM   3471   O O    . GLY B 2 90  ? -66.594  8.911   -57.875  1.00 0.00 ? 90  GLY B O    1  
ATOM   3472   H H    . GLY B 2 90  ? -69.089  8.051   -56.706  1.00 0.00 ? 90  GLY B H    1  
ATOM   3473   H HA2  . GLY B 2 90  ? -66.724  7.046   -55.233  1.00 0.00 ? 90  GLY B HA2  1  
ATOM   3474   H HA3  . GLY B 2 90  ? -67.170  6.526   -56.858  1.00 0.00 ? 90  GLY B HA3  1  
ATOM   3475   N N    . SER B 2 91  ? -65.388  8.967   -55.981  1.00 0.00 ? 91  SER B N    1  
ATOM   3476   C CA   . SER B 2 91  ? -64.424  9.908   -56.495  1.00 0.00 ? 91  SER B CA   1  
ATOM   3477   C C    . SER B 2 91  ? -63.129  9.143   -56.558  1.00 0.00 ? 91  SER B C    1  
ATOM   3478   O O    . SER B 2 91  ? -63.095  7.964   -56.195  1.00 0.00 ? 91  SER B O    1  
ATOM   3479   C CB   . SER B 2 91  ? -64.290  11.105  -55.563  1.00 0.00 ? 91  SER B CB   1  
ATOM   3480   O OG   . SER B 2 91  ? -63.868  10.709  -54.266  1.00 0.00 ? 91  SER B OG   1  
ATOM   3481   H H    . SER B 2 91  ? -65.263  8.597   -55.082  1.00 0.00 ? 91  SER B H    1  
ATOM   3482   H HA   . SER B 2 91  ? -64.712  10.233  -57.485  1.00 0.00 ? 91  SER B HA   1  
ATOM   3483   H HB2  . SER B 2 91  ? -63.564  11.790  -55.967  1.00 0.00 ? 91  SER B HB2  1  
ATOM   3484   H HB3  . SER B 2 91  ? -65.246  11.608  -55.499  1.00 0.00 ? 91  SER B HB3  1  
ATOM   3485   H HG   . SER B 2 91  ? -62.989  11.065  -54.118  1.00 0.00 ? 91  SER B HG   1  
ATOM   3486   N N    . GLY B 2 92  ? -62.068  9.799   -57.010  1.00 0.00 ? 92  GLY B N    1  
ATOM   3487   C CA   . GLY B 2 92  ? -60.744  9.196   -57.006  1.00 0.00 ? 92  GLY B CA   1  
ATOM   3488   C C    . GLY B 2 92  ? -60.207  9.099   -58.409  1.00 0.00 ? 92  GLY B C    1  
ATOM   3489   O O    . GLY B 2 92  ? -60.958  9.192   -59.371  1.00 0.00 ? 92  GLY B O    1  
ATOM   3490   H H    . GLY B 2 92  ? -62.165  10.736  -57.282  1.00 0.00 ? 92  GLY B H    1  
ATOM   3491   H HA2  . GLY B 2 92  ? -60.079  9.803   -56.409  1.00 0.00 ? 92  GLY B HA2  1  
ATOM   3492   H HA3  . GLY B 2 92  ? -60.804  8.206   -56.580  1.00 0.00 ? 92  GLY B HA3  1  
ATOM   3493   N N    . SER B 2 93  ? -58.903  8.897   -58.525  1.00 0.00 ? 93  SER B N    1  
ATOM   3494   C CA   . SER B 2 93  ? -58.240  8.924   -59.813  1.00 0.00 ? 93  SER B CA   1  
ATOM   3495   C C    . SER B 2 93  ? -56.742  8.772   -59.653  1.00 0.00 ? 93  SER B C    1  
ATOM   3496   O O    . SER B 2 93  ? -56.127  9.424   -58.819  1.00 0.00 ? 93  SER B O    1  
ATOM   3497   C CB   . SER B 2 93  ? -58.533  10.242  -60.530  1.00 0.00 ? 93  SER B CB   1  
ATOM   3498   O OG   . SER B 2 93  ? -58.198  10.158  -61.906  1.00 0.00 ? 93  SER B OG   1  
ATOM   3499   H H    . SER B 2 93  ? -58.360  8.821   -57.713  1.00 0.00 ? 93  SER B H    1  
ATOM   3500   H HA   . SER B 2 93  ? -58.613  8.111   -60.417  1.00 0.00 ? 93  SER B HA   1  
ATOM   3501   H HB2  . SER B 2 93  ? -59.580  10.472  -60.441  1.00 0.00 ? 93  SER B HB2  1  
ATOM   3502   H HB3  . SER B 2 93  ? -57.959  11.032  -60.062  1.00 0.00 ? 93  SER B HB3  1  
ATOM   3503   H HG   . SER B 2 93  ? -57.380  10.640  -62.042  1.00 0.00 ? 93  SER B HG   1  
ATOM   3504   N N    . GLY B 2 94  ? -56.150  7.928   -60.484  1.00 0.00 ? 94  GLY B N    1  
ATOM   3505   C CA   . GLY B 2 94  ? -54.761  7.554   -60.307  1.00 0.00 ? 94  GLY B CA   1  
ATOM   3506   C C    . GLY B 2 94  ? -54.684  6.446   -59.275  1.00 0.00 ? 94  GLY B C    1  
ATOM   3507   O O    . GLY B 2 94  ? -55.231  5.357   -59.490  1.00 0.00 ? 94  GLY B O    1  
ATOM   3508   H H    . GLY B 2 94  ? -56.691  7.453   -61.148  1.00 0.00 ? 94  GLY B H    1  
ATOM   3509   H HA2  . GLY B 2 94  ? -54.357  7.208   -61.248  1.00 0.00 ? 94  GLY B HA2  1  
ATOM   3510   H HA3  . GLY B 2 94  ? -54.197  8.405   -59.959  1.00 0.00 ? 94  GLY B HA3  1  
ATOM   3511   N N    . THR B 2 95  ? -54.019  6.721   -58.154  1.00 0.00 ? 95  THR B N    1  
ATOM   3512   C CA   . THR B 2 95  ? -53.818  5.709   -57.121  1.00 0.00 ? 95  THR B CA   1  
ATOM   3513   C C    . THR B 2 95  ? -54.715  5.963   -55.904  1.00 0.00 ? 95  THR B C    1  
ATOM   3514   O O    . THR B 2 95  ? -54.510  5.371   -54.859  1.00 0.00 ? 95  THR B O    1  
ATOM   3515   C CB   . THR B 2 95  ? -52.316  5.624   -56.686  1.00 0.00 ? 95  THR B CB   1  
ATOM   3516   O OG1  . THR B 2 95  ? -51.906  6.864   -56.120  1.00 0.00 ? 95  THR B OG1  1  
ATOM   3517   C CG2  . THR B 2 95  ? -51.403  5.335   -57.856  1.00 0.00 ? 95  THR B CG2  1  
ATOM   3518   H H    . THR B 2 95  ? -53.616  7.607   -58.041  1.00 0.00 ? 95  THR B H    1  
ATOM   3519   H HA   . THR B 2 95  ? -54.091  4.797   -57.547  1.00 0.00 ? 95  THR B HA   1  
ATOM   3520   H HB   . THR B 2 95  ? -52.204  4.843   -55.948  1.00 0.00 ? 95  THR B HB   1  
ATOM   3521   H HG1  . THR B 2 95  ? -51.125  6.703   -55.586  1.00 0.00 ? 95  THR B HG1  1  
ATOM   3522   H HG21 . THR B 2 95  ? -51.666  5.975   -58.685  1.00 0.00 ? 95  THR B HG21 1  
ATOM   3523   H HG22 . THR B 2 95  ? -51.511  4.301   -58.150  1.00 0.00 ? 95  THR B HG22 1  
ATOM   3524   H HG23 . THR B 2 95  ? -50.379  5.523   -57.568  1.00 0.00 ? 95  THR B HG23 1  
ATOM   3525   N N    . ASP B 2 96  ? -55.730  6.813   -56.054  1.00 0.00 ? 96  ASP B N    1  
ATOM   3526   C CA   . ASP B 2 96  ? -56.369  7.466   -54.897  1.00 0.00 ? 96  ASP B CA   1  
ATOM   3527   C C    . ASP B 2 96  ? -57.870  7.564   -54.917  1.00 0.00 ? 96  ASP B C    1  
ATOM   3528   O O    . ASP B 2 96  ? -58.436  8.597   -55.282  1.00 0.00 ? 96  ASP B O    1  
ATOM   3529   C CB   . ASP B 2 96  ? -55.843  8.889   -54.750  1.00 0.00 ? 96  ASP B CB   1  
ATOM   3530   C CG   . ASP B 2 96  ? -54.932  9.037   -53.580  1.00 0.00 ? 96  ASP B CG   1  
ATOM   3531   O OD1  . ASP B 2 96  ? -54.028  8.184   -53.440  1.00 0.00 ? 96  ASP B OD1  1  
ATOM   3532   O OD2  . ASP B 2 96  ? -55.125  10.007  -52.806  1.00 0.00 ? 96  ASP B OD2  1  
ATOM   3533   H H    . ASP B 2 96  ? -55.856  7.224   -56.935  1.00 0.00 ? 96  ASP B H    1  
ATOM   3534   H HA   . ASP B 2 96  ? -56.081  6.926   -54.011  1.00 0.00 ? 96  ASP B HA   1  
ATOM   3535   H HB2  . ASP B 2 96  ? -55.304  9.157   -55.646  1.00 0.00 ? 96  ASP B HB2  1  
ATOM   3536   H HB3  . ASP B 2 96  ? -56.681  9.560   -54.633  1.00 0.00 ? 96  ASP B HB3  1  
ATOM   3537   N N    . PHE B 2 97  ? -58.528  6.518   -54.462  1.00 0.00 ? 97  PHE B N    1  
ATOM   3538   C CA   . PHE B 2 97  ? -59.971  6.503   -54.559  1.00 0.00 ? 97  PHE B CA   1  
ATOM   3539   C C    . PHE B 2 97  ? -60.638  6.648   -53.208  1.00 0.00 ? 97  PHE B C    1  
ATOM   3540   O O    . PHE B 2 97  ? -60.053  6.315   -52.164  1.00 0.00 ? 97  PHE B O    1  
ATOM   3541   C CB   . PHE B 2 97  ? -60.419  5.263   -55.326  1.00 0.00 ? 97  PHE B CB   1  
ATOM   3542   C CG   . PHE B 2 97  ? -59.723  5.122   -56.632  1.00 0.00 ? 97  PHE B CG   1  
ATOM   3543   C CD1  . PHE B 2 97  ? -58.377  4.785   -56.678  1.00 0.00 ? 97  PHE B CD1  1  
ATOM   3544   C CD2  . PHE B 2 97  ? -60.383  5.383   -57.810  1.00 0.00 ? 97  PHE B CD2  1  
ATOM   3545   C CE1  . PHE B 2 97  ? -57.716  4.678   -57.873  1.00 0.00 ? 97  PHE B CE1  1  
ATOM   3546   C CE2  . PHE B 2 97  ? -59.725  5.277   -59.012  1.00 0.00 ? 97  PHE B CE2  1  
ATOM   3547   C CZ   . PHE B 2 97  ? -58.388  4.917   -59.043  1.00 0.00 ? 97  PHE B CZ   1  
ATOM   3548   H H    . PHE B 2 97  ? -58.044  5.732   -54.133  1.00 0.00 ? 97  PHE B H    1  
ATOM   3549   H HA   . PHE B 2 97  ? -60.258  7.363   -55.146  1.00 0.00 ? 97  PHE B HA   1  
ATOM   3550   H HB2  . PHE B 2 97  ? -60.222  4.387   -54.728  1.00 0.00 ? 97  PHE B HB2  1  
ATOM   3551   H HB3  . PHE B 2 97  ? -61.484  5.332   -55.501  1.00 0.00 ? 97  PHE B HB3  1  
ATOM   3552   H HD1  . PHE B 2 97  ? -57.849  4.578   -55.758  1.00 0.00 ? 97  PHE B HD1  1  
ATOM   3553   H HD2  . PHE B 2 97  ? -61.426  5.664   -57.791  1.00 0.00 ? 97  PHE B HD2  1  
ATOM   3554   H HE1  . PHE B 2 97  ? -56.669  4.415   -57.892  1.00 0.00 ? 97  PHE B HE1  1  
ATOM   3555   H HE2  . PHE B 2 97  ? -60.254  5.465   -59.934  1.00 0.00 ? 97  PHE B HE2  1  
ATOM   3556   H HZ   . PHE B 2 97  ? -57.873  4.834   -59.988  1.00 0.00 ? 97  PHE B HZ   1  
ATOM   3557   N N    . THR B 2 98  ? -61.856  7.184   -53.246  1.00 0.00 ? 98  THR B N    1  
ATOM   3558   C CA   . THR B 2 98  ? -62.633  7.477   -52.049  1.00 0.00 ? 98  THR B CA   1  
ATOM   3559   C C    . THR B 2 98  ? -64.118  7.169   -52.290  1.00 0.00 ? 98  THR B C    1  
ATOM   3560   O O    . THR B 2 98  ? -64.701  7.562   -53.312  1.00 0.00 ? 98  THR B O    1  
ATOM   3561   C CB   . THR B 2 98  ? -62.436  8.958   -51.606  1.00 0.00 ? 98  THR B CB   1  
ATOM   3562   O OG1  . THR B 2 98  ? -61.096  9.160   -51.115  1.00 0.00 ? 98  THR B OG1  1  
ATOM   3563   C CG2  . THR B 2 98  ? -63.423  9.317   -50.518  1.00 0.00 ? 98  THR B CG2  1  
ATOM   3564   H H    . THR B 2 98  ? -62.226  7.439   -54.117  1.00 0.00 ? 98  THR B H    1  
ATOM   3565   H HA   . THR B 2 98  ? -62.281  6.835   -51.254  1.00 0.00 ? 98  THR B HA   1  
ATOM   3566   H HB   . THR B 2 98  ? -62.599  9.603   -52.456  1.00 0.00 ? 98  THR B HB   1  
ATOM   3567   H HG1  . THR B 2 98  ? -60.760  9.974   -51.498  1.00 0.00 ? 98  THR B HG1  1  
ATOM   3568   H HG21 . THR B 2 98  ? -62.887  9.616   -49.630  1.00 0.00 ? 98  THR B HG21 1  
ATOM   3569   H HG22 . THR B 2 98  ? -64.041  8.460   -50.296  1.00 0.00 ? 98  THR B HG22 1  
ATOM   3570   H HG23 . THR B 2 98  ? -64.046  10.133  -50.853  1.00 0.00 ? 98  THR B HG23 1  
ATOM   3571   N N    . LEU B 2 99  ? -64.717  6.437   -51.359  1.00 0.00 ? 99  LEU B N    1  
ATOM   3572   C CA   . LEU B 2 99  ? -66.148  6.167   -51.431  1.00 0.00 ? 99  LEU B CA   1  
ATOM   3573   C C    . LEU B 2 99  ? -66.842  6.980   -50.384  1.00 0.00 ? 99  LEU B C    1  
ATOM   3574   O O    . LEU B 2 99  ? -66.366  7.061   -49.251  1.00 0.00 ? 99  LEU B O    1  
ATOM   3575   C CB   . LEU B 2 99  ? -66.469  4.693   -51.197  1.00 0.00 ? 99  LEU B CB   1  
ATOM   3576   C CG   . LEU B 2 99  ? -67.966  4.365   -51.158  1.00 0.00 ? 99  LEU B CG   1  
ATOM   3577   C CD1  . LEU B 2 99  ? -68.572  4.310   -52.553  1.00 0.00 ? 99  LEU B CD1  1  
ATOM   3578   C CD2  . LEU B 2 99  ? -68.175  3.058   -50.452  1.00 0.00 ? 99  LEU B CD2  1  
ATOM   3579   H H    . LEU B 2 99  ? -64.205  6.132   -50.580  1.00 0.00 ? 99  LEU B H    1  
ATOM   3580   H HA   . LEU B 2 99  ? -66.514  6.458   -52.405  1.00 0.00 ? 99  LEU B HA   1  
ATOM   3581   H HB2  . LEU B 2 99  ? -66.016  4.114   -51.986  1.00 0.00 ? 99  LEU B HB2  1  
ATOM   3582   H HB3  . LEU B 2 99  ? -66.025  4.394   -50.257  1.00 0.00 ? 99  LEU B HB3  1  
ATOM   3583   H HG   . LEU B 2 99  ? -68.469  5.142   -50.599  1.00 0.00 ? 99  LEU B HG   1  
ATOM   3584   H HD11 . LEU B 2 99  ? -68.533  5.292   -53.002  1.00 0.00 ? 99  LEU B HD11 1  
ATOM   3585   H HD12 . LEU B 2 99  ? -69.600  3.986   -52.486  1.00 0.00 ? 99  LEU B HD12 1  
ATOM   3586   H HD13 . LEU B 2 99  ? -68.014  3.614   -53.161  1.00 0.00 ? 99  LEU B HD13 1  
ATOM   3587   H HD21 . LEU B 2 99  ? -67.421  2.353   -50.769  1.00 0.00 ? 99  LEU B HD21 1  
ATOM   3588   H HD22 . LEU B 2 99  ? -69.154  2.671   -50.693  1.00 0.00 ? 99  LEU B HD22 1  
ATOM   3589   H HD23 . LEU B 2 99  ? -68.100  3.208   -49.385  1.00 0.00 ? 99  LEU B HD23 1  
ATOM   3590   N N    . THR B 2 100 ? -67.980  7.553   -50.765  1.00 0.00 ? 100 THR B N    1  
ATOM   3591   C CA   . THR B 2 100 ? -68.702  8.511   -49.929  1.00 0.00 ? 100 THR B CA   1  
ATOM   3592   C C    . THR B 2 100 ? -70.224  8.240   -49.879  1.00 0.00 ? 100 THR B C    1  
ATOM   3593   O O    . THR B 2 100 ? -70.916  8.257   -50.907  1.00 0.00 ? 100 THR B O    1  
ATOM   3594   C CB   . THR B 2 100 ? -68.319  10.001  -50.293  1.00 0.00 ? 100 THR B CB   1  
ATOM   3595   O OG1  . THR B 2 100 ? -69.413  10.881  -50.028  1.00 0.00 ? 100 THR B OG1  1  
ATOM   3596   C CG2  . THR B 2 100 ? -67.898  10.152  -51.746  1.00 0.00 ? 100 THR B CG2  1  
ATOM   3597   H H    . THR B 2 100 ? -68.290  7.410   -51.684  1.00 0.00 ? 100 THR B H    1  
ATOM   3598   H HA   . THR B 2 100 ? -68.344  8.345   -48.920  1.00 0.00 ? 100 THR B HA   1  
ATOM   3599   H HB   . THR B 2 100 ? -67.490  10.297  -49.666  1.00 0.00 ? 100 THR B HB   1  
ATOM   3600   H HG1  . THR B 2 100 ? -69.061  11.768  -49.920  1.00 0.00 ? 100 THR B HG1  1  
ATOM   3601   H HG21 . THR B 2 100 ? -66.821  10.173  -51.809  1.00 0.00 ? 100 THR B HG21 1  
ATOM   3602   H HG22 . THR B 2 100 ? -68.301  11.073  -52.143  1.00 0.00 ? 100 THR B HG22 1  
ATOM   3603   H HG23 . THR B 2 100 ? -68.276  9.318   -52.318  1.00 0.00 ? 100 THR B HG23 1  
ATOM   3604   N N    . ILE B 2 101 ? -70.723  7.961   -48.677  1.00 0.00 ? 101 ILE B N    1  
ATOM   3605   C CA   . ILE B 2 101 ? -72.119  7.587   -48.490  1.00 0.00 ? 101 ILE B CA   1  
ATOM   3606   C C    . ILE B 2 101 ? -72.795  8.630   -47.645  1.00 0.00 ? 101 ILE B C    1  
ATOM   3607   O O    . ILE B 2 101 ? -72.575  8.680   -46.430  1.00 0.00 ? 101 ILE B O    1  
ATOM   3608   C CB   . ILE B 2 101 ? -72.270  6.248   -47.729  1.00 0.00 ? 101 ILE B CB   1  
ATOM   3609   C CG1  . ILE B 2 101 ? -71.483  5.118   -48.404  1.00 0.00 ? 101 ILE B CG1  1  
ATOM   3610   C CG2  . ILE B 2 101 ? -73.753  5.879   -47.576  1.00 0.00 ? 101 ILE B CG2  1  
ATOM   3611   C CD1  . ILE B 2 101 ? -71.416  3.830   -47.587  1.00 0.00 ? 101 ILE B CD1  1  
ATOM   3612   H H    . ILE B 2 101 ? -70.119  7.943   -47.905  1.00 0.00 ? 101 ILE B H    1  
ATOM   3613   H HA   . ILE B 2 101 ? -72.611  7.516   -49.447  1.00 0.00 ? 101 ILE B HA   1  
ATOM   3614   H HB   . ILE B 2 101 ? -71.867  6.392   -46.735  1.00 0.00 ? 101 ILE B HB   1  
ATOM   3615   H HG12 . ILE B 2 101 ? -71.946  4.895   -49.352  1.00 0.00 ? 101 ILE B HG12 1  
ATOM   3616   H HG13 . ILE B 2 101 ? -70.476  5.465   -48.588  1.00 0.00 ? 101 ILE B HG13 1  
ATOM   3617   H HG21 . ILE B 2 101 ? -73.888  4.831   -47.798  1.00 0.00 ? 101 ILE B HG21 1  
ATOM   3618   H HG22 . ILE B 2 101 ? -74.343  6.471   -48.260  1.00 0.00 ? 101 ILE B HG22 1  
ATOM   3619   H HG23 . ILE B 2 101 ? -74.070  6.077   -46.563  1.00 0.00 ? 101 ILE B HG23 1  
ATOM   3620   H HD11 . ILE B 2 101 ? -72.406  3.407   -47.499  1.00 0.00 ? 101 ILE B HD11 1  
ATOM   3621   H HD12 . ILE B 2 101 ? -71.029  4.048   -46.603  1.00 0.00 ? 101 ILE B HD12 1  
ATOM   3622   H HD13 . ILE B 2 101 ? -70.765  3.124   -48.082  1.00 0.00 ? 101 ILE B HD13 1  
ATOM   3623   N N    . SER B 2 102 ? -73.628  9.452   -48.278  1.00 0.00 ? 102 SER B N    1  
ATOM   3624   C CA   . SER B 2 102 ? -74.425  10.448  -47.548  1.00 0.00 ? 102 SER B CA   1  
ATOM   3625   C C    . SER B 2 102 ? -75.767  9.862   -47.108  1.00 0.00 ? 102 SER B C    1  
ATOM   3626   O O    . SER B 2 102 ? -76.334  8.991   -47.792  1.00 0.00 ? 102 SER B O    1  
ATOM   3627   C CB   . SER B 2 102 ? -74.643  11.720  -48.380  1.00 0.00 ? 102 SER B CB   1  
ATOM   3628   O OG   . SER B 2 102 ? -75.471  11.470  -49.503  1.00 0.00 ? 102 SER B OG   1  
ATOM   3629   H H    . SER B 2 102 ? -73.762  9.347   -49.243  1.00 0.00 ? 102 SER B H    1  
ATOM   3630   H HA   . SER B 2 102 ? -73.877  10.721  -46.658  1.00 0.00 ? 102 SER B HA   1  
ATOM   3631   H HB2  . SER B 2 102 ? -75.111  12.469  -47.767  1.00 0.00 ? 102 SER B HB2  1  
ATOM   3632   H HB3  . SER B 2 102 ? -73.680  12.090  -48.711  1.00 0.00 ? 102 SER B HB3  1  
ATOM   3633   H HG   . SER B 2 102 ? -75.904  12.293  -49.741  1.00 0.00 ? 102 SER B HG   1  
ATOM   3634   N N    . SER B 2 103 ? -76.257  10.340  -45.960  1.00 0.00 ? 103 SER B N    1  
ATOM   3635   C CA   . SER B 2 103 ? -77.567  9.949   -45.418  1.00 0.00 ? 103 SER B CA   1  
ATOM   3636   C C    . SER B 2 103 ? -77.621  8.460   -45.085  1.00 0.00 ? 103 SER B C    1  
ATOM   3637   O O    . SER B 2 103 ? -78.512  7.738   -45.555  1.00 0.00 ? 103 SER B O    1  
ATOM   3638   C CB   . SER B 2 103 ? -78.702  10.341  -46.384  1.00 0.00 ? 103 SER B CB   1  
ATOM   3639   O OG   . SER B 2 103 ? -78.640  11.724  -46.695  1.00 0.00 ? 103 SER B OG   1  
ATOM   3640   H H    . SER B 2 103 ? -75.740  11.020  -45.481  1.00 0.00 ? 103 SER B H    1  
ATOM   3641   H HA   . SER B 2 103 ? -77.715  10.495  -44.497  1.00 0.00 ? 103 SER B HA   1  
ATOM   3642   H HB2  . SER B 2 103 ? -78.603  9.777   -47.295  1.00 0.00 ? 103 SER B HB2  1  
ATOM   3643   H HB3  . SER B 2 103 ? -79.655  10.107  -45.927  1.00 0.00 ? 103 SER B HB3  1  
ATOM   3644   H HG   . SER B 2 103 ? -78.491  12.206  -45.878  1.00 0.00 ? 103 SER B HG   1  
ATOM   3645   N N    . VAL B 2 104 ? -76.660  8.022   -44.272  1.00 0.00 ? 104 VAL B N    1  
ATOM   3646   C CA   . VAL B 2 104 ? -76.503  6.619   -43.893  1.00 0.00 ? 104 VAL B CA   1  
ATOM   3647   C C    . VAL B 2 104 ? -77.768  5.995   -43.309  1.00 0.00 ? 104 VAL B C    1  
ATOM   3648   O O    . VAL B 2 104 ? -78.088  6.190   -42.129  1.00 0.00 ? 104 VAL B O    1  
ATOM   3649   C CB   . VAL B 2 104 ? -75.394  6.439   -42.846  1.00 0.00 ? 104 VAL B CB   1  
ATOM   3650   C CG1  . VAL B 2 104 ? -75.098  4.939   -42.625  1.00 0.00 ? 104 VAL B CG1  1  
ATOM   3651   C CG2  . VAL B 2 104 ? -74.150  7.209   -43.255  1.00 0.00 ? 104 VAL B CG2  1  
ATOM   3652   H H    . VAL B 2 104 ? -75.997  8.667   -43.947  1.00 0.00 ? 104 VAL B H    1  
ATOM   3653   H HA   . VAL B 2 104 ? -76.223  6.060   -44.772  1.00 0.00 ? 104 VAL B HA   1  
ATOM   3654   H HB   . VAL B 2 104 ? -75.756  6.845   -41.910  1.00 0.00 ? 104 VAL B HB   1  
ATOM   3655   H HG11 . VAL B 2 104 ? -74.420  4.825   -41.792  1.00 0.00 ? 104 VAL B HG11 1  
ATOM   3656   H HG12 . VAL B 2 104 ? -74.646  4.526   -43.515  1.00 0.00 ? 104 VAL B HG12 1  
ATOM   3657   H HG13 . VAL B 2 104 ? -76.020  4.417   -42.414  1.00 0.00 ? 104 VAL B HG13 1  
ATOM   3658   H HG21 . VAL B 2 104 ? -74.344  7.746   -44.172  1.00 0.00 ? 104 VAL B HG21 1  
ATOM   3659   H HG22 . VAL B 2 104 ? -73.334  6.518   -43.409  1.00 0.00 ? 104 VAL B HG22 1  
ATOM   3660   H HG23 . VAL B 2 104 ? -73.888  7.909   -42.476  1.00 0.00 ? 104 VAL B HG23 1  
ATOM   3661   N N    . GLN B 2 105 ? -78.481  5.232   -44.130  1.00 0.00 ? 105 GLN B N    1  
ATOM   3662   C CA   . GLN B 2 105 ? -79.572  4.455   -43.599  1.00 0.00 ? 105 GLN B CA   1  
ATOM   3663   C C    . GLN B 2 105 ? -79.066  3.301   -42.753  1.00 0.00 ? 105 GLN B C    1  
ATOM   3664   O O    . GLN B 2 105 ? -77.862  3.048   -42.674  1.00 0.00 ? 105 GLN B O    1  
ATOM   3665   C CB   . GLN B 2 105 ? -80.550  4.012   -44.683  1.00 0.00 ? 105 GLN B CB   1  
ATOM   3666   C CG   . GLN B 2 105 ? -81.820  4.880   -44.701  1.00 0.00 ? 105 GLN B CG   1  
ATOM   3667   C CD   . GLN B 2 105 ? -82.409  5.169   -43.280  1.00 0.00 ? 105 GLN B CD   1  
ATOM   3668   O OE1  . GLN B 2 105 ? -82.720  6.324   -42.945  1.00 0.00 ? 105 GLN B OE1  1  
ATOM   3669   N NE2  . GLN B 2 105 ? -82.564  4.113   -42.460  1.00 0.00 ? 105 GLN B NE2  1  
ATOM   3670   H H    . GLN B 2 105 ? -78.186  5.095   -45.054  1.00 0.00 ? 105 GLN B H    1  
ATOM   3671   H HA   . GLN B 2 105 ? -80.117  5.109   -42.931  1.00 0.00 ? 105 GLN B HA   1  
ATOM   3672   H HB2  . GLN B 2 105 ? -80.066  4.065   -45.646  1.00 0.00 ? 105 GLN B HB2  1  
ATOM   3673   H HB3  . GLN B 2 105 ? -80.834  2.987   -44.490  1.00 0.00 ? 105 GLN B HB3  1  
ATOM   3674   H HG2  . GLN B 2 105 ? -81.586  5.822   -45.173  1.00 0.00 ? 105 GLN B HG2  1  
ATOM   3675   H HG3  . GLN B 2 105 ? -82.572  4.377   -45.292  1.00 0.00 ? 105 GLN B HG3  1  
ATOM   3676   H HE21 . GLN B 2 105 ? -82.312  3.216   -42.762  1.00 0.00 ? 105 GLN B HE21 1  
ATOM   3677   H HE22 . GLN B 2 105 ? -82.930  4.242   -41.559  1.00 0.00 ? 105 GLN B HE22 1  
ATOM   3678   N N    . ALA B 2 106 ? -80.000  2.640   -42.082  1.00 0.00 ? 106 ALA B N    1  
ATOM   3679   C CA   . ALA B 2 106 ? -79.682  1.584   -41.132  1.00 0.00 ? 106 ALA B CA   1  
ATOM   3680   C C    . ALA B 2 106 ? -79.209  0.340   -41.876  1.00 0.00 ? 106 ALA B C    1  
ATOM   3681   O O    . ALA B 2 106 ? -78.337  -0.398  -41.391  1.00 0.00 ? 106 ALA B O    1  
ATOM   3682   C CB   . ALA B 2 106 ? -80.907  1.272   -40.269  1.00 0.00 ? 106 ALA B CB   1  
ATOM   3683   H H    . ALA B 2 106 ? -80.933  2.926   -42.171  1.00 0.00 ? 106 ALA B H    1  
ATOM   3684   H HA   . ALA B 2 106 ? -78.884  1.927   -40.489  1.00 0.00 ? 106 ALA B HA   1  
ATOM   3685   H HB1  . ALA B 2 106 ? -81.790  1.685   -40.734  1.00 0.00 ? 106 ALA B HB1  1  
ATOM   3686   H HB2  . ALA B 2 106 ? -80.779  1.710   -39.290  1.00 0.00 ? 106 ALA B HB2  1  
ATOM   3687   H HB3  . ALA B 2 106 ? -81.018  0.202   -40.174  1.00 0.00 ? 106 ALA B HB3  1  
ATOM   3688   N N    . GLU B 2 107 ? -79.793  0.140   -43.060  1.00 0.00 ? 107 GLU B N    1  
ATOM   3689   C CA   . GLU B 2 107 ? -79.473  -0.965  -43.953  1.00 0.00 ? 107 GLU B CA   1  
ATOM   3690   C C    . GLU B 2 107 ? -78.272  -0.574  -44.804  1.00 0.00 ? 107 GLU B C    1  
ATOM   3691   O O    . GLU B 2 107 ? -78.294  -0.673  -46.034  1.00 0.00 ? 107 GLU B O    1  
ATOM   3692   C CB   . GLU B 2 107 ? -80.686  -1.323  -44.831  1.00 0.00 ? 107 GLU B CB   1  
ATOM   3693   C CG   . GLU B 2 107 ? -81.830  -2.082  -44.102  1.00 0.00 ? 107 GLU B CG   1  
ATOM   3694   C CD   . GLU B 2 107 ? -82.622  -1.222  -43.071  1.00 0.00 ? 107 GLU B CD   1  
ATOM   3695   O OE1  . GLU B 2 107 ? -82.521  0.040   -43.118  1.00 0.00 ? 107 GLU B OE1  1  
ATOM   3696   O OE2  . GLU B 2 107 ? -83.349  -1.814  -42.219  1.00 0.00 ? 107 GLU B OE2  1  
ATOM   3697   H H    . GLU B 2 107 ? -80.465  0.789   -43.356  1.00 0.00 ? 107 GLU B H    1  
ATOM   3698   H HA   . GLU B 2 107 ? -79.208  -1.827  -43.356  1.00 0.00 ? 107 GLU B HA   1  
ATOM   3699   H HB2  . GLU B 2 107 ? -81.094  -0.409  -45.234  1.00 0.00 ? 107 GLU B HB2  1  
ATOM   3700   H HB3  . GLU B 2 107 ? -80.340  -1.932  -45.654  1.00 0.00 ? 107 GLU B HB3  1  
ATOM   3701   H HG2  . GLU B 2 107 ? -82.524  -2.445  -44.843  1.00 0.00 ? 107 GLU B HG2  1  
ATOM   3702   H HG3  . GLU B 2 107 ? -81.402  -2.931  -43.588  1.00 0.00 ? 107 GLU B HG3  1  
ATOM   3703   N N    . ASP B 2 108 ? -77.230  -0.104  -44.123  1.00 0.00 ? 108 ASP B N    1  
ATOM   3704   C CA   . ASP B 2 108 ? -75.960  0.228   -44.739  1.00 0.00 ? 108 ASP B CA   1  
ATOM   3705   C C    . ASP B 2 108 ? -74.860  -0.316  -43.855  1.00 0.00 ? 108 ASP B C    1  
ATOM   3706   O O    . ASP B 2 108 ? -73.714  0.102   -43.937  1.00 0.00 ? 108 ASP B O    1  
ATOM   3707   C CB   . ASP B 2 108 ? -75.821  1.743   -44.913  1.00 0.00 ? 108 ASP B CB   1  
ATOM   3708   C CG   . ASP B 2 108 ? -76.716  2.298   -46.020  1.00 0.00 ? 108 ASP B CG   1  
ATOM   3709   O OD1  . ASP B 2 108 ? -76.782  1.700   -47.120  1.00 0.00 ? 108 ASP B OD1  1  
ATOM   3710   O OD2  . ASP B 2 108 ? -77.351  3.351   -45.795  1.00 0.00 ? 108 ASP B OD2  1  
ATOM   3711   H H    . ASP B 2 108 ? -77.304  -0.041  -43.148  1.00 0.00 ? 108 ASP B H    1  
ATOM   3712   H HA   . ASP B 2 108 ? -75.902  -0.248  -45.708  1.00 0.00 ? 108 ASP B HA   1  
ATOM   3713   H HB2  . ASP B 2 108 ? -76.081  2.225   -43.983  1.00 0.00 ? 108 ASP B HB2  1  
ATOM   3714   H HB3  . ASP B 2 108 ? -74.791  1.972   -45.146  1.00 0.00 ? 108 ASP B HB3  1  
ATOM   3715   N N    . LEU B 2 109 ? -75.219  -1.258  -42.995  1.00 0.00 ? 109 LEU B N    1  
ATOM   3716   C CA   . LEU B 2 109 ? -74.219  -1.955  -42.207  1.00 0.00 ? 109 LEU B CA   1  
ATOM   3717   C C    . LEU B 2 109 ? -73.473  -2.923  -43.117  1.00 0.00 ? 109 LEU B C    1  
ATOM   3718   O O    . LEU B 2 109 ? -74.068  -3.875  -43.647  1.00 0.00 ? 109 LEU B O    1  
ATOM   3719   C CB   . LEU B 2 109 ? -74.853  -2.701  -41.032  1.00 0.00 ? 109 LEU B CB   1  
ATOM   3720   C CG   . LEU B 2 109 ? -74.047  -2.343  -39.780  1.00 0.00 ? 109 LEU B CG   1  
ATOM   3721   C CD1  . LEU B 2 109 ? -74.887  -2.551  -38.538  1.00 0.00 ? 109 LEU B CD1  1  
ATOM   3722   C CD2  . LEU B 2 109 ? -72.675  -3.050  -39.679  1.00 0.00 ? 109 LEU B CD2  1  
ATOM   3723   H H    . LEU B 2 109 ? -76.152  -1.556  -42.966  1.00 0.00 ? 109 LEU B H    1  
ATOM   3724   H HA   . LEU B 2 109 ? -73.515  -1.230  -41.823  1.00 0.00 ? 109 LEU B HA   1  
ATOM   3725   H HB2  . LEU B 2 109 ? -75.882  -2.390  -40.913  1.00 0.00 ? 109 LEU B HB2  1  
ATOM   3726   H HB3  . LEU B 2 109 ? -74.806  -3.765  -41.202  1.00 0.00 ? 109 LEU B HB3  1  
ATOM   3727   H HG   . LEU B 2 109 ? -73.853  -1.278  -39.840  1.00 0.00 ? 109 LEU B HG   1  
ATOM   3728   H HD11 . LEU B 2 109 ? -74.368  -2.150  -37.680  1.00 0.00 ? 109 LEU B HD11 1  
ATOM   3729   H HD12 . LEU B 2 109 ? -75.060  -3.607  -38.393  1.00 0.00 ? 109 LEU B HD12 1  
ATOM   3730   H HD13 . LEU B 2 109 ? -75.833  -2.044  -38.654  1.00 0.00 ? 109 LEU B HD13 1  
ATOM   3731   H HD21 . LEU B 2 109 ? -72.338  -3.325  -40.668  1.00 0.00 ? 109 LEU B HD21 1  
ATOM   3732   H HD22 . LEU B 2 109 ? -72.771  -3.939  -39.073  1.00 0.00 ? 109 LEU B HD22 1  
ATOM   3733   H HD23 . LEU B 2 109 ? -71.957  -2.382  -39.226  1.00 0.00 ? 109 LEU B HD23 1  
ATOM   3734   N N    . ALA B 2 110 ? -72.183  -2.681  -43.315  1.00 0.00 ? 110 ALA B N    1  
ATOM   3735   C CA   . ALA B 2 110 ? -71.451  -3.475  -44.281  1.00 0.00 ? 110 ALA B CA   1  
ATOM   3736   C C    . ALA B 2 110 ? -69.951  -3.306  -44.194  1.00 0.00 ? 110 ALA B C    1  
ATOM   3737   O O    . ALA B 2 110 ? -69.447  -2.379  -43.562  1.00 0.00 ? 110 ALA B O    1  
ATOM   3738   C CB   . ALA B 2 110 ? -71.922  -3.124  -45.687  1.00 0.00 ? 110 ALA B CB   1  
ATOM   3739   H H    . ALA B 2 110 ? -71.755  -1.910  -42.886  1.00 0.00 ? 110 ALA B H    1  
ATOM   3740   H HA   . ALA B 2 110 ? -71.683  -4.514  -44.106  1.00 0.00 ? 110 ALA B HA   1  
ATOM   3741   H HB1  . ALA B 2 110 ? -71.351  -2.287  -46.060  1.00 0.00 ? 110 ALA B HB1  1  
ATOM   3742   H HB2  . ALA B 2 110 ? -72.970  -2.862  -45.661  1.00 0.00 ? 110 ALA B HB2  1  
ATOM   3743   H HB3  . ALA B 2 110 ? -71.780  -3.975  -46.338  1.00 0.00 ? 110 ALA B HB3  1  
ATOM   3744   N N    . VAL B 2 111 ? -69.232  -4.214  -44.835  1.00 0.00 ? 111 VAL B N    1  
ATOM   3745   C CA   . VAL B 2 111 ? -67.865  -3.933  -45.196  1.00 0.00 ? 111 VAL B CA   1  
ATOM   3746   C C    . VAL B 2 111 ? -67.843  -3.567  -46.688  1.00 0.00 ? 111 VAL B C    1  
ATOM   3747   O O    . VAL B 2 111 ? -68.554  -4.162  -47.506  1.00 0.00 ? 111 VAL B O    1  
ATOM   3748   C CB   . VAL B 2 111 ? -66.908  -5.058  -44.775  1.00 0.00 ? 111 VAL B CB   1  
ATOM   3749   C CG1  . VAL B 2 111 ? -65.477  -4.778  -45.217  1.00 0.00 ? 111 VAL B CG1  1  
ATOM   3750   C CG2  . VAL B 2 111 ? -66.937  -5.172  -43.281  1.00 0.00 ? 111 VAL B CG2  1  
ATOM   3751   H H    . VAL B 2 111 ? -69.701  -4.930  -45.312  1.00 0.00 ? 111 VAL B H    1  
ATOM   3752   H HA   . VAL B 2 111 ? -67.577  -3.039  -44.653  1.00 0.00 ? 111 VAL B HA   1  
ATOM   3753   H HB   . VAL B 2 111 ? -67.240  -5.990  -45.209  1.00 0.00 ? 111 VAL B HB   1  
ATOM   3754   H HG11 . VAL B 2 111 ? -64.954  -5.712  -45.359  1.00 0.00 ? 111 VAL B HG11 1  
ATOM   3755   H HG12 . VAL B 2 111 ? -64.974  -4.195  -44.460  1.00 0.00 ? 111 VAL B HG12 1  
ATOM   3756   H HG13 . VAL B 2 111 ? -65.489  -4.228  -46.146  1.00 0.00 ? 111 VAL B HG13 1  
ATOM   3757   H HG21 . VAL B 2 111 ? -66.245  -4.463  -42.852  1.00 0.00 ? 111 VAL B HG21 1  
ATOM   3758   H HG22 . VAL B 2 111 ? -66.655  -6.173  -42.990  1.00 0.00 ? 111 VAL B HG22 1  
ATOM   3759   H HG23 . VAL B 2 111 ? -67.934  -4.960  -42.923  1.00 0.00 ? 111 VAL B HG23 1  
ATOM   3760   N N    . TYR B 2 112 ? -67.060  -2.533  -46.997  1.00 0.00 ? 112 TYR B N    1  
ATOM   3761   C CA   . TYR B 2 112 ? -66.960  -1.942  -48.325  1.00 0.00 ? 112 TYR B CA   1  
ATOM   3762   C C    . TYR B 2 112 ? -65.578  -2.235  -48.890  1.00 0.00 ? 112 TYR B C    1  
ATOM   3763   O O    . TYR B 2 112 ? -64.553  -1.889  -48.306  1.00 0.00 ? 112 TYR B O    1  
ATOM   3764   C CB   . TYR B 2 112 ? -67.263  -0.439  -48.239  1.00 0.00 ? 112 TYR B CB   1  
ATOM   3765   C CG   . TYR B 2 112 ? -68.717  -0.178  -47.880  1.00 0.00 ? 112 TYR B CG   1  
ATOM   3766   C CD1  . TYR B 2 112 ? -69.687  -0.129  -48.876  1.00 0.00 ? 112 TYR B CD1  1  
ATOM   3767   C CD2  . TYR B 2 112 ? -69.127  -0.026  -46.549  1.00 0.00 ? 112 TYR B CD2  1  
ATOM   3768   C CE1  . TYR B 2 112 ? -71.016  0.079   -48.577  1.00 0.00 ? 112 TYR B CE1  1  
ATOM   3769   C CE2  . TYR B 2 112 ? -70.474  0.181   -46.235  1.00 0.00 ? 112 TYR B CE2  1  
ATOM   3770   C CZ   . TYR B 2 112 ? -71.414  0.231   -47.266  1.00 0.00 ? 112 TYR B CZ   1  
ATOM   3771   O OH   . TYR B 2 112 ? -72.758  0.433   -47.028  1.00 0.00 ? 112 TYR B OH   1  
ATOM   3772   H H    . TYR B 2 112 ? -66.569  -2.100  -46.268  1.00 0.00 ? 112 TYR B H    1  
ATOM   3773   H HA   . TYR B 2 112 ? -67.697  -2.408  -48.964  1.00 0.00 ? 112 TYR B HA   1  
ATOM   3774   H HB2  . TYR B 2 112 ? -66.629  0.008   -47.488  1.00 0.00 ? 112 TYR B HB2  1  
ATOM   3775   H HB3  . TYR B 2 112 ? -67.049  0.017   -49.196  1.00 0.00 ? 112 TYR B HB3  1  
ATOM   3776   H HD1  . TYR B 2 112 ? -69.391  -0.246  -49.908  1.00 0.00 ? 112 TYR B HD1  1  
ATOM   3777   H HD2  . TYR B 2 112 ? -68.393  -0.061  -45.757  1.00 0.00 ? 112 TYR B HD2  1  
ATOM   3778   H HE1  . TYR B 2 112 ? -71.747  0.119   -49.371  1.00 0.00 ? 112 TYR B HE1  1  
ATOM   3779   H HE2  . TYR B 2 112 ? -70.784  0.298   -45.207  1.00 0.00 ? 112 TYR B HE2  1  
ATOM   3780   H HH   . TYR B 2 112 ? -72.865  0.651   -46.099  1.00 0.00 ? 112 TYR B HH   1  
ATOM   3781   N N    . TYR B 2 113 ? -65.563  -2.939  -50.009  1.00 0.00 ? 113 TYR B N    1  
ATOM   3782   C CA   . TYR B 2 113 ? -64.334  -3.483  -50.557  1.00 0.00 ? 113 TYR B CA   1  
ATOM   3783   C C    . TYR B 2 113 ? -64.064  -2.760  -51.853  1.00 0.00 ? 113 TYR B C    1  
ATOM   3784   O O    . TYR B 2 113 ? -64.995  -2.523  -52.640  1.00 0.00 ? 113 TYR B O    1  
ATOM   3785   C CB   . TYR B 2 113 ? -64.485  -4.988  -50.837  1.00 0.00 ? 113 TYR B CB   1  
ATOM   3786   C CG   . TYR B 2 113 ? -64.458  -5.844  -49.598  1.00 0.00 ? 113 TYR B CG   1  
ATOM   3787   C CD1  . TYR B 2 113 ? -63.260  -6.174  -49.001  1.00 0.00 ? 113 TYR B CD1  1  
ATOM   3788   C CD2  . TYR B 2 113 ? -65.634  -6.318  -49.028  1.00 0.00 ? 113 TYR B CD2  1  
ATOM   3789   C CE1  . TYR B 2 113 ? -63.226  -6.949  -47.881  1.00 0.00 ? 113 TYR B CE1  1  
ATOM   3790   C CE2  . TYR B 2 113 ? -65.618  -7.087  -47.891  1.00 0.00 ? 113 TYR B CE2  1  
ATOM   3791   C CZ   . TYR B 2 113 ? -64.408  -7.397  -47.319  1.00 0.00 ? 113 TYR B CZ   1  
ATOM   3792   O OH   . TYR B 2 113 ? -64.346  -8.159  -46.170  1.00 0.00 ? 113 TYR B OH   1  
ATOM   3793   H H    . TYR B 2 113 ? -66.417  -3.221  -50.399  1.00 0.00 ? 113 TYR B H    1  
ATOM   3794   H HA   . TYR B 2 113 ? -63.519  -3.318  -49.868  1.00 0.00 ? 113 TYR B HA   1  
ATOM   3795   H HB2  . TYR B 2 113 ? -65.423  -5.151  -51.343  1.00 0.00 ? 113 TYR B HB2  1  
ATOM   3796   H HB3  . TYR B 2 113 ? -63.683  -5.297  -51.493  1.00 0.00 ? 113 TYR B HB3  1  
ATOM   3797   H HD1  . TYR B 2 113 ? -62.334  -5.827  -49.437  1.00 0.00 ? 113 TYR B HD1  1  
ATOM   3798   H HD2  . TYR B 2 113 ? -66.580  -6.068  -49.484  1.00 0.00 ? 113 TYR B HD2  1  
ATOM   3799   H HE1  . TYR B 2 113 ? -62.280  -7.198  -47.423  1.00 0.00 ? 113 TYR B HE1  1  
ATOM   3800   H HE2  . TYR B 2 113 ? -66.540  -7.448  -47.458  1.00 0.00 ? 113 TYR B HE2  1  
ATOM   3801   H HH   . TYR B 2 113 ? -64.131  -7.576  -45.438  1.00 0.00 ? 113 TYR B HH   1  
ATOM   3802   N N    . CYS B 2 114 ? -62.814  -2.377  -52.081  1.00 0.00 ? 114 CYS B N    1  
ATOM   3803   C CA   . CYS B 2 114 ? -62.486  -1.842  -53.378  1.00 0.00 ? 114 CYS B CA   1  
ATOM   3804   C C    . CYS B 2 114 ? -61.753  -2.925  -54.124  1.00 0.00 ? 114 CYS B C    1  
ATOM   3805   O O    . CYS B 2 114 ? -61.069  -3.739  -53.506  1.00 0.00 ? 114 CYS B O    1  
ATOM   3806   C CB   . CYS B 2 114 ? -61.703  -0.537  -53.277  1.00 0.00 ? 114 CYS B CB   1  
ATOM   3807   S SG   . CYS B 2 114 ? -60.048  -0.626  -52.602  1.00 0.00 ? 114 CYS B SG   1  
ATOM   3808   H H    . CYS B 2 114 ? -62.108  -2.564  -51.427  1.00 0.00 ? 114 CYS B H    1  
ATOM   3809   H HA   . CYS B 2 114 ? -63.413  -1.647  -53.901  1.00 0.00 ? 114 CYS B HA   1  
ATOM   3810   H HB2  . CYS B 2 114 ? -61.625  -0.119  -54.267  1.00 0.00 ? 114 CYS B HB2  1  
ATOM   3811   H HB3  . CYS B 2 114 ? -62.283  0.150   -52.674  1.00 0.00 ? 114 CYS B HB3  1  
ATOM   3812   N N    . LYS B 2 115 ? -61.954  -2.971  -55.440  1.00 0.00 ? 115 LYS B N    1  
ATOM   3813   C CA   . LYS B 2 115 ? -61.286  -3.949  -56.305  1.00 0.00 ? 115 LYS B CA   1  
ATOM   3814   C C    . LYS B 2 115 ? -60.618  -3.216  -57.443  1.00 0.00 ? 115 LYS B C    1  
ATOM   3815   O O    . LYS B 2 115 ? -61.205  -2.296  -58.040  1.00 0.00 ? 115 LYS B O    1  
ATOM   3816   C CB   . LYS B 2 115 ? -62.278  -4.899  -56.955  1.00 0.00 ? 115 LYS B CB   1  
ATOM   3817   C CG   . LYS B 2 115 ? -62.487  -4.569  -58.472  1.00 0.00 ? 115 LYS B CG   1  
ATOM   3818   C CD   . LYS B 2 115 ? -63.381  -5.529  -59.264  1.00 0.00 ? 115 LYS B CD   1  
ATOM   3819   C CE   . LYS B 2 115 ? -63.350  -6.896  -58.654  1.00 0.00 ? 115 LYS B CE   1  
ATOM   3820   N NZ   . LYS B 2 115 ? -62.170  -6.995  -57.719  1.00 0.00 ? 115 LYS B NZ   1  
ATOM   3821   H H    . LYS B 2 115 ? -62.555  -2.313  -55.848  1.00 0.00 ? 115 LYS B H    1  
ATOM   3822   H HA   . LYS B 2 115 ? -60.555  -4.509  -55.742  1.00 0.00 ? 115 LYS B HA   1  
ATOM   3823   H HB2  . LYS B 2 115 ? -61.911  -5.911  -56.861  1.00 0.00 ? 115 LYS B HB2  1  
ATOM   3824   H HB3  . LYS B 2 115 ? -63.227  -4.820  -56.445  1.00 0.00 ? 115 LYS B HB3  1  
ATOM   3825   H HG2  . LYS B 2 115 ? -62.919  -3.585  -58.544  1.00 0.00 ? 115 LYS B HG2  1  
ATOM   3826   H HG3  . LYS B 2 115 ? -61.513  -4.541  -58.944  1.00 0.00 ? 115 LYS B HG3  1  
ATOM   3827   H HD2  . LYS B 2 115 ? -64.390  -5.159  -59.332  1.00 0.00 ? 115 LYS B HD2  1  
ATOM   3828   H HD3  . LYS B 2 115 ? -62.966  -5.603  -60.259  1.00 0.00 ? 115 LYS B HD3  1  
ATOM   3829   H HE2  . LYS B 2 115 ? -64.264  -7.067  -58.104  1.00 0.00 ? 115 LYS B HE2  1  
ATOM   3830   H HE3  . LYS B 2 115 ? -63.253  -7.637  -59.433  1.00 0.00 ? 115 LYS B HE3  1  
ATOM   3831   H HZ1  . LYS B 2 115 ? -62.205  -6.215  -57.032  1.00 0.00 ? 115 LYS B HZ1  1  
ATOM   3832   H HZ2  . LYS B 2 115 ? -61.288  -6.934  -58.268  1.00 0.00 ? 115 LYS B HZ2  1  
ATOM   3833   H HZ3  . LYS B 2 115 ? -62.203  -7.902  -57.213  1.00 0.00 ? 115 LYS B HZ3  1  
ATOM   3834   N N    . GLN B 2 116 ? -59.411  -3.639  -57.782  1.00 0.00 ? 116 GLN B N    1  
ATOM   3835   C CA   . GLN B 2 116 ? -58.819  -3.154  -59.008  1.00 0.00 ? 116 GLN B CA   1  
ATOM   3836   C C    . GLN B 2 116 ? -59.062  -4.191  -60.077  1.00 0.00 ? 116 GLN B C    1  
ATOM   3837   O O    . GLN B 2 116 ? -59.032  -5.401  -59.799  1.00 0.00 ? 116 GLN B O    1  
ATOM   3838   C CB   . GLN B 2 116 ? -57.332  -2.908  -58.836  1.00 0.00 ? 116 GLN B CB   1  
ATOM   3839   C CG   . GLN B 2 116 ? -56.551  -4.133  -58.469  1.00 0.00 ? 116 GLN B CG   1  
ATOM   3840   C CD   . GLN B 2 116 ? -56.055  -4.871  -59.679  1.00 0.00 ? 116 GLN B CD   1  
ATOM   3841   O OE1  . GLN B 2 116 ? -55.602  -6.001  -59.575  1.00 0.00 ? 116 GLN B OE1  1  
ATOM   3842   N NE2  . GLN B 2 116 ? -56.136  -4.236  -60.837  1.00 0.00 ? 116 GLN B NE2  1  
ATOM   3843   H H    . GLN B 2 116 ? -59.000  -4.388  -57.301  1.00 0.00 ? 116 GLN B H    1  
ATOM   3844   H HA   . GLN B 2 116 ? -59.303  -2.231  -59.294  1.00 0.00 ? 116 GLN B HA   1  
ATOM   3845   H HB2  . GLN B 2 116 ? -56.938  -2.518  -59.761  1.00 0.00 ? 116 GLN B HB2  1  
ATOM   3846   H HB3  . GLN B 2 116 ? -57.196  -2.163  -58.064  1.00 0.00 ? 116 GLN B HB3  1  
ATOM   3847   H HG2  . GLN B 2 116 ? -55.704  -3.840  -57.868  1.00 0.00 ? 116 GLN B HG2  1  
ATOM   3848   H HG3  . GLN B 2 116 ? -57.182  -4.790  -57.889  1.00 0.00 ? 116 GLN B HG3  1  
ATOM   3849   H HE21 . GLN B 2 116 ? -56.505  -3.329  -60.874  1.00 0.00 ? 116 GLN B HE21 1  
ATOM   3850   H HE22 . GLN B 2 116 ? -55.827  -4.672  -61.658  1.00 0.00 ? 116 GLN B HE22 1  
ATOM   3851   N N    . SER B 2 117 ? -59.310  -3.719  -61.295  1.00 0.00 ? 117 SER B N    1  
ATOM   3852   C CA   . SER B 2 117 ? -59.423  -4.605  -62.442  1.00 0.00 ? 117 SER B CA   1  
ATOM   3853   C C    . SER B 2 117 ? -58.549  -4.112  -63.597  1.00 0.00 ? 117 SER B C    1  
ATOM   3854   O O    . SER B 2 117 ? -58.847  -4.347  -64.757  1.00 0.00 ? 117 SER B O    1  
ATOM   3855   C CB   . SER B 2 117 ? -60.887  -4.777  -62.852  1.00 0.00 ? 117 SER B CB   1  
ATOM   3856   O OG   . SER B 2 117 ? -61.378  -3.622  -63.505  1.00 0.00 ? 117 SER B OG   1  
ATOM   3857   H H    . SER B 2 117 ? -59.324  -2.749  -61.438  1.00 0.00 ? 117 SER B H    1  
ATOM   3858   H HA   . SER B 2 117 ? -59.048  -5.574  -62.142  1.00 0.00 ? 117 SER B HA   1  
ATOM   3859   H HB2  . SER B 2 117 ? -60.972  -5.615  -63.523  1.00 0.00 ? 117 SER B HB2  1  
ATOM   3860   H HB3  . SER B 2 117 ? -61.479  -4.977  -61.967  1.00 0.00 ? 117 SER B HB3  1  
ATOM   3861   H HG   . SER B 2 117 ? -61.011  -2.853  -63.063  1.00 0.00 ? 117 SER B HG   1  
ATOM   3862   N N    . TYR B 2 118 ? -57.457  -3.436  -63.264  1.00 0.00 ? 118 TYR B N    1  
ATOM   3863   C CA   . TYR B 2 118 ? -56.534  -2.916  -64.266  1.00 0.00 ? 118 TYR B CA   1  
ATOM   3864   C C    . TYR B 2 118 ? -55.553  -3.970  -64.664  1.00 0.00 ? 118 TYR B C    1  
ATOM   3865   O O    . TYR B 2 118 ? -55.119  -3.974  -65.796  1.00 0.00 ? 118 TYR B O    1  
ATOM   3866   C CB   . TYR B 2 118 ? -55.755  -1.706  -63.748  1.00 0.00 ? 118 TYR B CB   1  
ATOM   3867   C CG   . TYR B 2 118 ? -54.706  -1.138  -64.681  1.00 0.00 ? 118 TYR B CG   1  
ATOM   3868   C CD1  . TYR B 2 118 ? -53.415  -1.663  -64.702  1.00 0.00 ? 118 TYR B CD1  1  
ATOM   3869   C CD2  . TYR B 2 118 ? -54.993  -0.049  -65.512  1.00 0.00 ? 118 TYR B CD2  1  
ATOM   3870   C CE1  . TYR B 2 118 ? -52.427  -1.136  -65.550  1.00 0.00 ? 118 TYR B CE1  1  
ATOM   3871   C CE2  . TYR B 2 118 ? -54.026  0.490   -66.364  1.00 0.00 ? 118 TYR B CE2  1  
ATOM   3872   C CZ   . TYR B 2 118 ? -52.734  -0.057  -66.373  1.00 0.00 ? 118 TYR B CZ   1  
ATOM   3873   O OH   . TYR B 2 118 ? -51.743  0.451   -67.189  1.00 0.00 ? 118 TYR B OH   1  
ATOM   3874   H H    . TYR B 2 118 ? -57.263  -3.285  -62.315  1.00 0.00 ? 118 TYR B H    1  
ATOM   3875   H HA   . TYR B 2 118 ? -57.097  -2.617  -65.137  1.00 0.00 ? 118 TYR B HA   1  
ATOM   3876   H HB2  . TYR B 2 118 ? -56.460  -0.922  -63.526  1.00 0.00 ? 118 TYR B HB2  1  
ATOM   3877   H HB3  . TYR B 2 118 ? -55.271  -1.993  -62.824  1.00 0.00 ? 118 TYR B HB3  1  
ATOM   3878   H HD1  . TYR B 2 118 ? -53.174  -2.500  -64.064  1.00 0.00 ? 118 TYR B HD1  1  
ATOM   3879   H HD2  . TYR B 2 118 ? -55.988  0.371   -65.509  1.00 0.00 ? 118 TYR B HD2  1  
ATOM   3880   H HE1  . TYR B 2 118 ? -51.433  -1.558  -65.555  1.00 0.00 ? 118 TYR B HE1  1  
ATOM   3881   H HE2  . TYR B 2 118 ? -54.266  1.331   -66.998  1.00 0.00 ? 118 TYR B HE2  1  
ATOM   3882   H HH   . TYR B 2 118 ? -51.125  0.938   -66.638  1.00 0.00 ? 118 TYR B HH   1  
ATOM   3883   N N    . ASN B 2 119 ? -55.150  -4.827  -63.739  1.00 0.00 ? 119 ASN B N    1  
ATOM   3884   C CA   . ASN B 2 119 ? -54.271  -5.919  -64.094  1.00 0.00 ? 119 ASN B CA   1  
ATOM   3885   C C    . ASN B 2 119 ? -54.503  -7.027  -63.124  1.00 0.00 ? 119 ASN B C    1  
ATOM   3886   O O    . ASN B 2 119 ? -53.993  -7.002  -62.007  1.00 0.00 ? 119 ASN B O    1  
ATOM   3887   C CB   . ASN B 2 119 ? -52.801  -5.502  -64.145  1.00 0.00 ? 119 ASN B CB   1  
ATOM   3888   C CG   . ASN B 2 119 ? -51.849  -6.697  -64.131  1.00 0.00 ? 119 ASN B CG   1  
ATOM   3889   O OD1  . ASN B 2 119 ? -52.226  -7.833  -64.432  1.00 0.00 ? 119 ASN B OD1  1  
ATOM   3890   N ND2  . ASN B 2 119 ? -50.602  -6.440  -63.758  1.00 0.00 ? 119 ASN B ND2  1  
ATOM   3891   H H    . ASN B 2 119 ? -55.496  -4.757  -62.825  1.00 0.00 ? 119 ASN B H    1  
ATOM   3892   H HA   . ASN B 2 119 ? -54.559  -6.272  -65.076  1.00 0.00 ? 119 ASN B HA   1  
ATOM   3893   H HB2  . ASN B 2 119 ? -52.631  -4.933  -65.047  1.00 0.00 ? 119 ASN B HB2  1  
ATOM   3894   H HB3  . ASN B 2 119 ? -52.588  -4.874  -63.292  1.00 0.00 ? 119 ASN B HB3  1  
ATOM   3895   H HD21 . ASN B 2 119 ? -50.342  -5.528  -63.513  1.00 0.00 ? 119 ASN B HD21 1  
ATOM   3896   H HD22 . ASN B 2 119 ? -49.941  -7.163  -63.728  1.00 0.00 ? 119 ASN B HD22 1  
ATOM   3897   N N    . LEU B 2 120 ? -55.275  -8.003  -63.596  1.00 0.00 ? 120 LEU B N    1  
ATOM   3898   C CA   . LEU B 2 120 ? -55.900  -9.043  -62.777  1.00 0.00 ? 120 LEU B CA   1  
ATOM   3899   C C    . LEU B 2 120 ? -56.905  -8.396  -61.800  1.00 0.00 ? 120 LEU B C    1  
ATOM   3900   O O    . LEU B 2 120 ? -57.229  -7.210  -61.936  1.00 0.00 ? 120 LEU B O    1  
ATOM   3901   C CB   . LEU B 2 120 ? -54.854  -9.951  -62.102  1.00 0.00 ? 120 LEU B CB   1  
ATOM   3902   C CG   . LEU B 2 120 ? -53.665  -10.447 -62.954  1.00 0.00 ? 120 LEU B CG   1  
ATOM   3903   C CD1  . LEU B 2 120 ? -53.177  -11.857 -62.553  1.00 0.00 ? 120 LEU B CD1  1  
ATOM   3904   C CD2  . LEU B 2 120 ? -53.970  -10.413 -64.444  1.00 0.00 ? 120 LEU B CD2  1  
ATOM   3905   H H    . LEU B 2 120 ? -55.601  -7.907  -64.515  1.00 0.00 ? 120 LEU B H    1  
ATOM   3906   H HA   . LEU B 2 120 ? -56.480  -9.663  -63.451  1.00 0.00 ? 120 LEU B HA   1  
ATOM   3907   H HB2  . LEU B 2 120 ? -54.445  -9.412  -61.264  1.00 0.00 ? 120 LEU B HB2  1  
ATOM   3908   H HB3  . LEU B 2 120 ? -55.375  -10.816 -61.714  1.00 0.00 ? 120 LEU B HB3  1  
ATOM   3909   H HG   . LEU B 2 120 ? -52.843  -9.766  -62.773  1.00 0.00 ? 120 LEU B HG   1  
ATOM   3910   H HD11 . LEU B 2 120 ? -53.977  -12.388 -62.059  1.00 0.00 ? 120 LEU B HD11 1  
ATOM   3911   H HD12 . LEU B 2 120 ? -52.335  -11.770 -61.882  1.00 0.00 ? 120 LEU B HD12 1  
ATOM   3912   H HD13 . LEU B 2 120 ? -52.876  -12.399 -63.438  1.00 0.00 ? 120 LEU B HD13 1  
ATOM   3913   H HD21 . LEU B 2 120 ? -54.224  -11.407 -64.782  1.00 0.00 ? 120 LEU B HD21 1  
ATOM   3914   H HD22 . LEU B 2 120 ? -53.102  -10.061 -64.981  1.00 0.00 ? 120 LEU B HD22 1  
ATOM   3915   H HD23 . LEU B 2 120 ? -54.801  -9.748  -64.626  1.00 0.00 ? 120 LEU B HD23 1  
ATOM   3916   N N    . TYR B 2 121 ? -57.421  -9.157  -60.846  1.00 0.00 ? 121 TYR B N    1  
ATOM   3917   C CA   . TYR B 2 121 ? -58.380  -8.630  -59.907  1.00 0.00 ? 121 TYR B CA   1  
ATOM   3918   C C    . TYR B 2 121 ? -57.774  -8.618  -58.512  1.00 0.00 ? 121 TYR B C    1  
ATOM   3919   O O    . TYR B 2 121 ? -57.528  -9.683  -57.960  1.00 0.00 ? 121 TYR B O    1  
ATOM   3920   C CB   . TYR B 2 121 ? -59.565  -9.561  -59.876  1.00 0.00 ? 121 TYR B CB   1  
ATOM   3921   C CG   . TYR B 2 121 ? -60.591  -9.351  -60.930  1.00 0.00 ? 121 TYR B CG   1  
ATOM   3922   C CD1  . TYR B 2 121 ? -61.298  -8.174  -60.990  1.00 0.00 ? 121 TYR B CD1  1  
ATOM   3923   C CD2  . TYR B 2 121 ? -60.907  -10.356 -61.845  1.00 0.00 ? 121 TYR B CD2  1  
ATOM   3924   C CE1  . TYR B 2 121 ? -62.304  -7.971  -61.962  1.00 0.00 ? 121 TYR B CE1  1  
ATOM   3925   C CE2  . TYR B 2 121 ? -61.908  -10.177 -62.834  1.00 0.00 ? 121 TYR B CE2  1  
ATOM   3926   C CZ   . TYR B 2 121 ? -62.606  -8.971  -62.887  1.00 0.00 ? 121 TYR B CZ   1  
ATOM   3927   O OH   . TYR B 2 121 ? -63.608  -8.725  -63.817  1.00 0.00 ? 121 TYR B OH   1  
ATOM   3928   H H    . TYR B 2 121 ? -57.156  -10.099 -60.786  1.00 0.00 ? 121 TYR B H    1  
ATOM   3929   H HA   . TYR B 2 121 ? -58.694  -7.640  -60.196  1.00 0.00 ? 121 TYR B HA   1  
ATOM   3930   H HB2  . TYR B 2 121 ? -59.200  -10.570 -59.970  1.00 0.00 ? 121 TYR B HB2  1  
ATOM   3931   H HB3  . TYR B 2 121 ? -60.040  -9.466  -58.909  1.00 0.00 ? 121 TYR B HB3  1  
ATOM   3932   H HD1  . TYR B 2 121 ? -61.079  -7.388  -60.282  1.00 0.00 ? 121 TYR B HD1  1  
ATOM   3933   H HD2  . TYR B 2 121 ? -60.362  -11.288 -61.812  1.00 0.00 ? 121 TYR B HD2  1  
ATOM   3934   H HE1  . TYR B 2 121 ? -62.838  -7.033  -61.994  1.00 0.00 ? 121 TYR B HE1  1  
ATOM   3935   H HE2  . TYR B 2 121 ? -62.135  -10.970 -63.531  1.00 0.00 ? 121 TYR B HE2  1  
ATOM   3936   H HH   . TYR B 2 121 ? -63.274  -8.088  -64.453  1.00 0.00 ? 121 TYR B HH   1  
ATOM   3937   N N    . THR B 2 122 ? -57.523  -7.452  -57.912  1.00 0.00 ? 122 THR B N    1  
ATOM   3938   C CA   . THR B 2 122 ? -57.242  -7.449  -56.454  1.00 0.00 ? 122 THR B CA   1  
ATOM   3939   C C    . THR B 2 122 ? -58.236  -6.621  -55.640  1.00 0.00 ? 122 THR B C    1  
ATOM   3940   O O    . THR B 2 122 ? -58.892  -5.709  -56.168  1.00 0.00 ? 122 THR B O    1  
ATOM   3941   C CB   . THR B 2 122 ? -55.772  -7.126  -56.061  1.00 0.00 ? 122 THR B CB   1  
ATOM   3942   O OG1  . THR B 2 122 ? -55.545  -5.734  -56.158  1.00 0.00 ? 122 THR B OG1  1  
ATOM   3943   C CG2  . THR B 2 122 ? -54.771  -7.838  -56.947  1.00 0.00 ? 122 THR B CG2  1  
ATOM   3944   H H    . THR B 2 122 ? -57.729  -6.612  -58.372  1.00 0.00 ? 122 THR B H    1  
ATOM   3945   H HA   . THR B 2 122 ? -57.410  -8.472  -56.140  1.00 0.00 ? 122 THR B HA   1  
ATOM   3946   H HB   . THR B 2 122 ? -55.611  -7.433  -55.038  1.00 0.00 ? 122 THR B HB   1  
ATOM   3947   H HG1  . THR B 2 122 ? -55.257  -5.420  -55.298  1.00 0.00 ? 122 THR B HG1  1  
ATOM   3948   H HG21 . THR B 2 122 ? -53.891  -7.224  -57.062  1.00 0.00 ? 122 THR B HG21 1  
ATOM   3949   H HG22 . THR B 2 122 ? -55.213  -8.019  -57.916  1.00 0.00 ? 122 THR B HG22 1  
ATOM   3950   H HG23 . THR B 2 122 ? -54.496  -8.780  -56.495  1.00 0.00 ? 122 THR B HG23 1  
ATOM   3951   N N    . PHE B 2 123 ? -58.348  -6.976  -54.359  1.00 0.00 ? 123 PHE B N    1  
ATOM   3952   C CA   . PHE B 2 123 ? -59.300  -6.362  -53.412  1.00 0.00 ? 123 PHE B CA   1  
ATOM   3953   C C    . PHE B 2 123 ? -58.558  -5.592  -52.304  1.00 0.00 ? 123 PHE B C    1  
ATOM   3954   O O    . PHE B 2 123 ? -57.375  -5.839  -52.015  1.00 0.00 ? 123 PHE B O    1  
ATOM   3955   C CB   . PHE B 2 123 ? -60.252  -7.416  -52.786  1.00 0.00 ? 123 PHE B CB   1  
ATOM   3956   C CG   . PHE B 2 123 ? -61.279  -8.010  -53.758  1.00 0.00 ? 123 PHE B CG   1  
ATOM   3957   C CD1  . PHE B 2 123 ? -60.930  -9.048  -54.632  1.00 0.00 ? 123 PHE B CD1  1  
ATOM   3958   C CD2  . PHE B 2 123 ? -62.601  -7.548  -53.774  1.00 0.00 ? 123 PHE B CD2  1  
ATOM   3959   C CE1  . PHE B 2 123 ? -61.872  -9.598  -55.522  1.00 0.00 ? 123 PHE B CE1  1  
ATOM   3960   C CE2  . PHE B 2 123 ? -63.560  -8.088  -54.668  1.00 0.00 ? 123 PHE B CE2  1  
ATOM   3961   C CZ   . PHE B 2 123 ? -63.193  -9.126  -55.532  1.00 0.00 ? 123 PHE B CZ   1  
ATOM   3962   H H    . PHE B 2 123 ? -57.799  -7.723  -54.039  1.00 0.00 ? 123 PHE B H    1  
ATOM   3963   H HA   . PHE B 2 123 ? -59.902  -5.652  -53.962  1.00 0.00 ? 123 PHE B HA   1  
ATOM   3964   H HB2  . PHE B 2 123 ? -59.656  -8.223  -52.391  1.00 0.00 ? 123 PHE B HB2  1  
ATOM   3965   H HB3  . PHE B 2 123 ? -60.781  -6.951  -51.966  1.00 0.00 ? 123 PHE B HB3  1  
ATOM   3966   H HD1  . PHE B 2 123 ? -59.917  -9.420  -54.636  1.00 0.00 ? 123 PHE B HD1  1  
ATOM   3967   H HD2  . PHE B 2 123 ? -62.890  -6.747  -53.109  1.00 0.00 ? 123 PHE B HD2  1  
ATOM   3968   H HE1  . PHE B 2 123 ? -61.581  -10.398 -56.187  1.00 0.00 ? 123 PHE B HE1  1  
ATOM   3969   H HE2  . PHE B 2 123 ? -64.574  -7.716  -54.667  1.00 0.00 ? 123 PHE B HE2  1  
ATOM   3970   H HZ   . PHE B 2 123 ? -63.916  -9.547  -56.214  1.00 0.00 ? 123 PHE B HZ   1  
ATOM   3971   N N    . GLY B 2 124 ? -59.252  -4.637  -51.702  1.00 0.00 ? 124 GLY B N    1  
ATOM   3972   C CA   . GLY B 2 124 ? -58.739  -3.982  -50.519  1.00 0.00 ? 124 GLY B CA   1  
ATOM   3973   C C    . GLY B 2 124 ? -59.011  -4.920  -49.378  1.00 0.00 ? 124 GLY B C    1  
ATOM   3974   O O    . GLY B 2 124 ? -59.568  -5.992  -49.567  1.00 0.00 ? 124 GLY B O    1  
ATOM   3975   H H    . GLY B 2 124 ? -60.176  -4.466  -51.981  1.00 0.00 ? 124 GLY B H    1  
ATOM   3976   H HA2  . GLY B 2 124 ? -57.675  -3.811  -50.622  1.00 0.00 ? 124 GLY B HA2  1  
ATOM   3977   H HA3  . GLY B 2 124 ? -59.254  -3.049  -50.354  1.00 0.00 ? 124 GLY B HA3  1  
ATOM   3978   N N    . GLY B 2 125 ? -58.618  -4.513  -48.186  1.00 0.00 ? 125 GLY B N    1  
ATOM   3979   C CA   . GLY B 2 125 ? -58.832  -5.327  -47.004  1.00 0.00 ? 125 GLY B CA   1  
ATOM   3980   C C    . GLY B 2 125 ? -60.256  -5.227  -46.495  1.00 0.00 ? 125 GLY B C    1  
ATOM   3981   O O    . GLY B 2 125 ? -60.805  -6.198  -45.970  1.00 0.00 ? 125 GLY B O    1  
ATOM   3982   H H    . GLY B 2 125 ? -58.178  -3.642  -48.096  1.00 0.00 ? 125 GLY B H    1  
ATOM   3983   H HA2  . GLY B 2 125 ? -58.616  -6.358  -47.244  1.00 0.00 ? 125 GLY B HA2  1  
ATOM   3984   H HA3  . GLY B 2 125 ? -58.159  -4.999  -46.226  1.00 0.00 ? 125 GLY B HA3  1  
ATOM   3985   N N    . GLY B 2 126 ? -60.856  -4.057  -46.647  1.00 0.00 ? 126 GLY B N    1  
ATOM   3986   C CA   . GLY B 2 126 ? -62.222  -3.861  -46.218  1.00 0.00 ? 126 GLY B CA   1  
ATOM   3987   C C    . GLY B 2 126 ? -62.277  -2.755  -45.198  1.00 0.00 ? 126 GLY B C    1  
ATOM   3988   O O    . GLY B 2 126 ? -61.282  -2.463  -44.550  1.00 0.00 ? 126 GLY B O    1  
ATOM   3989   H H    . GLY B 2 126 ? -60.372  -3.318  -47.072  1.00 0.00 ? 126 GLY B H    1  
ATOM   3990   H HA2  . GLY B 2 126 ? -62.832  -3.598  -47.070  1.00 0.00 ? 126 GLY B HA2  1  
ATOM   3991   H HA3  . GLY B 2 126 ? -62.595  -4.771  -45.775  1.00 0.00 ? 126 GLY B HA3  1  
ATOM   3992   N N    . THR B 2 127 ? -63.447  -2.134  -45.084  1.00 0.00 ? 127 THR B N    1  
ATOM   3993   C CA   . THR B 2 127 ? -63.713  -1.047  -44.154  1.00 0.00 ? 127 THR B CA   1  
ATOM   3994   C C    . THR B 2 127 ? -65.084  -1.378  -43.603  1.00 0.00 ? 127 THR B C    1  
ATOM   3995   O O    . THR B 2 127 ? -66.065  -1.392  -44.357  1.00 0.00 ? 127 THR B O    1  
ATOM   3996   C CB   . THR B 2 127 ? -63.765  0.325   -44.885  1.00 0.00 ? 127 THR B CB   1  
ATOM   3997   O OG1  . THR B 2 127 ? -62.441  0.835   -45.076  1.00 0.00 ? 127 THR B OG1  1  
ATOM   3998   C CG2  . THR B 2 127 ? -64.568  1.345   -44.104  1.00 0.00 ? 127 THR B CG2  1  
ATOM   3999   H H    . THR B 2 127 ? -64.181  -2.432  -45.660  1.00 0.00 ? 127 THR B H    1  
ATOM   4000   H HA   . THR B 2 127 ? -62.977  -1.034  -43.362  1.00 0.00 ? 127 THR B HA   1  
ATOM   4001   H HB   . THR B 2 127 ? -64.227  0.186   -45.851  1.00 0.00 ? 127 THR B HB   1  
ATOM   4002   H HG1  . THR B 2 127 ? -62.025  0.911   -44.214  1.00 0.00 ? 127 THR B HG1  1  
ATOM   4003   H HG21 . THR B 2 127 ? -65.439  1.630   -44.674  1.00 0.00 ? 127 THR B HG21 1  
ATOM   4004   H HG22 . THR B 2 127 ? -63.958  2.216   -43.917  1.00 0.00 ? 127 THR B HG22 1  
ATOM   4005   H HG23 . THR B 2 127 ? -64.878  0.914   -43.163  1.00 0.00 ? 127 THR B HG23 1  
ATOM   4006   N N    . LYS B 2 128 ? -65.153  -1.654  -42.303  1.00 0.00 ? 128 LYS B N    1  
ATOM   4007   C CA   . LYS B 2 128 ? -66.419  -1.972  -41.646  1.00 0.00 ? 128 LYS B CA   1  
ATOM   4008   C C    . LYS B 2 128 ? -67.168  -0.707  -41.220  1.00 0.00 ? 128 LYS B C    1  
ATOM   4009   O O    . LYS B 2 128 ? -66.720  -0.004  -40.329  1.00 0.00 ? 128 LYS B O    1  
ATOM   4010   C CB   . LYS B 2 128 ? -66.159  -2.856  -40.425  1.00 0.00 ? 128 LYS B CB   1  
ATOM   4011   C CG   . LYS B 2 128 ? -67.418  -3.503  -39.816  1.00 0.00 ? 128 LYS B CG   1  
ATOM   4012   C CD   . LYS B 2 128 ? -67.129  -4.211  -38.472  1.00 0.00 ? 128 LYS B CD   1  
ATOM   4013   C CE   . LYS B 2 128 ? -65.881  -5.117  -38.498  1.00 0.00 ? 128 LYS B CE   1  
ATOM   4014   N NZ   . LYS B 2 128 ? -65.898  -6.168  -39.580  1.00 0.00 ? 128 LYS B NZ   1  
ATOM   4015   H H    . LYS B 2 128 ? -64.333  -1.631  -41.768  1.00 0.00 ? 128 LYS B H    1  
ATOM   4016   H HA   . LYS B 2 128 ? -67.038  -2.521  -42.340  1.00 0.00 ? 128 LYS B HA   1  
ATOM   4017   H HB2  . LYS B 2 128 ? -65.480  -3.643  -40.712  1.00 0.00 ? 128 LYS B HB2  1  
ATOM   4018   H HB3  . LYS B 2 128 ? -65.679  -2.253  -39.667  1.00 0.00 ? 128 LYS B HB3  1  
ATOM   4019   H HG2  . LYS B 2 128 ? -68.161  -2.737  -39.652  1.00 0.00 ? 128 LYS B HG2  1  
ATOM   4020   H HG3  . LYS B 2 128 ? -67.811  -4.226  -40.516  1.00 0.00 ? 128 LYS B HG3  1  
ATOM   4021   H HD2  . LYS B 2 128 ? -66.988  -3.460  -37.711  1.00 0.00 ? 128 LYS B HD2  1  
ATOM   4022   H HD3  . LYS B 2 128 ? -67.989  -4.811  -38.208  1.00 0.00 ? 128 LYS B HD3  1  
ATOM   4023   H HE2  . LYS B 2 128 ? -65.011  -4.497  -38.642  1.00 0.00 ? 128 LYS B HE2  1  
ATOM   4024   H HE3  . LYS B 2 128 ? -65.796  -5.607  -37.537  1.00 0.00 ? 128 LYS B HE3  1  
ATOM   4025   H HZ1  . LYS B 2 128 ? -66.313  -5.768  -40.445  1.00 0.00 ? 128 LYS B HZ1  1  
ATOM   4026   H HZ2  . LYS B 2 128 ? -66.467  -6.980  -39.265  1.00 0.00 ? 128 LYS B HZ2  1  
ATOM   4027   H HZ3  . LYS B 2 128 ? -64.926  -6.480  -39.775  1.00 0.00 ? 128 LYS B HZ3  1  
ATOM   4028   N N    . LEU B 2 129 ? -68.299  -0.422  -41.863  1.00 0.00 ? 129 LEU B N    1  
ATOM   4029   C CA   . LEU B 2 129 ? -69.153  0.705   -41.485  1.00 0.00 ? 129 LEU B CA   1  
ATOM   4030   C C    . LEU B 2 129 ? -70.231  0.259   -40.510  1.00 0.00 ? 129 LEU B C    1  
ATOM   4031   O O    . LEU B 2 129 ? -71.363  -0.071  -40.923  1.00 0.00 ? 129 LEU B O    1  
ATOM   4032   C CB   . LEU B 2 129 ? -69.832  1.313   -42.710  1.00 0.00 ? 129 LEU B CB   1  
ATOM   4033   C CG   . LEU B 2 129 ? -70.900  2.389   -42.483  1.00 0.00 ? 129 LEU B CG   1  
ATOM   4034   C CD1  . LEU B 2 129 ? -70.322  3.633   -41.847  1.00 0.00 ? 129 LEU B CD1  1  
ATOM   4035   C CD2  . LEU B 2 129 ? -71.572  2.749   -43.781  1.00 0.00 ? 129 LEU B CD2  1  
ATOM   4036   H H    . LEU B 2 129 ? -68.601  -1.025  -42.574  1.00 0.00 ? 129 LEU B H    1  
ATOM   4037   H HA   . LEU B 2 129 ? -68.546  1.462   -41.013  1.00 0.00 ? 129 LEU B HA   1  
ATOM   4038   H HB2  . LEU B 2 129 ? -69.065  1.747   -43.329  1.00 0.00 ? 129 LEU B HB2  1  
ATOM   4039   H HB3  . LEU B 2 129 ? -70.284  0.502   -43.268  1.00 0.00 ? 129 LEU B HB3  1  
ATOM   4040   H HG   . LEU B 2 129 ? -71.647  1.985   -41.813  1.00 0.00 ? 129 LEU B HG   1  
ATOM   4041   H HD11 . LEU B 2 129 ? -69.547  4.035   -42.482  1.00 0.00 ? 129 LEU B HD11 1  
ATOM   4042   H HD12 . LEU B 2 129 ? -69.904  3.384   -40.882  1.00 0.00 ? 129 LEU B HD12 1  
ATOM   4043   H HD13 . LEU B 2 129 ? -71.102  4.369   -41.722  1.00 0.00 ? 129 LEU B HD13 1  
ATOM   4044   H HD21 . LEU B 2 129 ? -71.045  3.571   -44.242  1.00 0.00 ? 129 LEU B HD21 1  
ATOM   4045   H HD22 . LEU B 2 129 ? -72.595  3.038   -43.589  1.00 0.00 ? 129 LEU B HD22 1  
ATOM   4046   H HD23 . LEU B 2 129 ? -71.556  1.896   -44.443  1.00 0.00 ? 129 LEU B HD23 1  
ATOM   4047   N N    . GLU B 2 130 ? -69.884  0.242   -39.219  1.00 0.00 ? 130 GLU B N    1  
ATOM   4048   C CA   . GLU B 2 130 ? -70.848  -0.136  -38.170  1.00 0.00 ? 130 GLU B CA   1  
ATOM   4049   C C    . GLU B 2 130 ? -71.613  1.064   -37.626  1.00 0.00 ? 130 GLU B C    1  
ATOM   4050   O O    . GLU B 2 130 ? -71.029  2.130   -37.419  1.00 0.00 ? 130 GLU B O    1  
ATOM   4051   C CB   . GLU B 2 130 ? -70.199  -0.959  -37.046  1.00 0.00 ? 130 GLU B CB   1  
ATOM   4052   C CG   . GLU B 2 130 ? -68.876  -0.451  -36.529  1.00 0.00 ? 130 GLU B CG   1  
ATOM   4053   C CD   . GLU B 2 130 ? -68.136  -1.517  -35.731  1.00 0.00 ? 130 GLU B CD   1  
ATOM   4054   O OE1  . GLU B 2 130 ? -68.606  -2.681  -35.707  1.00 0.00 ? 130 GLU B OE1  1  
ATOM   4055   O OE2  . GLU B 2 130 ? -67.085  -1.192  -35.126  1.00 0.00 ? 130 GLU B OE2  1  
ATOM   4056   H H    . GLU B 2 130 ? -68.977  0.511   -38.963  1.00 0.00 ? 130 GLU B H    1  
ATOM   4057   H HA   . GLU B 2 130 ? -71.581  -0.774  -38.646  1.00 0.00 ? 130 GLU B HA   1  
ATOM   4058   H HB2  . GLU B 2 130 ? -70.886  -0.995  -36.216  1.00 0.00 ? 130 GLU B HB2  1  
ATOM   4059   H HB3  . GLU B 2 130 ? -70.061  -1.969  -37.410  1.00 0.00 ? 130 GLU B HB3  1  
ATOM   4060   H HG2  . GLU B 2 130 ? -68.263  -0.149  -37.366  1.00 0.00 ? 130 GLU B HG2  1  
ATOM   4061   H HG3  . GLU B 2 130 ? -69.051  0.406   -35.895  1.00 0.00 ? 130 GLU B HG3  1  
ATOM   4062   N N    . ILE B 2 131 ? -72.917  0.887   -37.409  1.00 0.00 ? 131 ILE B N    1  
ATOM   4063   C CA   . ILE B 2 131 ? -73.789  1.994   -37.004  1.00 0.00 ? 131 ILE B CA   1  
ATOM   4064   C C    . ILE B 2 131 ? -73.710  2.342   -35.511  1.00 0.00 ? 131 ILE B C    1  
ATOM   4065   O O    . ILE B 2 131 ? -73.414  1.490   -34.661  1.00 0.00 ? 131 ILE B O    1  
ATOM   4066   C CB   . ILE B 2 131 ? -75.262  1.773   -37.436  1.00 0.00 ? 131 ILE B CB   1  
ATOM   4067   C CG1  . ILE B 2 131 ? -75.344  1.648   -38.960  1.00 0.00 ? 131 ILE B CG1  1  
ATOM   4068   C CG2  . ILE B 2 131 ? -76.153  2.930   -36.980  1.00 0.00 ? 131 ILE B CG2  1  
ATOM   4069   C CD1  . ILE B 2 131 ? -76.685  1.109   -39.489  1.00 0.00 ? 131 ILE B CD1  1  
ATOM   4070   H H    . ILE B 2 131 ? -73.317  0.014   -37.604  1.00 0.00 ? 131 ILE B H    1  
ATOM   4071   H HA   . ILE B 2 131 ? -73.438  2.866   -37.537  1.00 0.00 ? 131 ILE B HA   1  
ATOM   4072   H HB   . ILE B 2 131 ? -75.623  0.858   -36.988  1.00 0.00 ? 131 ILE B HB   1  
ATOM   4073   H HG12 . ILE B 2 131 ? -75.166  2.616   -39.399  1.00 0.00 ? 131 ILE B HG12 1  
ATOM   4074   H HG13 . ILE B 2 131 ? -74.558  0.979   -39.281  1.00 0.00 ? 131 ILE B HG13 1  
ATOM   4075   H HG21 . ILE B 2 131 ? -76.640  3.368   -37.839  1.00 0.00 ? 131 ILE B HG21 1  
ATOM   4076   H HG22 . ILE B 2 131 ? -75.549  3.677   -36.488  1.00 0.00 ? 131 ILE B HG22 1  
ATOM   4077   H HG23 . ILE B 2 131 ? -76.900  2.560   -36.293  1.00 0.00 ? 131 ILE B HG23 1  
ATOM   4078   H HD11 . ILE B 2 131 ? -76.532  0.645   -40.452  1.00 0.00 ? 131 ILE B HD11 1  
ATOM   4079   H HD12 . ILE B 2 131 ? -77.386  1.925   -39.590  1.00 0.00 ? 131 ILE B HD12 1  
ATOM   4080   H HD13 . ILE B 2 131 ? -77.079  0.380   -38.796  1.00 0.00 ? 131 ILE B HD13 1  
ATOM   4081   N N    . LYS B 2 132 ? -73.933  3.628   -35.236  1.00 0.00 ? 132 LYS B N    1  
ATOM   4082   C CA   . LYS B 2 132 ? -74.183  4.145   -33.902  1.00 0.00 ? 132 LYS B CA   1  
ATOM   4083   C C    . LYS B 2 132 ? -75.668  3.966   -33.619  1.00 0.00 ? 132 LYS B C    1  
ATOM   4084   O O    . LYS B 2 132 ? -76.096  3.864   -32.473  1.00 0.00 ? 132 LYS B O    1  
ATOM   4085   C CB   . LYS B 2 132 ? -73.820  5.628   -33.844  1.00 0.00 ? 132 LYS B CB   1  
ATOM   4086   C CG   . LYS B 2 132 ? -72.406  5.920   -34.299  1.00 0.00 ? 132 LYS B CG   1  
ATOM   4087   C CD   . LYS B 2 132 ? -71.906  7.260   -33.778  1.00 0.00 ? 132 LYS B CD   1  
ATOM   4088   C CE   . LYS B 2 132 ? -71.113  7.093   -32.474  1.00 0.00 ? 132 LYS B CE   1  
ATOM   4089   N NZ   . LYS B 2 132 ? -70.481  8.375   -32.052  1.00 0.00 ? 132 LYS B NZ   1  
ATOM   4090   H H    . LYS B 2 132 ? -74.115  4.225   -35.992  1.00 0.00 ? 132 LYS B H    1  
ATOM   4091   H HA   . LYS B 2 132 ? -73.601  3.593   -33.178  1.00 0.00 ? 132 LYS B HA   1  
ATOM   4092   H HB2  . LYS B 2 132 ? -74.503  6.177   -34.472  1.00 0.00 ? 132 LYS B HB2  1  
ATOM   4093   H HB3  . LYS B 2 132 ? -73.937  5.971   -32.825  1.00 0.00 ? 132 LYS B HB3  1  
ATOM   4094   H HG2  . LYS B 2 132 ? -71.753  5.139   -33.939  1.00 0.00 ? 132 LYS B HG2  1  
ATOM   4095   H HG3  . LYS B 2 132 ? -72.380  5.930   -35.379  1.00 0.00 ? 132 LYS B HG3  1  
ATOM   4096   H HD2  . LYS B 2 132 ? -71.268  7.712   -34.523  1.00 0.00 ? 132 LYS B HD2  1  
ATOM   4097   H HD3  . LYS B 2 132 ? -72.752  7.906   -33.597  1.00 0.00 ? 132 LYS B HD3  1  
ATOM   4098   H HE2  . LYS B 2 132 ? -71.780  6.759   -31.695  1.00 0.00 ? 132 LYS B HE2  1  
ATOM   4099   H HE3  . LYS B 2 132 ? -70.343  6.349   -32.622  1.00 0.00 ? 132 LYS B HE3  1  
ATOM   4100   H HZ1  . LYS B 2 132 ? -69.547  8.181   -31.637  1.00 0.00 ? 132 LYS B HZ1  1  
ATOM   4101   H HZ2  . LYS B 2 132 ? -71.085  8.843   -31.346  1.00 0.00 ? 132 LYS B HZ2  1  
ATOM   4102   H HZ3  . LYS B 2 132 ? -70.368  8.995   -32.878  1.00 0.00 ? 132 LYS B HZ3  1  
ATOM   4103   N N    . ALA B 2 134 ? -78.637  5.307   -30.168  1.00 0.00 ? 134 ALA B N    1  
ATOM   4104   C CA   . ALA B 2 134 ? -78.991  5.430   -28.748  1.00 0.00 ? 134 ALA B CA   1  
ATOM   4105   C C    . ALA B 2 134 ? -79.243  4.067   -28.114  1.00 0.00 ? 134 ALA B C    1  
ATOM   4106   O O    . ALA B 2 134 ? -79.787  3.169   -28.761  1.00 0.00 ? 134 ALA B O    1  
ATOM   4107   C CB   . ALA B 2 134 ? -80.205  6.344   -28.556  1.00 0.00 ? 134 ALA B CB   1  
ATOM   4108   H H    . ALA B 2 134 ? -78.932  4.375   -30.520  1.00 0.00 ? 134 ALA B H    1  
ATOM   4109   H HA   . ALA B 2 134 ? -78.152  5.881   -28.237  1.00 0.00 ? 134 ALA B HA   1  
ATOM   4110   H HB1  . ALA B 2 134 ? -80.549  6.693   -29.519  1.00 0.00 ? 134 ALA B HB1  1  
ATOM   4111   H HB2  . ALA B 2 134 ? -79.926  7.190   -27.945  1.00 0.00 ? 134 ALA B HB2  1  
ATOM   4112   H HB3  . ALA B 2 134 ? -80.996  5.794   -28.069  1.00 0.00 ? 134 ALA B HB3  1  
ATOM   4113   N N    . ASP B 2 135 ? -78.852  3.928   -26.848  1.00 0.00 ? 135 ASP B N    1  
ATOM   4114   C CA   . ASP B 2 135 ? -78.865  2.646   -26.138  1.00 0.00 ? 135 ASP B CA   1  
ATOM   4115   C C    . ASP B 2 135 ? -80.253  1.962   -26.119  1.00 0.00 ? 135 ASP B C    1  
ATOM   4116   O O    . ASP B 2 135 ? -81.276  2.594   -26.428  1.00 0.00 ? 135 ASP B O    1  
ATOM   4117   C CB   . ASP B 2 135 ? -78.320  2.832   -24.707  1.00 0.00 ? 135 ASP B CB   1  
ATOM   4118   C CG   . ASP B 2 135 ? -77.165  3.845   -24.628  1.00 0.00 ? 135 ASP B CG   1  
ATOM   4119   O OD1  . ASP B 2 135 ? -77.353  5.015   -25.027  1.00 0.00 ? 135 ASP B OD1  1  
ATOM   4120   O OD2  . ASP B 2 135 ? -76.066  3.473   -24.154  1.00 0.00 ? 135 ASP B OD2  1  
ATOM   4121   H H    . ASP B 2 135 ? -78.437  4.697   -26.406  1.00 0.00 ? 135 ASP B H    1  
ATOM   4122   H HA   . ASP B 2 135 ? -78.188  1.984   -26.657  1.00 0.00 ? 135 ASP B HA   1  
ATOM   4123   H HB2  . ASP B 2 135 ? -79.123  3.175   -24.072  1.00 0.00 ? 135 ASP B HB2  1  
ATOM   4124   H HB3  . ASP B 2 135 ? -77.973  1.876   -24.342  1.00 0.00 ? 135 ASP B HB3  1  
ATOM   4125   N N    . ALA B 2 136 ? -80.276  0.666   -25.792  1.00 0.00 ? 136 ALA B N    1  
ATOM   4126   C CA   . ALA B 2 136 ? -81.523  -0.061  -25.496  1.00 0.00 ? 136 ALA B CA   1  
ATOM   4127   C C    . ALA B 2 136 ? -81.291  -1.235  -24.519  1.00 0.00 ? 136 ALA B C    1  
ATOM   4128   O O    . ALA B 2 136 ? -80.157  -1.716  -24.354  1.00 0.00 ? 136 ALA B O    1  
ATOM   4129   C CB   . ALA B 2 136 ? -82.220  -0.525  -26.776  1.00 0.00 ? 136 ALA B CB   1  
ATOM   4130   H H    . ALA B 2 136 ? -79.425  0.225   -25.590  1.00 0.00 ? 136 ALA B H    1  
ATOM   4131   H HA   . ALA B 2 136 ? -82.185  0.636   -25.001  1.00 0.00 ? 136 ALA B HA   1  
ATOM   4132   H HB1  . ALA B 2 136 ? -82.906  0.239   -27.110  1.00 0.00 ? 136 ALA B HB1  1  
ATOM   4133   H HB2  . ALA B 2 136 ? -82.765  -1.436  -26.579  1.00 0.00 ? 136 ALA B HB2  1  
ATOM   4134   H HB3  . ALA B 2 136 ? -81.482  -0.706  -27.543  1.00 0.00 ? 136 ALA B HB3  1  
ATOM   4135   N N    . ALA B 2 137 ? -82.373  -1.679  -23.872  1.00 0.00 ? 137 ALA B N    1  
ATOM   4136   C CA   . ALA B 2 137 ? -82.321  -2.720  -22.834  1.00 0.00 ? 137 ALA B CA   1  
ATOM   4137   C C    . ALA B 2 137 ? -82.307  -4.162  -23.362  1.00 0.00 ? 137 ALA B C    1  
ATOM   4138   O O    . ALA B 2 137 ? -83.229  -4.574  -24.064  1.00 0.00 ? 137 ALA B O    1  
ATOM   4139   C CB   . ALA B 2 137 ? -83.484  -2.541  -21.888  1.00 0.00 ? 137 ALA B CB   1  
ATOM   4140   H H    . ALA B 2 137 ? -83.232  -1.245  -24.052  1.00 0.00 ? 137 ALA B H    1  
ATOM   4141   H HA   . ALA B 2 137 ? -81.415  -2.571  -22.267  1.00 0.00 ? 137 ALA B HA   1  
ATOM   4142   H HB1  . ALA B 2 137 ? -83.150  -2.023  -21.001  1.00 0.00 ? 137 ALA B HB1  1  
ATOM   4143   H HB2  . ALA B 2 137 ? -83.877  -3.509  -21.613  1.00 0.00 ? 137 ALA B HB2  1  
ATOM   4144   H HB3  . ALA B 2 137 ? -84.256  -1.963  -22.372  1.00 0.00 ? 137 ALA B HB3  1  
ATOM   4145   N N    . PRO B 2 138 ? -81.273  -4.943  -23.003  1.00 0.00 ? 138 PRO B N    1  
ATOM   4146   C CA   . PRO B 2 138 ? -81.161  -6.366  -23.392  1.00 0.00 ? 138 PRO B CA   1  
ATOM   4147   C C    . PRO B 2 138 ? -82.356  -7.172  -22.911  1.00 0.00 ? 138 PRO B C    1  
ATOM   4148   O O    . PRO B 2 138 ? -82.853  -6.905  -21.809  1.00 0.00 ? 138 PRO B O    1  
ATOM   4149   C CB   . PRO B 2 138 ? -79.897  -6.844  -22.661  1.00 0.00 ? 138 PRO B CB   1  
ATOM   4150   C CG   . PRO B 2 138 ? -79.671  -5.842  -21.578  1.00 0.00 ? 138 PRO B CG   1  
ATOM   4151   C CD   . PRO B 2 138 ? -80.163  -4.527  -22.129  1.00 0.00 ? 138 PRO B CD   1  
ATOM   4152   H HA   . PRO B 2 138 ? -81.029  -6.466  -24.456  1.00 0.00 ? 138 PRO B HA   1  
ATOM   4153   H HB2  . PRO B 2 138 ? -80.059  -7.827  -22.239  1.00 0.00 ? 138 PRO B HB2  1  
ATOM   4154   H HB3  . PRO B 2 138 ? -79.055  -6.857  -23.334  1.00 0.00 ? 138 PRO B HB3  1  
ATOM   4155   H HG2  . PRO B 2 138 ? -80.233  -6.115  -20.695  1.00 0.00 ? 138 PRO B HG2  1  
ATOM   4156   H HG3  . PRO B 2 138 ? -78.619  -5.771  -21.347  1.00 0.00 ? 138 PRO B HG3  1  
ATOM   4157   H HD2  . PRO B 2 138 ? -80.516  -3.887  -21.331  1.00 0.00 ? 138 PRO B HD2  1  
ATOM   4158   H HD3  . PRO B 2 138 ? -79.394  -4.039  -22.707  1.00 0.00 ? 138 PRO B HD3  1  
ATOM   4159   N N    . THR B 2 139 ? -82.800  -8.144  -23.712  1.00 0.00 ? 139 THR B N    1  
ATOM   4160   C CA   . THR B 2 139 ? -84.055  -8.854  -23.433  1.00 0.00 ? 139 THR B CA   1  
ATOM   4161   C C    . THR B 2 139 ? -83.844  -10.356 -23.129  1.00 0.00 ? 139 THR B C    1  
ATOM   4162   O O    . THR B 2 139 ? -84.121  -11.199 -23.979  1.00 0.00 ? 139 THR B O    1  
ATOM   4163   C CB   . THR B 2 139 ? -85.080  -8.639  -24.597  1.00 0.00 ? 139 THR B CB   1  
ATOM   4164   O OG1  . THR B 2 139 ? -85.041  -7.276  -25.044  1.00 0.00 ? 139 THR B OG1  1  
ATOM   4165   C CG2  . THR B 2 139 ? -86.492  -8.984  -24.160  1.00 0.00 ? 139 THR B CG2  1  
ATOM   4166   H H    . THR B 2 139 ? -82.344  -8.302  -24.565  1.00 0.00 ? 139 THR B H    1  
ATOM   4167   H HA   . THR B 2 139 ? -84.480  -8.409  -22.545  1.00 0.00 ? 139 THR B HA   1  
ATOM   4168   H HB   . THR B 2 139 ? -84.805  -9.281  -25.421  1.00 0.00 ? 139 THR B HB   1  
ATOM   4169   H HG1  . THR B 2 139 ? -84.473  -6.784  -24.447  1.00 0.00 ? 139 THR B HG1  1  
ATOM   4170   H HG21 . THR B 2 139 ? -86.577  -10.052 -24.029  1.00 0.00 ? 139 THR B HG21 1  
ATOM   4171   H HG22 . THR B 2 139 ? -87.192  -8.656  -24.915  1.00 0.00 ? 139 THR B HG22 1  
ATOM   4172   H HG23 . THR B 2 139 ? -86.711  -8.488  -23.226  1.00 0.00 ? 139 THR B HG23 1  
ATOM   4173   N N    . VAL B 2 140 ? -83.371  -10.692 -21.923  1.00 0.00 ? 140 VAL B N    1  
ATOM   4174   C CA   . VAL B 2 140 ? -82.984  -12.093 -21.607  1.00 0.00 ? 140 VAL B CA   1  
ATOM   4175   C C    . VAL B 2 140 ? -84.163  -13.073 -21.507  1.00 0.00 ? 140 VAL B C    1  
ATOM   4176   O O    . VAL B 2 140 ? -85.320  -12.655 -21.366  1.00 0.00 ? 140 VAL B O    1  
ATOM   4177   C CB   . VAL B 2 140 ? -82.007  -12.218 -20.377  1.00 0.00 ? 140 VAL B CB   1  
ATOM   4178   C CG1  . VAL B 2 140 ? -82.655  -11.738 -19.102  1.00 0.00 ? 140 VAL B CG1  1  
ATOM   4179   C CG2  . VAL B 2 140 ? -81.470  -13.655 -20.216  1.00 0.00 ? 140 VAL B CG2  1  
ATOM   4180   H H    . VAL B 2 140 ? -83.176  -9.985  -21.273  1.00 0.00 ? 140 VAL B H    1  
ATOM   4181   H HA   . VAL B 2 140 ? -82.416  -12.426 -22.466  1.00 0.00 ? 140 VAL B HA   1  
ATOM   4182   H HB   . VAL B 2 140 ? -81.163  -11.569 -20.571  1.00 0.00 ? 140 VAL B HB   1  
ATOM   4183   H HG11 . VAL B 2 140 ? -83.689  -11.495 -19.294  1.00 0.00 ? 140 VAL B HG11 1  
ATOM   4184   H HG12 . VAL B 2 140 ? -82.138  -10.860 -18.745  1.00 0.00 ? 140 VAL B HG12 1  
ATOM   4185   H HG13 . VAL B 2 140 ? -82.601  -12.516 -18.356  1.00 0.00 ? 140 VAL B HG13 1  
ATOM   4186   H HG21 . VAL B 2 140 ? -82.267  -14.360 -20.402  1.00 0.00 ? 140 VAL B HG21 1  
ATOM   4187   H HG22 . VAL B 2 140 ? -81.097  -13.790 -19.211  1.00 0.00 ? 140 VAL B HG22 1  
ATOM   4188   H HG23 . VAL B 2 140 ? -80.670  -13.822 -20.922  1.00 0.00 ? 140 VAL B HG23 1  
ATOM   4189   N N    . SER B 2 141 ? -83.845  -14.369 -21.615  1.00 0.00 ? 141 SER B N    1  
ATOM   4190   C CA   . SER B 2 141 ? -84.813  -15.475 -21.618  1.00 0.00 ? 141 SER B CA   1  
ATOM   4191   C C    . SER B 2 141 ? -84.048  -16.795 -21.485  1.00 0.00 ? 141 SER B C    1  
ATOM   4192   O O    . SER B 2 141 ? -83.272  -17.142 -22.369  1.00 0.00 ? 141 SER B O    1  
ATOM   4193   C CB   . SER B 2 141 ? -85.678  -15.464 -22.896  1.00 0.00 ? 141 SER B CB   1  
ATOM   4194   O OG   . SER B 2 141 ? -84.932  -15.100 -24.047  1.00 0.00 ? 141 SER B OG   1  
ATOM   4195   H H    . SER B 2 141 ? -82.900  -14.593 -21.746  1.00 0.00 ? 141 SER B H    1  
ATOM   4196   H HA   . SER B 2 141 ? -85.460  -15.366 -20.758  1.00 0.00 ? 141 SER B HA   1  
ATOM   4197   H HB2  . SER B 2 141 ? -86.088  -16.446 -23.052  1.00 0.00 ? 141 SER B HB2  1  
ATOM   4198   H HB3  . SER B 2 141 ? -86.495  -14.766 -22.756  1.00 0.00 ? 141 SER B HB3  1  
ATOM   4199   H HG   . SER B 2 141 ? -84.092  -14.740 -23.754  1.00 0.00 ? 141 SER B HG   1  
ATOM   4200   N N    . ILE B 2 142 ? -84.256  -17.521 -20.385  1.00 0.00 ? 142 ILE B N    1  
ATOM   4201   C CA   . ILE B 2 142 ? -83.499  -18.763 -20.118  1.00 0.00 ? 142 ILE B CA   1  
ATOM   4202   C C    . ILE B 2 142 ? -84.139  -20.037 -20.679  1.00 0.00 ? 142 ILE B C    1  
ATOM   4203   O O    . ILE B 2 142 ? -85.370  -20.158 -20.741  1.00 0.00 ? 142 ILE B O    1  
ATOM   4204   C CB   . ILE B 2 142 ? -83.135  -18.945 -18.609  1.00 0.00 ? 142 ILE B CB   1  
ATOM   4205   C CG1  . ILE B 2 142 ? -82.278  -20.207 -18.401  1.00 0.00 ? 142 ILE B CG1  1  
ATOM   4206   C CG2  . ILE B 2 142 ? -84.391  -18.976 -17.734  1.00 0.00 ? 142 ILE B CG2  1  
ATOM   4207   C CD1  . ILE B 2 142 ? -81.343  -20.149 -17.194  1.00 0.00 ? 142 ILE B CD1  1  
ATOM   4208   H H    . ILE B 2 142 ? -84.882  -17.191 -19.708  1.00 0.00 ? 142 ILE B H    1  
ATOM   4209   H HA   . ILE B 2 142 ? -82.560  -18.651 -20.642  1.00 0.00 ? 142 ILE B HA   1  
ATOM   4210   H HB   . ILE B 2 142 ? -82.549  -18.086 -18.308  1.00 0.00 ? 142 ILE B HB   1  
ATOM   4211   H HG12 . ILE B 2 142 ? -82.940  -21.049 -18.273  1.00 0.00 ? 142 ILE B HG12 1  
ATOM   4212   H HG13 . ILE B 2 142 ? -81.687  -20.370 -19.292  1.00 0.00 ? 142 ILE B HG13 1  
ATOM   4213   H HG21 . ILE B 2 142 ? -84.235  -18.365 -16.858  1.00 0.00 ? 142 ILE B HG21 1  
ATOM   4214   H HG22 . ILE B 2 142 ? -84.595  -19.993 -17.432  1.00 0.00 ? 142 ILE B HG22 1  
ATOM   4215   H HG23 . ILE B 2 142 ? -85.230  -18.592 -18.296  1.00 0.00 ? 142 ILE B HG23 1  
ATOM   4216   H HD11 . ILE B 2 142 ? -80.331  -20.356 -17.511  1.00 0.00 ? 142 ILE B HD11 1  
ATOM   4217   H HD12 . ILE B 2 142 ? -81.649  -20.885 -16.465  1.00 0.00 ? 142 ILE B HD12 1  
ATOM   4218   H HD13 . ILE B 2 142 ? -81.386  -19.165 -16.751  1.00 0.00 ? 142 ILE B HD13 1  
ATOM   4219   N N    . PHE B 2 143 ? -83.272  -20.970 -21.079  1.00 0.00 ? 143 PHE B N    1  
ATOM   4220   C CA   . PHE B 2 143 ? -83.672  -22.204 -21.768  1.00 0.00 ? 143 PHE B CA   1  
ATOM   4221   C C    . PHE B 2 143 ? -82.995  -23.458 -21.195  1.00 0.00 ? 143 PHE B C    1  
ATOM   4222   O O    . PHE B 2 143 ? -81.783  -23.636 -21.345  1.00 0.00 ? 143 PHE B O    1  
ATOM   4223   C CB   . PHE B 2 143 ? -83.392  -22.094 -23.274  1.00 0.00 ? 143 PHE B CB   1  
ATOM   4224   C CG   . PHE B 2 143 ? -84.286  -21.126 -23.990  1.00 0.00 ? 143 PHE B CG   1  
ATOM   4225   C CD1  . PHE B 2 143 ? -84.130  -19.752 -23.823  1.00 0.00 ? 143 PHE B CD1  1  
ATOM   4226   C CD2  . PHE B 2 143 ? -85.279  -21.588 -24.840  1.00 0.00 ? 143 PHE B CD2  1  
ATOM   4227   C CE1  . PHE B 2 143 ? -84.967  -18.841 -24.479  1.00 0.00 ? 143 PHE B CE1  1  
ATOM   4228   C CE2  . PHE B 2 143 ? -86.116  -20.690 -25.512  1.00 0.00 ? 143 PHE B CE2  1  
ATOM   4229   C CZ   . PHE B 2 143 ? -85.956  -19.308 -25.331  1.00 0.00 ? 143 PHE B CZ   1  
ATOM   4230   H H    . PHE B 2 143 ? -82.314  -20.782 -20.986  1.00 0.00 ? 143 PHE B H    1  
ATOM   4231   H HA   . PHE B 2 143 ? -84.738  -22.319 -21.640  1.00 0.00 ? 143 PHE B HA   1  
ATOM   4232   H HB2  . PHE B 2 143 ? -82.371  -21.777 -23.412  1.00 0.00 ? 143 PHE B HB2  1  
ATOM   4233   H HB3  . PHE B 2 143 ? -83.511  -23.073 -23.718  1.00 0.00 ? 143 PHE B HB3  1  
ATOM   4234   H HD1  . PHE B 2 143 ? -83.359  -19.383 -23.163  1.00 0.00 ? 143 PHE B HD1  1  
ATOM   4235   H HD2  . PHE B 2 143 ? -85.409  -22.650 -24.985  1.00 0.00 ? 143 PHE B HD2  1  
ATOM   4236   H HE1  . PHE B 2 143 ? -84.830  -17.779 -24.337  1.00 0.00 ? 143 PHE B HE1  1  
ATOM   4237   H HE2  . PHE B 2 143 ? -86.885  -21.061 -26.175  1.00 0.00 ? 143 PHE B HE2  1  
ATOM   4238   H HZ   . PHE B 2 143 ? -86.606  -18.613 -25.841  1.00 0.00 ? 143 PHE B HZ   1  
ATOM   4239   N N    . PRO B 2 144 ? -83.790  -24.338 -20.551  1.00 0.00 ? 144 PRO B N    1  
ATOM   4240   C CA   . PRO B 2 144 ? -83.328  -25.588 -19.948  1.00 0.00 ? 144 PRO B CA   1  
ATOM   4241   C C    . PRO B 2 144 ? -82.828  -26.571 -21.004  1.00 0.00 ? 144 PRO B C    1  
ATOM   4242   O O    . PRO B 2 144 ? -83.143  -26.406 -22.182  1.00 0.00 ? 144 PRO B O    1  
ATOM   4243   C CB   . PRO B 2 144 ? -84.602  -26.145 -19.328  1.00 0.00 ? 144 PRO B CB   1  
ATOM   4244   C CG   . PRO B 2 144 ? -85.690  -25.615 -20.211  1.00 0.00 ? 144 PRO B CG   1  
ATOM   4245   C CD   . PRO B 2 144 ? -85.258  -24.219 -20.487  1.00 0.00 ? 144 PRO B CD   1  
ATOM   4246   H HA   . PRO B 2 144 ? -82.589  -25.412 -19.186  1.00 0.00 ? 144 PRO B HA   1  
ATOM   4247   H HB2  . PRO B 2 144 ? -84.588  -27.227 -19.342  1.00 0.00 ? 144 PRO B HB2  1  
ATOM   4248   H HB3  . PRO B 2 144 ? -84.729  -25.777 -18.322  1.00 0.00 ? 144 PRO B HB3  1  
ATOM   4249   H HG2  . PRO B 2 144 ? -85.749  -26.190 -21.126  1.00 0.00 ? 144 PRO B HG2  1  
ATOM   4250   H HG3  . PRO B 2 144 ? -86.637  -25.616 -19.695  1.00 0.00 ? 144 PRO B HG3  1  
ATOM   4251   H HD2  . PRO B 2 144 ? -85.661  -23.874 -21.431  1.00 0.00 ? 144 PRO B HD2  1  
ATOM   4252   H HD3  . PRO B 2 144 ? -85.543  -23.562 -19.681  1.00 0.00 ? 144 PRO B HD3  1  
ATOM   4253   N N    . PRO B 2 145 ? -82.048  -27.585 -20.598  1.00 0.00 ? 145 PRO B N    1  
ATOM   4254   C CA   . PRO B 2 145 ? -81.695  -28.690 -21.490  1.00 0.00 ? 145 PRO B CA   1  
ATOM   4255   C C    . PRO B 2 145 ? -82.892  -29.248 -22.246  1.00 0.00 ? 145 PRO B C    1  
ATOM   4256   O O    . PRO B 2 145 ? -84.028  -28.998 -21.860  1.00 0.00 ? 145 PRO B O    1  
ATOM   4257   C CB   . PRO B 2 145 ? -81.174  -29.742 -20.517  1.00 0.00 ? 145 PRO B CB   1  
ATOM   4258   C CG   . PRO B 2 145 ? -80.517  -28.932 -19.437  1.00 0.00 ? 145 PRO B CG   1  
ATOM   4259   C CD   . PRO B 2 145 ? -81.231  -27.602 -19.373  1.00 0.00 ? 145 PRO B CD   1  
ATOM   4260   H HA   . PRO B 2 145 ? -80.910  -28.403 -22.167  1.00 0.00 ? 145 PRO B HA   1  
ATOM   4261   H HB2  . PRO B 2 145 ? -81.999  -30.314 -20.112  1.00 0.00 ? 145 PRO B HB2  1  
ATOM   4262   H HB3  . PRO B 2 145 ? -80.455  -30.390 -20.992  1.00 0.00 ? 145 PRO B HB3  1  
ATOM   4263   H HG2  . PRO B 2 145 ? -80.604  -29.445 -18.489  1.00 0.00 ? 145 PRO B HG2  1  
ATOM   4264   H HG3  . PRO B 2 145 ? -79.477  -28.774 -19.677  1.00 0.00 ? 145 PRO B HG3  1  
ATOM   4265   H HD2  . PRO B 2 145 ? -81.857  -27.551 -18.493  1.00 0.00 ? 145 PRO B HD2  1  
ATOM   4266   H HD3  . PRO B 2 145 ? -80.523  -26.789 -19.387  1.00 0.00 ? 145 PRO B HD3  1  
ATOM   4267   N N    . SER B 2 146 ? -82.638  -29.986 -23.321  1.00 0.00 ? 146 SER B N    1  
ATOM   4268   C CA   . SER B 2 146 ? -83.708  -30.712 -24.020  1.00 0.00 ? 146 SER B CA   1  
ATOM   4269   C C    . SER B 2 146 ? -83.690  -32.194 -23.689  1.00 0.00 ? 146 SER B C    1  
ATOM   4270   O O    . SER B 2 146 ? -82.645  -32.848 -23.759  1.00 0.00 ? 146 SER B O    1  
ATOM   4271   C CB   . SER B 2 146 ? -83.642  -30.516 -25.534  1.00 0.00 ? 146 SER B CB   1  
ATOM   4272   O OG   . SER B 2 146 ? -82.298  -30.453 -25.953  1.00 0.00 ? 146 SER B OG   1  
ATOM   4273   H H    . SER B 2 146 ? -81.707  -30.140 -23.584  1.00 0.00 ? 146 SER B H    1  
ATOM   4274   H HA   . SER B 2 146 ? -84.652  -30.313 -23.677  1.00 0.00 ? 146 SER B HA   1  
ATOM   4275   H HB2  . SER B 2 146 ? -84.124  -31.344 -26.025  1.00 0.00 ? 146 SER B HB2  1  
ATOM   4276   H HB3  . SER B 2 146 ? -84.155  -29.600 -25.797  1.00 0.00 ? 146 SER B HB3  1  
ATOM   4277   H HG   . SER B 2 146 ? -82.018  -29.535 -25.912  1.00 0.00 ? 146 SER B HG   1  
ATOM   4278   N N    . SER B 2 147 ? -84.864  -32.702 -23.326  1.00 0.00 ? 147 SER B N    1  
ATOM   4279   C CA   . SER B 2 147 ? -85.058  -34.106 -22.981  1.00 0.00 ? 147 SER B CA   1  
ATOM   4280   C C    . SER B 2 147 ? -84.008  -35.008 -23.639  1.00 0.00 ? 147 SER B C    1  
ATOM   4281   O O    . SER B 2 147 ? -83.235  -35.674 -22.935  1.00 0.00 ? 147 SER B O    1  
ATOM   4282   C CB   . SER B 2 147 ? -86.486  -34.544 -23.337  1.00 0.00 ? 147 SER B CB   1  
ATOM   4283   O OG   . SER B 2 147 ? -86.514  -35.843 -23.899  1.00 0.00 ? 147 SER B OG   1  
ATOM   4284   H H    . SER B 2 147 ? -85.640  -32.105 -23.296  1.00 0.00 ? 147 SER B H    1  
ATOM   4285   H HA   . SER B 2 147 ? -84.943  -34.198 -21.910  1.00 0.00 ? 147 SER B HA   1  
ATOM   4286   H HB2  . SER B 2 147 ? -87.089  -34.543 -22.446  1.00 0.00 ? 147 SER B HB2  1  
ATOM   4287   H HB3  . SER B 2 147 ? -86.904  -33.833 -24.040  1.00 0.00 ? 147 SER B HB3  1  
ATOM   4288   H HG   . SER B 2 147 ? -85.665  -36.004 -24.317  1.00 0.00 ? 147 SER B HG   1  
ATOM   4289   N N    . GLU B 2 148 ? -83.957  -34.991 -24.976  1.00 0.00 ? 148 GLU B N    1  
ATOM   4290   C CA   . GLU B 2 148 ? -83.111  -35.921 -25.728  1.00 0.00 ? 148 GLU B CA   1  
ATOM   4291   C C    . GLU B 2 148 ? -81.627  -35.710 -25.481  1.00 0.00 ? 148 GLU B C    1  
ATOM   4292   O O    . GLU B 2 148 ? -80.888  -36.687 -25.371  1.00 0.00 ? 148 GLU B O    1  
ATOM   4293   C CB   . GLU B 2 148 ? -83.428  -35.906 -27.225  1.00 0.00 ? 148 GLU B CB   1  
ATOM   4294   C CG   . GLU B 2 148 ? -83.016  -34.643 -27.957  1.00 0.00 ? 148 GLU B CG   1  
ATOM   4295   C CD   . GLU B 2 148 ? -82.954  -34.842 -29.462  1.00 0.00 ? 148 GLU B CD   1  
ATOM   4296   O OE1  . GLU B 2 148 ? -84.035  -34.886 -30.097  1.00 0.00 ? 148 GLU B OE1  1  
ATOM   4297   O OE2  . GLU B 2 148 ? -81.825  -34.965 -30.006  1.00 0.00 ? 148 GLU B OE2  1  
ATOM   4298   H H    . GLU B 2 148 ? -84.579  -34.414 -25.466  1.00 0.00 ? 148 GLU B H    1  
ATOM   4299   H HA   . GLU B 2 148 ? -83.346  -36.912 -25.367  1.00 0.00 ? 148 GLU B HA   1  
ATOM   4300   H HB2  . GLU B 2 148 ? -82.926  -36.740 -27.687  1.00 0.00 ? 148 GLU B HB2  1  
ATOM   4301   H HB3  . GLU B 2 148 ? -84.494  -36.043 -27.346  1.00 0.00 ? 148 GLU B HB3  1  
ATOM   4302   H HG2  . GLU B 2 148 ? -83.729  -33.863 -27.738  1.00 0.00 ? 148 GLU B HG2  1  
ATOM   4303   H HG3  . GLU B 2 148 ? -82.042  -34.336 -27.603  1.00 0.00 ? 148 GLU B HG3  1  
ATOM   4304   N N    . GLN B 2 149 ? -81.202  -34.448 -25.383  1.00 0.00 ? 149 GLN B N    1  
ATOM   4305   C CA   . GLN B 2 149 ? -79.811  -34.123 -25.035  1.00 0.00 ? 149 GLN B CA   1  
ATOM   4306   C C    . GLN B 2 149 ? -79.420  -34.864 -23.754  1.00 0.00 ? 149 GLN B C    1  
ATOM   4307   O O    . GLN B 2 149 ? -78.331  -35.460 -23.661  1.00 0.00 ? 149 GLN B O    1  
ATOM   4308   C CB   . GLN B 2 149 ? -79.612  -32.609 -24.856  1.00 0.00 ? 149 GLN B CB   1  
ATOM   4309   C CG   . GLN B 2 149 ? -78.351  -32.251 -24.052  1.00 0.00 ? 149 GLN B CG   1  
ATOM   4310   C CD   . GLN B 2 149 ? -78.035  -30.757 -23.991  1.00 0.00 ? 149 GLN B CD   1  
ATOM   4311   O OE1  . GLN B 2 149 ? -76.863  -30.368 -24.019  1.00 0.00 ? 149 GLN B OE1  1  
ATOM   4312   N NE2  . GLN B 2 149 ? -79.073  -29.919 -23.898  1.00 0.00 ? 149 GLN B NE2  1  
ATOM   4313   H H    . GLN B 2 149 ? -81.851  -33.720 -25.473  1.00 0.00 ? 149 GLN B H    1  
ATOM   4314   H HA   . GLN B 2 149 ? -79.170  -34.464 -25.836  1.00 0.00 ? 149 GLN B HA   1  
ATOM   4315   H HB2  . GLN B 2 149 ? -79.540  -32.151 -25.831  1.00 0.00 ? 149 GLN B HB2  1  
ATOM   4316   H HB3  . GLN B 2 149 ? -80.476  -32.204 -24.348  1.00 0.00 ? 149 GLN B HB3  1  
ATOM   4317   H HG2  . GLN B 2 149 ? -78.489  -32.603 -23.042  1.00 0.00 ? 149 GLN B HG2  1  
ATOM   4318   H HG3  . GLN B 2 149 ? -77.507  -32.772 -24.482  1.00 0.00 ? 149 GLN B HG3  1  
ATOM   4319   H HE21 . GLN B 2 149 ? -79.987  -30.272 -23.871  1.00 0.00 ? 149 GLN B HE21 1  
ATOM   4320   H HE22 . GLN B 2 149 ? -78.920  -28.952 -23.855  1.00 0.00 ? 149 GLN B HE22 1  
ATOM   4321   N N    . LEU B 2 150 ? -80.337  -34.830 -22.786  1.00 0.00 ? 150 LEU B N    1  
ATOM   4322   C CA   . LEU B 2 150 ? -80.163  -35.473 -21.495  1.00 0.00 ? 150 LEU B CA   1  
ATOM   4323   C C    . LEU B 2 150 ? -80.096  -36.972 -21.666  1.00 0.00 ? 150 LEU B C    1  
ATOM   4324   O O    . LEU B 2 150 ? -79.075  -37.576 -21.349  1.00 0.00 ? 150 LEU B O    1  
ATOM   4325   C CB   . LEU B 2 150 ? -81.298  -35.078 -20.552  1.00 0.00 ? 150 LEU B CB   1  
ATOM   4326   C CG   . LEU B 2 150 ? -81.287  -33.610 -20.137  1.00 0.00 ? 150 LEU B CG   1  
ATOM   4327   C CD1  . LEU B 2 150 ? -82.667  -33.153 -19.705  1.00 0.00 ? 150 LEU B CD1  1  
ATOM   4328   C CD2  . LEU B 2 150 ? -80.254  -33.389 -19.038  1.00 0.00 ? 150 LEU B CD2  1  
ATOM   4329   H H    . LEU B 2 150 ? -81.173  -34.347 -22.955  1.00 0.00 ? 150 LEU B H    1  
ATOM   4330   H HA   . LEU B 2 150 ? -79.230  -35.136 -21.068  1.00 0.00 ? 150 LEU B HA   1  
ATOM   4331   H HB2  . LEU B 2 150 ? -82.237  -35.282 -21.043  1.00 0.00 ? 150 LEU B HB2  1  
ATOM   4332   H HB3  . LEU B 2 150 ? -81.236  -35.691 -19.664  1.00 0.00 ? 150 LEU B HB3  1  
ATOM   4333   H HG   . LEU B 2 150 ? -80.997  -33.023 -20.998  1.00 0.00 ? 150 LEU B HG   1  
ATOM   4334   H HD11 . LEU B 2 150 ? -83.245  -34.008 -19.385  1.00 0.00 ? 150 LEU B HD11 1  
ATOM   4335   H HD12 . LEU B 2 150 ? -83.164  -32.673 -20.535  1.00 0.00 ? 150 LEU B HD12 1  
ATOM   4336   H HD13 . LEU B 2 150 ? -82.576  -32.454 -18.887  1.00 0.00 ? 150 LEU B HD13 1  
ATOM   4337   H HD21 . LEU B 2 150 ? -80.203  -32.338 -18.798  1.00 0.00 ? 150 LEU B HD21 1  
ATOM   4338   H HD22 . LEU B 2 150 ? -79.287  -33.727 -19.380  1.00 0.00 ? 150 LEU B HD22 1  
ATOM   4339   H HD23 . LEU B 2 150 ? -80.540  -33.946 -18.158  1.00 0.00 ? 150 LEU B HD23 1  
ATOM   4340   N N    . THR B 2 151 ? -81.168  -37.559 -22.201  1.00 0.00 ? 151 THR B N    1  
ATOM   4341   C CA   . THR B 2 151 ? -81.255  -39.015 -22.389  1.00 0.00 ? 151 THR B CA   1  
ATOM   4342   C C    . THR B 2 151 ? -80.195  -39.544 -23.382  1.00 0.00 ? 151 THR B C    1  
ATOM   4343   O O    . THR B 2 151 ? -80.078  -40.758 -23.619  1.00 0.00 ? 151 THR B O    1  
ATOM   4344   C CB   . THR B 2 151 ? -82.707  -39.495 -22.748  1.00 0.00 ? 151 THR B CB   1  
ATOM   4345   O OG1  . THR B 2 151 ? -83.280  -38.634 -23.739  1.00 0.00 ? 151 THR B OG1  1  
ATOM   4346   C CG2  . THR B 2 151 ? -83.613  -39.516 -21.507  1.00 0.00 ? 151 THR B CG2  1  
ATOM   4347   H H    . THR B 2 151 ? -81.935  -37.003 -22.454  1.00 0.00 ? 151 THR B H    1  
ATOM   4348   H HA   . THR B 2 151 ? -81.012  -39.455 -21.430  1.00 0.00 ? 151 THR B HA   1  
ATOM   4349   H HB   . THR B 2 151 ? -82.649  -40.496 -23.152  1.00 0.00 ? 151 THR B HB   1  
ATOM   4350   H HG1  . THR B 2 151 ? -82.725  -37.854 -23.812  1.00 0.00 ? 151 THR B HG1  1  
ATOM   4351   H HG21 . THR B 2 151 ? -83.021  -39.321 -20.625  1.00 0.00 ? 151 THR B HG21 1  
ATOM   4352   H HG22 . THR B 2 151 ? -84.081  -40.486 -21.418  1.00 0.00 ? 151 THR B HG22 1  
ATOM   4353   H HG23 . THR B 2 151 ? -84.375  -38.757 -21.604  1.00 0.00 ? 151 THR B HG23 1  
ATOM   4354   N N    . SER B 2 152 ? -79.413  -38.617 -23.931  1.00 0.00 ? 152 SER B N    1  
ATOM   4355   C CA   . SER B 2 152 ? -78.226  -38.960 -24.704  1.00 0.00 ? 152 SER B CA   1  
ATOM   4356   C C    . SER B 2 152 ? -76.922  -38.518 -24.014  1.00 0.00 ? 152 SER B C    1  
ATOM   4357   O O    . SER B 2 152 ? -75.886  -38.366 -24.665  1.00 0.00 ? 152 SER B O    1  
ATOM   4358   C CB   . SER B 2 152 ? -78.332  -38.400 -26.119  1.00 0.00 ? 152 SER B CB   1  
ATOM   4359   O OG   . SER B 2 152 ? -79.482  -38.915 -26.768  1.00 0.00 ? 152 SER B OG   1  
ATOM   4360   H H    . SER B 2 152 ? -79.553  -37.679 -23.682  1.00 0.00 ? 152 SER B H    1  
ATOM   4361   H HA   . SER B 2 152 ? -78.197  -40.037 -24.784  1.00 0.00 ? 152 SER B HA   1  
ATOM   4362   H HB2  . SER B 2 152 ? -78.408  -37.326 -26.075  1.00 0.00 ? 152 SER B HB2  1  
ATOM   4363   H HB3  . SER B 2 152 ? -77.443  -38.669 -26.675  1.00 0.00 ? 152 SER B HB3  1  
ATOM   4364   H HG   . SER B 2 152 ? -80.063  -39.280 -26.097  1.00 0.00 ? 152 SER B HG   1  
ATOM   4365   N N    . GLY B 2 153 ? -76.992  -38.304 -22.699  1.00 0.00 ? 153 GLY B N    1  
ATOM   4366   C CA   . GLY B 2 153 ? -75.804  -38.249 -21.844  1.00 0.00 ? 153 GLY B CA   1  
ATOM   4367   C C    . GLY B 2 153 ? -75.115  -36.913 -21.644  1.00 0.00 ? 153 GLY B C    1  
ATOM   4368   O O    . GLY B 2 153 ? -73.910  -36.868 -21.369  1.00 0.00 ? 153 GLY B O    1  
ATOM   4369   H H    . GLY B 2 153 ? -77.860  -38.432 -22.263  1.00 0.00 ? 153 GLY B H    1  
ATOM   4370   H HA2  . GLY B 2 153 ? -76.094  -38.604 -20.868  1.00 0.00 ? 153 GLY B HA2  1  
ATOM   4371   H HA3  . GLY B 2 153 ? -75.080  -38.947 -22.243  1.00 0.00 ? 153 GLY B HA3  1  
ATOM   4372   N N    . GLY B 2 154 ? -75.875  -35.827 -21.760  1.00 0.00 ? 154 GLY B N    1  
ATOM   4373   C CA   . GLY B 2 154 ? -75.337  -34.479 -21.559  1.00 0.00 ? 154 GLY B CA   1  
ATOM   4374   C C    . GLY B 2 154 ? -76.415  -33.480 -21.190  1.00 0.00 ? 154 GLY B C    1  
ATOM   4375   O O    . GLY B 2 154 ? -77.608  -33.789 -21.268  1.00 0.00 ? 154 GLY B O    1  
ATOM   4376   H H    . GLY B 2 154 ? -76.827  -35.933 -21.965  1.00 0.00 ? 154 GLY B H    1  
ATOM   4377   H HA2  . GLY B 2 154 ? -74.603  -34.510 -20.767  1.00 0.00 ? 154 GLY B HA2  1  
ATOM   4378   H HA3  . GLY B 2 154 ? -74.856  -34.155 -22.469  1.00 0.00 ? 154 GLY B HA3  1  
ATOM   4379   N N    . ALA B 2 155 ? -75.996  -32.283 -20.781  1.00 0.00 ? 155 ALA B N    1  
ATOM   4380   C CA   . ALA B 2 155 ? -76.938  -31.240 -20.357  1.00 0.00 ? 155 ALA B CA   1  
ATOM   4381   C C    . ALA B 2 155 ? -76.379  -29.831 -20.545  1.00 0.00 ? 155 ALA B C    1  
ATOM   4382   O O    . ALA B 2 155 ? -75.323  -29.507 -19.998  1.00 0.00 ? 155 ALA B O    1  
ATOM   4383   C CB   . ALA B 2 155 ? -77.335  -31.455 -18.901  1.00 0.00 ? 155 ALA B CB   1  
ATOM   4384   H H    . ALA B 2 155 ? -75.033  -32.103 -20.738  1.00 0.00 ? 155 ALA B H    1  
ATOM   4385   H HA   . ALA B 2 155 ? -77.828  -31.329 -20.961  1.00 0.00 ? 155 ALA B HA   1  
ATOM   4386   H HB1  . ALA B 2 155 ? -76.496  -31.226 -18.261  1.00 0.00 ? 155 ALA B HB1  1  
ATOM   4387   H HB2  . ALA B 2 155 ? -77.628  -32.484 -18.756  1.00 0.00 ? 155 ALA B HB2  1  
ATOM   4388   H HB3  . ALA B 2 155 ? -78.163  -30.807 -18.654  1.00 0.00 ? 155 ALA B HB3  1  
ATOM   4389   N N    . SER B 2 156 ? -77.097  -28.999 -21.300  1.00 0.00 ? 156 SER B N    1  
ATOM   4390   C CA   . SER B 2 156 ? -76.646  -27.638 -21.597  1.00 0.00 ? 156 SER B CA   1  
ATOM   4391   C C    . SER B 2 156 ? -77.753  -26.631 -21.361  1.00 0.00 ? 156 SER B C    1  
ATOM   4392   O O    . SER B 2 156 ? -78.889  -26.844 -21.780  1.00 0.00 ? 156 SER B O    1  
ATOM   4393   C CB   . SER B 2 156 ? -76.168  -27.531 -23.048  1.00 0.00 ? 156 SER B CB   1  
ATOM   4394   O OG   . SER B 2 156 ? -75.239  -28.556 -23.363  1.00 0.00 ? 156 SER B OG   1  
ATOM   4395   H H    . SER B 2 156 ? -77.935  -29.318 -21.695  1.00 0.00 ? 156 SER B H    1  
ATOM   4396   H HA   . SER B 2 156 ? -75.819  -27.400 -20.946  1.00 0.00 ? 156 SER B HA   1  
ATOM   4397   H HB2  . SER B 2 156 ? -77.013  -27.615 -23.708  1.00 0.00 ? 156 SER B HB2  1  
ATOM   4398   H HB3  . SER B 2 156 ? -75.706  -26.562 -23.193  1.00 0.00 ? 156 SER B HB3  1  
ATOM   4399   H HG   . SER B 2 156 ? -74.363  -28.165 -23.389  1.00 0.00 ? 156 SER B HG   1  
ATOM   4400   N N    . VAL B 2 157 ? -77.415  -25.522 -20.710  1.00 0.00 ? 157 VAL B N    1  
ATOM   4401   C CA   . VAL B 2 157 ? -78.399  -24.492 -20.388  1.00 0.00 ? 157 VAL B CA   1  
ATOM   4402   C C    . VAL B 2 157 ? -77.997  -23.129 -20.968  1.00 0.00 ? 157 VAL B C    1  
ATOM   4403   O O    . VAL B 2 157 ? -76.890  -22.658 -20.726  1.00 0.00 ? 157 VAL B O    1  
ATOM   4404   C CB   . VAL B 2 157 ? -78.602  -24.399 -18.867  1.00 0.00 ? 157 VAL B CB   1  
ATOM   4405   C CG1  . VAL B 2 157 ? -79.808  -23.529 -18.523  1.00 0.00 ? 157 VAL B CG1  1  
ATOM   4406   C CG2  . VAL B 2 157 ? -78.777  -25.791 -18.282  1.00 0.00 ? 157 VAL B CG2  1  
ATOM   4407   H H    . VAL B 2 157 ? -76.488  -25.405 -20.417  1.00 0.00 ? 157 VAL B H    1  
ATOM   4408   H HA   . VAL B 2 157 ? -79.340  -24.779 -20.834  1.00 0.00 ? 157 VAL B HA   1  
ATOM   4409   H HB   . VAL B 2 157 ? -77.721  -23.949 -18.432  1.00 0.00 ? 157 VAL B HB   1  
ATOM   4410   H HG11 . VAL B 2 157 ? -79.485  -22.679 -17.941  1.00 0.00 ? 157 VAL B HG11 1  
ATOM   4411   H HG12 . VAL B 2 157 ? -80.518  -24.108 -17.951  1.00 0.00 ? 157 VAL B HG12 1  
ATOM   4412   H HG13 . VAL B 2 157 ? -80.275  -23.185 -19.434  1.00 0.00 ? 157 VAL B HG13 1  
ATOM   4413   H HG21 . VAL B 2 157 ? -79.690  -25.827 -17.706  1.00 0.00 ? 157 VAL B HG21 1  
ATOM   4414   H HG22 . VAL B 2 157 ? -77.938  -26.021 -17.642  1.00 0.00 ? 157 VAL B HG22 1  
ATOM   4415   H HG23 . VAL B 2 157 ? -78.829  -26.514 -19.082  1.00 0.00 ? 157 VAL B HG23 1  
ATOM   4416   N N    . VAL B 2 158 ? -78.904  -22.511 -21.736  1.00 0.00 ? 158 VAL B N    1  
ATOM   4417   C CA   . VAL B 2 158 ? -78.623  -21.257 -22.470  1.00 0.00 ? 158 VAL B CA   1  
ATOM   4418   C C    . VAL B 2 158 ? -79.624  -20.135 -22.181  1.00 0.00 ? 158 VAL B C    1  
ATOM   4419   O O    . VAL B 2 158 ? -80.800  -20.389 -21.928  1.00 0.00 ? 158 VAL B O    1  
ATOM   4420   C CB   . VAL B 2 158 ? -78.569  -21.467 -24.038  1.00 0.00 ? 158 VAL B CB   1  
ATOM   4421   C CG1  . VAL B 2 158 ? -77.634  -22.588 -24.424  1.00 0.00 ? 158 VAL B CG1  1  
ATOM   4422   C CG2  . VAL B 2 158 ? -79.945  -21.726 -24.632  1.00 0.00 ? 158 VAL B CG2  1  
ATOM   4423   H H    . VAL B 2 158 ? -79.766  -22.953 -21.884  1.00 0.00 ? 158 VAL B H    1  
ATOM   4424   H HA   . VAL B 2 158 ? -77.650  -20.912 -22.158  1.00 0.00 ? 158 VAL B HA   1  
ATOM   4425   H HB   . VAL B 2 158 ? -78.181  -20.556 -24.473  1.00 0.00 ? 158 VAL B HB   1  
ATOM   4426   H HG11 . VAL B 2 158 ? -77.782  -22.838 -25.464  1.00 0.00 ? 158 VAL B HG11 1  
ATOM   4427   H HG12 . VAL B 2 158 ? -77.838  -23.454 -23.812  1.00 0.00 ? 158 VAL B HG12 1  
ATOM   4428   H HG13 . VAL B 2 158 ? -76.612  -22.273 -24.272  1.00 0.00 ? 158 VAL B HG13 1  
ATOM   4429   H HG21 . VAL B 2 158 ? -80.047  -22.777 -24.860  1.00 0.00 ? 158 VAL B HG21 1  
ATOM   4430   H HG22 . VAL B 2 158 ? -80.061  -21.149 -25.538  1.00 0.00 ? 158 VAL B HG22 1  
ATOM   4431   H HG23 . VAL B 2 158 ? -80.705  -21.437 -23.921  1.00 0.00 ? 158 VAL B HG23 1  
ATOM   4432   N N    . CYS B 2 159 ? -79.150  -18.895 -22.223  1.00 0.00 ? 159 CYS B N    1  
ATOM   4433   C CA   . CYS B 2 159 ? -80.056  -17.750 -22.305  1.00 0.00 ? 159 CYS B CA   1  
ATOM   4434   C C    . CYS B 2 159 ? -79.628  -16.726 -23.348  1.00 0.00 ? 159 CYS B C    1  
ATOM   4435   O O    . CYS B 2 159 ? -78.460  -16.345 -23.423  1.00 0.00 ? 159 CYS B O    1  
ATOM   4436   C CB   . CYS B 2 159 ? -80.322  -17.078 -20.943  1.00 0.00 ? 159 CYS B CB   1  
ATOM   4437   S SG   . CYS B 2 159 ? -79.110  -17.356 -19.631  1.00 0.00 ? 159 CYS B SG   1  
ATOM   4438   H H    . CYS B 2 159 ? -78.202  -18.760 -22.428  1.00 0.00 ? 159 CYS B H    1  
ATOM   4439   H HA   . CYS B 2 159 ? -81.007  -18.145 -22.633  1.00 0.00 ? 159 CYS B HA   1  
ATOM   4440   H HB2  . CYS B 2 159 ? -80.382  -16.016 -21.104  1.00 0.00 ? 159 CYS B HB2  1  
ATOM   4441   H HB3  . CYS B 2 159 ? -81.290  -17.414 -20.593  1.00 0.00 ? 159 CYS B HB3  1  
ATOM   4442   N N    . PHE B 2 160 ? -80.598  -16.303 -24.154  1.00 0.00 ? 160 PHE B N    1  
ATOM   4443   C CA   . PHE B 2 160 ? -80.384  -15.317 -25.200  1.00 0.00 ? 160 PHE B CA   1  
ATOM   4444   C C    . PHE B 2 160 ? -80.554  -13.917 -24.642  1.00 0.00 ? 160 PHE B C    1  
ATOM   4445   O O    . PHE B 2 160 ? -81.384  -13.689 -23.771  1.00 0.00 ? 160 PHE B O    1  
ATOM   4446   C CB   . PHE B 2 160 ? -81.370  -15.531 -26.352  1.00 0.00 ? 160 PHE B CB   1  
ATOM   4447   C CG   . PHE B 2 160 ? -81.314  -16.902 -26.955  1.00 0.00 ? 160 PHE B CG   1  
ATOM   4448   C CD1  . PHE B 2 160 ? -80.219  -17.303 -27.703  1.00 0.00 ? 160 PHE B CD1  1  
ATOM   4449   C CD2  . PHE B 2 160 ? -82.361  -17.791 -26.780  1.00 0.00 ? 160 PHE B CD2  1  
ATOM   4450   C CE1  . PHE B 2 160 ? -80.167  -18.567 -28.258  1.00 0.00 ? 160 PHE B CE1  1  
ATOM   4451   C CE2  . PHE B 2 160 ? -82.318  -19.061 -27.336  1.00 0.00 ? 160 PHE B CE2  1  
ATOM   4452   C CZ   . PHE B 2 160 ? -81.221  -19.450 -28.072  1.00 0.00 ? 160 PHE B CZ   1  
ATOM   4453   H H    . PHE B 2 160 ? -81.500  -16.666 -24.031  1.00 0.00 ? 160 PHE B H    1  
ATOM   4454   H HA   . PHE B 2 160 ? -79.379  -15.423 -25.579  1.00 0.00 ? 160 PHE B HA   1  
ATOM   4455   H HB2  . PHE B 2 160 ? -82.370  -15.364 -25.983  1.00 0.00 ? 160 PHE B HB2  1  
ATOM   4456   H HB3  . PHE B 2 160 ? -81.163  -14.801 -27.122  1.00 0.00 ? 160 PHE B HB3  1  
ATOM   4457   H HD1  . PHE B 2 160 ? -79.396  -16.621 -27.852  1.00 0.00 ? 160 PHE B HD1  1  
ATOM   4458   H HD2  . PHE B 2 160 ? -83.221  -17.493 -26.199  1.00 0.00 ? 160 PHE B HD2  1  
ATOM   4459   H HE1  . PHE B 2 160 ? -79.305  -18.869 -28.835  1.00 0.00 ? 160 PHE B HE1  1  
ATOM   4460   H HE2  . PHE B 2 160 ? -83.142  -19.744 -27.191  1.00 0.00 ? 160 PHE B HE2  1  
ATOM   4461   H HZ   . PHE B 2 160 ? -81.184  -20.438 -28.507  1.00 0.00 ? 160 PHE B HZ   1  
ATOM   4462   N N    . LEU B 2 161 ? -79.760  -12.985 -25.156  1.00 0.00 ? 161 LEU B N    1  
ATOM   4463   C CA   . LEU B 2 161 ? -79.831  -11.583 -24.771  1.00 0.00 ? 161 LEU B CA   1  
ATOM   4464   C C    . LEU B 2 161 ? -80.156  -10.766 -26.020  1.00 0.00 ? 161 LEU B C    1  
ATOM   4465   O O    . LEU B 2 161 ? -79.292  -10.100 -26.591  1.00 0.00 ? 161 LEU B O    1  
ATOM   4466   C CB   . LEU B 2 161 ? -78.495  -11.130 -24.165  1.00 0.00 ? 161 LEU B CB   1  
ATOM   4467   C CG   . LEU B 2 161 ? -77.977  -11.549 -22.780  1.00 0.00 ? 161 LEU B CG   1  
ATOM   4468   C CD1  . LEU B 2 161 ? -78.873  -10.982 -21.686  1.00 0.00 ? 161 LEU B CD1  1  
ATOM   4469   C CD2  . LEU B 2 161 ? -77.759  -13.055 -22.605  1.00 0.00 ? 161 LEU B CD2  1  
ATOM   4470   H H    . LEU B 2 161 ? -79.122  -13.247 -25.852  1.00 0.00 ? 161 LEU B H    1  
ATOM   4471   H HA   . LEU B 2 161 ? -80.619  -11.452 -24.043  1.00 0.00 ? 161 LEU B HA   1  
ATOM   4472   H HB2  . LEU B 2 161 ? -77.733  -11.431 -24.858  1.00 0.00 ? 161 LEU B HB2  1  
ATOM   4473   H HB3  . LEU B 2 161 ? -78.513  -10.045 -24.184  1.00 0.00 ? 161 LEU B HB3  1  
ATOM   4474   H HG   . LEU B 2 161 ? -77.012  -11.068 -22.661  1.00 0.00 ? 161 LEU B HG   1  
ATOM   4475   H HD11 . LEU B 2 161 ? -78.368  -10.163 -21.195  1.00 0.00 ? 161 LEU B HD11 1  
ATOM   4476   H HD12 . LEU B 2 161 ? -79.092  -11.755 -20.963  1.00 0.00 ? 161 LEU B HD12 1  
ATOM   4477   H HD13 . LEU B 2 161 ? -79.794  -10.626 -22.123  1.00 0.00 ? 161 LEU B HD13 1  
ATOM   4478   H HD21 . LEU B 2 161 ? -76.803  -13.228 -22.134  1.00 0.00 ? 161 LEU B HD21 1  
ATOM   4479   H HD22 . LEU B 2 161 ? -77.776  -13.536 -23.572  1.00 0.00 ? 161 LEU B HD22 1  
ATOM   4480   H HD23 . LEU B 2 161 ? -78.545  -13.463 -21.987  1.00 0.00 ? 161 LEU B HD23 1  
ATOM   4481   N N    . ASN B 2 162 ? -81.400  -10.832 -26.462  1.00 0.00 ? 162 ASN B N    1  
ATOM   4482   C CA   . ASN B 2 162 ? -81.756  -10.223 -27.732  1.00 0.00 ? 162 ASN B CA   1  
ATOM   4483   C C    . ASN B 2 162 ? -81.773  -8.696  -27.686  1.00 0.00 ? 162 ASN B C    1  
ATOM   4484   O O    . ASN B 2 162 ? -81.893  -8.107  -26.612  1.00 0.00 ? 162 ASN B O    1  
ATOM   4485   C CB   . ASN B 2 162 ? -83.085  -10.793 -28.251  1.00 0.00 ? 162 ASN B CB   1  
ATOM   4486   C CG   . ASN B 2 162 ? -82.987  -12.277 -28.628  1.00 0.00 ? 162 ASN B CG   1  
ATOM   4487   O OD1  . ASN B 2 162 ? -81.976  -12.940 -28.366  1.00 0.00 ? 162 ASN B OD1  1  
ATOM   4488   N ND2  . ASN B 2 162 ? -84.046  -12.798 -29.250  1.00 0.00 ? 162 ASN B ND2  1  
ATOM   4489   H H    . ASN B 2 162 ? -82.056  -11.387 -25.989  1.00 0.00 ? 162 ASN B H    1  
ATOM   4490   H HA   . ASN B 2 162 ? -80.992  -10.506 -28.441  1.00 0.00 ? 162 ASN B HA   1  
ATOM   4491   H HB2  . ASN B 2 162 ? -83.836  -10.680 -27.484  1.00 0.00 ? 162 ASN B HB2  1  
ATOM   4492   H HB3  . ASN B 2 162 ? -83.388  -10.230 -29.121  1.00 0.00 ? 162 ASN B HB3  1  
ATOM   4493   H HD21 . ASN B 2 162 ? -84.827  -12.237 -29.441  1.00 0.00 ? 162 ASN B HD21 1  
ATOM   4494   H HD22 . ASN B 2 162 ? -84.044  -13.741 -29.517  1.00 0.00 ? 162 ASN B HD22 1  
ATOM   4495   N N    . ASN B 2 163 ? -81.575  -8.091  -28.861  1.00 0.00 ? 163 ASN B N    1  
ATOM   4496   C CA   . ASN B 2 163 ? -81.801  -6.662  -29.152  1.00 0.00 ? 163 ASN B CA   1  
ATOM   4497   C C    . ASN B 2 163 ? -81.207  -5.588  -28.234  1.00 0.00 ? 163 ASN B C    1  
ATOM   4498   O O    . ASN B 2 163 ? -81.845  -4.560  -28.007  1.00 0.00 ? 163 ASN B O    1  
ATOM   4499   C CB   . ASN B 2 163 ? -83.297  -6.402  -29.344  1.00 0.00 ? 163 ASN B CB   1  
ATOM   4500   C CG   . ASN B 2 163 ? -83.879  -7.193  -30.489  1.00 0.00 ? 163 ASN B CG   1  
ATOM   4501   O OD1  . ASN B 2 163 ? -83.880  -8.420  -30.464  1.00 0.00 ? 163 ASN B OD1  1  
ATOM   4502   N ND2  . ASN B 2 163 ? -84.382  -6.494  -31.503  1.00 0.00 ? 163 ASN B ND2  1  
ATOM   4503   H H    . ASN B 2 163 ? -81.430  -8.676  -29.634  1.00 0.00 ? 163 ASN B H    1  
ATOM   4504   H HA   . ASN B 2 163 ? -81.355  -6.492  -30.119  1.00 0.00 ? 163 ASN B HA   1  
ATOM   4505   H HB2  . ASN B 2 163 ? -83.818  -6.668  -28.438  1.00 0.00 ? 163 ASN B HB2  1  
ATOM   4506   H HB3  . ASN B 2 163 ? -83.445  -5.348  -29.535  1.00 0.00 ? 163 ASN B HB3  1  
ATOM   4507   H HD21 . ASN B 2 163 ? -84.363  -5.515  -31.481  1.00 0.00 ? 163 ASN B HD21 1  
ATOM   4508   H HD22 . ASN B 2 163 ? -84.772  -6.959  -32.273  1.00 0.00 ? 163 ASN B HD22 1  
ATOM   4509   N N    . PHE B 2 164 ? -79.993  -5.794  -27.728  1.00 0.00 ? 164 PHE B N    1  
ATOM   4510   C CA   . PHE B 2 164 ? -79.375  -4.778  -26.876  1.00 0.00 ? 164 PHE B CA   1  
ATOM   4511   C C    . PHE B 2 164 ? -78.378  -3.890  -27.608  1.00 0.00 ? 164 PHE B C    1  
ATOM   4512   O O    . PHE B 2 164 ? -77.999  -4.179  -28.739  1.00 0.00 ? 164 PHE B O    1  
ATOM   4513   C CB   . PHE B 2 164 ? -78.744  -5.398  -25.636  1.00 0.00 ? 164 PHE B CB   1  
ATOM   4514   C CG   . PHE B 2 164 ? -77.578  -6.292  -25.915  1.00 0.00 ? 164 PHE B CG   1  
ATOM   4515   C CD1  . PHE B 2 164 ? -76.332  -5.765  -26.240  1.00 0.00 ? 164 PHE B CD1  1  
ATOM   4516   C CD2  . PHE B 2 164 ? -77.707  -7.662  -25.795  1.00 0.00 ? 164 PHE B CD2  1  
ATOM   4517   C CE1  . PHE B 2 164 ? -75.238  -6.600  -26.474  1.00 0.00 ? 164 PHE B CE1  1  
ATOM   4518   C CE2  . PHE B 2 164 ? -76.621  -8.504  -26.019  1.00 0.00 ? 164 PHE B CE2  1  
ATOM   4519   C CZ   . PHE B 2 164 ? -75.387  -7.974  -26.363  1.00 0.00 ? 164 PHE B CZ   1  
ATOM   4520   H H    . PHE B 2 164 ? -79.504  -6.615  -27.946  1.00 0.00 ? 164 PHE B H    1  
ATOM   4521   H HA   . PHE B 2 164 ? -80.172  -4.134  -26.534  1.00 0.00 ? 164 PHE B HA   1  
ATOM   4522   H HB2  . PHE B 2 164 ? -78.410  -4.602  -24.989  1.00 0.00 ? 164 PHE B HB2  1  
ATOM   4523   H HB3  . PHE B 2 164 ? -79.502  -5.966  -25.115  1.00 0.00 ? 164 PHE B HB3  1  
ATOM   4524   H HD1  . PHE B 2 164 ? -76.216  -4.696  -26.337  1.00 0.00 ? 164 PHE B HD1  1  
ATOM   4525   H HD2  . PHE B 2 164 ? -78.664  -8.086  -25.528  1.00 0.00 ? 164 PHE B HD2  1  
ATOM   4526   H HE1  . PHE B 2 164 ? -74.276  -6.177  -26.725  1.00 0.00 ? 164 PHE B HE1  1  
ATOM   4527   H HE2  . PHE B 2 164 ? -76.742  -9.573  -25.931  1.00 0.00 ? 164 PHE B HE2  1  
ATOM   4528   H HZ   . PHE B 2 164 ? -74.546  -8.628  -26.542  1.00 0.00 ? 164 PHE B HZ   1  
ATOM   4529   N N    . TYR B 2 165 ? -77.956  -2.817  -26.939  1.00 0.00 ? 165 TYR B N    1  
ATOM   4530   C CA   . TYR B 2 165 ? -77.030  -1.822  -27.491  1.00 0.00 ? 165 TYR B CA   1  
ATOM   4531   C C    . TYR B 2 165 ? -76.651  -0.809  -26.396  1.00 0.00 ? 165 TYR B C    1  
ATOM   4532   O O    . TYR B 2 165 ? -77.535  -0.298  -25.705  1.00 0.00 ? 165 TYR B O    1  
ATOM   4533   C CB   . TYR B 2 165 ? -77.675  -1.111  -28.690  1.00 0.00 ? 165 TYR B CB   1  
ATOM   4534   C CG   . TYR B 2 165 ? -76.901  0.074   -29.218  1.00 0.00 ? 165 TYR B CG   1  
ATOM   4535   C CD1  . TYR B 2 165 ? -75.718  -0.101  -29.935  1.00 0.00 ? 165 TYR B CD1  1  
ATOM   4536   C CD2  . TYR B 2 165 ? -77.363  1.370   -29.018  1.00 0.00 ? 165 TYR B CD2  1  
ATOM   4537   C CE1  . TYR B 2 165 ? -75.012  0.984   -30.417  1.00 0.00 ? 165 TYR B CE1  1  
ATOM   4538   C CE2  . TYR B 2 165 ? -76.671  2.458   -29.499  1.00 0.00 ? 165 TYR B CE2  1  
ATOM   4539   C CZ   . TYR B 2 165 ? -75.497  2.258   -30.194  1.00 0.00 ? 165 TYR B CZ   1  
ATOM   4540   O OH   . TYR B 2 165 ? -74.803  3.340   -30.673  1.00 0.00 ? 165 TYR B OH   1  
ATOM   4541   H H    . TYR B 2 165 ? -78.306  -2.670  -26.036  1.00 0.00 ? 165 TYR B H    1  
ATOM   4542   H HA   . TYR B 2 165 ? -76.134  -2.326  -27.823  1.00 0.00 ? 165 TYR B HA   1  
ATOM   4543   H HB2  . TYR B 2 165 ? -77.783  -1.825  -29.490  1.00 0.00 ? 165 TYR B HB2  1  
ATOM   4544   H HB3  . TYR B 2 165 ? -78.661  -0.778  -28.396  1.00 0.00 ? 165 TYR B HB3  1  
ATOM   4545   H HD1  . TYR B 2 165 ? -75.341  -1.099  -30.102  1.00 0.00 ? 165 TYR B HD1  1  
ATOM   4546   H HD2  . TYR B 2 165 ? -78.283  1.526   -28.473  1.00 0.00 ? 165 TYR B HD2  1  
ATOM   4547   H HE1  . TYR B 2 165 ? -74.097  0.837   -30.971  1.00 0.00 ? 165 TYR B HE1  1  
ATOM   4548   H HE2  . TYR B 2 165 ? -77.041  3.459   -29.331  1.00 0.00 ? 165 TYR B HE2  1  
ATOM   4549   H HH   . TYR B 2 165 ? -74.383  3.776   -29.928  1.00 0.00 ? 165 TYR B HH   1  
ATOM   4550   N N    . PRO B 2 166 ? -75.348  -0.511  -26.216  1.00 0.00 ? 166 PRO B N    1  
ATOM   4551   C CA   . PRO B 2 166 ? -74.156  -0.941  -26.940  1.00 0.00 ? 166 PRO B CA   1  
ATOM   4552   C C    . PRO B 2 166 ? -73.724  -2.378  -26.642  1.00 0.00 ? 166 PRO B C    1  
ATOM   4553   O O    . PRO B 2 166 ? -74.361  -3.068  -25.839  1.00 0.00 ? 166 PRO B O    1  
ATOM   4554   C CB   . PRO B 2 166 ? -73.072  0.042   -26.455  1.00 0.00 ? 166 PRO B CB   1  
ATOM   4555   C CG   . PRO B 2 166 ? -73.783  1.096   -25.691  1.00 0.00 ? 166 PRO B CG   1  
ATOM   4556   C CD   . PRO B 2 166 ? -74.992  0.437   -25.148  1.00 0.00 ? 166 PRO B CD   1  
ATOM   4557   H HA   . PRO B 2 166 ? -74.297  -0.808  -27.999  1.00 0.00 ? 166 PRO B HA   1  
ATOM   4558   H HB2  . PRO B 2 166 ? -72.366  -0.471  -25.817  1.00 0.00 ? 166 PRO B HB2  1  
ATOM   4559   H HB3  . PRO B 2 166 ? -72.562  0.480   -27.299  1.00 0.00 ? 166 PRO B HB3  1  
ATOM   4560   H HG2  . PRO B 2 166 ? -73.157  1.460   -24.887  1.00 0.00 ? 166 PRO B HG2  1  
ATOM   4561   H HG3  . PRO B 2 166 ? -74.067  1.906   -26.343  1.00 0.00 ? 166 PRO B HG3  1  
ATOM   4562   H HD2  . PRO B 2 166 ? -74.762  -0.084  -24.227  1.00 0.00 ? 166 PRO B HD2  1  
ATOM   4563   H HD3  . PRO B 2 166 ? -75.787  1.150   -25.002  1.00 0.00 ? 166 PRO B HD3  1  
ATOM   4564   N N    . LYS B 2 167 ? -72.635  -2.786  -27.305  1.00 0.00 ? 167 LYS B N    1  
ATOM   4565   C CA   . LYS B 2 167 ? -72.055  -4.135  -27.250  1.00 0.00 ? 167 LYS B CA   1  
ATOM   4566   C C    . LYS B 2 167 ? -71.865  -4.666  -25.831  1.00 0.00 ? 167 LYS B C    1  
ATOM   4567   O O    . LYS B 2 167 ? -72.141  -5.843  -25.558  1.00 0.00 ? 167 LYS B O    1  
ATOM   4568   C CB   . LYS B 2 167 ? -70.702  -4.151  -28.002  1.00 0.00 ? 167 LYS B CB   1  
ATOM   4569   C CG   . LYS B 2 167 ? -70.024  -5.546  -28.210  1.00 0.00 ? 167 LYS B CG   1  
ATOM   4570   C CD   . LYS B 2 167 ? -68.930  -5.877  -27.152  1.00 0.00 ? 167 LYS B CD   1  
ATOM   4571   C CE   . LYS B 2 167 ? -68.188  -7.185  -27.482  1.00 0.00 ? 167 LYS B CE   1  
ATOM   4572   N NZ   . LYS B 2 167 ? -67.225  -7.635  -26.425  1.00 0.00 ? 167 LYS B NZ   1  
ATOM   4573   H H    . LYS B 2 167 ? -72.213  -2.142  -27.911  1.00 0.00 ? 167 LYS B H    1  
ATOM   4574   H HA   . LYS B 2 167 ? -72.724  -4.805  -27.767  1.00 0.00 ? 167 LYS B HA   1  
ATOM   4575   H HB2  . LYS B 2 167 ? -70.857  -3.714  -28.974  1.00 0.00 ? 167 LYS B HB2  1  
ATOM   4576   H HB3  . LYS B 2 167 ? -70.014  -3.518  -27.458  1.00 0.00 ? 167 LYS B HB3  1  
ATOM   4577   H HG2  . LYS B 2 167 ? -70.785  -6.309  -28.165  1.00 0.00 ? 167 LYS B HG2  1  
ATOM   4578   H HG3  . LYS B 2 167 ? -69.575  -5.566  -29.193  1.00 0.00 ? 167 LYS B HG3  1  
ATOM   4579   H HD2  . LYS B 2 167 ? -68.215  -5.068  -27.119  1.00 0.00 ? 167 LYS B HD2  1  
ATOM   4580   H HD3  . LYS B 2 167 ? -69.397  -5.972  -26.182  1.00 0.00 ? 167 LYS B HD3  1  
ATOM   4581   H HE2  . LYS B 2 167 ? -68.917  -7.965  -27.629  1.00 0.00 ? 167 LYS B HE2  1  
ATOM   4582   H HE3  . LYS B 2 167 ? -67.648  -7.045  -28.409  1.00 0.00 ? 167 LYS B HE3  1  
ATOM   4583   H HZ1  . LYS B 2 167 ? -67.751  -8.054  -25.632  1.00 0.00 ? 167 LYS B HZ1  1  
ATOM   4584   H HZ2  . LYS B 2 167 ? -66.677  -6.818  -26.085  1.00 0.00 ? 167 LYS B HZ2  1  
ATOM   4585   H HZ3  . LYS B 2 167 ? -66.579  -8.345  -26.823  1.00 0.00 ? 167 LYS B HZ3  1  
ATOM   4586   N N    . ASP B 2 168 ? -71.400  -3.793  -24.941  1.00 0.00 ? 168 ASP B N    1  
ATOM   4587   C CA   . ASP B 2 168 ? -70.917  -4.204  -23.627  1.00 0.00 ? 168 ASP B CA   1  
ATOM   4588   C C    . ASP B 2 168 ? -72.025  -4.665  -22.688  1.00 0.00 ? 168 ASP B C    1  
ATOM   4589   O O    . ASP B 2 168 ? -72.942  -3.909  -22.351  1.00 0.00 ? 168 ASP B O    1  
ATOM   4590   C CB   . ASP B 2 168 ? -70.073  -3.090  -23.017  1.00 0.00 ? 168 ASP B CB   1  
ATOM   4591   C CG   . ASP B 2 168 ? -69.047  -2.558  -23.997  1.00 0.00 ? 168 ASP B CG   1  
ATOM   4592   O OD1  . ASP B 2 168 ? -68.359  -3.390  -24.634  1.00 0.00 ? 168 ASP B OD1  1  
ATOM   4593   O OD2  . ASP B 2 168 ? -68.944  -1.320  -24.148  1.00 0.00 ? 168 ASP B OD2  1  
ATOM   4594   H H    . ASP B 2 168 ? -71.214  -2.878  -25.239  1.00 0.00 ? 168 ASP B H    1  
ATOM   4595   H HA   . ASP B 2 168 ? -70.264  -5.050  -23.782  1.00 0.00 ? 168 ASP B HA   1  
ATOM   4596   H HB2  . ASP B 2 168 ? -70.722  -2.282  -22.717  1.00 0.00 ? 168 ASP B HB2  1  
ATOM   4597   H HB3  . ASP B 2 168 ? -69.563  -3.474  -22.145  1.00 0.00 ? 168 ASP B HB3  1  
ATOM   4598   N N    . ILE B 2 169 ? -71.917  -5.934  -22.293  1.00 0.00 ? 169 ILE B N    1  
ATOM   4599   C CA   . ILE B 2 169 ? -72.887  -6.600  -21.431  1.00 0.00 ? 169 ILE B CA   1  
ATOM   4600   C C    . ILE B 2 169 ? -72.198  -7.746  -20.675  1.00 0.00 ? 169 ILE B C    1  
ATOM   4601   O O    . ILE B 2 169 ? -71.723  -8.708  -21.285  1.00 0.00 ? 169 ILE B O    1  
ATOM   4602   C CB   . ILE B 2 169 ? -74.130  -7.095  -22.243  1.00 0.00 ? 169 ILE B CB   1  
ATOM   4603   C CG1  . ILE B 2 169 ? -75.105  -7.869  -21.347  1.00 0.00 ? 169 ILE B CG1  1  
ATOM   4604   C CG2  . ILE B 2 169 ? -73.705  -7.928  -23.456  1.00 0.00 ? 169 ILE B CG2  1  
ATOM   4605   C CD1  . ILE B 2 169 ? -76.421  -8.181  -22.012  1.00 0.00 ? 169 ILE B CD1  1  
ATOM   4606   H H    . ILE B 2 169 ? -71.158  -6.457  -22.624  1.00 0.00 ? 169 ILE B H    1  
ATOM   4607   H HA   . ILE B 2 169 ? -73.228  -5.880  -20.699  1.00 0.00 ? 169 ILE B HA   1  
ATOM   4608   H HB   . ILE B 2 169 ? -74.642  -6.217  -22.616  1.00 0.00 ? 169 ILE B HB   1  
ATOM   4609   H HG12 . ILE B 2 169 ? -74.642  -8.798  -21.053  1.00 0.00 ? 169 ILE B HG12 1  
ATOM   4610   H HG13 . ILE B 2 169 ? -75.293  -7.283  -20.458  1.00 0.00 ? 169 ILE B HG13 1  
ATOM   4611   H HG21 . ILE B 2 169 ? -73.825  -7.341  -24.355  1.00 0.00 ? 169 ILE B HG21 1  
ATOM   4612   H HG22 . ILE B 2 169 ? -74.321  -8.812  -23.519  1.00 0.00 ? 169 ILE B HG22 1  
ATOM   4613   H HG23 . ILE B 2 169 ? -72.669  -8.216  -23.350  1.00 0.00 ? 169 ILE B HG23 1  
ATOM   4614   H HD11 . ILE B 2 169 ? -76.243  -8.521  -23.021  1.00 0.00 ? 169 ILE B HD11 1  
ATOM   4615   H HD12 . ILE B 2 169 ? -77.032  -7.290  -22.035  1.00 0.00 ? 169 ILE B HD12 1  
ATOM   4616   H HD13 . ILE B 2 169 ? -76.931  -8.954  -21.457  1.00 0.00 ? 169 ILE B HD13 1  
ATOM   4617   N N    . ASN B 2 170 ? -72.119  -7.619  -19.350  1.00 0.00 ? 170 ASN B N    1  
ATOM   4618   C CA   . ASN B 2 170 ? -71.537  -8.669  -18.520  1.00 0.00 ? 170 ASN B CA   1  
ATOM   4619   C C    . ASN B 2 170 ? -72.633  -9.588  -17.985  1.00 0.00 ? 170 ASN B C    1  
ATOM   4620   O O    . ASN B 2 170 ? -73.368  -9.246  -17.052  1.00 0.00 ? 170 ASN B O    1  
ATOM   4621   C CB   . ASN B 2 170 ? -70.664  -8.088  -17.394  1.00 0.00 ? 170 ASN B CB   1  
ATOM   4622   C CG   . ASN B 2 170 ? -69.661  -9.102  -16.838  1.00 0.00 ? 170 ASN B CG   1  
ATOM   4623   O OD1  . ASN B 2 170 ? -69.138  -9.951  -17.566  1.00 0.00 ? 170 ASN B OD1  1  
ATOM   4624   N ND2  . ASN B 2 170 ? -69.386  -9.006  -15.540  1.00 0.00 ? 170 ASN B ND2  1  
ATOM   4625   H H    . ASN B 2 170 ? -72.493  -6.820  -18.922  1.00 0.00 ? 170 ASN B H    1  
ATOM   4626   H HA   . ASN B 2 170 ? -70.898  -9.266  -19.157  1.00 0.00 ? 170 ASN B HA   1  
ATOM   4627   H HB2  . ASN B 2 170 ? -70.121  -7.239  -17.777  1.00 0.00 ? 170 ASN B HB2  1  
ATOM   4628   H HB3  . ASN B 2 170 ? -71.308  -7.756  -16.592  1.00 0.00 ? 170 ASN B HB3  1  
ATOM   4629   H HD21 . ASN B 2 170 ? -69.818  -8.314  -14.997  1.00 0.00 ? 170 ASN B HD21 1  
ATOM   4630   H HD22 . ASN B 2 170 ? -68.751  -9.627  -15.127  1.00 0.00 ? 170 ASN B HD22 1  
ATOM   4631   N N    . VAL B 2 171 ? -72.734  -10.757 -18.611  1.00 0.00 ? 171 VAL B N    1  
ATOM   4632   C CA   . VAL B 2 171 ? -73.773  -11.731 -18.301  1.00 0.00 ? 171 VAL B CA   1  
ATOM   4633   C C    . VAL B 2 171 ? -73.252  -12.764 -17.303  1.00 0.00 ? 171 VAL B C    1  
ATOM   4634   O O    . VAL B 2 171 ? -72.270  -13.462 -17.565  1.00 0.00 ? 171 VAL B O    1  
ATOM   4635   C CB   . VAL B 2 171 ? -74.334  -12.400 -19.588  1.00 0.00 ? 171 VAL B CB   1  
ATOM   4636   C CG1  . VAL B 2 171 ? -75.245  -13.567 -19.250  1.00 0.00 ? 171 VAL B CG1  1  
ATOM   4637   C CG2  . VAL B 2 171 ? -75.078  -11.375 -20.445  1.00 0.00 ? 171 VAL B CG2  1  
ATOM   4638   H H    . VAL B 2 171 ? -72.119  -10.947 -19.350  1.00 0.00 ? 171 VAL B H    1  
ATOM   4639   H HA   . VAL B 2 171 ? -74.585  -11.200 -17.824  1.00 0.00 ? 171 VAL B HA   1  
ATOM   4640   H HB   . VAL B 2 171 ? -73.498  -12.782 -20.159  1.00 0.00 ? 171 VAL B HB   1  
ATOM   4641   H HG11 . VAL B 2 171 ? -75.269  -14.257 -20.080  1.00 0.00 ? 171 VAL B HG11 1  
ATOM   4642   H HG12 . VAL B 2 171 ? -76.243  -13.200 -19.058  1.00 0.00 ? 171 VAL B HG12 1  
ATOM   4643   H HG13 . VAL B 2 171 ? -74.873  -14.072 -18.372  1.00 0.00 ? 171 VAL B HG13 1  
ATOM   4644   H HG21 . VAL B 2 171 ? -74.542  -11.222 -21.370  1.00 0.00 ? 171 VAL B HG21 1  
ATOM   4645   H HG22 . VAL B 2 171 ? -75.146  -10.440 -19.909  1.00 0.00 ? 171 VAL B HG22 1  
ATOM   4646   H HG23 . VAL B 2 171 ? -76.071  -11.740 -20.660  1.00 0.00 ? 171 VAL B HG23 1  
ATOM   4647   N N    . LYS B 2 172 ? -73.928  -12.839 -16.158  1.00 0.00 ? 172 LYS B N    1  
ATOM   4648   C CA   . LYS B 2 172 ? -73.494  -13.648 -15.022  1.00 0.00 ? 172 LYS B CA   1  
ATOM   4649   C C    . LYS B 2 172 ? -74.500  -14.742 -14.695  1.00 0.00 ? 172 LYS B C    1  
ATOM   4650   O O    . LYS B 2 172 ? -75.665  -14.450 -14.405  1.00 0.00 ? 172 LYS B O    1  
ATOM   4651   C CB   . LYS B 2 172 ? -73.286  -12.751 -13.796  1.00 0.00 ? 172 LYS B CB   1  
ATOM   4652   C CG   . LYS B 2 172 ? -74.290  -11.597 -13.687  1.00 0.00 ? 172 LYS B CG   1  
ATOM   4653   C CD   . LYS B 2 172 ? -74.170  -10.817 -12.378  1.00 0.00 ? 172 LYS B CD   1  
ATOM   4654   C CE   . LYS B 2 172 ? -75.025  -11.424 -11.276  1.00 0.00 ? 172 LYS B CE   1  
ATOM   4655   N NZ   . LYS B 2 172 ? -75.030  -10.579 -10.055  1.00 0.00 ? 172 LYS B NZ   1  
ATOM   4656   H H    . LYS B 2 172 ? -74.697  -12.244 -16.036  1.00 0.00 ? 172 LYS B H    1  
ATOM   4657   H HA   . LYS B 2 172 ? -72.551  -14.110 -15.270  1.00 0.00 ? 172 LYS B HA   1  
ATOM   4658   H HB2  . LYS B 2 172 ? -73.368  -13.358 -12.908  1.00 0.00 ? 172 LYS B HB2  1  
ATOM   4659   H HB3  . LYS B 2 172 ? -72.287  -12.339 -13.839  1.00 0.00 ? 172 LYS B HB3  1  
ATOM   4660   H HG2  . LYS B 2 172 ? -74.133  -10.918 -14.511  1.00 0.00 ? 172 LYS B HG2  1  
ATOM   4661   H HG3  . LYS B 2 172 ? -75.289  -12.003 -13.760  1.00 0.00 ? 172 LYS B HG3  1  
ATOM   4662   H HD2  . LYS B 2 172 ? -73.138  -10.818 -12.062  1.00 0.00 ? 172 LYS B HD2  1  
ATOM   4663   H HD3  . LYS B 2 172 ? -74.484  -9.797  -12.548  1.00 0.00 ? 172 LYS B HD3  1  
ATOM   4664   H HE2  . LYS B 2 172 ? -76.038  -11.516 -11.636  1.00 0.00 ? 172 LYS B HE2  1  
ATOM   4665   H HE3  . LYS B 2 172 ? -74.648  -12.406 -11.032  1.00 0.00 ? 172 LYS B HE3  1  
ATOM   4666   H HZ1  . LYS B 2 172 ? -74.094  -10.146 -9.929   1.00 0.00 ? 172 LYS B HZ1  1  
ATOM   4667   H HZ2  . LYS B 2 172 ? -75.255  -11.169 -9.227   1.00 0.00 ? 172 LYS B HZ2  1  
ATOM   4668   H HZ3  . LYS B 2 172 ? -75.745  -9.831  -10.153  1.00 0.00 ? 172 LYS B HZ3  1  
ATOM   4669   N N    . TRP B 2 173 ? -74.040  -15.995 -14.745  1.00 0.00 ? 173 TRP B N    1  
ATOM   4670   C CA   . TRP B 2 173 ? -74.867  -17.162 -14.397  1.00 0.00 ? 173 TRP B CA   1  
ATOM   4671   C C    . TRP B 2 173 ? -74.950  -17.382 -12.875  1.00 0.00 ? 173 TRP B C    1  
ATOM   4672   O O    . TRP B 2 173 ? -73.970  -17.161 -12.160  1.00 0.00 ? 173 TRP B O    1  
ATOM   4673   C CB   . TRP B 2 173 ? -74.315  -18.434 -15.051  1.00 0.00 ? 173 TRP B CB   1  
ATOM   4674   C CG   . TRP B 2 173 ? -74.553  -18.589 -16.544  1.00 0.00 ? 173 TRP B CG   1  
ATOM   4675   C CD1  . TRP B 2 173 ? -73.708  -18.213 -17.552  1.00 0.00 ? 173 TRP B CD1  1  
ATOM   4676   C CD2  . TRP B 2 173 ? -75.688  -19.203 -17.184  1.00 0.00 ? 173 TRP B CD2  1  
ATOM   4677   N NE1  . TRP B 2 173 ? -74.251  -18.535 -18.774  1.00 0.00 ? 173 TRP B NE1  1  
ATOM   4678   C CE2  . TRP B 2 173 ? -75.464  -19.141 -18.581  1.00 0.00 ? 173 TRP B CE2  1  
ATOM   4679   C CE3  . TRP B 2 173 ? -76.878  -19.783 -16.715  1.00 0.00 ? 173 TRP B CE3  1  
ATOM   4680   C CZ2  . TRP B 2 173 ? -76.387  -19.642 -19.512  1.00 0.00 ? 173 TRP B CZ2  1  
ATOM   4681   C CZ3  . TRP B 2 173 ? -77.794  -20.283 -17.644  1.00 0.00 ? 173 TRP B CZ3  1  
ATOM   4682   C CH2  . TRP B 2 173 ? -77.541  -20.207 -19.024  1.00 0.00 ? 173 TRP B CH2  1  
ATOM   4683   H H    . TRP B 2 173 ? -73.102  -16.141 -14.986  1.00 0.00 ? 173 TRP B H    1  
ATOM   4684   H HA   . TRP B 2 173 ? -75.866  -16.994 -14.772  1.00 0.00 ? 173 TRP B HA   1  
ATOM   4685   H HB2  . TRP B 2 173 ? -73.251  -18.460 -14.884  1.00 0.00 ? 173 TRP B HB2  1  
ATOM   4686   H HB3  . TRP B 2 173 ? -74.753  -19.284 -14.545  1.00 0.00 ? 173 TRP B HB3  1  
ATOM   4687   H HD1  . TRP B 2 173 ? -72.755  -17.725 -17.409  1.00 0.00 ? 173 TRP B HD1  1  
ATOM   4688   H HE1  . TRP B 2 173 ? -73.852  -18.366 -19.653  1.00 0.00 ? 173 TRP B HE1  1  
ATOM   4689   H HE3  . TRP B 2 173 ? -77.079  -19.845 -15.655  1.00 0.00 ? 173 TRP B HE3  1  
ATOM   4690   H HZ2  . TRP B 2 173 ? -76.197  -19.585 -20.574  1.00 0.00 ? 173 TRP B HZ2  1  
ATOM   4691   H HZ3  . TRP B 2 173 ? -78.711  -20.735 -17.296  1.00 0.00 ? 173 TRP B HZ3  1  
ATOM   4692   H HH2  . TRP B 2 173 ? -78.269  -20.603 -19.717  1.00 0.00 ? 173 TRP B HH2  1  
ATOM   4693   N N    . LYS B 2 174 ? -76.117  -17.822 -12.395  1.00 0.00 ? 174 LYS B N    1  
ATOM   4694   C CA   . LYS B 2 174 ? -76.339  -18.133 -10.969  1.00 0.00 ? 174 LYS B CA   1  
ATOM   4695   C C    . LYS B 2 174 ? -76.940  -19.520 -10.779  1.00 0.00 ? 174 LYS B C    1  
ATOM   4696   O O    . LYS B 2 174 ? -77.974  -19.854 -11.370  1.00 0.00 ? 174 LYS B O    1  
ATOM   4697   C CB   . LYS B 2 174 ? -77.264  -17.106 -10.290  1.00 0.00 ? 174 LYS B CB   1  
ATOM   4698   C CG   . LYS B 2 174 ? -76.732  -15.672 -10.197  1.00 0.00 ? 174 LYS B CG   1  
ATOM   4699   C CD   . LYS B 2 174 ? -77.437  -14.894 -9.091   1.00 0.00 ? 174 LYS B CD   1  
ATOM   4700   C CE   . LYS B 2 174 ? -76.961  -13.456 -9.038   1.00 0.00 ? 174 LYS B CE   1  
ATOM   4701   N NZ   . LYS B 2 174 ? -77.263  -12.816 -7.728   1.00 0.00 ? 174 LYS B NZ   1  
ATOM   4702   H H    . LYS B 2 174 ? -76.851  -17.980 -13.025  1.00 0.00 ? 174 LYS B H    1  
ATOM   4703   H HA   . LYS B 2 174 ? -75.383  -18.108 -10.467  1.00 0.00 ? 174 LYS B HA   1  
ATOM   4704   H HB2  . LYS B 2 174 ? -78.192  -17.078 -10.837  1.00 0.00 ? 174 LYS B HB2  1  
ATOM   4705   H HB3  . LYS B 2 174 ? -77.475  -17.458 -9.289   1.00 0.00 ? 174 LYS B HB3  1  
ATOM   4706   H HG2  . LYS B 2 174 ? -75.673  -15.701 -9.989   1.00 0.00 ? 174 LYS B HG2  1  
ATOM   4707   H HG3  . LYS B 2 174 ? -76.894  -15.172 -11.141  1.00 0.00 ? 174 LYS B HG3  1  
ATOM   4708   H HD2  . LYS B 2 174 ? -78.501  -14.907 -9.273   1.00 0.00 ? 174 LYS B HD2  1  
ATOM   4709   H HD3  . LYS B 2 174 ? -77.235  -15.369 -8.142   1.00 0.00 ? 174 LYS B HD3  1  
ATOM   4710   H HE2  . LYS B 2 174 ? -75.894  -13.434 -9.199   1.00 0.00 ? 174 LYS B HE2  1  
ATOM   4711   H HE3  . LYS B 2 174 ? -77.445  -12.897 -9.826   1.00 0.00 ? 174 LYS B HE3  1  
ATOM   4712   H HZ1  . LYS B 2 174 ? -76.906  -11.840 -7.728   1.00 0.00 ? 174 LYS B HZ1  1  
ATOM   4713   H HZ2  . LYS B 2 174 ? -76.802  -13.355 -6.966   1.00 0.00 ? 174 LYS B HZ2  1  
ATOM   4714   H HZ3  . LYS B 2 174 ? -78.291  -12.808 -7.575   1.00 0.00 ? 174 LYS B HZ3  1  
ATOM   4715   N N    . ILE B 2 175 ? -76.285  -20.327 -9.952   1.00 0.00 ? 175 ILE B N    1  
ATOM   4716   C CA   . ILE B 2 175 ? -76.881  -21.576 -9.492   1.00 0.00 ? 175 ILE B CA   1  
ATOM   4717   C C    . ILE B 2 175 ? -77.476  -21.294 -8.107   1.00 0.00 ? 175 ILE B C    1  
ATOM   4718   O O    . ILE B 2 175 ? -76.746  -21.235 -7.105   1.00 0.00 ? 175 ILE B O    1  
ATOM   4719   C CB   . ILE B 2 175 ? -75.874  -22.767 -9.453   1.00 0.00 ? 175 ILE B CB   1  
ATOM   4720   C CG1  . ILE B 2 175 ? -74.747  -22.602 -10.488  1.00 0.00 ? 175 ILE B CG1  1  
ATOM   4721   C CG2  . ILE B 2 175 ? -76.608  -24.085 -9.636   1.00 0.00 ? 175 ILE B CG2  1  
ATOM   4722   C CD1  . ILE B 2 175 ? -75.180  -22.710 -11.951  1.00 0.00 ? 175 ILE B CD1  1  
ATOM   4723   H H    . ILE B 2 175 ? -75.469  -20.001 -9.518   1.00 0.00 ? 175 ILE B H    1  
ATOM   4724   H HA   . ILE B 2 175 ? -77.693  -21.829 -10.163  1.00 0.00 ? 175 ILE B HA   1  
ATOM   4725   H HB   . ILE B 2 175 ? -75.426  -22.781 -8.466   1.00 0.00 ? 175 ILE B HB   1  
ATOM   4726   H HG12 . ILE B 2 175 ? -74.295  -21.634 -10.345  1.00 0.00 ? 175 ILE B HG12 1  
ATOM   4727   H HG13 . ILE B 2 175 ? -73.997  -23.357 -10.294  1.00 0.00 ? 175 ILE B HG13 1  
ATOM   4728   H HG21 . ILE B 2 175 ? -77.671  -23.900 -9.691   1.00 0.00 ? 175 ILE B HG21 1  
ATOM   4729   H HG22 . ILE B 2 175 ? -76.399  -24.734 -8.798   1.00 0.00 ? 175 ILE B HG22 1  
ATOM   4730   H HG23 . ILE B 2 175 ? -76.278  -24.558 -10.549  1.00 0.00 ? 175 ILE B HG23 1  
ATOM   4731   H HD11 . ILE B 2 175 ? -74.320  -22.583 -12.592  1.00 0.00 ? 175 ILE B HD11 1  
ATOM   4732   H HD12 . ILE B 2 175 ? -75.908  -21.942 -12.169  1.00 0.00 ? 175 ILE B HD12 1  
ATOM   4733   H HD13 . ILE B 2 175 ? -75.619  -23.681 -12.126  1.00 0.00 ? 175 ILE B HD13 1  
ATOM   4734   N N    . ASP B 2 176 ? -78.803  -21.113 -8.083   1.00 0.00 ? 176 ASP B N    1  
ATOM   4735   C CA   . ASP B 2 176 ? -79.593  -20.636 -6.920   1.00 0.00 ? 176 ASP B CA   1  
ATOM   4736   C C    . ASP B 2 176 ? -79.080  -19.359 -6.230   1.00 0.00 ? 176 ASP B C    1  
ATOM   4737   O O    . ASP B 2 176 ? -79.864  -18.622 -5.618   1.00 0.00 ? 176 ASP B O    1  
ATOM   4738   C CB   . ASP B 2 176 ? -79.935  -21.759 -5.900   1.00 0.00 ? 176 ASP B CB   1  
ATOM   4739   C CG   . ASP B 2 176 ? -78.882  -22.880 -5.832   1.00 0.00 ? 176 ASP B CG   1  
ATOM   4740   O OD1  . ASP B 2 176 ? -77.743  -22.628 -5.377   1.00 0.00 ? 176 ASP B OD1  1  
ATOM   4741   O OD2  . ASP B 2 176 ? -79.204  -24.026 -6.218   1.00 0.00 ? 176 ASP B OD2  1  
ATOM   4742   H H    . ASP B 2 176 ? -79.275  -21.181 -8.940   1.00 0.00 ? 176 ASP B H    1  
ATOM   4743   H HA   . ASP B 2 176 ? -80.544  -20.344 -7.347   1.00 0.00 ? 176 ASP B HA   1  
ATOM   4744   H HB2  . ASP B 2 176 ? -80.026  -21.317 -4.920   1.00 0.00 ? 176 ASP B HB2  1  
ATOM   4745   H HB3  . ASP B 2 176 ? -80.888  -22.191 -6.172   1.00 0.00 ? 176 ASP B HB3  1  
ATOM   4746   N N    . GLY B 2 177 ? -77.778  -19.100 -6.365   1.00 0.00 ? 177 GLY B N    1  
ATOM   4747   C CA   . GLY B 2 177 ? -77.090  -17.967 -5.738   1.00 0.00 ? 177 GLY B CA   1  
ATOM   4748   C C    . GLY B 2 177 ? -75.578  -18.156 -5.774   1.00 0.00 ? 177 GLY B C    1  
ATOM   4749   O O    . GLY B 2 177 ? -74.825  -17.181 -5.896   1.00 0.00 ? 177 GLY B O    1  
ATOM   4750   H H    . GLY B 2 177 ? -77.238  -19.729 -6.889   1.00 0.00 ? 177 GLY B H    1  
ATOM   4751   H HA2  . GLY B 2 177 ? -77.348  -17.061 -6.266   1.00 0.00 ? 177 GLY B HA2  1  
ATOM   4752   H HA3  . GLY B 2 177 ? -77.411  -17.883 -4.710   1.00 0.00 ? 177 GLY B HA3  1  
ATOM   4753   N N    . SER B 2 178 ? -75.146  -19.418 -5.660   1.00 0.00 ? 178 SER B N    1  
ATOM   4754   C CA   . SER B 2 178 ? -73.735  -19.813 -5.785   1.00 0.00 ? 178 SER B CA   1  
ATOM   4755   C C    . SER B 2 178 ? -73.309  -19.746 -7.248   1.00 0.00 ? 178 SER B C    1  
ATOM   4756   O O    . SER B 2 178 ? -73.909  -20.397 -8.111   1.00 0.00 ? 178 SER B O    1  
ATOM   4757   C CB   . SER B 2 178 ? -73.523  -21.232 -5.248   1.00 0.00 ? 178 SER B CB   1  
ATOM   4758   O OG   . SER B 2 178 ? -74.008  -21.357 -3.927   1.00 0.00 ? 178 SER B OG   1  
ATOM   4759   H H    . SER B 2 178 ? -75.816  -20.126 -5.560   1.00 0.00 ? 178 SER B H    1  
ATOM   4760   H HA   . SER B 2 178 ? -73.128  -19.127 -5.212   1.00 0.00 ? 178 SER B HA   1  
ATOM   4761   H HB2  . SER B 2 178 ? -74.046  -21.932 -5.876   1.00 0.00 ? 178 SER B HB2  1  
ATOM   4762   H HB3  . SER B 2 178 ? -72.465  -21.462 -5.273   1.00 0.00 ? 178 SER B HB3  1  
ATOM   4763   H HG   . SER B 2 178 ? -73.265  -21.255 -3.327   1.00 0.00 ? 178 SER B HG   1  
ATOM   4764   N N    . GLU B 2 179 ? -72.265  -18.972 -7.528   1.00 0.00 ? 179 GLU B N    1  
ATOM   4765   C CA   . GLU B 2 179 ? -71.934  -18.629 -8.909   1.00 0.00 ? 179 GLU B CA   1  
ATOM   4766   C C    . GLU B 2 179 ? -70.609  -19.208 -9.422   1.00 0.00 ? 179 GLU B C    1  
ATOM   4767   O O    . GLU B 2 179 ? -69.544  -18.631 -9.195   1.00 0.00 ? 179 GLU B O    1  
ATOM   4768   C CB   . GLU B 2 179 ? -72.000  -17.103 -9.099   1.00 0.00 ? 179 GLU B CB   1  
ATOM   4769   C CG   . GLU B 2 179 ? -73.407  -16.520 -8.850   1.00 0.00 ? 179 GLU B CG   1  
ATOM   4770   C CD   . GLU B 2 179 ? -73.492  -15.001 -8.998   1.00 0.00 ? 179 GLU B CD   1  
ATOM   4771   O OE1  . GLU B 2 179 ? -72.820  -14.431 -9.893   1.00 0.00 ? 179 GLU B OE1  1  
ATOM   4772   O OE2  . GLU B 2 179 ? -74.245  -14.378 -8.213   1.00 0.00 ? 179 GLU B OE2  1  
ATOM   4773   H H    . GLU B 2 179 ? -71.822  -18.490 -6.799   1.00 0.00 ? 179 GLU B H    1  
ATOM   4774   H HA   . GLU B 2 179 ? -72.713  -19.051 -9.527   1.00 0.00 ? 179 GLU B HA   1  
ATOM   4775   H HB2  . GLU B 2 179 ? -71.309  -16.639 -8.412   1.00 0.00 ? 179 GLU B HB2  1  
ATOM   4776   H HB3  . GLU B 2 179 ? -71.697  -16.866 -10.108  1.00 0.00 ? 179 GLU B HB3  1  
ATOM   4777   H HG2  . GLU B 2 179 ? -74.093  -16.968 -9.552   1.00 0.00 ? 179 GLU B HG2  1  
ATOM   4778   H HG3  . GLU B 2 179 ? -73.717  -16.790 -7.850   1.00 0.00 ? 179 GLU B HG3  1  
ATOM   4779   N N    . ARG B 2 180 ? -70.698  -20.344 -10.119  1.00 0.00 ? 180 ARG B N    1  
ATOM   4780   C CA   . ARG B 2 180 ? -69.551  -20.965 -10.823  1.00 0.00 ? 180 ARG B CA   1  
ATOM   4781   C C    . ARG B 2 180 ? -69.431  -20.516 -12.298  1.00 0.00 ? 180 ARG B C    1  
ATOM   4782   O O    . ARG B 2 180 ? -70.396  -20.002 -12.878  1.00 0.00 ? 180 ARG B O    1  
ATOM   4783   C CB   . ARG B 2 180 ? -69.613  -22.499 -10.724  1.00 0.00 ? 180 ARG B CB   1  
ATOM   4784   C CG   . ARG B 2 180 ? -71.012  -23.122 -10.929  1.00 0.00 ? 180 ARG B CG   1  
ATOM   4785   C CD   . ARG B 2 180 ? -71.401  -23.312 -12.405  1.00 0.00 ? 180 ARG B CD   1  
ATOM   4786   N NE   . ARG B 2 180 ? -70.349  -23.944 -13.202  1.00 0.00 ? 180 ARG B NE   1  
ATOM   4787   C CZ   . ARG B 2 180 ? -69.940  -25.206 -13.070  1.00 0.00 ? 180 ARG B CZ   1  
ATOM   4788   N NH1  . ARG B 2 180 ? -70.473  -26.009 -12.151  1.00 0.00 ? 180 ARG B NH1  1  
ATOM   4789   N NH2  . ARG B 2 180 ? -68.980  -25.670 -13.857  1.00 0.00 ? 180 ARG B NH2  1  
ATOM   4790   H H    . ARG B 2 180 ? -71.587  -20.732 -10.256  1.00 0.00 ? 180 ARG B H    1  
ATOM   4791   H HA   . ARG B 2 180 ? -68.653  -20.643 -10.316  1.00 0.00 ? 180 ARG B HA   1  
ATOM   4792   H HB2  . ARG B 2 180 ? -68.951  -22.913 -11.467  1.00 0.00 ? 180 ARG B HB2  1  
ATOM   4793   H HB3  . ARG B 2 180 ? -69.248  -22.788 -9.748   1.00 0.00 ? 180 ARG B HB3  1  
ATOM   4794   H HG2  . ARG B 2 180 ? -71.009  -24.096 -10.463  1.00 0.00 ? 180 ARG B HG2  1  
ATOM   4795   H HG3  . ARG B 2 180 ? -71.753  -22.509 -10.438  1.00 0.00 ? 180 ARG B HG3  1  
ATOM   4796   H HD2  . ARG B 2 180 ? -72.285  -23.928 -12.455  1.00 0.00 ? 180 ARG B HD2  1  
ATOM   4797   H HD3  . ARG B 2 180 ? -71.632  -22.344 -12.829  1.00 0.00 ? 180 ARG B HD3  1  
ATOM   4798   H HE   . ARG B 2 180 ? -69.912  -23.397 -13.888  1.00 0.00 ? 180 ARG B HE   1  
ATOM   4799   H HH11 . ARG B 2 180 ? -71.192  -25.668 -11.546  1.00 0.00 ? 180 ARG B HH11 1  
ATOM   4800   H HH12 . ARG B 2 180 ? -70.155  -26.953 -12.067  1.00 0.00 ? 180 ARG B HH12 1  
ATOM   4801   H HH21 . ARG B 2 180 ? -68.567  -25.073 -14.545  1.00 0.00 ? 180 ARG B HH21 1  
ATOM   4802   H HH22 . ARG B 2 180 ? -68.669  -26.615 -13.763  1.00 0.00 ? 180 ARG B HH22 1  
ATOM   4803   N N    . GLN B 2 181 ? -68.258  -20.719 -12.906  1.00 0.00 ? 181 GLN B N    1  
ATOM   4804   C CA   . GLN B 2 181 ? -67.987  -20.128 -14.225  1.00 0.00 ? 181 GLN B CA   1  
ATOM   4805   C C    . GLN B 2 181 ? -67.418  -21.071 -15.301  1.00 0.00 ? 181 GLN B C    1  
ATOM   4806   O O    . GLN B 2 181 ? -67.827  -20.988 -16.461  1.00 0.00 ? 181 GLN B O    1  
ATOM   4807   C CB   . GLN B 2 181 ? -67.101  -18.887 -14.078  1.00 0.00 ? 181 GLN B CB   1  
ATOM   4808   C CG   . GLN B 2 181 ? -67.664  -17.632 -14.750  1.00 0.00 ? 181 GLN B CG   1  
ATOM   4809   C CD   . GLN B 2 181 ? -67.637  -17.682 -16.283  1.00 0.00 ? 181 GLN B CD   1  
ATOM   4810   O OE1  . GLN B 2 181 ? -66.736  -18.272 -16.890  1.00 0.00 ? 181 GLN B OE1  1  
ATOM   4811   N NE2  . GLN B 2 181 ? -68.626  -17.043 -16.913  1.00 0.00 ? 181 GLN B NE2  1  
ATOM   4812   H H    . GLN B 2 181 ? -67.526  -21.139 -12.409  1.00 0.00 ? 181 GLN B H    1  
ATOM   4813   H HA   . GLN B 2 181 ? -68.936  -19.779 -14.600  1.00 0.00 ? 181 GLN B HA   1  
ATOM   4814   H HB2  . GLN B 2 181 ? -66.955  -18.683 -13.029  1.00 0.00 ? 181 GLN B HB2  1  
ATOM   4815   H HB3  . GLN B 2 181 ? -66.139  -19.109 -14.519  1.00 0.00 ? 181 GLN B HB3  1  
ATOM   4816   H HG2  . GLN B 2 181 ? -68.685  -17.499 -14.431  1.00 0.00 ? 181 GLN B HG2  1  
ATOM   4817   H HG3  . GLN B 2 181 ? -67.087  -16.779 -14.421  1.00 0.00 ? 181 GLN B HG3  1  
ATOM   4818   H HE21 . GLN B 2 181 ? -69.316  -16.577 -16.396  1.00 0.00 ? 181 GLN B HE21 1  
ATOM   4819   H HE22 . GLN B 2 181 ? -68.661  -17.039 -17.892  1.00 0.00 ? 181 GLN B HE22 1  
ATOM   4820   N N    . ASN B 2 182 ? -66.487  -21.951 -14.926  1.00 0.00 ? 182 ASN B N    1  
ATOM   4821   C CA   . ASN B 2 182 ? -65.840  -22.881 -15.881  1.00 0.00 ? 182 ASN B CA   1  
ATOM   4822   C C    . ASN B 2 182 ? -66.800  -23.643 -16.827  1.00 0.00 ? 182 ASN B C    1  
ATOM   4823   O O    . ASN B 2 182 ? -67.437  -24.624 -16.438  1.00 0.00 ? 182 ASN B O    1  
ATOM   4824   C CB   . ASN B 2 182 ? -64.882  -23.847 -15.150  1.00 0.00 ? 182 ASN B CB   1  
ATOM   4825   C CG   . ASN B 2 182 ? -65.560  -24.621 -14.003  1.00 0.00 ? 182 ASN B CG   1  
ATOM   4826   O OD1  . ASN B 2 182 ? -66.726  -24.383 -13.664  1.00 0.00 ? 182 ASN B OD1  1  
ATOM   4827   N ND2  . ASN B 2 182 ? -64.818  -25.552 -13.403  1.00 0.00 ? 182 ASN B ND2  1  
ATOM   4828   H H    . ASN B 2 182 ? -66.202  -21.965 -13.989  1.00 0.00 ? 182 ASN B H    1  
ATOM   4829   H HA   . ASN B 2 182 ? -65.222  -22.266 -16.519  1.00 0.00 ? 182 ASN B HA   1  
ATOM   4830   H HB2  . ASN B 2 182 ? -64.494  -24.557 -15.863  1.00 0.00 ? 182 ASN B HB2  1  
ATOM   4831   H HB3  . ASN B 2 182 ? -64.057  -23.276 -14.746  1.00 0.00 ? 182 ASN B HB3  1  
ATOM   4832   H HD21 . ASN B 2 182 ? -63.897  -25.711 -13.699  1.00 0.00 ? 182 ASN B HD21 1  
ATOM   4833   H HD22 . ASN B 2 182 ? -65.193  -26.079 -12.666  1.00 0.00 ? 182 ASN B HD22 1  
ATOM   4834   N N    . GLY B 2 183 ? -66.900  -23.172 -18.069  1.00 0.00 ? 183 GLY B N    1  
ATOM   4835   C CA   . GLY B 2 183 ? -67.766  -23.793 -19.076  1.00 0.00 ? 183 GLY B CA   1  
ATOM   4836   C C    . GLY B 2 183 ? -68.961  -22.937 -19.448  1.00 0.00 ? 183 GLY B C    1  
ATOM   4837   O O    . GLY B 2 183 ? -70.092  -23.408 -19.419  1.00 0.00 ? 183 GLY B O    1  
ATOM   4838   H H    . GLY B 2 183 ? -66.374  -22.384 -18.320  1.00 0.00 ? 183 GLY B H    1  
ATOM   4839   H HA2  . GLY B 2 183 ? -67.184  -23.978 -19.967  1.00 0.00 ? 183 GLY B HA2  1  
ATOM   4840   H HA3  . GLY B 2 183 ? -68.121  -24.738 -18.692  1.00 0.00 ? 183 GLY B HA3  1  
ATOM   4841   N N    . VAL B 2 184 ? -68.699  -21.682 -19.804  1.00 0.00 ? 184 VAL B N    1  
ATOM   4842   C CA   . VAL B 2 184 ? -69.739  -20.691 -20.107  1.00 0.00 ? 184 VAL B CA   1  
ATOM   4843   C C    . VAL B 2 184 ? -69.349  -19.856 -21.339  1.00 0.00 ? 184 VAL B C    1  
ATOM   4844   O O    . VAL B 2 184 ? -68.734  -18.790 -21.216  1.00 0.00 ? 184 VAL B O    1  
ATOM   4845   C CB   . VAL B 2 184 ? -70.021  -19.779 -18.870  1.00 0.00 ? 184 VAL B CB   1  
ATOM   4846   C CG1  . VAL B 2 184 ? -70.669  -18.455 -19.277  1.00 0.00 ? 184 VAL B CG1  1  
ATOM   4847   C CG2  . VAL B 2 184 ? -70.881  -20.507 -17.843  1.00 0.00 ? 184 VAL B CG2  1  
ATOM   4848   H H    . VAL B 2 184 ? -67.764  -21.388 -19.808  1.00 0.00 ? 184 VAL B H    1  
ATOM   4849   H HA   . VAL B 2 184 ? -70.648  -21.226 -20.343  1.00 0.00 ? 184 VAL B HA   1  
ATOM   4850   H HB   . VAL B 2 184 ? -69.069  -19.549 -18.410  1.00 0.00 ? 184 VAL B HB   1  
ATOM   4851   H HG11 . VAL B 2 184 ? -71.741  -18.579 -19.326  1.00 0.00 ? 184 VAL B HG11 1  
ATOM   4852   H HG12 . VAL B 2 184 ? -70.297  -18.155 -20.245  1.00 0.00 ? 184 VAL B HG12 1  
ATOM   4853   H HG13 . VAL B 2 184 ? -70.428  -17.697 -18.547  1.00 0.00 ? 184 VAL B HG13 1  
ATOM   4854   H HG21 . VAL B 2 184 ? -70.931  -21.557 -18.094  1.00 0.00 ? 184 VAL B HG21 1  
ATOM   4855   H HG22 . VAL B 2 184 ? -71.877  -20.089 -17.845  1.00 0.00 ? 184 VAL B HG22 1  
ATOM   4856   H HG23 . VAL B 2 184 ? -70.445  -20.392 -16.862  1.00 0.00 ? 184 VAL B HG23 1  
ATOM   4857   N N    . LEU B 2 185 ? -69.712  -20.348 -22.526  1.00 0.00 ? 185 LEU B N    1  
ATOM   4858   C CA   . LEU B 2 185 ? -69.231  -19.779 -23.801  1.00 0.00 ? 185 LEU B CA   1  
ATOM   4859   C C    . LEU B 2 185 ? -70.277  -18.967 -24.582  1.00 0.00 ? 185 LEU B C    1  
ATOM   4860   O O    . LEU B 2 185 ? -71.343  -19.478 -24.934  1.00 0.00 ? 185 LEU B O    1  
ATOM   4861   C CB   . LEU B 2 185 ? -68.640  -20.882 -24.685  1.00 0.00 ? 185 LEU B CB   1  
ATOM   4862   C CG   . LEU B 2 185 ? -67.198  -21.366 -24.483  1.00 0.00 ? 185 LEU B CG   1  
ATOM   4863   C CD1  . LEU B 2 185 ? -66.574  -21.047 -23.115  1.00 0.00 ? 185 LEU B CD1  1  
ATOM   4864   C CD2  . LEU B 2 185 ? -67.142  -22.862 -24.768  1.00 0.00 ? 185 LEU B CD2  1  
ATOM   4865   H H    . LEU B 2 185 ? -70.200  -21.197 -22.549  1.00 0.00 ? 185 LEU B H    1  
ATOM   4866   H HA   . LEU B 2 185 ? -68.425  -19.102 -23.559  1.00 0.00 ? 185 LEU B HA   1  
ATOM   4867   H HB2  . LEU B 2 185 ? -69.270  -21.747 -24.571  1.00 0.00 ? 185 LEU B HB2  1  
ATOM   4868   H HB3  . LEU B 2 185 ? -68.738  -20.550 -25.711  1.00 0.00 ? 185 LEU B HB3  1  
ATOM   4869   H HG   . LEU B 2 185 ? -66.591  -20.875 -25.230  1.00 0.00 ? 185 LEU B HG   1  
ATOM   4870   H HD11 . LEU B 2 185 ? -65.588  -20.630 -23.257  1.00 0.00 ? 185 LEU B HD11 1  
ATOM   4871   H HD12 . LEU B 2 185 ? -66.500  -21.954 -22.532  1.00 0.00 ? 185 LEU B HD12 1  
ATOM   4872   H HD13 . LEU B 2 185 ? -67.195  -20.334 -22.593  1.00 0.00 ? 185 LEU B HD13 1  
ATOM   4873   H HD21 . LEU B 2 185 ? -66.473  -23.337 -24.066  1.00 0.00 ? 185 LEU B HD21 1  
ATOM   4874   H HD22 . LEU B 2 185 ? -66.783  -23.024 -25.774  1.00 0.00 ? 185 LEU B HD22 1  
ATOM   4875   H HD23 . LEU B 2 185 ? -68.131  -23.285 -24.666  1.00 0.00 ? 185 LEU B HD23 1  
ATOM   4876   N N    . ASN B 2 186 ? -69.934  -17.713 -24.871  1.00 0.00 ? 186 ASN B N    1  
ATOM   4877   C CA   . ASN B 2 186 ? -70.862  -16.731 -25.435  1.00 0.00 ? 186 ASN B CA   1  
ATOM   4878   C C    . ASN B 2 186 ? -70.761  -16.546 -26.950  1.00 0.00 ? 186 ASN B C    1  
ATOM   4879   O O    . ASN B 2 186 ? -69.957  -17.204 -27.614  1.00 0.00 ? 186 ASN B O    1  
ATOM   4880   C CB   . ASN B 2 186 ? -70.640  -15.378 -24.756  1.00 0.00 ? 186 ASN B CB   1  
ATOM   4881   C CG   . ASN B 2 186 ? -70.848  -15.431 -23.251  1.00 0.00 ? 186 ASN B CG   1  
ATOM   4882   O OD1  . ASN B 2 186 ? -70.915  -16.506 -22.646  1.00 0.00 ? 186 ASN B OD1  1  
ATOM   4883   N ND2  . ASN B 2 186 ? -70.943  -14.260 -22.635  1.00 0.00 ? 186 ASN B ND2  1  
ATOM   4884   H H    . ASN B 2 186 ? -69.054  -17.398 -24.577  1.00 0.00 ? 186 ASN B H    1  
ATOM   4885   H HA   . ASN B 2 186 ? -71.866  -17.051 -25.204  1.00 0.00 ? 186 ASN B HA   1  
ATOM   4886   H HB2  . ASN B 2 186 ? -69.631  -15.052 -24.954  1.00 0.00 ? 186 ASN B HB2  1  
ATOM   4887   H HB3  . ASN B 2 186 ? -71.327  -14.659 -25.180  1.00 0.00 ? 186 ASN B HB3  1  
ATOM   4888   H HD21 . ASN B 2 186 ? -70.880  -13.429 -23.151  1.00 0.00 ? 186 ASN B HD21 1  
ATOM   4889   H HD22 . ASN B 2 186 ? -71.078  -14.226 -21.665  1.00 0.00 ? 186 ASN B HD22 1  
ATOM   4890   N N    . SER B 2 187 ? -71.614  -15.671 -27.486  1.00 0.00 ? 187 SER B N    1  
ATOM   4891   C CA   . SER B 2 187 ? -71.424  -15.087 -28.820  1.00 0.00 ? 187 SER B CA   1  
ATOM   4892   C C    . SER B 2 187 ? -72.379  -13.945 -29.150  1.00 0.00 ? 187 SER B C    1  
ATOM   4893   O O    . SER B 2 187 ? -73.604  -14.095 -29.084  1.00 0.00 ? 187 SER B O    1  
ATOM   4894   C CB   . SER B 2 187 ? -71.481  -16.122 -29.940  1.00 0.00 ? 187 SER B CB   1  
ATOM   4895   O OG   . SER B 2 187 ? -71.084  -15.508 -31.158  1.00 0.00 ? 187 SER B OG   1  
ATOM   4896   H H    . SER B 2 187 ? -72.241  -15.222 -26.882  1.00 0.00 ? 187 SER B H    1  
ATOM   4897   H HA   . SER B 2 187 ? -70.428  -14.670 -28.832  1.00 0.00 ? 187 SER B HA   1  
ATOM   4898   H HB2  . SER B 2 187 ? -70.816  -16.939 -29.717  1.00 0.00 ? 187 SER B HB2  1  
ATOM   4899   H HB3  . SER B 2 187 ? -72.493  -16.497 -30.028  1.00 0.00 ? 187 SER B HB3  1  
ATOM   4900   H HG   . SER B 2 187 ? -70.457  -14.812 -30.948  1.00 0.00 ? 187 SER B HG   1  
ATOM   4901   N N    . TRP B 2 188 ? -71.789  -12.816 -29.531  1.00 0.00 ? 188 TRP B N    1  
ATOM   4902   C CA   . TRP B 2 188 ? -72.526  -11.630 -29.932  1.00 0.00 ? 188 TRP B CA   1  
ATOM   4903   C C    . TRP B 2 188 ? -72.751  -11.735 -31.429  1.00 0.00 ? 188 TRP B C    1  
ATOM   4904   O O    . TRP B 2 188 ? -71.808  -12.021 -32.168  1.00 0.00 ? 188 TRP B O    1  
ATOM   4905   C CB   . TRP B 2 188 ? -71.705  -10.360 -29.640  1.00 0.00 ? 188 TRP B CB   1  
ATOM   4906   C CG   . TRP B 2 188 ? -71.347  -10.092 -28.185  1.00 0.00 ? 188 TRP B CG   1  
ATOM   4907   C CD1  . TRP B 2 188 ? -71.735  -9.012  -27.435  1.00 0.00 ? 188 TRP B CD1  1  
ATOM   4908   C CD2  . TRP B 2 188 ? -70.510  -10.898 -27.323  1.00 0.00 ? 188 TRP B CD2  1  
ATOM   4909   N NE1  . TRP B 2 188 ? -71.206  -9.100  -26.167  1.00 0.00 ? 188 TRP B NE1  1  
ATOM   4910   C CE2  . TRP B 2 188 ? -70.453  -10.246 -26.069  1.00 0.00 ? 188 TRP B CE2  1  
ATOM   4911   C CE3  . TRP B 2 188 ? -69.816  -12.114 -27.486  1.00 0.00 ? 188 TRP B CE3  1  
ATOM   4912   C CZ2  . TRP B 2 188 ? -69.723  -10.769 -24.980  1.00 0.00 ? 188 TRP B CZ2  1  
ATOM   4913   C CZ3  . TRP B 2 188 ? -69.096  -12.637 -26.401  1.00 0.00 ? 188 TRP B CZ3  1  
ATOM   4914   C CH2  . TRP B 2 188 ? -69.055  -11.959 -25.168  1.00 0.00 ? 188 TRP B CH2  1  
ATOM   4915   H H    . TRP B 2 188 ? -70.810  -12.792 -29.573  1.00 0.00 ? 188 TRP B H    1  
ATOM   4916   H HA   . TRP B 2 188 ? -73.473  -11.587 -29.414  1.00 0.00 ? 188 TRP B HA   1  
ATOM   4917   H HB2  . TRP B 2 188 ? -70.784  -10.424 -30.196  1.00 0.00 ? 188 TRP B HB2  1  
ATOM   4918   H HB3  . TRP B 2 188 ? -72.262  -9.512  -30.016  1.00 0.00 ? 188 TRP B HB3  1  
ATOM   4919   H HD1  . TRP B 2 188 ? -72.368  -8.210  -27.786  1.00 0.00 ? 188 TRP B HD1  1  
ATOM   4920   H HE1  . TRP B 2 188 ? -71.335  -8.460  -25.436  1.00 0.00 ? 188 TRP B HE1  1  
ATOM   4921   H HE3  . TRP B 2 188 ? -69.844  -12.639 -28.430  1.00 0.00 ? 188 TRP B HE3  1  
ATOM   4922   H HZ2  . TRP B 2 188 ? -69.688  -10.253 -24.032  1.00 0.00 ? 188 TRP B HZ2  1  
ATOM   4923   H HZ3  . TRP B 2 188 ? -68.561  -13.568 -26.515  1.00 0.00 ? 188 TRP B HZ3  1  
ATOM   4924   H HH2  . TRP B 2 188 ? -68.493  -12.385 -24.350  1.00 0.00 ? 188 TRP B HH2  1  
ATOM   4925   N N    . THR B 2 189 ? -73.984  -11.524 -31.890  1.00 0.00 ? 189 THR B N    1  
ATOM   4926   C CA   . THR B 2 189 ? -74.180  -11.331 -33.321  1.00 0.00 ? 189 THR B CA   1  
ATOM   4927   C C    . THR B 2 189 ? -73.434  -10.055 -33.682  1.00 0.00 ? 189 THR B C    1  
ATOM   4928   O O    . THR B 2 189 ? -73.270  -9.165  -32.852  1.00 0.00 ? 189 THR B O    1  
ATOM   4929   C CB   . THR B 2 189 ? -75.682  -11.230 -33.793  1.00 0.00 ? 189 THR B CB   1  
ATOM   4930   O OG1  . THR B 2 189 ? -76.263  -9.981  -33.400  1.00 0.00 ? 189 THR B OG1  1  
ATOM   4931   C CG2  . THR B 2 189 ? -76.526  -12.386 -33.285  1.00 0.00 ? 189 THR B CG2  1  
ATOM   4932   H H    . THR B 2 189 ? -74.708  -11.310 -31.266  1.00 0.00 ? 189 THR B H    1  
ATOM   4933   H HA   . THR B 2 189 ? -73.708  -12.156 -33.840  1.00 0.00 ? 189 THR B HA   1  
ATOM   4934   H HB   . THR B 2 189 ? -75.686  -11.265 -34.874  1.00 0.00 ? 189 THR B HB   1  
ATOM   4935   H HG1  . THR B 2 189 ? -75.550  -9.386  -33.155  1.00 0.00 ? 189 THR B HG1  1  
ATOM   4936   H HG21 . THR B 2 189 ? -76.378  -13.247 -33.921  1.00 0.00 ? 189 THR B HG21 1  
ATOM   4937   H HG22 . THR B 2 189 ? -77.569  -12.103 -33.298  1.00 0.00 ? 189 THR B HG22 1  
ATOM   4938   H HG23 . THR B 2 189 ? -76.232  -12.630 -32.275  1.00 0.00 ? 189 THR B HG23 1  
ATOM   4939   N N    . ASP B 2 190 ? -72.934  -9.992  -34.905  1.00 0.00 ? 190 ASP B N    1  
ATOM   4940   C CA   . ASP B 2 190 ? -72.455  -8.738  -35.440  1.00 0.00 ? 190 ASP B CA   1  
ATOM   4941   C C    . ASP B 2 190 ? -73.713  -7.895  -35.647  1.00 0.00 ? 190 ASP B C    1  
ATOM   4942   O O    . ASP B 2 190 ? -74.698  -8.368  -36.217  1.00 0.00 ? 190 ASP B O    1  
ATOM   4943   C CB   . ASP B 2 190 ? -71.655  -8.965  -36.738  1.00 0.00 ? 190 ASP B CB   1  
ATOM   4944   C CG   . ASP B 2 190 ? -70.359  -9.775  -36.504  1.00 0.00 ? 190 ASP B CG   1  
ATOM   4945   O OD1  . ASP B 2 190 ? -70.454  -10.991 -36.210  1.00 0.00 ? 190 ASP B OD1  1  
ATOM   4946   O OD2  . ASP B 2 190 ? -69.246  -9.196  -36.599  1.00 0.00 ? 190 ASP B OD2  1  
ATOM   4947   H H    . ASP B 2 190 ? -73.060  -10.752 -35.512  1.00 0.00 ? 190 ASP B H    1  
ATOM   4948   H HA   . ASP B 2 190 ? -71.824  -8.258  -34.703  1.00 0.00 ? 190 ASP B HA   1  
ATOM   4949   H HB2  . ASP B 2 190 ? -72.275  -9.498  -37.442  1.00 0.00 ? 190 ASP B HB2  1  
ATOM   4950   H HB3  . ASP B 2 190 ? -71.396  -8.005  -37.159  1.00 0.00 ? 190 ASP B HB3  1  
ATOM   4951   N N    . GLN B 2 191 ? -73.682  -6.679  -35.108  1.00 0.00 ? 191 GLN B N    1  
ATOM   4952   C CA   . GLN B 2 191 ? -74.787  -5.700  -35.139  1.00 0.00 ? 191 GLN B CA   1  
ATOM   4953   C C    . GLN B 2 191 ? -75.868  -5.907  -36.234  1.00 0.00 ? 191 GLN B C    1  
ATOM   4954   O O    . GLN B 2 191 ? -75.548  -6.073  -37.410  1.00 0.00 ? 191 GLN B O    1  
ATOM   4955   C CB   . GLN B 2 191 ? -74.178  -4.291  -35.226  1.00 0.00 ? 191 GLN B CB   1  
ATOM   4956   C CG   . GLN B 2 191 ? -75.077  -3.139  -34.821  1.00 0.00 ? 191 GLN B CG   1  
ATOM   4957   C CD   . GLN B 2 191 ? -74.424  -1.799  -35.087  1.00 0.00 ? 191 GLN B CD   1  
ATOM   4958   O OE1  . GLN B 2 191 ? -73.234  -1.622  -34.828  1.00 0.00 ? 191 GLN B OE1  1  
ATOM   4959   N NE2  . GLN B 2 191 ? -75.197  -0.849  -35.612  1.00 0.00 ? 191 GLN B NE2  1  
ATOM   4960   H H    . GLN B 2 191 ? -72.867  -6.421  -34.629  1.00 0.00 ? 191 GLN B H    1  
ATOM   4961   H HA   . GLN B 2 191 ? -75.290  -5.764  -34.187  1.00 0.00 ? 191 GLN B HA   1  
ATOM   4962   H HB2  . GLN B 2 191 ? -73.306  -4.264  -34.594  1.00 0.00 ? 191 GLN B HB2  1  
ATOM   4963   H HB3  . GLN B 2 191 ? -73.855  -4.131  -36.247  1.00 0.00 ? 191 GLN B HB3  1  
ATOM   4964   H HG2  . GLN B 2 191 ? -75.999  -3.198  -35.379  1.00 0.00 ? 191 GLN B HG2  1  
ATOM   4965   H HG3  . GLN B 2 191 ? -75.298  -3.220  -33.767  1.00 0.00 ? 191 GLN B HG3  1  
ATOM   4966   H HE21 . GLN B 2 191 ? -76.139  -1.036  -35.807  1.00 0.00 ? 191 GLN B HE21 1  
ATOM   4967   H HE22 . GLN B 2 191 ? -74.823  0.036   -35.804  1.00 0.00 ? 191 GLN B HE22 1  
ATOM   4968   N N    . ASP B 2 192 ? -77.136  -5.892  -35.818  1.00 0.00 ? 192 ASP B N    1  
ATOM   4969   C CA   . ASP B 2 192 ? -78.306  -6.006  -36.706  1.00 0.00 ? 192 ASP B CA   1  
ATOM   4970   C C    . ASP B 2 192 ? -78.280  -4.917  -37.777  1.00 0.00 ? 192 ASP B C    1  
ATOM   4971   O O    . ASP B 2 192 ? -77.676  -3.869  -37.573  1.00 0.00 ? 192 ASP B O    1  
ATOM   4972   C CB   . ASP B 2 192 ? -79.579  -5.881  -35.863  1.00 0.00 ? 192 ASP B CB   1  
ATOM   4973   C CG   . ASP B 2 192 ? -80.846  -6.219  -36.629  1.00 0.00 ? 192 ASP B CG   1  
ATOM   4974   O OD1  . ASP B 2 192 ? -81.148  -5.579  -37.657  1.00 0.00 ? 192 ASP B OD1  1  
ATOM   4975   O OD2  . ASP B 2 192 ? -81.570  -7.118  -36.171  1.00 0.00 ? 192 ASP B OD2  1  
ATOM   4976   H H    . ASP B 2 192 ? -77.301  -5.756  -34.862  1.00 0.00 ? 192 ASP B H    1  
ATOM   4977   H HA   . ASP B 2 192 ? -78.295  -6.973  -37.184  1.00 0.00 ? 192 ASP B HA   1  
ATOM   4978   H HB2  . ASP B 2 192 ? -79.501  -6.547  -35.017  1.00 0.00 ? 192 ASP B HB2  1  
ATOM   4979   H HB3  . ASP B 2 192 ? -79.652  -4.867  -35.497  1.00 0.00 ? 192 ASP B HB3  1  
ATOM   4980   N N    . SER B 2 193 ? -78.931  -5.158  -38.913  1.00 0.00 ? 193 SER B N    1  
ATOM   4981   C CA   . SER B 2 193 ? -78.924  -4.184  -40.013  1.00 0.00 ? 193 SER B CA   1  
ATOM   4982   C C    . SER B 2 193 ? -80.228  -3.387  -40.146  1.00 0.00 ? 193 SER B C    1  
ATOM   4983   O O    . SER B 2 193 ? -80.221  -2.238  -40.587  1.00 0.00 ? 193 SER B O    1  
ATOM   4984   C CB   . SER B 2 193 ? -78.598  -4.874  -41.336  1.00 0.00 ? 193 SER B CB   1  
ATOM   4985   O OG   . SER B 2 193 ? -79.745  -5.534  -41.841  1.00 0.00 ? 193 SER B OG   1  
ATOM   4986   H H    . SER B 2 193 ? -79.399  -6.011  -39.027  1.00 0.00 ? 193 SER B H    1  
ATOM   4987   H HA   . SER B 2 193 ? -78.133  -3.478  -39.814  1.00 0.00 ? 193 SER B HA   1  
ATOM   4988   H HB2  . SER B 2 193 ? -78.273  -4.139  -42.053  1.00 0.00 ? 193 SER B HB2  1  
ATOM   4989   H HB3  . SER B 2 193 ? -77.801  -5.589  -41.177  1.00 0.00 ? 193 SER B HB3  1  
ATOM   4990   H HG   . SER B 2 193 ? -80.518  -5.143  -41.429  1.00 0.00 ? 193 SER B HG   1  
ATOM   4991   N N    . LYS B 2 194 ? -81.343  -4.012  -39.784  1.00 0.00 ? 194 LYS B N    1  
ATOM   4992   C CA   . LYS B 2 194 ? -82.635  -3.337  -39.782  1.00 0.00 ? 194 LYS B CA   1  
ATOM   4993   C C    . LYS B 2 194 ? -82.757  -2.472  -38.534  1.00 0.00 ? 194 LYS B C    1  
ATOM   4994   O O    . LYS B 2 194 ? -82.957  -1.258  -38.622  1.00 0.00 ? 194 LYS B O    1  
ATOM   4995   C CB   . LYS B 2 194 ? -83.771  -4.356  -39.826  1.00 0.00 ? 194 LYS B CB   1  
ATOM   4996   C CG   . LYS B 2 194 ? -84.932  -3.941  -40.701  1.00 0.00 ? 194 LYS B CG   1  
ATOM   4997   C CD   . LYS B 2 194 ? -85.816  -5.137  -41.002  1.00 0.00 ? 194 LYS B CD   1  
ATOM   4998   C CE   . LYS B 2 194 ? -86.847  -4.797  -42.059  1.00 0.00 ? 194 LYS B CE   1  
ATOM   4999   N NZ   . LYS B 2 194 ? -88.068  -5.650  -41.932  1.00 0.00 ? 194 LYS B NZ   1  
ATOM   5000   H H    . LYS B 2 194 ? -81.287  -4.934  -39.456  1.00 0.00 ? 194 LYS B H    1  
ATOM   5001   H HA   . LYS B 2 194 ? -82.699  -2.703  -40.654  1.00 0.00 ? 194 LYS B HA   1  
ATOM   5002   H HB2  . LYS B 2 194 ? -83.381  -5.290  -40.199  1.00 0.00 ? 194 LYS B HB2  1  
ATOM   5003   H HB3  . LYS B 2 194 ? -84.132  -4.512  -38.819  1.00 0.00 ? 194 LYS B HB3  1  
ATOM   5004   H HG2  . LYS B 2 194 ? -85.512  -3.187  -40.190  1.00 0.00 ? 194 LYS B HG2  1  
ATOM   5005   H HG3  . LYS B 2 194 ? -84.554  -3.535  -41.628  1.00 0.00 ? 194 LYS B HG3  1  
ATOM   5006   H HD2  . LYS B 2 194 ? -85.202  -5.952  -41.356  1.00 0.00 ? 194 LYS B HD2  1  
ATOM   5007   H HD3  . LYS B 2 194 ? -86.322  -5.440  -40.098  1.00 0.00 ? 194 LYS B HD3  1  
ATOM   5008   H HE2  . LYS B 2 194 ? -87.131  -3.761  -41.954  1.00 0.00 ? 194 LYS B HE2  1  
ATOM   5009   H HE3  . LYS B 2 194 ? -86.412  -4.945  -43.037  1.00 0.00 ? 194 LYS B HE3  1  
ATOM   5010   H HZ1  . LYS B 2 194 ? -87.815  -6.645  -42.093  1.00 0.00 ? 194 LYS B HZ1  1  
ATOM   5011   H HZ2  . LYS B 2 194 ? -88.773  -5.352  -42.637  1.00 0.00 ? 194 LYS B HZ2  1  
ATOM   5012   H HZ3  . LYS B 2 194 ? -88.467  -5.545  -40.977  1.00 0.00 ? 194 LYS B HZ3  1  
ATOM   5013   N N    . ASP B 2 195 ? -82.614  -3.111  -37.378  1.00 0.00 ? 195 ASP B N    1  
ATOM   5014   C CA   . ASP B 2 195 ? -82.726  -2.451  -36.087  1.00 0.00 ? 195 ASP B CA   1  
ATOM   5015   C C    . ASP B 2 195 ? -81.381  -1.917  -35.591  1.00 0.00 ? 195 ASP B C    1  
ATOM   5016   O O    . ASP B 2 195 ? -81.339  -1.065  -34.712  1.00 0.00 ? 195 ASP B O    1  
ATOM   5017   C CB   . ASP B 2 195 ? -83.376  -3.411  -35.079  1.00 0.00 ? 195 ASP B CB   1  
ATOM   5018   C CG   . ASP B 2 195 ? -82.510  -3.670  -33.860  1.00 0.00 ? 195 ASP B CG   1  
ATOM   5019   O OD1  . ASP B 2 195 ? -82.572  -2.871  -32.910  1.00 0.00 ? 195 ASP B OD1  1  
ATOM   5020   O OD2  . ASP B 2 195 ? -81.761  -4.670  -33.855  1.00 0.00 ? 195 ASP B OD2  1  
ATOM   5021   H H    . ASP B 2 195 ? -82.443  -4.076  -37.396  1.00 0.00 ? 195 ASP B H    1  
ATOM   5022   H HA   . ASP B 2 195 ? -83.387  -1.606  -36.208  1.00 0.00 ? 195 ASP B HA   1  
ATOM   5023   H HB2  . ASP B 2 195 ? -84.314  -2.991  -34.753  1.00 0.00 ? 195 ASP B HB2  1  
ATOM   5024   H HB3  . ASP B 2 195 ? -83.571  -4.351  -35.575  1.00 0.00 ? 195 ASP B HB3  1  
ATOM   5025   N N    . SER B 2 196 ? -80.291  -2.432  -36.151  1.00 0.00 ? 196 SER B N    1  
ATOM   5026   C CA   . SER B 2 196 ? -78.944  -1.919  -35.886  1.00 0.00 ? 196 SER B CA   1  
ATOM   5027   C C    . SER B 2 196 ? -78.479  -2.038  -34.439  1.00 0.00 ? 196 SER B C    1  
ATOM   5028   O O    . SER B 2 196 ? -77.813  -1.143  -33.914  1.00 0.00 ? 196 SER B O    1  
ATOM   5029   C CB   . SER B 2 196 ? -78.807  -0.476  -36.383  1.00 0.00 ? 196 SER B CB   1  
ATOM   5030   O OG   . SER B 2 196 ? -79.204  -0.391  -37.738  1.00 0.00 ? 196 SER B OG   1  
ATOM   5031   H H    . SER B 2 196 ? -80.401  -3.119  -36.841  1.00 0.00 ? 196 SER B H    1  
ATOM   5032   H HA   . SER B 2 196 ? -78.266  -2.516  -36.477  1.00 0.00 ? 196 SER B HA   1  
ATOM   5033   H HB2  . SER B 2 196 ? -79.434  0.170   -35.792  1.00 0.00 ? 196 SER B HB2  1  
ATOM   5034   H HB3  . SER B 2 196 ? -77.776  -0.161  -36.280  1.00 0.00 ? 196 SER B HB3  1  
ATOM   5035   H HG   . SER B 2 196 ? -78.802  0.394   -38.116  1.00 0.00 ? 196 SER B HG   1  
ATOM   5036   N N    . THR B 2 197 ? -78.812  -3.157  -33.805  1.00 0.00 ? 197 THR B N    1  
ATOM   5037   C CA   . THR B 2 197 ? -78.404  -3.401  -32.421  1.00 0.00 ? 197 THR B CA   1  
ATOM   5038   C C    . THR B 2 197 ? -77.942  -4.840  -32.195  1.00 0.00 ? 197 THR B C    1  
ATOM   5039   O O    . THR B 2 197 ? -78.585  -5.776  -32.675  1.00 0.00 ? 197 THR B O    1  
ATOM   5040   C CB   . THR B 2 197 ? -79.564  -3.130  -31.439  1.00 0.00 ? 197 THR B CB   1  
ATOM   5041   O OG1  . THR B 2 197 ? -80.597  -4.100  -31.648  1.00 0.00 ? 197 THR B OG1  1  
ATOM   5042   C CG2  . THR B 2 197 ? -80.127  -1.691  -31.587  1.00 0.00 ? 197 THR B CG2  1  
ATOM   5043   H H    . THR B 2 197 ? -79.329  -3.841  -34.280  1.00 0.00 ? 197 THR B H    1  
ATOM   5044   H HA   . THR B 2 197 ? -77.591  -2.735  -32.179  1.00 0.00 ? 197 THR B HA   1  
ATOM   5045   H HB   . THR B 2 197 ? -79.188  -3.247  -30.432  1.00 0.00 ? 197 THR B HB   1  
ATOM   5046   H HG1  . THR B 2 197 ? -80.804  -4.500  -30.800  1.00 0.00 ? 197 THR B HG1  1  
ATOM   5047   H HG21 . THR B 2 197 ? -80.825  -1.661  -32.410  1.00 0.00 ? 197 THR B HG21 1  
ATOM   5048   H HG22 . THR B 2 197 ? -79.316  -1.005  -31.779  1.00 0.00 ? 197 THR B HG22 1  
ATOM   5049   H HG23 . THR B 2 197 ? -80.631  -1.406  -30.675  1.00 0.00 ? 197 THR B HG23 1  
ATOM   5050   N N    . TYR B 2 198 ? -76.860  -5.010  -31.436  1.00 0.00 ? 198 TYR B N    1  
ATOM   5051   C CA   . TYR B 2 198 ? -76.299  -6.329  -31.117  1.00 0.00 ? 198 TYR B CA   1  
ATOM   5052   C C    . TYR B 2 198 ? -77.305  -7.342  -30.555  1.00 0.00 ? 198 TYR B C    1  
ATOM   5053   O O    . TYR B 2 198 ? -78.482  -7.034  -30.364  1.00 0.00 ? 198 TYR B O    1  
ATOM   5054   C CB   . TYR B 2 198 ? -75.166  -6.193  -30.101  1.00 0.00 ? 198 TYR B CB   1  
ATOM   5055   C CG   . TYR B 2 198 ? -73.991  -5.333  -30.518  1.00 0.00 ? 198 TYR B CG   1  
ATOM   5056   C CD1  . TYR B 2 198 ? -74.045  -3.936  -30.403  1.00 0.00 ? 198 TYR B CD1  1  
ATOM   5057   C CD2  . TYR B 2 198 ? -72.806  -5.911  -30.981  1.00 0.00 ? 198 TYR B CD2  1  
ATOM   5058   C CE1  . TYR B 2 198 ? -72.960  -3.143  -30.767  1.00 0.00 ? 198 TYR B CE1  1  
ATOM   5059   C CE2  . TYR B 2 198 ? -71.718  -5.126  -31.347  1.00 0.00 ? 198 TYR B CE2  1  
ATOM   5060   C CZ   . TYR B 2 198 ? -71.805  -3.745  -31.240  1.00 0.00 ? 198 TYR B CZ   1  
ATOM   5061   O OH   . TYR B 2 198 ? -70.737  -2.959  -31.596  1.00 0.00 ? 198 TYR B OH   1  
ATOM   5062   H H    . TYR B 2 198 ? -76.421  -4.215  -31.066  1.00 0.00 ? 198 TYR B H    1  
ATOM   5063   H HA   . TYR B 2 198 ? -75.879  -6.740  -32.022  1.00 0.00 ? 198 TYR B HA   1  
ATOM   5064   H HB2  . TYR B 2 198 ? -75.576  -5.776  -29.196  1.00 0.00 ? 198 TYR B HB2  1  
ATOM   5065   H HB3  . TYR B 2 198 ? -74.801  -7.186  -29.876  1.00 0.00 ? 198 TYR B HB3  1  
ATOM   5066   H HD1  . TYR B 2 198 ? -74.950  -3.467  -30.047  1.00 0.00 ? 198 TYR B HD1  1  
ATOM   5067   H HD2  . TYR B 2 198 ? -72.737  -6.986  -31.065  1.00 0.00 ? 198 TYR B HD2  1  
ATOM   5068   H HE1  . TYR B 2 198 ? -73.015  -2.068  -30.673  1.00 0.00 ? 198 TYR B HE1  1  
ATOM   5069   H HE2  . TYR B 2 198 ? -70.814  -5.587  -31.716  1.00 0.00 ? 198 TYR B HE2  1  
ATOM   5070   H HH   . TYR B 2 198 ? -70.362  -2.587  -30.795  1.00 0.00 ? 198 TYR B HH   1  
ATOM   5071   N N    . SER B 2 199 ? -76.820  -8.560  -30.317  1.00 0.00 ? 199 SER B N    1  
ATOM   5072   C CA   . SER B 2 199 ? -77.517  -9.603  -29.555  1.00 0.00 ? 199 SER B CA   1  
ATOM   5073   C C    . SER B 2 199 ? -76.430  -10.412 -28.859  1.00 0.00 ? 199 SER B C    1  
ATOM   5074   O O    . SER B 2 199 ? -75.260  -10.038 -28.930  1.00 0.00 ? 199 SER B O    1  
ATOM   5075   C CB   . SER B 2 199 ? -78.338  -10.504 -30.472  1.00 0.00 ? 199 SER B CB   1  
ATOM   5076   O OG   . SER B 2 199 ? -79.216  -9.745  -31.271  1.00 0.00 ? 199 SER B OG   1  
ATOM   5077   H H    . SER B 2 199 ? -75.874  -8.714  -30.523  1.00 0.00 ? 199 SER B H    1  
ATOM   5078   H HA   . SER B 2 199 ? -78.159  -9.145  -28.815  1.00 0.00 ? 199 SER B HA   1  
ATOM   5079   H HB2  . SER B 2 199 ? -77.680  -11.069 -31.109  1.00 0.00 ? 199 SER B HB2  1  
ATOM   5080   H HB3  . SER B 2 199 ? -78.908  -11.192 -29.859  1.00 0.00 ? 199 SER B HB3  1  
ATOM   5081   H HG   . SER B 2 199 ? -79.108  -8.821  -31.036  1.00 0.00 ? 199 SER B HG   1  
ATOM   5082   N N    . MET B 2 200 ? -76.790  -11.504 -28.191  1.00 0.00 ? 200 MET B N    1  
ATOM   5083   C CA   . MET B 2 200 ? -75.793  -12.356 -27.531  1.00 0.00 ? 200 MET B CA   1  
ATOM   5084   C C    . MET B 2 200 ? -76.409  -13.681 -27.111  1.00 0.00 ? 200 MET B C    1  
ATOM   5085   O O    . MET B 2 200 ? -77.631  -13.805 -27.104  1.00 0.00 ? 200 MET B O    1  
ATOM   5086   C CB   . MET B 2 200 ? -75.218  -11.664 -26.298  1.00 0.00 ? 200 MET B CB   1  
ATOM   5087   C CG   . MET B 2 200 ? -73.742  -11.926 -26.094  1.00 0.00 ? 200 MET B CG   1  
ATOM   5088   S SD   . MET B 2 200 ? -73.237  -12.182 -24.380  1.00 0.00 ? 200 MET B SD   1  
ATOM   5089   C CE   . MET B 2 200 ? -73.913  -13.811 -24.084  1.00 0.00 ? 200 MET B CE   1  
ATOM   5090   H H    . MET B 2 200 ? -77.735  -11.760 -28.162  1.00 0.00 ? 200 MET B H    1  
ATOM   5091   H HA   . MET B 2 200 ? -74.989  -12.551 -28.225  1.00 0.00 ? 200 MET B HA   1  
ATOM   5092   H HB2  . MET B 2 200 ? -75.366  -10.600 -26.398  1.00 0.00 ? 200 MET B HB2  1  
ATOM   5093   H HB3  . MET B 2 200 ? -75.758  -12.006 -25.426  1.00 0.00 ? 200 MET B HB3  1  
ATOM   5094   H HG2  . MET B 2 200 ? -73.472  -12.805 -26.656  1.00 0.00 ? 200 MET B HG2  1  
ATOM   5095   H HG3  . MET B 2 200 ? -73.192  -11.085 -26.496  1.00 0.00 ? 200 MET B HG3  1  
ATOM   5096   H HE1  . MET B 2 200 ? -73.260  -14.555 -24.518  1.00 0.00 ? 200 MET B HE1  1  
ATOM   5097   H HE2  . MET B 2 200 ? -74.889  -13.885 -24.538  1.00 0.00 ? 200 MET B HE2  1  
ATOM   5098   H HE3  . MET B 2 200 ? -73.999  -13.976 -23.019  1.00 0.00 ? 200 MET B HE3  1  
ATOM   5099   N N    . SER B 2 201 ? -75.577  -14.665 -26.762  1.00 0.00 ? 201 SER B N    1  
ATOM   5100   C CA   . SER B 2 201 ? -76.069  -15.958 -26.256  1.00 0.00 ? 201 SER B CA   1  
ATOM   5101   C C    . SER B 2 201 ? -75.013  -16.736 -25.474  1.00 0.00 ? 201 SER B C    1  
ATOM   5102   O O    . SER B 2 201 ? -74.049  -17.243 -26.053  1.00 0.00 ? 201 SER B O    1  
ATOM   5103   C CB   . SER B 2 201 ? -76.624  -16.829 -27.391  1.00 0.00 ? 201 SER B CB   1  
ATOM   5104   O OG   . SER B 2 201 ? -75.579  -17.415 -28.150  1.00 0.00 ? 201 SER B OG   1  
ATOM   5105   H H    . SER B 2 201 ? -74.611  -14.502 -26.789  1.00 0.00 ? 201 SER B H    1  
ATOM   5106   H HA   . SER B 2 201 ? -76.884  -15.750 -25.579  1.00 0.00 ? 201 SER B HA   1  
ATOM   5107   H HB2  . SER B 2 201 ? -77.228  -17.615 -26.972  1.00 0.00 ? 201 SER B HB2  1  
ATOM   5108   H HB3  . SER B 2 201 ? -77.244  -16.217 -28.033  1.00 0.00 ? 201 SER B HB3  1  
ATOM   5109   H HG   . SER B 2 201 ? -74.747  -17.042 -27.846  1.00 0.00 ? 201 SER B HG   1  
ATOM   5110   N N    . SER B 2 202 ? -75.212  -16.830 -24.159  1.00 0.00 ? 202 SER B N    1  
ATOM   5111   C CA   . SER B 2 202 ? -74.323  -17.592 -23.286  1.00 0.00 ? 202 SER B CA   1  
ATOM   5112   C C    . SER B 2 202 ? -74.816  -19.015 -23.056  1.00 0.00 ? 202 SER B C    1  
ATOM   5113   O O    . SER B 2 202 ? -76.007  -19.248 -22.860  1.00 0.00 ? 202 SER B O    1  
ATOM   5114   C CB   . SER B 2 202 ? -74.156  -16.900 -21.943  1.00 0.00 ? 202 SER B CB   1  
ATOM   5115   O OG   . SER B 2 202 ? -73.366  -17.702 -21.088  1.00 0.00 ? 202 SER B OG   1  
ATOM   5116   H H    . SER B 2 202 ? -76.005  -16.406 -23.770  1.00 0.00 ? 202 SER B H    1  
ATOM   5117   H HA   . SER B 2 202 ? -73.353  -17.645 -23.758  1.00 0.00 ? 202 SER B HA   1  
ATOM   5118   H HB2  . SER B 2 202 ? -73.668  -15.950 -22.086  1.00 0.00 ? 202 SER B HB2  1  
ATOM   5119   H HB3  . SER B 2 202 ? -75.131  -16.736 -21.502  1.00 0.00 ? 202 SER B HB3  1  
ATOM   5120   H HG   . SER B 2 202 ? -72.890  -17.119 -20.491  1.00 0.00 ? 202 SER B HG   1  
ATOM   5121   N N    . THR B 2 203 ? -73.882  -19.957 -23.057  1.00 0.00 ? 203 THR B N    1  
ATOM   5122   C CA   . THR B 2 203 ? -74.203  -21.368 -22.915  1.00 0.00 ? 203 THR B CA   1  
ATOM   5123   C C    . THR B 2 203 ? -73.409  -21.988 -21.775  1.00 0.00 ? 203 THR B C    1  
ATOM   5124   O O    . THR B 2 203 ? -72.180  -22.095 -21.822  1.00 0.00 ? 203 THR B O    1  
ATOM   5125   C CB   . THR B 2 203 ? -73.931  -22.146 -24.227  1.00 0.00 ? 203 THR B CB   1  
ATOM   5126   O OG1  . THR B 2 203 ? -74.788  -21.656 -25.262  1.00 0.00 ? 203 THR B OG1  1  
ATOM   5127   C CG2  . THR B 2 203 ? -74.170  -23.648 -24.046  1.00 0.00 ? 203 THR B CG2  1  
ATOM   5128   H H    . THR B 2 203 ? -72.948  -19.696 -23.201  1.00 0.00 ? 203 THR B H    1  
ATOM   5129   H HA   . THR B 2 203 ? -75.254  -21.454 -22.683  1.00 0.00 ? 203 THR B HA   1  
ATOM   5130   H HB   . THR B 2 203 ? -72.903  -21.989 -24.520  1.00 0.00 ? 203 THR B HB   1  
ATOM   5131   H HG1  . THR B 2 203 ? -74.493  -20.773 -25.497  1.00 0.00 ? 203 THR B HG1  1  
ATOM   5132   H HG21 . THR B 2 203 ? -75.115  -23.918 -24.492  1.00 0.00 ? 203 THR B HG21 1  
ATOM   5133   H HG22 . THR B 2 203 ? -74.188  -23.885 -22.992  1.00 0.00 ? 203 THR B HG22 1  
ATOM   5134   H HG23 . THR B 2 203 ? -73.374  -24.199 -24.525  1.00 0.00 ? 203 THR B HG23 1  
ATOM   5135   N N    . LEU B 2 204 ? -74.133  -22.395 -20.748  1.00 0.00 ? 204 LEU B N    1  
ATOM   5136   C CA   . LEU B 2 204 ? -73.560  -23.156 -19.665  1.00 0.00 ? 204 LEU B CA   1  
ATOM   5137   C C    . LEU B 2 204 ? -73.701  -24.638 -19.997  1.00 0.00 ? 204 LEU B C    1  
ATOM   5138   O O    . LEU B 2 204 ? -74.810  -25.137 -20.211  1.00 0.00 ? 204 LEU B O    1  
ATOM   5139   C CB   . LEU B 2 204 ? -74.273  -22.819 -18.366  1.00 0.00 ? 204 LEU B CB   1  
ATOM   5140   C CG   . LEU B 2 204 ? -73.416  -23.012 -17.126  1.00 0.00 ? 204 LEU B CG   1  
ATOM   5141   C CD1  . LEU B 2 204 ? -73.919  -22.076 -16.045  1.00 0.00 ? 204 LEU B CD1  1  
ATOM   5142   C CD2  . LEU B 2 204 ? -73.380  -24.485 -16.661  1.00 0.00 ? 204 LEU B CD2  1  
ATOM   5143   H H    . LEU B 2 204 ? -75.106  -22.276 -20.779  1.00 0.00 ? 204 LEU B H    1  
ATOM   5144   H HA   . LEU B 2 204 ? -72.512  -22.910 -19.573  1.00 0.00 ? 204 LEU B HA   1  
ATOM   5145   H HB2  . LEU B 2 204 ? -74.589  -21.788 -18.404  1.00 0.00 ? 204 LEU B HB2  1  
ATOM   5146   H HB3  . LEU B 2 204 ? -75.151  -23.444 -18.283  1.00 0.00 ? 204 LEU B HB3  1  
ATOM   5147   H HG   . LEU B 2 204 ? -72.406  -22.709 -17.377  1.00 0.00 ? 204 LEU B HG   1  
ATOM   5148   H HD11 . LEU B 2 204 ? -74.217  -22.651 -15.181  1.00 0.00 ? 204 LEU B HD11 1  
ATOM   5149   H HD12 . LEU B 2 204 ? -74.767  -21.519 -16.417  1.00 0.00 ? 204 LEU B HD12 1  
ATOM   5150   H HD13 . LEU B 2 204 ? -73.132  -21.391 -15.767  1.00 0.00 ? 204 LEU B HD13 1  
ATOM   5151   H HD21 . LEU B 2 204 ? -72.966  -25.100 -17.446  1.00 0.00 ? 204 LEU B HD21 1  
ATOM   5152   H HD22 . LEU B 2 204 ? -74.383  -24.816 -16.436  1.00 0.00 ? 204 LEU B HD22 1  
ATOM   5153   H HD23 . LEU B 2 204 ? -72.766  -24.568 -15.776  1.00 0.00 ? 204 LEU B HD23 1  
ATOM   5154   N N    . THR B 2 205 ? -72.576  -25.338 -20.032  1.00 0.00 ? 205 THR B N    1  
ATOM   5155   C CA   . THR B 2 205 ? -72.561  -26.692 -20.561  1.00 0.00 ? 205 THR B CA   1  
ATOM   5156   C C    . THR B 2 205 ? -71.951  -27.707 -19.584  1.00 0.00 ? 205 THR B C    1  
ATOM   5157   O O    . THR B 2 205 ? -70.731  -27.791 -19.439  1.00 0.00 ? 205 THR B O    1  
ATOM   5158   C CB   . THR B 2 205 ? -71.909  -26.728 -21.980  1.00 0.00 ? 205 THR B CB   1  
ATOM   5159   O OG1  . THR B 2 205 ? -71.726  -28.085 -22.407  1.00 0.00 ? 205 THR B OG1  1  
ATOM   5160   C CG2  . THR B 2 205 ? -70.568  -25.972 -22.008  1.00 0.00 ? 205 THR B CG2  1  
ATOM   5161   H H    . THR B 2 205 ? -71.726  -24.887 -19.847  1.00 0.00 ? 205 THR B H    1  
ATOM   5162   H HA   . THR B 2 205 ? -73.595  -26.980 -20.688  1.00 0.00 ? 205 THR B HA   1  
ATOM   5163   H HB   . THR B 2 205 ? -72.585  -26.246 -22.672  1.00 0.00 ? 205 THR B HB   1  
ATOM   5164   H HG1  . THR B 2 205 ? -70.914  -28.413 -22.013  1.00 0.00 ? 205 THR B HG1  1  
ATOM   5165   H HG21 . THR B 2 205 ? -70.208  -25.841 -20.998  1.00 0.00 ? 205 THR B HG21 1  
ATOM   5166   H HG22 . THR B 2 205 ? -70.710  -25.004 -22.467  1.00 0.00 ? 205 THR B HG22 1  
ATOM   5167   H HG23 . THR B 2 205 ? -69.847  -26.538 -22.578  1.00 0.00 ? 205 THR B HG23 1  
ATOM   5168   N N    . LEU B 2 206 ? -72.828  -28.469 -18.924  1.00 0.00 ? 206 LEU B N    1  
ATOM   5169   C CA   . LEU B 2 206 ? -72.449  -29.453 -17.898  1.00 0.00 ? 206 LEU B CA   1  
ATOM   5170   C C    . LEU B 2 206 ? -72.349  -30.888 -18.415  1.00 0.00 ? 206 LEU B C    1  
ATOM   5171   O O    . LEU B 2 206 ? -72.426  -31.136 -19.624  1.00 0.00 ? 206 LEU B O    1  
ATOM   5172   C CB   . LEU B 2 206 ? -73.457  -29.420 -16.742  1.00 0.00 ? 206 LEU B CB   1  
ATOM   5173   C CG   . LEU B 2 206 ? -73.188  -28.422 -15.617  1.00 0.00 ? 206 LEU B CG   1  
ATOM   5174   C CD1  . LEU B 2 206 ? -74.486  -28.000 -14.934  1.00 0.00 ? 206 LEU B CD1  1  
ATOM   5175   C CD2  . LEU B 2 206 ? -72.187  -28.983 -14.604  1.00 0.00 ? 206 LEU B CD2  1  
ATOM   5176   H H    . LEU B 2 206 ? -73.782  -28.334 -19.103  1.00 0.00 ? 206 LEU B H    1  
ATOM   5177   H HA   . LEU B 2 206 ? -71.486  -29.171 -17.503  1.00 0.00 ? 206 LEU B HA   1  
ATOM   5178   H HB2  . LEU B 2 206 ? -74.426  -29.192 -17.153  1.00 0.00 ? 206 LEU B HB2  1  
ATOM   5179   H HB3  . LEU B 2 206 ? -73.503  -30.413 -16.313  1.00 0.00 ? 206 LEU B HB3  1  
ATOM   5180   H HG   . LEU B 2 206 ? -72.753  -27.537 -16.063  1.00 0.00 ? 206 LEU B HG   1  
ATOM   5181   H HD11 . LEU B 2 206 ? -74.965  -27.228 -15.518  1.00 0.00 ? 206 LEU B HD11 1  
ATOM   5182   H HD12 . LEU B 2 206 ? -74.267  -27.621 -13.947  1.00 0.00 ? 206 LEU B HD12 1  
ATOM   5183   H HD13 . LEU B 2 206 ? -75.145  -28.852 -14.855  1.00 0.00 ? 206 LEU B HD13 1  
ATOM   5184   H HD21 . LEU B 2 206 ? -72.722  -29.420 -13.773  1.00 0.00 ? 206 LEU B HD21 1  
ATOM   5185   H HD22 . LEU B 2 206 ? -71.553  -28.186 -14.245  1.00 0.00 ? 206 LEU B HD22 1  
ATOM   5186   H HD23 . LEU B 2 206 ? -71.580  -29.740 -15.079  1.00 0.00 ? 206 LEU B HD23 1  
ATOM   5187   N N    . THR B 2 207 ? -72.160  -31.826 -17.483  1.00 0.00 ? 207 THR B N    1  
ATOM   5188   C CA   . THR B 2 207 ? -72.357  -33.254 -17.775  1.00 0.00 ? 207 THR B CA   1  
ATOM   5189   C C    . THR B 2 207 ? -73.837  -33.609 -17.501  1.00 0.00 ? 207 THR B C    1  
ATOM   5190   O O    . THR B 2 207 ? -74.549  -32.836 -16.839  1.00 0.00 ? 207 THR B O    1  
ATOM   5191   C CB   . THR B 2 207 ? -71.360  -34.194 -16.989  1.00 0.00 ? 207 THR B CB   1  
ATOM   5192   O OG1  . THR B 2 207 ? -71.857  -34.471 -15.675  1.00 0.00 ? 207 THR B OG1  1  
ATOM   5193   C CG2  . THR B 2 207 ? -69.947  -33.588 -16.898  1.00 0.00 ? 207 THR B CG2  1  
ATOM   5194   H H    . THR B 2 207 ? -72.093  -31.547 -16.546  1.00 0.00 ? 207 THR B H    1  
ATOM   5195   H HA   . THR B 2 207 ? -72.182  -33.393 -18.835  1.00 0.00 ? 207 THR B HA   1  
ATOM   5196   H HB   . THR B 2 207 ? -71.292  -35.130 -17.525  1.00 0.00 ? 207 THR B HB   1  
ATOM   5197   H HG1  . THR B 2 207 ? -71.228  -34.120 -15.040  1.00 0.00 ? 207 THR B HG1  1  
ATOM   5198   H HG21 . THR B 2 207 ? -69.215  -34.383 -16.886  1.00 0.00 ? 207 THR B HG21 1  
ATOM   5199   H HG22 . THR B 2 207 ? -69.861  -33.007 -15.992  1.00 0.00 ? 207 THR B HG22 1  
ATOM   5200   H HG23 . THR B 2 207 ? -69.773  -32.950 -17.752  1.00 0.00 ? 207 THR B HG23 1  
ATOM   5201   N N    . LYS B 2 208 ? -74.297  -34.748 -18.023  1.00 0.00 ? 208 LYS B N    1  
ATOM   5202   C CA   . LYS B 2 208 ? -75.670  -35.234 -17.799  1.00 0.00 ? 208 LYS B CA   1  
ATOM   5203   C C    . LYS B 2 208 ? -76.079  -35.241 -16.319  1.00 0.00 ? 208 LYS B C    1  
ATOM   5204   O O    . LYS B 2 208 ? -77.182  -34.803 -15.968  1.00 0.00 ? 208 LYS B O    1  
ATOM   5205   C CB   . LYS B 2 208 ? -75.822  -36.646 -18.382  1.00 0.00 ? 208 LYS B CB   1  
ATOM   5206   C CG   . LYS B 2 208 ? -77.190  -37.303 -18.186  1.00 0.00 ? 208 LYS B CG   1  
ATOM   5207   C CD   . LYS B 2 208 ? -77.123  -38.790 -18.521  1.00 0.00 ? 208 LYS B CD   1  
ATOM   5208   C CE   . LYS B 2 208 ? -78.489  -39.454 -18.471  1.00 0.00 ? 208 LYS B CE   1  
ATOM   5209   N NZ   . LYS B 2 208 ? -78.418  -40.839 -19.019  1.00 0.00 ? 208 LYS B NZ   1  
ATOM   5210   H H    . LYS B 2 208 ? -73.685  -35.302 -18.551  1.00 0.00 ? 208 LYS B H    1  
ATOM   5211   H HA   . LYS B 2 208 ? -76.346  -34.582 -18.330  1.00 0.00 ? 208 LYS B HA   1  
ATOM   5212   H HB2  . LYS B 2 208 ? -75.626  -36.597 -19.441  1.00 0.00 ? 208 LYS B HB2  1  
ATOM   5213   H HB3  . LYS B 2 208 ? -75.070  -37.278 -17.930  1.00 0.00 ? 208 LYS B HB3  1  
ATOM   5214   H HG2  . LYS B 2 208 ? -77.498  -37.184 -17.157  1.00 0.00 ? 208 LYS B HG2  1  
ATOM   5215   H HG3  . LYS B 2 208 ? -77.912  -36.825 -18.832  1.00 0.00 ? 208 LYS B HG3  1  
ATOM   5216   H HD2  . LYS B 2 208 ? -76.716  -38.905 -19.514  1.00 0.00 ? 208 LYS B HD2  1  
ATOM   5217   H HD3  . LYS B 2 208 ? -76.466  -39.279 -17.815  1.00 0.00 ? 208 LYS B HD3  1  
ATOM   5218   H HE2  . LYS B 2 208 ? -78.827  -39.495 -17.447  1.00 0.00 ? 208 LYS B HE2  1  
ATOM   5219   H HE3  . LYS B 2 208 ? -79.189  -38.874 -19.055  1.00 0.00 ? 208 LYS B HE3  1  
ATOM   5220   H HZ1  . LYS B 2 208 ? -79.378  -41.227 -19.108  1.00 0.00 ? 208 LYS B HZ1  1  
ATOM   5221   H HZ2  . LYS B 2 208 ? -77.859  -41.438 -18.377  1.00 0.00 ? 208 LYS B HZ2  1  
ATOM   5222   H HZ3  . LYS B 2 208 ? -77.967  -40.820 -19.956  1.00 0.00 ? 208 LYS B HZ3  1  
ATOM   5223   N N    . ASP B 2 209 ? -75.163  -35.729 -15.475  1.00 0.00 ? 209 ASP B N    1  
ATOM   5224   C CA   . ASP B 2 209 ? -75.411  -36.023 -14.056  1.00 0.00 ? 209 ASP B CA   1  
ATOM   5225   C C    . ASP B 2 209 ? -75.136  -34.849 -13.111  1.00 0.00 ? 209 ASP B C    1  
ATOM   5226   O O    . ASP B 2 209 ? -75.855  -34.655 -12.130  1.00 0.00 ? 209 ASP B O    1  
ATOM   5227   C CB   . ASP B 2 209 ? -74.597  -37.254 -13.619  1.00 0.00 ? 209 ASP B CB   1  
ATOM   5228   C CG   . ASP B 2 209 ? -74.891  -38.497 -14.469  1.00 0.00 ? 209 ASP B CG   1  
ATOM   5229   O OD1  . ASP B 2 209 ? -74.713  -38.446 -15.706  1.00 0.00 ? 209 ASP B OD1  1  
ATOM   5230   O OD2  . ASP B 2 209 ? -75.299  -39.532 -13.894  1.00 0.00 ? 209 ASP B OD2  1  
ATOM   5231   H H    . ASP B 2 209 ? -74.314  -36.034 -15.858  1.00 0.00 ? 209 ASP B H    1  
ATOM   5232   H HA   . ASP B 2 209 ? -76.456  -36.278 -13.957  1.00 0.00 ? 209 ASP B HA   1  
ATOM   5233   H HB2  . ASP B 2 209 ? -73.546  -37.022 -13.699  1.00 0.00 ? 209 ASP B HB2  1  
ATOM   5234   H HB3  . ASP B 2 209 ? -74.826  -37.474 -12.586  1.00 0.00 ? 209 ASP B HB3  1  
ATOM   5235   N N    . GLU B 2 210 ? -74.099  -34.075 -13.412  1.00 0.00 ? 210 GLU B N    1  
ATOM   5236   C CA   . GLU B 2 210 ? -73.776  -32.860 -12.658  1.00 0.00 ? 210 GLU B CA   1  
ATOM   5237   C C    . GLU B 2 210 ? -74.865  -31.763 -12.700  1.00 0.00 ? 210 GLU B C    1  
ATOM   5238   O O    . GLU B 2 210 ? -74.808  -30.812 -11.914  1.00 0.00 ? 210 GLU B O    1  
ATOM   5239   C CB   . GLU B 2 210 ? -72.452  -32.261 -13.155  1.00 0.00 ? 210 GLU B CB   1  
ATOM   5240   C CG   . GLU B 2 210 ? -71.180  -32.994 -12.735  1.00 0.00 ? 210 GLU B CG   1  
ATOM   5241   C CD   . GLU B 2 210 ? -69.917  -32.447 -13.417  1.00 0.00 ? 210 GLU B CD   1  
ATOM   5242   O OE1  . GLU B 2 210 ? -70.019  -31.492 -14.220  1.00 0.00 ? 210 GLU B OE1  1  
ATOM   5243   O OE2  . GLU B 2 210 ? -68.816  -32.981 -13.154  1.00 0.00 ? 210 GLU B OE2  1  
ATOM   5244   H H    . GLU B 2 210 ? -73.568  -34.288 -14.208  1.00 0.00 ? 210 GLU B H    1  
ATOM   5245   H HA   . GLU B 2 210 ? -73.636  -33.143 -11.626  1.00 0.00 ? 210 GLU B HA   1  
ATOM   5246   H HB2  . GLU B 2 210 ? -72.479  -32.239 -14.232  1.00 0.00 ? 210 GLU B HB2  1  
ATOM   5247   H HB3  . GLU B 2 210 ? -72.393  -31.240 -12.801  1.00 0.00 ? 210 GLU B HB3  1  
ATOM   5248   H HG2  . GLU B 2 210 ? -71.063  -32.901 -11.666  1.00 0.00 ? 210 GLU B HG2  1  
ATOM   5249   H HG3  . GLU B 2 210 ? -71.286  -34.041 -12.982  1.00 0.00 ? 210 GLU B HG3  1  
ATOM   5250   N N    . TYR B 2 211 ? -75.833  -31.882 -13.614  1.00 0.00 ? 211 TYR B N    1  
ATOM   5251   C CA   . TYR B 2 211 ? -76.860  -30.837 -13.820  1.00 0.00 ? 211 TYR B CA   1  
ATOM   5252   C C    . TYR B 2 211 ? -77.888  -30.764 -12.688  1.00 0.00 ? 211 TYR B C    1  
ATOM   5253   O O    . TYR B 2 211 ? -78.342  -29.677 -12.335  1.00 0.00 ? 211 TYR B O    1  
ATOM   5254   C CB   . TYR B 2 211 ? -77.534  -30.982 -15.212  1.00 0.00 ? 211 TYR B CB   1  
ATOM   5255   C CG   . TYR B 2 211 ? -78.907  -30.310 -15.408  1.00 0.00 ? 211 TYR B CG   1  
ATOM   5256   C CD1  . TYR B 2 211 ? -79.056  -28.918 -15.375  1.00 0.00 ? 211 TYR B CD1  1  
ATOM   5257   C CD2  . TYR B 2 211 ? -80.048  -31.083 -15.668  1.00 0.00 ? 211 TYR B CD2  1  
ATOM   5258   C CE1  . TYR B 2 211 ? -80.312  -28.321 -15.564  1.00 0.00 ? 211 TYR B CE1  1  
ATOM   5259   C CE2  . TYR B 2 211 ? -81.304  -30.494 -15.861  1.00 0.00 ? 211 TYR B CE2  1  
ATOM   5260   C CZ   . TYR B 2 211 ? -81.428  -29.118 -15.804  1.00 0.00 ? 211 TYR B CZ   1  
ATOM   5261   O OH   . TYR B 2 211 ? -82.670  -28.547 -15.986  1.00 0.00 ? 211 TYR B OH   1  
ATOM   5262   H H    . TYR B 2 211 ? -75.818  -32.654 -14.217  1.00 0.00 ? 211 TYR B H    1  
ATOM   5263   H HA   . TYR B 2 211 ? -76.339  -29.889 -13.822  1.00 0.00 ? 211 TYR B HA   1  
ATOM   5264   H HB2  . TYR B 2 211 ? -76.864  -30.572 -15.949  1.00 0.00 ? 211 TYR B HB2  1  
ATOM   5265   H HB3  . TYR B 2 211 ? -77.642  -32.039 -15.415  1.00 0.00 ? 211 TYR B HB3  1  
ATOM   5266   H HD1  . TYR B 2 211 ? -78.196  -28.296 -15.177  1.00 0.00 ? 211 TYR B HD1  1  
ATOM   5267   H HD2  . TYR B 2 211 ? -79.958  -32.159 -15.714  1.00 0.00 ? 211 TYR B HD2  1  
ATOM   5268   H HE1  . TYR B 2 211 ? -80.410  -27.246 -15.535  1.00 0.00 ? 211 TYR B HE1  1  
ATOM   5269   H HE2  . TYR B 2 211 ? -82.171  -31.111 -16.047  1.00 0.00 ? 211 TYR B HE2  1  
ATOM   5270   H HH   . TYR B 2 211 ? -82.560  -27.593 -15.992  1.00 0.00 ? 211 TYR B HH   1  
ATOM   5271   N N    . GLU B 2 212 ? -78.230  -31.914 -12.112  1.00 0.00 ? 212 GLU B N    1  
ATOM   5272   C CA   . GLU B 2 212 ? -79.222  -31.983 -11.033  1.00 0.00 ? 212 GLU B CA   1  
ATOM   5273   C C    . GLU B 2 212 ? -78.621  -31.769 -9.635   1.00 0.00 ? 212 GLU B C    1  
ATOM   5274   O O    . GLU B 2 212 ? -79.284  -32.007 -8.624   1.00 0.00 ? 212 GLU B O    1  
ATOM   5275   C CB   . GLU B 2 212 ? -79.979  -33.303 -11.114  1.00 0.00 ? 212 GLU B CB   1  
ATOM   5276   C CG   . GLU B 2 212 ? -80.693  -33.482 -12.439  1.00 0.00 ? 212 GLU B CG   1  
ATOM   5277   C CD   . GLU B 2 212 ? -80.445  -34.836 -13.062  1.00 0.00 ? 212 GLU B CD   1  
ATOM   5278   O OE1  . GLU B 2 212 ? -79.295  -35.325 -13.002  1.00 0.00 ? 212 GLU B OE1  1  
ATOM   5279   O OE2  . GLU B 2 212 ? -81.399  -35.410 -13.627  1.00 0.00 ? 212 GLU B OE2  1  
ATOM   5280   H H    . GLU B 2 212 ? -77.818  -32.744 -12.431  1.00 0.00 ? 212 GLU B H    1  
ATOM   5281   H HA   . GLU B 2 212 ? -79.936  -31.189 -11.200  1.00 0.00 ? 212 GLU B HA   1  
ATOM   5282   H HB2  . GLU B 2 212 ? -79.281  -34.115 -10.984  1.00 0.00 ? 212 GLU B HB2  1  
ATOM   5283   H HB3  . GLU B 2 212 ? -80.707  -33.337 -10.316  1.00 0.00 ? 212 GLU B HB3  1  
ATOM   5284   H HG2  . GLU B 2 212 ? -81.754  -33.368 -12.277  1.00 0.00 ? 212 GLU B HG2  1  
ATOM   5285   H HG3  . GLU B 2 212 ? -80.361  -32.713 -13.121  1.00 0.00 ? 212 GLU B HG3  1  
ATOM   5286   N N    . ARG B 2 213 ? -77.368  -31.302 -9.608   1.00 0.00 ? 213 ARG B N    1  
ATOM   5287   C CA   . ARG B 2 213 ? -76.632  -30.932 -8.391   1.00 0.00 ? 213 ARG B CA   1  
ATOM   5288   C C    . ARG B 2 213 ? -77.374  -29.887 -7.555   1.00 0.00 ? 213 ARG B C    1  
ATOM   5289   O O    . ARG B 2 213 ? -77.423  -29.991 -6.331   1.00 0.00 ? 213 ARG B O    1  
ATOM   5290   C CB   . ARG B 2 213 ? -75.233  -30.405 -8.765   1.00 0.00 ? 213 ARG B CB   1  
ATOM   5291   C CG   . ARG B 2 213 ? -74.254  -30.230 -7.602   1.00 0.00 ? 213 ARG B CG   1  
ATOM   5292   C CD   . ARG B 2 213 ? -73.045  -29.398 -8.020   1.00 0.00 ? 213 ARG B CD   1  
ATOM   5293   N NE   . ARG B 2 213 ? -71.911  -30.194 -8.500   1.00 0.00 ? 213 ARG B NE   1  
ATOM   5294   C CZ   . ARG B 2 213 ? -71.549  -30.333 -9.777   1.00 0.00 ? 213 ARG B CZ   1  
ATOM   5295   N NH1  . ARG B 2 213 ? -72.232  -29.744 -10.747  1.00 0.00 ? 213 ARG B NH1  1  
ATOM   5296   N NH2  . ARG B 2 213 ? -70.490  -31.072 -10.081  1.00 0.00 ? 213 ARG B NH2  1  
ATOM   5297   H H    . ARG B 2 213 ? -76.930  -31.136 -10.469  1.00 0.00 ? 213 ARG B H    1  
ATOM   5298   H HA   . ARG B 2 213 ? -76.506  -31.819 -7.789   1.00 0.00 ? 213 ARG B HA   1  
ATOM   5299   H HB2  . ARG B 2 213 ? -74.793  -31.105 -9.457   1.00 0.00 ? 213 ARG B HB2  1  
ATOM   5300   H HB3  . ARG B 2 213 ? -75.347  -29.457 -9.272   1.00 0.00 ? 213 ARG B HB3  1  
ATOM   5301   H HG2  . ARG B 2 213 ? -74.761  -29.728 -6.791   1.00 0.00 ? 213 ARG B HG2  1  
ATOM   5302   H HG3  . ARG B 2 213 ? -73.921  -31.201 -7.264   1.00 0.00 ? 213 ARG B HG3  1  
ATOM   5303   H HD2  . ARG B 2 213 ? -73.346  -28.726 -8.807   1.00 0.00 ? 213 ARG B HD2  1  
ATOM   5304   H HD3  . ARG B 2 213 ? -72.726  -28.809 -7.171   1.00 0.00 ? 213 ARG B HD3  1  
ATOM   5305   H HE   . ARG B 2 213 ? -71.372  -30.659 -7.827   1.00 0.00 ? 213 ARG B HE   1  
ATOM   5306   H HH11 . ARG B 2 213 ? -73.033  -29.186 -10.528  1.00 0.00 ? 213 ARG B HH11 1  
ATOM   5307   H HH12 . ARG B 2 213 ? -71.947  -29.857 -11.699  1.00 0.00 ? 213 ARG B HH12 1  
ATOM   5308   H HH21 . ARG B 2 213 ? -69.969  -31.522 -9.356   1.00 0.00 ? 213 ARG B HH21 1  
ATOM   5309   H HH22 . ARG B 2 213 ? -70.213  -31.179 -11.036  1.00 0.00 ? 213 ARG B HH22 1  
ATOM   5310   N N    . HIS B 2 214 ? -77.933  -28.881 -8.225   1.00 0.00 ? 214 HIS B N    1  
ATOM   5311   C CA   . HIS B 2 214 ? -78.776  -27.871 -7.584   1.00 0.00 ? 214 HIS B CA   1  
ATOM   5312   C C    . HIS B 2 214 ? -80.182  -27.894 -8.194   1.00 0.00 ? 214 HIS B C    1  
ATOM   5313   O O    . HIS B 2 214 ? -80.542  -28.819 -8.936   1.00 0.00 ? 214 HIS B O    1  
ATOM   5314   C CB   . HIS B 2 214 ? -78.176  -26.472 -7.754   1.00 0.00 ? 214 HIS B CB   1  
ATOM   5315   C CG   . HIS B 2 214 ? -76.830  -26.290 -7.116   1.00 0.00 ? 214 HIS B CG   1  
ATOM   5316   N ND1  . HIS B 2 214 ? -76.560  -25.260 -6.239   1.00 0.00 ? 214 HIS B ND1  1  
ATOM   5317   C CD2  . HIS B 2 214 ? -75.670  -26.980 -7.254   1.00 0.00 ? 214 HIS B CD2  1  
ATOM   5318   C CE1  . HIS B 2 214 ? -75.298  -25.333 -5.852   1.00 0.00 ? 214 HIS B CE1  1  
ATOM   5319   N NE2  . HIS B 2 214 ? -74.736  -26.369 -6.451   1.00 0.00 ? 214 HIS B NE2  1  
ATOM   5320   H H    . HIS B 2 214 ? -77.840  -28.861 -9.201   1.00 0.00 ? 214 HIS B H    1  
ATOM   5321   H HA   . HIS B 2 214 ? -78.848  -28.094 -6.530   1.00 0.00 ? 214 HIS B HA   1  
ATOM   5322   H HB2  . HIS B 2 214 ? -78.080  -26.266 -8.808   1.00 0.00 ? 214 HIS B HB2  1  
ATOM   5323   H HB3  . HIS B 2 214 ? -78.862  -25.753 -7.327   1.00 0.00 ? 214 HIS B HB3  1  
ATOM   5324   H HD1  . HIS B 2 214 ? -77.203  -24.580 -5.949   1.00 0.00 ? 214 HIS B HD1  1  
ATOM   5325   H HD2  . HIS B 2 214 ? -75.510  -27.847 -7.877   1.00 0.00 ? 214 HIS B HD2  1  
ATOM   5326   H HE1  . HIS B 2 214 ? -74.809  -24.660 -5.164   1.00 0.00 ? 214 HIS B HE1  1  
ATOM   5327   H HE2  . HIS B 2 214 ? -73.806  -26.655 -6.341   1.00 0.00 ? 214 HIS B HE2  1  
ATOM   5328   N N    . ASN B 2 215 ? -80.970  -26.868 -7.883   1.00 0.00 ? 215 ASN B N    1  
ATOM   5329   C CA   . ASN B 2 215 ? -82.330  -26.763 -8.403   1.00 0.00 ? 215 ASN B CA   1  
ATOM   5330   C C    . ASN B 2 215 ? -82.570  -25.478 -9.200   1.00 0.00 ? 215 ASN B C    1  
ATOM   5331   O O    . ASN B 2 215 ? -82.883  -25.529 -10.396  1.00 0.00 ? 215 ASN B O    1  
ATOM   5332   C CB   . ASN B 2 215 ? -83.358  -26.892 -7.274   1.00 0.00 ? 215 ASN B CB   1  
ATOM   5333   C CG   . ASN B 2 215 ? -84.778  -27.026 -7.792   1.00 0.00 ? 215 ASN B CG   1  
ATOM   5334   O OD1  . ASN B 2 215 ? -85.098  -27.976 -8.515   1.00 0.00 ? 215 ASN B OD1  1  
ATOM   5335   N ND2  . ASN B 2 215 ? -85.640  -26.078 -7.421   1.00 0.00 ? 215 ASN B ND2  1  
ATOM   5336   H H    . ASN B 2 215 ? -80.627  -26.163 -7.295   1.00 0.00 ? 215 ASN B H    1  
ATOM   5337   H HA   . ASN B 2 215 ? -82.483  -27.593 -9.076   1.00 0.00 ? 215 ASN B HA   1  
ATOM   5338   H HB2  . ASN B 2 215 ? -83.120  -27.763 -6.682   1.00 0.00 ? 215 ASN B HB2  1  
ATOM   5339   H HB3  . ASN B 2 215 ? -83.295  -26.016 -6.644   1.00 0.00 ? 215 ASN B HB3  1  
ATOM   5340   H HD21 . ASN B 2 215 ? -85.343  -25.344 -6.843   1.00 0.00 ? 215 ASN B HD21 1  
ATOM   5341   H HD22 . ASN B 2 215 ? -86.571  -26.115 -7.726   1.00 0.00 ? 215 ASN B HD22 1  
ATOM   5342   N N    . SER B 2 216 ? -82.423  -24.332 -8.542   1.00 0.00 ? 216 SER B N    1  
ATOM   5343   C CA   . SER B 2 216 ? -82.639  -23.054 -9.207   1.00 0.00 ? 216 SER B CA   1  
ATOM   5344   C C    . SER B 2 216 ? -81.441  -22.668 -10.071  1.00 0.00 ? 216 SER B C    1  
ATOM   5345   O O    . SER B 2 216 ? -80.285  -22.857 -9.679   1.00 0.00 ? 216 SER B O    1  
ATOM   5346   C CB   . SER B 2 216 ? -82.955  -21.953 -8.194   1.00 0.00 ? 216 SER B CB   1  
ATOM   5347   O OG   . SER B 2 216 ? -83.532  -20.826 -8.836   1.00 0.00 ? 216 SER B OG   1  
ATOM   5348   H H    . SER B 2 216 ? -82.174  -24.348 -7.595   1.00 0.00 ? 216 SER B H    1  
ATOM   5349   H HA   . SER B 2 216 ? -83.495  -23.163 -9.859   1.00 0.00 ? 216 SER B HA   1  
ATOM   5350   H HB2  . SER B 2 216 ? -83.648  -22.328 -7.461   1.00 0.00 ? 216 SER B HB2  1  
ATOM   5351   H HB3  . SER B 2 216 ? -82.039  -21.661 -7.694   1.00 0.00 ? 216 SER B HB3  1  
ATOM   5352   H HG   . SER B 2 216 ? -82.916  -20.093 -8.760   1.00 0.00 ? 216 SER B HG   1  
ATOM   5353   N N    . TYR B 2 217 ? -81.745  -22.147 -11.257  1.00 0.00 ? 217 TYR B N    1  
ATOM   5354   C CA   . TYR B 2 217 ? -80.757  -21.606 -12.177  1.00 0.00 ? 217 TYR B CA   1  
ATOM   5355   C C    . TYR B 2 217 ? -81.227  -20.257 -12.697  1.00 0.00 ? 217 TYR B C    1  
ATOM   5356   O O    . TYR B 2 217 ? -82.428  -20.018 -12.837  1.00 0.00 ? 217 TYR B O    1  
ATOM   5357   C CB   . TYR B 2 217 ? -80.606  -22.520 -13.383  1.00 0.00 ? 217 TYR B CB   1  
ATOM   5358   C CG   . TYR B 2 217 ? -79.922  -23.837 -13.145  1.00 0.00 ? 217 TYR B CG   1  
ATOM   5359   C CD1  . TYR B 2 217 ? -78.543  -23.904 -12.956  1.00 0.00 ? 217 TYR B CD1  1  
ATOM   5360   C CD2  . TYR B 2 217 ? -80.646  -25.027 -13.166  1.00 0.00 ? 217 TYR B CD2  1  
ATOM   5361   C CE1  . TYR B 2 217 ? -77.903  -25.126 -12.765  1.00 0.00 ? 217 TYR B CE1  1  
ATOM   5362   C CE2  . TYR B 2 217 ? -80.019  -26.250 -12.974  1.00 0.00 ? 217 TYR B CE2  1  
ATOM   5363   C CZ   . TYR B 2 217 ? -78.649  -26.294 -12.775  1.00 0.00 ? 217 TYR B CZ   1  
ATOM   5364   O OH   . TYR B 2 217 ? -78.020  -27.503 -12.584  1.00 0.00 ? 217 TYR B OH   1  
ATOM   5365   H H    . TYR B 2 217 ? -82.692  -22.052 -11.490  1.00 0.00 ? 217 TYR B H    1  
ATOM   5366   H HA   . TYR B 2 217 ? -79.806  -21.500 -11.680  1.00 0.00 ? 217 TYR B HA   1  
ATOM   5367   H HB2  . TYR B 2 217 ? -81.590  -22.727 -13.770  1.00 0.00 ? 217 TYR B HB2  1  
ATOM   5368   H HB3  . TYR B 2 217 ? -80.056  -21.981 -14.143  1.00 0.00 ? 217 TYR B HB3  1  
ATOM   5369   H HD1  . TYR B 2 217 ? -77.963  -22.994 -12.948  1.00 0.00 ? 217 TYR B HD1  1  
ATOM   5370   H HD2  . TYR B 2 217 ? -81.716  -24.995 -13.312  1.00 0.00 ? 217 TYR B HD2  1  
ATOM   5371   H HE1  . TYR B 2 217 ? -76.835  -25.163 -12.609  1.00 0.00 ? 217 TYR B HE1  1  
ATOM   5372   H HE2  . TYR B 2 217 ? -80.595  -27.164 -12.994  1.00 0.00 ? 217 TYR B HE2  1  
ATOM   5373   H HH   . TYR B 2 217 ? -77.269  -27.359 -12.004  1.00 0.00 ? 217 TYR B HH   1  
ATOM   5374   N N    . THR B 2 218 ? -80.278  -19.383 -13.005  1.00 0.00 ? 218 THR B N    1  
ATOM   5375   C CA   . THR B 2 218 ? -80.591  -18.121 -13.685  1.00 0.00 ? 218 THR B CA   1  
ATOM   5376   C C    . THR B 2 218 ? -79.365  -17.508 -14.385  1.00 0.00 ? 218 THR B C    1  
ATOM   5377   O O    . THR B 2 218 ? -78.247  -18.022 -14.288  1.00 0.00 ? 218 THR B O    1  
ATOM   5378   C CB   . THR B 2 218 ? -81.309  -17.096 -12.735  1.00 0.00 ? 218 THR B CB   1  
ATOM   5379   O OG1  . THR B 2 218 ? -81.340  -15.796 -13.340  1.00 0.00 ? 218 THR B OG1  1  
ATOM   5380   C CG2  . THR B 2 218 ? -80.654  -17.027 -11.357  1.00 0.00 ? 218 THR B CG2  1  
ATOM   5381   H H    . THR B 2 218 ? -79.339  -19.639 -12.885  1.00 0.00 ? 218 THR B H    1  
ATOM   5382   H HA   . THR B 2 218 ? -81.295  -18.366 -14.468  1.00 0.00 ? 218 THR B HA   1  
ATOM   5383   H HB   . THR B 2 218 ? -82.331  -17.425 -12.607  1.00 0.00 ? 218 THR B HB   1  
ATOM   5384   H HG1  . THR B 2 218 ? -80.756  -15.222 -12.839  1.00 0.00 ? 218 THR B HG1  1  
ATOM   5385   H HG21 . THR B 2 218 ? -80.666  -16.007 -11.003  1.00 0.00 ? 218 THR B HG21 1  
ATOM   5386   H HG22 . THR B 2 218 ? -79.632  -17.371 -11.427  1.00 0.00 ? 218 THR B HG22 1  
ATOM   5387   H HG23 . THR B 2 218 ? -81.199  -17.654 -10.667  1.00 0.00 ? 218 THR B HG23 1  
ATOM   5388   N N    . CYS B 2 219 ? -79.596  -16.436 -15.131  1.00 0.00 ? 219 CYS B N    1  
ATOM   5389   C CA   . CYS B 2 219 ? -78.504  -15.628 -15.643  1.00 0.00 ? 219 CYS B CA   1  
ATOM   5390   C C    . CYS B 2 219 ? -78.896  -14.164 -15.560  1.00 0.00 ? 219 CYS B C    1  
ATOM   5391   O O    . CYS B 2 219 ? -80.085  -13.824 -15.584  1.00 0.00 ? 219 CYS B O    1  
ATOM   5392   C CB   . CYS B 2 219 ? -78.079  -16.050 -17.067  1.00 0.00 ? 219 CYS B CB   1  
ATOM   5393   S SG   . CYS B 2 219 ? -79.191  -15.666 -18.493  1.00 0.00 ? 219 CYS B SG   1  
ATOM   5394   H H    . CYS B 2 219 ? -80.512  -16.095 -15.202  1.00 0.00 ? 219 CYS B H    1  
ATOM   5395   H HA   . CYS B 2 219 ? -77.657  -15.774 -14.985  1.00 0.00 ? 219 CYS B HA   1  
ATOM   5396   H HB2  . CYS B 2 219 ? -77.132  -15.584 -17.275  1.00 0.00 ? 219 CYS B HB2  1  
ATOM   5397   H HB3  . CYS B 2 219 ? -77.915  -17.121 -17.048  1.00 0.00 ? 219 CYS B HB3  1  
ATOM   5398   N N    . GLU B 2 220 ? -77.897  -13.301 -15.432  1.00 0.00 ? 220 GLU B N    1  
ATOM   5399   C CA   . GLU B 2 220 ? -78.152  -11.876 -15.365  1.00 0.00 ? 220 GLU B CA   1  
ATOM   5400   C C    . GLU B 2 220 ? -77.297  -11.087 -16.331  1.00 0.00 ? 220 GLU B C    1  
ATOM   5401   O O    . GLU B 2 220 ? -76.147  -11.432 -16.582  1.00 0.00 ? 220 GLU B O    1  
ATOM   5402   C CB   . GLU B 2 220 ? -77.922  -11.348 -13.948  1.00 0.00 ? 220 GLU B CB   1  
ATOM   5403   C CG   . GLU B 2 220 ? -79.005  -11.702 -12.949  1.00 0.00 ? 220 GLU B CG   1  
ATOM   5404   C CD   . GLU B 2 220 ? -79.001  -10.800 -11.723  1.00 0.00 ? 220 GLU B CD   1  
ATOM   5405   O OE1  . GLU B 2 220 ? -78.106  -9.932  -11.600  1.00 0.00 ? 220 GLU B OE1  1  
ATOM   5406   O OE2  . GLU B 2 220 ? -79.900  -10.971 -10.874  1.00 0.00 ? 220 GLU B OE2  1  
ATOM   5407   H H    . GLU B 2 220 ? -76.974  -13.630 -15.397  1.00 0.00 ? 220 GLU B H    1  
ATOM   5408   H HA   . GLU B 2 220 ? -79.187  -11.708 -15.618  1.00 0.00 ? 220 GLU B HA   1  
ATOM   5409   H HB2  . GLU B 2 220 ? -76.988  -11.745 -13.585  1.00 0.00 ? 220 GLU B HB2  1  
ATOM   5410   H HB3  . GLU B 2 220 ? -77.836  -10.271 -13.998  1.00 0.00 ? 220 GLU B HB3  1  
ATOM   5411   H HG2  . GLU B 2 220 ? -79.965  -11.617 -13.434  1.00 0.00 ? 220 GLU B HG2  1  
ATOM   5412   H HG3  . GLU B 2 220 ? -78.865  -12.725 -12.632  1.00 0.00 ? 220 GLU B HG3  1  
ATOM   5413   N N    . ALA B 2 221 ? -77.883  -10.022 -16.864  1.00 0.00 ? 221 ALA B N    1  
ATOM   5414   C CA   . ALA B 2 221 ? -77.143  -9.004  -17.592  1.00 0.00 ? 221 ALA B CA   1  
ATOM   5415   C C    . ALA B 2 221 ? -76.604  -7.961  -16.607  1.00 0.00 ? 221 ALA B C    1  
ATOM   5416   O O    . ALA B 2 221 ? -76.762  -8.114  -15.391  1.00 0.00 ? 221 ALA B O    1  
ATOM   5417   C CB   . ALA B 2 221 ? -78.046  -8.344  -18.610  1.00 0.00 ? 221 ALA B CB   1  
ATOM   5418   H H    . ALA B 2 221 ? -78.808  -9.825  -16.606  1.00 0.00 ? 221 ALA B H    1  
ATOM   5419   H HA   . ALA B 2 221 ? -76.313  -9.469  -18.103  1.00 0.00 ? 221 ALA B HA   1  
ATOM   5420   H HB1  . ALA B 2 221 ? -79.065  -8.662  -18.447  1.00 0.00 ? 221 ALA B HB1  1  
ATOM   5421   H HB2  . ALA B 2 221 ? -77.734  -8.628  -19.604  1.00 0.00 ? 221 ALA B HB2  1  
ATOM   5422   H HB3  . ALA B 2 221 ? -77.983  -7.272  -18.505  1.00 0.00 ? 221 ALA B HB3  1  
ATOM   5423   N N    . THR B 2 222 ? -75.957  -6.922  -17.138  1.00 0.00 ? 222 THR B N    1  
ATOM   5424   C CA   . THR B 2 222 ? -75.532  -5.743  -16.363  1.00 0.00 ? 222 THR B CA   1  
ATOM   5425   C C    . THR B 2 222 ? -75.447  -4.536  -17.300  1.00 0.00 ? 222 THR B C    1  
ATOM   5426   O O    . THR B 2 222 ? -75.136  -3.418  -16.879  1.00 0.00 ? 222 THR B O    1  
ATOM   5427   C CB   . THR B 2 222 ? -74.182  -5.965  -15.604  1.00 0.00 ? 222 THR B CB   1  
ATOM   5428   O OG1  . THR B 2 222 ? -73.390  -6.943  -16.288  1.00 0.00 ? 222 THR B OG1  1  
ATOM   5429   C CG2  . THR B 2 222 ? -74.424  -6.452  -14.175  1.00 0.00 ? 222 THR B CG2  1  
ATOM   5430   H H    . THR B 2 222 ? -75.862  -6.889  -18.113  1.00 0.00 ? 222 THR B H    1  
ATOM   5431   H HA   . THR B 2 222 ? -76.301  -5.537  -15.631  1.00 0.00 ? 222 THR B HA   1  
ATOM   5432   H HB   . THR B 2 222 ? -73.639  -5.032  -15.570  1.00 0.00 ? 222 THR B HB   1  
ATOM   5433   H HG1  . THR B 2 222 ? -72.499  -6.905  -15.932  1.00 0.00 ? 222 THR B HG1  1  
ATOM   5434   H HG21 . THR B 2 222 ? -74.280  -7.522  -14.130  1.00 0.00 ? 222 THR B HG21 1  
ATOM   5435   H HG22 . THR B 2 222 ? -75.435  -6.212  -13.879  1.00 0.00 ? 222 THR B HG22 1  
ATOM   5436   H HG23 . THR B 2 222 ? -73.728  -5.967  -13.506  1.00 0.00 ? 222 THR B HG23 1  
ATOM   5437   N N    . HIS B 2 223 ? -75.753  -4.801  -18.570  1.00 0.00 ? 223 HIS B N    1  
ATOM   5438   C CA   . HIS B 2 223 ? -75.749  -3.828  -19.667  1.00 0.00 ? 223 HIS B CA   1  
ATOM   5439   C C    . HIS B 2 223 ? -76.150  -2.397  -19.286  1.00 0.00 ? 223 HIS B C    1  
ATOM   5440   O O    . HIS B 2 223 ? -77.187  -2.154  -18.667  1.00 0.00 ? 223 HIS B O    1  
ATOM   5441   C CB   . HIS B 2 223 ? -76.620  -4.350  -20.811  1.00 0.00 ? 223 HIS B CB   1  
ATOM   5442   C CG   . HIS B 2 223 ? -76.625  -3.474  -22.023  1.00 0.00 ? 223 HIS B CG   1  
ATOM   5443   N ND1  . HIS B 2 223 ? -77.525  -2.443  -22.193  1.00 0.00 ? 223 HIS B ND1  1  
ATOM   5444   C CD2  . HIS B 2 223 ? -75.846  -3.479  -23.130  1.00 0.00 ? 223 HIS B CD2  1  
ATOM   5445   C CE1  . HIS B 2 223 ? -77.294  -1.849  -23.348  1.00 0.00 ? 223 HIS B CE1  1  
ATOM   5446   N NE2  . HIS B 2 223 ? -76.282  -2.457  -23.937  1.00 0.00 ? 223 HIS B NE2  1  
ATOM   5447   H H    . HIS B 2 223 ? -76.000  -5.723  -18.789  1.00 0.00 ? 223 HIS B H    1  
ATOM   5448   H HA   . HIS B 2 223 ? -74.738  -3.780  -20.041  1.00 0.00 ? 223 HIS B HA   1  
ATOM   5449   H HB2  . HIS B 2 223 ? -76.202  -5.298  -21.112  1.00 0.00 ? 223 HIS B HB2  1  
ATOM   5450   H HB3  . HIS B 2 223 ? -77.628  -4.516  -20.469  1.00 0.00 ? 223 HIS B HB3  1  
ATOM   5451   H HD1  . HIS B 2 223 ? -78.226  -2.192  -21.555  1.00 0.00 ? 223 HIS B HD1  1  
ATOM   5452   H HD2  . HIS B 2 223 ? -75.033  -4.159  -23.340  1.00 0.00 ? 223 HIS B HD2  1  
ATOM   5453   H HE1  . HIS B 2 223 ? -77.841  -1.006  -23.744  1.00 0.00 ? 223 HIS B HE1  1  
ATOM   5454   H HE2  . HIS B 2 223 ? -75.903  -2.218  -24.808  1.00 0.00 ? 223 HIS B HE2  1  
ATOM   5455   N N    . LYS B 2 224 ? -75.316  -1.457  -19.713  1.00 0.00 ? 224 LYS B N    1  
ATOM   5456   C CA   . LYS B 2 224 ? -75.336  -0.086  -19.227  1.00 0.00 ? 224 LYS B CA   1  
ATOM   5457   C C    . LYS B 2 224 ? -76.458  0.788   -19.805  1.00 0.00 ? 224 LYS B C    1  
ATOM   5458   O O    . LYS B 2 224 ? -76.199  1.902   -20.265  1.00 0.00 ? 224 LYS B O    1  
ATOM   5459   C CB   . LYS B 2 224 ? -73.964  0.566   -19.475  1.00 0.00 ? 224 LYS B CB   1  
ATOM   5460   C CG   . LYS B 2 224 ? -73.531  1.545   -18.398  1.00 0.00 ? 224 LYS B CG   1  
ATOM   5461   C CD   . LYS B 2 224 ? -72.532  2.556   -18.930  1.00 0.00 ? 224 LYS B CD   1  
ATOM   5462   C CE   . LYS B 2 224 ? -72.329  3.700   -17.934  1.00 0.00 ? 224 LYS B CE   1  
ATOM   5463   N NZ   . LYS B 2 224 ? -73.566  4.510   -17.685  1.00 0.00 ? 224 LYS B NZ   1  
ATOM   5464   H H    . LYS B 2 224 ? -74.534  -1.743  -20.230  1.00 0.00 ? 224 LYS B H    1  
ATOM   5465   H HA   . LYS B 2 224 ? -75.480  -0.126  -18.159  1.00 0.00 ? 224 LYS B HA   1  
ATOM   5466   H HB2  . LYS B 2 224 ? -73.221  -0.213  -19.543  1.00 0.00 ? 224 LYS B HB2  1  
ATOM   5467   H HB3  . LYS B 2 224 ? -74.000  1.087   -20.422  1.00 0.00 ? 224 LYS B HB3  1  
ATOM   5468   H HG2  . LYS B 2 224 ? -74.399  2.069   -18.027  1.00 0.00 ? 224 LYS B HG2  1  
ATOM   5469   H HG3  . LYS B 2 224 ? -73.079  0.995   -17.585  1.00 0.00 ? 224 LYS B HG3  1  
ATOM   5470   H HD2  . LYS B 2 224 ? -71.586  2.063   -19.102  1.00 0.00 ? 224 LYS B HD2  1  
ATOM   5471   H HD3  . LYS B 2 224 ? -72.897  2.959   -19.863  1.00 0.00 ? 224 LYS B HD3  1  
ATOM   5472   H HE2  . LYS B 2 224 ? -71.997  3.286   -16.995  1.00 0.00 ? 224 LYS B HE2  1  
ATOM   5473   H HE3  . LYS B 2 224 ? -71.555  4.352   -18.314  1.00 0.00 ? 224 LYS B HE3  1  
ATOM   5474   H HZ1  . LYS B 2 224 ? -74.404  3.956   -17.952  1.00 0.00 ? 224 LYS B HZ1  1  
ATOM   5475   H HZ2  . LYS B 2 224 ? -73.530  5.381   -18.253  1.00 0.00 ? 224 LYS B HZ2  1  
ATOM   5476   H HZ3  . LYS B 2 224 ? -73.622  4.755   -16.676  1.00 0.00 ? 224 LYS B HZ3  1  
ATOM   5477   N N    . THR B 2 225 ? -77.691  0.287   -19.797  1.00 0.00 ? 225 THR B N    1  
ATOM   5478   C CA   . THR B 2 225 ? -78.860  1.174   -19.937  1.00 0.00 ? 225 THR B CA   1  
ATOM   5479   C C    . THR B 2 225 ? -79.220  1.678   -18.543  1.00 0.00 ? 225 THR B C    1  
ATOM   5480   O O    . THR B 2 225 ? -79.578  2.849   -18.356  1.00 0.00 ? 225 THR B O    1  
ATOM   5481   C CB   . THR B 2 225 ? -80.075  0.504   -20.607  1.00 0.00 ? 225 THR B CB   1  
ATOM   5482   O OG1  . THR B 2 225 ? -79.787  -0.878  -20.870  1.00 0.00 ? 225 THR B OG1  1  
ATOM   5483   C CG2  . THR B 2 225 ? -80.395  1.208   -21.910  1.00 0.00 ? 225 THR B CG2  1  
ATOM   5484   H H    . THR B 2 225 ? -77.829  -0.612  -19.431  1.00 0.00 ? 225 THR B H    1  
ATOM   5485   H HA   . THR B 2 225 ? -78.562  2.026   -20.534  1.00 0.00 ? 225 THR B HA   1  
ATOM   5486   H HB   . THR B 2 225 ? -80.927  0.571   -19.949  1.00 0.00 ? 225 THR B HB   1  
ATOM   5487   H HG1  . THR B 2 225 ? -79.372  -1.248  -20.088  1.00 0.00 ? 225 THR B HG1  1  
ATOM   5488   H HG21 . THR B 2 225 ? -79.878  2.155   -21.943  1.00 0.00 ? 225 THR B HG21 1  
ATOM   5489   H HG22 . THR B 2 225 ? -81.460  1.377   -21.975  1.00 0.00 ? 225 THR B HG22 1  
ATOM   5490   H HG23 . THR B 2 225 ? -80.076  0.594   -22.739  1.00 0.00 ? 225 THR B HG23 1  
ATOM   5491   N N    . SER B 2 226 ? -79.145  0.750   -17.587  1.00 0.00 ? 226 SER B N    1  
ATOM   5492   C CA   . SER B 2 226 ? -78.875  1.027   -16.174  1.00 0.00 ? 226 SER B CA   1  
ATOM   5493   C C    . SER B 2 226 ? -78.305  -0.259  -15.578  1.00 0.00 ? 226 SER B C    1  
ATOM   5494   O O    . SER B 2 226 ? -78.823  -1.353  -15.831  1.00 0.00 ? 226 SER B O    1  
ATOM   5495   C CB   . SER B 2 226 ? -80.114  1.498   -15.403  1.00 0.00 ? 226 SER B CB   1  
ATOM   5496   O OG   . SER B 2 226 ? -79.734  2.132   -14.184  1.00 0.00 ? 226 SER B OG   1  
ATOM   5497   H H    . SER B 2 226 ? -78.896  -0.148  -17.889  1.00 0.00 ? 226 SER B H    1  
ATOM   5498   H HA   . SER B 2 226 ? -78.113  1.795   -16.118  1.00 0.00 ? 226 SER B HA   1  
ATOM   5499   H HB2  . SER B 2 226 ? -80.664  2.202   -16.005  1.00 0.00 ? 226 SER B HB2  1  
ATOM   5500   H HB3  . SER B 2 226 ? -80.747  0.645   -15.193  1.00 0.00 ? 226 SER B HB3  1  
ATOM   5501   H HG   . SER B 2 226 ? -79.013  2.736   -14.376  1.00 0.00 ? 226 SER B HG   1  
ATOM   5502   N N    . THR B 2 227 ? -77.230  -0.130  -14.804  1.00 0.00 ? 227 THR B N    1  
ATOM   5503   C CA   . THR B 2 227 ? -76.533  -1.294  -14.249  1.00 0.00 ? 227 THR B CA   1  
ATOM   5504   C C    . THR B 2 227 ? -77.327  -1.947  -13.094  1.00 0.00 ? 227 THR B C    1  
ATOM   5505   O O    . THR B 2 227 ? -76.793  -2.289  -12.027  1.00 0.00 ? 227 THR B O    1  
ATOM   5506   C CB   . THR B 2 227 ? -75.039  -0.978  -13.911  1.00 0.00 ? 227 THR B CB   1  
ATOM   5507   O OG1  . THR B 2 227 ? -74.950  0.217   -13.122  1.00 0.00 ? 227 THR B OG1  1  
ATOM   5508   C CG2  . THR B 2 227 ? -74.234  -0.777  -15.200  1.00 0.00 ? 227 THR B CG2  1  
ATOM   5509   H H    . THR B 2 227 ? -76.858  0.764   -14.652  1.00 0.00 ? 227 THR B H    1  
ATOM   5510   H HA   . THR B 2 227 ? -76.503  -2.031  -15.041  1.00 0.00 ? 227 THR B HA   1  
ATOM   5511   H HB   . THR B 2 227 ? -74.617  -1.803  -13.357  1.00 0.00 ? 227 THR B HB   1  
ATOM   5512   H HG1  . THR B 2 227 ? -74.162  0.155   -12.577  1.00 0.00 ? 227 THR B HG1  1  
ATOM   5513   H HG21 . THR B 2 227 ? -74.217  0.272   -15.454  1.00 0.00 ? 227 THR B HG21 1  
ATOM   5514   H HG22 . THR B 2 227 ? -74.695  -1.334  -16.003  1.00 0.00 ? 227 THR B HG22 1  
ATOM   5515   H HG23 . THR B 2 227 ? -73.224  -1.129  -15.053  1.00 0.00 ? 227 THR B HG23 1  
ATOM   5516   N N    . SER B 2 228 ? -78.623  -2.096  -13.360  1.00 0.00 ? 228 SER B N    1  
ATOM   5517   C CA   . SER B 2 228 ? -79.564  -2.832  -12.535  1.00 0.00 ? 228 SER B CA   1  
ATOM   5518   C C    . SER B 2 228 ? -79.741  -4.207  -13.202  1.00 0.00 ? 228 SER B C    1  
ATOM   5519   O O    . SER B 2 228 ? -80.559  -4.353  -14.118  1.00 0.00 ? 228 SER B O    1  
ATOM   5520   C CB   . SER B 2 228 ? -80.906  -2.085  -12.477  1.00 0.00 ? 228 SER B CB   1  
ATOM   5521   O OG   . SER B 2 228 ? -80.753  -0.691  -12.714  1.00 0.00 ? 228 SER B OG   1  
ATOM   5522   H H    . SER B 2 228 ? -78.940  -1.783  -14.233  1.00 0.00 ? 228 SER B H    1  
ATOM   5523   H HA   . SER B 2 228 ? -79.163  -2.954  -11.539  1.00 0.00 ? 228 SER B HA   1  
ATOM   5524   H HB2  . SER B 2 228 ? -81.567  -2.489  -13.224  1.00 0.00 ? 228 SER B HB2  1  
ATOM   5525   H HB3  . SER B 2 228 ? -81.350  -2.242  -11.501  1.00 0.00 ? 228 SER B HB3  1  
ATOM   5526   H HG   . SER B 2 228 ? -80.376  -0.295  -11.924  1.00 0.00 ? 228 SER B HG   1  
ATOM   5527   N N    . PRO B 2 229 ? -78.965  -5.214  -12.748  1.00 0.00 ? 229 PRO B N    1  
ATOM   5528   C CA   . PRO B 2 229 ? -78.746  -6.478  -13.474  1.00 0.00 ? 229 PRO B CA   1  
ATOM   5529   C C    . PRO B 2 229 ? -79.992  -7.315  -13.792  1.00 0.00 ? 229 PRO B C    1  
ATOM   5530   O O    . PRO B 2 229 ? -80.418  -8.119  -12.963  1.00 0.00 ? 229 PRO B O    1  
ATOM   5531   C CB   . PRO B 2 229 ? -77.781  -7.245  -12.559  1.00 0.00 ? 229 PRO B CB   1  
ATOM   5532   C CG   . PRO B 2 229 ? -77.107  -6.188  -11.751  1.00 0.00 ? 229 PRO B CG   1  
ATOM   5533   C CD   . PRO B 2 229 ? -78.172  -5.164  -11.504  1.00 0.00 ? 229 PRO B CD   1  
ATOM   5534   H HA   . PRO B 2 229 ? -78.228  -6.267  -14.394  1.00 0.00 ? 229 PRO B HA   1  
ATOM   5535   H HB2  . PRO B 2 229 ? -78.330  -7.921  -11.917  1.00 0.00 ? 229 PRO B HB2  1  
ATOM   5536   H HB3  . PRO B 2 229 ? -77.053  -7.785  -13.144  1.00 0.00 ? 229 PRO B HB3  1  
ATOM   5537   H HG2  . PRO B 2 229 ? -76.751  -6.601  -10.817  1.00 0.00 ? 229 PRO B HG2  1  
ATOM   5538   H HG3  . PRO B 2 229 ? -76.294  -5.748  -12.306  1.00 0.00 ? 229 PRO B HG3  1  
ATOM   5539   H HD2  . PRO B 2 229 ? -78.775  -5.440  -10.649  1.00 0.00 ? 229 PRO B HD2  1  
ATOM   5540   H HD3  . PRO B 2 229 ? -77.742  -4.184  -11.375  1.00 0.00 ? 229 PRO B HD3  1  
ATOM   5541   N N    . ILE B 2 230 ? -80.534  -7.133  -15.006  1.00 0.00 ? 230 ILE B N    1  
ATOM   5542   C CA   . ILE B 2 230 ? -81.714  -7.865  -15.524  1.00 0.00 ? 230 ILE B CA   1  
ATOM   5543   C C    . ILE B 2 230 ? -81.589  -9.387  -15.352  1.00 0.00 ? 230 ILE B C    1  
ATOM   5544   O O    . ILE B 2 230 ? -80.701  -10.020 -15.929  1.00 0.00 ? 230 ILE B O    1  
ATOM   5545   C CB   . ILE B 2 230 ? -82.009  -7.519  -17.022  1.00 0.00 ? 230 ILE B CB   1  
ATOM   5546   C CG1  . ILE B 2 230 ? -82.236  -6.018  -17.198  1.00 0.00 ? 230 ILE B CG1  1  
ATOM   5547   C CG2  . ILE B 2 230 ? -83.223  -8.281  -17.532  1.00 0.00 ? 230 ILE B CG2  1  
ATOM   5548   C CD1  . ILE B 2 230 ? -81.987  -5.516  -18.603  1.00 0.00 ? 230 ILE B CD1  1  
ATOM   5549   H H    . ILE B 2 230 ? -80.103  -6.486  -15.603  1.00 0.00 ? 230 ILE B H    1  
ATOM   5550   H HA   . ILE B 2 230 ? -82.568  -7.545  -14.944  1.00 0.00 ? 230 ILE B HA   1  
ATOM   5551   H HB   . ILE B 2 230 ? -81.152  -7.811  -17.613  1.00 0.00 ? 230 ILE B HB   1  
ATOM   5552   H HG12 . ILE B 2 230 ? -83.256  -5.791  -16.932  1.00 0.00 ? 230 ILE B HG12 1  
ATOM   5553   H HG13 . ILE B 2 230 ? -81.579  -5.492  -16.519  1.00 0.00 ? 230 ILE B HG13 1  
ATOM   5554   H HG21 . ILE B 2 230 ? -83.284  -9.236  -17.032  1.00 0.00 ? 230 ILE B HG21 1  
ATOM   5555   H HG22 . ILE B 2 230 ? -83.129  -8.437  -18.597  1.00 0.00 ? 230 ILE B HG22 1  
ATOM   5556   H HG23 . ILE B 2 230 ? -84.117  -7.711  -17.330  1.00 0.00 ? 230 ILE B HG23 1  
ATOM   5557   H HD11 . ILE B 2 230 ? -82.931  -5.309  -19.084  1.00 0.00 ? 230 ILE B HD11 1  
ATOM   5558   H HD12 . ILE B 2 230 ? -81.453  -6.268  -19.165  1.00 0.00 ? 230 ILE B HD12 1  
ATOM   5559   H HD13 . ILE B 2 230 ? -81.398  -4.611  -18.563  1.00 0.00 ? 230 ILE B HD13 1  
ATOM   5560   N N    . VAL B 2 231 ? -82.494  -9.954  -14.556  1.00 0.00 ? 231 VAL B N    1  
ATOM   5561   C CA   . VAL B 2 231 ? -82.459  -11.369 -14.171  1.00 0.00 ? 231 VAL B CA   1  
ATOM   5562   C C    . VAL B 2 231 ? -83.625  -12.184 -14.783  1.00 0.00 ? 231 VAL B C    1  
ATOM   5563   O O    . VAL B 2 231 ? -84.755  -11.690 -14.894  1.00 0.00 ? 231 VAL B O    1  
ATOM   5564   C CB   . VAL B 2 231 ? -82.404  -11.503 -12.609  1.00 0.00 ? 231 VAL B CB   1  
ATOM   5565   C CG1  . VAL B 2 231 ? -83.576  -10.765 -11.928  1.00 0.00 ? 231 VAL B CG1  1  
ATOM   5566   C CG2  . VAL B 2 231 ? -82.304  -12.957 -12.157  1.00 0.00 ? 231 VAL B CG2  1  
ATOM   5567   H H    . VAL B 2 231 ? -83.171  -9.379  -14.142  1.00 0.00 ? 231 VAL B H    1  
ATOM   5568   H HA   . VAL B 2 231 ? -81.541  -11.784 -14.562  1.00 0.00 ? 231 VAL B HA   1  
ATOM   5569   H HB   . VAL B 2 231 ? -81.498  -11.001 -12.289  1.00 0.00 ? 231 VAL B HB   1  
ATOM   5570   H HG11 . VAL B 2 231 ? -84.316  -11.484 -11.607  1.00 0.00 ? 231 VAL B HG11 1  
ATOM   5571   H HG12 . VAL B 2 231 ? -84.024  -10.076 -12.628  1.00 0.00 ? 231 VAL B HG12 1  
ATOM   5572   H HG13 . VAL B 2 231 ? -83.208  -10.219 -11.071  1.00 0.00 ? 231 VAL B HG13 1  
ATOM   5573   H HG21 . VAL B 2 231 ? -83.227  -13.250 -11.680  1.00 0.00 ? 231 VAL B HG21 1  
ATOM   5574   H HG22 . VAL B 2 231 ? -81.488  -13.062 -11.458  1.00 0.00 ? 231 VAL B HG22 1  
ATOM   5575   H HG23 . VAL B 2 231 ? -82.127  -13.589 -13.015  1.00 0.00 ? 231 VAL B HG23 1  
ATOM   5576   N N    . LYS B 2 232 ? -83.336  -13.417 -15.197  1.00 0.00 ? 232 LYS B N    1  
ATOM   5577   C CA   . LYS B 2 232 ? -84.368  -14.328 -15.690  1.00 0.00 ? 232 LYS B CA   1  
ATOM   5578   C C    . LYS B 2 232 ? -84.002  -15.752 -15.294  1.00 0.00 ? 232 LYS B C    1  
ATOM   5579   O O    . LYS B 2 232 ? -82.898  -16.223 -15.594  1.00 0.00 ? 232 LYS B O    1  
ATOM   5580   C CB   . LYS B 2 232 ? -84.529  -14.197 -17.204  1.00 0.00 ? 232 LYS B CB   1  
ATOM   5581   C CG   . LYS B 2 232 ? -85.946  -14.394 -17.718  1.00 0.00 ? 232 LYS B CG   1  
ATOM   5582   C CD   . LYS B 2 232 ? -86.215  -15.845 -18.073  1.00 0.00 ? 232 LYS B CD   1  
ATOM   5583   C CE   . LYS B 2 232 ? -87.467  -15.979 -18.918  1.00 0.00 ? 232 LYS B CE   1  
ATOM   5584   N NZ   . LYS B 2 232 ? -87.922  -17.390 -18.995  1.00 0.00 ? 232 LYS B NZ   1  
ATOM   5585   H H    . LYS B 2 232 ? -82.418  -13.747 -15.101  1.00 0.00 ? 232 LYS B H    1  
ATOM   5586   H HA   . LYS B 2 232 ? -85.306  -14.071 -15.218  1.00 0.00 ? 232 LYS B HA   1  
ATOM   5587   H HB2  . LYS B 2 232 ? -84.199  -13.213 -17.497  1.00 0.00 ? 232 LYS B HB2  1  
ATOM   5588   H HB3  . LYS B 2 232 ? -83.885  -14.926 -17.678  1.00 0.00 ? 232 LYS B HB3  1  
ATOM   5589   H HG2  . LYS B 2 232 ? -86.644  -14.083 -16.956  1.00 0.00 ? 232 LYS B HG2  1  
ATOM   5590   H HG3  . LYS B 2 232 ? -86.089  -13.782 -18.597  1.00 0.00 ? 232 LYS B HG3  1  
ATOM   5591   H HD2  . LYS B 2 232 ? -85.373  -16.237 -18.625  1.00 0.00 ? 232 LYS B HD2  1  
ATOM   5592   H HD3  . LYS B 2 232 ? -86.338  -16.415 -17.164  1.00 0.00 ? 232 LYS B HD3  1  
ATOM   5593   H HE2  . LYS B 2 232 ? -88.244  -15.419 -18.416  1.00 0.00 ? 232 LYS B HE2  1  
ATOM   5594   H HE3  . LYS B 2 232 ? -87.319  -15.568 -19.904  1.00 0.00 ? 232 LYS B HE3  1  
ATOM   5595   H HZ1  . LYS B 2 232 ? -88.267  -17.694 -18.062  1.00 0.00 ? 232 LYS B HZ1  1  
ATOM   5596   H HZ2  . LYS B 2 232 ? -87.127  -17.995 -19.285  1.00 0.00 ? 232 LYS B HZ2  1  
ATOM   5597   H HZ3  . LYS B 2 232 ? -88.690  -17.469 -19.691  1.00 0.00 ? 232 LYS B HZ3  1  
ATOM   5598   N N    . SER B 2 233 ? -84.943  -16.430 -14.634  1.00 0.00 ? 233 SER B N    1  
ATOM   5599   C CA   . SER B 2 233 ? -84.655  -17.663 -13.895  1.00 0.00 ? 233 SER B CA   1  
ATOM   5600   C C    . SER B 2 233 ? -85.597  -18.832 -14.203  1.00 0.00 ? 233 SER B C    1  
ATOM   5601   O O    . SER B 2 233 ? -86.669  -18.644 -14.773  1.00 0.00 ? 233 SER B O    1  
ATOM   5602   C CB   . SER B 2 233 ? -84.697  -17.357 -12.394  1.00 0.00 ? 233 SER B CB   1  
ATOM   5603   O OG   . SER B 2 233 ? -83.854  -18.222 -11.656  1.00 0.00 ? 233 SER B OG   1  
ATOM   5604   H H    . SER B 2 233 ? -85.794  -15.979 -14.457  1.00 0.00 ? 233 SER B H    1  
ATOM   5605   H HA   . SER B 2 233 ? -83.651  -17.972 -14.138  1.00 0.00 ? 233 SER B HA   1  
ATOM   5606   H HB2  . SER B 2 233 ? -84.373  -16.343 -12.231  1.00 0.00 ? 233 SER B HB2  1  
ATOM   5607   H HB3  . SER B 2 233 ? -85.717  -17.455 -12.045  1.00 0.00 ? 233 SER B HB3  1  
ATOM   5608   H HG   . SER B 2 233 ? -83.353  -17.689 -11.034  1.00 0.00 ? 233 SER B HG   1  
ATOM   5609   N N    . PHE B 2 234 ? -85.167  -20.038 -13.836  1.00 0.00 ? 234 PHE B N    1  
ATOM   5610   C CA   . PHE B 2 234 ? -86.045  -21.208 -13.748  1.00 0.00 ? 234 PHE B CA   1  
ATOM   5611   C C    . PHE B 2 234 ? -85.481  -22.183 -12.711  1.00 0.00 ? 234 PHE B C    1  
ATOM   5612   O O    . PHE B 2 234 ? -84.382  -21.964 -12.202  1.00 0.00 ? 234 PHE B O    1  
ATOM   5613   C CB   . PHE B 2 234 ? -86.259  -21.869 -15.124  1.00 0.00 ? 234 PHE B CB   1  
ATOM   5614   C CG   . PHE B 2 234 ? -85.254  -22.945 -15.473  1.00 0.00 ? 234 PHE B CG   1  
ATOM   5615   C CD1  . PHE B 2 234 ? -83.984  -22.613 -15.946  1.00 0.00 ? 234 PHE B CD1  1  
ATOM   5616   C CD2  . PHE B 2 234 ? -85.593  -24.296 -15.361  1.00 0.00 ? 234 PHE B CD2  1  
ATOM   5617   C CE1  . PHE B 2 234 ? -83.054  -23.613 -16.282  1.00 0.00 ? 234 PHE B CE1  1  
ATOM   5618   C CE2  . PHE B 2 234 ? -84.669  -25.300 -15.691  1.00 0.00 ? 234 PHE B CE2  1  
ATOM   5619   C CZ   . PHE B 2 234 ? -83.398  -24.955 -16.150  1.00 0.00 ? 234 PHE B CZ   1  
ATOM   5620   H H    . PHE B 2 234 ? -84.288  -20.096 -13.408  1.00 0.00 ? 234 PHE B H    1  
ATOM   5621   H HA   . PHE B 2 234 ? -87.007  -20.867 -13.386  1.00 0.00 ? 234 PHE B HA   1  
ATOM   5622   H HB2  . PHE B 2 234 ? -87.243  -22.309 -15.141  1.00 0.00 ? 234 PHE B HB2  1  
ATOM   5623   H HB3  . PHE B 2 234 ? -86.218  -21.097 -15.881  1.00 0.00 ? 234 PHE B HB3  1  
ATOM   5624   H HD1  . PHE B 2 234 ? -83.710  -21.574 -16.051  1.00 0.00 ? 234 PHE B HD1  1  
ATOM   5625   H HD2  . PHE B 2 234 ? -86.572  -24.571 -14.997  1.00 0.00 ? 234 PHE B HD2  1  
ATOM   5626   H HE1  . PHE B 2 234 ? -82.071  -23.339 -16.637  1.00 0.00 ? 234 PHE B HE1  1  
ATOM   5627   H HE2  . PHE B 2 234 ? -84.946  -26.340 -15.599  1.00 0.00 ? 234 PHE B HE2  1  
ATOM   5628   H HZ   . PHE B 2 234 ? -82.685  -25.725 -16.404  1.00 0.00 ? 234 PHE B HZ   1  
ATOM   5629   N N    . ASN B 2 235 ? -86.230  -23.238 -12.380  1.00 0.00 ? 235 ASN B N    1  
ATOM   5630   C CA   . ASN B 2 235 ? -85.738  -24.262 -11.440  1.00 0.00 ? 235 ASN B CA   1  
ATOM   5631   C C    . ASN B 2 235 ? -85.962  -25.706 -11.872  1.00 0.00 ? 235 ASN B C    1  
ATOM   5632   O O    . ASN B 2 235 ? -87.062  -26.094 -12.250  1.00 0.00 ? 235 ASN B O    1  
ATOM   5633   C CB   . ASN B 2 235 ? -86.256  -24.027 -10.015  1.00 0.00 ? 235 ASN B CB   1  
ATOM   5634   C CG   . ASN B 2 235 ? -87.737  -23.720 -9.973   1.00 0.00 ? 235 ASN B CG   1  
ATOM   5635   O OD1  . ASN B 2 235 ? -88.578  -24.580 -10.244  1.00 0.00 ? 235 ASN B OD1  1  
ATOM   5636   N ND2  . ASN B 2 235 ? -88.065  -22.483 -9.623   1.00 0.00 ? 235 ASN B ND2  1  
ATOM   5637   H H    . ASN B 2 235 ? -87.106  -23.356 -12.802  1.00 0.00 ? 235 ASN B H    1  
ATOM   5638   H HA   . ASN B 2 235 ? -84.666  -24.130 -11.395  1.00 0.00 ? 235 ASN B HA   1  
ATOM   5639   H HB2  . ASN B 2 235 ? -86.070  -24.912 -9.426   1.00 0.00 ? 235 ASN B HB2  1  
ATOM   5640   H HB3  . ASN B 2 235 ? -85.713  -23.200 -9.580   1.00 0.00 ? 235 ASN B HB3  1  
ATOM   5641   H HD21 . ASN B 2 235 ? -87.364  -21.832 -9.410   1.00 0.00 ? 235 ASN B HD21 1  
ATOM   5642   H HD22 . ASN B 2 235 ? -89.008  -22.221 -9.577   1.00 0.00 ? 235 ASN B HD22 1  
ATOM   5643   N N    . ARG B 2 236 ? -84.884  -26.478 -11.781  1.00 0.00 ? 236 ARG B N    1  
ATOM   5644   C CA   . ARG B 2 236 ? -84.776  -27.865 -12.248  1.00 0.00 ? 236 ARG B CA   1  
ATOM   5645   C C    . ARG B 2 236 ? -86.041  -28.718 -12.099  1.00 0.00 ? 236 ARG B C    1  
ATOM   5646   O O    . ARG B 2 236 ? -86.886  -28.735 -12.989  1.00 0.00 ? 236 ARG B O    1  
ATOM   5647   C CB   . ARG B 2 236 ? -83.615  -28.549 -11.511  1.00 0.00 ? 236 ARG B CB   1  
ATOM   5648   C CG   . ARG B 2 236 ? -82.802  -29.510 -12.350  1.00 0.00 ? 236 ARG B CG   1  
ATOM   5649   C CD   . ARG B 2 236 ? -82.637  -30.843 -11.652  1.00 0.00 ? 236 ARG B CD   1  
ATOM   5650   N NE   . ARG B 2 236 ? -83.838  -31.666 -11.804  1.00 0.00 ? 236 ARG B NE   1  
ATOM   5651   C CZ   . ARG B 2 236 ? -84.192  -32.294 -12.926  1.00 0.00 ? 236 ARG B CZ   1  
ATOM   5652   N NH1  . ARG B 2 236 ? -83.444  -32.211 -14.020  1.00 0.00 ? 236 ARG B NH1  1  
ATOM   5653   N NH2  . ARG B 2 236 ? -85.311  -33.008 -12.962  1.00 0.00 ? 236 ARG B NH2  1  
ATOM   5654   H H    . ARG B 2 236 ? -84.063  -26.058 -11.448  1.00 0.00 ? 236 ARG B H    1  
ATOM   5655   H HA   . ARG B 2 236 ? -84.520  -27.840 -13.295  1.00 0.00 ? 236 ARG B HA   1  
ATOM   5656   H HB2  . ARG B 2 236 ? -82.951  -27.785 -11.140  1.00 0.00 ? 236 ARG B HB2  1  
ATOM   5657   H HB3  . ARG B 2 236 ? -84.020  -29.087 -10.665  1.00 0.00 ? 236 ARG B HB3  1  
ATOM   5658   H HG2  . ARG B 2 236 ? -83.301  -29.664 -13.295  1.00 0.00 ? 236 ARG B HG2  1  
ATOM   5659   H HG3  . ARG B 2 236 ? -81.827  -29.082 -12.531  1.00 0.00 ? 236 ARG B HG3  1  
ATOM   5660   H HD2  . ARG B 2 236 ? -81.795  -31.366 -12.078  1.00 0.00 ? 236 ARG B HD2  1  
ATOM   5661   H HD3  . ARG B 2 236 ? -82.453  -30.672 -10.601  1.00 0.00 ? 236 ARG B HD3  1  
ATOM   5662   H HE   . ARG B 2 236 ? -84.426  -31.759 -11.026  1.00 0.00 ? 236 ARG B HE   1  
ATOM   5663   H HH11 . ARG B 2 236 ? -82.602  -31.672 -14.011  1.00 0.00 ? 236 ARG B HH11 1  
ATOM   5664   H HH12 . ARG B 2 236 ? -83.723  -32.688 -14.854  1.00 0.00 ? 236 ARG B HH12 1  
ATOM   5665   H HH21 . ARG B 2 236 ? -85.888  -33.074 -12.148  1.00 0.00 ? 236 ARG B HH21 1  
ATOM   5666   H HH22 . ARG B 2 236 ? -85.576  -33.479 -13.803  1.00 0.00 ? 236 ARG B HH22 1  
ATOM   5667   N N    . ASN B 2 237 ? -86.132  -29.421 -10.964  1.00 0.00 ? 237 ASN B N    1  
ATOM   5668   C CA   . ASN B 2 237 ? -87.194  -30.399 -10.621  1.00 0.00 ? 237 ASN B CA   1  
ATOM   5669   C C    . ASN B 2 237 ? -88.168  -30.880 -11.722  1.00 0.00 ? 237 ASN B C    1  
ATOM   5670   O O    . ASN B 2 237 ? -88.123  -32.055 -12.131  1.00 0.00 ? 237 ASN B O    1  
ATOM   5671   C CB   . ASN B 2 237 ? -87.959  -29.958 -9.356   1.00 0.00 ? 237 ASN B CB   1  
ATOM   5672   C CG   . ASN B 2 237 ? -88.327  -28.477 -9.369   1.00 0.00 ? 237 ASN B CG   1  
ATOM   5673   O OD1  . ASN B 2 237 ? -87.898  -27.720 -8.495   1.00 0.00 ? 237 ASN B OD1  1  
ATOM   5674   N ND2  . ASN B 2 237 ? -89.125  -28.058 -10.357  1.00 0.00 ? 237 ASN B ND2  1  
ATOM   5675   H H    . ASN B 2 237 ? -85.392  -29.331 -10.327  1.00 0.00 ? 237 ASN B H    1  
ATOM   5676   H HA   . ASN B 2 237 ? -86.659  -31.289 -10.326  1.00 0.00 ? 237 ASN B HA   1  
ATOM   5677   H HB2  . ASN B 2 237 ? -88.866  -30.538 -9.277   1.00 0.00 ? 237 ASN B HB2  1  
ATOM   5678   H HB3  . ASN B 2 237 ? -87.343  -30.158 -8.491   1.00 0.00 ? 237 ASN B HB3  1  
ATOM   5679   H HD21 . ASN B 2 237 ? -89.431  -28.652 -10.979  1.00 0.00 ? 237 ASN B HD21 1  
ATOM   5680   H HD22 . ASN B 2 237 ? -89.389  -27.116 -10.407  1.00 0.00 ? 237 ASN B HD22 1  
ATOM   5681   N N    . GLU B 2 238 ? -89.045  -29.985 -12.182  1.00 0.00 ? 238 GLU B N    1  
ATOM   5682   C CA   . GLU B 2 238 ? -90.028  -30.330 -13.206  1.00 0.00 ? 238 GLU B CA   1  
ATOM   5683   C C    . GLU B 2 238 ? -89.353  -30.727 -14.528  1.00 0.00 ? 238 GLU B C    1  
ATOM   5684   O O    . GLU B 2 238 ? -89.698  -31.750 -15.138  1.00 0.00 ? 238 GLU B O    1  
ATOM   5685   C CB   . GLU B 2 238 ? -91.043  -29.192 -13.412  1.00 0.00 ? 238 GLU B CB   1  
ATOM   5686   C CG   . GLU B 2 238 ? -92.234  -29.578 -14.310  1.00 0.00 ? 238 GLU B CG   1  
ATOM   5687   C CD   . GLU B 2 238 ? -92.806  -30.976 -14.010  1.00 0.00 ? 238 GLU B CD   1  
ATOM   5688   O OE1  . GLU B 2 238 ? -93.345  -31.188 -12.900  1.00 0.00 ? 238 GLU B OE1  1  
ATOM   5689   O OE2  . GLU B 2 238 ? -92.710  -31.862 -14.889  1.00 0.00 ? 238 GLU B OE2  1  
ATOM   5690   H H    . GLU B 2 238 ? -89.038  -29.077 -11.813  1.00 0.00 ? 238 GLU B H    1  
ATOM   5691   H HA   . GLU B 2 238 ? -90.572  -31.194 -12.850  1.00 0.00 ? 238 GLU B HA   1  
ATOM   5692   H HB2  . GLU B 2 238 ? -91.422  -28.883 -12.450  1.00 0.00 ? 238 GLU B HB2  1  
ATOM   5693   H HB3  . GLU B 2 238 ? -90.529  -28.355 -13.863  1.00 0.00 ? 238 GLU B HB3  1  
ATOM   5694   H HG2  . GLU B 2 238 ? -93.019  -28.851 -14.173  1.00 0.00 ? 238 GLU B HG2  1  
ATOM   5695   H HG3  . GLU B 2 238 ? -91.911  -29.548 -15.341  1.00 0.00 ? 238 GLU B HG3  1  
ATOM   5696   N N    . CYS B 2 239 ? -88.372  -29.928 -14.940  1.00 0.00 ? 239 CYS B N    1  
ATOM   5697   C CA   . CYS B 2 239 ? -87.750  -30.066 -16.250  1.00 0.00 ? 239 CYS B CA   1  
ATOM   5698   C C    . CYS B 2 239 ? -86.259  -30.419 -16.152  1.00 0.00 ? 239 CYS B C    1  
ATOM   5699   O O    . CYS B 2 239 ? -85.409  -29.960 -16.925  1.00 0.00 ? 239 CYS B O    1  
ATOM   5700   C CB   . CYS B 2 239 ? -88.016  -28.800 -17.078  1.00 0.00 ? 239 CYS B CB   1  
ATOM   5701   S SG   . CYS B 2 239 ? -89.703  -28.796 -17.788  1.00 0.00 ? 239 CYS B SG   1  
ATOM   5702   O OXT  . CYS B 2 239 ? -85.874  -31.203 -15.280  1.00 0.00 ? 239 CYS B OXT  1  
ATOM   5703   H H    . CYS B 2 239 ? -88.139  -29.151 -14.390  1.00 0.00 ? 239 CYS B H    1  
ATOM   5704   H HA   . CYS B 2 239 ? -88.239  -30.889 -16.751  1.00 0.00 ? 239 CYS B HA   1  
ATOM   5705   H HB2  . CYS B 2 239 ? -87.901  -27.934 -16.444  1.00 0.00 ? 239 CYS B HB2  1  
ATOM   5706   H HB3  . CYS B 2 239 ? -87.294  -28.746 -17.880  1.00 0.00 ? 239 CYS B HB3  1  
ATOM   5707   N N    . GLU C 3 1   ? -84.707  -12.620 -61.276  1.00 0.00 ? 1   GLU C N    1  
ATOM   5708   C CA   . GLU C 3 1   ? -84.435  -12.500 -62.735  1.00 0.00 ? 1   GLU C CA   1  
ATOM   5709   C C    . GLU C 3 1   ? -83.229  -13.348 -63.136  1.00 0.00 ? 1   GLU C C    1  
ATOM   5710   O O    . GLU C 3 1   ? -83.362  -14.300 -63.913  1.00 0.00 ? 1   GLU C O    1  
ATOM   5711   C CB   . GLU C 3 1   ? -84.220  -11.033 -63.142  1.00 0.00 ? 1   GLU C CB   1  
ATOM   5712   C CG   . GLU C 3 1   ? -83.782  -10.858 -64.611  1.00 0.00 ? 1   GLU C CG   1  
ATOM   5713   C CD   . GLU C 3 1   ? -84.461  -9.673  -65.302  1.00 0.00 ? 1   GLU C CD   1  
ATOM   5714   O OE1  . GLU C 3 1   ? -84.129  -8.510  -64.967  1.00 0.00 ? 1   GLU C OE1  1  
ATOM   5715   O OE2  . GLU C 3 1   ? -85.326  -9.907  -66.185  1.00 0.00 ? 1   GLU C OE2  1  
ATOM   5716   H H1   . GLU C 3 1   ? -85.718  -12.812 -61.126  1.00 0.00 ? 1   GLU C H1   1  
ATOM   5717   H H2   . GLU C 3 1   ? -84.449  -11.730 -60.801  1.00 0.00 ? 1   GLU C H2   1  
ATOM   5718   H H3   . GLU C 3 1   ? -84.146  -13.400 -60.881  1.00 0.00 ? 1   GLU C H3   1  
ATOM   5719   H HA   . GLU C 3 1   ? -85.298  -12.875 -63.267  1.00 0.00 ? 1   GLU C HA   1  
ATOM   5720   H HB2  . GLU C 3 1   ? -85.143  -10.495 -62.993  1.00 0.00 ? 1   GLU C HB2  1  
ATOM   5721   H HB3  . GLU C 3 1   ? -83.464  -10.605 -62.500  1.00 0.00 ? 1   GLU C HB3  1  
ATOM   5722   H HG2  . GLU C 3 1   ? -82.714  -10.709 -64.640  1.00 0.00 ? 1   GLU C HG2  1  
ATOM   5723   H HG3  . GLU C 3 1   ? -84.019  -11.763 -65.153  1.00 0.00 ? 1   GLU C HG3  1  
ATOM   5724   N N    . VAL C 3 2   ? -82.068  -12.984 -62.592  1.00 0.00 ? 2   VAL C N    1  
ATOM   5725   C CA   . VAL C 3 2   ? -80.784  -13.635 -62.873  1.00 0.00 ? 2   VAL C CA   1  
ATOM   5726   C C    . VAL C 3 2   ? -80.258  -14.307 -61.608  1.00 0.00 ? 2   VAL C C    1  
ATOM   5727   O O    . VAL C 3 2   ? -80.118  -13.670 -60.571  1.00 0.00 ? 2   VAL C O    1  
ATOM   5728   C CB   . VAL C 3 2   ? -79.756  -12.613 -63.430  1.00 0.00 ? 2   VAL C CB   1  
ATOM   5729   C CG1  . VAL C 3 2   ? -80.041  -11.221 -62.880  1.00 0.00 ? 2   VAL C CG1  1  
ATOM   5730   C CG2  . VAL C 3 2   ? -78.319  -13.038 -63.136  1.00 0.00 ? 2   VAL C CG2  1  
ATOM   5731   H H    . VAL C 3 2   ? -82.068  -12.215 -61.985  1.00 0.00 ? 2   VAL C H    1  
ATOM   5732   H HA   . VAL C 3 2   ? -80.947  -14.398 -63.620  1.00 0.00 ? 2   VAL C HA   1  
ATOM   5733   H HB   . VAL C 3 2   ? -79.885  -12.573 -64.504  1.00 0.00 ? 2   VAL C HB   1  
ATOM   5734   H HG11 . VAL C 3 2   ? -79.658  -11.145 -61.873  1.00 0.00 ? 2   VAL C HG11 1  
ATOM   5735   H HG12 . VAL C 3 2   ? -81.107  -11.048 -62.873  1.00 0.00 ? 2   VAL C HG12 1  
ATOM   5736   H HG13 . VAL C 3 2   ? -79.561  -10.482 -63.504  1.00 0.00 ? 2   VAL C HG13 1  
ATOM   5737   H HG21 . VAL C 3 2   ? -77.744  -13.020 -64.050  1.00 0.00 ? 2   VAL C HG21 1  
ATOM   5738   H HG22 . VAL C 3 2   ? -78.315  -14.039 -62.728  1.00 0.00 ? 2   VAL C HG22 1  
ATOM   5739   H HG23 . VAL C 3 2   ? -77.880  -12.357 -62.421  1.00 0.00 ? 2   VAL C HG23 1  
ATOM   5740   N N    . GLN C 3 3   ? -79.975  -15.600 -61.702  1.00 0.00 ? 3   GLN C N    1  
ATOM   5741   C CA   . GLN C 3 3   ? -79.531  -16.357 -60.541  1.00 0.00 ? 3   GLN C CA   1  
ATOM   5742   C C    . GLN C 3 3   ? -78.251  -17.165 -60.742  1.00 0.00 ? 3   GLN C C    1  
ATOM   5743   O O    . GLN C 3 3   ? -77.898  -17.556 -61.854  1.00 0.00 ? 3   GLN C O    1  
ATOM   5744   C CB   . GLN C 3 3   ? -80.641  -17.281 -60.050  1.00 0.00 ? 3   GLN C CB   1  
ATOM   5745   C CG   . GLN C 3 3   ? -81.305  -16.868 -58.748  1.00 0.00 ? 3   GLN C CG   1  
ATOM   5746   C CD   . GLN C 3 3   ? -81.901  -18.061 -58.013  1.00 0.00 ? 3   GLN C CD   1  
ATOM   5747   O OE1  . GLN C 3 3   ? -82.581  -18.914 -58.606  1.00 0.00 ? 3   GLN C OE1  1  
ATOM   5748   N NE2  . GLN C 3 3   ? -81.638  -18.135 -56.712  1.00 0.00 ? 3   GLN C NE2  1  
ATOM   5749   H H    . GLN C 3 3   ? -80.111  -16.062 -62.555  1.00 0.00 ? 3   GLN C H    1  
ATOM   5750   H HA   . GLN C 3 3   ? -79.339  -15.646 -59.752  1.00 0.00 ? 3   GLN C HA   1  
ATOM   5751   H HB2  . GLN C 3 3   ? -81.405  -17.314 -60.810  1.00 0.00 ? 3   GLN C HB2  1  
ATOM   5752   H HB3  . GLN C 3 3   ? -80.235  -18.276 -59.935  1.00 0.00 ? 3   GLN C HB3  1  
ATOM   5753   H HG2  . GLN C 3 3   ? -80.575  -16.388 -58.113  1.00 0.00 ? 3   GLN C HG2  1  
ATOM   5754   H HG3  . GLN C 3 3   ? -82.094  -16.164 -58.970  1.00 0.00 ? 3   GLN C HG3  1  
ATOM   5755   H HE21 . GLN C 3 3   ? -81.089  -17.446 -56.284  1.00 0.00 ? 3   GLN C HE21 1  
ATOM   5756   H HE22 . GLN C 3 3   ? -81.992  -18.879 -56.182  1.00 0.00 ? 3   GLN C HE22 1  
ATOM   5757   N N    . LEU C 3 4   ? -77.570  -17.391 -59.622  1.00 0.00 ? 4   LEU C N    1  
ATOM   5758   C CA   . LEU C 3 4   ? -76.420  -18.280 -59.516  1.00 0.00 ? 4   LEU C CA   1  
ATOM   5759   C C    . LEU C 3 4   ? -76.490  -19.018 -58.175  1.00 0.00 ? 4   LEU C C    1  
ATOM   5760   O O    . LEU C 3 4   ? -76.705  -18.408 -57.116  1.00 0.00 ? 4   LEU C O    1  
ATOM   5761   C CB   . LEU C 3 4   ? -75.108  -17.496 -59.616  1.00 0.00 ? 4   LEU C CB   1  
ATOM   5762   C CG   . LEU C 3 4   ? -74.802  -16.771 -60.918  1.00 0.00 ? 4   LEU C CG   1  
ATOM   5763   C CD1  . LEU C 3 4   ? -73.577  -15.898 -60.784  1.00 0.00 ? 4   LEU C CD1  1  
ATOM   5764   C CD2  . LEU C 3 4   ? -74.594  -17.825 -61.959  1.00 0.00 ? 4   LEU C CD2  1  
ATOM   5765   H H    . LEU C 3 4   ? -77.936  -17.026 -58.790  1.00 0.00 ? 4   LEU C H    1  
ATOM   5766   H HA   . LEU C 3 4   ? -76.461  -19.004 -60.317  1.00 0.00 ? 4   LEU C HA   1  
ATOM   5767   H HB2  . LEU C 3 4   ? -75.106  -16.759 -58.832  1.00 0.00 ? 4   LEU C HB2  1  
ATOM   5768   H HB3  . LEU C 3 4   ? -74.300  -18.188 -59.417  1.00 0.00 ? 4   LEU C HB3  1  
ATOM   5769   H HG   . LEU C 3 4   ? -75.648  -16.160 -61.194  1.00 0.00 ? 4   LEU C HG   1  
ATOM   5770   H HD11 . LEU C 3 4   ? -72.757  -16.484 -60.396  1.00 0.00 ? 4   LEU C HD11 1  
ATOM   5771   H HD12 . LEU C 3 4   ? -73.789  -15.082 -60.108  1.00 0.00 ? 4   LEU C HD12 1  
ATOM   5772   H HD13 . LEU C 3 4   ? -73.310  -15.502 -61.752  1.00 0.00 ? 4   LEU C HD13 1  
ATOM   5773   H HD21 . LEU C 3 4   ? -74.885  -18.786 -61.561  1.00 0.00 ? 4   LEU C HD21 1  
ATOM   5774   H HD22 . LEU C 3 4   ? -73.552  -17.852 -62.240  1.00 0.00 ? 4   LEU C HD22 1  
ATOM   5775   H HD23 . LEU C 3 4   ? -75.196  -17.598 -62.826  1.00 0.00 ? 4   LEU C HD23 1  
ATOM   5776   N N    . VAL C 3 5   ? -76.332  -20.334 -58.242  1.00 0.00 ? 5   VAL C N    1  
ATOM   5777   C CA   . VAL C 3 5   ? -76.284  -21.177 -57.061  1.00 0.00 ? 5   VAL C CA   1  
ATOM   5778   C C    . VAL C 3 5   ? -75.158  -22.165 -57.233  1.00 0.00 ? 5   VAL C C    1  
ATOM   5779   O O    . VAL C 3 5   ? -75.304  -23.180 -57.920  1.00 0.00 ? 5   VAL C O    1  
ATOM   5780   C CB   . VAL C 3 5   ? -77.591  -21.948 -56.830  1.00 0.00 ? 5   VAL C CB   1  
ATOM   5781   C CG1  . VAL C 3 5   ? -78.471  -21.220 -55.836  1.00 0.00 ? 5   VAL C CG1  1  
ATOM   5782   C CG2  . VAL C 3 5   ? -78.331  -22.197 -58.153  1.00 0.00 ? 5   VAL C CG2  1  
ATOM   5783   H H    . VAL C 3 5   ? -76.184  -20.745 -59.119  1.00 0.00 ? 5   VAL C H    1  
ATOM   5784   H HA   . VAL C 3 5   ? -76.080  -20.560 -56.198  1.00 0.00 ? 5   VAL C HA   1  
ATOM   5785   H HB   . VAL C 3 5   ? -77.335  -22.907 -56.400  1.00 0.00 ? 5   VAL C HB   1  
ATOM   5786   H HG11 . VAL C 3 5   ? -79.161  -20.581 -56.366  1.00 0.00 ? 5   VAL C HG11 1  
ATOM   5787   H HG12 . VAL C 3 5   ? -77.855  -20.621 -55.182  1.00 0.00 ? 5   VAL C HG12 1  
ATOM   5788   H HG13 . VAL C 3 5   ? -79.024  -21.940 -55.251  1.00 0.00 ? 5   VAL C HG13 1  
ATOM   5789   H HG21 . VAL C 3 5   ? -79.293  -21.706 -58.126  1.00 0.00 ? 5   VAL C HG21 1  
ATOM   5790   H HG22 . VAL C 3 5   ? -78.473  -23.259 -58.292  1.00 0.00 ? 5   VAL C HG22 1  
ATOM   5791   H HG23 . VAL C 3 5   ? -77.747  -21.802 -58.972  1.00 0.00 ? 5   VAL C HG23 1  
ATOM   5792   N N    . GLU C 3 6   ? -74.019  -21.845 -56.637  1.00 0.00 ? 6   GLU C N    1  
ATOM   5793   C CA   . GLU C 3 6   ? -72.889  -22.757 -56.652  1.00 0.00 ? 6   GLU C CA   1  
ATOM   5794   C C    . GLU C 3 6   ? -73.136  -23.769 -55.561  1.00 0.00 ? 6   GLU C C    1  
ATOM   5795   O O    . GLU C 3 6   ? -73.961  -23.531 -54.680  1.00 0.00 ? 6   GLU C O    1  
ATOM   5796   C CB   . GLU C 3 6   ? -71.547  -22.025 -56.461  1.00 0.00 ? 6   GLU C CB   1  
ATOM   5797   C CG   . GLU C 3 6   ? -71.380  -21.273 -55.142  1.00 0.00 ? 6   GLU C CG   1  
ATOM   5798   C CD   . GLU C 3 6   ? -71.985  -19.887 -55.174  1.00 0.00 ? 6   GLU C CD   1  
ATOM   5799   O OE1  . GLU C 3 6   ? -71.378  -18.988 -55.797  1.00 0.00 ? 6   GLU C OE1  1  
ATOM   5800   O OE2  . GLU C 3 6   ? -73.068  -19.701 -54.581  1.00 0.00 ? 6   GLU C OE2  1  
ATOM   5801   H H    . GLU C 3 6   ? -73.958  -21.010 -56.129  1.00 0.00 ? 6   GLU C H    1  
ATOM   5802   H HA   . GLU C 3 6   ? -72.877  -23.273 -57.603  1.00 0.00 ? 6   GLU C HA   1  
ATOM   5803   H HB2  . GLU C 3 6   ? -70.754  -22.753 -56.530  1.00 0.00 ? 6   GLU C HB2  1  
ATOM   5804   H HB3  . GLU C 3 6   ? -71.429  -21.322 -57.275  1.00 0.00 ? 6   GLU C HB3  1  
ATOM   5805   H HG2  . GLU C 3 6   ? -71.856  -21.839 -54.356  1.00 0.00 ? 6   GLU C HG2  1  
ATOM   5806   H HG3  . GLU C 3 6   ? -70.325  -21.191 -54.920  1.00 0.00 ? 6   GLU C HG3  1  
ATOM   5807   N N    . SER C 3 7   ? -72.443  -24.900 -55.633  1.00 0.00 ? 7   SER C N    1  
ATOM   5808   C CA   . SER C 3 7   ? -72.628  -25.953 -54.654  1.00 0.00 ? 7   SER C CA   1  
ATOM   5809   C C    . SER C 3 7   ? -71.714  -27.150 -54.877  1.00 0.00 ? 7   SER C C    1  
ATOM   5810   O O    . SER C 3 7   ? -71.002  -27.230 -55.873  1.00 0.00 ? 7   SER C O    1  
ATOM   5811   C CB   . SER C 3 7   ? -74.094  -26.389 -54.640  1.00 0.00 ? 7   SER C CB   1  
ATOM   5812   O OG   . SER C 3 7   ? -74.636  -26.302 -55.952  1.00 0.00 ? 7   SER C OG   1  
ATOM   5813   H H    . SER C 3 7   ? -71.813  -25.033 -56.372  1.00 0.00 ? 7   SER C H    1  
ATOM   5814   H HA   . SER C 3 7   ? -72.400  -25.543 -53.682  1.00 0.00 ? 7   SER C HA   1  
ATOM   5815   H HB2  . SER C 3 7   ? -74.164  -27.407 -54.297  1.00 0.00 ? 7   SER C HB2  1  
ATOM   5816   H HB3  . SER C 3 7   ? -74.650  -25.748 -53.968  1.00 0.00 ? 7   SER C HB3  1  
ATOM   5817   H HG   . SER C 3 7   ? -74.130  -25.649 -56.440  1.00 0.00 ? 7   SER C HG   1  
ATOM   5818   N N    . GLY C 3 8   ? -71.746  -28.064 -53.913  1.00 0.00 ? 8   GLY C N    1  
ATOM   5819   C CA   . GLY C 3 8   ? -71.031  -29.325 -53.983  1.00 0.00 ? 8   GLY C CA   1  
ATOM   5820   C C    . GLY C 3 8   ? -69.624  -29.308 -53.392  1.00 0.00 ? 8   GLY C C    1  
ATOM   5821   O O    . GLY C 3 8   ? -68.646  -29.588 -54.102  1.00 0.00 ? 8   GLY C O    1  
ATOM   5822   H H    . GLY C 3 8   ? -72.337  -27.909 -53.147  1.00 0.00 ? 8   GLY C H    1  
ATOM   5823   H HA2  . GLY C 3 8   ? -71.605  -30.054 -53.431  1.00 0.00 ? 8   GLY C HA2  1  
ATOM   5824   H HA3  . GLY C 3 8   ? -70.977  -29.644 -55.013  1.00 0.00 ? 8   GLY C HA3  1  
ATOM   5825   N N    . GLY C 3 9   ? -69.501  -29.010 -52.099  1.00 0.00 ? 9   GLY C N    1  
ATOM   5826   C CA   . GLY C 3 9   ? -68.191  -29.040 -51.477  1.00 0.00 ? 9   GLY C CA   1  
ATOM   5827   C C    . GLY C 3 9   ? -68.226  -28.766 -50.003  1.00 0.00 ? 9   GLY C C    1  
ATOM   5828   O O    . GLY C 3 9   ? -68.782  -27.768 -49.570  1.00 0.00 ? 9   GLY C O    1  
ATOM   5829   H H    . GLY C 3 9   ? -70.297  -28.812 -51.561  1.00 0.00 ? 9   GLY C H    1  
ATOM   5830   H HA2  . GLY C 3 9   ? -67.755  -30.015 -51.636  1.00 0.00 ? 9   GLY C HA2  1  
ATOM   5831   H HA3  . GLY C 3 9   ? -67.565  -28.299 -51.954  1.00 0.00 ? 9   GLY C HA3  1  
ATOM   5832   N N    . GLY C 3 10  ? -67.628  -29.663 -49.233  1.00 0.00 ? 10  GLY C N    1  
ATOM   5833   C CA   . GLY C 3 10  ? -67.455  -29.460 -47.800  1.00 0.00 ? 10  GLY C CA   1  
ATOM   5834   C C    . GLY C 3 10  ? -66.004  -29.615 -47.377  1.00 0.00 ? 10  GLY C C    1  
ATOM   5835   O O    . GLY C 3 10  ? -65.167  -28.742 -47.662  1.00 0.00 ? 10  GLY C O    1  
ATOM   5836   H H    . GLY C 3 10  ? -67.206  -30.441 -49.654  1.00 0.00 ? 10  GLY C H    1  
ATOM   5837   H HA2  . GLY C 3 10  ? -67.791  -28.466 -47.543  1.00 0.00 ? 10  GLY C HA2  1  
ATOM   5838   H HA3  . GLY C 3 10  ? -68.054  -30.183 -47.267  1.00 0.00 ? 10  GLY C HA3  1  
ATOM   5839   N N    . LEU C 3 11  ? -65.698  -30.722 -46.696  1.00 0.00 ? 11  LEU C N    1  
ATOM   5840   C CA   . LEU C 3 11  ? -64.345  -30.951 -46.186  1.00 0.00 ? 11  LEU C CA   1  
ATOM   5841   C C    . LEU C 3 11  ? -63.537  -31.854 -47.122  1.00 0.00 ? 11  LEU C C    1  
ATOM   5842   O O    . LEU C 3 11  ? -64.085  -32.762 -47.741  1.00 0.00 ? 11  LEU C O    1  
ATOM   5843   C CB   . LEU C 3 11  ? -64.370  -31.491 -44.751  1.00 0.00 ? 11  LEU C CB   1  
ATOM   5844   C CG   . LEU C 3 11  ? -63.070  -32.083 -44.193  1.00 0.00 ? 11  LEU C CG   1  
ATOM   5845   C CD1  . LEU C 3 11  ? -62.079  -31.018 -43.733  1.00 0.00 ? 11  LEU C CD1  1  
ATOM   5846   C CD2  . LEU C 3 11  ? -63.372  -33.057 -43.061  1.00 0.00 ? 11  LEU C CD2  1  
ATOM   5847   H H    . LEU C 3 11  ? -66.403  -31.375 -46.500  1.00 0.00 ? 11  LEU C H    1  
ATOM   5848   H HA   . LEU C 3 11  ? -63.847  -29.991 -46.164  1.00 0.00 ? 11  LEU C HA   1  
ATOM   5849   H HB2  . LEU C 3 11  ? -64.663  -30.685 -44.100  1.00 0.00 ? 11  LEU C HB2  1  
ATOM   5850   H HB3  . LEU C 3 11  ? -65.138  -32.252 -44.700  1.00 0.00 ? 11  LEU C HB3  1  
ATOM   5851   H HG   . LEU C 3 11  ? -62.599  -32.640 -44.991  1.00 0.00 ? 11  LEU C HG   1  
ATOM   5852   H HD11 . LEU C 3 11  ? -61.088  -31.443 -43.687  1.00 0.00 ? 11  LEU C HD11 1  
ATOM   5853   H HD12 . LEU C 3 11  ? -62.363  -30.661 -42.754  1.00 0.00 ? 11  LEU C HD12 1  
ATOM   5854   H HD13 . LEU C 3 11  ? -62.086  -30.194 -44.432  1.00 0.00 ? 11  LEU C HD13 1  
ATOM   5855   H HD21 . LEU C 3 11  ? -63.074  -34.053 -43.354  1.00 0.00 ? 11  LEU C HD21 1  
ATOM   5856   H HD22 . LEU C 3 11  ? -64.431  -33.046 -42.850  1.00 0.00 ? 11  LEU C HD22 1  
ATOM   5857   H HD23 . LEU C 3 11  ? -62.825  -32.764 -42.178  1.00 0.00 ? 11  LEU C HD23 1  
ATOM   5858   N N    . VAL C 3 12  ? -62.241  -31.566 -47.236  1.00 0.00 ? 12  VAL C N    1  
ATOM   5859   C CA   . VAL C 3 12  ? -61.329  -32.329 -48.079  1.00 0.00 ? 12  VAL C CA   1  
ATOM   5860   C C    . VAL C 3 12  ? -59.935  -32.296 -47.484  1.00 0.00 ? 12  VAL C C    1  
ATOM   5861   O O    . VAL C 3 12  ? -59.502  -31.274 -46.940  1.00 0.00 ? 12  VAL C O    1  
ATOM   5862   C CB   . VAL C 3 12  ? -61.281  -31.792 -49.515  1.00 0.00 ? 12  VAL C CB   1  
ATOM   5863   C CG1  . VAL C 3 12  ? -60.630  -30.422 -49.549  1.00 0.00 ? 12  VAL C CG1  1  
ATOM   5864   C CG2  . VAL C 3 12  ? -60.531  -32.757 -50.413  1.00 0.00 ? 12  VAL C CG2  1  
ATOM   5865   H H    . VAL C 3 12  ? -61.884  -30.809 -46.726  1.00 0.00 ? 12  VAL C H    1  
ATOM   5866   H HA   . VAL C 3 12  ? -61.665  -33.355 -48.106  1.00 0.00 ? 12  VAL C HA   1  
ATOM   5867   H HB   . VAL C 3 12  ? -62.296  -31.697 -49.877  1.00 0.00 ? 12  VAL C HB   1  
ATOM   5868   H HG11 . VAL C 3 12  ? -61.235  -29.750 -50.140  1.00 0.00 ? 12  VAL C HG11 1  
ATOM   5869   H HG12 . VAL C 3 12  ? -59.646  -30.502 -49.988  1.00 0.00 ? 12  VAL C HG12 1  
ATOM   5870   H HG13 . VAL C 3 12  ? -60.545  -30.039 -48.543  1.00 0.00 ? 12  VAL C HG13 1  
ATOM   5871   H HG21 . VAL C 3 12  ? -61.150  -33.019 -51.257  1.00 0.00 ? 12  VAL C HG21 1  
ATOM   5872   H HG22 . VAL C 3 12  ? -60.284  -33.649 -49.856  1.00 0.00 ? 12  VAL C HG22 1  
ATOM   5873   H HG23 . VAL C 3 12  ? -59.623  -32.289 -50.764  1.00 0.00 ? 12  VAL C HG23 1  
ATOM   5874   N N    . LYS C 3 13  ? -59.240  -33.422 -47.586  1.00 0.00 ? 13  LYS C N    1  
ATOM   5875   C CA   . LYS C 3 13  ? -57.937  -33.540 -46.956  1.00 0.00 ? 13  LYS C CA   1  
ATOM   5876   C C    . LYS C 3 13  ? -56.873  -32.824 -47.792  1.00 0.00 ? 13  LYS C C    1  
ATOM   5877   O O    . LYS C 3 13  ? -57.059  -32.671 -49.004  1.00 0.00 ? 13  LYS C O    1  
ATOM   5878   C CB   . LYS C 3 13  ? -57.572  -35.018 -46.648  1.00 0.00 ? 13  LYS C CB   1  
ATOM   5879   C CG   . LYS C 3 13  ? -57.954  -36.095 -47.689  1.00 0.00 ? 13  LYS C CG   1  
ATOM   5880   C CD   . LYS C 3 13  ? -57.218  -37.413 -47.388  1.00 0.00 ? 13  LYS C CD   1  
ATOM   5881   C CE   . LYS C 3 13  ? -57.298  -38.408 -48.562  1.00 0.00 ? 13  LYS C CE   1  
ATOM   5882   N NZ   . LYS C 3 13  ? -56.652  -39.766 -48.327  1.00 0.00 ? 13  LYS C NZ   1  
ATOM   5883   H H    . LYS C 3 13  ? -59.640  -34.201 -48.026  1.00 0.00 ? 13  LYS C H    1  
ATOM   5884   H HA   . LYS C 3 13  ? -57.997  -33.018 -46.010  1.00 0.00 ? 13  LYS C HA   1  
ATOM   5885   H HB2  . LYS C 3 13  ? -56.505  -35.070 -46.510  1.00 0.00 ? 13  LYS C HB2  1  
ATOM   5886   H HB3  . LYS C 3 13  ? -58.038  -35.279 -45.706  1.00 0.00 ? 13  LYS C HB3  1  
ATOM   5887   H HG2  . LYS C 3 13  ? -59.021  -36.263 -47.657  1.00 0.00 ? 13  LYS C HG2  1  
ATOM   5888   H HG3  . LYS C 3 13  ? -57.676  -35.750 -48.674  1.00 0.00 ? 13  LYS C HG3  1  
ATOM   5889   H HD2  . LYS C 3 13  ? -56.180  -37.196 -47.185  1.00 0.00 ? 13  LYS C HD2  1  
ATOM   5890   H HD3  . LYS C 3 13  ? -57.658  -37.867 -46.512  1.00 0.00 ? 13  LYS C HD3  1  
ATOM   5891   H HE2  . LYS C 3 13  ? -58.338  -38.572 -48.795  1.00 0.00 ? 13  LYS C HE2  1  
ATOM   5892   H HE3  . LYS C 3 13  ? -56.830  -37.949 -49.422  1.00 0.00 ? 13  LYS C HE3  1  
ATOM   5893   H HZ1  . LYS C 3 13  ? -56.056  -39.723 -47.476  1.00 0.00 ? 13  LYS C HZ1  1  
ATOM   5894   H HZ2  . LYS C 3 13  ? -56.066  -40.017 -49.149  1.00 0.00 ? 13  LYS C HZ2  1  
ATOM   5895   H HZ3  . LYS C 3 13  ? -57.392  -40.484 -48.195  1.00 0.00 ? 13  LYS C HZ3  1  
ATOM   5896   N N    . PRO C 3 14  ? -55.788  -32.336 -47.141  1.00 0.00 ? 14  PRO C N    1  
ATOM   5897   C CA   . PRO C 3 14  ? -54.604  -31.849 -47.839  1.00 0.00 ? 14  PRO C CA   1  
ATOM   5898   C C    . PRO C 3 14  ? -54.211  -32.716 -49.025  1.00 0.00 ? 14  PRO C C    1  
ATOM   5899   O O    . PRO C 3 14  ? -54.437  -33.927 -49.008  1.00 0.00 ? 14  PRO C O    1  
ATOM   5900   C CB   . PRO C 3 14  ? -53.537  -31.899 -46.753  1.00 0.00 ? 14  PRO C CB   1  
ATOM   5901   C CG   . PRO C 3 14  ? -54.282  -31.510 -45.535  1.00 0.00 ? 14  PRO C CG   1  
ATOM   5902   C CD   . PRO C 3 14  ? -55.729  -31.957 -45.719  1.00 0.00 ? 14  PRO C CD   1  
ATOM   5903   H HA   . PRO C 3 14  ? -54.745  -30.828 -48.151  1.00 0.00 ? 14  PRO C HA   1  
ATOM   5904   H HB2  . PRO C 3 14  ? -53.138  -32.901 -46.659  1.00 0.00 ? 14  PRO C HB2  1  
ATOM   5905   H HB3  . PRO C 3 14  ? -52.752  -31.188 -46.954  1.00 0.00 ? 14  PRO C HB3  1  
ATOM   5906   H HG2  . PRO C 3 14  ? -53.850  -31.998 -44.671  1.00 0.00 ? 14  PRO C HG2  1  
ATOM   5907   H HG3  . PRO C 3 14  ? -54.248  -30.440 -45.409  1.00 0.00 ? 14  PRO C HG3  1  
ATOM   5908   H HD2  . PRO C 3 14  ? -55.949  -32.806 -45.085  1.00 0.00 ? 14  PRO C HD2  1  
ATOM   5909   H HD3  . PRO C 3 14  ? -56.409  -31.143 -45.521  1.00 0.00 ? 14  PRO C HD3  1  
ATOM   5910   N N    . GLY C 3 15  ? -53.657  -32.092 -50.060  1.00 0.00 ? 15  GLY C N    1  
ATOM   5911   C CA   . GLY C 3 15  ? -53.359  -32.785 -51.315  1.00 0.00 ? 15  GLY C CA   1  
ATOM   5912   C C    . GLY C 3 15  ? -54.610  -33.246 -52.050  1.00 0.00 ? 15  GLY C C    1  
ATOM   5913   O O    . GLY C 3 15  ? -54.531  -33.723 -53.184  1.00 0.00 ? 15  GLY C O    1  
ATOM   5914   H H    . GLY C 3 15  ? -53.528  -31.122 -50.014  1.00 0.00 ? 15  GLY C H    1  
ATOM   5915   H HA2  . GLY C 3 15  ? -52.806  -32.117 -51.958  1.00 0.00 ? 15  GLY C HA2  1  
ATOM   5916   H HA3  . GLY C 3 15  ? -52.745  -33.647 -51.098  1.00 0.00 ? 15  GLY C HA3  1  
ATOM   5917   N N    . GLY C 3 16  ? -55.763  -33.077 -51.407  1.00 0.00 ? 16  GLY C N    1  
ATOM   5918   C CA   . GLY C 3 16  ? -57.032  -33.593 -51.913  1.00 0.00 ? 16  GLY C CA   1  
ATOM   5919   C C    . GLY C 3 16  ? -57.583  -33.014 -53.209  1.00 0.00 ? 16  GLY C C    1  
ATOM   5920   O O    . GLY C 3 16  ? -56.916  -32.252 -53.918  1.00 0.00 ? 16  GLY C O    1  
ATOM   5921   H H    . GLY C 3 16  ? -55.746  -32.671 -50.515  1.00 0.00 ? 16  GLY C H    1  
ATOM   5922   H HA2  . GLY C 3 16  ? -56.919  -34.654 -52.059  1.00 0.00 ? 16  GLY C HA2  1  
ATOM   5923   H HA3  . GLY C 3 16  ? -57.774  -33.446 -51.139  1.00 0.00 ? 16  GLY C HA3  1  
ATOM   5924   N N    . SER C 3 17  ? -58.816  -33.401 -53.518  1.00 0.00 ? 17  SER C N    1  
ATOM   5925   C CA   . SER C 3 17  ? -59.484  -32.955 -54.729  1.00 0.00 ? 17  SER C CA   1  
ATOM   5926   C C    . SER C 3 17  ? -60.988  -32.847 -54.498  1.00 0.00 ? 17  SER C C    1  
ATOM   5927   O O    . SER C 3 17  ? -61.494  -33.359 -53.494  1.00 0.00 ? 17  SER C O    1  
ATOM   5928   C CB   . SER C 3 17  ? -59.138  -33.871 -55.905  1.00 0.00 ? 17  SER C CB   1  
ATOM   5929   O OG   . SER C 3 17  ? -57.734  -33.817 -56.162  1.00 0.00 ? 17  SER C OG   1  
ATOM   5930   H H    . SER C 3 17  ? -59.285  -34.015 -52.916  1.00 0.00 ? 17  SER C H    1  
ATOM   5931   H HA   . SER C 3 17  ? -59.118  -31.964 -54.960  1.00 0.00 ? 17  SER C HA   1  
ATOM   5932   H HB2  . SER C 3 17  ? -59.414  -34.884 -55.667  1.00 0.00 ? 17  SER C HB2  1  
ATOM   5933   H HB3  . SER C 3 17  ? -59.686  -33.550 -56.782  1.00 0.00 ? 17  SER C HB3  1  
ATOM   5934   H HG   . SER C 3 17  ? -57.403  -32.979 -55.830  1.00 0.00 ? 17  SER C HG   1  
ATOM   5935   N N    . LEU C 3 18  ? -61.686  -32.161 -55.409  1.00 0.00 ? 18  LEU C N    1  
ATOM   5936   C CA   . LEU C 3 18  ? -63.116  -31.819 -55.246  1.00 0.00 ? 18  LEU C CA   1  
ATOM   5937   C C    . LEU C 3 18  ? -63.541  -30.718 -56.217  1.00 0.00 ? 18  LEU C C    1  
ATOM   5938   O O    . LEU C 3 18  ? -62.836  -29.720 -56.382  1.00 0.00 ? 18  LEU C O    1  
ATOM   5939   C CB   . LEU C 3 18  ? -63.435  -31.414 -53.793  1.00 0.00 ? 18  LEU C CB   1  
ATOM   5940   C CG   . LEU C 3 18  ? -64.526  -30.390 -53.465  1.00 0.00 ? 18  LEU C CG   1  
ATOM   5941   C CD1  . LEU C 3 18  ? -65.908  -30.976 -53.648  1.00 0.00 ? 18  LEU C CD1  1  
ATOM   5942   C CD2  . LEU C 3 18  ? -64.342  -29.878 -52.047  1.00 0.00 ? 18  LEU C CD2  1  
ATOM   5943   H H    . LEU C 3 18  ? -61.201  -31.773 -56.167  1.00 0.00 ? 18  LEU C H    1  
ATOM   5944   H HA   . LEU C 3 18  ? -63.689  -32.707 -55.482  1.00 0.00 ? 18  LEU C HA   1  
ATOM   5945   H HB2  . LEU C 3 18  ? -63.698  -32.313 -53.267  1.00 0.00 ? 18  LEU C HB2  1  
ATOM   5946   H HB3  . LEU C 3 18  ? -62.508  -31.055 -53.359  1.00 0.00 ? 18  LEU C HB3  1  
ATOM   5947   H HG   . LEU C 3 18  ? -64.421  -29.556 -54.145  1.00 0.00 ? 18  LEU C HG   1  
ATOM   5948   H HD11 . LEU C 3 18  ? -66.435  -30.957 -52.706  1.00 0.00 ? 18  LEU C HD11 1  
ATOM   5949   H HD12 . LEU C 3 18  ? -65.824  -31.997 -53.992  1.00 0.00 ? 18  LEU C HD12 1  
ATOM   5950   H HD13 . LEU C 3 18  ? -66.453  -30.394 -54.376  1.00 0.00 ? 18  LEU C HD13 1  
ATOM   5951   H HD21 . LEU C 3 18  ? -65.304  -29.815 -51.560  1.00 0.00 ? 18  LEU C HD21 1  
ATOM   5952   H HD22 . LEU C 3 18  ? -63.887  -28.899 -52.074  1.00 0.00 ? 18  LEU C HD22 1  
ATOM   5953   H HD23 . LEU C 3 18  ? -63.705  -30.557 -51.499  1.00 0.00 ? 18  LEU C HD23 1  
ATOM   5954   N N    . LYS C 3 19  ? -64.713  -30.906 -56.824  1.00 0.00 ? 19  LYS C N    1  
ATOM   5955   C CA   . LYS C 3 19  ? -65.199  -30.078 -57.928  1.00 0.00 ? 19  LYS C CA   1  
ATOM   5956   C C    . LYS C 3 19  ? -66.560  -29.418 -57.629  1.00 0.00 ? 19  LYS C C    1  
ATOM   5957   O O    . LYS C 3 19  ? -67.522  -30.094 -57.240  1.00 0.00 ? 19  LYS C O    1  
ATOM   5958   C CB   . LYS C 3 19  ? -65.272  -30.939 -59.191  1.00 0.00 ? 19  LYS C CB   1  
ATOM   5959   C CG   . LYS C 3 19  ? -66.080  -30.367 -60.324  1.00 0.00 ? 19  LYS C CG   1  
ATOM   5960   C CD   . LYS C 3 19  ? -65.781  -31.073 -61.626  1.00 0.00 ? 19  LYS C CD   1  
ATOM   5961   C CE   . LYS C 3 19  ? -66.645  -30.497 -62.711  1.00 0.00 ? 19  LYS C CE   1  
ATOM   5962   N NZ   . LYS C 3 19  ? -65.900  -30.341 -63.976  1.00 0.00 ? 19  LYS C NZ   1  
ATOM   5963   H H    . LYS C 3 19  ? -65.215  -31.720 -56.607  1.00 0.00 ? 19  LYS C H    1  
ATOM   5964   H HA   . LYS C 3 19  ? -64.478  -29.293 -58.101  1.00 0.00 ? 19  LYS C HA   1  
ATOM   5965   H HB2  . LYS C 3 19  ? -64.268  -31.101 -59.547  1.00 0.00 ? 19  LYS C HB2  1  
ATOM   5966   H HB3  . LYS C 3 19  ? -65.691  -31.898 -58.919  1.00 0.00 ? 19  LYS C HB3  1  
ATOM   5967   H HG2  . LYS C 3 19  ? -67.130  -30.474 -60.099  1.00 0.00 ? 19  LYS C HG2  1  
ATOM   5968   H HG3  . LYS C 3 19  ? -65.846  -29.318 -60.430  1.00 0.00 ? 19  LYS C HG3  1  
ATOM   5969   H HD2  . LYS C 3 19  ? -64.740  -30.933 -61.880  1.00 0.00 ? 19  LYS C HD2  1  
ATOM   5970   H HD3  . LYS C 3 19  ? -65.989  -32.127 -61.522  1.00 0.00 ? 19  LYS C HD3  1  
ATOM   5971   H HE2  . LYS C 3 19  ? -67.486  -31.153 -62.877  1.00 0.00 ? 19  LYS C HE2  1  
ATOM   5972   H HE3  . LYS C 3 19  ? -67.010  -29.531 -62.393  1.00 0.00 ? 19  LYS C HE3  1  
ATOM   5973   H HZ1  . LYS C 3 19  ? -66.446  -29.746 -64.630  1.00 0.00 ? 19  LYS C HZ1  1  
ATOM   5974   H HZ2  . LYS C 3 19  ? -65.745  -31.277 -64.405  1.00 0.00 ? 19  LYS C HZ2  1  
ATOM   5975   H HZ3  . LYS C 3 19  ? -64.983  -29.890 -63.786  1.00 0.00 ? 19  LYS C HZ3  1  
ATOM   5976   N N    . LEU C 3 20  ? -66.633  -28.099 -57.815  1.00 0.00 ? 20  LEU C N    1  
ATOM   5977   C CA   . LEU C 3 20  ? -67.843  -27.333 -57.498  1.00 0.00 ? 20  LEU C CA   1  
ATOM   5978   C C    . LEU C 3 20  ? -68.459  -26.828 -58.772  1.00 0.00 ? 20  LEU C C    1  
ATOM   5979   O O    . LEU C 3 20  ? -67.760  -26.536 -59.739  1.00 0.00 ? 20  LEU C O    1  
ATOM   5980   C CB   . LEU C 3 20  ? -67.531  -26.139 -56.596  1.00 0.00 ? 20  LEU C CB   1  
ATOM   5981   C CG   . LEU C 3 20  ? -66.301  -26.234 -55.698  1.00 0.00 ? 20  LEU C CG   1  
ATOM   5982   C CD1  . LEU C 3 20  ? -65.883  -24.862 -55.262  1.00 0.00 ? 20  LEU C CD1  1  
ATOM   5983   C CD2  . LEU C 3 20  ? -66.562  -27.110 -54.504  1.00 0.00 ? 20  LEU C CD2  1  
ATOM   5984   H H    . LEU C 3 20  ? -65.837  -27.619 -58.126  1.00 0.00 ? 20  LEU C H    1  
ATOM   5985   H HA   . LEU C 3 20  ? -68.549  -27.979 -56.996  1.00 0.00 ? 20  LEU C HA   1  
ATOM   5986   H HB2  . LEU C 3 20  ? -67.404  -25.275 -57.227  1.00 0.00 ? 20  LEU C HB2  1  
ATOM   5987   H HB3  . LEU C 3 20  ? -68.396  -25.966 -55.970  1.00 0.00 ? 20  LEU C HB3  1  
ATOM   5988   H HG   . LEU C 3 20  ? -65.494  -26.666 -56.275  1.00 0.00 ? 20  LEU C HG   1  
ATOM   5989   H HD11 . LEU C 3 20  ? -65.759  -24.846 -54.190  1.00 0.00 ? 20  LEU C HD11 1  
ATOM   5990   H HD12 . LEU C 3 20  ? -66.641  -24.147 -55.548  1.00 0.00 ? 20  LEU C HD12 1  
ATOM   5991   H HD13 . LEU C 3 20  ? -64.947  -24.603 -55.735  1.00 0.00 ? 20  LEU C HD13 1  
ATOM   5992   H HD21 . LEU C 3 20  ? -66.428  -28.145 -54.781  1.00 0.00 ? 20  LEU C HD21 1  
ATOM   5993   H HD22 . LEU C 3 20  ? -67.575  -26.957 -54.161  1.00 0.00 ? 20  LEU C HD22 1  
ATOM   5994   H HD23 . LEU C 3 20  ? -65.872  -26.857 -53.714  1.00 0.00 ? 20  LEU C HD23 1  
ATOM   5995   N N    . SER C 3 21  ? -69.774  -26.713 -58.774  1.00 0.00 ? 21  SER C N    1  
ATOM   5996   C CA   . SER C 3 21  ? -70.478  -26.267 -59.958  1.00 0.00 ? 21  SER C CA   1  
ATOM   5997   C C    . SER C 3 21  ? -71.416  -25.155 -59.610  1.00 0.00 ? 21  SER C C    1  
ATOM   5998   O O    . SER C 3 21  ? -72.175  -25.249 -58.663  1.00 0.00 ? 21  SER C O    1  
ATOM   5999   C CB   . SER C 3 21  ? -71.259  -27.415 -60.586  1.00 0.00 ? 21  SER C CB   1  
ATOM   6000   O OG   . SER C 3 21  ? -71.653  -28.351 -59.599  1.00 0.00 ? 21  SER C OG   1  
ATOM   6001   H H    . SER C 3 21  ? -70.282  -26.952 -57.970  1.00 0.00 ? 21  SER C H    1  
ATOM   6002   H HA   . SER C 3 21  ? -69.758  -25.905 -60.676  1.00 0.00 ? 21  SER C HA   1  
ATOM   6003   H HB2  . SER C 3 21  ? -72.139  -27.026 -61.069  1.00 0.00 ? 21  SER C HB2  1  
ATOM   6004   H HB3  . SER C 3 21  ? -70.636  -27.902 -61.326  1.00 0.00 ? 21  SER C HB3  1  
ATOM   6005   H HG   . SER C 3 21  ? -71.209  -28.123 -58.779  1.00 0.00 ? 21  SER C HG   1  
ATOM   6006   N N    . CYS C 3 22  ? -71.346  -24.090 -60.380  1.00 0.00 ? 22  CYS C N    1  
ATOM   6007   C CA   . CYS C 3 22  ? -72.257  -22.992 -60.229  1.00 0.00 ? 22  CYS C CA   1  
ATOM   6008   C C    . CYS C 3 22  ? -73.402  -23.263 -61.173  1.00 0.00 ? 22  CYS C C    1  
ATOM   6009   O O    . CYS C 3 22  ? -73.214  -23.259 -62.392  1.00 0.00 ? 22  CYS C O    1  
ATOM   6010   C CB   . CYS C 3 22  ? -71.556  -21.707 -60.622  1.00 0.00 ? 22  CYS C CB   1  
ATOM   6011   S SG   . CYS C 3 22  ? -72.541  -20.217 -60.480  1.00 0.00 ? 22  CYS C SG   1  
ATOM   6012   H H    . CYS C 3 22  ? -70.703  -24.077 -61.120  1.00 0.00 ? 22  CYS C H    1  
ATOM   6013   H HA   . CYS C 3 22  ? -72.612  -22.932 -59.211  1.00 0.00 ? 22  CYS C HA   1  
ATOM   6014   H HB2  . CYS C 3 22  ? -70.687  -21.590 -59.997  1.00 0.00 ? 22  CYS C HB2  1  
ATOM   6015   H HB3  . CYS C 3 22  ? -71.223  -21.806 -61.647  1.00 0.00 ? 22  CYS C HB3  1  
ATOM   6016   N N    . ALA C 3 23  ? -74.582  -23.527 -60.621  1.00 0.00 ? 23  ALA C N    1  
ATOM   6017   C CA   . ALA C 3 23  ? -75.756  -23.756 -61.455  1.00 0.00 ? 23  ALA C CA   1  
ATOM   6018   C C    . ALA C 3 23  ? -76.297  -22.391 -61.878  1.00 0.00 ? 23  ALA C C    1  
ATOM   6019   O O    . ALA C 3 23  ? -76.826  -21.651 -61.051  1.00 0.00 ? 23  ALA C O    1  
ATOM   6020   C CB   . ALA C 3 23  ? -76.803  -24.581 -60.695  1.00 0.00 ? 23  ALA C CB   1  
ATOM   6021   H H    . ALA C 3 23  ? -74.670  -23.537 -59.645  1.00 0.00 ? 23  ALA C H    1  
ATOM   6022   H HA   . ALA C 3 23  ? -75.453  -24.299 -62.340  1.00 0.00 ? 23  ALA C HA   1  
ATOM   6023   H HB1  . ALA C 3 23  ? -77.788  -24.184 -60.893  1.00 0.00 ? 23  ALA C HB1  1  
ATOM   6024   H HB2  . ALA C 3 23  ? -76.602  -24.530 -59.635  1.00 0.00 ? 23  ALA C HB2  1  
ATOM   6025   H HB3  . ALA C 3 23  ? -76.758  -25.609 -61.021  1.00 0.00 ? 23  ALA C HB3  1  
ATOM   6026   N N    . ALA C 3 24  ? -76.121  -22.025 -63.143  1.00 0.00 ? 24  ALA C N    1  
ATOM   6027   C CA   . ALA C 3 24  ? -76.515  -20.686 -63.580  1.00 0.00 ? 24  ALA C CA   1  
ATOM   6028   C C    . ALA C 3 24  ? -77.933  -20.678 -64.128  1.00 0.00 ? 24  ALA C C    1  
ATOM   6029   O O    . ALA C 3 24  ? -78.300  -21.580 -64.881  1.00 0.00 ? 24  ALA C O    1  
ATOM   6030   C CB   . ALA C 3 24  ? -75.565  -20.172 -64.612  1.00 0.00 ? 24  ALA C CB   1  
ATOM   6031   H H    . ALA C 3 24  ? -75.658  -22.624 -63.765  1.00 0.00 ? 24  ALA C H    1  
ATOM   6032   H HA   . ALA C 3 24  ? -76.479  -20.027 -62.725  1.00 0.00 ? 24  ALA C HA   1  
ATOM   6033   H HB1  . ALA C 3 24  ? -75.061  -19.295 -64.233  1.00 0.00 ? 24  ALA C HB1  1  
ATOM   6034   H HB2  . ALA C 3 24  ? -76.111  -19.914 -65.507  1.00 0.00 ? 24  ALA C HB2  1  
ATOM   6035   H HB3  . ALA C 3 24  ? -74.835  -20.934 -64.842  1.00 0.00 ? 24  ALA C HB3  1  
ATOM   6036   N N    . SER C 3 25  ? -78.726  -19.664 -63.777  1.00 0.00 ? 25  SER C N    1  
ATOM   6037   C CA   . SER C 3 25  ? -80.114  -19.626 -64.241  1.00 0.00 ? 25  SER C CA   1  
ATOM   6038   C C    . SER C 3 25  ? -80.809  -18.253 -64.267  1.00 0.00 ? 25  SER C C    1  
ATOM   6039   O O    . SER C 3 25  ? -81.204  -17.697 -63.226  1.00 0.00 ? 25  SER C O    1  
ATOM   6040   C CB   . SER C 3 25  ? -80.960  -20.616 -63.437  1.00 0.00 ? 25  SER C CB   1  
ATOM   6041   O OG   . SER C 3 25  ? -81.928  -21.243 -64.263  1.00 0.00 ? 25  SER C OG   1  
ATOM   6042   H H    . SER C 3 25  ? -78.388  -18.959 -63.186  1.00 0.00 ? 25  SER C H    1  
ATOM   6043   H HA   . SER C 3 25  ? -80.108  -19.986 -65.257  1.00 0.00 ? 25  SER C HA   1  
ATOM   6044   H HB2  . SER C 3 25  ? -80.320  -21.373 -63.017  1.00 0.00 ? 25  SER C HB2  1  
ATOM   6045   H HB3  . SER C 3 25  ? -81.453  -20.086 -62.632  1.00 0.00 ? 25  SER C HB3  1  
ATOM   6046   H HG   . SER C 3 25  ? -82.726  -20.709 -64.243  1.00 0.00 ? 25  SER C HG   1  
ATOM   6047   N N    . GLY C 3 26  ? -80.990  -17.732 -65.479  1.00 0.00 ? 26  GLY C N    1  
ATOM   6048   C CA   . GLY C 3 26  ? -81.868  -16.583 -65.686  1.00 0.00 ? 26  GLY C CA   1  
ATOM   6049   C C    . GLY C 3 26  ? -81.228  -15.435 -66.433  1.00 0.00 ? 26  GLY C C    1  
ATOM   6050   O O    . GLY C 3 26  ? -81.613  -14.274 -66.246  1.00 0.00 ? 26  GLY C O    1  
ATOM   6051   H H    . GLY C 3 26  ? -80.678  -18.234 -66.260  1.00 0.00 ? 26  GLY C H    1  
ATOM   6052   H HA2  . GLY C 3 26  ? -82.734  -16.909 -66.241  1.00 0.00 ? 26  GLY C HA2  1  
ATOM   6053   H HA3  . GLY C 3 26  ? -82.195  -16.225 -64.720  1.00 0.00 ? 26  GLY C HA3  1  
ATOM   6054   N N    . PHE C 3 27  ? -80.241  -15.763 -67.263  1.00 0.00 ? 27  PHE C N    1  
ATOM   6055   C CA   . PHE C 3 27  ? -79.602  -14.803 -68.161  1.00 0.00 ? 27  PHE C CA   1  
ATOM   6056   C C    . PHE C 3 27  ? -78.971  -15.564 -69.324  1.00 0.00 ? 27  PHE C C    1  
ATOM   6057   O O    . PHE C 3 27  ? -78.743  -16.774 -69.235  1.00 0.00 ? 27  PHE C O    1  
ATOM   6058   C CB   . PHE C 3 27  ? -78.562  -13.920 -67.424  1.00 0.00 ? 27  PHE C CB   1  
ATOM   6059   C CG   . PHE C 3 27  ? -77.361  -14.679 -66.902  1.00 0.00 ? 27  PHE C CG   1  
ATOM   6060   C CD1  . PHE C 3 27  ? -77.409  -15.331 -65.666  1.00 0.00 ? 27  PHE C CD1  1  
ATOM   6061   C CD2  . PHE C 3 27  ? -76.186  -14.754 -67.654  1.00 0.00 ? 27  PHE C CD2  1  
ATOM   6062   C CE1  . PHE C 3 27  ? -76.309  -16.051 -65.190  1.00 0.00 ? 27  PHE C CE1  1  
ATOM   6063   C CE2  . PHE C 3 27  ? -75.086  -15.467 -67.186  1.00 0.00 ? 27  PHE C CE2  1  
ATOM   6064   C CZ   . PHE C 3 27  ? -75.146  -16.115 -65.947  1.00 0.00 ? 27  PHE C CZ   1  
ATOM   6065   H H    . PHE C 3 27  ? -79.992  -16.708 -67.338  1.00 0.00 ? 27  PHE C H    1  
ATOM   6066   H HA   . PHE C 3 27  ? -80.373  -14.159 -68.562  1.00 0.00 ? 27  PHE C HA   1  
ATOM   6067   H HB2  . PHE C 3 27  ? -78.212  -13.161 -68.106  1.00 0.00 ? 27  PHE C HB2  1  
ATOM   6068   H HB3  . PHE C 3 27  ? -79.054  -13.433 -66.593  1.00 0.00 ? 27  PHE C HB3  1  
ATOM   6069   H HD1  . PHE C 3 27  ? -78.311  -15.284 -65.074  1.00 0.00 ? 27  PHE C HD1  1  
ATOM   6070   H HD2  . PHE C 3 27  ? -76.131  -14.257 -68.611  1.00 0.00 ? 27  PHE C HD2  1  
ATOM   6071   H HE1  . PHE C 3 27  ? -76.360  -16.550 -64.233  1.00 0.00 ? 27  PHE C HE1  1  
ATOM   6072   H HE2  . PHE C 3 27  ? -74.183  -15.516 -67.777  1.00 0.00 ? 27  PHE C HE2  1  
ATOM   6073   H HZ   . PHE C 3 27  ? -74.292  -16.668 -65.584  1.00 0.00 ? 27  PHE C HZ   1  
ATOM   6074   N N    . ALA C 3 28  ? -78.699  -14.851 -70.412  1.00 0.00 ? 28  ALA C N    1  
ATOM   6075   C CA   . ALA C 3 28  ? -78.046  -15.432 -71.586  1.00 0.00 ? 28  ALA C CA   1  
ATOM   6076   C C    . ALA C 3 28  ? -76.669  -16.009 -71.233  1.00 0.00 ? 28  ALA C C    1  
ATOM   6077   O O    . ALA C 3 28  ? -75.628  -15.397 -71.515  1.00 0.00 ? 28  ALA C O    1  
ATOM   6078   C CB   . ALA C 3 28  ? -77.928  -14.388 -72.688  1.00 0.00 ? 28  ALA C CB   1  
ATOM   6079   H H    . ALA C 3 28  ? -78.912  -13.894 -70.416  1.00 0.00 ? 28  ALA C H    1  
ATOM   6080   H HA   . ALA C 3 28  ? -78.665  -16.240 -71.949  1.00 0.00 ? 28  ALA C HA   1  
ATOM   6081   H HB1  . ALA C 3 28  ? -77.571  -14.859 -73.593  1.00 0.00 ? 28  ALA C HB1  1  
ATOM   6082   H HB2  . ALA C 3 28  ? -77.233  -13.620 -72.384  1.00 0.00 ? 28  ALA C HB2  1  
ATOM   6083   H HB3  . ALA C 3 28  ? -78.897  -13.946 -72.871  1.00 0.00 ? 28  ALA C HB3  1  
ATOM   6084   N N    . PHE C 3 29  ? -76.670  -17.190 -70.620  1.00 0.00 ? 29  PHE C N    1  
ATOM   6085   C CA   . PHE C 3 29  ? -75.436  -17.764 -70.111  1.00 0.00 ? 29  PHE C CA   1  
ATOM   6086   C C    . PHE C 3 29  ? -74.256  -17.702 -71.100  1.00 0.00 ? 29  PHE C C    1  
ATOM   6087   O O    . PHE C 3 29  ? -73.246  -17.069 -70.800  1.00 0.00 ? 29  PHE C O    1  
ATOM   6088   C CB   . PHE C 3 29  ? -75.645  -19.193 -69.597  1.00 0.00 ? 29  PHE C CB   1  
ATOM   6089   C CG   . PHE C 3 29  ? -74.435  -19.759 -68.885  1.00 0.00 ? 29  PHE C CG   1  
ATOM   6090   C CD1  . PHE C 3 29  ? -74.261  -19.561 -67.513  1.00 0.00 ? 29  PHE C CD1  1  
ATOM   6091   C CD2  . PHE C 3 29  ? -73.459  -20.479 -69.591  1.00 0.00 ? 29  PHE C CD2  1  
ATOM   6092   C CE1  . PHE C 3 29  ? -73.136  -20.077 -66.851  1.00 0.00 ? 29  PHE C CE1  1  
ATOM   6093   C CE2  . PHE C 3 29  ? -72.338  -20.997 -68.937  1.00 0.00 ? 29  PHE C CE2  1  
ATOM   6094   C CZ   . PHE C 3 29  ? -72.178  -20.798 -67.563  1.00 0.00 ? 29  PHE C CZ   1  
ATOM   6095   H H    . PHE C 3 29  ? -77.523  -17.631 -70.425  1.00 0.00 ? 29  PHE C H    1  
ATOM   6096   H HA   . PHE C 3 29  ? -75.151  -17.166 -69.257  1.00 0.00 ? 29  PHE C HA   1  
ATOM   6097   H HB2  . PHE C 3 29  ? -76.478  -19.196 -68.912  1.00 0.00 ? 29  PHE C HB2  1  
ATOM   6098   H HB3  . PHE C 3 29  ? -75.886  -19.830 -70.436  1.00 0.00 ? 29  PHE C HB3  1  
ATOM   6099   H HD1  . PHE C 3 29  ? -75.003  -19.008 -66.955  1.00 0.00 ? 29  PHE C HD1  1  
ATOM   6100   H HD2  . PHE C 3 29  ? -73.577  -20.637 -70.653  1.00 0.00 ? 29  PHE C HD2  1  
ATOM   6101   H HE1  . PHE C 3 29  ? -73.013  -19.917 -65.790  1.00 0.00 ? 29  PHE C HE1  1  
ATOM   6102   H HE2  . PHE C 3 29  ? -71.599  -21.555 -69.492  1.00 0.00 ? 29  PHE C HE2  1  
ATOM   6103   H HZ   . PHE C 3 29  ? -71.311  -21.196 -67.056  1.00 0.00 ? 29  PHE C HZ   1  
ATOM   6104   N N    . SER C 3 30  ? -74.395  -18.318 -72.273  1.00 0.00 ? 30  SER C N    1  
ATOM   6105   C CA   . SER C 3 30  ? -73.248  -18.528 -73.177  1.00 0.00 ? 30  SER C CA   1  
ATOM   6106   C C    . SER C 3 30  ? -72.588  -17.242 -73.691  1.00 0.00 ? 30  SER C C    1  
ATOM   6107   O O    . SER C 3 30  ? -71.536  -17.280 -74.327  1.00 0.00 ? 30  SER C O    1  
ATOM   6108   C CB   . SER C 3 30  ? -73.617  -19.475 -74.336  1.00 0.00 ? 30  SER C CB   1  
ATOM   6109   O OG   . SER C 3 30  ? -73.959  -18.781 -75.531  1.00 0.00 ? 30  SER C OG   1  
ATOM   6110   H H    . SER C 3 30  ? -75.237  -18.782 -72.465  1.00 0.00 ? 30  SER C H    1  
ATOM   6111   H HA   . SER C 3 30  ? -72.495  -19.038 -72.592  1.00 0.00 ? 30  SER C HA   1  
ATOM   6112   H HB2  . SER C 3 30  ? -72.778  -20.115 -74.545  1.00 0.00 ? 30  SER C HB2  1  
ATOM   6113   H HB3  . SER C 3 30  ? -74.451  -20.093 -74.024  1.00 0.00 ? 30  SER C HB3  1  
ATOM   6114   H HG   . SER C 3 30  ? -74.005  -17.844 -75.327  1.00 0.00 ? 30  SER C HG   1  
ATOM   6115   N N    . SER C 3 31  ? -73.203  -16.115 -73.375  1.00 0.00 ? 31  SER C N    1  
ATOM   6116   C CA   . SER C 3 31  ? -72.720  -14.805 -73.791  1.00 0.00 ? 31  SER C CA   1  
ATOM   6117   C C    . SER C 3 31  ? -71.813  -14.061 -72.759  1.00 0.00 ? 31  SER C C    1  
ATOM   6118   O O    . SER C 3 31  ? -70.939  -13.254 -73.141  1.00 0.00 ? 31  SER C O    1  
ATOM   6119   C CB   . SER C 3 31  ? -73.932  -13.955 -74.113  1.00 0.00 ? 31  SER C CB   1  
ATOM   6120   O OG   . SER C 3 31  ? -74.925  -14.158 -73.118  1.00 0.00 ? 31  SER C OG   1  
ATOM   6121   H H    . SER C 3 31  ? -74.024  -16.164 -72.842  1.00 0.00 ? 31  SER C H    1  
ATOM   6122   H HA   . SER C 3 31  ? -72.156  -14.930 -74.701  1.00 0.00 ? 31  SER C HA   1  
ATOM   6123   H HB2  . SER C 3 31  ? -73.651  -12.915 -74.126  1.00 0.00 ? 31  SER C HB2  1  
ATOM   6124   H HB3  . SER C 3 31  ? -74.319  -14.234 -75.084  1.00 0.00 ? 31  SER C HB3  1  
ATOM   6125   H HG   . SER C 3 31  ? -74.565  -13.869 -72.276  1.00 0.00 ? 31  SER C HG   1  
ATOM   6126   N N    . TYR C 3 32  ? -72.026  -14.310 -71.467  1.00 0.00 ? 32  TYR C N    1  
ATOM   6127   C CA   . TYR C 3 32  ? -71.180  -13.701 -70.448  1.00 0.00 ? 32  TYR C CA   1  
ATOM   6128   C C    . TYR C 3 32  ? -69.891  -14.500 -70.185  1.00 0.00 ? 32  TYR C C    1  
ATOM   6129   O O    . TYR C 3 32  ? -69.751  -15.632 -70.638  1.00 0.00 ? 32  TYR C O    1  
ATOM   6130   C CB   . TYR C 3 32  ? -71.993  -13.458 -69.163  1.00 0.00 ? 32  TYR C CB   1  
ATOM   6131   C CG   . TYR C 3 32  ? -72.865  -12.199 -69.223  1.00 0.00 ? 32  TYR C CG   1  
ATOM   6132   C CD1  . TYR C 3 32  ? -74.054  -12.181 -69.964  1.00 0.00 ? 32  TYR C CD1  1  
ATOM   6133   C CD2  . TYR C 3 32  ? -72.492  -11.017 -68.550  1.00 0.00 ? 32  TYR C CD2  1  
ATOM   6134   C CE1  . TYR C 3 32  ? -74.851  -11.026 -70.035  1.00 0.00 ? 32  TYR C CE1  1  
ATOM   6135   C CE2  . TYR C 3 32  ? -73.285  -9.854  -68.620  1.00 0.00 ? 32  TYR C CE2  1  
ATOM   6136   C CZ   . TYR C 3 32  ? -74.463  -9.878  -69.363  1.00 0.00 ? 32  TYR C CZ   1  
ATOM   6137   O OH   . TYR C 3 32  ? -75.265  -8.768  -69.450  1.00 0.00 ? 32  TYR C OH   1  
ATOM   6138   H H    . TYR C 3 32  ? -72.729  -14.939 -71.202  1.00 0.00 ? 32  TYR C H    1  
ATOM   6139   H HA   . TYR C 3 32  ? -70.880  -12.734 -70.824  1.00 0.00 ? 32  TYR C HA   1  
ATOM   6140   H HB2  . TYR C 3 32  ? -72.631  -14.311 -68.990  1.00 0.00 ? 32  TYR C HB2  1  
ATOM   6141   H HB3  . TYR C 3 32  ? -71.306  -13.368 -68.333  1.00 0.00 ? 32  TYR C HB3  1  
ATOM   6142   H HD1  . TYR C 3 32  ? -74.364  -13.072 -70.490  1.00 0.00 ? 32  TYR C HD1  1  
ATOM   6143   H HD2  . TYR C 3 32  ? -71.578  -11.001 -67.974  1.00 0.00 ? 32  TYR C HD2  1  
ATOM   6144   H HE1  . TYR C 3 32  ? -75.764  -11.033 -70.612  1.00 0.00 ? 32  TYR C HE1  1  
ATOM   6145   H HE2  . TYR C 3 32  ? -72.987  -8.957  -68.098  1.00 0.00 ? 32  TYR C HE2  1  
ATOM   6146   H HH   . TYR C 3 32  ? -74.703  -7.991  -69.403  1.00 0.00 ? 32  TYR C HH   1  
ATOM   6147   N N    . ASP C 3 33  ? -68.937  -13.888 -69.483  1.00 0.00 ? 33  ASP C N    1  
ATOM   6148   C CA   . ASP C 3 33  ? -67.792  -14.611 -68.923  1.00 0.00 ? 33  ASP C CA   1  
ATOM   6149   C C    . ASP C 3 33  ? -68.086  -15.036 -67.492  1.00 0.00 ? 33  ASP C C    1  
ATOM   6150   O O    . ASP C 3 33  ? -69.037  -14.569 -66.869  1.00 0.00 ? 33  ASP C O    1  
ATOM   6151   C CB   . ASP C 3 33  ? -66.542  -13.744 -68.937  1.00 0.00 ? 33  ASP C CB   1  
ATOM   6152   C CG   . ASP C 3 33  ? -65.957  -13.592 -70.314  1.00 0.00 ? 33  ASP C CG   1  
ATOM   6153   O OD1  . ASP C 3 33  ? -66.725  -13.723 -71.285  1.00 0.00 ? 33  ASP C OD1  1  
ATOM   6154   O OD2  . ASP C 3 33  ? -64.741  -13.330 -70.433  1.00 0.00 ? 33  ASP C OD2  1  
ATOM   6155   H H    . ASP C 3 33  ? -69.101  -12.971 -69.179  1.00 0.00 ? 33  ASP C H    1  
ATOM   6156   H HA   . ASP C 3 33  ? -67.612  -15.493 -69.519  1.00 0.00 ? 33  ASP C HA   1  
ATOM   6157   H HB2  . ASP C 3 33  ? -66.791  -12.766 -68.556  1.00 0.00 ? 33  ASP C HB2  1  
ATOM   6158   H HB3  . ASP C 3 33  ? -65.802  -14.192 -68.288  1.00 0.00 ? 33  ASP C HB3  1  
ATOM   6159   N N    . MET C 3 34  ? -67.267  -15.926 -66.961  1.00 0.00 ? 34  MET C N    1  
ATOM   6160   C CA   . MET C 3 34  ? -67.503  -16.372 -65.609  1.00 0.00 ? 34  MET C CA   1  
ATOM   6161   C C    . MET C 3 34  ? -66.227  -16.406 -64.782  1.00 0.00 ? 34  MET C C    1  
ATOM   6162   O O    . MET C 3 34  ? -65.126  -16.638 -65.326  1.00 0.00 ? 34  MET C O    1  
ATOM   6163   C CB   . MET C 3 34  ? -68.206  -17.729 -65.615  1.00 0.00 ? 34  MET C CB   1  
ATOM   6164   C CG   . MET C 3 34  ? -69.626  -17.702 -66.197  1.00 0.00 ? 34  MET C CG   1  
ATOM   6165   S SD   . MET C 3 34  ? -70.713  -16.416 -65.513  1.00 0.00 ? 34  MET C SD   1  
ATOM   6166   C CE   . MET C 3 34  ? -71.290  -17.207 -64.002  1.00 0.00 ? 34  MET C CE   1  
ATOM   6167   H H    . MET C 3 34  ? -66.516  -16.282 -67.479  1.00 0.00 ? 34  MET C H    1  
ATOM   6168   H HA   . MET C 3 34  ? -68.171  -15.661 -65.144  1.00 0.00 ? 34  MET C HA   1  
ATOM   6169   H HB2  . MET C 3 34  ? -67.615  -18.418 -66.198  1.00 0.00 ? 34  MET C HB2  1  
ATOM   6170   H HB3  . MET C 3 34  ? -68.255  -18.095 -64.599  1.00 0.00 ? 34  MET C HB3  1  
ATOM   6171   H HG2  . MET C 3 34  ? -69.554  -17.546 -67.261  1.00 0.00 ? 34  MET C HG2  1  
ATOM   6172   H HG3  . MET C 3 34  ? -70.081  -18.669 -66.026  1.00 0.00 ? 34  MET C HG3  1  
ATOM   6173   H HE1  . MET C 3 34  ? -72.345  -17.009 -63.874  1.00 0.00 ? 34  MET C HE1  1  
ATOM   6174   H HE2  . MET C 3 34  ? -70.747  -16.813 -63.158  1.00 0.00 ? 34  MET C HE2  1  
ATOM   6175   H HE3  . MET C 3 34  ? -71.124  -18.273 -64.069  1.00 0.00 ? 34  MET C HE3  1  
ATOM   6176   N N    . SER C 3 35  ? -66.397  -16.164 -63.475  1.00 0.00 ? 35  SER C N    1  
ATOM   6177   C CA   . SER C 3 35  ? -65.294  -16.054 -62.518  1.00 0.00 ? 35  SER C CA   1  
ATOM   6178   C C    . SER C 3 35  ? -65.626  -16.780 -61.245  1.00 0.00 ? 35  SER C C    1  
ATOM   6179   O O    . SER C 3 35  ? -66.790  -17.044 -60.972  1.00 0.00 ? 35  SER C O    1  
ATOM   6180   C CB   . SER C 3 35  ? -65.052  -14.603 -62.164  1.00 0.00 ? 35  SER C CB   1  
ATOM   6181   O OG   . SER C 3 35  ? -66.154  -14.117 -61.422  1.00 0.00 ? 35  SER C OG   1  
ATOM   6182   H H    . SER C 3 35  ? -67.306  -15.989 -63.152  1.00 0.00 ? 35  SER C H    1  
ATOM   6183   H HA   . SER C 3 35  ? -64.397  -16.470 -62.950  1.00 0.00 ? 35  SER C HA   1  
ATOM   6184   H HB2  . SER C 3 35  ? -64.158  -14.519 -61.569  1.00 0.00 ? 35  SER C HB2  1  
ATOM   6185   H HB3  . SER C 3 35  ? -64.934  -14.027 -63.073  1.00 0.00 ? 35  SER C HB3  1  
ATOM   6186   H HG   . SER C 3 35  ? -65.830  -13.446 -60.817  1.00 0.00 ? 35  SER C HG   1  
ATOM   6187   N N    . TRP C 3 36  ? -64.596  -17.057 -60.453  1.00 0.00 ? 36  TRP C N    1  
ATOM   6188   C CA   . TRP C 3 36  ? -64.732  -17.843 -59.236  1.00 0.00 ? 36  TRP C CA   1  
ATOM   6189   C C    . TRP C 3 36  ? -63.989  -17.179 -58.130  1.00 0.00 ? 36  TRP C C    1  
ATOM   6190   O O    . TRP C 3 36  ? -62.778  -17.306 -58.069  1.00 0.00 ? 36  TRP C O    1  
ATOM   6191   C CB   . TRP C 3 36  ? -64.096  -19.209 -59.416  1.00 0.00 ? 36  TRP C CB   1  
ATOM   6192   C CG   . TRP C 3 36  ? -65.033  -20.261 -59.847  1.00 0.00 ? 36  TRP C CG   1  
ATOM   6193   C CD1  . TRP C 3 36  ? -65.071  -20.876 -61.059  1.00 0.00 ? 36  TRP C CD1  1  
ATOM   6194   C CD2  . TRP C 3 36  ? -66.076  -20.839 -59.068  1.00 0.00 ? 36  TRP C CD2  1  
ATOM   6195   N NE1  . TRP C 3 36  ? -66.068  -21.810 -61.081  1.00 0.00 ? 36  TRP C NE1  1  
ATOM   6196   C CE2  . TRP C 3 36  ? -66.706  -21.803 -59.870  1.00 0.00 ? 36  TRP C CE2  1  
ATOM   6197   C CE3  . TRP C 3 36  ? -66.540  -20.634 -57.766  1.00 0.00 ? 36  TRP C CE3  1  
ATOM   6198   C CZ2  . TRP C 3 36  ? -67.782  -22.561 -59.420  1.00 0.00 ? 36  TRP C CZ2  1  
ATOM   6199   C CZ3  . TRP C 3 36  ? -67.612  -21.394 -57.309  1.00 0.00 ? 36  TRP C CZ3  1  
ATOM   6200   C CH2  . TRP C 3 36  ? -68.223  -22.343 -58.136  1.00 0.00 ? 36  TRP C CH2  1  
ATOM   6201   H H    . TRP C 3 36  ? -63.699  -16.779 -60.735  1.00 0.00 ? 36  TRP C H    1  
ATOM   6202   H HA   . TRP C 3 36  ? -65.772  -17.955 -58.975  1.00 0.00 ? 36  TRP C HA   1  
ATOM   6203   H HB2  . TRP C 3 36  ? -63.314  -19.130 -60.155  1.00 0.00 ? 36  TRP C HB2  1  
ATOM   6204   H HB3  . TRP C 3 36  ? -63.648  -19.504 -58.476  1.00 0.00 ? 36  TRP C HB3  1  
ATOM   6205   H HD1  . TRP C 3 36  ? -64.403  -20.664 -61.882  1.00 0.00 ? 36  TRP C HD1  1  
ATOM   6206   H HE1  . TRP C 3 36  ? -66.308  -22.393 -61.831  1.00 0.00 ? 36  TRP C HE1  1  
ATOM   6207   H HE3  . TRP C 3 36  ? -66.071  -19.902 -57.124  1.00 0.00 ? 36  TRP C HE3  1  
ATOM   6208   H HZ2  . TRP C 3 36  ? -68.255  -23.294 -60.056  1.00 0.00 ? 36  TRP C HZ2  1  
ATOM   6209   H HZ3  . TRP C 3 36  ? -67.981  -21.246 -56.304  1.00 0.00 ? 36  TRP C HZ3  1  
ATOM   6210   H HH2  . TRP C 3 36  ? -69.054  -22.919 -57.757  1.00 0.00 ? 36  TRP C HH2  1  
ATOM   6211   N N    . VAL C 3 37  ? -64.697  -16.500 -57.242  1.00 0.00 ? 37  VAL C N    1  
ATOM   6212   C CA   . VAL C 3 37  ? -64.053  -15.799 -56.143  1.00 0.00 ? 37  VAL C CA   1  
ATOM   6213   C C    . VAL C 3 37  ? -64.272  -16.582 -54.853  1.00 0.00 ? 37  VAL C C    1  
ATOM   6214   O O    . VAL C 3 37  ? -65.364  -17.101 -54.617  1.00 0.00 ? 37  VAL C O    1  
ATOM   6215   C CB   . VAL C 3 37  ? -64.583  -14.350 -56.017  1.00 0.00 ? 37  VAL C CB   1  
ATOM   6216   C CG1  . VAL C 3 37  ? -63.759  -13.551 -55.031  1.00 0.00 ? 37  VAL C CG1  1  
ATOM   6217   C CG2  . VAL C 3 37  ? -64.558  -13.651 -57.365  1.00 0.00 ? 37  VAL C CG2  1  
ATOM   6218   H H    . VAL C 3 37  ? -65.671  -16.454 -57.336  1.00 0.00 ? 37  VAL C H    1  
ATOM   6219   H HA   . VAL C 3 37  ? -62.991  -15.760 -56.341  1.00 0.00 ? 37  VAL C HA   1  
ATOM   6220   H HB   . VAL C 3 37  ? -65.604  -14.387 -55.662  1.00 0.00 ? 37  VAL C HB   1  
ATOM   6221   H HG11 . VAL C 3 37  ? -63.475  -14.183 -54.203  1.00 0.00 ? 37  VAL C HG11 1  
ATOM   6222   H HG12 . VAL C 3 37  ? -64.342  -12.718 -54.666  1.00 0.00 ? 37  VAL C HG12 1  
ATOM   6223   H HG13 . VAL C 3 37  ? -62.871  -13.181 -55.521  1.00 0.00 ? 37  VAL C HG13 1  
ATOM   6224   H HG21 . VAL C 3 37  ? -65.566  -13.558 -57.742  1.00 0.00 ? 37  VAL C HG21 1  
ATOM   6225   H HG22 . VAL C 3 37  ? -63.966  -14.229 -58.059  1.00 0.00 ? 37  VAL C HG22 1  
ATOM   6226   H HG23 . VAL C 3 37  ? -64.124  -12.668 -57.253  1.00 0.00 ? 37  VAL C HG23 1  
ATOM   6227   N N    . ARG C 3 38  ? -63.216  -16.690 -54.043  1.00 0.00 ? 38  ARG C N    1  
ATOM   6228   C CA   . ARG C 3 38  ? -63.312  -17.272 -52.700  1.00 0.00 ? 38  ARG C CA   1  
ATOM   6229   C C    . ARG C 3 38  ? -63.104  -16.195 -51.652  1.00 0.00 ? 38  ARG C C    1  
ATOM   6230   O O    . ARG C 3 38  ? -62.554  -15.124 -51.943  1.00 0.00 ? 38  ARG C O    1  
ATOM   6231   C CB   . ARG C 3 38  ? -62.278  -18.370 -52.495  1.00 0.00 ? 38  ARG C CB   1  
ATOM   6232   C CG   . ARG C 3 38  ? -60.850  -17.860 -52.394  1.00 0.00 ? 38  ARG C CG   1  
ATOM   6233   C CD   . ARG C 3 38  ? -59.822  -18.971 -52.446  1.00 0.00 ? 38  ARG C CD   1  
ATOM   6234   N NE   . ARG C 3 38  ? -58.471  -18.435 -52.587  1.00 0.00 ? 38  ARG C NE   1  
ATOM   6235   C CZ   . ARG C 3 38  ? -57.370  -19.170 -52.739  1.00 0.00 ? 38  ARG C CZ   1  
ATOM   6236   N NH1  . ARG C 3 38  ? -57.417  -20.504 -52.771  1.00 0.00 ? 38  ARG C NH1  1  
ATOM   6237   N NH2  . ARG C 3 38  ? -56.201  -18.559 -52.868  1.00 0.00 ? 38  ARG C NH2  1  
ATOM   6238   H H    . ARG C 3 38  ? -62.372  -16.272 -54.314  1.00 0.00 ? 38  ARG C H    1  
ATOM   6239   H HA   . ARG C 3 38  ? -64.299  -17.694 -52.574  1.00 0.00 ? 38  ARG C HA   1  
ATOM   6240   H HB2  . ARG C 3 38  ? -62.516  -18.902 -51.588  1.00 0.00 ? 38  ARG C HB2  1  
ATOM   6241   H HB3  . ARG C 3 38  ? -62.342  -19.060 -53.325  1.00 0.00 ? 38  ARG C HB3  1  
ATOM   6242   H HG2  . ARG C 3 38  ? -60.665  -17.179 -53.209  1.00 0.00 ? 38  ARG C HG2  1  
ATOM   6243   H HG3  . ARG C 3 38  ? -60.739  -17.325 -51.461  1.00 0.00 ? 38  ARG C HG3  1  
ATOM   6244   H HD2  . ARG C 3 38  ? -59.878  -19.550 -51.537  1.00 0.00 ? 38  ARG C HD2  1  
ATOM   6245   H HD3  . ARG C 3 38  ? -60.040  -19.614 -53.288  1.00 0.00 ? 38  ARG C HD3  1  
ATOM   6246   H HE   . ARG C 3 38  ? -58.367  -17.460 -52.573  1.00 0.00 ? 38  ARG C HE   1  
ATOM   6247   H HH11 . ARG C 3 38  ? -58.294  -20.975 -52.680  1.00 0.00 ? 38  ARG C HH11 1  
ATOM   6248   H HH12 . ARG C 3 38  ? -56.576  -21.031 -52.887  1.00 0.00 ? 38  ARG C HH12 1  
ATOM   6249   H HH21 . ARG C 3 38  ? -56.154  -17.561 -52.849  1.00 0.00 ? 38  ARG C HH21 1  
ATOM   6250   H HH22 . ARG C 3 38  ? -55.366  -19.097 -52.982  1.00 0.00 ? 38  ARG C HH22 1  
ATOM   6251   N N    . GLN C 3 39  ? -63.532  -16.475 -50.429  1.00 0.00 ? 39  GLN C N    1  
ATOM   6252   C CA   . GLN C 3 39  ? -63.313  -15.540 -49.337  1.00 0.00 ? 39  GLN C CA   1  
ATOM   6253   C C    . GLN C 3 39  ? -62.740  -16.275 -48.160  1.00 0.00 ? 39  GLN C C    1  
ATOM   6254   O O    . GLN C 3 39  ? -63.361  -17.198 -47.651  1.00 0.00 ? 39  GLN C O    1  
ATOM   6255   C CB   . GLN C 3 39  ? -64.606  -14.843 -48.931  1.00 0.00 ? 39  GLN C CB   1  
ATOM   6256   C CG   . GLN C 3 39  ? -64.414  -13.757 -47.871  1.00 0.00 ? 39  GLN C CG   1  
ATOM   6257   C CD   . GLN C 3 39  ? -65.645  -12.879 -47.675  1.00 0.00 ? 39  GLN C CD   1  
ATOM   6258   O OE1  . GLN C 3 39  ? -66.747  -13.210 -48.127  1.00 0.00 ? 39  GLN C OE1  1  
ATOM   6259   N NE2  . GLN C 3 39  ? -65.461  -11.755 -46.988  1.00 0.00 ? 39  GLN C NE2  1  
ATOM   6260   H H    . GLN C 3 39  ? -63.956  -17.340 -50.250  1.00 0.00 ? 39  GLN C H    1  
ATOM   6261   H HA   . GLN C 3 39  ? -62.602  -14.793 -49.659  1.00 0.00 ? 39  GLN C HA   1  
ATOM   6262   H HB2  . GLN C 3 39  ? -65.043  -14.390 -49.808  1.00 0.00 ? 39  GLN C HB2  1  
ATOM   6263   H HB3  . GLN C 3 39  ? -65.292  -15.585 -48.549  1.00 0.00 ? 39  GLN C HB3  1  
ATOM   6264   H HG2  . GLN C 3 39  ? -64.175  -14.229 -46.931  1.00 0.00 ? 39  GLN C HG2  1  
ATOM   6265   H HG3  . GLN C 3 39  ? -63.582  -13.132 -48.164  1.00 0.00 ? 39  GLN C HG3  1  
ATOM   6266   H HE21 . GLN C 3 39  ? -64.571  -11.534 -46.641  1.00 0.00 ? 39  GLN C HE21 1  
ATOM   6267   H HE22 . GLN C 3 39  ? -66.214  -11.149 -46.829  1.00 0.00 ? 39  GLN C HE22 1  
ATOM   6268   N N    . THR C 3 40  ? -61.556  -15.860 -47.724  1.00 0.00 ? 40  THR C N    1  
ATOM   6269   C CA   . THR C 3 40  ? -60.841  -16.587 -46.685  1.00 0.00 ? 40  THR C CA   1  
ATOM   6270   C C    . THR C 3 40  ? -61.532  -16.455 -45.338  1.00 0.00 ? 40  THR C C    1  
ATOM   6271   O O    . THR C 3 40  ? -62.481  -15.670 -45.201  1.00 0.00 ? 40  THR C O    1  
ATOM   6272   C CB   . THR C 3 40  ? -59.417  -16.089 -46.504  1.00 0.00 ? 40  THR C CB   1  
ATOM   6273   O OG1  . THR C 3 40  ? -59.413  -15.042 -45.523  1.00 0.00 ? 40  THR C OG1  1  
ATOM   6274   C CG2  . THR C 3 40  ? -58.841  -15.605 -47.823  1.00 0.00 ? 40  THR C CG2  1  
ATOM   6275   H H    . THR C 3 40  ? -61.115  -15.110 -48.175  1.00 0.00 ? 40  THR C H    1  
ATOM   6276   H HA   . THR C 3 40  ? -60.807  -17.631 -46.955  1.00 0.00 ? 40  THR C HA   1  
ATOM   6277   H HB   . THR C 3 40  ? -58.811  -16.905 -46.138  1.00 0.00 ? 40  THR C HB   1  
ATOM   6278   H HG1  . THR C 3 40  ? -58.513  -14.721 -45.436  1.00 0.00 ? 40  THR C HG1  1  
ATOM   6279   H HG21 . THR C 3 40  ? -59.647  -15.346 -48.494  1.00 0.00 ? 40  THR C HG21 1  
ATOM   6280   H HG22 . THR C 3 40  ? -58.243  -16.389 -48.263  1.00 0.00 ? 40  THR C HG22 1  
ATOM   6281   H HG23 . THR C 3 40  ? -58.225  -14.736 -47.649  1.00 0.00 ? 40  THR C HG23 1  
ATOM   6282   N N    . PRO C 3 41  ? -61.064  -17.240 -44.341  1.00 0.00 ? 41  PRO C N    1  
ATOM   6283   C CA   . PRO C 3 41  ? -61.537  -17.125 -42.962  1.00 0.00 ? 41  PRO C CA   1  
ATOM   6284   C C    . PRO C 3 41  ? -61.237  -15.782 -42.325  1.00 0.00 ? 41  PRO C C    1  
ATOM   6285   O O    . PRO C 3 41  ? -61.955  -15.382 -41.415  1.00 0.00 ? 41  PRO C O    1  
ATOM   6286   C CB   . PRO C 3 41  ? -60.795  -18.251 -42.257  1.00 0.00 ? 41  PRO C CB   1  
ATOM   6287   C CG   . PRO C 3 41  ? -60.697  -19.313 -43.334  1.00 0.00 ? 41  PRO C CG   1  
ATOM   6288   C CD   . PRO C 3 41  ? -60.315  -18.500 -44.539  1.00 0.00 ? 41  PRO C CD   1  
ATOM   6289   H HA   . PRO C 3 41  ? -62.594  -17.323 -42.919  1.00 0.00 ? 41  PRO C HA   1  
ATOM   6290   H HB2  . PRO C 3 41  ? -59.812  -17.922 -41.945  1.00 0.00 ? 41  PRO C HB2  1  
ATOM   6291   H HB3  . PRO C 3 41  ? -61.363  -18.621 -41.420  1.00 0.00 ? 41  PRO C HB3  1  
ATOM   6292   H HG2  . PRO C 3 41  ? -59.930  -20.036 -43.090  1.00 0.00 ? 41  PRO C HG2  1  
ATOM   6293   H HG3  . PRO C 3 41  ? -61.649  -19.792 -43.493  1.00 0.00 ? 41  PRO C HG3  1  
ATOM   6294   H HD2  . PRO C 3 41  ? -59.248  -18.318 -44.552  1.00 0.00 ? 41  PRO C HD2  1  
ATOM   6295   H HD3  . PRO C 3 41  ? -60.635  -18.985 -45.447  1.00 0.00 ? 41  PRO C HD3  1  
ATOM   6296   N N    . GLU C 3 42  ? -60.223  -15.078 -42.827  1.00 0.00 ? 42  GLU C N    1  
ATOM   6297   C CA   . GLU C 3 42  ? -59.943  -13.718 -42.379  1.00 0.00 ? 42  GLU C CA   1  
ATOM   6298   C C    . GLU C 3 42  ? -60.969  -12.744 -42.942  1.00 0.00 ? 42  GLU C C    1  
ATOM   6299   O O    . GLU C 3 42  ? -60.957  -11.577 -42.572  1.00 0.00 ? 42  GLU C O    1  
ATOM   6300   C CB   . GLU C 3 42  ? -58.546  -13.255 -42.797  1.00 0.00 ? 42  GLU C CB   1  
ATOM   6301   C CG   . GLU C 3 42  ? -57.406  -14.144 -42.380  1.00 0.00 ? 42  GLU C CG   1  
ATOM   6302   C CD   . GLU C 3 42  ? -57.578  -15.566 -42.875  1.00 0.00 ? 42  GLU C CD   1  
ATOM   6303   O OE1  . GLU C 3 42  ? -57.152  -15.881 -44.013  1.00 0.00 ? 42  GLU C OE1  1  
ATOM   6304   O OE2  . GLU C 3 42  ? -58.149  -16.374 -42.114  1.00 0.00 ? 42  GLU C OE2  1  
ATOM   6305   H H    . GLU C 3 42  ? -59.712  -15.447 -43.578  1.00 0.00 ? 42  GLU C H    1  
ATOM   6306   H HA   . GLU C 3 42  ? -60.004  -13.693 -41.301  1.00 0.00 ? 42  GLU C HA   1  
ATOM   6307   H HB2  . GLU C 3 42  ? -58.526  -13.172 -43.871  1.00 0.00 ? 42  GLU C HB2  1  
ATOM   6308   H HB3  . GLU C 3 42  ? -58.383  -12.269 -42.382  1.00 0.00 ? 42  GLU C HB3  1  
ATOM   6309   H HG2  . GLU C 3 42  ? -56.486  -13.744 -42.778  1.00 0.00 ? 42  GLU C HG2  1  
ATOM   6310   H HG3  . GLU C 3 42  ? -57.346  -14.153 -41.301  1.00 0.00 ? 42  GLU C HG3  1  
ATOM   6311   N N    . LYS C 3 43  ? -61.856  -13.221 -43.817  1.00 0.00 ? 43  LYS C N    1  
ATOM   6312   C CA   . LYS C 3 43  ? -62.853  -12.378 -44.507  1.00 0.00 ? 43  LYS C CA   1  
ATOM   6313   C C    . LYS C 3 43  ? -62.251  -11.720 -45.740  1.00 0.00 ? 43  LYS C C    1  
ATOM   6314   O O    . LYS C 3 43  ? -62.912  -10.954 -46.440  1.00 0.00 ? 43  LYS C O    1  
ATOM   6315   C CB   . LYS C 3 43  ? -63.475  -11.326 -43.574  1.00 0.00 ? 43  LYS C CB   1  
ATOM   6316   C CG   . LYS C 3 43  ? -64.587  -11.842 -42.662  1.00 0.00 ? 43  LYS C CG   1  
ATOM   6317   C CD   . LYS C 3 43  ? -64.056  -12.628 -41.462  1.00 0.00 ? 43  LYS C CD   1  
ATOM   6318   C CE   . LYS C 3 43  ? -65.190  -13.362 -40.730  1.00 0.00 ? 43  LYS C CE   1  
ATOM   6319   N NZ   . LYS C 3 43  ? -66.091  -12.448 -39.921  1.00 0.00 ? 43  LYS C NZ   1  
ATOM   6320   H H    . LYS C 3 43  ? -61.808  -14.170 -44.054  1.00 0.00 ? 43  LYS C H    1  
ATOM   6321   H HA   . LYS C 3 43  ? -63.648  -13.030 -44.844  1.00 0.00 ? 43  LYS C HA   1  
ATOM   6322   H HB2  . LYS C 3 43  ? -62.694  -10.917 -42.953  1.00 0.00 ? 43  LYS C HB2  1  
ATOM   6323   H HB3  . LYS C 3 43  ? -63.874  -10.528 -44.185  1.00 0.00 ? 43  LYS C HB3  1  
ATOM   6324   H HG2  . LYS C 3 43  ? -65.157  -11.001 -42.299  1.00 0.00 ? 43  LYS C HG2  1  
ATOM   6325   H HG3  . LYS C 3 43  ? -65.240  -12.482 -43.238  1.00 0.00 ? 43  LYS C HG3  1  
ATOM   6326   H HD2  . LYS C 3 43  ? -63.331  -13.351 -41.805  1.00 0.00 ? 43  LYS C HD2  1  
ATOM   6327   H HD3  . LYS C 3 43  ? -63.577  -11.945 -40.776  1.00 0.00 ? 43  LYS C HD3  1  
ATOM   6328   H HE2  . LYS C 3 43  ? -65.794  -13.878 -41.459  1.00 0.00 ? 43  LYS C HE2  1  
ATOM   6329   H HE3  . LYS C 3 43  ? -64.752  -14.095 -40.067  1.00 0.00 ? 43  LYS C HE3  1  
ATOM   6330   H HZ1  . LYS C 3 43  ? -65.556  -12.051 -39.122  1.00 0.00 ? 43  LYS C HZ1  1  
ATOM   6331   H HZ2  . LYS C 3 43  ? -66.902  -12.991 -39.560  1.00 0.00 ? 43  LYS C HZ2  1  
ATOM   6332   H HZ3  . LYS C 3 43  ? -66.432  -11.674 -40.525  1.00 0.00 ? 43  LYS C HZ3  1  
ATOM   6333   N N    . ARG C 3 44  ? -60.980  -12.051 -45.978  1.00 0.00 ? 44  ARG C N    1  
ATOM   6334   C CA   . ARG C 3 44  ? -60.172  -11.640 -47.141  1.00 0.00 ? 44  ARG C CA   1  
ATOM   6335   C C    . ARG C 3 44  ? -60.819  -12.070 -48.476  1.00 0.00 ? 44  ARG C C    1  
ATOM   6336   O O    . ARG C 3 44  ? -61.585  -13.032 -48.504  1.00 0.00 ? 44  ARG C O    1  
ATOM   6337   C CB   . ARG C 3 44  ? -58.767  -12.245 -46.961  1.00 0.00 ? 44  ARG C CB   1  
ATOM   6338   C CG   . ARG C 3 44  ? -57.680  -11.670 -47.814  1.00 0.00 ? 44  ARG C CG   1  
ATOM   6339   C CD   . ARG C 3 44  ? -57.416  -10.218 -47.441  1.00 0.00 ? 44  ARG C CD   1  
ATOM   6340   N NE   . ARG C 3 44  ? -57.277  -9.368  -48.634  1.00 0.00 ? 44  ARG C NE   1  
ATOM   6341   C CZ   . ARG C 3 44  ? -58.290  -8.877  -49.360  1.00 0.00 ? 44  ARG C CZ   1  
ATOM   6342   N NH1  . ARG C 3 44  ? -59.564  -9.126  -49.038  1.00 0.00 ? 44  ARG C NH1  1  
ATOM   6343   N NH2  . ARG C 3 44  ? -58.028  -8.117  -50.420  1.00 0.00 ? 44  ARG C NH2  1  
ATOM   6344   H H    . ARG C 3 44  ? -60.560  -12.673 -45.348  1.00 0.00 ? 44  ARG C H    1  
ATOM   6345   H HA   . ARG C 3 44  ? -60.083  -10.564 -47.134  1.00 0.00 ? 44  ARG C HA   1  
ATOM   6346   H HB2  . ARG C 3 44  ? -58.477  -12.118 -45.931  1.00 0.00 ? 44  ARG C HB2  1  
ATOM   6347   H HB3  . ARG C 3 44  ? -58.834  -13.307 -47.159  1.00 0.00 ? 44  ARG C HB3  1  
ATOM   6348   H HG2  . ARG C 3 44  ? -56.775  -12.244 -47.673  1.00 0.00 ? 44  ARG C HG2  1  
ATOM   6349   H HG3  . ARG C 3 44  ? -57.976  -11.721 -48.851  1.00 0.00 ? 44  ARG C HG3  1  
ATOM   6350   H HD2  . ARG C 3 44  ? -58.238  -9.853  -46.845  1.00 0.00 ? 44  ARG C HD2  1  
ATOM   6351   H HD3  . ARG C 3 44  ? -56.508  -10.164 -46.858  1.00 0.00 ? 44  ARG C HD3  1  
ATOM   6352   H HE   . ARG C 3 44  ? -56.368  -9.142  -48.920  1.00 0.00 ? 44  ARG C HE   1  
ATOM   6353   H HH11 . ARG C 3 44  ? -59.777  -9.690  -48.240  1.00 0.00 ? 44  ARG C HH11 1  
ATOM   6354   H HH12 . ARG C 3 44  ? -60.304  -8.749  -49.596  1.00 0.00 ? 44  ARG C HH12 1  
ATOM   6355   H HH21 . ARG C 3 44  ? -57.081  -7.916  -50.669  1.00 0.00 ? 44  ARG C HH21 1  
ATOM   6356   H HH22 . ARG C 3 44  ? -58.778  -7.747  -50.968  1.00 0.00 ? 44  ARG C HH22 1  
ATOM   6357   N N    . LEU C 3 45  ? -60.537  -11.364 -49.572  1.00 0.00 ? 45  LEU C N    1  
ATOM   6358   C CA   . LEU C 3 45  ? -61.191  -11.677 -50.868  1.00 0.00 ? 45  LEU C CA   1  
ATOM   6359   C C    . LEU C 3 45  ? -60.260  -11.949 -52.057  1.00 0.00 ? 45  LEU C C    1  
ATOM   6360   O O    . LEU C 3 45  ? -59.745  -11.015 -52.673  1.00 0.00 ? 45  LEU C O    1  
ATOM   6361   C CB   . LEU C 3 45  ? -62.213  -10.597 -51.254  1.00 0.00 ? 45  LEU C CB   1  
ATOM   6362   C CG   . LEU C 3 45  ? -63.670  -10.855 -50.862  1.00 0.00 ? 45  LEU C CG   1  
ATOM   6363   C CD1  . LEU C 3 45  ? -64.605  -9.737  -51.333  1.00 0.00 ? 45  LEU C CD1  1  
ATOM   6364   C CD2  . LEU C 3 45  ? -64.130  -12.206 -51.398  1.00 0.00 ? 45  LEU C CD2  1  
ATOM   6365   H H    . LEU C 3 45  ? -59.932  -10.596 -49.509  1.00 0.00 ? 45  LEU C H    1  
ATOM   6366   H HA   . LEU C 3 45  ? -61.753  -12.585 -50.710  1.00 0.00 ? 45  LEU C HA   1  
ATOM   6367   H HB2  . LEU C 3 45  ? -61.910  -9.671  -50.795  1.00 0.00 ? 45  LEU C HB2  1  
ATOM   6368   H HB3  . LEU C 3 45  ? -62.167  -10.467 -52.327  1.00 0.00 ? 45  LEU C HB3  1  
ATOM   6369   H HG   . LEU C 3 45  ? -63.718  -10.889 -49.783  1.00 0.00 ? 45  LEU C HG   1  
ATOM   6370   H HD11 . LEU C 3 45  ? -65.565  -10.157 -51.595  1.00 0.00 ? 45  LEU C HD11 1  
ATOM   6371   H HD12 . LEU C 3 45  ? -64.178  -9.250  -52.198  1.00 0.00 ? 45  LEU C HD12 1  
ATOM   6372   H HD13 . LEU C 3 45  ? -64.732  -9.015  -50.540  1.00 0.00 ? 45  LEU C HD13 1  
ATOM   6373   H HD21 . LEU C 3 45  ? -63.656  -12.997 -50.837  1.00 0.00 ? 45  LEU C HD21 1  
ATOM   6374   H HD22 . LEU C 3 45  ? -63.859  -12.291 -52.440  1.00 0.00 ? 45  LEU C HD22 1  
ATOM   6375   H HD23 . LEU C 3 45  ? -65.203  -12.286 -51.298  1.00 0.00 ? 45  LEU C HD23 1  
ATOM   6376   N N    . GLU C 3 46  ? -60.066  -13.214 -52.405  1.00 0.00 ? 46  GLU C N    1  
ATOM   6377   C CA   . GLU C 3 46  ? -59.177  -13.530 -53.517  1.00 0.00 ? 46  GLU C CA   1  
ATOM   6378   C C    . GLU C 3 46  ? -59.940  -14.023 -54.743  1.00 0.00 ? 46  GLU C C    1  
ATOM   6379   O O    . GLU C 3 46  ? -60.874  -14.851 -54.637  1.00 0.00 ? 46  GLU C O    1  
ATOM   6380   C CB   . GLU C 3 46  ? -58.118  -14.542 -53.104  1.00 0.00 ? 46  GLU C CB   1  
ATOM   6381   C CG   . GLU C 3 46  ? -57.298  -14.146 -51.880  1.00 0.00 ? 46  GLU C CG   1  
ATOM   6382   C CD   . GLU C 3 46  ? -56.460  -15.307 -51.339  1.00 0.00 ? 46  GLU C CD   1  
ATOM   6383   O OE1  . GLU C 3 46  ? -55.754  -15.965 -52.143  1.00 0.00 ? 46  GLU C OE1  1  
ATOM   6384   O OE2  . GLU C 3 46  ? -56.505  -15.572 -50.112  1.00 0.00 ? 46  GLU C OE2  1  
ATOM   6385   H H    . GLU C 3 46  ? -60.508  -13.934 -51.909  1.00 0.00 ? 46  GLU C H    1  
ATOM   6386   H HA   . GLU C 3 46  ? -58.669  -12.618 -53.795  1.00 0.00 ? 46  GLU C HA   1  
ATOM   6387   H HB2  . GLU C 3 46  ? -58.608  -15.479 -52.892  1.00 0.00 ? 46  GLU C HB2  1  
ATOM   6388   H HB3  . GLU C 3 46  ? -57.446  -14.691 -53.938  1.00 0.00 ? 46  GLU C HB3  1  
ATOM   6389   H HG2  . GLU C 3 46  ? -56.639  -13.335 -52.148  1.00 0.00 ? 46  GLU C HG2  1  
ATOM   6390   H HG3  . GLU C 3 46  ? -57.971  -13.808 -51.104  1.00 0.00 ? 46  GLU C HG3  1  
ATOM   6391   N N    . TRP C 3 47  ? -59.552  -13.488 -55.905  1.00 0.00 ? 47  TRP C N    1  
ATOM   6392   C CA   . TRP C 3 47  ? -60.099  -13.929 -57.185  1.00 0.00 ? 47  TRP C CA   1  
ATOM   6393   C C    . TRP C 3 47  ? -59.332  -15.177 -57.517  1.00 0.00 ? 47  TRP C C    1  
ATOM   6394   O O    . TRP C 3 47  ? -58.135  -15.263 -57.209  1.00 0.00 ? 47  TRP C O    1  
ATOM   6395   C CB   . TRP C 3 47  ? -59.866  -12.893 -58.265  1.00 0.00 ? 47  TRP C CB   1  
ATOM   6396   C CG   . TRP C 3 47  ? -59.723  -13.493 -59.627  1.00 0.00 ? 47  TRP C CG   1  
ATOM   6397   C CD1  . TRP C 3 47  ? -60.706  -14.091 -60.365  1.00 0.00 ? 47  TRP C CD1  1  
ATOM   6398   C CD2  . TRP C 3 47  ? -58.527  -13.558 -60.426  1.00 0.00 ? 47  TRP C CD2  1  
ATOM   6399   N NE1  . TRP C 3 47  ? -60.202  -14.524 -61.574  1.00 0.00 ? 47  TRP C NE1  1  
ATOM   6400   C CE2  . TRP C 3 47  ? -58.868  -14.211 -61.639  1.00 0.00 ? 47  TRP C CE2  1  
ATOM   6401   C CE3  . TRP C 3 47  ? -57.206  -13.138 -60.235  1.00 0.00 ? 47  TRP C CE3  1  
ATOM   6402   C CZ2  . TRP C 3 47  ? -57.928  -14.453 -62.656  1.00 0.00 ? 47  TRP C CZ2  1  
ATOM   6403   C CZ3  . TRP C 3 47  ? -56.277  -13.373 -61.248  1.00 0.00 ? 47  TRP C CZ3  1  
ATOM   6404   C CH2  . TRP C 3 47  ? -56.642  -14.026 -62.443  1.00 0.00 ? 47  TRP C CH2  1  
ATOM   6405   H H    . TRP C 3 47  ? -58.825  -12.830 -55.903  1.00 0.00 ? 47  TRP C H    1  
ATOM   6406   H HA   . TRP C 3 47  ? -61.153  -14.149 -57.088  1.00 0.00 ? 47  TRP C HA   1  
ATOM   6407   H HB2  . TRP C 3 47  ? -60.699  -12.208 -58.276  1.00 0.00 ? 47  TRP C HB2  1  
ATOM   6408   H HB3  . TRP C 3 47  ? -58.967  -12.342 -58.029  1.00 0.00 ? 47  TRP C HB3  1  
ATOM   6409   H HD1  . TRP C 3 47  ? -61.732  -14.207 -60.047  1.00 0.00 ? 47  TRP C HD1  1  
ATOM   6410   H HE1  . TRP C 3 47  ? -60.698  -14.982 -62.284  1.00 0.00 ? 47  TRP C HE1  1  
ATOM   6411   H HE3  . TRP C 3 47  ? -56.914  -12.637 -59.324  1.00 0.00 ? 47  TRP C HE3  1  
ATOM   6412   H HZ2  . TRP C 3 47  ? -58.209  -14.953 -63.571  1.00 0.00 ? 47  TRP C HZ2  1  
ATOM   6413   H HZ3  . TRP C 3 47  ? -55.255  -13.050 -61.113  1.00 0.00 ? 47  TRP C HZ3  1  
ATOM   6414   H HH2  . TRP C 3 47  ? -55.896  -14.191 -63.205  1.00 0.00 ? 47  TRP C HH2  1  
ATOM   6415   N N    . VAL C 3 48  ? -59.998  -16.136 -58.155  1.00 0.00 ? 48  VAL C N    1  
ATOM   6416   C CA   . VAL C 3 48  ? -59.455  -17.479 -58.254  1.00 0.00 ? 48  VAL C CA   1  
ATOM   6417   C C    . VAL C 3 48  ? -59.347  -18.032 -59.677  1.00 0.00 ? 48  VAL C C    1  
ATOM   6418   O O    . VAL C 3 48  ? -58.367  -18.694 -60.014  1.00 0.00 ? 48  VAL C O    1  
ATOM   6419   C CB   . VAL C 3 48  ? -60.226  -18.406 -57.317  1.00 0.00 ? 48  VAL C CB   1  
ATOM   6420   C CG1  . VAL C 3 48  ? -60.471  -19.772 -57.931  1.00 0.00 ? 48  VAL C CG1  1  
ATOM   6421   C CG2  . VAL C 3 48  ? -59.507  -18.496 -55.989  1.00 0.00 ? 48  VAL C CG2  1  
ATOM   6422   H H    . VAL C 3 48  ? -60.941  -15.989 -58.379  1.00 0.00 ? 48  VAL C H    1  
ATOM   6423   H HA   . VAL C 3 48  ? -58.446  -17.428 -57.873  1.00 0.00 ? 48  VAL C HA   1  
ATOM   6424   H HB   . VAL C 3 48  ? -61.193  -17.955 -57.140  1.00 0.00 ? 48  VAL C HB   1  
ATOM   6425   H HG11 . VAL C 3 48  ? -59.779  -20.486 -57.509  1.00 0.00 ? 48  VAL C HG11 1  
ATOM   6426   H HG12 . VAL C 3 48  ? -60.325  -19.717 -59.000  1.00 0.00 ? 48  VAL C HG12 1  
ATOM   6427   H HG13 . VAL C 3 48  ? -61.483  -20.085 -57.721  1.00 0.00 ? 48  VAL C HG13 1  
ATOM   6428   H HG21 . VAL C 3 48  ? -59.126  -17.522 -55.719  1.00 0.00 ? 48  VAL C HG21 1  
ATOM   6429   H HG22 . VAL C 3 48  ? -58.686  -19.194 -56.070  1.00 0.00 ? 48  VAL C HG22 1  
ATOM   6430   H HG23 . VAL C 3 48  ? -60.195  -18.836 -55.229  1.00 0.00 ? 48  VAL C HG23 1  
ATOM   6431   N N    . ALA C 3 49  ? -60.337  -17.761 -60.513  1.00 0.00 ? 49  ALA C N    1  
ATOM   6432   C CA   . ALA C 3 49  ? -60.311  -18.245 -61.879  1.00 0.00 ? 49  ALA C CA   1  
ATOM   6433   C C    . ALA C 3 49  ? -61.236  -17.415 -62.735  1.00 0.00 ? 49  ALA C C    1  
ATOM   6434   O O    . ALA C 3 49  ? -62.170  -16.764 -62.245  1.00 0.00 ? 49  ALA C O    1  
ATOM   6435   C CB   . ALA C 3 49  ? -60.725  -19.680 -61.924  1.00 0.00 ? 49  ALA C CB   1  
ATOM   6436   H H    . ALA C 3 49  ? -61.097  -17.224 -60.205  1.00 0.00 ? 49  ALA C H    1  
ATOM   6437   H HA   . ALA C 3 49  ? -59.306  -18.158 -62.263  1.00 0.00 ? 49  ALA C HA   1  
ATOM   6438   H HB1  . ALA C 3 49  ? -60.983  -20.012 -60.929  1.00 0.00 ? 49  ALA C HB1  1  
ATOM   6439   H HB2  . ALA C 3 49  ? -59.908  -20.278 -62.303  1.00 0.00 ? 49  ALA C HB2  1  
ATOM   6440   H HB3  . ALA C 3 49  ? -61.582  -19.788 -62.572  1.00 0.00 ? 49  ALA C HB3  1  
ATOM   6441   N N    . TYR C 3 50  ? -60.976  -17.447 -64.030  1.00 0.00 ? 50  TYR C N    1  
ATOM   6442   C CA   . TYR C 3 50  ? -61.776  -16.699 -64.979  1.00 0.00 ? 50  TYR C CA   1  
ATOM   6443   C C    . TYR C 3 50  ? -61.830  -17.471 -66.259  1.00 0.00 ? 50  TYR C C    1  
ATOM   6444   O O    . TYR C 3 50  ? -60.788  -17.761 -66.849  1.00 0.00 ? 50  TYR C O    1  
ATOM   6445   C CB   . TYR C 3 50  ? -61.121  -15.358 -65.261  1.00 0.00 ? 50  TYR C CB   1  
ATOM   6446   C CG   . TYR C 3 50  ? -61.979  -14.398 -66.027  1.00 0.00 ? 50  TYR C CG   1  
ATOM   6447   C CD1  . TYR C 3 50  ? -61.991  -14.404 -67.410  1.00 0.00 ? 50  TYR C CD1  1  
ATOM   6448   C CD2  . TYR C 3 50  ? -62.757  -13.457 -65.355  1.00 0.00 ? 50  TYR C CD2  1  
ATOM   6449   C CE1  . TYR C 3 50  ? -62.761  -13.497 -68.112  1.00 0.00 ? 50  TYR C CE1  1  
ATOM   6450   C CE2  . TYR C 3 50  ? -63.536  -12.547 -66.034  1.00 0.00 ? 50  TYR C CE2  1  
ATOM   6451   C CZ   . TYR C 3 50  ? -63.542  -12.566 -67.420  1.00 0.00 ? 50  TYR C CZ   1  
ATOM   6452   O OH   . TYR C 3 50  ? -64.333  -11.652 -68.103  1.00 0.00 ? 50  TYR C OH   1  
ATOM   6453   H H    . TYR C 3 50  ? -60.225  -17.987 -64.355  1.00 0.00 ? 50  TYR C H    1  
ATOM   6454   H HA   . TYR C 3 50  ? -62.771  -16.548 -64.591  1.00 0.00 ? 50  TYR C HA   1  
ATOM   6455   H HB2  . TYR C 3 50  ? -60.860  -14.901 -64.320  1.00 0.00 ? 50  TYR C HB2  1  
ATOM   6456   H HB3  . TYR C 3 50  ? -60.212  -15.534 -65.819  1.00 0.00 ? 50  TYR C HB3  1  
ATOM   6457   H HD1  . TYR C 3 50  ? -61.388  -15.121 -67.946  1.00 0.00 ? 50  TYR C HD1  1  
ATOM   6458   H HD2  . TYR C 3 50  ? -62.754  -13.446 -64.275  1.00 0.00 ? 50  TYR C HD2  1  
ATOM   6459   H HE1  . TYR C 3 50  ? -62.766  -13.513 -69.192  1.00 0.00 ? 50  TYR C HE1  1  
ATOM   6460   H HE2  . TYR C 3 50  ? -64.131  -11.826 -65.494  1.00 0.00 ? 50  TYR C HE2  1  
ATOM   6461   H HH   . TYR C 3 50  ? -64.116  -10.774 -67.781  1.00 0.00 ? 50  TYR C HH   1  
ATOM   6462   N N    . ILE C 3 51  ? -63.037  -17.813 -66.686  1.00 0.00 ? 51  ILE C N    1  
ATOM   6463   C CA   . ILE C 3 51  ? -63.206  -18.418 -67.999  1.00 0.00 ? 51  ILE C CA   1  
ATOM   6464   C C    . ILE C 3 51  ? -63.909  -17.432 -68.938  1.00 0.00 ? 51  ILE C C    1  
ATOM   6465   O O    . ILE C 3 51  ? -64.806  -16.677 -68.513  1.00 0.00 ? 51  ILE C O    1  
ATOM   6466   C CB   . ILE C 3 51  ? -63.941  -19.786 -67.926  1.00 0.00 ? 51  ILE C CB   1  
ATOM   6467   C CG1  . ILE C 3 51  ? -63.912  -20.478 -69.291  1.00 0.00 ? 51  ILE C CG1  1  
ATOM   6468   C CG2  . ILE C 3 51  ? -65.357  -19.616 -67.377  1.00 0.00 ? 51  ILE C CG2  1  
ATOM   6469   C CD1  . ILE C 3 51  ? -64.410  -21.898 -69.271  1.00 0.00 ? 51  ILE C CD1  1  
ATOM   6470   H H    . ILE C 3 51  ? -63.826  -17.557 -66.165  1.00 0.00 ? 51  ILE C H    1  
ATOM   6471   H HA   . ILE C 3 51  ? -62.218  -18.596 -68.401  1.00 0.00 ? 51  ILE C HA   1  
ATOM   6472   H HB   . ILE C 3 51  ? -63.397  -20.406 -67.224  1.00 0.00 ? 51  ILE C HB   1  
ATOM   6473   H HG12 . ILE C 3 51  ? -64.525  -19.913 -69.976  1.00 0.00 ? 51  ILE C HG12 1  
ATOM   6474   H HG13 . ILE C 3 51  ? -62.895  -20.470 -69.657  1.00 0.00 ? 51  ILE C HG13 1  
ATOM   6475   H HG21 . ILE C 3 51  ? -65.440  -18.659 -66.884  1.00 0.00 ? 51  ILE C HG21 1  
ATOM   6476   H HG22 . ILE C 3 51  ? -65.566  -20.405 -66.670  1.00 0.00 ? 51  ILE C HG22 1  
ATOM   6477   H HG23 . ILE C 3 51  ? -66.066  -19.664 -68.191  1.00 0.00 ? 51  ILE C HG23 1  
ATOM   6478   H HD11 . ILE C 3 51  ? -64.223  -22.332 -68.300  1.00 0.00 ? 51  ILE C HD11 1  
ATOM   6479   H HD12 . ILE C 3 51  ? -63.893  -22.471 -70.028  1.00 0.00 ? 51  ILE C HD12 1  
ATOM   6480   H HD13 . ILE C 3 51  ? -65.471  -21.911 -69.472  1.00 0.00 ? 51  ILE C HD13 1  
ATOM   6481   N N    . SER C 3 52  ? -63.488  -17.438 -70.201  1.00 0.00 ? 52  SER C N    1  
ATOM   6482   C CA   . SER C 3 52  ? -64.115  -16.631 -71.242  1.00 0.00 ? 52  SER C CA   1  
ATOM   6483   C C    . SER C 3 52  ? -65.449  -17.195 -71.716  1.00 0.00 ? 52  SER C C    1  
ATOM   6484   O O    . SER C 3 52  ? -65.675  -18.408 -71.687  1.00 0.00 ? 52  SER C O    1  
ATOM   6485   C CB   . SER C 3 52  ? -63.182  -16.550 -72.430  1.00 0.00 ? 52  SER C CB   1  
ATOM   6486   O OG   . SER C 3 52  ? -62.763  -17.849 -72.807  1.00 0.00 ? 52  SER C OG   1  
ATOM   6487   H H    . SER C 3 52  ? -62.770  -18.055 -70.453  1.00 0.00 ? 52  SER C H    1  
ATOM   6488   H HA   . SER C 3 52  ? -64.272  -15.634 -70.863  1.00 0.00 ? 52  SER C HA   1  
ATOM   6489   H HB2  . SER C 3 52  ? -63.693  -16.091 -73.259  1.00 0.00 ? 52  SER C HB2  1  
ATOM   6490   H HB3  . SER C 3 52  ? -62.322  -15.948 -72.166  1.00 0.00 ? 52  SER C HB3  1  
ATOM   6491   H HG   . SER C 3 52  ? -61.942  -18.041 -72.348  1.00 0.00 ? 52  SER C HG   1  
ATOM   6492   N N    . SER C 3 53  ? -66.311  -16.293 -72.180  1.00 0.00 ? 53  SER C N    1  
ATOM   6493   C CA   . SER C 3 53  ? -67.673  -16.604 -72.686  1.00 0.00 ? 53  SER C CA   1  
ATOM   6494   C C    . SER C 3 53  ? -67.822  -17.976 -73.357  1.00 0.00 ? 53  SER C C    1  
ATOM   6495   O O    . SER C 3 53  ? -68.720  -18.754 -72.999  1.00 0.00 ? 53  SER C O    1  
ATOM   6496   C CB   . SER C 3 53  ? -68.178  -15.478 -73.633  1.00 0.00 ? 53  SER C CB   1  
ATOM   6497   O OG   . SER C 3 53  ? -69.404  -15.809 -74.281  1.00 0.00 ? 53  SER C OG   1  
ATOM   6498   H H    . SER C 3 53  ? -66.029  -15.354 -72.182  1.00 0.00 ? 53  SER C H    1  
ATOM   6499   H HA   . SER C 3 53  ? -68.328  -16.606 -71.827  1.00 0.00 ? 53  SER C HA   1  
ATOM   6500   H HB2  . SER C 3 53  ? -68.330  -14.581 -73.059  1.00 0.00 ? 53  SER C HB2  1  
ATOM   6501   H HB3  . SER C 3 53  ? -67.414  -15.284 -74.377  1.00 0.00 ? 53  SER C HB3  1  
ATOM   6502   H HG   . SER C 3 53  ? -69.846  -16.480 -73.755  1.00 0.00 ? 53  SER C HG   1  
ATOM   6503   N N    . GLY C 3 54  ? -66.945  -18.243 -74.328  1.00 0.00 ? 54  GLY C N    1  
ATOM   6504   C CA   . GLY C 3 54  ? -66.968  -19.482 -75.088  1.00 0.00 ? 54  GLY C CA   1  
ATOM   6505   C C    . GLY C 3 54  ? -65.863  -20.438 -74.675  1.00 0.00 ? 54  GLY C C    1  
ATOM   6506   O O    . GLY C 3 54  ? -65.180  -20.992 -75.527  1.00 0.00 ? 54  GLY C O    1  
ATOM   6507   H H    . GLY C 3 54  ? -66.271  -17.567 -74.552  1.00 0.00 ? 54  GLY C H    1  
ATOM   6508   H HA2  . GLY C 3 54  ? -67.922  -19.965 -74.938  1.00 0.00 ? 54  GLY C HA2  1  
ATOM   6509   H HA3  . GLY C 3 54  ? -66.854  -19.250 -76.137  1.00 0.00 ? 54  GLY C HA3  1  
ATOM   6510   N N    . GLY C 3 55  ? -65.668  -20.619 -73.370  1.00 0.00 ? 55  GLY C N    1  
ATOM   6511   C CA   . GLY C 3 55  ? -64.697  -21.581 -72.844  1.00 0.00 ? 55  GLY C CA   1  
ATOM   6512   C C    . GLY C 3 55  ? -63.303  -21.506 -73.428  1.00 0.00 ? 55  GLY C C    1  
ATOM   6513   O O    . GLY C 3 55  ? -62.452  -22.325 -73.118  1.00 0.00 ? 55  GLY C O    1  
ATOM   6514   H H    . GLY C 3 55  ? -66.238  -20.133 -72.738  1.00 0.00 ? 55  GLY C H    1  
ATOM   6515   H HA2  . GLY C 3 55  ? -64.618  -21.430 -71.779  1.00 0.00 ? 55  GLY C HA2  1  
ATOM   6516   H HA3  . GLY C 3 55  ? -65.085  -22.576 -73.014  1.00 0.00 ? 55  GLY C HA3  1  
ATOM   6517   N N    . GLY C 3 56  ? -63.080  -20.501 -74.262  1.00 0.00 ? 56  GLY C N    1  
ATOM   6518   C CA   . GLY C 3 56  ? -61.859  -20.359 -75.043  1.00 0.00 ? 56  GLY C CA   1  
ATOM   6519   C C    . GLY C 3 56  ? -60.631  -20.221 -74.178  1.00 0.00 ? 56  GLY C C    1  
ATOM   6520   O O    . GLY C 3 56  ? -59.853  -21.168 -74.046  1.00 0.00 ? 56  GLY C O    1  
ATOM   6521   H H    . GLY C 3 56  ? -63.816  -19.879 -74.442  1.00 0.00 ? 56  GLY C H    1  
ATOM   6522   H HA2  . GLY C 3 56  ? -61.745  -21.229 -75.672  1.00 0.00 ? 56  GLY C HA2  1  
ATOM   6523   H HA3  . GLY C 3 56  ? -61.945  -19.484 -75.670  1.00 0.00 ? 56  GLY C HA3  1  
ATOM   6524   N N    . SER C 3 57  ? -60.468  -19.041 -73.590  1.00 0.00 ? 57  SER C N    1  
ATOM   6525   C CA   . SER C 3 57  ? -59.382  -18.775 -72.646  1.00 0.00 ? 57  SER C CA   1  
ATOM   6526   C C    . SER C 3 57  ? -59.804  -18.929 -71.157  1.00 0.00 ? 57  SER C C    1  
ATOM   6527   O O    . SER C 3 57  ? -60.986  -18.729 -70.793  1.00 0.00 ? 57  SER C O    1  
ATOM   6528   C CB   . SER C 3 57  ? -58.820  -17.380 -72.911  1.00 0.00 ? 57  SER C CB   1  
ATOM   6529   O OG   . SER C 3 57  ? -59.864  -16.499 -73.298  1.00 0.00 ? 57  SER C OG   1  
ATOM   6530   H H    . SER C 3 57  ? -61.137  -18.342 -73.747  1.00 0.00 ? 57  SER C H    1  
ATOM   6531   H HA   . SER C 3 57  ? -58.595  -19.489 -72.840  1.00 0.00 ? 57  SER C HA   1  
ATOM   6532   H HB2  . SER C 3 57  ? -58.357  -17.003 -72.015  1.00 0.00 ? 57  SER C HB2  1  
ATOM   6533   H HB3  . SER C 3 57  ? -58.077  -17.439 -73.697  1.00 0.00 ? 57  SER C HB3  1  
ATOM   6534   H HG   . SER C 3 57  ? -59.903  -15.785 -72.658  1.00 0.00 ? 57  SER C HG   1  
ATOM   6535   N N    . THR C 3 58  ? -58.847  -19.321 -70.313  1.00 0.00 ? 58  THR C N    1  
ATOM   6536   C CA   . THR C 3 58  ? -59.056  -19.301 -68.867  1.00 0.00 ? 58  THR C CA   1  
ATOM   6537   C C    . THR C 3 58  ? -57.907  -18.530 -68.265  1.00 0.00 ? 58  THR C C    1  
ATOM   6538   O O    . THR C 3 58  ? -56.856  -18.455 -68.888  1.00 0.00 ? 58  THR C O    1  
ATOM   6539   C CB   . THR C 3 58  ? -59.094  -20.706 -68.245  1.00 0.00 ? 58  THR C CB   1  
ATOM   6540   O OG1  . THR C 3 58  ? -57.856  -21.389 -68.496  1.00 0.00 ? 58  THR C OG1  1  
ATOM   6541   C CG2  . THR C 3 58  ? -60.255  -21.488 -68.802  1.00 0.00 ? 58  THR C CG2  1  
ATOM   6542   H H    . THR C 3 58  ? -57.947  -19.491 -70.660  1.00 0.00 ? 58  THR C H    1  
ATOM   6543   H HA   . THR C 3 58  ? -59.981  -18.786 -68.649  1.00 0.00 ? 58  THR C HA   1  
ATOM   6544   H HB   . THR C 3 58  ? -59.224  -20.608 -67.177  1.00 0.00 ? 58  THR C HB   1  
ATOM   6545   H HG1  . THR C 3 58  ? -57.153  -20.736 -68.499  1.00 0.00 ? 58  THR C HG1  1  
ATOM   6546   H HG21 . THR C 3 58  ? -60.040  -21.775 -69.821  1.00 0.00 ? 58  THR C HG21 1  
ATOM   6547   H HG22 . THR C 3 58  ? -61.145  -20.876 -68.780  1.00 0.00 ? 58  THR C HG22 1  
ATOM   6548   H HG23 . THR C 3 58  ? -60.412  -22.374 -68.205  1.00 0.00 ? 58  THR C HG23 1  
ATOM   6549   N N    . TYR C 3 59  ? -58.093  -17.958 -67.071  1.00 0.00 ? 59  TYR C N    1  
ATOM   6550   C CA   . TYR C 3 59  ? -56.980  -17.299 -66.351  1.00 0.00 ? 59  TYR C CA   1  
ATOM   6551   C C    . TYR C 3 59  ? -56.975  -17.595 -64.847  1.00 0.00 ? 59  TYR C C    1  
ATOM   6552   O O    . TYR C 3 59  ? -58.022  -17.837 -64.245  1.00 0.00 ? 59  TYR C O    1  
ATOM   6553   C CB   . TYR C 3 59  ? -56.995  -15.789 -66.588  1.00 0.00 ? 59  TYR C CB   1  
ATOM   6554   C CG   . TYR C 3 59  ? -57.401  -15.361 -67.978  1.00 0.00 ? 59  TYR C CG   1  
ATOM   6555   C CD1  . TYR C 3 59  ? -58.739  -15.243 -68.319  1.00 0.00 ? 59  TYR C CD1  1  
ATOM   6556   C CD2  . TYR C 3 59  ? -56.449  -15.060 -68.947  1.00 0.00 ? 59  TYR C CD2  1  
ATOM   6557   C CE1  . TYR C 3 59  ? -59.131  -14.837 -69.607  1.00 0.00 ? 59  TYR C CE1  1  
ATOM   6558   C CE2  . TYR C 3 59  ? -56.825  -14.651 -70.247  1.00 0.00 ? 59  TYR C CE2  1  
ATOM   6559   C CZ   . TYR C 3 59  ? -58.174  -14.544 -70.567  1.00 0.00 ? 59  TYR C CZ   1  
ATOM   6560   O OH   . TYR C 3 59  ? -58.582  -14.136 -71.825  1.00 0.00 ? 59  TYR C OH   1  
ATOM   6561   H H    . TYR C 3 59  ? -58.960  -18.053 -66.625  1.00 0.00 ? 59  TYR C H    1  
ATOM   6562   H HA   . TYR C 3 59  ? -56.058  -17.684 -66.760  1.00 0.00 ? 59  TYR C HA   1  
ATOM   6563   H HB2  . TYR C 3 59  ? -57.680  -15.342 -65.886  1.00 0.00 ? 59  TYR C HB2  1  
ATOM   6564   H HB3  . TYR C 3 59  ? -56.004  -15.406 -66.385  1.00 0.00 ? 59  TYR C HB3  1  
ATOM   6565   H HD1  . TYR C 3 59  ? -59.496  -15.472 -67.583  1.00 0.00 ? 59  TYR C HD1  1  
ATOM   6566   H HD2  . TYR C 3 59  ? -55.401  -15.143 -68.701  1.00 0.00 ? 59  TYR C HD2  1  
ATOM   6567   H HE1  . TYR C 3 59  ? -60.180  -14.753 -69.849  1.00 0.00 ? 59  TYR C HE1  1  
ATOM   6568   H HE2  . TYR C 3 59  ? -56.071  -14.425 -70.986  1.00 0.00 ? 59  TYR C HE2  1  
ATOM   6569   H HH   . TYR C 3 59  ? -58.198  -13.273 -71.996  1.00 0.00 ? 59  TYR C HH   1  
ATOM   6570   N N    . TYR C 3 60  ? -55.796  -17.591 -64.241  1.00 0.00 ? 60  TYR C N    1  
ATOM   6571   C CA   . TYR C 3 60  ? -55.714  -17.846 -62.808  1.00 0.00 ? 60  TYR C CA   1  
ATOM   6572   C C    . TYR C 3 60  ? -54.623  -17.055 -62.138  1.00 0.00 ? 60  TYR C C    1  
ATOM   6573   O O    . TYR C 3 60  ? -53.576  -16.816 -62.723  1.00 0.00 ? 60  TYR C O    1  
ATOM   6574   C CB   . TYR C 3 60  ? -55.430  -19.311 -62.508  1.00 0.00 ? 60  TYR C CB   1  
ATOM   6575   C CG   . TYR C 3 60  ? -56.269  -20.300 -63.258  1.00 0.00 ? 60  TYR C CG   1  
ATOM   6576   C CD1  . TYR C 3 60  ? -55.845  -20.800 -64.476  1.00 0.00 ? 60  TYR C CD1  1  
ATOM   6577   C CD2  . TYR C 3 60  ? -57.460  -20.771 -62.733  1.00 0.00 ? 60  TYR C CD2  1  
ATOM   6578   C CE1  . TYR C 3 60  ? -56.580  -21.717 -65.166  1.00 0.00 ? 60  TYR C CE1  1  
ATOM   6579   C CE2  . TYR C 3 60  ? -58.209  -21.702 -63.419  1.00 0.00 ? 60  TYR C CE2  1  
ATOM   6580   C CZ   . TYR C 3 60  ? -57.762  -22.164 -64.646  1.00 0.00 ? 60  TYR C CZ   1  
ATOM   6581   O OH   . TYR C 3 60  ? -58.490  -23.077 -65.371  1.00 0.00 ? 60  TYR C OH   1  
ATOM   6582   H H    . TYR C 3 60  ? -54.981  -17.405 -64.754  1.00 0.00 ? 60  TYR C H    1  
ATOM   6583   H HA   . TYR C 3 60  ? -56.658  -17.585 -62.357  1.00 0.00 ? 60  TYR C HA   1  
ATOM   6584   H HB2  . TYR C 3 60  ? -54.396  -19.510 -62.739  1.00 0.00 ? 60  TYR C HB2  1  
ATOM   6585   H HB3  . TYR C 3 60  ? -55.574  -19.471 -61.447  1.00 0.00 ? 60  TYR C HB3  1  
ATOM   6586   H HD1  . TYR C 3 60  ? -54.917  -20.442 -64.898  1.00 0.00 ? 60  TYR C HD1  1  
ATOM   6587   H HD2  . TYR C 3 60  ? -57.804  -20.408 -61.776  1.00 0.00 ? 60  TYR C HD2  1  
ATOM   6588   H HE1  . TYR C 3 60  ? -56.228  -22.093 -66.115  1.00 0.00 ? 60  TYR C HE1  1  
ATOM   6589   H HE2  . TYR C 3 60  ? -59.143  -22.057 -63.011  1.00 0.00 ? 60  TYR C HE2  1  
ATOM   6590   H HH   . TYR C 3 60  ? -58.006  -23.267 -66.179  1.00 0.00 ? 60  TYR C HH   1  
ATOM   6591   N N    . PRO C 3 61  ? -54.846  -16.668 -60.886  1.00 0.00 ? 61  PRO C N    1  
ATOM   6592   C CA   . PRO C 3 61  ? -53.749  -16.196 -60.097  1.00 0.00 ? 61  PRO C CA   1  
ATOM   6593   C C    . PRO C 3 61  ? -52.711  -17.294 -60.035  1.00 0.00 ? 61  PRO C C    1  
ATOM   6594   O O    . PRO C 3 61  ? -53.077  -18.485 -60.069  1.00 0.00 ? 61  PRO C O    1  
ATOM   6595   C CB   . PRO C 3 61  ? -54.380  -16.047 -58.718  1.00 0.00 ? 61  PRO C CB   1  
ATOM   6596   C CG   . PRO C 3 61  ? -55.578  -16.932 -58.750  1.00 0.00 ? 61  PRO C CG   1  
ATOM   6597   C CD   . PRO C 3 61  ? -56.081  -16.732 -60.102  1.00 0.00 ? 61  PRO C CD   1  
ATOM   6598   H HA   . PRO C 3 61  ? -53.351  -15.261 -60.452  1.00 0.00 ? 61  PRO C HA   1  
ATOM   6599   H HB2  . PRO C 3 61  ? -53.688  -16.371 -57.953  1.00 0.00 ? 61  PRO C HB2  1  
ATOM   6600   H HB3  . PRO C 3 61  ? -54.680  -15.025 -58.549  1.00 0.00 ? 61  PRO C HB3  1  
ATOM   6601   H HG2  . PRO C 3 61  ? -55.294  -17.964 -58.589  1.00 0.00 ? 61  PRO C HG2  1  
ATOM   6602   H HG3  . PRO C 3 61  ? -56.311  -16.614 -58.026  1.00 0.00 ? 61  PRO C HG3  1  
ATOM   6603   H HD2  . PRO C 3 61  ? -56.696  -17.569 -60.409  1.00 0.00 ? 61  PRO C HD2  1  
ATOM   6604   H HD3  . PRO C 3 61  ? -56.622  -15.803 -60.180  1.00 0.00 ? 61  PRO C HD3  1  
ATOM   6605   N N    . ASP C 3 62  ? -51.438  -16.913 -59.941  1.00 0.00 ? 62  ASP C N    1  
ATOM   6606   C CA   . ASP C 3 62  ? -50.371  -17.889 -59.733  1.00 0.00 ? 62  ASP C CA   1  
ATOM   6607   C C    . ASP C 3 62  ? -50.576  -18.812 -58.521  1.00 0.00 ? 62  ASP C C    1  
ATOM   6608   O O    . ASP C 3 62  ? -49.999  -19.910 -58.483  1.00 0.00 ? 62  ASP C O    1  
ATOM   6609   C CB   . ASP C 3 62  ? -49.031  -17.190 -59.601  1.00 0.00 ? 62  ASP C CB   1  
ATOM   6610   C CG   . ASP C 3 62  ? -48.438  -16.810 -60.935  1.00 0.00 ? 62  ASP C CG   1  
ATOM   6611   O OD1  . ASP C 3 62  ? -49.041  -17.152 -61.990  1.00 0.00 ? 62  ASP C OD1  1  
ATOM   6612   O OD2  . ASP C 3 62  ? -47.355  -16.165 -60.925  1.00 0.00 ? 62  ASP C OD2  1  
ATOM   6613   H H    . ASP C 3 62  ? -51.225  -15.957 -59.917  1.00 0.00 ? 62  ASP C H    1  
ATOM   6614   H HA   . ASP C 3 62  ? -50.325  -18.512 -60.613  1.00 0.00 ? 62  ASP C HA   1  
ATOM   6615   H HB2  . ASP C 3 62  ? -49.162  -16.294 -59.013  1.00 0.00 ? 62  ASP C HB2  1  
ATOM   6616   H HB3  . ASP C 3 62  ? -48.345  -17.847 -59.085  1.00 0.00 ? 62  ASP C HB3  1  
ATOM   6617   N N    . THR C 3 63  ? -51.388  -18.378 -57.549  1.00 0.00 ? 63  THR C N    1  
ATOM   6618   C CA   . THR C 3 63  ? -51.621  -19.142 -56.326  1.00 0.00 ? 63  THR C CA   1  
ATOM   6619   C C    . THR C 3 63  ? -52.494  -20.361 -56.516  1.00 0.00 ? 63  THR C C    1  
ATOM   6620   O O    . THR C 3 63  ? -52.478  -21.257 -55.677  1.00 0.00 ? 63  THR C O    1  
ATOM   6621   C CB   . THR C 3 63  ? -52.216  -18.297 -55.209  1.00 0.00 ? 63  THR C CB   1  
ATOM   6622   O OG1  . THR C 3 63  ? -53.258  -17.481 -55.736  1.00 0.00 ? 63  THR C OG1  1  
ATOM   6623   C CG2  . THR C 3 63  ? -51.140  -17.420 -54.573  1.00 0.00 ? 63  THR C CG2  1  
ATOM   6624   H H    . THR C 3 63  ? -51.815  -17.501 -57.647  1.00 0.00 ? 63  THR C H    1  
ATOM   6625   H HA   . THR C 3 63  ? -50.658  -19.490 -55.982  1.00 0.00 ? 63  THR C HA   1  
ATOM   6626   H HB   . THR C 3 63  ? -52.627  -18.950 -54.453  1.00 0.00 ? 63  THR C HB   1  
ATOM   6627   H HG1  . THR C 3 63  ? -52.967  -16.567 -55.697  1.00 0.00 ? 63  THR C HG1  1  
ATOM   6628   H HG21 . THR C 3 63  ? -50.936  -16.577 -55.216  1.00 0.00 ? 63  THR C HG21 1  
ATOM   6629   H HG22 . THR C 3 63  ? -50.237  -17.998 -54.441  1.00 0.00 ? 63  THR C HG22 1  
ATOM   6630   H HG23 . THR C 3 63  ? -51.484  -17.066 -53.613  1.00 0.00 ? 63  THR C HG23 1  
ATOM   6631   N N    . VAL C 3 64  ? -53.258  -20.421 -57.597  1.00 0.00 ? 64  VAL C N    1  
ATOM   6632   C CA   . VAL C 3 64  ? -53.890  -21.701 -57.936  1.00 0.00 ? 64  VAL C CA   1  
ATOM   6633   C C    . VAL C 3 64  ? -53.548  -22.203 -59.342  1.00 0.00 ? 64  VAL C C    1  
ATOM   6634   O O    . VAL C 3 64  ? -53.948  -23.304 -59.726  1.00 0.00 ? 64  VAL C O    1  
ATOM   6635   C CB   . VAL C 3 64  ? -55.446  -21.772 -57.639  1.00 0.00 ? 64  VAL C CB   1  
ATOM   6636   C CG1  . VAL C 3 64  ? -55.707  -21.733 -56.165  1.00 0.00 ? 64  VAL C CG1  1  
ATOM   6637   C CG2  . VAL C 3 64  ? -56.245  -20.680 -58.336  1.00 0.00 ? 64  VAL C CG2  1  
ATOM   6638   H H    . VAL C 3 64  ? -53.247  -19.689 -58.249  1.00 0.00 ? 64  VAL C H    1  
ATOM   6639   H HA   . VAL C 3 64  ? -53.434  -22.419 -57.266  1.00 0.00 ? 64  VAL C HA   1  
ATOM   6640   H HB   . VAL C 3 64  ? -55.799  -22.730 -58.002  1.00 0.00 ? 64  VAL C HB   1  
ATOM   6641   H HG11 . VAL C 3 64  ? -56.757  -21.556 -55.989  1.00 0.00 ? 64  VAL C HG11 1  
ATOM   6642   H HG12 . VAL C 3 64  ? -55.128  -20.938 -55.718  1.00 0.00 ? 64  VAL C HG12 1  
ATOM   6643   H HG13 . VAL C 3 64  ? -55.423  -22.677 -55.724  1.00 0.00 ? 64  VAL C HG13 1  
ATOM   6644   H HG21 . VAL C 3 64  ? -56.244  -19.788 -57.727  1.00 0.00 ? 64  VAL C HG21 1  
ATOM   6645   H HG22 . VAL C 3 64  ? -57.262  -21.015 -58.482  1.00 0.00 ? 64  VAL C HG22 1  
ATOM   6646   H HG23 . VAL C 3 64  ? -55.797  -20.462 -59.294  1.00 0.00 ? 64  VAL C HG23 1  
ATOM   6647   N N    . LYS C 3 65  ? -52.806  -21.410 -60.109  1.00 0.00 ? 65  LYS C N    1  
ATOM   6648   C CA   . LYS C 3 65  ? -52.471  -21.839 -61.461  1.00 0.00 ? 65  LYS C CA   1  
ATOM   6649   C C    . LYS C 3 65  ? -51.796  -23.181 -61.350  1.00 0.00 ? 65  LYS C C    1  
ATOM   6650   O O    . LYS C 3 65  ? -50.837  -23.346 -60.593  1.00 0.00 ? 65  LYS C O    1  
ATOM   6651   C CB   . LYS C 3 65  ? -51.552  -20.849 -62.168  1.00 0.00 ? 65  LYS C CB   1  
ATOM   6652   C CG   . LYS C 3 65  ? -51.475  -21.020 -63.680  1.00 0.00 ? 65  LYS C CG   1  
ATOM   6653   C CD   . LYS C 3 65  ? -50.153  -20.476 -64.245  1.00 0.00 ? 65  LYS C CD   1  
ATOM   6654   C CE   . LYS C 3 65  ? -50.091  -18.947 -64.337  1.00 0.00 ? 65  LYS C CE   1  
ATOM   6655   N NZ   . LYS C 3 65  ? -51.015  -18.428 -65.365  1.00 0.00 ? 65  LYS C NZ   1  
ATOM   6656   H H    . LYS C 3 65  ? -52.498  -20.542 -59.774  1.00 0.00 ? 65  LYS C H    1  
ATOM   6657   H HA   . LYS C 3 65  ? -53.383  -21.950 -62.031  1.00 0.00 ? 65  LYS C HA   1  
ATOM   6658   H HB2  . LYS C 3 65  ? -51.902  -19.850 -61.960  1.00 0.00 ? 65  LYS C HB2  1  
ATOM   6659   H HB3  . LYS C 3 65  ? -50.558  -20.954 -61.757  1.00 0.00 ? 65  LYS C HB3  1  
ATOM   6660   H HG2  . LYS C 3 65  ? -51.555  -22.070 -63.920  1.00 0.00 ? 65  LYS C HG2  1  
ATOM   6661   H HG3  . LYS C 3 65  ? -52.298  -20.490 -64.137  1.00 0.00 ? 65  LYS C HG3  1  
ATOM   6662   H HD2  . LYS C 3 65  ? -49.346  -20.811 -63.612  1.00 0.00 ? 65  LYS C HD2  1  
ATOM   6663   H HD3  . LYS C 3 65  ? -50.007  -20.890 -65.233  1.00 0.00 ? 65  LYS C HD3  1  
ATOM   6664   H HE2  . LYS C 3 65  ? -50.359  -18.525 -63.381  1.00 0.00 ? 65  LYS C HE2  1  
ATOM   6665   H HE3  . LYS C 3 65  ? -49.082  -18.649 -64.583  1.00 0.00 ? 65  LYS C HE3  1  
ATOM   6666   H HZ1  . LYS C 3 65  ? -51.901  -18.972 -65.342  1.00 0.00 ? 65  LYS C HZ1  1  
ATOM   6667   H HZ2  . LYS C 3 65  ? -50.575  -18.520 -66.304  1.00 0.00 ? 65  LYS C HZ2  1  
ATOM   6668   H HZ3  . LYS C 3 65  ? -51.221  -17.428 -65.174  1.00 0.00 ? 65  LYS C HZ3  1  
ATOM   6669   N N    . GLY C 3 66  ? -52.332  -24.141 -62.088  1.00 0.00 ? 66  GLY C N    1  
ATOM   6670   C CA   . GLY C 3 66  ? -51.829  -25.510 -62.071  1.00 0.00 ? 66  GLY C CA   1  
ATOM   6671   C C    . GLY C 3 66  ? -52.731  -26.463 -61.315  1.00 0.00 ? 66  GLY C C    1  
ATOM   6672   O O    . GLY C 3 66  ? -52.946  -27.587 -61.758  1.00 0.00 ? 66  GLY C O    1  
ATOM   6673   H H    . GLY C 3 66  ? -53.111  -23.930 -62.644  1.00 0.00 ? 66  GLY C H    1  
ATOM   6674   H HA2  . GLY C 3 66  ? -51.733  -25.857 -63.089  1.00 0.00 ? 66  GLY C HA2  1  
ATOM   6675   H HA3  . GLY C 3 66  ? -50.852  -25.514 -61.609  1.00 0.00 ? 66  GLY C HA3  1  
ATOM   6676   N N    . ARG C 3 67  ? -53.269  -26.008 -60.182  1.00 0.00 ? 67  ARG C N    1  
ATOM   6677   C CA   . ARG C 3 67  ? -54.047  -26.856 -59.283  1.00 0.00 ? 67  ARG C CA   1  
ATOM   6678   C C    . ARG C 3 67  ? -55.539  -26.704 -59.494  1.00 0.00 ? 67  ARG C C    1  
ATOM   6679   O O    . ARG C 3 67  ? -56.314  -27.466 -58.934  1.00 0.00 ? 67  ARG C O    1  
ATOM   6680   C CB   . ARG C 3 67  ? -53.708  -26.551 -57.817  1.00 0.00 ? 67  ARG C CB   1  
ATOM   6681   C CG   . ARG C 3 67  ? -52.200  -26.383 -57.503  1.00 0.00 ? 67  ARG C CG   1  
ATOM   6682   C CD   . ARG C 3 67  ? -51.885  -26.579 -56.010  1.00 0.00 ? 67  ARG C CD   1  
ATOM   6683   N NE   . ARG C 3 67  ? -52.989  -26.104 -55.178  1.00 0.00 ? 67  ARG C NE   1  
ATOM   6684   C CZ   . ARG C 3 67  ? -53.106  -24.854 -54.750  1.00 0.00 ? 67  ARG C CZ   1  
ATOM   6685   N NH1  . ARG C 3 67  ? -52.168  -23.962 -55.060  1.00 0.00 ? 67  ARG C NH1  1  
ATOM   6686   N NH2  . ARG C 3 67  ? -54.147  -24.500 -54.011  1.00 0.00 ? 67  ARG C NH2  1  
ATOM   6687   H H    . ARG C 3 67  ? -53.061  -25.093 -59.900  1.00 0.00 ? 67  ARG C H    1  
ATOM   6688   H HA   . ARG C 3 67  ? -53.783  -27.884 -59.479  1.00 0.00 ? 67  ARG C HA   1  
ATOM   6689   H HB2  . ARG C 3 67  ? -54.210  -25.638 -57.537  1.00 0.00 ? 67  ARG C HB2  1  
ATOM   6690   H HB3  . ARG C 3 67  ? -54.099  -27.353 -57.206  1.00 0.00 ? 67  ARG C HB3  1  
ATOM   6691   H HG2  . ARG C 3 67  ? -51.641  -27.108 -58.074  1.00 0.00 ? 67  ARG C HG2  1  
ATOM   6692   H HG3  . ARG C 3 67  ? -51.890  -25.391 -57.800  1.00 0.00 ? 67  ARG C HG3  1  
ATOM   6693   H HD2  . ARG C 3 67  ? -51.722  -27.627 -55.815  1.00 0.00 ? 67  ARG C HD2  1  
ATOM   6694   H HD3  . ARG C 3 67  ? -50.988  -26.029 -55.762  1.00 0.00 ? 67  ARG C HD3  1  
ATOM   6695   H HE   . ARG C 3 67  ? -53.685  -26.746 -54.926  1.00 0.00 ? 67  ARG C HE   1  
ATOM   6696   H HH11 . ARG C 3 67  ? -51.381  -24.235 -55.612  1.00 0.00 ? 67  ARG C HH11 1  
ATOM   6697   H HH12 . ARG C 3 67  ? -52.251  -23.018 -54.739  1.00 0.00 ? 67  ARG C HH12 1  
ATOM   6698   H HH21 . ARG C 3 67  ? -54.846  -25.175 -53.775  1.00 0.00 ? 67  ARG C HH21 1  
ATOM   6699   H HH22 . ARG C 3 67  ? -54.235  -23.557 -53.689  1.00 0.00 ? 67  ARG C HH22 1  
ATOM   6700   N N    . PHE C 3 68  ? -55.939  -25.724 -60.301  1.00 0.00 ? 68  PHE C N    1  
ATOM   6701   C CA   . PHE C 3 68  ? -57.358  -25.326 -60.441  1.00 0.00 ? 68  PHE C CA   1  
ATOM   6702   C C    . PHE C 3 68  ? -57.829  -25.153 -61.908  1.00 0.00 ? 68  PHE C C    1  
ATOM   6703   O O    . PHE C 3 68  ? -57.039  -24.764 -62.773  1.00 0.00 ? 68  PHE C O    1  
ATOM   6704   C CB   . PHE C 3 68  ? -57.600  -24.048 -59.641  1.00 0.00 ? 68  PHE C CB   1  
ATOM   6705   C CG   . PHE C 3 68  ? -57.795  -24.270 -58.164  1.00 0.00 ? 68  PHE C CG   1  
ATOM   6706   C CD1  . PHE C 3 68  ? -57.162  -25.303 -57.502  1.00 0.00 ? 68  PHE C CD1  1  
ATOM   6707   C CD2  . PHE C 3 68  ? -58.603  -23.417 -57.430  1.00 0.00 ? 68  PHE C CD2  1  
ATOM   6708   C CE1  . PHE C 3 68  ? -57.345  -25.497 -56.128  1.00 0.00 ? 68  PHE C CE1  1  
ATOM   6709   C CE2  . PHE C 3 68  ? -58.789  -23.598 -56.058  1.00 0.00 ? 68  PHE C CE2  1  
ATOM   6710   C CZ   . PHE C 3 68  ? -58.159  -24.639 -55.408  1.00 0.00 ? 68  PHE C CZ   1  
ATOM   6711   H H    . PHE C 3 68  ? -55.256  -25.157 -60.717  1.00 0.00 ? 68  PHE C H    1  
ATOM   6712   H HA   . PHE C 3 68  ? -57.959  -26.106 -59.998  1.00 0.00 ? 68  PHE C HA   1  
ATOM   6713   H HB2  . PHE C 3 68  ? -56.753  -23.394 -59.776  1.00 0.00 ? 68  PHE C HB2  1  
ATOM   6714   H HB3  . PHE C 3 68  ? -58.478  -23.557 -60.039  1.00 0.00 ? 68  PHE C HB3  1  
ATOM   6715   H HD1  . PHE C 3 68  ? -56.528  -25.979 -58.055  1.00 0.00 ? 68  PHE C HD1  1  
ATOM   6716   H HD2  . PHE C 3 68  ? -59.101  -22.599 -57.929  1.00 0.00 ? 68  PHE C HD2  1  
ATOM   6717   H HE1  . PHE C 3 68  ? -56.842  -26.311 -55.627  1.00 0.00 ? 68  PHE C HE1  1  
ATOM   6718   H HE2  . PHE C 3 68  ? -59.426  -22.923 -55.506  1.00 0.00 ? 68  PHE C HE2  1  
ATOM   6719   H HZ   . PHE C 3 68  ? -58.303  -24.786 -54.348  1.00 0.00 ? 68  PHE C HZ   1  
ATOM   6720   N N    . THR C 3 69  ? -59.103  -25.442 -62.189  1.00 0.00 ? 69  THR C N    1  
ATOM   6721   C CA   . THR C 3 69  ? -59.556  -25.596 -63.591  1.00 0.00 ? 69  THR C CA   1  
ATOM   6722   C C    . THR C 3 69  ? -60.995  -25.107 -63.900  1.00 0.00 ? 69  THR C C    1  
ATOM   6723   O O    . THR C 3 69  ? -61.989  -25.814 -63.663  1.00 0.00 ? 69  THR C O    1  
ATOM   6724   C CB   . THR C 3 69  ? -59.402  -27.065 -64.059  1.00 0.00 ? 69  THR C CB   1  
ATOM   6725   O OG1  . THR C 3 69  ? -58.382  -27.722 -63.288  1.00 0.00 ? 69  THR C OG1  1  
ATOM   6726   C CG2  . THR C 3 69  ? -59.059  -27.130 -65.537  1.00 0.00 ? 69  THR C CG2  1  
ATOM   6727   H H    . THR C 3 69  ? -59.690  -25.746 -61.465  1.00 0.00 ? 69  THR C H    1  
ATOM   6728   H HA   . THR C 3 69  ? -58.889  -25.005 -64.199  1.00 0.00 ? 69  THR C HA   1  
ATOM   6729   H HB   . THR C 3 69  ? -60.339  -27.578 -63.898  1.00 0.00 ? 69  THR C HB   1  
ATOM   6730   H HG1  . THR C 3 69  ? -58.047  -27.095 -62.643  1.00 0.00 ? 69  THR C HG1  1  
ATOM   6731   H HG21 . THR C 3 69  ? -58.952  -28.162 -65.837  1.00 0.00 ? 69  THR C HG21 1  
ATOM   6732   H HG22 . THR C 3 69  ? -58.132  -26.605 -65.715  1.00 0.00 ? 69  THR C HG22 1  
ATOM   6733   H HG23 . THR C 3 69  ? -59.850  -26.670 -66.111  1.00 0.00 ? 69  THR C HG23 1  
ATOM   6734   N N    . ILE C 3 70  ? -61.102  -23.908 -64.454  1.00 0.00 ? 70  ILE C N    1  
ATOM   6735   C CA   . ILE C 3 70  ? -62.397  -23.288 -64.611  1.00 0.00 ? 70  ILE C CA   1  
ATOM   6736   C C    . ILE C 3 70  ? -63.073  -23.704 -65.918  1.00 0.00 ? 70  ILE C C    1  
ATOM   6737   O O    . ILE C 3 70  ? -62.947  -23.041 -66.937  1.00 0.00 ? 70  ILE C O    1  
ATOM   6738   C CB   . ILE C 3 70  ? -62.322  -21.738 -64.419  1.00 0.00 ? 70  ILE C CB   1  
ATOM   6739   C CG1  . ILE C 3 70  ? -63.709  -21.104 -64.571  1.00 0.00 ? 70  ILE C CG1  1  
ATOM   6740   C CG2  . ILE C 3 70  ? -61.305  -21.091 -65.356  1.00 0.00 ? 70  ILE C CG2  1  
ATOM   6741   C CD1  . ILE C 3 70  ? -63.873  -19.749 -63.917  1.00 0.00 ? 70  ILE C CD1  1  
ATOM   6742   H H    . ILE C 3 70  ? -60.292  -23.389 -64.644  1.00 0.00 ? 70  ILE C H    1  
ATOM   6743   H HA   . ILE C 3 70  ? -63.017  -23.672 -63.813  1.00 0.00 ? 70  ILE C HA   1  
ATOM   6744   H HB   . ILE C 3 70  ? -61.984  -21.557 -63.406  1.00 0.00 ? 70  ILE C HB   1  
ATOM   6745   H HG12 . ILE C 3 70  ? -63.920  -20.995 -65.622  1.00 0.00 ? 70  ILE C HG12 1  
ATOM   6746   H HG13 . ILE C 3 70  ? -64.439  -21.782 -64.148  1.00 0.00 ? 70  ILE C HG13 1  
ATOM   6747   H HG21 . ILE C 3 70  ? -60.760  -20.326 -64.822  1.00 0.00 ? 70  ILE C HG21 1  
ATOM   6748   H HG22 . ILE C 3 70  ? -61.821  -20.646 -66.195  1.00 0.00 ? 70  ILE C HG22 1  
ATOM   6749   H HG23 . ILE C 3 70  ? -60.616  -21.841 -65.714  1.00 0.00 ? 70  ILE C HG23 1  
ATOM   6750   H HD11 . ILE C 3 70  ? -63.419  -18.992 -64.539  1.00 0.00 ? 70  ILE C HD11 1  
ATOM   6751   H HD12 . ILE C 3 70  ? -63.393  -19.756 -62.949  1.00 0.00 ? 70  ILE C HD12 1  
ATOM   6752   H HD13 . ILE C 3 70  ? -64.924  -19.532 -63.796  1.00 0.00 ? 70  ILE C HD13 1  
ATOM   6753   N N    . SER C 3 71  ? -63.794  -24.814 -65.895  1.00 0.00 ? 71  SER C N    1  
ATOM   6754   C CA   . SER C 3 71  ? -64.551  -25.228 -67.079  1.00 0.00 ? 71  SER C CA   1  
ATOM   6755   C C    . SER C 3 71  ? -65.998  -24.728 -67.018  1.00 0.00 ? 71  SER C C    1  
ATOM   6756   O O    . SER C 3 71  ? -66.468  -24.288 -65.955  1.00 0.00 ? 71  SER C O    1  
ATOM   6757   C CB   . SER C 3 71  ? -64.519  -26.746 -67.231  1.00 0.00 ? 71  SER C CB   1  
ATOM   6758   O OG   . SER C 3 71  ? -65.049  -27.382 -66.080  1.00 0.00 ? 71  SER C OG   1  
ATOM   6759   H H    . SER C 3 71  ? -63.872  -25.326 -65.063  1.00 0.00 ? 71  SER C H    1  
ATOM   6760   H HA   . SER C 3 71  ? -64.081  -24.791 -67.948  1.00 0.00 ? 71  SER C HA   1  
ATOM   6761   H HB2  . SER C 3 71  ? -65.107  -27.031 -68.087  1.00 0.00 ? 71  SER C HB2  1  
ATOM   6762   H HB3  . SER C 3 71  ? -63.495  -27.063 -67.387  1.00 0.00 ? 71  SER C HB3  1  
ATOM   6763   H HG   . SER C 3 71  ? -64.585  -27.041 -65.312  1.00 0.00 ? 71  SER C HG   1  
ATOM   6764   N N    . ARG C 3 72  ? -66.680  -24.772 -68.166  1.00 0.00 ? 72  ARG C N    1  
ATOM   6765   C CA   . ARG C 3 72  ? -68.122  -24.479 -68.248  1.00 0.00 ? 72  ARG C CA   1  
ATOM   6766   C C    . ARG C 3 72  ? -68.810  -25.400 -69.245  1.00 0.00 ? 72  ARG C C    1  
ATOM   6767   O O    . ARG C 3 72  ? -68.167  -25.967 -70.131  1.00 0.00 ? 72  ARG C O    1  
ATOM   6768   C CB   . ARG C 3 72  ? -68.394  -23.018 -68.623  1.00 0.00 ? 72  ARG C CB   1  
ATOM   6769   C CG   . ARG C 3 72  ? -68.269  -22.717 -70.107  1.00 0.00 ? 72  ARG C CG   1  
ATOM   6770   C CD   . ARG C 3 72  ? -68.081  -21.225 -70.362  1.00 0.00 ? 72  ARG C CD   1  
ATOM   6771   N NE   . ARG C 3 72  ? -69.312  -20.449 -70.211  1.00 0.00 ? 72  ARG C NE   1  
ATOM   6772   C CZ   . ARG C 3 72  ? -69.369  -19.120 -70.136  1.00 0.00 ? 72  ARG C CZ   1  
ATOM   6773   N NH1  . ARG C 3 72  ? -68.263  -18.389 -70.187  1.00 0.00 ? 72  ARG C NH1  1  
ATOM   6774   N NH2  . ARG C 3 72  ? -70.545  -18.521 -70.002  1.00 0.00 ? 72  ARG C NH2  1  
ATOM   6775   H H    . ARG C 3 72  ? -66.227  -25.112 -68.966  1.00 0.00 ? 72  ARG C H    1  
ATOM   6776   H HA   . ARG C 3 72  ? -68.554  -24.662 -67.274  1.00 0.00 ? 72  ARG C HA   1  
ATOM   6777   H HB2  . ARG C 3 72  ? -69.393  -22.763 -68.309  1.00 0.00 ? 72  ARG C HB2  1  
ATOM   6778   H HB3  . ARG C 3 72  ? -67.696  -22.392 -68.083  1.00 0.00 ? 72  ARG C HB3  1  
ATOM   6779   H HG2  . ARG C 3 72  ? -67.420  -23.252 -70.505  1.00 0.00 ? 72  ARG C HG2  1  
ATOM   6780   H HG3  . ARG C 3 72  ? -69.165  -23.051 -70.610  1.00 0.00 ? 72  ARG C HG3  1  
ATOM   6781   H HD2  . ARG C 3 72  ? -67.350  -20.845 -69.666  1.00 0.00 ? 72  ARG C HD2  1  
ATOM   6782   H HD3  . ARG C 3 72  ? -67.701  -21.092 -71.366  1.00 0.00 ? 72  ARG C HD3  1  
ATOM   6783   H HE   . ARG C 3 72  ? -70.157  -20.944 -70.162  1.00 0.00 ? 72  ARG C HE   1  
ATOM   6784   H HH11 . ARG C 3 72  ? -67.373  -18.835 -70.283  1.00 0.00 ? 72  ARG C HH11 1  
ATOM   6785   H HH12 . ARG C 3 72  ? -68.319  -17.392 -70.130  1.00 0.00 ? 72  ARG C HH12 1  
ATOM   6786   H HH21 . ARG C 3 72  ? -71.382  -19.066 -69.957  1.00 0.00 ? 72  ARG C HH21 1  
ATOM   6787   H HH22 . ARG C 3 72  ? -70.594  -17.523 -69.945  1.00 0.00 ? 72  ARG C HH22 1  
ATOM   6788   N N    . ASP C 3 73  ? -70.121  -25.535 -69.095  1.00 0.00 ? 73  ASP C N    1  
ATOM   6789   C CA   . ASP C 3 73  ? -70.924  -26.330 -69.995  1.00 0.00 ? 73  ASP C CA   1  
ATOM   6790   C C    . ASP C 3 73  ? -72.247  -25.603 -70.181  1.00 0.00 ? 73  ASP C C    1  
ATOM   6791   O O    . ASP C 3 73  ? -73.161  -25.716 -69.359  1.00 0.00 ? 73  ASP C O    1  
ATOM   6792   C CB   . ASP C 3 73  ? -71.124  -27.740 -69.420  1.00 0.00 ? 73  ASP C CB   1  
ATOM   6793   C CG   . ASP C 3 73  ? -72.156  -28.552 -70.193  1.00 0.00 ? 73  ASP C CG   1  
ATOM   6794   O OD1  . ASP C 3 73  ? -72.027  -28.611 -71.445  1.00 0.00 ? 73  ASP C OD1  1  
ATOM   6795   O OD2  . ASP C 3 73  ? -73.087  -29.119 -69.546  1.00 0.00 ? 73  ASP C OD2  1  
ATOM   6796   H H    . ASP C 3 73  ? -70.565  -25.048 -68.369  1.00 0.00 ? 73  ASP C H    1  
ATOM   6797   H HA   . ASP C 3 73  ? -70.422  -26.400 -70.950  1.00 0.00 ? 73  ASP C HA   1  
ATOM   6798   H HB2  . ASP C 3 73  ? -70.182  -28.266 -69.432  1.00 0.00 ? 73  ASP C HB2  1  
ATOM   6799   H HB3  . ASP C 3 73  ? -71.455  -27.646 -68.396  1.00 0.00 ? 73  ASP C HB3  1  
ATOM   6800   N N    . ASN C 3 74  ? -72.330  -24.828 -71.256  1.00 0.00 ? 74  ASN C N    1  
ATOM   6801   C CA   . ASN C 3 74  ? -73.535  -24.045 -71.574  1.00 0.00 ? 74  ASN C CA   1  
ATOM   6802   C C    . ASN C 3 74  ? -74.616  -24.946 -72.196  1.00 0.00 ? 74  ASN C C    1  
ATOM   6803   O O    . ASN C 3 74  ? -75.629  -24.468 -72.735  1.00 0.00 ? 74  ASN C O    1  
ATOM   6804   C CB   . ASN C 3 74  ? -73.191  -22.885 -72.519  1.00 0.00 ? 74  ASN C CB   1  
ATOM   6805   C CG   . ASN C 3 74  ? -71.699  -22.721 -72.712  1.00 0.00 ? 74  ASN C CG   1  
ATOM   6806   O OD1  . ASN C 3 74  ? -70.949  -23.697 -72.653  1.00 0.00 ? 74  ASN C OD1  1  
ATOM   6807   N ND2  . ASN C 3 74  ? -71.258  -21.493 -72.942  1.00 0.00 ? 74  ASN C ND2  1  
ATOM   6808   H H    . ASN C 3 74  ? -71.557  -24.768 -71.855  1.00 0.00 ? 74  ASN C H    1  
ATOM   6809   H HA   . ASN C 3 74  ? -73.925  -23.633 -70.654  1.00 0.00 ? 74  ASN C HA   1  
ATOM   6810   H HB2  . ASN C 3 74  ? -73.647  -23.068 -73.479  1.00 0.00 ? 74  ASN C HB2  1  
ATOM   6811   H HB3  . ASN C 3 74  ? -73.595  -21.970 -72.109  1.00 0.00 ? 74  ASN C HB3  1  
ATOM   6812   H HD21 . ASN C 3 74  ? -71.889  -20.745 -72.980  1.00 0.00 ? 74  ASN C HD21 1  
ATOM   6813   H HD22 . ASN C 3 74  ? -70.300  -21.334 -73.074  1.00 0.00 ? 74  ASN C HD22 1  
ATOM   6814   N N    . ALA C 3 75  ? -74.370  -26.253 -72.147  1.00 0.00 ? 75  ALA C N    1  
ATOM   6815   C CA   . ALA C 3 75  ? -75.395  -27.213 -72.453  1.00 0.00 ? 75  ALA C CA   1  
ATOM   6816   C C    . ALA C 3 75  ? -76.257  -27.282 -71.199  1.00 0.00 ? 75  ALA C C    1  
ATOM   6817   O O    . ALA C 3 75  ? -77.450  -26.948 -71.221  1.00 0.00 ? 75  ALA C O    1  
ATOM   6818   C CB   . ALA C 3 75  ? -74.783  -28.557 -72.781  1.00 0.00 ? 75  ALA C CB   1  
ATOM   6819   H H    . ALA C 3 75  ? -73.538  -26.563 -71.734  1.00 0.00 ? 75  ALA C H    1  
ATOM   6820   H HA   . ALA C 3 75  ? -75.989  -26.861 -73.286  1.00 0.00 ? 75  ALA C HA   1  
ATOM   6821   H HB1  . ALA C 3 75  ? -73.767  -28.590 -72.414  1.00 0.00 ? 75  ALA C HB1  1  
ATOM   6822   H HB2  . ALA C 3 75  ? -74.784  -28.702 -73.851  1.00 0.00 ? 75  ALA C HB2  1  
ATOM   6823   H HB3  . ALA C 3 75  ? -75.359  -29.340 -72.311  1.00 0.00 ? 75  ALA C HB3  1  
ATOM   6824   N N    . LYS C 3 76  ? -75.643  -27.666 -70.089  1.00 0.00 ? 76  LYS C N    1  
ATOM   6825   C CA   . LYS C 3 76  ? -76.380  -27.729 -68.842  1.00 0.00 ? 76  LYS C CA   1  
ATOM   6826   C C    . LYS C 3 76  ? -76.201  -26.497 -67.958  1.00 0.00 ? 76  LYS C C    1  
ATOM   6827   O O    . LYS C 3 76  ? -76.425  -26.545 -66.748  1.00 0.00 ? 76  LYS C O    1  
ATOM   6828   C CB   . LYS C 3 76  ? -76.101  -29.051 -68.118  1.00 0.00 ? 76  LYS C CB   1  
ATOM   6829   C CG   . LYS C 3 76  ? -77.285  -30.057 -68.204  1.00 0.00 ? 76  LYS C CG   1  
ATOM   6830   C CD   . LYS C 3 76  ? -78.062  -30.049 -69.569  1.00 0.00 ? 76  LYS C CD   1  
ATOM   6831   C CE   . LYS C 3 76  ? -79.533  -30.518 -69.420  1.00 0.00 ? 76  LYS C CE   1  
ATOM   6832   N NZ   . LYS C 3 76  ? -80.457  -29.414 -69.000  1.00 0.00 ? 76  LYS C NZ   1  
ATOM   6833   H H    . LYS C 3 76  ? -74.688  -27.886 -70.106  1.00 0.00 ? 76  LYS C H    1  
ATOM   6834   H HA   . LYS C 3 76  ? -77.426  -27.746 -69.115  1.00 0.00 ? 76  LYS C HA   1  
ATOM   6835   H HB2  . LYS C 3 76  ? -75.226  -29.508 -68.555  1.00 0.00 ? 76  LYS C HB2  1  
ATOM   6836   H HB3  . LYS C 3 76  ? -75.899  -28.840 -67.077  1.00 0.00 ? 76  LYS C HB3  1  
ATOM   6837   H HG2  . LYS C 3 76  ? -76.900  -31.052 -68.042  1.00 0.00 ? 76  LYS C HG2  1  
ATOM   6838   H HG3  . LYS C 3 76  ? -77.983  -29.830 -67.410  1.00 0.00 ? 76  LYS C HG3  1  
ATOM   6839   H HD2  . LYS C 3 76  ? -78.056  -29.046 -69.968  1.00 0.00 ? 76  LYS C HD2  1  
ATOM   6840   H HD3  . LYS C 3 76  ? -77.553  -30.702 -70.263  1.00 0.00 ? 76  LYS C HD3  1  
ATOM   6841   H HE2  . LYS C 3 76  ? -79.871  -30.908 -70.367  1.00 0.00 ? 76  LYS C HE2  1  
ATOM   6842   H HE3  . LYS C 3 76  ? -79.572  -31.310 -68.685  1.00 0.00 ? 76  LYS C HE3  1  
ATOM   6843   H HZ1  . LYS C 3 76  ? -80.339  -28.601 -69.636  1.00 0.00 ? 76  LYS C HZ1  1  
ATOM   6844   H HZ2  . LYS C 3 76  ? -80.234  -29.128 -68.024  1.00 0.00 ? 76  LYS C HZ2  1  
ATOM   6845   H HZ3  . LYS C 3 76  ? -81.441  -29.748 -69.047  1.00 0.00 ? 76  LYS C HZ3  1  
ATOM   6846   N N    . ASN C 3 77  ? -75.812  -25.387 -68.586  1.00 0.00 ? 77  ASN C N    1  
ATOM   6847   C CA   . ASN C 3 77  ? -75.801  -24.073 -67.946  1.00 0.00 ? 77  ASN C CA   1  
ATOM   6848   C C    . ASN C 3 77  ? -74.937  -23.911 -66.691  1.00 0.00 ? 77  ASN C C    1  
ATOM   6849   O O    . ASN C 3 77  ? -74.973  -22.877 -66.010  1.00 0.00 ? 77  ASN C O    1  
ATOM   6850   C CB   . ASN C 3 77  ? -77.234  -23.616 -67.667  1.00 0.00 ? 77  ASN C CB   1  
ATOM   6851   C CG   . ASN C 3 77  ? -77.631  -22.421 -68.507  1.00 0.00 ? 77  ASN C CG   1  
ATOM   6852   O OD1  . ASN C 3 77  ? -77.188  -22.250 -69.658  1.00 0.00 ? 77  ASN C OD1  1  
ATOM   6853   N ND2  . ASN C 3 77  ? -78.463  -21.568 -67.929  1.00 0.00 ? 77  ASN C ND2  1  
ATOM   6854   H H    . ASN C 3 77  ? -75.664  -25.431 -69.553  1.00 0.00 ? 77  ASN C H    1  
ATOM   6855   H HA   . ASN C 3 77  ? -75.403  -23.385 -68.676  1.00 0.00 ? 77  ASN C HA   1  
ATOM   6856   H HB2  . ASN C 3 77  ? -77.909  -24.430 -67.880  1.00 0.00 ? 77  ASN C HB2  1  
ATOM   6857   H HB3  . ASN C 3 77  ? -77.319  -23.356 -66.622  1.00 0.00 ? 77  ASN C HB3  1  
ATOM   6858   H HD21 . ASN C 3 77  ? -78.779  -21.735 -67.016  1.00 0.00 ? 77  ASN C HD21 1  
ATOM   6859   H HD22 . ASN C 3 77  ? -78.763  -20.771 -68.413  1.00 0.00 ? 77  ASN C HD22 1  
ATOM   6860   N N    . THR C 3 78  ? -74.148  -24.936 -66.400  1.00 0.00 ? 78  THR C N    1  
ATOM   6861   C CA   . THR C 3 78  ? -73.294  -24.936 -65.217  1.00 0.00 ? 78  THR C CA   1  
ATOM   6862   C C    . THR C 3 78  ? -71.910  -24.300 -65.505  1.00 0.00 ? 78  THR C C    1  
ATOM   6863   O O    . THR C 3 78  ? -71.393  -24.359 -66.635  1.00 0.00 ? 78  THR C O    1  
ATOM   6864   C CB   . THR C 3 78  ? -73.122  -26.382 -64.624  1.00 0.00 ? 78  THR C CB   1  
ATOM   6865   O OG1  . THR C 3 78  ? -72.300  -27.156 -65.499  1.00 0.00 ? 78  THR C OG1  1  
ATOM   6866   C CG2  . THR C 3 78  ? -74.485  -27.103 -64.416  1.00 0.00 ? 78  THR C CG2  1  
ATOM   6867   H H    . THR C 3 78  ? -74.154  -25.723 -66.984  1.00 0.00 ? 78  THR C H    1  
ATOM   6868   H HA   . THR C 3 78  ? -73.780  -24.330 -64.466  1.00 0.00 ? 78  THR C HA   1  
ATOM   6869   H HB   . THR C 3 78  ? -72.624  -26.302 -63.668  1.00 0.00 ? 78  THR C HB   1  
ATOM   6870   H HG1  . THR C 3 78  ? -71.407  -26.807 -65.454  1.00 0.00 ? 78  THR C HG1  1  
ATOM   6871   H HG21 . THR C 3 78  ? -75.111  -26.947 -65.283  1.00 0.00 ? 78  THR C HG21 1  
ATOM   6872   H HG22 . THR C 3 78  ? -74.976  -26.701 -63.542  1.00 0.00 ? 78  THR C HG22 1  
ATOM   6873   H HG23 . THR C 3 78  ? -74.316  -28.161 -64.279  1.00 0.00 ? 78  THR C HG23 1  
ATOM   6874   N N    . LEU C 3 79  ? -71.346  -23.663 -64.483  1.00 0.00 ? 79  LEU C N    1  
ATOM   6875   C CA   . LEU C 3 79  ? -69.935  -23.301 -64.471  1.00 0.00 ? 79  LEU C CA   1  
ATOM   6876   C C    . LEU C 3 79  ? -69.268  -24.324 -63.571  1.00 0.00 ? 79  LEU C C    1  
ATOM   6877   O O    . LEU C 3 79  ? -69.928  -24.912 -62.721  1.00 0.00 ? 79  LEU C O    1  
ATOM   6878   C CB   . LEU C 3 79  ? -69.743  -21.882 -63.927  1.00 0.00 ? 79  LEU C CB   1  
ATOM   6879   C CG   . LEU C 3 79  ? -68.347  -21.377 -63.560  1.00 0.00 ? 79  LEU C CG   1  
ATOM   6880   C CD1  . LEU C 3 79  ? -67.426  -21.289 -64.753  1.00 0.00 ? 79  LEU C CD1  1  
ATOM   6881   C CD2  . LEU C 3 79  ? -68.464  -20.038 -62.892  1.00 0.00 ? 79  LEU C CD2  1  
ATOM   6882   H H    . LEU C 3 79  ? -71.834  -23.632 -63.634  1.00 0.00 ? 79  LEU C H    1  
ATOM   6883   H HA   . LEU C 3 79  ? -69.530  -23.374 -65.471  1.00 0.00 ? 79  LEU C HA   1  
ATOM   6884   H HB2  . LEU C 3 79  ? -70.134  -21.202 -64.663  1.00 0.00 ? 79  LEU C HB2  1  
ATOM   6885   H HB3  . LEU C 3 79  ? -70.369  -21.794 -63.047  1.00 0.00 ? 79  LEU C HB3  1  
ATOM   6886   H HG   . LEU C 3 79  ? -67.914  -22.071 -62.853  1.00 0.00 ? 79  LEU C HG   1  
ATOM   6887   H HD11 . LEU C 3 79  ? -66.450  -20.960 -64.430  1.00 0.00 ? 79  LEU C HD11 1  
ATOM   6888   H HD12 . LEU C 3 79  ? -67.827  -20.583 -65.465  1.00 0.00 ? 79  LEU C HD12 1  
ATOM   6889   H HD13 . LEU C 3 79  ? -67.343  -22.261 -65.216  1.00 0.00 ? 79  LEU C HD13 1  
ATOM   6890   H HD21 . LEU C 3 79  ? -68.828  -20.169 -61.884  1.00 0.00 ? 79  LEU C HD21 1  
ATOM   6891   H HD22 . LEU C 3 79  ? -69.154  -19.419 -63.447  1.00 0.00 ? 79  LEU C HD22 1  
ATOM   6892   H HD23 . LEU C 3 79  ? -67.495  -19.562 -62.865  1.00 0.00 ? 79  LEU C HD23 1  
ATOM   6893   N N    . TYR C 3 80  ? -67.978  -24.563 -63.752  1.00 0.00 ? 80  TYR C N    1  
ATOM   6894   C CA   . TYR C 3 80  ? -67.304  -25.511 -62.880  1.00 0.00 ? 80  TYR C CA   1  
ATOM   6895   C C    . TYR C 3 80  ? -65.979  -25.005 -62.354  1.00 0.00 ? 80  TYR C C    1  
ATOM   6896   O O    . TYR C 3 80  ? -65.225  -24.344 -63.074  1.00 0.00 ? 80  TYR C O    1  
ATOM   6897   C CB   . TYR C 3 80  ? -67.045  -26.828 -63.606  1.00 0.00 ? 80  TYR C CB   1  
ATOM   6898   C CG   . TYR C 3 80  ? -68.264  -27.550 -64.093  1.00 0.00 ? 80  TYR C CG   1  
ATOM   6899   C CD1  . TYR C 3 80  ? -69.180  -28.097 -63.194  1.00 0.00 ? 80  TYR C CD1  1  
ATOM   6900   C CD2  . TYR C 3 80  ? -68.489  -27.713 -65.455  1.00 0.00 ? 80  TYR C CD2  1  
ATOM   6901   C CE1  . TYR C 3 80  ? -70.296  -28.768 -63.638  1.00 0.00 ? 80  TYR C CE1  1  
ATOM   6902   C CE2  . TYR C 3 80  ? -69.601  -28.388 -65.915  1.00 0.00 ? 80  TYR C CE2  1  
ATOM   6903   C CZ   . TYR C 3 80  ? -70.499  -28.915 -64.999  1.00 0.00 ? 80  TYR C CZ   1  
ATOM   6904   O OH   . TYR C 3 80  ? -71.604  -29.592 -65.452  1.00 0.00 ? 80  TYR C OH   1  
ATOM   6905   H H    . TYR C 3 80  ? -67.478  -24.089 -64.449  1.00 0.00 ? 80  TYR C H    1  
ATOM   6906   H HA   . TYR C 3 80  ? -67.948  -25.716 -62.039  1.00 0.00 ? 80  TYR C HA   1  
ATOM   6907   H HB2  . TYR C 3 80  ? -66.416  -26.626 -64.458  1.00 0.00 ? 80  TYR C HB2  1  
ATOM   6908   H HB3  . TYR C 3 80  ? -66.503  -27.481 -62.934  1.00 0.00 ? 80  TYR C HB3  1  
ATOM   6909   H HD1  . TYR C 3 80  ? -69.017  -27.980 -62.133  1.00 0.00 ? 80  TYR C HD1  1  
ATOM   6910   H HD2  . TYR C 3 80  ? -67.789  -27.295 -66.164  1.00 0.00 ? 80  TYR C HD2  1  
ATOM   6911   H HE1  . TYR C 3 80  ? -71.001  -29.183 -62.933  1.00 0.00 ? 80  TYR C HE1  1  
ATOM   6912   H HE2  . TYR C 3 80  ? -69.766  -28.510 -66.975  1.00 0.00 ? 80  TYR C HE2  1  
ATOM   6913   H HH   . TYR C 3 80  ? -72.262  -29.588 -64.752  1.00 0.00 ? 80  TYR C HH   1  
ATOM   6914   N N    . LEU C 3 81  ? -65.688  -25.335 -61.104  1.00 0.00 ? 81  LEU C N    1  
ATOM   6915   C CA   . LEU C 3 81  ? -64.330  -25.237 -60.631  1.00 0.00 ? 81  LEU C CA   1  
ATOM   6916   C C    . LEU C 3 81  ? -63.850  -26.593 -60.127  1.00 0.00 ? 81  LEU C C    1  
ATOM   6917   O O    . LEU C 3 81  ? -64.409  -27.160 -59.183  1.00 0.00 ? 81  LEU C O    1  
ATOM   6918   C CB   . LEU C 3 81  ? -64.166  -24.140 -59.574  1.00 0.00 ? 81  LEU C CB   1  
ATOM   6919   C CG   . LEU C 3 81  ? -62.693  -23.721 -59.411  1.00 0.00 ? 81  LEU C CG   1  
ATOM   6920   C CD1  . LEU C 3 81  ? -62.229  -22.788 -60.531  1.00 0.00 ? 81  LEU C CD1  1  
ATOM   6921   C CD2  . LEU C 3 81  ? -62.430  -23.094 -58.061  1.00 0.00 ? 81  LEU C CD2  1  
ATOM   6922   H H    . LEU C 3 81  ? -66.329  -25.873 -60.594  1.00 0.00 ? 81  LEU C H    1  
ATOM   6923   H HA   . LEU C 3 81  ? -63.713  -24.971 -61.479  1.00 0.00 ? 81  LEU C HA   1  
ATOM   6924   H HB2  . LEU C 3 81  ? -64.746  -23.278 -59.868  1.00 0.00 ? 81  LEU C HB2  1  
ATOM   6925   H HB3  . LEU C 3 81  ? -64.535  -24.506 -58.627  1.00 0.00 ? 81  LEU C HB3  1  
ATOM   6926   H HG   . LEU C 3 81  ? -62.097  -24.622 -59.479  1.00 0.00 ? 81  LEU C HG   1  
ATOM   6927   H HD11 . LEU C 3 81  ? -61.470  -22.120 -60.151  1.00 0.00 ? 81  LEU C HD11 1  
ATOM   6928   H HD12 . LEU C 3 81  ? -63.069  -22.211 -60.890  1.00 0.00 ? 81  LEU C HD12 1  
ATOM   6929   H HD13 . LEU C 3 81  ? -61.821  -23.373 -61.341  1.00 0.00 ? 81  LEU C HD13 1  
ATOM   6930   H HD21 . LEU C 3 81  ? -63.208  -23.384 -57.371  1.00 0.00 ? 81  LEU C HD21 1  
ATOM   6931   H HD22 . LEU C 3 81  ? -62.418  -22.018 -58.160  1.00 0.00 ? 81  LEU C HD22 1  
ATOM   6932   H HD23 . LEU C 3 81  ? -61.475  -23.432 -57.687  1.00 0.00 ? 81  LEU C HD23 1  
ATOM   6933   N N    . GLN C 3 82  ? -62.814  -27.109 -60.781  1.00 0.00 ? 82  GLN C N    1  
ATOM   6934   C CA   . GLN C 3 82  ? -62.230  -28.383 -60.392  1.00 0.00 ? 82  GLN C CA   1  
ATOM   6935   C C    . GLN C 3 82  ? -60.933  -28.160 -59.637  1.00 0.00 ? 82  GLN C C    1  
ATOM   6936   O O    . GLN C 3 82  ? -59.905  -27.854 -60.251  1.00 0.00 ? 82  GLN C O    1  
ATOM   6937   C CB   . GLN C 3 82  ? -61.976  -29.260 -61.623  1.00 0.00 ? 82  GLN C CB   1  
ATOM   6938   C CG   . GLN C 3 82  ? -62.313  -30.755 -61.426  1.00 0.00 ? 82  GLN C CG   1  
ATOM   6939   C CD   . GLN C 3 82  ? -61.534  -31.406 -60.291  1.00 0.00 ? 82  GLN C CD   1  
ATOM   6940   O OE1  . GLN C 3 82  ? -60.380  -31.815 -60.471  1.00 0.00 ? 82  GLN C OE1  1  
ATOM   6941   N NE2  . GLN C 3 82  ? -62.164  -31.515 -59.116  1.00 0.00 ? 82  GLN C NE2  1  
ATOM   6942   H H    . GLN C 3 82  ? -62.422  -26.611 -61.529  1.00 0.00 ? 82  GLN C H    1  
ATOM   6943   H HA   . GLN C 3 82  ? -62.924  -28.895 -59.742  1.00 0.00 ? 82  GLN C HA   1  
ATOM   6944   H HB2  . GLN C 3 82  ? -62.571  -28.883 -62.440  1.00 0.00 ? 82  GLN C HB2  1  
ATOM   6945   H HB3  . GLN C 3 82  ? -60.932  -29.174 -61.893  1.00 0.00 ? 82  GLN C HB3  1  
ATOM   6946   H HG2  . GLN C 3 82  ? -63.369  -30.903 -61.298  1.00 0.00 ? 82  GLN C HG2  1  
ATOM   6947   H HG3  . GLN C 3 82  ? -62.011  -31.249 -62.339  1.00 0.00 ? 82  GLN C HG3  1  
ATOM   6948   H HE21 . GLN C 3 82  ? -63.081  -31.183 -59.019  1.00 0.00 ? 82  GLN C HE21 1  
ATOM   6949   H HE22 . GLN C 3 82  ? -61.707  -31.925 -58.352  1.00 0.00 ? 82  GLN C HE22 1  
ATOM   6950   N N    . MET C 3 83  ? -60.995  -28.314 -58.311  1.00 0.00 ? 83  MET C N    1  
ATOM   6951   C CA   . MET C 3 83  ? -59.849  -28.104 -57.408  1.00 0.00 ? 83  MET C CA   1  
ATOM   6952   C C    . MET C 3 83  ? -59.065  -29.389 -57.282  1.00 0.00 ? 83  MET C C    1  
ATOM   6953   O O    . MET C 3 83  ? -59.667  -30.439 -57.096  1.00 0.00 ? 83  MET C O    1  
ATOM   6954   C CB   . MET C 3 83  ? -60.329  -27.676 -56.007  1.00 0.00 ? 83  MET C CB   1  
ATOM   6955   C CG   . MET C 3 83  ? -61.108  -26.350 -55.967  1.00 0.00 ? 83  MET C CG   1  
ATOM   6956   S SD   . MET C 3 83  ? -61.904  -25.944 -54.383  1.00 0.00 ? 83  MET C SD   1  
ATOM   6957   C CE   . MET C 3 83  ? -60.579  -25.178 -53.486  1.00 0.00 ? 83  MET C CE   1  
ATOM   6958   H H    . MET C 3 83  ? -61.857  -28.557 -57.914  1.00 0.00 ? 83  MET C H    1  
ATOM   6959   H HA   . MET C 3 83  ? -59.211  -27.335 -57.814  1.00 0.00 ? 83  MET C HA   1  
ATOM   6960   H HB2  . MET C 3 83  ? -60.965  -28.453 -55.613  1.00 0.00 ? 83  MET C HB2  1  
ATOM   6961   H HB3  . MET C 3 83  ? -59.463  -27.588 -55.365  1.00 0.00 ? 83  MET C HB3  1  
ATOM   6962   H HG2  . MET C 3 83  ? -60.432  -25.549 -56.215  1.00 0.00 ? 83  MET C HG2  1  
ATOM   6963   H HG3  . MET C 3 83  ? -61.872  -26.392 -56.734  1.00 0.00 ? 83  MET C HG3  1  
ATOM   6964   H HE1  . MET C 3 83  ? -60.070  -24.475 -54.130  1.00 0.00 ? 83  MET C HE1  1  
ATOM   6965   H HE2  . MET C 3 83  ? -59.882  -25.932 -53.158  1.00 0.00 ? 83  MET C HE2  1  
ATOM   6966   H HE3  . MET C 3 83  ? -60.980  -24.661 -52.625  1.00 0.00 ? 83  MET C HE3  1  
ATOM   6967   N N    . SER C 3 84  ? -57.739  -29.317 -57.390  1.00 0.00 ? 84  SER C N    1  
ATOM   6968   C CA   . SER C 3 84  ? -56.879  -30.471 -57.109  1.00 0.00 ? 84  SER C CA   1  
ATOM   6969   C C    . SER C 3 84  ? -55.911  -30.137 -55.976  1.00 0.00 ? 84  SER C C    1  
ATOM   6970   O O    . SER C 3 84  ? -56.289  -29.411 -55.079  1.00 0.00 ? 84  SER C O    1  
ATOM   6971   C CB   . SER C 3 84  ? -56.152  -30.943 -58.365  1.00 0.00 ? 84  SER C CB   1  
ATOM   6972   O OG   . SER C 3 84  ? -54.998  -30.161 -58.606  1.00 0.00 ? 84  SER C OG   1  
ATOM   6973   H H    . SER C 3 84  ? -57.323  -28.443 -57.547  1.00 0.00 ? 84  SER C H    1  
ATOM   6974   H HA   . SER C 3 84  ? -57.515  -31.277 -56.767  1.00 0.00 ? 84  SER C HA   1  
ATOM   6975   H HB2  . SER C 3 84  ? -55.855  -31.970 -58.240  1.00 0.00 ? 84  SER C HB2  1  
ATOM   6976   H HB3  . SER C 3 84  ? -56.826  -30.873 -59.209  1.00 0.00 ? 84  SER C HB3  1  
ATOM   6977   H HG   . SER C 3 84  ? -54.818  -29.646 -57.816  1.00 0.00 ? 84  SER C HG   1  
ATOM   6978   N N    . SER C 3 85  ? -54.678  -30.647 -56.032  1.00 0.00 ? 85  SER C N    1  
ATOM   6979   C CA   . SER C 3 85  ? -53.657  -30.574 -54.942  1.00 0.00 ? 85  SER C CA   1  
ATOM   6980   C C    . SER C 3 85  ? -53.960  -29.620 -53.786  1.00 0.00 ? 85  SER C C    1  
ATOM   6981   O O    . SER C 3 85  ? -53.254  -28.629 -53.594  1.00 0.00 ? 85  SER C O    1  
ATOM   6982   C CB   . SER C 3 85  ? -52.272  -30.239 -55.509  1.00 0.00 ? 85  SER C CB   1  
ATOM   6983   O OG   . SER C 3 85  ? -52.045  -30.913 -56.732  1.00 0.00 ? 85  SER C OG   1  
ATOM   6984   H H    . SER C 3 85  ? -54.462  -31.208 -56.806  1.00 0.00 ? 85  SER C H    1  
ATOM   6985   H HA   . SER C 3 85  ? -53.587  -31.564 -54.517  1.00 0.00 ? 85  SER C HA   1  
ATOM   6986   H HB2  . SER C 3 85  ? -52.205  -29.179 -55.680  1.00 0.00 ? 85  SER C HB2  1  
ATOM   6987   H HB3  . SER C 3 85  ? -51.518  -30.526 -54.786  1.00 0.00 ? 85  SER C HB3  1  
ATOM   6988   H HG   . SER C 3 85  ? -51.491  -31.676 -56.552  1.00 0.00 ? 85  SER C HG   1  
ATOM   6989   N N    . LEU C 3 86  ? -54.978  -29.940 -52.994  1.00 0.00 ? 86  LEU C N    1  
ATOM   6990   C CA   . LEU C 3 86  ? -55.587  -28.941 -52.128  1.00 0.00 ? 86  LEU C CA   1  
ATOM   6991   C C    . LEU C 3 86  ? -54.759  -28.520 -50.936  1.00 0.00 ? 86  LEU C C    1  
ATOM   6992   O O    . LEU C 3 86  ? -54.558  -29.299 -50.023  1.00 0.00 ? 86  LEU C O    1  
ATOM   6993   C CB   . LEU C 3 86  ? -57.002  -29.358 -51.715  1.00 0.00 ? 86  LEU C CB   1  
ATOM   6994   C CG   . LEU C 3 86  ? -58.080  -28.681 -52.569  1.00 0.00 ? 86  LEU C CG   1  
ATOM   6995   C CD1  . LEU C 3 86  ? -59.082  -29.677 -53.110  1.00 0.00 ? 86  LEU C CD1  1  
ATOM   6996   C CD2  . LEU C 3 86  ? -58.770  -27.600 -51.791  1.00 0.00 ? 86  LEU C CD2  1  
ATOM   6997   H H    . LEU C 3 86  ? -55.476  -30.763 -53.181  1.00 0.00 ? 86  LEU C H    1  
ATOM   6998   H HA   . LEU C 3 86  ? -55.702  -28.055 -52.735  1.00 0.00 ? 86  LEU C HA   1  
ATOM   6999   H HB2  . LEU C 3 86  ? -57.096  -30.428 -51.820  1.00 0.00 ? 86  LEU C HB2  1  
ATOM   7000   H HB3  . LEU C 3 86  ? -57.157  -29.093 -50.679  1.00 0.00 ? 86  LEU C HB3  1  
ATOM   7001   H HG   . LEU C 3 86  ? -57.587  -28.222 -53.414  1.00 0.00 ? 86  LEU C HG   1  
ATOM   7002   H HD11 . LEU C 3 86  ? -59.614  -30.135 -52.289  1.00 0.00 ? 86  LEU C HD11 1  
ATOM   7003   H HD12 . LEU C 3 86  ? -58.563  -30.440 -53.673  1.00 0.00 ? 86  LEU C HD12 1  
ATOM   7004   H HD13 . LEU C 3 86  ? -59.784  -29.169 -53.754  1.00 0.00 ? 86  LEU C HD13 1  
ATOM   7005   H HD21 . LEU C 3 86  ? -58.163  -27.324 -50.942  1.00 0.00 ? 86  LEU C HD21 1  
ATOM   7006   H HD22 . LEU C 3 86  ? -59.729  -27.961 -51.446  1.00 0.00 ? 86  LEU C HD22 1  
ATOM   7007   H HD23 . LEU C 3 86  ? -58.915  -26.738 -52.423  1.00 0.00 ? 86  LEU C HD23 1  
ATOM   7008   N N    . LYS C 3 87  ? -54.287  -27.276 -50.975  1.00 0.00 ? 87  LYS C N    1  
ATOM   7009   C CA   . LYS C 3 87  ? -53.671  -26.619 -49.827  1.00 0.00 ? 87  LYS C CA   1  
ATOM   7010   C C    . LYS C 3 87  ? -54.720  -26.205 -48.804  1.00 0.00 ? 87  LYS C C    1  
ATOM   7011   O O    . LYS C 3 87  ? -55.836  -25.812 -49.167  1.00 0.00 ? 87  LYS C O    1  
ATOM   7012   C CB   . LYS C 3 87  ? -52.913  -25.360 -50.256  1.00 0.00 ? 87  LYS C CB   1  
ATOM   7013   C CG   . LYS C 3 87  ? -51.996  -25.541 -51.442  1.00 0.00 ? 87  LYS C CG   1  
ATOM   7014   C CD   . LYS C 3 87  ? -50.850  -24.557 -51.406  1.00 0.00 ? 87  LYS C CD   1  
ATOM   7015   C CE   . LYS C 3 87  ? -49.888  -24.864 -52.508  1.00 0.00 ? 87  LYS C CE   1  
ATOM   7016   N NZ   . LYS C 3 87  ? -48.551  -24.481 -52.024  1.00 0.00 ? 87  LYS C NZ   1  
ATOM   7017   H H    . LYS C 3 87  ? -54.500  -26.728 -51.759  1.00 0.00 ? 87  LYS C H    1  
ATOM   7018   H HA   . LYS C 3 87  ? -52.976  -27.301 -49.362  1.00 0.00 ? 87  LYS C HA   1  
ATOM   7019   H HB2  . LYS C 3 87  ? -53.633  -24.596 -50.502  1.00 0.00 ? 87  LYS C HB2  1  
ATOM   7020   H HB3  . LYS C 3 87  ? -52.327  -25.015 -49.415  1.00 0.00 ? 87  LYS C HB3  1  
ATOM   7021   H HG2  . LYS C 3 87  ? -51.607  -26.547 -51.450  1.00 0.00 ? 87  LYS C HG2  1  
ATOM   7022   H HG3  . LYS C 3 87  ? -52.566  -25.376 -52.345  1.00 0.00 ? 87  LYS C HG3  1  
ATOM   7023   H HD2  . LYS C 3 87  ? -51.233  -23.555 -51.531  1.00 0.00 ? 87  LYS C HD2  1  
ATOM   7024   H HD3  . LYS C 3 87  ? -50.343  -24.632 -50.456  1.00 0.00 ? 87  LYS C HD3  1  
ATOM   7025   H HE2  . LYS C 3 87  ? -49.912  -25.920 -52.737  1.00 0.00 ? 87  LYS C HE2  1  
ATOM   7026   H HE3  . LYS C 3 87  ? -50.137  -24.289 -53.387  1.00 0.00 ? 87  LYS C HE3  1  
ATOM   7027   H HZ1  . LYS C 3 87  ? -48.097  -25.301 -51.575  1.00 0.00 ? 87  LYS C HZ1  1  
ATOM   7028   H HZ2  . LYS C 3 87  ? -48.642  -23.710 -51.331  1.00 0.00 ? 87  LYS C HZ2  1  
ATOM   7029   H HZ3  . LYS C 3 87  ? -47.970  -24.162 -52.825  1.00 0.00 ? 87  LYS C HZ3  1  
ATOM   7030   N N    . SER C 3 88  ? -54.336  -26.263 -47.531  1.00 0.00 ? 88  SER C N    1  
ATOM   7031   C CA   . SER C 3 88  ? -55.154  -25.777 -46.426  1.00 0.00 ? 88  SER C CA   1  
ATOM   7032   C C    . SER C 3 88  ? -55.271  -24.247 -46.405  1.00 0.00 ? 88  SER C C    1  
ATOM   7033   O O    . SER C 3 88  ? -55.947  -23.680 -45.543  1.00 0.00 ? 88  SER C O    1  
ATOM   7034   C CB   . SER C 3 88  ? -54.505  -26.211 -45.143  1.00 0.00 ? 88  SER C CB   1  
ATOM   7035   O OG   . SER C 3 88  ? -53.220  -25.614 -45.096  1.00 0.00 ? 88  SER C OG   1  
ATOM   7036   H H    . SER C 3 88  ? -53.424  -26.563 -47.336  1.00 0.00 ? 88  SER C H    1  
ATOM   7037   H HA   . SER C 3 88  ? -56.138  -26.212 -46.487  1.00 0.00 ? 88  SER C HA   1  
ATOM   7038   H HB2  . SER C 3 88  ? -55.092  -25.876 -44.302  1.00 0.00 ? 88  SER C HB2  1  
ATOM   7039   H HB3  . SER C 3 88  ? -54.419  -27.289 -45.122  1.00 0.00 ? 88  SER C HB3  1  
ATOM   7040   H HG   . SER C 3 88  ? -52.971  -25.518 -44.174  1.00 0.00 ? 88  SER C HG   1  
ATOM   7041   N N    . GLU C 3 89  ? -54.561  -23.590 -47.324  1.00 0.00 ? 89  GLU C N    1  
ATOM   7042   C CA   . GLU C 3 89  ? -54.802  -22.187 -47.655  1.00 0.00 ? 89  GLU C CA   1  
ATOM   7043   C C    . GLU C 3 89  ? -56.124  -22.041 -48.421  1.00 0.00 ? 89  GLU C C    1  
ATOM   7044   O O    . GLU C 3 89  ? -56.829  -21.052 -48.255  1.00 0.00 ? 89  GLU C O    1  
ATOM   7045   C CB   . GLU C 3 89  ? -53.658  -21.619 -48.499  1.00 0.00 ? 89  GLU C CB   1  
ATOM   7046   C CG   . GLU C 3 89  ? -52.373  -21.308 -47.727  1.00 0.00 ? 89  GLU C CG   1  
ATOM   7047   C CD   . GLU C 3 89  ? -51.448  -22.517 -47.556  1.00 0.00 ? 89  GLU C CD   1  
ATOM   7048   O OE1  . GLU C 3 89  ? -51.145  -23.195 -48.573  1.00 0.00 ? 89  GLU C OE1  1  
ATOM   7049   O OE2  . GLU C 3 89  ? -51.008  -22.775 -46.402  1.00 0.00 ? 89  GLU C OE2  1  
ATOM   7050   H H    . GLU C 3 89  ? -54.011  -24.117 -47.941  1.00 0.00 ? 89  GLU C H    1  
ATOM   7051   H HA   . GLU C 3 89  ? -54.869  -21.622 -46.737  1.00 0.00 ? 89  GLU C HA   1  
ATOM   7052   H HB2  . GLU C 3 89  ? -53.420  -22.332 -49.272  1.00 0.00 ? 89  GLU C HB2  1  
ATOM   7053   H HB3  . GLU C 3 89  ? -54.005  -20.710 -48.972  1.00 0.00 ? 89  GLU C HB3  1  
ATOM   7054   H HG2  . GLU C 3 89  ? -51.833  -20.536 -48.253  1.00 0.00 ? 89  GLU C HG2  1  
ATOM   7055   H HG3  . GLU C 3 89  ? -52.642  -20.934 -46.749  1.00 0.00 ? 89  GLU C HG3  1  
ATOM   7056   N N    . ASP C 3 90  ? -56.458  -23.036 -49.245  1.00 0.00 ? 90  ASP C N    1  
ATOM   7057   C CA   . ASP C 3 90  ? -57.634  -22.988 -50.123  1.00 0.00 ? 90  ASP C CA   1  
ATOM   7058   C C    . ASP C 3 90  ? -58.943  -22.906 -49.352  1.00 0.00 ? 90  ASP C C    1  
ATOM   7059   O O    . ASP C 3 90  ? -60.001  -22.537 -49.895  1.00 0.00 ? 90  ASP C O    1  
ATOM   7060   C CB   . ASP C 3 90  ? -57.660  -24.216 -51.014  1.00 0.00 ? 90  ASP C CB   1  
ATOM   7061   C CG   . ASP C 3 90  ? -56.533  -24.237 -52.001  1.00 0.00 ? 90  ASP C CG   1  
ATOM   7062   O OD1  . ASP C 3 90  ? -55.921  -23.169 -52.265  1.00 0.00 ? 90  ASP C OD1  1  
ATOM   7063   O OD2  . ASP C 3 90  ? -56.261  -25.331 -52.535  1.00 0.00 ? 90  ASP C OD2  1  
ATOM   7064   H H    . ASP C 3 90  ? -55.853  -23.803 -49.319  1.00 0.00 ? 90  ASP C H    1  
ATOM   7065   H HA   . ASP C 3 90  ? -57.554  -22.116 -50.753  1.00 0.00 ? 90  ASP C HA   1  
ATOM   7066   H HB2  . ASP C 3 90  ? -57.596  -25.098 -50.396  1.00 0.00 ? 90  ASP C HB2  1  
ATOM   7067   H HB3  . ASP C 3 90  ? -58.598  -24.236 -51.551  1.00 0.00 ? 90  ASP C HB3  1  
ATOM   7068   N N    . THR C 3 91  ? -58.854  -23.295 -48.086  1.00 0.00 ? 91  THR C N    1  
ATOM   7069   C CA   . THR C 3 91  ? -59.919  -23.175 -47.118  1.00 0.00 ? 91  THR C CA   1  
ATOM   7070   C C    . THR C 3 91  ? -60.593  -21.795 -47.191  1.00 0.00 ? 91  THR C C    1  
ATOM   7071   O O    . THR C 3 91  ? -60.047  -20.806 -46.676  1.00 0.00 ? 91  THR C O    1  
ATOM   7072   C CB   . THR C 3 91  ? -59.302  -23.343 -45.739  1.00 0.00 ? 91  THR C CB   1  
ATOM   7073   O OG1  . THR C 3 91  ? -58.401  -24.462 -45.761  1.00 0.00 ? 91  THR C OG1  1  
ATOM   7074   C CG2  . THR C 3 91  ? -60.371  -23.518 -44.697  1.00 0.00 ? 91  THR C CG2  1  
ATOM   7075   H H    . THR C 3 91  ? -57.979  -23.597 -47.764  1.00 0.00 ? 91  THR C H    1  
ATOM   7076   H HA   . THR C 3 91  ? -60.650  -23.950 -47.278  1.00 0.00 ? 91  THR C HA   1  
ATOM   7077   H HB   . THR C 3 91  ? -58.735  -22.453 -45.508  1.00 0.00 ? 91  THR C HB   1  
ATOM   7078   H HG1  . THR C 3 91  ? -57.724  -24.311 -45.098  1.00 0.00 ? 91  THR C HG1  1  
ATOM   7079   H HG21 . THR C 3 91  ? -61.264  -22.993 -45.004  1.00 0.00 ? 91  THR C HG21 1  
ATOM   7080   H HG22 . THR C 3 91  ? -60.025  -23.117 -43.755  1.00 0.00 ? 91  THR C HG22 1  
ATOM   7081   H HG23 . THR C 3 91  ? -60.594  -24.568 -44.581  1.00 0.00 ? 91  THR C HG23 1  
ATOM   7082   N N    . ALA C 3 92  ? -61.761  -21.722 -47.838  1.00 0.00 ? 92  ALA C N    1  
ATOM   7083   C CA   . ALA C 3 92  ? -62.517  -20.475 -47.916  1.00 0.00 ? 92  ALA C CA   1  
ATOM   7084   C C    . ALA C 3 92  ? -63.931  -20.731 -48.391  1.00 0.00 ? 92  ALA C C    1  
ATOM   7085   O O    . ALA C 3 92  ? -64.273  -21.862 -48.710  1.00 0.00 ? 92  ALA C O    1  
ATOM   7086   C CB   . ALA C 3 92  ? -61.838  -19.529 -48.843  1.00 0.00 ? 92  ALA C CB   1  
ATOM   7087   H H    . ALA C 3 92  ? -62.139  -22.534 -48.235  1.00 0.00 ? 92  ALA C H    1  
ATOM   7088   H HA   . ALA C 3 92  ? -62.555  -20.030 -46.933  1.00 0.00 ? 92  ALA C HA   1  
ATOM   7089   H HB1  . ALA C 3 92  ? -60.914  -19.966 -49.192  1.00 0.00 ? 92  ALA C HB1  1  
ATOM   7090   H HB2  . ALA C 3 92  ? -61.626  -18.605 -48.324  1.00 0.00 ? 92  ALA C HB2  1  
ATOM   7091   H HB3  . ALA C 3 92  ? -62.480  -19.329 -49.688  1.00 0.00 ? 92  ALA C HB3  1  
ATOM   7092   N N    . MET C 3 93  ? -64.750  -19.676 -48.433  1.00 0.00 ? 93  MET C N    1  
ATOM   7093   C CA   . MET C 3 93  ? -66.082  -19.699 -49.044  1.00 0.00 ? 93  MET C CA   1  
ATOM   7094   C C    . MET C 3 93  ? -65.909  -19.416 -50.519  1.00 0.00 ? 93  MET C C    1  
ATOM   7095   O O    . MET C 3 93  ? -65.104  -18.561 -50.871  1.00 0.00 ? 93  MET C O    1  
ATOM   7096   C CB   . MET C 3 93  ? -66.933  -18.595 -48.446  1.00 0.00 ? 93  MET C CB   1  
ATOM   7097   C CG   . MET C 3 93  ? -68.280  -18.416 -49.101  1.00 0.00 ? 93  MET C CG   1  
ATOM   7098   S SD   . MET C 3 93  ? -69.361  -19.801 -48.717  1.00 0.00 ? 93  MET C SD   1  
ATOM   7099   C CE   . MET C 3 93  ? -69.501  -19.662 -46.932  1.00 0.00 ? 93  MET C CE   1  
ATOM   7100   H H    . MET C 3 93  ? -64.391  -18.809 -48.153  1.00 0.00 ? 93  MET C H    1  
ATOM   7101   H HA   . MET C 3 93  ? -66.552  -20.660 -48.895  1.00 0.00 ? 93  MET C HA   1  
ATOM   7102   H HB2  . MET C 3 93  ? -67.092  -18.814 -47.402  1.00 0.00 ? 93  MET C HB2  1  
ATOM   7103   H HB3  . MET C 3 93  ? -66.385  -17.666 -48.519  1.00 0.00 ? 93  MET C HB3  1  
ATOM   7104   H HG2  . MET C 3 93  ? -68.732  -17.504 -48.742  1.00 0.00 ? 93  MET C HG2  1  
ATOM   7105   H HG3  . MET C 3 93  ? -68.149  -18.350 -50.172  1.00 0.00 ? 93  MET C HG3  1  
ATOM   7106   H HE1  . MET C 3 93  ? -68.778  -18.944 -46.569  1.00 0.00 ? 93  MET C HE1  1  
ATOM   7107   H HE2  . MET C 3 93  ? -69.310  -20.621 -46.478  1.00 0.00 ? 93  MET C HE2  1  
ATOM   7108   H HE3  . MET C 3 93  ? -70.500  -19.336 -46.674  1.00 0.00 ? 93  MET C HE3  1  
ATOM   7109   N N    . TYR C 3 94  ? -66.667  -20.096 -51.377  1.00 0.00 ? 94  TYR C N    1  
ATOM   7110   C CA   . TYR C 3 94  ? -66.431  -20.023 -52.828  1.00 0.00 ? 94  TYR C CA   1  
ATOM   7111   C C    . TYR C 3 94  ? -67.540  -19.409 -53.699  1.00 0.00 ? 94  TYR C C    1  
ATOM   7112   O O    . TYR C 3 94  ? -68.457  -20.107 -54.106  1.00 0.00 ? 94  TYR C O    1  
ATOM   7113   C CB   . TYR C 3 94  ? -66.016  -21.397 -53.357  1.00 0.00 ? 94  TYR C CB   1  
ATOM   7114   C CG   . TYR C 3 94  ? -64.537  -21.615 -53.235  1.00 0.00 ? 94  TYR C CG   1  
ATOM   7115   C CD1  . TYR C 3 94  ? -63.967  -21.964 -52.019  1.00 0.00 ? 94  TYR C CD1  1  
ATOM   7116   C CD2  . TYR C 3 94  ? -63.697  -21.438 -54.328  1.00 0.00 ? 94  TYR C CD2  1  
ATOM   7117   C CE1  . TYR C 3 94  ? -62.583  -22.147 -51.894  1.00 0.00 ? 94  TYR C CE1  1  
ATOM   7118   C CE2  . TYR C 3 94  ? -62.319  -21.618 -54.219  1.00 0.00 ? 94  TYR C CE2  1  
ATOM   7119   C CZ   . TYR C 3 94  ? -61.766  -21.971 -52.998  1.00 0.00 ? 94  TYR C CZ   1  
ATOM   7120   O OH   . TYR C 3 94  ? -60.403  -22.149 -52.874  1.00 0.00 ? 94  TYR C OH   1  
ATOM   7121   H H    . TYR C 3 94  ? -67.308  -20.751 -51.031  1.00 0.00 ? 94  TYR C H    1  
ATOM   7122   H HA   . TYR C 3 94  ? -65.571  -19.384 -52.955  1.00 0.00 ? 94  TYR C HA   1  
ATOM   7123   H HB2  . TYR C 3 94  ? -66.536  -22.166 -52.808  1.00 0.00 ? 94  TYR C HB2  1  
ATOM   7124   H HB3  . TYR C 3 94  ? -66.293  -21.462 -54.400  1.00 0.00 ? 94  TYR C HB3  1  
ATOM   7125   H HD1  . TYR C 3 94  ? -64.601  -22.107 -51.157  1.00 0.00 ? 94  TYR C HD1  1  
ATOM   7126   H HD2  . TYR C 3 94  ? -64.121  -21.163 -55.283  1.00 0.00 ? 94  TYR C HD2  1  
ATOM   7127   H HE1  . TYR C 3 94  ? -62.155  -22.418 -50.941  1.00 0.00 ? 94  TYR C HE1  1  
ATOM   7128   H HE2  . TYR C 3 94  ? -61.685  -21.481 -55.082  1.00 0.00 ? 94  TYR C HE2  1  
ATOM   7129   H HH   . TYR C 3 94  ? -60.029  -21.338 -52.520  1.00 0.00 ? 94  TYR C HH   1  
ATOM   7130   N N    . TYR C 3 95  ? -67.437  -18.122 -54.022  1.00 0.00 ? 95  TYR C N    1  
ATOM   7131   C CA   . TYR C 3 95  ? -68.478  -17.451 -54.814  1.00 0.00 ? 95  TYR C CA   1  
ATOM   7132   C C    . TYR C 3 95  ? -68.250  -17.616 -56.300  1.00 0.00 ? 95  TYR C C    1  
ATOM   7133   O O    . TYR C 3 95  ? -67.110  -17.716 -56.753  1.00 0.00 ? 95  TYR C O    1  
ATOM   7134   C CB   . TYR C 3 95  ? -68.571  -15.959 -54.485  1.00 0.00 ? 95  TYR C CB   1  
ATOM   7135   C CG   . TYR C 3 95  ? -68.799  -15.691 -53.032  1.00 0.00 ? 95  TYR C CG   1  
ATOM   7136   C CD1  . TYR C 3 95  ? -67.723  -15.581 -52.163  1.00 0.00 ? 95  TYR C CD1  1  
ATOM   7137   C CD2  . TYR C 3 95  ? -70.088  -15.567 -52.517  1.00 0.00 ? 95  TYR C CD2  1  
ATOM   7138   C CE1  . TYR C 3 95  ? -67.913  -15.355 -50.827  1.00 0.00 ? 95  TYR C CE1  1  
ATOM   7139   C CE2  . TYR C 3 95  ? -70.291  -15.330 -51.174  1.00 0.00 ? 95  TYR C CE2  1  
ATOM   7140   C CZ   . TYR C 3 95  ? -69.192  -15.231 -50.333  1.00 0.00 ? 95  TYR C CZ   1  
ATOM   7141   O OH   . TYR C 3 95  ? -69.345  -15.014 -48.983  1.00 0.00 ? 95  TYR C OH   1  
ATOM   7142   H H    . TYR C 3 95  ? -66.668  -17.606 -53.702  1.00 0.00 ? 95  TYR C H    1  
ATOM   7143   H HA   . TYR C 3 95  ? -69.426  -17.906 -54.570  1.00 0.00 ? 95  TYR C HA   1  
ATOM   7144   H HB2  . TYR C 3 95  ? -67.653  -15.479 -54.784  1.00 0.00 ? 95  TYR C HB2  1  
ATOM   7145   H HB3  . TYR C 3 95  ? -69.386  -15.531 -55.053  1.00 0.00 ? 95  TYR C HB3  1  
ATOM   7146   H HD1  . TYR C 3 95  ? -66.718  -15.675 -52.548  1.00 0.00 ? 95  TYR C HD1  1  
ATOM   7147   H HD2  . TYR C 3 95  ? -70.937  -15.645 -53.180  1.00 0.00 ? 95  TYR C HD2  1  
ATOM   7148   H HE1  . TYR C 3 95  ? -67.065  -15.272 -50.164  1.00 0.00 ? 95  TYR C HE1  1  
ATOM   7149   H HE2  . TYR C 3 95  ? -71.292  -15.231 -50.781  1.00 0.00 ? 95  TYR C HE2  1  
ATOM   7150   H HH   . TYR C 3 95  ? -68.475  -14.863 -48.607  1.00 0.00 ? 95  TYR C HH   1  
ATOM   7151   N N    . CYS C 3 96  ? -69.355  -17.630 -57.038  1.00 0.00 ? 96  CYS C N    1  
ATOM   7152   C CA   . CYS C 3 96  ? -69.359  -17.721 -58.477  1.00 0.00 ? 96  CYS C CA   1  
ATOM   7153   C C    . CYS C 3 96  ? -69.896  -16.395 -58.963  1.00 0.00 ? 96  CYS C C    1  
ATOM   7154   O O    . CYS C 3 96  ? -71.014  -16.025 -58.643  1.00 0.00 ? 96  CYS C O    1  
ATOM   7155   C CB   . CYS C 3 96  ? -70.260  -18.887 -58.903  1.00 0.00 ? 96  CYS C CB   1  
ATOM   7156   S SG   . CYS C 3 96  ? -71.091  -18.783 -60.551  1.00 0.00 ? 96  CYS C SG   1  
ATOM   7157   H H    . CYS C 3 96  ? -70.216  -17.536 -56.580  1.00 0.00 ? 96  CYS C H    1  
ATOM   7158   H HA   . CYS C 3 96  ? -68.354  -17.872 -58.843  1.00 0.00 ? 96  CYS C HA   1  
ATOM   7159   H HB2  . CYS C 3 96  ? -69.660  -19.781 -58.905  1.00 0.00 ? 96  CYS C HB2  1  
ATOM   7160   H HB3  . CYS C 3 96  ? -71.023  -19.005 -58.144  1.00 0.00 ? 96  CYS C HB3  1  
ATOM   7161   N N    . ALA C 3 97  ? -69.095  -15.664 -59.727  1.00 0.00 ? 97  ALA C N    1  
ATOM   7162   C CA   . ALA C 3 97  ? -69.459  -14.297 -60.102  1.00 0.00 ? 97  ALA C CA   1  
ATOM   7163   C C    . ALA C 3 97  ? -69.616  -14.035 -61.614  1.00 0.00 ? 97  ALA C C    1  
ATOM   7164   O O    . ALA C 3 97  ? -69.175  -14.829 -62.458  1.00 0.00 ? 97  ALA C O    1  
ATOM   7165   C CB   . ALA C 3 97  ? -68.488  -13.308 -59.478  1.00 0.00 ? 97  ALA C CB   1  
ATOM   7166   H H    . ALA C 3 97  ? -68.201  -16.001 -59.947  1.00 0.00 ? 97  ALA C H    1  
ATOM   7167   H HA   . ALA C 3 97  ? -70.424  -14.104 -59.657  1.00 0.00 ? 97  ALA C HA   1  
ATOM   7168   H HB1  . ALA C 3 97  ? -69.036  -12.582 -58.896  1.00 0.00 ? 97  ALA C HB1  1  
ATOM   7169   H HB2  . ALA C 3 97  ? -67.937  -12.802 -60.258  1.00 0.00 ? 97  ALA C HB2  1  
ATOM   7170   H HB3  . ALA C 3 97  ? -67.798  -13.837 -58.836  1.00 0.00 ? 97  ALA C HB3  1  
ATOM   7171   N N    . ARG C 3 98  ? -70.242  -12.904 -61.935  1.00 0.00 ? 98  ARG C N    1  
ATOM   7172   C CA   . ARG C 3 98  ? -70.547  -12.527 -63.303  1.00 0.00 ? 98  ARG C CA   1  
ATOM   7173   C C    . ARG C 3 98  ? -70.006  -11.143 -63.634  1.00 0.00 ? 98  ARG C C    1  
ATOM   7174   O O    . ARG C 3 98  ? -70.347  -10.179 -62.947  1.00 0.00 ? 98  ARG C O    1  
ATOM   7175   C CB   . ARG C 3 98  ? -72.046  -12.488 -63.479  1.00 0.00 ? 98  ARG C CB   1  
ATOM   7176   C CG   . ARG C 3 98  ? -72.449  -12.333 -64.906  1.00 0.00 ? 98  ARG C CG   1  
ATOM   7177   C CD   . ARG C 3 98  ? -73.909  -12.516 -65.016  1.00 0.00 ? 98  ARG C CD   1  
ATOM   7178   N NE   . ARG C 3 98  ? -74.580  -11.235 -65.017  1.00 0.00 ? 98  ARG C NE   1  
ATOM   7179   C CZ   . ARG C 3 98  ? -75.317  -10.801 -66.030  1.00 0.00 ? 98  ARG C CZ   1  
ATOM   7180   N NH1  . ARG C 3 98  ? -75.480  -11.576 -67.103  1.00 0.00 ? 98  ARG C NH1  1  
ATOM   7181   N NH2  . ARG C 3 98  ? -75.910  -9.610  -65.956  1.00 0.00 ? 98  ARG C NH2  1  
ATOM   7182   H H    . ARG C 3 98  ? -70.555  -12.322 -61.211  1.00 0.00 ? 98  ARG C H    1  
ATOM   7183   H HA   . ARG C 3 98  ? -70.129  -13.253 -63.982  1.00 0.00 ? 98  ARG C HA   1  
ATOM   7184   H HB2  . ARG C 3 98  ? -72.466  -13.405 -63.098  1.00 0.00 ? 98  ARG C HB2  1  
ATOM   7185   H HB3  . ARG C 3 98  ? -72.442  -11.659 -62.909  1.00 0.00 ? 98  ARG C HB3  1  
ATOM   7186   H HG2  . ARG C 3 98  ? -72.181  -11.345 -65.252  1.00 0.00 ? 98  ARG C HG2  1  
ATOM   7187   H HG3  . ARG C 3 98  ? -71.946  -13.076 -65.507  1.00 0.00 ? 98  ARG C HG3  1  
ATOM   7188   H HD2  . ARG C 3 98  ? -74.134  -13.035 -65.936  1.00 0.00 ? 98  ARG C HD2  1  
ATOM   7189   H HD3  . ARG C 3 98  ? -74.260  -13.105 -64.181  1.00 0.00 ? 98  ARG C HD3  1  
ATOM   7190   H HE   . ARG C 3 98  ? -74.485  -10.659 -64.229  1.00 0.00 ? 98  ARG C HE   1  
ATOM   7191   H HH11 . ARG C 3 98  ? -75.047  -12.476 -67.140  1.00 0.00 ? 98  ARG C HH11 1  
ATOM   7192   H HH12 . ARG C 3 98  ? -76.035  -11.256 -67.871  1.00 0.00 ? 98  ARG C HH12 1  
ATOM   7193   H HH21 . ARG C 3 98  ? -75.798  -9.045  -65.138  1.00 0.00 ? 98  ARG C HH21 1  
ATOM   7194   H HH22 . ARG C 3 98  ? -76.467  -9.280  -66.718  1.00 0.00 ? 98  ARG C HH22 1  
ATOM   7195   N N    . PRO C 3 99  ? -69.157  -11.042 -64.672  1.00 0.00 ? 99  PRO C N    1  
ATOM   7196   C CA   . PRO C 3 99  ? -68.667  -9.762  -65.187  1.00 0.00 ? 99  PRO C CA   1  
ATOM   7197   C C    . PRO C 3 99  ? -69.162  -9.396  -66.599  1.00 0.00 ? 99  PRO C C    1  
ATOM   7198   O O    . PRO C 3 99  ? -69.684  -10.259 -67.300  1.00 0.00 ? 99  PRO C O    1  
ATOM   7199   C CB   . PRO C 3 99  ? -67.146  -9.963  -65.181  1.00 0.00 ? 99  PRO C CB   1  
ATOM   7200   C CG   . PRO C 3 99  ? -66.909  -11.473 -65.022  1.00 0.00 ? 99  PRO C CG   1  
ATOM   7201   C CD   . PRO C 3 99  ? -68.245  -12.141 -65.023  1.00 0.00 ? 99  PRO C CD   1  
ATOM   7202   H HA   . PRO C 3 99  ? -68.912  -8.972  -64.498  1.00 0.00 ? 99  PRO C HA   1  
ATOM   7203   H HB2  . PRO C 3 99  ? -66.723  -9.614  -66.113  1.00 0.00 ? 99  PRO C HB2  1  
ATOM   7204   H HB3  . PRO C 3 99  ? -66.704  -9.435  -64.351  1.00 0.00 ? 99  PRO C HB3  1  
ATOM   7205   H HG2  . PRO C 3 99  ? -66.313  -11.840 -65.845  1.00 0.00 ? 99  PRO C HG2  1  
ATOM   7206   H HG3  . PRO C 3 99  ? -66.404  -11.669 -64.087  1.00 0.00 ? 99  PRO C HG3  1  
ATOM   7207   H HD2  . PRO C 3 99  ? -68.471  -12.525 -66.009  1.00 0.00 ? 99  PRO C HD2  1  
ATOM   7208   H HD3  . PRO C 3 99  ? -68.293  -12.923 -64.283  1.00 0.00 ? 99  PRO C HD3  1  
ATOM   7209   N N    . ASP C 3 100 ? -68.960  -8.138  -67.014  1.00 0.00 ? 100 ASP C N    1  
ATOM   7210   C CA   . ASP C 3 100 ? -69.514  -7.586  -68.279  1.00 0.00 ? 100 ASP C CA   1  
ATOM   7211   C C    . ASP C 3 100 ? -68.527  -7.552  -69.464  1.00 0.00 ? 100 ASP C C    1  
ATOM   7212   O O    . ASP C 3 100 ? -68.738  -6.866  -70.485  1.00 0.00 ? 100 ASP C O    1  
ATOM   7213   C CB   . ASP C 3 100 ? -70.092  -6.188  -68.036  1.00 0.00 ? 100 ASP C CB   1  
ATOM   7214   C CG   . ASP C 3 100 ? -71.016  -6.138  -66.820  1.00 0.00 ? 100 ASP C CG   1  
ATOM   7215   O OD1  . ASP C 3 100 ? -71.026  -7.108  -66.016  1.00 0.00 ? 100 ASP C OD1  1  
ATOM   7216   O OD2  . ASP C 3 100 ? -71.735  -5.120  -66.652  1.00 0.00 ? 100 ASP C OD2  1  
ATOM   7217   H H    . ASP C 3 100 ? -68.508  -7.520  -66.403  1.00 0.00 ? 100 ASP C H    1  
ATOM   7218   H HA   . ASP C 3 100 ? -70.335  -8.223  -68.569  1.00 0.00 ? 100 ASP C HA   1  
ATOM   7219   H HB2  . ASP C 3 100 ? -69.279  -5.495  -67.883  1.00 0.00 ? 100 ASP C HB2  1  
ATOM   7220   H HB3  . ASP C 3 100 ? -70.649  -5.885  -68.912  1.00 0.00 ? 100 ASP C HB3  1  
ATOM   7221   N N    . ALA C 3 105 ? -65.982  -6.822  -63.555  1.00 0.00 ? 105 ALA C N    1  
ATOM   7222   C CA   . ALA C 3 105 ? -66.950  -6.127  -62.695  1.00 0.00 ? 105 ALA C CA   1  
ATOM   7223   C C    . ALA C 3 105 ? -68.117  -7.036  -62.330  1.00 0.00 ? 105 ALA C C    1  
ATOM   7224   O O    . ALA C 3 105 ? -69.173  -7.007  -62.961  1.00 0.00 ? 105 ALA C O    1  
ATOM   7225   C CB   . ALA C 3 105 ? -67.452  -4.846  -63.349  1.00 0.00 ? 105 ALA C CB   1  
ATOM   7226   H H    . ALA C 3 105 ? -66.029  -7.844  -63.375  1.00 0.00 ? 105 ALA C H    1  
ATOM   7227   H HA   . ALA C 3 105 ? -66.443  -5.858  -61.780  1.00 0.00 ? 105 ALA C HA   1  
ATOM   7228   H HB1  . ALA C 3 105 ? -66.962  -3.996  -62.899  1.00 0.00 ? 105 ALA C HB1  1  
ATOM   7229   H HB2  . ALA C 3 105 ? -68.520  -4.764  -63.207  1.00 0.00 ? 105 ALA C HB2  1  
ATOM   7230   H HB3  . ALA C 3 105 ? -67.231  -4.870  -64.406  1.00 0.00 ? 105 ALA C HB3  1  
ATOM   7231   N N    . MET C 3 106 ? -67.897  -7.835  -61.289  1.00 0.00 ? 106 MET C N    1  
ATOM   7232   C CA   . MET C 3 106 ? -68.815  -8.867  -60.810  1.00 0.00 ? 106 MET C CA   1  
ATOM   7233   C C    . MET C 3 106 ? -70.165  -8.278  -60.425  1.00 0.00 ? 106 MET C C    1  
ATOM   7234   O O    . MET C 3 106 ? -70.290  -7.634  -59.386  1.00 0.00 ? 106 MET C O    1  
ATOM   7235   C CB   . MET C 3 106 ? -68.205  -9.545  -59.587  1.00 0.00 ? 106 MET C CB   1  
ATOM   7236   C CG   . MET C 3 106 ? -66.690  -9.612  -59.559  1.00 0.00 ? 106 MET C CG   1  
ATOM   7237   S SD   . MET C 3 106 ? -66.109  -11.218 -60.124  1.00 0.00 ? 106 MET C SD   1  
ATOM   7238   C CE   . MET C 3 106 ? -64.323  -10.984 -60.108  1.00 0.00 ? 106 MET C CE   1  
ATOM   7239   H H    . MET C 3 106 ? -67.022  -7.773  -60.851  1.00 0.00 ? 106 MET C H    1  
ATOM   7240   H HA   . MET C 3 106 ? -68.956  -9.605  -61.584  1.00 0.00 ? 106 MET C HA   1  
ATOM   7241   H HB2  . MET C 3 106 ? -68.532  -9.016  -58.707  1.00 0.00 ? 106 MET C HB2  1  
ATOM   7242   H HB3  . MET C 3 106 ? -68.593  -10.554 -59.536  1.00 0.00 ? 106 MET C HB3  1  
ATOM   7243   H HG2  . MET C 3 106 ? -66.288  -8.845  -60.203  1.00 0.00 ? 106 MET C HG2  1  
ATOM   7244   H HG3  . MET C 3 106 ? -66.346  -9.443  -58.549  1.00 0.00 ? 106 MET C HG3  1  
ATOM   7245   H HE1  . MET C 3 106 ? -64.018  -10.486 -61.018  1.00 0.00 ? 106 MET C HE1  1  
ATOM   7246   H HE2  . MET C 3 106 ? -63.834  -11.943 -60.044  1.00 0.00 ? 106 MET C HE2  1  
ATOM   7247   H HE3  . MET C 3 106 ? -64.047  -10.383 -59.253  1.00 0.00 ? 106 MET C HE3  1  
ATOM   7248   N N    . ASP C 3 107 ? -71.179  -8.500  -61.247  1.00 0.00 ? 107 ASP C N    1  
ATOM   7249   C CA   . ASP C 3 107 ? -72.430  -7.802  -61.027  1.00 0.00 ? 107 ASP C CA   1  
ATOM   7250   C C    . ASP C 3 107 ? -73.546  -8.644  -60.429  1.00 0.00 ? 107 ASP C C    1  
ATOM   7251   O O    . ASP C 3 107 ? -74.456  -8.086  -59.806  1.00 0.00 ? 107 ASP C O    1  
ATOM   7252   C CB   . ASP C 3 107 ? -72.891  -7.052  -62.286  1.00 0.00 ? 107 ASP C CB   1  
ATOM   7253   C CG   . ASP C 3 107 ? -73.291  -7.972  -63.418  1.00 0.00 ? 107 ASP C CG   1  
ATOM   7254   O OD1  . ASP C 3 107 ? -72.904  -9.160  -63.400  1.00 0.00 ? 107 ASP C OD1  1  
ATOM   7255   O OD2  . ASP C 3 107 ? -73.998  -7.496  -64.333  1.00 0.00 ? 107 ASP C OD2  1  
ATOM   7256   H H    . ASP C 3 107 ? -71.044  -9.024  -62.065  1.00 0.00 ? 107 ASP C H    1  
ATOM   7257   H HA   . ASP C 3 107 ? -72.213  -7.041  -60.291  1.00 0.00 ? 107 ASP C HA   1  
ATOM   7258   H HB2  . ASP C 3 107 ? -73.737  -6.433  -62.031  1.00 0.00 ? 107 ASP C HB2  1  
ATOM   7259   H HB3  . ASP C 3 107 ? -72.085  -6.414  -62.622  1.00 0.00 ? 107 ASP C HB3  1  
ATOM   7260   N N    . TYR C 3 108 ? -73.483  -9.970  -60.626  1.00 0.00 ? 108 TYR C N    1  
ATOM   7261   C CA   . TYR C 3 108 ? -74.363  -10.923 -59.910  1.00 0.00 ? 108 TYR C CA   1  
ATOM   7262   C C    . TYR C 3 108 ? -73.555  -12.043 -59.260  1.00 0.00 ? 108 TYR C C    1  
ATOM   7263   O O    . TYR C 3 108 ? -72.976  -12.889 -59.948  1.00 0.00 ? 108 TYR C O    1  
ATOM   7264   C CB   . TYR C 3 108 ? -75.484  -11.473 -60.806  1.00 0.00 ? 108 TYR C CB   1  
ATOM   7265   C CG   . TYR C 3 108 ? -76.471  -10.400 -61.175  1.00 0.00 ? 108 TYR C CG   1  
ATOM   7266   C CD1  . TYR C 3 108 ? -77.179  -9.724  -60.181  1.00 0.00 ? 108 TYR C CD1  1  
ATOM   7267   C CD2  . TYR C 3 108 ? -76.669  -10.019 -62.510  1.00 0.00 ? 108 TYR C CD2  1  
ATOM   7268   C CE1  . TYR C 3 108 ? -78.072  -8.707  -60.499  1.00 0.00 ? 108 TYR C CE1  1  
ATOM   7269   C CE2  . TYR C 3 108 ? -77.565  -8.998  -62.844  1.00 0.00 ? 108 TYR C CE2  1  
ATOM   7270   C CZ   . TYR C 3 108 ? -78.265  -8.347  -61.825  1.00 0.00 ? 108 TYR C CZ   1  
ATOM   7271   O OH   . TYR C 3 108 ? -79.158  -7.334  -62.100  1.00 0.00 ? 108 TYR C OH   1  
ATOM   7272   H H    . TYR C 3 108 ? -72.732  -10.328 -61.143  1.00 0.00 ? 108 TYR C H    1  
ATOM   7273   H HA   . TYR C 3 108 ? -74.834  -10.371 -59.107  1.00 0.00 ? 108 TYR C HA   1  
ATOM   7274   H HB2  . TYR C 3 108 ? -75.045  -11.868 -61.710  1.00 0.00 ? 108 TYR C HB2  1  
ATOM   7275   H HB3  . TYR C 3 108 ? -75.998  -12.269 -60.287  1.00 0.00 ? 108 TYR C HB3  1  
ATOM   7276   H HD1  . TYR C 3 108 ? -77.033  -9.999  -59.147  1.00 0.00 ? 108 TYR C HD1  1  
ATOM   7277   H HD2  . TYR C 3 108 ? -76.130  -10.531 -63.294  1.00 0.00 ? 108 TYR C HD2  1  
ATOM   7278   H HE1  . TYR C 3 108 ? -78.616  -8.200  -59.716  1.00 0.00 ? 108 TYR C HE1  1  
ATOM   7279   H HE2  . TYR C 3 108 ? -77.709  -8.713  -63.875  1.00 0.00 ? 108 TYR C HE2  1  
ATOM   7280   H HH   . TYR C 3 108 ? -78.925  -6.578  -61.556  1.00 0.00 ? 108 TYR C HH   1  
ATOM   7281   N N    . TRP C 3 109 ? -73.505  -12.027 -57.930  1.00 0.00 ? 109 TRP C N    1  
ATOM   7282   C CA   . TRP C 3 109 ? -72.692  -12.967 -57.167  1.00 0.00 ? 109 TRP C CA   1  
ATOM   7283   C C    . TRP C 3 109 ? -73.547  -14.092 -56.645  1.00 0.00 ? 109 TRP C C    1  
ATOM   7284   O O    . TRP C 3 109 ? -74.746  -13.923 -56.443  1.00 0.00 ? 109 TRP C O    1  
ATOM   7285   C CB   . TRP C 3 109 ? -72.087  -12.254 -55.981  1.00 0.00 ? 109 TRP C CB   1  
ATOM   7286   C CG   . TRP C 3 109 ? -71.004  -11.296 -56.314  1.00 0.00 ? 109 TRP C CG   1  
ATOM   7287   C CD1  . TRP C 3 109 ? -71.106  -10.146 -57.047  1.00 0.00 ? 109 TRP C CD1  1  
ATOM   7288   C CD2  . TRP C 3 109 ? -69.651  -11.382 -55.884  1.00 0.00 ? 109 TRP C CD2  1  
ATOM   7289   N NE1  . TRP C 3 109 ? -69.891  -9.526  -57.107  1.00 0.00 ? 109 TRP C NE1  1  
ATOM   7290   C CE2  . TRP C 3 109 ? -68.979  -10.267 -56.402  1.00 0.00 ? 109 TRP C CE2  1  
ATOM   7291   C CE3  . TRP C 3 109 ? -68.938  -12.308 -55.111  1.00 0.00 ? 109 TRP C CE3  1  
ATOM   7292   C CZ2  . TRP C 3 109 ? -67.625  -10.048 -56.179  1.00 0.00 ? 109 TRP C CZ2  1  
ATOM   7293   C CZ3  . TRP C 3 109 ? -67.598  -12.098 -54.888  1.00 0.00 ? 109 TRP C CZ3  1  
ATOM   7294   C CH2  . TRP C 3 109 ? -66.951  -10.975 -55.419  1.00 0.00 ? 109 TRP C CH2  1  
ATOM   7295   H H    . TRP C 3 109 ? -73.979  -11.316 -57.450  1.00 0.00 ? 109 TRP C H    1  
ATOM   7296   H HA   . TRP C 3 109 ? -71.905  -13.362 -57.790  1.00 0.00 ? 109 TRP C HA   1  
ATOM   7297   H HB2  . TRP C 3 109 ? -72.869  -11.713 -55.473  1.00 0.00 ? 109 TRP C HB2  1  
ATOM   7298   H HB3  . TRP C 3 109 ? -71.694  -12.999 -55.302  1.00 0.00 ? 109 TRP C HB3  1  
ATOM   7299   H HD1  . TRP C 3 109 ? -72.011  -9.785  -57.514  1.00 0.00 ? 109 TRP C HD1  1  
ATOM   7300   H HE1  . TRP C 3 109 ? -69.684  -8.690  -57.575  1.00 0.00 ? 109 TRP C HE1  1  
ATOM   7301   H HE3  . TRP C 3 109 ? -69.433  -13.176 -54.699  1.00 0.00 ? 109 TRP C HE3  1  
ATOM   7302   H HZ2  . TRP C 3 109 ? -67.121  -9.184  -56.586  1.00 0.00 ? 109 TRP C HZ2  1  
ATOM   7303   H HZ3  . TRP C 3 109 ? -67.038  -12.806 -54.296  1.00 0.00 ? 109 TRP C HZ3  1  
ATOM   7304   H HH2  . TRP C 3 109 ? -65.897  -10.835 -55.228  1.00 0.00 ? 109 TRP C HH2  1  
ATOM   7305   N N    . GLY C 3 110 ? -72.930  -15.236 -56.396  1.00 0.00 ? 110 GLY C N    1  
ATOM   7306   C CA   . GLY C 3 110 ? -73.667  -16.390 -55.916  1.00 0.00 ? 110 GLY C CA   1  
ATOM   7307   C C    . GLY C 3 110 ? -74.048  -16.258 -54.457  1.00 0.00 ? 110 GLY C C    1  
ATOM   7308   O O    . GLY C 3 110 ? -74.729  -15.302 -54.051  1.00 0.00 ? 110 GLY C O    1  
ATOM   7309   H H    . GLY C 3 110 ? -71.966  -15.310 -56.555  1.00 0.00 ? 110 GLY C H    1  
ATOM   7310   H HA2  . GLY C 3 110 ? -74.566  -16.500 -56.504  1.00 0.00 ? 110 GLY C HA2  1  
ATOM   7311   H HA3  . GLY C 3 110 ? -73.056  -17.272 -56.039  1.00 0.00 ? 110 GLY C HA3  1  
ATOM   7312   N N    . GLN C 3 111 ? -73.590  -17.218 -53.663  1.00 0.00 ? 111 GLN C N    1  
ATOM   7313   C CA   . GLN C 3 111 ? -73.988  -17.333 -52.271  1.00 0.00 ? 111 GLN C CA   1  
ATOM   7314   C C    . GLN C 3 111 ? -72.927  -18.113 -51.524  1.00 0.00 ? 111 GLN C C    1  
ATOM   7315   O O    . GLN C 3 111 ? -72.871  -18.083 -50.293  1.00 0.00 ? 111 GLN C O    1  
ATOM   7316   C CB   . GLN C 3 111 ? -75.329  -18.060 -52.170  1.00 0.00 ? 111 GLN C CB   1  
ATOM   7317   C CG   . GLN C 3 111 ? -75.222  -19.567 -52.470  1.00 0.00 ? 111 GLN C CG   1  
ATOM   7318   C CD   . GLN C 3 111 ? -76.539  -20.217 -52.842  1.00 0.00 ? 111 GLN C CD   1  
ATOM   7319   O OE1  . GLN C 3 111 ? -77.547  -19.534 -53.069  1.00 0.00 ? 111 GLN C OE1  1  
ATOM   7320   N NE2  . GLN C 3 111 ? -76.540  -21.549 -52.914  1.00 0.00 ? 111 GLN C NE2  1  
ATOM   7321   H H    . GLN C 3 111 ? -73.047  -17.932 -54.056  1.00 0.00 ? 111 GLN C H    1  
ATOM   7322   H HA   . GLN C 3 111 ? -74.081  -16.347 -51.840  1.00 0.00 ? 111 GLN C HA   1  
ATOM   7323   H HB2  . GLN C 3 111 ? -75.718  -17.934 -51.171  1.00 0.00 ? 111 GLN C HB2  1  
ATOM   7324   H HB3  . GLN C 3 111 ? -76.020  -17.613 -52.870  1.00 0.00 ? 111 GLN C HB3  1  
ATOM   7325   H HG2  . GLN C 3 111 ? -74.531  -19.707 -53.287  1.00 0.00 ? 111 GLN C HG2  1  
ATOM   7326   H HG3  . GLN C 3 111 ? -74.823  -20.063 -51.596  1.00 0.00 ? 111 GLN C HG3  1  
ATOM   7327   H HE21 . GLN C 3 111 ? -75.718  -22.050 -52.731  1.00 0.00 ? 111 GLN C HE21 1  
ATOM   7328   H HE22 . GLN C 3 111 ? -77.362  -22.027 -53.150  1.00 0.00 ? 111 GLN C HE22 1  
ATOM   7329   N N    . GLY C 3 112 ? -72.107  -18.833 -52.281  1.00 0.00 ? 112 GLY C N    1  
ATOM   7330   C CA   . GLY C 3 112 ? -71.000  -19.594 -51.723  1.00 0.00 ? 112 GLY C CA   1  
ATOM   7331   C C    . GLY C 3 112 ? -71.239  -21.076 -51.488  1.00 0.00 ? 112 GLY C C    1  
ATOM   7332   O O    . GLY C 3 112 ? -72.345  -21.513 -51.183  1.00 0.00 ? 112 GLY C O    1  
ATOM   7333   H H    . GLY C 3 112 ? -72.229  -18.822 -53.253  1.00 0.00 ? 112 GLY C H    1  
ATOM   7334   H HA2  . GLY C 3 112 ? -70.160  -19.499 -52.392  1.00 0.00 ? 112 GLY C HA2  1  
ATOM   7335   H HA3  . GLY C 3 112 ? -70.728  -19.141 -50.780  1.00 0.00 ? 112 GLY C HA3  1  
ATOM   7336   N N    . THR C 3 113 ? -70.187  -21.852 -51.687  1.00 0.00 ? 113 THR C N    1  
ATOM   7337   C CA   . THR C 3 113 ? -70.069  -23.140 -51.069  1.00 0.00 ? 113 THR C CA   1  
ATOM   7338   C C    . THR C 3 113 ? -68.843  -22.947 -50.224  1.00 0.00 ? 113 THR C C    1  
ATOM   7339   O O    . THR C 3 113 ? -67.799  -22.535 -50.739  1.00 0.00 ? 113 THR C O    1  
ATOM   7340   C CB   . THR C 3 113 ? -69.743  -24.222 -52.064  1.00 0.00 ? 113 THR C CB   1  
ATOM   7341   O OG1  . THR C 3 113 ? -70.240  -23.841 -53.343  1.00 0.00 ? 113 THR C OG1  1  
ATOM   7342   C CG2  . THR C 3 113 ? -70.357  -25.550 -51.626  1.00 0.00 ? 113 THR C CG2  1  
ATOM   7343   H H    . THR C 3 113 ? -69.358  -21.419 -51.978  1.00 0.00 ? 113 THR C H    1  
ATOM   7344   H HA   . THR C 3 113 ? -70.935  -23.383 -50.470  1.00 0.00 ? 113 THR C HA   1  
ATOM   7345   H HB   . THR C 3 113 ? -68.671  -24.335 -52.122  1.00 0.00 ? 113 THR C HB   1  
ATOM   7346   H HG1  . THR C 3 113 ? -70.142  -22.890 -53.428  1.00 0.00 ? 113 THR C HG1  1  
ATOM   7347   H HG21 . THR C 3 113 ? -69.837  -25.916 -50.753  1.00 0.00 ? 113 THR C HG21 1  
ATOM   7348   H HG22 . THR C 3 113 ? -70.267  -26.269 -52.426  1.00 0.00 ? 113 THR C HG22 1  
ATOM   7349   H HG23 . THR C 3 113 ? -71.400  -25.404 -51.389  1.00 0.00 ? 113 THR C HG23 1  
ATOM   7350   N N    . SER C 3 114 ? -68.968  -23.198 -48.927  1.00 0.00 ? 114 SER C N    1  
ATOM   7351   C CA   . SER C 3 114 ? -67.812  -23.233 -48.069  1.00 0.00 ? 114 SER C CA   1  
ATOM   7352   C C    . SER C 3 114 ? -66.994  -24.475 -48.411  1.00 0.00 ? 114 SER C C    1  
ATOM   7353   O O    . SER C 3 114 ? -67.548  -25.541 -48.655  1.00 0.00 ? 114 SER C O    1  
ATOM   7354   C CB   . SER C 3 114 ? -68.258  -23.271 -46.619  1.00 0.00 ? 114 SER C CB   1  
ATOM   7355   O OG   . SER C 3 114 ? -67.259  -23.840 -45.790  1.00 0.00 ? 114 SER C OG   1  
ATOM   7356   H H    . SER C 3 114 ? -69.835  -23.492 -48.577  1.00 0.00 ? 114 SER C H    1  
ATOM   7357   H HA   . SER C 3 114 ? -67.212  -22.351 -48.238  1.00 0.00 ? 114 SER C HA   1  
ATOM   7358   H HB2  . SER C 3 114 ? -68.460  -22.269 -46.282  1.00 0.00 ? 114 SER C HB2  1  
ATOM   7359   H HB3  . SER C 3 114 ? -69.167  -23.855 -46.548  1.00 0.00 ? 114 SER C HB3  1  
ATOM   7360   H HG   . SER C 3 114 ? -66.966  -23.166 -45.173  1.00 0.00 ? 114 SER C HG   1  
ATOM   7361   N N    . VAL C 3 115 ? -65.678  -24.330 -48.460  1.00 0.00 ? 115 VAL C N    1  
ATOM   7362   C CA   . VAL C 3 115 ? -64.789  -25.472 -48.647  1.00 0.00 ? 115 VAL C CA   1  
ATOM   7363   C C    . VAL C 3 115 ? -63.676  -25.379 -47.611  1.00 0.00 ? 115 VAL C C    1  
ATOM   7364   O O    . VAL C 3 115 ? -62.933  -24.386 -47.578  1.00 0.00 ? 115 VAL C O    1  
ATOM   7365   C CB   . VAL C 3 115 ? -64.162  -25.514 -50.072  1.00 0.00 ? 115 VAL C CB   1  
ATOM   7366   C CG1  . VAL C 3 115 ? -63.244  -26.721 -50.237  1.00 0.00 ? 115 VAL C CG1  1  
ATOM   7367   C CG2  . VAL C 3 115 ? -65.231  -25.511 -51.140  1.00 0.00 ? 115 VAL C CG2  1  
ATOM   7368   H H    . VAL C 3 115 ? -65.290  -23.448 -48.281  1.00 0.00 ? 115 VAL C H    1  
ATOM   7369   H HA   . VAL C 3 115 ? -65.348  -26.381 -48.481  1.00 0.00 ? 115 VAL C HA   1  
ATOM   7370   H HB   . VAL C 3 115 ? -63.559  -24.623 -50.192  1.00 0.00 ? 115 VAL C HB   1  
ATOM   7371   H HG11 . VAL C 3 115 ? -62.242  -26.456 -49.933  1.00 0.00 ? 115 VAL C HG11 1  
ATOM   7372   H HG12 . VAL C 3 115 ? -63.237  -27.030 -51.272  1.00 0.00 ? 115 VAL C HG12 1  
ATOM   7373   H HG13 . VAL C 3 115 ? -63.603  -27.533 -49.622  1.00 0.00 ? 115 VAL C HG13 1  
ATOM   7374   H HG21 . VAL C 3 115 ? -66.186  -25.280 -50.693  1.00 0.00 ? 115 VAL C HG21 1  
ATOM   7375   H HG22 . VAL C 3 115 ? -65.277  -26.485 -51.606  1.00 0.00 ? 115 VAL C HG22 1  
ATOM   7376   H HG23 . VAL C 3 115 ? -64.993  -24.766 -51.886  1.00 0.00 ? 115 VAL C HG23 1  
ATOM   7377   N N    . THR C 3 116 ? -63.565  -26.390 -46.749  1.00 0.00 ? 116 THR C N    1  
ATOM   7378   C CA   . THR C 3 116 ? -62.430  -26.415 -45.816  1.00 0.00 ? 116 THR C CA   1  
ATOM   7379   C C    . THR C 3 116 ? -61.483  -27.587 -46.000  1.00 0.00 ? 116 THR C C    1  
ATOM   7380   O O    . THR C 3 116 ? -61.872  -28.667 -46.434  1.00 0.00 ? 116 THR C O    1  
ATOM   7381   C CB   . THR C 3 116 ? -62.778  -26.170 -44.314  1.00 0.00 ? 116 THR C CB   1  
ATOM   7382   O OG1  . THR C 3 116 ? -61.927  -26.987 -43.501  1.00 0.00 ? 116 THR C OG1  1  
ATOM   7383   C CG2  . THR C 3 116 ? -64.250  -26.436 -44.001  1.00 0.00 ? 116 THR C CG2  1  
ATOM   7384   H H    . THR C 3 116 ? -64.182  -27.149 -46.797  1.00 0.00 ? 116 THR C H    1  
ATOM   7385   H HA   . THR C 3 116 ? -61.839  -25.555 -46.106  1.00 0.00 ? 116 THR C HA   1  
ATOM   7386   H HB   . THR C 3 116 ? -62.562  -25.135 -44.087  1.00 0.00 ? 116 THR C HB   1  
ATOM   7387   H HG1  . THR C 3 116 ? -61.324  -26.409 -43.028  1.00 0.00 ? 116 THR C HG1  1  
ATOM   7388   H HG21 . THR C 3 116 ? -64.487  -26.040 -43.025  1.00 0.00 ? 116 THR C HG21 1  
ATOM   7389   H HG22 . THR C 3 116 ? -64.434  -27.500 -44.014  1.00 0.00 ? 116 THR C HG22 1  
ATOM   7390   H HG23 . THR C 3 116 ? -64.868  -25.954 -44.744  1.00 0.00 ? 116 THR C HG23 1  
ATOM   7391   N N    . VAL C 3 117 ? -60.222  -27.317 -45.694  1.00 0.00 ? 117 VAL C N    1  
ATOM   7392   C CA   . VAL C 3 117 ? -59.137  -28.229 -45.931  1.00 0.00 ? 117 VAL C CA   1  
ATOM   7393   C C    . VAL C 3 117 ? -58.380  -28.349 -44.624  1.00 0.00 ? 117 VAL C C    1  
ATOM   7394   O O    . VAL C 3 117 ? -57.879  -27.356 -44.072  1.00 0.00 ? 117 VAL C O    1  
ATOM   7395   C CB   . VAL C 3 117 ? -58.223  -27.736 -47.046  1.00 0.00 ? 117 VAL C CB   1  
ATOM   7396   C CG1  . VAL C 3 117 ? -57.117  -28.748 -47.320  1.00 0.00 ? 117 VAL C CG1  1  
ATOM   7397   C CG2  . VAL C 3 117 ? -59.025  -27.515 -48.291  1.00 0.00 ? 117 VAL C CG2  1  
ATOM   7398   H H    . VAL C 3 117 ? -60.006  -26.414 -45.381  1.00 0.00 ? 117 VAL C H    1  
ATOM   7399   H HA   . VAL C 3 117 ? -59.539  -29.197 -46.197  1.00 0.00 ? 117 VAL C HA   1  
ATOM   7400   H HB   . VAL C 3 117 ? -57.775  -26.801 -46.743  1.00 0.00 ? 117 VAL C HB   1  
ATOM   7401   H HG11 . VAL C 3 117 ? -56.596  -28.475 -48.226  1.00 0.00 ? 117 VAL C HG11 1  
ATOM   7402   H HG12 . VAL C 3 117 ? -57.549  -29.731 -47.436  1.00 0.00 ? 117 VAL C HG12 1  
ATOM   7403   H HG13 . VAL C 3 117 ? -56.422  -28.755 -46.493  1.00 0.00 ? 117 VAL C HG13 1  
ATOM   7404   H HG21 . VAL C 3 117 ? -58.590  -26.709 -48.861  1.00 0.00 ? 117 VAL C HG21 1  
ATOM   7405   H HG22 . VAL C 3 117 ? -60.041  -27.261 -48.024  1.00 0.00 ? 117 VAL C HG22 1  
ATOM   7406   H HG23 . VAL C 3 117 ? -59.023  -28.417 -48.885  1.00 0.00 ? 117 VAL C HG23 1  
ATOM   7407   N N    . SER C 3 118 ? -58.305  -29.595 -44.159  1.00 0.00 ? 118 SER C N    1  
ATOM   7408   C CA   . SER C 3 118 ? -57.985  -29.953 -42.782  1.00 0.00 ? 118 SER C CA   1  
ATOM   7409   C C    . SER C 3 118 ? -57.856  -31.478 -42.794  1.00 0.00 ? 118 SER C C    1  
ATOM   7410   O O    . SER C 3 118 ? -58.157  -32.121 -43.813  1.00 0.00 ? 118 SER C O    1  
ATOM   7411   C CB   . SER C 3 118 ? -59.147  -29.538 -41.865  1.00 0.00 ? 118 SER C CB   1  
ATOM   7412   O OG   . SER C 3 118 ? -58.695  -29.105 -40.600  1.00 0.00 ? 118 SER C OG   1  
ATOM   7413   H H    . SER C 3 118 ? -58.725  -30.292 -44.704  1.00 0.00 ? 118 SER C H    1  
ATOM   7414   H HA   . SER C 3 118 ? -57.060  -29.491 -42.469  1.00 0.00 ? 118 SER C HA   1  
ATOM   7415   H HB2  . SER C 3 118 ? -59.691  -28.733 -42.327  1.00 0.00 ? 118 SER C HB2  1  
ATOM   7416   H HB3  . SER C 3 118 ? -59.815  -30.383 -41.744  1.00 0.00 ? 118 SER C HB3  1  
ATOM   7417   H HG   . SER C 3 118 ? -58.177  -28.306 -40.728  1.00 0.00 ? 118 SER C HG   1  
ATOM   7418   N N    . SER C 3 119 ? -57.432  -32.061 -41.677  1.00 0.00 ? 119 SER C N    1  
ATOM   7419   C CA   . SER C 3 119 ? -57.391  -33.526 -41.564  1.00 0.00 ? 119 SER C CA   1  
ATOM   7420   C C    . SER C 3 119 ? -58.326  -34.060 -40.472  1.00 0.00 ? 119 SER C C    1  
ATOM   7421   O O    . SER C 3 119 ? -59.413  -34.561 -40.755  1.00 0.00 ? 119 SER C O    1  
ATOM   7422   C CB   . SER C 3 119 ? -55.957  -33.993 -41.318  1.00 0.00 ? 119 SER C CB   1  
ATOM   7423   O OG   . SER C 3 119 ? -55.039  -33.184 -42.042  1.00 0.00 ? 119 SER C OG   1  
ATOM   7424   H H    . SER C 3 119 ? -57.217  -31.510 -40.895  1.00 0.00 ? 119 SER C H    1  
ATOM   7425   H HA   . SER C 3 119 ? -57.722  -33.938 -42.506  1.00 0.00 ? 119 SER C HA   1  
ATOM   7426   H HB2  . SER C 3 119 ? -55.733  -33.921 -40.268  1.00 0.00 ? 119 SER C HB2  1  
ATOM   7427   H HB3  . SER C 3 119 ? -55.862  -35.026 -41.630  1.00 0.00 ? 119 SER C HB3  1  
ATOM   7428   H HG   . SER C 3 119 ? -54.884  -32.384 -41.533  1.00 0.00 ? 119 SER C HG   1  
ATOM   7429   N N    . LYS C 3 121 ? -61.704  -34.700 -40.407  1.00 0.00 ? 121 LYS C N    1  
ATOM   7430   C CA   . LYS C 3 121 ? -62.485  -35.408 -39.399  1.00 0.00 ? 121 LYS C CA   1  
ATOM   7431   C C    . LYS C 3 121 ? -63.887  -34.806 -39.238  1.00 0.00 ? 121 LYS C C    1  
ATOM   7432   O O    . LYS C 3 121 ? -64.177  -34.066 -38.281  1.00 0.00 ? 121 LYS C O    1  
ATOM   7433   C CB   . LYS C 3 121 ? -61.735  -35.482 -38.058  1.00 0.00 ? 121 LYS C CB   1  
ATOM   7434   C CG   . LYS C 3 121 ? -61.489  -34.136 -37.339  1.00 0.00 ? 121 LYS C CG   1  
ATOM   7435   C CD   . LYS C 3 121 ? -60.392  -33.280 -37.998  1.00 0.00 ? 121 LYS C CD   1  
ATOM   7436   C CE   . LYS C 3 121 ? -59.725  -32.348 -36.994  1.00 0.00 ? 121 LYS C CE   1  
ATOM   7437   N NZ   . LYS C 3 121 ? -59.193  -33.068 -35.794  1.00 0.00 ? 121 LYS C NZ   1  
ATOM   7438   H H    . LYS C 3 121 ? -61.153  -35.383 -40.963  1.00 0.00 ? 121 LYS C H    1  
ATOM   7439   H HA   . LYS C 3 121 ? -62.614  -36.422 -39.753  1.00 0.00 ? 121 LYS C HA   1  
ATOM   7440   H HB2  . LYS C 3 121 ? -62.301  -36.113 -37.392  1.00 0.00 ? 121 LYS C HB2  1  
ATOM   7441   H HB3  . LYS C 3 121 ? -60.779  -35.954 -38.236  1.00 0.00 ? 121 LYS C HB3  1  
ATOM   7442   H HG2  . LYS C 3 121 ? -62.409  -33.572 -37.335  1.00 0.00 ? 121 LYS C HG2  1  
ATOM   7443   H HG3  . LYS C 3 121 ? -61.205  -34.339 -36.316  1.00 0.00 ? 121 LYS C HG3  1  
ATOM   7444   H HD2  . LYS C 3 121 ? -59.644  -33.933 -38.422  1.00 0.00 ? 121 LYS C HD2  1  
ATOM   7445   H HD3  . LYS C 3 121 ? -60.833  -32.691 -38.789  1.00 0.00 ? 121 LYS C HD3  1  
ATOM   7446   H HE2  . LYS C 3 121 ? -58.907  -31.840 -37.481  1.00 0.00 ? 121 LYS C HE2  1  
ATOM   7447   H HE3  . LYS C 3 121 ? -60.447  -31.612 -36.671  1.00 0.00 ? 121 LYS C HE3  1  
ATOM   7448   H HZ1  . LYS C 3 121 ? -58.466  -32.485 -35.333  1.00 0.00 ? 121 LYS C HZ1  1  
ATOM   7449   H HZ2  . LYS C 3 121 ? -58.775  -33.974 -36.091  1.00 0.00 ? 121 LYS C HZ2  1  
ATOM   7450   H HZ3  . LYS C 3 121 ? -59.968  -33.246 -35.124  1.00 0.00 ? 121 LYS C HZ3  1  
ATOM   7451   N N    . THR C 3 122 ? -64.749  -35.141 -40.198  1.00 0.00 ? 122 THR C N    1  
ATOM   7452   C CA   . THR C 3 122 ? -66.144  -34.695 -40.224  1.00 0.00 ? 122 THR C CA   1  
ATOM   7453   C C    . THR C 3 122 ? -66.939  -35.204 -39.019  1.00 0.00 ? 122 THR C C    1  
ATOM   7454   O O    . THR C 3 122 ? -66.689  -36.297 -38.514  1.00 0.00 ? 122 THR C O    1  
ATOM   7455   C CB   . THR C 3 122 ? -66.822  -35.150 -41.523  1.00 0.00 ? 122 THR C CB   1  
ATOM   7456   O OG1  . THR C 3 122 ? -66.125  -34.582 -42.632  1.00 0.00 ? 122 THR C OG1  1  
ATOM   7457   C CG2  . THR C 3 122 ? -68.250  -34.699 -41.577  1.00 0.00 ? 122 THR C CG2  1  
ATOM   7458   H H    . THR C 3 122 ? -64.437  -35.730 -40.917  1.00 0.00 ? 122 THR C H    1  
ATOM   7459   H HA   . THR C 3 122 ? -66.153  -33.616 -40.202  1.00 0.00 ? 122 THR C HA   1  
ATOM   7460   H HB   . THR C 3 122 ? -66.783  -36.227 -41.589  1.00 0.00 ? 122 THR C HB   1  
ATOM   7461   H HG1  . THR C 3 122 ? -65.217  -34.424 -42.363  1.00 0.00 ? 122 THR C HG1  1  
ATOM   7462   H HG21 . THR C 3 122 ? -68.366  -33.801 -40.989  1.00 0.00 ? 122 THR C HG21 1  
ATOM   7463   H HG22 . THR C 3 122 ? -68.888  -35.475 -41.181  1.00 0.00 ? 122 THR C HG22 1  
ATOM   7464   H HG23 . THR C 3 122 ? -68.524  -34.495 -42.602  1.00 0.00 ? 122 THR C HG23 1  
ATOM   7465   N N    . THR C 3 123 ? -67.893  -34.401 -38.562  1.00 0.00 ? 123 THR C N    1  
ATOM   7466   C CA   . THR C 3 123 ? -68.715  -34.747 -37.412  1.00 0.00 ? 123 THR C CA   1  
ATOM   7467   C C    . THR C 3 123 ? -70.117  -34.150 -37.577  1.00 0.00 ? 123 THR C C    1  
ATOM   7468   O O    . THR C 3 123 ? -70.298  -32.930 -37.498  1.00 0.00 ? 123 THR C O    1  
ATOM   7469   C CB   . THR C 3 123 ? -68.070  -34.224 -36.108  1.00 0.00 ? 123 THR C CB   1  
ATOM   7470   O OG1  . THR C 3 123 ? -66.643  -34.385 -36.166  1.00 0.00 ? 123 THR C OG1  1  
ATOM   7471   C CG2  . THR C 3 123 ? -68.634  -34.951 -34.893  1.00 0.00 ? 123 THR C CG2  1  
ATOM   7472   H H    . THR C 3 123 ? -68.040  -33.540 -39.006  1.00 0.00 ? 123 THR C H    1  
ATOM   7473   H HA   . THR C 3 123 ? -68.798  -35.823 -37.353  1.00 0.00 ? 123 THR C HA   1  
ATOM   7474   H HB   . THR C 3 123 ? -68.294  -33.171 -36.014  1.00 0.00 ? 123 THR C HB   1  
ATOM   7475   H HG1  . THR C 3 123 ? -66.243  -33.664 -35.674  1.00 0.00 ? 123 THR C HG1  1  
ATOM   7476   H HG21 . THR C 3 123 ? -68.972  -35.934 -35.187  1.00 0.00 ? 123 THR C HG21 1  
ATOM   7477   H HG22 . THR C 3 123 ? -69.464  -34.390 -34.491  1.00 0.00 ? 123 THR C HG22 1  
ATOM   7478   H HG23 . THR C 3 123 ? -67.864  -35.045 -34.141  1.00 0.00 ? 123 THR C HG23 1  
ATOM   7479   N N    . ALA C 3 124 ? -71.103  -35.012 -37.823  1.00 0.00 ? 124 ALA C N    1  
ATOM   7480   C CA   . ALA C 3 124 ? -72.497  -34.586 -37.935  1.00 0.00 ? 124 ALA C CA   1  
ATOM   7481   C C    . ALA C 3 124 ? -72.930  -33.778 -36.706  1.00 0.00 ? 124 ALA C C    1  
ATOM   7482   O O    . ALA C 3 124 ? -72.601  -34.137 -35.583  1.00 0.00 ? 124 ALA C O    1  
ATOM   7483   C CB   . ALA C 3 124 ? -73.388  -35.788 -38.113  1.00 0.00 ? 124 ALA C CB   1  
ATOM   7484   H H    . ALA C 3 124 ? -70.892  -35.967 -37.886  1.00 0.00 ? 124 ALA C H    1  
ATOM   7485   H HA   . ALA C 3 124 ? -72.592  -33.956 -38.807  1.00 0.00 ? 124 ALA C HA   1  
ATOM   7486   H HB1  . ALA C 3 124 ? -72.782  -36.677 -38.200  1.00 0.00 ? 124 ALA C HB1  1  
ATOM   7487   H HB2  . ALA C 3 124 ? -73.980  -35.667 -39.009  1.00 0.00 ? 124 ALA C HB2  1  
ATOM   7488   H HB3  . ALA C 3 124 ? -74.042  -35.881 -37.259  1.00 0.00 ? 124 ALA C HB3  1  
ATOM   7489   N N    . PRO C 3 125 ? -73.671  -32.679 -36.910  1.00 0.00 ? 125 PRO C N    1  
ATOM   7490   C CA   . PRO C 3 125 ? -74.040  -31.863 -35.757  1.00 0.00 ? 125 PRO C CA   1  
ATOM   7491   C C    . PRO C 3 125 ? -75.239  -32.421 -34.995  1.00 0.00 ? 125 PRO C C    1  
ATOM   7492   O O    . PRO C 3 125 ? -76.197  -32.908 -35.607  1.00 0.00 ? 125 PRO C O    1  
ATOM   7493   C CB   . PRO C 3 125 ? -74.392  -30.508 -36.382  1.00 0.00 ? 125 PRO C CB   1  
ATOM   7494   C CG   . PRO C 3 125 ? -74.856  -30.828 -37.762  1.00 0.00 ? 125 PRO C CG   1  
ATOM   7495   C CD   . PRO C 3 125 ? -74.272  -32.174 -38.158  1.00 0.00 ? 125 PRO C CD   1  
ATOM   7496   H HA   . PRO C 3 125 ? -73.199  -31.742 -35.096  1.00 0.00 ? 125 PRO C HA   1  
ATOM   7497   H HB2  . PRO C 3 125 ? -75.181  -30.029 -35.818  1.00 0.00 ? 125 PRO C HB2  1  
ATOM   7498   H HB3  . PRO C 3 125 ? -73.519  -29.875 -36.423  1.00 0.00 ? 125 PRO C HB3  1  
ATOM   7499   H HG2  . PRO C 3 125 ? -75.936  -30.875 -37.781  1.00 0.00 ? 125 PRO C HG2  1  
ATOM   7500   H HG3  . PRO C 3 125 ? -74.511  -30.070 -38.448  1.00 0.00 ? 125 PRO C HG3  1  
ATOM   7501   H HD2  . PRO C 3 125 ? -75.052  -32.838 -38.505  1.00 0.00 ? 125 PRO C HD2  1  
ATOM   7502   H HD3  . PRO C 3 125 ? -73.511  -32.051 -38.914  1.00 0.00 ? 125 PRO C HD3  1  
ATOM   7503   N N    . SER C 3 126 ? -75.169  -32.349 -33.668  1.00 0.00 ? 126 SER C N    1  
ATOM   7504   C CA   . SER C 3 126 ? -76.284  -32.726 -32.808  1.00 0.00 ? 126 SER C CA   1  
ATOM   7505   C C    . SER C 3 126 ? -77.223  -31.524 -32.698  1.00 0.00 ? 126 SER C C    1  
ATOM   7506   O O    . SER C 3 126 ? -76.763  -30.400 -32.490  1.00 0.00 ? 126 SER C O    1  
ATOM   7507   C CB   . SER C 3 126 ? -75.765  -33.150 -31.433  1.00 0.00 ? 126 SER C CB   1  
ATOM   7508   O OG   . SER C 3 126 ? -74.715  -34.105 -31.541  1.00 0.00 ? 126 SER C OG   1  
ATOM   7509   H H    . SER C 3 126 ? -74.371  -31.954 -33.259  1.00 0.00 ? 126 SER C H    1  
ATOM   7510   H HA   . SER C 3 126 ? -76.816  -33.551 -33.260  1.00 0.00 ? 126 SER C HA   1  
ATOM   7511   H HB2  . SER C 3 126 ? -75.391  -32.284 -30.914  1.00 0.00 ? 126 SER C HB2  1  
ATOM   7512   H HB3  . SER C 3 126 ? -76.585  -33.570 -30.864  1.00 0.00 ? 126 SER C HB3  1  
ATOM   7513   H HG   . SER C 3 126 ? -74.312  -34.202 -30.675  1.00 0.00 ? 126 SER C HG   1  
ATOM   7514   N N    . VAL C 3 127 ? -78.526  -31.760 -32.867  1.00 0.00 ? 127 VAL C N    1  
ATOM   7515   C CA   . VAL C 3 127 ? -79.529  -30.684 -32.916  1.00 0.00 ? 127 VAL C CA   1  
ATOM   7516   C C    . VAL C 3 127 ? -80.632  -30.895 -31.889  1.00 0.00 ? 127 VAL C C    1  
ATOM   7517   O O    . VAL C 3 127 ? -81.469  -31.786 -32.032  1.00 0.00 ? 127 VAL C O    1  
ATOM   7518   C CB   . VAL C 3 127 ? -80.188  -30.562 -34.315  1.00 0.00 ? 127 VAL C CB   1  
ATOM   7519   C CG1  . VAL C 3 127 ? -81.280  -29.488 -34.320  1.00 0.00 ? 127 VAL C CG1  1  
ATOM   7520   C CG2  . VAL C 3 127 ? -79.152  -30.271 -35.387  1.00 0.00 ? 127 VAL C CG2  1  
ATOM   7521   H H    . VAL C 3 127 ? -78.816  -32.678 -33.050  1.00 0.00 ? 127 VAL C H    1  
ATOM   7522   H HA   . VAL C 3 127 ? -79.033  -29.751 -32.695  1.00 0.00 ? 127 VAL C HA   1  
ATOM   7523   H HB   . VAL C 3 127 ? -80.657  -31.510 -34.543  1.00 0.00 ? 127 VAL C HB   1  
ATOM   7524   H HG11 . VAL C 3 127 ? -82.173  -29.881 -33.857  1.00 0.00 ? 127 VAL C HG11 1  
ATOM   7525   H HG12 . VAL C 3 127 ? -81.498  -29.201 -35.338  1.00 0.00 ? 127 VAL C HG12 1  
ATOM   7526   H HG13 . VAL C 3 127 ? -80.938  -28.625 -33.767  1.00 0.00 ? 127 VAL C HG13 1  
ATOM   7527   H HG21 . VAL C 3 127 ? -78.703  -29.307 -35.202  1.00 0.00 ? 127 VAL C HG21 1  
ATOM   7528   H HG22 . VAL C 3 127 ? -79.629  -30.266 -36.357  1.00 0.00 ? 127 VAL C HG22 1  
ATOM   7529   H HG23 . VAL C 3 127 ? -78.388  -31.034 -35.366  1.00 0.00 ? 127 VAL C HG23 1  
ATOM   7530   N N    . TYR C 3 128 ? -80.640  -30.056 -30.864  1.00 0.00 ? 128 TYR C N    1  
ATOM   7531   C CA   . TYR C 3 128 ? -81.644  -30.157 -29.818  1.00 0.00 ? 128 TYR C CA   1  
ATOM   7532   C C    . TYR C 3 128 ? -82.563  -28.940 -29.870  1.00 0.00 ? 128 TYR C C    1  
ATOM   7533   O O    . TYR C 3 128 ? -82.077  -27.817 -30.023  1.00 0.00 ? 128 TYR C O    1  
ATOM   7534   C CB   . TYR C 3 128 ? -80.975  -30.261 -28.442  1.00 0.00 ? 128 TYR C CB   1  
ATOM   7535   C CG   . TYR C 3 128 ? -79.672  -31.035 -28.405  1.00 0.00 ? 128 TYR C CG   1  
ATOM   7536   C CD1  . TYR C 3 128 ? -79.661  -32.436 -28.439  1.00 0.00 ? 128 TYR C CD1  1  
ATOM   7537   C CD2  . TYR C 3 128 ? -78.447  -30.365 -28.322  1.00 0.00 ? 128 TYR C CD2  1  
ATOM   7538   C CE1  . TYR C 3 128 ? -78.454  -33.151 -28.407  1.00 0.00 ? 128 TYR C CE1  1  
ATOM   7539   C CE2  . TYR C 3 128 ? -77.236  -31.064 -28.289  1.00 0.00 ? 128 TYR C CE2  1  
ATOM   7540   C CZ   . TYR C 3 128 ? -77.242  -32.457 -28.332  1.00 0.00 ? 128 TYR C CZ   1  
ATOM   7541   O OH   . TYR C 3 128 ? -76.042  -33.147 -28.294  1.00 0.00 ? 128 TYR C OH   1  
ATOM   7542   H H    . TYR C 3 128 ? -79.957  -29.355 -30.810  1.00 0.00 ? 128 TYR C H    1  
ATOM   7543   H HA   . TYR C 3 128 ? -82.234  -31.046 -29.987  1.00 0.00 ? 128 TYR C HA   1  
ATOM   7544   H HB2  . TYR C 3 128 ? -80.779  -29.263 -28.086  1.00 0.00 ? 128 TYR C HB2  1  
ATOM   7545   H HB3  . TYR C 3 128 ? -81.674  -30.730 -27.763  1.00 0.00 ? 128 TYR C HB3  1  
ATOM   7546   H HD1  . TYR C 3 128 ? -80.596  -32.973 -28.496  1.00 0.00 ? 128 TYR C HD1  1  
ATOM   7547   H HD2  . TYR C 3 128 ? -78.436  -29.285 -28.295  1.00 0.00 ? 128 TYR C HD2  1  
ATOM   7548   H HE1  . TYR C 3 128 ? -78.461  -34.231 -28.440  1.00 0.00 ? 128 TYR C HE1  1  
ATOM   7549   H HE2  . TYR C 3 128 ? -76.301  -30.527 -28.225  1.00 0.00 ? 128 TYR C HE2  1  
ATOM   7550   H HH   . TYR C 3 128 ? -75.386  -32.579 -27.885  1.00 0.00 ? 128 TYR C HH   1  
ATOM   7551   N N    . PRO C 3 129 ? -83.890  -29.155 -29.745  1.00 0.00 ? 129 PRO C N    1  
ATOM   7552   C CA   . PRO C 3 129 ? -84.821  -28.027 -29.746  1.00 0.00 ? 129 PRO C CA   1  
ATOM   7553   C C    . PRO C 3 129 ? -84.880  -27.355 -28.381  1.00 0.00 ? 129 PRO C C    1  
ATOM   7554   O O    . PRO C 3 129 ? -84.805  -28.028 -27.364  1.00 0.00 ? 129 PRO C O    1  
ATOM   7555   C CB   . PRO C 3 129 ? -86.167  -28.675 -30.095  1.00 0.00 ? 129 PRO C CB   1  
ATOM   7556   C CG   . PRO C 3 129 ? -86.051  -30.095 -29.660  1.00 0.00 ? 129 PRO C CG   1  
ATOM   7557   C CD   . PRO C 3 129 ? -84.584  -30.446 -29.557  1.00 0.00 ? 129 PRO C CD   1  
ATOM   7558   H HA   . PRO C 3 129 ? -84.553  -27.315 -30.508  1.00 0.00 ? 129 PRO C HA   1  
ATOM   7559   H HB2  . PRO C 3 129 ? -86.960  -28.184 -29.547  1.00 0.00 ? 129 PRO C HB2  1  
ATOM   7560   H HB3  . PRO C 3 129 ? -86.354  -28.622 -31.156  1.00 0.00 ? 129 PRO C HB3  1  
ATOM   7561   H HG2  . PRO C 3 129 ? -86.525  -30.218 -28.696  1.00 0.00 ? 129 PRO C HG2  1  
ATOM   7562   H HG3  . PRO C 3 129 ? -86.525  -30.738 -30.384  1.00 0.00 ? 129 PRO C HG3  1  
ATOM   7563   H HD2  . PRO C 3 129 ? -84.363  -30.860 -28.582  1.00 0.00 ? 129 PRO C HD2  1  
ATOM   7564   H HD3  . PRO C 3 129 ? -84.302  -31.136 -30.337  1.00 0.00 ? 129 PRO C HD3  1  
ATOM   7565   N N    . LEU C 3 130 ? -85.008  -26.036 -28.361  1.00 0.00 ? 130 LEU C N    1  
ATOM   7566   C CA   . LEU C 3 130 ? -85.064  -25.304 -27.100  1.00 0.00 ? 130 LEU C CA   1  
ATOM   7567   C C    . LEU C 3 130 ? -86.468  -24.767 -26.791  1.00 0.00 ? 130 LEU C C    1  
ATOM   7568   O O    . LEU C 3 130 ? -86.856  -23.692 -27.266  1.00 0.00 ? 130 LEU C O    1  
ATOM   7569   C CB   . LEU C 3 130 ? -84.048  -24.159 -27.109  1.00 0.00 ? 130 LEU C CB   1  
ATOM   7570   C CG   . LEU C 3 130 ? -82.595  -24.267 -26.632  1.00 0.00 ? 130 LEU C CG   1  
ATOM   7571   C CD1  . LEU C 3 130 ? -82.040  -25.683 -26.646  1.00 0.00 ? 130 LEU C CD1  1  
ATOM   7572   C CD2  . LEU C 3 130 ? -81.721  -23.326 -27.464  1.00 0.00 ? 130 LEU C CD2  1  
ATOM   7573   H H    . LEU C 3 130 ? -85.061  -25.544 -29.207  1.00 0.00 ? 130 LEU C H    1  
ATOM   7574   H HA   . LEU C 3 130 ? -84.788  -25.985 -26.309  1.00 0.00 ? 130 LEU C HA   1  
ATOM   7575   H HB2  . LEU C 3 130 ? -83.989  -23.821 -28.126  1.00 0.00 ? 130 LEU C HB2  1  
ATOM   7576   H HB3  . LEU C 3 130 ? -84.508  -23.351 -26.548  1.00 0.00 ? 130 LEU C HB3  1  
ATOM   7577   H HG   . LEU C 3 130 ? -82.564  -23.920 -25.610  1.00 0.00 ? 130 LEU C HG   1  
ATOM   7578   H HD11 . LEU C 3 130 ? -81.203  -25.748 -25.967  1.00 0.00 ? 130 LEU C HD11 1  
ATOM   7579   H HD12 . LEU C 3 130 ? -81.713  -25.932 -27.645  1.00 0.00 ? 130 LEU C HD12 1  
ATOM   7580   H HD13 . LEU C 3 130 ? -82.810  -26.374 -26.336  1.00 0.00 ? 130 LEU C HD13 1  
ATOM   7581   H HD21 . LEU C 3 130 ? -81.152  -23.902 -28.179  1.00 0.00 ? 130 LEU C HD21 1  
ATOM   7582   H HD22 . LEU C 3 130 ? -81.045  -22.793 -26.812  1.00 0.00 ? 130 LEU C HD22 1  
ATOM   7583   H HD23 . LEU C 3 130 ? -82.348  -22.621 -27.988  1.00 0.00 ? 130 LEU C HD23 1  
ATOM   7584   N N    . ALA C 3 131 ? -87.225  -25.523 -25.997  1.00 0.00 ? 131 ALA C N    1  
ATOM   7585   C CA   . ALA C 3 131 ? -88.540  -25.088 -25.532  1.00 0.00 ? 131 ALA C CA   1  
ATOM   7586   C C    . ALA C 3 131 ? -88.400  -24.186 -24.292  1.00 0.00 ? 131 ALA C C    1  
ATOM   7587   O O    . ALA C 3 131 ? -87.528  -24.443 -23.449  1.00 0.00 ? 131 ALA C O    1  
ATOM   7588   C CB   . ALA C 3 131 ? -89.378  -26.288 -25.218  1.00 0.00 ? 131 ALA C CB   1  
ATOM   7589   H H    . ALA C 3 131 ? -86.859  -26.366 -25.657  1.00 0.00 ? 131 ALA C H    1  
ATOM   7590   H HA   . ALA C 3 131 ? -89.018  -24.524 -26.319  1.00 0.00 ? 131 ALA C HA   1  
ATOM   7591   H HB1  . ALA C 3 131 ? -90.397  -26.106 -25.525  1.00 0.00 ? 131 ALA C HB1  1  
ATOM   7592   H HB2  . ALA C 3 131 ? -89.351  -26.478 -24.155  1.00 0.00 ? 131 ALA C HB2  1  
ATOM   7593   H HB3  . ALA C 3 131 ? -88.992  -27.146 -25.747  1.00 0.00 ? 131 ALA C HB3  1  
ATOM   7594   N N    . PRO C 3 132 ? -89.256  -23.140 -24.162  1.00 0.00 ? 132 PRO C N    1  
ATOM   7595   C CA   . PRO C 3 132 ? -89.090  -22.213 -23.036  1.00 0.00 ? 132 PRO C CA   1  
ATOM   7596   C C    . PRO C 3 132 ? -89.412  -22.835 -21.660  1.00 0.00 ? 132 PRO C C    1  
ATOM   7597   O O    . PRO C 3 132 ? -89.732  -24.022 -21.578  1.00 0.00 ? 132 PRO C O    1  
ATOM   7598   C CB   . PRO C 3 132 ? -90.050  -21.061 -23.375  1.00 0.00 ? 132 PRO C CB   1  
ATOM   7599   C CG   . PRO C 3 132 ? -91.040  -21.622 -24.285  1.00 0.00 ? 132 PRO C CG   1  
ATOM   7600   C CD   . PRO C 3 132 ? -90.424  -22.791 -24.994  1.00 0.00 ? 132 PRO C CD   1  
ATOM   7601   H HA   . PRO C 3 132 ? -88.083  -21.831 -23.030  1.00 0.00 ? 132 PRO C HA   1  
ATOM   7602   H HB2  . PRO C 3 132 ? -90.529  -20.699 -22.477  1.00 0.00 ? 132 PRO C HB2  1  
ATOM   7603   H HB3  . PRO C 3 132 ? -89.513  -20.259 -23.861  1.00 0.00 ? 132 PRO C HB3  1  
ATOM   7604   H HG2  . PRO C 3 132 ? -91.906  -21.947 -23.725  1.00 0.00 ? 132 PRO C HG2  1  
ATOM   7605   H HG3  . PRO C 3 132 ? -91.333  -20.877 -25.009  1.00 0.00 ? 132 PRO C HG3  1  
ATOM   7606   H HD2  . PRO C 3 132 ? -91.122  -23.616 -25.039  1.00 0.00 ? 132 PRO C HD2  1  
ATOM   7607   H HD3  . PRO C 3 132 ? -90.102  -22.508 -25.984  1.00 0.00 ? 132 PRO C HD3  1  
ATOM   7608   N N    . VAL C 3 133 ? -89.285  -22.046 -20.592  1.00 0.00 ? 133 VAL C N    1  
ATOM   7609   C CA   . VAL C 3 133 ? -89.653  -22.468 -19.229  1.00 0.00 ? 133 VAL C CA   1  
ATOM   7610   C C    . VAL C 3 133 ? -90.932  -23.323 -19.201  1.00 0.00 ? 133 VAL C C    1  
ATOM   7611   O O    . VAL C 3 133 ? -91.964  -22.876 -19.713  1.00 0.00 ? 133 VAL C O    1  
ATOM   7612   C CB   . VAL C 3 133 ? -89.840  -21.228 -18.303  1.00 0.00 ? 133 VAL C CB   1  
ATOM   7613   C CG1  . VAL C 3 133 ? -88.494  -20.658 -17.899  1.00 0.00 ? 133 VAL C CG1  1  
ATOM   7614   C CG2  . VAL C 3 133 ? -90.707  -20.141 -18.978  1.00 0.00 ? 133 VAL C CG2  1  
ATOM   7615   H H    . VAL C 3 133 ? -88.996  -21.120 -20.730  1.00 0.00 ? 133 VAL C H    1  
ATOM   7616   H HA   . VAL C 3 133 ? -88.844  -23.062 -18.832  1.00 0.00 ? 133 VAL C HA   1  
ATOM   7617   H HB   . VAL C 3 133 ? -90.344  -21.558 -17.404  1.00 0.00 ? 133 VAL C HB   1  
ATOM   7618   H HG11 . VAL C 3 133 ? -87.767  -21.454 -17.847  1.00 0.00 ? 133 VAL C HG11 1  
ATOM   7619   H HG12 . VAL C 3 133 ? -88.580  -20.183 -16.933  1.00 0.00 ? 133 VAL C HG12 1  
ATOM   7620   H HG13 . VAL C 3 133 ? -88.178  -19.929 -18.631  1.00 0.00 ? 133 VAL C HG13 1  
ATOM   7621   H HG21 . VAL C 3 133 ? -91.745  -20.440 -18.950  1.00 0.00 ? 133 VAL C HG21 1  
ATOM   7622   H HG22 . VAL C 3 133 ? -90.396  -20.018 -20.005  1.00 0.00 ? 133 VAL C HG22 1  
ATOM   7623   H HG23 . VAL C 3 133 ? -90.586  -19.206 -18.452  1.00 0.00 ? 133 VAL C HG23 1  
ATOM   7624   N N    . CYS C 3 134 ? -90.881  -24.533 -18.621  1.00 0.00 ? 134 CYS C N    1  
ATOM   7625   C CA   . CYS C 3 134 ? -92.093  -25.406 -18.584  1.00 0.00 ? 134 CYS C CA   1  
ATOM   7626   C C    . CYS C 3 134 ? -93.265  -24.850 -17.778  1.00 0.00 ? 134 CYS C C    1  
ATOM   7627   O O    . CYS C 3 134 ? -94.365  -25.420 -17.794  1.00 0.00 ? 134 CYS C O    1  
ATOM   7628   C CB   . CYS C 3 134 ? -91.828  -26.886 -18.221  1.00 0.00 ? 134 CYS C CB   1  
ATOM   7629   S SG   . CYS C 3 134 ? -90.636  -27.328 -16.920  1.00 0.00 ? 134 CYS C SG   1  
ATOM   7630   H H    . CYS C 3 134 ? -90.040  -24.850 -18.229  1.00 0.00 ? 134 CYS C H    1  
ATOM   7631   H HA   . CYS C 3 134 ? -92.446  -25.420 -19.608  1.00 0.00 ? 134 CYS C HA   1  
ATOM   7632   H HB2  . CYS C 3 134 ? -92.769  -27.313 -17.927  1.00 0.00 ? 134 CYS C HB2  1  
ATOM   7633   H HB3  . CYS C 3 134 ? -91.525  -27.385 -19.135  1.00 0.00 ? 134 CYS C HB3  1  
ATOM   7634   N N    . GLY C 3 135 ? -93.013  -23.736 -17.089  1.00 0.00 ? 135 GLY C N    1  
ATOM   7635   C CA   . GLY C 3 135 ? -94.055  -22.941 -16.453  1.00 0.00 ? 135 GLY C CA   1  
ATOM   7636   C C    . GLY C 3 135 ? -94.974  -22.352 -17.507  1.00 0.00 ? 135 GLY C C    1  
ATOM   7637   O O    . GLY C 3 135 ? -94.516  -21.924 -18.574  1.00 0.00 ? 135 GLY C O    1  
ATOM   7638   H H    . GLY C 3 135 ? -92.110  -23.357 -17.139  1.00 0.00 ? 135 GLY C H    1  
ATOM   7639   H HA2  . GLY C 3 135 ? -94.628  -23.569 -15.785  1.00 0.00 ? 135 GLY C HA2  1  
ATOM   7640   H HA3  . GLY C 3 135 ? -93.601  -22.140 -15.891  1.00 0.00 ? 135 GLY C HA3  1  
ATOM   7641   N N    . ASP C 3 136 ? -96.272  -22.342 -17.201  1.00 0.00 ? 136 ASP C N    1  
ATOM   7642   C CA   . ASP C 3 136 ? -97.308  -21.884 -18.129  1.00 0.00 ? 136 ASP C CA   1  
ATOM   7643   C C    . ASP C 3 136 ? -97.288  -20.361 -18.262  1.00 0.00 ? 136 ASP C C    1  
ATOM   7644   O O    . ASP C 3 136 ? -97.840  -19.801 -19.224  1.00 0.00 ? 136 ASP C O    1  
ATOM   7645   C CB   . ASP C 3 136 ? -98.676  -22.397 -17.673  1.00 0.00 ? 136 ASP C CB   1  
ATOM   7646   C CG   . ASP C 3 136 ? -98.679  -23.911 -17.433  1.00 0.00 ? 136 ASP C CG   1  
ATOM   7647   O OD1  . ASP C 3 136 ? -98.202  -24.659 -18.318  1.00 0.00 ? 136 ASP C OD1  1  
ATOM   7648   O OD2  . ASP C 3 136 ? -99.142  -24.355 -16.354  1.00 0.00 ? 136 ASP C OD2  1  
ATOM   7649   H H    . ASP C 3 136 ? -96.550  -22.705 -16.334  1.00 0.00 ? 136 ASP C H    1  
ATOM   7650   H HA   . ASP C 3 136 ? -97.096  -22.306 -19.101  1.00 0.00 ? 136 ASP C HA   1  
ATOM   7651   H HB2  . ASP C 3 136 ? -98.952  -21.896 -16.757  1.00 0.00 ? 136 ASP C HB2  1  
ATOM   7652   H HB3  . ASP C 3 136 ? -99.406  -22.162 -18.434  1.00 0.00 ? 136 ASP C HB3  1  
ATOM   7653   N N    . THR C 3 137 ? -96.629  -19.721 -17.288  1.00 0.00 ? 137 THR C N    1  
ATOM   7654   C CA   . THR C 3 137 ? -96.334  -18.274 -17.258  1.00 0.00 ? 137 THR C CA   1  
ATOM   7655   C C    . THR C 3 137 ? -96.231  -17.618 -18.638  1.00 0.00 ? 137 THR C C    1  
ATOM   7656   O O    . THR C 3 137 ? -95.143  -17.537 -19.234  1.00 0.00 ? 137 THR C O    1  
ATOM   7657   C CB   . THR C 3 137 ? -95.034  -17.976 -16.458  1.00 0.00 ? 137 THR C CB   1  
ATOM   7658   O OG1  . THR C 3 137 ? -94.016  -18.925 -16.815  1.00 0.00 ? 137 THR C OG1  1  
ATOM   7659   C CG2  . THR C 3 137 ? -95.295  -18.036 -14.944  1.00 0.00 ? 137 THR C CG2  1  
ATOM   7660   H H    . THR C 3 137 ? -96.227  -20.272 -16.585  1.00 0.00 ? 137 THR C H    1  
ATOM   7661   H HA   . THR C 3 137 ? -97.147  -17.793 -16.734  1.00 0.00 ? 137 THR C HA   1  
ATOM   7662   H HB   . THR C 3 137 ? -94.689  -16.984 -16.713  1.00 0.00 ? 137 THR C HB   1  
ATOM   7663   H HG1  . THR C 3 137 ? -93.180  -18.610 -16.466  1.00 0.00 ? 137 THR C HG1  1  
ATOM   7664   H HG21 . THR C 3 137 ? -96.189  -17.477 -14.711  1.00 0.00 ? 137 THR C HG21 1  
ATOM   7665   H HG22 . THR C 3 137 ? -94.455  -17.610 -14.417  1.00 0.00 ? 137 THR C HG22 1  
ATOM   7666   H HG23 . THR C 3 137 ? -95.425  -19.065 -14.643  1.00 0.00 ? 137 THR C HG23 1  
ATOM   7667   N N    . THR C 3 138 ? -97.378  -17.161 -19.139  1.00 0.00 ? 138 THR C N    1  
ATOM   7668   C CA   . THR C 3 138 ? -97.424  -16.485 -20.429  1.00 0.00 ? 138 THR C CA   1  
ATOM   7669   C C    . THR C 3 138 ? -96.949  -15.027 -20.297  1.00 0.00 ? 138 THR C C    1  
ATOM   7670   O O    . THR C 3 138 ? -97.411  -14.278 -19.430  1.00 0.00 ? 138 THR C O    1  
ATOM   7671   C CB   . THR C 3 138 ? -98.818  -16.635 -21.133  1.00 0.00 ? 138 THR C CB   1  
ATOM   7672   O OG1  . THR C 3 138 ? -98.732  -16.171 -22.487  1.00 0.00 ? 138 THR C OG1  1  
ATOM   7673   C CG2  . THR C 3 138 ? -99.940  -15.890 -20.379  1.00 0.00 ? 138 THR C CG2  1  
ATOM   7674   H H    . THR C 3 138 ? -98.203  -17.262 -18.620  1.00 0.00 ? 138 THR C H    1  
ATOM   7675   H HA   . THR C 3 138 ? -96.698  -16.984 -21.059  1.00 0.00 ? 138 THR C HA   1  
ATOM   7676   H HB   . THR C 3 138 ? -99.064  -17.651 -21.230  1.00 0.00 ? 138 THR C HB   1  
ATOM   7677   H HG1  . THR C 3 138 ? -98.602  -15.220 -22.467  1.00 0.00 ? 138 THR C HG1  1  
ATOM   7678   H HG21 . THR C 3 138 ? -100.753 -16.573 -20.179  1.00 0.00 ? 138 THR C HG21 1  
ATOM   7679   H HG22 . THR C 3 138 ? -100.298 -15.071 -20.984  1.00 0.00 ? 138 THR C HG22 1  
ATOM   7680   H HG23 . THR C 3 138 ? -99.554  -15.507 -19.446  1.00 0.00 ? 138 THR C HG23 1  
ATOM   7681   N N    . GLY C 3 139 ? -95.963  -14.674 -21.120  1.00 0.00 ? 139 GLY C N    1  
ATOM   7682   C CA   . GLY C 3 139 ? -95.518  -13.294 -21.281  1.00 0.00 ? 139 GLY C CA   1  
ATOM   7683   C C    . GLY C 3 139 ? -96.324  -12.685 -22.411  1.00 0.00 ? 139 GLY C C    1  
ATOM   7684   O O    . GLY C 3 139 ? -97.554  -12.623 -22.328  1.00 0.00 ? 139 GLY C O    1  
ATOM   7685   H H    . GLY C 3 139 ? -95.612  -15.348 -21.738  1.00 0.00 ? 139 GLY C H    1  
ATOM   7686   H HA2  . GLY C 3 139 ? -95.689  -12.744 -20.365  1.00 0.00 ? 139 GLY C HA2  1  
ATOM   7687   H HA3  . GLY C 3 139 ? -94.469  -13.272 -21.533  1.00 0.00 ? 139 GLY C HA3  1  
ATOM   7688   N N    . SER C 3 140 ? -95.645  -12.268 -23.480  1.00 0.00 ? 140 SER C N    1  
ATOM   7689   C CA   . SER C 3 140 ? -96.330  -11.679 -24.635  1.00 0.00 ? 140 SER C CA   1  
ATOM   7690   C C    . SER C 3 140 ? -95.676  -12.065 -25.968  1.00 0.00 ? 140 SER C C    1  
ATOM   7691   O O    . SER C 3 140 ? -96.347  -12.534 -26.894  1.00 0.00 ? 140 SER C O    1  
ATOM   7692   C CB   . SER C 3 140 ? -96.392  -10.152 -24.481  1.00 0.00 ? 140 SER C CB   1  
ATOM   7693   O OG   . SER C 3 140 ? -97.312  -9.582  -25.393  1.00 0.00 ? 140 SER C OG   1  
ATOM   7694   H H    . SER C 3 140 ? -94.671  -12.366 -23.499  1.00 0.00 ? 140 SER C H    1  
ATOM   7695   H HA   . SER C 3 140 ? -97.344  -12.052 -24.644  1.00 0.00 ? 140 SER C HA   1  
ATOM   7696   H HB2  . SER C 3 140 ? -96.701  -9.907  -23.480  1.00 0.00 ? 140 SER C HB2  1  
ATOM   7697   H HB3  . SER C 3 140 ? -95.404  -9.741  -24.652  1.00 0.00 ? 140 SER C HB3  1  
ATOM   7698   H HG   . SER C 3 140 ? -97.299  -8.630  -25.271  1.00 0.00 ? 140 SER C HG   1  
ATOM   7699   N N    . SER C 3 141 ? -94.366  -11.834 -26.045  1.00 0.00 ? 141 SER C N    1  
ATOM   7700   C CA   . SER C 3 141 ? -93.550  -12.143 -27.214  1.00 0.00 ? 141 SER C CA   1  
ATOM   7701   C C    . SER C 3 141 ? -92.689  -13.335 -26.876  1.00 0.00 ? 141 SER C C    1  
ATOM   7702   O O    . SER C 3 141 ? -91.566  -13.180 -26.364  1.00 0.00 ? 141 SER C O    1  
ATOM   7703   C CB   . SER C 3 141 ? -92.644  -10.967 -27.566  1.00 0.00 ? 141 SER C CB   1  
ATOM   7704   O OG   . SER C 3 141 ? -93.372  -9.929  -28.182  1.00 0.00 ? 141 SER C OG   1  
ATOM   7705   H H    . SER C 3 141 ? -93.921  -11.443 -25.265  1.00 0.00 ? 141 SER C H    1  
ATOM   7706   H HA   . SER C 3 141 ? -94.187  -12.378 -28.054  1.00 0.00 ? 141 SER C HA   1  
ATOM   7707   H HB2  . SER C 3 141 ? -92.191  -10.586 -26.667  1.00 0.00 ? 141 SER C HB2  1  
ATOM   7708   H HB3  . SER C 3 141 ? -91.863  -11.312 -28.232  1.00 0.00 ? 141 SER C HB3  1  
ATOM   7709   H HG   . SER C 3 141 ? -92.861  -9.120  -28.101  1.00 0.00 ? 141 SER C HG   1  
ATOM   7710   N N    . VAL C 3 142 ? -93.227  -14.520 -27.162  1.00 0.00 ? 142 VAL C N    1  
ATOM   7711   C CA   . VAL C 3 142 ? -92.573  -15.794 -26.860  1.00 0.00 ? 142 VAL C CA   1  
ATOM   7712   C C    . VAL C 3 142 ? -91.363  -16.043 -27.746  1.00 0.00 ? 142 VAL C C    1  
ATOM   7713   O O    . VAL C 3 142 ? -91.471  -16.000 -28.967  1.00 0.00 ? 142 VAL C O    1  
ATOM   7714   C CB   . VAL C 3 142 ? -93.544  -16.957 -27.049  1.00 0.00 ? 142 VAL C CB   1  
ATOM   7715   C CG1  . VAL C 3 142 ? -92.961  -18.236 -26.448  1.00 0.00 ? 142 VAL C CG1  1  
ATOM   7716   C CG2  . VAL C 3 142 ? -94.880  -16.615 -26.416  1.00 0.00 ? 142 VAL C CG2  1  
ATOM   7717   H H    . VAL C 3 142 ? -94.121  -14.540 -27.563  1.00 0.00 ? 142 VAL C H    1  
ATOM   7718   H HA   . VAL C 3 142 ? -92.252  -15.783 -25.830  1.00 0.00 ? 142 VAL C HA   1  
ATOM   7719   H HB   . VAL C 3 142 ? -93.689  -17.113 -28.109  1.00 0.00 ? 142 VAL C HB   1  
ATOM   7720   H HG11 . VAL C 3 142 ? -93.700  -18.707 -25.816  1.00 0.00 ? 142 VAL C HG11 1  
ATOM   7721   H HG12 . VAL C 3 142 ? -92.088  -17.992 -25.860  1.00 0.00 ? 142 VAL C HG12 1  
ATOM   7722   H HG13 . VAL C 3 142 ? -92.682  -18.913 -27.242  1.00 0.00 ? 142 VAL C HG13 1  
ATOM   7723   H HG21 . VAL C 3 142 ? -95.613  -16.446 -27.190  1.00 0.00 ? 142 VAL C HG21 1  
ATOM   7724   H HG22 . VAL C 3 142 ? -94.777  -15.722 -25.817  1.00 0.00 ? 142 VAL C HG22 1  
ATOM   7725   H HG23 . VAL C 3 142 ? -95.202  -17.433 -25.789  1.00 0.00 ? 142 VAL C HG23 1  
ATOM   7726   N N    . THR C 3 143 ? -90.211  -16.288 -27.132  1.00 0.00 ? 143 THR C N    1  
ATOM   7727   C CA   . THR C 3 143 ? -89.028  -16.650 -27.902  1.00 0.00 ? 143 THR C CA   1  
ATOM   7728   C C    . THR C 3 143 ? -88.675  -18.124 -27.642  1.00 0.00 ? 143 THR C C    1  
ATOM   7729   O O    . THR C 3 143 ? -88.695  -18.584 -26.500  1.00 0.00 ? 143 THR C O    1  
ATOM   7730   C CB   . THR C 3 143 ? -87.794  -15.679 -27.696  1.00 0.00 ? 143 THR C CB   1  
ATOM   7731   O OG1  . THR C 3 143 ? -86.853  -16.246 -26.783  1.00 0.00 ? 143 THR C OG1  1  
ATOM   7732   C CG2  . THR C 3 143 ? -88.215  -14.276 -27.224  1.00 0.00 ? 143 THR C CG2  1  
ATOM   7733   H H    . THR C 3 143 ? -90.176  -16.301 -26.153  1.00 0.00 ? 143 THR C H    1  
ATOM   7734   H HA   . THR C 3 143 ? -89.312  -16.584 -28.945  1.00 0.00 ? 143 THR C HA   1  
ATOM   7735   H HB   . THR C 3 143 ? -87.299  -15.573 -28.652  1.00 0.00 ? 143 THR C HB   1  
ATOM   7736   H HG1  . THR C 3 143 ? -86.146  -15.611 -26.652  1.00 0.00 ? 143 THR C HG1  1  
ATOM   7737   H HG21 . THR C 3 143 ? -88.668  -14.347 -26.246  1.00 0.00 ? 143 THR C HG21 1  
ATOM   7738   H HG22 . THR C 3 143 ? -88.927  -13.860 -27.921  1.00 0.00 ? 143 THR C HG22 1  
ATOM   7739   H HG23 . THR C 3 143 ? -87.345  -13.638 -27.173  1.00 0.00 ? 143 THR C HG23 1  
ATOM   7740   N N    . LEU C 3 144 ? -88.406  -18.862 -28.719  1.00 0.00 ? 144 LEU C N    1  
ATOM   7741   C CA   . LEU C 3 144 ? -87.984  -20.248 -28.625  1.00 0.00 ? 144 LEU C CA   1  
ATOM   7742   C C    . LEU C 3 144 ? -86.589  -20.319 -29.206  1.00 0.00 ? 144 LEU C C    1  
ATOM   7743   O O    . LEU C 3 144 ? -86.110  -19.357 -29.808  1.00 0.00 ? 144 LEU C O    1  
ATOM   7744   C CB   . LEU C 3 144 ? -88.915  -21.184 -29.405  1.00 0.00 ? 144 LEU C CB   1  
ATOM   7745   C CG   . LEU C 3 144 ? -90.185  -20.726 -30.129  1.00 0.00 ? 144 LEU C CG   1  
ATOM   7746   C CD1  . LEU C 3 144 ? -90.748  -21.888 -30.912  1.00 0.00 ? 144 LEU C CD1  1  
ATOM   7747   C CD2  . LEU C 3 144 ? -91.237  -20.170 -29.205  1.00 0.00 ? 144 LEU C CD2  1  
ATOM   7748   H H    . LEU C 3 144 ? -88.445  -18.439 -29.602  1.00 0.00 ? 144 LEU C H    1  
ATOM   7749   H HA   . LEU C 3 144 ? -87.957  -20.546 -27.587  1.00 0.00 ? 144 LEU C HA   1  
ATOM   7750   H HB2  . LEU C 3 144 ? -88.309  -21.652 -30.158  1.00 0.00 ? 144 LEU C HB2  1  
ATOM   7751   H HB3  . LEU C 3 144 ? -89.203  -21.969 -28.713  1.00 0.00 ? 144 LEU C HB3  1  
ATOM   7752   H HG   . LEU C 3 144 ? -89.903  -19.955 -30.835  1.00 0.00 ? 144 LEU C HG   1  
ATOM   7753   H HD11 . LEU C 3 144 ? -91.379  -22.484 -30.269  1.00 0.00 ? 144 LEU C HD11 1  
ATOM   7754   H HD12 . LEU C 3 144 ? -89.938  -22.497 -31.286  1.00 0.00 ? 144 LEU C HD12 1  
ATOM   7755   H HD13 . LEU C 3 144 ? -91.331  -21.515 -31.741  1.00 0.00 ? 144 LEU C HD13 1  
ATOM   7756   H HD21 . LEU C 3 144 ? -91.824  -20.272 -30.172  1.00 0.00 ? 144 LEU C HD21 1  
ATOM   7757   H HD22 . LEU C 3 144 ? -90.237  -19.846 -28.923  1.00 0.00 ? 144 LEU C HD22 1  
ATOM   7758   H HD23 . LEU C 3 144 ? -91.389  -21.090 -28.597  1.00 0.00 ? 144 LEU C HD23 1  
ATOM   7759   N N    . GLY C 3 145 ? -85.938  -21.461 -29.033  1.00 0.00 ? 145 GLY C N    1  
ATOM   7760   C CA   . GLY C 3 145 ? -84.586  -21.637 -29.535  1.00 0.00 ? 145 GLY C CA   1  
ATOM   7761   C C    . GLY C 3 145 ? -84.330  -22.949 -30.258  1.00 0.00 ? 145 GLY C C    1  
ATOM   7762   O O    . GLY C 3 145 ? -85.177  -23.856 -30.285  1.00 0.00 ? 145 GLY C O    1  
ATOM   7763   H H    . GLY C 3 145 ? -86.372  -22.195 -28.550  1.00 0.00 ? 145 GLY C H    1  
ATOM   7764   H HA2  . GLY C 3 145 ? -84.369  -20.829 -30.217  1.00 0.00 ? 145 GLY C HA2  1  
ATOM   7765   H HA3  . GLY C 3 145 ? -83.903  -21.568 -28.700  1.00 0.00 ? 145 GLY C HA3  1  
ATOM   7766   N N    . CYS C 3 146 ? -83.145  -23.024 -30.858  1.00 0.00 ? 146 CYS C N    1  
ATOM   7767   C CA   . CYS C 3 146 ? -82.617  -24.243 -31.452  1.00 0.00 ? 146 CYS C CA   1  
ATOM   7768   C C    . CYS C 3 146 ? -81.130  -24.300 -31.118  1.00 0.00 ? 146 CYS C C    1  
ATOM   7769   O O    . CYS C 3 146 ? -80.432  -23.289 -31.262  1.00 0.00 ? 146 CYS C O    1  
ATOM   7770   C CB   . CYS C 3 146 ? -82.831  -24.239 -32.963  1.00 0.00 ? 146 CYS C CB   1  
ATOM   7771   S SG   . CYS C 3 146 ? -82.268  -25.737 -33.750  1.00 0.00 ? 146 CYS C SG   1  
ATOM   7772   H H    . CYS C 3 146 ? -82.547  -22.250 -30.792  1.00 0.00 ? 146 CYS C H    1  
ATOM   7773   H HA   . CYS C 3 146 ? -83.115  -25.098 -31.017  1.00 0.00 ? 146 CYS C HA   1  
ATOM   7774   H HB2  . CYS C 3 146 ? -83.886  -24.131 -33.158  1.00 0.00 ? 146 CYS C HB2  1  
ATOM   7775   H HB3  . CYS C 3 146 ? -82.311  -23.393 -33.390  1.00 0.00 ? 146 CYS C HB3  1  
ATOM   7776   N N    . LEU C 3 147 ? -80.651  -25.458 -30.655  1.00 0.00 ? 147 LEU C N    1  
ATOM   7777   C CA   . LEU C 3 147 ? -79.234  -25.591 -30.290  1.00 0.00 ? 147 LEU C CA   1  
ATOM   7778   C C    . LEU C 3 147 ? -78.497  -26.669 -31.068  1.00 0.00 ? 147 LEU C C    1  
ATOM   7779   O O    . LEU C 3 147 ? -78.979  -27.802 -31.182  1.00 0.00 ? 147 LEU C O    1  
ATOM   7780   C CB   . LEU C 3 147 ? -79.042  -25.823 -28.793  1.00 0.00 ? 147 LEU C CB   1  
ATOM   7781   C CG   . LEU C 3 147 ? -77.616  -25.480 -28.349  1.00 0.00 ? 147 LEU C CG   1  
ATOM   7782   C CD1  . LEU C 3 147 ? -77.513  -24.017 -27.884  1.00 0.00 ? 147 LEU C CD1  1  
ATOM   7783   C CD2  . LEU C 3 147 ? -77.123  -26.450 -27.276  1.00 0.00 ? 147 LEU C CD2  1  
ATOM   7784   H H    . LEU C 3 147 ? -81.254  -26.222 -30.544  1.00 0.00 ? 147 LEU C H    1  
ATOM   7785   H HA   . LEU C 3 147 ? -78.759  -24.650 -30.529  1.00 0.00 ? 147 LEU C HA   1  
ATOM   7786   H HB2  . LEU C 3 147 ? -79.739  -25.203 -28.249  1.00 0.00 ? 147 LEU C HB2  1  
ATOM   7787   H HB3  . LEU C 3 147 ? -79.243  -26.860 -28.568  1.00 0.00 ? 147 LEU C HB3  1  
ATOM   7788   H HG   . LEU C 3 147 ? -76.975  -25.587 -29.215  1.00 0.00 ? 147 LEU C HG   1  
ATOM   7789   H HD11 . LEU C 3 147 ? -78.460  -23.704 -27.469  1.00 0.00 ? 147 LEU C HD11 1  
ATOM   7790   H HD12 . LEU C 3 147 ? -77.264  -23.389 -28.726  1.00 0.00 ? 147 LEU C HD12 1  
ATOM   7791   H HD13 . LEU C 3 147 ? -76.744  -23.932 -27.131  1.00 0.00 ? 147 LEU C HD13 1  
ATOM   7792   H HD21 . LEU C 3 147 ? -76.442  -27.161 -27.719  1.00 0.00 ? 147 LEU C HD21 1  
ATOM   7793   H HD22 . LEU C 3 147 ? -77.965  -26.974 -26.851  1.00 0.00 ? 147 LEU C HD22 1  
ATOM   7794   H HD23 . LEU C 3 147 ? -76.612  -25.899 -26.500  1.00 0.00 ? 147 LEU C HD23 1  
ATOM   7795   N N    . VAL C 3 148 ? -77.311  -26.298 -31.563  1.00 0.00 ? 148 VAL C N    1  
ATOM   7796   C CA   . VAL C 3 148 ? -76.513  -27.116 -32.490  1.00 0.00 ? 148 VAL C CA   1  
ATOM   7797   C C    . VAL C 3 148 ? -75.072  -27.294 -31.980  1.00 0.00 ? 148 VAL C C    1  
ATOM   7798   O O    . VAL C 3 148 ? -74.322  -26.335 -31.806  1.00 0.00 ? 148 VAL C O    1  
ATOM   7799   C CB   . VAL C 3 148 ? -76.542  -26.525 -33.937  1.00 0.00 ? 148 VAL C CB   1  
ATOM   7800   C CG1  . VAL C 3 148 ? -75.717  -27.380 -34.901  1.00 0.00 ? 148 VAL C CG1  1  
ATOM   7801   C CG2  . VAL C 3 148 ? -77.988  -26.389 -34.440  1.00 0.00 ? 148 VAL C CG2  1  
ATOM   7802   H H    . VAL C 3 148 ? -77.011  -25.382 -31.388  1.00 0.00 ? 148 VAL C H    1  
ATOM   7803   H HA   . VAL C 3 148 ? -76.966  -28.097 -32.528  1.00 0.00 ? 148 VAL C HA   1  
ATOM   7804   H HB   . VAL C 3 148 ? -76.097  -25.539 -33.903  1.00 0.00 ? 148 VAL C HB   1  
ATOM   7805   H HG11 . VAL C 3 148 ? -75.500  -28.333 -34.442  1.00 0.00 ? 148 VAL C HG11 1  
ATOM   7806   H HG12 . VAL C 3 148 ? -74.792  -26.872 -35.131  1.00 0.00 ? 148 VAL C HG12 1  
ATOM   7807   H HG13 . VAL C 3 148 ? -76.277  -27.538 -35.811  1.00 0.00 ? 148 VAL C HG13 1  
ATOM   7808   H HG21 . VAL C 3 148 ? -78.671  -26.560 -33.622  1.00 0.00 ? 148 VAL C HG21 1  
ATOM   7809   H HG22 . VAL C 3 148 ? -78.168  -27.116 -35.219  1.00 0.00 ? 148 VAL C HG22 1  
ATOM   7810   H HG23 . VAL C 3 148 ? -78.141  -25.395 -34.833  1.00 0.00 ? 148 VAL C HG23 1  
ATOM   7811   N N    . LYS C 3 149 ? -74.688  -28.542 -31.759  1.00 0.00 ? 149 LYS C N    1  
ATOM   7812   C CA   . LYS C 3 149 ? -73.547  -28.813 -30.905  1.00 0.00 ? 149 LYS C CA   1  
ATOM   7813   C C    . LYS C 3 149 ? -72.713  -30.001 -31.382  1.00 0.00 ? 149 LYS C C    1  
ATOM   7814   O O    . LYS C 3 149 ? -73.258  -31.004 -31.880  1.00 0.00 ? 149 LYS C O    1  
ATOM   7815   C CB   . LYS C 3 149 ? -74.045  -29.049 -29.467  1.00 0.00 ? 149 LYS C CB   1  
ATOM   7816   C CG   . LYS C 3 149 ? -72.969  -29.227 -28.414  1.00 0.00 ? 149 LYS C CG   1  
ATOM   7817   C CD   . LYS C 3 149 ? -73.418  -30.186 -27.332  1.00 0.00 ? 149 LYS C CD   1  
ATOM   7818   C CE   . LYS C 3 149 ? -72.309  -30.372 -26.325  1.00 0.00 ? 149 LYS C CE   1  
ATOM   7819   N NZ   . LYS C 3 149 ? -71.648  -29.068 -25.985  1.00 0.00 ? 149 LYS C NZ   1  
ATOM   7820   H H    . LYS C 3 149 ? -75.324  -29.266 -31.934  1.00 0.00 ? 149 LYS C H    1  
ATOM   7821   H HA   . LYS C 3 149 ? -72.915  -27.938 -30.898  1.00 0.00 ? 149 LYS C HA   1  
ATOM   7822   H HB2  . LYS C 3 149 ? -74.659  -28.212 -29.178  1.00 0.00 ? 149 LYS C HB2  1  
ATOM   7823   H HB3  . LYS C 3 149 ? -74.667  -29.934 -29.473  1.00 0.00 ? 149 LYS C HB3  1  
ATOM   7824   H HG2  . LYS C 3 149 ? -72.077  -29.615 -28.883  1.00 0.00 ? 149 LYS C HG2  1  
ATOM   7825   H HG3  . LYS C 3 149 ? -72.747  -28.269 -27.969  1.00 0.00 ? 149 LYS C HG3  1  
ATOM   7826   H HD2  . LYS C 3 149 ? -74.292  -29.789 -26.837  1.00 0.00 ? 149 LYS C HD2  1  
ATOM   7827   H HD3  . LYS C 3 149 ? -73.660  -31.140 -27.777  1.00 0.00 ? 149 LYS C HD3  1  
ATOM   7828   H HE2  . LYS C 3 149 ? -72.718  -30.804 -25.425  1.00 0.00 ? 149 LYS C HE2  1  
ATOM   7829   H HE3  . LYS C 3 149 ? -71.571  -31.046 -26.735  1.00 0.00 ? 149 LYS C HE3  1  
ATOM   7830   H HZ1  . LYS C 3 149 ? -72.303  -28.285 -26.182  1.00 0.00 ? 149 LYS C HZ1  1  
ATOM   7831   H HZ2  . LYS C 3 149 ? -70.789  -28.955 -26.561  1.00 0.00 ? 149 LYS C HZ2  1  
ATOM   7832   H HZ3  . LYS C 3 149 ? -71.395  -29.060 -24.977  1.00 0.00 ? 149 LYS C HZ3  1  
ATOM   7833   N N    . GLY C 3 150 ? -71.394  -29.867 -31.203  1.00 0.00 ? 150 GLY C N    1  
ATOM   7834   C CA   . GLY C 3 150 ? -70.439  -30.931 -31.481  1.00 0.00 ? 150 GLY C CA   1  
ATOM   7835   C C    . GLY C 3 150 ? -70.396  -31.292 -32.953  1.00 0.00 ? 150 GLY C C    1  
ATOM   7836   O O    . GLY C 3 150 ? -70.792  -32.404 -33.342  1.00 0.00 ? 150 GLY C O    1  
ATOM   7837   H H    . GLY C 3 150 ? -71.063  -29.041 -30.794  1.00 0.00 ? 150 GLY C H    1  
ATOM   7838   H HA2  . GLY C 3 150 ? -69.456  -30.607 -31.172  1.00 0.00 ? 150 GLY C HA2  1  
ATOM   7839   H HA3  . GLY C 3 150 ? -70.715  -31.807 -30.913  1.00 0.00 ? 150 GLY C HA3  1  
ATOM   7840   N N    . TYR C 3 151 ? -69.936  -30.348 -33.778  1.00 0.00 ? 151 TYR C N    1  
ATOM   7841   C CA   . TYR C 3 151 ? -69.777  -30.611 -35.210  1.00 0.00 ? 151 TYR C CA   1  
ATOM   7842   C C    . TYR C 3 151 ? -68.472  -30.100 -35.794  1.00 0.00 ? 151 TYR C C    1  
ATOM   7843   O O    . TYR C 3 151 ? -67.809  -29.232 -35.217  1.00 0.00 ? 151 TYR C O    1  
ATOM   7844   C CB   . TYR C 3 151 ? -70.972  -30.097 -36.028  1.00 0.00 ? 151 TYR C CB   1  
ATOM   7845   C CG   . TYR C 3 151 ? -71.098  -28.591 -36.148  1.00 0.00 ? 151 TYR C CG   1  
ATOM   7846   C CD1  . TYR C 3 151 ? -70.239  -27.862 -36.962  1.00 0.00 ? 151 TYR C CD1  1  
ATOM   7847   C CD2  . TYR C 3 151 ? -72.108  -27.904 -35.480  1.00 0.00 ? 151 TYR C CD2  1  
ATOM   7848   C CE1  . TYR C 3 151 ? -70.368  -26.491 -37.083  1.00 0.00 ? 151 TYR C CE1  1  
ATOM   7849   C CE2  . TYR C 3 151 ? -72.243  -26.530 -35.598  1.00 0.00 ? 151 TYR C CE2  1  
ATOM   7850   C CZ   . TYR C 3 151 ? -71.370  -25.832 -36.399  1.00 0.00 ? 151 TYR C CZ   1  
ATOM   7851   O OH   . TYR C 3 151 ? -71.499  -24.473 -36.525  1.00 0.00 ? 151 TYR C OH   1  
ATOM   7852   H H    . TYR C 3 151 ? -69.653  -29.484 -33.411  1.00 0.00 ? 151 TYR C H    1  
ATOM   7853   H HA   . TYR C 3 151 ? -69.763  -31.685 -35.324  1.00 0.00 ? 151 TYR C HA   1  
ATOM   7854   H HB2  . TYR C 3 151 ? -70.897  -30.502 -37.024  1.00 0.00 ? 151 TYR C HB2  1  
ATOM   7855   H HB3  . TYR C 3 151 ? -71.876  -30.483 -35.576  1.00 0.00 ? 151 TYR C HB3  1  
ATOM   7856   H HD1  . TYR C 3 151 ? -69.448  -28.371 -37.492  1.00 0.00 ? 151 TYR C HD1  1  
ATOM   7857   H HD2  . TYR C 3 151 ? -72.794  -28.451 -34.851  1.00 0.00 ? 151 TYR C HD2  1  
ATOM   7858   H HE1  . TYR C 3 151 ? -69.693  -25.938 -37.719  1.00 0.00 ? 151 TYR C HE1  1  
ATOM   7859   H HE2  . TYR C 3 151 ? -73.026  -26.012 -35.064  1.00 0.00 ? 151 TYR C HE2  1  
ATOM   7860   H HH   . TYR C 3 151 ? -70.736  -24.063 -36.111  1.00 0.00 ? 151 TYR C HH   1  
ATOM   7861   N N    . PHE C 3 152 ? -68.129  -30.664 -36.949  1.00 0.00 ? 152 PHE C N    1  
ATOM   7862   C CA   . PHE C 3 152 ? -67.039  -30.189 -37.777  1.00 0.00 ? 152 PHE C CA   1  
ATOM   7863   C C    . PHE C 3 152 ? -67.358  -30.506 -39.232  1.00 0.00 ? 152 PHE C C    1  
ATOM   7864   O O    . PHE C 3 152 ? -67.906  -31.566 -39.527  1.00 0.00 ? 152 PHE C O    1  
ATOM   7865   C CB   . PHE C 3 152 ? -65.722  -30.850 -37.381  1.00 0.00 ? 152 PHE C CB   1  
ATOM   7866   C CG   . PHE C 3 152 ? -64.500  -30.100 -37.849  1.00 0.00 ? 152 PHE C CG   1  
ATOM   7867   C CD1  . PHE C 3 152 ? -64.118  -28.905 -37.234  1.00 0.00 ? 152 PHE C CD1  1  
ATOM   7868   C CD2  . PHE C 3 152 ? -63.725  -30.591 -38.897  1.00 0.00 ? 152 PHE C CD2  1  
ATOM   7869   C CE1  . PHE C 3 152 ? -62.980  -28.214 -37.656  1.00 0.00 ? 152 PHE C CE1  1  
ATOM   7870   C CE2  . PHE C 3 152 ? -62.578  -29.908 -39.322  1.00 0.00 ? 152 PHE C CE2  1  
ATOM   7871   C CZ   . PHE C 3 152 ? -62.209  -28.716 -38.701  1.00 0.00 ? 152 PHE C CZ   1  
ATOM   7872   H H    . PHE C 3 152 ? -68.725  -31.348 -37.321  1.00 0.00 ? 152 PHE C H    1  
ATOM   7873   H HA   . PHE C 3 152 ? -66.948  -29.119 -37.660  1.00 0.00 ? 152 PHE C HA   1  
ATOM   7874   H HB2  . PHE C 3 152 ? -65.684  -30.926 -36.306  1.00 0.00 ? 152 PHE C HB2  1  
ATOM   7875   H HB3  . PHE C 3 152 ? -65.700  -31.848 -37.796  1.00 0.00 ? 152 PHE C HB3  1  
ATOM   7876   H HD1  . PHE C 3 152 ? -64.709  -28.511 -36.420  1.00 0.00 ? 152 PHE C HD1  1  
ATOM   7877   H HD2  . PHE C 3 152 ? -64.006  -31.514 -39.382  1.00 0.00 ? 152 PHE C HD2  1  
ATOM   7878   H HE1  . PHE C 3 152 ? -62.697  -27.291 -37.171  1.00 0.00 ? 152 PHE C HE1  1  
ATOM   7879   H HE2  . PHE C 3 152 ? -61.983  -30.302 -40.132  1.00 0.00 ? 152 PHE C HE2  1  
ATOM   7880   H HZ   . PHE C 3 152 ? -61.328  -28.184 -39.029  1.00 0.00 ? 152 PHE C HZ   1  
ATOM   7881   N N    . PRO C 3 153 ? -67.039  -29.576 -40.145  1.00 0.00 ? 153 PRO C N    1  
ATOM   7882   C CA   . PRO C 3 153 ? -66.560  -28.236 -39.851  1.00 0.00 ? 153 PRO C CA   1  
ATOM   7883   C C    . PRO C 3 153 ? -67.667  -27.212 -40.038  1.00 0.00 ? 153 PRO C C    1  
ATOM   7884   O O    . PRO C 3 153 ? -68.810  -27.590 -40.313  1.00 0.00 ? 153 PRO C O    1  
ATOM   7885   C CB   . PRO C 3 153 ? -65.466  -28.020 -40.908  1.00 0.00 ? 153 PRO C CB   1  
ATOM   7886   C CG   . PRO C 3 153 ? -65.532  -29.238 -41.842  1.00 0.00 ? 153 PRO C CG   1  
ATOM   7887   C CD   . PRO C 3 153 ? -66.833  -29.903 -41.561  1.00 0.00 ? 153 PRO C CD   1  
ATOM   7888   H HA   . PRO C 3 153 ? -66.137  -28.180 -38.864  1.00 0.00 ? 153 PRO C HA   1  
ATOM   7889   H HB2  . PRO C 3 153 ? -65.659  -27.111 -41.462  1.00 0.00 ? 153 PRO C HB2  1  
ATOM   7890   H HB3  . PRO C 3 153 ? -64.497  -27.974 -40.438  1.00 0.00 ? 153 PRO C HB3  1  
ATOM   7891   H HG2  . PRO C 3 153 ? -65.491  -28.918 -42.874  1.00 0.00 ? 153 PRO C HG2  1  
ATOM   7892   H HG3  . PRO C 3 153 ? -64.720  -29.915 -41.629  1.00 0.00 ? 153 PRO C HG3  1  
ATOM   7893   H HD2  . PRO C 3 153 ? -67.619  -29.484 -42.177  1.00 0.00 ? 153 PRO C HD2  1  
ATOM   7894   H HD3  . PRO C 3 153 ? -66.761  -30.971 -41.693  1.00 0.00 ? 153 PRO C HD3  1  
ATOM   7895   N N    . GLU C 3 154 ? -67.324  -25.935 -39.876  1.00 0.00 ? 154 GLU C N    1  
ATOM   7896   C CA   . GLU C 3 154 ? -68.164  -24.842 -40.339  1.00 0.00 ? 154 GLU C CA   1  
ATOM   7897   C C    . GLU C 3 154 ? -68.386  -25.020 -41.842  1.00 0.00 ? 154 GLU C C    1  
ATOM   7898   O O    . GLU C 3 154 ? -67.543  -25.607 -42.526  1.00 0.00 ? 154 GLU C O    1  
ATOM   7899   C CB   . GLU C 3 154 ? -67.468  -23.510 -40.075  1.00 0.00 ? 154 GLU C CB   1  
ATOM   7900   C CG   . GLU C 3 154 ? -67.437  -23.089 -38.615  1.00 0.00 ? 154 GLU C CG   1  
ATOM   7901   C CD   . GLU C 3 154 ? -68.497  -22.035 -38.264  1.00 0.00 ? 154 GLU C CD   1  
ATOM   7902   O OE1  . GLU C 3 154 ? -69.715  -22.275 -38.513  1.00 0.00 ? 154 GLU C OE1  1  
ATOM   7903   O OE2  . GLU C 3 154 ? -68.095  -20.969 -37.724  1.00 0.00 ? 154 GLU C OE2  1  
ATOM   7904   H H    . GLU C 3 154 ? -66.394  -25.733 -39.643  1.00 0.00 ? 154 GLU C H    1  
ATOM   7905   H HA   . GLU C 3 154 ? -69.113  -24.866 -39.824  1.00 0.00 ? 154 GLU C HA   1  
ATOM   7906   H HB2  . GLU C 3 154 ? -66.451  -23.582 -40.426  1.00 0.00 ? 154 GLU C HB2  1  
ATOM   7907   H HB3  . GLU C 3 154 ? -67.972  -22.743 -40.646  1.00 0.00 ? 154 GLU C HB3  1  
ATOM   7908   H HG2  . GLU C 3 154 ? -67.601  -23.960 -37.999  1.00 0.00 ? 154 GLU C HG2  1  
ATOM   7909   H HG3  . GLU C 3 154 ? -66.459  -22.687 -38.392  1.00 0.00 ? 154 GLU C HG3  1  
ATOM   7910   N N    . PRO C 3 155 ? -69.516  -24.536 -42.368  1.00 0.00 ? 155 PRO C N    1  
ATOM   7911   C CA   . PRO C 3 155 ? -70.612  -23.887 -41.679  1.00 0.00 ? 155 PRO C CA   1  
ATOM   7912   C C    . PRO C 3 155 ? -71.722  -24.884 -41.392  1.00 0.00 ? 155 PRO C C    1  
ATOM   7913   O O    . PRO C 3 155 ? -71.596  -26.063 -41.744  1.00 0.00 ? 155 PRO C O    1  
ATOM   7914   C CB   . PRO C 3 155 ? -71.099  -22.877 -42.720  1.00 0.00 ? 155 PRO C CB   1  
ATOM   7915   C CG   . PRO C 3 155 ? -70.765  -23.506 -44.058  1.00 0.00 ? 155 PRO C CG   1  
ATOM   7916   C CD   . PRO C 3 155 ? -69.744  -24.577 -43.823  1.00 0.00 ? 155 PRO C CD   1  
ATOM   7917   H HA   . PRO C 3 155 ? -70.283  -23.381 -40.788  1.00 0.00 ? 155 PRO C HA   1  
ATOM   7918   H HB2  . PRO C 3 155 ? -72.167  -22.727 -42.627  1.00 0.00 ? 155 PRO C HB2  1  
ATOM   7919   H HB3  . PRO C 3 155 ? -70.575  -21.941 -42.612  1.00 0.00 ? 155 PRO C HB3  1  
ATOM   7920   H HG2  . PRO C 3 155 ? -71.656  -23.936 -44.492  1.00 0.00 ? 155 PRO C HG2  1  
ATOM   7921   H HG3  . PRO C 3 155 ? -70.358  -22.758 -44.721  1.00 0.00 ? 155 PRO C HG3  1  
ATOM   7922   H HD2  . PRO C 3 155 ? -70.133  -25.541 -44.124  1.00 0.00 ? 155 PRO C HD2  1  
ATOM   7923   H HD3  . PRO C 3 155 ? -68.830  -24.353 -44.349  1.00 0.00 ? 155 PRO C HD3  1  
ATOM   7924   N N    . VAL C 3 156 ? -72.788  -24.427 -40.746  1.00 0.00 ? 156 VAL C N    1  
ATOM   7925   C CA   . VAL C 3 156 ? -74.065  -25.130 -40.821  1.00 0.00 ? 156 VAL C CA   1  
ATOM   7926   C C    . VAL C 3 156 ? -75.062  -24.195 -41.492  1.00 0.00 ? 156 VAL C C    1  
ATOM   7927   O O    . VAL C 3 156 ? -74.705  -23.072 -41.845  1.00 0.00 ? 156 VAL C O    1  
ATOM   7928   C CB   . VAL C 3 156 ? -74.573  -25.628 -39.448  1.00 0.00 ? 156 VAL C CB   1  
ATOM   7929   C CG1  . VAL C 3 156 ? -74.161  -27.058 -39.238  1.00 0.00 ? 156 VAL C CG1  1  
ATOM   7930   C CG2  . VAL C 3 156 ? -74.059  -24.761 -38.318  1.00 0.00 ? 156 VAL C CG2  1  
ATOM   7931   H H    . VAL C 3 156 ? -72.799  -23.482 -40.484  1.00 0.00 ? 156 VAL C H    1  
ATOM   7932   H HA   . VAL C 3 156 ? -73.931  -25.989 -41.467  1.00 0.00 ? 156 VAL C HA   1  
ATOM   7933   H HB   . VAL C 3 156 ? -75.655  -25.586 -39.453  1.00 0.00 ? 156 VAL C HB   1  
ATOM   7934   H HG11 . VAL C 3 156 ? -73.931  -27.510 -40.191  1.00 0.00 ? 156 VAL C HG11 1  
ATOM   7935   H HG12 . VAL C 3 156 ? -74.968  -27.599 -38.767  1.00 0.00 ? 156 VAL C HG12 1  
ATOM   7936   H HG13 . VAL C 3 156 ? -73.287  -27.091 -38.605  1.00 0.00 ? 156 VAL C HG13 1  
ATOM   7937   H HG21 . VAL C 3 156 ? -73.447  -25.357 -37.656  1.00 0.00 ? 156 VAL C HG21 1  
ATOM   7938   H HG22 . VAL C 3 156 ? -74.895  -24.354 -37.767  1.00 0.00 ? 156 VAL C HG22 1  
ATOM   7939   H HG23 . VAL C 3 156 ? -73.468  -23.953 -38.723  1.00 0.00 ? 156 VAL C HG23 1  
ATOM   7940   N N    . THR C 3 157 ? -76.289  -24.661 -41.707  1.00 0.00 ? 157 THR C N    1  
ATOM   7941   C CA   . THR C 3 157 ? -77.352  -23.812 -42.244  1.00 0.00 ? 157 THR C CA   1  
ATOM   7942   C C    . THR C 3 157 ? -78.659  -24.005 -41.467  1.00 0.00 ? 157 THR C C    1  
ATOM   7943   O O    . THR C 3 157 ? -79.407  -24.975 -41.686  1.00 0.00 ? 157 THR C O    1  
ATOM   7944   C CB   . THR C 3 157 ? -77.519  -23.980 -43.773  1.00 0.00 ? 157 THR C CB   1  
ATOM   7945   O OG1  . THR C 3 157 ? -76.534  -23.180 -44.430  1.00 0.00 ? 157 THR C OG1  1  
ATOM   7946   C CG2  . THR C 3 157 ? -78.892  -23.517 -44.243  1.00 0.00 ? 157 THR C CG2  1  
ATOM   7947   H H    . THR C 3 157 ? -76.505  -25.576 -41.432  1.00 0.00 ? 157 THR C H    1  
ATOM   7948   H HA   . THR C 3 157 ? -77.043  -22.789 -42.070  1.00 0.00 ? 157 THR C HA   1  
ATOM   7949   H HB   . THR C 3 157 ? -77.378  -25.017 -44.040  1.00 0.00 ? 157 THR C HB   1  
ATOM   7950   H HG1  . THR C 3 157 ? -76.334  -22.431 -43.863  1.00 0.00 ? 157 THR C HG1  1  
ATOM   7951   H HG21 . THR C 3 157 ? -79.033  -22.480 -43.975  1.00 0.00 ? 157 THR C HG21 1  
ATOM   7952   H HG22 . THR C 3 157 ? -79.655  -24.118 -43.771  1.00 0.00 ? 157 THR C HG22 1  
ATOM   7953   H HG23 . THR C 3 157 ? -78.960  -23.624 -45.315  1.00 0.00 ? 157 THR C HG23 1  
ATOM   7954   N N    . LEU C 3 158 ? -78.906  -23.069 -40.546  1.00 0.00 ? 158 LEU C N    1  
ATOM   7955   C CA   . LEU C 3 158 ? -80.057  -23.129 -39.658  1.00 0.00 ? 158 LEU C CA   1  
ATOM   7956   C C    . LEU C 3 158 ? -81.191  -22.269 -40.202  1.00 0.00 ? 158 LEU C C    1  
ATOM   7957   O O    . LEU C 3 158 ? -81.028  -21.065 -40.396  1.00 0.00 ? 158 LEU C O    1  
ATOM   7958   C CB   . LEU C 3 158 ? -79.653  -22.668 -38.257  1.00 0.00 ? 158 LEU C CB   1  
ATOM   7959   C CG   . LEU C 3 158 ? -80.366  -23.233 -37.028  1.00 0.00 ? 158 LEU C CG   1  
ATOM   7960   C CD1  . LEU C 3 158 ? -79.545  -22.912 -35.791  1.00 0.00 ? 158 LEU C CD1  1  
ATOM   7961   C CD2  . LEU C 3 158 ? -81.776  -22.684 -36.898  1.00 0.00 ? 158 LEU C CD2  1  
ATOM   7962   H H    . LEU C 3 158 ? -78.259  -22.342 -40.430  1.00 0.00 ? 158 LEU C H    1  
ATOM   7963   H HA   . LEU C 3 158 ? -80.397  -24.153 -39.600  1.00 0.00 ? 158 LEU C HA   1  
ATOM   7964   H HB2  . LEU C 3 158 ? -78.606  -22.888 -38.137  1.00 0.00 ? 158 LEU C HB2  1  
ATOM   7965   H HB3  . LEU C 3 158 ? -79.758  -21.590 -38.235  1.00 0.00 ? 158 LEU C HB3  1  
ATOM   7966   H HG   . LEU C 3 158 ? -80.417  -24.309 -37.131  1.00 0.00 ? 158 LEU C HG   1  
ATOM   7967   H HD11 . LEU C 3 158 ? -79.863  -23.543 -34.974  1.00 0.00 ? 158 LEU C HD11 1  
ATOM   7968   H HD12 . LEU C 3 158 ? -79.690  -21.875 -35.522  1.00 0.00 ? 158 LEU C HD12 1  
ATOM   7969   H HD13 . LEU C 3 158 ? -78.500  -23.088 -35.996  1.00 0.00 ? 158 LEU C HD13 1  
ATOM   7970   H HD21 . LEU C 3 158 ? -81.735  -21.668 -36.535  1.00 0.00 ? 158 LEU C HD21 1  
ATOM   7971   H HD22 . LEU C 3 158 ? -82.336  -23.292 -36.202  1.00 0.00 ? 158 LEU C HD22 1  
ATOM   7972   H HD23 . LEU C 3 158 ? -82.260  -22.703 -37.863  1.00 0.00 ? 158 LEU C HD23 1  
ATOM   7973   N N    . THR C 3 159 ? -82.334  -22.903 -40.447  1.00 0.00 ? 159 THR C N    1  
ATOM   7974   C CA   . THR C 3 159 ? -83.522  -22.224 -40.977  1.00 0.00 ? 159 THR C CA   1  
ATOM   7975   C C    . THR C 3 159 ? -84.738  -22.478 -40.089  1.00 0.00 ? 159 THR C C    1  
ATOM   7976   O O    . THR C 3 159 ? -85.038  -23.626 -39.741  1.00 0.00 ? 159 THR C O    1  
ATOM   7977   C CB   . THR C 3 159 ? -83.829  -22.630 -42.470  1.00 0.00 ? 159 THR C CB   1  
ATOM   7978   O OG1  . THR C 3 159 ? -85.202  -22.376 -42.791  1.00 0.00 ? 159 THR C OG1  1  
ATOM   7979   C CG2  . THR C 3 159 ? -83.550  -24.101 -42.717  1.00 0.00 ? 159 THR C CG2  1  
ATOM   7980   H H    . THR C 3 159 ? -82.384  -23.865 -40.268  1.00 0.00 ? 159 THR C H    1  
ATOM   7981   H HA   . THR C 3 159 ? -83.323  -21.162 -40.960  1.00 0.00 ? 159 THR C HA   1  
ATOM   7982   H HB   . THR C 3 159 ? -83.204  -22.042 -43.126  1.00 0.00 ? 159 THR C HB   1  
ATOM   7983   H HG1  . THR C 3 159 ? -85.523  -21.691 -42.201  1.00 0.00 ? 159 THR C HG1  1  
ATOM   7984   H HG21 . THR C 3 159 ? -83.310  -24.252 -43.759  1.00 0.00 ? 159 THR C HG21 1  
ATOM   7985   H HG22 . THR C 3 159 ? -84.424  -24.681 -42.461  1.00 0.00 ? 159 THR C HG22 1  
ATOM   7986   H HG23 . THR C 3 159 ? -82.717  -24.416 -42.107  1.00 0.00 ? 159 THR C HG23 1  
ATOM   7987   N N    . TRP C 3 160 ? -85.429  -21.404 -39.719  1.00 0.00 ? 160 TRP C N    1  
ATOM   7988   C CA   . TRP C 3 160 ? -86.694  -21.528 -39.011  1.00 0.00 ? 160 TRP C CA   1  
ATOM   7989   C C    . TRP C 3 160 ? -87.843  -21.698 -39.992  1.00 0.00 ? 160 TRP C C    1  
ATOM   7990   O O    . TRP C 3 160 ? -88.027  -20.866 -40.896  1.00 0.00 ? 160 TRP C O    1  
ATOM   7991   C CB   . TRP C 3 160 ? -86.907  -20.335 -38.093  1.00 0.00 ? 160 TRP C CB   1  
ATOM   7992   C CG   . TRP C 3 160 ? -85.946  -20.362 -36.978  1.00 0.00 ? 160 TRP C CG   1  
ATOM   7993   C CD1  . TRP C 3 160 ? -84.768  -19.699 -36.900  1.00 0.00 ? 160 TRP C CD1  1  
ATOM   7994   C CD2  . TRP C 3 160 ? -86.051  -21.137 -35.786  1.00 0.00 ? 160 TRP C CD2  1  
ATOM   7995   N NE1  . TRP C 3 160 ? -84.136  -19.987 -35.721  1.00 0.00 ? 160 TRP C NE1  1  
ATOM   7996   C CE2  . TRP C 3 160 ? -84.903  -20.877 -35.019  1.00 0.00 ? 160 TRP C CE2  1  
ATOM   7997   C CE3  . TRP C 3 160 ? -87.019  -22.015 -35.283  1.00 0.00 ? 160 TRP C CE3  1  
ATOM   7998   C CZ2  . TRP C 3 160 ? -84.691  -21.461 -33.780  1.00 0.00 ? 160 TRP C CZ2  1  
ATOM   7999   C CZ3  . TRP C 3 160 ? -86.811  -22.586 -34.061  1.00 0.00 ? 160 TRP C CZ3  1  
ATOM   8000   C CH2  . TRP C 3 160 ? -85.652  -22.313 -33.320  1.00 0.00 ? 160 TRP C CH2  1  
ATOM   8001   H H    . TRP C 3 160 ? -85.136  -20.519 -40.022  1.00 0.00 ? 160 TRP C H    1  
ATOM   8002   H HA   . TRP C 3 160 ? -86.646  -22.418 -38.399  1.00 0.00 ? 160 TRP C HA   1  
ATOM   8003   H HB2  . TRP C 3 160 ? -86.773  -19.424 -38.656  1.00 0.00 ? 160 TRP C HB2  1  
ATOM   8004   H HB3  . TRP C 3 160 ? -87.913  -20.365 -37.699  1.00 0.00 ? 160 TRP C HB3  1  
ATOM   8005   H HD1  . TRP C 3 160 ? -84.390  -19.024 -37.653  1.00 0.00 ? 160 TRP C HD1  1  
ATOM   8006   H HE1  . TRP C 3 160 ? -83.275  -19.633 -35.415  1.00 0.00 ? 160 TRP C HE1  1  
ATOM   8007   H HE3  . TRP C 3 160 ? -87.914  -22.230 -35.847  1.00 0.00 ? 160 TRP C HE3  1  
ATOM   8008   H HZ2  . TRP C 3 160 ? -83.801  -21.254 -33.206  1.00 0.00 ? 160 TRP C HZ2  1  
ATOM   8009   H HZ3  . TRP C 3 160 ? -87.548  -23.266 -33.661  1.00 0.00 ? 160 TRP C HZ3  1  
ATOM   8010   H HH2  . TRP C 3 160 ? -85.521  -22.783 -32.357  1.00 0.00 ? 160 TRP C HH2  1  
ATOM   8011   N N    . ASN C 3 161 ? -88.590  -22.793 -39.814  1.00 0.00 ? 161 ASN C N    1  
ATOM   8012   C CA   . ASN C 3 161 ? -89.737  -23.143 -40.663  1.00 0.00 ? 161 ASN C CA   1  
ATOM   8013   C C    . ASN C 3 161 ? -89.506  -23.002 -42.165  1.00 0.00 ? 161 ASN C C    1  
ATOM   8014   O O    . ASN C 3 161 ? -90.172  -22.185 -42.818  1.00 0.00 ? 161 ASN C O    1  
ATOM   8015   C CB   . ASN C 3 161 ? -90.985  -22.348 -40.268  1.00 0.00 ? 161 ASN C CB   1  
ATOM   8016   C CG   . ASN C 3 161 ? -91.896  -23.115 -39.341  1.00 0.00 ? 161 ASN C CG   1  
ATOM   8017   O OD1  . ASN C 3 161 ? -92.996  -22.659 -39.046  1.00 0.00 ? 161 ASN C OD1  1  
ATOM   8018   N ND2  . ASN C 3 161 ? -91.455  -24.291 -38.885  1.00 0.00 ? 161 ASN C ND2  1  
ATOM   8019   H H    . ASN C 3 161 ? -88.355  -23.399 -39.081  1.00 0.00 ? 161 ASN C H    1  
ATOM   8020   H HA   . ASN C 3 161 ? -89.957  -24.183 -40.476  1.00 0.00 ? 161 ASN C HA   1  
ATOM   8021   H HB2  . ASN C 3 161 ? -90.678  -21.438 -39.776  1.00 0.00 ? 161 ASN C HB2  1  
ATOM   8022   H HB3  . ASN C 3 161 ? -91.531  -22.091 -41.164  1.00 0.00 ? 161 ASN C HB3  1  
ATOM   8023   H HD21 . ASN C 3 161 ? -90.573  -24.622 -39.155  1.00 0.00 ? 161 ASN C HD21 1  
ATOM   8024   H HD22 . ASN C 3 161 ? -92.014  -24.824 -38.281  1.00 0.00 ? 161 ASN C HD22 1  
ATOM   8025   N N    . SER C 3 162 ? -88.566  -23.793 -42.693  1.00 0.00 ? 162 SER C N    1  
ATOM   8026   C CA   . SER C 3 162 ? -88.267  -23.858 -44.131  1.00 0.00 ? 162 SER C CA   1  
ATOM   8027   C C    . SER C 3 162 ? -88.026  -22.485 -44.758  1.00 0.00 ? 162 SER C C    1  
ATOM   8028   O O    . SER C 3 162 ? -88.453  -22.228 -45.891  1.00 0.00 ? 162 SER C O    1  
ATOM   8029   C CB   . SER C 3 162 ? -89.384  -24.589 -44.879  1.00 0.00 ? 162 SER C CB   1  
ATOM   8030   O OG   . SER C 3 162 ? -89.648  -25.841 -44.275  1.00 0.00 ? 162 SER C OG   1  
ATOM   8031   H H    . SER C 3 162 ? -88.117  -24.363 -42.144  1.00 0.00 ? 162 SER C H    1  
ATOM   8032   H HA   . SER C 3 162 ? -87.362  -24.434 -44.250  1.00 0.00 ? 162 SER C HA   1  
ATOM   8033   H HB2  . SER C 3 162 ? -90.281  -23.993 -44.854  1.00 0.00 ? 162 SER C HB2  1  
ATOM   8034   H HB3  . SER C 3 162 ? -89.085  -24.732 -45.910  1.00 0.00 ? 162 SER C HB3  1  
ATOM   8035   H HG   . SER C 3 162 ? -88.909  -26.055 -43.700  1.00 0.00 ? 162 SER C HG   1  
ATOM   8036   N N    . GLY C 3 163 ? -87.349  -21.612 -44.008  1.00 0.00 ? 163 GLY C N    1  
ATOM   8037   C CA   . GLY C 3 163 ? -87.038  -20.257 -44.449  1.00 0.00 ? 163 GLY C CA   1  
ATOM   8038   C C    . GLY C 3 163 ? -88.167  -19.262 -44.256  1.00 0.00 ? 163 GLY C C    1  
ATOM   8039   O O    . GLY C 3 163 ? -87.962  -18.051 -44.416  1.00 0.00 ? 163 GLY C O    1  
ATOM   8040   H H    . GLY C 3 163 ? -87.051  -21.894 -43.118  1.00 0.00 ? 163 GLY C H    1  
ATOM   8041   H HA2  . GLY C 3 163 ? -86.178  -19.908 -43.899  1.00 0.00 ? 163 GLY C HA2  1  
ATOM   8042   H HA3  . GLY C 3 163 ? -86.782  -20.290 -45.499  1.00 0.00 ? 163 GLY C HA3  1  
ATOM   8043   N N    . SER C 3 164 ? -89.354  -19.765 -43.916  1.00 0.00 ? 164 SER C N    1  
ATOM   8044   C CA   . SER C 3 164 ? -90.547  -18.923 -43.782  1.00 0.00 ? 164 SER C CA   1  
ATOM   8045   C C    . SER C 3 164 ? -90.520  -18.041 -42.533  1.00 0.00 ? 164 SER C C    1  
ATOM   8046   O O    . SER C 3 164 ? -90.980  -16.893 -42.572  1.00 0.00 ? 164 SER C O    1  
ATOM   8047   C CB   . SER C 3 164 ? -91.811  -19.770 -43.817  1.00 0.00 ? 164 SER C CB   1  
ATOM   8048   O OG   . SER C 3 164 ? -91.871  -20.491 -45.028  1.00 0.00 ? 164 SER C OG   1  
ATOM   8049   H H    . SER C 3 164 ? -89.444  -20.735 -43.807  1.00 0.00 ? 164 SER C H    1  
ATOM   8050   H HA   . SER C 3 164 ? -90.574  -18.265 -44.639  1.00 0.00 ? 164 SER C HA   1  
ATOM   8051   H HB2  . SER C 3 164 ? -91.802  -20.464 -42.994  1.00 0.00 ? 164 SER C HB2  1  
ATOM   8052   H HB3  . SER C 3 164 ? -92.675  -19.124 -43.728  1.00 0.00 ? 164 SER C HB3  1  
ATOM   8053   H HG   . SER C 3 164 ? -90.976  -20.740 -45.270  1.00 0.00 ? 164 SER C HG   1  
ATOM   8054   N N    . LEU C 3 165 ? -89.983  -18.577 -41.434  1.00 0.00 ? 165 LEU C N    1  
ATOM   8055   C CA   . LEU C 3 165 ? -89.707  -17.763 -40.253  1.00 0.00 ? 165 LEU C CA   1  
ATOM   8056   C C    . LEU C 3 165 ? -88.313  -17.160 -40.439  1.00 0.00 ? 165 LEU C C    1  
ATOM   8057   O O    . LEU C 3 165 ? -87.290  -17.788 -40.165  1.00 0.00 ? 165 LEU C O    1  
ATOM   8058   C CB   . LEU C 3 165 ? -89.842  -18.574 -38.955  1.00 0.00 ? 165 LEU C CB   1  
ATOM   8059   C CG   . LEU C 3 165 ? -90.790  -18.010 -37.893  1.00 0.00 ? 165 LEU C CG   1  
ATOM   8060   C CD1  . LEU C 3 165 ? -92.207  -17.888 -38.428  1.00 0.00 ? 165 LEU C CD1  1  
ATOM   8061   C CD2  . LEU C 3 165 ? -90.796  -18.870 -36.659  1.00 0.00 ? 165 LEU C CD2  1  
ATOM   8062   H H    . LEU C 3 165 ? -89.638  -19.493 -41.472  1.00 0.00 ? 165 LEU C H    1  
ATOM   8063   H HA   . LEU C 3 165 ? -90.423  -16.951 -40.231  1.00 0.00 ? 165 LEU C HA   1  
ATOM   8064   H HB2  . LEU C 3 165 ? -90.186  -19.562 -39.212  1.00 0.00 ? 165 LEU C HB2  1  
ATOM   8065   H HB3  . LEU C 3 165 ? -88.857  -18.667 -38.518  1.00 0.00 ? 165 LEU C HB3  1  
ATOM   8066   H HG   . LEU C 3 165 ? -90.445  -17.022 -37.622  1.00 0.00 ? 165 LEU C HG   1  
ATOM   8067   H HD11 . LEU C 3 165 ? -92.231  -18.205 -39.460  1.00 0.00 ? 165 LEU C HD11 1  
ATOM   8068   H HD12 . LEU C 3 165 ? -92.530  -16.860 -38.359  1.00 0.00 ? 165 LEU C HD12 1  
ATOM   8069   H HD13 . LEU C 3 165 ? -92.867  -18.513 -37.844  1.00 0.00 ? 165 LEU C HD13 1  
ATOM   8070   H HD21 . LEU C 3 165 ? -90.240  -18.379 -35.875  1.00 0.00 ? 165 LEU C HD21 1  
ATOM   8071   H HD22 . LEU C 3 165 ? -90.339  -19.823 -36.883  1.00 0.00 ? 165 LEU C HD22 1  
ATOM   8072   H HD23 . LEU C 3 165 ? -91.814  -19.026 -36.334  1.00 0.00 ? 165 LEU C HD23 1  
ATOM   8073   N N    . SER C 3 166 ? -88.296  -15.943 -40.966  1.00 0.00 ? 166 SER C N    1  
ATOM   8074   C CA   . SER C 3 166 ? -87.053  -15.265 -41.286  1.00 0.00 ? 166 SER C CA   1  
ATOM   8075   C C    . SER C 3 166 ? -86.971  -13.928 -40.577  1.00 0.00 ? 166 SER C C    1  
ATOM   8076   O O    . SER C 3 166 ? -85.872  -13.482 -40.235  1.00 0.00 ? 166 SER C O    1  
ATOM   8077   C CB   . SER C 3 166 ? -86.911  -15.066 -42.804  1.00 0.00 ? 166 SER C CB   1  
ATOM   8078   O OG   . SER C 3 166 ? -88.047  -14.425 -43.358  1.00 0.00 ? 166 SER C OG   1  
ATOM   8079   H H    . SER C 3 166 ? -89.146  -15.513 -41.198  1.00 0.00 ? 166 SER C H    1  
ATOM   8080   H HA   . SER C 3 166 ? -86.234  -15.881 -40.947  1.00 0.00 ? 166 SER C HA   1  
ATOM   8081   H HB2  . SER C 3 166 ? -86.045  -14.459 -43.000  1.00 0.00 ? 166 SER C HB2  1  
ATOM   8082   H HB3  . SER C 3 166 ? -86.772  -16.033 -43.272  1.00 0.00 ? 166 SER C HB3  1  
ATOM   8083   H HG   . SER C 3 166 ? -87.998  -13.492 -43.139  1.00 0.00 ? 166 SER C HG   1  
ATOM   8084   N N    . SER C 3 167 ? -88.127  -13.294 -40.359  1.00 0.00 ? 167 SER C N    1  
ATOM   8085   C CA   . SER C 3 167 ? -88.175  -12.004 -39.660  1.00 0.00 ? 167 SER C CA   1  
ATOM   8086   C C    . SER C 3 167 ? -88.307  -12.125 -38.134  1.00 0.00 ? 167 SER C C    1  
ATOM   8087   O O    . SER C 3 167 ? -89.390  -12.421 -37.611  1.00 0.00 ? 167 SER C O    1  
ATOM   8088   C CB   . SER C 3 167 ? -89.282  -11.113 -40.218  1.00 0.00 ? 167 SER C CB   1  
ATOM   8089   O OG   . SER C 3 167 ? -89.312  -9.882  -39.518  1.00 0.00 ? 167 SER C OG   1  
ATOM   8090   H H    . SER C 3 167 ? -88.964  -13.707 -40.660  1.00 0.00 ? 167 SER C H    1  
ATOM   8091   H HA   . SER C 3 167 ? -87.237  -11.505 -39.857  1.00 0.00 ? 167 SER C HA   1  
ATOM   8092   H HB2  . SER C 3 167 ? -89.097  -10.919 -41.261  1.00 0.00 ? 167 SER C HB2  1  
ATOM   8093   H HB3  . SER C 3 167 ? -90.233  -11.619 -40.114  1.00 0.00 ? 167 SER C HB3  1  
ATOM   8094   H HG   . SER C 3 167 ? -88.693  -9.942  -38.786  1.00 0.00 ? 167 SER C HG   1  
ATOM   8095   N N    . GLY C 3 168 ? -87.193  -11.886 -37.440  1.00 0.00 ? 168 GLY C N    1  
ATOM   8096   C CA   . GLY C 3 168 ? -87.151  -11.899 -35.986  1.00 0.00 ? 168 GLY C CA   1  
ATOM   8097   C C    . GLY C 3 168 ? -86.406  -13.092 -35.435  1.00 0.00 ? 168 GLY C C    1  
ATOM   8098   O O    . GLY C 3 168 ? -86.952  -13.844 -34.639  1.00 0.00 ? 168 GLY C O    1  
ATOM   8099   H H    . GLY C 3 168 ? -86.377  -11.654 -37.930  1.00 0.00 ? 168 GLY C H    1  
ATOM   8100   H HA2  . GLY C 3 168 ? -86.665  -10.998 -35.644  1.00 0.00 ? 168 GLY C HA2  1  
ATOM   8101   H HA3  . GLY C 3 168 ? -88.163  -11.915 -35.608  1.00 0.00 ? 168 GLY C HA3  1  
ATOM   8102   N N    . VAL C 3 169 ? -85.150  -13.249 -35.835  1.00 0.00 ? 169 VAL C N    1  
ATOM   8103   C CA   . VAL C 3 169 ? -84.352  -14.409 -35.430  1.00 0.00 ? 169 VAL C CA   1  
ATOM   8104   C C    . VAL C 3 169 ? -82.850  -14.092 -35.338  1.00 0.00 ? 169 VAL C C    1  
ATOM   8105   O O    . VAL C 3 169 ? -82.330  -13.369 -36.174  1.00 0.00 ? 169 VAL C O    1  
ATOM   8106   C CB   . VAL C 3 169 ? -84.636  -15.628 -36.378  1.00 0.00 ? 169 VAL C CB   1  
ATOM   8107   C CG1  . VAL C 3 169 ? -84.939  -15.165 -37.806  1.00 0.00 ? 169 VAL C CG1  1  
ATOM   8108   C CG2  . VAL C 3 169 ? -83.505  -16.658 -36.363  1.00 0.00 ? 169 VAL C CG2  1  
ATOM   8109   H H    . VAL C 3 169 ? -84.763  -12.598 -36.458  1.00 0.00 ? 169 VAL C H    1  
ATOM   8110   H HA   . VAL C 3 169 ? -84.679  -14.690 -34.440  1.00 0.00 ? 169 VAL C HA   1  
ATOM   8111   H HB   . VAL C 3 169 ? -85.530  -16.113 -36.008  1.00 0.00 ? 169 VAL C HB   1  
ATOM   8112   H HG11 . VAL C 3 169 ? -85.985  -15.329 -38.023  1.00 0.00 ? 169 VAL C HG11 1  
ATOM   8113   H HG12 . VAL C 3 169 ? -84.335  -15.727 -38.503  1.00 0.00 ? 169 VAL C HG12 1  
ATOM   8114   H HG13 . VAL C 3 169 ? -84.713  -14.113 -37.899  1.00 0.00 ? 169 VAL C HG13 1  
ATOM   8115   H HG21 . VAL C 3 169 ? -83.906  -17.629 -36.109  1.00 0.00 ? 169 VAL C HG21 1  
ATOM   8116   H HG22 . VAL C 3 169 ? -82.766  -16.371 -35.631  1.00 0.00 ? 169 VAL C HG22 1  
ATOM   8117   H HG23 . VAL C 3 169 ? -83.046  -16.704 -37.340  1.00 0.00 ? 169 VAL C HG23 1  
ATOM   8118   N N    . HIS C 3 170 ? -82.166  -14.624 -34.323  1.00 0.00 ? 170 HIS C N    1  
ATOM   8119   C CA   . HIS C 3 170 ? -80.711  -14.441 -34.173  1.00 0.00 ? 170 HIS C CA   1  
ATOM   8120   C C    . HIS C 3 170 ? -79.937  -15.762 -34.168  1.00 0.00 ? 170 HIS C C    1  
ATOM   8121   O O    . HIS C 3 170 ? -80.302  -16.692 -33.444  1.00 0.00 ? 170 HIS C O    1  
ATOM   8122   C CB   . HIS C 3 170 ? -80.386  -13.645 -32.907  1.00 0.00 ? 170 HIS C CB   1  
ATOM   8123   C CG   . HIS C 3 170 ? -81.018  -12.292 -32.874  1.00 0.00 ? 170 HIS C CG   1  
ATOM   8124   N ND1  . HIS C 3 170 ? -81.898  -11.906 -31.886  1.00 0.00 ? 170 HIS C ND1  1  
ATOM   8125   C CD2  . HIS C 3 170 ? -80.921  -11.241 -33.723  1.00 0.00 ? 170 HIS C CD2  1  
ATOM   8126   C CE1  . HIS C 3 170 ? -82.310  -10.673 -32.123  1.00 0.00 ? 170 HIS C CE1  1  
ATOM   8127   N NE2  . HIS C 3 170 ? -81.733  -10.247 -33.232  1.00 0.00 ? 170 HIS C NE2  1  
ATOM   8128   H H    . HIS C 3 170 ? -82.639  -15.191 -33.678  1.00 0.00 ? 170 HIS C H    1  
ATOM   8129   H HA   . HIS C 3 170 ? -80.366  -13.865 -35.019  1.00 0.00 ? 170 HIS C HA   1  
ATOM   8130   H HB2  . HIS C 3 170 ? -80.730  -14.202 -32.050  1.00 0.00 ? 170 HIS C HB2  1  
ATOM   8131   H HB3  . HIS C 3 170 ? -79.313  -13.532 -32.837  1.00 0.00 ? 170 HIS C HB3  1  
ATOM   8132   H HD1  . HIS C 3 170 ? -82.174  -12.460 -31.125  1.00 0.00 ? 170 HIS C HD1  1  
ATOM   8133   H HD2  . HIS C 3 170 ? -80.318  -11.194 -34.618  1.00 0.00 ? 170 HIS C HD2  1  
ATOM   8134   H HE1  . HIS C 3 170 ? -83.002  -10.110 -31.514  1.00 0.00 ? 170 HIS C HE1  1  
ATOM   8135   H HE2  . HIS C 3 170 ? -81.863  -9.365  -33.639  1.00 0.00 ? 170 HIS C HE2  1  
ATOM   8136   N N    . THR C 3 171 ? -78.868  -15.838 -34.963  1.00 0.00 ? 171 THR C N    1  
ATOM   8137   C CA   . THR C 3 171 ? -78.066  -17.063 -35.064  1.00 0.00 ? 171 THR C CA   1  
ATOM   8138   C C    . THR C 3 171 ? -76.585  -16.833 -34.793  1.00 0.00 ? 171 THR C C    1  
ATOM   8139   O O    . THR C 3 171 ? -75.834  -16.383 -35.659  1.00 0.00 ? 171 THR C O    1  
ATOM   8140   C CB   . THR C 3 171 ? -78.233  -17.741 -36.428  1.00 0.00 ? 171 THR C CB   1  
ATOM   8141   O OG1  . THR C 3 171 ? -79.626  -17.819 -36.761  1.00 0.00 ? 171 THR C OG1  1  
ATOM   8142   C CG2  . THR C 3 171 ? -77.640  -19.146 -36.383  1.00 0.00 ? 171 THR C CG2  1  
ATOM   8143   H H    . THR C 3 171 ? -78.623  -15.061 -35.508  1.00 0.00 ? 171 THR C H    1  
ATOM   8144   H HA   . THR C 3 171 ? -78.430  -17.749 -34.314  1.00 0.00 ? 171 THR C HA   1  
ATOM   8145   H HB   . THR C 3 171 ? -77.717  -17.163 -37.179  1.00 0.00 ? 171 THR C HB   1  
ATOM   8146   H HG1  . THR C 3 171 ? -79.902  -16.958 -37.085  1.00 0.00 ? 171 THR C HG1  1  
ATOM   8147   H HG21 . THR C 3 171 ? -76.836  -19.174 -35.663  1.00 0.00 ? 171 THR C HG21 1  
ATOM   8148   H HG22 . THR C 3 171 ? -77.259  -19.406 -37.360  1.00 0.00 ? 171 THR C HG22 1  
ATOM   8149   H HG23 . THR C 3 171 ? -78.406  -19.850 -36.096  1.00 0.00 ? 171 THR C HG23 1  
ATOM   8150   N N    . PHE C 3 172 ? -76.168  -17.211 -33.597  1.00 0.00 ? 172 PHE C N    1  
ATOM   8151   C CA   . PHE C 3 172 ? -74.914  -16.751 -33.005  1.00 0.00 ? 172 PHE C CA   1  
ATOM   8152   C C    . PHE C 3 172 ? -73.683  -17.532 -33.464  1.00 0.00 ? 172 PHE C C    1  
ATOM   8153   O O    . PHE C 3 172 ? -73.702  -18.754 -33.491  1.00 0.00 ? 172 PHE C O    1  
ATOM   8154   C CB   . PHE C 3 172 ? -75.068  -16.748 -31.480  1.00 0.00 ? 172 PHE C CB   1  
ATOM   8155   C CG   . PHE C 3 172 ? -76.383  -16.171 -31.026  1.00 0.00 ? 172 PHE C CG   1  
ATOM   8156   C CD1  . PHE C 3 172 ? -77.533  -16.960 -30.995  1.00 0.00 ? 172 PHE C CD1  1  
ATOM   8157   C CD2  . PHE C 3 172 ? -76.485  -14.828 -30.681  1.00 0.00 ? 172 PHE C CD2  1  
ATOM   8158   C CE1  . PHE C 3 172 ? -78.753  -16.430 -30.611  1.00 0.00 ? 172 PHE C CE1  1  
ATOM   8159   C CE2  . PHE C 3 172 ? -77.708  -14.285 -30.291  1.00 0.00 ? 172 PHE C CE2  1  
ATOM   8160   C CZ   . PHE C 3 172 ? -78.843  -15.091 -30.252  1.00 0.00 ? 172 PHE C CZ   1  
ATOM   8161   H H    . PHE C 3 172 ? -76.829  -17.610 -32.994  1.00 0.00 ? 172 PHE C H    1  
ATOM   8162   H HA   . PHE C 3 172 ? -74.773  -15.726 -33.313  1.00 0.00 ? 172 PHE C HA   1  
ATOM   8163   H HB2  . PHE C 3 172 ? -74.992  -17.762 -31.119  1.00 0.00 ? 172 PHE C HB2  1  
ATOM   8164   H HB3  . PHE C 3 172 ? -74.263  -16.166 -31.052  1.00 0.00 ? 172 PHE C HB3  1  
ATOM   8165   H HD1  . PHE C 3 172 ? -77.467  -18.005 -31.261  1.00 0.00 ? 172 PHE C HD1  1  
ATOM   8166   H HD2  . PHE C 3 172 ? -75.606  -14.201 -30.710  1.00 0.00 ? 172 PHE C HD2  1  
ATOM   8167   H HE1  . PHE C 3 172 ? -79.633  -17.055 -30.593  1.00 0.00 ? 172 PHE C HE1  1  
ATOM   8168   H HE2  . PHE C 3 172 ? -77.774  -13.244 -30.013  1.00 0.00 ? 172 PHE C HE2  1  
ATOM   8169   H HZ   . PHE C 3 172 ? -79.792  -14.673 -29.952  1.00 0.00 ? 172 PHE C HZ   1  
ATOM   8170   N N    . PRO C 3 173 ? -72.615  -16.811 -33.844  1.00 0.00 ? 173 PRO C N    1  
ATOM   8171   C CA   . PRO C 3 173 ? -71.353  -17.343 -34.368  1.00 0.00 ? 173 PRO C CA   1  
ATOM   8172   C C    . PRO C 3 173 ? -70.822  -18.560 -33.624  1.00 0.00 ? 173 PRO C C    1  
ATOM   8173   O O    . PRO C 3 173 ? -70.409  -18.432 -32.482  1.00 0.00 ? 173 PRO C O    1  
ATOM   8174   C CB   . PRO C 3 173 ? -70.385  -16.175 -34.166  1.00 0.00 ? 173 PRO C CB   1  
ATOM   8175   C CG   . PRO C 3 173 ? -71.240  -14.946 -34.249  1.00 0.00 ? 173 PRO C CG   1  
ATOM   8176   C CD   . PRO C 3 173 ? -72.656  -15.337 -33.911  1.00 0.00 ? 173 PRO C CD   1  
ATOM   8177   H HA   . PRO C 3 173 ? -71.437  -17.551 -35.420  1.00 0.00 ? 173 PRO C HA   1  
ATOM   8178   H HB2  . PRO C 3 173 ? -69.913  -16.244 -33.195  1.00 0.00 ? 173 PRO C HB2  1  
ATOM   8179   H HB3  . PRO C 3 173 ? -69.642  -16.162 -34.947  1.00 0.00 ? 173 PRO C HB3  1  
ATOM   8180   H HG2  . PRO C 3 173 ? -70.886  -14.207 -33.544  1.00 0.00 ? 173 PRO C HG2  1  
ATOM   8181   H HG3  . PRO C 3 173 ? -71.206  -14.543 -35.250  1.00 0.00 ? 173 PRO C HG3  1  
ATOM   8182   H HD2  . PRO C 3 173 ? -72.946  -14.918 -32.956  1.00 0.00 ? 173 PRO C HD2  1  
ATOM   8183   H HD3  . PRO C 3 173 ? -73.334  -15.019 -34.688  1.00 0.00 ? 173 PRO C HD3  1  
ATOM   8184   N N    . ALA C 3 174 ? -70.818  -19.722 -34.272  1.00 0.00 ? 174 ALA C N    1  
ATOM   8185   C CA   . ALA C 3 174 ? -70.317  -20.959 -33.658  1.00 0.00 ? 174 ALA C CA   1  
ATOM   8186   C C    . ALA C 3 174 ? -68.950  -20.752 -33.022  1.00 0.00 ? 174 ALA C C    1  
ATOM   8187   O O    . ALA C 3 174 ? -68.132  -20.016 -33.564  1.00 0.00 ? 174 ALA C O    1  
ATOM   8188   C CB   . ALA C 3 174 ? -70.244  -22.068 -34.687  1.00 0.00 ? 174 ALA C CB   1  
ATOM   8189   H H    . ALA C 3 174 ? -71.152  -19.753 -35.193  1.00 0.00 ? 174 ALA C H    1  
ATOM   8190   H HA   . ALA C 3 174 ? -71.008  -21.258 -32.884  1.00 0.00 ? 174 ALA C HA   1  
ATOM   8191   H HB1  . ALA C 3 174 ? -70.385  -23.021 -34.200  1.00 0.00 ? 174 ALA C HB1  1  
ATOM   8192   H HB2  . ALA C 3 174 ? -69.277  -22.049 -35.168  1.00 0.00 ? 174 ALA C HB2  1  
ATOM   8193   H HB3  . ALA C 3 174 ? -71.017  -21.924 -35.426  1.00 0.00 ? 174 ALA C HB3  1  
ATOM   8194   N N    . VAL C 3 175 ? -68.700  -21.390 -31.879  1.00 0.00 ? 175 VAL C N    1  
ATOM   8195   C CA   . VAL C 3 175 ? -67.395  -21.258 -31.216  1.00 0.00 ? 175 VAL C CA   1  
ATOM   8196   C C    . VAL C 3 175 ? -66.552  -22.532 -31.303  1.00 0.00 ? 175 VAL C C    1  
ATOM   8197   O O    . VAL C 3 175 ? -67.039  -23.605 -31.690  1.00 0.00 ? 175 VAL C O    1  
ATOM   8198   C CB   . VAL C 3 175 ? -67.495  -20.803 -29.738  1.00 0.00 ? 175 VAL C CB   1  
ATOM   8199   C CG1  . VAL C 3 175 ? -66.151  -20.239 -29.285  1.00 0.00 ? 175 VAL C CG1  1  
ATOM   8200   C CG2  . VAL C 3 175 ? -68.597  -19.766 -29.546  1.00 0.00 ? 175 VAL C CG2  1  
ATOM   8201   H H    . VAL C 3 175 ? -69.389  -21.964 -31.484  1.00 0.00 ? 175 VAL C H    1  
ATOM   8202   H HA   . VAL C 3 175 ? -66.854  -20.488 -31.748  1.00 0.00 ? 175 VAL C HA   1  
ATOM   8203   H HB   . VAL C 3 175 ? -67.721  -21.670 -29.131  1.00 0.00 ? 175 VAL C HB   1  
ATOM   8204   H HG11 . VAL C 3 175 ? -66.051  -19.222 -29.636  1.00 0.00 ? 175 VAL C HG11 1  
ATOM   8205   H HG12 . VAL C 3 175 ? -65.352  -20.841 -29.693  1.00 0.00 ? 175 VAL C HG12 1  
ATOM   8206   H HG13 . VAL C 3 175 ? -66.099  -20.254 -28.206  1.00 0.00 ? 175 VAL C HG13 1  
ATOM   8207   H HG21 . VAL C 3 175 ? -69.484  -20.250 -29.165  1.00 0.00 ? 175 VAL C HG21 1  
ATOM   8208   H HG22 . VAL C 3 175 ? -68.821  -19.299 -30.494  1.00 0.00 ? 175 VAL C HG22 1  
ATOM   8209   H HG23 . VAL C 3 175 ? -68.267  -19.015 -28.844  1.00 0.00 ? 175 VAL C HG23 1  
ATOM   8210   N N    . LEU C 3 176 ? -65.288  -22.393 -30.909  1.00 0.00 ? 176 LEU C N    1  
ATOM   8211   C CA   . LEU C 3 176 ? -64.262  -23.396 -31.167  1.00 0.00 ? 176 LEU C CA   1  
ATOM   8212   C C    . LEU C 3 176 ? -63.759  -24.100 -29.903  1.00 0.00 ? 176 LEU C C    1  
ATOM   8213   O O    . LEU C 3 176 ? -62.548  -24.267 -29.724  1.00 0.00 ? 176 LEU C O    1  
ATOM   8214   C CB   . LEU C 3 176 ? -63.094  -22.760 -31.958  1.00 0.00 ? 176 LEU C CB   1  
ATOM   8215   C CG   . LEU C 3 176 ? -62.613  -21.365 -31.510  1.00 0.00 ? 176 LEU C CG   1  
ATOM   8216   C CD1  . LEU C 3 176 ? -61.288  -21.429 -30.744  1.00 0.00 ? 176 LEU C CD1  1  
ATOM   8217   C CD2  . LEU C 3 176 ? -62.498  -20.404 -32.698  1.00 0.00 ? 176 LEU C CD2  1  
ATOM   8218   H H    . LEU C 3 176 ? -64.999  -21.511 -30.594  1.00 0.00 ? 176 LEU C H    1  
ATOM   8219   H HA   . LEU C 3 176 ? -64.703  -24.151 -31.800  1.00 0.00 ? 176 LEU C HA   1  
ATOM   8220   H HB2  . LEU C 3 176 ? -62.252  -23.429 -31.908  1.00 0.00 ? 176 LEU C HB2  1  
ATOM   8221   H HB3  . LEU C 3 176 ? -63.402  -22.693 -32.994  1.00 0.00 ? 176 LEU C HB3  1  
ATOM   8222   H HG   . LEU C 3 176 ? -63.358  -20.969 -30.833  1.00 0.00 ? 176 LEU C HG   1  
ATOM   8223   H HD11 . LEU C 3 176 ? -60.751  -20.502 -30.876  1.00 0.00 ? 176 LEU C HD11 1  
ATOM   8224   H HD12 . LEU C 3 176 ? -60.693  -22.248 -31.121  1.00 0.00 ? 176 LEU C HD12 1  
ATOM   8225   H HD13 . LEU C 3 176 ? -61.487  -21.583 -29.693  1.00 0.00 ? 176 LEU C HD13 1  
ATOM   8226   H HD21 . LEU C 3 176 ? -61.638  -19.765 -32.562  1.00 0.00 ? 176 LEU C HD21 1  
ATOM   8227   H HD22 . LEU C 3 176 ? -63.390  -19.799 -32.759  1.00 0.00 ? 176 LEU C HD22 1  
ATOM   8228   H HD23 . LEU C 3 176 ? -62.385  -20.971 -33.610  1.00 0.00 ? 176 LEU C HD23 1  
ATOM   8229   N N    . GLN C 3 177 ? -64.675  -24.522 -29.030  1.00 0.00 ? 177 GLN C N    1  
ATOM   8230   C CA   . GLN C 3 177 ? -64.279  -25.420 -27.937  1.00 0.00 ? 177 GLN C CA   1  
ATOM   8231   C C    . GLN C 3 177 ? -63.772  -26.735 -28.524  1.00 0.00 ? 177 GLN C C    1  
ATOM   8232   O O    . GLN C 3 177 ? -64.354  -27.254 -29.484  1.00 0.00 ? 177 GLN C O    1  
ATOM   8233   C CB   . GLN C 3 177 ? -65.390  -25.651 -26.886  1.00 0.00 ? 177 GLN C CB   1  
ATOM   8234   C CG   . GLN C 3 177 ? -66.853  -25.655 -27.380  1.00 0.00 ? 177 GLN C CG   1  
ATOM   8235   C CD   . GLN C 3 177 ? -67.278  -26.920 -28.150  1.00 0.00 ? 177 GLN C CD   1  
ATOM   8236   O OE1  . GLN C 3 177 ? -68.320  -26.921 -28.815  1.00 0.00 ? 177 GLN C OE1  1  
ATOM   8237   N NE2  . GLN C 3 177 ? -66.484  -27.993 -28.059  1.00 0.00 ? 177 GLN C NE2  1  
ATOM   8238   H H    . GLN C 3 177 ? -65.626  -24.373 -29.215  1.00 0.00 ? 177 GLN C H    1  
ATOM   8239   H HA   . GLN C 3 177 ? -63.441  -24.954 -27.433  1.00 0.00 ? 177 GLN C HA   1  
ATOM   8240   H HB2  . GLN C 3 177 ? -65.206  -26.602 -26.415  1.00 0.00 ? 177 GLN C HB2  1  
ATOM   8241   H HB3  . GLN C 3 177 ? -65.290  -24.884 -26.129  1.00 0.00 ? 177 GLN C HB3  1  
ATOM   8242   H HG2  . GLN C 3 177 ? -67.500  -25.550 -26.524  1.00 0.00 ? 177 GLN C HG2  1  
ATOM   8243   H HG3  . GLN C 3 177 ? -66.996  -24.797 -28.021  1.00 0.00 ? 177 GLN C HG3  1  
ATOM   8244   H HE21 . GLN C 3 177 ? -65.668  -27.954 -27.517  1.00 0.00 ? 177 GLN C HE21 1  
ATOM   8245   H HE22 . GLN C 3 177 ? -66.718  -28.818 -28.533  1.00 0.00 ? 177 GLN C HE22 1  
ATOM   8246   N N    . SER C 3 178 ? -62.679  -27.248 -27.955  1.00 0.00 ? 178 SER C N    1  
ATOM   8247   C CA   . SER C 3 178 ? -62.008  -28.464 -28.444  1.00 0.00 ? 178 SER C CA   1  
ATOM   8248   C C    . SER C 3 178 ? -61.575  -28.339 -29.910  1.00 0.00 ? 178 SER C C    1  
ATOM   8249   O O    . SER C 3 178 ? -60.542  -27.729 -30.221  1.00 0.00 ? 178 SER C O    1  
ATOM   8250   C CB   . SER C 3 178 ? -62.904  -29.704 -28.263  1.00 0.00 ? 178 SER C CB   1  
ATOM   8251   O OG   . SER C 3 178 ? -62.775  -30.264 -26.968  1.00 0.00 ? 178 SER C OG   1  
ATOM   8252   H H    . SER C 3 178 ? -62.273  -26.762 -27.207  1.00 0.00 ? 178 SER C H    1  
ATOM   8253   H HA   . SER C 3 178 ? -61.118  -28.609 -27.849  1.00 0.00 ? 178 SER C HA   1  
ATOM   8254   H HB2  . SER C 3 178 ? -63.931  -29.414 -28.405  1.00 0.00 ? 178 SER C HB2  1  
ATOM   8255   H HB3  . SER C 3 178 ? -62.645  -30.442 -29.012  1.00 0.00 ? 178 SER C HB3  1  
ATOM   8256   H HG   . SER C 3 178 ? -62.432  -29.584 -26.383  1.00 0.00 ? 178 SER C HG   1  
ATOM   8257   N N    . ASP C 3 179 ? -62.380  -28.957 -30.781  1.00 0.00 ? 179 ASP C N    1  
ATOM   8258   C CA   . ASP C 3 179 ? -62.291  -28.884 -32.244  1.00 0.00 ? 179 ASP C CA   1  
ATOM   8259   C C    . ASP C 3 179 ? -63.637  -29.354 -32.776  1.00 0.00 ? 179 ASP C C    1  
ATOM   8260   O O    . ASP C 3 179 ? -63.738  -30.081 -33.774  1.00 0.00 ? 179 ASP C O    1  
ATOM   8261   C CB   . ASP C 3 179 ? -61.143  -29.733 -32.803  1.00 0.00 ? 179 ASP C CB   1  
ATOM   8262   C CG   . ASP C 3 179 ? -60.610  -30.741 -31.796  1.00 0.00 ? 179 ASP C CG   1  
ATOM   8263   O OD1  . ASP C 3 179 ? -61.369  -31.662 -31.383  1.00 0.00 ? 179 ASP C OD1  1  
ATOM   8264   O OD2  . ASP C 3 179 ? -59.429  -30.577 -31.406  1.00 0.00 ? 179 ASP C OD2  1  
ATOM   8265   H H    . ASP C 3 179 ? -63.154  -29.428 -30.408  1.00 0.00 ? 179 ASP C H    1  
ATOM   8266   H HA   . ASP C 3 179 ? -62.145  -27.851 -32.532  1.00 0.00 ? 179 ASP C HA   1  
ATOM   8267   H HB2  . ASP C 3 179 ? -61.495  -30.266 -33.672  1.00 0.00 ? 179 ASP C HB2  1  
ATOM   8268   H HB3  . ASP C 3 179 ? -60.338  -29.076 -33.101  1.00 0.00 ? 179 ASP C HB3  1  
ATOM   8269   N N    . LEU C 3 180 ? -64.666  -28.936 -32.043  1.00 0.00 ? 180 LEU C N    1  
ATOM   8270   C CA   . LEU C 3 180 ? -66.069  -29.069 -32.428  1.00 0.00 ? 180 LEU C CA   1  
ATOM   8271   C C    . LEU C 3 180 ? -66.736  -27.694 -32.279  1.00 0.00 ? 180 LEU C C    1  
ATOM   8272   O O    . LEU C 3 180 ? -66.480  -26.962 -31.312  1.00 0.00 ? 180 LEU C O    1  
ATOM   8273   C CB   . LEU C 3 180 ? -66.785  -30.120 -31.561  1.00 0.00 ? 180 LEU C CB   1  
ATOM   8274   C CG   . LEU C 3 180 ? -66.534  -31.634 -31.718  1.00 0.00 ? 180 LEU C CG   1  
ATOM   8275   C CD1  . LEU C 3 180 ? -66.787  -32.112 -33.152  1.00 0.00 ? 180 LEU C CD1  1  
ATOM   8276   C CD2  . LEU C 3 180 ? -65.145  -32.076 -31.205  1.00 0.00 ? 180 LEU C CD2  1  
ATOM   8277   H H    . LEU C 3 180 ? -64.466  -28.388 -31.255  1.00 0.00 ? 180 LEU C H    1  
ATOM   8278   H HA   . LEU C 3 180 ? -66.120  -29.371 -33.465  1.00 0.00 ? 180 LEU C HA   1  
ATOM   8279   H HB2  . LEU C 3 180 ? -66.557  -29.885 -30.537  1.00 0.00 ? 180 LEU C HB2  1  
ATOM   8280   H HB3  . LEU C 3 180 ? -67.848  -29.952 -31.690  1.00 0.00 ? 180 LEU C HB3  1  
ATOM   8281   H HG   . LEU C 3 180 ? -67.273  -32.128 -31.099  1.00 0.00 ? 180 LEU C HG   1  
ATOM   8282   H HD11 . LEU C 3 180 ? -67.766  -31.787 -33.472  1.00 0.00 ? 180 LEU C HD11 1  
ATOM   8283   H HD12 . LEU C 3 180 ? -66.737  -33.190 -33.186  1.00 0.00 ? 180 LEU C HD12 1  
ATOM   8284   H HD13 . LEU C 3 180 ? -66.037  -31.696 -33.808  1.00 0.00 ? 180 LEU C HD13 1  
ATOM   8285   H HD21 . LEU C 3 180 ? -64.499  -32.282 -32.046  1.00 0.00 ? 180 LEU C HD21 1  
ATOM   8286   H HD22 . LEU C 3 180 ? -65.249  -32.968 -30.605  1.00 0.00 ? 180 LEU C HD22 1  
ATOM   8287   H HD23 . LEU C 3 180 ? -64.715  -31.287 -30.605  1.00 0.00 ? 180 LEU C HD23 1  
ATOM   8288   N N    . TYR C 3 181 ? -67.563  -27.328 -33.248  1.00 0.00 ? 181 TYR C N    1  
ATOM   8289   C CA   . TYR C 3 181 ? -68.168  -26.013 -33.217  1.00 0.00 ? 181 TYR C CA   1  
ATOM   8290   C C    . TYR C 3 181 ? -69.510  -26.156 -32.568  1.00 0.00 ? 181 TYR C C    1  
ATOM   8291   O O    . TYR C 3 181 ? -70.135  -27.204 -32.694  1.00 0.00 ? 181 TYR C O    1  
ATOM   8292   C CB   . TYR C 3 181 ? -68.285  -25.429 -34.625  1.00 0.00 ? 181 TYR C CB   1  
ATOM   8293   C CG   . TYR C 3 181 ? -66.958  -24.965 -35.197  1.00 0.00 ? 181 TYR C CG   1  
ATOM   8294   C CD1  . TYR C 3 181 ? -66.063  -25.873 -35.778  1.00 0.00 ? 181 TYR C CD1  1  
ATOM   8295   C CD2  . TYR C 3 181 ? -66.588  -23.624 -35.140  1.00 0.00 ? 181 TYR C CD2  1  
ATOM   8296   C CE1  . TYR C 3 181 ? -64.843  -25.457 -36.291  1.00 0.00 ? 181 TYR C CE1  1  
ATOM   8297   C CE2  . TYR C 3 181 ? -65.368  -23.192 -35.654  1.00 0.00 ? 181 TYR C CE2  1  
ATOM   8298   C CZ   . TYR C 3 181 ? -64.503  -24.113 -36.231  1.00 0.00 ? 181 TYR C CZ   1  
ATOM   8299   O OH   . TYR C 3 181 ? -63.297  -23.685 -36.740  1.00 0.00 ? 181 TYR C OH   1  
ATOM   8300   H H    . TYR C 3 181 ? -67.722  -27.923 -34.010  1.00 0.00 ? 181 TYR C H    1  
ATOM   8301   H HA   . TYR C 3 181 ? -67.555  -25.359 -32.612  1.00 0.00 ? 181 TYR C HA   1  
ATOM   8302   H HB2  . TYR C 3 181 ? -68.695  -26.183 -35.279  1.00 0.00 ? 181 TYR C HB2  1  
ATOM   8303   H HB3  . TYR C 3 181 ? -68.966  -24.590 -34.596  1.00 0.00 ? 181 TYR C HB3  1  
ATOM   8304   H HD1  . TYR C 3 181 ? -66.331  -26.918 -35.832  1.00 0.00 ? 181 TYR C HD1  1  
ATOM   8305   H HD2  . TYR C 3 181 ? -67.260  -22.906 -34.692  1.00 0.00 ? 181 TYR C HD2  1  
ATOM   8306   H HE1  . TYR C 3 181 ? -64.166  -26.172 -36.736  1.00 0.00 ? 181 TYR C HE1  1  
ATOM   8307   H HE2  . TYR C 3 181 ? -65.099  -22.147 -35.610  1.00 0.00 ? 181 TYR C HE2  1  
ATOM   8308   H HH   . TYR C 3 181 ? -62.770  -23.347 -36.012  1.00 0.00 ? 181 TYR C HH   1  
ATOM   8309   N N    . THR C 3 182 ? -69.943  -25.123 -31.852  1.00 0.00 ? 182 THR C N    1  
ATOM   8310   C CA   . THR C 3 182 ? -71.255  -25.165 -31.207  1.00 0.00 ? 182 THR C CA   1  
ATOM   8311   C C    . THR C 3 182 ? -71.991  -23.813 -31.296  1.00 0.00 ? 182 THR C C    1  
ATOM   8312   O O    . THR C 3 182 ? -71.434  -22.762 -30.955  1.00 0.00 ? 182 THR C O    1  
ATOM   8313   C CB   . THR C 3 182 ? -71.158  -25.746 -29.759  1.00 0.00 ? 182 THR C CB   1  
ATOM   8314   O OG1  . THR C 3 182 ? -70.772  -27.130 -29.829  1.00 0.00 ? 182 THR C OG1  1  
ATOM   8315   C CG2  . THR C 3 182 ? -72.493  -25.626 -28.993  1.00 0.00 ? 182 THR C CG2  1  
ATOM   8316   H H    . THR C 3 182 ? -69.387  -24.320 -31.771  1.00 0.00 ? 182 THR C H    1  
ATOM   8317   H HA   . THR C 3 182 ? -71.848  -25.866 -31.783  1.00 0.00 ? 182 THR C HA   1  
ATOM   8318   H HB   . THR C 3 182 ? -70.397  -25.201 -29.219  1.00 0.00 ? 182 THR C HB   1  
ATOM   8319   H HG1  . THR C 3 182 ? -70.093  -27.282 -29.167  1.00 0.00 ? 182 THR C HG1  1  
ATOM   8320   H HG21 . THR C 3 182 ? -72.372  -24.947 -28.162  1.00 0.00 ? 182 THR C HG21 1  
ATOM   8321   H HG22 . THR C 3 182 ? -72.786  -26.598 -28.625  1.00 0.00 ? 182 THR C HG22 1  
ATOM   8322   H HG23 . THR C 3 182 ? -73.257  -25.248 -29.658  1.00 0.00 ? 182 THR C HG23 1  
ATOM   8323   N N    . LEU C 3 183 ? -73.249  -23.870 -31.744  1.00 0.00 ? 183 LEU C N    1  
ATOM   8324   C CA   . LEU C 3 183 ? -73.998  -22.693 -32.191  1.00 0.00 ? 183 LEU C CA   1  
ATOM   8325   C C    . LEU C 3 183 ? -75.493  -22.704 -31.815  1.00 0.00 ? 183 LEU C C    1  
ATOM   8326   O O    . LEU C 3 183 ? -76.177  -23.723 -31.935  1.00 0.00 ? 183 LEU C O    1  
ATOM   8327   C CB   . LEU C 3 183 ? -73.820  -22.556 -33.705  1.00 0.00 ? 183 LEU C CB   1  
ATOM   8328   C CG   . LEU C 3 183 ? -74.689  -21.674 -34.599  1.00 0.00 ? 183 LEU C CG   1  
ATOM   8329   C CD1  . LEU C 3 183 ? -73.845  -21.196 -35.769  1.00 0.00 ? 183 LEU C CD1  1  
ATOM   8330   C CD2  . LEU C 3 183 ? -75.943  -22.408 -35.091  1.00 0.00 ? 183 LEU C CD2  1  
ATOM   8331   H H    . LEU C 3 183 ? -73.611  -24.752 -31.974  1.00 0.00 ? 183 LEU C H    1  
ATOM   8332   H HA   . LEU C 3 183 ? -73.551  -21.825 -31.732  1.00 0.00 ? 183 LEU C HA   1  
ATOM   8333   H HB2  . LEU C 3 183 ? -72.813  -22.220 -33.862  1.00 0.00 ? 183 LEU C HB2  1  
ATOM   8334   H HB3  . LEU C 3 183 ? -73.871  -23.564 -34.104  1.00 0.00 ? 183 LEU C HB3  1  
ATOM   8335   H HG   . LEU C 3 183 ? -74.994  -20.808 -34.026  1.00 0.00 ? 183 LEU C HG   1  
ATOM   8336   H HD11 . LEU C 3 183 ? -74.435  -21.222 -36.673  1.00 0.00 ? 183 LEU C HD11 1  
ATOM   8337   H HD12 . LEU C 3 183 ? -72.986  -21.841 -35.880  1.00 0.00 ? 183 LEU C HD12 1  
ATOM   8338   H HD13 . LEU C 3 183 ? -73.514  -20.184 -35.584  1.00 0.00 ? 183 LEU C HD13 1  
ATOM   8339   H HD21 . LEU C 3 183 ? -75.708  -23.448 -35.260  1.00 0.00 ? 183 LEU C HD21 1  
ATOM   8340   H HD22 . LEU C 3 183 ? -76.283  -21.961 -36.014  1.00 0.00 ? 183 LEU C HD22 1  
ATOM   8341   H HD23 . LEU C 3 183 ? -76.721  -22.330 -34.346  1.00 0.00 ? 183 LEU C HD23 1  
ATOM   8342   N N    . SER C 3 184 ? -75.991  -21.543 -31.399  1.00 0.00 ? 184 SER C N    1  
ATOM   8343   C CA   . SER C 3 184 ? -77.339  -21.392 -30.838  1.00 0.00 ? 184 SER C CA   1  
ATOM   8344   C C    . SER C 3 184 ? -78.249  -20.635 -31.794  1.00 0.00 ? 184 SER C C    1  
ATOM   8345   O O    . SER C 3 184 ? -77.745  -19.958 -32.686  1.00 0.00 ? 184 SER C O    1  
ATOM   8346   C CB   . SER C 3 184 ? -77.234  -20.611 -29.536  1.00 0.00 ? 184 SER C CB   1  
ATOM   8347   O OG   . SER C 3 184 ? -76.463  -19.439 -29.734  1.00 0.00 ? 184 SER C OG   1  
ATOM   8348   H H    . SER C 3 184 ? -75.389  -20.770 -31.363  1.00 0.00 ? 184 SER C H    1  
ATOM   8349   H HA   . SER C 3 184 ? -77.758  -22.365 -30.635  1.00 0.00 ? 184 SER C HA   1  
ATOM   8350   H HB2  . SER C 3 184 ? -78.219  -20.332 -29.203  1.00 0.00 ? 184 SER C HB2  1  
ATOM   8351   H HB3  . SER C 3 184 ? -76.769  -21.235 -28.784  1.00 0.00 ? 184 SER C HB3  1  
ATOM   8352   H HG   . SER C 3 184 ? -76.043  -19.216 -28.900  1.00 0.00 ? 184 SER C HG   1  
ATOM   8353   N N    . SER C 3 185 ? -79.571  -20.735 -31.612  1.00 0.00 ? 185 SER C N    1  
ATOM   8354   C CA   . SER C 3 185 ? -80.522  -19.968 -32.445  1.00 0.00 ? 185 SER C CA   1  
ATOM   8355   C C    . SER C 3 185 ? -81.819  -19.492 -31.769  1.00 0.00 ? 185 SER C C    1  
ATOM   8356   O O    . SER C 3 185 ? -82.699  -20.291 -31.450  1.00 0.00 ? 185 SER C O    1  
ATOM   8357   C CB   . SER C 3 185 ? -80.872  -20.730 -33.723  1.00 0.00 ? 185 SER C CB   1  
ATOM   8358   O OG   . SER C 3 185 ? -81.484  -19.864 -34.670  1.00 0.00 ? 185 SER C OG   1  
ATOM   8359   H H    . SER C 3 185 ? -79.913  -21.286 -30.877  1.00 0.00 ? 185 SER C H    1  
ATOM   8360   H HA   . SER C 3 185 ? -79.999  -19.077 -32.757  1.00 0.00 ? 185 SER C HA   1  
ATOM   8361   H HB2  . SER C 3 185 ? -79.972  -21.137 -34.153  1.00 0.00 ? 185 SER C HB2  1  
ATOM   8362   H HB3  . SER C 3 185 ? -81.544  -21.543 -33.479  1.00 0.00 ? 185 SER C HB3  1  
ATOM   8363   H HG   . SER C 3 185 ? -80.905  -19.109 -34.798  1.00 0.00 ? 185 SER C HG   1  
ATOM   8364   N N    . SER C 3 186 ? -81.941  -18.183 -31.581  1.00 0.00 ? 186 SER C N    1  
ATOM   8365   C CA   . SER C 3 186 ? -83.146  -17.621 -30.993  1.00 0.00 ? 186 SER C CA   1  
ATOM   8366   C C    . SER C 3 186 ? -84.062  -17.166 -32.103  1.00 0.00 ? 186 SER C C    1  
ATOM   8367   O O    . SER C 3 186 ? -83.602  -16.734 -33.147  1.00 0.00 ? 186 SER C O    1  
ATOM   8368   C CB   . SER C 3 186 ? -82.821  -16.427 -30.086  1.00 0.00 ? 186 SER C CB   1  
ATOM   8369   O OG   . SER C 3 186 ? -83.155  -15.186 -30.704  1.00 0.00 ? 186 SER C OG   1  
ATOM   8370   H H    . SER C 3 186 ? -81.221  -17.584 -31.871  1.00 0.00 ? 186 SER C H    1  
ATOM   8371   H HA   . SER C 3 186 ? -83.645  -18.382 -30.412  1.00 0.00 ? 186 SER C HA   1  
ATOM   8372   H HB2  . SER C 3 186 ? -83.379  -16.516 -29.170  1.00 0.00 ? 186 SER C HB2  1  
ATOM   8373   H HB3  . SER C 3 186 ? -81.764  -16.444 -29.852  1.00 0.00 ? 186 SER C HB3  1  
ATOM   8374   H HG   . SER C 3 186 ? -83.111  -14.499 -30.035  1.00 0.00 ? 186 SER C HG   1  
ATOM   8375   N N    . VAL C 3 187 ? -85.361  -17.260 -31.858  1.00 0.00 ? 187 VAL C N    1  
ATOM   8376   C CA   . VAL C 3 187 ? -86.378  -16.697 -32.741  1.00 0.00 ? 187 VAL C CA   1  
ATOM   8377   C C    . VAL C 3 187 ? -87.547  -16.245 -31.863  1.00 0.00 ? 187 VAL C C    1  
ATOM   8378   O O    . VAL C 3 187 ? -88.153  -17.065 -31.171  1.00 0.00 ? 187 VAL C O    1  
ATOM   8379   C CB   . VAL C 3 187 ? -86.834  -17.720 -33.830  1.00 0.00 ? 187 VAL C CB   1  
ATOM   8380   C CG1  . VAL C 3 187 ? -87.330  -19.009 -33.200  1.00 0.00 ? 187 VAL C CG1  1  
ATOM   8381   C CG2  . VAL C 3 187 ? -87.904  -17.137 -34.720  1.00 0.00 ? 187 VAL C CG2  1  
ATOM   8382   H H    . VAL C 3 187 ? -85.646  -17.615 -30.990  1.00 0.00 ? 187 VAL C H    1  
ATOM   8383   H HA   . VAL C 3 187 ? -85.962  -15.827 -33.231  1.00 0.00 ? 187 VAL C HA   1  
ATOM   8384   H HB   . VAL C 3 187 ? -85.973  -17.960 -34.441  1.00 0.00 ? 187 VAL C HB   1  
ATOM   8385   H HG11 . VAL C 3 187 ? -87.777  -18.792 -32.242  1.00 0.00 ? 187 VAL C HG11 1  
ATOM   8386   H HG12 . VAL C 3 187 ? -86.500  -19.687 -33.066  1.00 0.00 ? 187 VAL C HG12 1  
ATOM   8387   H HG13 . VAL C 3 187 ? -88.067  -19.465 -33.846  1.00 0.00 ? 187 VAL C HG13 1  
ATOM   8388   H HG21 . VAL C 3 187 ? -87.974  -16.073 -34.549  1.00 0.00 ? 187 VAL C HG21 1  
ATOM   8389   H HG22 . VAL C 3 187 ? -88.852  -17.601 -34.494  1.00 0.00 ? 187 VAL C HG22 1  
ATOM   8390   H HG23 . VAL C 3 187 ? -87.651  -17.318 -35.754  1.00 0.00 ? 187 VAL C HG23 1  
ATOM   8391   N N    . THR C 3 188 ? -87.835  -14.942 -31.860  1.00 0.00 ? 188 THR C N    1  
ATOM   8392   C CA   . THR C 3 188 ? -88.966  -14.407 -31.095  1.00 0.00 ? 188 THR C CA   1  
ATOM   8393   C C    . THR C 3 188 ? -90.235  -14.687 -31.886  1.00 0.00 ? 188 THR C C    1  
ATOM   8394   O O    . THR C 3 188 ? -90.161  -15.061 -33.055  1.00 0.00 ? 188 THR C O    1  
ATOM   8395   C CB   . THR C 3 188 ? -88.805  -12.874 -30.819  1.00 0.00 ? 188 THR C CB   1  
ATOM   8396   O OG1  . THR C 3 188 ? -87.547  -12.628 -30.174  1.00 0.00 ? 188 THR C OG1  1  
ATOM   8397   C CG2  . THR C 3 188 ? -89.916  -12.332 -29.916  1.00 0.00 ? 188 THR C CG2  1  
ATOM   8398   H H    . THR C 3 188 ? -87.299  -14.333 -32.409  1.00 0.00 ? 188 THR C H    1  
ATOM   8399   H HA   . THR C 3 188 ? -89.023  -14.930 -30.150  1.00 0.00 ? 188 THR C HA   1  
ATOM   8400   H HB   . THR C 3 188 ? -88.827  -12.343 -31.760  1.00 0.00 ? 188 THR C HB   1  
ATOM   8401   H HG1  . THR C 3 188 ? -87.436  -11.677 -30.094  1.00 0.00 ? 188 THR C HG1  1  
ATOM   8402   H HG21 . THR C 3 188 ? -90.256  -13.116 -29.255  1.00 0.00 ? 188 THR C HG21 1  
ATOM   8403   H HG22 . THR C 3 188 ? -90.740  -11.991 -30.524  1.00 0.00 ? 188 THR C HG22 1  
ATOM   8404   H HG23 . THR C 3 188 ? -89.534  -11.508 -29.331  1.00 0.00 ? 188 THR C HG23 1  
ATOM   8405   N N    . VAL C 3 189 ? -91.394  -14.547 -31.249  1.00 0.00 ? 189 VAL C N    1  
ATOM   8406   C CA   . VAL C 3 189 ? -92.653  -14.417 -31.992  1.00 0.00 ? 189 VAL C CA   1  
ATOM   8407   C C    . VAL C 3 189 ? -93.889  -14.310 -31.073  1.00 0.00 ? 189 VAL C C    1  
ATOM   8408   O O    . VAL C 3 189 ? -93.890  -14.839 -29.961  1.00 0.00 ? 189 VAL C O    1  
ATOM   8409   C CB   . VAL C 3 189 ? -92.772  -15.485 -33.147  1.00 0.00 ? 189 VAL C CB   1  
ATOM   8410   C CG1  . VAL C 3 189 ? -93.294  -16.831 -32.650  1.00 0.00 ? 189 VAL C CG1  1  
ATOM   8411   C CG2  . VAL C 3 189 ? -93.575  -14.921 -34.335  1.00 0.00 ? 189 VAL C CG2  1  
ATOM   8412   H H    . VAL C 3 189 ? -91.380  -14.278 -30.307  1.00 0.00 ? 189 VAL C H    1  
ATOM   8413   H HA   . VAL C 3 189 ? -92.590  -13.455 -32.486  1.00 0.00 ? 189 VAL C HA   1  
ATOM   8414   H HB   . VAL C 3 189 ? -91.763  -15.664 -33.500  1.00 0.00 ? 189 VAL C HB   1  
ATOM   8415   H HG11 . VAL C 3 189 ? -93.106  -16.921 -31.590  1.00 0.00 ? 189 VAL C HG11 1  
ATOM   8416   H HG12 . VAL C 3 189 ? -92.790  -17.629 -33.175  1.00 0.00 ? 189 VAL C HG12 1  
ATOM   8417   H HG13 . VAL C 3 189 ? -94.357  -16.894 -32.833  1.00 0.00 ? 189 VAL C HG13 1  
ATOM   8418   H HG21 . VAL C 3 189 ? -94.501  -15.469 -34.435  1.00 0.00 ? 189 VAL C HG21 1  
ATOM   8419   H HG22 . VAL C 3 189 ? -92.997  -15.022 -35.241  1.00 0.00 ? 189 VAL C HG22 1  
ATOM   8420   H HG23 . VAL C 3 189 ? -93.792  -13.877 -34.160  1.00 0.00 ? 189 VAL C HG23 1  
ATOM   8421   N N    . THR C 3 190 ? -94.909  -13.595 -31.543  1.00 0.00 ? 190 THR C N    1  
ATOM   8422   C CA   . THR C 3 190 ? -96.166  -13.411 -30.826  1.00 0.00 ? 190 THR C CA   1  
ATOM   8423   C C    . THR C 3 190 ? -96.693  -14.695 -30.218  1.00 0.00 ? 190 THR C C    1  
ATOM   8424   O O    . THR C 3 190 ? -96.609  -15.760 -30.833  1.00 0.00 ? 190 THR C O    1  
ATOM   8425   C CB   . THR C 3 190 ? -97.254  -12.940 -31.763  1.00 0.00 ? 190 THR C CB   1  
ATOM   8426   O OG1  . THR C 3 190 ? -96.659  -12.202 -32.831  1.00 0.00 ? 190 THR C OG1  1  
ATOM   8427   C CG2  . THR C 3 190 ? -98.268  -12.076 -31.020  1.00 0.00 ? 190 THR C CG2  1  
ATOM   8428   H H    . THR C 3 190 ? -94.817  -13.185 -32.428  1.00 0.00 ? 190 THR C H    1  
ATOM   8429   H HA   . THR C 3 190 ? -96.033  -12.674 -30.051  1.00 0.00 ? 190 THR C HA   1  
ATOM   8430   H HB   . THR C 3 190 ? -97.761  -13.801 -32.173  1.00 0.00 ? 190 THR C HB   1  
ATOM   8431   H HG1  . THR C 3 190 ? -96.012  -11.602 -32.452  1.00 0.00 ? 190 THR C HG1  1  
ATOM   8432   H HG21 . THR C 3 190 ? -98.592  -11.270 -31.662  1.00 0.00 ? 190 THR C HG21 1  
ATOM   8433   H HG22 . THR C 3 190 ? -97.811  -11.667 -30.131  1.00 0.00 ? 190 THR C HG22 1  
ATOM   8434   H HG23 . THR C 3 190 ? -99.120  -12.679 -30.742  1.00 0.00 ? 190 THR C HG23 1  
ATOM   8435   N N    . SER C 3 191 ? -97.257  -14.577 -29.014  1.00 0.00 ? 191 SER C N    1  
ATOM   8436   C CA   . SER C 3 191 ? -97.824  -15.711 -28.294  1.00 0.00 ? 191 SER C CA   1  
ATOM   8437   C C    . SER C 3 191 ? -99.005  -16.249 -29.062  1.00 0.00 ? 191 SER C C    1  
ATOM   8438   O O    . SER C 3 191 ? -99.374  -17.411 -28.906  1.00 0.00 ? 191 SER C O    1  
ATOM   8439   C CB   . SER C 3 191 ? -98.266  -15.307 -26.888  1.00 0.00 ? 191 SER C CB   1  
ATOM   8440   O OG   . SER C 3 191 ? -99.538  -14.674 -26.923  1.00 0.00 ? 191 SER C OG   1  
ATOM   8441   H H    . SER C 3 191 ? -97.299  -13.690 -28.600  1.00 0.00 ? 191 SER C H    1  
ATOM   8442   H HA   . SER C 3 191 ? -97.075  -16.486 -28.217  1.00 0.00 ? 191 SER C HA   1  
ATOM   8443   H HB2  . SER C 3 191 ? -98.332  -16.185 -26.267  1.00 0.00 ? 191 SER C HB2  1  
ATOM   8444   H HB3  . SER C 3 191 ? -97.532  -14.633 -26.467  1.00 0.00 ? 191 SER C HB3  1  
ATOM   8445   H HG   . SER C 3 191 ? -99.467  -13.840 -26.452  1.00 0.00 ? 191 SER C HG   1  
ATOM   8446   N N    . SER C 3 192 ? -99.600  -15.397 -29.886  1.00 0.00 ? 192 SER C N    1  
ATOM   8447   C CA   . SER C 3 192 ? -100.670 -15.838 -30.746  1.00 0.00 ? 192 SER C CA   1  
ATOM   8448   C C    . SER C 3 192 ? -100.159 -16.845 -31.772  1.00 0.00 ? 192 SER C C    1  
ATOM   8449   O O    . SER C 3 192 ? -100.791 -17.894 -32.005  1.00 0.00 ? 192 SER C O    1  
ATOM   8450   C CB   . SER C 3 192 ? -101.366 -14.652 -31.410  1.00 0.00 ? 192 SER C CB   1  
ATOM   8451   O OG   . SER C 3 192 ? -102.662 -14.458 -30.851  1.00 0.00 ? 192 SER C OG   1  
ATOM   8452   H H    . SER C 3 192 ? -99.262  -14.481 -29.963  1.00 0.00 ? 192 SER C H    1  
ATOM   8453   H HA   . SER C 3 192 ? -101.398 -16.345 -30.127  1.00 0.00 ? 192 SER C HA   1  
ATOM   8454   H HB2  . SER C 3 192 ? -100.782 -13.761 -31.254  1.00 0.00 ? 192 SER C HB2  1  
ATOM   8455   H HB3  . SER C 3 192 ? -101.449 -14.839 -32.473  1.00 0.00 ? 192 SER C HB3  1  
ATOM   8456   H HG   . SER C 3 192 ? -102.555 -14.040 -29.993  1.00 0.00 ? 192 SER C HG   1  
ATOM   8457   N N    . THR C 3 193 ? -98.996  -16.539 -32.352  1.00 0.00 ? 193 THR C N    1  
ATOM   8458   C CA   . THR C 3 193 ? -98.416  -17.397 -33.393  1.00 0.00 ? 193 THR C CA   1  
ATOM   8459   C C    . THR C 3 193 ? -97.773  -18.700 -32.877  1.00 0.00 ? 193 THR C C    1  
ATOM   8460   O O    . THR C 3 193 ? -97.759  -19.678 -33.609  1.00 0.00 ? 193 THR C O    1  
ATOM   8461   C CB   . THR C 3 193 ? -97.459  -16.642 -34.389  1.00 0.00 ? 193 THR C CB   1  
ATOM   8462   O OG1  . THR C 3 193 ? -96.112  -16.686 -33.910  1.00 0.00 ? 193 THR C OG1  1  
ATOM   8463   C CG2  . THR C 3 193 ? -97.913  -15.185 -34.658  1.00 0.00 ? 193 THR C CG2  1  
ATOM   8464   H H    . THR C 3 193 ? -98.538  -15.710 -32.102  1.00 0.00 ? 193 THR C H    1  
ATOM   8465   H HA   . THR C 3 193 ? -99.270  -17.681 -33.998  1.00 0.00 ? 193 THR C HA   1  
ATOM   8466   H HB   . THR C 3 193 ? -97.485  -17.176 -35.330  1.00 0.00 ? 193 THR C HB   1  
ATOM   8467   H HG1  . THR C 3 193 ? -95.914  -15.838 -33.505  1.00 0.00 ? 193 THR C HG1  1  
ATOM   8468   H HG21 . THR C 3 193 ? -97.460  -14.829 -35.572  1.00 0.00 ? 193 THR C HG21 1  
ATOM   8469   H HG22 . THR C 3 193 ? -97.607  -14.555 -33.836  1.00 0.00 ? 193 THR C HG22 1  
ATOM   8470   H HG23 . THR C 3 193 ? -98.989  -15.155 -34.753  1.00 0.00 ? 193 THR C HG23 1  
ATOM   8471   N N    . TRP C 3 194 ? -97.254  -18.750 -31.646  1.00 0.00 ? 194 TRP C N    1  
ATOM   8472   C CA   . TRP C 3 194 ? -96.773  -20.060 -31.173  1.00 0.00 ? 194 TRP C CA   1  
ATOM   8473   C C    . TRP C 3 194 ? -97.885  -20.985 -30.686  1.00 0.00 ? 194 TRP C C    1  
ATOM   8474   O O    . TRP C 3 194 ? -98.996  -20.896 -31.208  1.00 0.00 ? 194 TRP C O    1  
ATOM   8475   C CB   . TRP C 3 194 ? -95.560  -20.046 -30.226  1.00 0.00 ? 194 TRP C CB   1  
ATOM   8476   C CG   . TRP C 3 194 ? -94.938  -21.466 -30.104  1.00 0.00 ? 194 TRP C CG   1  
ATOM   8477   C CD1  . TRP C 3 194 ? -94.651  -22.317 -31.130  1.00 0.00 ? 194 TRP C CD1  1  
ATOM   8478   C CD2  . TRP C 3 194 ? -94.572  -22.167 -28.898  1.00 0.00 ? 194 TRP C CD2  1  
ATOM   8479   N NE1  . TRP C 3 194 ? -94.122  -23.488 -30.652  1.00 0.00 ? 194 TRP C NE1  1  
ATOM   8480   C CE2  . TRP C 3 194 ? -94.056  -23.425 -29.288  1.00 0.00 ? 194 TRP C CE2  1  
ATOM   8481   C CE3  . TRP C 3 194 ? -94.614  -21.848 -27.529  1.00 0.00 ? 194 TRP C CE3  1  
ATOM   8482   C CZ2  . TRP C 3 194 ? -93.589  -24.368 -28.363  1.00 0.00 ? 194 TRP C CZ2  1  
ATOM   8483   C CZ3  . TRP C 3 194 ? -94.148  -22.794 -26.606  1.00 0.00 ? 194 TRP C CZ3  1  
ATOM   8484   C CH2  . TRP C 3 194 ? -93.646  -24.036 -27.032  1.00 0.00 ? 194 TRP C CH2  1  
ATOM   8485   H H    . TRP C 3 194 ? -97.273  -17.970 -31.054  1.00 0.00 ? 194 TRP C H    1  
ATOM   8486   H HA   . TRP C 3 194 ? -96.414  -20.540 -32.077  1.00 0.00 ? 194 TRP C HA   1  
ATOM   8487   H HB2  . TRP C 3 194 ? -94.816  -19.364 -30.611  1.00 0.00 ? 194 TRP C HB2  1  
ATOM   8488   H HB3  . TRP C 3 194 ? -95.876  -19.713 -29.249  1.00 0.00 ? 194 TRP C HB3  1  
ATOM   8489   H HD1  . TRP C 3 194 ? -94.815  -22.097 -32.174  1.00 0.00 ? 194 TRP C HD1  1  
ATOM   8490   H HE1  . TRP C 3 194 ? -93.827  -24.256 -31.184  1.00 0.00 ? 194 TRP C HE1  1  
ATOM   8491   H HE3  . TRP C 3 194 ? -94.999  -20.895 -27.196  1.00 0.00 ? 194 TRP C HE3  1  
ATOM   8492   H HZ2  . TRP C 3 194 ? -93.202  -25.324 -28.685  1.00 0.00 ? 194 TRP C HZ2  1  
ATOM   8493   H HZ3  . TRP C 3 194 ? -94.178  -22.566 -25.551  1.00 0.00 ? 194 TRP C HZ3  1  
ATOM   8494   H HH2  . TRP C 3 194 ? -93.294  -24.744 -26.296  1.00 0.00 ? 194 TRP C HH2  1  
ATOM   8495   N N    . PRO C 3 195 ? -97.619  -21.794 -29.634  1.00 0.00 ? 195 PRO C N    1  
ATOM   8496   C CA   . PRO C 3 195 ? -98.000  -23.222 -29.528  1.00 0.00 ? 195 PRO C CA   1  
ATOM   8497   C C    . PRO C 3 195 ? -98.996  -23.714 -30.587  1.00 0.00 ? 195 PRO C C    1  
ATOM   8498   O O    . PRO C 3 195 ? -98.709  -24.682 -31.280  1.00 0.00 ? 195 PRO C O    1  
ATOM   8499   C CB   . PRO C 3 195 ? -98.585  -23.340 -28.120  1.00 0.00 ? 195 PRO C CB   1  
ATOM   8500   C CG   . PRO C 3 195 ? -98.710  -21.927 -27.629  1.00 0.00 ? 195 PRO C CG   1  
ATOM   8501   C CD   . PRO C 3 195 ? -97.650  -21.152 -28.313  1.00 0.00 ? 195 PRO C CD   1  
ATOM   8502   H HA   . PRO C 3 195 ? -97.111  -23.828 -29.575  1.00 0.00 ? 195 PRO C HA   1  
ATOM   8503   H HB2  . PRO C 3 195 ? -99.556  -23.816 -28.157  1.00 0.00 ? 195 PRO C HB2  1  
ATOM   8504   H HB3  . PRO C 3 195 ? -97.917  -23.894 -27.480  1.00 0.00 ? 195 PRO C HB3  1  
ATOM   8505   H HG2  . PRO C 3 195 ? -99.684  -21.532 -27.883  1.00 0.00 ? 195 PRO C HG2  1  
ATOM   8506   H HG3  . PRO C 3 195 ? -98.560  -21.890 -26.561  1.00 0.00 ? 195 PRO C HG3  1  
ATOM   8507   H HD2  . PRO C 3 195 ? -97.926  -20.108 -28.390  1.00 0.00 ? 195 PRO C HD2  1  
ATOM   8508   H HD3  . PRO C 3 195 ? -96.701  -21.270 -27.816  1.00 0.00 ? 195 PRO C HD3  1  
ATOM   8509   N N    . SER C 3 196 ? -100.144 -23.042 -30.698  1.00 0.00 ? 196 SER C N    1  
ATOM   8510   C CA   . SER C 3 196 ? -101.149 -23.295 -31.737  1.00 0.00 ? 196 SER C CA   1  
ATOM   8511   C C    . SER C 3 196 ? -100.509 -23.603 -33.074  1.00 0.00 ? 196 SER C C    1  
ATOM   8512   O O    . SER C 3 196 ? -100.578 -24.730 -33.562  1.00 0.00 ? 196 SER C O    1  
ATOM   8513   C CB   . SER C 3 196 ? -102.117 -22.105 -31.870  1.00 0.00 ? 196 SER C CB   1  
ATOM   8514   O OG   . SER C 3 196 ? -101.450 -20.848 -31.907  1.00 0.00 ? 196 SER C OG   1  
ATOM   8515   H H    . SER C 3 196 ? -100.287 -22.280 -30.099  1.00 0.00 ? 196 SER C H    1  
ATOM   8516   H HA   . SER C 3 196 ? -101.725 -24.159 -31.438  1.00 0.00 ? 196 SER C HA   1  
ATOM   8517   H HB2  . SER C 3 196 ? -102.681 -22.214 -32.779  1.00 0.00 ? 196 SER C HB2  1  
ATOM   8518   H HB3  . SER C 3 196 ? -102.806 -22.125 -31.034  1.00 0.00 ? 196 SER C HB3  1  
ATOM   8519   H HG   . SER C 3 196 ? -100.922 -20.768 -31.109  1.00 0.00 ? 196 SER C HG   1  
ATOM   8520   N N    . GLN C 3 197 ? -99.866  -22.596 -33.642  1.00 0.00 ? 197 GLN C N    1  
ATOM   8521   C CA   . GLN C 3 197 ? -99.203  -22.700 -34.930  1.00 0.00 ? 197 GLN C CA   1  
ATOM   8522   C C    . GLN C 3 197 ? -97.829  -23.325 -34.704  1.00 0.00 ? 197 GLN C C    1  
ATOM   8523   O O    . GLN C 3 197 ? -97.167  -22.999 -33.735  1.00 0.00 ? 197 GLN C O    1  
ATOM   8524   C CB   . GLN C 3 197 ? -99.149  -21.294 -35.550  1.00 0.00 ? 197 GLN C CB   1  
ATOM   8525   C CG   . GLN C 3 197 ? -98.145  -21.022 -36.662  1.00 0.00 ? 197 GLN C CG   1  
ATOM   8526   C CD   . GLN C 3 197 ? -98.579  -19.838 -37.523  1.00 0.00 ? 197 GLN C CD   1  
ATOM   8527   O OE1  . GLN C 3 197 ? -99.645  -19.876 -38.143  1.00 0.00 ? 197 GLN C OE1  1  
ATOM   8528   N NE2  . GLN C 3 197 ? -97.757  -18.788 -37.570  1.00 0.00 ? 197 GLN C NE2  1  
ATOM   8529   H H    . GLN C 3 197 ? -99.844  -21.734 -33.175  1.00 0.00 ? 197 GLN C H    1  
ATOM   8530   H HA   . GLN C 3 197 ? -99.782  -23.349 -35.572  1.00 0.00 ? 197 GLN C HA   1  
ATOM   8531   H HB2  . GLN C 3 197 ? -100.126 -21.074 -35.944  1.00 0.00 ? 197 GLN C HB2  1  
ATOM   8532   H HB3  . GLN C 3 197 ? -98.958  -20.594 -34.746  1.00 0.00 ? 197 GLN C HB3  1  
ATOM   8533   H HG2  . GLN C 3 197 ? -97.181  -20.806 -36.224  1.00 0.00 ? 197 GLN C HG2  1  
ATOM   8534   H HG3  . GLN C 3 197 ? -98.062  -21.900 -37.285  1.00 0.00 ? 197 GLN C HG3  1  
ATOM   8535   H HE21 . GLN C 3 197 ? -96.918  -18.800 -37.064  1.00 0.00 ? 197 GLN C HE21 1  
ATOM   8536   H HE22 . GLN C 3 197 ? -97.993  -18.005 -38.109  1.00 0.00 ? 197 GLN C HE22 1  
ATOM   8537   N N    . SER C 3 198 ? -97.432  -24.251 -35.569  1.00 0.00 ? 198 SER C N    1  
ATOM   8538   C CA   . SER C 3 198 ? -96.153  -24.960 -35.422  1.00 0.00 ? 198 SER C CA   1  
ATOM   8539   C C    . SER C 3 198 ? -94.973  -24.096 -35.832  1.00 0.00 ? 198 SER C C    1  
ATOM   8540   O O    . SER C 3 198 ? -95.104  -23.232 -36.706  1.00 0.00 ? 198 SER C O    1  
ATOM   8541   C CB   . SER C 3 198 ? -96.136  -26.252 -36.251  1.00 0.00 ? 198 SER C CB   1  
ATOM   8542   O OG   . SER C 3 198 ? -94.814  -26.601 -36.666  1.00 0.00 ? 198 SER C OG   1  
ATOM   8543   H H    . SER C 3 198 ? -98.026  -24.495 -36.309  1.00 0.00 ? 198 SER C H    1  
ATOM   8544   H HA   . SER C 3 198 ? -96.032  -25.226 -34.383  1.00 0.00 ? 198 SER C HA   1  
ATOM   8545   H HB2  . SER C 3 198 ? -96.541  -27.058 -35.665  1.00 0.00 ? 198 SER C HB2  1  
ATOM   8546   H HB3  . SER C 3 198 ? -96.762  -26.108 -37.123  1.00 0.00 ? 198 SER C HB3  1  
ATOM   8547   H HG   . SER C 3 198 ? -94.198  -26.261 -36.013  1.00 0.00 ? 198 SER C HG   1  
ATOM   8548   N N    . ILE C 3 199 ? -93.826  -24.359 -35.203  1.00 0.00 ? 199 ILE C N    1  
ATOM   8549   C CA   . ILE C 3 199 ? -92.561  -23.681 -35.492  1.00 0.00 ? 199 ILE C CA   1  
ATOM   8550   C C    . ILE C 3 199 ? -91.444  -24.696 -35.319  1.00 0.00 ? 199 ILE C C    1  
ATOM   8551   O O    . ILE C 3 199 ? -91.239  -25.218 -34.221  1.00 0.00 ? 199 ILE C O    1  
ATOM   8552   C CB   . ILE C 3 199 ? -92.323  -22.476 -34.535  1.00 0.00 ? 199 ILE C CB   1  
ATOM   8553   C CG1  . ILE C 3 199 ? -93.260  -21.316 -34.881  1.00 0.00 ? 199 ILE C CG1  1  
ATOM   8554   C CG2  . ILE C 3 199 ? -90.851  -22.014 -34.571  1.00 0.00 ? 199 ILE C CG2  1  
ATOM   8555   C CD1  . ILE C 3 199 ? -93.727  -20.524 -33.699  1.00 0.00 ? 199 ILE C CD1  1  
ATOM   8556   H H    . ILE C 3 199 ? -93.822  -25.074 -34.533  1.00 0.00 ? 199 ILE C H    1  
ATOM   8557   H HA   . ILE C 3 199 ? -92.570  -23.331 -36.514  1.00 0.00 ? 199 ILE C HA   1  
ATOM   8558   H HB   . ILE C 3 199 ? -92.543  -22.804 -33.527  1.00 0.00 ? 199 ILE C HB   1  
ATOM   8559   H HG12 . ILE C 3 199 ? -92.746  -20.649 -35.553  1.00 0.00 ? 199 ILE C HG12 1  
ATOM   8560   H HG13 . ILE C 3 199 ? -94.124  -21.718 -35.394  1.00 0.00 ? 199 ILE C HG13 1  
ATOM   8561   H HG21 . ILE C 3 199 ? -90.256  -22.749 -35.093  1.00 0.00 ? 199 ILE C HG21 1  
ATOM   8562   H HG22 . ILE C 3 199 ? -90.483  -21.905 -33.561  1.00 0.00 ? 199 ILE C HG22 1  
ATOM   8563   H HG23 . ILE C 3 199 ? -90.784  -21.066 -35.083  1.00 0.00 ? 199 ILE C HG23 1  
ATOM   8564   H HD11 . ILE C 3 199 ? -94.651  -20.941 -33.327  1.00 0.00 ? 199 ILE C HD11 1  
ATOM   8565   H HD12 . ILE C 3 199 ? -93.888  -19.497 -33.995  1.00 0.00 ? 199 ILE C HD12 1  
ATOM   8566   H HD13 . ILE C 3 199 ? -92.978  -20.561 -32.922  1.00 0.00 ? 199 ILE C HD13 1  
ATOM   8567   N N    . THR C 3 200 ? -90.726  -24.990 -36.396  1.00 0.00 ? 200 THR C N    1  
ATOM   8568   C CA   . THR C 3 200 ? -89.641  -25.964 -36.313  1.00 0.00 ? 200 THR C CA   1  
ATOM   8569   C C    . THR C 3 200 ? -88.311  -25.384 -36.779  1.00 0.00 ? 200 THR C C    1  
ATOM   8570   O O    . THR C 3 200 ? -88.267  -24.491 -37.642  1.00 0.00 ? 200 THR C O    1  
ATOM   8571   C CB   . THR C 3 200 ? -89.926  -27.258 -37.111  1.00 0.00 ? 200 THR C CB   1  
ATOM   8572   O OG1  . THR C 3 200 ? -89.274  -27.187 -38.382  1.00 0.00 ? 200 THR C OG1  1  
ATOM   8573   C CG2  . THR C 3 200 ? -91.423  -27.467 -37.315  1.00 0.00 ? 200 THR C CG2  1  
ATOM   8574   H H    . THR C 3 200 ? -90.930  -24.557 -37.252  1.00 0.00 ? 200 THR C H    1  
ATOM   8575   H HA   . THR C 3 200 ? -89.531  -26.239 -35.274  1.00 0.00 ? 200 THR C HA   1  
ATOM   8576   H HB   . THR C 3 200 ? -89.529  -28.100 -36.563  1.00 0.00 ? 200 THR C HB   1  
ATOM   8577   H HG1  . THR C 3 200 ? -88.365  -26.916 -38.234  1.00 0.00 ? 200 THR C HG1  1  
ATOM   8578   H HG21 . THR C 3 200 ? -91.969  -26.936 -36.549  1.00 0.00 ? 200 THR C HG21 1  
ATOM   8579   H HG22 . THR C 3 200 ? -91.651  -28.521 -37.256  1.00 0.00 ? 200 THR C HG22 1  
ATOM   8580   H HG23 . THR C 3 200 ? -91.710  -27.091 -38.286  1.00 0.00 ? 200 THR C HG23 1  
ATOM   8581   N N    . CYS C 3 201 ? -87.243  -25.920 -36.186  1.00 0.00 ? 201 CYS C N    1  
ATOM   8582   C CA   . CYS C 3 201 ? -85.864  -25.606 -36.527  1.00 0.00 ? 201 CYS C CA   1  
ATOM   8583   C C    . CYS C 3 201 ? -85.362  -26.609 -37.579  1.00 0.00 ? 201 CYS C C    1  
ATOM   8584   O O    . CYS C 3 201 ? -85.393  -27.818 -37.344  1.00 0.00 ? 201 CYS C O    1  
ATOM   8585   C CB   . CYS C 3 201 ? -84.997  -25.661 -35.252  1.00 0.00 ? 201 CYS C CB   1  
ATOM   8586   S SG   . CYS C 3 201 ? -83.208  -25.788 -35.560  1.00 0.00 ? 201 CYS C SG   1  
ATOM   8587   H H    . CYS C 3 201 ? -87.398  -26.619 -35.518  1.00 0.00 ? 201 CYS C H    1  
ATOM   8588   H HA   . CYS C 3 201 ? -85.821  -24.610 -36.941  1.00 0.00 ? 201 CYS C HA   1  
ATOM   8589   H HB2  . CYS C 3 201 ? -85.175  -24.766 -34.679  1.00 0.00 ? 201 CYS C HB2  1  
ATOM   8590   H HB3  . CYS C 3 201 ? -85.311  -26.512 -34.662  1.00 0.00 ? 201 CYS C HB3  1  
ATOM   8591   N N    . ASN C 3 202 ? -84.926  -26.112 -38.740  1.00 0.00 ? 202 ASN C N    1  
ATOM   8592   C CA   . ASN C 3 202 ? -84.232  -26.946 -39.732  1.00 0.00 ? 202 ASN C CA   1  
ATOM   8593   C C    . ASN C 3 202 ? -82.727  -26.658 -39.743  1.00 0.00 ? 202 ASN C C    1  
ATOM   8594   O O    . ASN C 3 202 ? -82.314  -25.508 -39.884  1.00 0.00 ? 202 ASN C O    1  
ATOM   8595   C CB   . ASN C 3 202 ? -84.765  -26.731 -41.156  1.00 0.00 ? 202 ASN C CB   1  
ATOM   8596   C CG   . ASN C 3 202 ? -86.243  -26.384 -41.213  1.00 0.00 ? 202 ASN C CG   1  
ATOM   8597   O OD1  . ASN C 3 202 ? -87.103  -27.227 -40.966  1.00 0.00 ? 202 ASN C OD1  1  
ATOM   8598   N ND2  . ASN C 3 202 ? -86.541  -25.149 -41.599  1.00 0.00 ? 202 ASN C ND2  1  
ATOM   8599   H H    . ASN C 3 202 ? -84.947  -25.141 -38.873  1.00 0.00 ? 202 ASN C H    1  
ATOM   8600   H HA   . ASN C 3 202 ? -84.378  -27.982 -39.466  1.00 0.00 ? 202 ASN C HA   1  
ATOM   8601   H HB2  . ASN C 3 202 ? -84.210  -25.928 -41.614  1.00 0.00 ? 202 ASN C HB2  1  
ATOM   8602   H HB3  . ASN C 3 202 ? -84.597  -27.634 -41.726  1.00 0.00 ? 202 ASN C HB3  1  
ATOM   8603   H HD21 . ASN C 3 202 ? -85.824  -24.520 -41.827  1.00 0.00 ? 202 ASN C HD21 1  
ATOM   8604   H HD22 . ASN C 3 202 ? -87.405  -24.878 -41.612  1.00 0.00 ? 202 ASN C HD22 1  
ATOM   8605   N N    . VAL C 3 203 ? -81.909  -27.698 -39.611  1.00 0.00 ? 203 VAL C N    1  
ATOM   8606   C CA   . VAL C 3 203 ? -80.453  -27.530 -39.628  1.00 0.00 ? 203 VAL C CA   1  
ATOM   8607   C C    . VAL C 3 203 ? -79.823  -28.333 -40.756  1.00 0.00 ? 203 VAL C C    1  
ATOM   8608   O O    . VAL C 3 203 ? -80.108  -29.523 -40.909  1.00 0.00 ? 203 VAL C O    1  
ATOM   8609   C CB   . VAL C 3 203 ? -79.805  -27.950 -38.285  1.00 0.00 ? 203 VAL C CB   1  
ATOM   8610   C CG1  . VAL C 3 203 ? -78.269  -27.875 -38.357  1.00 0.00 ? 203 VAL C CG1  1  
ATOM   8611   C CG2  . VAL C 3 203 ? -80.336  -27.087 -37.137  1.00 0.00 ? 203 VAL C CG2  1  
ATOM   8612   H H    . VAL C 3 203 ? -82.287  -28.596 -39.514  1.00 0.00 ? 203 VAL C H    1  
ATOM   8613   H HA   . VAL C 3 203 ? -80.236  -26.485 -39.795  1.00 0.00 ? 203 VAL C HA   1  
ATOM   8614   H HB   . VAL C 3 203 ? -80.078  -28.979 -38.092  1.00 0.00 ? 203 VAL C HB   1  
ATOM   8615   H HG11 . VAL C 3 203 ? -77.866  -27.769 -37.361  1.00 0.00 ? 203 VAL C HG11 1  
ATOM   8616   H HG12 . VAL C 3 203 ? -77.977  -27.025 -38.955  1.00 0.00 ? 203 VAL C HG12 1  
ATOM   8617   H HG13 . VAL C 3 203 ? -77.886  -28.780 -38.807  1.00 0.00 ? 203 VAL C HG13 1  
ATOM   8618   H HG21 . VAL C 3 203 ? -79.576  -26.380 -36.838  1.00 0.00 ? 203 VAL C HG21 1  
ATOM   8619   H HG22 . VAL C 3 203 ? -80.589  -27.719 -36.299  1.00 0.00 ? 203 VAL C HG22 1  
ATOM   8620   H HG23 . VAL C 3 203 ? -81.215  -26.554 -37.465  1.00 0.00 ? 203 VAL C HG23 1  
ATOM   8621   N N    . ALA C 3 204 ? -78.958  -27.687 -41.536  1.00 0.00 ? 204 ALA C N    1  
ATOM   8622   C CA   . ALA C 3 204 ? -78.267  -28.367 -42.624  1.00 0.00 ? 204 ALA C CA   1  
ATOM   8623   C C    . ALA C 3 204 ? -76.753  -28.314 -42.490  1.00 0.00 ? 204 ALA C C    1  
ATOM   8624   O O    . ALA C 3 204 ? -76.134  -27.263 -42.630  1.00 0.00 ? 204 ALA C O    1  
ATOM   8625   C CB   . ALA C 3 204 ? -78.701  -27.807 -43.960  1.00 0.00 ? 204 ALA C CB   1  
ATOM   8626   H H    . ALA C 3 204 ? -78.764  -26.743 -41.359  1.00 0.00 ? 204 ALA C H    1  
ATOM   8627   H HA   . ALA C 3 204 ? -78.560  -29.406 -42.595  1.00 0.00 ? 204 ALA C HA   1  
ATOM   8628   H HB1  . ALA C 3 204 ? -78.031  -27.013 -44.253  1.00 0.00 ? 204 ALA C HB1  1  
ATOM   8629   H HB2  . ALA C 3 204 ? -79.706  -27.419 -43.879  1.00 0.00 ? 204 ALA C HB2  1  
ATOM   8630   H HB3  . ALA C 3 204 ? -78.677  -28.590 -44.704  1.00 0.00 ? 204 ALA C HB3  1  
ATOM   8631   N N    . HIS C 3 205 ? -76.161  -29.462 -42.204  1.00 0.00 ? 205 HIS C N    1  
ATOM   8632   C CA   . HIS C 3 205 ? -74.725  -29.605 -42.277  1.00 0.00 ? 205 HIS C CA   1  
ATOM   8633   C C    . HIS C 3 205 ? -74.419  -30.105 -43.682  1.00 0.00 ? 205 HIS C C    1  
ATOM   8634   O O    . HIS C 3 205 ? -74.833  -31.212 -44.054  1.00 0.00 ? 205 HIS C O    1  
ATOM   8635   C CB   . HIS C 3 205 ? -74.243  -30.602 -41.235  1.00 0.00 ? 205 HIS C CB   1  
ATOM   8636   C CG   . HIS C 3 205 ? -72.796  -30.466 -40.888  1.00 0.00 ? 205 HIS C CG   1  
ATOM   8637   N ND1  . HIS C 3 205 ? -71.813  -31.202 -41.507  1.00 0.00 ? 205 HIS C ND1  1  
ATOM   8638   C CD2  . HIS C 3 205 ? -72.166  -29.689 -39.975  1.00 0.00 ? 205 HIS C CD2  1  
ATOM   8639   C CE1  . HIS C 3 205 ? -70.638  -30.884 -40.993  1.00 0.00 ? 205 HIS C CE1  1  
ATOM   8640   N NE2  . HIS C 3 205 ? -70.824  -29.966 -40.062  1.00 0.00 ? 205 HIS C NE2  1  
ATOM   8641   H H    . HIS C 3 205 ? -76.712  -30.265 -42.093  1.00 0.00 ? 205 HIS C H    1  
ATOM   8642   H HA   . HIS C 3 205 ? -74.253  -28.645 -42.118  1.00 0.00 ? 205 HIS C HA   1  
ATOM   8643   H HB2  . HIS C 3 205 ? -74.822  -30.466 -40.335  1.00 0.00 ? 205 HIS C HB2  1  
ATOM   8644   H HB3  . HIS C 3 205 ? -74.420  -31.600 -41.609  1.00 0.00 ? 205 HIS C HB3  1  
ATOM   8645   H HD1  . HIS C 3 205 ? -71.961  -31.860 -42.218  1.00 0.00 ? 205 HIS C HD1  1  
ATOM   8646   H HD2  . HIS C 3 205 ? -72.632  -28.983 -39.303  1.00 0.00 ? 205 HIS C HD2  1  
ATOM   8647   H HE1  . HIS C 3 205 ? -69.687  -31.304 -41.285  1.00 0.00 ? 205 HIS C HE1  1  
ATOM   8648   H HE2  . HIS C 3 205 ? -70.119  -29.551 -39.522  1.00 0.00 ? 205 HIS C HE2  1  
ATOM   8649   N N    . PRO C 3 206 ? -73.728  -29.272 -44.487  1.00 0.00 ? 206 PRO C N    1  
ATOM   8650   C CA   . PRO C 3 206 ? -73.410  -29.634 -45.869  1.00 0.00 ? 206 PRO C CA   1  
ATOM   8651   C C    . PRO C 3 206 ? -72.157  -30.485 -45.905  1.00 0.00 ? 206 PRO C C    1  
ATOM   8652   O O    . PRO C 3 206 ? -72.120  -31.516 -46.583  1.00 0.00 ? 206 PRO C O    1  
ATOM   8653   C CB   . PRO C 3 206 ? -73.141  -28.284 -46.526  1.00 0.00 ? 206 PRO C CB   1  
ATOM   8654   C CG   . PRO C 3 206 ? -72.598  -27.432 -45.416  1.00 0.00 ? 206 PRO C CG   1  
ATOM   8655   C CD   . PRO C 3 206 ? -73.204  -27.937 -44.128  1.00 0.00 ? 206 PRO C CD   1  
ATOM   8656   H HA   . PRO C 3 206 ? -74.238  -30.128 -46.348  1.00 0.00 ? 206 PRO C HA   1  
ATOM   8657   H HB2  . PRO C 3 206 ? -72.403  -28.396 -47.309  1.00 0.00 ? 206 PRO C HB2  1  
ATOM   8658   H HB3  . PRO C 3 206 ? -74.050  -27.856 -46.918  1.00 0.00 ? 206 PRO C HB3  1  
ATOM   8659   H HG2  . PRO C 3 206 ? -71.521  -27.521 -45.379  1.00 0.00 ? 206 PRO C HG2  1  
ATOM   8660   H HG3  . PRO C 3 206 ? -72.878  -26.402 -45.570  1.00 0.00 ? 206 PRO C HG3  1  
ATOM   8661   H HD2  . PRO C 3 206 ? -72.447  -28.015 -43.359  1.00 0.00 ? 206 PRO C HD2  1  
ATOM   8662   H HD3  . PRO C 3 206 ? -74.010  -27.295 -43.808  1.00 0.00 ? 206 PRO C HD3  1  
ATOM   8663   N N    . ALA C 3 207 ? -71.149  -30.051 -45.149  1.00 0.00 ? 207 ALA C N    1  
ATOM   8664   C CA   . ALA C 3 207 ? -69.861  -30.721 -45.069  1.00 0.00 ? 207 ALA C CA   1  
ATOM   8665   C C    . ALA C 3 207 ? -69.941  -32.154 -44.505  1.00 0.00 ? 207 ALA C C    1  
ATOM   8666   O O    . ALA C 3 207 ? -68.902  -32.797 -44.319  1.00 0.00 ? 207 ALA C O    1  
ATOM   8667   C CB   . ALA C 3 207 ? -68.869  -29.854 -44.280  1.00 0.00 ? 207 ALA C CB   1  
ATOM   8668   H H    . ALA C 3 207 ? -71.278  -29.230 -44.630  1.00 0.00 ? 207 ALA C H    1  
ATOM   8669   H HA   . ALA C 3 207 ? -69.482  -30.800 -46.078  1.00 0.00 ? 207 ALA C HA   1  
ATOM   8670   H HB1  . ALA C 3 207 ? -68.289  -30.482 -43.619  1.00 0.00 ? 207 ALA C HB1  1  
ATOM   8671   H HB2  . ALA C 3 207 ? -69.413  -29.125 -43.698  1.00 0.00 ? 207 ALA C HB2  1  
ATOM   8672   H HB3  . ALA C 3 207 ? -68.209  -29.347 -44.967  1.00 0.00 ? 207 ALA C HB3  1  
ATOM   8673   N N    . SER C 3 208 ? -71.172  -32.636 -44.257  1.00 0.00 ? 208 SER C N    1  
ATOM   8674   C CA   . SER C 3 208 ? -71.447  -34.032 -43.829  1.00 0.00 ? 208 SER C CA   1  
ATOM   8675   C C    . SER C 3 208 ? -72.730  -34.672 -44.394  1.00 0.00 ? 208 SER C C    1  
ATOM   8676   O O    . SER C 3 208 ? -72.975  -35.853 -44.174  1.00 0.00 ? 208 SER C O    1  
ATOM   8677   C CB   . SER C 3 208 ? -71.444  -34.162 -42.291  1.00 0.00 ? 208 SER C CB   1  
ATOM   8678   O OG   . SER C 3 208 ? -72.640  -33.698 -41.687  1.00 0.00 ? 208 SER C OG   1  
ATOM   8679   H H    . SER C 3 208 ? -71.938  -32.055 -44.445  1.00 0.00 ? 208 SER C H    1  
ATOM   8680   H HA   . SER C 3 208 ? -70.623  -34.629 -44.190  1.00 0.00 ? 208 SER C HA   1  
ATOM   8681   H HB2  . SER C 3 208 ? -71.314  -35.197 -42.029  1.00 0.00 ? 208 SER C HB2  1  
ATOM   8682   H HB3  . SER C 3 208 ? -70.601  -33.603 -41.901  1.00 0.00 ? 208 SER C HB3  1  
ATOM   8683   H HG   . SER C 3 208 ? -72.404  -33.042 -41.027  1.00 0.00 ? 208 SER C HG   1  
ATOM   8684   N N    . SER C 3 209 ? -73.532  -33.899 -45.121  1.00 0.00 ? 209 SER C N    1  
ATOM   8685   C CA   . SER C 3 209 ? -74.896  -34.297 -45.496  1.00 0.00 ? 209 SER C CA   1  
ATOM   8686   C C    . SER C 3 209 ? -75.714  -34.651 -44.256  1.00 0.00 ? 209 SER C C    1  
ATOM   8687   O O    . SER C 3 209 ? -75.642  -35.777 -43.753  1.00 0.00 ? 209 SER C O    1  
ATOM   8688   C CB   . SER C 3 209 ? -74.886  -35.465 -46.468  1.00 0.00 ? 209 SER C CB   1  
ATOM   8689   O OG   . SER C 3 209 ? -73.808  -35.319 -47.352  1.00 0.00 ? 209 SER C OG   1  
ATOM   8690   H H    . SER C 3 209 ? -73.268  -32.966 -45.265  1.00 0.00 ? 209 SER C H    1  
ATOM   8691   H HA   . SER C 3 209 ? -75.369  -33.455 -45.981  1.00 0.00 ? 209 SER C HA   1  
ATOM   8692   H HB2  . SER C 3 209 ? -74.776  -36.389 -45.925  1.00 0.00 ? 209 SER C HB2  1  
ATOM   8693   H HB3  . SER C 3 209 ? -75.818  -35.482 -47.018  1.00 0.00 ? 209 SER C HB3  1  
ATOM   8694   H HG   . SER C 3 209 ? -73.026  -35.112 -46.834  1.00 0.00 ? 209 SER C HG   1  
ATOM   8695   N N    . THR C 3 210 ? -76.473  -33.675 -43.758  1.00 0.00 ? 210 THR C N    1  
ATOM   8696   C CA   . THR C 3 210 ? -77.297  -33.844 -42.570  1.00 0.00 ? 210 THR C CA   1  
ATOM   8697   C C    . THR C 3 210 ? -78.494  -32.902 -42.682  1.00 0.00 ? 210 THR C C    1  
ATOM   8698   O O    . THR C 3 210 ? -78.337  -31.677 -42.659  1.00 0.00 ? 210 THR C O    1  
ATOM   8699   C CB   . THR C 3 210 ? -76.495  -33.509 -41.299  1.00 0.00 ? 210 THR C CB   1  
ATOM   8700   O OG1  . THR C 3 210 ? -75.202  -34.121 -41.367  1.00 0.00 ? 210 THR C OG1  1  
ATOM   8701   C CG2  . THR C 3 210 ? -77.213  -33.989 -40.053  1.00 0.00 ? 210 THR C CG2  1  
ATOM   8702   H H    . THR C 3 210 ? -76.467  -32.803 -44.204  1.00 0.00 ? 210 THR C H    1  
ATOM   8703   H HA   . THR C 3 210 ? -77.646  -34.864 -42.517  1.00 0.00 ? 210 THR C HA   1  
ATOM   8704   H HB   . THR C 3 210 ? -76.371  -32.438 -41.238  1.00 0.00 ? 210 THR C HB   1  
ATOM   8705   H HG1  . THR C 3 210 ? -74.639  -33.698 -40.715  1.00 0.00 ? 210 THR C HG1  1  
ATOM   8706   H HG21 . THR C 3 210 ? -78.241  -33.659 -40.079  1.00 0.00 ? 210 THR C HG21 1  
ATOM   8707   H HG22 . THR C 3 210 ? -76.727  -33.583 -39.178  1.00 0.00 ? 210 THR C HG22 1  
ATOM   8708   H HG23 . THR C 3 210 ? -77.184  -35.068 -40.013  1.00 0.00 ? 210 THR C HG23 1  
ATOM   8709   N N    . LYS C 3 211 ? -79.688  -33.466 -42.832  1.00 0.00 ? 211 LYS C N    1  
ATOM   8710   C CA   . LYS C 3 211 ? -80.900  -32.649 -42.895  1.00 0.00 ? 211 LYS C CA   1  
ATOM   8711   C C    . LYS C 3 211 ? -81.768  -32.861 -41.650  1.00 0.00 ? 211 LYS C C    1  
ATOM   8712   O O    . LYS C 3 211 ? -82.932  -33.284 -41.747  1.00 0.00 ? 211 LYS C O    1  
ATOM   8713   C CB   . LYS C 3 211 ? -81.692  -32.914 -44.185  1.00 0.00 ? 211 LYS C CB   1  
ATOM   8714   C CG   . LYS C 3 211 ? -81.242  -32.088 -45.402  1.00 0.00 ? 211 LYS C CG   1  
ATOM   8715   C CD   . LYS C 3 211 ? -82.266  -32.172 -46.556  1.00 0.00 ? 211 LYS C CD   1  
ATOM   8716   C CE   . LYS C 3 211 ? -82.295  -33.566 -47.211  1.00 0.00 ? 211 LYS C CE   1  
ATOM   8717   N NZ   . LYS C 3 211 ? -83.684  -34.053 -47.467  1.00 0.00 ? 211 LYS C NZ   1  
ATOM   8718   H H    . LYS C 3 211 ? -79.760  -34.442 -42.865  1.00 0.00 ? 211 LYS C H    1  
ATOM   8719   H HA   . LYS C 3 211 ? -80.593  -31.612 -42.903  1.00 0.00 ? 211 LYS C HA   1  
ATOM   8720   H HB2  . LYS C 3 211 ? -81.596  -33.959 -44.434  1.00 0.00 ? 211 LYS C HB2  1  
ATOM   8721   H HB3  . LYS C 3 211 ? -82.735  -32.705 -43.992  1.00 0.00 ? 211 LYS C HB3  1  
ATOM   8722   H HG2  . LYS C 3 211 ? -81.131  -31.056 -45.104  1.00 0.00 ? 211 LYS C HG2  1  
ATOM   8723   H HG3  . LYS C 3 211 ? -80.289  -32.460 -45.748  1.00 0.00 ? 211 LYS C HG3  1  
ATOM   8724   H HD2  . LYS C 3 211 ? -83.249  -31.948 -46.168  1.00 0.00 ? 211 LYS C HD2  1  
ATOM   8725   H HD3  . LYS C 3 211 ? -82.010  -31.436 -47.305  1.00 0.00 ? 211 LYS C HD3  1  
ATOM   8726   H HE2  . LYS C 3 211 ? -81.766  -33.522 -48.149  1.00 0.00 ? 211 LYS C HE2  1  
ATOM   8727   H HE3  . LYS C 3 211 ? -81.791  -34.266 -46.560  1.00 0.00 ? 211 LYS C HE3  1  
ATOM   8728   H HZ1  . LYS C 3 211 ? -84.138  -34.297 -46.564  1.00 0.00 ? 211 LYS C HZ1  1  
ATOM   8729   H HZ2  . LYS C 3 211 ? -83.649  -34.895 -48.077  1.00 0.00 ? 211 LYS C HZ2  1  
ATOM   8730   H HZ3  . LYS C 3 211 ? -84.233  -33.306 -47.937  1.00 0.00 ? 211 LYS C HZ3  1  
ATOM   8731   N N    . VAL C 3 212 ? -81.193  -32.555 -40.488  1.00 0.00 ? 212 VAL C N    1  
ATOM   8732   C CA   . VAL C 3 212 ? -81.875  -32.725 -39.210  1.00 0.00 ? 212 VAL C CA   1  
ATOM   8733   C C    . VAL C 3 212 ? -82.993  -31.701 -39.005  1.00 0.00 ? 212 VAL C C    1  
ATOM   8734   O O    . VAL C 3 212 ? -82.762  -30.496 -39.067  1.00 0.00 ? 212 VAL C O    1  
ATOM   8735   C CB   . VAL C 3 212 ? -80.880  -32.660 -38.028  1.00 0.00 ? 212 VAL C CB   1  
ATOM   8736   C CG1  . VAL C 3 212 ? -81.616  -32.759 -36.710  1.00 0.00 ? 212 VAL C CG1  1  
ATOM   8737   C CG2  . VAL C 3 212 ? -79.839  -33.776 -38.128  1.00 0.00 ? 212 VAL C CG2  1  
ATOM   8738   H H    . VAL C 3 212 ? -80.272  -32.220 -40.491  1.00 0.00 ? 212 VAL C H    1  
ATOM   8739   H HA   . VAL C 3 212 ? -82.325  -33.707 -39.207  1.00 0.00 ? 212 VAL C HA   1  
ATOM   8740   H HB   . VAL C 3 212 ? -80.372  -31.706 -38.063  1.00 0.00 ? 212 VAL C HB   1  
ATOM   8741   H HG11 . VAL C 3 212 ? -82.680  -32.713 -36.887  1.00 0.00 ? 212 VAL C HG11 1  
ATOM   8742   H HG12 . VAL C 3 212 ? -81.321  -31.940 -36.071  1.00 0.00 ? 212 VAL C HG12 1  
ATOM   8743   H HG13 . VAL C 3 212 ? -81.371  -33.695 -36.231  1.00 0.00 ? 212 VAL C HG13 1  
ATOM   8744   H HG21 . VAL C 3 212 ? -79.558  -33.914 -39.161  1.00 0.00 ? 212 VAL C HG21 1  
ATOM   8745   H HG22 . VAL C 3 212 ? -80.257  -34.694 -37.742  1.00 0.00 ? 212 VAL C HG22 1  
ATOM   8746   H HG23 . VAL C 3 212 ? -78.967  -33.507 -37.550  1.00 0.00 ? 212 VAL C HG23 1  
ATOM   8747   N N    . ASP C 3 213 ? -84.201  -32.207 -38.771  1.00 0.00 ? 213 ASP C N    1  
ATOM   8748   C CA   . ASP C 3 213 ? -85.380  -31.390 -38.478  1.00 0.00 ? 213 ASP C CA   1  
ATOM   8749   C C    . ASP C 3 213 ? -85.753  -31.551 -37.022  1.00 0.00 ? 213 ASP C C    1  
ATOM   8750   O O    . ASP C 3 213 ? -85.849  -32.678 -36.535  1.00 0.00 ? 213 ASP C O    1  
ATOM   8751   C CB   . ASP C 3 213 ? -86.575  -31.864 -39.307  1.00 0.00 ? 213 ASP C CB   1  
ATOM   8752   C CG   . ASP C 3 213 ? -86.756  -31.085 -40.587  1.00 0.00 ? 213 ASP C CG   1  
ATOM   8753   O OD1  . ASP C 3 213 ? -85.760  -30.550 -41.123  1.00 0.00 ? 213 ASP C OD1  1  
ATOM   8754   O OD2  . ASP C 3 213 ? -87.906  -31.025 -41.066  1.00 0.00 ? 213 ASP C OD2  1  
ATOM   8755   H H    . ASP C 3 213 ? -84.297  -33.182 -38.747  1.00 0.00 ? 213 ASP C H    1  
ATOM   8756   H HA   . ASP C 3 213 ? -85.175  -30.353 -38.695  1.00 0.00 ? 213 ASP C HA   1  
ATOM   8757   H HB2  . ASP C 3 213 ? -86.438  -32.905 -39.553  1.00 0.00 ? 213 ASP C HB2  1  
ATOM   8758   H HB3  . ASP C 3 213 ? -87.470  -31.765 -38.709  1.00 0.00 ? 213 ASP C HB3  1  
ATOM   8759   N N    . LYS C 3 214 ? -85.994  -30.438 -36.335  1.00 0.00 ? 214 LYS C N    1  
ATOM   8760   C CA   . LYS C 3 214 ? -86.391  -30.463 -34.931  1.00 0.00 ? 214 LYS C CA   1  
ATOM   8761   C C    . LYS C 3 214 ? -87.589  -29.571 -34.723  1.00 0.00 ? 214 LYS C C    1  
ATOM   8762   O O    . LYS C 3 214 ? -87.475  -28.358 -34.857  1.00 0.00 ? 214 LYS C O    1  
ATOM   8763   C CB   . LYS C 3 214 ? -85.236  -29.986 -34.046  1.00 0.00 ? 214 LYS C CB   1  
ATOM   8764   C CG   . LYS C 3 214 ? -84.562  -31.075 -33.231  1.00 0.00 ? 214 LYS C CG   1  
ATOM   8765   C CD   . LYS C 3 214 ? -84.180  -32.272 -34.076  1.00 0.00 ? 214 LYS C CD   1  
ATOM   8766   C CE   . LYS C 3 214 ? -84.517  -33.588 -33.396  1.00 0.00 ? 214 LYS C CE   1  
ATOM   8767   N NZ   . LYS C 3 214 ? -83.338  -34.142 -32.683  1.00 0.00 ? 214 LYS C NZ   1  
ATOM   8768   H H    . LYS C 3 214 ? -85.920  -29.574 -36.792  1.00 0.00 ? 214 LYS C H    1  
ATOM   8769   H HA   . LYS C 3 214 ? -86.651  -31.474 -34.655  1.00 0.00 ? 214 LYS C HA   1  
ATOM   8770   H HB2  . LYS C 3 214 ? -84.491  -29.528 -34.676  1.00 0.00 ? 214 LYS C HB2  1  
ATOM   8771   H HB3  . LYS C 3 214 ? -85.618  -29.234 -33.370  1.00 0.00 ? 214 LYS C HB3  1  
ATOM   8772   H HG2  . LYS C 3 214 ? -83.673  -30.672 -32.771  1.00 0.00 ? 214 LYS C HG2  1  
ATOM   8773   H HG3  . LYS C 3 214 ? -85.242  -31.398 -32.455  1.00 0.00 ? 214 LYS C HG3  1  
ATOM   8774   H HD2  . LYS C 3 214 ? -84.707  -32.220 -35.016  1.00 0.00 ? 214 LYS C HD2  1  
ATOM   8775   H HD3  . LYS C 3 214 ? -83.117  -32.238 -34.269  1.00 0.00 ? 214 LYS C HD3  1  
ATOM   8776   H HE2  . LYS C 3 214 ? -85.314  -33.426 -32.686  1.00 0.00 ? 214 LYS C HE2  1  
ATOM   8777   H HE3  . LYS C 3 214 ? -84.848  -34.297 -34.142  1.00 0.00 ? 214 LYS C HE3  1  
ATOM   8778   H HZ1  . LYS C 3 214 ? -83.135  -33.562 -31.845  1.00 0.00 ? 214 LYS C HZ1  1  
ATOM   8779   H HZ2  . LYS C 3 214 ? -82.515  -34.135 -33.320  1.00 0.00 ? 214 LYS C HZ2  1  
ATOM   8780   H HZ3  . LYS C 3 214 ? -83.539  -35.118 -32.386  1.00 0.00 ? 214 LYS C HZ3  1  
ATOM   8781   N N    . LYS C 3 215 ? -88.741  -30.165 -34.416  1.00 0.00 ? 215 LYS C N    1  
ATOM   8782   C CA   . LYS C 3 215 ? -89.961  -29.382 -34.130  1.00 0.00 ? 215 LYS C CA   1  
ATOM   8783   C C    . LYS C 3 215 ? -89.978  -28.953 -32.662  1.00 0.00 ? 215 LYS C C    1  
ATOM   8784   O O    . LYS C 3 215 ? -89.732  -29.778 -31.779  1.00 0.00 ? 215 LYS C O    1  
ATOM   8785   C CB   . LYS C 3 215 ? -91.227  -30.176 -34.472  1.00 0.00 ? 215 LYS C CB   1  
ATOM   8786   C CG   . LYS C 3 215 ? -92.498  -29.346 -34.430  1.00 0.00 ? 215 LYS C CG   1  
ATOM   8787   C CD   . LYS C 3 215 ? -93.770  -30.192 -34.382  1.00 0.00 ? 215 LYS C CD   1  
ATOM   8788   C CE   . LYS C 3 215 ? -95.013  -29.326 -34.620  1.00 0.00 ? 215 LYS C CE   1  
ATOM   8789   N NZ   . LYS C 3 215 ? -96.190  -29.687 -33.783  1.00 0.00 ? 215 LYS C NZ   1  
ATOM   8790   H H    . LYS C 3 215 ? -88.770  -31.141 -34.338  1.00 0.00 ? 215 LYS C H    1  
ATOM   8791   H HA   . LYS C 3 215 ? -89.940  -28.491 -34.742  1.00 0.00 ? 215 LYS C HA   1  
ATOM   8792   H HB2  . LYS C 3 215 ? -91.120  -30.587 -35.464  1.00 0.00 ? 215 LYS C HB2  1  
ATOM   8793   H HB3  . LYS C 3 215 ? -91.321  -30.993 -33.770  1.00 0.00 ? 215 LYS C HB3  1  
ATOM   8794   H HG2  . LYS C 3 215 ? -92.471  -28.709 -33.560  1.00 0.00 ? 215 LYS C HG2  1  
ATOM   8795   H HG3  . LYS C 3 215 ? -92.529  -28.724 -35.313  1.00 0.00 ? 215 LYS C HG3  1  
ATOM   8796   H HD2  . LYS C 3 215 ? -93.719  -30.960 -35.139  1.00 0.00 ? 215 LYS C HD2  1  
ATOM   8797   H HD3  . LYS C 3 215 ? -93.846  -30.657 -33.410  1.00 0.00 ? 215 LYS C HD3  1  
ATOM   8798   H HE2  . LYS C 3 215 ? -94.757  -28.299 -34.417  1.00 0.00 ? 215 LYS C HE2  1  
ATOM   8799   H HE3  . LYS C 3 215 ? -95.289  -29.408 -35.663  1.00 0.00 ? 215 LYS C HE3  1  
ATOM   8800   H HZ1  . LYS C 3 215 ? -96.888  -28.918 -33.816  1.00 0.00 ? 215 LYS C HZ1  1  
ATOM   8801   H HZ2  . LYS C 3 215 ? -95.883  -29.835 -32.800  1.00 0.00 ? 215 LYS C HZ2  1  
ATOM   8802   H HZ3  . LYS C 3 215 ? -96.621  -30.559 -34.148  1.00 0.00 ? 215 LYS C HZ3  1  
ATOM   8803   N N    . ILE C 3 216 ? -90.253  -27.672 -32.398  1.00 0.00 ? 216 ILE C N    1  
ATOM   8804   C CA   . ILE C 3 216 ? -90.222  -27.158 -31.021  1.00 0.00 ? 216 ILE C CA   1  
ATOM   8805   C C    . ILE C 3 216 ? -91.518  -27.465 -30.296  1.00 0.00 ? 216 ILE C C    1  
ATOM   8806   O O    . ILE C 3 216 ? -92.565  -26.866 -30.569  1.00 0.00 ? 216 ILE C O    1  
ATOM   8807   C CB   . ILE C 3 216 ? -89.882  -25.647 -30.921  1.00 0.00 ? 216 ILE C CB   1  
ATOM   8808   C CG1  . ILE C 3 216 ? -88.410  -25.413 -31.246  1.00 0.00 ? 216 ILE C CG1  1  
ATOM   8809   C CG2  . ILE C 3 216 ? -90.169  -25.111 -29.515  1.00 0.00 ? 216 ILE C CG2  1  
ATOM   8810   C CD1  . ILE C 3 216 ? -88.143  -25.230 -32.707  1.00 0.00 ? 216 ILE C CD1  1  
ATOM   8811   H H    . ILE C 3 216 ? -90.432  -27.056 -33.138  1.00 0.00 ? 216 ILE C H    1  
ATOM   8812   H HA   . ILE C 3 216 ? -89.440  -27.698 -30.505  1.00 0.00 ? 216 ILE C HA   1  
ATOM   8813   H HB   . ILE C 3 216 ? -90.490  -25.105 -31.632  1.00 0.00 ? 216 ILE C HB   1  
ATOM   8814   H HG12 . ILE C 3 216 ? -88.077  -24.529 -30.725  1.00 0.00 ? 216 ILE C HG12 1  
ATOM   8815   H HG13 . ILE C 3 216 ? -87.839  -26.259 -30.889  1.00 0.00 ? 216 ILE C HG13 1  
ATOM   8816   H HG21 . ILE C 3 216 ? -89.273  -24.665 -29.110  1.00 0.00 ? 216 ILE C HG21 1  
ATOM   8817   H HG22 . ILE C 3 216 ? -90.487  -25.923 -28.878  1.00 0.00 ? 216 ILE C HG22 1  
ATOM   8818   H HG23 . ILE C 3 216 ? -90.951  -24.367 -29.566  1.00 0.00 ? 216 ILE C HG23 1  
ATOM   8819   H HD11 . ILE C 3 216 ? -88.437  -26.121 -33.241  1.00 0.00 ? 216 ILE C HD11 1  
ATOM   8820   H HD12 . ILE C 3 216 ? -87.090  -25.048 -32.861  1.00 0.00 ? 216 ILE C HD12 1  
ATOM   8821   H HD13 . ILE C 3 216 ? -88.711  -24.388 -33.074  1.00 0.00 ? 216 ILE C HD13 1  
ATOM   8822   N N    . GLU C 3 217 ? -91.414  -28.422 -29.377  1.00 0.00 ? 217 GLU C N    1  
ATOM   8823   C CA   . GLU C 3 217 ? -92.520  -28.874 -28.557  1.00 0.00 ? 217 GLU C CA   1  
ATOM   8824   C C    . GLU C 3 217 ? -92.500  -28.162 -27.223  1.00 0.00 ? 217 GLU C C    1  
ATOM   8825   O O    . GLU C 3 217 ? -91.425  -27.875 -26.706  1.00 0.00 ? 217 GLU C O    1  
ATOM   8826   C CB   . GLU C 3 217 ? -92.422  -30.378 -28.318  1.00 0.00 ? 217 GLU C CB   1  
ATOM   8827   C CG   . GLU C 3 217 ? -92.765  -31.209 -29.533  1.00 0.00 ? 217 GLU C CG   1  
ATOM   8828   C CD   . GLU C 3 217 ? -94.084  -30.802 -30.163  1.00 0.00 ? 217 GLU C CD   1  
ATOM   8829   O OE1  . GLU C 3 217 ? -95.053  -30.524 -29.422  1.00 0.00 ? 217 GLU C OE1  1  
ATOM   8830   O OE2  . GLU C 3 217 ? -94.155  -30.762 -31.406  1.00 0.00 ? 217 GLU C OE2  1  
ATOM   8831   H H    . GLU C 3 217 ? -90.539  -28.841 -29.243  1.00 0.00 ? 217 GLU C H    1  
ATOM   8832   H HA   . GLU C 3 217 ? -93.449  -28.658 -29.061  1.00 0.00 ? 217 GLU C HA   1  
ATOM   8833   H HB2  . GLU C 3 217 ? -91.413  -30.614 -28.018  1.00 0.00 ? 217 GLU C HB2  1  
ATOM   8834   H HB3  . GLU C 3 217 ? -93.092  -30.643 -27.512  1.00 0.00 ? 217 GLU C HB3  1  
ATOM   8835   H HG2  . GLU C 3 217 ? -91.983  -31.082 -30.266  1.00 0.00 ? 217 GLU C HG2  1  
ATOM   8836   H HG3  . GLU C 3 217 ? -92.812  -32.250 -29.249  1.00 0.00 ? 217 GLU C HG3  1  
ATOM   8837   N N    . PRO C 3 218 ? -93.689  -27.856 -26.668  1.00 0.00 ? 218 PRO C N    1  
ATOM   8838   C CA   . PRO C 3 218 ? -93.793  -27.447 -25.269  1.00 0.00 ? 218 PRO C CA   1  
ATOM   8839   C C    . PRO C 3 218 ? -93.259  -28.534 -24.325  1.00 0.00 ? 218 PRO C C    1  
ATOM   8840   O O    . PRO C 3 218 ? -92.461  -29.377 -24.741  1.00 0.00 ? 218 PRO C O    1  
ATOM   8841   C CB   . PRO C 3 218 ? -95.295  -27.238 -25.089  1.00 0.00 ? 218 PRO C CB   1  
ATOM   8842   C CG   . PRO C 3 218 ? -95.767  -26.821 -26.445  1.00 0.00 ? 218 PRO C CG   1  
ATOM   8843   C CD   . PRO C 3 218 ? -94.961  -27.656 -27.391  1.00 0.00 ? 218 PRO C CD   1  
ATOM   8844   H HA   . PRO C 3 218 ? -93.275  -26.516 -25.107  1.00 0.00 ? 218 PRO C HA   1  
ATOM   8845   H HB2  . PRO C 3 218 ? -95.771  -28.161 -24.784  1.00 0.00 ? 218 PRO C HB2  1  
ATOM   8846   H HB3  . PRO C 3 218 ? -95.487  -26.455 -24.373  1.00 0.00 ? 218 PRO C HB3  1  
ATOM   8847   H HG2  . PRO C 3 218 ? -96.823  -27.029 -26.556  1.00 0.00 ? 218 PRO C HG2  1  
ATOM   8848   H HG3  . PRO C 3 218 ? -95.565  -25.775 -26.612  1.00 0.00 ? 218 PRO C HG3  1  
ATOM   8849   H HD2  . PRO C 3 218 ? -95.453  -28.602 -27.577  1.00 0.00 ? 218 PRO C HD2  1  
ATOM   8850   H HD3  . PRO C 3 218 ? -94.785  -27.126 -28.314  1.00 0.00 ? 218 PRO C HD3  1  
ATOM   8851   N N    . ARG C 3 219 ? -93.676  -28.528 -23.064  1.00 0.00 ? 219 ARG C N    1  
ATOM   8852   C CA   . ARG C 3 219 ? -93.037  -29.419 -22.097  1.00 0.00 ? 219 ARG C CA   1  
ATOM   8853   C C    . ARG C 3 219 ? -93.989  -30.201 -21.199  1.00 0.00 ? 219 ARG C C    1  
ATOM   8854   O O    . ARG C 3 219 ? -94.310  -29.766 -20.090  1.00 0.00 ? 219 ARG C O    1  
ATOM   8855   C CB   . ARG C 3 219 ? -92.012  -28.649 -21.263  1.00 0.00 ? 219 ARG C CB   1  
ATOM   8856   C CG   . ARG C 3 219 ? -91.011  -27.841 -22.095  1.00 0.00 ? 219 ARG C CG   1  
ATOM   8857   C CD   . ARG C 3 219 ? -91.432  -26.365 -22.298  1.00 0.00 ? 219 ARG C CD   1  
ATOM   8858   N NE   . ARG C 3 219 ? -92.873  -26.146 -22.479  1.00 0.00 ? 219 ARG C NE   1  
ATOM   8859   C CZ   . ARG C 3 219 ? -93.442  -24.953 -22.661  1.00 0.00 ? 219 ARG C CZ   1  
ATOM   8860   N NH1  . ARG C 3 219 ? -92.695  -23.853 -22.697  1.00 0.00 ? 219 ARG C NH1  1  
ATOM   8861   N NH2  . ARG C 3 219 ? -94.760  -24.855 -22.805  1.00 0.00 ? 219 ARG C NH2  1  
ATOM   8862   H H    . ARG C 3 219 ? -94.307  -27.843 -22.759  1.00 0.00 ? 219 ARG C H    1  
ATOM   8863   H HA   . ARG C 3 219 ? -92.484  -30.148 -22.669  1.00 0.00 ? 219 ARG C HA   1  
ATOM   8864   H HB2  . ARG C 3 219 ? -92.539  -27.970 -20.610  1.00 0.00 ? 219 ARG C HB2  1  
ATOM   8865   H HB3  . ARG C 3 219 ? -91.466  -29.356 -20.653  1.00 0.00 ? 219 ARG C HB3  1  
ATOM   8866   H HG2  . ARG C 3 219 ? -90.053  -27.860 -21.598  1.00 0.00 ? 219 ARG C HG2  1  
ATOM   8867   H HG3  . ARG C 3 219 ? -90.908  -28.310 -23.063  1.00 0.00 ? 219 ARG C HG3  1  
ATOM   8868   H HD2  . ARG C 3 219 ? -91.115  -25.800 -21.438  1.00 0.00 ? 219 ARG C HD2  1  
ATOM   8869   H HD3  . ARG C 3 219 ? -90.910  -25.982 -23.165  1.00 0.00 ? 219 ARG C HD3  1  
ATOM   8870   H HE   . ARG C 3 219 ? -93.459  -26.931 -22.460  1.00 0.00 ? 219 ARG C HE   1  
ATOM   8871   H HH11 . ARG C 3 219 ? -91.703  -23.918 -22.587  1.00 0.00 ? 219 ARG C HH11 1  
ATOM   8872   H HH12 . ARG C 3 219 ? -93.125  -22.961 -22.834  1.00 0.00 ? 219 ARG C HH12 1  
ATOM   8873   H HH21 . ARG C 3 219 ? -95.329  -25.677 -22.776  1.00 0.00 ? 219 ARG C HH21 1  
ATOM   8874   H HH22 . ARG C 3 219 ? -95.183  -23.959 -22.941  1.00 0.00 ? 219 ARG C HH22 1  
ATOM   8875   N N    . GLY C 3 220 ? -94.425  -31.359 -21.700  1.00 0.00 ? 220 GLY C N    1  
ATOM   8876   C CA   . GLY C 3 220 ? -95.216  -32.329 -20.938  1.00 0.00 ? 220 GLY C CA   1  
ATOM   8877   C C    . GLY C 3 220 ? -94.329  -33.230 -20.079  1.00 0.00 ? 220 GLY C C    1  
ATOM   8878   O O    . GLY C 3 220 ? -93.108  -33.319 -20.309  1.00 0.00 ? 220 GLY C O    1  
ATOM   8879   H H    . GLY C 3 220 ? -94.113  -31.619 -22.592  1.00 0.00 ? 220 GLY C H    1  
ATOM   8880   H HA2  . GLY C 3 220 ? -95.903  -31.797 -20.297  1.00 0.00 ? 220 GLY C HA2  1  
ATOM   8881   H HA3  . GLY C 3 220 ? -95.778  -32.943 -21.626  1.00 0.00 ? 220 GLY C HA3  1  
ATOM   8882   N N    . PRO C 3 221 ? -94.926  -33.895 -19.068  1.00 0.00 ? 221 PRO C N    1  
ATOM   8883   C CA   . PRO C 3 221 ? -94.138  -34.738 -18.174  1.00 0.00 ? 221 PRO C CA   1  
ATOM   8884   C C    . PRO C 3 221 ? -94.271  -36.230 -18.494  1.00 0.00 ? 221 PRO C C    1  
ATOM   8885   O O    . PRO C 3 221 ? -93.924  -36.666 -19.595  1.00 0.00 ? 221 PRO C O    1  
ATOM   8886   C CB   . PRO C 3 221 ? -94.734  -34.422 -16.794  1.00 0.00 ? 221 PRO C CB   1  
ATOM   8887   C CG   . PRO C 3 221 ? -96.125  -33.811 -17.070  1.00 0.00 ? 221 PRO C CG   1  
ATOM   8888   C CD   . PRO C 3 221 ? -96.304  -33.729 -18.569  1.00 0.00 ? 221 PRO C CD   1  
ATOM   8889   H HA   . PRO C 3 221 ? -93.103  -34.441 -18.191  1.00 0.00 ? 221 PRO C HA   1  
ATOM   8890   H HB2  . PRO C 3 221 ? -94.828  -35.329 -16.212  1.00 0.00 ? 221 PRO C HB2  1  
ATOM   8891   H HB3  . PRO C 3 221 ? -94.118  -33.705 -16.275  1.00 0.00 ? 221 PRO C HB3  1  
ATOM   8892   H HG2  . PRO C 3 221 ? -96.893  -34.441 -16.643  1.00 0.00 ? 221 PRO C HG2  1  
ATOM   8893   H HG3  . PRO C 3 221 ? -96.182  -32.822 -16.643  1.00 0.00 ? 221 PRO C HG3  1  
ATOM   8894   H HD2  . PRO C 3 221 ? -96.943  -34.528 -18.921  1.00 0.00 ? 221 PRO C HD2  1  
ATOM   8895   H HD3  . PRO C 3 221 ? -96.693  -32.765 -18.857  1.00 0.00 ? 221 PRO C HD3  1  
ATOM   8896   N N    . GLN D 1 10  ? -125.416 -35.566 -151.323 1.00 0.00 ? 10  GLN D N    1  
ATOM   8897   C CA   . GLN D 1 10  ? -125.045 -34.117 -151.281 1.00 0.00 ? 10  GLN D CA   1  
ATOM   8898   C C    . GLN D 1 10  ? -125.981 -33.300 -152.197 1.00 0.00 ? 10  GLN D C    1  
ATOM   8899   O O    . GLN D 1 10  ? -125.672 -32.169 -152.598 1.00 0.00 ? 10  GLN D O    1  
ATOM   8900   C CB   . GLN D 1 10  ? -123.568 -33.913 -151.690 1.00 0.00 ? 10  GLN D CB   1  
ATOM   8901   C CG   . GLN D 1 10  ? -122.591 -34.368 -150.589 1.00 0.00 ? 10  GLN D CG   1  
ATOM   8902   C CD   . GLN D 1 10  ? -121.144 -34.076 -150.976 1.00 0.00 ? 10  GLN D CD   1  
ATOM   8903   O OE1  . GLN D 1 10  ? -120.825 -32.972 -151.446 1.00 0.00 ? 10  GLN D OE1  1  
ATOM   8904   N NE2  . GLN D 1 10  ? -120.250 -35.024 -150.772 1.00 0.00 ? 10  GLN D NE2  1  
ATOM   8905   H H    . GLN D 1 10  ? -125.514 -35.883 -152.306 1.00 0.00 ? 10  GLN D H    1  
ATOM   8906   H HA   . GLN D 1 10  ? -125.181 -33.770 -150.280 1.00 0.00 ? 10  GLN D HA   1  
ATOM   8907   H HB2  . GLN D 1 10  ? -123.369 -34.479 -152.574 1.00 0.00 ? 10  GLN D HB2  1  
ATOM   8908   H HB3  . GLN D 1 10  ? -123.412 -32.871 -151.880 1.00 0.00 ? 10  GLN D HB3  1  
ATOM   8909   H HG2  . GLN D 1 10  ? -122.811 -33.853 -149.676 1.00 0.00 ? 10  GLN D HG2  1  
ATOM   8910   H HG3  . GLN D 1 10  ? -122.690 -35.429 -150.442 1.00 0.00 ? 10  GLN D HG3  1  
ATOM   8911   H HE21 . GLN D 1 10  ? -120.538 -35.885 -150.382 1.00 0.00 ? 10  GLN D HE21 1  
ATOM   8912   H HE22 . GLN D 1 10  ? -119.309 -34.888 -150.996 1.00 0.00 ? 10  GLN D HE22 1  
ATOM   8913   N N    . GLY D 1 11  ? -127.132 -33.885 -152.485 1.00 0.00 ? 11  GLY D N    1  
ATOM   8914   C CA   . GLY D 1 11  ? -128.151 -33.254 -153.300 1.00 0.00 ? 11  GLY D CA   1  
ATOM   8915   C C    . GLY D 1 11  ? -129.497 -33.829 -152.894 1.00 0.00 ? 11  GLY D C    1  
ATOM   8916   O O    . GLY D 1 11  ? -129.553 -34.680 -152.012 1.00 0.00 ? 11  GLY D O    1  
ATOM   8917   H H    . GLY D 1 11  ? -127.311 -34.777 -152.123 1.00 0.00 ? 11  GLY D H    1  
ATOM   8918   H HA2  . GLY D 1 11  ? -128.138 -32.182 -153.149 1.00 0.00 ? 11  GLY D HA2  1  
ATOM   8919   H HA3  . GLY D 1 11  ? -127.981 -33.477 -154.344 1.00 0.00 ? 11  GLY D HA3  1  
ATOM   8920   N N    . ARG D 1 12  ? -130.555 -33.310 -153.526 1.00 0.00 ? 12  ARG D N    1  
ATOM   8921   C CA   . ARG D 1 12  ? -131.989 -33.672 -153.255 1.00 0.00 ? 12  ARG D CA   1  
ATOM   8922   C C    . ARG D 1 12  ? -132.316 -35.163 -153.015 1.00 0.00 ? 12  ARG D C    1  
ATOM   8923   O O    . ARG D 1 12  ? -133.234 -35.447 -152.227 1.00 0.00 ? 12  ARG D O    1  
ATOM   8924   C CB   . ARG D 1 12  ? -132.886 -33.111 -154.385 1.00 0.00 ? 12  ARG D CB   1  
ATOM   8925   C CG   . ARG D 1 12  ? -134.396 -33.111 -154.019 1.00 0.00 ? 12  ARG D CG   1  
ATOM   8926   C CD   . ARG D 1 12  ? -135.099 -34.335 -154.646 1.00 0.00 ? 12  ARG D CD   1  
ATOM   8927   N NE   . ARG D 1 12  ? -136.527 -34.380 -154.293 1.00 0.00 ? 12  ARG D NE   1  
ATOM   8928   C CZ   . ARG D 1 12  ? -137.506 -33.927 -155.092 1.00 0.00 ? 12  ARG D CZ   1  
ATOM   8929   N NH1  . ARG D 1 12  ? -137.244 -33.406 -156.269 1.00 0.00 ? 12  ARG D NH1  1  
ATOM   8930   N NH2  . ARG D 1 12  ? -138.756 -34.015 -154.675 1.00 0.00 ? 12  ARG D NH2  1  
ATOM   8931   H H    . ARG D 1 12  ? -130.381 -32.597 -154.169 1.00 0.00 ? 12  ARG D H    1  
ATOM   8932   H HA   . ARG D 1 12  ? -132.236 -33.161 -152.371 1.00 0.00 ? 12  ARG D HA   1  
ATOM   8933   H HB2  . ARG D 1 12  ? -132.591 -32.095 -154.575 1.00 0.00 ? 12  ARG D HB2  1  
ATOM   8934   H HB3  . ARG D 1 12  ? -132.745 -33.694 -155.265 1.00 0.00 ? 12  ARG D HB3  1  
ATOM   8935   H HG2  . ARG D 1 12  ? -134.515 -33.128 -152.956 1.00 0.00 ? 12  ARG D HG2  1  
ATOM   8936   H HG3  . ARG D 1 12  ? -134.847 -32.211 -154.421 1.00 0.00 ? 12  ARG D HG3  1  
ATOM   8937   H HD2  . ARG D 1 12  ? -134.993 -34.301 -155.711 1.00 0.00 ? 12  ARG D HD2  1  
ATOM   8938   H HD3  . ARG D 1 12  ? -134.619 -35.230 -154.269 1.00 0.00 ? 12  ARG D HD3  1  
ATOM   8939   H HE   . ARG D 1 12  ? -136.777 -34.763 -153.439 1.00 0.00 ? 12  ARG D HE   1  
ATOM   8940   H HH11 . ARG D 1 12  ? -136.300 -33.337 -156.593 1.00 0.00 ? 12  ARG D HH11 1  
ATOM   8941   H HH12 . ARG D 1 12  ? -137.993 -33.076 -156.850 1.00 0.00 ? 12  ARG D HH12 1  
ATOM   8942   H HH21 . ARG D 1 12  ? -138.964 -34.414 -153.778 1.00 0.00 ? 12  ARG D HH21 1  
ATOM   8943   H HH22 . ARG D 1 12  ? -139.502 -33.682 -155.253 1.00 0.00 ? 12  ARG D HH22 1  
ATOM   8944   N N    . GLY D 1 13  ? -131.616 -36.087 -153.660 1.00 0.00 ? 13  GLY D N    1  
ATOM   8945   C CA   . GLY D 1 13  ? -131.863 -37.522 -153.462 1.00 0.00 ? 13  GLY D CA   1  
ATOM   8946   C C    . GLY D 1 13  ? -130.964 -38.115 -152.369 1.00 0.00 ? 13  GLY D C    1  
ATOM   8947   O O    . GLY D 1 13  ? -131.435 -38.895 -151.542 1.00 0.00 ? 13  GLY D O    1  
ATOM   8948   H H    . GLY D 1 13  ? -130.935 -35.807 -154.297 1.00 0.00 ? 13  GLY D H    1  
ATOM   8949   H HA2  . GLY D 1 13  ? -132.886 -37.671 -153.172 1.00 0.00 ? 13  GLY D HA2  1  
ATOM   8950   H HA3  . GLY D 1 13  ? -131.667 -38.034 -154.379 1.00 0.00 ? 13  GLY D HA3  1  
ATOM   8951   N N    . ALA D 1 14  ? -129.681 -37.740 -152.390 1.00 0.00 ? 14  ALA D N    1  
ATOM   8952   C CA   . ALA D 1 14  ? -128.705 -38.212 -151.396 1.00 0.00 ? 14  ALA D CA   1  
ATOM   8953   C C    . ALA D 1 14  ? -128.797 -37.399 -150.090 1.00 0.00 ? 14  ALA D C    1  
ATOM   8954   O O    . ALA D 1 14  ? -128.922 -37.960 -149.000 1.00 0.00 ? 14  ALA D O    1  
ATOM   8955   C CB   . ALA D 1 14  ? -127.283 -38.137 -151.978 1.00 0.00 ? 14  ALA D CB   1  
ATOM   8956   H H    . ALA D 1 14  ? -129.389 -37.118 -153.080 1.00 0.00 ? 14  ALA D H    1  
ATOM   8957   H HA   . ALA D 1 14  ? -128.921 -39.237 -151.163 1.00 0.00 ? 14  ALA D HA   1  
ATOM   8958   H HB1  . ALA D 1 14  ? -126.572 -38.490 -151.244 1.00 0.00 ? 14  ALA D HB1  1  
ATOM   8959   H HB2  . ALA D 1 14  ? -127.047 -37.118 -152.245 1.00 0.00 ? 14  ALA D HB2  1  
ATOM   8960   H HB3  . ALA D 1 14  ? -127.225 -38.761 -152.860 1.00 0.00 ? 14  ALA D HB3  1  
ATOM   8961   N N    . TRP D 1 15  ? -128.755 -36.075 -150.234 1.00 0.00 ? 15  TRP D N    1  
ATOM   8962   C CA   . TRP D 1 15  ? -128.822 -35.156 -149.093 1.00 0.00 ? 15  TRP D CA   1  
ATOM   8963   C C    . TRP D 1 15  ? -130.055 -35.419 -148.226 1.00 0.00 ? 15  TRP D C    1  
ATOM   8964   O O    . TRP D 1 15  ? -129.949 -35.383 -147.006 1.00 0.00 ? 15  TRP D O    1  
ATOM   8965   C CB   . TRP D 1 15  ? -128.837 -33.705 -149.622 1.00 0.00 ? 15  TRP D CB   1  
ATOM   8966   C CG   . TRP D 1 15  ? -128.564 -32.683 -148.552 1.00 0.00 ? 15  TRP D CG   1  
ATOM   8967   C CD1  . TRP D 1 15  ? -127.369 -32.041 -148.338 1.00 0.00 ? 15  TRP D CD1  1  
ATOM   8968   C CD2  . TRP D 1 15  ? -129.481 -32.148 -147.594 1.00 0.00 ? 15  TRP D CD2  1  
ATOM   8969   N NE1  . TRP D 1 15  ? -127.515 -31.160 -147.293 1.00 0.00 ? 15  TRP D NE1  1  
ATOM   8970   C CE2  . TRP D 1 15  ? -128.785 -31.182 -146.799 1.00 0.00 ? 15  TRP D CE2  1  
ATOM   8971   C CE3  . TRP D 1 15  ? -130.831 -32.391 -147.315 1.00 0.00 ? 15  TRP D CE3  1  
ATOM   8972   C CZ2  . TRP D 1 15  ? -129.401 -30.495 -145.784 1.00 0.00 ? 15  TRP D CZ2  1  
ATOM   8973   C CZ3  . TRP D 1 15  ? -131.448 -31.687 -146.278 1.00 0.00 ? 15  TRP D CZ3  1  
ATOM   8974   C CH2  . TRP D 1 15  ? -130.730 -30.742 -145.516 1.00 0.00 ? 15  TRP D CH2  1  
ATOM   8975   H H    . TRP D 1 15  ? -128.672 -35.705 -151.131 1.00 0.00 ? 15  TRP D H    1  
ATOM   8976   H HA   . TRP D 1 15  ? -127.946 -35.291 -148.497 1.00 0.00 ? 15  TRP D HA   1  
ATOM   8977   H HB2  . TRP D 1 15  ? -128.093 -33.608 -150.379 1.00 0.00 ? 15  TRP D HB2  1  
ATOM   8978   H HB3  . TRP D 1 15  ? -129.808 -33.506 -150.043 1.00 0.00 ? 15  TRP D HB3  1  
ATOM   8979   H HD1  . TRP D 1 15  ? -126.467 -32.206 -148.888 1.00 0.00 ? 15  TRP D HD1  1  
ATOM   8980   H HE1  . TRP D 1 15  ? -126.805 -30.571 -146.922 1.00 0.00 ? 15  TRP D HE1  1  
ATOM   8981   H HE3  . TRP D 1 15  ? -131.396 -33.118 -147.894 1.00 0.00 ? 15  TRP D HE3  1  
ATOM   8982   H HZ2  . TRP D 1 15  ? -128.847 -29.765 -145.193 1.00 0.00 ? 15  TRP D HZ2  1  
ATOM   8983   H HZ3  . TRP D 1 15  ? -132.484 -31.867 -146.055 1.00 0.00 ? 15  TRP D HZ3  1  
ATOM   8984   H HH2  . TRP D 1 15  ? -131.217 -30.213 -144.724 1.00 0.00 ? 15  TRP D HH2  1  
ATOM   8985   N N    . LEU D 1 16  ? -131.209 -35.683 -148.854 1.00 0.00 ? 16  LEU D N    1  
ATOM   8986   C CA   . LEU D 1 16  ? -132.484 -35.931 -148.114 1.00 0.00 ? 16  LEU D CA   1  
ATOM   8987   C C    . LEU D 1 16  ? -132.462 -37.209 -147.266 1.00 0.00 ? 16  LEU D C    1  
ATOM   8988   O O    . LEU D 1 16  ? -133.078 -37.250 -146.195 1.00 0.00 ? 16  LEU D O    1  
ATOM   8989   C CB   . LEU D 1 16  ? -133.642 -36.017 -149.141 1.00 0.00 ? 16  LEU D CB   1  
ATOM   8990   C CG   . LEU D 1 16  ? -135.046 -36.211 -148.518 1.00 0.00 ? 16  LEU D CG   1  
ATOM   8991   C CD1  . LEU D 1 16  ? -135.499 -34.939 -147.819 1.00 0.00 ? 16  LEU D CD1  1  
ATOM   8992   C CD2  . LEU D 1 16  ? -136.047 -36.590 -149.632 1.00 0.00 ? 16  LEU D CD2  1  
ATOM   8993   H H    . LEU D 1 16  ? -131.217 -35.699 -149.832 1.00 0.00 ? 16  LEU D H    1  
ATOM   8994   H HA   . LEU D 1 16  ? -132.653 -35.098 -147.480 1.00 0.00 ? 16  LEU D HA   1  
ATOM   8995   H HB2  . LEU D 1 16  ? -133.655 -35.116 -149.704 1.00 0.00 ? 16  LEU D HB2  1  
ATOM   8996   H HB3  . LEU D 1 16  ? -133.452 -36.845 -149.784 1.00 0.00 ? 16  LEU D HB3  1  
ATOM   8997   H HG   . LEU D 1 16  ? -135.012 -37.003 -147.809 1.00 0.00 ? 16  LEU D HG   1  
ATOM   8998   H HD11 . LEU D 1 16  ? -134.832 -34.743 -146.994 1.00 0.00 ? 16  LEU D HD11 1  
ATOM   8999   H HD12 . LEU D 1 16  ? -136.502 -35.077 -147.445 1.00 0.00 ? 16  LEU D HD12 1  
ATOM   9000   H HD13 . LEU D 1 16  ? -135.478 -34.110 -148.507 1.00 0.00 ? 16  LEU D HD13 1  
ATOM   9001   H HD21 . LEU D 1 16  ? -136.113 -35.799 -150.360 1.00 0.00 ? 16  LEU D HD21 1  
ATOM   9002   H HD22 . LEU D 1 16  ? -137.020 -36.761 -149.193 1.00 0.00 ? 16  LEU D HD22 1  
ATOM   9003   H HD23 . LEU D 1 16  ? -135.711 -37.499 -150.117 1.00 0.00 ? 16  LEU D HD23 1  
ATOM   9004   N N    . LEU D 1 17  ? -131.704 -38.208 -147.726 1.00 0.00 ? 17  LEU D N    1  
ATOM   9005   C CA   . LEU D 1 17  ? -131.569 -39.491 -147.017 1.00 0.00 ? 17  LEU D CA   1  
ATOM   9006   C C    . LEU D 1 17  ? -131.060 -39.151 -145.644 1.00 0.00 ? 17  LEU D C    1  
ATOM   9007   O O    . LEU D 1 17  ? -131.620 -39.578 -144.644 1.00 0.00 ? 17  LEU D O    1  
ATOM   9008   C CB   . LEU D 1 17  ? -130.526 -40.323 -147.816 1.00 0.00 ? 17  LEU D CB   1  
ATOM   9009   C CG   . LEU D 1 17  ? -130.138 -41.734 -147.294 1.00 0.00 ? 17  LEU D CG   1  
ATOM   9010   C CD1  . LEU D 1 17  ? -131.343 -42.656 -147.196 1.00 0.00 ? 17  LEU D CD1  1  
ATOM   9011   C CD2  . LEU D 1 17  ? -129.106 -42.331 -148.284 1.00 0.00 ? 17  LEU D CD2  1  
ATOM   9012   H H    . LEU D 1 17  ? -131.195 -38.065 -148.541 1.00 0.00 ? 17  LEU D H    1  
ATOM   9013   H HA   . LEU D 1 17  ? -132.513 -40.003 -146.975 1.00 0.00 ? 17  LEU D HA   1  
ATOM   9014   H HB2  . LEU D 1 17  ? -130.899 -40.451 -148.790 1.00 0.00 ? 17  LEU D HB2  1  
ATOM   9015   H HB3  . LEU D 1 17  ? -129.634 -39.742 -147.845 1.00 0.00 ? 17  LEU D HB3  1  
ATOM   9016   H HG   . LEU D 1 17  ? -129.672 -41.649 -146.343 1.00 0.00 ? 17  LEU D HG   1  
ATOM   9017   H HD11 . LEU D 1 17  ? -131.829 -42.483 -146.247 1.00 0.00 ? 17  LEU D HD11 1  
ATOM   9018   H HD12 . LEU D 1 17  ? -131.019 -43.687 -147.249 1.00 0.00 ? 17  LEU D HD12 1  
ATOM   9019   H HD13 . LEU D 1 17  ? -132.033 -42.453 -147.999 1.00 0.00 ? 17  LEU D HD13 1  
ATOM   9020   H HD21 . LEU D 1 17  ? -128.235 -41.692 -148.323 1.00 0.00 ? 17  LEU D HD21 1  
ATOM   9021   H HD22 . LEU D 1 17  ? -129.539 -42.409 -149.270 1.00 0.00 ? 17  LEU D HD22 1  
ATOM   9022   H HD23 . LEU D 1 17  ? -128.814 -43.313 -147.941 1.00 0.00 ? 17  LEU D HD23 1  
ATOM   9023   N N    . MET D 1 18  ? -130.002 -38.339 -145.624 1.00 0.00 ? 18  MET D N    1  
ATOM   9024   C CA   . MET D 1 18  ? -129.388 -37.896 -144.376 1.00 0.00 ? 18  MET D CA   1  
ATOM   9025   C C    . MET D 1 18  ? -130.275 -37.003 -143.522 1.00 0.00 ? 18  MET D C    1  
ATOM   9026   O O    . MET D 1 18  ? -130.268 -37.149 -142.306 1.00 0.00 ? 18  MET D O    1  
ATOM   9027   C CB   . MET D 1 18  ? -128.008 -37.144 -144.739 1.00 0.00 ? 18  MET D CB   1  
ATOM   9028   C CG   . MET D 1 18  ? -127.457 -36.414 -143.519 1.00 0.00 ? 18  MET D CG   1  
ATOM   9029   S SD   . MET D 1 18  ? -125.644 -36.255 -143.582 1.00 0.00 ? 18  MET D SD   1  
ATOM   9030   C CE   . MET D 1 18  ? -125.440 -35.614 -145.258 1.00 0.00 ? 18  MET D CE   1  
ATOM   9031   H H    . MET D 1 18  ? -129.629 -38.035 -146.475 1.00 0.00 ? 18  MET D H    1  
ATOM   9032   H HA   . MET D 1 18  ? -129.117 -38.751 -143.810 1.00 0.00 ? 18  MET D HA   1  
ATOM   9033   H HB2  . MET D 1 18  ? -127.326 -37.890 -145.059 1.00 0.00 ? 18  MET D HB2  1  
ATOM   9034   H HB3  . MET D 1 18  ? -128.220 -36.452 -145.518 1.00 0.00 ? 18  MET D HB3  1  
ATOM   9035   H HG2  . MET D 1 18  ? -127.882 -35.434 -143.492 1.00 0.00 ? 18  MET D HG2  1  
ATOM   9036   H HG3  . MET D 1 18  ? -127.726 -36.950 -142.631 1.00 0.00 ? 18  MET D HG3  1  
ATOM   9037   H HE1  . MET D 1 18  ? -124.566 -34.976 -145.291 1.00 0.00 ? 18  MET D HE1  1  
ATOM   9038   H HE2  . MET D 1 18  ? -126.308 -35.047 -145.540 1.00 0.00 ? 18  MET D HE2  1  
ATOM   9039   H HE3  . MET D 1 18  ? -125.311 -36.443 -145.940 1.00 0.00 ? 18  MET D HE3  1  
ATOM   9040   N N    . ALA D 1 19  ? -131.045 -36.108 -144.147 1.00 0.00 ? 19  ALA D N    1  
ATOM   9041   C CA   . ALA D 1 19  ? -131.958 -35.231 -143.400 1.00 0.00 ? 19  ALA D CA   1  
ATOM   9042   C C    . ALA D 1 19  ? -133.155 -36.009 -142.857 1.00 0.00 ? 19  ALA D C    1  
ATOM   9043   O O    . ALA D 1 19  ? -133.386 -36.026 -141.649 1.00 0.00 ? 19  ALA D O    1  
ATOM   9044   C CB   . ALA D 1 19  ? -132.451 -34.101 -144.302 1.00 0.00 ? 19  ALA D CB   1  
ATOM   9045   H H    . ALA D 1 19  ? -131.012 -36.048 -145.118 1.00 0.00 ? 19  ALA D H    1  
ATOM   9046   H HA   . ALA D 1 19  ? -131.429 -34.800 -142.574 1.00 0.00 ? 19  ALA D HA   1  
ATOM   9047   H HB1  . ALA D 1 19  ? -131.825 -33.232 -144.156 1.00 0.00 ? 19  ALA D HB1  1  
ATOM   9048   H HB2  . ALA D 1 19  ? -133.472 -33.853 -144.049 1.00 0.00 ? 19  ALA D HB2  1  
ATOM   9049   H HB3  . ALA D 1 19  ? -132.399 -34.412 -145.330 1.00 0.00 ? 19  ALA D HB3  1  
ATOM   9050   N N    . PHE D 1 20  ? -133.874 -36.670 -143.764 1.00 0.00 ? 20  PHE D N    1  
ATOM   9051   C CA   . PHE D 1 20  ? -135.043 -37.474 -143.398 1.00 0.00 ? 20  PHE D CA   1  
ATOM   9052   C C    . PHE D 1 20  ? -134.690 -38.642 -142.465 1.00 0.00 ? 20  PHE D C    1  
ATOM   9053   O O    . PHE D 1 20  ? -135.555 -39.096 -141.715 1.00 0.00 ? 20  PHE D O    1  
ATOM   9054   C CB   . PHE D 1 20  ? -135.770 -37.960 -144.675 1.00 0.00 ? 20  PHE D CB   1  
ATOM   9055   C CG   . PHE D 1 20  ? -135.921 -39.470 -144.725 1.00 0.00 ? 20  PHE D CG   1  
ATOM   9056   C CD1  . PHE D 1 20  ? -134.798 -40.276 -144.944 1.00 0.00 ? 20  PHE D CD1  1  
ATOM   9057   C CD2  . PHE D 1 20  ? -137.180 -40.053 -144.553 1.00 0.00 ? 20  PHE D CD2  1  
ATOM   9058   C CE1  . PHE D 1 20  ? -134.932 -41.669 -144.992 1.00 0.00 ? 20  PHE D CE1  1  
ATOM   9059   C CE2  . PHE D 1 20  ? -137.315 -41.445 -144.599 1.00 0.00 ? 20  PHE D CE2  1  
ATOM   9060   C CZ   . PHE D 1 20  ? -136.189 -42.255 -144.818 1.00 0.00 ? 20  PHE D CZ   1  
ATOM   9061   H H    . PHE D 1 20  ? -133.606 -36.622 -144.703 1.00 0.00 ? 20  PHE D H    1  
ATOM   9062   H HA   . PHE D 1 20  ? -135.722 -36.833 -142.866 1.00 0.00 ? 20  PHE D HA   1  
ATOM   9063   H HB2  . PHE D 1 20  ? -136.755 -37.522 -144.693 1.00 0.00 ? 20  PHE D HB2  1  
ATOM   9064   H HB3  . PHE D 1 20  ? -135.224 -37.633 -145.535 1.00 0.00 ? 20  PHE D HB3  1  
ATOM   9065   H HD1  . PHE D 1 20  ? -133.834 -39.828 -145.078 1.00 0.00 ? 20  PHE D HD1  1  
ATOM   9066   H HD2  . PHE D 1 20  ? -138.044 -39.434 -144.387 1.00 0.00 ? 20  PHE D HD2  1  
ATOM   9067   H HE1  . PHE D 1 20  ? -134.061 -42.290 -145.160 1.00 0.00 ? 20  PHE D HE1  1  
ATOM   9068   H HE2  . PHE D 1 20  ? -138.289 -41.895 -144.464 1.00 0.00 ? 20  PHE D HE2  1  
ATOM   9069   H HZ   . PHE D 1 20  ? -136.293 -43.329 -144.853 1.00 0.00 ? 20  PHE D HZ   1  
ATOM   9070   N N    . THR D 1 21  ? -133.454 -39.155 -142.543 1.00 0.00 ? 21  THR D N    1  
ATOM   9071   C CA   . THR D 1 21  ? -133.060 -40.326 -141.734 1.00 0.00 ? 21  THR D CA   1  
ATOM   9072   C C    . THR D 1 21  ? -133.573 -40.247 -140.249 1.00 0.00 ? 21  THR D C    1  
ATOM   9073   O O    . THR D 1 21  ? -134.226 -41.188 -139.806 1.00 0.00 ? 21  THR D O    1  
ATOM   9074   C CB   . THR D 1 21  ? -131.527 -40.584 -141.734 1.00 0.00 ? 21  THR D CB   1  
ATOM   9075   O OG1  . THR D 1 21  ? -130.839 -39.493 -142.313 1.00 0.00 ? 21  THR D OG1  1  
ATOM   9076   C CG2  . THR D 1 21  ? -131.195 -41.830 -142.551 1.00 0.00 ? 21  THR D CG2  1  
ATOM   9077   H H    . THR D 1 21  ? -132.815 -38.772 -143.172 1.00 0.00 ? 21  THR D H    1  
ATOM   9078   H HA   . THR D 1 21  ? -133.546 -41.165 -142.163 1.00 0.00 ? 21  THR D HA   1  
ATOM   9079   H HB   . THR D 1 21  ? -131.178 -40.745 -140.722 1.00 0.00 ? 21  THR D HB   1  
ATOM   9080   H HG1  . THR D 1 21  ? -129.975 -39.430 -141.898 1.00 0.00 ? 21  THR D HG1  1  
ATOM   9081   H HG21 . THR D 1 21  ? -131.495 -42.710 -142.008 1.00 0.00 ? 21  THR D HG21 1  
ATOM   9082   H HG22 . THR D 1 21  ? -130.131 -41.856 -142.730 1.00 0.00 ? 21  THR D HG22 1  
ATOM   9083   H HG23 . THR D 1 21  ? -131.721 -41.783 -143.491 1.00 0.00 ? 21  THR D HG23 1  
ATOM   9084   N N    . ALA D 1 22  ? -133.269 -39.158 -139.566 1.00 0.00 ? 22  ALA D N    1  
ATOM   9085   C CA   . ALA D 1 22  ? -133.705 -38.999 -138.181 1.00 0.00 ? 22  ALA D CA   1  
ATOM   9086   C C    . ALA D 1 22  ? -135.215 -38.751 -138.079 1.00 0.00 ? 22  ALA D C    1  
ATOM   9087   O O    . ALA D 1 22  ? -135.872 -39.289 -137.192 1.00 0.00 ? 22  ALA D O    1  
ATOM   9088   C CB   . ALA D 1 22  ? -132.943 -37.855 -137.508 1.00 0.00 ? 22  ALA D CB   1  
ATOM   9089   H H    . ALA D 1 22  ? -132.747 -38.449 -139.993 1.00 0.00 ? 22  ALA D H    1  
ATOM   9090   H HA   . ALA D 1 22  ? -133.478 -39.901 -137.648 1.00 0.00 ? 22  ALA D HA   1  
ATOM   9091   H HB1  . ALA D 1 22  ? -133.323 -36.908 -137.853 1.00 0.00 ? 22  ALA D HB1  1  
ATOM   9092   H HB2  . ALA D 1 22  ? -131.893 -37.934 -137.752 1.00 0.00 ? 22  ALA D HB2  1  
ATOM   9093   H HB3  . ALA D 1 22  ? -133.068 -37.926 -136.436 1.00 0.00 ? 22  ALA D HB3  1  
ATOM   9094   N N    . LEU D 1 23  ? -135.780 -38.017 -139.041 1.00 0.00 ? 23  LEU D N    1  
ATOM   9095   C CA   . LEU D 1 23  ? -137.217 -37.744 -139.021 1.00 0.00 ? 23  LEU D CA   1  
ATOM   9096   C C    . LEU D 1 23  ? -138.021 -39.055 -139.050 1.00 0.00 ? 23  LEU D C    1  
ATOM   9097   O O    . LEU D 1 23  ? -138.919 -39.240 -138.224 1.00 0.00 ? 23  LEU D O    1  
ATOM   9098   C CB   . LEU D 1 23  ? -137.662 -36.886 -140.246 1.00 0.00 ? 23  LEU D CB   1  
ATOM   9099   C CG   . LEU D 1 23  ? -137.157 -35.415 -140.189 1.00 0.00 ? 23  LEU D CG   1  
ATOM   9100   C CD1  . LEU D 1 23  ? -135.682 -35.343 -140.562 1.00 0.00 ? 23  LEU D CD1  1  
ATOM   9101   C CD2  . LEU D 1 23  ? -137.969 -34.518 -141.156 1.00 0.00 ? 23  LEU D CD2  1  
ATOM   9102   H H    . LEU D 1 23  ? -135.227 -37.679 -139.769 1.00 0.00 ? 23  LEU D H    1  
ATOM   9103   H HA   . LEU D 1 23  ? -137.473 -37.223 -138.133 1.00 0.00 ? 23  LEU D HA   1  
ATOM   9104   H HB2  . LEU D 1 23  ? -137.291 -37.337 -141.134 1.00 0.00 ? 23  LEU D HB2  1  
ATOM   9105   H HB3  . LEU D 1 23  ? -138.733 -36.873 -140.264 1.00 0.00 ? 23  LEU D HB3  1  
ATOM   9106   H HG   . LEU D 1 23  ? -137.280 -35.042 -139.201 1.00 0.00 ? 23  LEU D HG   1  
ATOM   9107   H HD11 . LEU D 1 23  ? -135.558 -34.834 -141.507 1.00 0.00 ? 23  LEU D HD11 1  
ATOM   9108   H HD12 . LEU D 1 23  ? -135.278 -36.336 -140.635 1.00 0.00 ? 23  LEU D HD12 1  
ATOM   9109   H HD13 . LEU D 1 23  ? -135.159 -34.797 -139.790 1.00 0.00 ? 23  LEU D HD13 1  
ATOM   9110   H HD21 . LEU D 1 23  ? -137.655 -33.488 -141.023 1.00 0.00 ? 23  LEU D HD21 1  
ATOM   9111   H HD22 . LEU D 1 23  ? -139.018 -34.603 -140.931 1.00 0.00 ? 23  LEU D HD22 1  
ATOM   9112   H HD23 . LEU D 1 23  ? -137.789 -34.814 -142.178 1.00 0.00 ? 23  LEU D HD23 1  
ATOM   9113   N N    . ALA D 1 24  ? -137.624 -39.984 -139.927 1.00 0.00 ? 24  ALA D N    1  
ATOM   9114   C CA   . ALA D 1 24  ? -138.286 -41.277 -140.034 1.00 0.00 ? 24  ALA D CA   1  
ATOM   9115   C C    . ALA D 1 24  ? -137.819 -42.177 -138.898 1.00 0.00 ? 24  ALA D C    1  
ATOM   9116   O O    . ALA D 1 24  ? -138.625 -42.632 -138.090 1.00 0.00 ? 24  ALA D O    1  
ATOM   9117   C CB   . ALA D 1 24  ? -137.961 -41.941 -141.393 1.00 0.00 ? 24  ALA D CB   1  
ATOM   9118   H H    . ALA D 1 24  ? -136.843 -39.801 -140.477 1.00 0.00 ? 24  ALA D H    1  
ATOM   9119   H HA   . ALA D 1 24  ? -139.355 -41.156 -139.971 1.00 0.00 ? 24  ALA D HA   1  
ATOM   9120   H HB1  . ALA D 1 24  ? -138.529 -41.458 -142.176 1.00 0.00 ? 24  ALA D HB1  1  
ATOM   9121   H HB2  . ALA D 1 24  ? -138.224 -42.990 -141.357 1.00 0.00 ? 24  ALA D HB2  1  
ATOM   9122   H HB3  . ALA D 1 24  ? -136.907 -41.843 -141.602 1.00 0.00 ? 24  ALA D HB3  1  
ATOM   9123   N N    . LEU D 1 25  ? -136.501 -42.368 -138.810 1.00 0.00 ? 25  LEU D N    1  
ATOM   9124   C CA   . LEU D 1 25  ? -135.901 -43.229 -137.776 1.00 0.00 ? 25  LEU D CA   1  
ATOM   9125   C C    . LEU D 1 25  ? -136.327 -42.801 -136.384 1.00 0.00 ? 25  LEU D C    1  
ATOM   9126   O O    . LEU D 1 25  ? -136.730 -43.641 -135.583 1.00 0.00 ? 25  LEU D O    1  
ATOM   9127   C CB   . LEU D 1 25  ? -134.365 -43.133 -137.926 1.00 0.00 ? 25  LEU D CB   1  
ATOM   9128   C CG   . LEU D 1 25  ? -133.534 -44.093 -136.997 1.00 0.00 ? 25  LEU D CG   1  
ATOM   9129   C CD1  . LEU D 1 25  ? -134.052 -45.512 -137.106 1.00 0.00 ? 25  LEU D CD1  1  
ATOM   9130   C CD2  . LEU D 1 25  ? -132.054 -44.030 -137.434 1.00 0.00 ? 25  LEU D CD2  1  
ATOM   9131   H H    . LEU D 1 25  ? -135.918 -41.917 -139.450 1.00 0.00 ? 25  LEU D H    1  
ATOM   9132   H HA   . LEU D 1 25  ? -136.206 -44.240 -137.953 1.00 0.00 ? 25  LEU D HA   1  
ATOM   9133   H HB2  . LEU D 1 25  ? -134.109 -43.363 -138.921 1.00 0.00 ? 25  LEU D HB2  1  
ATOM   9134   H HB3  . LEU D 1 25  ? -134.075 -42.137 -137.687 1.00 0.00 ? 25  LEU D HB3  1  
ATOM   9135   H HG   . LEU D 1 25  ? -133.609 -43.752 -135.994 1.00 0.00 ? 25  LEU D HG   1  
ATOM   9136   H HD11 . LEU D 1 25  ? -133.296 -46.195 -136.755 1.00 0.00 ? 25  LEU D HD11 1  
ATOM   9137   H HD12 . LEU D 1 25  ? -134.304 -45.740 -138.129 1.00 0.00 ? 25  LEU D HD12 1  
ATOM   9138   H HD13 . LEU D 1 25  ? -134.933 -45.601 -136.487 1.00 0.00 ? 25  LEU D HD13 1  
ATOM   9139   H HD21 . LEU D 1 25  ? -131.731 -42.999 -137.476 1.00 0.00 ? 25  LEU D HD21 1  
ATOM   9140   H HD22 . LEU D 1 25  ? -131.934 -44.484 -138.405 1.00 0.00 ? 25  LEU D HD22 1  
ATOM   9141   H HD23 . LEU D 1 25  ? -131.456 -44.563 -136.709 1.00 0.00 ? 25  LEU D HD23 1  
ATOM   9142   N N    . GLU D 1 26  ? -136.237 -41.510 -136.089 1.00 0.00 ? 26  GLU D N    1  
ATOM   9143   C CA   . GLU D 1 26  ? -136.592 -41.036 -134.763 1.00 0.00 ? 26  GLU D CA   1  
ATOM   9144   C C    . GLU D 1 26  ? -138.120 -41.138 -134.473 1.00 0.00 ? 26  GLU D C    1  
ATOM   9145   O O    . GLU D 1 26  ? -138.497 -41.548 -133.383 1.00 0.00 ? 26  GLU D O    1  
ATOM   9146   C CB   . GLU D 1 26  ? -136.111 -39.562 -134.564 1.00 0.00 ? 26  GLU D CB   1  
ATOM   9147   C CG   . GLU D 1 26  ? -137.169 -38.556 -134.998 1.00 0.00 ? 26  GLU D CG   1  
ATOM   9148   C CD   . GLU D 1 26  ? -138.190 -38.279 -133.895 1.00 0.00 ? 26  GLU D CD   1  
ATOM   9149   O OE1  . GLU D 1 26  ? -137.802 -38.253 -132.729 1.00 0.00 ? 26  GLU D OE1  1  
ATOM   9150   O OE2  . GLU D 1 26  ? -139.354 -38.084 -134.248 1.00 0.00 ? 26  GLU D OE2  1  
ATOM   9151   H H    . GLU D 1 26  ? -135.914 -40.879 -136.763 1.00 0.00 ? 26  GLU D H    1  
ATOM   9152   H HA   . GLU D 1 26  ? -136.085 -41.632 -134.040 1.00 0.00 ? 26  GLU D HA   1  
ATOM   9153   H HB2  . GLU D 1 26  ? -135.881 -39.424 -133.529 1.00 0.00 ? 26  GLU D HB2  1  
ATOM   9154   H HB3  . GLU D 1 26  ? -135.227 -39.429 -135.156 1.00 0.00 ? 26  GLU D HB3  1  
ATOM   9155   H HG2  . GLU D 1 26  ? -136.677 -37.647 -135.247 1.00 0.00 ? 26  GLU D HG2  1  
ATOM   9156   H HG3  . GLU D 1 26  ? -137.686 -38.933 -135.860 1.00 0.00 ? 26  GLU D HG3  1  
ATOM   9157   N N    . LEU D 1 27  ? -138.910 -40.871 -135.513 1.00 0.00 ? 27  LEU D N    1  
ATOM   9158   C CA   . LEU D 1 27  ? -140.381 -40.993 -135.442 1.00 0.00 ? 27  LEU D CA   1  
ATOM   9159   C C    . LEU D 1 27  ? -140.722 -42.467 -135.303 1.00 0.00 ? 27  LEU D C    1  
ATOM   9160   O O    . LEU D 1 27  ? -141.524 -42.837 -134.453 1.00 0.00 ? 27  LEU D O    1  
ATOM   9161   C CB   . LEU D 1 27  ? -140.992 -40.423 -136.742 1.00 0.00 ? 27  LEU D CB   1  
ATOM   9162   C CG   . LEU D 1 27  ? -142.533 -40.539 -136.893 1.00 0.00 ? 27  LEU D CG   1  
ATOM   9163   C CD1  . LEU D 1 27  ? -142.952 -41.987 -137.107 1.00 0.00 ? 27  LEU D CD1  1  
ATOM   9164   C CD2  . LEU D 1 27  ? -143.261 -39.940 -135.692 1.00 0.00 ? 27  LEU D CD2  1  
ATOM   9165   H H    . LEU D 1 27  ? -138.494 -40.641 -136.365 1.00 0.00 ? 27  LEU D H    1  
ATOM   9166   H HA   . LEU D 1 27  ? -140.748 -40.449 -134.598 1.00 0.00 ? 27  LEU D HA   1  
ATOM   9167   H HB2  . LEU D 1 27  ? -140.756 -39.392 -136.795 1.00 0.00 ? 27  LEU D HB2  1  
ATOM   9168   H HB3  . LEU D 1 27  ? -140.544 -40.935 -137.568 1.00 0.00 ? 27  LEU D HB3  1  
ATOM   9169   H HG   . LEU D 1 27  ? -142.807 -39.976 -137.781 1.00 0.00 ? 27  LEU D HG   1  
ATOM   9170   H HD11 . LEU D 1 27  ? -143.158 -42.445 -136.154 1.00 0.00 ? 27  LEU D HD11 1  
ATOM   9171   H HD12 . LEU D 1 27  ? -142.160 -42.525 -137.605 1.00 0.00 ? 27  LEU D HD12 1  
ATOM   9172   H HD13 . LEU D 1 27  ? -143.842 -42.013 -137.721 1.00 0.00 ? 27  LEU D HD13 1  
ATOM   9173   H HD21 . LEU D 1 27  ? -143.309 -40.670 -134.902 1.00 0.00 ? 27  LEU D HD21 1  
ATOM   9174   H HD22 . LEU D 1 27  ? -144.266 -39.662 -135.987 1.00 0.00 ? 27  LEU D HD22 1  
ATOM   9175   H HD23 . LEU D 1 27  ? -142.734 -39.064 -135.350 1.00 0.00 ? 27  LEU D HD23 1  
ATOM   9176   N N    . THR D 1 28  ? -140.052 -43.302 -136.119 1.00 0.00 ? 28  THR D N    1  
ATOM   9177   C CA   . THR D 1 28  ? -140.226 -44.769 -136.076 1.00 0.00 ? 28  THR D CA   1  
ATOM   9178   C C    . THR D 1 28  ? -139.693 -45.316 -134.742 1.00 0.00 ? 28  THR D C    1  
ATOM   9179   O O    . THR D 1 28  ? -140.341 -46.145 -134.102 1.00 0.00 ? 28  THR D O    1  
ATOM   9180   C CB   . THR D 1 28  ? -139.473 -45.458 -137.258 1.00 0.00 ? 28  THR D CB   1  
ATOM   9181   O OG1  . THR D 1 28  ? -140.323 -45.550 -138.402 1.00 0.00 ? 28  THR D OG1  1  
ATOM   9182   C CG2  . THR D 1 28  ? -139.014 -46.870 -136.864 1.00 0.00 ? 28  THR D CG2  1  
ATOM   9183   H H    . THR D 1 28  ? -139.413 -42.923 -136.743 1.00 0.00 ? 28  THR D H    1  
ATOM   9184   H HA   . THR D 1 28  ? -141.272 -45.002 -136.151 1.00 0.00 ? 28  THR D HA   1  
ATOM   9185   H HB   . THR D 1 28  ? -138.603 -44.876 -137.513 1.00 0.00 ? 28  THR D HB   1  
ATOM   9186   H HG1  . THR D 1 28  ? -140.799 -46.386 -138.359 1.00 0.00 ? 28  THR D HG1  1  
ATOM   9187   H HG21 . THR D 1 28  ? -138.754 -47.424 -137.751 1.00 0.00 ? 28  THR D HG21 1  
ATOM   9188   H HG22 . THR D 1 28  ? -139.813 -47.373 -136.341 1.00 0.00 ? 28  THR D HG22 1  
ATOM   9189   H HG23 . THR D 1 28  ? -138.150 -46.797 -136.218 1.00 0.00 ? 28  THR D HG23 1  
ATOM   9190   N N    . ALA D 1 29  ? -138.510 -44.834 -134.347 1.00 0.00 ? 29  ALA D N    1  
ATOM   9191   C CA   . ALA D 1 29  ? -137.859 -45.256 -133.103 1.00 0.00 ? 29  ALA D CA   1  
ATOM   9192   C C    . ALA D 1 29  ? -138.552 -44.649 -131.879 1.00 0.00 ? 29  ALA D C    1  
ATOM   9193   O O    . ALA D 1 29  ? -138.418 -45.165 -130.768 1.00 0.00 ? 29  ALA D O    1  
ATOM   9194   C CB   . ALA D 1 29  ? -136.380 -44.872 -133.127 1.00 0.00 ? 29  ALA D CB   1  
ATOM   9195   H H    . ALA D 1 29  ? -138.065 -44.169 -134.903 1.00 0.00 ? 29  ALA D H    1  
ATOM   9196   H HA   . ALA D 1 29  ? -137.927 -46.327 -133.026 1.00 0.00 ? 29  ALA D HA   1  
ATOM   9197   H HB1  . ALA D 1 29  ? -136.283 -43.799 -133.103 1.00 0.00 ? 29  ALA D HB1  1  
ATOM   9198   H HB2  . ALA D 1 29  ? -135.926 -45.257 -134.029 1.00 0.00 ? 29  ALA D HB2  1  
ATOM   9199   H HB3  . ALA D 1 29  ? -135.886 -45.300 -132.267 1.00 0.00 ? 29  ALA D HB3  1  
ATOM   9200   N N    . LEU D 1 30  ? -139.289 -43.553 -132.093 1.00 0.00 ? 30  LEU D N    1  
ATOM   9201   C CA   . LEU D 1 30  ? -139.995 -42.859 -130.997 1.00 0.00 ? 30  LEU D CA   1  
ATOM   9202   C C    . LEU D 1 30  ? -140.731 -43.838 -130.061 1.00 0.00 ? 30  LEU D C    1  
ATOM   9203   O O    . LEU D 1 30  ? -140.583 -43.743 -128.838 1.00 0.00 ? 30  LEU D O    1  
ATOM   9204   C CB   . LEU D 1 30  ? -140.977 -41.830 -131.588 1.00 0.00 ? 30  LEU D CB   1  
ATOM   9205   C CG   . LEU D 1 30  ? -140.983 -40.498 -130.809 1.00 0.00 ? 30  LEU D CG   1  
ATOM   9206   C CD1  . LEU D 1 30  ? -141.125 -40.739 -129.313 1.00 0.00 ? 30  LEU D CD1  1  
ATOM   9207   C CD2  . LEU D 1 30  ? -139.717 -39.697 -131.111 1.00 0.00 ? 30  LEU D CD2  1  
ATOM   9208   H H    . LEU D 1 30  ? -139.365 -43.206 -133.003 1.00 0.00 ? 30  LEU D H    1  
ATOM   9209   H HA   . LEU D 1 30  ? -139.266 -42.344 -130.421 1.00 0.00 ? 30  LEU D HA   1  
ATOM   9210   H HB2  . LEU D 1 30  ? -140.703 -41.622 -132.604 1.00 0.00 ? 30  LEU D HB2  1  
ATOM   9211   H HB3  . LEU D 1 30  ? -141.971 -42.234 -131.564 1.00 0.00 ? 30  LEU D HB3  1  
ATOM   9212   H HG   . LEU D 1 30  ? -141.831 -39.932 -131.135 1.00 0.00 ? 30  LEU D HG   1  
ATOM   9213   H HD11 . LEU D 1 30  ? -140.164 -40.954 -128.882 1.00 0.00 ? 30  LEU D HD11 1  
ATOM   9214   H HD12 . LEU D 1 30  ? -141.795 -41.570 -129.149 1.00 0.00 ? 30  LEU D HD12 1  
ATOM   9215   H HD13 . LEU D 1 30  ? -141.535 -39.850 -128.857 1.00 0.00 ? 30  LEU D HD13 1  
ATOM   9216   H HD21 . LEU D 1 30  ? -139.529 -39.719 -132.174 1.00 0.00 ? 30  LEU D HD21 1  
ATOM   9217   H HD22 . LEU D 1 30  ? -138.879 -40.118 -130.585 1.00 0.00 ? 30  LEU D HD22 1  
ATOM   9218   H HD23 . LEU D 1 30  ? -139.865 -38.674 -130.796 1.00 0.00 ? 30  LEU D HD23 1  
ATOM   9219   N N    . TRP D 1 31  ? -141.471 -44.785 -130.648 1.00 0.00 ? 31  TRP D N    1  
ATOM   9220   C CA   . TRP D 1 31  ? -142.210 -45.806 -129.885 1.00 0.00 ? 31  TRP D CA   1  
ATOM   9221   C C    . TRP D 1 31  ? -142.887 -45.193 -128.667 1.00 0.00 ? 31  TRP D C    1  
ATOM   9222   O O    . TRP D 1 31  ? -142.309 -45.141 -127.583 1.00 0.00 ? 31  TRP D O    1  
ATOM   9223   C CB   . TRP D 1 31  ? -141.239 -46.930 -129.458 1.00 0.00 ? 31  TRP D CB   1  
ATOM   9224   C CG   . TRP D 1 31  ? -141.936 -48.111 -128.825 1.00 0.00 ? 31  TRP D CG   1  
ATOM   9225   C CD1  . TRP D 1 31  ? -143.284 -48.262 -128.636 1.00 0.00 ? 31  TRP D CD1  1  
ATOM   9226   C CD2  . TRP D 1 31  ? -141.324 -49.312 -128.310 1.00 0.00 ? 31  TRP D CD2  1  
ATOM   9227   N NE1  . TRP D 1 31  ? -143.523 -49.472 -128.026 1.00 0.00 ? 31  TRP D NE1  1  
ATOM   9228   C CE2  . TRP D 1 31  ? -142.363 -50.159 -127.805 1.00 0.00 ? 31  TRP D CE2  1  
ATOM   9229   C CE3  . TRP D 1 31  ? -139.995 -49.764 -128.219 1.00 0.00 ? 31  TRP D CE3  1  
ATOM   9230   C CZ2  . TRP D 1 31  ? -142.096 -51.387 -127.239 1.00 0.00 ? 31  TRP D CZ2  1  
ATOM   9231   C CZ3  . TRP D 1 31  ? -139.736 -51.016 -127.643 1.00 0.00 ? 31  TRP D CZ3  1  
ATOM   9232   C CH2  . TRP D 1 31  ? -140.787 -51.822 -127.156 1.00 0.00 ? 31  TRP D CH2  1  
ATOM   9233   H H    . TRP D 1 31  ? -141.509 -44.808 -131.621 1.00 0.00 ? 31  TRP D H    1  
ATOM   9234   H HA   . TRP D 1 31  ? -142.963 -46.229 -130.530 1.00 0.00 ? 31  TRP D HA   1  
ATOM   9235   H HB2  . TRP D 1 31  ? -140.707 -47.279 -130.327 1.00 0.00 ? 31  TRP D HB2  1  
ATOM   9236   H HB3  . TRP D 1 31  ? -140.531 -46.525 -128.755 1.00 0.00 ? 31  TRP D HB3  1  
ATOM   9237   H HD1  . TRP D 1 31  ? -144.033 -47.550 -128.912 1.00 0.00 ? 31  TRP D HD1  1  
ATOM   9238   H HE1  . TRP D 1 31  ? -144.416 -49.831 -127.772 1.00 0.00 ? 31  TRP D HE1  1  
ATOM   9239   H HE3  . TRP D 1 31  ? -139.174 -49.155 -128.591 1.00 0.00 ? 31  TRP D HE3  1  
ATOM   9240   H HZ2  . TRP D 1 31  ? -142.907 -52.011 -126.861 1.00 0.00 ? 31  TRP D HZ2  1  
ATOM   9241   H HZ3  . TRP D 1 31  ? -138.723 -51.373 -127.570 1.00 0.00 ? 31  TRP D HZ3  1  
ATOM   9242   H HH2  . TRP D 1 31  ? -140.570 -52.777 -126.719 1.00 0.00 ? 31  TRP D HH2  1  
ATOM   9243   N N    . PHE D 1 32  ? -144.131 -44.748 -128.867 1.00 0.00 ? 32  PHE D N    1  
ATOM   9244   C CA   . PHE D 1 32  ? -144.947 -44.137 -127.811 1.00 0.00 ? 32  PHE D CA   1  
ATOM   9245   C C    . PHE D 1 32  ? -144.203 -42.990 -127.107 1.00 0.00 ? 32  PHE D C    1  
ATOM   9246   O O    . PHE D 1 32  ? -142.988 -43.009 -126.979 1.00 0.00 ? 32  PHE D O    1  
ATOM   9247   C CB   . PHE D 1 32  ? -145.406 -45.200 -126.790 1.00 0.00 ? 32  PHE D CB   1  
ATOM   9248   C CG   . PHE D 1 32  ? -146.676 -45.919 -127.241 1.00 0.00 ? 32  PHE D CG   1  
ATOM   9249   C CD1  . PHE D 1 32  ? -147.844 -45.201 -127.504 1.00 0.00 ? 32  PHE D CD1  1  
ATOM   9250   C CD2  . PHE D 1 32  ? -146.678 -47.309 -127.377 1.00 0.00 ? 32  PHE D CD2  1  
ATOM   9251   C CE1  . PHE D 1 32  ? -149.011 -45.868 -127.906 1.00 0.00 ? 32  PHE D CE1  1  
ATOM   9252   C CE2  . PHE D 1 32  ? -147.845 -47.976 -127.780 1.00 0.00 ? 32  PHE D CE2  1  
ATOM   9253   C CZ   . PHE D 1 32  ? -149.012 -47.255 -128.045 1.00 0.00 ? 32  PHE D CZ   1  
ATOM   9254   H H    . PHE D 1 32  ? -144.526 -44.839 -129.760 1.00 0.00 ? 32  PHE D H    1  
ATOM   9255   H HA   . PHE D 1 32  ? -145.810 -43.716 -128.273 1.00 0.00 ? 32  PHE D HA   1  
ATOM   9256   H HB2  . PHE D 1 32  ? -144.629 -45.927 -126.670 1.00 0.00 ? 32  PHE D HB2  1  
ATOM   9257   H HB3  . PHE D 1 32  ? -145.598 -44.718 -125.851 1.00 0.00 ? 32  PHE D HB3  1  
ATOM   9258   H HD1  . PHE D 1 32  ? -147.852 -44.134 -127.399 1.00 0.00 ? 32  PHE D HD1  1  
ATOM   9259   H HD2  . PHE D 1 32  ? -145.784 -47.870 -127.172 1.00 0.00 ? 32  PHE D HD2  1  
ATOM   9260   H HE1  . PHE D 1 32  ? -149.911 -45.305 -128.108 1.00 0.00 ? 32  PHE D HE1  1  
ATOM   9261   H HE2  . PHE D 1 32  ? -147.840 -49.051 -127.889 1.00 0.00 ? 32  PHE D HE2  1  
ATOM   9262   H HZ   . PHE D 1 32  ? -149.909 -47.769 -128.355 1.00 0.00 ? 32  PHE D HZ   1  
ATOM   9263   N N    . GLN D 1 33  ? -144.976 -42.030 -126.588 1.00 0.00 ? 33  GLN D N    1  
ATOM   9264   C CA   . GLN D 1 33  ? -144.419 -40.894 -125.865 1.00 0.00 ? 33  GLN D CA   1  
ATOM   9265   C C    . GLN D 1 33  ? -145.548 -40.028 -125.309 1.00 0.00 ? 33  GLN D C    1  
ATOM   9266   O O    . GLN D 1 33  ? -146.691 -40.482 -125.216 1.00 0.00 ? 33  GLN D O    1  
ATOM   9267   C CB   . GLN D 1 33  ? -143.468 -40.045 -126.740 1.00 0.00 ? 33  GLN D CB   1  
ATOM   9268   C CG   . GLN D 1 33  ? -144.173 -39.363 -127.933 1.00 0.00 ? 33  GLN D CG   1  
ATOM   9269   C CD   . GLN D 1 33  ? -143.592 -37.975 -128.226 1.00 0.00 ? 33  GLN D CD   1  
ATOM   9270   O OE1  . GLN D 1 33  ? -142.370 -37.762 -128.154 1.00 0.00 ? 33  GLN D OE1  1  
ATOM   9271   N NE2  . GLN D 1 33  ? -144.437 -37.021 -128.558 1.00 0.00 ? 33  GLN D NE2  1  
ATOM   9272   H H    . GLN D 1 33  ? -145.947 -42.106 -126.669 1.00 0.00 ? 33  GLN D H    1  
ATOM   9273   H HA   . GLN D 1 33  ? -143.840 -41.292 -125.032 1.00 0.00 ? 33  GLN D HA   1  
ATOM   9274   H HB2  . GLN D 1 33  ? -143.028 -39.292 -126.122 1.00 0.00 ? 33  GLN D HB2  1  
ATOM   9275   H HB3  . GLN D 1 33  ? -142.700 -40.694 -127.115 1.00 0.00 ? 33  GLN D HB3  1  
ATOM   9276   H HG2  . GLN D 1 33  ? -144.049 -39.970 -128.812 1.00 0.00 ? 33  GLN D HG2  1  
ATOM   9277   H HG3  . GLN D 1 33  ? -145.219 -39.249 -127.722 1.00 0.00 ? 33  GLN D HG3  1  
ATOM   9278   H HE21 . GLN D 1 33  ? -145.403 -37.226 -128.607 1.00 0.00 ? 33  GLN D HE21 1  
ATOM   9279   H HE22 . GLN D 1 33  ? -144.127 -36.115 -128.749 1.00 0.00 ? 33  GLN D HE22 1  
ATOM   9280   N N    . HIS D 1 34  ? -145.210 -38.803 -124.896 1.00 0.00 ? 34  HIS D N    1  
ATOM   9281   C CA   . HIS D 1 34  ? -146.188 -37.882 -124.286 1.00 0.00 ? 34  HIS D CA   1  
ATOM   9282   C C    . HIS D 1 34  ? -147.540 -37.771 -124.999 1.00 0.00 ? 34  HIS D C    1  
ATOM   9283   O O    . HIS D 1 34  ? -148.560 -37.615 -124.319 1.00 0.00 ? 34  HIS D O    1  
ATOM   9284   C CB   . HIS D 1 34  ? -145.551 -36.500 -124.057 1.00 0.00 ? 34  HIS D CB   1  
ATOM   9285   C CG   . HIS D 1 34  ? -146.237 -35.412 -124.826 1.00 0.00 ? 34  HIS D CG   1  
ATOM   9286   N ND1  . HIS D 1 34  ? -147.284 -34.672 -124.284 1.00 0.00 ? 34  HIS D ND1  1  
ATOM   9287   C CD2  . HIS D 1 34  ? -146.041 -34.930 -126.068 1.00 0.00 ? 34  HIS D CD2  1  
ATOM   9288   C CE1  . HIS D 1 34  ? -147.671 -33.795 -125.198 1.00 0.00 ? 34  HIS D CE1  1  
ATOM   9289   N NE2  . HIS D 1 34  ? -146.948 -33.909 -126.305 1.00 0.00 ? 34  HIS D NE2  1  
ATOM   9290   H H    . HIS D 1 34  ? -144.272 -38.524 -124.961 1.00 0.00 ? 34  HIS D H    1  
ATOM   9291   H HA   . HIS D 1 34  ? -146.392 -38.292 -123.319 1.00 0.00 ? 34  HIS D HA   1  
ATOM   9292   H HB2  . HIS D 1 34  ? -145.619 -36.268 -123.008 1.00 0.00 ? 34  HIS D HB2  1  
ATOM   9293   H HB3  . HIS D 1 34  ? -144.520 -36.538 -124.348 1.00 0.00 ? 34  HIS D HB3  1  
ATOM   9294   H HD1  . HIS D 1 34  ? -147.659 -34.782 -123.402 1.00 0.00 ? 34  HIS D HD1  1  
ATOM   9295   H HD2  . HIS D 1 34  ? -145.297 -35.285 -126.780 1.00 0.00 ? 34  HIS D HD2  1  
ATOM   9296   H HE1  . HIS D 1 34  ? -148.480 -33.073 -125.062 1.00 0.00 ? 34  HIS D HE1  1  
ATOM   9297   H HE2  . HIS D 1 34  ? -147.031 -33.393 -127.103 1.00 0.00 ? 34  HIS D HE2  1  
ATOM   9298   N N    . VAL D 1 35  ? -147.546 -37.720 -126.327 1.00 0.00 ? 35  VAL D N    1  
ATOM   9299   C CA   . VAL D 1 35  ? -148.820 -37.519 -127.058 1.00 0.00 ? 35  VAL D CA   1  
ATOM   9300   C C    . VAL D 1 35  ? -149.866 -38.617 -126.846 1.00 0.00 ? 35  VAL D C    1  
ATOM   9301   O O    . VAL D 1 35  ? -151.063 -38.308 -126.813 1.00 0.00 ? 35  VAL D O    1  
ATOM   9302   C CB   . VAL D 1 35  ? -148.501 -37.327 -128.613 1.00 0.00 ? 35  VAL D CB   1  
ATOM   9303   C CG1  . VAL D 1 35  ? -147.889 -38.596 -129.259 1.00 0.00 ? 35  VAL D CG1  1  
ATOM   9304   C CG2  . VAL D 1 35  ? -149.853 -36.976 -129.349 1.00 0.00 ? 35  VAL D CG2  1  
ATOM   9305   H H    . VAL D 1 35  ? -146.691 -37.745 -126.804 1.00 0.00 ? 35  VAL D H    1  
ATOM   9306   H HA   . VAL D 1 35  ? -149.214 -36.602 -126.720 1.00 0.00 ? 35  VAL D HA   1  
ATOM   9307   H HB   . VAL D 1 35  ? -147.873 -36.600 -128.506 1.00 0.00 ? 35  VAL D HB   1  
ATOM   9308   H HG11 . VAL D 1 35  ? -148.491 -38.955 -130.063 1.00 0.00 ? 35  VAL D HG11 1  
ATOM   9309   H HG12 . VAL D 1 35  ? -147.784 -39.364 -128.493 1.00 0.00 ? 35  VAL D HG12 1  
ATOM   9310   H HG13 . VAL D 1 35  ? -146.902 -38.325 -129.616 1.00 0.00 ? 35  VAL D HG13 1  
ATOM   9311   H HG21 . VAL D 1 35  ? -149.647 -36.890 -130.407 1.00 0.00 ? 35  VAL D HG21 1  
ATOM   9312   H HG22 . VAL D 1 35  ? -150.197 -36.023 -128.970 1.00 0.00 ? 35  VAL D HG22 1  
ATOM   9313   H HG23 . VAL D 1 35  ? -150.587 -37.736 -129.171 1.00 0.00 ? 35  VAL D HG23 1  
ATOM   9314   N N    . MET D 1 36  ? -149.418 -39.863 -126.732 1.00 0.00 ? 36  MET D N    1  
ATOM   9315   C CA   . MET D 1 36  ? -150.327 -40.981 -126.528 1.00 0.00 ? 36  MET D CA   1  
ATOM   9316   C C    . MET D 1 36  ? -149.952 -41.774 -125.177 1.00 0.00 ? 36  MET D C    1  
ATOM   9317   O O    . MET D 1 36  ? -150.824 -41.984 -124.346 1.00 0.00 ? 36  MET D O    1  
ATOM   9318   C CB   . MET D 1 36  ? -150.282 -41.968 -127.706 1.00 0.00 ? 36  MET D CB   1  
ATOM   9319   C CG   . MET D 1 36  ? -151.065 -41.429 -128.915 1.00 0.00 ? 36  MET D CG   1  
ATOM   9320   S SD   . MET D 1 36  ? -151.114 -42.656 -130.269 1.00 0.00 ? 36  MET D SD   1  
ATOM   9321   C CE   . MET D 1 36  ? -152.502 -43.702 -129.757 1.00 0.00 ? 36  MET D CE   1  
ATOM   9322   H H    . MET D 1 36  ? -148.456 -40.025 -126.772 1.00 0.00 ? 36  MET D H    1  
ATOM   9323   H HA   . MET D 1 36  ? -151.320 -40.625 -126.394 1.00 0.00 ? 36  MET D HA   1  
ATOM   9324   H HB2  . MET D 1 36  ? -149.262 -42.111 -127.994 1.00 0.00 ? 36  MET D HB2  1  
ATOM   9325   H HB3  . MET D 1 36  ? -150.710 -42.900 -127.402 1.00 0.00 ? 36  MET D HB3  1  
ATOM   9326   H HG2  . MET D 1 36  ? -152.061 -41.195 -128.620 1.00 0.00 ? 36  MET D HG2  1  
ATOM   9327   H HG3  . MET D 1 36  ? -150.572 -40.543 -129.281 1.00 0.00 ? 36  MET D HG3  1  
ATOM   9328   H HE1  . MET D 1 36  ? -152.956 -43.300 -128.870 1.00 0.00 ? 36  MET D HE1  1  
ATOM   9329   H HE2  . MET D 1 36  ? -152.138 -44.699 -129.559 1.00 0.00 ? 36  MET D HE2  1  
ATOM   9330   H HE3  . MET D 1 36  ? -153.229 -43.744 -130.560 1.00 0.00 ? 36  MET D HE3  1  
ATOM   9331   N N    . LEU D 1 37  ? -148.674 -42.124 -125.065 1.00 0.00 ? 37  LEU D N    1  
ATOM   9332   C CA   . LEU D 1 37  ? -148.133 -42.834 -123.838 1.00 0.00 ? 37  LEU D CA   1  
ATOM   9333   C C    . LEU D 1 37  ? -146.527 -42.275 -123.986 1.00 0.00 ? 37  LEU D C    1  
ATOM   9334   O O    . LEU D 1 37  ? -146.341 -41.445 -123.034 1.00 0.00 ? 37  LEU D O    1  
ATOM   9335   C CB   . LEU D 1 37  ? -148.316 -44.386 -124.061 1.00 0.00 ? 37  LEU D CB   1  
ATOM   9336   C CG   . LEU D 1 37  ? -149.532 -45.013 -123.310 1.00 0.00 ? 37  LEU D CG   1  
ATOM   9337   C CD1  . LEU D 1 37  ? -150.528 -45.595 -124.324 1.00 0.00 ? 37  LEU D CD1  1  
ATOM   9338   C CD2  . LEU D 1 37  ? -149.058 -46.141 -122.362 1.00 0.00 ? 37  LEU D CD2  1  
ATOM   9339   H H    . LEU D 1 37  ? -148.056 -41.858 -125.790 1.00 0.00 ? 37  LEU D H    1  
ATOM   9340   H HA   . LEU D 1 37  ? -148.675 -42.501 -123.039 1.00 0.00 ? 37  LEU D HA   1  
ATOM   9341   H HB2  . LEU D 1 37  ? -148.452 -44.576 -125.096 1.00 0.00 ? 37  LEU D HB2  1  
ATOM   9342   H HB3  . LEU D 1 37  ? -147.434 -44.847 -123.719 1.00 0.00 ? 37  LEU D HB3  1  
ATOM   9343   H HG   . LEU D 1 37  ? -150.030 -44.277 -122.739 1.00 0.00 ? 37  LEU D HG   1  
ATOM   9344   H HD11 . LEU D 1 37  ? -150.951 -44.778 -124.893 1.00 0.00 ? 37  LEU D HD11 1  
ATOM   9345   H HD12 . LEU D 1 37  ? -151.311 -46.114 -123.799 1.00 0.00 ? 37  LEU D HD12 1  
ATOM   9346   H HD13 . LEU D 1 37  ? -150.025 -46.276 -124.995 1.00 0.00 ? 37  LEU D HD13 1  
ATOM   9347   H HD21 . LEU D 1 37  ? -148.501 -46.884 -122.909 1.00 0.00 ? 37  LEU D HD21 1  
ATOM   9348   H HD22 . LEU D 1 37  ? -149.920 -46.601 -121.900 1.00 0.00 ? 37  LEU D HD22 1  
ATOM   9349   H HD23 . LEU D 1 37  ? -148.429 -45.709 -121.596 1.00 0.00 ? 37  LEU D HD23 1  
ATOM   9350   N N    . LEU D 1 38  ? -145.850 -43.503 -123.827 1.00 0.00 ? 38  LEU D N    1  
ATOM   9351   C CA   . LEU D 1 38  ? -144.554 -43.959 -123.197 1.00 0.00 ? 38  LEU D CA   1  
ATOM   9352   C C    . LEU D 1 38  ? -144.703 -43.649 -121.624 1.00 0.00 ? 38  LEU D C    1  
ATOM   9353   O O    . LEU D 1 38  ? -145.816 -43.581 -121.034 1.00 0.00 ? 38  LEU D O    1  
ATOM   9354   C CB   . LEU D 1 38  ? -143.224 -43.815 -123.724 1.00 0.00 ? 38  LEU D CB   1  
ATOM   9355   C CG   . LEU D 1 38  ? -142.294 -44.999 -123.340 1.00 0.00 ? 38  LEU D CG   1  
ATOM   9356   C CD1  . LEU D 1 38  ? -142.786 -46.337 -123.893 1.00 0.00 ? 38  LEU D CD1  1  
ATOM   9357   C CD2  . LEU D 1 38  ? -140.879 -44.701 -123.865 1.00 0.00 ? 38  LEU D CD2  1  
ATOM   9358   H H    . LEU D 1 38  ? -146.081 -43.487 -123.009 1.00 0.00 ? 38  LEU D H    1  
ATOM   9359   H HA   . LEU D 1 38  ? -144.856 -45.050 -123.191 1.00 0.00 ? 38  LEU D HA   1  
ATOM   9360   H HB2  . LEU D 1 38  ? -143.312 -43.769 -124.775 1.00 0.00 ? 38  LEU D HB2  1  
ATOM   9361   H HB3  . LEU D 1 38  ? -142.812 -42.923 -123.325 1.00 0.00 ? 38  LEU D HB3  1  
ATOM   9362   H HG   . LEU D 1 38  ? -142.247 -45.076 -122.284 1.00 0.00 ? 38  LEU D HG   1  
ATOM   9363   H HD11 . LEU D 1 38  ? -143.345 -46.182 -124.797 1.00 0.00 ? 38  LEU D HD11 1  
ATOM   9364   H HD12 . LEU D 1 38  ? -143.421 -46.801 -123.148 1.00 0.00 ? 38  LEU D HD12 1  
ATOM   9365   H HD13 . LEU D 1 38  ? -141.943 -46.982 -124.089 1.00 0.00 ? 38  LEU D HD13 1  
ATOM   9366   H HD21 . LEU D 1 38  ? -140.457 -43.891 -123.287 1.00 0.00 ? 38  LEU D HD21 1  
ATOM   9367   H HD22 . LEU D 1 38  ? -140.917 -44.424 -124.904 1.00 0.00 ? 38  LEU D HD22 1  
ATOM   9368   H HD23 . LEU D 1 38  ? -140.264 -45.582 -123.746 1.00 0.00 ? 38  LEU D HD23 1  
ATOM   9369   N N    . LYS D 1 39  ? -143.551 -43.578 -120.977 1.00 0.00 ? 39  LYS D N    1  
ATOM   9370   C CA   . LYS D 1 39  ? -143.461 -43.341 -119.531 1.00 0.00 ? 39  LYS D CA   1  
ATOM   9371   C C    . LYS D 1 39  ? -142.730 -42.040 -119.070 1.00 0.00 ? 39  LYS D C    1  
ATOM   9372   O O    . LYS D 1 39  ? -143.309 -41.287 -118.262 1.00 0.00 ? 39  LYS D O    1  
ATOM   9373   C CB   . LYS D 1 39  ? -142.752 -44.544 -118.893 1.00 0.00 ? 39  LYS D CB   1  
ATOM   9374   C CG   . LYS D 1 39  ? -143.381 -45.888 -119.298 1.00 0.00 ? 39  LYS D CG   1  
ATOM   9375   C CD   . LYS D 1 39  ? -144.575 -46.207 -118.401 1.00 0.00 ? 39  LYS D CD   1  
ATOM   9376   C CE   . LYS D 1 39  ? -145.555 -47.126 -119.134 1.00 0.00 ? 39  LYS D CE   1  
ATOM   9377   N NZ   . LYS D 1 39  ? -146.282 -46.381 -120.203 1.00 0.00 ? 39  LYS D NZ   1  
ATOM   9378   H H    . LYS D 1 39  ? -142.739 -43.720 -121.495 1.00 0.00 ? 39  LYS D H    1  
ATOM   9379   H HA   . LYS D 1 39  ? -144.452 -43.296 -119.141 1.00 0.00 ? 39  LYS D HA   1  
ATOM   9380   H HB2  . LYS D 1 39  ? -141.731 -44.559 -119.204 1.00 0.00 ? 39  LYS D HB2  1  
ATOM   9381   H HB3  . LYS D 1 39  ? -142.802 -44.445 -117.828 1.00 0.00 ? 39  LYS D HB3  1  
ATOM   9382   H HG2  . LYS D 1 39  ? -143.697 -45.848 -120.318 1.00 0.00 ? 39  LYS D HG2  1  
ATOM   9383   H HG3  . LYS D 1 39  ? -142.634 -46.665 -119.177 1.00 0.00 ? 39  LYS D HG3  1  
ATOM   9384   H HD2  . LYS D 1 39  ? -144.228 -46.710 -117.509 1.00 0.00 ? 39  LYS D HD2  1  
ATOM   9385   H HD3  . LYS D 1 39  ? -145.073 -45.297 -118.130 1.00 0.00 ? 39  LYS D HD3  1  
ATOM   9386   H HE2  . LYS D 1 39  ? -145.011 -47.940 -119.578 1.00 0.00 ? 39  LYS D HE2  1  
ATOM   9387   H HE3  . LYS D 1 39  ? -146.265 -47.511 -118.422 1.00 0.00 ? 39  LYS D HE3  1  
ATOM   9388   H HZ1  . LYS D 1 39  ? -147.046 -45.820 -119.779 1.00 0.00 ? 39  LYS D HZ1  1  
ATOM   9389   H HZ2  . LYS D 1 39  ? -146.689 -47.067 -120.876 1.00 0.00 ? 39  LYS D HZ2  1  
ATOM   9390   H HZ3  . LYS D 1 39  ? -145.626 -45.753 -120.703 1.00 0.00 ? 39  LYS D HZ3  1  
ATOM   9391   N N    . PRO D 1 40  ? -141.516 -41.752 -119.538 1.00 0.00 ? 40  PRO D N    1  
ATOM   9392   C CA   . PRO D 1 40  ? -140.734 -40.555 -119.086 1.00 0.00 ? 40  PRO D CA   1  
ATOM   9393   C C    . PRO D 1 40  ? -141.422 -39.214 -119.364 1.00 0.00 ? 40  PRO D C    1  
ATOM   9394   O O    . PRO D 1 40  ? -142.206 -39.083 -120.299 1.00 0.00 ? 40  PRO D O    1  
ATOM   9395   C CB   . PRO D 1 40  ? -139.432 -40.648 -119.882 1.00 0.00 ? 40  PRO D CB   1  
ATOM   9396   C CG   . PRO D 1 40  ? -139.764 -41.456 -121.083 1.00 0.00 ? 40  PRO D CG   1  
ATOM   9397   C CD   . PRO D 1 40  ? -140.772 -42.488 -120.591 1.00 0.00 ? 40  PRO D CD   1  
ATOM   9398   H HA   . PRO D 1 40  ? -140.514 -40.640 -118.041 1.00 0.00 ? 40  PRO D HA   1  
ATOM   9399   H HB2  . PRO D 1 40  ? -139.098 -39.660 -120.172 1.00 0.00 ? 40  PRO D HB2  1  
ATOM   9400   H HB3  . PRO D 1 40  ? -138.673 -41.147 -119.301 1.00 0.00 ? 40  PRO D HB3  1  
ATOM   9401   H HG2  . PRO D 1 40  ? -140.204 -40.828 -121.849 1.00 0.00 ? 40  PRO D HG2  1  
ATOM   9402   H HG3  . PRO D 1 40  ? -138.886 -41.952 -121.461 1.00 0.00 ? 40  PRO D HG3  1  
ATOM   9403   H HD2  . PRO D 1 40  ? -141.436 -42.764 -121.395 1.00 0.00 ? 40  PRO D HD2  1  
ATOM   9404   H HD3  . PRO D 1 40  ? -140.260 -43.340 -120.193 1.00 0.00 ? 40  PRO D HD3  1  
ATOM   9405   N N    . SER D 1 41  ? -141.053 -38.207 -118.542 1.00 0.00 ? 41  SER D N    1  
ATOM   9406   C CA   . SER D 1 41  ? -141.585 -36.834 -118.708 1.00 0.00 ? 41  SER D CA   1  
ATOM   9407   C C    . SER D 1 41  ? -140.840 -35.763 -117.860 1.00 0.00 ? 41  SER D C    1  
ATOM   9408   O O    . SER D 1 41  ? -141.455 -34.787 -117.427 1.00 0.00 ? 41  SER D O    1  
ATOM   9409   C CB   . SER D 1 41  ? -143.100 -36.800 -118.423 1.00 0.00 ? 41  SER D CB   1  
ATOM   9410   O OG   . SER D 1 41  ? -143.603 -35.467 -118.497 1.00 0.00 ? 41  SER D OG   1  
ATOM   9411   H H    . SER D 1 41  ? -140.400 -38.393 -117.846 1.00 0.00 ? 41  SER D H    1  
ATOM   9412   H HA   . SER D 1 41  ? -141.442 -36.576 -119.726 1.00 0.00 ? 41  SER D HA   1  
ATOM   9413   H HB2  . SER D 1 41  ? -143.602 -37.390 -119.169 1.00 0.00 ? 41  SER D HB2  1  
ATOM   9414   H HB3  . SER D 1 41  ? -143.298 -37.211 -117.451 1.00 0.00 ? 41  SER D HB3  1  
ATOM   9415   H HG   . SER D 1 41  ? -143.237 -34.972 -117.765 1.00 0.00 ? 41  SER D HG   1  
ATOM   9416   N N    . VAL D 1 42  ? -139.512 -35.954 -117.672 1.00 0.00 ? 42  VAL D N    1  
ATOM   9417   C CA   . VAL D 1 42  ? -138.660 -35.018 -116.879 1.00 0.00 ? 42  VAL D CA   1  
ATOM   9418   C C    . VAL D 1 42  ? -138.360 -33.671 -117.597 1.00 0.00 ? 42  VAL D C    1  
ATOM   9419   O O    . VAL D 1 42  ? -139.260 -33.036 -118.165 1.00 0.00 ? 42  VAL D O    1  
ATOM   9420   C CB   . VAL D 1 42  ? -137.308 -35.703 -116.449 1.00 0.00 ? 42  VAL D CB   1  
ATOM   9421   C CG1  . VAL D 1 42  ? -136.681 -34.954 -115.253 1.00 0.00 ? 42  VAL D CG1  1  
ATOM   9422   C CG2  . VAL D 1 42  ? -137.520 -37.181 -116.074 1.00 0.00 ? 42  VAL D CG2  1  
ATOM   9423   H H    . VAL D 1 42  ? -139.107 -36.741 -118.059 1.00 0.00 ? 42  VAL D H    1  
ATOM   9424   H HA   . VAL D 1 42  ? -139.198 -34.767 -115.992 1.00 0.00 ? 42  VAL D HA   1  
ATOM   9425   H HB   . VAL D 1 42  ? -136.615 -35.657 -117.265 1.00 0.00 ? 42  VAL D HB   1  
ATOM   9426   H HG11 . VAL D 1 42  ? -136.704 -33.892 -115.445 1.00 0.00 ? 42  VAL D HG11 1  
ATOM   9427   H HG12 . VAL D 1 42  ? -135.653 -35.269 -115.128 1.00 0.00 ? 42  VAL D HG12 1  
ATOM   9428   H HG13 . VAL D 1 42  ? -137.232 -35.166 -114.350 1.00 0.00 ? 42  VAL D HG13 1  
ATOM   9429   H HG21 . VAL D 1 42  ? -137.721 -37.746 -116.974 1.00 0.00 ? 42  VAL D HG21 1  
ATOM   9430   H HG22 . VAL D 1 42  ? -138.349 -37.274 -115.395 1.00 0.00 ? 42  VAL D HG22 1  
ATOM   9431   H HG23 . VAL D 1 42  ? -136.623 -37.568 -115.606 1.00 0.00 ? 42  VAL D HG23 1  
ATOM   9432   N N    . LEU D 1 43  ? -137.051 -33.333 -117.649 1.00 0.00 ? 43  LEU D N    1  
ATOM   9433   C CA   . LEU D 1 43  ? -136.526 -32.141 -118.319 1.00 0.00 ? 43  LEU D CA   1  
ATOM   9434   C C    . LEU D 1 43  ? -136.414 -32.458 -119.787 1.00 0.00 ? 43  LEU D C    1  
ATOM   9435   O O    . LEU D 1 43  ? -136.225 -31.575 -120.612 1.00 0.00 ? 43  LEU D O    1  
ATOM   9436   C CB   . LEU D 1 43  ? -135.156 -31.706 -117.699 1.00 0.00 ? 43  LEU D CB   1  
ATOM   9437   C CG   . LEU D 1 43  ? -133.807 -32.281 -118.236 1.00 0.00 ? 43  LEU D CG   1  
ATOM   9438   C CD1  . LEU D 1 43  ? -132.679 -31.578 -117.445 1.00 0.00 ? 43  LEU D CD1  1  
ATOM   9439   C CD2  . LEU D 1 43  ? -133.684 -33.778 -118.015 1.00 0.00 ? 43  LEU D CD2  1  
ATOM   9440   H H    . LEU D 1 43  ? -136.416 -33.950 -117.264 1.00 0.00 ? 43  LEU D H    1  
ATOM   9441   H HA   . LEU D 1 43  ? -137.224 -31.295 -118.185 1.00 0.00 ? 43  LEU D HA   1  
ATOM   9442   H HB2  . LEU D 1 43  ? -135.079 -30.669 -117.854 1.00 0.00 ? 43  LEU D HB2  1  
ATOM   9443   H HB3  . LEU D 1 43  ? -135.211 -31.916 -116.671 1.00 0.00 ? 43  LEU D HB3  1  
ATOM   9444   H HG   . LEU D 1 43  ? -133.679 -32.044 -119.262 1.00 0.00 ? 43  LEU D HG   1  
ATOM   9445   H HD11 . LEU D 1 43  ? -131.738 -32.057 -117.664 1.00 0.00 ? 43  LEU D HD11 1  
ATOM   9446   H HD12 . LEU D 1 43  ? -132.878 -31.639 -116.384 1.00 0.00 ? 43  LEU D HD12 1  
ATOM   9447   H HD13 . LEU D 1 43  ? -132.633 -30.540 -117.742 1.00 0.00 ? 43  LEU D HD13 1  
ATOM   9448   H HD21 . LEU D 1 43  ? -132.725 -34.113 -118.388 1.00 0.00 ? 43  LEU D HD21 1  
ATOM   9449   H HD22 . LEU D 1 43  ? -134.473 -34.266 -118.559 1.00 0.00 ? 43  LEU D HD22 1  
ATOM   9450   H HD23 . LEU D 1 43  ? -133.762 -34.009 -116.966 1.00 0.00 ? 43  LEU D HD23 1  
ATOM   9451   N N    . CYS D 1 44  ? -136.393 -33.771 -120.063 1.00 0.00 ? 44  CYS D N    1  
ATOM   9452   C CA   . CYS D 1 44  ? -136.163 -34.332 -121.384 1.00 0.00 ? 44  CYS D CA   1  
ATOM   9453   C C    . CYS D 1 44  ? -136.876 -33.665 -122.656 1.00 0.00 ? 44  CYS D C    1  
ATOM   9454   O O    . CYS D 1 44  ? -136.271 -33.726 -123.719 1.00 0.00 ? 44  CYS D O    1  
ATOM   9455   C CB   . CYS D 1 44  ? -136.562 -35.882 -121.370 1.00 0.00 ? 44  CYS D CB   1  
ATOM   9456   S SG   . CYS D 1 44  ? -135.353 -36.842 -122.289 1.00 0.00 ? 44  CYS D SG   1  
ATOM   9457   H H    . CYS D 1 44  ? -136.422 -34.387 -119.312 1.00 0.00 ? 44  CYS D H    1  
ATOM   9458   H HA   . CYS D 1 44  ? -135.147 -34.290 -121.559 1.00 0.00 ? 44  CYS D HA   1  
ATOM   9459   H HB2  . CYS D 1 44  ? -136.555 -36.186 -120.357 1.00 0.00 ? 44  CYS D HB2  1  
ATOM   9460   H HB3  . CYS D 1 44  ? -137.523 -35.996 -121.806 1.00 0.00 ? 44  CYS D HB3  1  
ATOM   9461   H HG   . CYS D 1 44  ? -135.521 -36.712 -123.221 1.00 0.00 ? 44  CYS D HG   1  
ATOM   9462   N N    . ILE D 1 45  ? -137.997 -33.005 -122.469 1.00 0.00 ? 45  ILE D N    1  
ATOM   9463   C CA   . ILE D 1 45  ? -138.628 -32.325 -123.602 1.00 0.00 ? 45  ILE D CA   1  
ATOM   9464   C C    . ILE D 1 45  ? -137.637 -31.227 -124.135 1.00 0.00 ? 45  ILE D C    1  
ATOM   9465   O O    . ILE D 1 45  ? -137.467 -31.116 -125.339 1.00 0.00 ? 45  ILE D O    1  
ATOM   9466   C CB   . ILE D 1 45  ? -139.990 -31.690 -123.216 1.00 0.00 ? 45  ILE D CB   1  
ATOM   9467   C CG1  . ILE D 1 45  ? -140.881 -31.423 -124.545 1.00 0.00 ? 45  ILE D CG1  1  
ATOM   9468   C CG2  . ILE D 1 45  ? -139.822 -30.350 -122.499 1.00 0.00 ? 45  ILE D CG2  1  
ATOM   9469   C CD1  . ILE D 1 45  ? -141.806 -32.602 -124.866 1.00 0.00 ? 45  ILE D CD1  1  
ATOM   9470   H H    . ILE D 1 45  ? -138.389 -32.948 -121.577 1.00 0.00 ? 45  ILE D H    1  
ATOM   9471   H HA   . ILE D 1 45  ? -138.771 -33.022 -124.391 1.00 0.00 ? 45  ILE D HA   1  
ATOM   9472   H HB   . ILE D 1 45  ? -140.529 -32.351 -122.598 1.00 0.00 ? 45  ILE D HB   1  
ATOM   9473   H HG12 . ILE D 1 45  ? -141.474 -30.561 -124.359 1.00 0.00 ? 45  ILE D HG12 1  
ATOM   9474   H HG13 . ILE D 1 45  ? -140.211 -31.255 -125.352 1.00 0.00 ? 45  ILE D HG13 1  
ATOM   9475   H HG21 . ILE D 1 45  ? -139.436 -29.602 -123.176 1.00 0.00 ? 45  ILE D HG21 1  
ATOM   9476   H HG22 . ILE D 1 45  ? -139.139 -30.493 -121.684 1.00 0.00 ? 45  ILE D HG22 1  
ATOM   9477   H HG23 . ILE D 1 45  ? -140.783 -30.025 -122.118 1.00 0.00 ? 45  ILE D HG23 1  
ATOM   9478   H HD11 . ILE D 1 45  ? -142.495 -32.278 -125.638 1.00 0.00 ? 45  ILE D HD11 1  
ATOM   9479   H HD12 . ILE D 1 45  ? -142.362 -32.897 -123.992 1.00 0.00 ? 45  ILE D HD12 1  
ATOM   9480   H HD13 . ILE D 1 45  ? -141.227 -33.434 -125.232 1.00 0.00 ? 45  ILE D HD13 1  
ATOM   9481   N N    . TYR D 1 46  ? -136.953 -30.562 -123.198 1.00 0.00 ? 46  TYR D N    1  
ATOM   9482   C CA   . TYR D 1 46  ? -135.930 -29.537 -123.519 1.00 0.00 ? 46  TYR D CA   1  
ATOM   9483   C C    . TYR D 1 46  ? -134.868 -30.173 -124.419 1.00 0.00 ? 46  TYR D C    1  
ATOM   9484   O O    . TYR D 1 46  ? -134.212 -29.477 -125.192 1.00 0.00 ? 46  TYR D O    1  
ATOM   9485   C CB   . TYR D 1 46  ? -135.249 -29.083 -122.195 1.00 0.00 ? 46  TYR D CB   1  
ATOM   9486   C CG   . TYR D 1 46  ? -134.709 -27.639 -122.175 1.00 0.00 ? 46  TYR D CG   1  
ATOM   9487   C CD1  . TYR D 1 46  ? -135.537 -26.553 -122.465 1.00 0.00 ? 46  TYR D CD1  1  
ATOM   9488   C CD2  . TYR D 1 46  ? -133.373 -27.405 -121.799 1.00 0.00 ? 46  TYR D CD2  1  
ATOM   9489   C CE1  . TYR D 1 46  ? -135.037 -25.248 -122.398 1.00 0.00 ? 46  TYR D CE1  1  
ATOM   9490   C CE2  . TYR D 1 46  ? -132.879 -26.099 -121.737 1.00 0.00 ? 46  TYR D CE2  1  
ATOM   9491   C CZ   . TYR D 1 46  ? -133.710 -25.024 -122.036 1.00 0.00 ? 46  TYR D CZ   1  
ATOM   9492   O OH   . TYR D 1 46  ? -133.220 -23.745 -121.976 1.00 0.00 ? 46  TYR D OH   1  
ATOM   9493   H H    . TYR D 1 46  ? -137.107 -30.791 -122.267 1.00 0.00 ? 46  TYR D H    1  
ATOM   9494   H HA   . TYR D 1 46  ? -136.376 -28.699 -124.011 1.00 0.00 ? 46  TYR D HA   1  
ATOM   9495   H HB2  . TYR D 1 46  ? -135.958 -29.172 -121.406 1.00 0.00 ? 46  TYR D HB2  1  
ATOM   9496   H HB3  . TYR D 1 46  ? -134.428 -29.754 -122.002 1.00 0.00 ? 46  TYR D HB3  1  
ATOM   9497   H HD1  . TYR D 1 46  ? -136.558 -26.717 -122.747 1.00 0.00 ? 46  TYR D HD1  1  
ATOM   9498   H HD2  . TYR D 1 46  ? -132.728 -28.228 -121.562 1.00 0.00 ? 46  TYR D HD2  1  
ATOM   9499   H HE1  . TYR D 1 46  ? -135.684 -24.409 -122.622 1.00 0.00 ? 46  TYR D HE1  1  
ATOM   9500   H HE2  . TYR D 1 46  ? -131.849 -25.923 -121.455 1.00 0.00 ? 46  TYR D HE2  1  
ATOM   9501   H HH   . TYR D 1 46  ? -132.622 -23.623 -122.717 1.00 0.00 ? 46  TYR D HH   1  
ATOM   9502   N N    . GLU D 1 47  ? -134.692 -31.493 -124.267 1.00 0.00 ? 47  GLU D N    1  
ATOM   9503   C CA   . GLU D 1 47  ? -133.711 -32.259 -125.049 1.00 0.00 ? 47  GLU D CA   1  
ATOM   9504   C C    . GLU D 1 47  ? -134.263 -32.681 -126.415 1.00 0.00 ? 47  GLU D C    1  
ATOM   9505   O O    . GLU D 1 47  ? -133.509 -32.789 -127.379 1.00 0.00 ? 47  GLU D O    1  
ATOM   9506   C CB   . GLU D 1 47  ? -133.289 -33.514 -124.258 1.00 0.00 ? 47  GLU D CB   1  
ATOM   9507   C CG   . GLU D 1 47  ? -131.784 -33.811 -124.418 1.00 0.00 ? 47  GLU D CG   1  
ATOM   9508   C CD   . GLU D 1 47  ? -131.318 -34.916 -123.444 1.00 0.00 ? 47  GLU D CD   1  
ATOM   9509   O OE1  . GLU D 1 47  ? -132.167 -35.484 -122.768 1.00 0.00 ? 47  GLU D OE1  1  
ATOM   9510   O OE2  . GLU D 1 47  ? -130.103 -35.175 -123.396 1.00 0.00 ? 47  GLU D OE2  1  
ATOM   9511   H H    . GLU D 1 47  ? -135.247 -31.967 -123.619 1.00 0.00 ? 47  GLU D H    1  
ATOM   9512   H HA   . GLU D 1 47  ? -132.850 -31.639 -125.207 1.00 0.00 ? 47  GLU D HA   1  
ATOM   9513   H HB2  . GLU D 1 47  ? -133.501 -33.355 -123.223 1.00 0.00 ? 47  GLU D HB2  1  
ATOM   9514   H HB3  . GLU D 1 47  ? -133.849 -34.355 -124.620 1.00 0.00 ? 47  GLU D HB3  1  
ATOM   9515   H HG2  . GLU D 1 47  ? -131.602 -34.139 -125.421 1.00 0.00 ? 47  GLU D HG2  1  
ATOM   9516   H HG3  . GLU D 1 47  ? -131.230 -32.916 -124.220 1.00 0.00 ? 47  GLU D HG3  1  
ATOM   9517   N N    . ARG D 1 48  ? -135.588 -32.855 -126.491 1.00 0.00 ? 48  ARG D N    1  
ATOM   9518   C CA   . ARG D 1 48  ? -136.234 -33.239 -127.742 1.00 0.00 ? 48  ARG D CA   1  
ATOM   9519   C C    . ARG D 1 48  ? -136.028 -32.148 -128.756 1.00 0.00 ? 48  ARG D C    1  
ATOM   9520   O O    . ARG D 1 48  ? -135.956 -32.401 -129.951 1.00 0.00 ? 48  ARG D O    1  
ATOM   9521   C CB   . ARG D 1 48  ? -137.757 -33.476 -127.489 1.00 0.00 ? 48  ARG D CB   1  
ATOM   9522   C CG   . ARG D 1 48  ? -138.638 -32.261 -128.006 1.00 0.00 ? 48  ARG D CG   1  
ATOM   9523   C CD   . ARG D 1 48  ? -138.739 -32.342 -129.567 1.00 0.00 ? 48  ARG D CD   1  
ATOM   9524   N NE   . ARG D 1 48  ? -138.132 -33.559 -130.135 1.00 0.00 ? 48  ARG D NE   1  
ATOM   9525   C CZ   . ARG D 1 48  ? -138.778 -34.361 -131.004 1.00 0.00 ? 48  ARG D CZ   1  
ATOM   9526   N NH1  . ARG D 1 48  ? -140.005 -34.089 -131.405 1.00 0.00 ? 48  ARG D NH1  1  
ATOM   9527   N NH2  . ARG D 1 48  ? -138.152 -35.427 -131.471 1.00 0.00 ? 48  ARG D NH2  1  
ATOM   9528   H H    . ARG D 1 48  ? -136.132 -32.678 -125.701 1.00 0.00 ? 48  ARG D H    1  
ATOM   9529   H HA   . ARG D 1 48  ? -135.831 -34.173 -128.109 1.00 0.00 ? 48  ARG D HA   1  
ATOM   9530   H HB2  . ARG D 1 48  ? -138.072 -34.331 -128.018 1.00 0.00 ? 48  ARG D HB2  1  
ATOM   9531   H HB3  . ARG D 1 48  ? -137.931 -33.565 -126.457 1.00 0.00 ? 48  ARG D HB3  1  
ATOM   9532   H HG2  . ARG D 1 48  ? -139.608 -32.369 -127.571 1.00 0.00 ? 48  ARG D HG2  1  
ATOM   9533   H HG3  . ARG D 1 48  ? -138.182 -31.346 -127.713 1.00 0.00 ? 48  ARG D HG3  1  
ATOM   9534   H HD2  . ARG D 1 48  ? -139.765 -32.305 -129.811 1.00 0.00 ? 48  ARG D HD2  1  
ATOM   9535   H HD3  . ARG D 1 48  ? -138.230 -31.483 -129.947 1.00 0.00 ? 48  ARG D HD3  1  
ATOM   9536   H HE   . ARG D 1 48  ? -137.224 -33.789 -129.890 1.00 0.00 ? 48  ARG D HE   1  
ATOM   9537   H HH11 . ARG D 1 48  ? -140.481 -33.276 -131.069 1.00 0.00 ? 48  ARG D HH11 1  
ATOM   9538   H HH12 . ARG D 1 48  ? -140.468 -34.702 -132.051 1.00 0.00 ? 48  ARG D HH12 1  
ATOM   9539   H HH21 . ARG D 1 48  ? -137.212 -35.633 -131.182 1.00 0.00 ? 48  ARG D HH21 1  
ATOM   9540   H HH22 . ARG D 1 48  ? -138.614 -36.038 -132.116 1.00 0.00 ? 48  ARG D HH22 1  
ATOM   9541   N N    . VAL D 1 49  ? -135.924 -30.923 -128.234 1.00 0.00 ? 49  VAL D N    1  
ATOM   9542   C CA   . VAL D 1 49  ? -135.726 -29.737 -129.058 1.00 0.00 ? 49  VAL D CA   1  
ATOM   9543   C C    . VAL D 1 49  ? -134.551 -29.926 -130.058 1.00 0.00 ? 49  VAL D C    1  
ATOM   9544   O O    . VAL D 1 49  ? -134.635 -29.485 -131.205 1.00 0.00 ? 49  VAL D O    1  
ATOM   9545   C CB   . VAL D 1 49  ? -135.528 -28.481 -128.148 1.00 0.00 ? 49  VAL D CB   1  
ATOM   9546   C CG1  . VAL D 1 49  ? -136.464 -28.529 -126.932 1.00 0.00 ? 49  VAL D CG1  1  
ATOM   9547   C CG2  . VAL D 1 49  ? -134.086 -28.386 -127.670 1.00 0.00 ? 49  VAL D CG2  1  
ATOM   9548   H H    . VAL D 1 49  ? -135.985 -30.822 -127.266 1.00 0.00 ? 49  VAL D H    1  
ATOM   9549   H HA   . VAL D 1 49  ? -136.608 -29.577 -129.631 1.00 0.00 ? 49  VAL D HA   1  
ATOM   9550   H HB   . VAL D 1 49  ? -135.771 -27.600 -128.717 1.00 0.00 ? 49  VAL D HB   1  
ATOM   9551   H HG11 . VAL D 1 49  ? -136.260 -29.411 -126.356 1.00 0.00 ? 49  VAL D HG11 1  
ATOM   9552   H HG12 . VAL D 1 49  ? -137.488 -28.541 -127.267 1.00 0.00 ? 49  VAL D HG12 1  
ATOM   9553   H HG13 . VAL D 1 49  ? -136.296 -27.652 -126.319 1.00 0.00 ? 49  VAL D HG13 1  
ATOM   9554   H HG21 . VAL D 1 49  ? -134.034 -27.760 -126.790 1.00 0.00 ? 49  VAL D HG21 1  
ATOM   9555   H HG22 . VAL D 1 49  ? -133.486 -27.952 -128.455 1.00 0.00 ? 49  VAL D HG22 1  
ATOM   9556   H HG23 . VAL D 1 49  ? -133.718 -29.371 -127.437 1.00 0.00 ? 49  VAL D HG23 1  
ATOM   9557   N N    . ALA D 1 50  ? -133.532 -30.689 -129.677 1.00 0.00 ? 50  ALA D N    1  
ATOM   9558   C CA   . ALA D 1 50  ? -132.421 -30.964 -130.591 1.00 0.00 ? 50  ALA D CA   1  
ATOM   9559   C C    . ALA D 1 50  ? -132.927 -31.589 -131.901 1.00 0.00 ? 50  ALA D C    1  
ATOM   9560   O O    . ALA D 1 50  ? -132.528 -31.171 -132.988 1.00 0.00 ? 50  ALA D O    1  
ATOM   9561   C CB   . ALA D 1 50  ? -131.411 -31.910 -129.925 1.00 0.00 ? 50  ALA D CB   1  
ATOM   9562   H H    . ALA D 1 50  ? -133.550 -31.102 -128.795 1.00 0.00 ? 50  ALA D H    1  
ATOM   9563   H HA   . ALA D 1 50  ? -131.915 -30.052 -130.825 1.00 0.00 ? 50  ALA D HA   1  
ATOM   9564   H HB1  . ALA D 1 50  ? -130.837 -32.419 -130.687 1.00 0.00 ? 50  ALA D HB1  1  
ATOM   9565   H HB2  . ALA D 1 50  ? -131.931 -32.635 -129.319 1.00 0.00 ? 50  ALA D HB2  1  
ATOM   9566   H HB3  . ALA D 1 50  ? -130.742 -31.332 -129.302 1.00 0.00 ? 50  ALA D HB3  1  
ATOM   9567   N N    . LEU D 1 51  ? -133.868 -32.535 -131.782 1.00 0.00 ? 51  LEU D N    1  
ATOM   9568   C CA   . LEU D 1 51  ? -134.461 -33.206 -132.963 1.00 0.00 ? 51  LEU D CA   1  
ATOM   9569   C C    . LEU D 1 51  ? -135.397 -32.250 -133.712 1.00 0.00 ? 51  LEU D C    1  
ATOM   9570   O O    . LEU D 1 51  ? -135.288 -32.126 -134.924 1.00 0.00 ? 51  LEU D O    1  
ATOM   9571   C CB   . LEU D 1 51  ? -135.252 -34.460 -132.508 1.00 0.00 ? 51  LEU D CB   1  
ATOM   9572   C CG   . LEU D 1 51  ? -135.349 -35.633 -133.526 1.00 0.00 ? 51  LEU D CG   1  
ATOM   9573   C CD1  . LEU D 1 51  ? -135.699 -35.108 -134.891 1.00 0.00 ? 51  LEU D CD1  1  
ATOM   9574   C CD2  . LEU D 1 51  ? -134.056 -36.450 -133.607 1.00 0.00 ? 51  LEU D CD2  1  
ATOM   9575   H H    . LEU D 1 51  ? -134.184 -32.762 -130.891 1.00 0.00 ? 51  LEU D H    1  
ATOM   9576   H HA   . LEU D 1 51  ? -133.680 -33.499 -133.613 1.00 0.00 ? 51  LEU D HA   1  
ATOM   9577   H HB2  . LEU D 1 51  ? -134.804 -34.835 -131.636 1.00 0.00 ? 51  LEU D HB2  1  
ATOM   9578   H HB3  . LEU D 1 51  ? -136.257 -34.148 -132.296 1.00 0.00 ? 51  LEU D HB3  1  
ATOM   9579   H HG   . LEU D 1 51  ? -136.146 -36.290 -133.183 1.00 0.00 ? 51  LEU D HG   1  
ATOM   9580   H HD11 . LEU D 1 51  ? -136.684 -34.668 -134.857 1.00 0.00 ? 51  LEU D HD11 1  
ATOM   9581   H HD12 . LEU D 1 51  ? -135.685 -35.914 -135.602 1.00 0.00 ? 51  LEU D HD12 1  
ATOM   9582   H HD13 . LEU D 1 51  ? -134.981 -34.366 -135.184 1.00 0.00 ? 51  LEU D HD13 1  
ATOM   9583   H HD21 . LEU D 1 51  ? -133.770 -36.784 -132.623 1.00 0.00 ? 51  LEU D HD21 1  
ATOM   9584   H HD22 . LEU D 1 51  ? -133.278 -35.841 -134.031 1.00 0.00 ? 51  LEU D HD22 1  
ATOM   9585   H HD23 . LEU D 1 51  ? -134.226 -37.313 -134.243 1.00 0.00 ? 51  LEU D HD23 1  
ATOM   9586   N N    . PHE D 1 52  ? -136.220 -31.482 -132.972 1.00 0.00 ? 52  PHE D N    1  
ATOM   9587   C CA   . PHE D 1 52  ? -137.097 -30.490 -133.607 1.00 0.00 ? 52  PHE D CA   1  
ATOM   9588   C C    . PHE D 1 52  ? -136.164 -29.518 -134.341 1.00 0.00 ? 52  PHE D C    1  
ATOM   9589   O O    . PHE D 1 52  ? -136.474 -29.023 -135.423 1.00 0.00 ? 52  PHE D O    1  
ATOM   9590   C CB   . PHE D 1 52  ? -137.930 -29.739 -132.538 1.00 0.00 ? 52  PHE D CB   1  
ATOM   9591   C CG   . PHE D 1 52  ? -139.416 -30.082 -132.611 1.00 0.00 ? 52  PHE D CG   1  
ATOM   9592   C CD1  . PHE D 1 52  ? -139.837 -31.403 -132.670 1.00 0.00 ? 52  PHE D CD1  1  
ATOM   9593   C CD2  . PHE D 1 52  ? -140.365 -29.060 -132.599 1.00 0.00 ? 52  PHE D CD2  1  
ATOM   9594   C CE1  . PHE D 1 52  ? -141.205 -31.704 -132.722 1.00 0.00 ? 52  PHE D CE1  1  
ATOM   9595   C CE2  . PHE D 1 52  ? -141.730 -29.364 -132.649 1.00 0.00 ? 52  PHE D CE2  1  
ATOM   9596   C CZ   . PHE D 1 52  ? -142.150 -30.684 -132.711 1.00 0.00 ? 52  PHE D CZ   1  
ATOM   9597   H H    . PHE D 1 52  ? -136.184 -31.549 -132.002 1.00 0.00 ? 52  PHE D H    1  
ATOM   9598   H HA   . PHE D 1 52  ? -137.752 -30.956 -134.313 1.00 0.00 ? 52  PHE D HA   1  
ATOM   9599   H HB2  . PHE D 1 52  ? -137.572 -30.009 -131.567 1.00 0.00 ? 52  PHE D HB2  1  
ATOM   9600   H HB3  . PHE D 1 52  ? -137.811 -28.680 -132.680 1.00 0.00 ? 52  PHE D HB3  1  
ATOM   9601   H HD1  . PHE D 1 52  ? -139.115 -32.195 -132.680 1.00 0.00 ? 52  PHE D HD1  1  
ATOM   9602   H HD2  . PHE D 1 52  ? -140.051 -28.037 -132.550 1.00 0.00 ? 52  PHE D HD2  1  
ATOM   9603   H HE1  . PHE D 1 52  ? -141.528 -32.731 -132.767 1.00 0.00 ? 52  PHE D HE1  1  
ATOM   9604   H HE2  . PHE D 1 52  ? -142.458 -28.570 -132.641 1.00 0.00 ? 52  PHE D HE2  1  
ATOM   9605   H HZ   . PHE D 1 52  ? -143.202 -30.916 -132.752 1.00 0.00 ? 52  PHE D HZ   1  
ATOM   9606   N N    . GLY D 1 53  ? -134.993 -29.322 -133.732 1.00 0.00 ? 53  GLY D N    1  
ATOM   9607   C CA   . GLY D 1 53  ? -133.945 -28.482 -134.276 1.00 0.00 ? 53  GLY D CA   1  
ATOM   9608   C C    . GLY D 1 53  ? -133.328 -29.124 -135.501 1.00 0.00 ? 53  GLY D C    1  
ATOM   9609   O O    . GLY D 1 53  ? -133.229 -28.489 -136.543 1.00 0.00 ? 53  GLY D O    1  
ATOM   9610   H H    . GLY D 1 53  ? -134.825 -29.781 -132.895 1.00 0.00 ? 53  GLY D H    1  
ATOM   9611   H HA2  . GLY D 1 53  ? -134.343 -27.518 -134.539 1.00 0.00 ? 53  GLY D HA2  1  
ATOM   9612   H HA3  . GLY D 1 53  ? -133.172 -28.365 -133.532 1.00 0.00 ? 53  GLY D HA3  1  
ATOM   9613   N N    . VAL D 1 54  ? -132.985 -30.409 -135.416 1.00 0.00 ? 54  VAL D N    1  
ATOM   9614   C CA   . VAL D 1 54  ? -132.435 -31.069 -136.599 1.00 0.00 ? 54  VAL D CA   1  
ATOM   9615   C C    . VAL D 1 54  ? -133.575 -31.286 -137.610 1.00 0.00 ? 54  VAL D C    1  
ATOM   9616   O O    . VAL D 1 54  ? -133.463 -30.896 -138.778 1.00 0.00 ? 54  VAL D O    1  
ATOM   9617   C CB   . VAL D 1 54  ? -131.704 -32.410 -136.276 1.00 0.00 ? 54  VAL D CB   1  
ATOM   9618   C CG1  . VAL D 1 54  ? -131.787 -33.355 -137.475 1.00 0.00 ? 54  VAL D CG1  1  
ATOM   9619   C CG2  . VAL D 1 54  ? -130.225 -32.137 -135.989 1.00 0.00 ? 54  VAL D CG2  1  
ATOM   9620   H H    . VAL D 1 54  ? -133.136 -30.901 -134.587 1.00 0.00 ? 54  VAL D H    1  
ATOM   9621   H HA   . VAL D 1 54  ? -131.729 -30.408 -137.051 1.00 0.00 ? 54  VAL D HA   1  
ATOM   9622   H HB   . VAL D 1 54  ? -132.147 -32.880 -135.421 1.00 0.00 ? 54  VAL D HB   1  
ATOM   9623   H HG11 . VAL D 1 54  ? -132.770 -33.798 -137.503 1.00 0.00 ? 54  VAL D HG11 1  
ATOM   9624   H HG12 . VAL D 1 54  ? -131.043 -34.131 -137.380 1.00 0.00 ? 54  VAL D HG12 1  
ATOM   9625   H HG13 . VAL D 1 54  ? -131.616 -32.800 -138.385 1.00 0.00 ? 54  VAL D HG13 1  
ATOM   9626   H HG21 . VAL D 1 54  ? -130.146 -31.428 -135.183 1.00 0.00 ? 54  VAL D HG21 1  
ATOM   9627   H HG22 . VAL D 1 54  ? -129.755 -31.737 -136.875 1.00 0.00 ? 54  VAL D HG22 1  
ATOM   9628   H HG23 . VAL D 1 54  ? -129.742 -33.062 -135.710 1.00 0.00 ? 54  VAL D HG23 1  
ATOM   9629   N N    . LEU D 1 55  ? -134.738 -31.724 -137.112 1.00 0.00 ? 55  LEU D N    1  
ATOM   9630   C CA   . LEU D 1 55  ? -135.918 -31.864 -137.972 1.00 0.00 ? 55  LEU D CA   1  
ATOM   9631   C C    . LEU D 1 55  ? -136.073 -30.531 -138.679 1.00 0.00 ? 55  LEU D C    1  
ATOM   9632   O O    . LEU D 1 55  ? -135.982 -30.473 -139.901 1.00 0.00 ? 55  LEU D O    1  
ATOM   9633   C CB   . LEU D 1 55  ? -137.175 -32.150 -137.093 1.00 0.00 ? 55  LEU D CB   1  
ATOM   9634   C CG   . LEU D 1 55  ? -138.487 -32.485 -137.862 1.00 0.00 ? 55  LEU D CG   1  
ATOM   9635   C CD1  . LEU D 1 55  ? -139.260 -33.584 -137.085 1.00 0.00 ? 55  LEU D CD1  1  
ATOM   9636   C CD2  . LEU D 1 55  ? -139.376 -31.232 -138.010 1.00 0.00 ? 55  LEU D CD2  1  
ATOM   9637   H H    . LEU D 1 55  ? -134.808 -31.873 -136.155 1.00 0.00 ? 55  LEU D H    1  
ATOM   9638   H HA   . LEU D 1 55  ? -135.780 -32.646 -138.685 1.00 0.00 ? 55  LEU D HA   1  
ATOM   9639   H HB2  . LEU D 1 55  ? -136.953 -32.986 -136.480 1.00 0.00 ? 55  LEU D HB2  1  
ATOM   9640   H HB3  . LEU D 1 55  ? -137.344 -31.292 -136.487 1.00 0.00 ? 55  LEU D HB3  1  
ATOM   9641   H HG   . LEU D 1 55  ? -138.252 -32.859 -138.824 1.00 0.00 ? 55  LEU D HG   1  
ATOM   9642   H HD11 . LEU D 1 55  ? -138.739 -34.528 -137.208 1.00 0.00 ? 55  LEU D HD11 1  
ATOM   9643   H HD12 . LEU D 1 55  ? -140.259 -33.676 -137.477 1.00 0.00 ? 55  LEU D HD12 1  
ATOM   9644   H HD13 . LEU D 1 55  ? -139.305 -33.341 -136.032 1.00 0.00 ? 55  LEU D HD13 1  
ATOM   9645   H HD21 . LEU D 1 55  ? -140.300 -31.509 -138.498 1.00 0.00 ? 55  LEU D HD21 1  
ATOM   9646   H HD22 . LEU D 1 55  ? -138.855 -30.506 -138.617 1.00 0.00 ? 55  LEU D HD22 1  
ATOM   9647   H HD23 . LEU D 1 55  ? -139.591 -30.806 -137.043 1.00 0.00 ? 55  LEU D HD23 1  
ATOM   9648   N N    . GLY D 1 56  ? -136.250 -29.456 -137.895 1.00 0.00 ? 56  GLY D N    1  
ATOM   9649   C CA   . GLY D 1 56  ? -136.398 -28.117 -138.452 1.00 0.00 ? 56  GLY D CA   1  
ATOM   9650   C C    . GLY D 1 56  ? -135.304 -27.854 -139.470 1.00 0.00 ? 56  GLY D C    1  
ATOM   9651   O O    . GLY D 1 56  ? -135.588 -27.570 -140.619 1.00 0.00 ? 56  GLY D O    1  
ATOM   9652   H H    . GLY D 1 56  ? -136.264 -29.569 -136.928 1.00 0.00 ? 56  GLY D H    1  
ATOM   9653   H HA2  . GLY D 1 56  ? -137.363 -28.027 -138.930 1.00 0.00 ? 56  GLY D HA2  1  
ATOM   9654   H HA3  . GLY D 1 56  ? -136.328 -27.393 -137.652 1.00 0.00 ? 56  GLY D HA3  1  
ATOM   9655   N N    . ALA D 1 57  ? -134.058 -27.948 -139.011 1.00 0.00 ? 57  ALA D N    1  
ATOM   9656   C CA   . ALA D 1 57  ? -132.865 -27.706 -139.843 1.00 0.00 ? 57  ALA D CA   1  
ATOM   9657   C C    . ALA D 1 57  ? -132.791 -28.537 -141.128 1.00 0.00 ? 57  ALA D C    1  
ATOM   9658   O O    . ALA D 1 57  ? -132.508 -27.983 -142.196 1.00 0.00 ? 57  ALA D O    1  
ATOM   9659   C CB   . ALA D 1 57  ? -131.619 -27.956 -139.005 1.00 0.00 ? 57  ALA D CB   1  
ATOM   9660   H H    . ALA D 1 57  ? -133.931 -28.170 -138.072 1.00 0.00 ? 57  ALA D H    1  
ATOM   9661   H HA   . ALA D 1 57  ? -132.867 -26.676 -140.119 1.00 0.00 ? 57  ALA D HA   1  
ATOM   9662   H HB1  . ALA D 1 57  ? -131.520 -29.008 -138.805 1.00 0.00 ? 57  ALA D HB1  1  
ATOM   9663   H HB2  . ALA D 1 57  ? -131.707 -27.415 -138.075 1.00 0.00 ? 57  ALA D HB2  1  
ATOM   9664   H HB3  . ALA D 1 57  ? -130.759 -27.605 -139.544 1.00 0.00 ? 57  ALA D HB3  1  
ATOM   9665   N N    . ALA D 1 58  ? -133.023 -29.845 -141.003 1.00 0.00 ? 58  ALA D N    1  
ATOM   9666   C CA   . ALA D 1 58  ? -132.987 -30.763 -142.144 1.00 0.00 ? 58  ALA D CA   1  
ATOM   9667   C C    . ALA D 1 58  ? -134.063 -30.405 -143.161 1.00 0.00 ? 58  ALA D C    1  
ATOM   9668   O O    . ALA D 1 58  ? -133.780 -30.312 -144.348 1.00 0.00 ? 58  ALA D O    1  
ATOM   9669   C CB   . ALA D 1 58  ? -133.197 -32.199 -141.665 1.00 0.00 ? 58  ALA D CB   1  
ATOM   9670   H H    . ALA D 1 58  ? -133.215 -30.200 -140.121 1.00 0.00 ? 58  ALA D H    1  
ATOM   9671   H HA   . ALA D 1 58  ? -132.027 -30.699 -142.619 1.00 0.00 ? 58  ALA D HA   1  
ATOM   9672   H HB1  . ALA D 1 58  ? -133.292 -32.210 -140.593 1.00 0.00 ? 58  ALA D HB1  1  
ATOM   9673   H HB2  . ALA D 1 58  ? -132.349 -32.797 -141.957 1.00 0.00 ? 58  ALA D HB2  1  
ATOM   9674   H HB3  . ALA D 1 58  ? -134.093 -32.605 -142.110 1.00 0.00 ? 58  ALA D HB3  1  
ATOM   9675   N N    . LEU D 1 59  ? -135.287 -30.208 -142.669 1.00 0.00 ? 59  LEU D N    1  
ATOM   9676   C CA   . LEU D 1 59  ? -136.434 -29.850 -143.523 1.00 0.00 ? 59  LEU D CA   1  
ATOM   9677   C C    . LEU D 1 59  ? -136.198 -28.549 -144.285 1.00 0.00 ? 59  LEU D C    1  
ATOM   9678   O O    . LEU D 1 59  ? -136.486 -28.477 -145.479 1.00 0.00 ? 59  LEU D O    1  
ATOM   9679   C CB   . LEU D 1 59  ? -137.678 -29.746 -142.611 1.00 0.00 ? 59  LEU D CB   1  
ATOM   9680   C CG   . LEU D 1 59  ? -138.862 -28.949 -143.188 1.00 0.00 ? 59  LEU D CG   1  
ATOM   9681   C CD1  . LEU D 1 59  ? -139.318 -29.546 -144.506 1.00 0.00 ? 59  LEU D CD1  1  
ATOM   9682   C CD2  . LEU D 1 59  ? -140.020 -28.967 -142.161 1.00 0.00 ? 59  LEU D CD2  1  
ATOM   9683   H H    . LEU D 1 59  ? -135.430 -30.312 -141.707 1.00 0.00 ? 59  LEU D H    1  
ATOM   9684   H HA   . LEU D 1 59  ? -136.590 -30.651 -144.218 1.00 0.00 ? 59  LEU D HA   1  
ATOM   9685   H HB2  . LEU D 1 59  ? -138.020 -30.734 -142.416 1.00 0.00 ? 59  LEU D HB2  1  
ATOM   9686   H HB3  . LEU D 1 59  ? -137.378 -29.282 -141.699 1.00 0.00 ? 59  LEU D HB3  1  
ATOM   9687   H HG   . LEU D 1 59  ? -138.565 -27.937 -143.342 1.00 0.00 ? 59  LEU D HG   1  
ATOM   9688   H HD11 . LEU D 1 59  ? -140.009 -28.867 -144.982 1.00 0.00 ? 59  LEU D HD11 1  
ATOM   9689   H HD12 . LEU D 1 59  ? -139.798 -30.496 -144.337 1.00 0.00 ? 59  LEU D HD12 1  
ATOM   9690   H HD13 . LEU D 1 59  ? -138.456 -29.683 -145.141 1.00 0.00 ? 59  LEU D HD13 1  
ATOM   9691   H HD21 . LEU D 1 59  ? -139.677 -28.540 -141.227 1.00 0.00 ? 59  LEU D HD21 1  
ATOM   9692   H HD22 . LEU D 1 59  ? -140.350 -29.980 -141.992 1.00 0.00 ? 59  LEU D HD22 1  
ATOM   9693   H HD23 . LEU D 1 59  ? -140.842 -28.378 -142.541 1.00 0.00 ? 59  LEU D HD23 1  
ATOM   9694   N N    . ILE D 1 60  ? -135.595 -27.559 -143.620 1.00 0.00 ? 60  ILE D N    1  
ATOM   9695   C CA   . ILE D 1 60  ? -135.277 -26.305 -144.282 1.00 0.00 ? 60  ILE D CA   1  
ATOM   9696   C C    . ILE D 1 60  ? -134.163 -26.570 -145.268 1.00 0.00 ? 60  ILE D C    1  
ATOM   9697   O O    . ILE D 1 60  ? -134.288 -26.250 -146.441 1.00 0.00 ? 60  ILE D O    1  
ATOM   9698   C CB   . ILE D 1 60  ? -134.783 -25.230 -143.225 1.00 0.00 ? 60  ILE D CB   1  
ATOM   9699   C CG1  . ILE D 1 60  ? -135.948 -25.020 -142.195 1.00 0.00 ? 60  ILE D CG1  1  
ATOM   9700   C CG2  . ILE D 1 60  ? -134.454 -23.920 -143.926 1.00 0.00 ? 60  ILE D CG2  1  
ATOM   9701   C CD1  . ILE D 1 60  ? -135.438 -24.403 -140.858 1.00 0.00 ? 60  ILE D CD1  1  
ATOM   9702   H H    . ILE D 1 60  ? -135.320 -27.708 -142.702 1.00 0.00 ? 60  ILE D H    1  
ATOM   9703   H HA   . ILE D 1 60  ? -136.130 -25.911 -144.794 1.00 0.00 ? 60  ILE D HA   1  
ATOM   9704   H HB   . ILE D 1 60  ? -133.928 -25.602 -142.732 1.00 0.00 ? 60  ILE D HB   1  
ATOM   9705   H HG12 . ILE D 1 60  ? -136.664 -24.360 -142.616 1.00 0.00 ? 60  ILE D HG12 1  
ATOM   9706   H HG13 . ILE D 1 60  ? -136.386 -25.968 -141.989 1.00 0.00 ? 60  ILE D HG13 1  
ATOM   9707   H HG21 . ILE D 1 60  ? -135.208 -23.686 -144.664 1.00 0.00 ? 60  ILE D HG21 1  
ATOM   9708   H HG22 . ILE D 1 60  ? -133.495 -24.019 -144.410 1.00 0.00 ? 60  ILE D HG22 1  
ATOM   9709   H HG23 . ILE D 1 60  ? -134.409 -23.129 -143.193 1.00 0.00 ? 60  ILE D HG23 1  
ATOM   9710   H HD11 . ILE D 1 60  ? -134.813 -25.115 -140.352 1.00 0.00 ? 60  ILE D HD11 1  
ATOM   9711   H HD12 . ILE D 1 60  ? -136.306 -24.182 -140.250 1.00 0.00 ? 60  ILE D HD12 1  
ATOM   9712   H HD13 . ILE D 1 60  ? -134.895 -23.502 -141.060 1.00 0.00 ? 60  ILE D HD13 1  
ATOM   9713   N N    . GLY D 1 61  ? -133.110 -27.245 -144.807 1.00 0.00 ? 61  GLY D N    1  
ATOM   9714   C CA   . GLY D 1 61  ? -131.977 -27.591 -145.667 1.00 0.00 ? 61  GLY D CA   1  
ATOM   9715   C C    . GLY D 1 61  ? -132.367 -28.618 -146.716 1.00 0.00 ? 61  GLY D C    1  
ATOM   9716   O O    . GLY D 1 61  ? -131.529 -29.057 -147.507 1.00 0.00 ? 61  GLY D O    1  
ATOM   9717   H H    . GLY D 1 61  ? -133.105 -27.550 -143.874 1.00 0.00 ? 61  GLY D H    1  
ATOM   9718   H HA2  . GLY D 1 61  ? -131.626 -26.694 -146.166 1.00 0.00 ? 61  GLY D HA2  1  
ATOM   9719   H HA3  . GLY D 1 61  ? -131.181 -27.987 -145.065 1.00 0.00 ? 61  GLY D HA3  1  
ATOM   9720   N N    . ALA D 1 62  ? -133.654 -28.964 -146.722 1.00 0.00 ? 62  ALA D N    1  
ATOM   9721   C CA   . ALA D 1 62  ? -134.187 -29.920 -147.677 1.00 0.00 ? 62  ALA D CA   1  
ATOM   9722   C C    . ALA D 1 62  ? -134.423 -29.207 -149.005 1.00 0.00 ? 62  ALA D C    1  
ATOM   9723   O O    . ALA D 1 62  ? -134.523 -29.844 -150.054 1.00 0.00 ? 62  ALA D O    1  
ATOM   9724   C CB   . ALA D 1 62  ? -135.483 -30.553 -147.138 1.00 0.00 ? 62  ALA D CB   1  
ATOM   9725   H H    . ALA D 1 62  ? -134.258 -28.532 -146.094 1.00 0.00 ? 62  ALA D H    1  
ATOM   9726   H HA   . ALA D 1 62  ? -133.467 -30.701 -147.840 1.00 0.00 ? 62  ALA D HA   1  
ATOM   9727   H HB1  . ALA D 1 62  ? -136.313 -29.886 -147.298 1.00 0.00 ? 62  ALA D HB1  1  
ATOM   9728   H HB2  . ALA D 1 62  ? -135.373 -30.746 -146.081 1.00 0.00 ? 62  ALA D HB2  1  
ATOM   9729   H HB3  . ALA D 1 62  ? -135.668 -31.487 -147.652 1.00 0.00 ? 62  ALA D HB3  1  
ATOM   9730   N N    . ILE D 1 63  ? -134.556 -27.874 -148.950 1.00 0.00 ? 63  ILE D N    1  
ATOM   9731   C CA   . ILE D 1 63  ? -134.806 -27.112 -150.176 1.00 0.00 ? 63  ILE D CA   1  
ATOM   9732   C C    . ILE D 1 63  ? -133.518 -26.768 -150.933 1.00 0.00 ? 63  ILE D C    1  
ATOM   9733   O O    . ILE D 1 63  ? -133.461 -26.931 -152.158 1.00 0.00 ? 63  ILE D O    1  
ATOM   9734   C CB   . ILE D 1 63  ? -135.678 -25.809 -149.842 1.00 0.00 ? 63  ILE D CB   1  
ATOM   9735   C CG1  . ILE D 1 63  ? -137.139 -26.287 -149.317 1.00 0.00 ? 63  ILE D CG1  1  
ATOM   9736   C CG2  . ILE D 1 63  ? -135.906 -24.941 -151.098 1.00 0.00 ? 63  ILE D CG2  1  
ATOM   9737   C CD1  . ILE D 1 63  ? -137.171 -26.690 -147.822 1.00 0.00 ? 63  ILE D CD1  1  
ATOM   9738   H H    . ILE D 1 63  ? -134.503 -27.427 -148.085 1.00 0.00 ? 63  ILE D H    1  
ATOM   9739   H HA   . ILE D 1 63  ? -135.383 -27.729 -150.808 1.00 0.00 ? 63  ILE D HA   1  
ATOM   9740   H HB   . ILE D 1 63  ? -135.223 -25.237 -149.089 1.00 0.00 ? 63  ILE D HB   1  
ATOM   9741   H HG12 . ILE D 1 63  ? -137.797 -25.464 -149.467 1.00 0.00 ? 63  ILE D HG12 1  
ATOM   9742   H HG13 . ILE D 1 63  ? -137.436 -27.112 -149.920 1.00 0.00 ? 63  ILE D HG13 1  
ATOM   9743   H HG21 . ILE D 1 63  ? -136.454 -25.489 -151.853 1.00 0.00 ? 63  ILE D HG21 1  
ATOM   9744   H HG22 . ILE D 1 63  ? -134.950 -24.643 -151.489 1.00 0.00 ? 63  ILE D HG22 1  
ATOM   9745   H HG23 . ILE D 1 63  ? -136.473 -24.056 -150.822 1.00 0.00 ? 63  ILE D HG23 1  
ATOM   9746   H HD11 . ILE D 1 63  ? -136.711 -27.656 -147.686 1.00 0.00 ? 63  ILE D HD11 1  
ATOM   9747   H HD12 . ILE D 1 63  ? -138.214 -26.753 -147.514 1.00 0.00 ? 63  ILE D HD12 1  
ATOM   9748   H HD13 . ILE D 1 63  ? -136.670 -25.957 -147.211 1.00 0.00 ? 63  ILE D HD13 1  
ATOM   9749   N N    . ALA D 1 64  ? -132.520 -26.299 -150.186 1.00 0.00 ? 64  ALA D N    1  
ATOM   9750   C CA   . ALA D 1 64  ? -131.211 -25.894 -150.725 1.00 0.00 ? 64  ALA D CA   1  
ATOM   9751   C C    . ALA D 1 64  ? -130.664 -26.848 -151.819 1.00 0.00 ? 64  ALA D C    1  
ATOM   9752   O O    . ALA D 1 64  ? -130.528 -26.423 -152.964 1.00 0.00 ? 64  ALA D O    1  
ATOM   9753   C CB   . ALA D 1 64  ? -130.193 -25.702 -149.566 1.00 0.00 ? 64  ALA D CB   1  
ATOM   9754   H H    . ALA D 1 64  ? -132.677 -26.204 -149.231 1.00 0.00 ? 64  ALA D H    1  
ATOM   9755   H HA   . ALA D 1 64  ? -131.353 -24.934 -151.178 1.00 0.00 ? 64  ALA D HA   1  
ATOM   9756   H HB1  . ALA D 1 64  ? -130.155 -24.655 -149.298 1.00 0.00 ? 64  ALA D HB1  1  
ATOM   9757   H HB2  . ALA D 1 64  ? -129.213 -26.012 -149.887 1.00 0.00 ? 64  ALA D HB2  1  
ATOM   9758   H HB3  . ALA D 1 64  ? -130.495 -26.279 -148.705 1.00 0.00 ? 64  ALA D HB3  1  
ATOM   9759   N N    . PRO D 1 65  ? -130.405 -28.091 -151.474 1.00 0.00 ? 65  PRO D N    1  
ATOM   9760   C CA   . PRO D 1 65  ? -129.831 -29.182 -152.343 1.00 0.00 ? 65  PRO D CA   1  
ATOM   9761   C C    . PRO D 1 65  ? -129.652 -29.161 -153.928 1.00 0.00 ? 65  PRO D C    1  
ATOM   9762   O O    . PRO D 1 65  ? -130.608 -29.576 -154.556 1.00 0.00 ? 65  PRO D O    1  
ATOM   9763   C CB   . PRO D 1 65  ? -130.653 -30.396 -151.919 1.00 0.00 ? 65  PRO D CB   1  
ATOM   9764   C CG   . PRO D 1 65  ? -130.812 -30.203 -150.447 1.00 0.00 ? 65  PRO D CG   1  
ATOM   9765   C CD   . PRO D 1 65  ? -130.712 -28.675 -150.157 1.00 0.00 ? 65  PRO D CD   1  
ATOM   9766   H HA   . PRO D 1 65  ? -128.836 -29.372 -151.992 1.00 0.00 ? 65  PRO D HA   1  
ATOM   9767   H HB2  . PRO D 1 65  ? -131.614 -30.413 -152.418 1.00 0.00 ? 65  PRO D HB2  1  
ATOM   9768   H HB3  . PRO D 1 65  ? -130.110 -31.318 -152.118 1.00 0.00 ? 65  PRO D HB3  1  
ATOM   9769   H HG2  . PRO D 1 65  ? -131.772 -30.586 -150.139 1.00 0.00 ? 65  PRO D HG2  1  
ATOM   9770   H HG3  . PRO D 1 65  ? -130.019 -30.716 -149.932 1.00 0.00 ? 65  PRO D HG3  1  
ATOM   9771   H HD2  . PRO D 1 65  ? -131.665 -28.294 -149.799 1.00 0.00 ? 65  PRO D HD2  1  
ATOM   9772   H HD3  . PRO D 1 65  ? -129.931 -28.452 -149.441 1.00 0.00 ? 65  PRO D HD3  1  
ATOM   9773   N N    . LYS D 1 66  ? -129.176 -27.931 -154.451 1.00 0.00 ? 66  LYS D N    1  
ATOM   9774   C CA   . LYS D 1 66  ? -129.122 -27.297 -155.626 1.00 0.00 ? 66  LYS D CA   1  
ATOM   9775   C C    . LYS D 1 66  ? -128.732 -25.854 -155.056 1.00 0.00 ? 66  LYS D C    1  
ATOM   9776   O O    . LYS D 1 66  ? -127.565 -25.482 -155.057 1.00 0.00 ? 66  LYS D O    1  
ATOM   9777   C CB   . LYS D 1 66  ? -130.616 -27.235 -155.996 1.00 0.00 ? 66  LYS D CB   1  
ATOM   9778   C CG   . LYS D 1 66  ? -130.921 -26.120 -157.021 1.00 0.00 ? 66  LYS D CG   1  
ATOM   9779   C CD   . LYS D 1 66  ? -132.344 -25.522 -156.831 1.00 0.00 ? 66  LYS D CD   1  
ATOM   9780   C CE   . LYS D 1 66  ? -133.438 -26.588 -157.078 1.00 0.00 ? 66  LYS D CE   1  
ATOM   9781   N NZ   . LYS D 1 66  ? -134.710 -26.324 -156.311 1.00 0.00 ? 66  LYS D NZ   1  
ATOM   9782   H H    . LYS D 1 66  ? -129.312 -27.388 -153.871 1.00 0.00 ? 66  LYS D H    1  
ATOM   9783   H HA   . LYS D 1 66  ? -128.491 -27.520 -156.382 1.00 0.00 ? 66  LYS D HA   1  
ATOM   9784   H HB2  . LYS D 1 66  ? -130.852 -28.178 -156.427 1.00 0.00 ? 66  LYS D HB2  1  
ATOM   9785   H HB3  . LYS D 1 66  ? -131.232 -27.080 -155.114 1.00 0.00 ? 66  LYS D HB3  1  
ATOM   9786   H HG2  . LYS D 1 66  ? -130.210 -25.327 -156.915 1.00 0.00 ? 66  LYS D HG2  1  
ATOM   9787   H HG3  . LYS D 1 66  ? -130.848 -26.539 -158.009 1.00 0.00 ? 66  LYS D HG3  1  
ATOM   9788   H HD2  . LYS D 1 66  ? -132.429 -25.129 -155.843 1.00 0.00 ? 66  LYS D HD2  1  
ATOM   9789   H HD3  . LYS D 1 66  ? -132.464 -24.722 -157.552 1.00 0.00 ? 66  LYS D HD3  1  
ATOM   9790   H HE2  . LYS D 1 66  ? -133.680 -26.588 -158.119 1.00 0.00 ? 66  LYS D HE2  1  
ATOM   9791   H HE3  . LYS D 1 66  ? -133.057 -27.550 -156.799 1.00 0.00 ? 66  LYS D HE3  1  
ATOM   9792   H HZ1  . LYS D 1 66  ? -135.474 -26.918 -156.713 1.00 0.00 ? 66  LYS D HZ1  1  
ATOM   9793   H HZ2  . LYS D 1 66  ? -134.977 -25.326 -156.392 1.00 0.00 ? 66  LYS D HZ2  1  
ATOM   9794   H HZ3  . LYS D 1 66  ? -134.581 -26.576 -155.312 1.00 0.00 ? 66  LYS D HZ3  1  
ATOM   9795   N N    . THR D 1 67  ? -129.724 -25.145 -154.449 1.00 0.00 ? 67  THR D N    1  
ATOM   9796   C CA   . THR D 1 67  ? -129.486 -23.816 -153.848 1.00 0.00 ? 67  THR D CA   1  
ATOM   9797   C C    . THR D 1 67  ? -128.543 -23.943 -152.653 1.00 0.00 ? 67  THR D C    1  
ATOM   9798   O O    . THR D 1 67  ? -128.059 -25.061 -152.342 1.00 0.00 ? 67  THR D O    1  
ATOM   9799   C CB   . THR D 1 67  ? -130.823 -23.133 -153.403 1.00 0.00 ? 67  THR D CB   1  
ATOM   9800   O OG1  . THR D 1 67  ? -131.862 -24.098 -153.290 1.00 0.00 ? 67  THR D OG1  1  
ATOM   9801   C CG2  . THR D 1 67  ? -131.251 -22.056 -154.430 1.00 0.00 ? 67  THR D CG2  1  
ATOM   9802   H H    . THR D 1 67  ? -130.603 -25.553 -154.382 1.00 0.00 ? 67  THR D H    1  
ATOM   9803   H HA   . THR D 1 67  ? -129.016 -23.203 -154.564 1.00 0.00 ? 67  THR D HA   1  
ATOM   9804   H HB   . THR D 1 67  ? -130.677 -22.650 -152.447 1.00 0.00 ? 67  THR D HB   1  
ATOM   9805   H HG1  . THR D 1 67  ? -132.301 -23.965 -152.444 1.00 0.00 ? 67  THR D HG1  1  
ATOM   9806   H HG21 . THR D 1 67  ? -130.700 -21.142 -154.252 1.00 0.00 ? 67  THR D HG21 1  
ATOM   9807   H HG22 . THR D 1 67  ? -132.309 -21.859 -154.325 1.00 0.00 ? 67  THR D HG22 1  
ATOM   9808   H HG23 . THR D 1 67  ? -131.049 -22.408 -155.430 1.00 0.00 ? 67  THR D HG23 1  
ATOM   9809   N N    . PRO D 1 68  ? -128.104 -22.848 -152.028 1.00 0.00 ? 68  PRO D N    1  
ATOM   9810   C CA   . PRO D 1 68  ? -127.246 -22.998 -150.899 1.00 0.00 ? 68  PRO D CA   1  
ATOM   9811   C C    . PRO D 1 68  ? -127.889 -22.747 -149.427 1.00 0.00 ? 68  PRO D C    1  
ATOM   9812   O O    . PRO D 1 68  ? -127.176 -22.926 -148.466 1.00 0.00 ? 68  PRO D O    1  
ATOM   9813   C CB   . PRO D 1 68  ? -126.147 -21.923 -151.174 1.00 0.00 ? 68  PRO D CB   1  
ATOM   9814   C CG   . PRO D 1 68  ? -126.940 -20.781 -151.950 1.00 0.00 ? 68  PRO D CG   1  
ATOM   9815   C CD   . PRO D 1 68  ? -128.255 -21.417 -152.441 1.00 0.00 ? 68  PRO D CD   1  
ATOM   9816   H HA   . PRO D 1 68  ? -126.787 -23.944 -150.919 1.00 0.00 ? 68  PRO D HA   1  
ATOM   9817   H HB2  . PRO D 1 68  ? -125.734 -21.547 -150.279 1.00 0.00 ? 68  PRO D HB2  1  
ATOM   9818   H HB3  . PRO D 1 68  ? -125.413 -22.342 -151.835 1.00 0.00 ? 68  PRO D HB3  1  
ATOM   9819   H HG2  . PRO D 1 68  ? -127.136 -19.973 -151.269 1.00 0.00 ? 68  PRO D HG2  1  
ATOM   9820   H HG3  . PRO D 1 68  ? -126.343 -20.442 -152.780 1.00 0.00 ? 68  PRO D HG3  1  
ATOM   9821   H HD2  . PRO D 1 68  ? -129.084 -20.911 -152.005 1.00 0.00 ? 68  PRO D HD2  1  
ATOM   9822   H HD3  . PRO D 1 68  ? -128.269 -21.372 -153.518 1.00 0.00 ? 68  PRO D HD3  1  
ATOM   9823   N N    . LEU D 1 69  ? -129.157 -22.439 -149.400 1.00 0.00 ? 69  LEU D N    1  
ATOM   9824   C CA   . LEU D 1 69  ? -129.871 -22.271 -148.124 1.00 0.00 ? 69  LEU D CA   1  
ATOM   9825   C C    . LEU D 1 69  ? -129.487 -23.378 -147.131 1.00 0.00 ? 69  LEU D C    1  
ATOM   9826   O O    . LEU D 1 69  ? -129.824 -23.316 -145.952 1.00 0.00 ? 69  LEU D O    1  
ATOM   9827   C CB   . LEU D 1 69  ? -131.375 -22.295 -148.456 1.00 0.00 ? 69  LEU D CB   1  
ATOM   9828   C CG   . LEU D 1 69  ? -132.327 -22.610 -147.296 1.00 0.00 ? 69  LEU D CG   1  
ATOM   9829   C CD1  . LEU D 1 69  ? -132.178 -24.052 -146.850 1.00 0.00 ? 69  LEU D CD1  1  
ATOM   9830   C CD2  . LEU D 1 69  ? -132.045 -21.666 -146.160 1.00 0.00 ? 69  LEU D CD2  1  
ATOM   9831   H H    . LEU D 1 69  ? -129.658 -22.350 -150.241 1.00 0.00 ? 69  LEU D H    1  
ATOM   9832   H HA   . LEU D 1 69  ? -129.611 -21.313 -147.712 1.00 0.00 ? 69  LEU D HA   1  
ATOM   9833   H HB2  . LEU D 1 69  ? -131.640 -21.334 -148.809 1.00 0.00 ? 69  LEU D HB2  1  
ATOM   9834   H HB3  . LEU D 1 69  ? -131.529 -23.015 -149.215 1.00 0.00 ? 69  LEU D HB3  1  
ATOM   9835   H HG   . LEU D 1 69  ? -133.350 -22.457 -147.643 1.00 0.00 ? 69  LEU D HG   1  
ATOM   9836   H HD11 . LEU D 1 69  ? -133.145 -24.500 -146.765 1.00 0.00 ? 69  LEU D HD11 1  
ATOM   9837   H HD12 . LEU D 1 69  ? -131.687 -24.072 -145.890 1.00 0.00 ? 69  LEU D HD12 1  
ATOM   9838   H HD13 . LEU D 1 69  ? -131.592 -24.589 -147.569 1.00 0.00 ? 69  LEU D HD13 1  
ATOM   9839   H HD21 . LEU D 1 69  ? -132.942 -21.132 -145.907 1.00 0.00 ? 69  LEU D HD21 1  
ATOM   9840   H HD22 . LEU D 1 69  ? -131.284 -20.969 -146.461 1.00 0.00 ? 69  LEU D HD22 1  
ATOM   9841   H HD23 . LEU D 1 69  ? -131.706 -22.230 -145.308 1.00 0.00 ? 69  LEU D HD23 1  
ATOM   9842   N N    . ARG D 1 70  ? -128.756 -24.379 -147.635 1.00 0.00 ? 70  ARG D N    1  
ATOM   9843   C CA   . ARG D 1 70  ? -128.280 -25.490 -146.847 1.00 0.00 ? 70  ARG D CA   1  
ATOM   9844   C C    . ARG D 1 70  ? -127.254 -24.879 -145.806 1.00 0.00 ? 70  ARG D C    1  
ATOM   9845   O O    . ARG D 1 70  ? -127.142 -25.413 -144.711 1.00 0.00 ? 70  ARG D O    1  
ATOM   9846   C CB   . ARG D 1 70  ? -127.552 -26.547 -147.690 1.00 0.00 ? 70  ARG D CB   1  
ATOM   9847   C CG   . ARG D 1 70  ? -126.480 -25.928 -148.601 1.00 0.00 ? 70  ARG D CG   1  
ATOM   9848   C CD   . ARG D 1 70  ? -125.834 -27.027 -149.529 1.00 0.00 ? 70  ARG D CD   1  
ATOM   9849   N NE   . ARG D 1 70  ? -126.367 -26.935 -150.902 1.00 0.00 ? 70  ARG D NE   1  
ATOM   9850   C CZ   . ARG D 1 70  ? -126.651 -28.016 -151.664 1.00 0.00 ? 70  ARG D CZ   1  
ATOM   9851   N NH1  . ARG D 1 70  ? -126.497 -29.243 -151.212 1.00 0.00 ? 70  ARG D NH1  1  
ATOM   9852   N NH2  . ARG D 1 70  ? -127.096 -27.830 -152.894 1.00 0.00 ? 70  ARG D NH2  1  
ATOM   9853   H H    . ARG D 1 70  ? -128.501 -24.338 -148.570 1.00 0.00 ? 70  ARG D H    1  
ATOM   9854   H HA   . ARG D 1 70  ? -129.079 -25.954 -146.297 1.00 0.00 ? 70  ARG D HA   1  
ATOM   9855   H HB2  . ARG D 1 70  ? -127.074 -27.254 -147.035 1.00 0.00 ? 70  ARG D HB2  1  
ATOM   9856   H HB3  . ARG D 1 70  ? -128.277 -27.046 -148.285 1.00 0.00 ? 70  ARG D HB3  1  
ATOM   9857   H HG2  . ARG D 1 70  ? -126.922 -25.191 -149.217 1.00 0.00 ? 70  ARG D HG2  1  
ATOM   9858   H HG3  . ARG D 1 70  ? -125.702 -25.503 -148.001 1.00 0.00 ? 70  ARG D HG3  1  
ATOM   9859   H HD2  . ARG D 1 70  ? -124.772 -26.844 -149.553 1.00 0.00 ? 70  ARG D HD2  1  
ATOM   9860   H HD3  . ARG D 1 70  ? -126.028 -27.988 -149.112 1.00 0.00 ? 70  ARG D HD3  1  
ATOM   9861   H HE   . ARG D 1 70  ? -126.508 -26.058 -151.288 1.00 0.00 ? 70  ARG D HE   1  
ATOM   9862   H HH11 . ARG D 1 70  ? -126.163 -29.404 -150.283 1.00 0.00 ? 70  ARG D HH11 1  
ATOM   9863   H HH12 . ARG D 1 70  ? -126.717 -30.025 -151.803 1.00 0.00 ? 70  ARG D HH12 1  
ATOM   9864   H HH21 . ARG D 1 70  ? -127.222 -26.904 -153.257 1.00 0.00 ? 70  ARG D HH21 1  
ATOM   9865   H HH22 . ARG D 1 70  ? -127.312 -28.620 -153.473 1.00 0.00 ? 70  ARG D HH22 1  
ATOM   9866   N N    . TYR D 1 71  ? -126.621 -23.802 -146.225 1.00 0.00 ? 71  TYR D N    1  
ATOM   9867   C CA   . TYR D 1 71  ? -125.648 -23.083 -145.395 1.00 0.00 ? 71  TYR D CA   1  
ATOM   9868   C C    . TYR D 1 71  ? -126.234 -22.784 -144.000 1.00 0.00 ? 71  TYR D C    1  
ATOM   9869   O O    . TYR D 1 71  ? -125.687 -23.231 -142.999 1.00 0.00 ? 71  TYR D O    1  
ATOM   9870   C CB   . TYR D 1 71  ? -125.299 -21.744 -146.064 1.00 0.00 ? 71  TYR D CB   1  
ATOM   9871   C CG   . TYR D 1 71  ? -124.031 -21.760 -146.923 1.00 0.00 ? 71  TYR D CG   1  
ATOM   9872   C CD1  . TYR D 1 71  ? -123.646 -22.886 -147.647 1.00 0.00 ? 71  TYR D CD1  1  
ATOM   9873   C CD2  . TYR D 1 71  ? -123.259 -20.585 -147.009 1.00 0.00 ? 71  TYR D CD2  1  
ATOM   9874   C CE1  . TYR D 1 71  ? -122.496 -22.846 -148.448 1.00 0.00 ? 71  TYR D CE1  1  
ATOM   9875   C CE2  . TYR D 1 71  ? -122.113 -20.552 -147.806 1.00 0.00 ? 71  TYR D CE2  1  
ATOM   9876   C CZ   . TYR D 1 71  ? -121.731 -21.678 -148.524 1.00 0.00 ? 71  TYR D CZ   1  
ATOM   9877   O OH   . TYR D 1 71  ? -120.604 -21.633 -149.307 1.00 0.00 ? 71  TYR D OH   1  
ATOM   9878   H H    . TYR D 1 71  ? -126.805 -23.471 -147.121 1.00 0.00 ? 71  TYR D H    1  
ATOM   9879   H HA   . TYR D 1 71  ? -124.770 -23.674 -145.285 1.00 0.00 ? 71  TYR D HA   1  
ATOM   9880   H HB2  . TYR D 1 71  ? -126.115 -21.457 -146.689 1.00 0.00 ? 71  TYR D HB2  1  
ATOM   9881   H HB3  . TYR D 1 71  ? -125.173 -21.010 -145.289 1.00 0.00 ? 71  TYR D HB3  1  
ATOM   9882   H HD1  . TYR D 1 71  ? -124.226 -23.783 -147.594 1.00 0.00 ? 71  TYR D HD1  1  
ATOM   9883   H HD2  . TYR D 1 71  ? -123.546 -19.711 -146.459 1.00 0.00 ? 71  TYR D HD2  1  
ATOM   9884   H HE1  . TYR D 1 71  ? -122.199 -23.723 -149.008 1.00 0.00 ? 71  TYR D HE1  1  
ATOM   9885   H HE2  . TYR D 1 71  ? -121.522 -19.646 -147.867 1.00 0.00 ? 71  TYR D HE2  1  
ATOM   9886   H HH   . TYR D 1 71  ? -120.010 -20.980 -148.929 1.00 0.00 ? 71  TYR D HH   1  
ATOM   9887   N N    . VAL D 1 72  ? -127.342 -22.022 -143.969 1.00 0.00 ? 72  VAL D N    1  
ATOM   9888   C CA   . VAL D 1 72  ? -128.022 -21.676 -142.708 1.00 0.00 ? 72  VAL D CA   1  
ATOM   9889   C C    . VAL D 1 72  ? -128.603 -22.923 -142.034 1.00 0.00 ? 72  VAL D C    1  
ATOM   9890   O O    . VAL D 1 72  ? -128.434 -23.115 -140.837 1.00 0.00 ? 72  VAL D O    1  
ATOM   9891   C CB   . VAL D 1 72  ? -129.169 -20.603 -142.964 1.00 0.00 ? 72  VAL D CB   1  
ATOM   9892   C CG1  . VAL D 1 72  ? -129.502 -20.477 -144.452 1.00 0.00 ? 72  VAL D CG1  1  
ATOM   9893   C CG2  . VAL D 1 72  ? -130.422 -20.977 -142.181 1.00 0.00 ? 72  VAL D CG2  1  
ATOM   9894   H H    . VAL D 1 72  ? -127.699 -21.687 -144.809 1.00 0.00 ? 72  VAL D H    1  
ATOM   9895   H HA   . VAL D 1 72  ? -127.318 -21.234 -142.042 1.00 0.00 ? 72  VAL D HA   1  
ATOM   9896   H HB   . VAL D 1 72  ? -128.810 -19.661 -142.612 1.00 0.00 ? 72  VAL D HB   1  
ATOM   9897   H HG11 . VAL D 1 72  ? -128.690 -19.977 -144.956 1.00 0.00 ? 72  VAL D HG11 1  
ATOM   9898   H HG12 . VAL D 1 72  ? -130.406 -19.894 -144.564 1.00 0.00 ? 72  VAL D HG12 1  
ATOM   9899   H HG13 . VAL D 1 72  ? -129.643 -21.447 -144.883 1.00 0.00 ? 72  VAL D HG13 1  
ATOM   9900   H HG21 . VAL D 1 72  ? -130.159 -21.121 -141.141 1.00 0.00 ? 72  VAL D HG21 1  
ATOM   9901   H HG22 . VAL D 1 72  ? -130.840 -21.888 -142.579 1.00 0.00 ? 72  VAL D HG22 1  
ATOM   9902   H HG23 . VAL D 1 72  ? -131.136 -20.180 -142.264 1.00 0.00 ? 72  VAL D HG23 1  
ATOM   9903   N N    . ALA D 1 73  ? -129.281 -23.741 -142.827 1.00 0.00 ? 73  ALA D N    1  
ATOM   9904   C CA   . ALA D 1 73  ? -129.889 -24.980 -142.347 1.00 0.00 ? 73  ALA D CA   1  
ATOM   9905   C C    . ALA D 1 73  ? -128.846 -25.962 -141.819 1.00 0.00 ? 73  ALA D C    1  
ATOM   9906   O O    . ALA D 1 73  ? -129.143 -26.740 -140.917 1.00 0.00 ? 73  ALA D O    1  
ATOM   9907   C CB   . ALA D 1 73  ? -130.665 -25.612 -143.477 1.00 0.00 ? 73  ALA D CB   1  
ATOM   9908   H H    . ALA D 1 73  ? -129.381 -23.505 -143.768 1.00 0.00 ? 73  ALA D H    1  
ATOM   9909   H HA   . ALA D 1 73  ? -130.570 -24.751 -141.553 1.00 0.00 ? 73  ALA D HA   1  
ATOM   9910   H HB1  . ALA D 1 73  ? -131.574 -25.054 -143.631 1.00 0.00 ? 73  ALA D HB1  1  
ATOM   9911   H HB2  . ALA D 1 73  ? -130.901 -26.630 -143.219 1.00 0.00 ? 73  ALA D HB2  1  
ATOM   9912   H HB3  . ALA D 1 73  ? -130.072 -25.589 -144.373 1.00 0.00 ? 73  ALA D HB3  1  
ATOM   9913   N N    . MET D 1 74  ? -127.671 -25.958 -142.445 1.00 0.00 ? 74  MET D N    1  
ATOM   9914   C CA   . MET D 1 74  ? -126.594 -26.852 -142.078 1.00 0.00 ? 74  MET D CA   1  
ATOM   9915   C C    . MET D 1 74  ? -125.983 -26.502 -140.637 1.00 0.00 ? 74  MET D C    1  
ATOM   9916   O O    . MET D 1 74  ? -125.634 -27.417 -139.933 1.00 0.00 ? 74  MET D O    1  
ATOM   9917   C CB   . MET D 1 74  ? -125.379 -26.694 -143.133 1.00 0.00 ? 74  MET D CB   1  
ATOM   9918   C CG   . MET D 1 74  ? -124.013 -27.231 -142.595 1.00 0.00 ? 74  MET D CG   1  
ATOM   9919   S SD   . MET D 1 74  ? -123.197 -26.051 -141.475 1.00 0.00 ? 74  MET D SD   1  
ATOM   9920   C CE   . MET D 1 74  ? -121.999 -25.261 -142.590 1.00 0.00 ? 74  MET D CE   1  
ATOM   9921   H H    . MET D 1 74  ? -127.545 -25.351 -143.195 1.00 0.00 ? 74  MET D H    1  
ATOM   9922   H HA   . MET D 1 74  ? -126.904 -27.848 -142.073 1.00 0.00 ? 74  MET D HA   1  
ATOM   9923   H HB2  . MET D 1 74  ? -125.666 -27.274 -143.963 1.00 0.00 ? 74  MET D HB2  1  
ATOM   9924   H HB3  . MET D 1 74  ? -125.298 -25.673 -143.365 1.00 0.00 ? 74  MET D HB3  1  
ATOM   9925   H HG2  . MET D 1 74  ? -124.169 -28.153 -142.077 1.00 0.00 ? 74  MET D HG2  1  
ATOM   9926   H HG3  . MET D 1 74  ? -123.402 -27.396 -143.461 1.00 0.00 ? 74  MET D HG3  1  
ATOM   9927   H HE1  . MET D 1 74  ? -122.526 -24.739 -143.372 1.00 0.00 ? 74  MET D HE1  1  
ATOM   9928   H HE2  . MET D 1 74  ? -121.351 -26.004 -143.021 1.00 0.00 ? 74  MET D HE2  1  
ATOM   9929   H HE3  . MET D 1 74  ? -121.401 -24.554 -142.020 1.00 0.00 ? 74  MET D HE3  1  
ATOM   9930   N N    . VAL D 1 75  ? -125.894 -25.222 -140.375 1.00 0.00 ? 75  VAL D N    1  
ATOM   9931   C CA   . VAL D 1 75  ? -125.376 -24.810 -139.097 1.00 0.00 ? 75  VAL D CA   1  
ATOM   9932   C C    . VAL D 1 75  ? -126.381 -25.133 -137.980 1.00 0.00 ? 75  VAL D C    1  
ATOM   9933   O O    . VAL D 1 75  ? -126.010 -25.748 -136.986 1.00 0.00 ? 75  VAL D O    1  
ATOM   9934   C CB   . VAL D 1 75  ? -124.926 -23.282 -139.098 1.00 0.00 ? 75  VAL D CB   1  
ATOM   9935   C CG1  . VAL D 1 75  ? -123.716 -23.106 -140.011 1.00 0.00 ? 75  VAL D CG1  1  
ATOM   9936   C CG2  . VAL D 1 75  ? -126.061 -22.346 -139.526 1.00 0.00 ? 75  VAL D CG2  1  
ATOM   9937   H H    . VAL D 1 75  ? -126.170 -24.555 -141.040 1.00 0.00 ? 75  VAL D H    1  
ATOM   9938   H HA   . VAL D 1 75  ? -124.498 -25.390 -138.901 1.00 0.00 ? 75  VAL D HA   1  
ATOM   9939   H HB   . VAL D 1 75  ? -124.617 -23.034 -138.109 1.00 0.00 ? 75  VAL D HB   1  
ATOM   9940   H HG11 . VAL D 1 75  ? -124.016 -23.179 -141.040 1.00 0.00 ? 75  VAL D HG11 1  
ATOM   9941   H HG12 . VAL D 1 75  ? -122.987 -23.873 -139.787 1.00 0.00 ? 75  VAL D HG12 1  
ATOM   9942   H HG13 . VAL D 1 75  ? -123.280 -22.139 -139.824 1.00 0.00 ? 75  VAL D HG13 1  
ATOM   9943   H HG21 . VAL D 1 75  ? -126.161 -22.345 -140.595 1.00 0.00 ? 75  VAL D HG21 1  
ATOM   9944   H HG22 . VAL D 1 75  ? -125.833 -21.343 -139.183 1.00 0.00 ? 75  VAL D HG22 1  
ATOM   9945   H HG23 . VAL D 1 75  ? -126.983 -22.673 -139.071 1.00 0.00 ? 75  VAL D HG23 1  
ATOM   9946   N N    . ILE D 1 76  ? -127.650 -24.772 -138.155 1.00 0.00 ? 76  ILE D N    1  
ATOM   9947   C CA   . ILE D 1 76  ? -128.644 -25.091 -137.139 1.00 0.00 ? 76  ILE D CA   1  
ATOM   9948   C C    . ILE D 1 76  ? -128.837 -26.653 -137.006 1.00 0.00 ? 76  ILE D C    1  
ATOM   9949   O O    . ILE D 1 76  ? -129.186 -27.138 -135.941 1.00 0.00 ? 76  ILE D O    1  
ATOM   9950   C CB   . ILE D 1 76  ? -130.002 -24.317 -137.435 1.00 0.00 ? 76  ILE D CB   1  
ATOM   9951   C CG1  . ILE D 1 76  ? -131.060 -24.735 -136.349 1.00 0.00 ? 76  ILE D CG1  1  
ATOM   9952   C CG2  . ILE D 1 76  ? -130.498 -24.571 -138.850 1.00 0.00 ? 76  ILE D CG2  1  
ATOM   9953   C CD1  . ILE D 1 76  ? -132.326 -23.867 -136.391 1.00 0.00 ? 76  ILE D CD1  1  
ATOM   9954   H H    . ILE D 1 76  ? -127.915 -24.302 -138.970 1.00 0.00 ? 76  ILE D H    1  
ATOM   9955   H HA   . ILE D 1 76  ? -128.283 -24.745 -136.208 1.00 0.00 ? 76  ILE D HA   1  
ATOM   9956   H HB   . ILE D 1 76  ? -129.788 -23.283 -137.317 1.00 0.00 ? 76  ILE D HB   1  
ATOM   9957   H HG12 . ILE D 1 76  ? -131.332 -25.747 -136.513 1.00 0.00 ? 76  ILE D HG12 1  
ATOM   9958   H HG13 . ILE D 1 76  ? -130.597 -24.628 -135.387 1.00 0.00 ? 76  ILE D HG13 1  
ATOM   9959   H HG21 . ILE D 1 76  ? -130.227 -23.721 -139.465 1.00 0.00 ? 76  ILE D HG21 1  
ATOM   9960   H HG22 . ILE D 1 76  ? -131.571 -24.679 -138.847 1.00 0.00 ? 76  ILE D HG22 1  
ATOM   9961   H HG23 . ILE D 1 76  ? -130.045 -25.459 -139.253 1.00 0.00 ? 76  ILE D HG23 1  
ATOM   9962   H HD11 . ILE D 1 76  ? -133.191 -24.521 -136.385 1.00 0.00 ? 76  ILE D HD11 1  
ATOM   9963   H HD12 . ILE D 1 76  ? -132.342 -23.257 -137.275 1.00 0.00 ? 76  ILE D HD12 1  
ATOM   9964   H HD13 . ILE D 1 76  ? -132.355 -23.237 -135.511 1.00 0.00 ? 76  ILE D HD13 1  
ATOM   9965   N N    . TRP D 1 77  ? -128.508 -27.342 -138.093 1.00 0.00 ? 77  TRP D N    1  
ATOM   9966   C CA   . TRP D 1 77  ? -128.507 -28.814 -138.175 1.00 0.00 ? 77  TRP D CA   1  
ATOM   9967   C C    . TRP D 1 77  ? -127.366 -29.297 -137.314 1.00 0.00 ? 77  TRP D C    1  
ATOM   9968   O O    . TRP D 1 77  ? -127.499 -30.254 -136.569 1.00 0.00 ? 77  TRP D O    1  
ATOM   9969   C CB   . TRP D 1 77  ? -128.319 -29.168 -139.679 1.00 0.00 ? 77  TRP D CB   1  
ATOM   9970   C CG   . TRP D 1 77  ? -127.682 -30.499 -140.059 1.00 0.00 ? 77  TRP D CG   1  
ATOM   9971   C CD1  . TRP D 1 77  ? -126.357 -30.703 -140.393 1.00 0.00 ? 77  TRP D CD1  1  
ATOM   9972   C CD2  . TRP D 1 77  ? -128.347 -31.746 -140.318 1.00 0.00 ? 77  TRP D CD2  1  
ATOM   9973   N NE1  . TRP D 1 77  ? -126.188 -32.011 -140.788 1.00 0.00 ? 77  TRP D NE1  1  
ATOM   9974   C CE2  . TRP D 1 77  ? -127.369 -32.699 -140.754 1.00 0.00 ? 77  TRP D CE2  1  
ATOM   9975   C CE3  . TRP D 1 77  ? -129.683 -32.172 -140.197 1.00 0.00 ? 77  TRP D CE3  1  
ATOM   9976   C CZ2  . TRP D 1 77  ? -127.703 -33.998 -141.054 1.00 0.00 ? 77  TRP D CZ2  1  
ATOM   9977   C CZ3  . TRP D 1 77  ? -130.008 -33.498 -140.504 1.00 0.00 ? 77  TRP D CZ3  1  
ATOM   9978   C CH2  . TRP D 1 77  ? -129.019 -34.404 -140.931 1.00 0.00 ? 77  TRP D CH2  1  
ATOM   9979   H H    . TRP D 1 77  ? -128.199 -26.848 -138.867 1.00 0.00 ? 77  TRP D H    1  
ATOM   9980   H HA   . TRP D 1 77  ? -129.448 -29.210 -137.816 1.00 0.00 ? 77  TRP D HA   1  
ATOM   9981   H HB2  . TRP D 1 77  ? -129.287 -29.168 -140.125 1.00 0.00 ? 77  TRP D HB2  1  
ATOM   9982   H HB3  . TRP D 1 77  ? -127.742 -28.385 -140.109 1.00 0.00 ? 77  TRP D HB3  1  
ATOM   9983   H HD1  . TRP D 1 77  ? -125.581 -29.969 -140.335 1.00 0.00 ? 77  TRP D HD1  1  
ATOM   9984   H HE1  . TRP D 1 77  ? -125.327 -32.437 -141.057 1.00 0.00 ? 77  TRP D HE1  1  
ATOM   9985   H HE3  . TRP D 1 77  ? -130.457 -31.481 -139.873 1.00 0.00 ? 77  TRP D HE3  1  
ATOM   9986   H HZ2  . TRP D 1 77  ? -126.938 -34.703 -141.384 1.00 0.00 ? 77  TRP D HZ2  1  
ATOM   9987   H HZ3  . TRP D 1 77  ? -131.025 -33.838 -140.410 1.00 0.00 ? 77  TRP D HZ3  1  
ATOM   9988   H HH2  . TRP D 1 77  ? -129.286 -35.415 -141.154 1.00 0.00 ? 77  TRP D HH2  1  
ATOM   9989   N N    . LEU D 1 78  ? -126.287 -28.503 -137.325 1.00 0.00 ? 78  LEU D N    1  
ATOM   9990   C CA   . LEU D 1 78  ? -125.119 -28.746 -136.488 1.00 0.00 ? 78  LEU D CA   1  
ATOM   9991   C C    . LEU D 1 78  ? -125.383 -28.328 -135.048 1.00 0.00 ? 78  LEU D C    1  
ATOM   9992   O O    . LEU D 1 78  ? -125.269 -29.132 -134.123 1.00 0.00 ? 78  LEU D O    1  
ATOM   9993   C CB   . LEU D 1 78  ? -123.962 -27.889 -137.084 1.00 0.00 ? 78  LEU D CB   1  
ATOM   9994   C CG   . LEU D 1 78  ? -122.972 -27.452 -135.999 1.00 0.00 ? 78  LEU D CG   1  
ATOM   9995   C CD1  . LEU D 1 78  ? -122.158 -28.503 -135.343 1.00 0.00 ? 78  LEU D CD1  1  
ATOM   9996   C CD2  . LEU D 1 78  ? -121.948 -26.493 -136.768 1.00 0.00 ? 78  LEU D CD2  1  
ATOM   9997   H H    . LEU D 1 78  ? -126.313 -27.694 -137.863 1.00 0.00 ? 78  LEU D H    1  
ATOM   9998   H HA   . LEU D 1 78  ? -124.858 -29.798 -136.512 1.00 0.00 ? 78  LEU D HA   1  
ATOM   9999   H HB2  . LEU D 1 78  ? -123.381 -28.620 -137.683 1.00 0.00 ? 78  LEU D HB2  1  
ATOM   10000  H HB3  . LEU D 1 78  ? -124.299 -27.142 -137.658 1.00 0.00 ? 78  LEU D HB3  1  
ATOM   10001  H HG   . LEU D 1 78  ? -123.501 -27.061 -135.191 1.00 0.00 ? 78  LEU D HG   1  
ATOM   10002  H HD11 . LEU D 1 78  ? -121.429 -28.157 -134.727 1.00 0.00 ? 78  LEU D HD11 1  
ATOM   10003  H HD12 . LEU D 1 78  ? -121.734 -29.153 -136.151 1.00 0.00 ? 78  LEU D HD12 1  
ATOM   10004  H HD13 . LEU D 1 78  ? -122.891 -29.136 -134.821 1.00 0.00 ? 78  LEU D HD13 1  
ATOM   10005  H HD21 . LEU D 1 78  ? -121.314 -25.988 -136.040 1.00 0.00 ? 78  LEU D HD21 1  
ATOM   10006  H HD22 . LEU D 1 78  ? -122.504 -25.732 -137.315 1.00 0.00 ? 78  LEU D HD22 1  
ATOM   10007  H HD23 . LEU D 1 78  ? -121.344 -27.054 -137.445 1.00 0.00 ? 78  LEU D HD23 1  
ATOM   10008  N N    . TYR D 1 79  ? -125.690 -27.040 -134.867 1.00 0.00 ? 79  TYR D N    1  
ATOM   10009  C CA   . TYR D 1 79  ? -125.942 -26.499 -133.532 1.00 0.00 ? 79  TYR D CA   1  
ATOM   10010  C C    . TYR D 1 79  ? -126.989 -27.322 -132.833 1.00 0.00 ? 79  TYR D C    1  
ATOM   10011  O O    . TYR D 1 79  ? -126.783 -27.737 -131.706 1.00 0.00 ? 79  TYR D O    1  
ATOM   10012  C CB   . TYR D 1 79  ? -126.375 -25.034 -133.662 1.00 0.00 ? 79  TYR D CB   1  
ATOM   10013  C CG   . TYR D 1 79  ? -127.164 -24.500 -132.466 1.00 0.00 ? 79  TYR D CG   1  
ATOM   10014  C CD1  . TYR D 1 79  ? -126.612 -24.487 -131.194 1.00 0.00 ? 79  TYR D CD1  1  
ATOM   10015  C CD2  . TYR D 1 79  ? -128.440 -23.965 -132.669 1.00 0.00 ? 79  TYR D CD2  1  
ATOM   10016  C CE1  . TYR D 1 79  ? -127.333 -23.957 -130.129 1.00 0.00 ? 79  TYR D CE1  1  
ATOM   10017  C CE2  . TYR D 1 79  ? -129.154 -23.441 -131.601 1.00 0.00 ? 79  TYR D CE2  1  
ATOM   10018  C CZ   . TYR D 1 79  ? -128.600 -23.437 -130.336 1.00 0.00 ? 79  TYR D CZ   1  
ATOM   10019  O OH   . TYR D 1 79  ? -129.309 -22.923 -129.285 1.00 0.00 ? 79  TYR D OH   1  
ATOM   10020  H H    . TYR D 1 79  ? -125.717 -26.444 -135.635 1.00 0.00 ? 79  TYR D H    1  
ATOM   10021  H HA   . TYR D 1 79  ? -125.022 -26.545 -132.976 1.00 0.00 ? 79  TYR D HA   1  
ATOM   10022  H HB2  . TYR D 1 79  ? -125.493 -24.435 -133.767 1.00 0.00 ? 79  TYR D HB2  1  
ATOM   10023  H HB3  . TYR D 1 79  ? -126.970 -24.943 -134.542 1.00 0.00 ? 79  TYR D HB3  1  
ATOM   10024  H HD1  . TYR D 1 79  ? -125.636 -24.891 -131.023 1.00 0.00 ? 79  TYR D HD1  1  
ATOM   10025  H HD2  . TYR D 1 79  ? -128.875 -23.961 -133.648 1.00 0.00 ? 79  TYR D HD2  1  
ATOM   10026  H HE1  . TYR D 1 79  ? -126.902 -23.947 -129.141 1.00 0.00 ? 79  TYR D HE1  1  
ATOM   10027  H HE2  . TYR D 1 79  ? -130.142 -23.034 -131.758 1.00 0.00 ? 79  TYR D HE2  1  
ATOM   10028  H HH   . TYR D 1 79  ? -128.807 -23.081 -128.484 1.00 0.00 ? 79  TYR D HH   1  
ATOM   10029  N N    . SER D 1 80  ? -128.111 -27.564 -133.486 1.00 0.00 ? 80  SER D N    1  
ATOM   10030  C CA   . SER D 1 80  ? -129.163 -28.361 -132.857 1.00 0.00 ? 80  SER D CA   1  
ATOM   10031  C C    . SER D 1 80  ? -128.594 -29.658 -132.257 1.00 0.00 ? 80  SER D C    1  
ATOM   10032  O O    . SER D 1 80  ? -128.962 -30.045 -131.137 1.00 0.00 ? 80  SER D O    1  
ATOM   10033  C CB   . SER D 1 80  ? -130.256 -28.675 -133.875 1.00 0.00 ? 80  SER D CB   1  
ATOM   10034  O OG   . SER D 1 80  ? -131.137 -29.641 -133.343 1.00 0.00 ? 80  SER D OG   1  
ATOM   10035  H H    . SER D 1 80  ? -128.248 -27.191 -134.385 1.00 0.00 ? 80  SER D H    1  
ATOM   10036  H HA   . SER D 1 80  ? -129.585 -27.783 -132.064 1.00 0.00 ? 80  SER D HA   1  
ATOM   10037  H HB2  . SER D 1 80  ? -130.811 -27.777 -134.095 1.00 0.00 ? 80  SER D HB2  1  
ATOM   10038  H HB3  . SER D 1 80  ? -129.808 -29.049 -134.779 1.00 0.00 ? 80  SER D HB3  1  
ATOM   10039  H HG   . SER D 1 80  ? -131.636 -30.021 -134.075 1.00 0.00 ? 80  SER D HG   1  
ATOM   10040  N N    . ALA D 1 81  ? -127.677 -30.291 -132.989 1.00 0.00 ? 81  ALA D N    1  
ATOM   10041  C CA   . ALA D 1 81  ? -127.019 -31.510 -132.526 1.00 0.00 ? 81  ALA D CA   1  
ATOM   10042  C C    . ALA D 1 81  ? -126.074 -31.178 -131.370 1.00 0.00 ? 81  ALA D C    1  
ATOM   10043  O O    . ALA D 1 81  ? -126.000 -31.915 -130.392 1.00 0.00 ? 81  ALA D O    1  
ATOM   10044  C CB   . ALA D 1 81  ? -126.244 -32.163 -133.677 1.00 0.00 ? 81  ALA D CB   1  
ATOM   10045  H H    . ALA D 1 81  ? -127.425 -29.916 -133.853 1.00 0.00 ? 81  ALA D H    1  
ATOM   10046  H HA   . ALA D 1 81  ? -127.763 -32.199 -132.171 1.00 0.00 ? 81  ALA D HA   1  
ATOM   10047  H HB1  . ALA D 1 81  ? -125.931 -31.408 -134.382 1.00 0.00 ? 81  ALA D HB1  1  
ATOM   10048  H HB2  . ALA D 1 81  ? -126.883 -32.878 -134.178 1.00 0.00 ? 81  ALA D HB2  1  
ATOM   10049  H HB3  . ALA D 1 81  ? -125.378 -32.672 -133.287 1.00 0.00 ? 81  ALA D HB3  1  
ATOM   10050  N N    . PHE D 1 82  ? -125.382 -30.048 -131.497 1.00 0.00 ? 82  PHE D N    1  
ATOM   10051  C CA   . PHE D 1 82  ? -124.439 -29.574 -130.469 1.00 0.00 ? 82  PHE D CA   1  
ATOM   10052  C C    . PHE D 1 82  ? -125.124 -29.418 -129.110 1.00 0.00 ? 82  PHE D C    1  
ATOM   10053  O O    . PHE D 1 82  ? -124.578 -29.847 -128.094 1.00 0.00 ? 82  PHE D O    1  
ATOM   10054  C CB   . PHE D 1 82  ? -123.878 -28.228 -130.927 1.00 0.00 ? 82  PHE D CB   1  
ATOM   10055  C CG   . PHE D 1 82  ? -122.793 -27.699 -130.028 1.00 0.00 ? 82  PHE D CG   1  
ATOM   10056  C CD1  . PHE D 1 82  ? -123.121 -27.091 -128.831 1.00 0.00 ? 82  PHE D CD1  1  
ATOM   10057  C CD2  . PHE D 1 82  ? -121.468 -27.775 -130.431 1.00 0.00 ? 82  PHE D CD2  1  
ATOM   10058  C CE1  . PHE D 1 82  ? -122.122 -26.571 -128.028 1.00 0.00 ? 82  PHE D CE1  1  
ATOM   10059  C CE2  . PHE D 1 82  ? -120.471 -27.252 -129.633 1.00 0.00 ? 82  PHE D CE2  1  
ATOM   10060  C CZ   . PHE D 1 82  ? -120.796 -26.650 -128.429 1.00 0.00 ? 82  PHE D CZ   1  
ATOM   10061  H H    . PHE D 1 82  ? -125.500 -29.515 -132.307 1.00 0.00 ? 82  PHE D H    1  
ATOM   10062  H HA   . PHE D 1 82  ? -123.640 -30.275 -130.380 1.00 0.00 ? 82  PHE D HA   1  
ATOM   10063  H HB2  . PHE D 1 82  ? -123.472 -28.341 -131.914 1.00 0.00 ? 82  PHE D HB2  1  
ATOM   10064  H HB3  . PHE D 1 82  ? -124.673 -27.514 -130.948 1.00 0.00 ? 82  PHE D HB3  1  
ATOM   10065  H HD1  . PHE D 1 82  ? -124.144 -27.021 -128.521 1.00 0.00 ? 82  PHE D HD1  1  
ATOM   10066  H HD2  . PHE D 1 82  ? -121.215 -28.246 -131.360 1.00 0.00 ? 82  PHE D HD2  1  
ATOM   10067  H HE1  . PHE D 1 82  ? -122.378 -26.105 -127.093 1.00 0.00 ? 82  PHE D HE1  1  
ATOM   10068  H HE2  . PHE D 1 82  ? -119.445 -27.308 -129.953 1.00 0.00 ? 82  PHE D HE2  1  
ATOM   10069  H HZ   . PHE D 1 82  ? -120.020 -26.246 -127.804 1.00 0.00 ? 82  PHE D HZ   1  
ATOM   10070  N N    . ARG D 1 83  ? -126.320 -28.836 -129.090 1.00 0.00 ? 83  ARG D N    1  
ATOM   10071  C CA   . ARG D 1 83  ? -127.046 -28.691 -127.832 1.00 0.00 ? 83  ARG D CA   1  
ATOM   10072  C C    . ARG D 1 83  ? -127.435 -30.073 -127.345 1.00 0.00 ? 83  ARG D C    1  
ATOM   10073  O O    . ARG D 1 83  ? -127.376 -30.341 -126.153 1.00 0.00 ? 83  ARG D O    1  
ATOM   10074  C CB   . ARG D 1 83  ? -128.278 -27.791 -128.004 1.00 0.00 ? 83  ARG D CB   1  
ATOM   10075  C CG   . ARG D 1 83  ? -129.050 -27.571 -126.685 1.00 0.00 ? 83  ARG D CG   1  
ATOM   10076  C CD   . ARG D 1 83  ? -128.297 -26.588 -125.706 1.00 0.00 ? 83  ARG D CD   1  
ATOM   10077  N NE   . ARG D 1 83  ? -129.258 -25.918 -124.809 1.00 0.00 ? 83  ARG D NE   1  
ATOM   10078  C CZ   . ARG D 1 83  ? -128.924 -25.433 -123.596 1.00 0.00 ? 83  ARG D CZ   1  
ATOM   10079  N NH1  . ARG D 1 83  ? -127.696 -25.520 -123.131 1.00 0.00 ? 83  ARG D NH1  1  
ATOM   10080  N NH2  . ARG D 1 83  ? -129.859 -24.853 -122.868 1.00 0.00 ? 83  ARG D NH2  1  
ATOM   10081  H H    . ARG D 1 83  ? -126.719 -28.522 -129.925 1.00 0.00 ? 83  ARG D H    1  
ATOM   10082  H HA   . ARG D 1 83  ? -126.393 -28.252 -127.108 1.00 0.00 ? 83  ARG D HA   1  
ATOM   10083  H HB2  . ARG D 1 83  ? -127.961 -26.842 -128.380 1.00 0.00 ? 83  ARG D HB2  1  
ATOM   10084  H HB3  . ARG D 1 83  ? -128.952 -28.250 -128.708 1.00 0.00 ? 83  ARG D HB3  1  
ATOM   10085  H HG2  . ARG D 1 83  ? -129.999 -27.139 -126.927 1.00 0.00 ? 83  ARG D HG2  1  
ATOM   10086  H HG3  . ARG D 1 83  ? -129.190 -28.510 -126.193 1.00 0.00 ? 83  ARG D HG3  1  
ATOM   10087  H HD2  . ARG D 1 83  ? -127.607 -27.154 -125.126 1.00 0.00 ? 83  ARG D HD2  1  
ATOM   10088  H HD3  . ARG D 1 83  ? -127.782 -25.854 -126.290 1.00 0.00 ? 83  ARG D HD3  1  
ATOM   10089  H HE   . ARG D 1 83  ? -130.174 -25.815 -125.102 1.00 0.00 ? 83  ARG D HE   1  
ATOM   10090  H HH11 . ARG D 1 83  ? -126.976 -25.952 -123.673 1.00 0.00 ? 83  ARG D HH11 1  
ATOM   10091  H HH12 . ARG D 1 83  ? -127.479 -25.148 -122.223 1.00 0.00 ? 83  ARG D HH12 1  
ATOM   10092  H HH21 . ARG D 1 83  ? -130.798 -24.778 -123.215 1.00 0.00 ? 83  ARG D HH21 1  
ATOM   10093  H HH22 . ARG D 1 83  ? -129.635 -24.488 -121.964 1.00 0.00 ? 83  ARG D HH22 1  
ATOM   10094  N N    . GLY D 1 84  ? -127.810 -30.948 -128.272 1.00 0.00 ? 84  GLY D N    1  
ATOM   10095  C CA   . GLY D 1 84  ? -128.194 -32.311 -127.922 1.00 0.00 ? 84  GLY D CA   1  
ATOM   10096  C C    . GLY D 1 84  ? -127.091 -33.040 -127.170 1.00 0.00 ? 84  GLY D C    1  
ATOM   10097  O O    . GLY D 1 84  ? -127.278 -33.426 -126.019 1.00 0.00 ? 84  GLY D O    1  
ATOM   10098  H H    . GLY D 1 84  ? -127.820 -30.677 -129.215 1.00 0.00 ? 84  GLY D H    1  
ATOM   10099  H HA2  . GLY D 1 84  ? -129.078 -32.283 -127.306 1.00 0.00 ? 84  GLY D HA2  1  
ATOM   10100  H HA3  . GLY D 1 84  ? -128.408 -32.852 -128.827 1.00 0.00 ? 84  GLY D HA3  1  
ATOM   10101  N N    . VAL D 1 85  ? -125.945 -33.205 -127.843 1.00 0.00 ? 85  VAL D N    1  
ATOM   10102  C CA   . VAL D 1 85  ? -124.785 -33.893 -127.266 1.00 0.00 ? 85  VAL D CA   1  
ATOM   10103  C C    . VAL D 1 85  ? -124.439 -33.320 -125.898 1.00 0.00 ? 85  VAL D C    1  
ATOM   10104  O O    . VAL D 1 85  ? -124.100 -34.071 -124.989 1.00 0.00 ? 85  VAL D O    1  
ATOM   10105  C CB   . VAL D 1 85  ? -123.567 -33.826 -128.241 1.00 0.00 ? 85  VAL D CB   1  
ATOM   10106  C CG1  . VAL D 1 85  ? -123.195 -32.381 -128.609 1.00 0.00 ? 85  VAL D CG1  1  
ATOM   10107  C CG2  . VAL D 1 85  ? -122.362 -34.526 -127.610 1.00 0.00 ? 85  VAL D CG2  1  
ATOM   10108  H H    . VAL D 1 85  ? -125.887 -32.861 -128.751 1.00 0.00 ? 85  VAL D H    1  
ATOM   10109  H HA   . VAL D 1 85  ? -125.040 -34.928 -127.138 1.00 0.00 ? 85  VAL D HA   1  
ATOM   10110  H HB   . VAL D 1 85  ? -123.827 -34.348 -129.142 1.00 0.00 ? 85  VAL D HB   1  
ATOM   10111  H HG11 . VAL D 1 85  ? -122.763 -31.880 -127.758 1.00 0.00 ? 85  VAL D HG11 1  
ATOM   10112  H HG12 . VAL D 1 85  ? -124.082 -31.860 -128.927 1.00 0.00 ? 85  VAL D HG12 1  
ATOM   10113  H HG13 . VAL D 1 85  ? -122.477 -32.392 -129.422 1.00 0.00 ? 85  VAL D HG13 1  
ATOM   10114  H HG21 . VAL D 1 85  ? -121.901 -33.877 -126.886 1.00 0.00 ? 85  VAL D HG21 1  
ATOM   10115  H HG22 . VAL D 1 85  ? -121.649 -34.771 -128.386 1.00 0.00 ? 85  VAL D HG22 1  
ATOM   10116  H HG23 . VAL D 1 85  ? -122.691 -35.434 -127.127 1.00 0.00 ? 85  VAL D HG23 1  
ATOM   10117  N N    . GLN D 1 86  ? -124.476 -31.991 -125.781 1.00 0.00 ? 86  GLN D N    1  
ATOM   10118  C CA   . GLN D 1 86  ? -124.125 -31.302 -124.523 1.00 0.00 ? 86  GLN D CA   1  
ATOM   10119  C C    . GLN D 1 86  ? -125.048 -31.597 -123.322 1.00 0.00 ? 86  GLN D C    1  
ATOM   10120  O O    . GLN D 1 86  ? -124.551 -31.993 -122.256 1.00 0.00 ? 86  GLN D O    1  
ATOM   10121  C CB   . GLN D 1 86  ? -124.054 -29.790 -124.818 1.00 0.00 ? 86  GLN D CB   1  
ATOM   10122  C CG   . GLN D 1 86  ? -123.609 -28.961 -123.564 1.00 0.00 ? 86  GLN D CG   1  
ATOM   10123  C CD   . GLN D 1 86  ? -123.739 -27.479 -123.844 1.00 0.00 ? 86  GLN D CD   1  
ATOM   10124  O OE1  . GLN D 1 86  ? -123.277 -26.974 -124.879 1.00 0.00 ? 86  GLN D OE1  1  
ATOM   10125  N NE2  . GLN D 1 86  ? -124.352 -26.758 -122.937 1.00 0.00 ? 86  GLN D NE2  1  
ATOM   10126  H H    . GLN D 1 86  ? -124.707 -31.459 -126.567 1.00 0.00 ? 86  GLN D H    1  
ATOM   10127  H HA   . GLN D 1 86  ? -123.151 -31.634 -124.267 1.00 0.00 ? 86  GLN D HA   1  
ATOM   10128  H HB2  . GLN D 1 86  ? -123.321 -29.624 -125.574 1.00 0.00 ? 86  GLN D HB2  1  
ATOM   10129  H HB3  . GLN D 1 86  ? -125.003 -29.435 -125.131 1.00 0.00 ? 86  GLN D HB3  1  
ATOM   10130  H HG2  . GLN D 1 86  ? -124.246 -29.209 -122.746 1.00 0.00 ? 86  GLN D HG2  1  
ATOM   10131  H HG3  . GLN D 1 86  ? -122.593 -29.192 -123.340 1.00 0.00 ? 86  GLN D HG3  1  
ATOM   10132  H HE21 . GLN D 1 86  ? -124.706 -27.201 -122.127 1.00 0.00 ? 86  GLN D HE21 1  
ATOM   10133  H HE22 . GLN D 1 86  ? -124.458 -25.796 -123.046 1.00 0.00 ? 86  GLN D HE22 1  
ATOM   10134  N N    . LEU D 1 87  ? -126.362 -31.450 -123.495 1.00 0.00 ? 87  LEU D N    1  
ATOM   10135  C CA   . LEU D 1 87  ? -127.296 -31.731 -122.410 1.00 0.00 ? 87  LEU D CA   1  
ATOM   10136  C C    . LEU D 1 87  ? -127.196 -33.236 -122.127 1.00 0.00 ? 87  LEU D C    1  
ATOM   10137  O O    . LEU D 1 87  ? -127.157 -33.646 -120.977 1.00 0.00 ? 87  LEU D O    1  
ATOM   10138  C CB   . LEU D 1 87  ? -128.758 -31.407 -122.833 1.00 0.00 ? 87  LEU D CB   1  
ATOM   10139  C CG   . LEU D 1 87  ? -129.280 -29.955 -122.635 1.00 0.00 ? 87  LEU D CG   1  
ATOM   10140  C CD1  . LEU D 1 87  ? -128.255 -28.977 -123.147 1.00 0.00 ? 87  LEU D CD1  1  
ATOM   10141  C CD2  . LEU D 1 87  ? -130.616 -29.756 -123.415 1.00 0.00 ? 87  LEU D CD2  1  
ATOM   10142  H H    . LEU D 1 87  ? -126.705 -31.182 -124.368 1.00 0.00 ? 87  LEU D H    1  
ATOM   10143  H HA   . LEU D 1 87  ? -127.013 -31.196 -121.529 1.00 0.00 ? 87  LEU D HA   1  
ATOM   10144  H HB2  . LEU D 1 87  ? -128.804 -31.595 -123.857 1.00 0.00 ? 87  LEU D HB2  1  
ATOM   10145  H HB3  . LEU D 1 87  ? -129.401 -32.071 -122.303 1.00 0.00 ? 87  LEU D HB3  1  
ATOM   10146  H HG   . LEU D 1 87  ? -129.474 -29.779 -121.602 1.00 0.00 ? 87  LEU D HG   1  
ATOM   10147  H HD11 . LEU D 1 87  ? -128.660 -27.981 -123.121 1.00 0.00 ? 87  LEU D HD11 1  
ATOM   10148  H HD12 . LEU D 1 87  ? -127.973 -29.232 -124.158 1.00 0.00 ? 87  LEU D HD12 1  
ATOM   10149  H HD13 . LEU D 1 87  ? -127.388 -29.034 -122.506 1.00 0.00 ? 87  LEU D HD13 1  
ATOM   10150  H HD21 . LEU D 1 87  ? -131.370 -30.427 -123.028 1.00 0.00 ? 87  LEU D HD21 1  
ATOM   10151  H HD22 . LEU D 1 87  ? -130.466 -29.946 -124.464 1.00 0.00 ? 87  LEU D HD22 1  
ATOM   10152  H HD23 . LEU D 1 87  ? -130.950 -28.733 -123.279 1.00 0.00 ? 87  LEU D HD23 1  
ATOM   10153  N N    . THR D 1 88  ? -127.130 -34.034 -123.209 1.00 0.00 ? 88  THR D N    1  
ATOM   10154  C CA   . THR D 1 88  ? -127.019 -35.501 -123.093 1.00 0.00 ? 88  THR D CA   1  
ATOM   10155  C C    . THR D 1 88  ? -125.817 -35.925 -122.238 1.00 0.00 ? 88  THR D C    1  
ATOM   10156  O O    . THR D 1 88  ? -125.963 -36.762 -121.344 1.00 0.00 ? 88  THR D O    1  
ATOM   10157  C CB   . THR D 1 88  ? -126.905 -36.167 -124.483 1.00 0.00 ? 88  THR D CB   1  
ATOM   10158  O OG1  . THR D 1 88  ? -125.997 -35.455 -125.314 1.00 0.00 ? 88  THR D OG1  1  
ATOM   10159  C CG2  . THR D 1 88  ? -128.276 -36.226 -125.157 1.00 0.00 ? 88  THR D CG2  1  
ATOM   10160  H H    . THR D 1 88  ? -127.158 -33.629 -124.095 1.00 0.00 ? 88  THR D H    1  
ATOM   10161  H HA   . THR D 1 88  ? -127.904 -35.858 -122.617 1.00 0.00 ? 88  THR D HA   1  
ATOM   10162  H HB   . THR D 1 88  ? -126.547 -37.178 -124.353 1.00 0.00 ? 88  THR D HB   1  
ATOM   10163  H HG1  . THR D 1 88  ? -126.494 -35.042 -126.030 1.00 0.00 ? 88  THR D HG1  1  
ATOM   10164  H HG21 . THR D 1 88  ? -128.664 -35.228 -125.271 1.00 0.00 ? 88  THR D HG21 1  
ATOM   10165  H HG22 . THR D 1 88  ? -128.950 -36.812 -124.552 1.00 0.00 ? 88  THR D HG22 1  
ATOM   10166  H HG23 . THR D 1 88  ? -128.174 -36.688 -126.130 1.00 0.00 ? 88  THR D HG23 1  
ATOM   10167  N N    . TYR D 1 89  ? -124.651 -35.350 -122.517 1.00 0.00 ? 89  TYR D N    1  
ATOM   10168  C CA   . TYR D 1 89  ? -123.440 -35.665 -121.761 1.00 0.00 ? 89  TYR D CA   1  
ATOM   10169  C C    . TYR D 1 89  ? -123.670 -35.375 -120.294 1.00 0.00 ? 89  TYR D C    1  
ATOM   10170  O O    . TYR D 1 89  ? -123.359 -36.200 -119.442 1.00 0.00 ? 89  TYR D O    1  
ATOM   10171  C CB   . TYR D 1 89  ? -122.262 -34.834 -122.304 1.00 0.00 ? 89  TYR D CB   1  
ATOM   10172  C CG   . TYR D 1 89  ? -121.489 -34.138 -121.201 1.00 0.00 ? 89  TYR D CG   1  
ATOM   10173  C CD1  . TYR D 1 89  ? -120.674 -34.869 -120.349 1.00 0.00 ? 89  TYR D CD1  1  
ATOM   10174  C CD2  . TYR D 1 89  ? -121.608 -32.760 -121.045 1.00 0.00 ? 89  TYR D CD2  1  
ATOM   10175  C CE1  . TYR D 1 89  ? -119.978 -34.219 -119.340 1.00 0.00 ? 89  TYR D CE1  1  
ATOM   10176  C CE2  . TYR D 1 89  ? -120.913 -32.116 -120.041 1.00 0.00 ? 89  TYR D CE2  1  
ATOM   10177  C CZ   . TYR D 1 89  ? -120.101 -32.839 -119.189 1.00 0.00 ? 89  TYR D CZ   1  
ATOM   10178  O OH   . TYR D 1 89  ? -119.415 -32.186 -118.200 1.00 0.00 ? 89  TYR D OH   1  
ATOM   10179  H H    . TYR D 1 89  ? -124.604 -34.710 -123.249 1.00 0.00 ? 89  TYR D H    1  
ATOM   10180  H HA   . TYR D 1 89  ? -123.215 -36.709 -121.881 1.00 0.00 ? 89  TYR D HA   1  
ATOM   10181  H HB2  . TYR D 1 89  ? -121.589 -35.490 -122.825 1.00 0.00 ? 89  TYR D HB2  1  
ATOM   10182  H HB3  . TYR D 1 89  ? -122.641 -34.096 -122.986 1.00 0.00 ? 89  TYR D HB3  1  
ATOM   10183  H HD1  . TYR D 1 89  ? -120.579 -35.929 -120.463 1.00 0.00 ? 89  TYR D HD1  1  
ATOM   10184  H HD2  . TYR D 1 89  ? -122.234 -32.194 -121.703 1.00 0.00 ? 89  TYR D HD2  1  
ATOM   10185  H HE1  . TYR D 1 89  ? -119.345 -34.784 -118.675 1.00 0.00 ? 89  TYR D HE1  1  
ATOM   10186  H HE2  . TYR D 1 89  ? -121.007 -31.047 -119.919 1.00 0.00 ? 89  TYR D HE2  1  
ATOM   10187  H HH   . TYR D 1 89  ? -120.042 -31.635 -117.725 1.00 0.00 ? 89  TYR D HH   1  
ATOM   10188  N N    . GLU D 1 90  ? -124.181 -34.188 -120.008 1.00 0.00 ? 90  GLU D N    1  
ATOM   10189  C CA   . GLU D 1 90  ? -124.434 -33.798 -118.624 1.00 0.00 ? 90  GLU D CA   1  
ATOM   10190  C C    . GLU D 1 90  ? -125.588 -34.602 -118.022 1.00 0.00 ? 90  GLU D C    1  
ATOM   10191  O O    . GLU D 1 90  ? -125.571 -34.898 -116.830 1.00 0.00 ? 90  GLU D O    1  
ATOM   10192  C CB   . GLU D 1 90  ? -124.719 -32.290 -118.565 1.00 0.00 ? 90  GLU D CB   1  
ATOM   10193  C CG   . GLU D 1 90  ? -124.606 -31.708 -117.152 1.00 0.00 ? 90  GLU D CG   1  
ATOM   10194  C CD   . GLU D 1 90  ? -123.165 -31.270 -116.846 1.00 0.00 ? 90  GLU D CD   1  
ATOM   10195  O OE1  . GLU D 1 90  ? -122.767 -30.178 -117.289 1.00 0.00 ? 90  GLU D OE1  1  
ATOM   10196  O OE2  . GLU D 1 90  ? -122.480 -32.039 -116.168 1.00 0.00 ? 90  GLU D OE2  1  
ATOM   10197  H H    . GLU D 1 90  ? -124.374 -33.557 -120.733 1.00 0.00 ? 90  GLU D H    1  
ATOM   10198  H HA   . GLU D 1 90  ? -123.550 -34.007 -118.066 1.00 0.00 ? 90  GLU D HA   1  
ATOM   10199  H HB2  . GLU D 1 90  ? -124.011 -31.788 -119.186 1.00 0.00 ? 90  GLU D HB2  1  
ATOM   10200  H HB3  . GLU D 1 90  ? -125.710 -32.110 -118.927 1.00 0.00 ? 90  GLU D HB3  1  
ATOM   10201  H HG2  . GLU D 1 90  ? -125.256 -30.846 -117.090 1.00 0.00 ? 90  GLU D HG2  1  
ATOM   10202  H HG3  . GLU D 1 90  ? -124.915 -32.443 -116.435 1.00 0.00 ? 90  GLU D HG3  1  
ATOM   10203  N N    . HIS D 1 91  ? -126.523 -35.027 -118.869 1.00 0.00 ? 91  HIS D N    1  
ATOM   10204  C CA   . HIS D 1 91  ? -127.640 -35.862 -118.433 1.00 0.00 ? 91  HIS D CA   1  
ATOM   10205  C C    . HIS D 1 91  ? -127.109 -37.232 -118.038 1.00 0.00 ? 91  HIS D C    1  
ATOM   10206  O O    . HIS D 1 91  ? -127.426 -37.748 -116.971 1.00 0.00 ? 91  HIS D O    1  
ATOM   10207  C CB   . HIS D 1 91  ? -128.656 -35.997 -119.580 1.00 0.00 ? 91  HIS D CB   1  
ATOM   10208  C CG   . HIS D 1 91  ? -128.822 -37.416 -120.040 1.00 0.00 ? 91  HIS D CG   1  
ATOM   10209  N ND1  . HIS D 1 91  ? -128.117 -37.920 -121.128 1.00 0.00 ? 91  HIS D ND1  1  
ATOM   10210  C CD2  . HIS D 1 91  ? -129.596 -38.423 -119.595 1.00 0.00 ? 91  HIS D CD2  1  
ATOM   10211  C CE1  . HIS D 1 91  ? -128.483 -39.182 -121.295 1.00 0.00 ? 91  HIS D CE1  1  
ATOM   10212  N NE2  . HIS D 1 91  ? -129.383 -39.542 -120.388 1.00 0.00 ? 91  HIS D NE2  1  
ATOM   10213  H H    . HIS D 1 91  ? -126.430 -34.819 -119.815 1.00 0.00 ? 91  HIS D H    1  
ATOM   10214  H HA   . HIS D 1 91  ? -128.134 -35.408 -117.585 1.00 0.00 ? 91  HIS D HA   1  
ATOM   10215  H HB2  . HIS D 1 91  ? -129.610 -35.646 -119.244 1.00 0.00 ? 91  HIS D HB2  1  
ATOM   10216  H HB3  . HIS D 1 91  ? -128.326 -35.406 -120.406 1.00 0.00 ? 91  HIS D HB3  1  
ATOM   10217  H HD1  . HIS D 1 91  ? -127.482 -37.434 -121.665 1.00 0.00 ? 91  HIS D HD1  1  
ATOM   10218  H HD2  . HIS D 1 91  ? -130.283 -38.375 -118.752 1.00 0.00 ? 91  HIS D HD2  1  
ATOM   10219  H HE1  . HIS D 1 91  ? -128.095 -39.843 -122.071 1.00 0.00 ? 91  HIS D HE1  1  
ATOM   10220  H HE2  . HIS D 1 91  ? -129.801 -40.394 -120.297 1.00 0.00 ? 91  HIS D HE2  1  
ATOM   10221  N N    . THR D 1 92  ? -126.279 -37.802 -118.920 1.00 0.00 ? 92  THR D N    1  
ATOM   10222  C CA   . THR D 1 92  ? -125.694 -39.118 -118.668 1.00 0.00 ? 92  THR D CA   1  
ATOM   10223  C C    . THR D 1 92  ? -124.702 -39.010 -117.502 1.00 0.00 ? 92  THR D C    1  
ATOM   10224  O O    . THR D 1 92  ? -124.535 -39.967 -116.744 1.00 0.00 ? 92  THR D O    1  
ATOM   10225  C CB   . THR D 1 92  ? -125.019 -39.705 -119.950 1.00 0.00 ? 92  THR D CB   1  
ATOM   10226  O OG1  . THR D 1 92  ? -125.516 -39.050 -121.115 1.00 0.00 ? 92  THR D OG1  1  
ATOM   10227  C CG2  . THR D 1 92  ? -125.318 -41.209 -120.073 1.00 0.00 ? 92  THR D CG2  1  
ATOM   10228  H H    . THR D 1 92  ? -126.054 -37.324 -119.738 1.00 0.00 ? 92  THR D H    1  
ATOM   10229  H HA   . THR D 1 92  ? -126.486 -39.782 -118.363 1.00 0.00 ? 92  THR D HA   1  
ATOM   10230  H HB   . THR D 1 92  ? -123.951 -39.573 -119.891 1.00 0.00 ? 92  THR D HB   1  
ATOM   10231  H HG1  . THR D 1 92  ? -125.939 -39.707 -121.678 1.00 0.00 ? 92  THR D HG1  1  
ATOM   10232  H HG21 . THR D 1 92  ? -124.665 -41.644 -120.816 1.00 0.00 ? 92  THR D HG21 1  
ATOM   10233  H HG22 . THR D 1 92  ? -126.346 -41.346 -120.372 1.00 0.00 ? 92  THR D HG22 1  
ATOM   10234  H HG23 . THR D 1 92  ? -125.150 -41.688 -119.121 1.00 0.00 ? 92  THR D HG23 1  
ATOM   10235  N N    . MET D 1 93  ? -124.111 -37.810 -117.320 1.00 0.00 ? 93  MET D N    1  
ATOM   10236  C CA   . MET D 1 93  ? -123.175 -37.579 -116.206 1.00 0.00 ? 93  MET D CA   1  
ATOM   10237  C C    . MET D 1 93  ? -123.942 -37.746 -114.865 1.00 0.00 ? 93  MET D C    1  
ATOM   10238  O O    . MET D 1 93  ? -123.457 -38.428 -113.984 1.00 0.00 ? 93  MET D O    1  
ATOM   10239  C CB   . MET D 1 93  ? -122.594 -36.110 -116.277 1.00 0.00 ? 93  MET D CB   1  
ATOM   10240  C CG   . MET D 1 93  ? -121.414 -35.891 -115.252 1.00 0.00 ? 93  MET D CG   1  
ATOM   10241  S SD   . MET D 1 93  ? -120.562 -34.292 -115.510 1.00 0.00 ? 93  MET D SD   1  
ATOM   10242  C CE   . MET D 1 93  ? -120.850 -33.529 -113.890 1.00 0.00 ? 93  MET D CE   1  
ATOM   10243  H H    . MET D 1 93  ? -124.338 -37.076 -117.921 1.00 0.00 ? 93  MET D H    1  
ATOM   10244  H HA   . MET D 1 93  ? -122.381 -38.278 -116.236 1.00 0.00 ? 93  MET D HA   1  
ATOM   10245  H HB2  . MET D 1 93  ? -122.233 -35.964 -117.252 1.00 0.00 ? 93  MET D HB2  1  
ATOM   10246  H HB3  . MET D 1 93  ? -123.380 -35.437 -116.042 1.00 0.00 ? 93  MET D HB3  1  
ATOM   10247  H HG2  . MET D 1 93  ? -121.813 -35.904 -114.274 1.00 0.00 ? 93  MET D HG2  1  
ATOM   10248  H HG3  . MET D 1 93  ? -120.709 -36.680 -115.383 1.00 0.00 ? 93  MET D HG3  1  
ATOM   10249  H HE1  . MET D 1 93  ? -120.201 -32.668 -113.785 1.00 0.00 ? 93  MET D HE1  1  
ATOM   10250  H HE2  . MET D 1 93  ? -120.634 -34.236 -113.109 1.00 0.00 ? 93  MET D HE2  1  
ATOM   10251  H HE3  . MET D 1 93  ? -121.881 -33.218 -113.824 1.00 0.00 ? 93  MET D HE3  1  
ATOM   10252  N N    . LEU D 1 94  ? -125.111 -37.118 -114.787 1.00 0.00 ? 94  LEU D N    1  
ATOM   10253  C CA   . LEU D 1 94  ? -125.968 -37.211 -113.589 1.00 0.00 ? 94  LEU D CA   1  
ATOM   10254  C C    . LEU D 1 94  ? -126.472 -38.627 -113.365 1.00 0.00 ? 94  LEU D C    1  
ATOM   10255  O O    . LEU D 1 94  ? -126.429 -39.124 -112.247 1.00 0.00 ? 94  LEU D O    1  
ATOM   10256  C CB   . LEU D 1 94  ? -127.155 -36.257 -113.779 1.00 0.00 ? 94  LEU D CB   1  
ATOM   10257  C CG   . LEU D 1 94  ? -128.191 -36.252 -112.636 1.00 0.00 ? 94  LEU D CG   1  
ATOM   10258  C CD1  . LEU D 1 94  ? -129.052 -34.988 -112.795 1.00 0.00 ? 94  LEU D CD1  1  
ATOM   10259  C CD2  . LEU D 1 94  ? -129.089 -37.498 -112.660 1.00 0.00 ? 94  LEU D CD2  1  
ATOM   10260  H H    . LEU D 1 94  ? -125.414 -36.580 -115.546 1.00 0.00 ? 94  LEU D H    1  
ATOM   10261  H HA   . LEU D 1 94  ? -125.394 -36.904 -112.744 1.00 0.00 ? 94  LEU D HA   1  
ATOM   10262  H HB2  . LEU D 1 94  ? -126.760 -35.267 -113.848 1.00 0.00 ? 94  LEU D HB2  1  
ATOM   10263  H HB3  . LEU D 1 94  ? -127.644 -36.509 -114.691 1.00 0.00 ? 94  LEU D HB3  1  
ATOM   10264  H HG   . LEU D 1 94  ? -127.688 -36.195 -111.700 1.00 0.00 ? 94  LEU D HG   1  
ATOM   10265  H HD11 . LEU D 1 94  ? -128.462 -34.129 -112.508 1.00 0.00 ? 94  LEU D HD11 1  
ATOM   10266  H HD12 . LEU D 1 94  ? -129.918 -35.062 -112.159 1.00 0.00 ? 94  LEU D HD12 1  
ATOM   10267  H HD13 . LEU D 1 94  ? -129.363 -34.882 -113.824 1.00 0.00 ? 94  LEU D HD13 1  
ATOM   10268  H HD21 . LEU D 1 94  ? -129.154 -37.892 -113.658 1.00 0.00 ? 94  LEU D HD21 1  
ATOM   10269  H HD22 . LEU D 1 94  ? -130.080 -37.240 -112.306 1.00 0.00 ? 94  LEU D HD22 1  
ATOM   10270  H HD23 . LEU D 1 94  ? -128.662 -38.242 -112.001 1.00 0.00 ? 94  LEU D HD23 1  
ATOM   10271  N N    . GLN D 1 95  ? -126.942 -39.272 -114.424 1.00 0.00 ? 95  GLN D N    1  
ATOM   10272  C CA   . GLN D 1 95  ? -127.449 -40.638 -114.308 1.00 0.00 ? 95  GLN D CA   1  
ATOM   10273  C C    . GLN D 1 95  ? -126.386 -41.567 -113.746 1.00 0.00 ? 95  GLN D C    1  
ATOM   10274  O O    . GLN D 1 95  ? -126.722 -42.523 -113.051 1.00 0.00 ? 95  GLN D O    1  
ATOM   10275  C CB   . GLN D 1 95  ? -127.982 -41.115 -115.678 1.00 0.00 ? 95  GLN D CB   1  
ATOM   10276  C CG   . GLN D 1 95  ? -127.611 -42.590 -115.991 1.00 0.00 ? 95  GLN D CG   1  
ATOM   10277  C CD   . GLN D 1 95  ? -128.223 -43.084 -117.314 1.00 0.00 ? 95  GLN D CD   1  
ATOM   10278  O OE1  . GLN D 1 95  ? -129.091 -43.986 -117.316 1.00 0.00 ? 95  GLN D OE1  1  
ATOM   10279  N NE2  . GLN D 1 95  ? -127.794 -42.545 -118.436 1.00 0.00 ? 95  GLN D NE2  1  
ATOM   10280  H H    . GLN D 1 95  ? -126.963 -38.821 -115.292 1.00 0.00 ? 95  GLN D H    1  
ATOM   10281  H HA   . GLN D 1 95  ? -128.265 -40.625 -113.613 1.00 0.00 ? 95  GLN D HA   1  
ATOM   10282  H HB2  . GLN D 1 95  ? -129.050 -41.027 -115.661 1.00 0.00 ? 95  GLN D HB2  1  
ATOM   10283  H HB3  . GLN D 1 95  ? -127.580 -40.477 -116.437 1.00 0.00 ? 95  GLN D HB3  1  
ATOM   10284  H HG2  . GLN D 1 95  ? -126.544 -42.659 -116.080 1.00 0.00 ? 95  GLN D HG2  1  
ATOM   10285  H HG3  . GLN D 1 95  ? -127.946 -43.212 -115.189 1.00 0.00 ? 95  GLN D HG3  1  
ATOM   10286  H HE21 . GLN D 1 95  ? -127.107 -41.836 -118.398 1.00 0.00 ? 95  GLN D HE21 1  
ATOM   10287  H HE22 . GLN D 1 95  ? -128.139 -42.835 -119.304 1.00 0.00 ? 95  GLN D HE22 1  
ATOM   10288  N N    . LEU D 1 96  ? -125.120 -41.329 -114.097 1.00 0.00 ? 96  LEU D N    1  
ATOM   10289  C CA   . LEU D 1 96  ? -124.035 -42.197 -113.626 1.00 0.00 ? 96  LEU D CA   1  
ATOM   10290  C C    . LEU D 1 96  ? -123.336 -41.660 -112.357 1.00 0.00 ? 96  LEU D C    1  
ATOM   10291  O O    . LEU D 1 96  ? -123.111 -42.419 -111.410 1.00 0.00 ? 96  LEU D O    1  
ATOM   10292  C CB   . LEU D 1 96  ? -122.974 -42.430 -114.732 1.00 0.00 ? 96  LEU D CB   1  
ATOM   10293  C CG   . LEU D 1 96  ? -123.465 -43.233 -115.976 1.00 0.00 ? 96  LEU D CG   1  
ATOM   10294  C CD1  . LEU D 1 96  ? -122.263 -43.516 -116.899 1.00 0.00 ? 96  LEU D CD1  1  
ATOM   10295  C CD2  . LEU D 1 96  ? -124.144 -44.556 -115.603 1.00 0.00 ? 96  LEU D CD2  1  
ATOM   10296  H H    . LEU D 1 96  ? -124.925 -40.583 -114.694 1.00 0.00 ? 96  LEU D H    1  
ATOM   10297  H HA   . LEU D 1 96  ? -124.458 -43.132 -113.360 1.00 0.00 ? 96  LEU D HA   1  
ATOM   10298  H HB2  . LEU D 1 96  ? -122.648 -41.480 -115.089 1.00 0.00 ? 96  LEU D HB2  1  
ATOM   10299  H HB3  . LEU D 1 96  ? -122.152 -42.947 -114.291 1.00 0.00 ? 96  LEU D HB3  1  
ATOM   10300  H HG   . LEU D 1 96  ? -124.150 -42.626 -116.521 1.00 0.00 ? 96  LEU D HG   1  
ATOM   10301  H HD11 . LEU D 1 96  ? -121.490 -44.033 -116.355 1.00 0.00 ? 96  LEU D HD11 1  
ATOM   10302  H HD12 . LEU D 1 96  ? -121.875 -42.579 -117.275 1.00 0.00 ? 96  LEU D HD12 1  
ATOM   10303  H HD13 . LEU D 1 96  ? -122.591 -44.125 -117.730 1.00 0.00 ? 96  LEU D HD13 1  
ATOM   10304  H HD21 . LEU D 1 96  ? -123.579 -45.069 -114.845 1.00 0.00 ? 96  LEU D HD21 1  
ATOM   10305  H HD22 . LEU D 1 96  ? -124.217 -45.184 -116.485 1.00 0.00 ? 96  LEU D HD22 1  
ATOM   10306  H HD23 . LEU D 1 96  ? -125.139 -44.345 -115.238 1.00 0.00 ? 96  LEU D HD23 1  
ATOM   10307  N N    . TYR D 1 97  ? -122.978 -40.383 -112.348 1.00 0.00 ? 97  TYR D N    1  
ATOM   10308  C CA   . TYR D 1 97  ? -122.310 -39.796 -111.186 1.00 0.00 ? 97  TYR D CA   1  
ATOM   10309  C C    . TYR D 1 97  ? -123.117 -38.611 -110.653 1.00 0.00 ? 97  TYR D C    1  
ATOM   10310  O O    . TYR D 1 97  ? -122.691 -37.449 -110.803 1.00 0.00 ? 97  TYR D O    1  
ATOM   10311  C CB   . TYR D 1 97  ? -120.887 -39.322 -111.558 1.00 0.00 ? 97  TYR D CB   1  
ATOM   10312  C CG   . TYR D 1 97  ? -120.152 -40.311 -112.454 1.00 0.00 ? 97  TYR D CG   1  
ATOM   10313  C CD1  . TYR D 1 97  ? -119.851 -41.584 -111.994 1.00 0.00 ? 97  TYR D CD1  1  
ATOM   10314  C CD2  . TYR D 1 97  ? -119.763 -39.934 -113.739 1.00 0.00 ? 97  TYR D CD2  1  
ATOM   10315  C CE1  . TYR D 1 97  ? -119.170 -42.482 -112.811 1.00 0.00 ? 97  TYR D CE1  1  
ATOM   10316  C CE2  . TYR D 1 97  ? -119.081 -40.836 -114.554 1.00 0.00 ? 97  TYR D CE2  1  
ATOM   10317  C CZ   . TYR D 1 97  ? -118.789 -42.112 -114.086 1.00 0.00 ? 97  TYR D CZ   1  
ATOM   10318  O OH   . TYR D 1 97  ? -118.120 -43.008 -114.877 1.00 0.00 ? 97  TYR D OH   1  
ATOM   10319  H H    . TYR D 1 97  ? -123.160 -39.832 -113.134 1.00 0.00 ? 97  TYR D H    1  
ATOM   10320  H HA   . TYR D 1 97  ? -122.242 -40.526 -110.407 1.00 0.00 ? 97  TYR D HA   1  
ATOM   10321  H HB2  . TYR D 1 97  ? -120.952 -38.384 -112.071 1.00 0.00 ? 97  TYR D HB2  1  
ATOM   10322  H HB3  . TYR D 1 97  ? -120.326 -39.195 -110.650 1.00 0.00 ? 97  TYR D HB3  1  
ATOM   10323  H HD1  . TYR D 1 97  ? -120.143 -41.880 -111.009 1.00 0.00 ? 97  TYR D HD1  1  
ATOM   10324  H HD2  . TYR D 1 97  ? -119.982 -38.950 -114.102 1.00 0.00 ? 97  TYR D HD2  1  
ATOM   10325  H HE1  . TYR D 1 97  ? -118.940 -43.472 -112.449 1.00 0.00 ? 97  TYR D HE1  1  
ATOM   10326  H HE2  . TYR D 1 97  ? -118.787 -40.545 -115.551 1.00 0.00 ? 97  TYR D HE2  1  
ATOM   10327  H HH   . TYR D 1 97  ? -117.263 -43.171 -114.475 1.00 0.00 ? 97  TYR D HH   1  
ATOM   10328  N N    . PRO D 1 98  ? -124.254 -38.838 -110.012 1.00 0.00 ? 98  PRO D N    1  
ATOM   10329  C CA   . PRO D 1 98  ? -125.078 -37.720 -109.552 1.00 0.00 ? 98  PRO D CA   1  
ATOM   10330  C C    . PRO D 1 98  ? -124.488 -37.106 -108.292 1.00 0.00 ? 98  PRO D C    1  
ATOM   10331  O O    . PRO D 1 98  ? -123.331 -37.350 -107.956 1.00 0.00 ? 98  PRO D O    1  
ATOM   10332  C CB   . PRO D 1 98  ? -126.452 -38.331 -109.309 1.00 0.00 ? 98  PRO D CB   1  
ATOM   10333  C CG   . PRO D 1 98  ? -126.185 -39.750 -108.936 1.00 0.00 ? 98  PRO D CG   1  
ATOM   10334  C CD   . PRO D 1 98  ? -124.832 -40.140 -109.573 1.00 0.00 ? 98  PRO D CD   1  
ATOM   10335  H HA   . PRO D 1 98  ? -125.144 -36.976 -110.339 1.00 0.00 ? 98  PRO D HA   1  
ATOM   10336  H HB2  . PRO D 1 98  ? -126.951 -37.811 -108.501 1.00 0.00 ? 98  PRO D HB2  1  
ATOM   10337  H HB3  . PRO D 1 98  ? -127.053 -38.291 -110.204 1.00 0.00 ? 98  PRO D HB3  1  
ATOM   10338  H HG2  . PRO D 1 98  ? -126.138 -39.836 -107.856 1.00 0.00 ? 98  PRO D HG2  1  
ATOM   10339  H HG3  . PRO D 1 98  ? -126.967 -40.384 -109.323 1.00 0.00 ? 98  PRO D HG3  1  
ATOM   10340  H HD2  . PRO D 1 98  ? -124.186 -40.595 -108.818 1.00 0.00 ? 98  PRO D HD2  1  
ATOM   10341  H HD3  . PRO D 1 98  ? -124.970 -40.807 -110.401 1.00 0.00 ? 98  PRO D HD3  1  
ATOM   10342  N N    . SER D 1 99  ? -125.294 -36.302 -107.601 1.00 0.00 ? 99  SER D N    1  
ATOM   10343  C CA   . SER D 1 99  ? -124.856 -35.637 -106.376 1.00 0.00 ? 99  SER D CA   1  
ATOM   10344  C C    . SER D 1 99  ? -125.713 -36.073 -105.200 1.00 0.00 ? 99  SER D C    1  
ATOM   10345  O O    . SER D 1 99  ? -126.515 -37.011 -105.333 1.00 0.00 ? 99  SER D O    1  
ATOM   10346  C CB   . SER D 1 99  ? -124.970 -34.121 -106.553 1.00 0.00 ? 99  SER D CB   1  
ATOM   10347  O OG   . SER D 1 99  ? -126.132 -33.628 -105.888 1.00 0.00 ? 99  SER D OG   1  
ATOM   10348  H H    . SER D 1 99  ? -126.202 -36.147 -107.925 1.00 0.00 ? 99  SER D H    1  
ATOM   10349  H HA   . SER D 1 99  ? -123.825 -35.890 -106.181 1.00 0.00 ? 99  SER D HA   1  
ATOM   10350  H HB2  . SER D 1 99  ? -124.102 -33.646 -106.135 1.00 0.00 ? 99  SER D HB2  1  
ATOM   10351  H HB3  . SER D 1 99  ? -125.028 -33.889 -107.603 1.00 0.00 ? 99  SER D HB3  1  
ATOM   10352  H HG   . SER D 1 99  ? -126.901 -33.984 -106.329 1.00 0.00 ? 99  SER D HG   1  
ATOM   10353  N N    . PRO D 1 100 ? -125.563 -35.443 -104.040 1.00 0.00 ? 100 PRO D N    1  
ATOM   10354  C CA   . PRO D 1 100 ? -126.371 -35.781 -102.867 1.00 0.00 ? 100 PRO D CA   1  
ATOM   10355  C C    . PRO D 1 100 ? -127.689 -35.018 -102.808 1.00 0.00 ? 100 PRO D C    1  
ATOM   10356  O O    . PRO D 1 100 ? -128.366 -35.064 -101.787 1.00 0.00 ? 100 PRO D O    1  
ATOM   10357  C CB   . PRO D 1 100 ? -125.471 -35.413 -101.698 1.00 0.00 ? 100 PRO D CB   1  
ATOM   10358  C CG   . PRO D 1 100 ? -124.683 -34.254 -102.182 1.00 0.00 ? 100 PRO D CG   1  
ATOM   10359  C CD   . PRO D 1 100 ? -124.579 -34.390 -103.696 1.00 0.00 ? 100 PRO D CD   1  
ATOM   10360  H HA   . PRO D 1 100 ? -126.560 -36.844 -102.862 1.00 0.00 ? 100 PRO D HA   1  
ATOM   10361  H HB2  . PRO D 1 100 ? -126.065 -35.134 -100.839 1.00 0.00 ? 100 PRO D HB2  1  
ATOM   10362  H HB3  . PRO D 1 100 ? -124.809 -36.225 -101.453 1.00 0.00 ? 100 PRO D HB3  1  
ATOM   10363  H HG2  . PRO D 1 100 ? -125.201 -33.332 -101.936 1.00 0.00 ? 100 PRO D HG2  1  
ATOM   10364  H HG3  . PRO D 1 100 ? -123.700 -34.261 -101.744 1.00 0.00 ? 100 PRO D HG3  1  
ATOM   10365  H HD2  . PRO D 1 100 ? -124.812 -33.444 -104.138 1.00 0.00 ? 100 PRO D HD2  1  
ATOM   10366  H HD3  . PRO D 1 100 ? -123.583 -34.720 -103.984 1.00 0.00 ? 100 PRO D HD3  1  
ATOM   10367  N N    . PHE D 1 101 ? -128.000 -34.263 -103.857 1.00 0.00 ? 101 PHE D N    1  
ATOM   10368  C CA   . PHE D 1 101 ? -129.220 -33.445 -103.879 1.00 0.00 ? 101 PHE D CA   1  
ATOM   10369  C C    . PHE D 1 101 ? -130.523 -34.225 -103.629 1.00 0.00 ? 101 PHE D C    1  
ATOM   10370  O O    . PHE D 1 101 ? -131.353 -34.355 -104.526 1.00 0.00 ? 101 PHE D O    1  
ATOM   10371  C CB   . PHE D 1 101 ? -129.275 -32.685 -105.213 1.00 0.00 ? 101 PHE D CB   1  
ATOM   10372  C CG   . PHE D 1 101 ? -130.647 -32.105 -105.495 1.00 0.00 ? 101 PHE D CG   1  
ATOM   10373  C CD1  . PHE D 1 101 ? -131.434 -31.619 -104.463 1.00 0.00 ? 101 PHE D CD1  1  
ATOM   10374  C CD2  . PHE D 1 101 ? -131.115 -32.047 -106.804 1.00 0.00 ? 101 PHE D CD2  1  
ATOM   10375  C CE1  . PHE D 1 101 ? -132.691 -31.081 -104.735 1.00 0.00 ? 101 PHE D CE1  1  
ATOM   10376  C CE2  . PHE D 1 101 ? -132.373 -31.505 -107.074 1.00 0.00 ? 101 PHE D CE2  1  
ATOM   10377  C CZ   . PHE D 1 101 ? -133.160 -31.022 -106.040 1.00 0.00 ? 101 PHE D CZ   1  
ATOM   10378  H H    . PHE D 1 101 ? -127.380 -34.218 -104.614 1.00 0.00 ? 101 PHE D H    1  
ATOM   10379  H HA   . PHE D 1 101 ? -129.116 -32.731 -103.096 1.00 0.00 ? 101 PHE D HA   1  
ATOM   10380  H HB2  . PHE D 1 101 ? -128.570 -31.871 -105.165 1.00 0.00 ? 101 PHE D HB2  1  
ATOM   10381  H HB3  . PHE D 1 101 ? -128.998 -33.347 -106.011 1.00 0.00 ? 101 PHE D HB3  1  
ATOM   10382  H HD1  . PHE D 1 101 ? -131.079 -31.655 -103.453 1.00 0.00 ? 101 PHE D HD1  1  
ATOM   10383  H HD2  . PHE D 1 101 ? -130.512 -32.423 -107.608 1.00 0.00 ? 101 PHE D HD2  1  
ATOM   10384  H HE1  . PHE D 1 101 ? -133.298 -30.706 -103.928 1.00 0.00 ? 101 PHE D HE1  1  
ATOM   10385  H HE2  . PHE D 1 101 ? -132.731 -31.457 -108.089 1.00 0.00 ? 101 PHE D HE2  1  
ATOM   10386  H HZ   . PHE D 1 101 ? -134.132 -30.607 -106.248 1.00 0.00 ? 101 PHE D HZ   1  
ATOM   10387  N N    . ALA D 1 102 ? -130.661 -34.742 -102.393 1.00 0.00 ? 102 ALA D N    1  
ATOM   10388  C CA   . ALA D 1 102 ? -131.832 -35.538 -101.963 1.00 0.00 ? 102 ALA D CA   1  
ATOM   10389  C C    . ALA D 1 102 ? -132.978 -35.536 -102.987 1.00 0.00 ? 102 ALA D C    1  
ATOM   10390  O O    . ALA D 1 102 ? -133.830 -34.652 -102.992 1.00 0.00 ? 102 ALA D O    1  
ATOM   10391  C CB   . ALA D 1 102 ? -132.339 -35.098 -100.566 1.00 0.00 ? 102 ALA D CB   1  
ATOM   10392  H H    . ALA D 1 102 ? -129.938 -34.603 -101.754 1.00 0.00 ? 102 ALA D H    1  
ATOM   10393  H HA   . ALA D 1 102 ? -131.491 -36.551 -101.874 1.00 0.00 ? 102 ALA D HA   1  
ATOM   10394  H HB1  . ALA D 1 102 ? -132.911 -35.907 -100.122 1.00 0.00 ? 102 ALA D HB1  1  
ATOM   10395  H HB2  . ALA D 1 102 ? -132.963 -34.226 -100.653 1.00 0.00 ? 102 ALA D HB2  1  
ATOM   10396  H HB3  . ALA D 1 102 ? -131.493 -34.875 -99.929  1.00 0.00 ? 102 ALA D HB3  1  
ATOM   10397  N N    . THR D 1 103 ? -132.963 -36.527 -103.881 1.00 0.00 ? 103 THR D N    1  
ATOM   10398  C CA   . THR D 1 103 ? -133.986 -36.584 -104.908 1.00 0.00 ? 103 THR D CA   1  
ATOM   10399  C C    . THR D 1 103 ? -134.428 -38.170 -105.182 1.00 0.00 ? 103 THR D C    1  
ATOM   10400  O O    . THR D 1 103 ? -133.636 -39.038 -104.921 1.00 0.00 ? 103 THR D O    1  
ATOM   10401  C CB   . THR D 1 103 ? -133.535 -35.976 -106.250 1.00 0.00 ? 103 THR D CB   1  
ATOM   10402  O OG1  . THR D 1 103 ? -132.137 -36.179 -106.442 1.00 0.00 ? 103 THR D OG1  1  
ATOM   10403  C CG2  . THR D 1 103 ? -133.846 -34.475 -106.238 1.00 0.00 ? 103 THR D CG2  1  
ATOM   10404  H H    . THR D 1 103 ? -132.255 -37.207 -103.841 1.00 0.00 ? 103 THR D H    1  
ATOM   10405  H HA   . THR D 1 103 ? -134.867 -36.120 -104.573 1.00 0.00 ? 103 THR D HA   1  
ATOM   10406  H HB   . THR D 1 103 ? -134.075 -36.437 -107.072 1.00 0.00 ? 103 THR D HB   1  
ATOM   10407  H HG1  . THR D 1 103 ? -131.938 -37.102 -106.269 1.00 0.00 ? 103 THR D HG1  1  
ATOM   10408  H HG21 . THR D 1 103 ? -134.862 -34.310 -106.569 1.00 0.00 ? 103 THR D HG21 1  
ATOM   10409  H HG22 . THR D 1 103 ? -133.165 -33.964 -106.899 1.00 0.00 ? 103 THR D HG22 1  
ATOM   10410  H HG23 . THR D 1 103 ? -133.730 -34.092 -105.235 1.00 0.00 ? 103 THR D HG23 1  
ATOM   10411  N N    . CYS D 1 104 ? -135.650 -38.298 -105.673 1.00 0.00 ? 104 CYS D N    1  
ATOM   10412  C CA   . CYS D 1 104 ? -136.174 -39.613 -105.966 1.00 0.00 ? 104 CYS D CA   1  
ATOM   10413  C C    . CYS D 1 104 ? -136.464 -39.813 -107.553 1.00 0.00 ? 104 CYS D C    1  
ATOM   10414  O O    . CYS D 1 104 ? -136.458 -38.848 -108.285 1.00 0.00 ? 104 CYS D O    1  
ATOM   10415  C CB   . CYS D 1 104 ? -137.559 -39.845 -105.132 1.00 0.00 ? 104 CYS D CB   1  
ATOM   10416  S SG   . CYS D 1 104 ? -138.765 -40.947 -105.924 1.00 0.00 ? 104 CYS D SG   1  
ATOM   10417  H H    . CYS D 1 104 ? -136.200 -37.494 -105.827 1.00 0.00 ? 104 CYS D H    1  
ATOM   10418  H HA   . CYS D 1 104 ? -135.498 -40.358 -105.673 1.00 0.00 ? 104 CYS D HA   1  
ATOM   10419  H HB2  . CYS D 1 104 ? -137.246 -40.268 -104.217 1.00 0.00 ? 104 CYS D HB2  1  
ATOM   10420  H HB3  . CYS D 1 104 ? -137.976 -38.882 -104.987 1.00 0.00 ? 104 CYS D HB3  1  
ATOM   10421  N N    . ASP D 1 105 ? -136.610 -41.072 -107.924 1.00 0.00 ? 105 ASP D N    1  
ATOM   10422  C CA   . ASP D 1 105 ? -136.779 -41.411 -109.339 1.00 0.00 ? 105 ASP D CA   1  
ATOM   10423  C C    . ASP D 1 105 ? -137.756 -40.517 -110.115 1.00 0.00 ? 105 ASP D C    1  
ATOM   10424  O O    . ASP D 1 105 ? -138.965 -40.588 -109.932 1.00 0.00 ? 105 ASP D O    1  
ATOM   10425  C CB   . ASP D 1 105 ? -137.195 -42.927 -109.493 1.00 0.00 ? 105 ASP D CB   1  
ATOM   10426  C CG   . ASP D 1 105 ? -138.558 -43.227 -108.864 1.00 0.00 ? 105 ASP D CG   1  
ATOM   10427  O OD1  . ASP D 1 105 ? -138.727 -42.961 -107.672 1.00 0.00 ? 105 ASP D OD1  1  
ATOM   10428  O OD2  . ASP D 1 105 ? -139.412 -43.752 -109.587 1.00 0.00 ? 105 ASP D OD2  1  
ATOM   10429  H H    . ASP D 1 105 ? -136.544 -41.791 -107.254 1.00 0.00 ? 105 ASP D H    1  
ATOM   10430  H HA   . ASP D 1 105 ? -135.820 -41.321 -109.798 1.00 0.00 ? 105 ASP D HA   1  
ATOM   10431  H HB2  . ASP D 1 105 ? -137.229 -43.154 -110.540 1.00 0.00 ? 105 ASP D HB2  1  
ATOM   10432  H HB3  . ASP D 1 105 ? -136.438 -43.524 -109.018 1.00 0.00 ? 105 ASP D HB3  1  
ATOM   10433  N N    . PHE D 1 106 ? -137.171 -39.663 -110.985 1.00 0.00 ? 106 PHE D N    1  
ATOM   10434  C CA   . PHE D 1 106 ? -137.932 -38.706 -111.824 1.00 0.00 ? 106 PHE D CA   1  
ATOM   10435  C C    . PHE D 1 106 ? -137.679 -37.245 -111.388 1.00 0.00 ? 106 PHE D C    1  
ATOM   10436  O O    . PHE D 1 106 ? -136.791 -36.589 -111.930 1.00 0.00 ? 106 PHE D O    1  
ATOM   10437  C CB   . PHE D 1 106 ? -139.444 -39.020 -111.775 1.00 0.00 ? 106 PHE D CB   1  
ATOM   10438  C CG   . PHE D 1 106 ? -140.280 -38.077 -112.624 1.00 0.00 ? 106 PHE D CG   1  
ATOM   10439  C CD1  . PHE D 1 106 ? -140.426 -38.304 -113.990 1.00 0.00 ? 106 PHE D CD1  1  
ATOM   10440  C CD2  . PHE D 1 106 ? -140.930 -36.991 -112.032 1.00 0.00 ? 106 PHE D CD2  1  
ATOM   10441  C CE1  . PHE D 1 106 ? -141.214 -37.445 -114.767 1.00 0.00 ? 106 PHE D CE1  1  
ATOM   10442  C CE2  . PHE D 1 106 ? -141.719 -36.131 -112.809 1.00 0.00 ? 106 PHE D CE2  1  
ATOM   10443  C CZ   . PHE D 1 106 ? -141.859 -36.357 -114.177 1.00 0.00 ? 106 PHE D CZ   1  
ATOM   10444  H H    . PHE D 1 106 ? -136.198 -39.671 -111.053 1.00 0.00 ? 106 PHE D H    1  
ATOM   10445  H HA   . PHE D 1 106 ? -137.590 -38.816 -112.847 1.00 0.00 ? 106 PHE D HA   1  
ATOM   10446  H HB2  . PHE D 1 106 ? -139.599 -40.023 -112.127 1.00 0.00 ? 106 PHE D HB2  1  
ATOM   10447  H HB3  . PHE D 1 106 ? -139.773 -38.945 -110.755 1.00 0.00 ? 106 PHE D HB3  1  
ATOM   10448  H HD1  . PHE D 1 106 ? -139.932 -39.140 -114.450 1.00 0.00 ? 106 PHE D HD1  1  
ATOM   10449  H HD2  . PHE D 1 106 ? -140.826 -36.814 -110.977 1.00 0.00 ? 106 PHE D HD2  1  
ATOM   10450  H HE1  . PHE D 1 106 ? -141.318 -37.624 -115.827 1.00 0.00 ? 106 PHE D HE1  1  
ATOM   10451  H HE2  . PHE D 1 106 ? -142.215 -35.289 -112.347 1.00 0.00 ? 106 PHE D HE2  1  
ATOM   10452  H HZ   . PHE D 1 106 ? -142.467 -35.696 -114.777 1.00 0.00 ? 106 PHE D HZ   1  
ATOM   10453  N N    . MET D 1 107 ? -138.440 -36.783 -110.365 1.00 0.00 ? 107 MET D N    1  
ATOM   10454  C CA   . MET D 1 107 ? -138.378 -35.394 -109.807 1.00 0.00 ? 107 MET D CA   1  
ATOM   10455  C C    . MET D 1 107 ? -137.155 -34.540 -110.260 1.00 0.00 ? 107 MET D C    1  
ATOM   10456  O O    . MET D 1 107 ? -137.279 -33.735 -111.197 1.00 0.00 ? 107 MET D O    1  
ATOM   10457  C CB   . MET D 1 107 ? -138.460 -35.398 -108.237 1.00 0.00 ? 107 MET D CB   1  
ATOM   10458  C CG   . MET D 1 107 ? -139.811 -35.945 -107.676 1.00 0.00 ? 107 MET D CG   1  
ATOM   10459  S SD   . MET D 1 107 ? -140.121 -35.281 -105.998 1.00 0.00 ? 107 MET D SD   1  
ATOM   10460  C CE   . MET D 1 107 ? -141.930 -35.386 -105.943 1.00 0.00 ? 107 MET D CE   1  
ATOM   10461  H H    . MET D 1 107 ? -139.081 -37.398 -109.967 1.00 0.00 ? 107 MET D H    1  
ATOM   10462  H HA   . MET D 1 107 ? -139.234 -34.875 -110.155 1.00 0.00 ? 107 MET D HA   1  
ATOM   10463  H HB2  . MET D 1 107 ? -137.672 -36.000 -107.850 1.00 0.00 ? 107 MET D HB2  1  
ATOM   10464  H HB3  . MET D 1 107 ? -138.338 -34.386 -107.902 1.00 0.00 ? 107 MET D HB3  1  
ATOM   10465  H HG2  . MET D 1 107 ? -140.613 -35.661 -108.314 1.00 0.00 ? 107 MET D HG2  1  
ATOM   10466  H HG3  . MET D 1 107 ? -139.749 -37.019 -107.612 1.00 0.00 ? 107 MET D HG3  1  
ATOM   10467  H HE1  . MET D 1 107 ? -142.250 -36.327 -106.358 1.00 0.00 ? 107 MET D HE1  1  
ATOM   10468  H HE2  . MET D 1 107 ? -142.353 -34.574 -106.510 1.00 0.00 ? 107 MET D HE2  1  
ATOM   10469  H HE3  . MET D 1 107 ? -142.255 -35.309 -104.912 1.00 0.00 ? 107 MET D HE3  1  
ATOM   10470  N N    . VAL D 1 108 ? -136.010 -34.717 -109.582 1.00 0.00 ? 108 VAL D N    1  
ATOM   10471  C CA   . VAL D 1 108 ? -134.770 -33.952 -109.861 1.00 0.00 ? 108 VAL D CA   1  
ATOM   10472  C C    . VAL D 1 108 ? -134.898 -33.081 -111.111 1.00 0.00 ? 108 VAL D C    1  
ATOM   10473  O O    . VAL D 1 108 ? -134.530 -31.908 -111.079 1.00 0.00 ? 108 VAL D O    1  
ATOM   10474  C CB   . VAL D 1 108 ? -133.519 -34.943 -109.990 1.00 0.00 ? 108 VAL D CB   1  
ATOM   10475  C CG1  . VAL D 1 108 ? -133.605 -35.785 -111.262 1.00 0.00 ? 108 VAL D CG1  1  
ATOM   10476  C CG2  . VAL D 1 108 ? -132.201 -34.149 -109.961 1.00 0.00 ? 108 VAL D CG2  1  
ATOM   10477  H H    . VAL D 1 108 ? -136.003 -35.371 -108.862 1.00 0.00 ? 108 VAL D H    1  
ATOM   10478  H HA   . VAL D 1 108 ? -134.586 -33.319 -109.018 1.00 0.00 ? 108 VAL D HA   1  
ATOM   10479  H HB   . VAL D 1 108 ? -133.534 -35.601 -109.151 1.00 0.00 ? 108 VAL D HB   1  
ATOM   10480  H HG11 . VAL D 1 108 ? -133.508 -35.159 -112.134 1.00 0.00 ? 108 VAL D HG11 1  
ATOM   10481  H HG12 . VAL D 1 108 ? -134.559 -36.293 -111.285 1.00 0.00 ? 108 VAL D HG12 1  
ATOM   10482  H HG13 . VAL D 1 108 ? -132.811 -36.520 -111.253 1.00 0.00 ? 108 VAL D HG13 1  
ATOM   10483  H HG21 . VAL D 1 108 ? -131.392 -34.796 -110.274 1.00 0.00 ? 108 VAL D HG21 1  
ATOM   10484  H HG22 . VAL D 1 108 ? -132.013 -33.811 -108.950 1.00 0.00 ? 108 VAL D HG22 1  
ATOM   10485  H HG23 . VAL D 1 108 ? -132.261 -33.300 -110.620 1.00 0.00 ? 108 VAL D HG23 1  
ATOM   10486  N N    . LEU D 1 114 ? -148.189 -9.575  -126.184 1.00 0.00 ? 114 LEU D N    1  
ATOM   10487  C CA   . LEU D 1 114 ? -146.793 -10.059 -126.093 1.00 0.00 ? 114 LEU D CA   1  
ATOM   10488  C C    . LEU D 1 114 ? -146.738 -11.605 -126.171 1.00 0.00 ? 114 LEU D C    1  
ATOM   10489  O O    . LEU D 1 114 ? -146.672 -12.290 -125.134 1.00 0.00 ? 114 LEU D O    1  
ATOM   10490  C CB   . LEU D 1 114 ? -146.158 -9.595  -124.765 1.00 0.00 ? 114 LEU D CB   1  
ATOM   10491  C CG   . LEU D 1 114 ? -145.605 -8.143  -124.719 1.00 0.00 ? 114 LEU D CG   1  
ATOM   10492  C CD1  . LEU D 1 114 ? -144.628 -7.853  -125.852 1.00 0.00 ? 114 LEU D CD1  1  
ATOM   10493  C CD2  . LEU D 1 114 ? -146.735 -7.120  -124.712 1.00 0.00 ? 114 LEU D CD2  1  
ATOM   10494  H H    . LEU D 1 114 ? -148.217 -8.802  -126.880 1.00 0.00 ? 114 LEU D H    1  
ATOM   10495  H HA   . LEU D 1 114 ? -146.249 -9.670  -126.911 1.00 0.00 ? 114 LEU D HA   1  
ATOM   10496  H HB2  . LEU D 1 114 ? -146.885 -9.677  -123.995 1.00 0.00 ? 114 LEU D HB2  1  
ATOM   10497  H HB3  . LEU D 1 114 ? -145.342 -10.257 -124.552 1.00 0.00 ? 114 LEU D HB3  1  
ATOM   10498  H HG   . LEU D 1 114 ? -145.065 -8.048  -123.787 1.00 0.00 ? 114 LEU D HG   1  
ATOM   10499  H HD11 . LEU D 1 114 ? -144.180 -8.772  -126.188 1.00 0.00 ? 114 LEU D HD11 1  
ATOM   10500  H HD12 . LEU D 1 114 ? -143.851 -7.191  -125.488 1.00 0.00 ? 114 LEU D HD12 1  
ATOM   10501  H HD13 . LEU D 1 114 ? -145.147 -7.381  -126.669 1.00 0.00 ? 114 LEU D HD13 1  
ATOM   10502  H HD21 . LEU D 1 114 ? -146.377 -6.204  -124.260 1.00 0.00 ? 114 LEU D HD21 1  
ATOM   10503  H HD22 . LEU D 1 114 ? -147.564 -7.502  -124.139 1.00 0.00 ? 114 LEU D HD22 1  
ATOM   10504  H HD23 . LEU D 1 114 ? -147.047 -6.925  -125.723 1.00 0.00 ? 114 LEU D HD23 1  
ATOM   10505  N N    . PRO D 1 115 ? -146.823 -12.147 -127.377 1.00 0.00 ? 115 PRO D N    1  
ATOM   10506  C CA   . PRO D 1 115 ? -146.712 -13.602 -127.615 1.00 0.00 ? 115 PRO D CA   1  
ATOM   10507  C C    . PRO D 1 115 ? -145.467 -14.248 -127.001 1.00 0.00 ? 115 PRO D C    1  
ATOM   10508  O O    . PRO D 1 115 ? -145.588 -15.056 -126.085 1.00 0.00 ? 115 PRO D O    1  
ATOM   10509  C CB   . PRO D 1 115 ? -146.664 -13.720 -129.172 1.00 0.00 ? 115 PRO D CB   1  
ATOM   10510  C CG   . PRO D 1 115 ? -147.469 -12.465 -129.655 1.00 0.00 ? 115 PRO D CG   1  
ATOM   10511  C CD   . PRO D 1 115 ? -147.188 -11.406 -128.607 1.00 0.00 ? 115 PRO D CD   1  
ATOM   10512  H HA   . PRO D 1 115 ? -147.610 -14.068 -127.267 1.00 0.00 ? 115 PRO D HA   1  
ATOM   10513  H HB2  . PRO D 1 115 ? -145.662 -13.648 -129.521 1.00 0.00 ? 115 PRO D HB2  1  
ATOM   10514  H HB3  . PRO D 1 115 ? -147.161 -14.597 -129.500 1.00 0.00 ? 115 PRO D HB3  1  
ATOM   10515  H HG2  . PRO D 1 115 ? -147.091 -12.177 -130.619 1.00 0.00 ? 115 PRO D HG2  1  
ATOM   10516  H HG3  . PRO D 1 115 ? -148.510 -12.716 -129.694 1.00 0.00 ? 115 PRO D HG3  1  
ATOM   10517  H HD2  . PRO D 1 115 ? -146.416 -10.746 -128.942 1.00 0.00 ? 115 PRO D HD2  1  
ATOM   10518  H HD3  . PRO D 1 115 ? -148.106 -10.866 -128.401 1.00 0.00 ? 115 PRO D HD3  1  
ATOM   10519  N N    . LEU D 1 116 ? -144.289 -13.903 -127.539 1.00 0.00 ? 116 LEU D N    1  
ATOM   10520  C CA   . LEU D 1 116 ? -142.996 -14.423 -127.090 1.00 0.00 ? 116 LEU D CA   1  
ATOM   10521  C C    . LEU D 1 116 ? -143.108 -15.829 -126.402 1.00 0.00 ? 116 LEU D C    1  
ATOM   10522  O O    . LEU D 1 116 ? -142.789 -16.850 -127.024 1.00 0.00 ? 116 LEU D O    1  
ATOM   10523  C CB   . LEU D 1 116 ? -142.281 -13.448 -126.096 1.00 0.00 ? 116 LEU D CB   1  
ATOM   10524  C CG   . LEU D 1 116 ? -141.967 -11.948 -126.464 1.00 0.00 ? 116 LEU D CG   1  
ATOM   10525  C CD1  . LEU D 1 116 ? -143.086 -11.162 -127.140 1.00 0.00 ? 116 LEU D CD1  1  
ATOM   10526  C CD2  . LEU D 1 116 ? -141.603 -11.257 -125.130 1.00 0.00 ? 116 LEU D CD2  1  
ATOM   10527  H H    . LEU D 1 116 ? -144.282 -13.277 -128.287 1.00 0.00 ? 116 LEU D H    1  
ATOM   10528  H HA   . LEU D 1 116 ? -142.377 -14.568 -127.942 1.00 0.00 ? 116 LEU D HA   1  
ATOM   10529  H HB2  . LEU D 1 116 ? -142.860 -13.414 -125.235 1.00 0.00 ? 116 LEU D HB2  1  
ATOM   10530  H HB3  . LEU D 1 116 ? -141.338 -13.900 -125.878 1.00 0.00 ? 116 LEU D HB3  1  
ATOM   10531  H HG   . LEU D 1 116 ? -141.100 -11.915 -127.075 1.00 0.00 ? 116 LEU D HG   1  
ATOM   10532  H HD11 . LEU D 1 116 ? -143.919 -11.039 -126.472 1.00 0.00 ? 116 LEU D HD11 1  
ATOM   10533  H HD12 . LEU D 1 116 ? -143.395 -11.687 -128.025 1.00 0.00 ? 116 LEU D HD12 1  
ATOM   10534  H HD13 . LEU D 1 116 ? -142.704 -10.181 -127.422 1.00 0.00 ? 116 LEU D HD13 1  
ATOM   10535  H HD21 . LEU D 1 116 ? -140.854 -11.848 -124.618 1.00 0.00 ? 116 LEU D HD21 1  
ATOM   10536  H HD22 . LEU D 1 116 ? -142.481 -11.178 -124.507 1.00 0.00 ? 116 LEU D HD22 1  
ATOM   10537  H HD23 . LEU D 1 116 ? -141.210 -10.277 -125.334 1.00 0.00 ? 116 LEU D HD23 1  
ATOM   10538  N N    . ASP D 1 117 ? -143.588 -15.851 -125.152 1.00 0.00 ? 117 ASP D N    1  
ATOM   10539  C CA   . ASP D 1 117 ? -143.767 -17.090 -124.381 1.00 0.00 ? 117 ASP D CA   1  
ATOM   10540  C C    . ASP D 1 117 ? -145.251 -17.280 -124.039 1.00 0.00 ? 117 ASP D C    1  
ATOM   10541  O O    . ASP D 1 117 ? -145.751 -18.408 -123.990 1.00 0.00 ? 117 ASP D O    1  
ATOM   10542  C CB   . ASP D 1 117 ? -142.973 -17.020 -123.077 1.00 0.00 ? 117 ASP D CB   1  
ATOM   10543  C CG   . ASP D 1 117 ? -141.498 -16.717 -123.331 1.00 0.00 ? 117 ASP D CG   1  
ATOM   10544  O OD1  . ASP D 1 117 ? -140.814 -17.605 -123.836 1.00 0.00 ? 117 ASP D OD1  1  
ATOM   10545  O OD2  . ASP D 1 117 ? -141.073 -15.600 -123.011 1.00 0.00 ? 117 ASP D OD2  1  
ATOM   10546  H H    . ASP D 1 117 ? -143.845 -15.008 -124.744 1.00 0.00 ? 117 ASP D H    1  
ATOM   10547  H HA   . ASP D 1 117 ? -143.439 -17.935 -124.959 1.00 0.00 ? 117 ASP D HA   1  
ATOM   10548  H HB2  . ASP D 1 117 ? -143.384 -16.244 -122.460 1.00 0.00 ? 117 ASP D HB2  1  
ATOM   10549  H HB3  . ASP D 1 117 ? -143.057 -17.964 -122.572 1.00 0.00 ? 117 ASP D HB3  1  
ATOM   10550  N N    . LYS D 1 118 ? -145.868 -16.174 -123.603 1.00 0.00 ? 118 LYS D N    1  
ATOM   10551  C CA   . LYS D 1 118 ? -147.247 -16.167 -123.112 1.00 0.00 ? 118 LYS D CA   1  
ATOM   10552  C C    . LYS D 1 118 ? -148.328 -16.598 -124.096 1.00 0.00 ? 118 LYS D C    1  
ATOM   10553  O O    . LYS D 1 118 ? -149.116 -17.489 -123.757 1.00 0.00 ? 118 LYS D O    1  
ATOM   10554  C CB   . LYS D 1 118 ? -147.541 -14.766 -122.504 1.00 0.00 ? 118 LYS D CB   1  
ATOM   10555  C CG   . LYS D 1 118 ? -148.832 -14.747 -121.645 1.00 0.00 ? 118 LYS D CG   1  
ATOM   10556  C CD   . LYS D 1 118 ? -148.979 -13.401 -120.884 1.00 0.00 ? 118 LYS D CD   1  
ATOM   10557  C CE   . LYS D 1 118 ? -149.334 -12.236 -121.825 1.00 0.00 ? 118 LYS D CE   1  
ATOM   10558  N NZ   . LYS D 1 118 ? -148.119 -11.476 -122.252 1.00 0.00 ? 118 LYS D NZ   1  
ATOM   10559  H H    . LYS D 1 118 ? -145.339 -15.368 -123.525 1.00 0.00 ? 118 LYS D H    1  
ATOM   10560  H HA   . LYS D 1 118 ? -147.250 -16.866 -122.313 1.00 0.00 ? 118 LYS D HA   1  
ATOM   10561  H HB2  . LYS D 1 118 ? -146.709 -14.496 -121.877 1.00 0.00 ? 118 LYS D HB2  1  
ATOM   10562  H HB3  . LYS D 1 118 ? -147.636 -14.055 -123.297 1.00 0.00 ? 118 LYS D HB3  1  
ATOM   10563  H HG2  . LYS D 1 118 ? -149.684 -14.883 -122.281 1.00 0.00 ? 118 LYS D HG2  1  
ATOM   10564  H HG3  . LYS D 1 118 ? -148.793 -15.543 -120.919 1.00 0.00 ? 118 LYS D HG3  1  
ATOM   10565  H HD2  . LYS D 1 118 ? -149.782 -13.507 -120.164 1.00 0.00 ? 118 LYS D HD2  1  
ATOM   10566  H HD3  . LYS D 1 118 ? -148.069 -13.183 -120.368 1.00 0.00 ? 118 LYS D HD3  1  
ATOM   10567  H HE2  . LYS D 1 118 ? -149.827 -12.616 -122.694 1.00 0.00 ? 118 LYS D HE2  1  
ATOM   10568  H HE3  . LYS D 1 118 ? -149.997 -11.563 -121.302 1.00 0.00 ? 118 LYS D HE3  1  
ATOM   10569  H HZ1  . LYS D 1 118 ? -147.498 -11.312 -121.439 1.00 0.00 ? 118 LYS D HZ1  1  
ATOM   10570  H HZ2  . LYS D 1 118 ? -148.419 -10.558 -122.651 1.00 0.00 ? 118 LYS D HZ2  1  
ATOM   10571  H HZ3  . LYS D 1 118 ? -147.611 -12.016 -122.978 1.00 0.00 ? 118 LYS D HZ3  1  
ATOM   10572  N N    . TRP D 1 119 ? -148.418 -15.974 -125.269 1.00 0.00 ? 119 TRP D N    1  
ATOM   10573  C CA   . TRP D 1 119 ? -149.490 -16.348 -126.212 1.00 0.00 ? 119 TRP D CA   1  
ATOM   10574  C C    . TRP D 1 119 ? -149.127 -17.495 -127.183 1.00 0.00 ? 119 TRP D C    1  
ATOM   10575  O O    . TRP D 1 119 ? -149.966 -17.878 -128.001 1.00 0.00 ? 119 TRP D O    1  
ATOM   10576  C CB   . TRP D 1 119 ? -149.997 -15.111 -126.986 1.00 0.00 ? 119 TRP D CB   1  
ATOM   10577  C CG   . TRP D 1 119 ? -151.512 -15.122 -127.118 1.00 0.00 ? 119 TRP D CG   1  
ATOM   10578  C CD1  . TRP D 1 119 ? -152.319 -16.234 -127.164 1.00 0.00 ? 119 TRP D CD1  1  
ATOM   10579  C CD2  . TRP D 1 119 ? -152.395 -13.987 -127.217 1.00 0.00 ? 119 TRP D CD2  1  
ATOM   10580  N NE1  . TRP D 1 119 ? -153.630 -15.836 -127.284 1.00 0.00 ? 119 TRP D NE1  1  
ATOM   10581  C CE2  . TRP D 1 119 ? -153.738 -14.474 -127.322 1.00 0.00 ? 119 TRP D CE2  1  
ATOM   10582  C CE3  . TRP D 1 119 ? -152.191 -12.595 -127.228 1.00 0.00 ? 119 TRP D CE3  1  
ATOM   10583  C CZ2  . TRP D 1 119 ? -154.816 -13.625 -127.433 1.00 0.00 ? 119 TRP D CZ2  1  
ATOM   10584  C CZ3  . TRP D 1 119 ? -153.297 -11.742 -127.341 1.00 0.00 ? 119 TRP D CZ3  1  
ATOM   10585  C CH2  . TRP D 1 119 ? -154.604 -12.260 -127.443 1.00 0.00 ? 119 TRP D CH2  1  
ATOM   10586  H H    . TRP D 1 119 ? -147.794 -15.250 -125.483 1.00 0.00 ? 119 TRP D H    1  
ATOM   10587  H HA   . TRP D 1 119 ? -150.296 -16.696 -125.614 1.00 0.00 ? 119 TRP D HA   1  
ATOM   10588  H HB2  . TRP D 1 119 ? -149.714 -14.220 -126.445 1.00 0.00 ? 119 TRP D HB2  1  
ATOM   10589  H HB3  . TRP D 1 119 ? -149.557 -15.088 -127.965 1.00 0.00 ? 119 TRP D HB3  1  
ATOM   10590  H HD1  . TRP D 1 119 ? -151.985 -17.247 -127.112 1.00 0.00 ? 119 TRP D HD1  1  
ATOM   10591  H HE1  . TRP D 1 119 ? -154.419 -16.438 -127.339 1.00 0.00 ? 119 TRP D HE1  1  
ATOM   10592  H HE3  . TRP D 1 119 ? -151.189 -12.181 -127.150 1.00 0.00 ? 119 TRP D HE3  1  
ATOM   10593  H HZ2  . TRP D 1 119 ? -155.828 -14.023 -127.511 1.00 0.00 ? 119 TRP D HZ2  1  
ATOM   10594  H HZ3  . TRP D 1 119 ? -153.153 -10.676 -127.351 1.00 0.00 ? 119 TRP D HZ3  1  
ATOM   10595  H HH2  . TRP D 1 119 ? -155.438 -11.593 -127.529 1.00 0.00 ? 119 TRP D HH2  1  
ATOM   10596  N N    . VAL D 1 120 ? -147.935 -18.106 -127.017 1.00 0.00 ? 120 VAL D N    1  
ATOM   10597  C CA   . VAL D 1 120 ? -147.549 -19.254 -127.871 1.00 0.00 ? 120 VAL D CA   1  
ATOM   10598  C C    . VAL D 1 120 ? -147.994 -20.585 -127.235 1.00 0.00 ? 120 VAL D C    1  
ATOM   10599  O O    . VAL D 1 120 ? -147.957 -20.748 -126.006 1.00 0.00 ? 120 VAL D O    1  
ATOM   10600  C CB   . VAL D 1 120 ? -145.967 -19.311 -128.105 1.00 0.00 ? 120 VAL D CB   1  
ATOM   10601  C CG1  . VAL D 1 120 ? -145.665 -20.099 -129.384 1.00 0.00 ? 120 VAL D CG1  1  
ATOM   10602  C CG2  . VAL D 1 120 ? -145.391 -17.904 -128.227 1.00 0.00 ? 120 VAL D CG2  1  
ATOM   10603  H H    . VAL D 1 120 ? -147.358 -17.804 -126.305 1.00 0.00 ? 120 VAL D H    1  
ATOM   10604  H HA   . VAL D 1 120 ? -148.004 -19.154 -128.810 1.00 0.00 ? 120 VAL D HA   1  
ATOM   10605  H HB   . VAL D 1 120 ? -145.514 -19.813 -127.278 1.00 0.00 ? 120 VAL D HB   1  
ATOM   10606  H HG11 . VAL D 1 120 ? -144.620 -19.987 -129.629 1.00 0.00 ? 120 VAL D HG11 1  
ATOM   10607  H HG12 . VAL D 1 120 ? -146.268 -19.729 -130.200 1.00 0.00 ? 120 VAL D HG12 1  
ATOM   10608  H HG13 . VAL D 1 120 ? -145.882 -21.145 -129.217 1.00 0.00 ? 120 VAL D HG13 1  
ATOM   10609  H HG21 . VAL D 1 120 ? -145.421 -17.424 -127.261 1.00 0.00 ? 120 VAL D HG21 1  
ATOM   10610  H HG22 . VAL D 1 120 ? -145.964 -17.330 -128.936 1.00 0.00 ? 120 VAL D HG22 1  
ATOM   10611  H HG23 . VAL D 1 120 ? -144.366 -17.974 -128.562 1.00 0.00 ? 120 VAL D HG23 1  
ATOM   10612  N N    . PRO D 1 121 ? -148.457 -21.526 -128.061 1.00 0.00 ? 121 PRO D N    1  
ATOM   10613  C CA   . PRO D 1 121 ? -148.878 -22.864 -127.611 1.00 0.00 ? 121 PRO D CA   1  
ATOM   10614  C C    . PRO D 1 121 ? -147.770 -23.708 -126.886 1.00 0.00 ? 121 PRO D C    1  
ATOM   10615  O O    . PRO D 1 121 ? -148.078 -24.780 -126.380 1.00 0.00 ? 121 PRO D O    1  
ATOM   10616  C CB   . PRO D 1 121 ? -149.346 -23.572 -128.934 1.00 0.00 ? 121 PRO D CB   1  
ATOM   10617  C CG   . PRO D 1 121 ? -149.710 -22.462 -129.858 1.00 0.00 ? 121 PRO D CG   1  
ATOM   10618  C CD   .