data_2LTZ
# 
_entry.id   2LTZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LTZ         
RCSB  RCSB102830   
BMRB  18502        
WWPDB D_1000102830 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
18502 BMRB unspecified . 
2LTV  PDB  unspecified . 
2LTW  PDB  unspecified . 
2LTX  PDB  unspecified . 
2LTY  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LTZ 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-06-04 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Macias, M.J.' 1 
'Aragon, E.'   2 
'Goerner, N.'  3 
'Xi, Q.'       4 
'Lopes, T.'    5 
'Gao, S.'      6 
'Massague, J.' 7 
# 
_citation.id                        primary 
_citation.title                     
'Structural Basis for the Versatile Interactions of Smad7 with Regulator WW Domains in TGF-beta Pathways.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                1726 
_citation.page_last                 1736 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22921829 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.07.014 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Aragon, E.'   1 
primary 'Goerner, N.'  2 
primary 'Xi, Q.'       3 
primary 'Gomes, T.'    4 
primary 'Gao, S.'      5 
primary 'Massague, J.' 6 
primary 'Macias, M.J.' 7 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'E3 ubiquitin-protein ligase SMURF2' 4204.599 1 ? ? 'WW3 domain (UNP residues 297-333)' ? 
2 polymer syn 'Smad7 derived peptide'              1778.955 1 ? ? 'UNP residues 203-217'              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'hSMURF2, SMAD ubiquitination regulatory factor 2, SMAD-specific E3 ubiquitin-protein ligase 2' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN A ? 
2 'polypeptide(L)' no no ELESPPPPYSRYPMD                       ELESPPPPYSRYPMD                       B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  PRO n 
1 5  PRO n 
1 6  GLY n 
1 7  TRP n 
1 8  GLU n 
1 9  ILE n 
1 10 ARG n 
1 11 ASN n 
1 12 THR n 
1 13 ALA n 
1 14 THR n 
1 15 GLY n 
1 16 ARG n 
1 17 VAL n 
1 18 TYR n 
1 19 PHE n 
1 20 VAL n 
1 21 ASP n 
1 22 HIS n 
1 23 ASN n 
1 24 ASN n 
1 25 ARG n 
1 26 THR n 
1 27 THR n 
1 28 GLN n 
1 29 PHE n 
1 30 THR n 
1 31 ASP n 
1 32 PRO n 
1 33 ARG n 
1 34 LEU n 
1 35 SER n 
1 36 ALA n 
1 37 ASN n 
2 1  GLU n 
2 2  LEU n 
2 3  GLU n 
2 4  SER n 
2 5  PRO n 
2 6  PRO n 
2 7  PRO n 
2 8  PRO n 
2 9  TYR n 
2 10 SER n 
2 11 ARG n 
2 12 TYR n 
2 13 PRO n 
2 14 MET n 
2 15 ASP n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 SMURF2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       petM11 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SMUF2_HUMAN Q9HAU4 1 GPLPPGWEIRNTATGRVYFVDHNNRTTQFTDPRLSAN 297 ? 
2 UNP SMAD7_HUMAN O15105 2 ELESPPPPYSRYPMD                       203 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LTZ A 1 ? 37 ? Q9HAU4 297 ? 333 ? 297 333 
2 2 2LTZ B 1 ? 15 ? O15105 203 ? 217 ? 203 217 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 2 '2D 1H-15N HSQC' 
1 2 1 '2D 1H-1H TOCSY' 
1 3 1 '2D 1H-1H NOESY' 
1 4 2 '3D CBCA(CO)NH'  
1 5 2 '3D HNCACB'      
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.2 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         285 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
'1 mM SMURF2WW3, 2 mM SMAD7, 20 mM [U-100% 2H] TRIS, 100 mM sodium chloride, 90% H2O/10% D2O'                          1 
'90% H2O/10% D2O' 
'1 mM [U-100% 13C; U-100% 15N] SMURF2WW3, 3 mM SMAD7, 20 mM [U-100% 2H] TRIS, 100 mM sodium chloride, 90% H2O/10% D2O' 2 
'90% H2O/10% D2O' 
# 
_pdbx_nmr_spectrometer.field_strength    600 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LTZ 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            300 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LTZ 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LTZ 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
'Bruker Biospin'                                    collection                  TOPSPIN  ? 1 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe  ? 2 
'Keller and Wuthrich'                               'peak picking'              CARA     ? 3 
'Keller and Wuthrich'                               'chemical shift assignment' CARA     ? 4 
'Brunger, Adams, Clore, Gros, Nilges and Read'      'structure solution'        CNSSOLVE ? 5 
'Brunger, Adams, Clore, Gros, Nilges and Read'      refinement                  CNSSOLVE ? 6 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LTZ 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LTZ 
_struct.title                     'Smurf2 WW3 domain in complex with a Smad7 derived peptide' 
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase SMURF2, Smad7 derived peptide' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LTZ 
_struct_keywords.pdbx_keywords   'PROTEIN BINDING/PEPTIDE' 
_struct_keywords.text            'WW, SMURF2, SMAD7, PROTEIN BINDING-PEPTIDE complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   3 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TRP A 7  ? THR A 12 ? TRP A 303 THR A 308 
A 2 ARG A 16 ? ASP A 21 ? ARG A 312 ASP A 317 
A 3 THR A 26 ? GLN A 28 ? THR A 322 GLN A 324 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 12 ? N THR A 308 O ARG A 16 ? O ARG A 312 
A 2 3 N ASP A 21 ? N ASP A 317 O THR A 26 ? O THR A 322 
# 
_atom_sites.entry_id                    2LTZ 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . GLY A 1 1  ? 4.205   8.948   13.084  1.00 15.00 ?  297 GLY A N    1  
ATOM 2     C CA   . GLY A 1 1  ? 3.903   7.508   13.278  1.00 15.00 ?  297 GLY A CA   1  
ATOM 3     C C    . GLY A 1 1  ? 4.969   6.612   12.680  1.00 15.00 ?  297 GLY A C    1  
ATOM 4     O O    . GLY A 1 1  ? 5.927   7.105   12.085  1.00 15.00 ?  297 GLY A O    1  
ATOM 5     H H1   . GLY A 1 1  ? 4.204   9.180   12.069  1.00 15.00 ?  297 GLY A H1   1  
ATOM 6     H H2   . GLY A 1 1  ? 5.144   9.173   13.479  1.00 15.00 ?  297 GLY A H2   1  
ATOM 7     H H3   . GLY A 1 1  ? 3.488   9.532   13.563  1.00 15.00 ?  297 GLY A H3   1  
ATOM 8     H HA2  . GLY A 1 1  ? 3.829   7.305   14.335  1.00 15.00 ?  297 GLY A HA2  1  
ATOM 9     H HA3  . GLY A 1 1  ? 2.955   7.283   12.811  1.00 15.00 ?  297 GLY A HA3  1  
ATOM 10    N N    . PRO A 1 2  ? 4.817   5.279   12.800  1.00 15.00 ?  298 PRO A N    1  
ATOM 11    C CA   . PRO A 1 2  ? 5.812   4.304   12.322  1.00 15.00 ?  298 PRO A CA   1  
ATOM 12    C C    . PRO A 1 2  ? 5.912   4.251   10.797  1.00 15.00 ?  298 PRO A C    1  
ATOM 13    O O    . PRO A 1 2  ? 6.669   3.456   10.241  1.00 15.00 ?  298 PRO A O    1  
ATOM 14    C CB   . PRO A 1 2  ? 5.301   2.960   12.862  1.00 15.00 ?  298 PRO A CB   1  
ATOM 15    C CG   . PRO A 1 2  ? 4.249   3.300   13.863  1.00 15.00 ?  298 PRO A CG   1  
ATOM 16    C CD   . PRO A 1 2  ? 3.666   4.609   13.422  1.00 15.00 ?  298 PRO A CD   1  
ATOM 17    H HA   . PRO A 1 2  ? 6.790   4.509   12.734  1.00 15.00 ?  298 PRO A HA   1  
ATOM 18    H HB2  . PRO A 1 2  ? 4.896   2.377   12.049  1.00 15.00 ?  298 PRO A HB2  1  
ATOM 19    H HB3  . PRO A 1 2  ? 6.119   2.423   13.321  1.00 15.00 ?  298 PRO A HB3  1  
ATOM 20    H HG2  . PRO A 1 2  ? 3.488   2.535   13.870  1.00 15.00 ?  298 PRO A HG2  1  
ATOM 21    H HG3  . PRO A 1 2  ? 4.692   3.399   14.844  1.00 15.00 ?  298 PRO A HG3  1  
ATOM 22    H HD2  . PRO A 1 2  ? 2.875   4.449   12.704  1.00 15.00 ?  298 PRO A HD2  1  
ATOM 23    H HD3  . PRO A 1 2  ? 3.304   5.170   14.271  1.00 15.00 ?  298 PRO A HD3  1  
ATOM 24    N N    . LEU A 1 3  ? 5.142   5.095   10.129  1.00 15.00 ?  299 LEU A N    1  
ATOM 25    C CA   . LEU A 1 3  ? 5.162   5.176   8.678   1.00 15.00 ?  299 LEU A CA   1  
ATOM 26    C C    . LEU A 1 3  ? 6.287   6.099   8.219   1.00 15.00 ?  299 LEU A C    1  
ATOM 27    O O    . LEU A 1 3  ? 6.411   7.222   8.712   1.00 15.00 ?  299 LEU A O    1  
ATOM 28    C CB   . LEU A 1 3  ? 3.822   5.714   8.172   1.00 15.00 ?  299 LEU A CB   1  
ATOM 29    C CG   . LEU A 1 3  ? 3.673   5.776   6.652   1.00 15.00 ?  299 LEU A CG   1  
ATOM 30    C CD1  . LEU A 1 3  ? 3.534   4.378   6.071   1.00 15.00 ?  299 LEU A CD1  1  
ATOM 31    C CD2  . LEU A 1 3  ? 2.484   6.644   6.273   1.00 15.00 ?  299 LEU A CD2  1  
ATOM 32    H H    . LEU A 1 3  ? 4.546   5.688   10.629  1.00 15.00 ?  299 LEU A H    1  
ATOM 33    H HA   . LEU A 1 3  ? 5.324   4.185   8.281   1.00 15.00 ?  299 LEU A HA   1  
ATOM 34    H HB2  . LEU A 1 3  ? 3.036   5.085   8.564   1.00 15.00 ?  299 LEU A HB2  1  
ATOM 35    H HB3  . LEU A 1 3  ? 3.689   6.711   8.564   1.00 15.00 ?  299 LEU A HB3  1  
ATOM 36    H HG   . LEU A 1 3  ? 4.562   6.224   6.230   1.00 15.00 ?  299 LEU A HG   1  
ATOM 37    H HD11 . LEU A 1 3  ? 3.369   4.445   5.006   1.00 15.00 ?  299 LEU A HD11 1  
ATOM 38    H HD12 . LEU A 1 3  ? 2.696   3.878   6.534   1.00 15.00 ?  299 LEU A HD12 1  
ATOM 39    H HD13 . LEU A 1 3  ? 4.437   3.818   6.261   1.00 15.00 ?  299 LEU A HD13 1  
ATOM 40    H HD21 . LEU A 1 3  ? 2.685   7.669   6.546   1.00 15.00 ?  299 LEU A HD21 1  
ATOM 41    H HD22 . LEU A 1 3  ? 1.607   6.298   6.799   1.00 15.00 ?  299 LEU A HD22 1  
ATOM 42    H HD23 . LEU A 1 3  ? 2.314   6.578   5.210   1.00 15.00 ?  299 LEU A HD23 1  
ATOM 43    N N    . PRO A 1 4  ? 7.124   5.643   7.276   1.00 15.00 ?  300 PRO A N    1  
ATOM 44    C CA   . PRO A 1 4  ? 8.172   6.480   6.687   1.00 15.00 ?  300 PRO A CA   1  
ATOM 45    C C    . PRO A 1 4  ? 7.566   7.563   5.796   1.00 15.00 ?  300 PRO A C    1  
ATOM 46    O O    . PRO A 1 4  ? 6.620   7.298   5.059   1.00 15.00 ?  300 PRO A O    1  
ATOM 47    C CB   . PRO A 1 4  ? 9.005   5.496   5.851   1.00 15.00 ?  300 PRO A CB   1  
ATOM 48    C CG   . PRO A 1 4  ? 8.551   4.133   6.264   1.00 15.00 ?  300 PRO A CG   1  
ATOM 49    C CD   . PRO A 1 4  ? 7.126   4.291   6.699   1.00 15.00 ?  300 PRO A CD   1  
ATOM 50    H HA   . PRO A 1 4  ? 8.791   6.938   7.446   1.00 15.00 ?  300 PRO A HA   1  
ATOM 51    H HB2  . PRO A 1 4  ? 8.819   5.671   4.802   1.00 15.00 ?  300 PRO A HB2  1  
ATOM 52    H HB3  . PRO A 1 4  ? 10.055  5.642   6.062   1.00 15.00 ?  300 PRO A HB3  1  
ATOM 53    H HG2  . PRO A 1 4  ? 8.614   3.454   5.425   1.00 15.00 ?  300 PRO A HG2  1  
ATOM 54    H HG3  . PRO A 1 4  ? 9.157   3.776   7.084   1.00 15.00 ?  300 PRO A HG3  1  
ATOM 55    H HD2  . PRO A 1 4  ? 6.462   4.232   5.849   1.00 15.00 ?  300 PRO A HD2  1  
ATOM 56    H HD3  . PRO A 1 4  ? 6.867   3.549   7.439   1.00 15.00 ?  300 PRO A HD3  1  
ATOM 57    N N    . PRO A 1 5  ? 8.115   8.791   5.837   1.00 15.00 ?  301 PRO A N    1  
ATOM 58    C CA   . PRO A 1 5  ? 7.550   9.947   5.113   1.00 15.00 ?  301 PRO A CA   1  
ATOM 59    C C    . PRO A 1 5  ? 7.499   9.757   3.594   1.00 15.00 ?  301 PRO A C    1  
ATOM 60    O O    . PRO A 1 5  ? 6.795   10.483  2.890   1.00 15.00 ?  301 PRO A O    1  
ATOM 61    C CB   . PRO A 1 5  ? 8.495   11.100  5.474   1.00 15.00 ?  301 PRO A CB   1  
ATOM 62    C CG   . PRO A 1 5  ? 9.203   10.653  6.709   1.00 15.00 ?  301 PRO A CG   1  
ATOM 63    C CD   . PRO A 1 5  ? 9.319   9.161   6.600   1.00 15.00 ?  301 PRO A CD   1  
ATOM 64    H HA   . PRO A 1 5  ? 6.557   10.178  5.469   1.00 15.00 ?  301 PRO A HA   1  
ATOM 65    H HB2  . PRO A 1 5  ? 9.187   11.267  4.662   1.00 15.00 ?  301 PRO A HB2  1  
ATOM 66    H HB3  . PRO A 1 5  ? 7.919   11.996  5.652   1.00 15.00 ?  301 PRO A HB3  1  
ATOM 67    H HG2  . PRO A 1 5  ? 10.183  11.104  6.753   1.00 15.00 ?  301 PRO A HG2  1  
ATOM 68    H HG3  . PRO A 1 5  ? 8.626   10.922  7.582   1.00 15.00 ?  301 PRO A HG3  1  
ATOM 69    H HD2  . PRO A 1 5  ? 10.217  8.890   6.063   1.00 15.00 ?  301 PRO A HD2  1  
ATOM 70    H HD3  . PRO A 1 5  ? 9.311   8.706   7.580   1.00 15.00 ?  301 PRO A HD3  1  
ATOM 71    N N    . GLY A 1 6  ? 8.259   8.796   3.095   1.00 15.00 ?  302 GLY A N    1  
ATOM 72    C CA   . GLY A 1 6  ? 8.264   8.505   1.675   1.00 15.00 ?  302 GLY A CA   1  
ATOM 73    C C    . GLY A 1 6  ? 7.201   7.492   1.297   1.00 15.00 ?  302 GLY A C    1  
ATOM 74    O O    . GLY A 1 6  ? 6.887   7.314   0.117   1.00 15.00 ?  302 GLY A O    1  
ATOM 75    H H    . GLY A 1 6  ? 8.830   8.280   3.699   1.00 15.00 ?  302 GLY A H    1  
ATOM 76    H HA2  . GLY A 1 6  ? 8.085   9.421   1.129   1.00 15.00 ?  302 GLY A HA2  1  
ATOM 77    H HA3  . GLY A 1 6  ? 9.233   8.116   1.401   1.00 15.00 ?  302 GLY A HA3  1  
ATOM 78    N N    . TRP A 1 7  ? 6.664   6.819   2.304   1.00 15.00 ?  303 TRP A N    1  
ATOM 79    C CA   . TRP A 1 7  ? 5.709   5.740   2.103   1.00 15.00 ?  303 TRP A CA   1  
ATOM 80    C C    . TRP A 1 7  ? 4.279   6.216   2.286   1.00 15.00 ?  303 TRP A C    1  
ATOM 81    O O    . TRP A 1 7  ? 4.015   7.131   3.067   1.00 15.00 ?  303 TRP A O    1  
ATOM 82    C CB   . TRP A 1 7  ? 5.985   4.604   3.075   1.00 15.00 ?  303 TRP A CB   1  
ATOM 83    C CG   . TRP A 1 7  ? 7.026   3.667   2.585   1.00 15.00 ?  303 TRP A CG   1  
ATOM 84    C CD1  . TRP A 1 7  ? 8.376   3.811   2.695   1.00 15.00 ?  303 TRP A CD1  1  
ATOM 85    C CD2  . TRP A 1 7  ? 6.803   2.435   1.899   1.00 15.00 ?  303 TRP A CD2  1  
ATOM 86    N NE1  . TRP A 1 7  ? 9.005   2.738   2.128   1.00 15.00 ?  303 TRP A NE1  1  
ATOM 87    C CE2  . TRP A 1 7  ? 8.057   1.882   1.633   1.00 15.00 ?  303 TRP A CE2  1  
ATOM 88    C CE3  . TRP A 1 7  ? 5.664   1.736   1.485   1.00 15.00 ?  303 TRP A CE3  1  
ATOM 89    C CZ2  . TRP A 1 7  ? 8.203   0.677   0.979   1.00 15.00 ?  303 TRP A CZ2  1  
ATOM 90    C CZ3  . TRP A 1 7  ? 5.821   0.534   0.836   1.00 15.00 ?  303 TRP A CZ3  1  
ATOM 91    C CH2  . TRP A 1 7  ? 7.082   0.015   0.590   1.00 15.00 ?  303 TRP A CH2  1  
ATOM 92    H H    . TRP A 1 7  ? 6.896   7.075   3.223   1.00 15.00 ?  303 TRP A H    1  
ATOM 93    H HA   . TRP A 1 7  ? 5.841   5.377   1.096   1.00 15.00 ?  303 TRP A HA   1  
ATOM 94    H HB2  . TRP A 1 7  ? 6.320   5.015   4.015   1.00 15.00 ?  303 TRP A HB2  1  
ATOM 95    H HB3  . TRP A 1 7  ? 5.074   4.044   3.234   1.00 15.00 ?  303 TRP A HB3  1  
ATOM 96    H HD1  . TRP A 1 7  ? 8.863   4.651   3.163   1.00 15.00 ?  303 TRP A HD1  1  
ATOM 97    H HE1  . TRP A 1 7  ? 9.981   2.603   2.083   1.00 15.00 ?  303 TRP A HE1  1  
ATOM 98    H HE3  . TRP A 1 7  ? 4.673   2.118   1.659   1.00 15.00 ?  303 TRP A HE3  1  
ATOM 99    H HZ2  . TRP A 1 7  ? 9.153   0.275   0.775   1.00 15.00 ?  303 TRP A HZ2  1  
ATOM 100   H HZ3  . TRP A 1 7  ? 4.953   -0.018  0.510   1.00 15.00 ?  303 TRP A HZ3  1  
ATOM 101   H HH2  . TRP A 1 7  ? 7.162   -0.933  0.091   1.00 15.00 ?  303 TRP A HH2  1  
ATOM 102   N N    . GLU A 1 8  ? 3.354   5.579   1.579   1.00 15.00 ?  304 GLU A N    1  
ATOM 103   C CA   . GLU A 1 8  ? 1.938   5.946   1.682   1.00 15.00 ?  304 GLU A CA   1  
ATOM 104   C C    . GLU A 1 8  ? 1.094   4.712   2.000   1.00 15.00 ?  304 GLU A C    1  
ATOM 105   O O    . GLU A 1 8  ? 1.094   3.746   1.252   1.00 15.00 ?  304 GLU A O    1  
ATOM 106   C CB   . GLU A 1 8  ? 1.488   6.622   0.384   1.00 15.00 ?  304 GLU A CB   1  
ATOM 107   C CG   . GLU A 1 8  ? 2.083   8.006   0.200   1.00 15.00 ?  304 GLU A CG   1  
ATOM 108   C CD   . GLU A 1 8  ? 1.348   9.086   0.976   1.00 15.00 ?  304 GLU A CD   1  
ATOM 109   O OE1  . GLU A 1 8  ? 1.367   9.061   2.223   1.00 15.00 ?  304 GLU A OE1  1  
ATOM 110   O OE2  . GLU A 1 8  ? 0.772   9.988   0.330   1.00 15.00 -1 304 GLU A OE2  1  
ATOM 111   H H    . GLU A 1 8  ? 3.628   4.821   0.982   1.00 15.00 ?  304 GLU A H    1  
ATOM 112   H HA   . GLU A 1 8  ? 1.841   6.650   2.496   1.00 15.00 ?  304 GLU A HA   1  
ATOM 113   H HB2  . GLU A 1 8  ? 1.799   6.010   -0.450  1.00 15.00 ?  304 GLU A HB2  1  
ATOM 114   H HB3  . GLU A 1 8  ? 0.416   6.710   0.370   1.00 15.00 ?  304 GLU A HB3  1  
ATOM 115   H HG2  . GLU A 1 8  ? 3.110   7.987   0.533   1.00 15.00 ?  304 GLU A HG2  1  
ATOM 116   H HG3  . GLU A 1 8  ? 2.054   8.256   -0.851  1.00 15.00 ?  304 GLU A HG3  1  
ATOM 117   N N    . ILE A 1 9  ? 0.372   4.744   3.113   1.00 15.00 ?  305 ILE A N    1  
ATOM 118   C CA   . ILE A 1 9  ? -0.278  3.540   3.627   1.00 15.00 ?  305 ILE A CA   1  
ATOM 119   C C    . ILE A 1 9  ? -1.808  3.594   3.535   1.00 15.00 ?  305 ILE A C    1  
ATOM 120   O O    . ILE A 1 9  ? -2.435  4.563   3.969   1.00 15.00 ?  305 ILE A O    1  
ATOM 121   C CB   . ILE A 1 9  ? 0.128   3.282   5.100   1.00 15.00 ?  305 ILE A CB   1  
ATOM 122   C CG1  . ILE A 1 9  ? -0.588  2.043   5.651   1.00 15.00 ?  305 ILE A CG1  1  
ATOM 123   C CG2  . ILE A 1 9  ? -0.175  4.502   5.962   1.00 15.00 ?  305 ILE A CG2  1  
ATOM 124   C CD1  . ILE A 1 9  ? -0.203  1.702   7.075   1.00 15.00 ?  305 ILE A CD1  1  
ATOM 125   H H    . ILE A 1 9  ? 0.262   5.597   3.595   1.00 15.00 ?  305 ILE A H    1  
ATOM 126   H HA   . ILE A 1 9  ? 0.075   2.706   3.040   1.00 15.00 ?  305 ILE A HA   1  
ATOM 127   H HB   . ILE A 1 9  ? 1.194   3.111   5.129   1.00 15.00 ?  305 ILE A HB   1  
ATOM 128   H HG12 . ILE A 1 9  ? -1.655  2.212   5.630   1.00 15.00 ?  305 ILE A HG12 1  
ATOM 129   H HG13 . ILE A 1 9  ? -0.350  1.193   5.029   1.00 15.00 ?  305 ILE A HG13 1  
ATOM 130   H HG21 . ILE A 1 9  ? -1.244  4.638   6.030   1.00 15.00 ?  305 ILE A HG21 1  
ATOM 131   H HG22 . ILE A 1 9  ? 0.271   5.377   5.514   1.00 15.00 ?  305 ILE A HG22 1  
ATOM 132   H HG23 . ILE A 1 9  ? 0.234   4.357   6.950   1.00 15.00 ?  305 ILE A HG23 1  
ATOM 133   H HD11 . ILE A 1 9  ? 0.845   1.445   7.113   1.00 15.00 ?  305 ILE A HD11 1  
ATOM 134   H HD12 . ILE A 1 9  ? -0.792  0.864   7.417   1.00 15.00 ?  305 ILE A HD12 1  
ATOM 135   H HD13 . ILE A 1 9  ? -0.386  2.555   7.713   1.00 15.00 ?  305 ILE A HD13 1  
ATOM 136   N N    . ARG A 1 10 ? -2.401  2.548   2.949   1.00 15.00 ?  306 ARG A N    1  
ATOM 137   C CA   . ARG A 1 10 ? -3.841  2.314   3.044   1.00 15.00 ?  306 ARG A CA   1  
ATOM 138   C C    . ARG A 1 10 ? -4.124  0.814   3.098   1.00 15.00 ?  306 ARG A C    1  
ATOM 139   O O    . ARG A 1 10 ? -3.376  0.013   2.539   1.00 15.00 ?  306 ARG A O    1  
ATOM 140   C CB   . ARG A 1 10 ? -4.629  2.919   1.877   1.00 15.00 ?  306 ARG A CB   1  
ATOM 141   C CG   . ARG A 1 10 ? -4.544  4.429   1.754   1.00 15.00 ?  306 ARG A CG   1  
ATOM 142   C CD   . ARG A 1 10 ? -5.819  4.997   1.149   1.00 15.00 ?  306 ARG A CD   1  
ATOM 143   N NE   . ARG A 1 10 ? -6.902  5.037   2.138   1.00 15.00 ?  306 ARG A NE   1  
ATOM 144   C CZ   . ARG A 1 10 ? -7.845  4.099   2.271   1.00 15.00 ?  306 ARG A CZ   1  
ATOM 145   N NH1  . ARG A 1 10 ? -7.929  3.107   1.397   1.00 15.00 1  306 ARG A NH1  1  
ATOM 146   N NH2  . ARG A 1 10 ? -8.730  4.174   3.258   1.00 15.00 ?  306 ARG A NH2  1  
ATOM 147   H H    . ARG A 1 10 ? -1.856  1.915   2.431   1.00 15.00 ?  306 ARG A H    1  
ATOM 148   H HA   . ARG A 1 10 ? -4.184  2.761   3.966   1.00 15.00 ?  306 ARG A HA   1  
ATOM 149   H HB2  . ARG A 1 10 ? -4.257  2.492   0.958   1.00 15.00 ?  306 ARG A HB2  1  
ATOM 150   H HB3  . ARG A 1 10 ? -5.670  2.649   1.988   1.00 15.00 ?  306 ARG A HB3  1  
ATOM 151   H HG2  . ARG A 1 10 ? -4.393  4.858   2.733   1.00 15.00 ?  306 ARG A HG2  1  
ATOM 152   H HG3  . ARG A 1 10 ? -3.711  4.679   1.112   1.00 15.00 ?  306 ARG A HG3  1  
ATOM 153   H HD2  . ARG A 1 10 ? -5.625  5.999   0.797   1.00 15.00 ?  306 ARG A HD2  1  
ATOM 154   H HD3  . ARG A 1 10 ? -6.121  4.372   0.321   1.00 15.00 ?  306 ARG A HD3  1  
ATOM 155   H HE   . ARG A 1 10 ? -6.898  5.802   2.770   1.00 15.00 ?  306 ARG A HE   1  
ATOM 156   H HH11 . ARG A 1 10 ? -7.293  3.064   0.620   1.00 15.00 ?  306 ARG A HH11 1  
ATOM 157   H HH12 . ARG A 1 10 ? -8.626  2.374   1.519   1.00 15.00 ?  306 ARG A HH12 1  
ATOM 158   H HH21 . ARG A 1 10 ? -8.700  4.938   3.909   1.00 15.00 ?  306 ARG A HH21 1  
ATOM 159   H HH22 . ARG A 1 10 ? -9.429  3.458   3.368   1.00 15.00 ?  306 ARG A HH22 1  
ATOM 160   N N    . ASN A 1 11 ? -5.206  0.446   3.768   1.00 15.00 ?  307 ASN A N    1  
ATOM 161   C CA   . ASN A 1 11 ? -5.639  -0.948  3.851   1.00 15.00 ?  307 ASN A CA   1  
ATOM 162   C C    . ASN A 1 11 ? -6.984  -1.096  3.133   1.00 15.00 ?  307 ASN A C    1  
ATOM 163   O O    . ASN A 1 11 ? -7.847  -0.234  3.274   1.00 15.00 ?  307 ASN A O    1  
ATOM 164   C CB   . ASN A 1 11 ? -5.774  -1.348  5.332   1.00 15.00 ?  307 ASN A CB   1  
ATOM 165   C CG   . ASN A 1 11 ? -5.974  -2.842  5.557   1.00 15.00 ?  307 ASN A CG   1  
ATOM 166   O OD1  . ASN A 1 11 ? -6.535  -3.551  4.727   1.00 15.00 ?  307 ASN A OD1  1  
ATOM 167   N ND2  . ASN A 1 11 ? -5.517  -3.332  6.698   1.00 15.00 ?  307 ASN A ND2  1  
ATOM 168   H H    . ASN A 1 11 ? -5.743  1.131   4.217   1.00 15.00 ?  307 ASN A H    1  
ATOM 169   H HA   . ASN A 1 11 ? -4.898  -1.570  3.370   1.00 15.00 ?  307 ASN A HA   1  
ATOM 170   H HB2  . ASN A 1 11 ? -4.880  -1.050  5.857   1.00 15.00 ?  307 ASN A HB2  1  
ATOM 171   H HB3  . ASN A 1 11 ? -6.619  -0.825  5.757   1.00 15.00 ?  307 ASN A HB3  1  
ATOM 172   H HD21 . ASN A 1 11 ? -5.076  -2.714  7.330   1.00 15.00 ?  307 ASN A HD21 1  
ATOM 173   H HD22 . ASN A 1 11 ? -5.635  -4.287  6.870   1.00 15.00 ?  307 ASN A HD22 1  
ATOM 174   N N    . THR A 1 12 ? -7.171  -2.189  2.393   1.00 15.00 ?  308 THR A N    1  
ATOM 175   C CA   . THR A 1 12 ? -8.429  -2.425  1.685   1.00 15.00 ?  308 THR A CA   1  
ATOM 176   C C    . THR A 1 12 ? -9.391  -3.187  2.580   1.00 15.00 ?  308 THR A C    1  
ATOM 177   O O    . THR A 1 12 ? -8.964  -4.016  3.395   1.00 15.00 ?  308 THR A O    1  
ATOM 178   C CB   . THR A 1 12 ? -8.253  -3.246  0.377   1.00 15.00 ?  308 THR A CB   1  
ATOM 179   O OG1  . THR A 1 12 ? -7.330  -4.330  0.577   1.00 15.00 ?  308 THR A OG1  1  
ATOM 180   C CG2  . THR A 1 12 ? -7.794  -2.384  -0.793  1.00 15.00 ?  308 THR A CG2  1  
ATOM 181   H H    . THR A 1 12 ? -6.461  -2.864  2.347   1.00 15.00 ?  308 THR A H    1  
ATOM 182   H HA   . THR A 1 12 ? -8.860  -1.467  1.436   1.00 15.00 ?  308 THR A HA   1  
ATOM 183   H HB   . THR A 1 12 ? -9.216  -3.667  0.123   1.00 15.00 ?  308 THR A HB   1  
ATOM 184   H HG1  . THR A 1 12 ? -6.542  -4.002  1.030   1.00 15.00 ?  308 THR A HG1  1  
ATOM 185   H HG21 . THR A 1 12 ? -8.381  -1.478  -0.828  1.00 15.00 ?  308 THR A HG21 1  
ATOM 186   H HG22 . THR A 1 12 ? -7.928  -2.930  -1.715  1.00 15.00 ?  308 THR A HG22 1  
ATOM 187   H HG23 . THR A 1 12 ? -6.752  -2.138  -0.676  1.00 15.00 ?  308 THR A HG23 1  
ATOM 188   N N    . ALA A 1 13 ? -10.685 -2.930  2.395   1.00 15.00 ?  309 ALA A N    1  
ATOM 189   C CA   . ALA A 1 13 ? -11.737 -3.534  3.213   1.00 15.00 ?  309 ALA A CA   1  
ATOM 190   C C    . ALA A 1 13 ? -11.750 -5.056  3.082   1.00 15.00 ?  309 ALA A C    1  
ATOM 191   O O    . ALA A 1 13 ? -12.371 -5.755  3.882   1.00 15.00 ?  309 ALA A O    1  
ATOM 192   C CB   . ALA A 1 13 ? -13.093 -2.955  2.835   1.00 15.00 ?  309 ALA A CB   1  
ATOM 193   H H    . ALA A 1 13 ? -10.944 -2.303  1.672   1.00 15.00 ?  309 ALA A H    1  
ATOM 194   H HA   . ALA A 1 13 ? -11.541 -3.278  4.243   1.00 15.00 ?  309 ALA A HA   1  
ATOM 195   H HB1  . ALA A 1 13 ? -13.065 -1.880  2.935   1.00 15.00 ?  309 ALA A HB1  1  
ATOM 196   H HB2  . ALA A 1 13 ? -13.851 -3.358  3.490   1.00 15.00 ?  309 ALA A HB2  1  
ATOM 197   H HB3  . ALA A 1 13 ? -13.325 -3.215  1.812   1.00 15.00 ?  309 ALA A HB3  1  
ATOM 198   N N    . THR A 1 14 ? -11.064 -5.564  2.065   1.00 15.00 ?  310 THR A N    1  
ATOM 199   C CA   . THR A 1 14 ? -10.915 -6.998  1.879   1.00 15.00 ?  310 THR A CA   1  
ATOM 200   C C    . THR A 1 14 ? -9.995  -7.585  2.957   1.00 15.00 ?  310 THR A C    1  
ATOM 201   O O    . THR A 1 14 ? -9.977  -8.793  3.187   1.00 15.00 ?  310 THR A O    1  
ATOM 202   C CB   . THR A 1 14 ? -10.326 -7.304  0.489   1.00 15.00 ?  310 THR A CB   1  
ATOM 203   O OG1  . THR A 1 14 ? -10.851 -6.379  -0.476  1.00 15.00 ?  310 THR A OG1  1  
ATOM 204   C CG2  . THR A 1 14 ? -10.652 -8.727  0.059   1.00 15.00 ?  310 THR A CG2  1  
ATOM 205   H H    . THR A 1 14 ? -10.653 -4.954  1.418   1.00 15.00 ?  310 THR A H    1  
ATOM 206   H HA   . THR A 1 14 ? -11.890 -7.456  1.952   1.00 15.00 ?  310 THR A HA   1  
ATOM 207   H HB   . THR A 1 14 ? -9.253  -7.193  0.536   1.00 15.00 ?  310 THR A HB   1  
ATOM 208   H HG1  . THR A 1 14 ? -11.356 -6.864  -1.151  1.00 15.00 ?  310 THR A HG1  1  
ATOM 209   H HG21 . THR A 1 14 ? -11.723 -8.854  0.020   1.00 15.00 ?  310 THR A HG21 1  
ATOM 210   H HG22 . THR A 1 14 ? -10.233 -9.424  0.771   1.00 15.00 ?  310 THR A HG22 1  
ATOM 211   H HG23 . THR A 1 14 ? -10.230 -8.913  -0.917  1.00 15.00 ?  310 THR A HG23 1  
ATOM 212   N N    . GLY A 1 15 ? -9.245  -6.713  3.622   1.00 15.00 ?  311 GLY A N    1  
ATOM 213   C CA   . GLY A 1 15 ? -8.316  -7.154  4.644   1.00 15.00 ?  311 GLY A CA   1  
ATOM 214   C C    . GLY A 1 15 ? -6.912  -7.330  4.102   1.00 15.00 ?  311 GLY A C    1  
ATOM 215   O O    . GLY A 1 15 ? -6.216  -8.277  4.461   1.00 15.00 ?  311 GLY A O    1  
ATOM 216   H H    . GLY A 1 15 ? -9.334  -5.752  3.425   1.00 15.00 ?  311 GLY A H    1  
ATOM 217   H HA2  . GLY A 1 15 ? -8.296  -6.422  5.439   1.00 15.00 ?  311 GLY A HA2  1  
ATOM 218   H HA3  . GLY A 1 15 ? -8.659  -8.097  5.043   1.00 15.00 ?  311 GLY A HA3  1  
ATOM 219   N N    . ARG A 1 16 ? -6.492  -6.415  3.235   1.00 15.00 ?  312 ARG A N    1  
ATOM 220   C CA   . ARG A 1 16 ? -5.167  -6.497  2.618   1.00 15.00 ?  312 ARG A CA   1  
ATOM 221   C C    . ARG A 1 16 ? -4.529  -5.119  2.600   1.00 15.00 ?  312 ARG A C    1  
ATOM 222   O O    . ARG A 1 16 ? -5.186  -4.144  2.236   1.00 15.00 ?  312 ARG A O    1  
ATOM 223   C CB   . ARG A 1 16 ? -5.250  -6.989  1.177   1.00 15.00 ?  312 ARG A CB   1  
ATOM 224   C CG   . ARG A 1 16 ? -6.077  -8.231  0.942   1.00 15.00 ?  312 ARG A CG   1  
ATOM 225   C CD   . ARG A 1 16 ? -6.343  -8.390  -0.543  1.00 15.00 ?  312 ARG A CD   1  
ATOM 226   N NE   . ARG A 1 16 ? -7.331  -7.419  -1.023  1.00 15.00 ?  312 ARG A NE   1  
ATOM 227   C CZ   . ARG A 1 16 ? -7.835  -7.407  -2.259  1.00 15.00 ?  312 ARG A CZ   1  
ATOM 228   N NH1  . ARG A 1 16 ? -7.409  -8.272  -3.171  1.00 15.00 1  312 ARG A NH1  1  
ATOM 229   N NH2  . ARG A 1 16 ? -8.766  -6.519  -2.588  1.00 15.00 ?  312 ARG A NH2  1  
ATOM 230   H H    . ARG A 1 16 ? -7.074  -5.642  3.031   1.00 15.00 ?  312 ARG A H    1  
ATOM 231   H HA   . ARG A 1 16 ? -4.555  -7.171  3.200   1.00 15.00 ?  312 ARG A HA   1  
ATOM 232   H HB2  . ARG A 1 16 ? -5.652  -6.197  0.559   1.00 15.00 ?  312 ARG A HB2  1  
ATOM 233   H HB3  . ARG A 1 16 ? -4.243  -7.197  0.840   1.00 15.00 ?  312 ARG A HB3  1  
ATOM 234   H HG2  . ARG A 1 16 ? -5.536  -9.094  1.303   1.00 15.00 ?  312 ARG A HG2  1  
ATOM 235   H HG3  . ARG A 1 16 ? -7.017  -8.138  1.464   1.00 15.00 ?  312 ARG A HG3  1  
ATOM 236   H HD2  . ARG A 1 16 ? -5.412  -8.223  -1.074  1.00 15.00 ?  312 ARG A HD2  1  
ATOM 237   H HD3  . ARG A 1 16 ? -6.701  -9.390  -0.734  1.00 15.00 ?  312 ARG A HD3  1  
ATOM 238   H HE   . ARG A 1 16 ? -7.646  -6.747  -0.378  1.00 15.00 ?  312 ARG A HE   1  
ATOM 239   H HH11 . ARG A 1 16 ? -6.697  -8.952  -2.942  1.00 15.00 ?  312 ARG A HH11 1  
ATOM 240   H HH12 . ARG A 1 16 ? -7.794  -8.258  -4.095  1.00 15.00 ?  312 ARG A HH12 1  
ATOM 241   H HH21 . ARG A 1 16 ? -9.092  -5.855  -1.912  1.00 15.00 ?  312 ARG A HH21 1  
ATOM 242   H HH22 . ARG A 1 16 ? -9.161  -6.523  -3.515  1.00 15.00 ?  312 ARG A HH22 1  
ATOM 243   N N    . VAL A 1 17 ? -3.251  -5.030  2.928   1.00 15.00 ?  313 VAL A N    1  
ATOM 244   C CA   . VAL A 1 17 ? -2.608  -3.730  3.014   1.00 15.00 ?  313 VAL A CA   1  
ATOM 245   C C    . VAL A 1 17 ? -1.683  -3.476  1.811   1.00 15.00 ?  313 VAL A C    1  
ATOM 246   O O    . VAL A 1 17 ? -0.877  -4.318  1.439   1.00 15.00 ?  313 VAL A O    1  
ATOM 247   C CB   . VAL A 1 17 ? -1.816  -3.571  4.323   1.00 15.00 ?  313 VAL A CB   1  
ATOM 248   C CG1  . VAL A 1 17 ? -1.649  -2.098  4.657   1.00 15.00 ?  313 VAL A CG1  1  
ATOM 249   C CG2  . VAL A 1 17 ? -2.501  -4.308  5.465   1.00 15.00 ?  313 VAL A CG2  1  
ATOM 250   H H    . VAL A 1 17 ? -2.726  -5.842  3.096   1.00 15.00 ?  313 VAL A H    1  
ATOM 251   H HA   . VAL A 1 17 ? -3.397  -2.991  3.013   1.00 15.00 ?  313 VAL A HA   1  
ATOM 252   H HB   . VAL A 1 17 ? -0.834  -3.999  4.181   1.00 15.00 ?  313 VAL A HB   1  
ATOM 253   H HG11 . VAL A 1 17 ? -1.113  -1.605  3.860   1.00 15.00 ?  313 VAL A HG11 1  
ATOM 254   H HG12 . VAL A 1 17 ? -1.094  -1.998  5.579   1.00 15.00 ?  313 VAL A HG12 1  
ATOM 255   H HG13 . VAL A 1 17 ? -2.621  -1.643  4.772   1.00 15.00 ?  313 VAL A HG13 1  
ATOM 256   H HG21 . VAL A 1 17 ? -2.569  -5.358  5.225   1.00 15.00 ?  313 VAL A HG21 1  
ATOM 257   H HG22 . VAL A 1 17 ? -3.493  -3.906  5.608   1.00 15.00 ?  313 VAL A HG22 1  
ATOM 258   H HG23 . VAL A 1 17 ? -1.927  -4.182  6.372   1.00 15.00 ?  313 VAL A HG23 1  
ATOM 259   N N    . TYR A 1 18 ? -1.806  -2.292  1.232   1.00 15.00 ?  314 TYR A N    1  
ATOM 260   C CA   . TYR A 1 18 ? -1.117  -1.899  0.033   1.00 15.00 ?  314 TYR A CA   1  
ATOM 261   C C    . TYR A 1 18 ? -0.537  -0.509  0.260   1.00 15.00 ?  314 TYR A C    1  
ATOM 262   O O    . TYR A 1 18 ? -1.264  0.461   0.484   1.00 15.00 ?  314 TYR A O    1  
ATOM 263   C CB   . TYR A 1 18 ? -2.081  -1.895  -1.172  1.00 15.00 ?  314 TYR A CB   1  
ATOM 264   C CG   . TYR A 1 18 ? -3.270  -0.965  -1.004  1.00 15.00 ?  314 TYR A CG   1  
ATOM 265   C CD1  . TYR A 1 18 ? -4.297  -1.278  -0.123  1.00 15.00 ?  314 TYR A CD1  1  
ATOM 266   C CD2  . TYR A 1 18 ? -3.352  0.238   -1.703  1.00 15.00 ?  314 TYR A CD2  1  
ATOM 267   C CE1  . TYR A 1 18 ? -5.366  -0.427  0.056   1.00 15.00 ?  314 TYR A CE1  1  
ATOM 268   C CE2  . TYR A 1 18 ? -4.426  1.093   -1.524  1.00 15.00 ?  314 TYR A CE2  1  
ATOM 269   C CZ   . TYR A 1 18 ? -5.427  0.752   -0.640  1.00 15.00 ?  314 TYR A CZ   1  
ATOM 270   O OH   . TYR A 1 18 ? -6.499  1.588   -0.447  1.00 15.00 ?  314 TYR A OH   1  
ATOM 271   H H    . TYR A 1 18 ? -2.344  -1.636  1.650   1.00 15.00 ?  314 TYR A H    1  
ATOM 272   H HA   . TYR A 1 18 ? -0.314  -2.599  -0.146  1.00 15.00 ?  314 TYR A HA   1  
ATOM 273   H HB2  . TYR A 1 18 ? -1.542  -1.585  -2.053  1.00 15.00 ?  314 TYR A HB2  1  
ATOM 274   H HB3  . TYR A 1 18 ? -2.462  -2.895  -1.322  1.00 15.00 ?  314 TYR A HB3  1  
ATOM 275   H HD1  . TYR A 1 18 ? -4.251  -2.205  0.428   1.00 15.00 ?  314 TYR A HD1  1  
ATOM 276   H HD2  . TYR A 1 18 ? -2.571  0.496   -2.405  1.00 15.00 ?  314 TYR A HD2  1  
ATOM 277   H HE1  . TYR A 1 18 ? -6.149  -0.686  0.751   1.00 15.00 ?  314 TYR A HE1  1  
ATOM 278   H HE2  . TYR A 1 18 ? -4.470  2.033   -2.067  1.00 15.00 ?  314 TYR A HE2  1  
ATOM 279   H HH   . TYR A 1 18 ? -6.929  1.365   0.387   1.00 15.00 ?  314 TYR A HH   1  
ATOM 280   N N    . PHE A 1 19 ? 0.765   -0.423  0.274   1.00 15.00 ?  315 PHE A N    1  
ATOM 281   C CA   . PHE A 1 19 ? 1.427   0.845   0.456   1.00 15.00 ?  315 PHE A CA   1  
ATOM 282   C C    . PHE A 1 19 ? 1.837   1.387   -0.893  1.00 15.00 ?  315 PHE A C    1  
ATOM 283   O O    . PHE A 1 19 ? 2.607   0.760   -1.604  1.00 15.00 ?  315 PHE A O    1  
ATOM 284   C CB   . PHE A 1 19 ? 2.670   0.695   1.323   1.00 15.00 ?  315 PHE A CB   1  
ATOM 285   C CG   . PHE A 1 19 ? 2.429   0.223   2.728   1.00 15.00 ?  315 PHE A CG   1  
ATOM 286   C CD1  . PHE A 1 19 ? 1.783   -0.974  2.974   1.00 15.00 ?  315 PHE A CD1  1  
ATOM 287   C CD2  . PHE A 1 19 ? 2.879   0.969   3.804   1.00 15.00 ?  315 PHE A CD2  1  
ATOM 288   C CE1  . PHE A 1 19 ? 1.587   -1.417  4.262   1.00 15.00 ?  315 PHE A CE1  1  
ATOM 289   C CE2  . PHE A 1 19 ? 2.692   0.524   5.098   1.00 15.00 ?  315 PHE A CE2  1  
ATOM 290   C CZ   . PHE A 1 19 ? 2.043   -0.672  5.324   1.00 15.00 ?  315 PHE A CZ   1  
ATOM 291   H H    . PHE A 1 19 ? 1.305   -1.240  0.163   1.00 15.00 ?  315 PHE A H    1  
ATOM 292   H HA   . PHE A 1 19 ? 0.737   1.529   0.927   1.00 15.00 ?  315 PHE A HA   1  
ATOM 293   H HB2  . PHE A 1 19 ? 3.334   -0.015  0.854   1.00 15.00 ?  315 PHE A HB2  1  
ATOM 294   H HB3  . PHE A 1 19 ? 3.170   1.652   1.379   1.00 15.00 ?  315 PHE A HB3  1  
ATOM 295   H HD1  . PHE A 1 19 ? 1.423   -1.562  2.142   1.00 15.00 ?  315 PHE A HD1  1  
ATOM 296   H HD2  . PHE A 1 19 ? 3.383   1.907   3.626   1.00 15.00 ?  315 PHE A HD2  1  
ATOM 297   H HE1  . PHE A 1 19 ? 1.079   -2.354  4.439   1.00 15.00 ?  315 PHE A HE1  1  
ATOM 298   H HE2  . PHE A 1 19 ? 3.048   1.114   5.930   1.00 15.00 ?  315 PHE A HE2  1  
ATOM 299   H HZ   . PHE A 1 19 ? 1.902   -1.031  6.327   1.00 15.00 ?  315 PHE A HZ   1  
ATOM 300   N N    . VAL A 1 20 ? 1.340   2.543   -1.251  1.00 15.00 ?  316 VAL A N    1  
ATOM 301   C CA   . VAL A 1 20 ? 1.721   3.124   -2.506  1.00 15.00 ?  316 VAL A CA   1  
ATOM 302   C C    . VAL A 1 20 ? 2.960   3.996   -2.305  1.00 15.00 ?  316 VAL A C    1  
ATOM 303   O O    . VAL A 1 20 ? 2.975   4.882   -1.449  1.00 15.00 ?  316 VAL A O    1  
ATOM 304   C CB   . VAL A 1 20 ? 0.576   3.933   -3.164  1.00 15.00 ?  316 VAL A CB   1  
ATOM 305   C CG1  . VAL A 1 20 ? -0.438  2.993   -3.795  1.00 15.00 ?  316 VAL A CG1  1  
ATOM 306   C CG2  . VAL A 1 20 ? -0.126  4.840   -2.170  1.00 15.00 ?  316 VAL A CG2  1  
ATOM 307   H H    . VAL A 1 20 ? 0.736   3.026   -0.648  1.00 15.00 ?  316 VAL A H    1  
ATOM 308   H HA   . VAL A 1 20 ? 1.966   2.308   -3.161  1.00 15.00 ?  316 VAL A HA   1  
ATOM 309   H HB   . VAL A 1 20 ? 0.999   4.547   -3.945  1.00 15.00 ?  316 VAL A HB   1  
ATOM 310   H HG11 . VAL A 1 20 ? 0.042   2.415   -4.570  1.00 15.00 ?  316 VAL A HG11 1  
ATOM 311   H HG12 . VAL A 1 20 ? -1.246  3.569   -4.224  1.00 15.00 ?  316 VAL A HG12 1  
ATOM 312   H HG13 . VAL A 1 20 ? -0.830  2.327   -3.043  1.00 15.00 ?  316 VAL A HG13 1  
ATOM 313   H HG21 . VAL A 1 20 ? 0.594   5.234   -1.469  1.00 15.00 ?  316 VAL A HG21 1  
ATOM 314   H HG22 . VAL A 1 20 ? -0.886  4.278   -1.642  1.00 15.00 ?  316 VAL A HG22 1  
ATOM 315   H HG23 . VAL A 1 20 ? -0.590  5.656   -2.703  1.00 15.00 ?  316 VAL A HG23 1  
ATOM 316   N N    . ASP A 1 21 ? 4.026   3.723   -3.051  1.00 15.00 ?  317 ASP A N    1  
ATOM 317   C CA   . ASP A 1 21 ? 5.223   4.522   -2.948  1.00 15.00 ?  317 ASP A CA   1  
ATOM 318   C C    . ASP A 1 21 ? 5.108   5.652   -3.934  1.00 15.00 ?  317 ASP A C    1  
ATOM 319   O O    . ASP A 1 21 ? 4.927   5.408   -5.127  1.00 15.00 ?  317 ASP A O    1  
ATOM 320   C CB   . ASP A 1 21 ? 6.489   3.726   -3.295  1.00 15.00 ?  317 ASP A CB   1  
ATOM 321   C CG   . ASP A 1 21 ? 6.419   2.261   -2.944  1.00 15.00 ?  317 ASP A CG   1  
ATOM 322   O OD1  . ASP A 1 21 ? 5.812   1.494   -3.718  1.00 15.00 -1 317 ASP A OD1  1  
ATOM 323   O OD2  . ASP A 1 21 ? 7.015   1.871   -1.925  1.00 15.00 ?  317 ASP A OD2  1  
ATOM 324   H H    . ASP A 1 21 ? 4.016   2.957   -3.672  1.00 15.00 ?  317 ASP A H    1  
ATOM 325   H HA   . ASP A 1 21 ? 5.296   4.914   -1.944  1.00 15.00 ?  317 ASP A HA   1  
ATOM 326   H HB2  . ASP A 1 21 ? 6.676   3.807   -4.354  1.00 15.00 ?  317 ASP A HB2  1  
ATOM 327   H HB3  . ASP A 1 21 ? 7.322   4.154   -2.758  1.00 15.00 ?  317 ASP A HB3  1  
ATOM 328   N N    . HIS A 1 22 ? 5.193   6.883   -3.452  1.00 15.00 ?  318 HIS A N    1  
ATOM 329   C CA   . HIS A 1 22 ? 5.224   8.032   -4.345  1.00 15.00 ?  318 HIS A CA   1  
ATOM 330   C C    . HIS A 1 22 ? 6.584   8.103   -5.027  1.00 15.00 ?  318 HIS A C    1  
ATOM 331   O O    . HIS A 1 22 ? 6.766   8.824   -6.004  1.00 15.00 ?  318 HIS A O    1  
ATOM 332   C CB   . HIS A 1 22 ? 4.927   9.337   -3.602  1.00 15.00 ?  318 HIS A CB   1  
ATOM 333   C CG   . HIS A 1 22 ? 3.505   9.477   -3.127  1.00 15.00 ?  318 HIS A CG   1  
ATOM 334   N ND1  . HIS A 1 22 ? 2.450   8.728   -3.618  1.00 15.00 ?  318 HIS A ND1  1  
ATOM 335   C CD2  . HIS A 1 22 ? 2.969   10.296  -2.193  1.00 15.00 ?  318 HIS A CD2  1  
ATOM 336   C CE1  . HIS A 1 22 ? 1.340   9.084   -3.003  1.00 15.00 ?  318 HIS A CE1  1  
ATOM 337   N NE2  . HIS A 1 22 ? 1.621   10.033  -2.129  1.00 15.00 ?  318 HIS A NE2  1  
ATOM 338   H H    . HIS A 1 22 ? 5.232   7.022   -2.480  1.00 15.00 ?  318 HIS A H    1  
ATOM 339   H HA   . HIS A 1 22 ? 4.467   7.877   -5.101  1.00 15.00 ?  318 HIS A HA   1  
ATOM 340   H HB2  . HIS A 1 22 ? 5.569   9.401   -2.736  1.00 15.00 ?  318 HIS A HB2  1  
ATOM 341   H HB3  . HIS A 1 22 ? 5.141   10.168  -4.259  1.00 15.00 ?  318 HIS A HB3  1  
ATOM 342   H HD1  . HIS A 1 22 ? 2.505   8.033   -4.318  1.00 15.00 ?  318 HIS A HD1  1  
ATOM 343   H HD2  . HIS A 1 22 ? 3.504   11.027  -1.602  1.00 15.00 ?  318 HIS A HD2  1  
ATOM 344   H HE1  . HIS A 1 22 ? 0.359   8.669   -3.184  1.00 15.00 ?  318 HIS A HE1  1  
ATOM 345   H HE2  . HIS A 1 22 ? 1.063   10.222  -1.328  1.00 15.00 ?  318 HIS A HE2  1  
ATOM 346   N N    . ASN A 1 23 ? 7.536   7.351   -4.477  1.00 15.00 ?  319 ASN A N    1  
ATOM 347   C CA   . ASN A 1 23 ? 8.880   7.255   -5.036  1.00 15.00 ?  319 ASN A CA   1  
ATOM 348   C C    . ASN A 1 23 ? 8.844   6.559   -6.393  1.00 15.00 ?  319 ASN A C    1  
ATOM 349   O O    . ASN A 1 23 ? 9.176   7.150   -7.417  1.00 15.00 ?  319 ASN A O    1  
ATOM 350   C CB   . ASN A 1 23 ? 9.808   6.475   -4.089  1.00 15.00 ?  319 ASN A CB   1  
ATOM 351   C CG   . ASN A 1 23 ? 9.726   6.952   -2.650  1.00 15.00 ?  319 ASN A CG   1  
ATOM 352   O OD1  . ASN A 1 23 ? 10.400  7.901   -2.256  1.00 15.00 ?  319 ASN A OD1  1  
ATOM 353   N ND2  . ASN A 1 23 ? 8.919   6.273   -1.845  1.00 15.00 ?  319 ASN A ND2  1  
ATOM 354   H H    . ASN A 1 23 ? 7.329   6.855   -3.661  1.00 15.00 ?  319 ASN A H    1  
ATOM 355   H HA   . ASN A 1 23 ? 9.263   8.257   -5.163  1.00 15.00 ?  319 ASN A HA   1  
ATOM 356   H HB2  . ASN A 1 23 ? 9.538   5.430   -4.113  1.00 15.00 ?  319 ASN A HB2  1  
ATOM 357   H HB3  . ASN A 1 23 ? 10.828  6.585   -4.426  1.00 15.00 ?  319 ASN A HB3  1  
ATOM 358   H HD21 . ASN A 1 23 ? 8.431   5.506   -2.211  1.00 15.00 ?  319 ASN A HD21 1  
ATOM 359   H HD22 . ASN A 1 23 ? 8.841   6.569   -0.913  1.00 15.00 ?  319 ASN A HD22 1  
ATOM 360   N N    . ASN A 1 24 ? 8.422   5.299   -6.393  1.00 15.00 ?  320 ASN A N    1  
ATOM 361   C CA   . ASN A 1 24 ? 8.395   4.498   -7.616  1.00 15.00 ?  320 ASN A CA   1  
ATOM 362   C C    . ASN A 1 24 ? 7.029   4.589   -8.296  1.00 15.00 ?  320 ASN A C    1  
ATOM 363   O O    . ASN A 1 24 ? 6.877   4.225   -9.462  1.00 15.00 ?  320 ASN A O    1  
ATOM 364   C CB   . ASN A 1 24 ? 8.740   3.038   -7.295  1.00 15.00 ?  320 ASN A CB   1  
ATOM 365   C CG   . ASN A 1 24 ? 8.938   2.186   -8.537  1.00 15.00 ?  320 ASN A CG   1  
ATOM 366   O OD1  . ASN A 1 24 ? 8.000   1.570   -9.040  1.00 15.00 ?  320 ASN A OD1  1  
ATOM 367   N ND2  . ASN A 1 24 ? 10.164  2.137   -9.034  1.00 15.00 ?  320 ASN A ND2  1  
ATOM 368   H H    . ASN A 1 24 ? 8.132   4.893   -5.552  1.00 15.00 ?  320 ASN A H    1  
ATOM 369   H HA   . ASN A 1 24 ? 9.142   4.895   -8.287  1.00 15.00 ?  320 ASN A HA   1  
ATOM 370   H HB2  . ASN A 1 24 ? 9.652   3.010   -6.718  1.00 15.00 ?  320 ASN A HB2  1  
ATOM 371   H HB3  . ASN A 1 24 ? 7.939   2.608   -6.710  1.00 15.00 ?  320 ASN A HB3  1  
ATOM 372   H HD21 . ASN A 1 24 ? 10.873  2.643   -8.574  1.00 15.00 ?  320 ASN A HD21 1  
ATOM 373   H HD22 . ASN A 1 24 ? 10.315  1.604   -9.842  1.00 15.00 ?  320 ASN A HD22 1  
ATOM 374   N N    . ARG A 1 25 ? 6.045   5.083   -7.545  1.00 15.00 ?  321 ARG A N    1  
ATOM 375   C CA   . ARG A 1 25 ? 4.664   5.219   -8.017  1.00 15.00 ?  321 ARG A CA   1  
ATOM 376   C C    . ARG A 1 25 ? 4.018   3.853   -8.223  1.00 15.00 ?  321 ARG A C    1  
ATOM 377   O O    . ARG A 1 25 ? 3.334   3.612   -9.218  1.00 15.00 ?  321 ARG A O    1  
ATOM 378   C CB   . ARG A 1 25 ? 4.591   6.057   -9.295  1.00 15.00 ?  321 ARG A CB   1  
ATOM 379   C CG   . ARG A 1 25 ? 4.929   7.523   -9.079  1.00 15.00 ?  321 ARG A CG   1  
ATOM 380   C CD   . ARG A 1 25 ? 4.870   8.301   -10.380 1.00 15.00 ?  321 ARG A CD   1  
ATOM 381   N NE   . ARG A 1 25 ? 3.507   8.434   -10.902 1.00 15.00 ?  321 ARG A NE   1  
ATOM 382   C CZ   . ARG A 1 25 ? 3.059   7.786   -11.981 1.00 15.00 ?  321 ARG A CZ   1  
ATOM 383   N NH1  . ARG A 1 25 ? 3.818   6.874   -12.575 1.00 15.00 1  321 ARG A NH1  1  
ATOM 384   N NH2  . ARG A 1 25 ? 1.842   8.031   -12.453 1.00 15.00 ?  321 ARG A NH2  1  
ATOM 385   H H    . ARG A 1 25 ? 6.252   5.363   -6.632  1.00 15.00 ?  321 ARG A H    1  
ATOM 386   H HA   . ARG A 1 25 ? 4.114   5.732   -7.240  1.00 15.00 ?  321 ARG A HA   1  
ATOM 387   H HB2  . ARG A 1 25 ? 5.283   5.652   -10.019 1.00 15.00 ?  321 ARG A HB2  1  
ATOM 388   H HB3  . ARG A 1 25 ? 3.589   5.996   -9.694  1.00 15.00 ?  321 ARG A HB3  1  
ATOM 389   H HG2  . ARG A 1 25 ? 4.219   7.948   -8.384  1.00 15.00 ?  321 ARG A HG2  1  
ATOM 390   H HG3  . ARG A 1 25 ? 5.925   7.597   -8.669  1.00 15.00 ?  321 ARG A HG3  1  
ATOM 391   H HD2  . ARG A 1 25 ? 5.279   9.287   -10.216 1.00 15.00 ?  321 ARG A HD2  1  
ATOM 392   H HD3  . ARG A 1 25 ? 5.469   7.783   -11.108 1.00 15.00 ?  321 ARG A HD3  1  
ATOM 393   H HE   . ARG A 1 25 ? 2.912   9.071   -10.448 1.00 15.00 ?  321 ARG A HE   1  
ATOM 394   H HH11 . ARG A 1 25 ? 4.734   6.660   -12.216 1.00 15.00 ?  321 ARG A HH11 1  
ATOM 395   H HH12 . ARG A 1 25 ? 3.482   6.394   -13.399 1.00 15.00 ?  321 ARG A HH12 1  
ATOM 396   H HH21 . ARG A 1 25 ? 1.248   8.705   -12.003 1.00 15.00 ?  321 ARG A HH21 1  
ATOM 397   H HH22 . ARG A 1 25 ? 1.511   7.547   -13.269 1.00 15.00 ?  321 ARG A HH22 1  
ATOM 398   N N    . THR A 1 26 ? 4.210   2.980   -7.248  1.00 15.00 ?  322 THR A N    1  
ATOM 399   C CA   . THR A 1 26 ? 3.665   1.623   -7.307  1.00 15.00 ?  322 THR A CA   1  
ATOM 400   C C    . THR A 1 26 ? 2.923   1.282   -6.009  1.00 15.00 ?  322 THR A C    1  
ATOM 401   O O    . THR A 1 26 ? 3.243   1.828   -4.957  1.00 15.00 ?  322 THR A O    1  
ATOM 402   C CB   . THR A 1 26 ? 4.787   0.595   -7.581  1.00 15.00 ?  322 THR A CB   1  
ATOM 403   O OG1  . THR A 1 26 ? 5.450   0.931   -8.808  1.00 15.00 ?  322 THR A OG1  1  
ATOM 404   C CG2  . THR A 1 26 ? 4.239   -0.823  -7.688  1.00 15.00 ?  322 THR A CG2  1  
ATOM 405   H H    . THR A 1 26 ? 4.707   3.265   -6.444  1.00 15.00 ?  322 THR A H    1  
ATOM 406   H HA   . THR A 1 26 ? 2.964   1.585   -8.128  1.00 15.00 ?  322 THR A HA   1  
ATOM 407   H HB   . THR A 1 26 ? 5.500   0.633   -6.770  1.00 15.00 ?  322 THR A HB   1  
ATOM 408   H HG1  . THR A 1 26 ? 6.324   1.299   -8.612  1.00 15.00 ?  322 THR A HG1  1  
ATOM 409   H HG21 . THR A 1 26 ? 3.524   -0.873  -8.497  1.00 15.00 ?  322 THR A HG21 1  
ATOM 410   H HG22 . THR A 1 26 ? 3.754   -1.093  -6.761  1.00 15.00 ?  322 THR A HG22 1  
ATOM 411   H HG23 . THR A 1 26 ? 5.050   -1.509  -7.883  1.00 15.00 ?  322 THR A HG23 1  
ATOM 412   N N    . THR A 1 27 ? 1.904   0.424   -6.089  1.00 15.00 ?  323 THR A N    1  
ATOM 413   C CA   . THR A 1 27 ? 1.198   -0.022  -4.891  1.00 15.00 ?  323 THR A CA   1  
ATOM 414   C C    . THR A 1 27 ? 1.804   -1.327  -4.368  1.00 15.00 ?  323 THR A C    1  
ATOM 415   O O    . THR A 1 27 ? 2.275   -2.159  -5.145  1.00 15.00 ?  323 THR A O    1  
ATOM 416   C CB   . THR A 1 27 ? -0.319  -0.187  -5.134  1.00 15.00 ?  323 THR A CB   1  
ATOM 417   O OG1  . THR A 1 27 ? -0.991  -0.435  -3.895  1.00 15.00 ?  323 THR A OG1  1  
ATOM 418   C CG2  . THR A 1 27 ? -0.620  -1.317  -6.100  1.00 15.00 ?  323 THR A CG2  1  
ATOM 419   H H    . THR A 1 27 ? 1.629   0.081   -6.965  1.00 15.00 ?  323 THR A H    1  
ATOM 420   H HA   . THR A 1 27 ? 1.332   0.734   -4.140  1.00 15.00 ?  323 THR A HA   1  
ATOM 421   H HB   . THR A 1 27 ? -0.697  0.734   -5.557  1.00 15.00 ?  323 THR A HB   1  
ATOM 422   H HG1  . THR A 1 27 ? -1.659  0.243   -3.755  1.00 15.00 ?  323 THR A HG1  1  
ATOM 423   H HG21 . THR A 1 27 ? -0.278  -1.051  -7.086  1.00 15.00 ?  323 THR A HG21 1  
ATOM 424   H HG22 . THR A 1 27 ? -1.687  -1.492  -6.120  1.00 15.00 ?  323 THR A HG22 1  
ATOM 425   H HG23 . THR A 1 27 ? -0.114  -2.212  -5.772  1.00 15.00 ?  323 THR A HG23 1  
ATOM 426   N N    . GLN A 1 28 ? 1.808   -1.492  -3.050  1.00 15.00 ?  324 GLN A N    1  
ATOM 427   C CA   . GLN A 1 28 ? 2.513   -2.603  -2.420  1.00 15.00 ?  324 GLN A CA   1  
ATOM 428   C C    . GLN A 1 28 ? 1.625   -3.404  -1.470  1.00 15.00 ?  324 GLN A C    1  
ATOM 429   O O    . GLN A 1 28 ? 1.501   -3.053  -0.304  1.00 15.00 ?  324 GLN A O    1  
ATOM 430   C CB   . GLN A 1 28 ? 3.727   -2.090  -1.623  1.00 15.00 ?  324 GLN A CB   1  
ATOM 431   C CG   . GLN A 1 28 ? 4.768   -1.353  -2.448  1.00 15.00 ?  324 GLN A CG   1  
ATOM 432   C CD   . GLN A 1 28 ? 5.532   -2.270  -3.388  1.00 15.00 ?  324 GLN A CD   1  
ATOM 433   O OE1  . GLN A 1 28 ? 6.580   -2.815  -3.035  1.00 15.00 ?  324 GLN A OE1  1  
ATOM 434   N NE2  . GLN A 1 28 ? 5.006   -2.464  -4.585  1.00 15.00 ?  324 GLN A NE2  1  
ATOM 435   H H    . GLN A 1 28 ? 1.337   -0.842  -2.486  1.00 15.00 ?  324 GLN A H    1  
ATOM 436   H HA   . GLN A 1 28 ? 2.866   -3.256  -3.203  1.00 15.00 ?  324 GLN A HA   1  
ATOM 437   H HB2  . GLN A 1 28 ? 3.372   -1.415  -0.859  1.00 15.00 ?  324 GLN A HB2  1  
ATOM 438   H HB3  . GLN A 1 28 ? 4.211   -2.928  -1.144  1.00 15.00 ?  324 GLN A HB3  1  
ATOM 439   H HG2  . GLN A 1 28 ? 4.270   -0.594  -3.032  1.00 15.00 ?  324 GLN A HG2  1  
ATOM 440   H HG3  . GLN A 1 28 ? 5.470   -0.878  -1.773  1.00 15.00 ?  324 GLN A HG3  1  
ATOM 441   H HE21 . GLN A 1 28 ? 4.160   -2.011  -4.798  1.00 15.00 ?  324 GLN A HE21 1  
ATOM 442   H HE22 . GLN A 1 28 ? 5.478   -3.050  -5.208  1.00 15.00 ?  324 GLN A HE22 1  
ATOM 443   N N    . PHE A 1 29 ? 1.008   -4.477  -1.968  1.00 15.00 ?  325 PHE A N    1  
ATOM 444   C CA   . PHE A 1 29 ? 0.438   -5.509  -1.086  1.00 15.00 ?  325 PHE A CA   1  
ATOM 445   C C    . PHE A 1 29 ? 1.566   -6.230  -0.396  1.00 15.00 ?  325 PHE A C    1  
ATOM 446   O O    . PHE A 1 29 ? 1.384   -7.086  0.466   1.00 15.00 ?  325 PHE A O    1  
ATOM 447   C CB   . PHE A 1 29 ? -0.445  -6.501  -1.829  1.00 15.00 ?  325 PHE A CB   1  
ATOM 448   C CG   . PHE A 1 29 ? -1.882  -6.115  -1.772  1.00 15.00 ?  325 PHE A CG   1  
ATOM 449   C CD1  . PHE A 1 29 ? -2.401  -5.504  -0.638  1.00 15.00 ?  325 PHE A CD1  1  
ATOM 450   C CD2  . PHE A 1 29 ? -2.715  -6.346  -2.847  1.00 15.00 ?  325 PHE A CD2  1  
ATOM 451   C CE1  . PHE A 1 29 ? -3.729  -5.129  -0.604  1.00 15.00 ?  325 PHE A CE1  1  
ATOM 452   C CE2  . PHE A 1 29 ? -4.042  -5.978  -2.809  1.00 15.00 ?  325 PHE A CE2  1  
ATOM 453   C CZ   . PHE A 1 29 ? -4.549  -5.366  -1.689  1.00 15.00 ?  325 PHE A CZ   1  
ATOM 454   H H    . PHE A 1 29 ? 0.928   -4.578  -2.940  1.00 15.00 ?  325 PHE A H    1  
ATOM 455   H HA   . PHE A 1 29 ? -0.154  -5.003  -0.336  1.00 15.00 ?  325 PHE A HA   1  
ATOM 456   H HB2  . PHE A 1 29 ? -0.144  -6.546  -2.868  1.00 15.00 ?  325 PHE A HB2  1  
ATOM 457   H HB3  . PHE A 1 29 ? -0.342  -7.478  -1.382  1.00 15.00 ?  325 PHE A HB3  1  
ATOM 458   H HD1  . PHE A 1 29 ? -1.746  -5.316  0.238   1.00 15.00 ?  325 PHE A HD1  1  
ATOM 459   H HD2  . PHE A 1 29 ? -2.320  -6.829  -3.726  1.00 15.00 ?  325 PHE A HD2  1  
ATOM 460   H HE1  . PHE A 1 29 ? -4.134  -4.665  0.278   1.00 15.00 ?  325 PHE A HE1  1  
ATOM 461   H HE2  . PHE A 1 29 ? -4.680  -6.166  -3.660  1.00 15.00 ?  325 PHE A HE2  1  
ATOM 462   H HZ   . PHE A 1 29 ? -5.587  -5.072  -1.657  1.00 15.00 ?  325 PHE A HZ   1  
ATOM 463   N N    . THR A 1 30 ? 2.734   -5.909  -0.875  1.00 15.00 ?  326 THR A N    1  
ATOM 464   C CA   . THR A 1 30 ? 3.962   -6.420  -0.321  1.00 15.00 ?  326 THR A CA   1  
ATOM 465   C C    . THR A 1 30 ? 4.381   -5.420  0.741   1.00 15.00 ?  326 THR A C    1  
ATOM 466   O O    . THR A 1 30 ? 5.068   -4.436  0.459   1.00 15.00 ?  326 THR A O    1  
ATOM 467   C CB   . THR A 1 30 ? 5.054   -6.566  -1.398  1.00 15.00 ?  326 THR A CB   1  
ATOM 468   O OG1  . THR A 1 30 ? 4.547   -7.363  -2.478  1.00 15.00 ?  326 THR A OG1  1  
ATOM 469   C CG2  . THR A 1 30 ? 6.304   -7.223  -0.827  1.00 15.00 ?  326 THR A CG2  1  
ATOM 470   H H    . THR A 1 30 ? 2.759   -5.205  -1.551  1.00 15.00 ?  326 THR A H    1  
ATOM 471   H HA   . THR A 1 30 ? 3.767   -7.388  0.120   1.00 15.00 ?  326 THR A HA   1  
ATOM 472   H HB   . THR A 1 30 ? 5.313   -5.585  -1.770  1.00 15.00 ?  326 THR A HB   1  
ATOM 473   H HG1  . THR A 1 30 ? 3.850   -7.944  -2.143  1.00 15.00 ?  326 THR A HG1  1  
ATOM 474   H HG21 . THR A 1 30 ? 7.049   -7.315  -1.603  1.00 15.00 ?  326 THR A HG21 1  
ATOM 475   H HG22 . THR A 1 30 ? 6.054   -8.203  -0.448  1.00 15.00 ?  326 THR A HG22 1  
ATOM 476   H HG23 . THR A 1 30 ? 6.695   -6.615  -0.024  1.00 15.00 ?  326 THR A HG23 1  
ATOM 477   N N    . ASP A 1 31 ? 3.913   -5.648  1.949   1.00 15.00 ?  327 ASP A N    1  
ATOM 478   C CA   . ASP A 1 31 ? 3.836   -4.606  2.930   1.00 15.00 ?  327 ASP A CA   1  
ATOM 479   C C    . ASP A 1 31 ? 4.745   -4.790  4.091   1.00 15.00 ?  327 ASP A C    1  
ATOM 480   O O    . ASP A 1 31 ? 5.099   -5.898  4.499   1.00 15.00 ?  327 ASP A O    1  
ATOM 481   C CB   . ASP A 1 31 ? 2.429   -4.404  3.447   1.00 15.00 ?  327 ASP A CB   1  
ATOM 482   C CG   . ASP A 1 31 ? 1.666   -5.692  3.690   1.00 15.00 ?  327 ASP A CG   1  
ATOM 483   O OD1  . ASP A 1 31 ? 2.292   -6.673  4.139   1.00 15.00 ?  327 ASP A OD1  1  
ATOM 484   O OD2  . ASP A 1 31 ? 0.440   -5.704  3.496   1.00 15.00 -1 327 ASP A OD2  1  
ATOM 485   H H    . ASP A 1 31 ? 3.599   -6.546  2.197   1.00 15.00 ?  327 ASP A H    1  
ATOM 486   H HA   . ASP A 1 31 ? 4.126   -3.690  2.440   1.00 15.00 ?  327 ASP A HA   1  
ATOM 487   H HB2  . ASP A 1 31 ? 2.490   -3.876  4.389   1.00 15.00 ?  327 ASP A HB2  1  
ATOM 488   H HB3  . ASP A 1 31 ? 1.908   -3.790  2.746   1.00 15.00 ?  327 ASP A HB3  1  
ATOM 489   N N    . PRO A 1 32 ? 5.126   -3.650  4.630   1.00 15.00 ?  328 PRO A N    1  
ATOM 490   C CA   . PRO A 1 32 ? 5.802   -3.560  5.898   1.00 15.00 ?  328 PRO A CA   1  
ATOM 491   C C    . PRO A 1 32 ? 4.844   -4.062  6.985   1.00 15.00 ?  328 PRO A C    1  
ATOM 492   O O    . PRO A 1 32 ? 5.234   -4.305  8.123   1.00 15.00 ?  328 PRO A O    1  
ATOM 493   C CB   . PRO A 1 32 ? 6.137   -2.061  6.025   1.00 15.00 ?  328 PRO A CB   1  
ATOM 494   C CG   . PRO A 1 32 ? 5.894   -1.491  4.656   1.00 15.00 ?  328 PRO A CG   1  
ATOM 495   C CD   . PRO A 1 32 ? 4.827   -2.326  4.071   1.00 15.00 ?  328 PRO A CD   1  
ATOM 496   H HA   . PRO A 1 32 ? 6.708   -4.151  5.911   1.00 15.00 ?  328 PRO A HA   1  
ATOM 497   H HB2  . PRO A 1 32 ? 5.491   -1.608  6.762   1.00 15.00 ?  328 PRO A HB2  1  
ATOM 498   H HB3  . PRO A 1 32 ? 7.168   -1.944  6.322   1.00 15.00 ?  328 PRO A HB3  1  
ATOM 499   H HG2  . PRO A 1 32 ? 5.579   -0.460  4.728   1.00 15.00 ?  328 PRO A HG2  1  
ATOM 500   H HG3  . PRO A 1 32 ? 6.767   -1.577  4.039   1.00 15.00 ?  328 PRO A HG3  1  
ATOM 501   H HD2  . PRO A 1 32 ? 3.855   -1.978  4.390   1.00 15.00 ?  328 PRO A HD2  1  
ATOM 502   H HD3  . PRO A 1 32 ? 4.898   -2.337  2.995   1.00 15.00 ?  328 PRO A HD3  1  
ATOM 503   N N    . ARG A 1 33 ? 3.561   -4.169  6.593   1.00 15.00 ?  329 ARG A N    1  
ATOM 504   C CA   . ARG A 1 33 ? 2.517   -4.762  7.421   1.00 15.00 ?  329 ARG A CA   1  
ATOM 505   C C    . ARG A 1 33 ? 2.838   -6.219  7.761   1.00 15.00 ?  329 ARG A C    1  
ATOM 506   O O    . ARG A 1 33 ? 3.129   -6.534  8.917   1.00 15.00 ?  329 ARG A O    1  
ATOM 507   C CB   . ARG A 1 33 ? 1.133   -4.664  6.732   1.00 15.00 ?  329 ARG A CB   1  
ATOM 508   C CG   . ARG A 1 33 ? 0.394   -3.382  7.075   1.00 15.00 ?  329 ARG A CG   1  
ATOM 509   C CD   . ARG A 1 33 ? 0.141   -3.281  8.572   1.00 15.00 ?  329 ARG A CD   1  
ATOM 510   N NE   . ARG A 1 33 ? -0.441  -4.512  9.101   1.00 15.00 ?  329 ARG A NE   1  
ATOM 511   C CZ   . ARG A 1 33 ? 0.015   -5.148  10.181  1.00 15.00 ?  329 ARG A CZ   1  
ATOM 512   N NH1  . ARG A 1 33 ? 0.988   -4.616  10.915  1.00 15.00 1  329 ARG A NH1  1  
ATOM 513   N NH2  . ARG A 1 33 ? -0.514  -6.310  10.533  1.00 15.00 ?  329 ARG A NH2  1  
ATOM 514   H H    . ARG A 1 33 ? 3.320   -3.846  5.700   1.00 15.00 ?  329 ARG A H    1  
ATOM 515   H HA   . ARG A 1 33 ? 2.481   -4.201  8.343   1.00 15.00 ?  329 ARG A HA   1  
ATOM 516   H HB2  . ARG A 1 33 ? 1.235   -4.722  5.632   1.00 15.00 ?  329 ARG A HB2  1  
ATOM 517   H HB3  . ARG A 1 33 ? 0.528   -5.495  7.064   1.00 15.00 ?  329 ARG A HB3  1  
ATOM 518   H HG2  . ARG A 1 33 ? 0.991   -2.537  6.763   1.00 15.00 ?  329 ARG A HG2  1  
ATOM 519   H HG3  . ARG A 1 33 ? -0.554  -3.371  6.556   1.00 15.00 ?  329 ARG A HG3  1  
ATOM 520   H HD2  . ARG A 1 33 ? 1.080   -3.091  9.073   1.00 15.00 ?  329 ARG A HD2  1  
ATOM 521   H HD3  . ARG A 1 33 ? -0.538  -2.461  8.756   1.00 15.00 ?  329 ARG A HD3  1  
ATOM 522   H HE   . ARG A 1 33 ? -1.197  -4.906  8.602   1.00 15.00 ?  329 ARG A HE   1  
ATOM 523   H HH11 . ARG A 1 33 ? 1.386   -3.735  10.662  1.00 15.00 ?  329 ARG A HH11 1  
ATOM 524   H HH12 . ARG A 1 33 ? 1.325   -5.097  11.735  1.00 15.00 ?  329 ARG A HH12 1  
ATOM 525   H HH21 . ARG A 1 33 ? -1.261  -6.709  9.991   1.00 15.00 ?  329 ARG A HH21 1  
ATOM 526   H HH22 . ARG A 1 33 ? -0.146  -6.818  11.333  1.00 15.00 ?  329 ARG A HH22 1  
ATOM 527   N N    . LEU A 1 34 ? 2.818   -7.095  6.760   1.00 15.00 ?  330 LEU A N    1  
ATOM 528   C CA   . LEU A 1 34 ? 3.092   -8.513  6.982   1.00 15.00 ?  330 LEU A CA   1  
ATOM 529   C C    . LEU A 1 34 ? 4.568   -8.707  7.336   1.00 15.00 ?  330 LEU A C    1  
ATOM 530   O O    . LEU A 1 34 ? 4.962   -9.722  7.915   1.00 15.00 ?  330 LEU A O    1  
ATOM 531   C CB   . LEU A 1 34 ? 2.715   -9.322  5.728   1.00 15.00 ?  330 LEU A CB   1  
ATOM 532   C CG   . LEU A 1 34 ? 2.250   -10.771 5.955   1.00 15.00 ?  330 LEU A CG   1  
ATOM 533   C CD1  . LEU A 1 34 ? 3.412   -11.689 6.296   1.00 15.00 ?  330 LEU A CD1  1  
ATOM 534   C CD2  . LEU A 1 34 ? 1.192   -10.826 7.047   1.00 15.00 ?  330 LEU A CD2  1  
ATOM 535   H H    . LEU A 1 34 ? 2.602   -6.786  5.844   1.00 15.00 ?  330 LEU A H    1  
ATOM 536   H HA   . LEU A 1 34 ? 2.486   -8.844  7.813   1.00 15.00 ?  330 LEU A HA   1  
ATOM 537   H HB2  . LEU A 1 34 ? 1.924   -8.796  5.216   1.00 15.00 ?  330 LEU A HB2  1  
ATOM 538   H HB3  . LEU A 1 34 ? 3.578   -9.350  5.079   1.00 15.00 ?  330 LEU A HB3  1  
ATOM 539   H HG   . LEU A 1 34 ? 1.801   -11.138 5.044   1.00 15.00 ?  330 LEU A HG   1  
ATOM 540   H HD11 . LEU A 1 34 ? 4.124   -11.684 5.484   1.00 15.00 ?  330 LEU A HD11 1  
ATOM 541   H HD12 . LEU A 1 34 ? 3.045   -12.693 6.447   1.00 15.00 ?  330 LEU A HD12 1  
ATOM 542   H HD13 . LEU A 1 34 ? 3.893   -11.342 7.199   1.00 15.00 ?  330 LEU A HD13 1  
ATOM 543   H HD21 . LEU A 1 34 ? 0.884   -11.850 7.198   1.00 15.00 ?  330 LEU A HD21 1  
ATOM 544   H HD22 . LEU A 1 34 ? 0.340   -10.232 6.752   1.00 15.00 ?  330 LEU A HD22 1  
ATOM 545   H HD23 . LEU A 1 34 ? 1.603   -10.434 7.966   1.00 15.00 ?  330 LEU A HD23 1  
ATOM 546   N N    . SER A 1 35 ? 5.383   -7.720  6.983   1.00 15.00 ?  331 SER A N    1  
ATOM 547   C CA   . SER A 1 35 ? 6.807   -7.747  7.290   1.00 15.00 ?  331 SER A CA   1  
ATOM 548   C C    . SER A 1 35 ? 7.050   -7.483  8.782   1.00 15.00 ?  331 SER A C    1  
ATOM 549   O O    . SER A 1 35 ? 8.167   -7.632  9.281   1.00 15.00 ?  331 SER A O    1  
ATOM 550   C CB   . SER A 1 35 ? 7.547   -6.709  6.436   1.00 15.00 ?  331 SER A CB   1  
ATOM 551   O OG   . SER A 1 35 ? 8.952   -6.877  6.508   1.00 15.00 ?  331 SER A OG   1  
ATOM 552   H H    . SER A 1 35 ? 5.016   -6.956  6.488   1.00 15.00 ?  331 SER A H    1  
ATOM 553   H HA   . SER A 1 35 ? 7.180   -8.731  7.045   1.00 15.00 ?  331 SER A HA   1  
ATOM 554   H HB2  . SER A 1 35 ? 7.242   -6.813  5.406   1.00 15.00 ?  331 SER A HB2  1  
ATOM 555   H HB3  . SER A 1 35 ? 7.297   -5.717  6.785   1.00 15.00 ?  331 SER A HB3  1  
ATOM 556   H HG   . SER A 1 35 ? 9.174   -7.792  6.274   1.00 15.00 ?  331 SER A HG   1  
ATOM 557   N N    . ALA A 1 36 ? 5.998   -7.083  9.487   1.00 15.00 ?  332 ALA A N    1  
ATOM 558   C CA   . ALA A 1 36 ? 6.097   -6.806  10.911  1.00 15.00 ?  332 ALA A CA   1  
ATOM 559   C C    . ALA A 1 36 ? 5.293   -7.818  11.719  1.00 15.00 ?  332 ALA A C    1  
ATOM 560   O O    . ALA A 1 36 ? 5.864   -8.626  12.454  1.00 15.00 ?  332 ALA A O    1  
ATOM 561   C CB   . ALA A 1 36 ? 5.623   -5.392  11.212  1.00 15.00 ?  332 ALA A CB   1  
ATOM 562   H H    . ALA A 1 36 ? 5.132   -6.975  9.038   1.00 15.00 ?  332 ALA A H    1  
ATOM 563   H HA   . ALA A 1 36 ? 7.137   -6.879  11.193  1.00 15.00 ?  332 ALA A HA   1  
ATOM 564   H HB1  . ALA A 1 36 ? 4.579   -5.300  10.952  1.00 15.00 ?  332 ALA A HB1  1  
ATOM 565   H HB2  . ALA A 1 36 ? 6.202   -4.688  10.631  1.00 15.00 ?  332 ALA A HB2  1  
ATOM 566   H HB3  . ALA A 1 36 ? 5.753   -5.183  12.264  1.00 15.00 ?  332 ALA A HB3  1  
ATOM 567   N N    . ASN A 1 37 ? 3.972   -7.779  11.563  1.00 15.00 ?  333 ASN A N    1  
ATOM 568   C CA   . ASN A 1 37 ? 3.072   -8.633  12.336  1.00 15.00 ?  333 ASN A CA   1  
ATOM 569   C C    . ASN A 1 37 ? 1.628   -8.390  11.914  1.00 15.00 ?  333 ASN A C    1  
ATOM 570   O O    . ASN A 1 37 ? 1.103   -9.182  11.107  1.00 15.00 ?  333 ASN A O    1  
ATOM 571   C CB   . ASN A 1 37 ? 3.224   -8.361  13.838  1.00 15.00 ?  333 ASN A CB   1  
ATOM 572   C CG   . ASN A 1 37 ? 2.286   -9.194  14.692  1.00 15.00 ?  333 ASN A CG   1  
ATOM 573   O OD1  . ASN A 1 37 ? 1.942   -10.328 14.353  1.00 15.00 ?  333 ASN A OD1  1  
ATOM 574   N ND2  . ASN A 1 37 ? 1.864   -8.629  15.812  1.00 15.00 ?  333 ASN A ND2  1  
ATOM 575   O OXT  . ASN A 1 37 ? 1.036   -7.388  12.371  1.00 15.00 ?  333 ASN A OXT  1  
ATOM 576   H H    . ASN A 1 37 ? 3.586   -7.167  10.899  1.00 15.00 ?  333 ASN A H    1  
ATOM 577   H HA   . ASN A 1 37 ? 3.329   -9.661  12.133  1.00 15.00 ?  333 ASN A HA   1  
ATOM 578   H HB2  . ASN A 1 37 ? 4.237   -8.584  14.134  1.00 15.00 ?  333 ASN A HB2  1  
ATOM 579   H HB3  . ASN A 1 37 ? 3.021   -7.317  14.028  1.00 15.00 ?  333 ASN A HB3  1  
ATOM 580   H HD21 . ASN A 1 37 ? 2.178   -7.726  16.019  1.00 15.00 ?  333 ASN A HD21 1  
ATOM 581   H HD22 . ASN A 1 37 ? 1.248   -9.140  16.391  1.00 15.00 ?  333 ASN A HD22 1  
ATOM 582   N N    . GLU B 2 1  ? 3.630   -8.988  -6.223  1.00 15.00 ?  203 GLU B N    1  
ATOM 583   C CA   . GLU B 2 1  ? 2.913   -9.154  -4.939  1.00 15.00 ?  203 GLU B CA   1  
ATOM 584   C C    . GLU B 2 1  ? 2.361   -10.569 -4.836  1.00 15.00 ?  203 GLU B C    1  
ATOM 585   O O    . GLU B 2 1  ? 1.657   -11.031 -5.732  1.00 15.00 ?  203 GLU B O    1  
ATOM 586   C CB   . GLU B 2 1  ? 1.768   -8.132  -4.812  1.00 15.00 ?  203 GLU B CB   1  
ATOM 587   C CG   . GLU B 2 1  ? 2.227   -6.679  -4.713  1.00 15.00 ?  203 GLU B CG   1  
ATOM 588   C CD   . GLU B 2 1  ? 2.917   -6.184  -5.969  1.00 15.00 ?  203 GLU B CD   1  
ATOM 589   O OE1  . GLU B 2 1  ? 4.137   -6.402  -6.104  1.00 15.00 ?  203 GLU B OE1  1  
ATOM 590   O OE2  . GLU B 2 1  ? 2.243   -5.594  -6.833  1.00 15.00 -1 203 GLU B OE2  1  
ATOM 591   H H1   . GLU B 2 1  ? 3.978   -8.007  -6.318  1.00 15.00 ?  203 GLU B H1   1  
ATOM 592   H H2   . GLU B 2 1  ? 2.996   -9.202  -7.019  1.00 15.00 ?  203 GLU B H2   1  
ATOM 593   H H3   . GLU B 2 1  ? 4.446   -9.638  -6.262  1.00 15.00 ?  203 GLU B H3   1  
ATOM 594   H HA   . GLU B 2 1  ? 3.618   -8.997  -4.136  1.00 15.00 ?  203 GLU B HA   1  
ATOM 595   H HB2  . GLU B 2 1  ? 1.123   -8.222  -5.674  1.00 15.00 ?  203 GLU B HB2  1  
ATOM 596   H HB3  . GLU B 2 1  ? 1.195   -8.364  -3.925  1.00 15.00 ?  203 GLU B HB3  1  
ATOM 597   H HG2  . GLU B 2 1  ? 1.366   -6.055  -4.527  1.00 15.00 ?  203 GLU B HG2  1  
ATOM 598   H HG3  . GLU B 2 1  ? 2.916   -6.593  -3.885  1.00 15.00 ?  203 GLU B HG3  1  
ATOM 599   N N    . LEU B 2 2  ? 2.691   -11.256 -3.745  1.00 15.00 ?  204 LEU B N    1  
ATOM 600   C CA   . LEU B 2 2  ? 2.206   -12.615 -3.512  1.00 15.00 ?  204 LEU B CA   1  
ATOM 601   C C    . LEU B 2 2  ? 0.702   -12.616 -3.250  1.00 15.00 ?  204 LEU B C    1  
ATOM 602   O O    . LEU B 2 2  ? 0.029   -13.638 -3.385  1.00 15.00 ?  204 LEU B O    1  
ATOM 603   C CB   . LEU B 2 2  ? 2.945   -13.252 -2.332  1.00 15.00 ?  204 LEU B CB   1  
ATOM 604   C CG   . LEU B 2 2  ? 2.617   -14.725 -2.070  1.00 15.00 ?  204 LEU B CG   1  
ATOM 605   C CD1  . LEU B 2 2  ? 3.078   -15.593 -3.232  1.00 15.00 ?  204 LEU B CD1  1  
ATOM 606   C CD2  . LEU B 2 2  ? 3.250   -15.188 -0.768  1.00 15.00 ?  204 LEU B CD2  1  
ATOM 607   H H    . LEU B 2 2  ? 3.296   -10.843 -3.085  1.00 15.00 ?  204 LEU B H    1  
ATOM 608   H HA   . LEU B 2 2  ? 2.402   -13.193 -4.402  1.00 15.00 ?  204 LEU B HA   1  
ATOM 609   H HB2  . LEU B 2 2  ? 4.006   -13.167 -2.514  1.00 15.00 ?  204 LEU B HB2  1  
ATOM 610   H HB3  . LEU B 2 2  ? 2.706   -12.692 -1.441  1.00 15.00 ?  204 LEU B HB3  1  
ATOM 611   H HG   . LEU B 2 2  ? 1.545   -14.836 -1.979  1.00 15.00 ?  204 LEU B HG   1  
ATOM 612   H HD11 . LEU B 2 2  ? 4.146   -15.492 -3.355  1.00 15.00 ?  204 LEU B HD11 1  
ATOM 613   H HD12 . LEU B 2 2  ? 2.580   -15.275 -4.137  1.00 15.00 ?  204 LEU B HD12 1  
ATOM 614   H HD13 . LEU B 2 2  ? 2.834   -16.625 -3.030  1.00 15.00 ?  204 LEU B HD13 1  
ATOM 615   H HD21 . LEU B 2 2  ? 2.874   -14.588 0.049   1.00 15.00 ?  204 LEU B HD21 1  
ATOM 616   H HD22 . LEU B 2 2  ? 4.324   -15.080 -0.829  1.00 15.00 ?  204 LEU B HD22 1  
ATOM 617   H HD23 . LEU B 2 2  ? 3.002   -16.225 -0.596  1.00 15.00 ?  204 LEU B HD23 1  
ATOM 618   N N    . GLU B 2 3  ? 0.188   -11.465 -2.859  1.00 15.00 ?  205 GLU B N    1  
ATOM 619   C CA   . GLU B 2 3  ? -1.235  -11.295 -2.649  1.00 15.00 ?  205 GLU B CA   1  
ATOM 620   C C    . GLU B 2 3  ? -1.895  -10.917 -3.975  1.00 15.00 ?  205 GLU B C    1  
ATOM 621   O O    . GLU B 2 3  ? -1.207  -10.546 -4.927  1.00 15.00 ?  205 GLU B O    1  
ATOM 622   C CB   . GLU B 2 3  ? -1.464  -10.215 -1.579  1.00 15.00 ?  205 GLU B CB   1  
ATOM 623   C CG   . GLU B 2 3  ? -2.922  -9.983  -1.204  1.00 15.00 ?  205 GLU B CG   1  
ATOM 624   C CD   . GLU B 2 3  ? -3.652  -11.263 -0.850  1.00 15.00 ?  205 GLU B CD   1  
ATOM 625   O OE1  . GLU B 2 3  ? -3.525  -11.738 0.298   1.00 15.00 ?  205 GLU B OE1  1  
ATOM 626   O OE2  . GLU B 2 3  ? -4.356  -11.804 -1.730  1.00 15.00 -1 205 GLU B OE2  1  
ATOM 627   H H    . GLU B 2 3  ? 0.785   -10.701 -2.715  1.00 15.00 ?  205 GLU B H    1  
ATOM 628   H HA   . GLU B 2 3  ? -1.641  -12.233 -2.305  1.00 15.00 ?  205 GLU B HA   1  
ATOM 629   H HB2  . GLU B 2 3  ? -0.930  -10.498 -0.685  1.00 15.00 ?  205 GLU B HB2  1  
ATOM 630   H HB3  . GLU B 2 3  ? -1.059  -9.282  -1.943  1.00 15.00 ?  205 GLU B HB3  1  
ATOM 631   H HG2  . GLU B 2 3  ? -2.959  -9.320  -0.352  1.00 15.00 ?  205 GLU B HG2  1  
ATOM 632   H HG3  . GLU B 2 3  ? -3.424  -9.519  -2.040  1.00 15.00 ?  205 GLU B HG3  1  
ATOM 633   N N    . SER B 2 4  ? -3.212  -11.046 -4.033  1.00 15.00 ?  206 SER B N    1  
ATOM 634   C CA   . SER B 2 4  ? -3.998  -10.652 -5.194  1.00 15.00 ?  206 SER B CA   1  
ATOM 635   C C    . SER B 2 4  ? -3.652  -9.256  -5.680  1.00 15.00 ?  206 SER B C    1  
ATOM 636   O O    . SER B 2 4  ? -3.222  -8.389  -4.922  1.00 15.00 ?  206 SER B O    1  
ATOM 637   C CB   . SER B 2 4  ? -5.477  -10.746 -4.863  1.00 15.00 ?  206 SER B CB   1  
ATOM 638   O OG   . SER B 2 4  ? -5.739  -10.385 -3.512  1.00 15.00 ?  206 SER B OG   1  
ATOM 639   H H    . SER B 2 4  ? -3.682  -11.420 -3.251  1.00 15.00 ?  206 SER B H    1  
ATOM 640   H HA   . SER B 2 4  ? -3.803  -11.337 -6.011  1.00 15.00 ?  206 SER B HA   1  
ATOM 641   H HB2  . SER B 2 4  ? -6.022  -10.080 -5.517  1.00 15.00 ?  206 SER B HB2  1  
ATOM 642   H HB3  . SER B 2 4  ? -5.803  -11.756 -5.036  1.00 15.00 ?  206 SER B HB3  1  
ATOM 643   H HG   . SER B 2 4  ? -5.304  -11.018 -2.914  1.00 15.00 ?  206 SER B HG   1  
ATOM 644   N N    . PRO B 2 5  ? -3.889  -9.064  -6.970  1.00 15.00 ?  207 PRO B N    1  
ATOM 645   C CA   . PRO B 2 5  ? -3.609  -7.823  -7.689  1.00 15.00 ?  207 PRO B CA   1  
ATOM 646   C C    . PRO B 2 5  ? -4.151  -6.599  -6.945  1.00 15.00 ?  207 PRO B C    1  
ATOM 647   O O    . PRO B 2 5  ? -5.355  -6.501  -6.691  1.00 15.00 ?  207 PRO B O    1  
ATOM 648   C CB   . PRO B 2 5  ? -4.371  -8.010  -9.006  1.00 15.00 ?  207 PRO B CB   1  
ATOM 649   C CG   . PRO B 2 5  ? -4.527  -9.486  -9.188  1.00 15.00 ?  207 PRO B CG   1  
ATOM 650   C CD   . PRO B 2 5  ? -4.410  -10.121 -7.827  1.00 15.00 ?  207 PRO B CD   1  
ATOM 651   H HA   . PRO B 2 5  ? -2.560  -7.706  -7.892  1.00 15.00 ?  207 PRO B HA   1  
ATOM 652   H HB2  . PRO B 2 5  ? -5.332  -7.521  -8.938  1.00 15.00 ?  207 PRO B HB2  1  
ATOM 653   H HB3  . PRO B 2 5  ? -3.802  -7.574  -9.814  1.00 15.00 ?  207 PRO B HB3  1  
ATOM 654   H HG2  . PRO B 2 5  ? -5.495  -9.699  -9.615  1.00 15.00 ?  207 PRO B HG2  1  
ATOM 655   H HG3  . PRO B 2 5  ? -3.745  -9.854  -9.837  1.00 15.00 ?  207 PRO B HG3  1  
ATOM 656   H HD2  . PRO B 2 5  ? -5.361  -10.455 -7.455  1.00 15.00 ?  207 PRO B HD2  1  
ATOM 657   H HD3  . PRO B 2 5  ? -3.734  -10.954 -7.844  1.00 15.00 ?  207 PRO B HD3  1  
ATOM 658   N N    . PRO B 2 6  ? -3.266  -5.654  -6.570  1.00 15.00 ?  208 PRO B N    1  
ATOM 659   C CA   . PRO B 2 6  ? -3.637  -4.517  -5.734  1.00 15.00 ?  208 PRO B CA   1  
ATOM 660   C C    . PRO B 2 6  ? -4.298  -3.369  -6.501  1.00 15.00 ?  208 PRO B C    1  
ATOM 661   O O    . PRO B 2 6  ? -4.257  -3.316  -7.734  1.00 15.00 ?  208 PRO B O    1  
ATOM 662   C CB   . PRO B 2 6  ? -2.302  -4.051  -5.127  1.00 15.00 ?  208 PRO B CB   1  
ATOM 663   C CG   . PRO B 2 6  ? -1.232  -4.907  -5.729  1.00 15.00 ?  208 PRO B CG   1  
ATOM 664   C CD   . PRO B 2 6  ? -1.838  -5.618  -6.905  1.00 15.00 ?  208 PRO B CD   1  
ATOM 665   H HA   . PRO B 2 6  ? -4.295  -4.825  -4.936  1.00 15.00 ?  208 PRO B HA   1  
ATOM 666   H HB2  . PRO B 2 6  ? -2.145  -3.008  -5.365  1.00 15.00 ?  208 PRO B HB2  1  
ATOM 667   H HB3  . PRO B 2 6  ? -2.345  -4.176  -4.048  1.00 15.00 ?  208 PRO B HB3  1  
ATOM 668   H HG2  . PRO B 2 6  ? -0.411  -4.287  -6.055  1.00 15.00 ?  208 PRO B HG2  1  
ATOM 669   H HG3  . PRO B 2 6  ? -0.887  -5.624  -4.997  1.00 15.00 ?  208 PRO B HG3  1  
ATOM 670   H HD2  . PRO B 2 6  ? -1.667  -5.061  -7.814  1.00 15.00 ?  208 PRO B HD2  1  
ATOM 671   H HD3  . PRO B 2 6  ? -1.429  -6.611  -6.984  1.00 15.00 ?  208 PRO B HD3  1  
ATOM 672   N N    . PRO B 2 7  ? -4.917  -2.439  -5.745  1.00 15.00 ?  209 PRO B N    1  
ATOM 673   C CA   . PRO B 2 7  ? -5.545  -1.227  -6.288  1.00 15.00 ?  209 PRO B CA   1  
ATOM 674   C C    . PRO B 2 7  ? -4.632  -0.468  -7.257  1.00 15.00 ?  209 PRO B C    1  
ATOM 675   O O    . PRO B 2 7  ? -3.449  -0.267  -6.974  1.00 15.00 ?  209 PRO B O    1  
ATOM 676   C CB   . PRO B 2 7  ? -5.792  -0.356  -5.047  1.00 15.00 ?  209 PRO B CB   1  
ATOM 677   C CG   . PRO B 2 7  ? -5.697  -1.248  -3.859  1.00 15.00 ?  209 PRO B CG   1  
ATOM 678   C CD   . PRO B 2 7  ? -5.072  -2.543  -4.286  1.00 15.00 ?  209 PRO B CD   1  
ATOM 679   H HA   . PRO B 2 7  ? -6.484  -1.446  -6.772  1.00 15.00 ?  209 PRO B HA   1  
ATOM 680   H HB2  . PRO B 2 7  ? -5.045  0.424   -5.002  1.00 15.00 ?  209 PRO B HB2  1  
ATOM 681   H HB3  . PRO B 2 7  ? -6.769  0.092   -5.110  1.00 15.00 ?  209 PRO B HB3  1  
ATOM 682   H HG2  . PRO B 2 7  ? -5.079  -0.779  -3.106  1.00 15.00 ?  209 PRO B HG2  1  
ATOM 683   H HG3  . PRO B 2 7  ? -6.686  -1.426  -3.463  1.00 15.00 ?  209 PRO B HG3  1  
ATOM 684   H HD2  . PRO B 2 7  ? -4.109  -2.664  -3.811  1.00 15.00 ?  209 PRO B HD2  1  
ATOM 685   H HD3  . PRO B 2 7  ? -5.719  -3.371  -4.028  1.00 15.00 ?  209 PRO B HD3  1  
ATOM 686   N N    . PRO B 2 8  ? -5.178  -0.036  -8.410  1.00 15.00 ?  210 PRO B N    1  
ATOM 687   C CA   . PRO B 2 8  ? -4.445  0.783   -9.388  1.00 15.00 ?  210 PRO B CA   1  
ATOM 688   C C    . PRO B 2 8  ? -3.855  2.028   -8.734  1.00 15.00 ?  210 PRO B C    1  
ATOM 689   O O    . PRO B 2 8  ? -4.487  2.630   -7.860  1.00 15.00 ?  210 PRO B O    1  
ATOM 690   C CB   . PRO B 2 8  ? -5.521  1.174   -10.404 1.00 15.00 ?  210 PRO B CB   1  
ATOM 691   C CG   . PRO B 2 8  ? -6.555  0.110   -10.289 1.00 15.00 ?  210 PRO B CG   1  
ATOM 692   C CD   . PRO B 2 8  ? -6.556  -0.312  -8.847  1.00 15.00 ?  210 PRO B CD   1  
ATOM 693   H HA   . PRO B 2 8  ? -3.662  0.220   -9.876  1.00 15.00 ?  210 PRO B HA   1  
ATOM 694   H HB2  . PRO B 2 8  ? -5.923  2.144   -10.152 1.00 15.00 ?  210 PRO B HB2  1  
ATOM 695   H HB3  . PRO B 2 8  ? -5.093  1.201   -11.395 1.00 15.00 ?  210 PRO B HB3  1  
ATOM 696   H HG2  . PRO B 2 8  ? -7.521  0.507   -10.565 1.00 15.00 ?  210 PRO B HG2  1  
ATOM 697   H HG3  . PRO B 2 8  ? -6.296  -0.724  -10.924 1.00 15.00 ?  210 PRO B HG3  1  
ATOM 698   H HD2  . PRO B 2 8  ? -7.264  0.275   -8.282  1.00 15.00 ?  210 PRO B HD2  1  
ATOM 699   H HD3  . PRO B 2 8  ? -6.782  -1.364  -8.763  1.00 15.00 ?  210 PRO B HD3  1  
ATOM 700   N N    . TYR B 2 9  ? -2.659  2.425   -9.163  1.00 15.00 ?  211 TYR B N    1  
ATOM 701   C CA   . TYR B 2 9  ? -1.933  3.494   -8.490  1.00 15.00 ?  211 TYR B CA   1  
ATOM 702   C C    . TYR B 2 9  ? -2.636  4.846   -8.587  1.00 15.00 ?  211 TYR B C    1  
ATOM 703   O O    . TYR B 2 9  ? -2.531  5.566   -9.582  1.00 15.00 ?  211 TYR B O    1  
ATOM 704   C CB   . TYR B 2 9  ? -0.500  3.622   -8.999  1.00 15.00 ?  211 TYR B CB   1  
ATOM 705   C CG   . TYR B 2 9  ? 0.342   4.557   -8.153  1.00 15.00 ?  211 TYR B CG   1  
ATOM 706   C CD1  . TYR B 2 9  ? 0.658   4.222   -6.844  1.00 15.00 ?  211 TYR B CD1  1  
ATOM 707   C CD2  . TYR B 2 9  ? 0.825   5.764   -8.653  1.00 15.00 ?  211 TYR B CD2  1  
ATOM 708   C CE1  . TYR B 2 9  ? 1.427   5.053   -6.059  1.00 15.00 ?  211 TYR B CE1  1  
ATOM 709   C CE2  . TYR B 2 9  ? 1.597   6.604   -7.863  1.00 15.00 ?  211 TYR B CE2  1  
ATOM 710   C CZ   . TYR B 2 9  ? 1.893   6.238   -6.569  1.00 15.00 ?  211 TYR B CZ   1  
ATOM 711   O OH   . TYR B 2 9  ? 2.670   7.053   -5.781  1.00 15.00 ?  211 TYR B OH   1  
ATOM 712   H H    . TYR B 2 9  ? -2.251  1.976   -9.940  1.00 15.00 ?  211 TYR B H    1  
ATOM 713   H HA   . TYR B 2 9  ? -1.886  3.223   -7.446  1.00 15.00 ?  211 TYR B HA   1  
ATOM 714   H HB2  . TYR B 2 9  ? -0.033  2.648   -8.985  1.00 15.00 ?  211 TYR B HB2  1  
ATOM 715   H HB3  . TYR B 2 9  ? -0.510  4.000   -10.010 1.00 15.00 ?  211 TYR B HB3  1  
ATOM 716   H HD1  . TYR B 2 9  ? 0.291   3.293   -6.436  1.00 15.00 ?  211 TYR B HD1  1  
ATOM 717   H HD2  . TYR B 2 9  ? 0.588   6.046   -9.669  1.00 15.00 ?  211 TYR B HD2  1  
ATOM 718   H HE1  . TYR B 2 9  ? 1.659   4.770   -5.044  1.00 15.00 ?  211 TYR B HE1  1  
ATOM 719   H HE2  . TYR B 2 9  ? 1.973   7.536   -8.264  1.00 15.00 ?  211 TYR B HE2  1  
ATOM 720   H HH   . TYR B 2 9  ? 3.431   6.545   -5.467  1.00 15.00 ?  211 TYR B HH   1  
ATOM 721   N N    . SER B 2 10 ? -3.398  5.134   -7.560  1.00 15.00 ?  212 SER B N    1  
ATOM 722   C CA   . SER B 2 10 ? -3.860  6.466   -7.264  1.00 15.00 ?  212 SER B CA   1  
ATOM 723   C C    . SER B 2 10 ? -3.209  6.849   -5.949  1.00 15.00 ?  212 SER B C    1  
ATOM 724   O O    . SER B 2 10 ? -2.921  5.959   -5.145  1.00 15.00 ?  212 SER B O    1  
ATOM 725   C CB   . SER B 2 10 ? -5.389  6.501   -7.179  1.00 15.00 ?  212 SER B CB   1  
ATOM 726   O OG   . SER B 2 10 ? -5.893  5.425   -6.405  1.00 15.00 ?  212 SER B OG   1  
ATOM 727   H H    . SER B 2 10 ? -3.672  4.406   -6.961  1.00 15.00 ?  212 SER B H    1  
ATOM 728   H HA   . SER B 2 10 ? -3.515  7.130   -8.045  1.00 15.00 ?  212 SER B HA   1  
ATOM 729   H HB2  . SER B 2 10 ? -5.698  7.429   -6.723  1.00 15.00 ?  212 SER B HB2  1  
ATOM 730   H HB3  . SER B 2 10 ? -5.803  6.436   -8.175  1.00 15.00 ?  212 SER B HB3  1  
ATOM 731   H HG   . SER B 2 10 ? -5.857  4.613   -6.925  1.00 15.00 ?  212 SER B HG   1  
ATOM 732   N N    . ARG B 2 11 ? -2.950  8.132   -5.715  1.00 15.00 ?  213 ARG B N    1  
ATOM 733   C CA   . ARG B 2 11 ? -2.165  8.511   -4.547  1.00 15.00 ?  213 ARG B CA   1  
ATOM 734   C C    . ARG B 2 11 ? -2.873  8.025   -3.298  1.00 15.00 ?  213 ARG B C    1  
ATOM 735   O O    . ARG B 2 11 ? -2.281  7.362   -2.450  1.00 15.00 ?  213 ARG B O    1  
ATOM 736   C CB   . ARG B 2 11 ? -2.004  10.031  -4.419  1.00 15.00 ?  213 ARG B CB   1  
ATOM 737   C CG   . ARG B 2 11 ? -1.481  10.746  -5.640  1.00 15.00 ?  213 ARG B CG   1  
ATOM 738   C CD   . ARG B 2 11 ? -1.261  12.230  -5.374  1.00 15.00 ?  213 ARG B CD   1  
ATOM 739   N NE   . ARG B 2 11 ? -0.723  12.476  -4.036  1.00 15.00 ?  213 ARG B NE   1  
ATOM 740   C CZ   . ARG B 2 11 ? 0.439   13.074  -3.782  1.00 15.00 ?  213 ARG B CZ   1  
ATOM 741   N NH1  . ARG B 2 11 ? 1.200   13.512  -4.774  1.00 15.00 1  213 ARG B NH1  1  
ATOM 742   N NH2  . ARG B 2 11 ? 0.823   13.250  -2.523  1.00 15.00 ?  213 ARG B NH2  1  
ATOM 743   H H    . ARG B 2 11 ? -3.306  8.826   -6.318  1.00 15.00 ?  213 ARG B H    1  
ATOM 744   H HA   . ARG B 2 11 ? -1.195  8.045   -4.616  1.00 15.00 ?  213 ARG B HA   1  
ATOM 745   H HB2  . ARG B 2 11 ? -2.966  10.456  -4.179  1.00 15.00 ?  213 ARG B HB2  1  
ATOM 746   H HB3  . ARG B 2 11 ? -1.328  10.232  -3.600  1.00 15.00 ?  213 ARG B HB3  1  
ATOM 747   H HG2  . ARG B 2 11 ? -0.554  10.298  -5.947  1.00 15.00 ?  213 ARG B HG2  1  
ATOM 748   H HG3  . ARG B 2 11 ? -2.216  10.647  -6.411  1.00 15.00 ?  213 ARG B HG3  1  
ATOM 749   H HD2  . ARG B 2 11 ? -0.567  12.614  -6.107  1.00 15.00 ?  213 ARG B HD2  1  
ATOM 750   H HD3  . ARG B 2 11 ? -2.206  12.744  -5.471  1.00 15.00 ?  213 ARG B HD3  1  
ATOM 751   H HE   . ARG B 2 11 ? -1.273  12.186  -3.278  1.00 15.00 ?  213 ARG B HE   1  
ATOM 752   H HH11 . ARG B 2 11 ? 0.904   13.401  -5.725  1.00 15.00 ?  213 ARG B HH11 1  
ATOM 753   H HH12 . ARG B 2 11 ? 2.080   13.961  -4.576  1.00 15.00 ?  213 ARG B HH12 1  
ATOM 754   H HH21 . ARG B 2 11 ? 0.238   12.940  -1.766  1.00 15.00 ?  213 ARG B HH21 1  
ATOM 755   H HH22 . ARG B 2 11 ? 1.710   13.689  -2.317  1.00 15.00 ?  213 ARG B HH22 1  
ATOM 756   N N    . TYR B 2 12 ? -4.128  8.412   -3.174  1.00 15.00 ?  214 TYR B N    1  
ATOM 757   C CA   . TYR B 2 12 ? -4.950  7.992   -2.062  1.00 15.00 ?  214 TYR B CA   1  
ATOM 758   C C    . TYR B 2 12 ? -6.164  7.241   -2.582  1.00 15.00 ?  214 TYR B C    1  
ATOM 759   O O    . TYR B 2 12 ? -7.181  7.840   -2.930  1.00 15.00 ?  214 TYR B O    1  
ATOM 760   C CB   . TYR B 2 12 ? -5.319  9.212   -1.205  1.00 15.00 ?  214 TYR B CB   1  
ATOM 761   C CG   . TYR B 2 12 ? -4.097  10.060  -0.915  1.00 15.00 ?  214 TYR B CG   1  
ATOM 762   C CD1  . TYR B 2 12 ? -3.561  10.883  -1.899  1.00 15.00 ?  214 TYR B CD1  1  
ATOM 763   C CD2  . TYR B 2 12 ? -3.432  9.981   0.299   1.00 15.00 ?  214 TYR B CD2  1  
ATOM 764   C CE1  . TYR B 2 12 ? -2.407  11.597  -1.690  1.00 15.00 ?  214 TYR B CE1  1  
ATOM 765   C CE2  . TYR B 2 12 ? -2.278  10.709  0.523   1.00 15.00 ?  214 TYR B CE2  1  
ATOM 766   C CZ   . TYR B 2 12 ? -1.766  11.510  -0.476  1.00 15.00 ?  214 TYR B CZ   1  
ATOM 767   O OH   . TYR B 2 12 ? -0.595  12.202  -0.263  1.00 15.00 ?  214 TYR B OH   1  
ATOM 768   H H    . TYR B 2 12 ? -4.518  8.992   -3.860  1.00 15.00 ?  214 TYR B H    1  
ATOM 769   H HA   . TYR B 2 12 ? -4.363  7.301   -1.465  1.00 15.00 ?  214 TYR B HA   1  
ATOM 770   H HB2  . TYR B 2 12 ? -6.041  9.821   -1.730  1.00 15.00 ?  214 TYR B HB2  1  
ATOM 771   H HB3  . TYR B 2 12 ? -5.733  8.883   -0.264  1.00 15.00 ?  214 TYR B HB3  1  
ATOM 772   H HD1  . TYR B 2 12 ? -4.062  10.951  -2.859  1.00 15.00 ?  214 TYR B HD1  1  
ATOM 773   H HD2  . TYR B 2 12 ? -3.834  9.353   1.080   1.00 15.00 ?  214 TYR B HD2  1  
ATOM 774   H HE1  . TYR B 2 12 ? -2.009  12.214  -2.492  1.00 15.00 ?  214 TYR B HE1  1  
ATOM 775   H HE2  . TYR B 2 12 ? -1.772  10.638  1.474   1.00 15.00 ?  214 TYR B HE2  1  
ATOM 776   H HH   . TYR B 2 12 ? 0.035   11.611  0.195   1.00 15.00 ?  214 TYR B HH   1  
ATOM 777   N N    . PRO B 2 13 ? -6.032  5.918   -2.698  1.00 15.00 ?  215 PRO B N    1  
ATOM 778   C CA   . PRO B 2 13 ? -7.072  5.060   -3.243  1.00 15.00 ?  215 PRO B CA   1  
ATOM 779   C C    . PRO B 2 13 ? -8.151  4.791   -2.207  1.00 15.00 ?  215 PRO B C    1  
ATOM 780   O O    . PRO B 2 13 ? -7.860  4.322   -1.110  1.00 15.00 ?  215 PRO B O    1  
ATOM 781   C CB   . PRO B 2 13 ? -6.331  3.769   -3.622  1.00 15.00 ?  215 PRO B CB   1  
ATOM 782   C CG   . PRO B 2 13 ? -4.944  3.875   -3.050  1.00 15.00 ?  215 PRO B CG   1  
ATOM 783   C CD   . PRO B 2 13 ? -4.853  5.158   -2.278  1.00 15.00 ?  215 PRO B CD   1  
ATOM 784   H HA   . PRO B 2 13 ? -7.521  5.496   -4.124  1.00 15.00 ?  215 PRO B HA   1  
ATOM 785   H HB2  . PRO B 2 13 ? -6.861  2.922   -3.210  1.00 15.00 ?  215 PRO B HB2  1  
ATOM 786   H HB3  . PRO B 2 13 ? -6.301  3.680   -4.699  1.00 15.00 ?  215 PRO B HB3  1  
ATOM 787   H HG2  . PRO B 2 13 ? -4.765  3.042   -2.386  1.00 15.00 ?  215 PRO B HG2  1  
ATOM 788   H HG3  . PRO B 2 13 ? -4.213  3.871   -3.847  1.00 15.00 ?  215 PRO B HG3  1  
ATOM 789   H HD2  . PRO B 2 13 ? -4.886  4.960   -1.217  1.00 15.00 ?  215 PRO B HD2  1  
ATOM 790   H HD3  . PRO B 2 13 ? -3.947  5.685   -2.534  1.00 15.00 ?  215 PRO B HD3  1  
ATOM 791   N N    . MET B 2 14 ? -9.395  5.094   -2.545  1.00 15.00 ?  216 MET B N    1  
ATOM 792   C CA   . MET B 2 14 ? -10.467 5.011   -1.567  1.00 15.00 ?  216 MET B CA   1  
ATOM 793   C C    . MET B 2 14 ? -11.045 3.604   -1.481  1.00 15.00 ?  216 MET B C    1  
ATOM 794   O O    . MET B 2 14 ? -11.800 3.167   -2.354  1.00 15.00 ?  216 MET B O    1  
ATOM 795   C CB   . MET B 2 14 ? -11.576 6.023   -1.861  1.00 15.00 ?  216 MET B CB   1  
ATOM 796   C CG   . MET B 2 14 ? -12.619 6.091   -0.757  1.00 15.00 ?  216 MET B CG   1  
ATOM 797   S SD   . MET B 2 14 ? -13.881 7.345   -1.052  1.00 15.00 ?  216 MET B SD   1  
ATOM 798   C CE   . MET B 2 14 ? -14.842 7.209   0.455   1.00 15.00 ?  216 MET B CE   1  
ATOM 799   H H    . MET B 2 14 ? -9.595  5.360   -3.469  1.00 15.00 ?  216 MET B H    1  
ATOM 800   H HA   . MET B 2 14 ? -10.036 5.252   -0.606  1.00 15.00 ?  216 MET B HA   1  
ATOM 801   H HB2  . MET B 2 14 ? -11.136 7.003   -1.976  1.00 15.00 ?  216 MET B HB2  1  
ATOM 802   H HB3  . MET B 2 14 ? -12.070 5.747   -2.780  1.00 15.00 ?  216 MET B HB3  1  
ATOM 803   H HG2  . MET B 2 14 ? -13.104 5.129   -0.680  1.00 15.00 ?  216 MET B HG2  1  
ATOM 804   H HG3  . MET B 2 14 ? -12.121 6.315   0.175   1.00 15.00 ?  216 MET B HG3  1  
ATOM 805   H HE1  . MET B 2 14 ? -15.237 6.208   0.541   1.00 15.00 ?  216 MET B HE1  1  
ATOM 806   H HE2  . MET B 2 14 ? -15.657 7.917   0.426   1.00 15.00 ?  216 MET B HE2  1  
ATOM 807   H HE3  . MET B 2 14 ? -14.210 7.422   1.305   1.00 15.00 ?  216 MET B HE3  1  
ATOM 808   N N    . ASP B 2 15 ? -10.645 2.902   -0.436  1.00 15.00 ?  217 ASP B N    1  
ATOM 809   C CA   . ASP B 2 15 ? -11.197 1.598   -0.095  1.00 15.00 ?  217 ASP B CA   1  
ATOM 810   C C    . ASP B 2 15 ? -10.870 1.310   1.355   1.00 15.00 ?  217 ASP B C    1  
ATOM 811   O O    . ASP B 2 15 ? -9.669  1.176   1.656   1.00 15.00 ?  217 ASP B O    1  
ATOM 812   C CB   . ASP B 2 15 ? -10.620 0.487   -0.973  1.00 15.00 ?  217 ASP B CB   1  
ATOM 813   C CG   . ASP B 2 15 ? -11.376 -0.820  -0.806  1.00 15.00 ?  217 ASP B CG   1  
ATOM 814   O OD1  . ASP B 2 15 ? -12.399 -1.005  -1.504  1.00 15.00 ?  217 ASP B OD1  1  
ATOM 815   O OD2  . ASP B 2 15 ? -10.957 -1.670  0.004   1.00 15.00 -1 217 ASP B OD2  1  
ATOM 816   O OXT  . ASP B 2 15 ? -11.794 1.265   2.187   1.00 15.00 ?  217 ASP B OXT  1  
ATOM 817   H H    . ASP B 2 15 ? -9.937  3.269   0.134   1.00 15.00 ?  217 ASP B H    1  
ATOM 818   H HA   . ASP B 2 15 ? -12.270 1.638   -0.219  1.00 15.00 ?  217 ASP B HA   1  
ATOM 819   H HB2  . ASP B 2 15 ? -10.675 0.787   -2.009  1.00 15.00 ?  217 ASP B HB2  1  
ATOM 820   H HB3  . ASP B 2 15 ? -9.589  0.322   -0.703  1.00 15.00 ?  217 ASP B HB3  1  
ATOM 821   N N    . GLY A 1 1  ? 4.905   3.977   15.861  1.00 15.00 ?  297 GLY A N    2  
ATOM 822   C CA   . GLY A 1 1  ? 4.762   3.537   14.453  1.00 15.00 ?  297 GLY A CA   2  
ATOM 823   C C    . GLY A 1 1  ? 5.368   4.522   13.478  1.00 15.00 ?  297 GLY A C    2  
ATOM 824   O O    . GLY A 1 1  ? 4.683   5.432   13.012  1.00 15.00 ?  297 GLY A O    2  
ATOM 825   H H1   . GLY A 1 1  ? 4.528   4.941   15.975  1.00 15.00 ?  297 GLY A H1   2  
ATOM 826   H H2   . GLY A 1 1  ? 5.908   3.968   16.144  1.00 15.00 ?  297 GLY A H2   2  
ATOM 827   H H3   . GLY A 1 1  ? 4.374   3.335   16.488  1.00 15.00 ?  297 GLY A H3   2  
ATOM 828   H HA2  . GLY A 1 1  ? 5.251   2.582   14.334  1.00 15.00 ?  297 GLY A HA2  2  
ATOM 829   H HA3  . GLY A 1 1  ? 3.711   3.423   14.227  1.00 15.00 ?  297 GLY A HA3  2  
ATOM 830   N N    . PRO A 1 2  ? 6.659   4.374   13.147  1.00 15.00 ?  298 PRO A N    2  
ATOM 831   C CA   . PRO A 1 2  ? 7.336   5.280   12.230  1.00 15.00 ?  298 PRO A CA   2  
ATOM 832   C C    . PRO A 1 2  ? 7.003   4.983   10.763  1.00 15.00 ?  298 PRO A C    2  
ATOM 833   O O    . PRO A 1 2  ? 7.468   3.988   10.200  1.00 15.00 ?  298 PRO A O    2  
ATOM 834   C CB   . PRO A 1 2  ? 8.815   5.027   12.511  1.00 15.00 ?  298 PRO A CB   2  
ATOM 835   C CG   . PRO A 1 2  ? 8.882   3.616   12.992  1.00 15.00 ?  298 PRO A CG   2  
ATOM 836   C CD   . PRO A 1 2  ? 7.557   3.314   13.644  1.00 15.00 ?  298 PRO A CD   2  
ATOM 837   H HA   . PRO A 1 2  ? 7.103   6.310   12.456  1.00 15.00 ?  298 PRO A HA   2  
ATOM 838   H HB2  . PRO A 1 2  ? 9.383   5.162   11.601  1.00 15.00 ?  298 PRO A HB2  2  
ATOM 839   H HB3  . PRO A 1 2  ? 9.165   5.717   13.265  1.00 15.00 ?  298 PRO A HB3  2  
ATOM 840   H HG2  . PRO A 1 2  ? 9.044   2.953   12.156  1.00 15.00 ?  298 PRO A HG2  2  
ATOM 841   H HG3  . PRO A 1 2  ? 9.684   3.514   13.710  1.00 15.00 ?  298 PRO A HG3  2  
ATOM 842   H HD2  . PRO A 1 2  ? 7.204   2.339   13.341  1.00 15.00 ?  298 PRO A HD2  2  
ATOM 843   H HD3  . PRO A 1 2  ? 7.649   3.362   14.719  1.00 15.00 ?  298 PRO A HD3  2  
ATOM 844   N N    . LEU A 1 3  ? 6.160   5.815   10.160  1.00 15.00 ?  299 LEU A N    2  
ATOM 845   C CA   . LEU A 1 3  ? 5.837   5.683   8.750   1.00 15.00 ?  299 LEU A CA   2  
ATOM 846   C C    . LEU A 1 3  ? 6.730   6.613   7.938   1.00 15.00 ?  299 LEU A C    2  
ATOM 847   O O    . LEU A 1 3  ? 6.852   7.792   8.263   1.00 15.00 ?  299 LEU A O    2  
ATOM 848   C CB   . LEU A 1 3  ? 4.366   6.034   8.510   1.00 15.00 ?  299 LEU A CB   2  
ATOM 849   C CG   . LEU A 1 3  ? 3.852   5.781   7.092   1.00 15.00 ?  299 LEU A CG   2  
ATOM 850   C CD1  . LEU A 1 3  ? 3.588   4.297   6.858   1.00 15.00 ?  299 LEU A CD1  2  
ATOM 851   C CD2  . LEU A 1 3  ? 2.601   6.604   6.836   1.00 15.00 ?  299 LEU A CD2  2  
ATOM 852   H H    . LEU A 1 3  ? 5.733   6.532   10.676  1.00 15.00 ?  299 LEU A H    2  
ATOM 853   H HA   . LEU A 1 3  ? 6.019   4.661   8.452   1.00 15.00 ?  299 LEU A HA   2  
ATOM 854   H HB2  . LEU A 1 3  ? 3.764   5.456   9.197   1.00 15.00 ?  299 LEU A HB2  2  
ATOM 855   H HB3  . LEU A 1 3  ? 4.227   7.082   8.731   1.00 15.00 ?  299 LEU A HB3  2  
ATOM 856   H HG   . LEU A 1 3  ? 4.608   6.097   6.387   1.00 15.00 ?  299 LEU A HG   2  
ATOM 857   H HD11 . LEU A 1 3  ? 3.321   4.140   5.823   1.00 15.00 ?  299 LEU A HD11 2  
ATOM 858   H HD12 . LEU A 1 3  ? 2.771   3.966   7.492   1.00 15.00 ?  299 LEU A HD12 2  
ATOM 859   H HD13 . LEU A 1 3  ? 4.477   3.733   7.092   1.00 15.00 ?  299 LEU A HD13 2  
ATOM 860   H HD21 . LEU A 1 3  ? 2.241   6.408   5.836   1.00 15.00 ?  299 LEU A HD21 2  
ATOM 861   H HD22 . LEU A 1 3  ? 2.832   7.654   6.935   1.00 15.00 ?  299 LEU A HD22 2  
ATOM 862   H HD23 . LEU A 1 3  ? 1.838   6.334   7.551   1.00 15.00 ?  299 LEU A HD23 2  
ATOM 863   N N    . PRO A 1 4  ? 7.382   6.103   6.886   1.00 15.00 ?  300 PRO A N    2  
ATOM 864   C CA   . PRO A 1 4  ? 8.229   6.921   6.014   1.00 15.00 ?  300 PRO A CA   2  
ATOM 865   C C    . PRO A 1 4  ? 7.412   7.987   5.280   1.00 15.00 ?  300 PRO A C    2  
ATOM 866   O O    . PRO A 1 4  ? 6.396   7.677   4.663   1.00 15.00 ?  300 PRO A O    2  
ATOM 867   C CB   . PRO A 1 4  ? 8.819   5.909   5.023   1.00 15.00 ?  300 PRO A CB   2  
ATOM 868   C CG   . PRO A 1 4  ? 8.605   4.573   5.650   1.00 15.00 ?  300 PRO A CG   2  
ATOM 869   C CD   . PRO A 1 4  ? 7.346   4.699   6.455   1.00 15.00 ?  300 PRO A CD   2  
ATOM 870   H HA   . PRO A 1 4  ? 9.025   7.398   6.568   1.00 15.00 ?  300 PRO A HA   2  
ATOM 871   H HB2  . PRO A 1 4  ? 8.302   5.987   4.077   1.00 15.00 ?  300 PRO A HB2  2  
ATOM 872   H HB3  . PRO A 1 4  ? 9.869   6.113   4.882   1.00 15.00 ?  300 PRO A HB3  2  
ATOM 873   H HG2  . PRO A 1 4  ? 8.489   3.822   4.884   1.00 15.00 ?  300 PRO A HG2  2  
ATOM 874   H HG3  . PRO A 1 4  ? 9.438   4.332   6.293   1.00 15.00 ?  300 PRO A HG3  2  
ATOM 875   H HD2  . PRO A 1 4  ? 6.482   4.505   5.836   1.00 15.00 ?  300 PRO A HD2  2  
ATOM 876   H HD3  . PRO A 1 4  ? 7.366   4.029   7.302   1.00 15.00 ?  300 PRO A HD3  2  
ATOM 877   N N    . PRO A 1 5  ? 7.854   9.254   5.330   1.00 15.00 ?  301 PRO A N    2  
ATOM 878   C CA   . PRO A 1 5  ? 7.112   10.394  4.760   1.00 15.00 ?  301 PRO A CA   2  
ATOM 879   C C    . PRO A 1 5  ? 6.974   10.343  3.233   1.00 15.00 ?  301 PRO A C    2  
ATOM 880   O O    . PRO A 1 5  ? 6.237   11.136  2.644   1.00 15.00 ?  301 PRO A O    2  
ATOM 881   C CB   . PRO A 1 5  ? 7.943   11.616  5.179   1.00 15.00 ?  301 PRO A CB   2  
ATOM 882   C CG   . PRO A 1 5  ? 8.825   11.132  6.277   1.00 15.00 ?  301 PRO A CG   2  
ATOM 883   C CD   . PRO A 1 5  ? 9.103   9.692   5.971   1.00 15.00 ?  301 PRO A CD   2  
ATOM 884   H HA   . PRO A 1 5  ? 6.127   10.467  5.196   1.00 15.00 ?  301 PRO A HA   2  
ATOM 885   H HB2  . PRO A 1 5  ? 8.521   11.969  4.337   1.00 15.00 ?  301 PRO A HB2  2  
ATOM 886   H HB3  . PRO A 1 5  ? 7.283   12.399  5.520   1.00 15.00 ?  301 PRO A HB3  2  
ATOM 887   H HG2  . PRO A 1 5  ? 9.745   11.697  6.287   1.00 15.00 ?  301 PRO A HG2  2  
ATOM 888   H HG3  . PRO A 1 5  ? 8.317   11.222  7.226   1.00 15.00 ?  301 PRO A HG3  2  
ATOM 889   H HD2  . PRO A 1 5  ? 9.940   9.603   5.292   1.00 15.00 ?  301 PRO A HD2  2  
ATOM 890   H HD3  . PRO A 1 5  ? 9.287   9.137   6.879   1.00 15.00 ?  301 PRO A HD3  2  
ATOM 891   N N    . GLY A 1 6  ? 7.716   9.445   2.595   1.00 15.00 ?  302 GLY A N    2  
ATOM 892   C CA   . GLY A 1 6  ? 7.563   9.235   1.163   1.00 15.00 ?  302 GLY A CA   2  
ATOM 893   C C    . GLY A 1 6  ? 6.592   8.111   0.863   1.00 15.00 ?  302 GLY A C    2  
ATOM 894   O O    . GLY A 1 6  ? 6.109   7.963   -0.265  1.00 15.00 ?  302 GLY A O    2  
ATOM 895   H H    . GLY A 1 6  ? 8.383   8.931   3.096   1.00 15.00 ?  302 GLY A H    2  
ATOM 896   H HA2  . GLY A 1 6  ? 7.201   10.145  0.709   1.00 15.00 ?  302 GLY A HA2  2  
ATOM 897   H HA3  . GLY A 1 6  ? 8.524   8.987   0.739   1.00 15.00 ?  302 GLY A HA3  2  
ATOM 898   N N    . TRP A 1 7  ? 6.300   7.333   1.890   1.00 15.00 ?  303 TRP A N    2  
ATOM 899   C CA   . TRP A 1 7  ? 5.469   6.151   1.770   1.00 15.00 ?  303 TRP A CA   2  
ATOM 900   C C    . TRP A 1 7  ? 4.018   6.467   2.063   1.00 15.00 ?  303 TRP A C    2  
ATOM 901   O O    . TRP A 1 7  ? 3.716   7.346   2.872   1.00 15.00 ?  303 TRP A O    2  
ATOM 902   C CB   . TRP A 1 7  ? 5.937   5.088   2.739   1.00 15.00 ?  303 TRP A CB   2  
ATOM 903   C CG   . TRP A 1 7  ? 7.011   4.224   2.188   1.00 15.00 ?  303 TRP A CG   2  
ATOM 904   C CD1  . TRP A 1 7  ? 8.326   4.539   2.017   1.00 15.00 ?  303 TRP A CD1  2  
ATOM 905   C CD2  . TRP A 1 7  ? 6.854   2.885   1.742   1.00 15.00 ?  303 TRP A CD2  2  
ATOM 906   N NE1  . TRP A 1 7  ? 8.998   3.462   1.505   1.00 15.00 ?  303 TRP A NE1  2  
ATOM 907   C CE2  . TRP A 1 7  ? 8.108   2.435   1.330   1.00 15.00 ?  303 TRP A CE2  2  
ATOM 908   C CE3  . TRP A 1 7  ? 5.771   2.015   1.657   1.00 15.00 ?  303 TRP A CE3  2  
ATOM 909   C CZ2  . TRP A 1 7  ? 8.303   1.157   0.850   1.00 15.00 ?  303 TRP A CZ2  2  
ATOM 910   C CZ3  . TRP A 1 7  ? 5.976   0.747   1.178   1.00 15.00 ?  303 TRP A CZ3  2  
ATOM 911   C CH2  . TRP A 1 7  ? 7.231   0.326   0.783   1.00 15.00 ?  303 TRP A CH2  2  
ATOM 912   H H    . TRP A 1 7  ? 6.634   7.577   2.778   1.00 15.00 ?  303 TRP A H    2  
ATOM 913   H HA   . TRP A 1 7  ? 5.565   5.779   0.763   1.00 15.00 ?  303 TRP A HA   2  
ATOM 914   H HB2  . TRP A 1 7  ? 6.317   5.563   3.632   1.00 15.00 ?  303 TRP A HB2  2  
ATOM 915   H HB3  . TRP A 1 7  ? 5.100   4.456   3.002   1.00 15.00 ?  303 TRP A HB3  2  
ATOM 916   H HD1  . TRP A 1 7  ? 8.760   5.497   2.260   1.00 15.00 ?  303 TRP A HD1  2  
ATOM 917   H HE1  . TRP A 1 7  ? 9.956   3.431   1.296   1.00 15.00 ?  303 TRP A HE1  2  
ATOM 918   H HE3  . TRP A 1 7  ? 4.783   2.320   1.949   1.00 15.00 ?  303 TRP A HE3  2  
ATOM 919   H HZ2  . TRP A 1 7  ? 9.247   0.824   0.535   1.00 15.00 ?  303 TRP A HZ2  2  
ATOM 920   H HZ3  . TRP A 1 7  ? 5.148   0.069   1.097   1.00 15.00 ?  303 TRP A HZ3  2  
ATOM 921   H HH2  . TRP A 1 7  ? 7.348   -0.687  0.436   1.00 15.00 ?  303 TRP A HH2  2  
ATOM 922   N N    . GLU A 1 8  ? 3.121   5.726   1.440   1.00 15.00 ?  304 GLU A N    2  
ATOM 923   C CA   . GLU A 1 8  ? 1.695   5.983   1.632   1.00 15.00 ?  304 GLU A CA   2  
ATOM 924   C C    . GLU A 1 8  ? 0.952   4.713   2.046   1.00 15.00 ?  304 GLU A C    2  
ATOM 925   O O    . GLU A 1 8  ? 0.853   3.764   1.285   1.00 15.00 ?  304 GLU A O    2  
ATOM 926   C CB   . GLU A 1 8  ? 1.110   6.594   0.358   1.00 15.00 ?  304 GLU A CB   2  
ATOM 927   C CG   . GLU A 1 8  ? 1.497   8.047   0.164   1.00 15.00 ?  304 GLU A CG   2  
ATOM 928   C CD   . GLU A 1 8  ? 0.528   9.004   0.826   1.00 15.00 ?  304 GLU A CD   2  
ATOM 929   O OE1  . GLU A 1 8  ? 0.252   8.845   2.034   1.00 15.00 -1 304 GLU A OE1  2  
ATOM 930   O OE2  . GLU A 1 8  ? 0.030   9.910   0.125   1.00 15.00 ?  304 GLU A OE2  2  
ATOM 931   H H    . GLU A 1 8  ? 3.423   4.977   0.846   1.00 15.00 ?  304 GLU A H    2  
ATOM 932   H HA   . GLU A 1 8  ? 1.607   6.703   2.433   1.00 15.00 ?  304 GLU A HA   2  
ATOM 933   H HB2  . GLU A 1 8  ? 1.472   6.036   -0.493  1.00 15.00 ?  304 GLU A HB2  2  
ATOM 934   H HB3  . GLU A 1 8  ? 0.037   6.531   0.382   1.00 15.00 ?  304 GLU A HB3  2  
ATOM 935   H HG2  . GLU A 1 8  ? 2.477   8.203   0.590   1.00 15.00 ?  304 GLU A HG2  2  
ATOM 936   H HG3  . GLU A 1 8  ? 1.527   8.263   -0.895  1.00 15.00 ?  304 GLU A HG3  2  
ATOM 937   N N    . ILE A 1 9  ? 0.433   4.704   3.263   1.00 15.00 ?  305 ILE A N    2  
ATOM 938   C CA   . ILE A 1 9  ? -0.195  3.509   3.815   1.00 15.00 ?  305 ILE A CA   2  
ATOM 939   C C    . ILE A 1 9  ? -1.723  3.559   3.698   1.00 15.00 ?  305 ILE A C    2  
ATOM 940   O O    . ILE A 1 9  ? -2.370  4.455   4.242   1.00 15.00 ?  305 ILE A O    2  
ATOM 941   C CB   . ILE A 1 9  ? 0.208   3.307   5.298   1.00 15.00 ?  305 ILE A CB   2  
ATOM 942   C CG1  . ILE A 1 9  ? -0.525  2.105   5.905   1.00 15.00 ?  305 ILE A CG1  2  
ATOM 943   C CG2  . ILE A 1 9  ? -0.066  4.567   6.109   1.00 15.00 ?  305 ILE A CG2  2  
ATOM 944   C CD1  . ILE A 1 9  ? -0.169  1.844   7.357   1.00 15.00 ?  305 ILE A CD1  2  
ATOM 945   H H    . ILE A 1 9  ? 0.461   5.526   3.803   1.00 15.00 ?  305 ILE A H    2  
ATOM 946   H HA   . ILE A 1 9  ? 0.168   2.661   3.254   1.00 15.00 ?  305 ILE A HA   2  
ATOM 947   H HB   . ILE A 1 9  ? 1.271   3.118   5.330   1.00 15.00 ?  305 ILE A HB   2  
ATOM 948   H HG12 . ILE A 1 9  ? -1.590  2.277   5.850   1.00 15.00 ?  305 ILE A HG12 2  
ATOM 949   H HG13 . ILE A 1 9  ? -0.278  1.219   5.336   1.00 15.00 ?  305 ILE A HG13 2  
ATOM 950   H HG21 . ILE A 1 9  ? 0.211   4.400   7.140   1.00 15.00 ?  305 ILE A HG21 2  
ATOM 951   H HG22 . ILE A 1 9  ? -1.118  4.808   6.055   1.00 15.00 ?  305 ILE A HG22 2  
ATOM 952   H HG23 . ILE A 1 9  ? 0.512   5.386   5.709   1.00 15.00 ?  305 ILE A HG23 2  
ATOM 953   H HD11 . ILE A 1 9  ? -0.858  1.132   7.773   1.00 15.00 ?  305 ILE A HD11 2  
ATOM 954   H HD12 . ILE A 1 9  ? -0.226  2.765   7.915   1.00 15.00 ?  305 ILE A HD12 2  
ATOM 955   H HD13 . ILE A 1 9  ? 0.830   1.450   7.419   1.00 15.00 ?  305 ILE A HD13 2  
ATOM 956   N N    . ARG A 1 10 ? -2.297  2.607   2.962   1.00 15.00 ?  306 ARG A N    2  
ATOM 957   C CA   . ARG A 1 10 ? -3.746  2.468   2.901   1.00 15.00 ?  306 ARG A CA   2  
ATOM 958   C C    . ARG A 1 10 ? -4.129  0.993   2.925   1.00 15.00 ?  306 ARG A C    2  
ATOM 959   O O    . ARG A 1 10 ? -3.422  0.150   2.372   1.00 15.00 ?  306 ARG A O    2  
ATOM 960   C CB   . ARG A 1 10 ? -4.322  3.149   1.655   1.00 15.00 ?  306 ARG A CB   2  
ATOM 961   C CG   . ARG A 1 10 ? -3.975  4.627   1.552   1.00 15.00 ?  306 ARG A CG   2  
ATOM 962   C CD   . ARG A 1 10 ? -5.048  5.419   0.829   1.00 15.00 ?  306 ARG A CD   2  
ATOM 963   N NE   . ARG A 1 10 ? -6.361  5.274   1.456   1.00 15.00 ?  306 ARG A NE   2  
ATOM 964   C CZ   . ARG A 1 10 ? -6.803  6.038   2.455   1.00 15.00 ?  306 ARG A CZ   2  
ATOM 965   N NH1  . ARG A 1 10 ? -6.035  7.003   2.946   1.00 15.00 1  306 ARG A NH1  2  
ATOM 966   N NH2  . ARG A 1 10 ? -8.013  5.839   2.962   1.00 15.00 ?  306 ARG A NH2  2  
ATOM 967   H H    . ARG A 1 10 ? -1.735  1.987   2.444   1.00 15.00 ?  306 ARG A H    2  
ATOM 968   H HA   . ARG A 1 10 ? -4.157  2.942   3.781   1.00 15.00 ?  306 ARG A HA   2  
ATOM 969   H HB2  . ARG A 1 10 ? -3.942  2.650   0.776   1.00 15.00 ?  306 ARG A HB2  2  
ATOM 970   H HB3  . ARG A 1 10 ? -5.398  3.057   1.672   1.00 15.00 ?  306 ARG A HB3  2  
ATOM 971   H HG2  . ARG A 1 10 ? -3.853  5.030   2.545   1.00 15.00 ?  306 ARG A HG2  2  
ATOM 972   H HG3  . ARG A 1 10 ? -3.048  4.724   1.007   1.00 15.00 ?  306 ARG A HG3  2  
ATOM 973   H HD2  . ARG A 1 10 ? -4.771  6.462   0.834   1.00 15.00 ?  306 ARG A HD2  2  
ATOM 974   H HD3  . ARG A 1 10 ? -5.107  5.068   -0.191  1.00 15.00 ?  306 ARG A HD3  2  
ATOM 975   H HE   . ARG A 1 10 ? -6.951  4.571   1.097   1.00 15.00 ?  306 ARG A HE   2  
ATOM 976   H HH11 . ARG A 1 10 ? -5.122  7.163   2.570   1.00 15.00 ?  306 ARG A HH11 2  
ATOM 977   H HH12 . ARG A 1 10 ? -6.369  7.580   3.707   1.00 15.00 ?  306 ARG A HH12 2  
ATOM 978   H HH21 . ARG A 1 10 ? -8.605  5.107   2.595   1.00 15.00 ?  306 ARG A HH21 2  
ATOM 979   H HH22 . ARG A 1 10 ? -8.346  6.410   3.716   1.00 15.00 ?  306 ARG A HH22 2  
ATOM 980   N N    . ASN A 1 11 ? -5.247  0.691   3.565   1.00 15.00 ?  307 ASN A N    2  
ATOM 981   C CA   . ASN A 1 11 ? -5.708  -0.685  3.712   1.00 15.00 ?  307 ASN A CA   2  
ATOM 982   C C    . ASN A 1 11 ? -7.002  -0.900  2.917   1.00 15.00 ?  307 ASN A C    2  
ATOM 983   O O    . ASN A 1 11 ? -7.902  -0.062  2.971   1.00 15.00 ?  307 ASN A O    2  
ATOM 984   C CB   . ASN A 1 11 ? -5.962  -0.966  5.197   1.00 15.00 ?  307 ASN A CB   2  
ATOM 985   C CG   . ASN A 1 11 ? -6.097  -2.442  5.529   1.00 15.00 ?  307 ASN A CG   2  
ATOM 986   O OD1  . ASN A 1 11 ? -6.487  -3.258  4.702   1.00 15.00 ?  307 ASN A OD1  2  
ATOM 987   N ND2  . ASN A 1 11 ? -5.774  -2.791  6.763   1.00 15.00 ?  307 ASN A ND2  2  
ATOM 988   H H    . ASN A 1 11 ? -5.776  1.413   3.964   1.00 15.00 ?  307 ASN A H    2  
ATOM 989   H HA   . ASN A 1 11 ? -4.934  -1.341  3.348   1.00 15.00 ?  307 ASN A HA   2  
ATOM 990   H HB2  . ASN A 1 11 ? -5.144  -0.565  5.773   1.00 15.00 ?  307 ASN A HB2  2  
ATOM 991   H HB3  . ASN A 1 11 ? -6.875  -0.468  5.492   1.00 15.00 ?  307 ASN A HB3  2  
ATOM 992   H HD21 . ASN A 1 11 ? -5.471  -2.090  7.379   1.00 15.00 ?  307 ASN A HD21 2  
ATOM 993   H HD22 . ASN A 1 11 ? -5.859  -3.734  7.013   1.00 15.00 ?  307 ASN A HD22 2  
ATOM 994   N N    . THR A 1 12 ? -7.104  -2.010  2.186   1.00 15.00 ?  308 THR A N    2  
ATOM 995   C CA   . THR A 1 12 ? -8.348  -2.353  1.505   1.00 15.00 ?  308 THR A CA   2  
ATOM 996   C C    . THR A 1 12 ? -9.213  -3.248  2.391   1.00 15.00 ?  308 THR A C    2  
ATOM 997   O O    . THR A 1 12 ? -8.697  -4.130  3.084   1.00 15.00 ?  308 THR A O    2  
ATOM 998   C CB   . THR A 1 12 ? -8.093  -3.056  0.151   1.00 15.00 ?  308 THR A CB   2  
ATOM 999   O OG1  . THR A 1 12 ? -6.796  -3.672  0.137   1.00 15.00 ?  308 THR A OG1  2  
ATOM 1000  C CG2  . THR A 1 12 ? -8.215  -2.079  -1.015  1.00 15.00 ?  308 THR A CG2  2  
ATOM 1001  H H    . THR A 1 12 ? -6.338  -2.619  2.119   1.00 15.00 ?  308 THR A H    2  
ATOM 1002  H HA   . THR A 1 12 ? -8.884  -1.434  1.314   1.00 15.00 ?  308 THR A HA   2  
ATOM 1003  H HB   . THR A 1 12 ? -8.840  -3.826  0.027   1.00 15.00 ?  308 THR A HB   2  
ATOM 1004  H HG1  . THR A 1 12 ? -6.494  -3.811  1.043   1.00 15.00 ?  308 THR A HG1  2  
ATOM 1005  H HG21 . THR A 1 12 ? -8.017  -2.599  -1.942  1.00 15.00 ?  308 THR A HG21 2  
ATOM 1006  H HG22 . THR A 1 12 ? -7.505  -1.278  -0.896  1.00 15.00 ?  308 THR A HG22 2  
ATOM 1007  H HG23 . THR A 1 12 ? -9.215  -1.671  -1.041  1.00 15.00 ?  308 THR A HG23 2  
ATOM 1008  N N    . ALA A 1 13 ? -10.525 -3.035  2.345   1.00 15.00 ?  309 ALA A N    2  
ATOM 1009  C CA   . ALA A 1 13 ? -11.469 -3.735  3.218   1.00 15.00 ?  309 ALA A CA   2  
ATOM 1010  C C    . ALA A 1 13 ? -11.465 -5.244  2.973   1.00 15.00 ?  309 ALA A C    2  
ATOM 1011  O O    . ALA A 1 13 ? -11.982 -6.015  3.782   1.00 15.00 ?  309 ALA A O    2  
ATOM 1012  C CB   . ALA A 1 13 ? -12.871 -3.180  3.025   1.00 15.00 ?  309 ALA A CB   2  
ATOM 1013  H H    . ALA A 1 13 ? -10.879 -2.380  1.692   1.00 15.00 ?  309 ALA A H    2  
ATOM 1014  H HA   . ALA A 1 13 ? -11.174 -3.548  4.240   1.00 15.00 ?  309 ALA A HA   2  
ATOM 1015  H HB1  . ALA A 1 13 ? -13.194 -3.365  2.011   1.00 15.00 ?  309 ALA A HB1  2  
ATOM 1016  H HB2  . ALA A 1 13 ? -12.866 -2.117  3.212   1.00 15.00 ?  309 ALA A HB2  2  
ATOM 1017  H HB3  . ALA A 1 13 ? -13.547 -3.665  3.713   1.00 15.00 ?  309 ALA A HB3  2  
ATOM 1018  N N    . THR A 1 14 ? -10.886 -5.653  1.853   1.00 15.00 ?  310 THR A N    2  
ATOM 1019  C CA   . THR A 1 14 ? -10.716 -7.066  1.536   1.00 15.00 ?  310 THR A CA   2  
ATOM 1020  C C    . THR A 1 14 ? -9.770  -7.752  2.525   1.00 15.00 ?  310 THR A C    2  
ATOM 1021  O O    . THR A 1 14 ? -9.700  -8.981  2.585   1.00 15.00 ?  310 THR A O    2  
ATOM 1022  C CB   . THR A 1 14 ? -10.182 -7.245  0.104   1.00 15.00 ?  310 THR A CB   2  
ATOM 1023  O OG1  . THR A 1 14 ? -9.344  -6.132  -0.244  1.00 15.00 ?  310 THR A OG1  2  
ATOM 1024  C CG2  . THR A 1 14 ? -11.324 -7.366  -0.895  1.00 15.00 ?  310 THR A CG2  2  
ATOM 1025  H H    . THR A 1 14 ? -10.569 -4.983  1.212   1.00 15.00 ?  310 THR A H    2  
ATOM 1026  H HA   . THR A 1 14 ? -11.686 -7.539  1.598   1.00 15.00 ?  310 THR A HA   2  
ATOM 1027  H HB   . THR A 1 14 ? -9.593  -8.152  0.068   1.00 15.00 ?  310 THR A HB   2  
ATOM 1028  H HG1  . THR A 1 14 ? -9.908  -5.376  -0.483  1.00 15.00 ?  310 THR A HG1  2  
ATOM 1029  H HG21 . THR A 1 14 ? -10.920 -7.512  -1.887  1.00 15.00 ?  310 THR A HG21 2  
ATOM 1030  H HG22 . THR A 1 14 ? -11.915 -6.463  -0.878  1.00 15.00 ?  310 THR A HG22 2  
ATOM 1031  H HG23 . THR A 1 14 ? -11.946 -8.208  -0.630  1.00 15.00 ?  310 THR A HG23 2  
ATOM 1032  N N    . GLY A 1 15 ? -9.035  -6.951  3.287   1.00 15.00 ?  311 GLY A N    2  
ATOM 1033  C CA   . GLY A 1 15 ? -8.105  -7.496  4.255   1.00 15.00 ?  311 GLY A CA   2  
ATOM 1034  C C    . GLY A 1 15 ? -6.699  -7.602  3.700   1.00 15.00 ?  311 GLY A C    2  
ATOM 1035  O O    . GLY A 1 15 ? -6.003  -8.590  3.932   1.00 15.00 ?  311 GLY A O    2  
ATOM 1036  H H    . GLY A 1 15 ? -9.140  -5.975  3.203   1.00 15.00 ?  311 GLY A H    2  
ATOM 1037  H HA2  . GLY A 1 15 ? -8.091  -6.857  5.127   1.00 15.00 ?  311 GLY A HA2  2  
ATOM 1038  H HA3  . GLY A 1 15 ? -8.441  -8.480  4.547   1.00 15.00 ?  311 GLY A HA3  2  
ATOM 1039  N N    . ARG A 1 16 ? -6.288  -6.585  2.954   1.00 15.00 ?  312 ARG A N    2  
ATOM 1040  C CA   . ARG A 1 16 ? -4.967  -6.550  2.347   1.00 15.00 ?  312 ARG A CA   2  
ATOM 1041  C C    . ARG A 1 16 ? -4.422  -5.132  2.449   1.00 15.00 ?  312 ARG A C    2  
ATOM 1042  O O    . ARG A 1 16 ? -5.171  -4.171  2.247   1.00 15.00 ?  312 ARG A O    2  
ATOM 1043  C CB   . ARG A 1 16 ? -5.033  -6.936  0.869   1.00 15.00 ?  312 ARG A CB   2  
ATOM 1044  C CG   . ARG A 1 16 ? -5.888  -8.142  0.539   1.00 15.00 ?  312 ARG A CG   2  
ATOM 1045  C CD   . ARG A 1 16 ? -6.089  -8.242  -0.962  1.00 15.00 ?  312 ARG A CD   2  
ATOM 1046  N NE   . ARG A 1 16 ? -7.000  -7.210  -1.462  1.00 15.00 ?  312 ARG A NE   2  
ATOM 1047  C CZ   . ARG A 1 16 ? -7.034  -6.789  -2.727  1.00 15.00 ?  312 ARG A CZ   2  
ATOM 1048  N NH1  . ARG A 1 16 ? -6.277  -7.373  -3.650  1.00 15.00 1  312 ARG A NH1  2  
ATOM 1049  N NH2  . ARG A 1 16 ? -7.844  -5.796  -3.068  1.00 15.00 ?  312 ARG A NH2  2  
ATOM 1050  H H    . ARG A 1 16 ? -6.886  -5.821  2.823   1.00 15.00 ?  312 ARG A H    2  
ATOM 1051  H HA   . ARG A 1 16 ? -4.315  -7.229  2.878   1.00 15.00 ?  312 ARG A HA   2  
ATOM 1052  H HB2  . ARG A 1 16 ? -5.408  -6.093  0.301   1.00 15.00 ?  312 ARG A HB2  2  
ATOM 1053  H HB3  . ARG A 1 16 ? -4.026  -7.144  0.534   1.00 15.00 ?  312 ARG A HB3  2  
ATOM 1054  H HG2  . ARG A 1 16 ? -5.392  -9.036  0.892   1.00 15.00 ?  312 ARG A HG2  2  
ATOM 1055  H HG3  . ARG A 1 16 ? -6.849  -8.040  1.020   1.00 15.00 ?  312 ARG A HG3  2  
ATOM 1056  H HD2  . ARG A 1 16 ? -5.127  -8.110  -1.444  1.00 15.00 ?  312 ARG A HD2  2  
ATOM 1057  H HD3  . ARG A 1 16 ? -6.490  -9.216  -1.203  1.00 15.00 ?  312 ARG A HD3  2  
ATOM 1058  H HE   . ARG A 1 16 ? -7.608  -6.790  -0.808  1.00 15.00 ?  312 ARG A HE   2  
ATOM 1059  H HH11 . ARG A 1 16 ? -5.678  -8.139  -3.401  1.00 15.00 ?  312 ARG A HH11 2  
ATOM 1060  H HH12 . ARG A 1 16 ? -6.293  -7.046  -4.601  1.00 15.00 ?  312 ARG A HH12 2  
ATOM 1061  H HH21 . ARG A 1 16 ? -8.430  -5.368  -2.380  1.00 15.00 ?  312 ARG A HH21 2  
ATOM 1062  H HH22 . ARG A 1 16 ? -7.867  -5.460  -4.022  1.00 15.00 ?  312 ARG A HH22 2  
ATOM 1063  N N    . VAL A 1 17 ? -3.135  -4.986  2.724   1.00 15.00 ?  313 VAL A N    2  
ATOM 1064  C CA   . VAL A 1 17 ? -2.557  -3.662  2.862   1.00 15.00 ?  313 VAL A CA   2  
ATOM 1065  C C    . VAL A 1 17 ? -1.603  -3.356  1.703   1.00 15.00 ?  313 VAL A C    2  
ATOM 1066  O O    . VAL A 1 17 ? -0.748  -4.155  1.366   1.00 15.00 ?  313 VAL A O    2  
ATOM 1067  C CB   . VAL A 1 17 ? -1.812  -3.485  4.198   1.00 15.00 ?  313 VAL A CB   2  
ATOM 1068  C CG1  . VAL A 1 17 ? -1.536  -2.011  4.452   1.00 15.00 ?  313 VAL A CG1  2  
ATOM 1069  C CG2  . VAL A 1 17 ? -2.605  -4.089  5.348   1.00 15.00 ?  313 VAL A CG2  2  
ATOM 1070  H H    . VAL A 1 17 ? -2.556  -5.781  2.814   1.00 15.00 ?  313 VAL A H    2  
ATOM 1071  H HA   . VAL A 1 17 ? -3.374  -2.956  2.841   1.00 15.00 ?  313 VAL A HA   2  
ATOM 1072  H HB   . VAL A 1 17 ? -0.865  -4.000  4.131   1.00 15.00 ?  313 VAL A HB   2  
ATOM 1073  H HG11 . VAL A 1 17 ? -0.934  -1.614  3.649   1.00 15.00 ?  313 VAL A HG11 2  
ATOM 1074  H HG12 . VAL A 1 17 ? -1.008  -1.901  5.388   1.00 15.00 ?  313 VAL A HG12 2  
ATOM 1075  H HG13 . VAL A 1 17 ? -2.470  -1.473  4.501   1.00 15.00 ?  313 VAL A HG13 2  
ATOM 1076  H HG21 . VAL A 1 17 ? -2.765  -5.141  5.162   1.00 15.00 ?  313 VAL A HG21 2  
ATOM 1077  H HG22 . VAL A 1 17 ? -3.559  -3.589  5.430   1.00 15.00 ?  313 VAL A HG22 2  
ATOM 1078  H HG23 . VAL A 1 17 ? -2.053  -3.966  6.268   1.00 15.00 ?  313 VAL A HG23 2  
ATOM 1079  N N    . TYR A 1 18 ? -1.750  -2.178  1.131   1.00 15.00 ?  314 TYR A N    2  
ATOM 1080  C CA   . TYR A 1 18 ? -1.046  -1.763  -0.048  1.00 15.00 ?  314 TYR A CA   2  
ATOM 1081  C C    . TYR A 1 18 ? -0.484  -0.368  0.208   1.00 15.00 ?  314 TYR A C    2  
ATOM 1082  O O    . TYR A 1 18 ? -1.224  0.598   0.422   1.00 15.00 ?  314 TYR A O    2  
ATOM 1083  C CB   . TYR A 1 18 ? -1.988  -1.767  -1.272  1.00 15.00 ?  314 TYR A CB   2  
ATOM 1084  C CG   . TYR A 1 18 ? -3.177  -0.835  -1.130  1.00 15.00 ?  314 TYR A CG   2  
ATOM 1085  C CD1  . TYR A 1 18 ? -4.246  -1.165  -0.309  1.00 15.00 ?  314 TYR A CD1  2  
ATOM 1086  C CD2  . TYR A 1 18 ? -3.213  0.389   -1.792  1.00 15.00 ?  314 TYR A CD2  2  
ATOM 1087  C CE1  . TYR A 1 18 ? -5.311  -0.305  -0.145  1.00 15.00 ?  314 TYR A CE1  2  
ATOM 1088  C CE2  . TYR A 1 18 ? -4.281  1.254   -1.633  1.00 15.00 ?  314 TYR A CE2  2  
ATOM 1089  C CZ   . TYR A 1 18 ? -5.323  0.903   -0.806  1.00 15.00 ?  314 TYR A CZ   2  
ATOM 1090  O OH   . TYR A 1 18 ? -6.387  1.760   -0.642  1.00 15.00 ?  314 TYR A OH   2  
ATOM 1091  H H    . TYR A 1 18 ? -2.309  -1.543  1.541   1.00 15.00 ?  314 TYR A H    2  
ATOM 1092  H HA   . TYR A 1 18 ? -0.232  -2.451  -0.217  1.00 15.00 ?  314 TYR A HA   2  
ATOM 1093  H HB2  . TYR A 1 18 ? -1.433  -1.460  -2.145  1.00 15.00 ?  314 TYR A HB2  2  
ATOM 1094  H HB3  . TYR A 1 18 ? -2.367  -2.768  -1.425  1.00 15.00 ?  314 TYR A HB3  2  
ATOM 1095  H HD1  . TYR A 1 18 ? -4.235  -2.112  0.211   1.00 15.00 ?  314 TYR A HD1  2  
ATOM 1096  H HD2  . TYR A 1 18 ? -2.401  0.652   -2.454  1.00 15.00 ?  314 TYR A HD2  2  
ATOM 1097  H HE1  . TYR A 1 18 ? -6.128  -0.578  0.502   1.00 15.00 ?  314 TYR A HE1  2  
ATOM 1098  H HE2  . TYR A 1 18 ? -4.284  2.217   -2.145  1.00 15.00 ?  314 TYR A HE2  2  
ATOM 1099  H HH   . TYR A 1 18 ? -6.698  1.714   0.266   1.00 15.00 ?  314 TYR A HH   2  
ATOM 1100  N N    . PHE A 1 19 ? 0.818   -0.277  0.270   1.00 15.00 ?  315 PHE A N    2  
ATOM 1101  C CA   . PHE A 1 19 ? 1.471   1.000   0.425   1.00 15.00 ?  315 PHE A CA   2  
ATOM 1102  C C    . PHE A 1 19 ? 1.770   1.571   -0.935  1.00 15.00 ?  315 PHE A C    2  
ATOM 1103  O O    . PHE A 1 19 ? 2.546   1.003   -1.680  1.00 15.00 ?  315 PHE A O    2  
ATOM 1104  C CB   . PHE A 1 19 ? 2.783   0.861   1.181   1.00 15.00 ?  315 PHE A CB   2  
ATOM 1105  C CG   . PHE A 1 19 ? 2.669   0.506   2.632   1.00 15.00 ?  315 PHE A CG   2  
ATOM 1106  C CD1  . PHE A 1 19 ? 1.929   -0.583  3.045   1.00 15.00 ?  315 PHE A CD1  2  
ATOM 1107  C CD2  . PHE A 1 19 ? 3.349   1.250   3.581   1.00 15.00 ?  315 PHE A CD2  2  
ATOM 1108  C CE1  . PHE A 1 19 ? 1.862   -0.920  4.378   1.00 15.00 ?  315 PHE A CE1  2  
ATOM 1109  C CE2  . PHE A 1 19 ? 3.294   0.914   4.912   1.00 15.00 ?  315 PHE A CE2  2  
ATOM 1110  C CZ   . PHE A 1 19 ? 2.548   -0.175  5.311   1.00 15.00 ?  315 PHE A CZ   2  
ATOM 1111  H H    . PHE A 1 19 ? 1.361   -1.096  0.216   1.00 15.00 ?  315 PHE A H    2  
ATOM 1112  H HA   . PHE A 1 19 ? 0.811   1.664   0.961   1.00 15.00 ?  315 PHE A HA   2  
ATOM 1113  H HB2  . PHE A 1 19 ? 3.372   0.092   0.709   1.00 15.00 ?  315 PHE A HB2  2  
ATOM 1114  H HB3  . PHE A 1 19 ? 3.320   1.799   1.113   1.00 15.00 ?  315 PHE A HB3  2  
ATOM 1115  H HD1  . PHE A 1 19 ? 1.391   -1.167  2.315   1.00 15.00 ?  315 PHE A HD1  2  
ATOM 1116  H HD2  . PHE A 1 19 ? 3.930   2.104   3.266   1.00 15.00 ?  315 PHE A HD2  2  
ATOM 1117  H HE1  . PHE A 1 19 ? 1.281   -1.774  4.693   1.00 15.00 ?  315 PHE A HE1  2  
ATOM 1118  H HE2  . PHE A 1 19 ? 3.834   1.501   5.641   1.00 15.00 ?  315 PHE A HE2  2  
ATOM 1119  H HZ   . PHE A 1 19 ? 2.509   -0.454  6.348   1.00 15.00 ?  315 PHE A HZ   2  
ATOM 1120  N N    . VAL A 1 20 ? 1.203   2.694   -1.264  1.00 15.00 ?  316 VAL A N    2  
ATOM 1121  C CA   . VAL A 1 20 ? 1.518   3.280   -2.531  1.00 15.00 ?  316 VAL A CA   2  
ATOM 1122  C C    . VAL A 1 20 ? 2.729   4.203   -2.350  1.00 15.00 ?  316 VAL A C    2  
ATOM 1123  O O    . VAL A 1 20 ? 2.694   5.143   -1.557  1.00 15.00 ?  316 VAL A O    2  
ATOM 1124  C CB   . VAL A 1 20 ? 0.316   4.025   -3.163  1.00 15.00 ?  316 VAL A CB   2  
ATOM 1125  C CG1  . VAL A 1 20 ? -0.705  3.027   -3.683  1.00 15.00 ?  316 VAL A CG1  2  
ATOM 1126  C CG2  . VAL A 1 20 ? -0.355  4.968   -2.186  1.00 15.00 ?  316 VAL A CG2  2  
ATOM 1127  H H    . VAL A 1 20 ? 0.590   3.143   -0.641  1.00 15.00 ?  316 VAL A H    2  
ATOM 1128  H HA   . VAL A 1 20 ? 1.783   2.464   -3.190  1.00 15.00 ?  316 VAL A HA   2  
ATOM 1129  H HB   . VAL A 1 20 ? 0.677   4.605   -4.001  1.00 15.00 ?  316 VAL A HB   2  
ATOM 1130  H HG11 . VAL A 1 20 ? -1.542  3.556   -4.113  1.00 15.00 ?  316 VAL A HG11 2  
ATOM 1131  H HG12 . VAL A 1 20 ? -1.050  2.406   -2.869  1.00 15.00 ?  316 VAL A HG12 2  
ATOM 1132  H HG13 . VAL A 1 20 ? -0.245  2.407   -4.437  1.00 15.00 ?  316 VAL A HG13 2  
ATOM 1133  H HG21 . VAL A 1 20 ? 0.396   5.487   -1.609  1.00 15.00 ?  316 VAL A HG21 2  
ATOM 1134  H HG22 . VAL A 1 20 ? -1.005  4.409   -1.529  1.00 15.00 ?  316 VAL A HG22 2  
ATOM 1135  H HG23 . VAL A 1 20 ? -0.939  5.687   -2.742  1.00 15.00 ?  316 VAL A HG23 2  
ATOM 1136  N N    . ASP A 1 21 ? 3.831   3.905   -3.033  1.00 15.00 ?  317 ASP A N    2  
ATOM 1137  C CA   . ASP A 1 21 ? 5.048   4.656   -2.846  1.00 15.00 ?  317 ASP A CA   2  
ATOM 1138  C C    . ASP A 1 21 ? 5.004   5.798   -3.823  1.00 15.00 ?  317 ASP A C    2  
ATOM 1139  O O    . ASP A 1 21 ? 4.892   5.566   -5.031  1.00 15.00 ?  317 ASP A O    2  
ATOM 1140  C CB   . ASP A 1 21 ? 6.303   3.825   -3.163  1.00 15.00 ?  317 ASP A CB   2  
ATOM 1141  C CG   . ASP A 1 21 ? 6.152   2.341   -2.924  1.00 15.00 ?  317 ASP A CG   2  
ATOM 1142  O OD1  . ASP A 1 21 ? 5.675   1.651   -3.845  1.00 15.00 ?  317 ASP A OD1  2  
ATOM 1143  O OD2  . ASP A 1 21 ? 6.570   1.861   -1.856  1.00 15.00 -1 317 ASP A OD2  2  
ATOM 1144  H H    . ASP A 1 21 ? 3.830   3.151   -3.670  1.00 15.00 ?  317 ASP A H    2  
ATOM 1145  H HA   . ASP A 1 21 ? 5.087   5.028   -1.832  1.00 15.00 ?  317 ASP A HA   2  
ATOM 1146  H HB2  . ASP A 1 21 ? 6.574   3.973   -4.196  1.00 15.00 ?  317 ASP A HB2  2  
ATOM 1147  H HB3  . ASP A 1 21 ? 7.109   4.174   -2.533  1.00 15.00 ?  317 ASP A HB3  2  
ATOM 1148  N N    . HIS A 1 22 ? 5.049   7.023   -3.321  1.00 15.00 ?  318 HIS A N    2  
ATOM 1149  C CA   . HIS A 1 22 ? 5.094   8.191   -4.191  1.00 15.00 ?  318 HIS A CA   2  
ATOM 1150  C C    . HIS A 1 22 ? 6.487   8.313   -4.799  1.00 15.00 ?  318 HIS A C    2  
ATOM 1151  O O    . HIS A 1 22 ? 6.704   9.053   -5.754  1.00 15.00 ?  318 HIS A O    2  
ATOM 1152  C CB   . HIS A 1 22 ? 4.709   9.476   -3.441  1.00 15.00 ?  318 HIS A CB   2  
ATOM 1153  C CG   . HIS A 1 22 ? 3.251   9.577   -3.060  1.00 15.00 ?  318 HIS A CG   2  
ATOM 1154  N ND1  . HIS A 1 22 ? 2.269   8.721   -3.522  1.00 15.00 ?  318 HIS A ND1  2  
ATOM 1155  C CD2  . HIS A 1 22 ? 2.614   10.457  -2.247  1.00 15.00 ?  318 HIS A CD2  2  
ATOM 1156  C CE1  . HIS A 1 22 ? 1.105   9.072   -3.010  1.00 15.00 ?  318 HIS A CE1  2  
ATOM 1157  N NE2  . HIS A 1 22 ? 1.280   10.119  -2.226  1.00 15.00 ?  318 HIS A NE2  2  
ATOM 1158  H H    . HIS A 1 22 ? 5.060   7.145   -2.344  1.00 15.00 ?  318 HIS A H    2  
ATOM 1159  H HA   . HIS A 1 22 ? 4.385   8.028   -4.992  1.00 15.00 ?  318 HIS A HA   2  
ATOM 1160  H HB2  . HIS A 1 22 ? 5.287   9.533   -2.531  1.00 15.00 ?  318 HIS A HB2  2  
ATOM 1161  H HB3  . HIS A 1 22 ? 4.947   10.327  -4.062  1.00 15.00 ?  318 HIS A HB3  2  
ATOM 1162  H HD1  . HIS A 1 22 ? 2.401   7.965   -4.140  1.00 15.00 ?  318 HIS A HD1  2  
ATOM 1163  H HD2  . HIS A 1 22 ? 3.068   11.284  -1.721  1.00 15.00 ?  318 HIS A HD2  2  
ATOM 1164  H HE1  . HIS A 1 22 ? 0.162   8.582   -3.202  1.00 15.00 ?  318 HIS A HE1  2  
ATOM 1165  H HE2  . HIS A 1 22 ? 0.660   10.359  -1.484  1.00 15.00 ?  318 HIS A HE2  2  
ATOM 1166  N N    . ASN A 1 23 ? 7.429   7.580   -4.214  1.00 15.00 ?  319 ASN A N    2  
ATOM 1167  C CA   . ASN A 1 23 ? 8.800   7.532   -4.707  1.00 15.00 ?  319 ASN A CA   2  
ATOM 1168  C C    . ASN A 1 23 ? 8.885   6.749   -6.016  1.00 15.00 ?  319 ASN A C    2  
ATOM 1169  O O    . ASN A 1 23 ? 9.517   7.190   -6.973  1.00 15.00 ?  319 ASN A O    2  
ATOM 1170  C CB   . ASN A 1 23 ? 9.715   6.875   -3.667  1.00 15.00 ?  319 ASN A CB   2  
ATOM 1171  C CG   . ASN A 1 23 ? 9.698   7.589   -2.329  1.00 15.00 ?  319 ASN A CG   2  
ATOM 1172  O OD1  . ASN A 1 23 ? 8.825   7.350   -1.499  1.00 15.00 ?  319 ASN A OD1  2  
ATOM 1173  N ND2  . ASN A 1 23 ? 10.678  8.445   -2.102  1.00 15.00 ?  319 ASN A ND2  2  
ATOM 1174  H H    . ASN A 1 23 ? 7.197   7.064   -3.414  1.00 15.00 ?  319 ASN A H    2  
ATOM 1175  H HA   . ASN A 1 23 ? 9.131   8.545   -4.879  1.00 15.00 ?  319 ASN A HA   2  
ATOM 1176  H HB2  . ASN A 1 23 ? 9.398   5.854   -3.511  1.00 15.00 ?  319 ASN A HB2  2  
ATOM 1177  H HB3  . ASN A 1 23 ? 10.729  6.877   -4.040  1.00 15.00 ?  319 ASN A HB3  2  
ATOM 1178  H HD21 . ASN A 1 23 ? 11.355  8.568   -2.803  1.00 15.00 ?  319 ASN A HD21 2  
ATOM 1179  H HD22 . ASN A 1 23 ? 10.694  8.914   -1.245  1.00 15.00 ?  319 ASN A HD22 2  
ATOM 1180  N N    . ASN A 1 24 ? 8.273   5.569   -6.039  1.00 15.00 ?  320 ASN A N    2  
ATOM 1181  C CA   . ASN A 1 24 ? 8.358   4.687   -7.204  1.00 15.00 ?  320 ASN A CA   2  
ATOM 1182  C C    . ASN A 1 24 ? 7.050   4.647   -8.016  1.00 15.00 ?  320 ASN A C    2  
ATOM 1183  O O    . ASN A 1 24 ? 7.038   4.173   -9.150  1.00 15.00 ?  320 ASN A O    2  
ATOM 1184  C CB   . ASN A 1 24 ? 8.768   3.280   -6.755  1.00 15.00 ?  320 ASN A CB   2  
ATOM 1185  C CG   . ASN A 1 24 ? 9.099   2.363   -7.916  1.00 15.00 ?  320 ASN A CG   2  
ATOM 1186  O OD1  . ASN A 1 24 ? 10.205  2.399   -8.453  1.00 15.00 ?  320 ASN A OD1  2  
ATOM 1187  N ND2  . ASN A 1 24 ? 8.163   1.509   -8.283  1.00 15.00 ?  320 ASN A ND2  2  
ATOM 1188  H H    . ASN A 1 24 ? 7.792   5.265   -5.241  1.00 15.00 ?  320 ASN A H    2  
ATOM 1189  H HA   . ASN A 1 24 ? 9.134   5.079   -7.842  1.00 15.00 ?  320 ASN A HA   2  
ATOM 1190  H HB2  . ASN A 1 24 ? 9.640   3.354   -6.123  1.00 15.00 ?  320 ASN A HB2  2  
ATOM 1191  H HB3  . ASN A 1 24 ? 7.958   2.841   -6.193  1.00 15.00 ?  320 ASN A HB3  2  
ATOM 1192  H HD21 . ASN A 1 24 ? 7.310   1.513   -7.786  1.00 15.00 ?  320 ASN A HD21 2  
ATOM 1193  H HD22 . ASN A 1 24 ? 8.350   0.909   -9.031  1.00 15.00 ?  320 ASN A HD22 2  
ATOM 1194  N N    . ARG A 1 25 ? 5.958   5.141   -7.428  1.00 15.00 ?  321 ARG A N    2  
ATOM 1195  C CA   . ARG A 1 25 ? 4.630   5.124   -8.058  1.00 15.00 ?  321 ARG A CA   2  
ATOM 1196  C C    . ARG A 1 25 ? 4.093   3.700   -8.158  1.00 15.00 ?  321 ARG A C    2  
ATOM 1197  O O    . ARG A 1 25 ? 3.563   3.295   -9.188  1.00 15.00 ?  321 ARG A O    2  
ATOM 1198  C CB   . ARG A 1 25 ? 4.623   5.784   -9.451  1.00 15.00 ?  321 ARG A CB   2  
ATOM 1199  C CG   . ARG A 1 25 ? 4.717   7.306   -9.437  1.00 15.00 ?  321 ARG A CG   2  
ATOM 1200  C CD   . ARG A 1 25 ? 6.079   7.802   -8.974  1.00 15.00 ?  321 ARG A CD   2  
ATOM 1201  N NE   . ARG A 1 25 ? 7.153   7.395   -9.879  1.00 15.00 ?  321 ARG A NE   2  
ATOM 1202  C CZ   . ARG A 1 25 ? 8.354   7.967   -9.908  1.00 15.00 ?  321 ARG A CZ   2  
ATOM 1203  N NH1  . ARG A 1 25 ? 8.615   9.011   -9.132  1.00 15.00 1  321 ARG A NH1  2  
ATOM 1204  N NH2  . ARG A 1 25 ? 9.285   7.511   -10.741 1.00 15.00 ?  321 ARG A NH2  2  
ATOM 1205  H H    . ARG A 1 25 ? 6.039   5.529   -6.534  1.00 15.00 ?  321 ARG A H    2  
ATOM 1206  H HA   . ARG A 1 25 ? 3.970   5.683   -7.411  1.00 15.00 ?  321 ARG A HA   2  
ATOM 1207  H HB2  . ARG A 1 25 ? 5.453   5.401   -10.024 1.00 15.00 ?  321 ARG A HB2  2  
ATOM 1208  H HB3  . ARG A 1 25 ? 3.697   5.514   -9.948  1.00 15.00 ?  321 ARG A HB3  2  
ATOM 1209  H HG2  . ARG A 1 25 ? 4.537   7.676   -10.435 1.00 15.00 ?  321 ARG A HG2  2  
ATOM 1210  H HG3  . ARG A 1 25 ? 3.961   7.693   -8.769  1.00 15.00 ?  321 ARG A HG3  2  
ATOM 1211  H HD2  . ARG A 1 25 ? 6.056   8.879   -8.923  1.00 15.00 ?  321 ARG A HD2  2  
ATOM 1212  H HD3  . ARG A 1 25 ? 6.279   7.399   -7.990  1.00 15.00 ?  321 ARG A HD3  2  
ATOM 1213  H HE   . ARG A 1 25 ? 6.969   6.646   -10.494 1.00 15.00 ?  321 ARG A HE   2  
ATOM 1214  H HH11 . ARG A 1 25 ? 7.904   9.374   -8.522  1.00 15.00 ?  321 ARG A HH11 2  
ATOM 1215  H HH12 . ARG A 1 25 ? 9.518   9.447   -9.155  1.00 15.00 ?  321 ARG A HH12 2  
ATOM 1216  H HH21 . ARG A 1 25 ? 9.077   6.737   -11.352 1.00 15.00 ?  321 ARG A HH21 2  
ATOM 1217  H HH22 . ARG A 1 25 ? 10.192  7.932   -10.765 1.00 15.00 ?  321 ARG A HH22 2  
ATOM 1218  N N    . THR A 1 26 ? 4.202   2.960   -7.068  1.00 15.00 ?  322 THR A N    2  
ATOM 1219  C CA   . THR A 1 26 ? 3.750   1.567   -7.040  1.00 15.00 ?  322 THR A CA   2  
ATOM 1220  C C    . THR A 1 26 ? 2.854   1.293   -5.840  1.00 15.00 ?  322 THR A C    2  
ATOM 1221  O O    . THR A 1 26 ? 2.971   1.962   -4.829  1.00 15.00 ?  322 THR A O    2  
ATOM 1222  C CB   . THR A 1 26 ? 4.936   0.589   -7.030  1.00 15.00 ?  322 THR A CB   2  
ATOM 1223  O OG1  . THR A 1 26 ? 6.067   1.194   -6.386  1.00 15.00 ?  322 THR A OG1  2  
ATOM 1224  C CG2  . THR A 1 26 ? 5.299   0.167   -8.446  1.00 15.00 ?  322 THR A CG2  2  
ATOM 1225  H H    . THR A 1 26 ? 4.580   3.367   -6.244  1.00 15.00 ?  322 THR A H    2  
ATOM 1226  H HA   . THR A 1 26 ? 3.180   1.391   -7.942  1.00 15.00 ?  322 THR A HA   2  
ATOM 1227  H HB   . THR A 1 26 ? 4.648   -0.291  -6.473  1.00 15.00 ?  322 THR A HB   2  
ATOM 1228  H HG1  . THR A 1 26 ? 5.875   1.292   -5.431  1.00 15.00 ?  322 THR A HG1  2  
ATOM 1229  H HG21 . THR A 1 26 ? 6.122   -0.532  -8.413  1.00 15.00 ?  322 THR A HG21 2  
ATOM 1230  H HG22 . THR A 1 26 ? 5.587   1.037   -9.019  1.00 15.00 ?  322 THR A HG22 2  
ATOM 1231  H HG23 . THR A 1 26 ? 4.445   -0.302  -8.910  1.00 15.00 ?  322 THR A HG23 2  
ATOM 1232  N N    . THR A 1 27 ? 1.922   0.357   -5.963  1.00 15.00 ?  323 THR A N    2  
ATOM 1233  C CA   . THR A 1 27 ? 1.126   -0.042  -4.811  1.00 15.00 ?  323 THR A CA   2  
ATOM 1234  C C    . THR A 1 27 ? 1.683   -1.345  -4.219  1.00 15.00 ?  323 THR A C    2  
ATOM 1235  O O    . THR A 1 27 ? 1.984   -2.292  -4.949  1.00 15.00 ?  323 THR A O    2  
ATOM 1236  C CB   . THR A 1 27 ? -0.373  -0.184  -5.154  1.00 15.00 ?  323 THR A CB   2  
ATOM 1237  O OG1  . THR A 1 27 ? -1.134  -0.352  -3.957  1.00 15.00 ?  323 THR A OG1  2  
ATOM 1238  C CG2  . THR A 1 27 ? -0.646  -1.354  -6.077  1.00 15.00 ?  323 THR A CG2  2  
ATOM 1239  H H    . THR A 1 27 ? 1.778   -0.080  -6.829  1.00 15.00 ?  323 THR A H    2  
ATOM 1240  H HA   . THR A 1 27 ? 1.226   0.744   -4.072  1.00 15.00 ?  323 THR A HA   2  
ATOM 1241  H HB   . THR A 1 27 ? -0.695  0.723   -5.648  1.00 15.00 ?  323 THR A HB   2  
ATOM 1242  H HG1  . THR A 1 27 ? -1.751  0.378   -3.865  1.00 15.00 ?  323 THR A HG1  2  
ATOM 1243  H HG21 . THR A 1 27 ? -0.293  -1.127  -7.070  1.00 15.00 ?  323 THR A HG21 2  
ATOM 1244  H HG22 . THR A 1 27 ? -1.709  -1.539  -6.102  1.00 15.00 ?  323 THR A HG22 2  
ATOM 1245  H HG23 . THR A 1 27 ? -0.137  -2.231  -5.704  1.00 15.00 ?  323 THR A HG23 2  
ATOM 1246  N N    . GLN A 1 28 ? 1.825   -1.390  -2.898  1.00 15.00 ?  324 GLN A N    2  
ATOM 1247  C CA   . GLN A 1 28 ? 2.597   -2.437  -2.256  1.00 15.00 ?  324 GLN A CA   2  
ATOM 1248  C C    . GLN A 1 28 ? 1.772   -3.284  -1.288  1.00 15.00 ?  324 GLN A C    2  
ATOM 1249  O O    . GLN A 1 28 ? 1.612   -2.921  -0.130  1.00 15.00 ?  324 GLN A O    2  
ATOM 1250  C CB   . GLN A 1 28 ? 3.777   -1.830  -1.477  1.00 15.00 ?  324 GLN A CB   2  
ATOM 1251  C CG   . GLN A 1 28 ? 4.732   -0.990  -2.307  1.00 15.00 ?  324 GLN A CG   2  
ATOM 1252  C CD   . GLN A 1 28 ? 5.491   -1.800  -3.340  1.00 15.00 ?  324 GLN A CD   2  
ATOM 1253  O OE1  . GLN A 1 28 ? 5.050   -1.958  -4.476  1.00 15.00 ?  324 GLN A OE1  2  
ATOM 1254  N NE2  . GLN A 1 28 ? 6.639   -2.328  -2.948  1.00 15.00 ?  324 GLN A NE2  2  
ATOM 1255  H H    . GLN A 1 28 ? 1.416   -0.692  -2.345  1.00 15.00 ?  324 GLN A H    2  
ATOM 1256  H HA   . GLN A 1 28 ? 2.990   -3.079  -3.029  1.00 15.00 ?  324 GLN A HA   2  
ATOM 1257  H HB2  . GLN A 1 28 ? 3.381   -1.199  -0.696  1.00 15.00 ?  324 GLN A HB2  2  
ATOM 1258  H HB3  . GLN A 1 28 ? 4.343   -2.628  -1.021  1.00 15.00 ?  324 GLN A HB3  2  
ATOM 1259  H HG2  . GLN A 1 28 ? 4.164   -0.225  -2.813  1.00 15.00 ?  324 GLN A HG2  2  
ATOM 1260  H HG3  . GLN A 1 28 ? 5.444   -0.519  -1.639  1.00 15.00 ?  324 GLN A HG3  2  
ATOM 1261  H HE21 . GLN A 1 28 ? 6.931   -2.167  -2.022  1.00 15.00 ?  324 GLN A HE21 2  
ATOM 1262  H HE22 . GLN A 1 28 ? 7.154   -2.851  -3.596  1.00 15.00 ?  324 GLN A HE22 2  
ATOM 1263  N N    . PHE A 1 29 ? 1.245   -4.406  -1.775  1.00 15.00 ?  325 PHE A N    2  
ATOM 1264  C CA   . PHE A 1 29 ? 0.854   -5.521  -0.895  1.00 15.00 ?  325 PHE A CA   2  
ATOM 1265  C C    . PHE A 1 29 ? 2.106   -6.101  -0.292  1.00 15.00 ?  325 PHE A C    2  
ATOM 1266  O O    . PHE A 1 29 ? 2.099   -7.012  0.532   1.00 15.00 ?  325 PHE A O    2  
ATOM 1267  C CB   . PHE A 1 29 ? 0.048   -6.589  -1.614  1.00 15.00 ?  325 PHE A CB   2  
ATOM 1268  C CG   . PHE A 1 29 ? -1.380  -6.195  -1.733  1.00 15.00 ?  325 PHE A CG   2  
ATOM 1269  C CD1  . PHE A 1 29 ? -2.001  -5.518  -0.695  1.00 15.00 ?  325 PHE A CD1  2  
ATOM 1270  C CD2  . PHE A 1 29 ? -2.098  -6.473  -2.876  1.00 15.00 ?  325 PHE A CD2  2  
ATOM 1271  C CE1  . PHE A 1 29 ? -3.319  -5.125  -0.813  1.00 15.00 ?  325 PHE A CE1  2  
ATOM 1272  C CE2  . PHE A 1 29 ? -3.416  -6.089  -2.990  1.00 15.00 ?  325 PHE A CE2  2  
ATOM 1273  C CZ   . PHE A 1 29 ? -4.025  -5.410  -1.961  1.00 15.00 ?  325 PHE A CZ   2  
ATOM 1274  H H    . PHE A 1 29 ? 1.104   -4.486  -2.739  1.00 15.00 ?  325 PHE A H    2  
ATOM 1275  H HA   . PHE A 1 29 ? 0.255   -5.106  -0.096  1.00 15.00 ?  325 PHE A HA   2  
ATOM 1276  H HB2  . PHE A 1 29 ? 0.449   -6.740  -2.608  1.00 15.00 ?  325 PHE A HB2  2  
ATOM 1277  H HB3  . PHE A 1 29 ? 0.097   -7.514  -1.058  1.00 15.00 ?  325 PHE A HB3  2  
ATOM 1278  H HD1  . PHE A 1 29 ? -1.435  -5.291  0.233   1.00 15.00 ?  325 PHE A HD1  2  
ATOM 1279  H HD2  . PHE A 1 29 ? -1.621  -7.007  -3.683  1.00 15.00 ?  325 PHE A HD2  2  
ATOM 1280  H HE1  . PHE A 1 29 ? -3.803  -4.607  -0.002  1.00 15.00 ?  325 PHE A HE1  2  
ATOM 1281  H HE2  . PHE A 1 29 ? -3.969  -6.314  -3.891  1.00 15.00 ?  325 PHE A HE2  2  
ATOM 1282  H HZ   . PHE A 1 29 ? -5.056  -5.102  -2.051  1.00 15.00 ?  325 PHE A HZ   2  
ATOM 1283  N N    . THR A 1 30 ? 3.185   -5.605  -0.830  1.00 15.00 ?  326 THR A N    2  
ATOM 1284  C CA   . THR A 1 30 ? 4.500   -5.927  -0.342  1.00 15.00 ?  326 THR A CA   2  
ATOM 1285  C C    . THR A 1 30 ? 4.796   -4.893  0.723   1.00 15.00 ?  326 THR A C    2  
ATOM 1286  O O    . THR A 1 30 ? 5.317   -3.819  0.433   1.00 15.00 ?  326 THR A O    2  
ATOM 1287  C CB   . THR A 1 30 ? 5.556   -5.853  -1.461  1.00 15.00 ?  326 THR A CB   2  
ATOM 1288  O OG1  . THR A 1 30 ? 5.080   -6.547  -2.619  1.00 15.00 ?  326 THR A OG1  2  
ATOM 1289  C CG2  . THR A 1 30 ? 6.872   -6.468  -1.005  1.00 15.00 ?  326 THR A CG2  2  
ATOM 1290  H H    . THR A 1 30 ? 3.061   -4.885  -1.483  1.00 15.00 ?  326 THR A H    2  
ATOM 1291  H HA   . THR A 1 30 ? 4.489   -6.921  0.082   1.00 15.00 ?  326 THR A HA   2  
ATOM 1292  H HB   . THR A 1 30 ? 5.726   -4.816  -1.714  1.00 15.00 ?  326 THR A HB   2  
ATOM 1293  H HG1  . THR A 1 30 ? 4.263   -7.003  -2.398  1.00 15.00 ?  326 THR A HG1  2  
ATOM 1294  H HG21 . THR A 1 30 ? 6.713   -7.503  -0.739  1.00 15.00 ?  326 THR A HG21 2  
ATOM 1295  H HG22 . THR A 1 30 ? 7.245   -5.929  -0.147  1.00 15.00 ?  326 THR A HG22 2  
ATOM 1296  H HG23 . THR A 1 30 ? 7.592   -6.410  -1.807  1.00 15.00 ?  326 THR A HG23 2  
ATOM 1297  N N    . ASP A 1 31 ? 4.426   -5.200  1.943   1.00 15.00 ?  327 ASP A N    2  
ATOM 1298  C CA   . ASP A 1 31 ? 4.268   -4.172  2.936   1.00 15.00 ?  327 ASP A CA   2  
ATOM 1299  C C    . ASP A 1 31 ? 4.975   -4.462  4.212   1.00 15.00 ?  327 ASP A C    2  
ATOM 1300  O O    . ASP A 1 31 ? 5.165   -5.604  4.632   1.00 15.00 ?  327 ASP A O    2  
ATOM 1301  C CB   . ASP A 1 31 ? 2.810   -3.884  3.231   1.00 15.00 ?  327 ASP A CB   2  
ATOM 1302  C CG   . ASP A 1 31 ? 1.979   -5.128  3.450   1.00 15.00 ?  327 ASP A CG   2  
ATOM 1303  O OD1  . ASP A 1 31 ? 2.136   -5.757  4.509   1.00 15.00 ?  327 ASP A OD1  2  
ATOM 1304  O OD2  . ASP A 1 31 ? 1.166   -5.467  2.585   1.00 15.00 -1 327 ASP A OD2  2  
ATOM 1305  H H    . ASP A 1 31 ? 4.244   -6.133  2.186   1.00 15.00 ?  327 ASP A H    2  
ATOM 1306  H HA   . ASP A 1 31 ? 4.694   -3.264  2.534   1.00 15.00 ?  327 ASP A HA   2  
ATOM 1307  H HB2  . ASP A 1 31 ? 2.755   -3.286  4.130   1.00 15.00 ?  327 ASP A HB2  2  
ATOM 1308  H HB3  . ASP A 1 31 ? 2.416   -3.317  2.417   1.00 15.00 ?  327 ASP A HB3  2  
ATOM 1309  N N    . PRO A 1 32 ? 5.356   -3.370  4.837   1.00 15.00 ?  328 PRO A N    2  
ATOM 1310  C CA   . PRO A 1 32 ? 5.933   -3.360  6.156   1.00 15.00 ?  328 PRO A CA   2  
ATOM 1311  C C    . PRO A 1 32 ? 4.877   -3.819  7.176   1.00 15.00 ?  328 PRO A C    2  
ATOM 1312  O O    . PRO A 1 32 ? 5.186   -4.105  8.331   1.00 15.00 ?  328 PRO A O    2  
ATOM 1313  C CB   . PRO A 1 32 ? 6.373   -1.891  6.339   1.00 15.00 ?  328 PRO A CB   2  
ATOM 1314  C CG   . PRO A 1 32 ? 6.259   -1.272  4.969   1.00 15.00 ?  328 PRO A CG   2  
ATOM 1315  C CD   . PRO A 1 32 ? 5.178   -2.012  4.303   1.00 15.00 ?  328 PRO A CD   2  
ATOM 1316  H HA   . PRO A 1 32 ? 6.794   -4.013  6.214   1.00 15.00 ?  328 PRO A HA   2  
ATOM 1317  H HB2  . PRO A 1 32 ? 5.719   -1.404  7.047   1.00 15.00 ?  328 PRO A HB2  2  
ATOM 1318  H HB3  . PRO A 1 32 ? 7.390   -1.859  6.701   1.00 15.00 ?  328 PRO A HB3  2  
ATOM 1319  H HG2  . PRO A 1 32 ? 6.005   -0.227  5.050   1.00 15.00 ?  328 PRO A HG2  2  
ATOM 1320  H HG3  . PRO A 1 32 ? 7.161   -1.399  4.396   1.00 15.00 ?  328 PRO A HG3  2  
ATOM 1321  H HD2  . PRO A 1 32 ? 4.214   -1.606  4.576   1.00 15.00 ?  328 PRO A HD2  2  
ATOM 1322  H HD3  . PRO A 1 32 ? 5.313   -1.995  3.230   1.00 15.00 ?  328 PRO A HD3  2  
ATOM 1323  N N    . ARG A 1 33 ? 3.610   -3.841  6.725   1.00 15.00 ?  329 ARG A N    2  
ATOM 1324  C CA   . ARG A 1 33 ? 2.490   -4.332  7.530   1.00 15.00 ?  329 ARG A CA   2  
ATOM 1325  C C    . ARG A 1 33 ? 2.638   -5.819  7.861   1.00 15.00 ?  329 ARG A C    2  
ATOM 1326  O O    . ARG A 1 33 ? 2.776   -6.188  9.029   1.00 15.00 ?  329 ARG A O    2  
ATOM 1327  C CB   . ARG A 1 33 ? 1.135   -4.075  6.828   1.00 15.00 ?  329 ARG A CB   2  
ATOM 1328  C CG   . ARG A 1 33 ? 0.660   -2.632  6.943   1.00 15.00 ?  329 ARG A CG   2  
ATOM 1329  C CD   . ARG A 1 33 ? 0.372   -2.230  8.388   1.00 15.00 ?  329 ARG A CD   2  
ATOM 1330  N NE   . ARG A 1 33 ? 1.592   -2.106  9.192   1.00 15.00 ?  329 ARG A NE   2  
ATOM 1331  C CZ   . ARG A 1 33 ? 1.711   -2.565  10.442  1.00 15.00 ?  329 ARG A CZ   2  
ATOM 1332  N NH1  . ARG A 1 33 ? 0.684   -3.149  11.044  1.00 15.00 1  329 ARG A NH1  2  
ATOM 1333  N NH2  . ARG A 1 33 ? 2.856   -2.432  11.097  1.00 15.00 ?  329 ARG A NH2  2  
ATOM 1334  H H    . ARG A 1 33 ? 3.433   -3.540  5.809   1.00 15.00 ?  329 ARG A H    2  
ATOM 1335  H HA   . ARG A 1 33 ? 2.503   -3.781  8.459   1.00 15.00 ?  329 ARG A HA   2  
ATOM 1336  H HB2  . ARG A 1 33 ? 1.201   -4.332  5.753   1.00 15.00 ?  329 ARG A HB2  2  
ATOM 1337  H HB3  . ARG A 1 33 ? 0.389   -4.708  7.287   1.00 15.00 ?  329 ARG A HB3  2  
ATOM 1338  H HG2  . ARG A 1 33 ? 1.425   -1.981  6.546   1.00 15.00 ?  329 ARG A HG2  2  
ATOM 1339  H HG3  . ARG A 1 33 ? -0.244  -2.518  6.361   1.00 15.00 ?  329 ARG A HG3  2  
ATOM 1340  H HD2  . ARG A 1 33 ? -0.141  -1.279  8.386   1.00 15.00 ?  329 ARG A HD2  2  
ATOM 1341  H HD3  . ARG A 1 33 ? -0.267  -2.977  8.836   1.00 15.00 ?  329 ARG A HD3  2  
ATOM 1342  H HE   . ARG A 1 33 ? 2.360   -1.661  8.777   1.00 15.00 ?  329 ARG A HE   2  
ATOM 1343  H HH11 . ARG A 1 33 ? -0.198  -3.247  10.569  1.00 15.00 ?  329 ARG A HH11 2  
ATOM 1344  H HH12 . ARG A 1 33 ? 0.783   -3.499  11.981  1.00 15.00 ?  329 ARG A HH12 2  
ATOM 1345  H HH21 . ARG A 1 33 ? 3.638   -1.987  10.665  1.00 15.00 ?  329 ARG A HH21 2  
ATOM 1346  H HH22 . ARG A 1 33 ? 2.939   -2.788  12.039  1.00 15.00 ?  329 ARG A HH22 2  
ATOM 1347  N N    . LEU A 1 34 ? 2.623   -6.661  6.840   1.00 15.00 ?  330 LEU A N    2  
ATOM 1348  C CA   . LEU A 1 34 ? 2.704   -8.106  7.027   1.00 15.00 ?  330 LEU A CA   2  
ATOM 1349  C C    . LEU A 1 34 ? 4.087   -8.516  7.520   1.00 15.00 ?  330 LEU A C    2  
ATOM 1350  O O    . LEU A 1 34 ? 4.283   -9.631  8.000   1.00 15.00 ?  330 LEU A O    2  
ATOM 1351  C CB   . LEU A 1 34 ? 2.368   -8.832  5.718   1.00 15.00 ?  330 LEU A CB   2  
ATOM 1352  C CG   . LEU A 1 34 ? 2.268   -10.358 5.816   1.00 15.00 ?  330 LEU A CG   2  
ATOM 1353  C CD1  . LEU A 1 34 ? 1.147   -10.761 6.764   1.00 15.00 ?  330 LEU A CD1  2  
ATOM 1354  C CD2  . LEU A 1 34 ? 2.043   -10.964 4.439   1.00 15.00 ?  330 LEU A CD2  2  
ATOM 1355  H H    . LEU A 1 34 ? 2.539   -6.302  5.917   1.00 15.00 ?  330 LEU A H    2  
ATOM 1356  H HA   . LEU A 1 34 ? 1.976   -8.381  7.774   1.00 15.00 ?  330 LEU A HA   2  
ATOM 1357  H HB2  . LEU A 1 34 ? 1.423   -8.454  5.359   1.00 15.00 ?  330 LEU A HB2  2  
ATOM 1358  H HB3  . LEU A 1 34 ? 3.131   -8.590  4.993   1.00 15.00 ?  330 LEU A HB3  2  
ATOM 1359  H HG   . LEU A 1 34 ? 3.194   -10.750 6.209   1.00 15.00 ?  330 LEU A HG   2  
ATOM 1360  H HD11 . LEU A 1 34 ? 0.208   -10.383 6.390   1.00 15.00 ?  330 LEU A HD11 2  
ATOM 1361  H HD12 . LEU A 1 34 ? 1.338   -10.347 7.743   1.00 15.00 ?  330 LEU A HD12 2  
ATOM 1362  H HD13 . LEU A 1 34 ? 1.101   -11.838 6.831   1.00 15.00 ?  330 LEU A HD13 2  
ATOM 1363  H HD21 . LEU A 1 34 ? 1.115   -10.593 4.031   1.00 15.00 ?  330 LEU A HD21 2  
ATOM 1364  H HD22 . LEU A 1 34 ? 1.995   -12.039 4.523   1.00 15.00 ?  330 LEU A HD22 2  
ATOM 1365  H HD23 . LEU A 1 34 ? 2.859   -10.689 3.787   1.00 15.00 ?  330 LEU A HD23 2  
ATOM 1366  N N    . SER A 1 35 ? 5.043   -7.613  7.395   1.00 15.00 ?  331 SER A N    2  
ATOM 1367  C CA   . SER A 1 35 ? 6.394   -7.861  7.873   1.00 15.00 ?  331 SER A CA   2  
ATOM 1368  C C    . SER A 1 35 ? 6.495   -7.578  9.376   1.00 15.00 ?  331 SER A C    2  
ATOM 1369  O O    . SER A 1 35 ? 7.501   -7.890  10.014  1.00 15.00 ?  331 SER A O    2  
ATOM 1370  C CB   . SER A 1 35 ? 7.390   -7.000  7.091   1.00 15.00 ?  331 SER A CB   2  
ATOM 1371  O OG   . SER A 1 35 ? 8.731   -7.367  7.370   1.00 15.00 ?  331 SER A OG   2  
ATOM 1372  H H    . SER A 1 35 ? 4.841   -6.763  6.949   1.00 15.00 ?  331 SER A H    2  
ATOM 1373  H HA   . SER A 1 35 ? 6.619   -8.902  7.702   1.00 15.00 ?  331 SER A HA   2  
ATOM 1374  H HB2  . SER A 1 35 ? 7.212   -7.121  6.033   1.00 15.00 ?  331 SER A HB2  2  
ATOM 1375  H HB3  . SER A 1 35 ? 7.253   -5.962  7.360   1.00 15.00 ?  331 SER A HB3  2  
ATOM 1376  H HG   . SER A 1 35 ? 8.757   -8.290  7.657   1.00 15.00 ?  331 SER A HG   2  
ATOM 1377  N N    . ALA A 1 36 ? 5.451   -6.979  9.938   1.00 15.00 ?  332 ALA A N    2  
ATOM 1378  C CA   . ALA A 1 36 ? 5.453   -6.614  11.348  1.00 15.00 ?  332 ALA A CA   2  
ATOM 1379  C C    . ALA A 1 36 ? 4.352   -7.337  12.123  1.00 15.00 ?  332 ALA A C    2  
ATOM 1380  O O    . ALA A 1 36 ? 4.601   -7.848  13.214  1.00 15.00 ?  332 ALA A O    2  
ATOM 1381  C CB   . ALA A 1 36 ? 5.305   -5.109  11.501  1.00 15.00 ?  332 ALA A CB   2  
ATOM 1382  H H    . ALA A 1 36 ? 4.665   -6.776  9.393   1.00 15.00 ?  332 ALA A H    2  
ATOM 1383  H HA   . ALA A 1 36 ? 6.410   -6.898  11.761  1.00 15.00 ?  332 ALA A HA   2  
ATOM 1384  H HB1  . ALA A 1 36 ? 6.097   -4.615  10.959  1.00 15.00 ?  332 ALA A HB1  2  
ATOM 1385  H HB2  . ALA A 1 36 ? 5.366   -4.845  12.547  1.00 15.00 ?  332 ALA A HB2  2  
ATOM 1386  H HB3  . ALA A 1 36 ? 4.349   -4.800  11.105  1.00 15.00 ?  332 ALA A HB3  2  
ATOM 1387  N N    . ASN A 1 37 ? 3.148   -7.381  11.549  1.00 15.00 ?  333 ASN A N    2  
ATOM 1388  C CA   . ASN A 1 37 ? 1.976   -7.986  12.204  1.00 15.00 ?  333 ASN A CA   2  
ATOM 1389  C C    . ASN A 1 37 ? 1.552   -7.153  13.411  1.00 15.00 ?  333 ASN A C    2  
ATOM 1390  O O    . ASN A 1 37 ? 1.953   -7.485  14.545  1.00 15.00 ?  333 ASN A O    2  
ATOM 1391  C CB   . ASN A 1 37 ? 2.232   -9.440  12.644  1.00 15.00 ?  333 ASN A CB   2  
ATOM 1392  C CG   . ASN A 1 37 ? 2.256   -10.435 11.494  1.00 15.00 ?  333 ASN A CG   2  
ATOM 1393  O OD1  . ASN A 1 37 ? 1.851   -11.587 11.653  1.00 15.00 ?  333 ASN A OD1  2  
ATOM 1394  N ND2  . ASN A 1 37 ? 2.744   -10.013 10.341  1.00 15.00 ?  333 ASN A ND2  2  
ATOM 1395  O OXT  . ASN A 1 37 ? 0.837   -6.151  13.217  1.00 15.00 ?  333 ASN A OXT  2  
ATOM 1396  H H    . ASN A 1 37 ? 3.031   -6.972  10.665  1.00 15.00 ?  333 ASN A H    2  
ATOM 1397  H HA   . ASN A 1 37 ? 1.166   -7.978  11.488  1.00 15.00 ?  333 ASN A HA   2  
ATOM 1398  H HB2  . ASN A 1 37 ? 3.185   -9.489  13.149  1.00 15.00 ?  333 ASN A HB2  2  
ATOM 1399  H HB3  . ASN A 1 37 ? 1.456   -9.738  13.333  1.00 15.00 ?  333 ASN A HB3  2  
ATOM 1400  H HD21 . ASN A 1 37 ? 3.066   -9.088  10.288  1.00 15.00 ?  333 ASN A HD21 2  
ATOM 1401  H HD22 . ASN A 1 37 ? 2.774   -10.641 9.588   1.00 15.00 ?  333 ASN A HD22 2  
ATOM 1402  N N    . GLU B 2 1  ? 3.351   -10.602 -6.904  1.00 15.00 ?  203 GLU B N    2  
ATOM 1403  C CA   . GLU B 2 1  ? 3.112   -10.656 -5.442  1.00 15.00 ?  203 GLU B CA   2  
ATOM 1404  C C    . GLU B 2 1  ? 2.266   -11.878 -5.106  1.00 15.00 ?  203 GLU B C    2  
ATOM 1405  O O    . GLU B 2 1  ? 1.440   -12.306 -5.906  1.00 15.00 ?  203 GLU B O    2  
ATOM 1406  C CB   . GLU B 2 1  ? 2.424   -9.366  -4.948  1.00 15.00 ?  203 GLU B CB   2  
ATOM 1407  C CG   . GLU B 2 1  ? 1.024   -9.127  -5.503  1.00 15.00 ?  203 GLU B CG   2  
ATOM 1408  C CD   . GLU B 2 1  ? 1.018   -8.789  -6.978  1.00 15.00 ?  203 GLU B CD   2  
ATOM 1409  O OE1  . GLU B 2 1  ? 1.015   -9.723  -7.805  1.00 15.00 -1 203 GLU B OE1  2  
ATOM 1410  O OE2  . GLU B 2 1  ? 1.033   -7.593  -7.313  1.00 15.00 ?  203 GLU B OE2  2  
ATOM 1411  H H1   . GLU B 2 1  ? 3.982   -9.812  -7.140  1.00 15.00 ?  203 GLU B H1   2  
ATOM 1412  H H2   . GLU B 2 1  ? 2.444   -10.473 -7.408  1.00 15.00 ?  203 GLU B H2   2  
ATOM 1413  H H3   . GLU B 2 1  ? 3.789   -11.492 -7.227  1.00 15.00 ?  203 GLU B H3   2  
ATOM 1414  H HA   . GLU B 2 1  ? 4.070   -10.755 -4.951  1.00 15.00 ?  203 GLU B HA   2  
ATOM 1415  H HB2  . GLU B 2 1  ? 2.351   -9.400  -3.871  1.00 15.00 ?  203 GLU B HB2  2  
ATOM 1416  H HB3  . GLU B 2 1  ? 3.041   -8.525  -5.226  1.00 15.00 ?  203 GLU B HB3  2  
ATOM 1417  H HG2  . GLU B 2 1  ? 0.438   -10.020 -5.353  1.00 15.00 ?  203 GLU B HG2  2  
ATOM 1418  H HG3  . GLU B 2 1  ? 0.573   -8.308  -4.959  1.00 15.00 ?  203 GLU B HG3  2  
ATOM 1419  N N    . LEU B 2 2  ? 2.467   -12.428 -3.912  1.00 15.00 ?  204 LEU B N    2  
ATOM 1420  C CA   . LEU B 2 2  ? 1.773   -13.648 -3.498  1.00 15.00 ?  204 LEU B CA   2  
ATOM 1421  C C    . LEU B 2 2  ? 0.308   -13.365 -3.149  1.00 15.00 ?  204 LEU B C    2  
ATOM 1422  O O    . LEU B 2 2  ? -0.488  -14.283 -2.957  1.00 15.00 ?  204 LEU B O    2  
ATOM 1423  C CB   . LEU B 2 2  ? 2.494   -14.274 -2.297  1.00 15.00 ?  204 LEU B CB   2  
ATOM 1424  C CG   . LEU B 2 2  ? 1.957   -15.630 -1.836  1.00 15.00 ?  204 LEU B CG   2  
ATOM 1425  C CD1  . LEU B 2 2  ? 2.130   -16.677 -2.927  1.00 15.00 ?  204 LEU B CD1  2  
ATOM 1426  C CD2  . LEU B 2 2  ? 2.653   -16.066 -0.555  1.00 15.00 ?  204 LEU B CD2  2  
ATOM 1427  H H    . LEU B 2 2  ? 3.097   -12.008 -3.293  1.00 15.00 ?  204 LEU B H    2  
ATOM 1428  H HA   . LEU B 2 2  ? 1.806   -14.342 -4.324  1.00 15.00 ?  204 LEU B HA   2  
ATOM 1429  H HB2  . LEU B 2 2  ? 3.536   -14.392 -2.554  1.00 15.00 ?  204 LEU B HB2  2  
ATOM 1430  H HB3  . LEU B 2 2  ? 2.424   -13.585 -1.466  1.00 15.00 ?  204 LEU B HB3  2  
ATOM 1431  H HG   . LEU B 2 2  ? 0.902   -15.537 -1.629  1.00 15.00 ?  204 LEU B HG   2  
ATOM 1432  H HD11 . LEU B 2 2  ? 1.750   -17.627 -2.581  1.00 15.00 ?  204 LEU B HD11 2  
ATOM 1433  H HD12 . LEU B 2 2  ? 3.178   -16.776 -3.170  1.00 15.00 ?  204 LEU B HD12 2  
ATOM 1434  H HD13 . LEU B 2 2  ? 1.586   -16.371 -3.809  1.00 15.00 ?  204 LEU B HD13 2  
ATOM 1435  H HD21 . LEU B 2 2  ? 3.717   -16.130 -0.725  1.00 15.00 ?  204 LEU B HD21 2  
ATOM 1436  H HD22 . LEU B 2 2  ? 2.278   -17.033 -0.254  1.00 15.00 ?  204 LEU B HD22 2  
ATOM 1437  H HD23 . LEU B 2 2  ? 2.457   -15.345 0.225   1.00 15.00 ?  204 LEU B HD23 2  
ATOM 1438  N N    . GLU B 2 3  ? -0.038  -12.091 -3.061  1.00 15.00 ?  205 GLU B N    2  
ATOM 1439  C CA   . GLU B 2 3  ? -1.389  -11.684 -2.713  1.00 15.00 ?  205 GLU B CA   2  
ATOM 1440  C C    . GLU B 2 3  ? -2.139  -11.236 -3.968  1.00 15.00 ?  205 GLU B C    2  
ATOM 1441  O O    . GLU B 2 3  ? -1.521  -10.878 -4.971  1.00 15.00 ?  205 GLU B O    2  
ATOM 1442  C CB   . GLU B 2 3  ? -1.327  -10.560 -1.666  1.00 15.00 ?  205 GLU B CB   2  
ATOM 1443  C CG   . GLU B 2 3  ? -2.682  -10.117 -1.133  1.00 15.00 ?  205 GLU B CG   2  
ATOM 1444  C CD   . GLU B 2 3  ? -3.526  -11.276 -0.640  1.00 15.00 ?  205 GLU B CD   2  
ATOM 1445  O OE1  . GLU B 2 3  ? -3.277  -11.775 0.477   1.00 15.00 -1 205 GLU B OE1  2  
ATOM 1446  O OE2  . GLU B 2 3  ? -4.442  -11.694 -1.379  1.00 15.00 ?  205 GLU B OE2  2  
ATOM 1447  H H    . GLU B 2 3  ? 0.628   -11.404 -3.251  1.00 15.00 ?  205 GLU B H    2  
ATOM 1448  H HA   . GLU B 2 3  ? -1.896  -12.538 -2.287  1.00 15.00 ?  205 GLU B HA   2  
ATOM 1449  H HB2  . GLU B 2 3  ? -0.734  -10.900 -0.830  1.00 15.00 ?  205 GLU B HB2  2  
ATOM 1450  H HB3  . GLU B 2 3  ? -0.842  -9.701  -2.109  1.00 15.00 ?  205 GLU B HB3  2  
ATOM 1451  H HG2  . GLU B 2 3  ? -2.525  -9.432  -0.314  1.00 15.00 ?  205 GLU B HG2  2  
ATOM 1452  H HG3  . GLU B 2 3  ? -3.217  -9.612  -1.925  1.00 15.00 ?  205 GLU B HG3  2  
ATOM 1453  N N    . SER B 2 4  ? -3.466  -11.274 -3.895  1.00 15.00 ?  206 SER B N    2  
ATOM 1454  C CA   . SER B 2 4  ? -4.336  -10.835 -4.985  1.00 15.00 ?  206 SER B CA   2  
ATOM 1455  C C    . SER B 2 4  ? -3.955  -9.469  -5.529  1.00 15.00 ?  206 SER B C    2  
ATOM 1456  O O    . SER B 2 4  ? -3.442  -8.602  -4.822  1.00 15.00 ?  206 SER B O    2  
ATOM 1457  C CB   . SER B 2 4  ? -5.782  -10.824 -4.515  1.00 15.00 ?  206 SER B CB   2  
ATOM 1458  O OG   . SER B 2 4  ? -5.891  -10.394 -3.168  1.00 15.00 ?  206 SER B OG   2  
ATOM 1459  H H    . SER B 2 4  ? -3.878  -11.608 -3.069  1.00 15.00 ?  206 SER B H    2  
ATOM 1460  H HA   . SER B 2 4  ? -4.265  -11.541 -5.803  1.00 15.00 ?  206 SER B HA   2  
ATOM 1461  H HB2  . SER B 2 4  ? -6.345  -10.149 -5.145  1.00 15.00 ?  206 SER B HB2  2  
ATOM 1462  H HB3  . SER B 2 4  ? -6.184  -11.817 -4.612  1.00 15.00 ?  206 SER B HB3  2  
ATOM 1463  H HG   . SER B 2 4  ? -5.313  -10.937 -2.603  1.00 15.00 ?  206 SER B HG   2  
ATOM 1464  N N    . PRO B 2 5  ? -4.283  -9.295  -6.802  1.00 15.00 ?  207 PRO B N    2  
ATOM 1465  C CA   . PRO B 2 5  ? -3.998  -8.091  -7.582  1.00 15.00 ?  207 PRO B CA   2  
ATOM 1466  C C    . PRO B 2 5  ? -4.404  -6.812  -6.848  1.00 15.00 ?  207 PRO B C    2  
ATOM 1467  O O    . PRO B 2 5  ? -5.547  -6.670  -6.399  1.00 15.00 ?  207 PRO B O    2  
ATOM 1468  C CB   . PRO B 2 5  ? -4.872  -8.276  -8.827  1.00 15.00 ?  207 PRO B CB   2  
ATOM 1469  C CG   . PRO B 2 5  ? -5.084  -9.750  -8.959  1.00 15.00 ?  207 PRO B CG   2  
ATOM 1470  C CD   . PRO B 2 5  ? -4.926  -10.344 -7.583  1.00 15.00 ?  207 PRO B CD   2  
ATOM 1471  H HA   . PRO B 2 5  ? -2.960  -8.037  -7.869  1.00 15.00 ?  207 PRO B HA   2  
ATOM 1472  H HB2  . PRO B 2 5  ? -5.810  -7.757  -8.689  1.00 15.00 ?  207 PRO B HB2  2  
ATOM 1473  H HB3  . PRO B 2 5  ? -4.360  -7.874  -9.691  1.00 15.00 ?  207 PRO B HB3  2  
ATOM 1474  H HG2  . PRO B 2 5  ? -6.078  -9.943  -9.336  1.00 15.00 ?  207 PRO B HG2  2  
ATOM 1475  H HG3  . PRO B 2 5  ? -4.347  -10.165 -9.630  1.00 15.00 ?  207 PRO B HG3  2  
ATOM 1476  H HD2  . PRO B 2 5  ? -5.873  -10.598 -7.146  1.00 15.00 ?  207 PRO B HD2  2  
ATOM 1477  H HD3  . PRO B 2 5  ? -4.307  -11.223 -7.608  1.00 15.00 ?  207 PRO B HD3  2  
ATOM 1478  N N    . PRO B 2 6  ? -3.449  -5.877  -6.701  1.00 15.00 ?  208 PRO B N    2  
ATOM 1479  C CA   . PRO B 2 6  ? -3.633  -4.668  -5.914  1.00 15.00 ?  208 PRO B CA   2  
ATOM 1480  C C    . PRO B 2 6  ? -4.260  -3.505  -6.685  1.00 15.00 ?  208 PRO B C    2  
ATOM 1481  O O    . PRO B 2 6  ? -4.243  -3.468  -7.921  1.00 15.00 ?  208 PRO B O    2  
ATOM 1482  C CB   . PRO B 2 6  ? -2.207  -4.321  -5.483  1.00 15.00 ?  208 PRO B CB   2  
ATOM 1483  C CG   . PRO B 2 6  ? -1.296  -4.944  -6.494  1.00 15.00 ?  208 PRO B CG   2  
ATOM 1484  C CD   . PRO B 2 6  ? -2.101  -5.944  -7.287  1.00 15.00 ?  208 PRO B CD   2  
ATOM 1485  H HA   . PRO B 2 6  ? -4.228  -4.867  -5.035  1.00 15.00 ?  208 PRO B HA   2  
ATOM 1486  H HB2  . PRO B 2 6  ? -2.089  -3.245  -5.468  1.00 15.00 ?  208 PRO B HB2  2  
ATOM 1487  H HB3  . PRO B 2 6  ? -2.029  -4.722  -4.489  1.00 15.00 ?  208 PRO B HB3  2  
ATOM 1488  H HG2  . PRO B 2 6  ? -0.910  -4.181  -7.152  1.00 15.00 ?  208 PRO B HG2  2  
ATOM 1489  H HG3  . PRO B 2 6  ? -0.482  -5.441  -5.988  1.00 15.00 ?  208 PRO B HG3  2  
ATOM 1490  H HD2  . PRO B 2 6  ? -2.123  -5.664  -8.329  1.00 15.00 ?  208 PRO B HD2  2  
ATOM 1491  H HD3  . PRO B 2 6  ? -1.680  -6.932  -7.172  1.00 15.00 ?  208 PRO B HD3  2  
ATOM 1492  N N    . PRO B 2 7  ? -4.803  -2.534  -5.923  1.00 15.00 ?  209 PRO B N    2  
ATOM 1493  C CA   . PRO B 2 7  ? -5.419  -1.310  -6.460  1.00 15.00 ?  209 PRO B CA   2  
ATOM 1494  C C    . PRO B 2 7  ? -4.525  -0.584  -7.472  1.00 15.00 ?  209 PRO B C    2  
ATOM 1495  O O    . PRO B 2 7  ? -3.317  -0.476  -7.270  1.00 15.00 ?  209 PRO B O    2  
ATOM 1496  C CB   . PRO B 2 7  ? -5.588  -0.428  -5.215  1.00 15.00 ?  209 PRO B CB   2  
ATOM 1497  C CG   . PRO B 2 7  ? -5.633  -1.360  -4.059  1.00 15.00 ?  209 PRO B CG   2  
ATOM 1498  C CD   . PRO B 2 7  ? -4.844  -2.575  -4.448  1.00 15.00 ?  209 PRO B CD   2  
ATOM 1499  H HA   . PRO B 2 7  ? -6.383  -1.508  -6.898  1.00 15.00 ?  209 PRO B HA   2  
ATOM 1500  H HB2  . PRO B 2 7  ? -4.749  0.250   -5.137  1.00 15.00 ?  209 PRO B HB2  2  
ATOM 1501  H HB3  . PRO B 2 7  ? -6.501  0.138   -5.289  1.00 15.00 ?  209 PRO B HB3  2  
ATOM 1502  H HG2  . PRO B 2 7  ? -5.182  -0.890  -3.200  1.00 15.00 ?  209 PRO B HG2  2  
ATOM 1503  H HG3  . PRO B 2 7  ? -6.656  -1.630  -3.844  1.00 15.00 ?  209 PRO B HG3  2  
ATOM 1504  H HD2  . PRO B 2 7  ? -3.846  -2.520  -4.039  1.00 15.00 ?  209 PRO B HD2  2  
ATOM 1505  H HD3  . PRO B 2 7  ? -5.342  -3.471  -4.104  1.00 15.00 ?  209 PRO B HD3  2  
ATOM 1506  N N    . PRO B 2 8  ? -5.110  -0.068  -8.570  1.00 15.00 ?  210 PRO B N    2  
ATOM 1507  C CA   . PRO B 2 8  ? -4.383  0.778   -9.525  1.00 15.00 ?  210 PRO B CA   2  
ATOM 1508  C C    . PRO B 2 8  ? -3.792  1.997   -8.824  1.00 15.00 ?  210 PRO B C    2  
ATOM 1509  O O    . PRO B 2 8  ? -4.440  2.586   -7.951  1.00 15.00 ?  210 PRO B O    2  
ATOM 1510  C CB   . PRO B 2 8  ? -5.458  1.203   -10.536 1.00 15.00 ?  210 PRO B CB   2  
ATOM 1511  C CG   . PRO B 2 8  ? -6.767  0.896   -9.883  1.00 15.00 ?  210 PRO B CG   2  
ATOM 1512  C CD   . PRO B 2 8  ? -6.511  -0.261  -8.964  1.00 15.00 ?  210 PRO B CD   2  
ATOM 1513  H HA   . PRO B 2 8  ? -3.598  0.233   -10.028 1.00 15.00 ?  210 PRO B HA   2  
ATOM 1514  H HB2  . PRO B 2 8  ? -5.361  2.259   -10.744 1.00 15.00 ?  210 PRO B HB2  2  
ATOM 1515  H HB3  . PRO B 2 8  ? -5.334  0.640   -11.449 1.00 15.00 ?  210 PRO B HB3  2  
ATOM 1516  H HG2  . PRO B 2 8  ? -7.108  1.753   -9.319  1.00 15.00 ?  210 PRO B HG2  2  
ATOM 1517  H HG3  . PRO B 2 8  ? -7.495  0.625   -10.632 1.00 15.00 ?  210 PRO B HG3  2  
ATOM 1518  H HD2  . PRO B 2 8  ? -7.165  -0.213  -8.105  1.00 15.00 ?  210 PRO B HD2  2  
ATOM 1519  H HD3  . PRO B 2 8  ? -6.639  -1.196  -9.489  1.00 15.00 ?  210 PRO B HD3  2  
ATOM 1520  N N    . TYR B 2 9  ? -2.575  2.386   -9.208  1.00 15.00 ?  211 TYR B N    2  
ATOM 1521  C CA   . TYR B 2 9  ? -1.847  3.409   -8.469  1.00 15.00 ?  211 TYR B CA   2  
ATOM 1522  C C    . TYR B 2 9  ? -2.534  4.768   -8.528  1.00 15.00 ?  211 TYR B C    2  
ATOM 1523  O O    . TYR B 2 9  ? -2.388  5.525   -9.490  1.00 15.00 ?  211 TYR B O    2  
ATOM 1524  C CB   . TYR B 2 9  ? -0.395  3.550   -8.939  1.00 15.00 ?  211 TYR B CB   2  
ATOM 1525  C CG   . TYR B 2 9  ? 0.411   4.488   -8.057  1.00 15.00 ?  211 TYR B CG   2  
ATOM 1526  C CD1  . TYR B 2 9  ? 0.663   4.165   -6.730  1.00 15.00 ?  211 TYR B CD1  2  
ATOM 1527  C CD2  . TYR B 2 9  ? 0.917   5.692   -8.541  1.00 15.00 ?  211 TYR B CD2  2  
ATOM 1528  C CE1  . TYR B 2 9  ? 1.389   5.008   -5.917  1.00 15.00 ?  211 TYR B CE1  2  
ATOM 1529  C CE2  . TYR B 2 9  ? 1.644   6.540   -7.722  1.00 15.00 ?  211 TYR B CE2  2  
ATOM 1530  C CZ   . TYR B 2 9  ? 1.874   6.189   -6.414  1.00 15.00 ?  211 TYR B CZ   2  
ATOM 1531  O OH   . TYR B 2 9  ? 2.607   7.021   -5.601  1.00 15.00 ?  211 TYR B OH   2  
ATOM 1532  H H    . TYR B 2 9  ? -2.166  1.979   -10.008 1.00 15.00 ?  211 TYR B H    2  
ATOM 1533  H HA   . TYR B 2 9  ? -1.828  3.092   -7.437  1.00 15.00 ?  211 TYR B HA   2  
ATOM 1534  H HB2  . TYR B 2 9  ? 0.082   2.582   -8.925  1.00 15.00 ?  211 TYR B HB2  2  
ATOM 1535  H HB3  . TYR B 2 9  ? -0.382  3.943   -9.945  1.00 15.00 ?  211 TYR B HB3  2  
ATOM 1536  H HD1  . TYR B 2 9  ? 0.275   3.241   -6.331  1.00 15.00 ?  211 TYR B HD1  2  
ATOM 1537  H HD2  . TYR B 2 9  ? 0.744   5.962   -9.573  1.00 15.00 ?  211 TYR B HD2  2  
ATOM 1538  H HE1  . TYR B 2 9  ? 1.573   4.734   -4.888  1.00 15.00 ?  211 TYR B HE1  2  
ATOM 1539  H HE2  . TYR B 2 9  ? 2.027   7.472   -8.105  1.00 15.00 ?  211 TYR B HE2  2  
ATOM 1540  H HH   . TYR B 2 9  ? 3.365   6.528   -5.255  1.00 15.00 ?  211 TYR B HH   2  
ATOM 1541  N N    . SER B 2 10 ? -3.327  5.027   -7.510  1.00 15.00 ?  212 SER B N    2  
ATOM 1542  C CA   . SER B 2 10 ? -3.834  6.348   -7.233  1.00 15.00 ?  212 SER B CA   2  
ATOM 1543  C C    . SER B 2 10 ? -3.082  6.840   -6.010  1.00 15.00 ?  212 SER B C    2  
ATOM 1544  O O    . SER B 2 10 ? -2.680  6.016   -5.187  1.00 15.00 ?  212 SER B O    2  
ATOM 1545  C CB   . SER B 2 10 ? -5.336  6.270   -6.958  1.00 15.00 ?  212 SER B CB   2  
ATOM 1546  O OG   . SER B 2 10 ? -5.984  5.469   -7.933  1.00 15.00 ?  212 SER B OG   2  
ATOM 1547  H H    . SER B 2 10 ? -3.591  4.292   -6.919  1.00 15.00 ?  212 SER B H    2  
ATOM 1548  H HA   . SER B 2 10 ? -3.635  6.992   -8.075  1.00 15.00 ?  212 SER B HA   2  
ATOM 1549  H HB2  . SER B 2 10 ? -5.500  5.836   -5.984  1.00 15.00 ?  212 SER B HB2  2  
ATOM 1550  H HB3  . SER B 2 10 ? -5.758  7.265   -6.986  1.00 15.00 ?  212 SER B HB3  2  
ATOM 1551  H HG   . SER B 2 10 ? -5.659  4.561   -7.868  1.00 15.00 ?  212 SER B HG   2  
ATOM 1552  N N    . ARG B 2 11 ? -2.874  8.145   -5.870  1.00 15.00 ?  213 ARG B N    2  
ATOM 1553  C CA   . ARG B 2 11 ? -2.107  8.632   -4.729  1.00 15.00 ?  213 ARG B CA   2  
ATOM 1554  C C    . ARG B 2 11 ? -2.817  8.209   -3.453  1.00 15.00 ?  213 ARG B C    2  
ATOM 1555  O O    . ARG B 2 11 ? -2.215  7.617   -2.559  1.00 15.00 ?  213 ARG B O    2  
ATOM 1556  C CB   . ARG B 2 11 ? -1.954  10.161  -4.717  1.00 15.00 ?  213 ARG B CB   2  
ATOM 1557  C CG   . ARG B 2 11 ? -1.688  10.805  -6.062  1.00 15.00 ?  213 ARG B CG   2  
ATOM 1558  C CD   . ARG B 2 11 ? -0.514  10.166  -6.794  1.00 15.00 ?  213 ARG B CD   2  
ATOM 1559  N NE   . ARG B 2 11 ? -0.332  10.738  -8.127  1.00 15.00 ?  213 ARG B NE   2  
ATOM 1560  C CZ   . ARG B 2 11 ? 0.827   10.769  -8.786  1.00 15.00 ?  213 ARG B CZ   2  
ATOM 1561  N NH1  . ARG B 2 11 ? 1.943   10.329  -8.215  1.00 15.00 1  213 ARG B NH1  2  
ATOM 1562  N NH2  . ARG B 2 11 ? 0.870   11.273  -10.010 1.00 15.00 ?  213 ARG B NH2  2  
ATOM 1563  H H    . ARG B 2 11 ? -3.229  8.777   -6.539  1.00 15.00 ?  213 ARG B H    2  
ATOM 1564  H HA   . ARG B 2 11 ? -1.130  8.172   -4.757  1.00 15.00 ?  213 ARG B HA   2  
ATOM 1565  H HB2  . ARG B 2 11 ? -2.859  10.594  -4.320  1.00 15.00 ?  213 ARG B HB2  2  
ATOM 1566  H HB3  . ARG B 2 11 ? -1.135  10.416  -4.058  1.00 15.00 ?  213 ARG B HB3  2  
ATOM 1567  H HG2  . ARG B 2 11 ? -2.574  10.718  -6.662  1.00 15.00 ?  213 ARG B HG2  2  
ATOM 1568  H HG3  . ARG B 2 11 ? -1.472  11.852  -5.903  1.00 15.00 ?  213 ARG B HG3  2  
ATOM 1569  H HD2  . ARG B 2 11 ? 0.384   10.326  -6.219  1.00 15.00 ?  213 ARG B HD2  2  
ATOM 1570  H HD3  . ARG B 2 11 ? -0.698  9.105   -6.891  1.00 15.00 ?  213 ARG B HD3  2  
ATOM 1571  H HE   . ARG B 2 11 ? -1.132  11.119  -8.566  1.00 15.00 ?  213 ARG B HE   2  
ATOM 1572  H HH11 . ARG B 2 11 ? 1.924   9.974   -7.282  1.00 15.00 ?  213 ARG B HH11 2  
ATOM 1573  H HH12 . ARG B 2 11 ? 2.816   10.358  -8.723  1.00 15.00 ?  213 ARG B HH12 2  
ATOM 1574  H HH21 . ARG B 2 11 ? 0.035   11.629  -10.437 1.00 15.00 ?  213 ARG B HH21 2  
ATOM 1575  H HH22 . ARG B 2 11 ? 1.738   11.303  -10.515 1.00 15.00 ?  213 ARG B HH22 2  
ATOM 1576  N N    . TYR B 2 12 ? -4.091  8.558   -3.366  1.00 15.00 ?  214 TYR B N    2  
ATOM 1577  C CA   . TYR B 2 12 ? -4.923  8.150   -2.249  1.00 15.00 ?  214 TYR B CA   2  
ATOM 1578  C C    . TYR B 2 12 ? -6.109  7.334   -2.748  1.00 15.00 ?  214 TYR B C    2  
ATOM 1579  O O    . TYR B 2 12 ? -7.130  7.888   -3.153  1.00 15.00 ?  214 TYR B O    2  
ATOM 1580  C CB   . TYR B 2 12 ? -5.390  9.378   -1.455  1.00 15.00 ?  214 TYR B CB   2  
ATOM 1581  C CG   . TYR B 2 12 ? -4.298  10.414  -1.252  1.00 15.00 ?  214 TYR B CG   2  
ATOM 1582  C CD1  . TYR B 2 12 ? -3.902  11.241  -2.299  1.00 15.00 ?  214 TYR B CD1  2  
ATOM 1583  C CD2  . TYR B 2 12 ? -3.651  10.552  -0.031  1.00 15.00 ?  214 TYR B CD2  2  
ATOM 1584  C CE1  . TYR B 2 12 ? -2.899  12.172  -2.143  1.00 15.00 ?  214 TYR B CE1  2  
ATOM 1585  C CE2  . TYR B 2 12 ? -2.645  11.488  0.138   1.00 15.00 ?  214 TYR B CE2  2  
ATOM 1586  C CZ   . TYR B 2 12 ? -2.272  12.294  -0.920  1.00 15.00 ?  214 TYR B CZ   2  
ATOM 1587  O OH   . TYR B 2 12 ? -1.272  13.225  -0.754  1.00 15.00 ?  214 TYR B OH   2  
ATOM 1588  H H    . TYR B 2 12 ? -4.489  9.098   -4.082  1.00 15.00 ?  214 TYR B H    2  
ATOM 1589  H HA   . TYR B 2 12 ? -4.326  7.506   -1.606  1.00 15.00 ?  214 TYR B HA   2  
ATOM 1590  H HB2  . TYR B 2 12 ? -6.203  9.850   -1.985  1.00 15.00 ?  214 TYR B HB2  2  
ATOM 1591  H HB3  . TYR B 2 12 ? -5.736  9.061   -0.482  1.00 15.00 ?  214 TYR B HB3  2  
ATOM 1592  H HD1  . TYR B 2 12 ? -4.393  11.147  -3.255  1.00 15.00 ?  214 TYR B HD1  2  
ATOM 1593  H HD2  . TYR B 2 12 ? -3.944  9.921   0.795   1.00 15.00 ?  214 TYR B HD2  2  
ATOM 1594  H HE1  . TYR B 2 12 ? -2.605  12.791  -2.983  1.00 15.00 ?  214 TYR B HE1  2  
ATOM 1595  H HE2  . TYR B 2 12 ? -2.151  11.582  1.093   1.00 15.00 ?  214 TYR B HE2  2  
ATOM 1596  H HH   . TYR B 2 12 ? -1.559  14.069  -1.115  1.00 15.00 ?  214 TYR B HH   2  
ATOM 1597  N N    . PRO B 2 13 ? -5.954  6.013   -2.793  1.00 15.00 ?  215 PRO B N    2  
ATOM 1598  C CA   . PRO B 2 13 ? -7.024  5.106   -3.183  1.00 15.00 ?  215 PRO B CA   2  
ATOM 1599  C C    . PRO B 2 13 ? -8.005  4.867   -2.036  1.00 15.00 ?  215 PRO B C    2  
ATOM 1600  O O    . PRO B 2 13 ? -7.610  4.518   -0.922  1.00 15.00 ?  215 PRO B O    2  
ATOM 1601  C CB   . PRO B 2 13 ? -6.292  3.819   -3.574  1.00 15.00 ?  215 PRO B CB   2  
ATOM 1602  C CG   . PRO B 2 13 ? -4.884  3.946   -3.070  1.00 15.00 ?  215 PRO B CG   2  
ATOM 1603  C CD   . PRO B 2 13 ? -4.712  5.311   -2.473  1.00 15.00 ?  215 PRO B CD   2  
ATOM 1604  H HA   . PRO B 2 13 ? -7.568  5.486   -4.037  1.00 15.00 ?  215 PRO B HA   2  
ATOM 1605  H HB2  . PRO B 2 13 ? -6.792  2.974   -3.124  1.00 15.00 ?  215 PRO B HB2  2  
ATOM 1606  H HB3  . PRO B 2 13 ? -6.312  3.715   -4.649  1.00 15.00 ?  215 PRO B HB3  2  
ATOM 1607  H HG2  . PRO B 2 13 ? -4.701  3.199   -2.310  1.00 15.00 ?  215 PRO B HG2  2  
ATOM 1608  H HG3  . PRO B 2 13 ? -4.189  3.812   -3.887  1.00 15.00 ?  215 PRO B HG3  2  
ATOM 1609  H HD2  . PRO B 2 13 ? -4.581  5.237   -1.404  1.00 15.00 ?  215 PRO B HD2  2  
ATOM 1610  H HD3  . PRO B 2 13 ? -3.865  5.810   -2.919  1.00 15.00 ?  215 PRO B HD3  2  
ATOM 1611  N N    . MET B 2 14 ? -9.286  5.057   -2.313  1.00 15.00 ?  216 MET B N    2  
ATOM 1612  C CA   . MET B 2 14 ? -10.302 5.017   -1.272  1.00 15.00 ?  216 MET B CA   2  
ATOM 1613  C C    . MET B 2 14 ? -11.076 3.707   -1.293  1.00 15.00 ?  216 MET B C    2  
ATOM 1614  O O    . MET B 2 14 ? -11.677 3.343   -2.305  1.00 15.00 ?  216 MET B O    2  
ATOM 1615  C CB   . MET B 2 14 ? -11.269 6.191   -1.427  1.00 15.00 ?  216 MET B CB   2  
ATOM 1616  C CG   . MET B 2 14 ? -10.637 7.543   -1.142  1.00 15.00 ?  216 MET B CG   2  
ATOM 1617  S SD   . MET B 2 14 ? -10.041 7.685   0.555   1.00 15.00 ?  216 MET B SD   2  
ATOM 1618  C CE   . MET B 2 14 ? -11.570 7.464   1.464   1.00 15.00 ?  216 MET B CE   2  
ATOM 1619  H H    . MET B 2 14 ? -9.557  5.206   -3.243  1.00 15.00 ?  216 MET B H    2  
ATOM 1620  H HA   . MET B 2 14 ? -9.798  5.107   -0.321  1.00 15.00 ?  216 MET B HA   2  
ATOM 1621  H HB2  . MET B 2 14 ? -11.646 6.198   -2.438  1.00 15.00 ?  216 MET B HB2  2  
ATOM 1622  H HB3  . MET B 2 14 ? -12.093 6.054   -0.745  1.00 15.00 ?  216 MET B HB3  2  
ATOM 1623  H HG2  . MET B 2 14 ? -9.804  7.683   -1.814  1.00 15.00 ?  216 MET B HG2  2  
ATOM 1624  H HG3  . MET B 2 14 ? -11.372 8.314   -1.317  1.00 15.00 ?  216 MET B HG3  2  
ATOM 1625  H HE1  . MET B 2 14 ? -11.371 7.526   2.524   1.00 15.00 ?  216 MET B HE1  2  
ATOM 1626  H HE2  . MET B 2 14 ? -11.989 6.495   1.234   1.00 15.00 ?  216 MET B HE2  2  
ATOM 1627  H HE3  . MET B 2 14 ? -12.271 8.235   1.183   1.00 15.00 ?  216 MET B HE3  2  
ATOM 1628  N N    . ASP B 2 15 ? -11.064 3.010   -0.165  1.00 15.00 ?  217 ASP B N    2  
ATOM 1629  C CA   . ASP B 2 15 ? -11.799 1.763   -0.026  1.00 15.00 ?  217 ASP B CA   2  
ATOM 1630  C C    . ASP B 2 15 ? -12.232 1.572   1.420   1.00 15.00 ?  217 ASP B C    2  
ATOM 1631  O O    . ASP B 2 15 ? -13.450 1.456   1.668   1.00 15.00 ?  217 ASP B O    2  
ATOM 1632  C CB   . ASP B 2 15 ? -10.954 0.572   -0.479  1.00 15.00 ?  217 ASP B CB   2  
ATOM 1633  C CG   . ASP B 2 15 ? -11.743 -0.721  -0.469  1.00 15.00 ?  217 ASP B CG   2  
ATOM 1634  O OD1  . ASP B 2 15 ? -12.734 -0.823  -1.225  1.00 15.00 ?  217 ASP B OD1  2  
ATOM 1635  O OD2  . ASP B 2 15 ? -11.373 -1.643  0.278   1.00 15.00 -1 217 ASP B OD2  2  
ATOM 1636  O OXT  . ASP B 2 15 ? -11.355 1.583   2.309   1.00 15.00 ?  217 ASP B OXT  2  
ATOM 1637  H H    . ASP B 2 15 ? -10.550 3.346   0.602   1.00 15.00 ?  217 ASP B H    2  
ATOM 1638  H HA   . ASP B 2 15 ? -12.680 1.827   -0.647  1.00 15.00 ?  217 ASP B HA   2  
ATOM 1639  H HB2  . ASP B 2 15 ? -10.597 0.749   -1.482  1.00 15.00 ?  217 ASP B HB2  2  
ATOM 1640  H HB3  . ASP B 2 15 ? -10.111 0.464   0.187   1.00 15.00 ?  217 ASP B HB3  2  
ATOM 1641  N N    . GLY A 1 1  ? 3.513   2.938   14.814  1.00 15.00 ?  297 GLY A N    3  
ATOM 1642  C CA   . GLY A 1 1  ? 4.909   2.966   14.318  1.00 15.00 ?  297 GLY A CA   3  
ATOM 1643  C C    . GLY A 1 1  ? 5.159   4.150   13.409  1.00 15.00 ?  297 GLY A C    3  
ATOM 1644  O O    . GLY A 1 1  ? 4.212   4.731   12.880  1.00 15.00 ?  297 GLY A O    3  
ATOM 1645  H H1   . GLY A 1 1  ? 3.323   3.788   15.384  1.00 15.00 ?  297 GLY A H1   3  
ATOM 1646  H H2   . GLY A 1 1  ? 3.355   2.092   15.402  1.00 15.00 ?  297 GLY A H2   3  
ATOM 1647  H H3   . GLY A 1 1  ? 2.846   2.920   14.009  1.00 15.00 ?  297 GLY A H3   3  
ATOM 1648  H HA2  . GLY A 1 1  ? 5.582   3.023   15.161  1.00 15.00 ?  297 GLY A HA2  3  
ATOM 1649  H HA3  . GLY A 1 1  ? 5.105   2.056   13.772  1.00 15.00 ?  297 GLY A HA3  3  
ATOM 1650  N N    . PRO A 1 2  ? 6.428   4.542   13.216  1.00 15.00 ?  298 PRO A N    3  
ATOM 1651  C CA   . PRO A 1 2  ? 6.782   5.663   12.347  1.00 15.00 ?  298 PRO A CA   3  
ATOM 1652  C C    . PRO A 1 2  ? 6.563   5.327   10.866  1.00 15.00 ?  298 PRO A C    3  
ATOM 1653  O O    . PRO A 1 2  ? 7.245   4.456   10.318  1.00 15.00 ?  298 PRO A O    3  
ATOM 1654  C CB   . PRO A 1 2  ? 8.278   5.888   12.618  1.00 15.00 ?  298 PRO A CB   3  
ATOM 1655  C CG   . PRO A 1 2  ? 8.594   5.071   13.827  1.00 15.00 ?  298 PRO A CG   3  
ATOM 1656  C CD   . PRO A 1 2  ? 7.613   3.938   13.832  1.00 15.00 ?  298 PRO A CD   3  
ATOM 1657  H HA   . PRO A 1 2  ? 6.234   6.554   12.614  1.00 15.00 ?  298 PRO A HA   3  
ATOM 1658  H HB2  . PRO A 1 2  ? 8.851   5.563   11.763  1.00 15.00 ?  298 PRO A HB2  3  
ATOM 1659  H HB3  . PRO A 1 2  ? 8.457   6.938   12.797  1.00 15.00 ?  298 PRO A HB3  3  
ATOM 1660  H HG2  . PRO A 1 2  ? 9.603   4.693   13.761  1.00 15.00 ?  298 PRO A HG2  3  
ATOM 1661  H HG3  . PRO A 1 2  ? 8.478   5.672   14.717  1.00 15.00 ?  298 PRO A HG3  3  
ATOM 1662  H HD2  . PRO A 1 2  ? 7.984   3.114   13.239  1.00 15.00 ?  298 PRO A HD2  3  
ATOM 1663  H HD3  . PRO A 1 2  ? 7.406   3.621   14.842  1.00 15.00 ?  298 PRO A HD3  3  
ATOM 1664  N N    . LEU A 1 3  ? 5.590   5.976   10.230  1.00 15.00 ?  299 LEU A N    3  
ATOM 1665  C CA   . LEU A 1 3  ? 5.340   5.772   8.813   1.00 15.00 ?  299 LEU A CA   3  
ATOM 1666  C C    . LEU A 1 3  ? 6.323   6.609   7.999   1.00 15.00 ?  299 LEU A C    3  
ATOM 1667  O O    . LEU A 1 3  ? 6.482   7.802   8.268   1.00 15.00 ?  299 LEU A O    3  
ATOM 1668  C CB   . LEU A 1 3  ? 3.905   6.185   8.476   1.00 15.00 ?  299 LEU A CB   3  
ATOM 1669  C CG   . LEU A 1 3  ? 3.388   5.699   7.122   1.00 15.00 ?  299 LEU A CG   3  
ATOM 1670  C CD1  . LEU A 1 3  ? 3.075   4.209   7.177   1.00 15.00 ?  299 LEU A CD1  3  
ATOM 1671  C CD2  . LEU A 1 3  ? 2.166   6.499   6.701   1.00 15.00 ?  299 LEU A CD2  3  
ATOM 1672  H H    . LEU A 1 3  ? 5.020   6.603   10.724  1.00 15.00 ?  299 LEU A H    3  
ATOM 1673  H HA   . LEU A 1 3  ? 5.480   4.726   8.587   1.00 15.00 ?  299 LEU A HA   3  
ATOM 1674  H HB2  . LEU A 1 3  ? 3.252   5.801   9.247   1.00 15.00 ?  299 LEU A HB2  3  
ATOM 1675  H HB3  . LEU A 1 3  ? 3.854   7.262   8.489   1.00 15.00 ?  299 LEU A HB3  3  
ATOM 1676  H HG   . LEU A 1 3  ? 4.158   5.848   6.379   1.00 15.00 ?  299 LEU A HG   3  
ATOM 1677  H HD11 . LEU A 1 3  ? 2.530   3.919   6.288   1.00 15.00 ?  299 LEU A HD11 3  
ATOM 1678  H HD12 . LEU A 1 3  ? 2.476   3.997   8.050   1.00 15.00 ?  299 LEU A HD12 3  
ATOM 1679  H HD13 . LEU A 1 3  ? 3.997   3.650   7.231   1.00 15.00 ?  299 LEU A HD13 3  
ATOM 1680  H HD21 . LEU A 1 3  ? 1.814   6.140   5.746   1.00 15.00 ?  299 LEU A HD21 3  
ATOM 1681  H HD22 . LEU A 1 3  ? 2.431   7.543   6.618   1.00 15.00 ?  299 LEU A HD22 3  
ATOM 1682  H HD23 . LEU A 1 3  ? 1.386   6.383   7.440   1.00 15.00 ?  299 LEU A HD23 3  
ATOM 1683  N N    . PRO A 1 4  ? 6.997   6.021   7.000   1.00 15.00 ?  300 PRO A N    3  
ATOM 1684  C CA   . PRO A 1 4  ? 7.978   6.750   6.183   1.00 15.00 ?  300 PRO A CA   3  
ATOM 1685  C C    . PRO A 1 4  ? 7.306   7.796   5.289   1.00 15.00 ?  300 PRO A C    3  
ATOM 1686  O O    . PRO A 1 4  ? 6.255   7.535   4.709   1.00 15.00 ?  300 PRO A O    3  
ATOM 1687  C CB   . PRO A 1 4  ? 8.633   5.651   5.334   1.00 15.00 ?  300 PRO A CB   3  
ATOM 1688  C CG   . PRO A 1 4  ? 8.210   4.360   5.957   1.00 15.00 ?  300 PRO A CG   3  
ATOM 1689  C CD   . PRO A 1 4  ? 6.860   4.625   6.553   1.00 15.00 ?  300 PRO A CD   3  
ATOM 1690  H HA   . PRO A 1 4  ? 8.726   7.230   6.799   1.00 15.00 ?  300 PRO A HA   3  
ATOM 1691  H HB2  . PRO A 1 4  ? 8.281   5.732   4.319   1.00 15.00 ?  300 PRO A HB2  3  
ATOM 1692  H HB3  . PRO A 1 4  ? 9.707   5.766   5.359   1.00 15.00 ?  300 PRO A HB3  3  
ATOM 1693  H HG2  . PRO A 1 4  ? 8.145   3.590   5.202   1.00 15.00 ?  300 PRO A HG2  3  
ATOM 1694  H HG3  . PRO A 1 4  ? 8.911   4.076   6.727   1.00 15.00 ?  300 PRO A HG3  3  
ATOM 1695  H HD2  . PRO A 1 4  ? 6.090   4.533   5.800   1.00 15.00 ?  300 PRO A HD2  3  
ATOM 1696  H HD3  . PRO A 1 4  ? 6.668   3.956   7.379   1.00 15.00 ?  300 PRO A HD3  3  
ATOM 1697  N N    . PRO A 1 5  ? 7.916   8.988   5.153   1.00 15.00 ?  301 PRO A N    3  
ATOM 1698  C CA   . PRO A 1 5  ? 7.320   10.118  4.415   1.00 15.00 ?  301 PRO A CA   3  
ATOM 1699  C C    . PRO A 1 5  ? 7.078   9.835   2.929   1.00 15.00 ?  301 PRO A C    3  
ATOM 1700  O O    . PRO A 1 5  ? 6.125   10.353  2.336   1.00 15.00 ?  301 PRO A O    3  
ATOM 1701  C CB   . PRO A 1 5  ? 8.348   11.244  4.577   1.00 15.00 ?  301 PRO A CB   3  
ATOM 1702  C CG   . PRO A 1 5  ? 9.195   10.840  5.738   1.00 15.00 ?  301 PRO A CG   3  
ATOM 1703  C CD   . PRO A 1 5  ? 9.229   9.339   5.719   1.00 15.00 ?  301 PRO A CD   3  
ATOM 1704  H HA   . PRO A 1 5  ? 6.388   10.424  4.867   1.00 15.00 ?  301 PRO A HA   3  
ATOM 1705  H HB2  . PRO A 1 5  ? 8.935   11.327  3.674   1.00 15.00 ?  301 PRO A HB2  3  
ATOM 1706  H HB3  . PRO A 1 5  ? 7.837   12.176  4.767   1.00 15.00 ?  301 PRO A HB3  3  
ATOM 1707  H HG2  . PRO A 1 5  ? 10.191  11.241  5.624   1.00 15.00 ?  301 PRO A HG2  3  
ATOM 1708  H HG3  . PRO A 1 5  ? 8.752   11.194  6.659   1.00 15.00 ?  301 PRO A HG3  3  
ATOM 1709  H HD2  . PRO A 1 5  ? 10.031  8.985   5.086   1.00 15.00 ?  301 PRO A HD2  3  
ATOM 1710  H HD3  . PRO A 1 5  ? 9.335   8.948   6.721   1.00 15.00 ?  301 PRO A HD3  3  
ATOM 1711  N N    . GLY A 1 6  ? 7.951   9.038   2.324   1.00 15.00 ?  302 GLY A N    3  
ATOM 1712  C CA   . GLY A 1 6  ? 7.800   8.693   0.919   1.00 15.00 ?  302 GLY A CA   3  
ATOM 1713  C C    . GLY A 1 6  ? 6.790   7.585   0.725   1.00 15.00 ?  302 GLY A C    3  
ATOM 1714  O O    . GLY A 1 6  ? 6.331   7.317   -0.392  1.00 15.00 ?  302 GLY A O    3  
ATOM 1715  H H    . GLY A 1 6  ? 8.707   8.672   2.838   1.00 15.00 ?  302 GLY A H    3  
ATOM 1716  H HA2  . GLY A 1 6  ? 7.473   9.567   0.374   1.00 15.00 ?  302 GLY A HA2  3  
ATOM 1717  H HA3  . GLY A 1 6  ? 8.754   8.371   0.529   1.00 15.00 ?  302 GLY A HA3  3  
ATOM 1718  N N    . TRP A 1 7  ? 6.469   6.934   1.828   1.00 15.00 ?  303 TRP A N    3  
ATOM 1719  C CA   . TRP A 1 7  ? 5.537   5.826   1.849   1.00 15.00 ?  303 TRP A CA   3  
ATOM 1720  C C    . TRP A 1 7  ? 4.139   6.302   2.173   1.00 15.00 ?  303 TRP A C    3  
ATOM 1721  O O    . TRP A 1 7  ? 3.969   7.271   2.913   1.00 15.00 ?  303 TRP A O    3  
ATOM 1722  C CB   . TRP A 1 7  ? 5.956   4.824   2.903   1.00 15.00 ?  303 TRP A CB   3  
ATOM 1723  C CG   . TRP A 1 7  ? 6.940   3.830   2.414   1.00 15.00 ?  303 TRP A CG   3  
ATOM 1724  C CD1  . TRP A 1 7  ? 8.297   3.950   2.384   1.00 15.00 ?  303 TRP A CD1  3  
ATOM 1725  C CD2  . TRP A 1 7  ? 6.632   2.552   1.878   1.00 15.00 ?  303 TRP A CD2  3  
ATOM 1726  N NE1  . TRP A 1 7  ? 8.850   2.804   1.886   1.00 15.00 ?  303 TRP A NE1  3  
ATOM 1727  C CE2  . TRP A 1 7  ? 7.844   1.936   1.567   1.00 15.00 ?  303 TRP A CE2  3  
ATOM 1728  C CE3  . TRP A 1 7  ? 5.448   1.859   1.637   1.00 15.00 ?  303 TRP A CE3  3  
ATOM 1729  C CZ2  . TRP A 1 7  ? 7.903   0.667   1.035   1.00 15.00 ?  303 TRP A CZ2  3  
ATOM 1730  C CZ3  . TRP A 1 7  ? 5.518   0.596   1.106   1.00 15.00 ?  303 TRP A CZ3  3  
ATOM 1731  C CH2  . TRP A 1 7  ? 6.738   0.009   0.811   1.00 15.00 ?  303 TRP A CH2  3  
ATOM 1732  H H    . TRP A 1 7  ? 6.859   7.232   2.677   1.00 15.00 ?  303 TRP A H    3  
ATOM 1733  H HA   . TRP A 1 7  ? 5.551   5.352   0.879   1.00 15.00 ?  303 TRP A HA   3  
ATOM 1734  H HB2  . TRP A 1 7  ? 6.400   5.352   3.734   1.00 15.00 ?  303 TRP A HB2  3  
ATOM 1735  H HB3  . TRP A 1 7  ? 5.083   4.290   3.247   1.00 15.00 ?  303 TRP A HB3  3  
ATOM 1736  H HD1  . TRP A 1 7  ? 8.843   4.817   2.717   1.00 15.00 ?  303 TRP A HD1  3  
ATOM 1737  H HE1  . TRP A 1 7  ? 9.810   2.636   1.771   1.00 15.00 ?  303 TRP A HE1  3  
ATOM 1738  H HE3  . TRP A 1 7  ? 4.486   2.293   1.853   1.00 15.00 ?  303 TRP A HE3  3  
ATOM 1739  H HZ2  . TRP A 1 7  ? 8.822   0.217   0.798   1.00 15.00 ?  303 TRP A HZ2  3  
ATOM 1740  H HZ3  . TRP A 1 7  ? 4.616   0.055   0.898   1.00 15.00 ?  303 TRP A HZ3  3  
ATOM 1741  H HH2  . TRP A 1 7  ? 6.748   -0.992  0.412   1.00 15.00 ?  303 TRP A HH2  3  
ATOM 1742  N N    . GLU A 1 8  ? 3.137   5.608   1.661   1.00 15.00 ?  304 GLU A N    3  
ATOM 1743  C CA   . GLU A 1 8  ? 1.755   5.993   1.963   1.00 15.00 ?  304 GLU A CA   3  
ATOM 1744  C C    . GLU A 1 8  ? 0.828   4.784   2.158   1.00 15.00 ?  304 GLU A C    3  
ATOM 1745  O O    . GLU A 1 8  ? 0.539   4.046   1.228   1.00 15.00 ?  304 GLU A O    3  
ATOM 1746  C CB   . GLU A 1 8  ? 1.231   6.996   0.924   1.00 15.00 ?  304 GLU A CB   3  
ATOM 1747  C CG   . GLU A 1 8  ? 1.513   8.434   1.355   1.00 15.00 ?  304 GLU A CG   3  
ATOM 1748  C CD   . GLU A 1 8  ? 1.374   9.471   0.263   1.00 15.00 ?  304 GLU A CD   3  
ATOM 1749  O OE1  . GLU A 1 8  ? 0.280   9.592   -0.327  1.00 15.00 ?  304 GLU A OE1  3  
ATOM 1750  O OE2  . GLU A 1 8  ? 2.363   10.204  0.020   1.00 15.00 -1 304 GLU A OE2  3  
ATOM 1751  H H    . GLU A 1 8  ? 3.333   4.811   1.082   1.00 15.00 ?  304 GLU A H    3  
ATOM 1752  H HA   . GLU A 1 8  ? 1.803   6.513   2.909   1.00 15.00 ?  304 GLU A HA   3  
ATOM 1753  H HB2  . GLU A 1 8  ? 1.725   6.815   -0.020  1.00 15.00 ?  304 GLU A HB2  3  
ATOM 1754  H HB3  . GLU A 1 8  ? 0.168   6.872   0.799   1.00 15.00 ?  304 GLU A HB3  3  
ATOM 1755  H HG2  . GLU A 1 8  ? 0.826   8.689   2.138   1.00 15.00 ?  304 GLU A HG2  3  
ATOM 1756  H HG3  . GLU A 1 8  ? 2.520   8.480   1.743   1.00 15.00 ?  304 GLU A HG3  3  
ATOM 1757  N N    . ILE A 1 9  ? 0.350   4.613   3.394   1.00 15.00 ?  305 ILE A N    3  
ATOM 1758  C CA   . ILE A 1 9  ? -0.351  3.400   3.813   1.00 15.00 ?  305 ILE A CA   3  
ATOM 1759  C C    . ILE A 1 9  ? -1.861  3.493   3.599   1.00 15.00 ?  305 ILE A C    3  
ATOM 1760  O O    . ILE A 1 9  ? -2.479  4.510   3.915   1.00 15.00 ?  305 ILE A O    3  
ATOM 1761  C CB   . ILE A 1 9  ? -0.077  3.127   5.312   1.00 15.00 ?  305 ILE A CB   3  
ATOM 1762  C CG1  . ILE A 1 9  ? -0.826  1.884   5.796   1.00 15.00 ?  305 ILE A CG1  3  
ATOM 1763  C CG2  . ILE A 1 9  ? -0.462  4.334   6.159   1.00 15.00 ?  305 ILE A CG2  3  
ATOM 1764  C CD1  . ILE A 1 9  ? -0.581  1.563   7.255   1.00 15.00 ?  305 ILE A CD1  3  
ATOM 1765  H H    . ILE A 1 9  ? 0.452   5.334   4.045   1.00 15.00 ?  305 ILE A H    3  
ATOM 1766  H HA   . ILE A 1 9  ? 0.038   2.572   3.243   1.00 15.00 ?  305 ILE A HA   3  
ATOM 1767  H HB   . ILE A 1 9  ? 0.985   2.963   5.431   1.00 15.00 ?  305 ILE A HB   3  
ATOM 1768  H HG12 . ILE A 1 9  ? -1.888  2.038   5.664   1.00 15.00 ?  305 ILE A HG12 3  
ATOM 1769  H HG13 . ILE A 1 9  ? -0.514  1.033   5.211   1.00 15.00 ?  305 ILE A HG13 3  
ATOM 1770  H HG21 . ILE A 1 9  ? -1.515  4.541   6.035   1.00 15.00 ?  305 ILE A HG21 3  
ATOM 1771  H HG22 . ILE A 1 9  ? 0.112   5.192   5.846   1.00 15.00 ?  305 ILE A HG22 3  
ATOM 1772  H HG23 . ILE A 1 9  ? -0.257  4.124   7.198   1.00 15.00 ?  305 ILE A HG23 3  
ATOM 1773  H HD11 . ILE A 1 9  ? -1.009  2.339   7.872   1.00 15.00 ?  305 ILE A HD11 3  
ATOM 1774  H HD12 . ILE A 1 9  ? 0.483   1.507   7.437   1.00 15.00 ?  305 ILE A HD12 3  
ATOM 1775  H HD13 . ILE A 1 9  ? -1.036  0.620   7.498   1.00 15.00 ?  305 ILE A HD13 3  
ATOM 1776  N N    . ARG A 1 10 ? -2.450  2.427   3.057   1.00 15.00 ?  306 ARG A N    3  
ATOM 1777  C CA   . ARG A 1 10 ? -3.902  2.311   2.978   1.00 15.00 ?  306 ARG A CA   3  
ATOM 1778  C C    . ARG A 1 10 ? -4.344  0.857   3.149   1.00 15.00 ?  306 ARG A C    3  
ATOM 1779  O O    . ARG A 1 10 ? -3.789  -0.054  2.534   1.00 15.00 ?  306 ARG A O    3  
ATOM 1780  C CB   . ARG A 1 10 ? -4.443  2.858   1.657   1.00 15.00 ?  306 ARG A CB   3  
ATOM 1781  C CG   . ARG A 1 10 ? -4.189  4.338   1.448   1.00 15.00 ?  306 ARG A CG   3  
ATOM 1782  C CD   . ARG A 1 10 ? -5.281  4.965   0.608   1.00 15.00 ?  306 ARG A CD   3  
ATOM 1783  N NE   . ARG A 1 10 ? -6.595  4.810   1.233   1.00 15.00 ?  306 ARG A NE   3  
ATOM 1784  C CZ   . ARG A 1 10 ? -7.222  5.771   1.904   1.00 15.00 ?  306 ARG A CZ   3  
ATOM 1785  N NH1  . ARG A 1 10 ? -6.666  6.971   2.017   1.00 15.00 1  306 ARG A NH1  3  
ATOM 1786  N NH2  . ARG A 1 10 ? -8.405  5.530   2.460   1.00 15.00 ?  306 ARG A NH2  3  
ATOM 1787  H H    . ARG A 1 10 ? -1.895  1.702   2.689   1.00 15.00 ?  306 ARG A H    3  
ATOM 1788  H HA   . ARG A 1 10 ? -4.315  2.893   3.789   1.00 15.00 ?  306 ARG A HA   3  
ATOM 1789  H HB2  . ARG A 1 10 ? -3.977  2.320   0.843   1.00 15.00 ?  306 ARG A HB2  3  
ATOM 1790  H HB3  . ARG A 1 10 ? -5.509  2.690   1.622   1.00 15.00 ?  306 ARG A HB3  3  
ATOM 1791  H HG2  . ARG A 1 10 ? -4.154  4.829   2.409   1.00 15.00 ?  306 ARG A HG2  3  
ATOM 1792  H HG3  . ARG A 1 10 ? -3.242  4.462   0.942   1.00 15.00 ?  306 ARG A HG3  3  
ATOM 1793  H HD2  . ARG A 1 10 ? -5.068  6.017   0.490   1.00 15.00 ?  306 ARG A HD2  3  
ATOM 1794  H HD3  . ARG A 1 10 ? -5.294  4.488   -0.360  1.00 15.00 ?  306 ARG A HD3  3  
ATOM 1795  H HE   . ARG A 1 10 ? -7.038  3.924   1.145   1.00 15.00 ?  306 ARG A HE   3  
ATOM 1796  H HH11 . ARG A 1 10 ? -5.778  7.152   1.598   1.00 15.00 ?  306 ARG A HH11 3  
ATOM 1797  H HH12 . ARG A 1 10 ? -7.134  7.705   2.525   1.00 15.00 ?  306 ARG A HH12 3  
ATOM 1798  H HH21 . ARG A 1 10 ? -8.830  4.613   2.371   1.00 15.00 ?  306 ARG A HH21 3  
ATOM 1799  H HH22 . ARG A 1 10 ? -8.876  6.248   2.976   1.00 15.00 ?  306 ARG A HH22 3  
ATOM 1800  N N    . ASN A 1 11 ? -5.359  0.654   3.976   1.00 15.00 ?  307 ASN A N    3  
ATOM 1801  C CA   . ASN A 1 11 ? -5.892  -0.676  4.239   1.00 15.00 ?  307 ASN A CA   3  
ATOM 1802  C C    . ASN A 1 11 ? -7.163  -0.893  3.408   1.00 15.00 ?  307 ASN A C    3  
ATOM 1803  O O    . ASN A 1 11 ? -8.115  -0.122  3.535   1.00 15.00 ?  307 ASN A O    3  
ATOM 1804  C CB   . ASN A 1 11 ? -6.214  -0.810  5.735   1.00 15.00 ?  307 ASN A CB   3  
ATOM 1805  C CG   . ASN A 1 11 ? -6.591  -2.222  6.165   1.00 15.00 ?  307 ASN A CG   3  
ATOM 1806  O OD1  . ASN A 1 11 ? -7.096  -3.022  5.382   1.00 15.00 ?  307 ASN A OD1  3  
ATOM 1807  N ND2  . ASN A 1 11 ? -6.350  -2.532  7.430   1.00 15.00 ?  307 ASN A ND2  3  
ATOM 1808  H H    . ASN A 1 11 ? -5.778  1.425   4.412   1.00 15.00 ?  307 ASN A H    3  
ATOM 1809  H HA   . ASN A 1 11 ? -5.139  -1.402  3.968   1.00 15.00 ?  307 ASN A HA   3  
ATOM 1810  H HB2  . ASN A 1 11 ? -5.349  -0.507  6.304   1.00 15.00 ?  307 ASN A HB2  3  
ATOM 1811  H HB3  . ASN A 1 11 ? -7.038  -0.151  5.971   1.00 15.00 ?  307 ASN A HB3  3  
ATOM 1812  H HD21 . ASN A 1 11 ? -5.945  -1.841  8.009   1.00 15.00 ?  307 ASN A HD21 3  
ATOM 1813  H HD22 . ASN A 1 11 ? -6.601  -3.430  7.743   1.00 15.00 ?  307 ASN A HD22 3  
ATOM 1814  N N    . THR A 1 12 ? -7.200  -1.933  2.574   1.00 15.00 ?  308 THR A N    3  
ATOM 1815  C CA   . THR A 1 12 ? -8.370  -2.185  1.749   1.00 15.00 ?  308 THR A CA   3  
ATOM 1816  C C    . THR A 1 12 ? -9.348  -3.089  2.489   1.00 15.00 ?  308 THR A C    3  
ATOM 1817  O O    . THR A 1 12 ? -8.932  -3.963  3.258   1.00 15.00 ?  308 THR A O    3  
ATOM 1818  C CB   . THR A 1 12 ? -7.987  -2.852  0.412   1.00 15.00 ?  308 THR A CB   3  
ATOM 1819  O OG1  . THR A 1 12 ? -6.567  -2.988  0.326   1.00 15.00 ?  308 THR A OG1  3  
ATOM 1820  C CG2  . THR A 1 12 ? -8.496  -2.040  -0.774  1.00 15.00 ?  308 THR A CG2  3  
ATOM 1821  H H    . THR A 1 12 ? -6.441  -2.554  2.527   1.00 15.00 ?  308 THR A H    3  
ATOM 1822  H HA   . THR A 1 12 ? -8.848  -1.240  1.539   1.00 15.00 ?  308 THR A HA   3  
ATOM 1823  H HB   . THR A 1 12 ? -8.438  -3.834  0.378   1.00 15.00 ?  308 THR A HB   3  
ATOM 1824  H HG1  . THR A 1 12 ? -6.149  -2.189  0.663   1.00 15.00 ?  308 THR A HG1  3  
ATOM 1825  H HG21 . THR A 1 12 ? -9.574  -1.981  -0.737  1.00 15.00 ?  308 THR A HG21 3  
ATOM 1826  H HG22 . THR A 1 12 ? -8.193  -2.515  -1.696  1.00 15.00 ?  308 THR A HG22 3  
ATOM 1827  H HG23 . THR A 1 12 ? -8.081  -1.044  -0.735  1.00 15.00 ?  308 THR A HG23 3  
ATOM 1828  N N    . ALA A 1 13 ? -10.642 -2.891  2.228   1.00 15.00 ?  309 ALA A N    3  
ATOM 1829  C CA   . ALA A 1 13 ? -11.710 -3.616  2.924   1.00 15.00 ?  309 ALA A CA   3  
ATOM 1830  C C    . ALA A 1 13 ? -11.601 -5.124  2.724   1.00 15.00 ?  309 ALA A C    3  
ATOM 1831  O O    . ALA A 1 13 ? -12.233 -5.904  3.437   1.00 15.00 ?  309 ALA A O    3  
ATOM 1832  C CB   . ALA A 1 13 ? -13.071 -3.121  2.457   1.00 15.00 ?  309 ALA A CB   3  
ATOM 1833  H H    . ALA A 1 13 ? -10.890 -2.230  1.548   1.00 15.00 ?  309 ALA A H    3  
ATOM 1834  H HA   . ALA A 1 13 ? -11.622 -3.398  3.979   1.00 15.00 ?  309 ALA A HA   3  
ATOM 1835  H HB1  . ALA A 1 13 ? -13.194 -3.348  1.408   1.00 15.00 ?  309 ALA A HB1  3  
ATOM 1836  H HB2  . ALA A 1 13 ? -13.136 -2.053  2.604   1.00 15.00 ?  309 ALA A HB2  3  
ATOM 1837  H HB3  . ALA A 1 13 ? -13.847 -3.610  3.025   1.00 15.00 ?  309 ALA A HB3  3  
ATOM 1838  N N    . THR A 1 14 ? -10.805 -5.526  1.744   1.00 15.00 ?  310 THR A N    3  
ATOM 1839  C CA   . THR A 1 14 ? -10.521 -6.928  1.499   1.00 15.00 ?  310 THR A CA   3  
ATOM 1840  C C    . THR A 1 14 ? -9.727  -7.533  2.665   1.00 15.00 ?  310 THR A C    3  
ATOM 1841  O O    . THR A 1 14 ? -9.612  -8.751  2.791   1.00 15.00 ?  310 THR A O    3  
ATOM 1842  C CB   . THR A 1 14 ? -9.721  -7.078  0.196   1.00 15.00 ?  310 THR A CB   3  
ATOM 1843  O OG1  . THR A 1 14 ? -10.085 -6.019  -0.706  1.00 15.00 ?  310 THR A OG1  3  
ATOM 1844  C CG2  . THR A 1 14 ? -9.991  -8.424  -0.458  1.00 15.00 ?  310 THR A CG2  3  
ATOM 1845  H H    . THR A 1 14 ? -10.398 -4.855  1.157   1.00 15.00 ?  310 THR A H    3  
ATOM 1846  H HA   . THR A 1 14 ? -11.460 -7.455  1.392   1.00 15.00 ?  310 THR A HA   3  
ATOM 1847  H HB   . THR A 1 14 ? -8.667  -7.004  0.424   1.00 15.00 ?  310 THR A HB   3  
ATOM 1848  H HG1  . THR A 1 14 ? -10.648 -6.374  -1.413  1.00 15.00 ?  310 THR A HG1  3  
ATOM 1849  H HG21 . THR A 1 14 ? -9.403  -8.511  -1.359  1.00 15.00 ?  310 THR A HG21 3  
ATOM 1850  H HG22 . THR A 1 14 ? -11.041 -8.499  -0.705  1.00 15.00 ?  310 THR A HG22 3  
ATOM 1851  H HG23 . THR A 1 14 ? -9.724  -9.216  0.224   1.00 15.00 ?  310 THR A HG23 3  
ATOM 1852  N N    . GLY A 1 15 ? -9.176  -6.663  3.506   1.00 15.00 ?  311 GLY A N    3  
ATOM 1853  C CA   . GLY A 1 15 ? -8.447  -7.108  4.676   1.00 15.00 ?  311 GLY A CA   3  
ATOM 1854  C C    . GLY A 1 15 ? -6.954  -7.198  4.439   1.00 15.00 ?  311 GLY A C    3  
ATOM 1855  O O    . GLY A 1 15 ? -6.296  -8.099  4.963   1.00 15.00 ?  311 GLY A O    3  
ATOM 1856  H H    . GLY A 1 15 ? -9.279  -5.700  3.336   1.00 15.00 ?  311 GLY A H    3  
ATOM 1857  H HA2  . GLY A 1 15 ? -8.629  -6.416  5.485   1.00 15.00 ?  311 GLY A HA2  3  
ATOM 1858  H HA3  . GLY A 1 15 ? -8.811  -8.082  4.963   1.00 15.00 ?  311 GLY A HA3  3  
ATOM 1859  N N    . ARG A 1 16 ? -6.416  -6.274  3.651   1.00 15.00 ?  312 ARG A N    3  
ATOM 1860  C CA   . ARG A 1 16 ? -4.983  -6.261  3.348   1.00 15.00 ?  312 ARG A CA   3  
ATOM 1861  C C    . ARG A 1 16 ? -4.512  -4.822  3.200   1.00 15.00 ?  312 ARG A C    3  
ATOM 1862  O O    . ARG A 1 16 ? -5.281  -3.963  2.770   1.00 15.00 ?  312 ARG A O    3  
ATOM 1863  C CB   . ARG A 1 16 ? -4.658  -7.028  2.061   1.00 15.00 ?  312 ARG A CB   3  
ATOM 1864  C CG   . ARG A 1 16 ? -5.326  -8.382  1.919   1.00 15.00 ?  312 ARG A CG   3  
ATOM 1865  C CD   . ARG A 1 16 ? -4.757  -9.127  0.727   1.00 15.00 ?  312 ARG A CD   3  
ATOM 1866  N NE   . ARG A 1 16 ? -5.559  -10.290 0.359   1.00 15.00 ?  312 ARG A NE   3  
ATOM 1867  C CZ   . ARG A 1 16 ? -5.178  -11.553 0.549   1.00 15.00 ?  312 ARG A CZ   3  
ATOM 1868  N NH1  . ARG A 1 16 ? -4.041  -11.830 1.178   1.00 15.00 1  312 ARG A NH1  3  
ATOM 1869  N NH2  . ARG A 1 16 ? -5.950  -12.539 0.113   1.00 15.00 ?  312 ARG A NH2  3  
ATOM 1870  H H    . ARG A 1 16 ? -6.988  -5.557  3.285   1.00 15.00 ?  312 ARG A H    3  
ATOM 1871  H HA   . ARG A 1 16 ? -4.465  -6.719  4.178   1.00 15.00 ?  312 ARG A HA   3  
ATOM 1872  H HB2  . ARG A 1 16 ? -4.945  -6.423  1.208   1.00 15.00 ?  312 ARG A HB2  3  
ATOM 1873  H HB3  . ARG A 1 16 ? -3.588  -7.181  2.022   1.00 15.00 ?  312 ARG A HB3  3  
ATOM 1874  H HG2  . ARG A 1 16 ? -5.151  -8.958  2.817   1.00 15.00 ?  312 ARG A HG2  3  
ATOM 1875  H HG3  . ARG A 1 16 ? -6.387  -8.240  1.776   1.00 15.00 ?  312 ARG A HG3  3  
ATOM 1876  H HD2  . ARG A 1 16 ? -4.711  -8.445  -0.111  1.00 15.00 ?  312 ARG A HD2  3  
ATOM 1877  H HD3  . ARG A 1 16 ? -3.759  -9.455  0.976   1.00 15.00 ?  312 ARG A HD3  3  
ATOM 1878  H HE   . ARG A 1 16 ? -6.423  -10.121 -0.093  1.00 15.00 ?  312 ARG A HE   3  
ATOM 1879  H HH11 . ARG A 1 16 ? -3.452  -11.089 1.520   1.00 15.00 ?  312 ARG A HH11 3  
ATOM 1880  H HH12 . ARG A 1 16 ? -3.754  -12.782 1.309   1.00 15.00 ?  312 ARG A HH12 3  
ATOM 1881  H HH21 . ARG A 1 16 ? -6.814  -12.328 -0.356  1.00 15.00 ?  312 ARG A HH21 3  
ATOM 1882  H HH22 . ARG A 1 16 ? -5.675  -13.498 0.241   1.00 15.00 ?  312 ARG A HH22 3  
ATOM 1883  N N    . VAL A 1 17 ? -3.255  -4.555  3.525   1.00 15.00 ?  313 VAL A N    3  
ATOM 1884  C CA   . VAL A 1 17 ? -2.764  -3.186  3.531   1.00 15.00 ?  313 VAL A CA   3  
ATOM 1885  C C    . VAL A 1 17 ? -1.730  -2.934  2.421   1.00 15.00 ?  313 VAL A C    3  
ATOM 1886  O O    . VAL A 1 17 ? -0.578  -3.337  2.521   1.00 15.00 ?  313 VAL A O    3  
ATOM 1887  C CB   . VAL A 1 17 ? -2.150  -2.823  4.897   1.00 15.00 ?  313 VAL A CB   3  
ATOM 1888  C CG1  . VAL A 1 17 ? -1.943  -1.324  5.010   1.00 15.00 ?  313 VAL A CG1  3  
ATOM 1889  C CG2  . VAL A 1 17 ? -3.028  -3.328  6.033   1.00 15.00 ?  313 VAL A CG2  3  
ATOM 1890  H H    . VAL A 1 17 ? -2.640  -5.287  3.748   1.00 15.00 ?  313 VAL A H    3  
ATOM 1891  H HA   . VAL A 1 17 ? -3.613  -2.536  3.369   1.00 15.00 ?  313 VAL A HA   3  
ATOM 1892  H HB   . VAL A 1 17 ? -1.186  -3.303  4.975   1.00 15.00 ?  313 VAL A HB   3  
ATOM 1893  H HG11 . VAL A 1 17 ? -1.272  -0.994  4.231   1.00 15.00 ?  313 VAL A HG11 3  
ATOM 1894  H HG12 . VAL A 1 17 ? -1.516  -1.089  5.975   1.00 15.00 ?  313 VAL A HG12 3  
ATOM 1895  H HG13 . VAL A 1 17 ? -2.892  -0.820  4.903   1.00 15.00 ?  313 VAL A HG13 3  
ATOM 1896  H HG21 . VAL A 1 17 ? -4.006  -2.870  5.965   1.00 15.00 ?  313 VAL A HG21 3  
ATOM 1897  H HG22 . VAL A 1 17 ? -2.576  -3.071  6.980   1.00 15.00 ?  313 VAL A HG22 3  
ATOM 1898  H HG23 . VAL A 1 17 ? -3.128  -4.401  5.962   1.00 15.00 ?  313 VAL A HG23 3  
ATOM 1899  N N    . TYR A 1 18 ? -2.167  -2.258  1.369   1.00 15.00 ?  314 TYR A N    3  
ATOM 1900  C CA   . TYR A 1 18 ? -1.311  -1.801  0.307   1.00 15.00 ?  314 TYR A CA   3  
ATOM 1901  C C    . TYR A 1 18 ? -0.783  -0.407  0.638   1.00 15.00 ?  314 TYR A C    3  
ATOM 1902  O O    . TYR A 1 18 ? -1.540  0.529   0.900   1.00 15.00 ?  314 TYR A O    3  
ATOM 1903  C CB   . TYR A 1 18 ? -2.101  -1.756  -1.020  1.00 15.00 ?  314 TYR A CB   3  
ATOM 1904  C CG   . TYR A 1 18 ? -3.230  -0.732  -1.041  1.00 15.00 ?  314 TYR A CG   3  
ATOM 1905  C CD1  . TYR A 1 18 ? -4.424  -0.968  -0.375  1.00 15.00 ?  314 TYR A CD1  3  
ATOM 1906  C CD2  . TYR A 1 18 ? -3.090  0.477   -1.717  1.00 15.00 ?  314 TYR A CD2  3  
ATOM 1907  C CE1  . TYR A 1 18 ? -5.444  -0.033  -0.380  1.00 15.00 ?  314 TYR A CE1  3  
ATOM 1908  C CE2  . TYR A 1 18 ? -4.106  1.419   -1.726  1.00 15.00 ?  314 TYR A CE2  3  
ATOM 1909  C CZ   . TYR A 1 18 ? -5.278  1.157   -1.054  1.00 15.00 ?  314 TYR A CZ   3  
ATOM 1910  O OH   . TYR A 1 18 ? -6.292  2.082   -1.068  1.00 15.00 ?  314 TYR A OH   3  
ATOM 1911  H H    . TYR A 1 18 ? -3.095  -2.111  1.275   1.00 15.00 ?  314 TYR A H    3  
ATOM 1912  H HA   . TYR A 1 18 ? -0.487  -2.490  0.209   1.00 15.00 ?  314 TYR A HA   3  
ATOM 1913  H HB2  . TYR A 1 18 ? -1.422  -1.514  -1.825  1.00 15.00 ?  314 TYR A HB2  3  
ATOM 1914  H HB3  . TYR A 1 18 ? -2.534  -2.729  -1.204  1.00 15.00 ?  314 TYR A HB3  3  
ATOM 1915  H HD1  . TYR A 1 18 ? -4.553  -1.898  0.157   1.00 15.00 ?  314 TYR A HD1  3  
ATOM 1916  H HD2  . TYR A 1 18 ? -2.177  0.670   -2.258  1.00 15.00 ?  314 TYR A HD2  3  
ATOM 1917  H HE1  . TYR A 1 18 ? -6.363  -0.237  0.146   1.00 15.00 ?  314 TYR A HE1  3  
ATOM 1918  H HE2  . TYR A 1 18 ? -3.972  2.369   -2.248  1.00 15.00 ?  314 TYR A HE2  3  
ATOM 1919  H HH   . TYR A 1 18 ? -6.719  2.119   -0.195  1.00 15.00 ?  314 TYR A HH   3  
ATOM 1920  N N    . PHE A 1 19 ? 0.521   -0.289  0.674   1.00 15.00 ?  315 PHE A N    3  
ATOM 1921  C CA   . PHE A 1 19 ? 1.159   0.997   0.815   1.00 15.00 ?  315 PHE A CA   3  
ATOM 1922  C C    . PHE A 1 19 ? 1.611   1.437   -0.561  1.00 15.00 ?  315 PHE A C    3  
ATOM 1923  O O    . PHE A 1 19 ? 2.409   0.758   -1.186  1.00 15.00 ?  315 PHE A O    3  
ATOM 1924  C CB   . PHE A 1 19 ? 2.390   0.920   1.721   1.00 15.00 ?  315 PHE A CB   3  
ATOM 1925  C CG   . PHE A 1 19 ? 2.167   0.432   3.129   1.00 15.00 ?  315 PHE A CG   3  
ATOM 1926  C CD1  . PHE A 1 19 ? 1.517   -0.763  3.380   1.00 15.00 ?  315 PHE A CD1  3  
ATOM 1927  C CD2  . PHE A 1 19 ? 2.649   1.164   4.204   1.00 15.00 ?  315 PHE A CD2  3  
ATOM 1928  C CE1  . PHE A 1 19 ? 1.345   -1.216  4.671   1.00 15.00 ?  315 PHE A CE1  3  
ATOM 1929  C CE2  . PHE A 1 19 ? 2.485   0.712   5.499   1.00 15.00 ?  315 PHE A CE2  3  
ATOM 1930  C CZ   . PHE A 1 19 ? 1.830   -0.481  5.731   1.00 15.00 ?  315 PHE A CZ   3  
ATOM 1931  H H    . PHE A 1 19 ? 1.078   -1.096  0.596   1.00 15.00 ?  315 PHE A H    3  
ATOM 1932  H HA   . PHE A 1 19 ? 0.448   1.703   1.212   1.00 15.00 ?  315 PHE A HA   3  
ATOM 1933  H HB2  . PHE A 1 19 ? 3.109   0.257   1.267   1.00 15.00 ?  315 PHE A HB2  3  
ATOM 1934  H HB3  . PHE A 1 19 ? 2.826   1.908   1.784   1.00 15.00 ?  315 PHE A HB3  3  
ATOM 1935  H HD1  . PHE A 1 19 ? 1.136   -1.342  2.552   1.00 15.00 ?  315 PHE A HD1  3  
ATOM 1936  H HD2  . PHE A 1 19 ? 3.160   2.098   4.021   1.00 15.00 ?  315 PHE A HD2  3  
ATOM 1937  H HE1  . PHE A 1 19 ? 0.832   -2.149  4.850   1.00 15.00 ?  315 PHE A HE1  3  
ATOM 1938  H HE2  . PHE A 1 19 ? 2.865   1.292   6.327   1.00 15.00 ?  315 PHE A HE2  3  
ATOM 1939  H HZ   . PHE A 1 19 ? 1.703   -0.842  6.738   1.00 15.00 ?  315 PHE A HZ   3  
ATOM 1940  N N    . VAL A 1 20 ? 1.124   2.551   -1.046  1.00 15.00 ?  316 VAL A N    3  
ATOM 1941  C CA   . VAL A 1 20 ? 1.553   3.003   -2.344  1.00 15.00 ?  316 VAL A CA   3  
ATOM 1942  C C    . VAL A 1 20 ? 2.787   3.894   -2.187  1.00 15.00 ?  316 VAL A C    3  
ATOM 1943  O O    . VAL A 1 20 ? 2.791   4.823   -1.372  1.00 15.00 ?  316 VAL A O    3  
ATOM 1944  C CB   . VAL A 1 20 ? 0.444   3.751   -3.130  1.00 15.00 ?  316 VAL A CB   3  
ATOM 1945  C CG1  . VAL A 1 20 ? -0.687  2.810   -3.502  1.00 15.00 ?  316 VAL A CG1  3  
ATOM 1946  C CG2  . VAL A 1 20 ? -0.112  4.937   -2.366  1.00 15.00 ?  316 VAL A CG2  3  
ATOM 1947  H H    . VAL A 1 20 ? 0.496   3.089   -0.516  1.00 15.00 ?  316 VAL A H    3  
ATOM 1948  H HA   . VAL A 1 20 ? 1.821   2.121   -2.908  1.00 15.00 ?  316 VAL A HA   3  
ATOM 1949  H HB   . VAL A 1 20 ? 0.880   4.121   -4.046  1.00 15.00 ?  316 VAL A HB   3  
ATOM 1950  H HG11 . VAL A 1 20 ? -1.417  3.343   -4.094  1.00 15.00 ?  316 VAL A HG11 3  
ATOM 1951  H HG12 . VAL A 1 20 ? -1.156  2.436   -2.606  1.00 15.00 ?  316 VAL A HG12 3  
ATOM 1952  H HG13 . VAL A 1 20 ? -0.294  1.983   -4.074  1.00 15.00 ?  316 VAL A HG13 3  
ATOM 1953  H HG21 . VAL A 1 20 ? 0.682   5.428   -1.824  1.00 15.00 ?  316 VAL A HG21 3  
ATOM 1954  H HG22 . VAL A 1 20 ? -0.875  4.599   -1.681  1.00 15.00 ?  316 VAL A HG22 3  
ATOM 1955  H HG23 . VAL A 1 20 ? -0.545  5.628   -3.075  1.00 15.00 ?  316 VAL A HG23 3  
ATOM 1956  N N    . ASP A 1 21 ? 3.855   3.589   -2.922  1.00 15.00 ?  317 ASP A N    3  
ATOM 1957  C CA   . ASP A 1 21 ? 5.060   4.385   -2.836  1.00 15.00 ?  317 ASP A CA   3  
ATOM 1958  C C    . ASP A 1 21 ? 4.959   5.486   -3.865  1.00 15.00 ?  317 ASP A C    3  
ATOM 1959  O O    . ASP A 1 21 ? 4.786   5.209   -5.053  1.00 15.00 ?  317 ASP A O    3  
ATOM 1960  C CB   . ASP A 1 21 ? 6.321   3.574   -3.150  1.00 15.00 ?  317 ASP A CB   3  
ATOM 1961  C CG   . ASP A 1 21 ? 6.229   2.114   -2.800  1.00 15.00 ?  317 ASP A CG   3  
ATOM 1962  O OD1  . ASP A 1 21 ? 6.594   1.760   -1.668  1.00 15.00 ?  317 ASP A OD1  3  
ATOM 1963  O OD2  . ASP A 1 21 ? 5.854   1.319   -3.682  1.00 15.00 -1 317 ASP A OD2  3  
ATOM 1964  H H    . ASP A 1 21 ? 3.835   2.809   -3.523  1.00 15.00 ?  317 ASP A H    3  
ATOM 1965  H HA   . ASP A 1 21 ? 5.129   4.811   -1.848  1.00 15.00 ?  317 ASP A HA   3  
ATOM 1966  H HB2  . ASP A 1 21 ? 6.547   3.658   -4.200  1.00 15.00 ?  317 ASP A HB2  3  
ATOM 1967  H HB3  . ASP A 1 21 ? 7.136   3.992   -2.578  1.00 15.00 ?  317 ASP A HB3  3  
ATOM 1968  N N    . HIS A 1 22 ? 5.049   6.731   -3.429  1.00 15.00 ?  318 HIS A N    3  
ATOM 1969  C CA   . HIS A 1 22 ? 5.017   7.854   -4.360  1.00 15.00 ?  318 HIS A CA   3  
ATOM 1970  C C    . HIS A 1 22 ? 6.324   7.949   -5.143  1.00 15.00 ?  318 HIS A C    3  
ATOM 1971  O O    . HIS A 1 22 ? 6.408   8.662   -6.138  1.00 15.00 ?  318 HIS A O    3  
ATOM 1972  C CB   . HIS A 1 22 ? 4.718   9.172   -3.643  1.00 15.00 ?  318 HIS A CB   3  
ATOM 1973  C CG   . HIS A 1 22 ? 3.259   9.406   -3.361  1.00 15.00 ?  318 HIS A CG   3  
ATOM 1974  N ND1  . HIS A 1 22 ? 2.272   8.466   -3.577  1.00 15.00 ?  318 HIS A ND1  3  
ATOM 1975  C CD2  . HIS A 1 22 ? 2.625   10.492  -2.865  1.00 15.00 ?  318 HIS A CD2  3  
ATOM 1976  C CE1  . HIS A 1 22 ? 1.107   8.963   -3.221  1.00 15.00 ?  318 HIS A CE1  3  
ATOM 1977  N NE2  . HIS A 1 22 ? 1.284   10.193  -2.781  1.00 15.00 ?  318 HIS A NE2  3  
ATOM 1978  H H    . HIS A 1 22 ? 5.131   6.901   -2.462  1.00 15.00 ?  318 HIS A H    3  
ATOM 1979  H HA   . HIS A 1 22 ? 4.221   7.660   -5.065  1.00 15.00 ?  318 HIS A HA   3  
ATOM 1980  H HB2  . HIS A 1 22 ? 5.241   9.184   -2.699  1.00 15.00 ?  318 HIS A HB2  3  
ATOM 1981  H HB3  . HIS A 1 22 ? 5.075   9.990   -4.252  1.00 15.00 ?  318 HIS A HB3  3  
ATOM 1982  H HD1  . HIS A 1 22 ? 2.400   7.566   -3.951  1.00 15.00 ?  318 HIS A HD1  3  
ATOM 1983  H HD2  . HIS A 1 22 ? 3.089   11.427  -2.582  1.00 15.00 ?  318 HIS A HD2  3  
ATOM 1984  H HE1  . HIS A 1 22 ? 0.160   8.447   -3.279  1.00 15.00 ?  318 HIS A HE1  3  
ATOM 1985  H HE2  . HIS A 1 22 ? 0.677   10.615  -2.130  1.00 15.00 ?  318 HIS A HE2  3  
ATOM 1986  N N    . ASN A 1 23 ? 7.345   7.242   -4.668  1.00 15.00 ?  319 ASN A N    3  
ATOM 1987  C CA   . ASN A 1 23 ? 8.644   7.214   -5.337  1.00 15.00 ?  319 ASN A CA   3  
ATOM 1988  C C    . ASN A 1 23 ? 8.555   6.547   -6.708  1.00 15.00 ?  319 ASN A C    3  
ATOM 1989  O O    . ASN A 1 23 ? 8.671   7.207   -7.737  1.00 15.00 ?  319 ASN A O    3  
ATOM 1990  C CB   . ASN A 1 23 ? 9.684   6.484   -4.480  1.00 15.00 ?  319 ASN A CB   3  
ATOM 1991  C CG   . ASN A 1 23 ? 10.166  7.312   -3.306  1.00 15.00 ?  319 ASN A CG   3  
ATOM 1992  O OD1  . ASN A 1 23 ? 11.105  8.093   -3.432  1.00 15.00 ?  319 ASN A OD1  3  
ATOM 1993  N ND2  . ASN A 1 23 ? 9.543   7.134   -2.150  1.00 15.00 ?  319 ASN A ND2  3  
ATOM 1994  H H    . ASN A 1 23 ? 7.221   6.729   -3.845  1.00 15.00 ?  319 ASN A H    3  
ATOM 1995  H HA   . ASN A 1 23 ? 8.963   8.236   -5.472  1.00 15.00 ?  319 ASN A HA   3  
ATOM 1996  H HB2  . ASN A 1 23 ? 9.250   5.572   -4.096  1.00 15.00 ?  319 ASN A HB2  3  
ATOM 1997  H HB3  . ASN A 1 23 ? 10.536  6.238   -5.096  1.00 15.00 ?  319 ASN A HB3  3  
ATOM 1998  H HD21 . ASN A 1 23 ? 8.811   6.487   -2.109  1.00 15.00 ?  319 ASN A HD21 3  
ATOM 1999  H HD22 . ASN A 1 23 ? 9.853   7.660   -1.375  1.00 15.00 ?  319 ASN A HD22 3  
ATOM 2000  N N    . ASN A 1 24 ? 8.352   5.233   -6.719  1.00 15.00 ?  320 ASN A N    3  
ATOM 2001  C CA   . ASN A 1 24 ? 8.289   4.480   -7.973  1.00 15.00 ?  320 ASN A CA   3  
ATOM 2002  C C    . ASN A 1 24 ? 6.869   4.483   -8.530  1.00 15.00 ?  320 ASN A C    3  
ATOM 2003  O O    . ASN A 1 24 ? 6.642   4.135   -9.689  1.00 15.00 ?  320 ASN A O    3  
ATOM 2004  C CB   . ASN A 1 24 ? 8.776   3.041   -7.766  1.00 15.00 ?  320 ASN A CB   3  
ATOM 2005  C CG   . ASN A 1 24 ? 8.937   2.281   -9.073  1.00 15.00 ?  320 ASN A CG   3  
ATOM 2006  O OD1  . ASN A 1 24 ? 8.007   1.632   -9.551  1.00 15.00 ?  320 ASN A OD1  3  
ATOM 2007  N ND2  . ASN A 1 24 ? 10.125  2.345   -9.651  1.00 15.00 ?  320 ASN A ND2  3  
ATOM 2008  H H    . ASN A 1 24 ? 8.252   4.756   -5.870  1.00 15.00 ?  320 ASN A H    3  
ATOM 2009  H HA   . ASN A 1 24 ? 8.938   4.972   -8.683  1.00 15.00 ?  320 ASN A HA   3  
ATOM 2010  H HB2  . ASN A 1 24 ? 9.733   3.061   -7.266  1.00 15.00 ?  320 ASN A HB2  3  
ATOM 2011  H HB3  . ASN A 1 24 ? 8.063   2.514   -7.148  1.00 15.00 ?  320 ASN A HB3  3  
ATOM 2012  H HD21 . ASN A 1 24 ? 10.832  2.866   -9.208  1.00 15.00 ?  320 ASN A HD21 3  
ATOM 2013  H HD22 . ASN A 1 24 ? 10.250  1.881   -10.509 1.00 15.00 ?  320 ASN A HD22 3  
ATOM 2014  N N    . ARG A 1 25 ? 5.921   4.863   -7.678  1.00 15.00 ?  321 ARG A N    3  
ATOM 2015  C CA   . ARG A 1 25 ? 4.500   4.867   -8.016  1.00 15.00 ?  321 ARG A CA   3  
ATOM 2016  C C    . ARG A 1 25 ? 3.984   3.444   -8.175  1.00 15.00 ?  321 ARG A C    3  
ATOM 2017  O O    . ARG A 1 25 ? 3.529   3.041   -9.244  1.00 15.00 ?  321 ARG A O    3  
ATOM 2018  C CB   . ARG A 1 25 ? 4.211   5.688   -9.278  1.00 15.00 ?  321 ARG A CB   3  
ATOM 2019  C CG   . ARG A 1 25 ? 4.615   7.146   -9.164  1.00 15.00 ?  321 ARG A CG   3  
ATOM 2020  C CD   . ARG A 1 25 ? 4.196   7.938   -10.391 1.00 15.00 ?  321 ARG A CD   3  
ATOM 2021  N NE   . ARG A 1 25 ? 4.758   7.390   -11.625 1.00 15.00 ?  321 ARG A NE   3  
ATOM 2022  C CZ   . ARG A 1 25 ? 5.354   8.125   -12.561 1.00 15.00 ?  321 ARG A CZ   3  
ATOM 2023  N NH1  . ARG A 1 25 ? 5.497   9.438   -12.393 1.00 15.00 1  321 ARG A NH1  3  
ATOM 2024  N NH2  . ARG A 1 25 ? 5.815   7.548   -13.664 1.00 15.00 ?  321 ARG A NH2  3  
ATOM 2025  H H    . ARG A 1 25 ? 6.187   5.152   -6.783  1.00 15.00 ?  321 ARG A H    3  
ATOM 2026  H HA   . ARG A 1 25 ? 3.977   5.321   -7.185  1.00 15.00 ?  321 ARG A HA   3  
ATOM 2027  H HB2  . ARG A 1 25 ? 4.746   5.251   -10.107 1.00 15.00 ?  321 ARG A HB2  3  
ATOM 2028  H HB3  . ARG A 1 25 ? 3.150   5.646   -9.485  1.00 15.00 ?  321 ARG A HB3  3  
ATOM 2029  H HG2  . ARG A 1 25 ? 4.140   7.573   -8.294  1.00 15.00 ?  321 ARG A HG2  3  
ATOM 2030  H HG3  . ARG A 1 25 ? 5.689   7.205   -9.056  1.00 15.00 ?  321 ARG A HG3  3  
ATOM 2031  H HD2  . ARG A 1 25 ? 3.119   7.920   -10.461 1.00 15.00 ?  321 ARG A HD2  3  
ATOM 2032  H HD3  . ARG A 1 25 ? 4.530   8.958   -10.276 1.00 15.00 ?  321 ARG A HD3  3  
ATOM 2033  H HE   . ARG A 1 25 ? 4.667   6.413   -11.770 1.00 15.00 ?  321 ARG A HE   3  
ATOM 2034  H HH11 . ARG A 1 25 ? 5.157   9.880   -11.556 1.00 15.00 ?  321 ARG A HH11 3  
ATOM 2035  H HH12 . ARG A 1 25 ? 5.943   9.997   -13.105 1.00 15.00 ?  321 ARG A HH12 3  
ATOM 2036  H HH21 . ARG A 1 25 ? 5.718   6.549   -13.796 1.00 15.00 ?  321 ARG A HH21 3  
ATOM 2037  H HH22 . ARG A 1 25 ? 6.260   8.098   -14.372 1.00 15.00 ?  321 ARG A HH22 3  
ATOM 2038  N N    . THR A 1 26 ? 4.086   2.677   -7.103  1.00 15.00 ?  322 THR A N    3  
ATOM 2039  C CA   . THR A 1 26 ? 3.590   1.310   -7.084  1.00 15.00 ?  322 THR A CA   3  
ATOM 2040  C C    . THR A 1 26 ? 2.716   1.099   -5.853  1.00 15.00 ?  322 THR A C    3  
ATOM 2041  O O    . THR A 1 26 ? 2.915   1.767   -4.841  1.00 15.00 ?  322 THR A O    3  
ATOM 2042  C CB   . THR A 1 26 ? 4.753   0.296   -7.064  1.00 15.00 ?  322 THR A CB   3  
ATOM 2043  O OG1  . THR A 1 26 ? 5.713   0.632   -8.072  1.00 15.00 ?  322 THR A OG1  3  
ATOM 2044  C CG2  . THR A 1 26 ? 4.250   -1.120  -7.307  1.00 15.00 ?  322 THR A CG2  3  
ATOM 2045  H H    . THR A 1 26 ? 4.501   3.045   -6.290  1.00 15.00 ?  322 THR A H    3  
ATOM 2046  H HA   . THR A 1 26 ? 3.001   1.147   -7.975  1.00 15.00 ?  322 THR A HA   3  
ATOM 2047  H HB   . THR A 1 26 ? 5.229   0.333   -6.095  1.00 15.00 ?  322 THR A HB   3  
ATOM 2048  H HG1  . THR A 1 26 ? 5.401   1.396   -8.573  1.00 15.00 ?  322 THR A HG1  3  
ATOM 2049  H HG21 . THR A 1 26 ? 3.541   -1.385  -6.539  1.00 15.00 ?  322 THR A HG21 3  
ATOM 2050  H HG22 . THR A 1 26 ? 5.083   -1.809  -7.283  1.00 15.00 ?  322 THR A HG22 3  
ATOM 2051  H HG23 . THR A 1 26 ? 3.769   -1.171  -8.273  1.00 15.00 ?  322 THR A HG23 3  
ATOM 2052  N N    . THR A 1 27 ? 1.731   0.215   -5.942  1.00 15.00 ?  323 THR A N    3  
ATOM 2053  C CA   . THR A 1 27 ? 0.943   -0.126  -4.776  1.00 15.00 ?  323 THR A CA   3  
ATOM 2054  C C    . THR A 1 27 ? 1.509   -1.411  -4.151  1.00 15.00 ?  323 THR A C    3  
ATOM 2055  O O    . THR A 1 27 ? 1.742   -2.399  -4.855  1.00 15.00 ?  323 THR A O    3  
ATOM 2056  C CB   . THR A 1 27 ? -0.567  -0.275  -5.112  1.00 15.00 ?  323 THR A CB   3  
ATOM 2057  O OG1  . THR A 1 27 ? -1.339  -0.164  -3.918  1.00 15.00 ?  323 THR A OG1  3  
ATOM 2058  C CG2  . THR A 1 27 ? -0.897  -1.605  -5.763  1.00 15.00 ?  323 THR A CG2  3  
ATOM 2059  H H    . THR A 1 27 ? 1.545   -0.222  -6.797  1.00 15.00 ?  323 THR A H    3  
ATOM 2060  H HA   . THR A 1 27 ? 1.052   0.690   -4.075  1.00 15.00 ?  323 THR A HA   3  
ATOM 2061  H HB   . THR A 1 27 ? -0.849  0.521   -5.788  1.00 15.00 ?  323 THR A HB   3  
ATOM 2062  H HG1  . THR A 1 27 ? -1.988  0.537   -4.024  1.00 15.00 ?  323 THR A HG1  3  
ATOM 2063  H HG21 . THR A 1 27 ? -1.890  -1.557  -6.187  1.00 15.00 ?  323 THR A HG21 3  
ATOM 2064  H HG22 . THR A 1 27 ? -0.870  -2.379  -5.009  1.00 15.00 ?  323 THR A HG22 3  
ATOM 2065  H HG23 . THR A 1 27 ? -0.179  -1.823  -6.537  1.00 15.00 ?  323 THR A HG23 3  
ATOM 2066  N N    . GLN A 1 28 ? 1.764   -1.391  -2.849  1.00 15.00 ?  324 GLN A N    3  
ATOM 2067  C CA   . GLN A 1 28 ? 2.459   -2.487  -2.200  1.00 15.00 ?  324 GLN A CA   3  
ATOM 2068  C C    . GLN A 1 28 ? 1.545   -3.254  -1.257  1.00 15.00 ?  324 GLN A C    3  
ATOM 2069  O O    . GLN A 1 28 ? 1.338   -2.837  -0.123  1.00 15.00 ?  324 GLN A O    3  
ATOM 2070  C CB   . GLN A 1 28 ? 3.654   -1.957  -1.398  1.00 15.00 ?  324 GLN A CB   3  
ATOM 2071  C CG   . GLN A 1 28 ? 4.684   -1.203  -2.222  1.00 15.00 ?  324 GLN A CG   3  
ATOM 2072  C CD   . GLN A 1 28 ? 5.475   -2.097  -3.155  1.00 15.00 ?  324 GLN A CD   3  
ATOM 2073  O OE1  . GLN A 1 28 ? 5.110   -2.296  -4.314  1.00 15.00 ?  324 GLN A OE1  3  
ATOM 2074  N NE2  . GLN A 1 28 ? 6.576   -2.640  -2.657  1.00 15.00 ?  324 GLN A NE2  3  
ATOM 2075  H H    . GLN A 1 28 ? 1.493   -0.620  -2.308  1.00 15.00 ?  324 GLN A H    3  
ATOM 2076  H HA   . GLN A 1 28 ? 2.820   -3.156  -2.967  1.00 15.00 ?  324 GLN A HA   3  
ATOM 2077  H HB2  . GLN A 1 28 ? 3.284   -1.289  -0.637  1.00 15.00 ?  324 GLN A HB2  3  
ATOM 2078  H HB3  . GLN A 1 28 ? 4.148   -2.785  -0.917  1.00 15.00 ?  324 GLN A HB3  3  
ATOM 2079  H HG2  . GLN A 1 28 ? 4.172   -0.459  -2.816  1.00 15.00 ?  324 GLN A HG2  3  
ATOM 2080  H HG3  . GLN A 1 28 ? 5.371   -0.708  -1.546  1.00 15.00 ?  324 GLN A HG3  3  
ATOM 2081  H HE21 . GLN A 1 28 ? 6.810   -2.433  -1.729  1.00 15.00 ?  324 GLN A HE21 3  
ATOM 2082  H HE22 . GLN A 1 28 ? 7.099   -3.231  -3.233  1.00 15.00 ?  324 GLN A HE22 3  
ATOM 2083  N N    . PHE A 1 29 ? 0.984   -4.363  -1.730  1.00 15.00 ?  325 PHE A N    3  
ATOM 2084  C CA   . PHE A 1 29 ? 0.350   -5.332  -0.832  1.00 15.00 ?  325 PHE A CA   3  
ATOM 2085  C C    . PHE A 1 29 ? 1.433   -6.058  -0.085  1.00 15.00 ?  325 PHE A C    3  
ATOM 2086  O O    . PHE A 1 29 ? 1.198   -6.838  0.837   1.00 15.00 ?  325 PHE A O    3  
ATOM 2087  C CB   . PHE A 1 29 ? -0.538  -6.324  -1.565  1.00 15.00 ?  325 PHE A CB   3  
ATOM 2088  C CG   . PHE A 1 29 ? -1.982  -6.006  -1.380  1.00 15.00 ?  325 PHE A CG   3  
ATOM 2089  C CD1  . PHE A 1 29 ? -2.420  -5.383  -0.214  1.00 15.00 ?  325 PHE A CD1  3  
ATOM 2090  C CD2  . PHE A 1 29 ? -2.901  -6.310  -2.365  1.00 15.00 ?  325 PHE A CD2  3  
ATOM 2091  C CE1  . PHE A 1 29 ? -3.756  -5.072  -0.061  1.00 15.00 ?  325 PHE A CE1  3  
ATOM 2092  C CE2  . PHE A 1 29 ? -4.235  -6.006  -2.207  1.00 15.00 ?  325 PHE A CE2  3  
ATOM 2093  C CZ   . PHE A 1 29 ? -4.664  -5.384  -1.054  1.00 15.00 ?  325 PHE A CZ   3  
ATOM 2094  H H    . PHE A 1 29 ? 1.009   -4.540  -2.694  1.00 15.00 ?  325 PHE A H    3  
ATOM 2095  H HA   . PHE A 1 29 ? -0.246  -4.778  -0.119  1.00 15.00 ?  325 PHE A HA   3  
ATOM 2096  H HB2  . PHE A 1 29 ? -0.315  -6.299  -2.628  1.00 15.00 ?  325 PHE A HB2  3  
ATOM 2097  H HB3  . PHE A 1 29 ? -0.359  -7.317  -1.183  1.00 15.00 ?  325 PHE A HB3  3  
ATOM 2098  H HD1  . PHE A 1 29 ? -1.702  -5.141  0.589   1.00 15.00 ?  325 PHE A HD1  3  
ATOM 2099  H HD2  . PHE A 1 29 ? -2.564  -6.797  -3.267  1.00 15.00 ?  325 PHE A HD2  3  
ATOM 2100  H HE1  . PHE A 1 29 ? -4.096  -4.599  0.844   1.00 15.00 ?  325 PHE A HE1  3  
ATOM 2101  H HE2  . PHE A 1 29 ? -4.942  -6.253  -2.984  1.00 15.00 ?  325 PHE A HE2  3  
ATOM 2102  H HZ   . PHE A 1 29 ? -5.709  -5.138  -0.928  1.00 15.00 ?  325 PHE A HZ   3  
ATOM 2103  N N    . THR A 1 30 ? 2.619   -5.798  -0.553  1.00 15.00 ?  326 THR A N    3  
ATOM 2104  C CA   . THR A 1 30 ? 3.821   -6.292  0.074   1.00 15.00 ?  326 THR A CA   3  
ATOM 2105  C C    . THR A 1 30 ? 4.158   -5.291  1.159   1.00 15.00 ?  326 THR A C    3  
ATOM 2106  O O    . THR A 1 30 ? 4.871   -4.312  0.926   1.00 15.00 ?  326 THR A O    3  
ATOM 2107  C CB   . THR A 1 30 ? 4.997   -6.405  -0.920  1.00 15.00 ?  326 THR A CB   3  
ATOM 2108  O OG1  . THR A 1 30 ? 4.583   -7.117  -2.091  1.00 15.00 ?  326 THR A OG1  3  
ATOM 2109  C CG2  . THR A 1 30 ? 6.179   -7.119  -0.286  1.00 15.00 ?  326 THR A CG2  3  
ATOM 2110  H H    . THR A 1 30 ? 2.673   -5.160  -1.294  1.00 15.00 ?  326 THR A H    3  
ATOM 2111  H HA   . THR A 1 30 ? 3.619   -7.265  0.501   1.00 15.00 ?  326 THR A HA   3  
ATOM 2112  H HB   . THR A 1 30 ? 5.306   -5.410  -1.204  1.00 15.00 ?  326 THR A HB   3  
ATOM 2113  H HG1  . THR A 1 30 ? 4.062   -6.511  -2.654  1.00 15.00 ?  326 THR A HG1  3  
ATOM 2114  H HG21 . THR A 1 30 ? 6.988   -7.183  -0.999  1.00 15.00 ?  326 THR A HG21 3  
ATOM 2115  H HG22 . THR A 1 30 ? 5.882   -8.114  0.013   1.00 15.00 ?  326 THR A HG22 3  
ATOM 2116  H HG23 . THR A 1 30 ? 6.509   -6.566  0.581   1.00 15.00 ?  326 THR A HG23 3  
ATOM 2117  N N    . ASP A 1 31 ? 3.620   -5.520  2.335   1.00 15.00 ?  327 ASP A N    3  
ATOM 2118  C CA   . ASP A 1 31 ? 3.546   -4.488  3.328   1.00 15.00 ?  327 ASP A CA   3  
ATOM 2119  C C    . ASP A 1 31 ? 4.493   -4.677  4.457   1.00 15.00 ?  327 ASP A C    3  
ATOM 2120  O O    . ASP A 1 31 ? 4.847   -5.788  4.850   1.00 15.00 ?  327 ASP A O    3  
ATOM 2121  C CB   . ASP A 1 31 ? 2.143   -4.321  3.889   1.00 15.00 ?  327 ASP A CB   3  
ATOM 2122  C CG   . ASP A 1 31 ? 1.377   -5.625  4.086   1.00 15.00 ?  327 ASP A CG   3  
ATOM 2123  O OD1  . ASP A 1 31 ? 2.022   -6.682  4.238   1.00 15.00 -1 327 ASP A OD1  3  
ATOM 2124  O OD2  . ASP A 1 31 ? 0.127   -5.589  4.140   1.00 15.00 ?  327 ASP A OD2  3  
ATOM 2125  H H    . ASP A 1 31 ? 3.253   -6.407  2.548   1.00 15.00 ?  327 ASP A H    3  
ATOM 2126  H HA   . ASP A 1 31 ? 3.808   -3.564  2.840   1.00 15.00 ?  327 ASP A HA   3  
ATOM 2127  H HB2  . ASP A 1 31 ? 2.221   -3.839  4.854   1.00 15.00 ?  327 ASP A HB2  3  
ATOM 2128  H HB3  . ASP A 1 31 ? 1.606   -3.672  3.230   1.00 15.00 ?  327 ASP A HB3  3  
ATOM 2129  N N    . PRO A 1 32 ? 4.883   -3.541  5.009   1.00 15.00 ?  328 PRO A N    3  
ATOM 2130  C CA   . PRO A 1 32 ? 5.612   -3.474  6.252   1.00 15.00 ?  328 PRO A CA   3  
ATOM 2131  C C    . PRO A 1 32 ? 4.705   -4.024  7.361   1.00 15.00 ?  328 PRO A C    3  
ATOM 2132  O O    . PRO A 1 32 ? 5.139   -4.308  8.475   1.00 15.00 ?  328 PRO A O    3  
ATOM 2133  C CB   . PRO A 1 32 ? 5.933   -1.973  6.404   1.00 15.00 ?  328 PRO A CB   3  
ATOM 2134  C CG   . PRO A 1 32 ? 5.630   -1.369  5.059   1.00 15.00 ?  328 PRO A CG   3  
ATOM 2135  C CD   . PRO A 1 32 ? 4.550   -2.204  4.494   1.00 15.00 ?  328 PRO A CD   3  
ATOM 2136  H HA   . PRO A 1 32 ? 6.525   -4.055  6.210   1.00 15.00 ?  328 PRO A HA   3  
ATOM 2137  H HB2  . PRO A 1 32 ? 5.310   -1.546  7.177   1.00 15.00 ?  328 PRO A HB2  3  
ATOM 2138  H HB3  . PRO A 1 32 ? 6.974   -1.850  6.664   1.00 15.00 ?  328 PRO A HB3  3  
ATOM 2139  H HG2  . PRO A 1 32 ? 5.307   -0.342  5.174   1.00 15.00 ?  328 PRO A HG2  3  
ATOM 2140  H HG3  . PRO A 1 32 ? 6.479   -1.427  4.404   1.00 15.00 ?  328 PRO A HG3  3  
ATOM 2141  H HD2  . PRO A 1 32 ? 3.588   -1.874  4.856   1.00 15.00 ?  328 PRO A HD2  3  
ATOM 2142  H HD3  . PRO A 1 32 ? 4.581   -2.187  3.415   1.00 15.00 ?  328 PRO A HD3  3  
ATOM 2143  N N    . ARG A 1 33 ? 3.411   -4.131  7.011   1.00 15.00 ?  329 ARG A N    3  
ATOM 2144  C CA   . ARG A 1 33 ? 2.405   -4.795  7.833   1.00 15.00 ?  329 ARG A CA   3  
ATOM 2145  C C    . ARG A 1 33 ? 2.763   -6.260  8.077   1.00 15.00 ?  329 ARG A C    3  
ATOM 2146  O O    . ARG A 1 33 ? 2.573   -6.776  9.179   1.00 15.00 ?  329 ARG A O    3  
ATOM 2147  C CB   . ARG A 1 33 ? 1.011   -4.716  7.172   1.00 15.00 ?  329 ARG A CB   3  
ATOM 2148  C CG   . ARG A 1 33 ? 0.216   -3.488  7.574   1.00 15.00 ?  329 ARG A CG   3  
ATOM 2149  C CD   . ARG A 1 33 ? -0.153  -3.546  9.045   1.00 15.00 ?  329 ARG A CD   3  
ATOM 2150  N NE   . ARG A 1 33 ? -0.648  -4.872  9.420   1.00 15.00 ?  329 ARG A NE   3  
ATOM 2151  C CZ   . ARG A 1 33 ? -1.043  -5.208  10.646  1.00 15.00 ?  329 ARG A CZ   3  
ATOM 2152  N NH1  . ARG A 1 33 ? -1.121  -4.291  11.605  1.00 15.00 1  329 ARG A NH1  3  
ATOM 2153  N NH2  . ARG A 1 33 ? -1.382  -6.464  10.908  1.00 15.00 ?  329 ARG A NH2  3  
ATOM 2154  H H    . ARG A 1 33 ? 3.132   -3.758  6.148   1.00 15.00 ?  329 ARG A H    3  
ATOM 2155  H HA   . ARG A 1 33 ? 2.370   -4.285  8.784   1.00 15.00 ?  329 ARG A HA   3  
ATOM 2156  H HB2  . ARG A 1 33 ? 1.106   -4.719  6.076   1.00 15.00 ?  329 ARG A HB2  3  
ATOM 2157  H HB3  . ARG A 1 33 ? 0.446   -5.589  7.470   1.00 15.00 ?  329 ARG A HB3  3  
ATOM 2158  H HG2  . ARG A 1 33 ? 0.812   -2.606  7.395   1.00 15.00 ?  329 ARG A HG2  3  
ATOM 2159  H HG3  . ARG A 1 33 ? -0.688  -3.443  6.983   1.00 15.00 ?  329 ARG A HG3  3  
ATOM 2160  H HD2  . ARG A 1 33 ? 0.722   -3.316  9.633   1.00 15.00 ?  329 ARG A HD2  3  
ATOM 2161  H HD3  . ARG A 1 33 ? -0.924  -2.814  9.241   1.00 15.00 ?  329 ARG A HD3  3  
ATOM 2162  H HE   . ARG A 1 33 ? -0.652  -5.561  8.719   1.00 15.00 ?  329 ARG A HE   3  
ATOM 2163  H HH11 . ARG A 1 33 ? -0.886  -3.328  11.410  1.00 15.00 ?  329 ARG A HH11 3  
ATOM 2164  H HH12 . ARG A 1 33 ? -1.415  -4.550  12.526  1.00 15.00 ?  329 ARG A HH12 3  
ATOM 2165  H HH21 . ARG A 1 33 ? -1.338  -7.161  10.187  1.00 15.00 ?  329 ARG A HH21 3  
ATOM 2166  H HH22 . ARG A 1 33 ? -1.679  -6.727  11.837  1.00 15.00 ?  329 ARG A HH22 3  
ATOM 2167  N N    . LEU A 1 34 ? 3.270   -6.927  7.045   1.00 15.00 ?  330 LEU A N    3  
ATOM 2168  C CA   . LEU A 1 34 ? 3.604   -8.343  7.133   1.00 15.00 ?  330 LEU A CA   3  
ATOM 2169  C C    . LEU A 1 34 ? 4.878   -8.555  7.947   1.00 15.00 ?  330 LEU A C    3  
ATOM 2170  O O    . LEU A 1 34 ? 5.153   -9.658  8.420   1.00 15.00 ?  330 LEU A O    3  
ATOM 2171  C CB   . LEU A 1 34 ? 3.769   -8.936  5.729   1.00 15.00 ?  330 LEU A CB   3  
ATOM 2172  C CG   . LEU A 1 34 ? 4.006   -10.446 5.668   1.00 15.00 ?  330 LEU A CG   3  
ATOM 2173  C CD1  . LEU A 1 34 ? 2.795   -11.203 6.190   1.00 15.00 ?  330 LEU A CD1  3  
ATOM 2174  C CD2  . LEU A 1 34 ? 4.331   -10.870 4.245   1.00 15.00 ?  330 LEU A CD2  3  
ATOM 2175  H H    . LEU A 1 34 ? 3.416   -6.456  6.191   1.00 15.00 ?  330 LEU A H    3  
ATOM 2176  H HA   . LEU A 1 34 ? 2.787   -8.846  7.631   1.00 15.00 ?  330 LEU A HA   3  
ATOM 2177  H HB2  . LEU A 1 34 ? 2.875   -8.713  5.162   1.00 15.00 ?  330 LEU A HB2  3  
ATOM 2178  H HB3  . LEU A 1 34 ? 4.604   -8.446  5.252   1.00 15.00 ?  330 LEU A HB3  3  
ATOM 2179  H HG   . LEU A 1 34 ? 4.851   -10.697 6.295   1.00 15.00 ?  330 LEU A HG   3  
ATOM 2180  H HD11 . LEU A 1 34 ? 1.931   -10.959 5.589   1.00 15.00 ?  330 LEU A HD11 3  
ATOM 2181  H HD12 . LEU A 1 34 ? 2.610   -10.922 7.217   1.00 15.00 ?  330 LEU A HD12 3  
ATOM 2182  H HD13 . LEU A 1 34 ? 2.983   -12.266 6.137   1.00 15.00 ?  330 LEU A HD13 3  
ATOM 2183  H HD21 . LEU A 1 34 ? 4.493   -11.938 4.216   1.00 15.00 ?  330 LEU A HD21 3  
ATOM 2184  H HD22 . LEU A 1 34 ? 5.225   -10.361 3.914   1.00 15.00 ?  330 LEU A HD22 3  
ATOM 2185  H HD23 . LEU A 1 34 ? 3.508   -10.612 3.597   1.00 15.00 ?  330 LEU A HD23 3  
ATOM 2186  N N    . SER A 1 35 ? 5.654   -7.495  8.106   1.00 15.00 ?  331 SER A N    3  
ATOM 2187  C CA   . SER A 1 35 ? 6.920   -7.576  8.819   1.00 15.00 ?  331 SER A CA   3  
ATOM 2188  C C    . SER A 1 35 ? 6.739   -7.335  10.318  1.00 15.00 ?  331 SER A C    3  
ATOM 2189  O O    . SER A 1 35 ? 7.671   -7.529  11.102  1.00 15.00 ?  331 SER A O    3  
ATOM 2190  C CB   . SER A 1 35 ? 7.916   -6.571  8.239   1.00 15.00 ?  331 SER A CB   3  
ATOM 2191  O OG   . SER A 1 35 ? 8.092   -6.782  6.848   1.00 15.00 ?  331 SER A OG   3  
ATOM 2192  H H    . SER A 1 35 ? 5.376   -6.637  7.726   1.00 15.00 ?  331 SER A H    3  
ATOM 2193  H HA   . SER A 1 35 ? 7.311   -8.572  8.678   1.00 15.00 ?  331 SER A HA   3  
ATOM 2194  H HB2  . SER A 1 35 ? 7.546   -5.569  8.395   1.00 15.00 ?  331 SER A HB2  3  
ATOM 2195  H HB3  . SER A 1 35 ? 8.869   -6.686  8.732   1.00 15.00 ?  331 SER A HB3  3  
ATOM 2196  H HG   . SER A 1 35 ? 8.498   -7.650  6.703   1.00 15.00 ?  331 SER A HG   3  
ATOM 2197  N N    . ALA A 1 36 ? 5.551   -6.897  10.717  1.00 15.00 ?  332 ALA A N    3  
ATOM 2198  C CA   . ALA A 1 36 ? 5.289   -6.620  12.122  1.00 15.00 ?  332 ALA A CA   3  
ATOM 2199  C C    . ALA A 1 36 ? 4.731   -7.857  12.817  1.00 15.00 ?  332 ALA A C    3  
ATOM 2200  O O    . ALA A 1 36 ? 5.430   -8.492  13.611  1.00 15.00 ?  332 ALA A O    3  
ATOM 2201  C CB   . ALA A 1 36 ? 4.330   -5.447  12.263  1.00 15.00 ?  332 ALA A CB   3  
ATOM 2202  H H    . ALA A 1 36 ? 4.836   -6.772  10.059  1.00 15.00 ?  332 ALA A H    3  
ATOM 2203  H HA   . ALA A 1 36 ? 6.226   -6.349  12.589  1.00 15.00 ?  332 ALA A HA   3  
ATOM 2204  H HB1  . ALA A 1 36 ? 4.744   -4.582  11.766  1.00 15.00 ?  332 ALA A HB1  3  
ATOM 2205  H HB2  . ALA A 1 36 ? 4.182   -5.224  13.310  1.00 15.00 ?  332 ALA A HB2  3  
ATOM 2206  H HB3  . ALA A 1 36 ? 3.382   -5.701  11.811  1.00 15.00 ?  332 ALA A HB3  3  
ATOM 2207  N N    . ASN A 1 37 ? 3.489   -8.204  12.475  1.00 15.00 ?  333 ASN A N    3  
ATOM 2208  C CA   . ASN A 1 37 ? 2.796   -9.377  13.021  1.00 15.00 ?  333 ASN A CA   3  
ATOM 2209  C C    . ASN A 1 37 ? 1.310   -9.265  12.724  1.00 15.00 ?  333 ASN A C    3  
ATOM 2210  O O    . ASN A 1 37 ? 0.609   -8.564  13.480  1.00 15.00 ?  333 ASN A O    3  
ATOM 2211  C CB   . ASN A 1 37 ? 2.991   -9.516  14.538  1.00 15.00 ?  333 ASN A CB   3  
ATOM 2212  C CG   . ASN A 1 37 ? 2.467   -10.837 15.071  1.00 15.00 ?  333 ASN A CG   3  
ATOM 2213  O OD1  . ASN A 1 37 ? 1.319   -10.941 15.504  1.00 15.00 ?  333 ASN A OD1  3  
ATOM 2214  N ND2  . ASN A 1 37 ? 3.309   -11.857 15.041  1.00 15.00 ?  333 ASN A ND2  3  
ATOM 2215  O OXT  . ASN A 1 37 ? 0.852   -9.858  11.730  1.00 15.00 ?  333 ASN A OXT  3  
ATOM 2216  H H    . ASN A 1 37 ? 3.013   -7.651  11.821  1.00 15.00 ?  333 ASN A H    3  
ATOM 2217  H HA   . ASN A 1 37 ? 3.187   -10.255 12.529  1.00 15.00 ?  333 ASN A HA   3  
ATOM 2218  H HB2  . ASN A 1 37 ? 4.044   -9.449  14.768  1.00 15.00 ?  333 ASN A HB2  3  
ATOM 2219  H HB3  . ASN A 1 37 ? 2.466   -8.715  15.036  1.00 15.00 ?  333 ASN A HB3  3  
ATOM 2220  H HD21 . ASN A 1 37 ? 4.210   -11.705 14.681  1.00 15.00 ?  333 ASN A HD21 3  
ATOM 2221  H HD22 . ASN A 1 37 ? 3.002   -12.727 15.382  1.00 15.00 ?  333 ASN A HD22 3  
ATOM 2222  N N    . GLU B 2 1  ? 2.753   -7.346  -7.536  1.00 15.00 ?  203 GLU B N    3  
ATOM 2223  C CA   . GLU B 2 1  ? 2.711   -8.026  -6.223  1.00 15.00 ?  203 GLU B CA   3  
ATOM 2224  C C    . GLU B 2 1  ? 2.418   -9.507  -6.409  1.00 15.00 ?  203 GLU B C    3  
ATOM 2225  O O    . GLU B 2 1  ? 1.543   -9.879  -7.189  1.00 15.00 ?  203 GLU B O    3  
ATOM 2226  C CB   . GLU B 2 1  ? 1.636   -7.390  -5.329  1.00 15.00 ?  203 GLU B CB   3  
ATOM 2227  C CG   . GLU B 2 1  ? 1.791   -5.888  -5.177  1.00 15.00 ?  203 GLU B CG   3  
ATOM 2228  C CD   . GLU B 2 1  ? 3.157   -5.508  -4.658  1.00 15.00 ?  203 GLU B CD   3  
ATOM 2229  O OE1  . GLU B 2 1  ? 4.089   -5.392  -5.481  1.00 15.00 -1 203 GLU B OE1  3  
ATOM 2230  O OE2  . GLU B 2 1  ? 3.304   -5.358  -3.432  1.00 15.00 ?  203 GLU B OE2  3  
ATOM 2231  H H1   . GLU B 2 1  ? 3.446   -7.819  -8.159  1.00 15.00 ?  203 GLU B H1   3  
ATOM 2232  H H2   . GLU B 2 1  ? 3.028   -6.351  -7.418  1.00 15.00 ?  203 GLU B H2   3  
ATOM 2233  H H3   . GLU B 2 1  ? 1.816   -7.384  -7.991  1.00 15.00 ?  203 GLU B H3   3  
ATOM 2234  H HA   . GLU B 2 1  ? 3.677   -7.916  -5.752  1.00 15.00 ?  203 GLU B HA   3  
ATOM 2235  H HB2  . GLU B 2 1  ? 0.660   -7.591  -5.742  1.00 15.00 ?  203 GLU B HB2  3  
ATOM 2236  H HB3  . GLU B 2 1  ? 1.698   -7.835  -4.346  1.00 15.00 ?  203 GLU B HB3  3  
ATOM 2237  H HG2  . GLU B 2 1  ? 1.644   -5.422  -6.141  1.00 15.00 ?  203 GLU B HG2  3  
ATOM 2238  H HG3  . GLU B 2 1  ? 1.043   -5.529  -4.484  1.00 15.00 ?  203 GLU B HG3  3  
ATOM 2239  N N    . LEU B 2 2  ? 3.147   -10.343 -5.676  1.00 15.00 ?  204 LEU B N    3  
ATOM 2240  C CA   . LEU B 2 2  ? 2.956   -11.791 -5.732  1.00 15.00 ?  204 LEU B CA   3  
ATOM 2241  C C    . LEU B 2 2  ? 1.627   -12.154 -5.066  1.00 15.00 ?  204 LEU B C    3  
ATOM 2242  O O    . LEU B 2 2  ? 1.065   -13.225 -5.291  1.00 15.00 ?  204 LEU B O    3  
ATOM 2243  C CB   . LEU B 2 2  ? 4.145   -12.496 -5.047  1.00 15.00 ?  204 LEU B CB   3  
ATOM 2244  C CG   . LEU B 2 2  ? 4.333   -13.995 -5.339  1.00 15.00 ?  204 LEU B CG   3  
ATOM 2245  C CD1  . LEU B 2 2  ? 3.434   -14.854 -4.461  1.00 15.00 ?  204 LEU B CD1  3  
ATOM 2246  C CD2  . LEU B 2 2  ? 4.082   -14.292 -6.809  1.00 15.00 ?  204 LEU B CD2  3  
ATOM 2247  H H    . LEU B 2 2  ? 3.838   -9.975  -5.077  1.00 15.00 ?  204 LEU B H    3  
ATOM 2248  H HA   . LEU B 2 2  ? 2.920   -12.081 -6.773  1.00 15.00 ?  204 LEU B HA   3  
ATOM 2249  H HB2  . LEU B 2 2  ? 5.049   -11.986 -5.344  1.00 15.00 ?  204 LEU B HB2  3  
ATOM 2250  H HB3  . LEU B 2 2  ? 4.028   -12.377 -3.979  1.00 15.00 ?  204 LEU B HB3  3  
ATOM 2251  H HG   . LEU B 2 2  ? 5.357   -14.265 -5.120  1.00 15.00 ?  204 LEU B HG   3  
ATOM 2252  H HD11 . LEU B 2 2  ? 2.401   -14.605 -4.653  1.00 15.00 ?  204 LEU B HD11 3  
ATOM 2253  H HD12 . LEU B 2 2  ? 3.661   -14.668 -3.422  1.00 15.00 ?  204 LEU B HD12 3  
ATOM 2254  H HD13 . LEU B 2 2  ? 3.602   -15.897 -4.685  1.00 15.00 ?  204 LEU B HD13 3  
ATOM 2255  H HD21 . LEU B 2 2  ? 3.073   -14.006 -7.066  1.00 15.00 ?  204 LEU B HD21 3  
ATOM 2256  H HD22 . LEU B 2 2  ? 4.212   -15.349 -6.992  1.00 15.00 ?  204 LEU B HD22 3  
ATOM 2257  H HD23 . LEU B 2 2  ? 4.781   -13.735 -7.413  1.00 15.00 ?  204 LEU B HD23 3  
ATOM 2258  N N    . GLU B 2 3  ? 1.140   -11.240 -4.245  1.00 15.00 ?  205 GLU B N    3  
ATOM 2259  C CA   . GLU B 2 3  ? -0.140  -11.400 -3.577  1.00 15.00 ?  205 GLU B CA   3  
ATOM 2260  C C    . GLU B 2 3  ? -1.277  -11.055 -4.547  1.00 15.00 ?  205 GLU B C    3  
ATOM 2261  O O    . GLU B 2 3  ? -1.026  -10.538 -5.636  1.00 15.00 ?  205 GLU B O    3  
ATOM 2262  C CB   . GLU B 2 3  ? -0.174  -10.495 -2.335  1.00 15.00 ?  205 GLU B CB   3  
ATOM 2263  C CG   . GLU B 2 3  ? -1.389  -10.691 -1.441  1.00 15.00 ?  205 GLU B CG   3  
ATOM 2264  C CD   . GLU B 2 3  ? -1.586  -12.135 -1.025  1.00 15.00 ?  205 GLU B CD   3  
ATOM 2265  O OE1  . GLU B 2 3  ? -2.082  -12.931 -1.853  1.00 15.00 ?  205 GLU B OE1  3  
ATOM 2266  O OE2  . GLU B 2 3  ? -1.255  -12.476 0.126   1.00 15.00 -1 205 GLU B OE2  3  
ATOM 2267  H H    . GLU B 2 3  ? 1.658   -10.427 -4.083  1.00 15.00 ?  205 GLU B H    3  
ATOM 2268  H HA   . GLU B 2 3  ? -0.234  -12.433 -3.272  1.00 15.00 ?  205 GLU B HA   3  
ATOM 2269  H HB2  . GLU B 2 3  ? 0.710   -10.685 -1.743  1.00 15.00 ?  205 GLU B HB2  3  
ATOM 2270  H HB3  . GLU B 2 3  ? -0.158  -9.466  -2.660  1.00 15.00 ?  205 GLU B HB3  3  
ATOM 2271  H HG2  . GLU B 2 3  ? -1.262  -10.093 -0.553  1.00 15.00 ?  205 GLU B HG2  3  
ATOM 2272  H HG3  . GLU B 2 3  ? -2.270  -10.360 -1.974  1.00 15.00 ?  205 GLU B HG3  3  
ATOM 2273  N N    . SER B 2 4  ? -2.513  -11.349 -4.147  1.00 15.00 ?  206 SER B N    3  
ATOM 2274  C CA   . SER B 2 4  ? -3.696  -11.027 -4.943  1.00 15.00 ?  206 SER B CA   3  
ATOM 2275  C C    . SER B 2 4  ? -3.689  -9.587  -5.422  1.00 15.00 ?  206 SER B C    3  
ATOM 2276  O O    . SER B 2 4  ? -3.198  -8.674  -4.752  1.00 15.00 ?  206 SER B O    3  
ATOM 2277  C CB   . SER B 2 4  ? -4.950  -11.309 -4.138  1.00 15.00 ?  206 SER B CB   3  
ATOM 2278  O OG   . SER B 2 4  ? -4.776  -10.968 -2.773  1.00 15.00 ?  206 SER B OG   3  
ATOM 2279  H H    . SER B 2 4  ? -2.636  -11.807 -3.282  1.00 15.00 ?  206 SER B H    3  
ATOM 2280  H HA   . SER B 2 4  ? -3.721  -11.659 -5.822  1.00 15.00 ?  206 SER B HA   3  
ATOM 2281  H HB2  . SER B 2 4  ? -5.763  -10.728 -4.547  1.00 15.00 ?  206 SER B HB2  3  
ATOM 2282  H HB3  . SER B 2 4  ? -5.184  -12.356 -4.223  1.00 15.00 ?  206 SER B HB3  3  
ATOM 2283  H HG   . SER B 2 4  ? -4.199  -10.201 -2.711  1.00 15.00 ?  206 SER B HG   3  
ATOM 2284  N N    . PRO B 2 5  ? -4.281  -9.418  -6.595  1.00 15.00 ?  207 PRO B N    3  
ATOM 2285  C CA   . PRO B 2 5  ? -4.303  -8.162  -7.343  1.00 15.00 ?  207 PRO B CA   3  
ATOM 2286  C C    . PRO B 2 5  ? -4.705  -6.968  -6.479  1.00 15.00 ?  207 PRO B C    3  
ATOM 2287  O O    . PRO B 2 5  ? -5.805  -6.931  -5.917  1.00 15.00 ?  207 PRO B O    3  
ATOM 2288  C CB   . PRO B 2 5  ? -5.371  -8.409  -8.413  1.00 15.00 ?  207 PRO B CB   3  
ATOM 2289  C CG   . PRO B 2 5  ? -5.483  -9.895  -8.556  1.00 15.00 ?  207 PRO B CG   3  
ATOM 2290  C CD   . PRO B 2 5  ? -4.943  -10.515 -7.291  1.00 15.00 ?  207 PRO B CD   3  
ATOM 2291  H HA   . PRO B 2 5  ? -3.358  -7.964  -7.819  1.00 15.00 ?  207 PRO B HA   3  
ATOM 2292  H HB2  . PRO B 2 5  ? -6.309  -7.976  -8.091  1.00 15.00 ?  207 PRO B HB2  3  
ATOM 2293  H HB3  . PRO B 2 5  ? -5.062  -7.949  -9.339  1.00 15.00 ?  207 PRO B HB3  3  
ATOM 2294  H HG2  . PRO B 2 5  ? -6.519  -10.170 -8.688  1.00 15.00 ?  207 PRO B HG2  3  
ATOM 2295  H HG3  . PRO B 2 5  ? -4.902  -10.223 -9.406  1.00 15.00 ?  207 PRO B HG3  3  
ATOM 2296  H HD2  . PRO B 2 5  ? -5.723  -10.918 -6.676  1.00 15.00 ?  207 PRO B HD2  3  
ATOM 2297  H HD3  . PRO B 2 5  ? -4.238  -11.294 -7.509  1.00 15.00 ?  207 PRO B HD3  3  
ATOM 2298  N N    . PRO B 2 6  ? -3.803  -5.976  -6.366  1.00 15.00 ?  208 PRO B N    3  
ATOM 2299  C CA   . PRO B 2 6  ? -4.003  -4.801  -5.532  1.00 15.00 ?  208 PRO B CA   3  
ATOM 2300  C C    . PRO B 2 6  ? -4.573  -3.594  -6.283  1.00 15.00 ?  208 PRO B C    3  
ATOM 2301  O O    . PRO B 2 6  ? -4.609  -3.569  -7.516  1.00 15.00 ?  208 PRO B O    3  
ATOM 2302  C CB   . PRO B 2 6  ? -2.581  -4.508  -5.042  1.00 15.00 ?  208 PRO B CB   3  
ATOM 2303  C CG   . PRO B 2 6  ? -1.654  -5.089  -6.070  1.00 15.00 ?  208 PRO B CG   3  
ATOM 2304  C CD   . PRO B 2 6  ? -2.478  -5.943  -7.004  1.00 15.00 ?  208 PRO B CD   3  
ATOM 2305  H HA   . PRO B 2 6  ? -4.634  -5.021  -4.685  1.00 15.00 ?  208 PRO B HA   3  
ATOM 2306  H HB2  . PRO B 2 6  ? -2.446  -3.438  -4.956  1.00 15.00 ?  208 PRO B HB2  3  
ATOM 2307  H HB3  . PRO B 2 6  ? -2.437  -4.971  -4.070  1.00 15.00 ?  208 PRO B HB3  3  
ATOM 2308  H HG2  . PRO B 2 6  ? -1.181  -4.290  -6.623  1.00 15.00 ?  208 PRO B HG2  3  
ATOM 2309  H HG3  . PRO B 2 6  ? -0.904  -5.692  -5.580  1.00 15.00 ?  208 PRO B HG3  3  
ATOM 2310  H HD2  . PRO B 2 6  ? -2.531  -5.490  -7.984  1.00 15.00 ?  208 PRO B HD2  3  
ATOM 2311  H HD3  . PRO B 2 6  ? -2.053  -6.933  -7.067  1.00 15.00 ?  208 PRO B HD3  3  
ATOM 2312  N N    . PRO B 2 7  ? -5.017  -2.579  -5.520  1.00 15.00 ?  209 PRO B N    3  
ATOM 2313  C CA   . PRO B 2 7  ? -5.562  -1.316  -6.052  1.00 15.00 ?  209 PRO B CA   3  
ATOM 2314  C C    . PRO B 2 7  ? -4.675  -0.667  -7.118  1.00 15.00 ?  209 PRO B C    3  
ATOM 2315  O O    . PRO B 2 7  ? -3.481  -0.473  -6.899  1.00 15.00 ?  209 PRO B O    3  
ATOM 2316  C CB   . PRO B 2 7  ? -5.600  -0.414  -4.814  1.00 15.00 ?  209 PRO B CB   3  
ATOM 2317  C CG   . PRO B 2 7  ? -5.736  -1.340  -3.662  1.00 15.00 ?  209 PRO B CG   3  
ATOM 2318  C CD   . PRO B 2 7  ? -5.029  -2.602  -4.043  1.00 15.00 ?  209 PRO B CD   3  
ATOM 2319  H HA   . PRO B 2 7  ? -6.563  -1.444  -6.438  1.00 15.00 ?  209 PRO B HA   3  
ATOM 2320  H HB2  . PRO B 2 7  ? -4.683  0.153   -4.754  1.00 15.00 ?  209 PRO B HB2  3  
ATOM 2321  H HB3  . PRO B 2 7  ? -6.435  0.259   -4.872  1.00 15.00 ?  209 PRO B HB3  3  
ATOM 2322  H HG2  . PRO B 2 7  ? -5.266  -0.905  -2.792  1.00 15.00 ?  209 PRO B HG2  3  
ATOM 2323  H HG3  . PRO B 2 7  ? -6.780  -1.537  -3.468  1.00 15.00 ?  209 PRO B HG3  3  
ATOM 2324  H HD2  . PRO B 2 7  ? -4.021  -2.600  -3.652  1.00 15.00 ?  209 PRO B HD2  3  
ATOM 2325  H HD3  . PRO B 2 7  ? -5.573  -3.461  -3.678  1.00 15.00 ?  209 PRO B HD3  3  
ATOM 2326  N N    . PRO B 2 8  ? -5.250  -0.324  -8.287  1.00 15.00 ?  210 PRO B N    3  
ATOM 2327  C CA   . PRO B 2 8  ? -4.547  0.450   -9.324  1.00 15.00 ?  210 PRO B CA   3  
ATOM 2328  C C    . PRO B 2 8  ? -4.010  1.761   -8.756  1.00 15.00 ?  210 PRO B C    3  
ATOM 2329  O O    . PRO B 2 8  ? -4.683  2.410   -7.952  1.00 15.00 ?  210 PRO B O    3  
ATOM 2330  C CB   . PRO B 2 8  ? -5.638  0.717   -10.365 1.00 15.00 ?  210 PRO B CB   3  
ATOM 2331  C CG   . PRO B 2 8  ? -6.623  -0.382  -10.166 1.00 15.00 ?  210 PRO B CG   3  
ATOM 2332  C CD   . PRO B 2 8  ? -6.621  -0.669  -8.694  1.00 15.00 ?  210 PRO B CD   3  
ATOM 2333  H HA   . PRO B 2 8  ? -3.740  -0.113  -9.769  1.00 15.00 ?  210 PRO B HA   3  
ATOM 2334  H HB2  . PRO B 2 8  ? -6.082  1.685   -10.185 1.00 15.00 ?  210 PRO B HB2  3  
ATOM 2335  H HB3  . PRO B 2 8  ? -5.210  0.687   -11.355 1.00 15.00 ?  210 PRO B HB3  3  
ATOM 2336  H HG2  . PRO B 2 8  ? -7.602  -0.059  -10.485 1.00 15.00 ?  210 PRO B HG2  3  
ATOM 2337  H HG3  . PRO B 2 8  ? -6.316  -1.256  -10.719 1.00 15.00 ?  210 PRO B HG3  3  
ATOM 2338  H HD2  . PRO B 2 8  ? -7.342  -0.044  -8.187  1.00 15.00 ?  210 PRO B HD2  3  
ATOM 2339  H HD3  . PRO B 2 8  ? -6.828  -1.712  -8.511  1.00 15.00 ?  210 PRO B HD3  3  
ATOM 2340  N N    . TYR B 2 9  ? -2.816  2.161   -9.187  1.00 15.00 ?  211 TYR B N    3  
ATOM 2341  C CA   . TYR B 2 9  ? -2.113  3.254   -8.528  1.00 15.00 ?  211 TYR B CA   3  
ATOM 2342  C C    . TYR B 2 9  ? -2.731  4.620   -8.811  1.00 15.00 ?  211 TYR B C    3  
ATOM 2343  O O    . TYR B 2 9  ? -2.491  5.239   -9.850  1.00 15.00 ?  211 TYR B O    3  
ATOM 2344  C CB   . TYR B 2 9  ? -0.630  3.282   -8.894  1.00 15.00 ?  211 TYR B CB   3  
ATOM 2345  C CG   . TYR B 2 9  ? 0.181   4.196   -8.000  1.00 15.00 ?  211 TYR B CG   3  
ATOM 2346  C CD1  . TYR B 2 9  ? 0.628   3.755   -6.763  1.00 15.00 ?  211 TYR B CD1  3  
ATOM 2347  C CD2  . TYR B 2 9  ? 0.510   5.493   -8.386  1.00 15.00 ?  211 TYR B CD2  3  
ATOM 2348  C CE1  . TYR B 2 9  ? 1.377   4.566   -5.945  1.00 15.00 ?  211 TYR B CE1  3  
ATOM 2349  C CE2  . TYR B 2 9  ? 1.258   6.314   -7.557  1.00 15.00 ?  211 TYR B CE2  3  
ATOM 2350  C CZ   . TYR B 2 9  ? 1.687   5.839   -6.343  1.00 15.00 ?  211 TYR B CZ   3  
ATOM 2351  O OH   . TYR B 2 9  ? 2.448   6.632   -5.524  1.00 15.00 ?  211 TYR B OH   3  
ATOM 2352  H H    . TYR B 2 9  ? -2.405  1.715   -9.960  1.00 15.00 ?  211 TYR B H    3  
ATOM 2353  H HA   . TYR B 2 9  ? -2.188  3.076   -7.463  1.00 15.00 ?  211 TYR B HA   3  
ATOM 2354  H HB2  . TYR B 2 9  ? -0.226  2.284   -8.807  1.00 15.00 ?  211 TYR B HB2  3  
ATOM 2355  H HB3  . TYR B 2 9  ? -0.521  3.625   -9.912  1.00 15.00 ?  211 TYR B HB3  3  
ATOM 2356  H HD1  . TYR B 2 9  ? 0.379   2.759   -6.436  1.00 15.00 ?  211 TYR B HD1  3  
ATOM 2357  H HD2  . TYR B 2 9  ? 0.170   5.860   -9.344  1.00 15.00 ?  211 TYR B HD2  3  
ATOM 2358  H HE1  . TYR B 2 9  ? 1.714   4.199   -4.986  1.00 15.00 ?  211 TYR B HE1  3  
ATOM 2359  H HE2  . TYR B 2 9  ? 1.504   7.319   -7.859  1.00 15.00 ?  211 TYR B HE2  3  
ATOM 2360  H HH   . TYR B 2 9  ? 3.239   6.139   -5.262  1.00 15.00 ?  211 TYR B HH   3  
ATOM 2361  N N    . SER B 2 10 ? -3.565  5.034   -7.892  1.00 15.00 ?  212 SER B N    3  
ATOM 2362  C CA   . SER B 2 10 ? -3.938  6.418   -7.721  1.00 15.00 ?  212 SER B CA   3  
ATOM 2363  C C    . SER B 2 10 ? -3.172  6.903   -6.501  1.00 15.00 ?  212 SER B C    3  
ATOM 2364  O O    . SER B 2 10 ? -2.868  6.086   -5.631  1.00 15.00 ?  212 SER B O    3  
ATOM 2365  C CB   . SER B 2 10 ? -5.451  6.548   -7.538  1.00 15.00 ?  212 SER B CB   3  
ATOM 2366  O OG   . SER B 2 10 ? -5.930  5.629   -6.574  1.00 15.00 ?  212 SER B OG   3  
ATOM 2367  H H    . SER B 2 10 ? -3.960  4.370   -7.285  1.00 15.00 ?  212 SER B H    3  
ATOM 2368  H HA   . SER B 2 10 ? -3.618  6.970   -8.595  1.00 15.00 ?  212 SER B HA   3  
ATOM 2369  H HB2  . SER B 2 10 ? -5.686  7.548   -7.207  1.00 15.00 ?  212 SER B HB2  3  
ATOM 2370  H HB3  . SER B 2 10 ? -5.945  6.354   -8.478  1.00 15.00 ?  212 SER B HB3  3  
ATOM 2371  H HG   . SER B 2 10 ? -6.636  5.091   -6.963  1.00 15.00 ?  212 SER B HG   3  
ATOM 2372  N N    . ARG B 2 11 ? -2.824  8.188   -6.420  1.00 15.00 ?  213 ARG B N    3  
ATOM 2373  C CA   . ARG B 2 11 ? -1.927  8.634   -5.353  1.00 15.00 ?  213 ARG B CA   3  
ATOM 2374  C C    . ARG B 2 11 ? -2.566  8.311   -4.012  1.00 15.00 ?  213 ARG B C    3  
ATOM 2375  O O    . ARG B 2 11 ? -1.918  7.784   -3.110  1.00 15.00 ?  213 ARG B O    3  
ATOM 2376  C CB   . ARG B 2 11 ? -1.666  10.152  -5.398  1.00 15.00 ?  213 ARG B CB   3  
ATOM 2377  C CG   . ARG B 2 11 ? -1.571  10.763  -6.784  1.00 15.00 ?  213 ARG B CG   3  
ATOM 2378  C CD   . ARG B 2 11 ? -0.385  10.224  -7.571  1.00 15.00 ?  213 ARG B CD   3  
ATOM 2379  N NE   . ARG B 2 11 ? 0.883   10.672  -6.997  1.00 15.00 ?  213 ARG B NE   3  
ATOM 2380  C CZ   . ARG B 2 11 ? 2.040   10.720  -7.655  1.00 15.00 ?  213 ARG B CZ   3  
ATOM 2381  N NH1  . ARG B 2 11 ? 2.116   10.350  -8.930  1.00 15.00 1  213 ARG B NH1  3  
ATOM 2382  N NH2  . ARG B 2 11 ? 3.121   11.174  -7.033  1.00 15.00 ?  213 ARG B NH2  3  
ATOM 2383  H H    . ARG B 2 11 ? -3.184  8.832   -7.064  1.00 15.00 ?  213 ARG B H    3  
ATOM 2384  H HA   . ARG B 2 11 ? -0.993  8.101   -5.446  1.00 15.00 ?  213 ARG B HA   3  
ATOM 2385  H HB2  . ARG B 2 11 ? -2.465  10.652  -4.874  1.00 15.00 ?  213 ARG B HB2  3  
ATOM 2386  H HB3  . ARG B 2 11 ? -0.738  10.354  -4.880  1.00 15.00 ?  213 ARG B HB3  3  
ATOM 2387  H HG2  . ARG B 2 11 ? -2.479  10.556  -7.313  1.00 15.00 ?  213 ARG B HG2  3  
ATOM 2388  H HG3  . ARG B 2 11 ? -1.458  11.832  -6.679  1.00 15.00 ?  213 ARG B HG3  3  
ATOM 2389  H HD2  . ARG B 2 11 ? -0.417  9.146   -7.558  1.00 15.00 ?  213 ARG B HD2  3  
ATOM 2390  H HD3  . ARG B 2 11 ? -0.452  10.576  -8.590  1.00 15.00 ?  213 ARG B HD3  3  
ATOM 2391  H HE   . ARG B 2 11 ? 0.867   10.976  -6.058  1.00 15.00 ?  213 ARG B HE   3  
ATOM 2392  H HH11 . ARG B 2 11 ? 1.293   10.025  -9.419  1.00 15.00 ?  213 ARG B HH11 3  
ATOM 2393  H HH12 . ARG B 2 11 ? 2.996   10.408  -9.421  1.00 15.00 ?  213 ARG B HH12 3  
ATOM 2394  H HH21 . ARG B 2 11 ? 3.061   11.480  -6.079  1.00 15.00 ?  213 ARG B HH21 3  
ATOM 2395  H HH22 . ARG B 2 11 ? 4.009   11.218  -7.514  1.00 15.00 ?  213 ARG B HH22 3  
ATOM 2396  N N    . TYR B 2 12 ? -3.832  8.666   -3.886  1.00 15.00 ?  214 TYR B N    3  
ATOM 2397  C CA   . TYR B 2 12 ? -4.627  8.304   -2.728  1.00 15.00 ?  214 TYR B CA   3  
ATOM 2398  C C    . TYR B 2 12 ? -5.817  7.485   -3.189  1.00 15.00 ?  214 TYR B C    3  
ATOM 2399  O O    . TYR B 2 12 ? -6.831  8.035   -3.627  1.00 15.00 ?  214 TYR B O    3  
ATOM 2400  C CB   . TYR B 2 12 ? -5.083  9.562   -1.971  1.00 15.00 ?  214 TYR B CB   3  
ATOM 2401  C CG   . TYR B 2 12 ? -3.990  10.600  -1.849  1.00 15.00 ?  214 TYR B CG   3  
ATOM 2402  C CD1  . TYR B 2 12 ? -3.612  11.357  -2.953  1.00 15.00 ?  214 TYR B CD1  3  
ATOM 2403  C CD2  . TYR B 2 12 ? -3.314  10.802  -0.654  1.00 15.00 ?  214 TYR B CD2  3  
ATOM 2404  C CE1  . TYR B 2 12 ? -2.594  12.277  -2.878  1.00 15.00 ?  214 TYR B CE1  3  
ATOM 2405  C CE2  . TYR B 2 12 ? -2.296  11.732  -0.563  1.00 15.00 ?  214 TYR B CE2  3  
ATOM 2406  C CZ   . TYR B 2 12 ? -1.936  12.465  -1.677  1.00 15.00 ?  214 TYR B CZ   3  
ATOM 2407  O OH   . TYR B 2 12 ? -0.913  13.380  -1.588  1.00 15.00 ?  214 TYR B OH   3  
ATOM 2408  H H    . TYR B 2 12 ? -4.257  9.176   -4.611  1.00 15.00 ?  214 TYR B H    3  
ATOM 2409  H HA   . TYR B 2 12 ? -4.018  7.679   -2.079  1.00 15.00 ?  214 TYR B HA   3  
ATOM 2410  H HB2  . TYR B 2 12 ? -5.915  10.011  -2.492  1.00 15.00 ?  214 TYR B HB2  3  
ATOM 2411  H HB3  . TYR B 2 12 ? -5.393  9.283   -0.973  1.00 15.00 ?  214 TYR B HB3  3  
ATOM 2412  H HD1  . TYR B 2 12 ? -4.131  11.209  -3.889  1.00 15.00 ?  214 TYR B HD1  3  
ATOM 2413  H HD2  . TYR B 2 12 ? -3.597  10.226  0.213   1.00 15.00 ?  214 TYR B HD2  3  
ATOM 2414  H HE1  . TYR B 2 12 ? -2.317  12.842  -3.762  1.00 15.00 ?  214 TYR B HE1  3  
ATOM 2415  H HE2  . TYR B 2 12 ? -1.782  11.878  0.376   1.00 15.00 ?  214 TYR B HE2  3  
ATOM 2416  H HH   . TYR B 2 12 ? -0.247  13.052  -0.973  1.00 15.00 ?  214 TYR B HH   3  
ATOM 2417  N N    . PRO B 2 13 ? -5.683  6.164   -3.160  1.00 15.00 ?  215 PRO B N    3  
ATOM 2418  C CA   . PRO B 2 13 ? -6.720  5.259   -3.620  1.00 15.00 ?  215 PRO B CA   3  
ATOM 2419  C C    . PRO B 2 13 ? -7.816  5.098   -2.581  1.00 15.00 ?  215 PRO B C    3  
ATOM 2420  O O    . PRO B 2 13 ? -7.556  4.704   -1.452  1.00 15.00 ?  215 PRO B O    3  
ATOM 2421  C CB   . PRO B 2 13 ? -5.982  3.930   -3.852  1.00 15.00 ?  215 PRO B CB   3  
ATOM 2422  C CG   . PRO B 2 13 ? -4.561  4.143   -3.412  1.00 15.00 ?  215 PRO B CG   3  
ATOM 2423  C CD   . PRO B 2 13 ? -4.514  5.441   -2.661  1.00 15.00 ?  215 PRO B CD   3  
ATOM 2424  H HA   . PRO B 2 13 ? -7.155  5.599   -4.549  1.00 15.00 ?  215 PRO B HA   3  
ATOM 2425  H HB2  . PRO B 2 13 ? -6.457  3.154   -3.270  1.00 15.00 ?  215 PRO B HB2  3  
ATOM 2426  H HB3  . PRO B 2 13 ? -6.031  3.672   -4.900  1.00 15.00 ?  215 PRO B HB3  3  
ATOM 2427  H HG2  . PRO B 2 13 ? -4.259  3.336   -2.762  1.00 15.00 ?  215 PRO B HG2  3  
ATOM 2428  H HG3  . PRO B 2 13 ? -3.908  4.188   -4.271  1.00 15.00 ?  215 PRO B HG3  3  
ATOM 2429  H HD2  . PRO B 2 13 ? -4.595  5.264   -1.600  1.00 15.00 ?  215 PRO B HD2  3  
ATOM 2430  H HD3  . PRO B 2 13 ? -3.604  5.975   -2.889  1.00 15.00 ?  215 PRO B HD3  3  
ATOM 2431  N N    . MET B 2 14 ? -9.039  5.431   -2.949  1.00 15.00 ?  216 MET B N    3  
ATOM 2432  C CA   . MET B 2 14 ? -10.149 5.290   -2.025  1.00 15.00 ?  216 MET B CA   3  
ATOM 2433  C C    . MET B 2 14 ? -10.588 3.837   -1.961  1.00 15.00 ?  216 MET B C    3  
ATOM 2434  O O    . MET B 2 14 ? -11.078 3.276   -2.947  1.00 15.00 ?  216 MET B O    3  
ATOM 2435  C CB   . MET B 2 14 ? -11.312 6.197   -2.418  1.00 15.00 ?  216 MET B CB   3  
ATOM 2436  C CG   . MET B 2 14 ? -10.983 7.677   -2.293  1.00 15.00 ?  216 MET B CG   3  
ATOM 2437  S SD   . MET B 2 14 ? -12.427 8.732   -2.504  1.00 15.00 ?  216 MET B SD   3  
ATOM 2438  C CE   . MET B 2 14 ? -13.457 8.175   -1.146  1.00 15.00 ?  216 MET B CE   3  
ATOM 2439  H H    . MET B 2 14 ? -9.198  5.765   -3.855  1.00 15.00 ?  216 MET B H    3  
ATOM 2440  H HA   . MET B 2 14 ? -9.794  5.582   -1.047  1.00 15.00 ?  216 MET B HA   3  
ATOM 2441  H HB2  . MET B 2 14 ? -11.585 5.996   -3.444  1.00 15.00 ?  216 MET B HB2  3  
ATOM 2442  H HB3  . MET B 2 14 ? -12.155 5.982   -1.780  1.00 15.00 ?  216 MET B HB3  3  
ATOM 2443  H HG2  . MET B 2 14 ? -10.566 7.855   -1.313  1.00 15.00 ?  216 MET B HG2  3  
ATOM 2444  H HG3  . MET B 2 14 ? -10.253 7.933   -3.045  1.00 15.00 ?  216 MET B HG3  3  
ATOM 2445  H HE1  . MET B 2 14 ? -13.672 7.124   -1.267  1.00 15.00 ?  216 MET B HE1  3  
ATOM 2446  H HE2  . MET B 2 14 ? -14.381 8.734   -1.141  1.00 15.00 ?  216 MET B HE2  3  
ATOM 2447  H HE3  . MET B 2 14 ? -12.938 8.332   -0.213  1.00 15.00 ?  216 MET B HE3  3  
ATOM 2448  N N    . ASP B 2 15 ? -10.367 3.233   -0.807  1.00 15.00 ?  217 ASP B N    3  
ATOM 2449  C CA   . ASP B 2 15 ? -10.665 1.826   -0.590  1.00 15.00 ?  217 ASP B CA   3  
ATOM 2450  C C    . ASP B 2 15 ? -12.162 1.624   -0.404  1.00 15.00 ?  217 ASP B C    3  
ATOM 2451  O O    . ASP B 2 15 ? -12.809 1.059   -1.316  1.00 15.00 ?  217 ASP B O    3  
ATOM 2452  C CB   . ASP B 2 15 ? -9.901  1.289   0.633   1.00 15.00 ?  217 ASP B CB   3  
ATOM 2453  C CG   . ASP B 2 15 ? -9.054  2.346   1.326   1.00 15.00 ?  217 ASP B CG   3  
ATOM 2454  O OD1  . ASP B 2 15 ? -9.611  3.137   2.125   1.00 15.00 ?  217 ASP B OD1  3  
ATOM 2455  O OD2  . ASP B 2 15 ? -7.830  2.400   1.075   1.00 15.00 -1 217 ASP B OD2  3  
ATOM 2456  O OXT  . ASP B 2 15 ? -12.692 2.042   0.641   1.00 15.00 ?  217 ASP B OXT  3  
ATOM 2457  H H    . ASP B 2 15 ? -9.994  3.755   -0.065  1.00 15.00 ?  217 ASP B H    3  
ATOM 2458  H HA   . ASP B 2 15 ? -10.348 1.283   -1.469  1.00 15.00 ?  217 ASP B HA   3  
ATOM 2459  H HB2  . ASP B 2 15 ? -10.610 0.902   1.348   1.00 15.00 ?  217 ASP B HB2  3  
ATOM 2460  H HB3  . ASP B 2 15 ? -9.249  0.487   0.313   1.00 15.00 ?  217 ASP B HB3  3  
ATOM 2461  N N    . GLY A 1 1  ? 4.796   2.755   14.639  1.00 15.00 ?  297 GLY A N    4  
ATOM 2462  C CA   . GLY A 1 1  ? 6.005   2.750   13.783  1.00 15.00 ?  297 GLY A CA   4  
ATOM 2463  C C    . GLY A 1 1  ? 6.127   4.027   12.981  1.00 15.00 ?  297 GLY A C    4  
ATOM 2464  O O    . GLY A 1 1  ? 5.120   4.560   12.517  1.00 15.00 ?  297 GLY A O    4  
ATOM 2465  H H1   . GLY A 1 1  ? 4.880   3.491   15.371  1.00 15.00 ?  297 GLY A H1   4  
ATOM 2466  H H2   . GLY A 1 1  ? 4.678   1.827   15.099  1.00 15.00 ?  297 GLY A H2   4  
ATOM 2467  H H3   . GLY A 1 1  ? 3.950   2.954   14.059  1.00 15.00 ?  297 GLY A H3   4  
ATOM 2468  H HA2  . GLY A 1 1  ? 6.880   2.642   14.406  1.00 15.00 ?  297 GLY A HA2  4  
ATOM 2469  H HA3  . GLY A 1 1  ? 5.951   1.911   13.103  1.00 15.00 ?  297 GLY A HA3  4  
ATOM 2470  N N    . PRO A 1 2  ? 7.345   4.557   12.814  1.00 15.00 ?  298 PRO A N    4  
ATOM 2471  C CA   . PRO A 1 2  ? 7.570   5.768   12.024  1.00 15.00 ?  298 PRO A CA   4  
ATOM 2472  C C    . PRO A 1 2  ? 7.341   5.530   10.524  1.00 15.00 ?  298 PRO A C    4  
ATOM 2473  O O    . PRO A 1 2  ? 8.122   4.825   9.875   1.00 15.00 ?  298 PRO A O    4  
ATOM 2474  C CB   . PRO A 1 2  ? 9.037   6.114   12.299  1.00 15.00 ?  298 PRO A CB   4  
ATOM 2475  C CG   . PRO A 1 2  ? 9.668   4.826   12.702  1.00 15.00 ?  298 PRO A CG   4  
ATOM 2476  C CD   . PRO A 1 2  ? 8.595   4.027   13.389  1.00 15.00 ?  298 PRO A CD   4  
ATOM 2477  H HA   . PRO A 1 2  ? 6.944   6.579   12.367  1.00 15.00 ?  298 PRO A HA   4  
ATOM 2478  H HB2  . PRO A 1 2  ? 9.487   6.512   11.402  1.00 15.00 ?  298 PRO A HB2  4  
ATOM 2479  H HB3  . PRO A 1 2  ? 9.095   6.845   13.092  1.00 15.00 ?  298 PRO A HB3  4  
ATOM 2480  H HG2  . PRO A 1 2  ? 10.021  4.301   11.826  1.00 15.00 ?  298 PRO A HG2  4  
ATOM 2481  H HG3  . PRO A 1 2  ? 10.487  5.016   13.381  1.00 15.00 ?  298 PRO A HG3  4  
ATOM 2482  H HD2  . PRO A 1 2  ? 8.707   2.975   13.164  1.00 15.00 ?  298 PRO A HD2  4  
ATOM 2483  H HD3  . PRO A 1 2  ? 8.628   4.190   14.456  1.00 15.00 ?  298 PRO A HD3  4  
ATOM 2484  N N    . LEU A 1 3  ? 6.245   6.069   9.985   1.00 15.00 ?  299 LEU A N    4  
ATOM 2485  C CA   . LEU A 1 3  ? 5.961   5.965   8.559   1.00 15.00 ?  299 LEU A CA   4  
ATOM 2486  C C    . LEU A 1 3  ? 6.886   6.892   7.778   1.00 15.00 ?  299 LEU A C    4  
ATOM 2487  O O    . LEU A 1 3  ? 6.997   8.076   8.101   1.00 15.00 ?  299 LEU A O    4  
ATOM 2488  C CB   . LEU A 1 3  ? 4.502   6.341   8.277   1.00 15.00 ?  299 LEU A CB   4  
ATOM 2489  C CG   . LEU A 1 3  ? 4.051   6.168   6.826   1.00 15.00 ?  299 LEU A CG   4  
ATOM 2490  C CD1  . LEU A 1 3  ? 3.910   4.695   6.476   1.00 15.00 ?  299 LEU A CD1  4  
ATOM 2491  C CD2  . LEU A 1 3  ? 2.746   6.905   6.586   1.00 15.00 ?  299 LEU A CD2  4  
ATOM 2492  H H    . LEU A 1 3  ? 5.605   6.537   10.558  1.00 15.00 ?  299 LEU A H    4  
ATOM 2493  H HA   . LEU A 1 3  ? 6.134   4.945   8.251   1.00 15.00 ?  299 LEU A HA   4  
ATOM 2494  H HB2  . LEU A 1 3  ? 3.866   5.733   8.904   1.00 15.00 ?  299 LEU A HB2  4  
ATOM 2495  H HB3  . LEU A 1 3  ? 4.361   7.376   8.547   1.00 15.00 ?  299 LEU A HB3  4  
ATOM 2496  H HG   . LEU A 1 3  ? 4.798   6.593   6.173   1.00 15.00 ?  299 LEU A HG   4  
ATOM 2497  H HD11 . LEU A 1 3  ? 3.579   4.598   5.452   1.00 15.00 ?  299 LEU A HD11 4  
ATOM 2498  H HD12 . LEU A 1 3  ? 3.185   4.236   7.132   1.00 15.00 ?  299 LEU A HD12 4  
ATOM 2499  H HD13 . LEU A 1 3  ? 4.864   4.203   6.593   1.00 15.00 ?  299 LEU A HD13 4  
ATOM 2500  H HD21 . LEU A 1 3  ? 2.887   7.958   6.779   1.00 15.00 ?  299 LEU A HD21 4  
ATOM 2501  H HD22 . LEU A 1 3  ? 1.987   6.516   7.249   1.00 15.00 ?  299 LEU A HD22 4  
ATOM 2502  H HD23 . LEU A 1 3  ? 2.437   6.763   5.561   1.00 15.00 ?  299 LEU A HD23 4  
ATOM 2503  N N    . PRO A 1 4  ? 7.563   6.375   6.745   1.00 15.00 ?  300 PRO A N    4  
ATOM 2504  C CA   . PRO A 1 4  ? 8.432   7.188   5.893   1.00 15.00 ?  300 PRO A CA   4  
ATOM 2505  C C    . PRO A 1 4  ? 7.624   8.230   5.114   1.00 15.00 ?  300 PRO A C    4  
ATOM 2506  O O    . PRO A 1 4  ? 6.619   7.897   4.494   1.00 15.00 ?  300 PRO A O    4  
ATOM 2507  C CB   . PRO A 1 4  ? 9.067   6.167   4.937   1.00 15.00 ?  300 PRO A CB   4  
ATOM 2508  C CG   . PRO A 1 4  ? 8.821   4.833   5.562   1.00 15.00 ?  300 PRO A CG   4  
ATOM 2509  C CD   . PRO A 1 4  ? 7.534   4.969   6.314   1.00 15.00 ?  300 PRO A CD   4  
ATOM 2510  H HA   . PRO A 1 4  ? 9.202   7.683   6.467   1.00 15.00 ?  300 PRO A HA   4  
ATOM 2511  H HB2  . PRO A 1 4  ? 8.595   6.241   3.971   1.00 15.00 ?  300 PRO A HB2  4  
ATOM 2512  H HB3  . PRO A 1 4  ? 10.123  6.369   4.844   1.00 15.00 ?  300 PRO A HB3  4  
ATOM 2513  H HG2  . PRO A 1 4  ? 8.730   4.075   4.797   1.00 15.00 ?  300 PRO A HG2  4  
ATOM 2514  H HG3  . PRO A 1 4  ? 9.626   4.590   6.240   1.00 15.00 ?  300 PRO A HG3  4  
ATOM 2515  H HD2  . PRO A 1 4  ? 6.696   4.783   5.658   1.00 15.00 ?  300 PRO A HD2  4  
ATOM 2516  H HD3  . PRO A 1 4  ? 7.511   4.298   7.161   1.00 15.00 ?  300 PRO A HD3  4  
ATOM 2517  N N    . PRO A 1 5  ? 8.062   9.503   5.128   1.00 15.00 ?  301 PRO A N    4  
ATOM 2518  C CA   . PRO A 1 5  ? 7.320   10.619  4.510   1.00 15.00 ?  301 PRO A CA   4  
ATOM 2519  C C    . PRO A 1 5  ? 7.221   10.522  2.983   1.00 15.00 ?  301 PRO A C    4  
ATOM 2520  O O    . PRO A 1 5  ? 6.530   11.317  2.345   1.00 15.00 ?  301 PRO A O    4  
ATOM 2521  C CB   . PRO A 1 5  ? 8.126   11.861  4.912   1.00 15.00 ?  301 PRO A CB   4  
ATOM 2522  C CG   . PRO A 1 5  ? 9.012   11.414  6.026   1.00 15.00 ?  301 PRO A CG   4  
ATOM 2523  C CD   . PRO A 1 5  ? 9.302   9.967   5.761   1.00 15.00 ?  301 PRO A CD   4  
ATOM 2524  H HA   . PRO A 1 5  ? 6.324   10.695  4.920   1.00 15.00 ?  301 PRO A HA   4  
ATOM 2525  H HB2  . PRO A 1 5  ? 8.704   12.207  4.067   1.00 15.00 ?  301 PRO A HB2  4  
ATOM 2526  H HB3  . PRO A 1 5  ? 7.451   12.639  5.234   1.00 15.00 ?  301 PRO A HB3  4  
ATOM 2527  H HG2  . PRO A 1 5  ? 9.927   11.986  6.020   1.00 15.00 ?  301 PRO A HG2  4  
ATOM 2528  H HG3  . PRO A 1 5  ? 8.500   11.528  6.972   1.00 15.00 ?  301 PRO A HG3  4  
ATOM 2529  H HD2  . PRO A 1 5  ? 10.143  9.864   5.091   1.00 15.00 ?  301 PRO A HD2  4  
ATOM 2530  H HD3  . PRO A 1 5  ? 9.483   9.441   6.687   1.00 15.00 ?  301 PRO A HD3  4  
ATOM 2531  N N    . GLY A 1 6  ? 7.945   9.576   2.404   1.00 15.00 ?  302 GLY A N    4  
ATOM 2532  C CA   . GLY A 1 6  ? 7.837   9.315   0.980   1.00 15.00 ?  302 GLY A CA   4  
ATOM 2533  C C    . GLY A 1 6  ? 6.812   8.236   0.689   1.00 15.00 ?  302 GLY A C    4  
ATOM 2534  O O    . GLY A 1 6  ? 6.386   8.048   -0.457  1.00 15.00 ?  302 GLY A O    4  
ATOM 2535  H H    . GLY A 1 6  ? 8.570   9.055   2.949   1.00 15.00 ?  302 GLY A H    4  
ATOM 2536  H HA2  . GLY A 1 6  ? 7.545   10.225  0.477   1.00 15.00 ?  302 GLY A HA2  4  
ATOM 2537  H HA3  . GLY A 1 6  ? 8.798   8.996   0.607   1.00 15.00 ?  302 GLY A HA3  4  
ATOM 2538  N N    . TRP A 1 7  ? 6.434   7.526   1.740   1.00 15.00 ?  303 TRP A N    4  
ATOM 2539  C CA   . TRP A 1 7  ? 5.544   6.384   1.644   1.00 15.00 ?  303 TRP A CA   4  
ATOM 2540  C C    . TRP A 1 7  ? 4.107   6.772   1.905   1.00 15.00 ?  303 TRP A C    4  
ATOM 2541  O O    . TRP A 1 7  ? 3.836   7.691   2.674   1.00 15.00 ?  303 TRP A O    4  
ATOM 2542  C CB   . TRP A 1 7  ? 5.944   5.330   2.650   1.00 15.00 ?  303 TRP A CB   4  
ATOM 2543  C CG   . TRP A 1 7  ? 6.987   4.416   2.139   1.00 15.00 ?  303 TRP A CG   4  
ATOM 2544  C CD1  . TRP A 1 7  ? 8.306   4.693   1.944   1.00 15.00 ?  303 TRP A CD1  4  
ATOM 2545  C CD2  . TRP A 1 7  ? 6.795   3.060   1.752   1.00 15.00 ?  303 TRP A CD2  4  
ATOM 2546  N NE1  . TRP A 1 7  ? 8.947   3.584   1.473   1.00 15.00 ?  303 TRP A NE1  4  
ATOM 2547  C CE2  . TRP A 1 7  ? 8.036   2.568   1.353   1.00 15.00 ?  303 TRP A CE2  4  
ATOM 2548  C CE3  . TRP A 1 7  ? 5.693   2.208   1.713   1.00 15.00 ?  303 TRP A CE3  4  
ATOM 2549  C CZ2  . TRP A 1 7  ? 8.203   1.268   0.926   1.00 15.00 ?  303 TRP A CZ2  4  
ATOM 2550  C CZ3  . TRP A 1 7  ? 5.870   0.916   1.288   1.00 15.00 ?  303 TRP A CZ3  4  
ATOM 2551  C CH2  . TRP A 1 7  ? 7.114   0.455   0.899   1.00 15.00 ?  303 TRP A CH2  4  
ATOM 2552  H H    . TRP A 1 7  ? 6.746   7.797   2.630   1.00 15.00 ?  303 TRP A H    4  
ATOM 2553  H HA   . TRP A 1 7  ? 5.637   5.977   0.651   1.00 15.00 ?  303 TRP A HA   4  
ATOM 2554  H HB2  . TRP A 1 7  ? 6.325   5.813   3.536   1.00 15.00 ?  303 TRP A HB2  4  
ATOM 2555  H HB3  . TRP A 1 7  ? 5.076   4.740   2.908   1.00 15.00 ?  303 TRP A HB3  4  
ATOM 2556  H HD1  . TRP A 1 7  ? 8.763   5.652   2.138   1.00 15.00 ?  303 TRP A HD1  4  
ATOM 2557  H HE1  . TRP A 1 7  ? 9.908   3.527   1.253   1.00 15.00 ?  303 TRP A HE1  4  
ATOM 2558  H HE3  . TRP A 1 7  ? 4.711   2.539   1.996   1.00 15.00 ?  303 TRP A HE3  4  
ATOM 2559  H HZ2  . TRP A 1 7  ? 9.140   0.910   0.616   1.00 15.00 ?  303 TRP A HZ2  4  
ATOM 2560  H HZ3  . TRP A 1 7  ? 5.030   0.254   1.236   1.00 15.00 ?  303 TRP A HZ3  4  
ATOM 2561  H HH2  . TRP A 1 7  ? 7.211   -0.573  0.591   1.00 15.00 ?  303 TRP A HH2  4  
ATOM 2562  N N    . GLU A 1 8  ? 3.183   6.050   1.290   1.00 15.00 ?  304 GLU A N    4  
ATOM 2563  C CA   . GLU A 1 8  ? 1.764   6.352   1.474   1.00 15.00 ?  304 GLU A CA   4  
ATOM 2564  C C    . GLU A 1 8  ? 1.005   5.097   1.895   1.00 15.00 ?  304 GLU A C    4  
ATOM 2565  O O    . GLU A 1 8  ? 0.947   4.122   1.158   1.00 15.00 ?  304 GLU A O    4  
ATOM 2566  C CB   . GLU A 1 8  ? 1.197   6.949   0.184   1.00 15.00 ?  304 GLU A CB   4  
ATOM 2567  C CG   . GLU A 1 8  ? 1.807   8.292   -0.173  1.00 15.00 ?  304 GLU A CG   4  
ATOM 2568  C CD   . GLU A 1 8  ? 1.203   9.450   0.601   1.00 15.00 ?  304 GLU A CD   4  
ATOM 2569  O OE1  . GLU A 1 8  ? 1.283   9.455   1.845   1.00 15.00 -1 304 GLU A OE1  4  
ATOM 2570  O OE2  . GLU A 1 8  ? 0.654   10.370  -0.047  1.00 15.00 ?  304 GLU A OE2  4  
ATOM 2571  H H    . GLU A 1 8  ? 3.462   5.275   0.715   1.00 15.00 ?  304 GLU A H    4  
ATOM 2572  H HA   . GLU A 1 8  ? 1.686   7.085   2.268   1.00 15.00 ?  304 GLU A HA   4  
ATOM 2573  H HB2  . GLU A 1 8  ? 1.394   6.265   -0.628  1.00 15.00 ?  304 GLU A HB2  4  
ATOM 2574  H HB3  . GLU A 1 8  ? 0.132   7.076   0.282   1.00 15.00 ?  304 GLU A HB3  4  
ATOM 2575  H HG2  . GLU A 1 8  ? 2.866   8.257   0.037   1.00 15.00 ?  304 GLU A HG2  4  
ATOM 2576  H HG3  . GLU A 1 8  ? 1.658   8.468   -1.228  1.00 15.00 ?  304 GLU A HG3  4  
ATOM 2577  N N    . ILE A 1 9  ? 0.428   5.114   3.087   1.00 15.00 ?  305 ILE A N    4  
ATOM 2578  C CA   . ILE A 1 9  ? -0.182  3.912   3.647   1.00 15.00 ?  305 ILE A CA   4  
ATOM 2579  C C    . ILE A 1 9  ? -1.709  3.911   3.515   1.00 15.00 ?  305 ILE A C    4  
ATOM 2580  O O    . ILE A 1 9  ? -2.376  4.894   3.847   1.00 15.00 ?  305 ILE A O    4  
ATOM 2581  C CB   . ILE A 1 9  ? 0.194   3.730   5.140   1.00 15.00 ?  305 ILE A CB   4  
ATOM 2582  C CG1  . ILE A 1 9  ? -0.509  2.495   5.721   1.00 15.00 ?  305 ILE A CG1  4  
ATOM 2583  C CG2  . ILE A 1 9  ? -0.153  4.980   5.940   1.00 15.00 ?  305 ILE A CG2  4  
ATOM 2584  C CD1  . ILE A 1 9  ? -0.173  2.219   7.171   1.00 15.00 ?  305 ILE A CD1  4  
ATOM 2585  H H    . ILE A 1 9  ? 0.405   5.950   3.599   1.00 15.00 ?  305 ILE A H    4  
ATOM 2586  H HA   . ILE A 1 9  ? 0.216   3.069   3.103   1.00 15.00 ?  305 ILE A HA   4  
ATOM 2587  H HB   . ILE A 1 9  ? 1.263   3.583   5.200   1.00 15.00 ?  305 ILE A HB   4  
ATOM 2588  H HG12 . ILE A 1 9  ? -1.578  2.634   5.653   1.00 15.00 ?  305 ILE A HG12 4  
ATOM 2589  H HG13 . ILE A 1 9  ? -0.228  1.626   5.143   1.00 15.00 ?  305 ILE A HG13 4  
ATOM 2590  H HG21 . ILE A 1 9  ? 0.106   4.829   6.978   1.00 15.00 ?  305 ILE A HG21 4  
ATOM 2591  H HG22 . ILE A 1 9  ? -1.212  5.176   5.859   1.00 15.00 ?  305 ILE A HG22 4  
ATOM 2592  H HG23 . ILE A 1 9  ? 0.400   5.823   5.550   1.00 15.00 ?  305 ILE A HG23 4  
ATOM 2593  H HD11 . ILE A 1 9  ? 0.890   2.054   7.270   1.00 15.00 ?  305 ILE A HD11 4  
ATOM 2594  H HD12 . ILE A 1 9  ? -0.708  1.340   7.503   1.00 15.00 ?  305 ILE A HD12 4  
ATOM 2595  H HD13 . ILE A 1 9  ? -0.464  3.066   7.774   1.00 15.00 ?  305 ILE A HD13 4  
ATOM 2596  N N    . ARG A 1 10 ? -2.252  2.804   3.007   1.00 15.00 ?  306 ARG A N    4  
ATOM 2597  C CA   . ARG A 1 10 ? -3.686  2.558   3.045   1.00 15.00 ?  306 ARG A CA   4  
ATOM 2598  C C    . ARG A 1 10 ? -3.967  1.074   3.240   1.00 15.00 ?  306 ARG A C    4  
ATOM 2599  O O    . ARG A 1 10 ? -3.204  0.220   2.787   1.00 15.00 ?  306 ARG A O    4  
ATOM 2600  C CB   . ARG A 1 10 ? -4.390  3.039   1.776   1.00 15.00 ?  306 ARG A CB   4  
ATOM 2601  C CG   . ARG A 1 10 ? -4.663  4.530   1.747   1.00 15.00 ?  306 ARG A CG   4  
ATOM 2602  C CD   . ARG A 1 10 ? -5.909  4.839   0.944   1.00 15.00 ?  306 ARG A CD   4  
ATOM 2603  N NE   . ARG A 1 10 ? -7.007  3.924   1.270   1.00 15.00 ?  306 ARG A NE   4  
ATOM 2604  C CZ   . ARG A 1 10 ? -8.136  4.284   1.881   1.00 15.00 ?  306 ARG A CZ   4  
ATOM 2605  N NH1  . ARG A 1 10 ? -8.319  5.536   2.282   1.00 15.00 1  306 ARG A NH1  4  
ATOM 2606  N NH2  . ARG A 1 10 ? -9.092  3.386   2.088   1.00 15.00 ?  306 ARG A NH2  4  
ATOM 2607  H H    . ARG A 1 10 ? -1.672  2.130   2.588   1.00 15.00 ?  306 ARG A H    4  
ATOM 2608  H HA   . ARG A 1 10 ? -4.088  3.095   3.892   1.00 15.00 ?  306 ARG A HA   4  
ATOM 2609  H HB2  . ARG A 1 10 ? -3.775  2.793   0.924   1.00 15.00 ?  306 ARG A HB2  4  
ATOM 2610  H HB3  . ARG A 1 10 ? -5.334  2.522   1.686   1.00 15.00 ?  306 ARG A HB3  4  
ATOM 2611  H HG2  . ARG A 1 10 ? -4.791  4.890   2.758   1.00 15.00 ?  306 ARG A HG2  4  
ATOM 2612  H HG3  . ARG A 1 10 ? -3.824  5.023   1.282   1.00 15.00 ?  306 ARG A HG3  4  
ATOM 2613  H HD2  . ARG A 1 10 ? -6.220  5.852   1.159   1.00 15.00 ?  306 ARG A HD2  4  
ATOM 2614  H HD3  . ARG A 1 10 ? -5.676  4.748   -0.107  1.00 15.00 ?  306 ARG A HD3  4  
ATOM 2615  H HE   . ARG A 1 10 ? -6.902  2.982   0.983   1.00 15.00 ?  306 ARG A HE   4  
ATOM 2616  H HH11 . ARG A 1 10 ? -7.603  6.232   2.129   1.00 15.00 ?  306 ARG A HH11 4  
ATOM 2617  H HH12 . ARG A 1 10 ? -9.178  5.798   2.738   1.00 15.00 ?  306 ARG A HH12 4  
ATOM 2618  H HH21 . ARG A 1 10 ? -8.972  2.432   1.788   1.00 15.00 ?  306 ARG A HH21 4  
ATOM 2619  H HH22 . ARG A 1 10 ? -9.945  3.656   2.541   1.00 15.00 ?  306 ARG A HH22 4  
ATOM 2620  N N    . ASN A 1 11 ? -5.064  0.783   3.913   1.00 15.00 ?  307 ASN A N    4  
ATOM 2621  C CA   . ASN A 1 11 ? -5.507  -0.588  4.131   1.00 15.00 ?  307 ASN A CA   4  
ATOM 2622  C C    . ASN A 1 11 ? -6.741  -0.863  3.262   1.00 15.00 ?  307 ASN A C    4  
ATOM 2623  O O    . ASN A 1 11 ? -7.641  -0.027  3.190   1.00 15.00 ?  307 ASN A O    4  
ATOM 2624  C CB   . ASN A 1 11 ? -5.848  -0.779  5.616   1.00 15.00 ?  307 ASN A CB   4  
ATOM 2625  C CG   . ASN A 1 11 ? -6.031  -2.235  6.023   1.00 15.00 ?  307 ASN A CG   4  
ATOM 2626  O OD1  . ASN A 1 11 ? -6.447  -3.077  5.232   1.00 15.00 ?  307 ASN A OD1  4  
ATOM 2627  N ND2  . ASN A 1 11 ? -5.720  -2.541  7.274   1.00 15.00 ?  307 ASN A ND2  4  
ATOM 2628  H H    . ASN A 1 11 ? -5.602  1.520   4.286   1.00 15.00 ?  307 ASN A H    4  
ATOM 2629  H HA   . ASN A 1 11 ? -4.704  -1.254  3.853   1.00 15.00 ?  307 ASN A HA   4  
ATOM 2630  H HB2  . ASN A 1 11 ? -5.052  -0.362  6.214   1.00 15.00 ?  307 ASN A HB2  4  
ATOM 2631  H HB3  . ASN A 1 11 ? -6.763  -0.249  5.833   1.00 15.00 ?  307 ASN A HB3  4  
ATOM 2632  H HD21 . ASN A 1 11 ? -5.392  -1.821  7.865   1.00 15.00 ?  307 ASN A HD21 4  
ATOM 2633  H HD22 . ASN A 1 11 ? -5.825  -3.472  7.562   1.00 15.00 ?  307 ASN A HD22 4  
ATOM 2634  N N    . THR A 1 12 ? -6.794  -2.029  2.623   1.00 15.00 ?  308 THR A N    4  
ATOM 2635  C CA   . THR A 1 12 ? -7.915  -2.378  1.763   1.00 15.00 ?  308 THR A CA   4  
ATOM 2636  C C    . THR A 1 12 ? -8.984  -3.078  2.582   1.00 15.00 ?  308 THR A C    4  
ATOM 2637  O O    . THR A 1 12 ? -8.671  -3.985  3.364   1.00 15.00 ?  308 THR A O    4  
ATOM 2638  C CB   . THR A 1 12 ? -7.498  -3.330  0.618   1.00 15.00 ?  308 THR A CB   4  
ATOM 2639  O OG1  . THR A 1 12 ? -6.080  -3.348  0.474   1.00 15.00 ?  308 THR A OG1  4  
ATOM 2640  C CG2  . THR A 1 12 ? -8.127  -2.906  -0.697  1.00 15.00 ?  308 THR A CG2  4  
ATOM 2641  H H    . THR A 1 12 ? -6.074  -2.689  2.759   1.00 15.00 ?  308 THR A H    4  
ATOM 2642  H HA   . THR A 1 12 ? -8.319  -1.473  1.335   1.00 15.00 ?  308 THR A HA   4  
ATOM 2643  H HB   . THR A 1 12 ? -7.838  -4.326  0.856   1.00 15.00 ?  308 THR A HB   4  
ATOM 2644  H HG1  . THR A 1 12 ? -5.719  -2.533  0.830   1.00 15.00 ?  308 THR A HG1  4  
ATOM 2645  H HG21 . THR A 1 12 ? -9.201  -2.904  -0.599  1.00 15.00 ?  308 THR A HG21 4  
ATOM 2646  H HG22 . THR A 1 12 ? -7.836  -3.598  -1.473  1.00 15.00 ?  308 THR A HG22 4  
ATOM 2647  H HG23 . THR A 1 12 ? -7.786  -1.913  -0.957  1.00 15.00 ?  308 THR A HG23 4  
ATOM 2648  N N    . ALA A 1 13 ? -10.238 -2.678  2.385   1.00 15.00 ?  309 ALA A N    4  
ATOM 2649  C CA   . ALA A 1 13 ? -11.368 -3.253  3.118   1.00 15.00 ?  309 ALA A CA   4  
ATOM 2650  C C    . ALA A 1 13 ? -11.491 -4.758  2.872   1.00 15.00 ?  309 ALA A C    4  
ATOM 2651  O O    . ALA A 1 13 ? -12.191 -5.463  3.599   1.00 15.00 ?  309 ALA A O    4  
ATOM 2652  C CB   . ALA A 1 13 ? -12.656 -2.544  2.739   1.00 15.00 ?  309 ALA A CB   4  
ATOM 2653  H H    . ALA A 1 13 ? -10.414 -1.962  1.725   1.00 15.00 ?  309 ALA A H    4  
ATOM 2654  H HA   . ALA A 1 13 ? -11.194 -3.088  4.174   1.00 15.00 ?  309 ALA A HA   4  
ATOM 2655  H HB1  . ALA A 1 13 ? -12.861 -2.707  1.691   1.00 15.00 ?  309 ALA A HB1  4  
ATOM 2656  H HB2  . ALA A 1 13 ? -12.554 -1.484  2.924   1.00 15.00 ?  309 ALA A HB2  4  
ATOM 2657  H HB3  . ALA A 1 13 ? -13.471 -2.935  3.329   1.00 15.00 ?  309 ALA A HB3  4  
ATOM 2658  N N    . THR A 1 14 ? -10.811 -5.237  1.839   1.00 15.00 ?  310 THR A N    4  
ATOM 2659  C CA   . THR A 1 14 ? -10.770 -6.658  1.532   1.00 15.00 ?  310 THR A CA   4  
ATOM 2660  C C    . THR A 1 14 ? -9.910  -7.429  2.542   1.00 15.00 ?  310 THR A C    4  
ATOM 2661  O O    . THR A 1 14 ? -9.979  -8.657  2.615   1.00 15.00 ?  310 THR A O    4  
ATOM 2662  C CB   . THR A 1 14 ? -10.245 -6.898  0.101   1.00 15.00 ?  310 THR A CB   4  
ATOM 2663  O OG1  . THR A 1 14 ? -9.174  -5.988  -0.197  1.00 15.00 ?  310 THR A OG1  4  
ATOM 2664  C CG2  . THR A 1 14 ? -11.357 -6.725  -0.921  1.00 15.00 ?  310 THR A CG2  4  
ATOM 2665  H H    . THR A 1 14 ? -10.323 -4.613  1.265   1.00 15.00 ?  310 THR A H    4  
ATOM 2666  H HA   . THR A 1 14 ? -11.782 -7.034  1.583   1.00 15.00 ?  310 THR A HA   4  
ATOM 2667  H HB   . THR A 1 14 ? -9.873  -7.911  0.036   1.00 15.00 ?  310 THR A HB   4  
ATOM 2668  H HG1  . THR A 1 14 ? -9.545  -5.147  -0.494  1.00 15.00 ?  310 THR A HG1  4  
ATOM 2669  H HG21 . THR A 1 14 ? -12.147 -7.431  -0.717  1.00 15.00 ?  310 THR A HG21 4  
ATOM 2670  H HG22 . THR A 1 14 ? -10.965 -6.899  -1.913  1.00 15.00 ?  310 THR A HG22 4  
ATOM 2671  H HG23 . THR A 1 14 ? -11.747 -5.719  -0.861  1.00 15.00 ?  310 THR A HG23 4  
ATOM 2672  N N    . GLY A 1 15 ? -9.108  -6.702  3.320   1.00 15.00 ?  311 GLY A N    4  
ATOM 2673  C CA   . GLY A 1 15 ? -8.306  -7.326  4.364   1.00 15.00 ?  311 GLY A CA   4  
ATOM 2674  C C    . GLY A 1 15 ? -6.849  -7.499  3.976   1.00 15.00 ?  311 GLY A C    4  
ATOM 2675  O O    . GLY A 1 15 ? -6.253  -8.544  4.235   1.00 15.00 ?  311 GLY A O    4  
ATOM 2676  H H    . GLY A 1 15 ? -9.072  -5.727  3.194   1.00 15.00 ?  311 GLY A H    4  
ATOM 2677  H HA2  . GLY A 1 15 ? -8.356  -6.714  5.252   1.00 15.00 ?  311 GLY A HA2  4  
ATOM 2678  H HA3  . GLY A 1 15 ? -8.723  -8.296  4.588   1.00 15.00 ?  311 GLY A HA3  4  
ATOM 2679  N N    . ARG A 1 16 ? -6.268  -6.472  3.366   1.00 15.00 ?  312 ARG A N    4  
ATOM 2680  C CA   . ARG A 1 16 ? -4.880  -6.527  2.891   1.00 15.00 ?  312 ARG A CA   4  
ATOM 2681  C C    . ARG A 1 16 ? -4.282  -5.125  2.950   1.00 15.00 ?  312 ARG A C    4  
ATOM 2682  O O    . ARG A 1 16 ? -5.011  -4.156  2.810   1.00 15.00 ?  312 ARG A O    4  
ATOM 2683  C CB   . ARG A 1 16 ? -4.819  -7.040  1.447   1.00 15.00 ?  312 ARG A CB   4  
ATOM 2684  C CG   . ARG A 1 16 ? -5.425  -8.414  1.217   1.00 15.00 ?  312 ARG A CG   4  
ATOM 2685  C CD   . ARG A 1 16 ? -5.607  -8.682  -0.266  1.00 15.00 ?  312 ARG A CD   4  
ATOM 2686  N NE   . ARG A 1 16 ? -6.630  -7.815  -0.852  1.00 15.00 ?  312 ARG A NE   4  
ATOM 2687  C CZ   . ARG A 1 16 ? -6.830  -7.659  -2.161  1.00 15.00 ?  312 ARG A CZ   4  
ATOM 2688  N NH1  . ARG A 1 16 ? -6.105  -8.337  -3.045  1.00 15.00 1  312 ARG A NH1  4  
ATOM 2689  N NH2  . ARG A 1 16 ? -7.770  -6.832  -2.586  1.00 15.00 ?  312 ARG A NH2  4  
ATOM 2690  H H    . ARG A 1 16 ? -6.779  -5.634  3.250   1.00 15.00 ?  312 ARG A H    4  
ATOM 2691  H HA   . ARG A 1 16 ? -4.320  -7.186  3.539   1.00 15.00 ?  312 ARG A HA   4  
ATOM 2692  H HB2  . ARG A 1 16 ? -5.326  -6.336  0.799   1.00 15.00 ?  312 ARG A HB2  4  
ATOM 2693  H HB3  . ARG A 1 16 ? -3.781  -7.085  1.151   1.00 15.00 ?  312 ARG A HB3  4  
ATOM 2694  H HG2  . ARG A 1 16 ? -4.765  -9.163  1.632   1.00 15.00 ?  312 ARG A HG2  4  
ATOM 2695  H HG3  . ARG A 1 16 ? -6.385  -8.465  1.706   1.00 15.00 ?  312 ARG A HG3  4  
ATOM 2696  H HD2  . ARG A 1 16 ? -4.667  -8.496  -0.765  1.00 15.00 ?  312 ARG A HD2  4  
ATOM 2697  H HD3  . ARG A 1 16 ? -5.895  -9.712  -0.408  1.00 15.00 ?  312 ARG A HD3  4  
ATOM 2698  H HE   . ARG A 1 16 ? -7.199  -7.309  -0.226  1.00 15.00 ?  312 ARG A HE   4  
ATOM 2699  H HH11 . ARG A 1 16 ? -5.398  -8.983  -2.736  1.00 15.00 ?  312 ARG A HH11 4  
ATOM 2700  H HH12 . ARG A 1 16 ? -6.257  -8.204  -4.028  1.00 15.00 ?  312 ARG A HH12 4  
ATOM 2701  H HH21 . ARG A 1 16 ? -8.330  -6.321  -1.927  1.00 15.00 ?  312 ARG A HH21 4  
ATOM 2702  H HH22 . ARG A 1 16 ? -7.929  -6.710  -3.578  1.00 15.00 ?  312 ARG A HH22 4  
ATOM 2703  N N    . VAL A 1 17 ? -2.980  -4.989  3.154   1.00 15.00 ?  313 VAL A N    4  
ATOM 2704  C CA   . VAL A 1 17 ? -2.394  -3.654  3.228   1.00 15.00 ?  313 VAL A CA   4  
ATOM 2705  C C    . VAL A 1 17 ? -1.518  -3.354  2.004   1.00 15.00 ?  313 VAL A C    4  
ATOM 2706  O O    . VAL A 1 17 ? -0.694  -4.163  1.605   1.00 15.00 ?  313 VAL A O    4  
ATOM 2707  C CB   . VAL A 1 17 ? -1.570  -3.440  4.510   1.00 15.00 ?  313 VAL A CB   4  
ATOM 2708  C CG1  . VAL A 1 17 ? -1.352  -1.954  4.749   1.00 15.00 ?  313 VAL A CG1  4  
ATOM 2709  C CG2  . VAL A 1 17 ? -2.251  -4.078  5.709   1.00 15.00 ?  313 VAL A CG2  4  
ATOM 2710  H H    . VAL A 1 17 ? -2.404  -5.784  3.242   1.00 15.00 ?  313 VAL A H    4  
ATOM 2711  H HA   . VAL A 1 17 ? -3.217  -2.953  3.244   1.00 15.00 ?  313 VAL A HA   4  
ATOM 2712  H HB   . VAL A 1 17 ? -0.604  -3.906  4.379   1.00 15.00 ?  313 VAL A HB   4  
ATOM 2713  H HG11 . VAL A 1 17 ? -0.826  -1.527  3.908   1.00 15.00 ?  313 VAL A HG11 4  
ATOM 2714  H HG12 . VAL A 1 17 ? -0.770  -1.816  5.648   1.00 15.00 ?  313 VAL A HG12 4  
ATOM 2715  H HG13 . VAL A 1 17 ? -2.308  -1.464  4.860   1.00 15.00 ?  313 VAL A HG13 4  
ATOM 2716  H HG21 . VAL A 1 17 ? -3.250  -3.678  5.811   1.00 15.00 ?  313 VAL A HG21 4  
ATOM 2717  H HG22 . VAL A 1 17 ? -1.683  -3.859  6.600   1.00 15.00 ?  313 VAL A HG22 4  
ATOM 2718  H HG23 . VAL A 1 17 ? -2.300  -5.146  5.567   1.00 15.00 ?  313 VAL A HG23 4  
ATOM 2719  N N    . TYR A 1 18 ? -1.693  -2.163  1.449   1.00 15.00 ?  314 TYR A N    4  
ATOM 2720  C CA   . TYR A 1 18 ? -1.066  -1.736  0.222   1.00 15.00 ?  314 TYR A CA   4  
ATOM 2721  C C    . TYR A 1 18 ? -0.526  -0.323  0.421   1.00 15.00 ?  314 TYR A C    4  
ATOM 2722  O O    . TYR A 1 18 ? -1.276  0.631   0.626   1.00 15.00 ?  314 TYR A O    4  
ATOM 2723  C CB   . TYR A 1 18 ? -2.063  -1.776  -0.957  1.00 15.00 ?  314 TYR A CB   4  
ATOM 2724  C CG   . TYR A 1 18 ? -3.262  -0.852  -0.809  1.00 15.00 ?  314 TYR A CG   4  
ATOM 2725  C CD1  . TYR A 1 18 ? -4.276  -1.150  0.084   1.00 15.00 ?  314 TYR A CD1  4  
ATOM 2726  C CD2  . TYR A 1 18 ? -3.377  0.316   -1.559  1.00 15.00 ?  314 TYR A CD2  4  
ATOM 2727  C CE1  . TYR A 1 18 ? -5.368  -0.322  0.234   1.00 15.00 ?  314 TYR A CE1  4  
ATOM 2728  C CE2  . TYR A 1 18 ? -4.472  1.154   -1.411  1.00 15.00 ?  314 TYR A CE2  4  
ATOM 2729  C CZ   . TYR A 1 18 ? -5.462  0.827   -0.509  1.00 15.00 ?  314 TYR A CZ   4  
ATOM 2730  O OH   . TYR A 1 18 ? -6.559  1.647   -0.354  1.00 15.00 ?  314 TYR A OH   4  
ATOM 2731  H H    . TYR A 1 18 ? -2.214  -1.525  1.907   1.00 15.00 ?  314 TYR A H    4  
ATOM 2732  H HA   . TYR A 1 18 ? -0.242  -2.403  0.016   1.00 15.00 ?  314 TYR A HA   4  
ATOM 2733  H HB2  . TYR A 1 18 ? -1.545  -1.495  -1.863  1.00 15.00 ?  314 TYR A HB2  4  
ATOM 2734  H HB3  . TYR A 1 18 ? -2.433  -2.785  -1.064  1.00 15.00 ?  314 TYR A HB3  4  
ATOM 2735  H HD1  . TYR A 1 18 ? -4.205  -2.051  0.674   1.00 15.00 ?  314 TYR A HD1  4  
ATOM 2736  H HD2  . TYR A 1 18 ? -2.600  0.562   -2.270  1.00 15.00 ?  314 TYR A HD2  4  
ATOM 2737  H HE1  . TYR A 1 18 ? -6.144  -0.577  0.939   1.00 15.00 ?  314 TYR A HE1  4  
ATOM 2738  H HE2  . TYR A 1 18 ? -4.541  2.070   -1.992  1.00 15.00 ?  314 TYR A HE2  4  
ATOM 2739  H HH   . TYR A 1 18 ? -7.083  1.650   -1.176  1.00 15.00 ?  314 TYR A HH   4  
ATOM 2740  N N    . PHE A 1 19 ? 0.775   -0.202  0.432   1.00 15.00 ?  315 PHE A N    4  
ATOM 2741  C CA   . PHE A 1 19 ? 1.401   1.095   0.544   1.00 15.00 ?  315 PHE A CA   4  
ATOM 2742  C C    . PHE A 1 19 ? 1.735   1.601   -0.836  1.00 15.00 ?  315 PHE A C    4  
ATOM 2743  O O    . PHE A 1 19 ? 2.535   1.002   -1.534  1.00 15.00 ?  315 PHE A O    4  
ATOM 2744  C CB   . PHE A 1 19 ? 2.687   1.022   1.358   1.00 15.00 ?  315 PHE A CB   4  
ATOM 2745  C CG   . PHE A 1 19 ? 2.521   0.623   2.794   1.00 15.00 ?  315 PHE A CG   4  
ATOM 2746  C CD1  . PHE A 1 19 ? 1.991   -0.606  3.130   1.00 15.00 ?  315 PHE A CD1  4  
ATOM 2747  C CD2  . PHE A 1 19 ? 2.925   1.475   3.807   1.00 15.00 ?  315 PHE A CD2  4  
ATOM 2748  C CE1  . PHE A 1 19 ? 1.861   -0.978  4.448   1.00 15.00 ?  315 PHE A CE1  4  
ATOM 2749  C CE2  . PHE A 1 19 ? 2.804   1.105   5.130   1.00 15.00 ?  315 PHE A CE2  4  
ATOM 2750  C CZ   . PHE A 1 19 ? 2.270   -0.125  5.449   1.00 15.00 ?  315 PHE A CZ   4  
ATOM 2751  H H    . PHE A 1 19 ? 1.337   -1.007  0.367   1.00 15.00 ?  315 PHE A H    4  
ATOM 2752  H HA   . PHE A 1 19 ? 0.708   1.772   1.020   1.00 15.00 ?  315 PHE A HA   4  
ATOM 2753  H HB2  . PHE A 1 19 ? 3.349   0.303   0.897   1.00 15.00 ?  315 PHE A HB2  4  
ATOM 2754  H HB3  . PHE A 1 19 ? 3.162   1.993   1.339   1.00 15.00 ?  315 PHE A HB3  4  
ATOM 2755  H HD1  . PHE A 1 19 ? 1.669   -1.278  2.347   1.00 15.00 ?  315 PHE A HD1  4  
ATOM 2756  H HD2  . PHE A 1 19 ? 3.343   2.439   3.554   1.00 15.00 ?  315 PHE A HD2  4  
ATOM 2757  H HE1  . PHE A 1 19 ? 1.444   -1.944  4.698   1.00 15.00 ?  315 PHE A HE1  4  
ATOM 2758  H HE2  . PHE A 1 19 ? 3.123   1.777   5.912   1.00 15.00 ?  315 PHE A HE2  4  
ATOM 2759  H HZ   . PHE A 1 19 ? 2.177   -0.424  6.477   1.00 15.00 ?  315 PHE A HZ   4  
ATOM 2760  N N    . VAL A 1 20 ? 1.164   2.706   -1.231  1.00 15.00 ?  316 VAL A N    4  
ATOM 2761  C CA   . VAL A 1 20 ? 1.476   3.238   -2.526  1.00 15.00 ?  316 VAL A CA   4  
ATOM 2762  C C    . VAL A 1 20 ? 2.675   4.174   -2.393  1.00 15.00 ?  316 VAL A C    4  
ATOM 2763  O O    . VAL A 1 20 ? 2.630   5.159   -1.659  1.00 15.00 ?  316 VAL A O    4  
ATOM 2764  C CB   . VAL A 1 20 ? 0.268   3.955   -3.183  1.00 15.00 ?  316 VAL A CB   4  
ATOM 2765  C CG1  . VAL A 1 20 ? -0.760  2.935   -3.638  1.00 15.00 ?  316 VAL A CG1  4  
ATOM 2766  C CG2  . VAL A 1 20 ? -0.384  4.950   -2.243  1.00 15.00 ?  316 VAL A CG2  4  
ATOM 2767  H H    . VAL A 1 20 ? 0.549   3.185   -0.634  1.00 15.00 ?  316 VAL A H    4  
ATOM 2768  H HA   . VAL A 1 20 ? 1.742   2.405   -3.151  1.00 15.00 ?  316 VAL A HA   4  
ATOM 2769  H HB   . VAL A 1 20 ? 0.620   4.490   -4.053  1.00 15.00 ?  316 VAL A HB   4  
ATOM 2770  H HG11 . VAL A 1 20 ? -1.606  3.444   -4.074  1.00 15.00 ?  316 VAL A HG11 4  
ATOM 2771  H HG12 . VAL A 1 20 ? -1.086  2.350   -2.791  1.00 15.00 ?  316 VAL A HG12 4  
ATOM 2772  H HG13 . VAL A 1 20 ? -0.314  2.283   -4.375  1.00 15.00 ?  316 VAL A HG13 4  
ATOM 2773  H HG21 . VAL A 1 20 ? 0.378   5.514   -1.726  1.00 15.00 ?  316 VAL A HG21 4  
ATOM 2774  H HG22 . VAL A 1 20 ? -1.002  4.422   -1.528  1.00 15.00 ?  316 VAL A HG22 4  
ATOM 2775  H HG23 . VAL A 1 20 ? -1.001  5.622   -2.820  1.00 15.00 ?  316 VAL A HG23 4  
ATOM 2776  N N    . ASP A 1 21 ? 3.781   3.841   -3.054  1.00 15.00 ?  317 ASP A N    4  
ATOM 2777  C CA   . ASP A 1 21 ? 4.975   4.636   -2.917  1.00 15.00 ?  317 ASP A CA   4  
ATOM 2778  C C    . ASP A 1 21 ? 4.921   5.698   -3.986  1.00 15.00 ?  317 ASP A C    4  
ATOM 2779  O O    . ASP A 1 21 ? 4.795   5.370   -5.168  1.00 15.00 ?  317 ASP A O    4  
ATOM 2780  C CB   . ASP A 1 21 ? 6.250   3.808   -3.143  1.00 15.00 ?  317 ASP A CB   4  
ATOM 2781  C CG   . ASP A 1 21 ? 6.123   2.354   -2.768  1.00 15.00 ?  317 ASP A CG   4  
ATOM 2782  O OD1  . ASP A 1 21 ? 5.612   1.578   -3.598  1.00 15.00 ?  317 ASP A OD1  4  
ATOM 2783  O OD2  . ASP A 1 21 ? 6.585   1.979   -1.678  1.00 15.00 -1 317 ASP A OD2  4  
ATOM 2784  H H    . ASP A 1 21 ? 3.802   3.038   -3.626  1.00 15.00 ?  317 ASP A H    4  
ATOM 2785  H HA   . ASP A 1 21 ? 4.992   5.091   -1.938  1.00 15.00 ?  317 ASP A HA   4  
ATOM 2786  H HB2  . ASP A 1 21 ? 6.538   3.867   -4.179  1.00 15.00 ?  317 ASP A HB2  4  
ATOM 2787  H HB3  . ASP A 1 21 ? 7.035   4.225   -2.529  1.00 15.00 ?  317 ASP A HB3  4  
ATOM 2788  N N    . HIS A 1 22 ? 4.982   6.960   -3.585  1.00 15.00 ?  318 HIS A N    4  
ATOM 2789  C CA   . HIS A 1 22 ? 4.998   8.057   -4.551  1.00 15.00 ?  318 HIS A CA   4  
ATOM 2790  C C    . HIS A 1 22 ? 6.347   8.108   -5.256  1.00 15.00 ?  318 HIS A C    4  
ATOM 2791  O O    . HIS A 1 22 ? 6.502   8.773   -6.274  1.00 15.00 ?  318 HIS A O    4  
ATOM 2792  C CB   . HIS A 1 22 ? 4.698   9.407   -3.889  1.00 15.00 ?  318 HIS A CB   4  
ATOM 2793  C CG   . HIS A 1 22 ? 3.267   9.607   -3.465  1.00 15.00 ?  318 HIS A CG   4  
ATOM 2794  N ND1  . HIS A 1 22 ? 2.219   8.803   -3.871  1.00 15.00 ?  318 HIS A ND1  4  
ATOM 2795  C CD2  . HIS A 1 22 ? 2.719   10.540  -2.651  1.00 15.00 ?  318 HIS A CD2  4  
ATOM 2796  C CE1  . HIS A 1 22 ? 1.100   9.237   -3.327  1.00 15.00 ?  318 HIS A CE1  4  
ATOM 2797  N NE2  . HIS A 1 22 ? 1.369   10.287  -2.576  1.00 15.00 ?  318 HIS A NE2  4  
ATOM 2798  H H    . HIS A 1 22 ? 5.016   7.160   -2.622  1.00 15.00 ?  318 HIS A H    4  
ATOM 2799  H HA   . HIS A 1 22 ? 4.235   7.851   -5.289  1.00 15.00 ?  318 HIS A HA   4  
ATOM 2800  H HB2  . HIS A 1 22 ? 5.317   9.506   -3.009  1.00 15.00 ?  318 HIS A HB2  4  
ATOM 2801  H HB3  . HIS A 1 22 ? 4.949   10.196  -4.584  1.00 15.00 ?  318 HIS A HB3  4  
ATOM 2802  H HD1  . HIS A 1 22 ? 2.283   8.023   -4.468  1.00 15.00 ?  318 HIS A HD1  4  
ATOM 2803  H HD2  . HIS A 1 22 ? 3.247   11.338  -2.149  1.00 15.00 ?  318 HIS A HD2  4  
ATOM 2804  H HE1  . HIS A 1 22 ? 0.120   8.803   -3.472  1.00 15.00 ?  318 HIS A HE1  4  
ATOM 2805  H HE2  . HIS A 1 22 ? 0.805   10.568  -1.810  1.00 15.00 ?  318 HIS A HE2  4  
ATOM 2806  N N    . ASN A 1 23 ? 7.329   7.409   -4.689  1.00 15.00 ?  319 ASN A N    4  
ATOM 2807  C CA   . ASN A 1 23 ? 8.663   7.350   -5.281  1.00 15.00 ?  319 ASN A CA   4  
ATOM 2808  C C    . ASN A 1 23 ? 8.667   6.432   -6.500  1.00 15.00 ?  319 ASN A C    4  
ATOM 2809  O O    . ASN A 1 23 ? 9.215   6.773   -7.544  1.00 15.00 ?  319 ASN A O    4  
ATOM 2810  C CB   . ASN A 1 23 ? 9.714   6.854   -4.269  1.00 15.00 ?  319 ASN A CB   4  
ATOM 2811  C CG   . ASN A 1 23 ? 10.054  7.861   -3.176  1.00 15.00 ?  319 ASN A CG   4  
ATOM 2812  O OD1  . ASN A 1 23 ? 11.208  7.974   -2.764  1.00 15.00 ?  319 ASN A OD1  4  
ATOM 2813  N ND2  . ASN A 1 23 ? 9.059   8.571   -2.671  1.00 15.00 ?  319 ASN A ND2  4  
ATOM 2814  H H    . ASN A 1 23 ? 7.147   6.914   -3.865  1.00 15.00 ?  319 ASN A H    4  
ATOM 2815  H HA   . ASN A 1 23 ? 8.927   8.348   -5.599  1.00 15.00 ?  319 ASN A HA   4  
ATOM 2816  H HB2  . ASN A 1 23 ? 9.345   5.958   -3.793  1.00 15.00 ?  319 ASN A HB2  4  
ATOM 2817  H HB3  . ASN A 1 23 ? 10.623  6.616   -4.802  1.00 15.00 ?  319 ASN A HB3  4  
ATOM 2818  H HD21 . ASN A 1 23 ? 8.159   8.418   -3.016  1.00 15.00 ?  319 ASN A HD21 4  
ATOM 2819  H HD22 . ASN A 1 23 ? 9.267   9.226   -1.971  1.00 15.00 ?  319 ASN A HD22 4  
ATOM 2820  N N    . ASN A 1 24 ? 8.063   5.258   -6.347  1.00 15.00 ?  320 ASN A N    4  
ATOM 2821  C CA   . ASN A 1 24 ? 8.050   4.252   -7.410  1.00 15.00 ?  320 ASN A CA   4  
ATOM 2822  C C    . ASN A 1 24 ? 6.728   4.269   -8.183  1.00 15.00 ?  320 ASN A C    4  
ATOM 2823  O O    . ASN A 1 24 ? 6.614   3.669   -9.253  1.00 15.00 ?  320 ASN A O    4  
ATOM 2824  C CB   . ASN A 1 24 ? 8.303   2.859   -6.821  1.00 15.00 ?  320 ASN A CB   4  
ATOM 2825  C CG   . ASN A 1 24 ? 8.556   1.799   -7.883  1.00 15.00 ?  320 ASN A CG   4  
ATOM 2826  O OD1  . ASN A 1 24 ? 9.076   2.089   -8.959  1.00 15.00 ?  320 ASN A OD1  4  
ATOM 2827  N ND2  . ASN A 1 24 ? 8.204   0.559   -7.579  1.00 15.00 ?  320 ASN A ND2  4  
ATOM 2828  H H    . ASN A 1 24 ? 7.637   5.052   -5.490  1.00 15.00 ?  320 ASN A H    4  
ATOM 2829  H HA   . ASN A 1 24 ? 8.851   4.490   -8.095  1.00 15.00 ?  320 ASN A HA   4  
ATOM 2830  H HB2  . ASN A 1 24 ? 9.164   2.902   -6.171  1.00 15.00 ?  320 ASN A HB2  4  
ATOM 2831  H HB3  . ASN A 1 24 ? 7.439   2.562   -6.244  1.00 15.00 ?  320 ASN A HB3  4  
ATOM 2832  H HD21 . ASN A 1 24 ? 7.806   0.392   -6.690  1.00 15.00 ?  320 ASN A HD21 4  
ATOM 2833  H HD22 . ASN A 1 24 ? 8.341   -0.140  -8.250  1.00 15.00 ?  320 ASN A HD22 4  
ATOM 2834  N N    . ARG A 1 25 ? 5.720   4.933   -7.610  1.00 15.00 ?  321 ARG A N    4  
ATOM 2835  C CA   . ARG A 1 25 ? 4.375   4.996   -8.192  1.00 15.00 ?  321 ARG A CA   4  
ATOM 2836  C C    . ARG A 1 25 ? 3.752   3.608   -8.253  1.00 15.00 ?  321 ARG A C    4  
ATOM 2837  O O    . ARG A 1 25 ? 3.045   3.268   -9.199  1.00 15.00 ?  321 ARG A O    4  
ATOM 2838  C CB   . ARG A 1 25 ? 4.405   5.626   -9.584  1.00 15.00 ?  321 ARG A CB   4  
ATOM 2839  C CG   . ARG A 1 25 ? 4.808   7.087   -9.579  1.00 15.00 ?  321 ARG A CG   4  
ATOM 2840  C CD   . ARG A 1 25 ? 4.943   7.622   -10.991 1.00 15.00 ?  321 ARG A CD   4  
ATOM 2841  N NE   . ARG A 1 25 ? 5.944   6.878   -11.751 1.00 15.00 ?  321 ARG A NE   4  
ATOM 2842  C CZ   . ARG A 1 25 ? 6.954   7.437   -12.411 1.00 15.00 ?  321 ARG A CZ   4  
ATOM 2843  N NH1  . ARG A 1 25 ? 7.097   8.759   -12.436 1.00 15.00 1  321 ARG A NH1  4  
ATOM 2844  N NH2  . ARG A 1 25 ? 7.823   6.669   -13.053 1.00 15.00 ?  321 ARG A NH2  4  
ATOM 2845  H H    . ARG A 1 25 ? 5.884   5.398   -6.766  1.00 15.00 ?  321 ARG A H    4  
ATOM 2846  H HA   . ARG A 1 25 ? 3.768   5.611   -7.544  1.00 15.00 ?  321 ARG A HA   4  
ATOM 2847  H HB2  . ARG A 1 25 ? 5.108   5.083   -10.197 1.00 15.00 ?  321 ARG A HB2  4  
ATOM 2848  H HB3  . ARG A 1 25 ? 3.419   5.546   -10.023 1.00 15.00 ?  321 ARG A HB3  4  
ATOM 2849  H HG2  . ARG A 1 25 ? 4.054   7.660   -9.058  1.00 15.00 ?  321 ARG A HG2  4  
ATOM 2850  H HG3  . ARG A 1 25 ? 5.756   7.186   -9.072  1.00 15.00 ?  321 ARG A HG3  4  
ATOM 2851  H HD2  . ARG A 1 25 ? 3.988   7.536   -11.490 1.00 15.00 ?  321 ARG A HD2  4  
ATOM 2852  H HD3  . ARG A 1 25 ? 5.233   8.659   -10.944 1.00 15.00 ?  321 ARG A HD3  4  
ATOM 2853  H HE   . ARG A 1 25 ? 5.862   5.893   -11.763 1.00 15.00 ?  321 ARG A HE   4  
ATOM 2854  H HH11 . ARG A 1 25 ? 6.439   9.351   -11.953 1.00 15.00 ?  321 ARG A HH11 4  
ATOM 2855  H HH12 . ARG A 1 25 ? 7.860   9.172   -12.938 1.00 15.00 ?  321 ARG A HH12 4  
ATOM 2856  H HH21 . ARG A 1 25 ? 7.719   5.669   -13.040 1.00 15.00 ?  321 ARG A HH21 4  
ATOM 2857  H HH22 . ARG A 1 25 ? 8.583   7.081   -13.558 1.00 15.00 ?  321 ARG A HH22 4  
ATOM 2858  N N    . THR A 1 26 ? 3.986   2.832   -7.211  1.00 15.00 ?  322 THR A N    4  
ATOM 2859  C CA   . THR A 1 26 ? 3.501   1.454   -7.167  1.00 15.00 ?  322 THR A CA   4  
ATOM 2860  C C    . THR A 1 26 ? 2.769   1.180   -5.852  1.00 15.00 ?  322 THR A C    4  
ATOM 2861  O O    . THR A 1 26 ? 3.060   1.815   -4.845  1.00 15.00 ?  322 THR A O    4  
ATOM 2862  C CB   . THR A 1 26 ? 4.666   0.460   -7.355  1.00 15.00 ?  322 THR A CB   4  
ATOM 2863  O OG1  . THR A 1 26 ? 5.385   0.794   -8.549  1.00 15.00 ?  322 THR A OG1  4  
ATOM 2864  C CG2  . THR A 1 26 ? 4.169   -0.977  -7.457  1.00 15.00 ?  322 THR A CG2  4  
ATOM 2865  H H    . THR A 1 26 ? 4.472   3.204   -6.431  1.00 15.00 ?  322 THR A H    4  
ATOM 2866  H HA   . THR A 1 26 ? 2.806   1.322   -7.985  1.00 15.00 ?  322 THR A HA   4  
ATOM 2867  H HB   . THR A 1 26 ? 5.332   0.540   -6.507  1.00 15.00 ?  322 THR A HB   4  
ATOM 2868  H HG1  . THR A 1 26 ? 5.550   1.742   -8.568  1.00 15.00 ?  322 THR A HG1  4  
ATOM 2869  H HG21 . THR A 1 26 ? 5.011   -1.641  -7.594  1.00 15.00 ?  322 THR A HG21 4  
ATOM 2870  H HG22 . THR A 1 26 ? 3.499   -1.067  -8.299  1.00 15.00 ?  322 THR A HG22 4  
ATOM 2871  H HG23 . THR A 1 26 ? 3.646   -1.242  -6.550  1.00 15.00 ?  322 THR A HG23 4  
ATOM 2872  N N    . THR A 1 27 ? 1.791   0.278   -5.875  1.00 15.00 ?  323 THR A N    4  
ATOM 2873  C CA   . THR A 1 27 ? 1.090   -0.106  -4.657  1.00 15.00 ?  323 THR A CA   4  
ATOM 2874  C C    . THR A 1 27 ? 1.724   -1.361  -4.048  1.00 15.00 ?  323 THR A C    4  
ATOM 2875  O O    . THR A 1 27 ? 2.150   -2.269  -4.766  1.00 15.00 ?  323 THR A O    4  
ATOM 2876  C CB   . THR A 1 27 ? -0.424  -0.309  -4.899  1.00 15.00 ?  323 THR A CB   4  
ATOM 2877  O OG1  . THR A 1 27 ? -1.098  -0.534  -3.657  1.00 15.00 ?  323 THR A OG1  4  
ATOM 2878  C CG2  . THR A 1 27 ? -0.695  -1.471  -5.834  1.00 15.00 ?  323 THR A CG2  4  
ATOM 2879  H H    . THR A 1 27 ? 1.542   -0.142  -6.724  1.00 15.00 ?  323 THR A H    4  
ATOM 2880  H HA   . THR A 1 27 ? 1.206   0.701   -3.956  1.00 15.00 ?  323 THR A HA   4  
ATOM 2881  H HB   . THR A 1 27 ? -0.819  0.591   -5.350  1.00 15.00 ?  323 THR A HB   4  
ATOM 2882  H HG1  . THR A 1 27 ? -1.939  -0.065  -3.662  1.00 15.00 ?  323 THR A HG1  4  
ATOM 2883  H HG21 . THR A 1 27 ? -0.348  -1.227  -6.826  1.00 15.00 ?  323 THR A HG21 4  
ATOM 2884  H HG22 . THR A 1 27 ? -1.760  -1.665  -5.857  1.00 15.00 ?  323 THR A HG22 4  
ATOM 2885  H HG23 . THR A 1 27 ? -0.177  -2.348  -5.476  1.00 15.00 ?  323 THR A HG23 4  
ATOM 2886  N N    . GLN A 1 28 ? 1.796   -1.402  -2.725  1.00 15.00 ?  324 GLN A N    4  
ATOM 2887  C CA   . GLN A 1 28 ? 2.560   -2.428  -2.037  1.00 15.00 ?  324 GLN A CA   4  
ATOM 2888  C C    . GLN A 1 28 ? 1.718   -3.268  -1.088  1.00 15.00 ?  324 GLN A C    4  
ATOM 2889  O O    . GLN A 1 28 ? 1.488   -2.873  0.046   1.00 15.00 ?  324 GLN A O    4  
ATOM 2890  C CB   . GLN A 1 28 ? 3.705   -1.805  -1.218  1.00 15.00 ?  324 GLN A CB   4  
ATOM 2891  C CG   . GLN A 1 28 ? 4.780   -1.080  -2.015  1.00 15.00 ?  324 GLN A CG   4  
ATOM 2892  C CD   . GLN A 1 28 ? 5.595   -1.991  -2.928  1.00 15.00 ?  324 GLN A CD   4  
ATOM 2893  O OE1  . GLN A 1 28 ? 6.795   -1.785  -3.102  1.00 15.00 ?  324 GLN A OE1  4  
ATOM 2894  N NE2  . GLN A 1 28 ? 4.959   -2.971  -3.553  1.00 15.00 ?  324 GLN A NE2  4  
ATOM 2895  H H    . GLN A 1 28 ? 1.337   -0.715  -2.197  1.00 15.00 ?  324 GLN A H    4  
ATOM 2896  H HA   . GLN A 1 28 ? 2.988   -3.075  -2.784  1.00 15.00 ?  324 GLN A HA   4  
ATOM 2897  H HB2  . GLN A 1 28 ? 3.279   -1.096  -0.527  1.00 15.00 ?  324 GLN A HB2  4  
ATOM 2898  H HB3  . GLN A 1 28 ? 4.186   -2.587  -0.648  1.00 15.00 ?  324 GLN A HB3  4  
ATOM 2899  H HG2  . GLN A 1 28 ? 4.307   -0.318  -2.616  1.00 15.00 ?  324 GLN A HG2  4  
ATOM 2900  H HG3  . GLN A 1 28 ? 5.456   -0.601  -1.314  1.00 15.00 ?  324 GLN A HG3  4  
ATOM 2901  H HE21 . GLN A 1 28 ? 3.997   -3.065  -3.410  1.00 15.00 ?  324 GLN A HE21 4  
ATOM 2902  H HE22 . GLN A 1 28 ? 5.480   -3.560  -4.140  1.00 15.00 ?  324 GLN A HE22 4  
ATOM 2903  N N    . PHE A 1 29 ? 1.272   -4.429  -1.554  1.00 15.00 ?  325 PHE A N    4  
ATOM 2904  C CA   . PHE A 1 29 ? 0.870   -5.503  -0.642  1.00 15.00 ?  325 PHE A CA   4  
ATOM 2905  C C    . PHE A 1 29 ? 2.120   -6.039  0.005   1.00 15.00 ?  325 PHE A C    4  
ATOM 2906  O O    . PHE A 1 29 ? 2.099   -6.869  0.910   1.00 15.00 ?  325 PHE A O    4  
ATOM 2907  C CB   . PHE A 1 29 ? 0.092   -6.607  -1.341  1.00 15.00 ?  325 PHE A CB   4  
ATOM 2908  C CG   . PHE A 1 29 ? -1.357  -6.277  -1.432  1.00 15.00 ?  325 PHE A CG   4  
ATOM 2909  C CD1  . PHE A 1 29 ? -1.980  -5.596  -0.398  1.00 15.00 ?  325 PHE A CD1  4  
ATOM 2910  C CD2  . PHE A 1 29 ? -2.092  -6.624  -2.548  1.00 15.00 ?  325 PHE A CD2  4  
ATOM 2911  C CE1  . PHE A 1 29 ? -3.317  -5.263  -0.491  1.00 15.00 ?  325 PHE A CE1  4  
ATOM 2912  C CE2  . PHE A 1 29 ? -3.430  -6.299  -2.638  1.00 15.00 ?  325 PHE A CE2  4  
ATOM 2913  C CZ   . PHE A 1 29 ? -4.041  -5.616  -1.610  1.00 15.00 ?  325 PHE A CZ   4  
ATOM 2914  H H    . PHE A 1 29 ? 1.213   -4.574  -2.520  1.00 15.00 ?  325 PHE A H    4  
ATOM 2915  H HA   . PHE A 1 29 ? 0.249   -5.062  0.126   1.00 15.00 ?  325 PHE A HA   4  
ATOM 2916  H HB2  . PHE A 1 29 ? 0.477   -6.741  -2.347  1.00 15.00 ?  325 PHE A HB2  4  
ATOM 2917  H HB3  . PHE A 1 29 ? 0.197   -7.528  -0.786  1.00 15.00 ?  325 PHE A HB3  4  
ATOM 2918  H HD1  . PHE A 1 29 ? -1.401  -5.319  0.505   1.00 15.00 ?  325 PHE A HD1  4  
ATOM 2919  H HD2  . PHE A 1 29 ? -1.612  -7.159  -3.353  1.00 15.00 ?  325 PHE A HD2  4  
ATOM 2920  H HE1  . PHE A 1 29 ? -3.798  -4.737  0.318   1.00 15.00 ?  325 PHE A HE1  4  
ATOM 2921  H HE2  . PHE A 1 29 ? -3.995  -6.576  -3.514  1.00 15.00 ?  325 PHE A HE2  4  
ATOM 2922  H HZ   . PHE A 1 29 ? -5.087  -5.357  -1.680  1.00 15.00 ?  325 PHE A HZ   4  
ATOM 2923  N N    . THR A 1 30 ? 3.209   -5.558  -0.543  1.00 15.00 ?  326 THR A N    4  
ATOM 2924  C CA   . THR A 1 30 ? 4.530   -5.863  -0.048  1.00 15.00 ?  326 THR A CA   4  
ATOM 2925  C C    . THR A 1 30 ? 4.814   -4.836  1.024   1.00 15.00 ?  326 THR A C    4  
ATOM 2926  O O    . THR A 1 30 ? 5.344   -3.755  0.745   1.00 15.00 ?  326 THR A O    4  
ATOM 2927  C CB   . THR A 1 30 ? 5.607   -5.757  -1.148  1.00 15.00 ?  326 THR A CB   4  
ATOM 2928  O OG1  . THR A 1 30 ? 5.243   -6.547  -2.284  1.00 15.00 ?  326 THR A OG1  4  
ATOM 2929  C CG2  . THR A 1 30 ? 6.963   -6.220  -0.634  1.00 15.00 ?  326 THR A CG2  4  
ATOM 2930  H H    . THR A 1 30 ? 3.088   -4.870  -1.229  1.00 15.00 ?  326 THR A H    4  
ATOM 2931  H HA   . THR A 1 30 ? 4.531   -6.863  0.365   1.00 15.00 ?  326 THR A HA   4  
ATOM 2932  H HB   . THR A 1 30 ? 5.689   -4.724  -1.449  1.00 15.00 ?  326 THR A HB   4  
ATOM 2933  H HG1  . THR A 1 30 ? 4.270   -6.625  -2.335  1.00 15.00 ?  326 THR A HG1  4  
ATOM 2934  H HG21 . THR A 1 30 ? 7.263   -5.601  0.198   1.00 15.00 ?  326 THR A HG21 4  
ATOM 2935  H HG22 . THR A 1 30 ? 7.693   -6.140  -1.426  1.00 15.00 ?  326 THR A HG22 4  
ATOM 2936  H HG23 . THR A 1 30 ? 6.893   -7.249  -0.311  1.00 15.00 ?  326 THR A HG23 4  
ATOM 2937  N N    . ASP A 1 31 ? 4.445   -5.155  2.239   1.00 15.00 ?  327 ASP A N    4  
ATOM 2938  C CA   . ASP A 1 31 ? 4.288   -4.149  3.247   1.00 15.00 ?  327 ASP A CA   4  
ATOM 2939  C C    . ASP A 1 31 ? 5.143   -4.349  4.440   1.00 15.00 ?  327 ASP A C    4  
ATOM 2940  O O    . ASP A 1 31 ? 5.510   -5.458  4.827   1.00 15.00 ?  327 ASP A O    4  
ATOM 2941  C CB   . ASP A 1 31 ? 2.852   -3.991  3.705   1.00 15.00 ?  327 ASP A CB   4  
ATOM 2942  C CG   . ASP A 1 31 ? 2.110   -5.300  3.911   1.00 15.00 ?  327 ASP A CG   4  
ATOM 2943  O OD1  . ASP A 1 31 ? 2.762   -6.308  4.247   1.00 15.00 ?  327 ASP A OD1  4  
ATOM 2944  O OD2  . ASP A 1 31 ? 0.869   -5.304  3.792   1.00 15.00 -1 327 ASP A OD2  4  
ATOM 2945  H H    . ASP A 1 31 ? 4.259   -6.093  2.471   1.00 15.00 ?  327 ASP A H    4  
ATOM 2946  H HA   . ASP A 1 31 ? 4.580   -3.212  2.797   1.00 15.00 ?  327 ASP A HA   4  
ATOM 2947  H HB2  . ASP A 1 31 ? 2.857   -3.466  4.652   1.00 15.00 ?  327 ASP A HB2  4  
ATOM 2948  H HB3  . ASP A 1 31 ? 2.344   -3.387  2.988   1.00 15.00 ?  327 ASP A HB3  4  
ATOM 2949  N N    . PRO A 1 32 ? 5.466   -3.222  5.037   1.00 15.00 ?  328 PRO A N    4  
ATOM 2950  C CA   . PRO A 1 32 ? 6.076   -3.170  6.339   1.00 15.00 ?  328 PRO A CA   4  
ATOM 2951  C C    . PRO A 1 32 ? 5.074   -3.735  7.362   1.00 15.00 ?  328 PRO A C    4  
ATOM 2952  O O    . PRO A 1 32 ? 5.413   -4.032  8.508   1.00 15.00 ?  328 PRO A O    4  
ATOM 2953  C CB   . PRO A 1 32 ? 6.378   -1.668  6.525   1.00 15.00 ?  328 PRO A CB   4  
ATOM 2954  C CG   . PRO A 1 32 ? 6.207   -1.067  5.156   1.00 15.00 ?  328 PRO A CG   4  
ATOM 2955  C CD   . PRO A 1 32 ? 5.163   -1.882  4.514   1.00 15.00 ?  328 PRO A CD   4  
ATOM 2956  H HA   . PRO A 1 32 ? 6.990   -3.745  6.373   1.00 15.00 ?  328 PRO A HA   4  
ATOM 2957  H HB2  . PRO A 1 32 ? 5.681   -1.243  7.233   1.00 15.00 ?  328 PRO A HB2  4  
ATOM 2958  H HB3  . PRO A 1 32 ? 7.387   -1.541  6.887   1.00 15.00 ?  328 PRO A HB3  4  
ATOM 2959  H HG2  . PRO A 1 32 ? 5.900   -0.032  5.230   1.00 15.00 ?  328 PRO A HG2  4  
ATOM 2960  H HG3  . PRO A 1 32 ? 7.104   -1.152  4.573   1.00 15.00 ?  328 PRO A HG3  4  
ATOM 2961  H HD2  . PRO A 1 32 ? 4.179   -1.554  4.818   1.00 15.00 ?  328 PRO A HD2  4  
ATOM 2962  H HD3  . PRO A 1 32 ? 5.265   -1.854  3.439   1.00 15.00 ?  328 PRO A HD3  4  
ATOM 2963  N N    . ARG A 1 33 ? 3.809   -3.849  6.907   1.00 15.00 ?  329 ARG A N    4  
ATOM 2964  C CA   . ARG A 1 33 ? 2.722   -4.455  7.677   1.00 15.00 ?  329 ARG A CA   4  
ATOM 2965  C C    . ARG A 1 33 ? 2.892   -5.967  7.820   1.00 15.00 ?  329 ARG A C    4  
ATOM 2966  O O    . ARG A 1 33 ? 2.235   -6.590  8.655   1.00 15.00 ?  329 ARG A O    4  
ATOM 2967  C CB   . ARG A 1 33 ? 1.349   -4.146  7.038   1.00 15.00 ?  329 ARG A CB   4  
ATOM 2968  C CG   . ARG A 1 33 ? 0.923   -2.690  7.170   1.00 15.00 ?  329 ARG A CG   4  
ATOM 2969  C CD   . ARG A 1 33 ? 0.805   -2.249  8.624   1.00 15.00 ?  329 ARG A CD   4  
ATOM 2970  N NE   . ARG A 1 33 ? 2.114   -2.058  9.251   1.00 15.00 ?  329 ARG A NE   4  
ATOM 2971  C CZ   . ARG A 1 33 ? 2.382   -2.350  10.522  1.00 15.00 ?  329 ARG A CZ   4  
ATOM 2972  N NH1  . ARG A 1 33 ? 1.423   -2.807  11.321  1.00 15.00 1  329 ARG A NH1  4  
ATOM 2973  N NH2  . ARG A 1 33 ? 3.606   -2.166  10.996  1.00 15.00 ?  329 ARG A NH2  4  
ATOM 2974  H H    . ARG A 1 33 ? 3.612   -3.529  6.002   1.00 15.00 ?  329 ARG A H    4  
ATOM 2975  H HA   . ARG A 1 33 ? 2.745   -4.017  8.665   1.00 15.00 ?  329 ARG A HA   4  
ATOM 2976  H HB2  . ARG A 1 33 ? 1.364   -4.404  5.963   1.00 15.00 ?  329 ARG A HB2  4  
ATOM 2977  H HB3  . ARG A 1 33 ? 0.603   -4.757  7.526   1.00 15.00 ?  329 ARG A HB3  4  
ATOM 2978  H HG2  . ARG A 1 33 ? 1.655   -2.067  6.679   1.00 15.00 ?  329 ARG A HG2  4  
ATOM 2979  H HG3  . ARG A 1 33 ? -0.037  -2.564  6.688   1.00 15.00 ?  329 ARG A HG3  4  
ATOM 2980  H HD2  . ARG A 1 33 ? 0.262   -1.317  8.662   1.00 15.00 ?  329 ARG A HD2  4  
ATOM 2981  H HD3  . ARG A 1 33 ? 0.262   -3.002  9.171   1.00 15.00 ?  329 ARG A HD3  4  
ATOM 2982  H HE   . ARG A 1 33 ? 2.833   -1.700  8.689   1.00 15.00 ?  329 ARG A HE   4  
ATOM 2983  H HH11 . ARG A 1 33 ? 0.488   -2.936  10.970  1.00 15.00 ?  329 ARG A HH11 4  
ATOM 2984  H HH12 . ARG A 1 33 ? 1.622   -3.023  12.281  1.00 15.00 ?  329 ARG A HH12 4  
ATOM 2985  H HH21 . ARG A 1 33 ? 4.334   -1.800  10.402  1.00 15.00 ?  329 ARG A HH21 4  
ATOM 2986  H HH22 . ARG A 1 33 ? 3.821   -2.405  11.954  1.00 15.00 ?  329 ARG A HH22 4  
ATOM 2987  N N    . LEU A 1 34 ? 3.772   -6.557  7.019   1.00 15.00 ?  330 LEU A N    4  
ATOM 2988  C CA   . LEU A 1 34 ? 4.013   -7.997  7.068   1.00 15.00 ?  330 LEU A CA   4  
ATOM 2989  C C    . LEU A 1 34 ? 4.601   -8.396  8.426   1.00 15.00 ?  330 LEU A C    4  
ATOM 2990  O O    . LEU A 1 34 ? 4.601   -9.568  8.803   1.00 15.00 ?  330 LEU A O    4  
ATOM 2991  C CB   . LEU A 1 34 ? 4.945   -8.408  5.912   1.00 15.00 ?  330 LEU A CB   4  
ATOM 2992  C CG   . LEU A 1 34 ? 4.885   -9.879  5.472   1.00 15.00 ?  330 LEU A CG   4  
ATOM 2993  C CD1  . LEU A 1 34 ? 5.306   -10.002 4.017   1.00 15.00 ?  330 LEU A CD1  4  
ATOM 2994  C CD2  . LEU A 1 34 ? 5.779   -10.754 6.341   1.00 15.00 ?  330 LEU A CD2  4  
ATOM 2995  H H    . LEU A 1 34 ? 4.248   -6.017  6.349   1.00 15.00 ?  330 LEU A H    4  
ATOM 2996  H HA   . LEU A 1 34 ? 3.061   -8.494  6.944   1.00 15.00 ?  330 LEU A HA   4  
ATOM 2997  H HB2  . LEU A 1 34 ? 4.704   -7.795  5.057   1.00 15.00 ?  330 LEU A HB2  4  
ATOM 2998  H HB3  . LEU A 1 34 ? 5.961   -8.189  6.209   1.00 15.00 ?  330 LEU A HB3  4  
ATOM 2999  H HG   . LEU A 1 34 ? 3.869   -10.238 5.559   1.00 15.00 ?  330 LEU A HG   4  
ATOM 3000  H HD11 . LEU A 1 34 ? 4.657   -9.396  3.402   1.00 15.00 ?  330 LEU A HD11 4  
ATOM 3001  H HD12 . LEU A 1 34 ? 5.237   -11.034 3.706   1.00 15.00 ?  330 LEU A HD12 4  
ATOM 3002  H HD13 . LEU A 1 34 ? 6.326   -9.662  3.908   1.00 15.00 ?  330 LEU A HD13 4  
ATOM 3003  H HD21 . LEU A 1 34 ? 5.702   -11.781 6.015   1.00 15.00 ?  330 LEU A HD21 4  
ATOM 3004  H HD22 . LEU A 1 34 ? 5.465   -10.678 7.372   1.00 15.00 ?  330 LEU A HD22 4  
ATOM 3005  H HD23 . LEU A 1 34 ? 6.803   -10.423 6.252   1.00 15.00 ?  330 LEU A HD23 4  
ATOM 3006  N N    . SER A 1 35 ? 5.091   -7.412  9.169   1.00 15.00 ?  331 SER A N    4  
ATOM 3007  C CA   . SER A 1 35 ? 5.675   -7.664  10.478  1.00 15.00 ?  331 SER A CA   4  
ATOM 3008  C C    . SER A 1 35 ? 4.609   -7.633  11.576  1.00 15.00 ?  331 SER A C    4  
ATOM 3009  O O    . SER A 1 35 ? 4.883   -7.987  12.723  1.00 15.00 ?  331 SER A O    4  
ATOM 3010  C CB   . SER A 1 35 ? 6.772   -6.638  10.774  1.00 15.00 ?  331 SER A CB   4  
ATOM 3011  O OG   . SER A 1 35 ? 7.418   -6.917  12.005  1.00 15.00 ?  331 SER A OG   4  
ATOM 3012  H H    . SER A 1 35 ? 5.060   -6.493  8.827   1.00 15.00 ?  331 SER A H    4  
ATOM 3013  H HA   . SER A 1 35 ? 6.117   -8.648  10.454  1.00 15.00 ?  331 SER A HA   4  
ATOM 3014  H HB2  . SER A 1 35 ? 7.509   -6.665  9.986   1.00 15.00 ?  331 SER A HB2  4  
ATOM 3015  H HB3  . SER A 1 35 ? 6.336   -5.652  10.825  1.00 15.00 ?  331 SER A HB3  4  
ATOM 3016  H HG   . SER A 1 35 ? 6.811   -7.403  12.580  1.00 15.00 ?  331 SER A HG   4  
ATOM 3017  N N    . ALA A 1 36 ? 3.402   -7.199  11.226  1.00 15.00 ?  332 ALA A N    4  
ATOM 3018  C CA   . ALA A 1 36 ? 2.329   -7.052  12.205  1.00 15.00 ?  332 ALA A CA   4  
ATOM 3019  C C    . ALA A 1 36 ? 1.791   -8.408  12.653  1.00 15.00 ?  332 ALA A C    4  
ATOM 3020  O O    . ALA A 1 36 ? 1.373   -8.570  13.799  1.00 15.00 ?  332 ALA A O    4  
ATOM 3021  C CB   . ALA A 1 36 ? 1.206   -6.201  11.637  1.00 15.00 ?  332 ALA A CB   4  
ATOM 3022  H H    . ALA A 1 36 ? 3.223   -6.984  10.284  1.00 15.00 ?  332 ALA A H    4  
ATOM 3023  H HA   . ALA A 1 36 ? 2.734   -6.540  13.064  1.00 15.00 ?  332 ALA A HA   4  
ATOM 3024  H HB1  . ALA A 1 36 ? 0.454   -6.042  12.396  1.00 15.00 ?  332 ALA A HB1  4  
ATOM 3025  H HB2  . ALA A 1 36 ? 0.763   -6.705  10.791  1.00 15.00 ?  332 ALA A HB2  4  
ATOM 3026  H HB3  . ALA A 1 36 ? 1.602   -5.247  11.320  1.00 15.00 ?  332 ALA A HB3  4  
ATOM 3027  N N    . ASN A 1 37 ? 1.791   -9.374  11.746  1.00 15.00 ?  333 ASN A N    4  
ATOM 3028  C CA   . ASN A 1 37 ? 1.300   -10.709 12.065  1.00 15.00 ?  333 ASN A CA   4  
ATOM 3029  C C    . ASN A 1 37 ? 2.456   -11.668 12.325  1.00 15.00 ?  333 ASN A C    4  
ATOM 3030  O O    . ASN A 1 37 ? 3.268   -11.897 11.406  1.00 15.00 ?  333 ASN A O    4  
ATOM 3031  C CB   . ASN A 1 37 ? 0.350   -11.243 10.971  1.00 15.00 ?  333 ASN A CB   4  
ATOM 3032  C CG   . ASN A 1 37 ? 0.803   -10.982 9.537   1.00 15.00 ?  333 ASN A CG   4  
ATOM 3033  O OD1  . ASN A 1 37 ? -0.023  -10.757 8.653   1.00 15.00 ?  333 ASN A OD1  4  
ATOM 3034  N ND2  . ASN A 1 37 ? 2.097   -11.042 9.281   1.00 15.00 ?  333 ASN A ND2  4  
ATOM 3035  O OXT  . ASN A 1 37 ? 2.557   -12.179 13.455  1.00 15.00 ?  333 ASN A OXT  4  
ATOM 3036  H H    . ASN A 1 37 ? 2.136   -9.192  10.847  1.00 15.00 ?  333 ASN A H    4  
ATOM 3037  H HA   . ASN A 1 37 ? 0.736   -10.621 12.982  1.00 15.00 ?  333 ASN A HA   4  
ATOM 3038  H HB2  . ASN A 1 37 ? 0.246   -12.310 11.095  1.00 15.00 ?  333 ASN A HB2  4  
ATOM 3039  H HB3  . ASN A 1 37 ? -0.621  -10.784 11.106  1.00 15.00 ?  333 ASN A HB3  4  
ATOM 3040  H HD21 . ASN A 1 37 ? 2.712   -11.258 10.028  1.00 15.00 ?  333 ASN A HD21 4  
ATOM 3041  H HD22 . ASN A 1 37 ? 2.398   -10.869 8.365   1.00 15.00 ?  333 ASN A HD22 4  
ATOM 3042  N N    . GLU B 2 1  ? 2.116   -8.279  -7.917  1.00 15.00 ?  203 GLU B N    4  
ATOM 3043  C CA   . GLU B 2 1  ? 2.270   -8.724  -6.517  1.00 15.00 ?  203 GLU B CA   4  
ATOM 3044  C C    . GLU B 2 1  ? 2.174   -10.247 -6.445  1.00 15.00 ?  203 GLU B C    4  
ATOM 3045  O O    . GLU B 2 1  ? 1.469   -10.866 -7.242  1.00 15.00 ?  203 GLU B O    4  
ATOM 3046  C CB   . GLU B 2 1  ? 1.181   -8.072  -5.651  1.00 15.00 ?  203 GLU B CB   4  
ATOM 3047  C CG   . GLU B 2 1  ? 1.301   -8.386  -4.173  1.00 15.00 ?  203 GLU B CG   4  
ATOM 3048  C CD   . GLU B 2 1  ? 2.666   -8.039  -3.626  1.00 15.00 ?  203 GLU B CD   4  
ATOM 3049  O OE1  . GLU B 2 1  ? 2.862   -6.887  -3.196  1.00 15.00 ?  203 GLU B OE1  4  
ATOM 3050  O OE2  . GLU B 2 1  ? 3.553   -8.920  -3.645  1.00 15.00 -1 203 GLU B OE2  4  
ATOM 3051  H H1   . GLU B 2 1  ? 2.229   -7.246  -7.982  1.00 15.00 ?  203 GLU B H1   4  
ATOM 3052  H H2   . GLU B 2 1  ? 1.168   -8.535  -8.266  1.00 15.00 ?  203 GLU B H2   4  
ATOM 3053  H H3   . GLU B 2 1  ? 2.830   -8.736  -8.523  1.00 15.00 ?  203 GLU B H3   4  
ATOM 3054  H HA   . GLU B 2 1  ? 3.243   -8.415  -6.163  1.00 15.00 ?  203 GLU B HA   4  
ATOM 3055  H HB2  . GLU B 2 1  ? 1.236   -7.000  -5.766  1.00 15.00 ?  203 GLU B HB2  4  
ATOM 3056  H HB3  . GLU B 2 1  ? 0.215   -8.411  -5.991  1.00 15.00 ?  203 GLU B HB3  4  
ATOM 3057  H HG2  . GLU B 2 1  ? 0.557   -7.819  -3.634  1.00 15.00 ?  203 GLU B HG2  4  
ATOM 3058  H HG3  . GLU B 2 1  ? 1.126   -9.442  -4.025  1.00 15.00 ?  203 GLU B HG3  4  
ATOM 3059  N N    . LEU B 2 2  ? 2.882   -10.844 -5.491  1.00 15.00 ?  204 LEU B N    4  
ATOM 3060  C CA   . LEU B 2 2  ? 2.818   -12.287 -5.276  1.00 15.00 ?  204 LEU B CA   4  
ATOM 3061  C C    . LEU B 2 2  ? 1.461   -12.631 -4.669  1.00 15.00 ?  204 LEU B C    4  
ATOM 3062  O O    . LEU B 2 2  ? 0.924   -13.720 -4.862  1.00 15.00 ?  204 LEU B O    4  
ATOM 3063  C CB   . LEU B 2 2  ? 3.976   -12.734 -4.361  1.00 15.00 ?  204 LEU B CB   4  
ATOM 3064  C CG   . LEU B 2 2  ? 4.272   -14.245 -4.287  1.00 15.00 ?  204 LEU B CG   4  
ATOM 3065  C CD1  . LEU B 2 2  ? 3.274   -14.972 -3.393  1.00 15.00 ?  204 LEU B CD1  4  
ATOM 3066  C CD2  . LEU B 2 2  ? 4.285   -14.858 -5.678  1.00 15.00 ?  204 LEU B CD2  4  
ATOM 3067  H H    . LEU B 2 2  ? 3.451   -10.296 -4.902  1.00 15.00 ?  204 LEU B H    4  
ATOM 3068  H HA   . LEU B 2 2  ? 2.910   -12.774 -6.237  1.00 15.00 ?  204 LEU B HA   4  
ATOM 3069  H HB2  . LEU B 2 2  ? 4.874   -12.239 -4.698  1.00 15.00 ?  204 LEU B HB2  4  
ATOM 3070  H HB3  . LEU B 2 2  ? 3.757   -12.388 -3.362  1.00 15.00 ?  204 LEU B HB3  4  
ATOM 3071  H HG   . LEU B 2 2  ? 5.253   -14.383 -3.858  1.00 15.00 ?  204 LEU B HG   4  
ATOM 3072  H HD11 . LEU B 2 2  ? 3.330   -14.572 -2.391  1.00 15.00 ?  204 LEU B HD11 4  
ATOM 3073  H HD12 . LEU B 2 2  ? 3.509   -16.025 -3.375  1.00 15.00 ?  204 LEU B HD12 4  
ATOM 3074  H HD13 . LEU B 2 2  ? 2.275   -14.831 -3.781  1.00 15.00 ?  204 LEU B HD13 4  
ATOM 3075  H HD21 . LEU B 2 2  ? 3.320   -14.718 -6.142  1.00 15.00 ?  204 LEU B HD21 4  
ATOM 3076  H HD22 . LEU B 2 2  ? 4.500   -15.914 -5.605  1.00 15.00 ?  204 LEU B HD22 4  
ATOM 3077  H HD23 . LEU B 2 2  ? 5.045   -14.377 -6.274  1.00 15.00 ?  204 LEU B HD23 4  
ATOM 3078  N N    . GLU B 2 3  ? 0.929   -11.678 -3.920  1.00 15.00 ?  205 GLU B N    4  
ATOM 3079  C CA   . GLU B 2 3  ? -0.414  -11.768 -3.376  1.00 15.00 ?  205 GLU B CA   4  
ATOM 3080  C C    . GLU B 2 3  ? -1.409  -11.303 -4.445  1.00 15.00 ?  205 GLU B C    4  
ATOM 3081  O O    . GLU B 2 3  ? -1.002  -10.785 -5.487  1.00 15.00 ?  205 GLU B O    4  
ATOM 3082  C CB   . GLU B 2 3  ? -0.493  -10.904 -2.100  1.00 15.00 ?  205 GLU B CB   4  
ATOM 3083  C CG   . GLU B 2 3  ? -1.853  -10.867 -1.407  1.00 15.00 ?  205 GLU B CG   4  
ATOM 3084  C CD   . GLU B 2 3  ? -2.408  -12.242 -1.102  1.00 15.00 ?  205 GLU B CD   4  
ATOM 3085  O OE1  . GLU B 2 3  ? -1.963  -12.870 -0.118  1.00 15.00 ?  205 GLU B OE1  4  
ATOM 3086  O OE2  . GLU B 2 3  ? -3.308  -12.693 -1.842  1.00 15.00 -1 205 GLU B OE2  4  
ATOM 3087  H H    . GLU B 2 3  ? 1.458   -10.876 -3.734  1.00 15.00 ?  205 GLU B H    4  
ATOM 3088  H HA   . GLU B 2 3  ? -0.611  -12.801 -3.129  1.00 15.00 ?  205 GLU B HA   4  
ATOM 3089  H HB2  . GLU B 2 3  ? 0.227   -11.278 -1.388  1.00 15.00 ?  205 GLU B HB2  4  
ATOM 3090  H HB3  . GLU B 2 3  ? -0.224  -9.890  -2.359  1.00 15.00 ?  205 GLU B HB3  4  
ATOM 3091  H HG2  . GLU B 2 3  ? -1.753  -10.326 -0.478  1.00 15.00 ?  205 GLU B HG2  4  
ATOM 3092  H HG3  . GLU B 2 3  ? -2.551  -10.348 -2.047  1.00 15.00 ?  205 GLU B HG3  4  
ATOM 3093  N N    . SER B 2 4  ? -2.696  -11.499 -4.187  1.00 15.00 ?  206 SER B N    4  
ATOM 3094  C CA   . SER B 2 4  ? -3.754  -11.073 -5.097  1.00 15.00 ?  206 SER B CA   4  
ATOM 3095  C C    . SER B 2 4  ? -3.584  -9.632  -5.549  1.00 15.00 ?  206 SER B C    4  
ATOM 3096  O O    . SER B 2 4  ? -3.118  -8.762  -4.812  1.00 15.00 ?  206 SER B O    4  
ATOM 3097  C CB   . SER B 2 4  ? -5.111  -11.266 -4.443  1.00 15.00 ?  206 SER B CB   4  
ATOM 3098  O OG   . SER B 2 4  ? -5.075  -10.963 -3.056  1.00 15.00 ?  206 SER B OG   4  
ATOM 3099  H H    . SER B 2 4  ? -2.947  -11.950 -3.349  1.00 15.00 ?  206 SER B H    4  
ATOM 3100  H HA   . SER B 2 4  ? -3.730  -11.693 -5.984  1.00 15.00 ?  206 SER B HA   4  
ATOM 3101  H HB2  . SER B 2 4  ? -5.821  -10.617 -4.932  1.00 15.00 ?  206 SER B HB2  4  
ATOM 3102  H HB3  . SER B 2 4  ? -5.415  -12.289 -4.580  1.00 15.00 ?  206 SER B HB3  4  
ATOM 3103  H HG   . SER B 2 4  ? -4.546  -11.634 -2.593  1.00 15.00 ?  206 SER B HG   4  
ATOM 3104  N N    . PRO B 2 5  ? -4.027  -9.407  -6.782  1.00 15.00 ?  207 PRO B N    4  
ATOM 3105  C CA   . PRO B 2 5  ? -3.894  -8.142  -7.507  1.00 15.00 ?  207 PRO B CA   4  
ATOM 3106  C C    . PRO B 2 5  ? -4.324  -6.937  -6.673  1.00 15.00 ?  207 PRO B C    4  
ATOM 3107  O O    . PRO B 2 5  ? -5.471  -6.859  -6.226  1.00 15.00 ?  207 PRO B O    4  
ATOM 3108  C CB   . PRO B 2 5  ? -4.846  -8.316  -8.694  1.00 15.00 ?  207 PRO B CB   4  
ATOM 3109  C CG   . PRO B 2 5  ? -4.998  -9.791  -8.886  1.00 15.00 ?  207 PRO B CG   4  
ATOM 3110  C CD   . PRO B 2 5  ? -4.673  -10.450 -7.570  1.00 15.00 ?  207 PRO B CD   4  
ATOM 3111  H HA   . PRO B 2 5  ? -2.891  -7.997  -7.871  1.00 15.00 ?  207 PRO B HA   4  
ATOM 3112  H HB2  . PRO B 2 5  ? -5.795  -7.851  -8.466  1.00 15.00 ?  207 PRO B HB2  4  
ATOM 3113  H HB3  . PRO B 2 5  ? -4.417  -7.849  -9.569  1.00 15.00 ?  207 PRO B HB3  4  
ATOM 3114  H HG2  . PRO B 2 5  ? -6.014  -10.016 -9.172  1.00 15.00 ?  207 PRO B HG2  4  
ATOM 3115  H HG3  . PRO B 2 5  ? -4.313  -10.129 -9.650  1.00 15.00 ?  207 PRO B HG3  4  
ATOM 3116  H HD2  . PRO B 2 5  ? -5.554  -10.799 -7.066  1.00 15.00 ?  207 PRO B HD2  4  
ATOM 3117  H HD3  . PRO B 2 5  ? -4.003  -11.277 -7.707  1.00 15.00 ?  207 PRO B HD3  4  
ATOM 3118  N N    . PRO B 2 6  ? -3.402  -5.988  -6.435  1.00 15.00 ?  208 PRO B N    4  
ATOM 3119  C CA   . PRO B 2 6  ? -3.660  -4.836  -5.586  1.00 15.00 ?  208 PRO B CA   4  
ATOM 3120  C C    . PRO B 2 6  ? -4.338  -3.680  -6.319  1.00 15.00 ?  208 PRO B C    4  
ATOM 3121  O O    . PRO B 2 6  ? -4.348  -3.628  -7.553  1.00 15.00 ?  208 PRO B O    4  
ATOM 3122  C CB   . PRO B 2 6  ? -2.263  -4.421  -5.103  1.00 15.00 ?  208 PRO B CB   4  
ATOM 3123  C CG   . PRO B 2 6  ? -1.270  -5.198  -5.915  1.00 15.00 ?  208 PRO B CG   4  
ATOM 3124  C CD   . PRO B 2 6  ? -2.033  -5.963  -6.964  1.00 15.00 ?  208 PRO B CD   4  
ATOM 3125  H HA   . PRO B 2 6  ? -4.264  -5.108  -4.734  1.00 15.00 ?  208 PRO B HA   4  
ATOM 3126  H HB2  . PRO B 2 6  ? -2.137  -3.358  -5.247  1.00 15.00 ?  208 PRO B HB2  4  
ATOM 3127  H HB3  . PRO B 2 6  ? -2.174  -4.654  -4.046  1.00 15.00 ?  208 PRO B HB3  4  
ATOM 3128  H HG2  . PRO B 2 6  ? -0.576  -4.518  -6.387  1.00 15.00 ?  208 PRO B HG2  4  
ATOM 3129  H HG3  . PRO B 2 6  ? -0.735  -5.884  -5.272  1.00 15.00 ?  208 PRO B HG3  4  
ATOM 3130  H HD2  . PRO B 2 6  ? -1.993  -5.447  -7.913  1.00 15.00 ?  208 PRO B HD2  4  
ATOM 3131  H HD3  . PRO B 2 6  ? -1.633  -6.959  -7.056  1.00 15.00 ?  208 PRO B HD3  4  
ATOM 3132  N N    . PRO B 2 7  ? -4.910  -2.739  -5.541  1.00 15.00 ?  209 PRO B N    4  
ATOM 3133  C CA   . PRO B 2 7  ? -5.576  -1.545  -6.069  1.00 15.00 ?  209 PRO B CA   4  
ATOM 3134  C C    . PRO B 2 7  ? -4.709  -0.774  -7.065  1.00 15.00 ?  209 PRO B C    4  
ATOM 3135  O O    . PRO B 2 7  ? -3.541  -0.495  -6.789  1.00 15.00 ?  209 PRO B O    4  
ATOM 3136  C CB   . PRO B 2 7  ? -5.812  -0.675  -4.829  1.00 15.00 ?  209 PRO B CB   4  
ATOM 3137  C CG   . PRO B 2 7  ? -5.718  -1.580  -3.651  1.00 15.00 ?  209 PRO B CG   4  
ATOM 3138  C CD   . PRO B 2 7  ? -4.945  -2.795  -4.068  1.00 15.00 ?  209 PRO B CD   4  
ATOM 3139  H HA   . PRO B 2 7  ? -6.523  -1.788  -6.528  1.00 15.00 ?  209 PRO B HA   4  
ATOM 3140  H HB2  . PRO B 2 7  ? -5.059  0.097   -4.785  1.00 15.00 ?  209 PRO B HB2  4  
ATOM 3141  H HB3  . PRO B 2 7  ? -6.789  -0.219  -4.889  1.00 15.00 ?  209 PRO B HB3  4  
ATOM 3142  H HG2  . PRO B 2 7  ? -5.195  -1.074  -2.854  1.00 15.00 ?  209 PRO B HG2  4  
ATOM 3143  H HG3  . PRO B 2 7  ? -6.710  -1.859  -3.327  1.00 15.00 ?  209 PRO B HG3  4  
ATOM 3144  H HD2  . PRO B 2 7  ? -3.945  -2.754  -3.663  1.00 15.00 ?  209 PRO B HD2  4  
ATOM 3145  H HD3  . PRO B 2 7  ? -5.449  -3.689  -3.731  1.00 15.00 ?  209 PRO B HD3  4  
ATOM 3146  N N    . PRO B 2 8  ? -5.279  -0.421  -8.235  1.00 15.00 ?  210 PRO B N    4  
ATOM 3147  C CA   . PRO B 2 8  ? -4.594  0.397   -9.252  1.00 15.00 ?  210 PRO B CA   4  
ATOM 3148  C C    . PRO B 2 8  ? -4.031  1.681   -8.646  1.00 15.00 ?  210 PRO B C    4  
ATOM 3149  O O    . PRO B 2 8  ? -4.675  2.297   -7.791  1.00 15.00 ?  210 PRO B O    4  
ATOM 3150  C CB   . PRO B 2 8  ? -5.709  0.713   -10.249 1.00 15.00 ?  210 PRO B CB   4  
ATOM 3151  C CG   . PRO B 2 8  ? -6.668  -0.417  -10.108 1.00 15.00 ?  210 PRO B CG   4  
ATOM 3152  C CD   . PRO B 2 8  ? -6.639  -0.798  -8.656  1.00 15.00 ?  210 PRO B CD   4  
ATOM 3153  H HA   . PRO B 2 8  ? -3.804  -0.151  -9.741  1.00 15.00 ?  210 PRO B HA   4  
ATOM 3154  H HB2  . PRO B 2 8  ? -6.169  1.658   -9.994  1.00 15.00 ?  210 PRO B HB2  4  
ATOM 3155  H HB3  . PRO B 2 8  ? -5.302  0.761   -11.247 1.00 15.00 ?  210 PRO B HB3  4  
ATOM 3156  H HG2  . PRO B 2 8  ? -7.659  -0.098  -10.393 1.00 15.00 ?  210 PRO B HG2  4  
ATOM 3157  H HG3  . PRO B 2 8  ? -6.346  -1.247  -10.719 1.00 15.00 ?  210 PRO B HG3  4  
ATOM 3158  H HD2  . PRO B 2 8  ? -7.382  -0.241  -8.105  1.00 15.00 ?  210 PRO B HD2  4  
ATOM 3159  H HD3  . PRO B 2 8  ? -6.798  -1.859  -8.540  1.00 15.00 ?  210 PRO B HD3  4  
ATOM 3160  N N    . TYR B 2 9  ? -2.850  2.098   -9.103  1.00 15.00 ?  211 TYR B N    4  
ATOM 3161  C CA   . TYR B 2 9  ? -2.123  3.179   -8.447  1.00 15.00 ?  211 TYR B CA   4  
ATOM 3162  C C    . TYR B 2 9  ? -2.890  4.498   -8.462  1.00 15.00 ?  211 TYR B C    4  
ATOM 3163  O O    . TYR B 2 9  ? -2.910  5.224   -9.459  1.00 15.00 ?  211 TYR B O    4  
ATOM 3164  C CB   . TYR B 2 9  ? -0.735  3.397   -9.048  1.00 15.00 ?  211 TYR B CB   4  
ATOM 3165  C CG   . TYR B 2 9  ? 0.112   4.343   -8.212  1.00 15.00 ?  211 TYR B CG   4  
ATOM 3166  C CD1  . TYR B 2 9  ? 0.391   4.047   -6.881  1.00 15.00 ?  211 TYR B CD1  4  
ATOM 3167  C CD2  . TYR B 2 9  ? 0.629   5.526   -8.739  1.00 15.00 ?  211 TYR B CD2  4  
ATOM 3168  C CE1  . TYR B 2 9  ? 1.154   4.892   -6.106  1.00 15.00 ?  211 TYR B CE1  4  
ATOM 3169  C CE2  . TYR B 2 9  ? 1.396   6.379   -7.957  1.00 15.00 ?  211 TYR B CE2  4  
ATOM 3170  C CZ   . TYR B 2 9  ? 1.652   6.052   -6.643  1.00 15.00 ?  211 TYR B CZ   4  
ATOM 3171  O OH   . TYR B 2 9  ? 2.424   6.881   -5.861  1.00 15.00 ?  211 TYR B OH   4  
ATOM 3172  H H    . TYR B 2 9  ? -2.464  1.670   -9.901  1.00 15.00 ?  211 TYR B H    4  
ATOM 3173  H HA   . TYR B 2 9  ? -1.989  2.880   -7.418  1.00 15.00 ?  211 TYR B HA   4  
ATOM 3174  H HB2  . TYR B 2 9  ? -0.222  2.450   -9.112  1.00 15.00 ?  211 TYR B HB2  4  
ATOM 3175  H HB3  . TYR B 2 9  ? -0.837  3.820   -10.037 1.00 15.00 ?  211 TYR B HB3  4  
ATOM 3176  H HD1  . TYR B 2 9  ? -0.004  3.141   -6.449  1.00 15.00 ?  211 TYR B HD1  4  
ATOM 3177  H HD2  . TYR B 2 9  ? 0.429   5.778   -9.770  1.00 15.00 ?  211 TYR B HD2  4  
ATOM 3178  H HE1  . TYR B 2 9  ? 1.357   4.639   -5.077  1.00 15.00 ?  211 TYR B HE1  4  
ATOM 3179  H HE2  . TYR B 2 9  ? 1.792   7.293   -8.376  1.00 15.00 ?  211 TYR B HE2  4  
ATOM 3180  H HH   . TYR B 2 9  ? 3.160   6.370   -5.496  1.00 15.00 ?  211 TYR B HH   4  
ATOM 3181  N N    . SER B 2 10 ? -3.558  4.762   -7.360  1.00 15.00 ?  212 SER B N    4  
ATOM 3182  C CA   . SER B 2 10 ? -4.108  6.061   -7.059  1.00 15.00 ?  212 SER B CA   4  
ATOM 3183  C C    . SER B 2 10 ? -3.308  6.610   -5.891  1.00 15.00 ?  212 SER B C    4  
ATOM 3184  O O    . SER B 2 10 ? -2.797  5.817   -5.097  1.00 15.00 ?  212 SER B O    4  
ATOM 3185  C CB   . SER B 2 10 ? -5.583  5.924   -6.689  1.00 15.00 ?  212 SER B CB   4  
ATOM 3186  O OG   . SER B 2 10 ? -6.256  5.073   -7.604  1.00 15.00 ?  212 SER B OG   4  
ATOM 3187  H H    . SER B 2 10 ? -3.705  4.040   -6.714  1.00 15.00 ?  212 SER B H    4  
ATOM 3188  H HA   . SER B 2 10 ? -3.992  6.703   -7.921  1.00 15.00 ?  212 SER B HA   4  
ATOM 3189  H HB2  . SER B 2 10 ? -5.667  5.505   -5.697  1.00 15.00 ?  212 SER B HB2  4  
ATOM 3190  H HB3  . SER B 2 10 ? -6.051  6.898   -6.711  1.00 15.00 ?  212 SER B HB3  4  
ATOM 3191  H HG   . SER B 2 10 ? -5.661  4.363   -7.877  1.00 15.00 ?  212 SER B HG   4  
ATOM 3192  N N    . ARG B 2 11 ? -3.162  7.925   -5.777  1.00 15.00 ?  213 ARG B N    4  
ATOM 3193  C CA   . ARG B 2 11 ? -2.386  8.468   -4.671  1.00 15.00 ?  213 ARG B CA   4  
ATOM 3194  C C    . ARG B 2 11 ? -3.025  8.027   -3.368  1.00 15.00 ?  213 ARG B C    4  
ATOM 3195  O O    . ARG B 2 11 ? -2.393  7.390   -2.530  1.00 15.00 ?  213 ARG B O    4  
ATOM 3196  C CB   . ARG B 2 11 ? -2.341  10.001  -4.665  1.00 15.00 ?  213 ARG B CB   4  
ATOM 3197  C CG   . ARG B 2 11 ? -1.884  10.655  -5.940  1.00 15.00 ?  213 ARG B CG   4  
ATOM 3198  C CD   . ARG B 2 11 ? -1.649  12.145  -5.745  1.00 15.00 ?  213 ARG B CD   4  
ATOM 3199  N NE   . ARG B 2 11 ? -2.868  12.851  -5.345  1.00 15.00 ?  213 ARG B NE   4  
ATOM 3200  C CZ   . ARG B 2 11 ? -2.876  13.960  -4.600  1.00 15.00 ?  213 ARG B CZ   4  
ATOM 3201  N NH1  . ARG B 2 11 ? -1.737  14.471  -4.151  1.00 15.00 1  213 ARG B NH1  4  
ATOM 3202  N NH2  . ARG B 2 11 ? -4.025  14.552  -4.295  1.00 15.00 ?  213 ARG B NH2  4  
ATOM 3203  H H    . ARG B 2 11 ? -3.586  8.529   -6.433  1.00 15.00 ?  213 ARG B H    4  
ATOM 3204  H HA   . ARG B 2 11 ? -1.381  8.074   -4.730  1.00 15.00 ?  213 ARG B HA   4  
ATOM 3205  H HB2  . ARG B 2 11 ? -3.333  10.368  -4.448  1.00 15.00 ?  213 ARG B HB2  4  
ATOM 3206  H HB3  . ARG B 2 11 ? -1.680  10.318  -3.871  1.00 15.00 ?  213 ARG B HB3  4  
ATOM 3207  H HG2  . ARG B 2 11 ? -0.970  10.193  -6.264  1.00 15.00 ?  213 ARG B HG2  4  
ATOM 3208  H HG3  . ARG B 2 11 ? -2.649  10.522  -6.677  1.00 15.00 ?  213 ARG B HG3  4  
ATOM 3209  H HD2  . ARG B 2 11 ? -0.900  12.281  -4.980  1.00 15.00 ?  213 ARG B HD2  4  
ATOM 3210  H HD3  . ARG B 2 11 ? -1.290  12.562  -6.675  1.00 15.00 ?  213 ARG B HD3  4  
ATOM 3211  H HE   . ARG B 2 11 ? -3.725  12.481  -5.656  1.00 15.00 ?  213 ARG B HE   4  
ATOM 3212  H HH11 . ARG B 2 11 ? -0.863  14.026  -4.361  1.00 15.00 ?  213 ARG B HH11 4  
ATOM 3213  H HH12 . ARG B 2 11 ? -1.743  15.317  -3.601  1.00 15.00 ?  213 ARG B HH12 4  
ATOM 3214  H HH21 . ARG B 2 11 ? -4.900  14.175  -4.627  1.00 15.00 ?  213 ARG B HH21 4  
ATOM 3215  H HH22 . ARG B 2 11 ? -4.028  15.378  -3.719  1.00 15.00 ?  213 ARG B HH22 4  
ATOM 3216  N N    . TYR B 2 12 ? -4.276  8.413   -3.195  1.00 15.00 ?  214 TYR B N    4  
ATOM 3217  C CA   . TYR B 2 12 ? -5.049  8.024   -2.035  1.00 15.00 ?  214 TYR B CA   4  
ATOM 3218  C C    . TYR B 2 12 ? -6.282  7.258   -2.491  1.00 15.00 ?  214 TYR B C    4  
ATOM 3219  O O    . TYR B 2 12 ? -7.367  7.825   -2.640  1.00 15.00 ?  214 TYR B O    4  
ATOM 3220  C CB   . TYR B 2 12 ? -5.395  9.271   -1.204  1.00 15.00 ?  214 TYR B CB   4  
ATOM 3221  C CG   . TYR B 2 12 ? -4.196  10.186  -1.039  1.00 15.00 ?  214 TYR B CG   4  
ATOM 3222  C CD1  . TYR B 2 12 ? -3.746  10.958  -2.106  1.00 15.00 ?  214 TYR B CD1  4  
ATOM 3223  C CD2  . TYR B 2 12 ? -3.479  10.229  0.146   1.00 15.00 ?  214 TYR B CD2  4  
ATOM 3224  C CE1  . TYR B 2 12 ? -2.621  11.739  -2.004  1.00 15.00 ?  214 TYR B CE1  4  
ATOM 3225  C CE2  . TYR B 2 12 ? -2.353  11.024  0.263   1.00 15.00 ?  214 TYR B CE2  4  
ATOM 3226  C CZ   . TYR B 2 12 ? -1.926  11.772  -0.815  1.00 15.00 ?  214 TYR B CZ   4  
ATOM 3227  O OH   . TYR B 2 12 ? -0.786  12.536  -0.700  1.00 15.00 ?  214 TYR B OH   4  
ATOM 3228  H H    . TYR B 2 12 ? -4.700  8.980   -3.880  1.00 15.00 ?  214 TYR B H    4  
ATOM 3229  H HA   . TYR B 2 12 ? -4.439  7.349   -1.439  1.00 15.00 ?  214 TYR B HA   4  
ATOM 3230  H HB2  . TYR B 2 12 ? -6.181  9.825   -1.700  1.00 15.00 ?  214 TYR B HB2  4  
ATOM 3231  H HB3  . TYR B 2 12 ? -5.727  8.968   -0.223  1.00 15.00 ?  214 TYR B HB3  4  
ATOM 3232  H HD1  . TYR B 2 12 ? -4.291  10.932  -3.041  1.00 15.00 ?  214 TYR B HD1  4  
ATOM 3233  H HD2  . TYR B 2 12 ? -3.815  9.641   0.987   1.00 15.00 ?  214 TYR B HD2  4  
ATOM 3234  H HE1  . TYR B 2 12 ? -2.287  12.313  -2.869  1.00 15.00 ?  214 TYR B HE1  4  
ATOM 3235  H HE2  . TYR B 2 12 ? -1.806  11.049  1.191   1.00 15.00 ?  214 TYR B HE2  4  
ATOM 3236  H HH   . TYR B 2 12 ? -0.102  12.007  -0.243  1.00 15.00 ?  214 TYR B HH   4  
ATOM 3237  N N    . PRO B 2 13 ? -6.091  5.971   -2.797  1.00 15.00 ?  215 PRO B N    4  
ATOM 3238  C CA   . PRO B 2 13 ? -7.148  5.108   -3.326  1.00 15.00 ?  215 PRO B CA   4  
ATOM 3239  C C    . PRO B 2 13 ? -8.186  4.764   -2.269  1.00 15.00 ?  215 PRO B C    4  
ATOM 3240  O O    . PRO B 2 13 ? -7.883  4.099   -1.290  1.00 15.00 ?  215 PRO B O    4  
ATOM 3241  C CB   . PRO B 2 13 ? -6.388  3.854   -3.773  1.00 15.00 ?  215 PRO B CB   4  
ATOM 3242  C CG   . PRO B 2 13 ? -5.145  3.836   -2.943  1.00 15.00 ?  215 PRO B CG   4  
ATOM 3243  C CD   . PRO B 2 13 ? -4.810  5.261   -2.647  1.00 15.00 ?  215 PRO B CD   4  
ATOM 3244  H HA   . PRO B 2 13 ? -7.639  5.558   -4.176  1.00 15.00 ?  215 PRO B HA   4  
ATOM 3245  H HB2  . PRO B 2 13 ? -6.996  2.978   -3.594  1.00 15.00 ?  215 PRO B HB2  4  
ATOM 3246  H HB3  . PRO B 2 13 ? -6.158  3.929   -4.826  1.00 15.00 ?  215 PRO B HB3  4  
ATOM 3247  H HG2  . PRO B 2 13 ? -5.325  3.303   -2.017  1.00 15.00 ?  215 PRO B HG2  4  
ATOM 3248  H HG3  . PRO B 2 13 ? -4.336  3.372   -3.493  1.00 15.00 ?  215 PRO B HG3  4  
ATOM 3249  H HD2  . PRO B 2 13 ? -4.434  5.354   -1.638  1.00 15.00 ?  215 PRO B HD2  4  
ATOM 3250  H HD3  . PRO B 2 13 ? -4.082  5.630   -3.356  1.00 15.00 ?  215 PRO B HD3  4  
ATOM 3251  N N    . MET B 2 14 ? -9.409  5.229   -2.456  1.00 15.00 ?  216 MET B N    4  
ATOM 3252  C CA   . MET B 2 14 ? -10.438 5.011   -1.451  1.00 15.00 ?  216 MET B CA   4  
ATOM 3253  C C    . MET B 2 14 ? -11.138 3.675   -1.671  1.00 15.00 ?  216 MET B C    4  
ATOM 3254  O O    . MET B 2 14 ? -12.115 3.587   -2.416  1.00 15.00 ?  216 MET B O    4  
ATOM 3255  C CB   . MET B 2 14 ? -11.458 6.156   -1.445  1.00 15.00 ?  216 MET B CB   4  
ATOM 3256  C CG   . MET B 2 14 ? -10.828 7.527   -1.253  1.00 15.00 ?  216 MET B CG   4  
ATOM 3257  S SD   . MET B 2 14 ? -12.046 8.848   -1.093  1.00 15.00 ?  216 MET B SD   4  
ATOM 3258  C CE   . MET B 2 14 ? -12.798 8.420   0.476   1.00 15.00 ?  216 MET B CE   4  
ATOM 3259  H H    . MET B 2 14 ? -9.624  5.716   -3.284  1.00 15.00 ?  216 MET B H    4  
ATOM 3260  H HA   . MET B 2 14 ? -9.948  4.983   -0.489  1.00 15.00 ?  216 MET B HA   4  
ATOM 3261  H HB2  . MET B 2 14 ? -11.992 6.157   -2.385  1.00 15.00 ?  216 MET B HB2  4  
ATOM 3262  H HB3  . MET B 2 14 ? -12.161 5.991   -0.641  1.00 15.00 ?  216 MET B HB3  4  
ATOM 3263  H HG2  . MET B 2 14 ? -10.224 7.508   -0.359  1.00 15.00 ?  216 MET B HG2  4  
ATOM 3264  H HG3  . MET B 2 14 ? -10.197 7.739   -2.104  1.00 15.00 ?  216 MET B HG3  4  
ATOM 3265  H HE1  . MET B 2 14 ? -13.568 9.139   0.714   1.00 15.00 ?  216 MET B HE1  4  
ATOM 3266  H HE2  . MET B 2 14 ? -12.046 8.427   1.251   1.00 15.00 ?  216 MET B HE2  4  
ATOM 3267  H HE3  . MET B 2 14 ? -13.236 7.435   0.408   1.00 15.00 ?  216 MET B HE3  4  
ATOM 3268  N N    . ASP B 2 15 ? -10.605 2.632   -1.050  1.00 15.00 ?  217 ASP B N    4  
ATOM 3269  C CA   . ASP B 2 15 ? -11.193 1.299   -1.119  1.00 15.00 ?  217 ASP B CA   4  
ATOM 3270  C C    . ASP B 2 15 ? -10.815 0.508   0.129   1.00 15.00 ?  217 ASP B C    4  
ATOM 3271  O O    . ASP B 2 15 ? -10.573 -0.713  0.037   1.00 15.00 ?  217 ASP B O    4  
ATOM 3272  C CB   . ASP B 2 15 ? -10.751 0.563   -2.397  1.00 15.00 ?  217 ASP B CB   4  
ATOM 3273  C CG   . ASP B 2 15 ? -9.248  0.348   -2.504  1.00 15.00 ?  217 ASP B CG   4  
ATOM 3274  O OD1  . ASP B 2 15 ? -8.486  1.329   -2.355  1.00 15.00 ?  217 ASP B OD1  4  
ATOM 3275  O OD2  . ASP B 2 15 ? -8.831  -0.792  -2.799  1.00 15.00 -1 217 ASP B OD2  4  
ATOM 3276  O OXT  . ASP B 2 15 ? -10.763 1.135   1.209   1.00 15.00 ?  217 ASP B OXT  4  
ATOM 3277  H H    . ASP B 2 15 ? -9.774  2.754   -0.542  1.00 15.00 ?  217 ASP B H    4  
ATOM 3278  H HA   . ASP B 2 15 ? -12.267 1.418   -1.135  1.00 15.00 ?  217 ASP B HA   4  
ATOM 3279  H HB2  . ASP B 2 15 ? -11.229 -0.405  -2.421  1.00 15.00 ?  217 ASP B HB2  4  
ATOM 3280  H HB3  . ASP B 2 15 ? -11.074 1.134   -3.256  1.00 15.00 ?  217 ASP B HB3  4  
ATOM 3281  N N    . GLY A 1 1  ? 6.768   8.610   14.031  1.00 15.00 ?  297 GLY A N    5  
ATOM 3282  C CA   . GLY A 1 1  ? 5.780   7.706   13.396  1.00 15.00 ?  297 GLY A CA   5  
ATOM 3283  C C    . GLY A 1 1  ? 6.442   6.499   12.767  1.00 15.00 ?  297 GLY A C    5  
ATOM 3284  O O    . GLY A 1 1  ? 7.583   6.583   12.310  1.00 15.00 ?  297 GLY A O    5  
ATOM 3285  H H1   . GLY A 1 1  ? 6.292   9.451   14.417  1.00 15.00 ?  297 GLY A H1   5  
ATOM 3286  H H2   . GLY A 1 1  ? 7.473   8.917   13.327  1.00 15.00 ?  297 GLY A H2   5  
ATOM 3287  H H3   . GLY A 1 1  ? 7.258   8.114   14.805  1.00 15.00 ?  297 GLY A H3   5  
ATOM 3288  H HA2  . GLY A 1 1  ? 5.080   7.370   14.147  1.00 15.00 ?  297 GLY A HA2  5  
ATOM 3289  H HA3  . GLY A 1 1  ? 5.245   8.252   12.634  1.00 15.00 ?  297 GLY A HA3  5  
ATOM 3290  N N    . PRO A 1 2  ? 5.756   5.345   12.737  1.00 15.00 ?  298 PRO A N    5  
ATOM 3291  C CA   . PRO A 1 2  ? 6.282   4.132   12.111  1.00 15.00 ?  298 PRO A CA   5  
ATOM 3292  C C    . PRO A 1 2  ? 6.155   4.164   10.590  1.00 15.00 ?  298 PRO A C    5  
ATOM 3293  O O    . PRO A 1 2  ? 6.592   3.243   9.897   1.00 15.00 ?  298 PRO A O    5  
ATOM 3294  C CB   . PRO A 1 2  ? 5.409   3.028   12.704  1.00 15.00 ?  298 PRO A CB   5  
ATOM 3295  C CG   . PRO A 1 2  ? 4.106   3.692   12.993  1.00 15.00 ?  298 PRO A CG   5  
ATOM 3296  C CD   . PRO A 1 2  ? 4.423   5.125   13.336  1.00 15.00 ?  298 PRO A CD   5  
ATOM 3297  H HA   . PRO A 1 2  ? 7.314   3.962   12.382  1.00 15.00 ?  298 PRO A HA   5  
ATOM 3298  H HB2  . PRO A 1 2  ? 5.297   2.230   11.984  1.00 15.00 ?  298 PRO A HB2  5  
ATOM 3299  H HB3  . PRO A 1 2  ? 5.868   2.647   13.605  1.00 15.00 ?  298 PRO A HB3  5  
ATOM 3300  H HG2  . PRO A 1 2  ? 3.472   3.648   12.121  1.00 15.00 ?  298 PRO A HG2  5  
ATOM 3301  H HG3  . PRO A 1 2  ? 3.627   3.205   13.830  1.00 15.00 ?  298 PRO A HG3  5  
ATOM 3302  H HD2  . PRO A 1 2  ? 3.691   5.787   12.897  1.00 15.00 ?  298 PRO A HD2  5  
ATOM 3303  H HD3  . PRO A 1 2  ? 4.458   5.258   14.406  1.00 15.00 ?  298 PRO A HD3  5  
ATOM 3304  N N    . LEU A 1 3  ? 5.536   5.221   10.085  1.00 15.00 ?  299 LEU A N    5  
ATOM 3305  C CA   . LEU A 1 3  ? 5.377   5.412   8.654   1.00 15.00 ?  299 LEU A CA   5  
ATOM 3306  C C    . LEU A 1 3  ? 6.435   6.375   8.130   1.00 15.00 ?  299 LEU A C    5  
ATOM 3307  O O    . LEU A 1 3  ? 6.541   7.509   8.607   1.00 15.00 ?  299 LEU A O    5  
ATOM 3308  C CB   . LEU A 1 3  ? 3.982   5.964   8.344   1.00 15.00 ?  299 LEU A CB   5  
ATOM 3309  C CG   . LEU A 1 3  ? 3.670   6.151   6.856   1.00 15.00 ?  299 LEU A CG   5  
ATOM 3310  C CD1  . LEU A 1 3  ? 3.543   4.801   6.163   1.00 15.00 ?  299 LEU A CD1  5  
ATOM 3311  C CD2  . LEU A 1 3  ? 2.403   6.971   6.676   1.00 15.00 ?  299 LEU A CD2  5  
ATOM 3312  H H    . LEU A 1 3  ? 5.175   5.895   10.697  1.00 15.00 ?  299 LEU A H    5  
ATOM 3313  H HA   . LEU A 1 3  ? 5.497   4.455   8.170   1.00 15.00 ?  299 LEU A HA   5  
ATOM 3314  H HB2  . LEU A 1 3  ? 3.251   5.286   8.760   1.00 15.00 ?  299 LEU A HB2  5  
ATOM 3315  H HB3  . LEU A 1 3  ? 3.880   6.921   8.833   1.00 15.00 ?  299 LEU A HB3  5  
ATOM 3316  H HG   . LEU A 1 3  ? 4.486   6.688   6.392   1.00 15.00 ?  299 LEU A HG   5  
ATOM 3317  H HD11 . LEU A 1 3  ? 3.282   4.949   5.125   1.00 15.00 ?  299 LEU A HD11 5  
ATOM 3318  H HD12 . LEU A 1 3  ? 2.771   4.221   6.646   1.00 15.00 ?  299 LEU A HD12 5  
ATOM 3319  H HD13 . LEU A 1 3  ? 4.483   4.273   6.227   1.00 15.00 ?  299 LEU A HD13 5  
ATOM 3320  H HD21 . LEU A 1 3  ? 2.198   7.091   5.623   1.00 15.00 ?  299 LEU A HD21 5  
ATOM 3321  H HD22 . LEU A 1 3  ? 2.536   7.942   7.131   1.00 15.00 ?  299 LEU A HD22 5  
ATOM 3322  H HD23 . LEU A 1 3  ? 1.576   6.463   7.149   1.00 15.00 ?  299 LEU A HD23 5  
ATOM 3323  N N    . PRO A 1 4  ? 7.236   5.938   7.150   1.00 15.00 ?  300 PRO A N    5  
ATOM 3324  C CA   . PRO A 1 4  ? 8.239   6.792   6.505   1.00 15.00 ?  300 PRO A CA   5  
ATOM 3325  C C    . PRO A 1 4  ? 7.578   7.895   5.671   1.00 15.00 ?  300 PRO A C    5  
ATOM 3326  O O    . PRO A 1 4  ? 6.587   7.648   4.986   1.00 15.00 ?  300 PRO A O    5  
ATOM 3327  C CB   . PRO A 1 4  ? 9.017   5.822   5.601   1.00 15.00 ?  300 PRO A CB   5  
ATOM 3328  C CG   . PRO A 1 4  ? 8.628   4.452   6.051   1.00 15.00 ?  300 PRO A CG   5  
ATOM 3329  C CD   . PRO A 1 4  ? 7.234   4.581   6.584   1.00 15.00 ?  300 PRO A CD   5  
ATOM 3330  H HA   . PRO A 1 4  ? 8.906   7.236   7.228   1.00 15.00 ?  300 PRO A HA   5  
ATOM 3331  H HB2  . PRO A 1 4  ? 8.737   5.992   4.574   1.00 15.00 ?  300 PRO A HB2  5  
ATOM 3332  H HB3  . PRO A 1 4  ? 10.077  5.989   5.721   1.00 15.00 ?  300 PRO A HB3  5  
ATOM 3333  H HG2  . PRO A 1 4  ? 8.647   3.767   5.215   1.00 15.00 ?  300 PRO A HG2  5  
ATOM 3334  H HG3  . PRO A 1 4  ? 9.297   4.115   6.829   1.00 15.00 ?  300 PRO A HG3  5  
ATOM 3335  H HD2  . PRO A 1 4  ? 6.515   4.497   5.781   1.00 15.00 ?  300 PRO A HD2  5  
ATOM 3336  H HD3  . PRO A 1 4  ? 7.047   3.837   7.345   1.00 15.00 ?  300 PRO A HD3  5  
ATOM 3337  N N    . PRO A 1 5  ? 8.138   9.119   5.695   1.00 15.00 ?  301 PRO A N    5  
ATOM 3338  C CA   . PRO A 1 5  ? 7.537   10.297  5.041   1.00 15.00 ?  301 PRO A CA   5  
ATOM 3339  C C    . PRO A 1 5  ? 7.445   10.180  3.518   1.00 15.00 ?  301 PRO A C    5  
ATOM 3340  O O    . PRO A 1 5  ? 6.760   10.969  2.867   1.00 15.00 ?  301 PRO A O    5  
ATOM 3341  C CB   . PRO A 1 5  ? 8.477   11.448  5.424   1.00 15.00 ?  301 PRO A CB   5  
ATOM 3342  C CG   . PRO A 1 5  ? 9.274   10.938  6.578   1.00 15.00 ?  301 PRO A CG   5  
ATOM 3343  C CD   . PRO A 1 5  ? 9.398   9.458   6.373   1.00 15.00 ?  301 PRO A CD   5  
ATOM 3344  H HA   . PRO A 1 5  ? 6.553   10.499  5.436   1.00 15.00 ?  301 PRO A HA   5  
ATOM 3345  H HB2  . PRO A 1 5  ? 9.111   11.691  4.582   1.00 15.00 ?  301 PRO A HB2  5  
ATOM 3346  H HB3  . PRO A 1 5  ? 7.893   12.313  5.700   1.00 15.00 ?  301 PRO A HB3  5  
ATOM 3347  H HG2  . PRO A 1 5  ? 10.251  11.400  6.582   1.00 15.00 ?  301 PRO A HG2  5  
ATOM 3348  H HG3  . PRO A 1 5  ? 8.755   11.147  7.501   1.00 15.00 ?  301 PRO A HG3  5  
ATOM 3349  H HD2  . PRO A 1 5  ? 10.248  9.232   5.745   1.00 15.00 ?  301 PRO A HD2  5  
ATOM 3350  H HD3  . PRO A 1 5  ? 9.477   8.948   7.321   1.00 15.00 ?  301 PRO A HD3  5  
ATOM 3351  N N    . GLY A 1 6  ? 8.162   9.222   2.951   1.00 15.00 ?  302 GLY A N    5  
ATOM 3352  C CA   . GLY A 1 6  ? 8.103   8.991   1.517   1.00 15.00 ?  302 GLY A CA   5  
ATOM 3353  C C    . GLY A 1 6  ? 7.073   7.938   1.158   1.00 15.00 ?  302 GLY A C    5  
ATOM 3354  O O    . GLY A 1 6  ? 6.691   7.786   -0.004  1.00 15.00 ?  302 GLY A O    5  
ATOM 3355  H H    . GLY A 1 6  ? 8.743   8.667   3.509   1.00 15.00 ?  302 GLY A H    5  
ATOM 3356  H HA2  . GLY A 1 6  ? 7.845   9.916   1.024   1.00 15.00 ?  302 GLY A HA2  5  
ATOM 3357  H HA3  . GLY A 1 6  ? 9.073   8.666   1.171   1.00 15.00 ?  302 GLY A HA3  5  
ATOM 3358  N N    . TRP A 1 7  ? 6.641   7.206   2.170   1.00 15.00 ?  303 TRP A N    5  
ATOM 3359  C CA   . TRP A 1 7  ? 5.751   6.073   1.996   1.00 15.00 ?  303 TRP A CA   5  
ATOM 3360  C C    . TRP A 1 7  ? 4.300   6.453   2.212   1.00 15.00 ?  303 TRP A C    5  
ATOM 3361  O O    . TRP A 1 7  ? 3.998   7.332   3.016   1.00 15.00 ?  303 TRP A O    5  
ATOM 3362  C CB   . TRP A 1 7  ? 6.118   4.984   2.979   1.00 15.00 ?  303 TRP A CB   5  
ATOM 3363  C CG   . TRP A 1 7  ? 7.191   4.090   2.483   1.00 15.00 ?  303 TRP A CG   5  
ATOM 3364  C CD1  . TRP A 1 7  ? 8.534   4.335   2.464   1.00 15.00 ?  303 TRP A CD1  5  
ATOM 3365  C CD2  . TRP A 1 7  ? 7.007   2.795   1.926   1.00 15.00 ?  303 TRP A CD2  5  
ATOM 3366  N NE1  . TRP A 1 7  ? 9.194   3.254   1.946   1.00 15.00 ?  303 TRP A NE1  5  
ATOM 3367  C CE2  . TRP A 1 7  ? 8.273   2.301   1.610   1.00 15.00 ?  303 TRP A CE2  5  
ATOM 3368  C CE3  . TRP A 1 7  ? 5.893   1.996   1.669   1.00 15.00 ?  303 TRP A CE3  5  
ATOM 3369  C CZ2  . TRP A 1 7  ? 8.450   1.053   1.058   1.00 15.00 ?  303 TRP A CZ2  5  
ATOM 3370  C CZ3  . TRP A 1 7  ? 6.084   0.754   1.120   1.00 15.00 ?  303 TRP A CZ3  5  
ATOM 3371  C CH2  . TRP A 1 7  ? 7.352   0.293   0.821   1.00 15.00 ?  303 TRP A CH2  5  
ATOM 3372  H H    . TRP A 1 7  ? 6.907   7.456   3.079   1.00 15.00 ?  303 TRP A H    5  
ATOM 3373  H HA   . TRP A 1 7  ? 5.883   5.700   0.993   1.00 15.00 ?  303 TRP A HA   5  
ATOM 3374  H HB2  . TRP A 1 7  ? 6.460   5.438   3.898   1.00 15.00 ?  303 TRP A HB2  5  
ATOM 3375  H HB3  . TRP A 1 7  ? 5.247   4.381   3.182   1.00 15.00 ?  303 TRP A HB3  5  
ATOM 3376  H HD1  . TRP A 1 7  ? 8.993   5.245   2.813   1.00 15.00 ?  303 TRP A HD1  5  
ATOM 3377  H HE1  . TRP A 1 7  ? 10.170  3.179   1.832   1.00 15.00 ?  303 TRP A HE1  5  
ATOM 3378  H HE3  . TRP A 1 7  ? 4.895   2.330   1.887   1.00 15.00 ?  303 TRP A HE3  5  
ATOM 3379  H HZ2  . TRP A 1 7  ? 9.408   0.694   0.813   1.00 15.00 ?  303 TRP A HZ2  5  
ATOM 3380  H HZ3  . TRP A 1 7  ? 5.237   0.132   0.903   1.00 15.00 ?  303 TRP A HZ3  5  
ATOM 3381  H HH2  . TRP A 1 7  ? 7.456   -0.694  0.408   1.00 15.00 ?  303 TRP A HH2  5  
ATOM 3382  N N    . GLU A 1 8  ? 3.400   5.757   1.530   1.00 15.00 ?  304 GLU A N    5  
ATOM 3383  C CA   . GLU A 1 8  ? 1.970   6.035   1.690   1.00 15.00 ?  304 GLU A CA   5  
ATOM 3384  C C    . GLU A 1 8  ? 1.217   4.752   2.028   1.00 15.00 ?  304 GLU A C    5  
ATOM 3385  O O    . GLU A 1 8  ? 1.246   3.794   1.271   1.00 15.00 ?  304 GLU A O    5  
ATOM 3386  C CB   . GLU A 1 8  ? 1.420   6.688   0.419   1.00 15.00 ?  304 GLU A CB   5  
ATOM 3387  C CG   . GLU A 1 8  ? 1.952   8.091   0.182   1.00 15.00 ?  304 GLU A CG   5  
ATOM 3388  C CD   . GLU A 1 8  ? 1.198   9.159   0.958   1.00 15.00 ?  304 GLU A CD   5  
ATOM 3389  O OE1  . GLU A 1 8  ? 1.210   9.121   2.202   1.00 15.00 -1 304 GLU A OE1  5  
ATOM 3390  O OE2  . GLU A 1 8  ? 0.595   10.048  0.312   1.00 15.00 ?  304 GLU A OE2  5  
ATOM 3391  H H    . GLU A 1 8  ? 3.701   5.023   0.913   1.00 15.00 ?  304 GLU A H    5  
ATOM 3392  H HA   . GLU A 1 8  ? 1.861   6.726   2.514   1.00 15.00 ?  304 GLU A HA   5  
ATOM 3393  H HB2  . GLU A 1 8  ? 1.693   6.077   -0.430  1.00 15.00 ?  304 GLU A HB2  5  
ATOM 3394  H HB3  . GLU A 1 8  ? 0.346   6.740   0.479   1.00 15.00 ?  304 GLU A HB3  5  
ATOM 3395  H HG2  . GLU A 1 8  ? 2.989   8.121   0.478   1.00 15.00 ?  304 GLU A HG2  5  
ATOM 3396  H HG3  . GLU A 1 8  ? 1.876   8.315   -0.873  1.00 15.00 ?  304 GLU A HG3  5  
ATOM 3397  N N    . ILE A 1 9  ? 0.547   4.726   3.170   1.00 15.00 ?  305 ILE A N    5  
ATOM 3398  C CA   . ILE A 1 9  ? -0.074  3.494   3.648   1.00 15.00 ?  305 ILE A CA   5  
ATOM 3399  C C    . ILE A 1 9  ? -1.601  3.540   3.551   1.00 15.00 ?  305 ILE A C    5  
ATOM 3400  O O    . ILE A 1 9  ? -2.230  4.524   3.946   1.00 15.00 ?  305 ILE A O    5  
ATOM 3401  C CB   . ILE A 1 9  ? 0.335   3.187   5.112   1.00 15.00 ?  305 ILE A CB   5  
ATOM 3402  C CG1  . ILE A 1 9  ? -0.348  1.905   5.605   1.00 15.00 ?  305 ILE A CG1  5  
ATOM 3403  C CG2  . ILE A 1 9  ? -0.006  4.360   6.025   1.00 15.00 ?  305 ILE A CG2  5  
ATOM 3404  C CD1  . ILE A 1 9  ? 0.036   1.512   7.015   1.00 15.00 ?  305 ILE A CD1  5  
ATOM 3405  H H    . ILE A 1 9  ? 0.459   5.547   3.695   1.00 15.00 ?  305 ILE A H    5  
ATOM 3406  H HA   . ILE A 1 9  ? 0.288   2.687   3.028   1.00 15.00 ?  305 ILE A HA   5  
ATOM 3407  H HB   . ILE A 1 9  ? 1.406   3.047   5.138   1.00 15.00 ?  305 ILE A HB   5  
ATOM 3408  H HG12 . ILE A 1 9  ? -1.418  2.045   5.582   1.00 15.00 ?  305 ILE A HG12 5  
ATOM 3409  H HG13 . ILE A 1 9  ? -0.082  1.089   4.948   1.00 15.00 ?  305 ILE A HG13 5  
ATOM 3410  H HG21 . ILE A 1 9  ? -1.068  4.554   5.981   1.00 15.00 ?  305 ILE A HG21 5  
ATOM 3411  H HG22 . ILE A 1 9  ? 0.534   5.238   5.702   1.00 15.00 ?  305 ILE A HG22 5  
ATOM 3412  H HG23 . ILE A 1 9  ? 0.273   4.120   7.041   1.00 15.00 ?  305 ILE A HG23 5  
ATOM 3413  H HD11 . ILE A 1 9  ? 1.083   1.247   7.044   1.00 15.00 ?  305 ILE A HD11 5  
ATOM 3414  H HD12 . ILE A 1 9  ? -0.558  0.666   7.328   1.00 15.00 ?  305 ILE A HD12 5  
ATOM 3415  H HD13 . ILE A 1 9  ? -0.140  2.343   7.680   1.00 15.00 ?  305 ILE A HD13 5  
ATOM 3416  N N    . ARG A 1 10 ? -2.190  2.474   3.008   1.00 15.00 ?  306 ARG A N    5  
ATOM 3417  C CA   . ARG A 1 10 ? -3.636  2.296   3.036   1.00 15.00 ?  306 ARG A CA   5  
ATOM 3418  C C    . ARG A 1 10 ? -3.999  0.827   3.185   1.00 15.00 ?  306 ARG A C    5  
ATOM 3419  O O    . ARG A 1 10 ? -3.272  -0.055  2.729   1.00 15.00 ?  306 ARG A O    5  
ATOM 3420  C CB   . ARG A 1 10 ? -4.310  2.853   1.786   1.00 15.00 ?  306 ARG A CB   5  
ATOM 3421  C CG   . ARG A 1 10 ? -4.556  4.347   1.837   1.00 15.00 ?  306 ARG A CG   5  
ATOM 3422  C CD   . ARG A 1 10 ? -5.787  4.719   1.036   1.00 15.00 ?  306 ARG A CD   5  
ATOM 3423  N NE   . ARG A 1 10 ? -6.905  3.824   1.341   1.00 15.00 ?  306 ARG A NE   5  
ATOM 3424  C CZ   . ARG A 1 10 ? -7.980  4.172   2.047   1.00 15.00 ?  306 ARG A CZ   5  
ATOM 3425  N NH1  . ARG A 1 10 ? -8.093  5.400   2.543   1.00 15.00 1  306 ARG A NH1  5  
ATOM 3426  N NH2  . ARG A 1 10 ? -8.937  3.279   2.270   1.00 15.00 ?  306 ARG A NH2  5  
ATOM 3427  H H    . ARG A 1 10 ? -1.638  1.787   2.570   1.00 15.00 ?  306 ARG A H    5  
ATOM 3428  H HA   . ARG A 1 10 ? -4.010  2.829   3.899   1.00 15.00 ?  306 ARG A HA   5  
ATOM 3429  H HB2  . ARG A 1 10 ? -3.687  2.642   0.930   1.00 15.00 ?  306 ARG A HB2  5  
ATOM 3430  H HB3  . ARG A 1 10 ? -5.263  2.358   1.657   1.00 15.00 ?  306 ARG A HB3  5  
ATOM 3431  H HG2  . ARG A 1 10 ? -4.693  4.652   2.863   1.00 15.00 ?  306 ARG A HG2  5  
ATOM 3432  H HG3  . ARG A 1 10 ? -3.701  4.853   1.415   1.00 15.00 ?  306 ARG A HG3  5  
ATOM 3433  H HD2  . ARG A 1 10 ? -6.069  5.732   1.278   1.00 15.00 ?  306 ARG A HD2  5  
ATOM 3434  H HD3  . ARG A 1 10 ? -5.556  4.648   -0.016  1.00 15.00 ?  306 ARG A HD3  5  
ATOM 3435  H HE   . ARG A 1 10 ? -6.846  2.901   0.991   1.00 15.00 ?  306 ARG A HE   5  
ATOM 3436  H HH11 . ARG A 1 10 ? -7.365  6.081   2.394   1.00 15.00 ?  306 ARG A HH11 5  
ATOM 3437  H HH12 . ARG A 1 10 ? -8.913  5.662   3.076   1.00 15.00 ?  306 ARG A HH12 5  
ATOM 3438  H HH21 . ARG A 1 10 ? -8.851  2.345   1.915   1.00 15.00 ?  306 ARG A HH21 5  
ATOM 3439  H HH22 . ARG A 1 10 ? -9.760  3.536   2.802   1.00 15.00 ?  306 ARG A HH22 5  
ATOM 3440  N N    . ASN A 1 11 ? -5.137  0.585   3.815   1.00 15.00 ?  307 ASN A N    5  
ATOM 3441  C CA   . ASN A 1 11 ? -5.662  -0.763  3.991   1.00 15.00 ?  307 ASN A CA   5  
ATOM 3442  C C    . ASN A 1 11 ? -6.987  -0.885  3.229   1.00 15.00 ?  307 ASN A C    5  
ATOM 3443  O O    . ASN A 1 11 ? -7.837  0.001   3.333   1.00 15.00 ?  307 ASN A O    5  
ATOM 3444  C CB   . ASN A 1 11 ? -5.880  -1.029  5.490   1.00 15.00 ?  307 ASN A CB   5  
ATOM 3445  C CG   . ASN A 1 11 ? -6.168  -2.484  5.825   1.00 15.00 ?  307 ASN A CG   5  
ATOM 3446  O OD1  . ASN A 1 11 ? -6.706  -3.239  5.016   1.00 15.00 ?  307 ASN A OD1  5  
ATOM 3447  N ND2  . ASN A 1 11 ? -5.822  -2.883  7.039   1.00 15.00 ?  307 ASN A ND2  5  
ATOM 3448  H H    . ASN A 1 11 ? -5.649  1.339   4.174   1.00 15.00 ?  307 ASN A H    5  
ATOM 3449  H HA   . ASN A 1 11 ? -4.941  -1.463  3.598   1.00 15.00 ?  307 ASN A HA   5  
ATOM 3450  H HB2  . ASN A 1 11 ? -4.992  -0.734  6.029   1.00 15.00 ?  307 ASN A HB2  5  
ATOM 3451  H HB3  . ASN A 1 11 ? -6.712  -0.433  5.832   1.00 15.00 ?  307 ASN A HB3  5  
ATOM 3452  H HD21 . ASN A 1 11 ? -5.406  -2.228  7.642   1.00 15.00 ?  307 ASN A HD21 5  
ATOM 3453  H HD22 . ASN A 1 11 ? -6.005  -3.817  7.294   1.00 15.00 ?  307 ASN A HD22 5  
ATOM 3454  N N    . THR A 1 12 ? -7.173  -1.966  2.471   1.00 15.00 ?  308 THR A N    5  
ATOM 3455  C CA   . THR A 1 12 ? -8.418  -2.162  1.736   1.00 15.00 ?  308 THR A CA   5  
ATOM 3456  C C    . THR A 1 12 ? -9.417  -2.925  2.583   1.00 15.00 ?  308 THR A C    5  
ATOM 3457  O O    . THR A 1 12 ? -9.031  -3.793  3.373   1.00 15.00 ?  308 THR A O    5  
ATOM 3458  C CB   . THR A 1 12 ? -8.220  -2.928  0.410   1.00 15.00 ?  308 THR A CB   5  
ATOM 3459  O OG1  . THR A 1 12 ? -7.046  -3.751  0.471   1.00 15.00 ?  308 THR A OG1  5  
ATOM 3460  C CG2  . THR A 1 12 ? -8.136  -1.976  -0.770  1.00 15.00 ?  308 THR A CG2  5  
ATOM 3461  H H    . THR A 1 12 ? -6.475  -2.656  2.432   1.00 15.00 ?  308 THR A H    5  
ATOM 3462  H HA   . THR A 1 12 ? -8.825  -1.188  1.507   1.00 15.00 ?  308 THR A HA   5  
ATOM 3463  H HB   . THR A 1 12 ? -9.079  -3.569  0.265   1.00 15.00 ?  308 THR A HB   5  
ATOM 3464  H HG1  . THR A 1 12 ? -6.328  -3.256  0.881   1.00 15.00 ?  308 THR A HG1  5  
ATOM 3465  H HG21 . THR A 1 12 ? -7.357  -1.254  -0.594  1.00 15.00 ?  308 THR A HG21 5  
ATOM 3466  H HG22 . THR A 1 12 ? -9.079  -1.466  -0.891  1.00 15.00 ?  308 THR A HG22 5  
ATOM 3467  H HG23 . THR A 1 12 ? -7.914  -2.538  -1.666  1.00 15.00 ?  308 THR A HG23 5  
ATOM 3468  N N    . ALA A 1 13 ? -10.696 -2.622  2.386   1.00 15.00 ?  309 ALA A N    5  
ATOM 3469  C CA   . ALA A 1 13 ? -11.776 -3.220  3.169   1.00 15.00 ?  309 ALA A CA   5  
ATOM 3470  C C    . ALA A 1 13 ? -11.811 -4.742  3.025   1.00 15.00 ?  309 ALA A C    5  
ATOM 3471  O O    . ALA A 1 13 ? -12.375 -5.443  3.867   1.00 15.00 ?  309 ALA A O    5  
ATOM 3472  C CB   . ALA A 1 13 ? -13.107 -2.619  2.753   1.00 15.00 ?  309 ALA A CB   5  
ATOM 3473  H H    . ALA A 1 13 ? -10.922 -1.956  1.687   1.00 15.00 ?  309 ALA A H    5  
ATOM 3474  H HA   . ALA A 1 13 ? -11.608 -2.973  4.206   1.00 15.00 ?  309 ALA A HA   5  
ATOM 3475  H HB1  . ALA A 1 13 ? -13.313 -2.873  1.723   1.00 15.00 ?  309 ALA A HB1  5  
ATOM 3476  H HB2  . ALA A 1 13 ? -13.064 -1.544  2.856   1.00 15.00 ?  309 ALA A HB2  5  
ATOM 3477  H HB3  . ALA A 1 13 ? -13.892 -3.009  3.383   1.00 15.00 ?  309 ALA A HB3  5  
ATOM 3478  N N    . THR A 1 14 ? -11.198 -5.244  1.962   1.00 15.00 ?  310 THR A N    5  
ATOM 3479  C CA   . THR A 1 14 ? -11.083 -6.679  1.735   1.00 15.00 ?  310 THR A CA   5  
ATOM 3480  C C    . THR A 1 14 ? -10.158 -7.321  2.778   1.00 15.00 ?  310 THR A C    5  
ATOM 3481  O O    . THR A 1 14 ? -10.184 -8.535  3.002   1.00 15.00 ?  310 THR A O    5  
ATOM 3482  C CB   . THR A 1 14 ? -10.534 -6.952  0.322   1.00 15.00 ?  310 THR A CB   5  
ATOM 3483  O OG1  . THR A 1 14 ? -11.200 -6.104  -0.623  1.00 15.00 ?  310 THR A OG1  5  
ATOM 3484  C CG2  . THR A 1 14 ? -10.730 -8.409  -0.077  1.00 15.00 ?  310 THR A CG2  5  
ATOM 3485  H H    . THR A 1 14 ? -10.818 -4.629  1.300   1.00 15.00 ?  310 THR A H    5  
ATOM 3486  H HA   . THR A 1 14 ? -12.069 -7.116  1.813   1.00 15.00 ?  310 THR A HA   5  
ATOM 3487  H HB   . THR A 1 14 ? -9.477  -6.729  0.313   1.00 15.00 ?  310 THR A HB   5  
ATOM 3488  H HG1  . THR A 1 14 ? -12.149 -6.071  -0.409  1.00 15.00 ?  310 THR A HG1  5  
ATOM 3489  H HG21 . THR A 1 14 ? -10.346 -8.564  -1.075  1.00 15.00 ?  310 THR A HG21 5  
ATOM 3490  H HG22 . THR A 1 14 ? -11.782 -8.649  -0.055  1.00 15.00 ?  310 THR A HG22 5  
ATOM 3491  H HG23 . THR A 1 14 ? -10.201 -9.046  0.616   1.00 15.00 ?  310 THR A HG23 5  
ATOM 3492  N N    . GLY A 1 15 ? -9.356  -6.490  3.425   1.00 15.00 ?  311 GLY A N    5  
ATOM 3493  C CA   . GLY A 1 15 ? -8.415  -6.975  4.411   1.00 15.00 ?  311 GLY A CA   5  
ATOM 3494  C C    . GLY A 1 15 ? -7.027  -7.154  3.833   1.00 15.00 ?  311 GLY A C    5  
ATOM 3495  O O    . GLY A 1 15 ? -6.361  -8.152  4.101   1.00 15.00 ?  311 GLY A O    5  
ATOM 3496  H H    . GLY A 1 15 ? -9.415  -5.526  3.242   1.00 15.00 ?  311 GLY A H    5  
ATOM 3497  H HA2  . GLY A 1 15 ? -8.367  -6.268  5.227   1.00 15.00 ?  311 GLY A HA2  5  
ATOM 3498  H HA3  . GLY A 1 15 ? -8.762  -7.925  4.789   1.00 15.00 ?  311 GLY A HA3  5  
ATOM 3499  N N    . ARG A 1 16 ? -6.588  -6.187  3.032   1.00 15.00 ?  312 ARG A N    5  
ATOM 3500  C CA   . ARG A 1 16 ? -5.271  -6.264  2.399   1.00 15.00 ?  312 ARG A CA   5  
ATOM 3501  C C    . ARG A 1 16 ? -4.542  -4.935  2.545   1.00 15.00 ?  312 ARG A C    5  
ATOM 3502  O O    . ARG A 1 16 ? -5.131  -3.874  2.333   1.00 15.00 ?  312 ARG A O    5  
ATOM 3503  C CB   . ARG A 1 16 ? -5.389  -6.614  0.908   1.00 15.00 ?  312 ARG A CB   5  
ATOM 3504  C CG   . ARG A 1 16 ? -6.127  -7.906  0.604   1.00 15.00 ?  312 ARG A CG   5  
ATOM 3505  C CD   . ARG A 1 16 ? -6.153  -8.174  -0.896  1.00 15.00 ?  312 ARG A CD   5  
ATOM 3506  N NE   . ARG A 1 16 ? -6.981  -7.202  -1.618  1.00 15.00 ?  312 ARG A NE   5  
ATOM 3507  C CZ   . ARG A 1 16 ? -7.043  -7.116  -2.950  1.00 15.00 ?  312 ARG A CZ   5  
ATOM 3508  N NH1  . ARG A 1 16 ? -6.332  -7.940  -3.711  1.00 15.00 1  312 ARG A NH1  5  
ATOM 3509  N NH2  . ARG A 1 16 ? -7.826  -6.211  -3.524  1.00 15.00 ?  312 ARG A NH2  5  
ATOM 3510  H H    . ARG A 1 16 ? -7.149  -5.389  2.884   1.00 15.00 ?  312 ARG A H    5  
ATOM 3511  H HA   . ARG A 1 16 ? -4.702  -7.034  2.900   1.00 15.00 ?  312 ARG A HA   5  
ATOM 3512  H HB2  . ARG A 1 16 ? -5.891  -5.807  0.393   1.00 15.00 ?  312 ARG A HB2  5  
ATOM 3513  H HB3  . ARG A 1 16 ? -4.390  -6.703  0.506   1.00 15.00 ?  312 ARG A HB3  5  
ATOM 3514  H HG2  . ARG A 1 16 ? -5.626  -8.724  1.100   1.00 15.00 ?  312 ARG A HG2  5  
ATOM 3515  H HG3  . ARG A 1 16 ? -7.141  -7.826  0.966   1.00 15.00 ?  312 ARG A HG3  5  
ATOM 3516  H HD2  . ARG A 1 16 ? -5.140  -8.114  -1.276  1.00 15.00 ?  312 ARG A HD2  5  
ATOM 3517  H HD3  . ARG A 1 16 ? -6.544  -9.167  -1.067  1.00 15.00 ?  312 ARG A HD3  5  
ATOM 3518  H HE   . ARG A 1 16 ? -7.519  -6.580  -1.080  1.00 15.00 ?  312 ARG A HE   5  
ATOM 3519  H HH11 . ARG A 1 16 ? -5.742  -8.641  -3.290  1.00 15.00 ?  312 ARG A HH11 5  
ATOM 3520  H HH12 . ARG A 1 16 ? -6.365  -7.859  -4.711  1.00 15.00 ?  312 ARG A HH12 5  
ATOM 3521  H HH21 . ARG A 1 16 ? -8.379  -5.579  -2.958  1.00 15.00 ?  312 ARG A HH21 5  
ATOM 3522  H HH22 . ARG A 1 16 ? -7.883  -6.153  -4.524  1.00 15.00 ?  312 ARG A HH22 5  
ATOM 3523  N N    . VAL A 1 17 ? -3.258  -4.981  2.875   1.00 15.00 ?  313 VAL A N    5  
ATOM 3524  C CA   . VAL A 1 17 ? -2.497  -3.754  3.051   1.00 15.00 ?  313 VAL A CA   5  
ATOM 3525  C C    . VAL A 1 17 ? -1.505  -3.552  1.899   1.00 15.00 ?  313 VAL A C    5  
ATOM 3526  O O    . VAL A 1 17 ? -0.773  -4.458  1.525   1.00 15.00 ?  313 VAL A O    5  
ATOM 3527  C CB   . VAL A 1 17 ? -1.751  -3.723  4.398   1.00 15.00 ?  313 VAL A CB   5  
ATOM 3528  C CG1  . VAL A 1 17 ? -1.333  -2.300  4.732   1.00 15.00 ?  313 VAL A CG1  5  
ATOM 3529  C CG2  . VAL A 1 17 ? -2.613  -4.303  5.510   1.00 15.00 ?  313 VAL A CG2  5  
ATOM 3530  H H    . VAL A 1 17 ? -2.812  -5.847  2.993   1.00 15.00 ?  313 VAL A H    5  
ATOM 3531  H HA   . VAL A 1 17 ? -3.206  -2.940  3.046   1.00 15.00 ?  313 VAL A HA   5  
ATOM 3532  H HB   . VAL A 1 17 ? -0.859  -4.327  4.309   1.00 15.00 ?  313 VAL A HB   5  
ATOM 3533  H HG11 . VAL A 1 17 ? -0.703  -1.914  3.946   1.00 15.00 ?  313 VAL A HG11 5  
ATOM 3534  H HG12 . VAL A 1 17 ? -0.786  -2.296  5.665   1.00 15.00 ?  313 VAL A HG12 5  
ATOM 3535  H HG13 . VAL A 1 17 ? -2.212  -1.680  4.828   1.00 15.00 ?  313 VAL A HG13 5  
ATOM 3536  H HG21 . VAL A 1 17 ? -2.857  -5.329  5.279   1.00 15.00 ?  313 VAL A HG21 5  
ATOM 3537  H HG22 . VAL A 1 17 ? -3.523  -3.728  5.598   1.00 15.00 ?  313 VAL A HG22 5  
ATOM 3538  H HG23 . VAL A 1 17 ? -2.072  -4.263  6.444   1.00 15.00 ?  313 VAL A HG23 5  
ATOM 3539  N N    . TYR A 1 18 ? -1.475  -2.336  1.385   1.00 15.00 ?  314 TYR A N    5  
ATOM 3540  C CA   . TYR A 1 18 ? -0.799  -1.972  0.168   1.00 15.00 ?  314 TYR A CA   5  
ATOM 3541  C C    . TYR A 1 18 ? -0.267  -0.557  0.349   1.00 15.00 ?  314 TYR A C    5  
ATOM 3542  O O    . TYR A 1 18 ? -1.028  0.384   0.589   1.00 15.00 ?  314 TYR A O    5  
ATOM 3543  C CB   . TYR A 1 18 ? -1.770  -2.035  -1.028  1.00 15.00 ?  314 TYR A CB   5  
ATOM 3544  C CG   . TYR A 1 18 ? -3.024  -1.202  -0.833  1.00 15.00 ?  314 TYR A CG   5  
ATOM 3545  C CD1  . TYR A 1 18 ? -4.026  -1.623  0.029   1.00 15.00 ?  314 TYR A CD1  5  
ATOM 3546  C CD2  . TYR A 1 18 ? -3.191  0.021   -1.478  1.00 15.00 ?  314 TYR A CD2  5  
ATOM 3547  C CE1  . TYR A 1 18 ? -5.148  -0.857  0.247   1.00 15.00 ?  314 TYR A CE1  5  
ATOM 3548  C CE2  . TYR A 1 18 ? -4.319  0.789   -1.265  1.00 15.00 ?  314 TYR A CE2  5  
ATOM 3549  C CZ   . TYR A 1 18 ? -5.292  0.348   -0.397  1.00 15.00 ?  314 TYR A CZ   5  
ATOM 3550  O OH   . TYR A 1 18 ? -6.412  1.114   -0.167  1.00 15.00 ?  314 TYR A OH   5  
ATOM 3551  H H    . TYR A 1 18 ? -1.876  -1.634  1.874   1.00 15.00 ?  314 TYR A H    5  
ATOM 3552  H HA   . TYR A 1 18 ? 0.025   -2.653  0.011   1.00 15.00 ?  314 TYR A HA   5  
ATOM 3553  H HB2  . TYR A 1 18 ? -1.266  -1.673  -1.911  1.00 15.00 ?  314 TYR A HB2  5  
ATOM 3554  H HB3  . TYR A 1 18 ? -2.071  -3.061  -1.186  1.00 15.00 ?  314 TYR A HB3  5  
ATOM 3555  H HD1  . TYR A 1 18 ? -3.915  -2.569  0.539   1.00 15.00 ?  314 TYR A HD1  5  
ATOM 3556  H HD2  . TYR A 1 18 ? -2.432  0.362   -2.166  1.00 15.00 ?  314 TYR A HD2  5  
ATOM 3557  H HE1  . TYR A 1 18 ? -5.912  -1.206  0.923   1.00 15.00 ?  314 TYR A HE1  5  
ATOM 3558  H HE2  . TYR A 1 18 ? -4.430  1.744   -1.771  1.00 15.00 ?  314 TYR A HE2  5  
ATOM 3559  H HH   . TYR A 1 18 ? -6.768  1.428   -1.008  1.00 15.00 ?  314 TYR A HH   5  
ATOM 3560  N N    . PHE A 1 19 ? 1.031   -0.412  0.308   1.00 15.00 ?  315 PHE A N    5  
ATOM 3561  C CA   . PHE A 1 19 ? 1.637   0.892   0.471   1.00 15.00 ?  315 PHE A CA   5  
ATOM 3562  C C    . PHE A 1 19 ? 1.983   1.461   -0.883  1.00 15.00 ?  315 PHE A C    5  
ATOM 3563  O O    . PHE A 1 19 ? 2.786   0.898   -1.601  1.00 15.00 ?  315 PHE A O    5  
ATOM 3564  C CB   . PHE A 1 19 ? 2.914   0.806   1.301   1.00 15.00 ?  315 PHE A CB   5  
ATOM 3565  C CG   . PHE A 1 19 ? 2.740   0.331   2.715   1.00 15.00 ?  315 PHE A CG   5  
ATOM 3566  C CD1  . PHE A 1 19 ? 2.132   -0.878  2.988   1.00 15.00 ?  315 PHE A CD1  5  
ATOM 3567  C CD2  . PHE A 1 19 ? 3.221   1.089   3.771   1.00 15.00 ?  315 PHE A CD2  5  
ATOM 3568  C CE1  . PHE A 1 19 ? 1.999   -1.322  4.283   1.00 15.00 ?  315 PHE A CE1  5  
ATOM 3569  C CE2  . PHE A 1 19 ? 3.098   0.644   5.071   1.00 15.00 ?  315 PHE A CE2  5  
ATOM 3570  C CZ   . PHE A 1 19 ? 2.485   -0.565  5.324   1.00 15.00 ?  315 PHE A CZ   5  
ATOM 3571  H H    . PHE A 1 19 ? 1.602   -1.203  0.173   1.00 15.00 ?  315 PHE A H    5  
ATOM 3572  H HA   . PHE A 1 19 ? 0.930   1.540   0.965   1.00 15.00 ?  315 PHE A HA   5  
ATOM 3573  H HB2  . PHE A 1 19 ? 3.597   0.126   0.814   1.00 15.00 ?  315 PHE A HB2  5  
ATOM 3574  H HB3  . PHE A 1 19 ? 3.367   1.786   1.336   1.00 15.00 ?  315 PHE A HB3  5  
ATOM 3575  H HD1  . PHE A 1 19 ? 1.748   -1.476  2.174   1.00 15.00 ?  315 PHE A HD1  5  
ATOM 3576  H HD2  . PHE A 1 19 ? 3.697   2.037   3.570   1.00 15.00 ?  315 PHE A HD2  5  
ATOM 3577  H HE1  . PHE A 1 19 ? 1.520   -2.267  4.483   1.00 15.00 ?  315 PHE A HE1  5  
ATOM 3578  H HE2  . PHE A 1 19 ? 3.476   1.241   5.887   1.00 15.00 ?  315 PHE A HE2  5  
ATOM 3579  H HZ   . PHE A 1 19 ? 2.394   -0.925  6.333   1.00 15.00 ?  315 PHE A HZ   5  
ATOM 3580  N N    . VAL A 1 20 ? 1.419   2.584   -1.229  1.00 15.00 ?  316 VAL A N    5  
ATOM 3581  C CA   . VAL A 1 20 ? 1.748   3.173   -2.493  1.00 15.00 ?  316 VAL A CA   5  
ATOM 3582  C C    . VAL A 1 20 ? 2.949   4.104   -2.310  1.00 15.00 ?  316 VAL A C    5  
ATOM 3583  O O    . VAL A 1 20 ? 2.919   5.021   -1.486  1.00 15.00 ?  316 VAL A O    5  
ATOM 3584  C CB   . VAL A 1 20 ? 0.551   3.925   -3.127  1.00 15.00 ?  316 VAL A CB   5  
ATOM 3585  C CG1  . VAL A 1 20 ? -0.491  2.935   -3.620  1.00 15.00 ?  316 VAL A CG1  5  
ATOM 3586  C CG2  . VAL A 1 20 ? -0.089  4.899   -2.156  1.00 15.00 ?  316 VAL A CG2  5  
ATOM 3587  H H    . VAL A 1 20 ? 0.801   3.038   -0.617  1.00 15.00 ?  316 VAL A H    5  
ATOM 3588  H HA   . VAL A 1 20 ? 2.016   2.363   -3.154  1.00 15.00 ?  316 VAL A HA   5  
ATOM 3589  H HB   . VAL A 1 20 ? 0.914   4.482   -3.979  1.00 15.00 ?  316 VAL A HB   5  
ATOM 3590  H HG11 . VAL A 1 20 ? -1.318  3.473   -4.061  1.00 15.00 ?  316 VAL A HG11 5  
ATOM 3591  H HG12 . VAL A 1 20 ? -0.847  2.344   -2.790  1.00 15.00 ?  316 VAL A HG12 5  
ATOM 3592  H HG13 . VAL A 1 20 ? -0.048  2.286   -4.361  1.00 15.00 ?  316 VAL A HG13 5  
ATOM 3593  H HG21 . VAL A 1 20 ? 0.677   5.484   -1.671  1.00 15.00 ?  316 VAL A HG21 5  
ATOM 3594  H HG22 . VAL A 1 20 ? -0.657  4.352   -1.416  1.00 15.00 ?  316 VAL A HG22 5  
ATOM 3595  H HG23 . VAL A 1 20 ? -0.751  5.555   -2.704  1.00 15.00 ?  316 VAL A HG23 5  
ATOM 3596  N N    . ASP A 1 21 ? 4.040   3.835   -3.019  1.00 15.00 ?  317 ASP A N    5  
ATOM 3597  C CA   . ASP A 1 21 ? 5.212   4.671   -2.906  1.00 15.00 ?  317 ASP A CA   5  
ATOM 3598  C C    . ASP A 1 21 ? 5.083   5.769   -3.942  1.00 15.00 ?  317 ASP A C    5  
ATOM 3599  O O    . ASP A 1 21 ? 4.937   5.480   -5.134  1.00 15.00 ?  317 ASP A O    5  
ATOM 3600  C CB   . ASP A 1 21 ? 6.505   3.882   -3.171  1.00 15.00 ?  317 ASP A CB   5  
ATOM 3601  C CG   . ASP A 1 21 ? 6.430   2.424   -2.796  1.00 15.00 ?  317 ASP A CG   5  
ATOM 3602  O OD1  . ASP A 1 21 ? 6.034   1.615   -3.654  1.00 15.00 -1 317 ASP A OD1  5  
ATOM 3603  O OD2  . ASP A 1 21 ? 6.824   2.083   -1.665  1.00 15.00 ?  317 ASP A OD2  5  
ATOM 3604  H H    . ASP A 1 21 ? 4.068   3.050   -3.613  1.00 15.00 ?  317 ASP A H    5  
ATOM 3605  H HA   . ASP A 1 21 ? 5.238   5.102   -1.918  1.00 15.00 ?  317 ASP A HA   5  
ATOM 3606  H HB2  . ASP A 1 21 ? 6.763   3.953   -4.214  1.00 15.00 ?  317 ASP A HB2  5  
ATOM 3607  H HB3  . ASP A 1 21 ? 7.296   4.319   -2.578  1.00 15.00 ?  317 ASP A HB3  5  
ATOM 3608  N N    . HIS A 1 22 ? 5.102   7.021   -3.501  1.00 15.00 ?  318 HIS A N    5  
ATOM 3609  C CA   . HIS A 1 22 ? 4.964   8.150   -4.421  1.00 15.00 ?  318 HIS A CA   5  
ATOM 3610  C C    . HIS A 1 22 ? 6.232   8.340   -5.245  1.00 15.00 ?  318 HIS A C    5  
ATOM 3611  O O    . HIS A 1 22 ? 6.230   9.057   -6.242  1.00 15.00 ?  318 HIS A O    5  
ATOM 3612  C CB   . HIS A 1 22 ? 4.623   9.450   -3.685  1.00 15.00 ?  318 HIS A CB   5  
ATOM 3613  C CG   . HIS A 1 22 ? 3.205   9.540   -3.194  1.00 15.00 ?  318 HIS A CG   5  
ATOM 3614  N ND1  . HIS A 1 22 ? 2.188   8.708   -3.620  1.00 15.00 ?  318 HIS A ND1  5  
ATOM 3615  C CD2  . HIS A 1 22 ? 2.640   10.378  -2.293  1.00 15.00 ?  318 HIS A CD2  5  
ATOM 3616  C CE1  . HIS A 1 22 ? 1.070   9.034   -3.001  1.00 15.00 ?  318 HIS A CE1  5  
ATOM 3617  N NE2  . HIS A 1 22 ? 1.312   10.043  -2.186  1.00 15.00 ?  318 HIS A NE2  5  
ATOM 3618  H H    . HIS A 1 22 ? 5.212   7.191   -2.537  1.00 15.00 ?  318 HIS A H    5  
ATOM 3619  H HA   . HIS A 1 22 ? 4.156   7.914   -5.097  1.00 15.00 ?  318 HIS A HA   5  
ATOM 3620  H HB2  . HIS A 1 22 ? 5.273   9.549   -2.829  1.00 15.00 ?  318 HIS A HB2  5  
ATOM 3621  H HB3  . HIS A 1 22 ? 4.793   10.282  -4.353  1.00 15.00 ?  318 HIS A HB3  5  
ATOM 3622  H HD1  . HIS A 1 22 ? 2.268   7.994   -4.293  1.00 15.00 ?  318 HIS A HD1  5  
ATOM 3623  H HD2  . HIS A 1 22 ? 3.141   11.173  -1.760  1.00 15.00 ?  318 HIS A HD2  5  
ATOM 3624  H HE1  . HIS A 1 22 ? 0.114   8.550   -3.135  1.00 15.00 ?  318 HIS A HE1  5  
ATOM 3625  H HE2  . HIS A 1 22 ? 0.763   10.239  -1.379  1.00 15.00 ?  318 HIS A HE2  5  
ATOM 3626  N N    . ASN A 1 23 ? 7.313   7.711   -4.811  1.00 15.00 ?  319 ASN A N    5  
ATOM 3627  C CA   . ASN A 1 23 ? 8.582   7.802   -5.519  1.00 15.00 ?  319 ASN A CA   5  
ATOM 3628  C C    . ASN A 1 23 ? 8.604   6.868   -6.724  1.00 15.00 ?  319 ASN A C    5  
ATOM 3629  O O    . ASN A 1 23 ? 9.085   7.234   -7.795  1.00 15.00 ?  319 ASN A O    5  
ATOM 3630  C CB   . ASN A 1 23 ? 9.746   7.473   -4.579  1.00 15.00 ?  319 ASN A CB   5  
ATOM 3631  C CG   . ASN A 1 23 ? 9.942   8.515   -3.492  1.00 15.00 ?  319 ASN A CG   5  
ATOM 3632  O OD1  . ASN A 1 23 ? 9.722   9.706   -3.707  1.00 15.00 ?  319 ASN A OD1  5  
ATOM 3633  N ND2  . ASN A 1 23 ? 10.328  8.070   -2.306  1.00 15.00 ?  319 ASN A ND2  5  
ATOM 3634  H H    . ASN A 1 23 ? 7.261   7.179   -3.991  1.00 15.00 ?  319 ASN A H    5  
ATOM 3635  H HA   . ASN A 1 23 ? 8.692   8.817   -5.868  1.00 15.00 ?  319 ASN A HA   5  
ATOM 3636  H HB2  . ASN A 1 23 ? 9.557   6.521   -4.106  1.00 15.00 ?  319 ASN A HB2  5  
ATOM 3637  H HB3  . ASN A 1 23 ? 10.656  7.407   -5.156  1.00 15.00 ?  319 ASN A HB3  5  
ATOM 3638  H HD21 . ASN A 1 23 ? 10.456  7.101   -2.195  1.00 15.00 ?  319 ASN A HD21 5  
ATOM 3639  H HD22 . ASN A 1 23 ? 10.483  8.725   -1.585  1.00 15.00 ?  319 ASN A HD22 5  
ATOM 3640  N N    . ASN A 1 24 ? 8.086   5.655   -6.543  1.00 15.00 ?  320 ASN A N    5  
ATOM 3641  C CA   . ASN A 1 24 ? 8.088   4.661   -7.615  1.00 15.00 ?  320 ASN A CA   5  
ATOM 3642  C C    . ASN A 1 24 ? 6.736   4.603   -8.329  1.00 15.00 ?  320 ASN A C    5  
ATOM 3643  O O    . ASN A 1 24 ? 6.628   4.039   -9.417  1.00 15.00 ?  320 ASN A O    5  
ATOM 3644  C CB   . ASN A 1 24 ? 8.435   3.277   -7.058  1.00 15.00 ?  320 ASN A CB   5  
ATOM 3645  C CG   . ASN A 1 24 ? 8.710   2.254   -8.148  1.00 15.00 ?  320 ASN A CG   5  
ATOM 3646  O OD1  . ASN A 1 24 ? 8.334   1.088   -8.029  1.00 15.00 ?  320 ASN A OD1  5  
ATOM 3647  N ND2  . ASN A 1 24 ? 9.391   2.675   -9.203  1.00 15.00 ?  320 ASN A ND2  5  
ATOM 3648  H H    . ASN A 1 24 ? 7.718   5.416   -5.668  1.00 15.00 ?  320 ASN A H    5  
ATOM 3649  H HA   . ASN A 1 24 ? 8.844   4.948   -8.330  1.00 15.00 ?  320 ASN A HA   5  
ATOM 3650  H HB2  . ASN A 1 24 ? 9.314   3.356   -6.436  1.00 15.00 ?  320 ASN A HB2  5  
ATOM 3651  H HB3  . ASN A 1 24 ? 7.609   2.922   -6.459  1.00 15.00 ?  320 ASN A HB3  5  
ATOM 3652  H HD21 . ASN A 1 24 ? 9.679   3.611   -9.226  1.00 15.00 ?  320 ASN A HD21 5  
ATOM 3653  H HD22 . ASN A 1 24 ? 9.578   2.033   -9.923  1.00 15.00 ?  320 ASN A HD22 5  
ATOM 3654  N N    . ARG A 1 25 ? 5.713   5.182   -7.703  1.00 15.00 ?  321 ARG A N    5  
ATOM 3655  C CA   . ARG A 1 25 ? 4.344   5.162   -8.228  1.00 15.00 ?  321 ARG A CA   5  
ATOM 3656  C C    . ARG A 1 25 ? 3.795   3.741   -8.271  1.00 15.00 ?  321 ARG A C    5  
ATOM 3657  O O    . ARG A 1 25 ? 3.104   3.359   -9.218  1.00 15.00 ?  321 ARG A O    5  
ATOM 3658  C CB   . ARG A 1 25 ? 4.264   5.781   -9.625  1.00 15.00 ?  321 ARG A CB   5  
ATOM 3659  C CG   . ARG A 1 25 ? 4.682   7.238   -9.693  1.00 15.00 ?  321 ARG A CG   5  
ATOM 3660  C CD   . ARG A 1 25 ? 4.440   7.797   -11.083 1.00 15.00 ?  321 ARG A CD   5  
ATOM 3661  N NE   . ARG A 1 25 ? 4.982   6.916   -12.121 1.00 15.00 ?  321 ARG A NE   5  
ATOM 3662  C CZ   . ARG A 1 25 ? 5.562   7.339   -13.242 1.00 15.00 ?  321 ARG A CZ   5  
ATOM 3663  N NH1  . ARG A 1 25 ? 5.708   8.637   -13.482 1.00 15.00 1  321 ARG A NH1  5  
ATOM 3664  N NH2  . ARG A 1 25 ? 5.999   6.454   -14.130 1.00 15.00 ?  321 ARG A NH2  5  
ATOM 3665  H H    . ARG A 1 25 ? 5.878   5.631   -6.849  1.00 15.00 ?  321 ARG A H    5  
ATOM 3666  H HA   . ARG A 1 25 ? 3.730   5.744   -7.555  1.00 15.00 ?  321 ARG A HA   5  
ATOM 3667  H HB2  . ARG A 1 25 ? 4.903   5.218   -10.290 1.00 15.00 ?  321 ARG A HB2  5  
ATOM 3668  H HB3  . ARG A 1 25 ? 3.244   5.706   -9.978  1.00 15.00 ?  321 ARG A HB3  5  
ATOM 3669  H HG2  . ARG A 1 25 ? 4.103   7.804   -8.979  1.00 15.00 ?  321 ARG A HG2  5  
ATOM 3670  H HG3  . ARG A 1 25 ? 5.734   7.315   -9.458  1.00 15.00 ?  321 ARG A HG3  5  
ATOM 3671  H HD2  . ARG A 1 25 ? 3.376   7.903   -11.234 1.00 15.00 ?  321 ARG A HD2  5  
ATOM 3672  H HD3  . ARG A 1 25 ? 4.910   8.764   -11.155 1.00 15.00 ?  321 ARG A HD3  5  
ATOM 3673  H HE   . ARG A 1 25 ? 4.901   5.945   -11.971 1.00 15.00 ?  321 ARG A HE   5  
ATOM 3674  H HH11 . ARG A 1 25 ? 5.379   9.320   -12.818 1.00 15.00 ?  321 ARG A HH11 5  
ATOM 3675  H HH12 . ARG A 1 25 ? 6.154   8.945   -14.330 1.00 15.00 ?  321 ARG A HH12 5  
ATOM 3676  H HH21 . ARG A 1 25 ? 5.891   5.469   -13.959 1.00 15.00 ?  321 ARG A HH21 5  
ATOM 3677  H HH22 . ARG A 1 25 ? 6.442   6.767   -14.975 1.00 15.00 ?  321 ARG A HH22 5  
ATOM 3678  N N    . THR A 1 26 ? 4.052   2.980   -7.223  1.00 15.00 ?  322 THR A N    5  
ATOM 3679  C CA   . THR A 1 26 ? 3.636   1.583   -7.184  1.00 15.00 ?  322 THR A CA   5  
ATOM 3680  C C    . THR A 1 26 ? 2.896   1.280   -5.881  1.00 15.00 ?  322 THR A C    5  
ATOM 3681  O O    . THR A 1 26 ? 3.142   1.928   -4.869  1.00 15.00 ?  322 THR A O    5  
ATOM 3682  C CB   . THR A 1 26 ? 4.857   0.650   -7.336  1.00 15.00 ?  322 THR A CB   5  
ATOM 3683  O OG1  . THR A 1 26 ? 5.596   1.014   -8.512  1.00 15.00 ?  322 THR A OG1  5  
ATOM 3684  C CG2  . THR A 1 26 ? 4.432   -0.808  -7.446  1.00 15.00 ?  322 THR A CG2  5  
ATOM 3685  H H    . THR A 1 26 ? 4.521   3.368   -6.445  1.00 15.00 ?  322 THR A H    5  
ATOM 3686  H HA   . THR A 1 26 ? 2.969   1.411   -8.016  1.00 15.00 ?  322 THR A HA   5  
ATOM 3687  H HB   . THR A 1 26 ? 5.491   0.763   -6.469  1.00 15.00 ?  322 THR A HB   5  
ATOM 3688  H HG1  . THR A 1 26 ? 6.545   0.938   -8.327  1.00 15.00 ?  322 THR A HG1  5  
ATOM 3689  H HG21 . THR A 1 26 ? 5.308   -1.431  -7.546  1.00 15.00 ?  322 THR A HG21 5  
ATOM 3690  H HG22 . THR A 1 26 ? 3.800   -0.934  -8.312  1.00 15.00 ?  322 THR A HG22 5  
ATOM 3691  H HG23 . THR A 1 26 ? 3.887   -1.092  -6.558  1.00 15.00 ?  322 THR A HG23 5  
ATOM 3692  N N    . THR A 1 27 ? 1.960   0.330   -5.922  1.00 15.00 ?  323 THR A N    5  
ATOM 3693  C CA   . THR A 1 27 ? 1.259   -0.090  -4.719  1.00 15.00 ?  323 THR A CA   5  
ATOM 3694  C C    . THR A 1 27 ? 1.879   -1.381  -4.178  1.00 15.00 ?  323 THR A C    5  
ATOM 3695  O O    . THR A 1 27 ? 2.221   -2.285  -4.943  1.00 15.00 ?  323 THR A O    5  
ATOM 3696  C CB   . THR A 1 27 ? -0.262  -0.272  -4.958  1.00 15.00 ?  323 THR A CB   5  
ATOM 3697  O OG1  . THR A 1 27 ? -0.932  -0.493  -3.713  1.00 15.00 ?  323 THR A OG1  5  
ATOM 3698  C CG2  . THR A 1 27 ? -0.562  -1.428  -5.896  1.00 15.00 ?  323 THR A CG2  5  
ATOM 3699  H H    . THR A 1 27 ? 1.753   -0.107  -6.772  1.00 15.00 ?  323 THR A H    5  
ATOM 3700  H HA   . THR A 1 27 ? 1.391   0.690   -3.983  1.00 15.00 ?  323 THR A HA   5  
ATOM 3701  H HB   . THR A 1 27 ? -0.647  0.637   -5.400  1.00 15.00 ?  323 THR A HB   5  
ATOM 3702  H HG1  . THR A 1 27 ? -1.650  0.139   -3.622  1.00 15.00 ?  323 THR A HG1  5  
ATOM 3703  H HG21 . THR A 1 27 ? -0.228  -1.184  -6.892  1.00 15.00 ?  323 THR A HG21 5  
ATOM 3704  H HG22 . THR A 1 27 ? -1.627  -1.609  -5.907  1.00 15.00 ?  323 THR A HG22 5  
ATOM 3705  H HG23 . THR A 1 27 ? -0.050  -2.313  -5.551  1.00 15.00 ?  323 THR A HG23 5  
ATOM 3706  N N    . GLN A 1 28 ? 2.019   -1.461  -2.864  1.00 15.00 ?  324 GLN A N    5  
ATOM 3707  C CA   . GLN A 1 28 ? 2.806   -2.509  -2.246  1.00 15.00 ?  324 GLN A CA   5  
ATOM 3708  C C    . GLN A 1 28 ? 1.974   -3.379  -1.312  1.00 15.00 ?  324 GLN A C    5  
ATOM 3709  O O    . GLN A 1 28 ? 1.828   -3.059  -0.136  1.00 15.00 ?  324 GLN A O    5  
ATOM 3710  C CB   . GLN A 1 28 ? 3.978   -1.897  -1.456  1.00 15.00 ?  324 GLN A CB   5  
ATOM 3711  C CG   . GLN A 1 28 ? 4.928   -1.060  -2.299  1.00 15.00 ?  324 GLN A CG   5  
ATOM 3712  C CD   . GLN A 1 28 ? 5.699   -1.883  -3.314  1.00 15.00 ?  324 GLN A CD   5  
ATOM 3713  O OE1  . GLN A 1 28 ? 5.239   -2.109  -4.429  1.00 15.00 ?  324 GLN A OE1  5  
ATOM 3714  N NE2  . GLN A 1 28 ? 6.893   -2.320  -2.942  1.00 15.00 ?  324 GLN A NE2  5  
ATOM 3715  H H    . GLN A 1 28 ? 1.591   -0.789  -2.293  1.00 15.00 ?  324 GLN A H    5  
ATOM 3716  H HA   . GLN A 1 28 ? 3.206   -3.130  -3.033  1.00 15.00 ?  324 GLN A HA   5  
ATOM 3717  H HB2  . GLN A 1 28 ? 3.573   -1.262  -0.681  1.00 15.00 ?  324 GLN A HB2  5  
ATOM 3718  H HB3  . GLN A 1 28 ? 4.545   -2.689  -0.993  1.00 15.00 ?  324 GLN A HB3  5  
ATOM 3719  H HG2  . GLN A 1 28 ? 4.353   -0.314  -2.827  1.00 15.00 ?  324 GLN A HG2  5  
ATOM 3720  H HG3  . GLN A 1 28 ? 5.632   -0.568  -1.640  1.00 15.00 ?  324 GLN A HG3  5  
ATOM 3721  H HE21 . GLN A 1 28 ? 7.213   -2.087  -2.046  1.00 15.00 ?  324 GLN A HE21 5  
ATOM 3722  H HE22 . GLN A 1 28 ? 7.404   -2.859  -3.580  1.00 15.00 ?  324 GLN A HE22 5  
ATOM 3723  N N    . PHE A 1 29 ? 1.412   -4.463  -1.848  1.00 15.00 ?  325 PHE A N    5  
ATOM 3724  C CA   . PHE A 1 29 ? 0.933   -5.576  -1.016  1.00 15.00 ?  325 PHE A CA   5  
ATOM 3725  C C    . PHE A 1 29 ? 2.129   -6.238  -0.388  1.00 15.00 ?  325 PHE A C    5  
ATOM 3726  O O    . PHE A 1 29 ? 2.033   -7.132  0.448   1.00 15.00 ?  325 PHE A O    5  
ATOM 3727  C CB   . PHE A 1 29 ? 0.106   -6.589  -1.802  1.00 15.00 ?  325 PHE A CB   5  
ATOM 3728  C CG   . PHE A 1 29 ? -1.343  -6.233  -1.805  1.00 15.00 ?  325 PHE A CG   5  
ATOM 3729  C CD1  . PHE A 1 29 ? -1.889  -5.559  -0.726  1.00 15.00 ?  325 PHE A CD1  5  
ATOM 3730  C CD2  . PHE A 1 29 ? -2.154  -6.544  -2.879  1.00 15.00 ?  325 PHE A CD2  5  
ATOM 3731  C CE1  . PHE A 1 29 ? -3.218  -5.196  -0.731  1.00 15.00 ?  325 PHE A CE1  5  
ATOM 3732  C CE2  . PHE A 1 29 ? -3.486  -6.191  -2.880  1.00 15.00 ?  325 PHE A CE2  5  
ATOM 3733  C CZ   . PHE A 1 29 ? -4.017  -5.511  -1.809  1.00 15.00 ?  325 PHE A CZ   5  
ATOM 3734  H H    . PHE A 1 29 ? 1.314   -4.516  -2.822  1.00 15.00 ?  325 PHE A H    5  
ATOM 3735  H HA   . PHE A 1 29 ? 0.324   -5.155  -0.229  1.00 15.00 ?  325 PHE A HA   5  
ATOM 3736  H HB2  . PHE A 1 29 ? 0.453   -6.619  -2.825  1.00 15.00 ?  325 PHE A HB2  5  
ATOM 3737  H HB3  . PHE A 1 29 ? 0.213   -7.567  -1.355  1.00 15.00 ?  325 PHE A HB3  5  
ATOM 3738  H HD1  . PHE A 1 29 ? -1.254  -5.312  0.143   1.00 15.00 ?  325 PHE A HD1  5  
ATOM 3739  H HD2  . PHE A 1 29 ? -1.741  -7.081  -3.716  1.00 15.00 ?  325 PHE A HD2  5  
ATOM 3740  H HE1  . PHE A 1 29 ? -3.637  -4.674  0.115   1.00 15.00 ?  325 PHE A HE1  5  
ATOM 3741  H HE2  . PHE A 1 29 ? -4.110  -6.440  -3.725  1.00 15.00 ?  325 PHE A HE2  5  
ATOM 3742  H HZ   . PHE A 1 29 ? -5.059  -5.226  -1.811  1.00 15.00 ?  325 PHE A HZ   5  
ATOM 3743  N N    . THR A 1 30 ? 3.257   -5.800  -0.877  1.00 15.00 ?  326 THR A N    5  
ATOM 3744  C CA   . THR A 1 30 ? 4.533   -6.227  -0.367  1.00 15.00 ?  326 THR A CA   5  
ATOM 3745  C C    . THR A 1 30 ? 4.903   -5.229  0.712   1.00 15.00 ?  326 THR A C    5  
ATOM 3746  O O    . THR A 1 30 ? 5.538   -4.201  0.448   1.00 15.00 ?  326 THR A O    5  
ATOM 3747  C CB   . THR A 1 30 ? 5.608   -6.243  -1.471  1.00 15.00 ?  326 THR A CB   5  
ATOM 3748  O OG1  . THR A 1 30 ? 5.528   -5.041  -2.248  1.00 15.00 ?  326 THR A OG1  5  
ATOM 3749  C CG2  . THR A 1 30 ? 5.439   -7.450  -2.379  1.00 15.00 ?  326 THR A CG2  5  
ATOM 3750  H H    . THR A 1 30 ? 3.207   -5.062  -1.518  1.00 15.00 ?  326 THR A H    5  
ATOM 3751  H HA   . THR A 1 30 ? 4.430   -7.220  0.045   1.00 15.00 ?  326 THR A HA   5  
ATOM 3752  H HB   . THR A 1 30 ? 6.581   -6.296  -1.004  1.00 15.00 ?  326 THR A HB   5  
ATOM 3753  H HG1  . THR A 1 30 ? 5.650   -4.281  -1.671  1.00 15.00 ?  326 THR A HG1  5  
ATOM 3754  H HG21 . THR A 1 30 ? 4.463   -7.420  -2.840  1.00 15.00 ?  326 THR A HG21 5  
ATOM 3755  H HG22 . THR A 1 30 ? 5.536   -8.356  -1.799  1.00 15.00 ?  326 THR A HG22 5  
ATOM 3756  H HG23 . THR A 1 30 ? 6.199   -7.432  -3.147  1.00 15.00 ?  326 THR A HG23 5  
ATOM 3757  N N    . ASP A 1 31 ? 4.485   -5.526  1.922   1.00 15.00 ?  327 ASP A N    5  
ATOM 3758  C CA   . ASP A 1 31 ? 4.364   -4.517  2.936   1.00 15.00 ?  327 ASP A CA   5  
ATOM 3759  C C    . ASP A 1 31 ? 5.195   -4.778  4.136   1.00 15.00 ?  327 ASP A C    5  
ATOM 3760  O O    . ASP A 1 31 ? 5.494   -5.909  4.512   1.00 15.00 ?  327 ASP A O    5  
ATOM 3761  C CB   . ASP A 1 31 ? 2.927   -4.301  3.375   1.00 15.00 ?  327 ASP A CB   5  
ATOM 3762  C CG   . ASP A 1 31 ? 2.134   -5.577  3.595   1.00 15.00 ?  327 ASP A CG   5  
ATOM 3763  O OD1  . ASP A 1 31 ? 2.753   -6.647  3.760   1.00 15.00 -1 327 ASP A OD1  5  
ATOM 3764  O OD2  . ASP A 1 31 ? 0.892   -5.497  3.651   1.00 15.00 ?  327 ASP A OD2  5  
ATOM 3765  H H    . ASP A 1 31 ? 4.235   -6.448  2.149   1.00 15.00 ?  327 ASP A H    5  
ATOM 3766  H HA   . ASP A 1 31 ? 4.705   -3.590  2.503   1.00 15.00 ?  327 ASP A HA   5  
ATOM 3767  H HB2  . ASP A 1 31 ? 2.944   -3.764  4.312   1.00 15.00 ?  327 ASP A HB2  5  
ATOM 3768  H HB3  . ASP A 1 31 ? 2.448   -3.690  2.643   1.00 15.00 ?  327 ASP A HB3  5  
ATOM 3769  N N    . PRO A 1 32 ? 5.566   -3.678  4.755   1.00 15.00 ?  328 PRO A N    5  
ATOM 3770  C CA   . PRO A 1 32 ? 6.205   -3.683  6.045   1.00 15.00 ?  328 PRO A CA   5  
ATOM 3771  C C    . PRO A 1 32 ? 5.212   -4.271  7.068   1.00 15.00 ?  328 PRO A C    5  
ATOM 3772  O O    . PRO A 1 32 ? 5.571   -4.618  8.194   1.00 15.00 ?  328 PRO A O    5  
ATOM 3773  C CB   . PRO A 1 32 ? 6.542   -2.196  6.279   1.00 15.00 ?  328 PRO A CB   5  
ATOM 3774  C CG   . PRO A 1 32 ? 6.349   -1.537  4.936   1.00 15.00 ?  328 PRO A CG   5  
ATOM 3775  C CD   . PRO A 1 32 ? 5.288   -2.317  4.277   1.00 15.00 ?  328 PRO A CD   5  
ATOM 3776  H HA   . PRO A 1 32 ? 7.110   -4.277  6.038   1.00 15.00 ?  328 PRO A HA   5  
ATOM 3777  H HB2  . PRO A 1 32 ? 5.872   -1.785  7.021   1.00 15.00 ?  328 PRO A HB2  5  
ATOM 3778  H HB3  . PRO A 1 32 ? 7.563   -2.105  6.618   1.00 15.00 ?  328 PRO A HB3  5  
ATOM 3779  H HG2  . PRO A 1 32 ? 6.045   -0.505  5.060   1.00 15.00 ?  328 PRO A HG2  5  
ATOM 3780  H HG3  . PRO A 1 32 ? 7.237   -1.598  4.330   1.00 15.00 ?  328 PRO A HG3  5  
ATOM 3781  H HD2  . PRO A 1 32 ? 4.311   -1.982  4.597   1.00 15.00 ?  328 PRO A HD2  5  
ATOM 3782  H HD3  . PRO A 1 32 ? 5.383   -2.258  3.202   1.00 15.00 ?  328 PRO A HD3  5  
ATOM 3783  N N    . ARG A 1 33 ? 3.937   -4.346  6.634   1.00 15.00 ?  329 ARG A N    5  
ATOM 3784  C CA   . ARG A 1 33 ? 2.859   -4.989  7.390   1.00 15.00 ?  329 ARG A CA   5  
ATOM 3785  C C    . ARG A 1 33 ? 3.068   -6.497  7.515   1.00 15.00 ?  329 ARG A C    5  
ATOM 3786  O O    . ARG A 1 33 ? 2.596   -7.114  8.471   1.00 15.00 ?  329 ARG A O    5  
ATOM 3787  C CB   . ARG A 1 33 ? 1.480   -4.727  6.737   1.00 15.00 ?  329 ARG A CB   5  
ATOM 3788  C CG   . ARG A 1 33 ? 1.016   -3.291  6.859   1.00 15.00 ?  329 ARG A CG   5  
ATOM 3789  C CD   . ARG A 1 33 ? 0.986   -2.829  8.305   1.00 15.00 ?  329 ARG A CD   5  
ATOM 3790  N NE   . ARG A 1 33 ? 0.143   -3.672  9.150   1.00 15.00 ?  329 ARG A NE   5  
ATOM 3791  C CZ   . ARG A 1 33 ? 0.102   -3.578  10.477  1.00 15.00 ?  329 ARG A CZ   5  
ATOM 3792  N NH1  . ARG A 1 33 ? 0.858   -2.682  11.101  1.00 15.00 1  329 ARG A NH1  5  
ATOM 3793  N NH2  . ARG A 1 33 ? -0.682  -4.387  11.177  1.00 15.00 ?  329 ARG A NH2  5  
ATOM 3794  H H    . ARG A 1 33 ? 3.725   -3.967  5.757   1.00 15.00 ?  329 ARG A H    5  
ATOM 3795  H HA   . ARG A 1 33 ? 2.856   -4.561  8.380   1.00 15.00 ?  329 ARG A HA   5  
ATOM 3796  H HB2  . ARG A 1 33 ? 1.514   -4.982  5.663   1.00 15.00 ?  329 ARG A HB2  5  
ATOM 3797  H HB3  . ARG A 1 33 ? 0.748   -5.359  7.218   1.00 15.00 ?  329 ARG A HB3  5  
ATOM 3798  H HG2  . ARG A 1 33 ? 1.691   -2.655  6.305   1.00 15.00 ?  329 ARG A HG2  5  
ATOM 3799  H HG3  . ARG A 1 33 ? 0.022   -3.208  6.445   1.00 15.00 ?  329 ARG A HG3  5  
ATOM 3800  H HD2  . ARG A 1 33 ? 1.993   -2.845  8.693   1.00 15.00 ?  329 ARG A HD2  5  
ATOM 3801  H HD3  . ARG A 1 33 ? 0.609   -1.817  8.335   1.00 15.00 ?  329 ARG A HD3  5  
ATOM 3802  H HE   . ARG A 1 33 ? -0.426  -4.351  8.701   1.00 15.00 ?  329 ARG A HE   5  
ATOM 3803  H HH11 . ARG A 1 33 ? 1.460   -2.069  10.573  1.00 15.00 ?  329 ARG A HH11 5  
ATOM 3804  H HH12 . ARG A 1 33 ? 0.850   -2.622  12.109  1.00 15.00 ?  329 ARG A HH12 5  
ATOM 3805  H HH21 . ARG A 1 33 ? -1.243  -5.078  10.710  1.00 15.00 ?  329 ARG A HH21 5  
ATOM 3806  H HH22 . ARG A 1 33 ? -0.735  -4.300  12.177  1.00 15.00 ?  329 ARG A HH22 5  
ATOM 3807  N N    . LEU A 1 34 ? 3.766   -7.085  6.547   1.00 15.00 ?  330 LEU A N    5  
ATOM 3808  C CA   . LEU A 1 34 ? 3.966   -8.534  6.500   1.00 15.00 ?  330 LEU A CA   5  
ATOM 3809  C C    . LEU A 1 34 ? 4.786   -9.032  7.693   1.00 15.00 ?  330 LEU A C    5  
ATOM 3810  O O    . LEU A 1 34 ? 4.804   -10.227 7.995   1.00 15.00 ?  330 LEU A O    5  
ATOM 3811  C CB   . LEU A 1 34 ? 4.656   -8.928  5.190   1.00 15.00 ?  330 LEU A CB   5  
ATOM 3812  C CG   . LEU A 1 34 ? 4.748   -10.432 4.916   1.00 15.00 ?  330 LEU A CG   5  
ATOM 3813  C CD1  . LEU A 1 34 ? 3.361   -11.029 4.734   1.00 15.00 ?  330 LEU A CD1  5  
ATOM 3814  C CD2  . LEU A 1 34 ? 5.611   -10.698 3.692   1.00 15.00 ?  330 LEU A CD2  5  
ATOM 3815  H H    . LEU A 1 34 ? 4.135   -6.534  5.821   1.00 15.00 ?  330 LEU A H    5  
ATOM 3816  H HA   . LEU A 1 34 ? 2.993   -9.000  6.533   1.00 15.00 ?  330 LEU A HA   5  
ATOM 3817  H HB2  . LEU A 1 34 ? 4.118   -8.469  4.374   1.00 15.00 ?  330 LEU A HB2  5  
ATOM 3818  H HB3  . LEU A 1 34 ? 5.659   -8.528  5.203   1.00 15.00 ?  330 LEU A HB3  5  
ATOM 3819  H HG   . LEU A 1 34 ? 5.210   -10.917 5.764   1.00 15.00 ?  330 LEU A HG   5  
ATOM 3820  H HD11 . LEU A 1 34 ? 2.781   -10.868 5.629   1.00 15.00 ?  330 LEU A HD11 5  
ATOM 3821  H HD12 . LEU A 1 34 ? 3.447   -12.089 4.545   1.00 15.00 ?  330 LEU A HD12 5  
ATOM 3822  H HD13 . LEU A 1 34 ? 2.872   -10.553 3.897   1.00 15.00 ?  330 LEU A HD13 5  
ATOM 3823  H HD21 . LEU A 1 34 ? 6.602   -10.298 3.857   1.00 15.00 ?  330 LEU A HD21 5  
ATOM 3824  H HD22 . LEU A 1 34 ? 5.169   -10.222 2.829   1.00 15.00 ?  330 LEU A HD22 5  
ATOM 3825  H HD23 . LEU A 1 34 ? 5.678   -11.762 3.522   1.00 15.00 ?  330 LEU A HD23 5  
ATOM 3826  N N    . SER A 1 35 ? 5.481   -8.118  8.352   1.00 15.00 ?  331 SER A N    5  
ATOM 3827  C CA   . SER A 1 35 ? 6.289   -8.466  9.509   1.00 15.00 ?  331 SER A CA   5  
ATOM 3828  C C    . SER A 1 35 ? 5.636   -7.963  10.794  1.00 15.00 ?  331 SER A C    5  
ATOM 3829  O O    . SER A 1 35 ? 6.071   -8.299  11.896  1.00 15.00 ?  331 SER A O    5  
ATOM 3830  C CB   . SER A 1 35 ? 7.701   -7.889  9.363   1.00 15.00 ?  331 SER A CB   5  
ATOM 3831  O OG   . SER A 1 35 ? 8.541   -8.308  10.427  1.00 15.00 ?  331 SER A OG   5  
ATOM 3832  H H    . SER A 1 35 ? 5.451   -7.186  8.050   1.00 15.00 ?  331 SER A H    5  
ATOM 3833  H HA   . SER A 1 35 ? 6.355   -9.544  9.552   1.00 15.00 ?  331 SER A HA   5  
ATOM 3834  H HB2  . SER A 1 35 ? 8.130   -8.225  8.430   1.00 15.00 ?  331 SER A HB2  5  
ATOM 3835  H HB3  . SER A 1 35 ? 7.647   -6.810  9.365   1.00 15.00 ?  331 SER A HB3  5  
ATOM 3836  H HG   . SER A 1 35 ? 7.990   -8.571  11.180  1.00 15.00 ?  331 SER A HG   5  
ATOM 3837  N N    . ALA A 1 36 ? 4.600   -7.147  10.644  1.00 15.00 ?  332 ALA A N    5  
ATOM 3838  C CA   . ALA A 1 36 ? 3.957   -6.511  11.783  1.00 15.00 ?  332 ALA A CA   5  
ATOM 3839  C C    . ALA A 1 36 ? 3.101   -7.501  12.567  1.00 15.00 ?  332 ALA A C    5  
ATOM 3840  O O    . ALA A 1 36 ? 3.417   -7.839  13.708  1.00 15.00 ?  332 ALA A O    5  
ATOM 3841  C CB   . ALA A 1 36 ? 3.119   -5.330  11.325  1.00 15.00 ?  332 ALA A CB   5  
ATOM 3842  H H    . ALA A 1 36 ? 4.247   -6.982  9.743   1.00 15.00 ?  332 ALA A H    5  
ATOM 3843  H HA   . ALA A 1 36 ? 4.733   -6.135  12.434  1.00 15.00 ?  332 ALA A HA   5  
ATOM 3844  H HB1  . ALA A 1 36 ? 2.701   -4.828  12.187  1.00 15.00 ?  332 ALA A HB1  5  
ATOM 3845  H HB2  . ALA A 1 36 ? 2.318   -5.681  10.691  1.00 15.00 ?  332 ALA A HB2  5  
ATOM 3846  H HB3  . ALA A 1 36 ? 3.740   -4.641  10.773  1.00 15.00 ?  332 ALA A HB3  5  
ATOM 3847  N N    . ASN A 1 37 ? 2.031   -7.976  11.951  1.00 15.00 ?  333 ASN A N    5  
ATOM 3848  C CA   . ASN A 1 37 ? 1.108   -8.878  12.625  1.00 15.00 ?  333 ASN A CA   5  
ATOM 3849  C C    . ASN A 1 37 ? 1.283   -10.311 12.135  1.00 15.00 ?  333 ASN A C    5  
ATOM 3850  O O    . ASN A 1 37 ? 1.464   -11.209 12.980  1.00 15.00 ?  333 ASN A O    5  
ATOM 3851  C CB   . ASN A 1 37 ? -0.353  -8.406  12.475  1.00 15.00 ?  333 ASN A CB   5  
ATOM 3852  C CG   . ASN A 1 37 ? -0.740  -7.962  11.065  1.00 15.00 ?  333 ASN A CG   5  
ATOM 3853  O OD1  . ASN A 1 37 ? -1.562  -7.060  10.903  1.00 15.00 ?  333 ASN A OD1  5  
ATOM 3854  N ND2  . ASN A 1 37 ? -0.180  -8.587  10.044  1.00 15.00 ?  333 ASN A ND2  5  
ATOM 3855  O OXT  . ASN A 1 37 ? 1.285   -10.529 10.909  1.00 15.00 ?  333 ASN A OXT  5  
ATOM 3856  H H    . ASN A 1 37 ? 1.862   -7.727  11.017  1.00 15.00 ?  333 ASN A H    5  
ATOM 3857  H HA   . ASN A 1 37 ? 1.361   -8.855  13.675  1.00 15.00 ?  333 ASN A HA   5  
ATOM 3858  H HB2  . ASN A 1 37 ? -1.007  -9.217  12.756  1.00 15.00 ?  333 ASN A HB2  5  
ATOM 3859  H HB3  . ASN A 1 37 ? -0.519  -7.577  13.148  1.00 15.00 ?  333 ASN A HB3  5  
ATOM 3860  H HD21 . ASN A 1 37 ? 0.461   -9.316  10.237  1.00 15.00 ?  333 ASN A HD21 5  
ATOM 3861  H HD22 . ASN A 1 37 ? -0.423  -8.303  9.133   1.00 15.00 ?  333 ASN A HD22 5  
ATOM 3862  N N    . GLU B 2 1  ? 2.571   -9.104  -7.667  1.00 15.00 ?  203 GLU B N    5  
ATOM 3863  C CA   . GLU B 2 1  ? 2.729   -9.358  -6.216  1.00 15.00 ?  203 GLU B CA   5  
ATOM 3864  C C    . GLU B 2 1  ? 2.318   -10.786 -5.892  1.00 15.00 ?  203 GLU B C    5  
ATOM 3865  O O    . GLU B 2 1  ? 1.480   -11.364 -6.583  1.00 15.00 ?  203 GLU B O    5  
ATOM 3866  C CB   . GLU B 2 1  ? 1.876   -8.374  -5.401  1.00 15.00 ?  203 GLU B CB   5  
ATOM 3867  C CG   . GLU B 2 1  ? 2.509   -6.998  -5.227  1.00 15.00 ?  203 GLU B CG   5  
ATOM 3868  C CD   . GLU B 2 1  ? 3.056   -6.434  -6.520  1.00 15.00 ?  203 GLU B CD   5  
ATOM 3869  O OE1  . GLU B 2 1  ? 2.326   -6.443  -7.532  1.00 15.00 -1 203 GLU B OE1  5  
ATOM 3870  O OE2  . GLU B 2 1  ? 4.232   -6.030  -6.542  1.00 15.00 ?  203 GLU B OE2  5  
ATOM 3871  H H1   . GLU B 2 1  ? 3.223   -9.712  -8.210  1.00 15.00 ?  203 GLU B H1   5  
ATOM 3872  H H2   . GLU B 2 1  ? 2.774   -8.102  -7.882  1.00 15.00 ?  203 GLU B H2   5  
ATOM 3873  H H3   . GLU B 2 1  ? 1.598   -9.317  -7.957  1.00 15.00 ?  203 GLU B H3   5  
ATOM 3874  H HA   . GLU B 2 1  ? 3.768   -9.228  -5.957  1.00 15.00 ?  203 GLU B HA   5  
ATOM 3875  H HB2  . GLU B 2 1  ? 0.923   -8.245  -5.892  1.00 15.00 ?  203 GLU B HB2  5  
ATOM 3876  H HB3  . GLU B 2 1  ? 1.707   -8.793  -4.420  1.00 15.00 ?  203 GLU B HB3  5  
ATOM 3877  H HG2  . GLU B 2 1  ? 1.762   -6.318  -4.845  1.00 15.00 ?  203 GLU B HG2  5  
ATOM 3878  H HG3  . GLU B 2 1  ? 3.318   -7.077  -4.514  1.00 15.00 ?  203 GLU B HG3  5  
ATOM 3879  N N    . LEU B 2 2  ? 2.906   -11.348 -4.841  1.00 15.00 ?  204 LEU B N    5  
ATOM 3880  C CA   . LEU B 2 2  ? 2.554   -12.691 -4.379  1.00 15.00 ?  204 LEU B CA   5  
ATOM 3881  C C    . LEU B 2 2  ? 1.109   -12.724 -3.871  1.00 15.00 ?  204 LEU B C    5  
ATOM 3882  O O    . LEU B 2 2  ? 0.514   -13.788 -3.699  1.00 15.00 ?  204 LEU B O    5  
ATOM 3883  C CB   . LEU B 2 2  ? 3.518   -13.132 -3.271  1.00 15.00 ?  204 LEU B CB   5  
ATOM 3884  C CG   . LEU B 2 2  ? 3.377   -14.585 -2.808  1.00 15.00 ?  204 LEU B CG   5  
ATOM 3885  C CD1  . LEU B 2 2  ? 3.732   -15.545 -3.935  1.00 15.00 ?  204 LEU B CD1  5  
ATOM 3886  C CD2  . LEU B 2 2  ? 4.252   -14.842 -1.590  1.00 15.00 ?  204 LEU B CD2  5  
ATOM 3887  H H    . LEU B 2 2  ? 3.617   -10.852 -4.370  1.00 15.00 ?  204 LEU B H    5  
ATOM 3888  H HA   . LEU B 2 2  ? 2.645   -13.366 -5.217  1.00 15.00 ?  204 LEU B HA   5  
ATOM 3889  H HB2  . LEU B 2 2  ? 4.527   -12.988 -3.628  1.00 15.00 ?  204 LEU B HB2  5  
ATOM 3890  H HB3  . LEU B 2 2  ? 3.364   -12.490 -2.416  1.00 15.00 ?  204 LEU B HB3  5  
ATOM 3891  H HG   . LEU B 2 2  ? 2.349   -14.766 -2.528  1.00 15.00 ?  204 LEU B HG   5  
ATOM 3892  H HD11 . LEU B 2 2  ? 3.628   -16.562 -3.588  1.00 15.00 ?  204 LEU B HD11 5  
ATOM 3893  H HD12 . LEU B 2 2  ? 4.752   -15.374 -4.247  1.00 15.00 ?  204 LEU B HD12 5  
ATOM 3894  H HD13 . LEU B 2 2  ? 3.068   -15.381 -4.772  1.00 15.00 ?  204 LEU B HD13 5  
ATOM 3895  H HD21 . LEU B 2 2  ? 5.286   -14.654 -1.844  1.00 15.00 ?  204 LEU B HD21 5  
ATOM 3896  H HD22 . LEU B 2 2  ? 4.141   -15.869 -1.277  1.00 15.00 ?  204 LEU B HD22 5  
ATOM 3897  H HD23 . LEU B 2 2  ? 3.954   -14.185 -0.786  1.00 15.00 ?  204 LEU B HD23 5  
ATOM 3898  N N    . GLU B 2 3  ? 0.566   -11.544 -3.621  1.00 15.00 ?  205 GLU B N    5  
ATOM 3899  C CA   . GLU B 2 3  ? -0.810  -11.393 -3.175  1.00 15.00 ?  205 GLU B CA   5  
ATOM 3900  C C    . GLU B 2 3  ? -1.701  -11.053 -4.375  1.00 15.00 ?  205 GLU B C    5  
ATOM 3901  O O    . GLU B 2 3  ? -1.198  -10.669 -5.433  1.00 15.00 ?  205 GLU B O    5  
ATOM 3902  C CB   . GLU B 2 3  ? -0.872  -10.286 -2.108  1.00 15.00 ?  205 GLU B CB   5  
ATOM 3903  C CG   . GLU B 2 3  ? -2.258  -10.022 -1.533  1.00 15.00 ?  205 GLU B CG   5  
ATOM 3904  C CD   . GLU B 2 3  ? -2.906  -11.263 -0.956  1.00 15.00 ?  205 GLU B CD   5  
ATOM 3905  O OE1  . GLU B 2 3  ? -2.555  -11.656 0.171   1.00 15.00 -1 205 GLU B OE1  5  
ATOM 3906  O OE2  . GLU B 2 3  ? -3.781  -11.848 -1.631  1.00 15.00 ?  205 GLU B OE2  5  
ATOM 3907  H H    . GLU B 2 3  ? 1.106   -10.742 -3.752  1.00 15.00 ?  205 GLU B H    5  
ATOM 3908  H HA   . GLU B 2 3  ? -1.133  -12.328 -2.745  1.00 15.00 ?  205 GLU B HA   5  
ATOM 3909  H HB2  . GLU B 2 3  ? -0.221  -10.561 -1.292  1.00 15.00 ?  205 GLU B HB2  5  
ATOM 3910  H HB3  . GLU B 2 3  ? -0.509  -9.367  -2.545  1.00 15.00 ?  205 GLU B HB3  5  
ATOM 3911  H HG2  . GLU B 2 3  ? -2.174  -9.284  -0.750  1.00 15.00 ?  205 GLU B HG2  5  
ATOM 3912  H HG3  . GLU B 2 3  ? -2.891  -9.637  -2.320  1.00 15.00 ?  205 GLU B HG3  5  
ATOM 3913  N N    . SER B 2 4  ? -3.007  -11.213 -4.200  1.00 15.00 ?  206 SER B N    5  
ATOM 3914  C CA   . SER B 2 4  ? -3.995  -10.838 -5.209  1.00 15.00 ?  206 SER B CA   5  
ATOM 3915  C C    . SER B 2 4  ? -3.774  -9.436  -5.746  1.00 15.00 ?  206 SER B C    5  
ATOM 3916  O O    . SER B 2 4  ? -3.229  -8.557  -5.077  1.00 15.00 ?  206 SER B O    5  
ATOM 3917  C CB   . SER B 2 4  ? -5.397  -10.960 -4.631  1.00 15.00 ?  206 SER B CB   5  
ATOM 3918  O OG   . SER B 2 4  ? -5.433  -10.594 -3.258  1.00 15.00 ?  206 SER B OG   5  
ATOM 3919  H H    . SER B 2 4  ? -3.323  -11.598 -3.352  1.00 15.00 ?  206 SER B H    5  
ATOM 3920  H HA   . SER B 2 4  ? -3.929  -11.522 -6.048  1.00 15.00 ?  206 SER B HA   5  
ATOM 3921  H HB2  . SER B 2 4  ? -6.058  -10.307 -5.182  1.00 15.00 ?  206 SER B HB2  5  
ATOM 3922  H HB3  . SER B 2 4  ? -5.727  -11.978 -4.745  1.00 15.00 ?  206 SER B HB3  5  
ATOM 3923  H HG   . SER B 2 4  ? -4.861  -11.192 -2.747  1.00 15.00 ?  206 SER B HG   5  
ATOM 3924  N N    . PRO B 2 5  ? -4.252  -9.247  -6.969  1.00 15.00 ?  207 PRO B N    5  
ATOM 3925  C CA   . PRO B 2 5  ? -4.138  -8.000  -7.721  1.00 15.00 ?  207 PRO B CA   5  
ATOM 3926  C C    . PRO B 2 5  ? -4.549  -6.785  -6.883  1.00 15.00 ?  207 PRO B C    5  
ATOM 3927  O O    . PRO B 2 5  ? -5.683  -6.713  -6.398  1.00 15.00 ?  207 PRO B O    5  
ATOM 3928  C CB   . PRO B 2 5  ? -5.134  -8.196  -8.869  1.00 15.00 ?  207 PRO B CB   5  
ATOM 3929  C CG   . PRO B 2 5  ? -5.303  -9.676  -9.025  1.00 15.00 ?  207 PRO B CG   5  
ATOM 3930  C CD   . PRO B 2 5  ? -4.901  -10.317 -7.721  1.00 15.00 ?  207 PRO B CD   5  
ATOM 3931  H HA   . PRO B 2 5  ? -3.149  -7.863  -8.119  1.00 15.00 ?  207 PRO B HA   5  
ATOM 3932  H HB2  . PRO B 2 5  ? -6.070  -7.721  -8.616  1.00 15.00 ?  207 PRO B HB2  5  
ATOM 3933  H HB3  . PRO B 2 5  ? -4.735  -7.753  -9.768  1.00 15.00 ?  207 PRO B HB3  5  
ATOM 3934  H HG2  . PRO B 2 5  ? -6.336  -9.903  -9.244  1.00 15.00 ?  207 PRO B HG2  5  
ATOM 3935  H HG3  . PRO B 2 5  ? -4.668  -10.031 -9.823  1.00 15.00 ?  207 PRO B HG3  5  
ATOM 3936  H HD2  . PRO B 2 5  ? -5.751  -10.685 -7.175  1.00 15.00 ?  207 PRO B HD2  5  
ATOM 3937  H HD3  . PRO B 2 5  ? -4.215  -11.128 -7.881  1.00 15.00 ?  207 PRO B HD3  5  
ATOM 3938  N N    . PRO B 2 6  ? -3.623  -5.827  -6.677  1.00 15.00 ?  208 PRO B N    5  
ATOM 3939  C CA   . PRO B 2 6  ? -3.857  -4.676  -5.816  1.00 15.00 ?  208 PRO B CA   5  
ATOM 3940  C C    . PRO B 2 6  ? -4.530  -3.500  -6.520  1.00 15.00 ?  208 PRO B C    5  
ATOM 3941  O O    . PRO B 2 6  ? -4.607  -3.454  -7.750  1.00 15.00 ?  208 PRO B O    5  
ATOM 3942  C CB   . PRO B 2 6  ? -2.445  -4.277  -5.356  1.00 15.00 ?  208 PRO B CB   5  
ATOM 3943  C CG   . PRO B 2 6  ? -1.478  -5.094  -6.161  1.00 15.00 ?  208 PRO B CG   5  
ATOM 3944  C CD   . PRO B 2 6  ? -2.266  -5.792  -7.235  1.00 15.00 ?  208 PRO B CD   5  
ATOM 3945  H HA   . PRO B 2 6  ? -4.444  -4.953  -4.952  1.00 15.00 ?  208 PRO B HA   5  
ATOM 3946  H HB2  . PRO B 2 6  ? -2.297  -3.219  -5.531  1.00 15.00 ?  208 PRO B HB2  5  
ATOM 3947  H HB3  . PRO B 2 6  ? -2.350  -4.485  -4.295  1.00 15.00 ?  208 PRO B HB3  5  
ATOM 3948  H HG2  . PRO B 2 6  ? -0.739  -4.446  -6.606  1.00 15.00 ?  208 PRO B HG2  5  
ATOM 3949  H HG3  . PRO B 2 6  ? -0.997  -5.819  -5.520  1.00 15.00 ?  208 PRO B HG3  5  
ATOM 3950  H HD2  . PRO B 2 6  ? -2.238  -5.226  -8.154  1.00 15.00 ?  208 PRO B HD2  5  
ATOM 3951  H HD3  . PRO B 2 6  ? -1.880  -6.786  -7.388  1.00 15.00 ?  208 PRO B HD3  5  
ATOM 3952  N N    . PRO B 2 7  ? -5.022  -2.538  -5.715  1.00 15.00 ?  209 PRO B N    5  
ATOM 3953  C CA   . PRO B 2 7  ? -5.623  -1.292  -6.203  1.00 15.00 ?  209 PRO B CA   5  
ATOM 3954  C C    . PRO B 2 7  ? -4.761  -0.584  -7.248  1.00 15.00 ?  209 PRO B C    5  
ATOM 3955  O O    . PRO B 2 7  ? -3.548  -0.446  -7.065  1.00 15.00 ?  209 PRO B O    5  
ATOM 3956  C CB   . PRO B 2 7  ? -5.685  -0.413  -4.948  1.00 15.00 ?  209 PRO B CB   5  
ATOM 3957  C CG   . PRO B 2 7  ? -5.681  -1.345  -3.788  1.00 15.00 ?  209 PRO B CG   5  
ATOM 3958  C CD   . PRO B 2 7  ? -5.051  -2.629  -4.244  1.00 15.00 ?  209 PRO B CD   5  
ATOM 3959  H HA   . PRO B 2 7  ? -6.618  -1.444  -6.590  1.00 15.00 ?  209 PRO B HA   5  
ATOM 3960  H HB2  . PRO B 2 7  ? -4.825  0.238   -4.925  1.00 15.00 ?  209 PRO B HB2  5  
ATOM 3961  H HB3  . PRO B 2 7  ? -6.583  0.181   -4.967  1.00 15.00 ?  209 PRO B HB3  5  
ATOM 3962  H HG2  . PRO B 2 7  ? -5.095  -0.917  -2.986  1.00 15.00 ?  209 PRO B HG2  5  
ATOM 3963  H HG3  . PRO B 2 7  ? -6.695  -1.521  -3.456  1.00 15.00 ?  209 PRO B HG3  5  
ATOM 3964  H HD2  . PRO B 2 7  ? -4.051  -2.713  -3.850  1.00 15.00 ?  209 PRO B HD2  5  
ATOM 3965  H HD3  . PRO B 2 7  ? -5.649  -3.470  -3.924  1.00 15.00 ?  209 PRO B HD3  5  
ATOM 3966  N N    . PRO B 2 8  ? -5.379  -0.120  -8.349  1.00 15.00 ?  210 PRO B N    5  
ATOM 3967  C CA   . PRO B 2 8  ? -4.701  0.722   -9.341  1.00 15.00 ?  210 PRO B CA   5  
ATOM 3968  C C    . PRO B 2 8  ? -4.113  1.965   -8.678  1.00 15.00 ?  210 PRO B C    5  
ATOM 3969  O O    . PRO B 2 8  ? -4.750  2.556   -7.799  1.00 15.00 ?  210 PRO B O    5  
ATOM 3970  C CB   . PRO B 2 8  ? -5.822  1.107   -10.312 1.00 15.00 ?  210 PRO B CB   5  
ATOM 3971  C CG   . PRO B 2 8  ? -6.857  0.049   -10.147 1.00 15.00 ?  210 PRO B CG   5  
ATOM 3972  C CD   . PRO B 2 8  ? -6.783  -0.383  -8.711  1.00 15.00 ?  210 PRO B CD   5  
ATOM 3973  H HA   . PRO B 2 8  ? -3.924  0.183   -9.863  1.00 15.00 ?  210 PRO B HA   5  
ATOM 3974  H HB2  . PRO B 2 8  ? -6.208  2.081   -10.050 1.00 15.00 ?  210 PRO B HB2  5  
ATOM 3975  H HB3  . PRO B 2 8  ? -5.437  1.126   -11.321 1.00 15.00 ?  210 PRO B HB3  5  
ATOM 3976  H HG2  . PRO B 2 8  ? -7.833  0.455   -10.365 1.00 15.00 ?  210 PRO B HG2  5  
ATOM 3977  H HG3  . PRO B 2 8  ? -6.641  -0.784  -10.801 1.00 15.00 ?  210 PRO B HG3  5  
ATOM 3978  H HD2  . PRO B 2 8  ? -7.455  0.206   -8.105  1.00 15.00 ?  210 PRO B HD2  5  
ATOM 3979  H HD3  . PRO B 2 8  ? -7.013  -1.436  -8.619  1.00 15.00 ?  210 PRO B HD3  5  
ATOM 3980  N N    . TYR B 2 9  ? -2.919  2.370   -9.104  1.00 15.00 ?  211 TYR B N    5  
ATOM 3981  C CA   . TYR B 2 9  ? -2.176  3.411   -8.401  1.00 15.00 ?  211 TYR B CA   5  
ATOM 3982  C C    . TYR B 2 9  ? -2.936  4.737   -8.339  1.00 15.00 ?  211 TYR B C    5  
ATOM 3983  O O    . TYR B 2 9  ? -2.966  5.507   -9.299  1.00 15.00 ?  211 TYR B O    5  
ATOM 3984  C CB   . TYR B 2 9  ? -0.796  3.646   -9.014  1.00 15.00 ?  211 TYR B CB   5  
ATOM 3985  C CG   . TYR B 2 9  ? 0.076   4.550   -8.162  1.00 15.00 ?  211 TYR B CG   5  
ATOM 3986  C CD1  . TYR B 2 9  ? 0.431   4.177   -6.871  1.00 15.00 ?  211 TYR B CD1  5  
ATOM 3987  C CD2  . TYR B 2 9  ? 0.547   5.771   -8.640  1.00 15.00 ?  211 TYR B CD2  5  
ATOM 3988  C CE1  . TYR B 2 9  ? 1.224   4.983   -6.085  1.00 15.00 ?  211 TYR B CE1  5  
ATOM 3989  C CE2  . TYR B 2 9  ? 1.343   6.586   -7.849  1.00 15.00 ?  211 TYR B CE2  5  
ATOM 3990  C CZ   . TYR B 2 9  ? 1.676   6.184   -6.574  1.00 15.00 ?  211 TYR B CZ   5  
ATOM 3991  O OH   . TYR B 2 9  ? 2.476   6.975   -5.783  1.00 15.00 ?  211 TYR B OH   5  
ATOM 3992  H H    . TYR B 2 9  ? -2.526  1.951   -9.904  1.00 15.00 ?  211 TYR B H    5  
ATOM 3993  H HA   . TYR B 2 9  ? -2.031  3.059   -7.389  1.00 15.00 ?  211 TYR B HA   5  
ATOM 3994  H HB2  . TYR B 2 9  ? -0.290  2.698   -9.126  1.00 15.00 ?  211 TYR B HB2  5  
ATOM 3995  H HB3  . TYR B 2 9  ? -0.911  4.107   -9.984  1.00 15.00 ?  211 TYR B HB3  5  
ATOM 3996  H HD1  . TYR B 2 9  ? 0.073   3.235   -6.479  1.00 15.00 ?  211 TYR B HD1  5  
ATOM 3997  H HD2  . TYR B 2 9  ? 0.284   6.083   -9.639  1.00 15.00 ?  211 TYR B HD2  5  
ATOM 3998  H HE1  . TYR B 2 9  ? 1.483   4.669   -5.086  1.00 15.00 ?  211 TYR B HE1  5  
ATOM 3999  H HE2  . TYR B 2 9  ? 1.704   7.533   -8.233  1.00 15.00 ?  211 TYR B HE2  5  
ATOM 4000  H HH   . TYR B 2 9  ? 3.225   6.450   -5.470  1.00 15.00 ?  211 TYR B HH   5  
ATOM 4001  N N    . SER B 2 10 ? -3.593  4.947   -7.214  1.00 15.00 ?  212 SER B N    5  
ATOM 4002  C CA   . SER B 2 10 ? -4.138  6.230   -6.838  1.00 15.00 ?  212 SER B CA   5  
ATOM 4003  C C    . SER B 2 10 ? -3.344  6.689   -5.626  1.00 15.00 ?  212 SER B C    5  
ATOM 4004  O O    . SER B 2 10 ? -2.858  5.838   -4.881  1.00 15.00 ?  212 SER B O    5  
ATOM 4005  C CB   . SER B 2 10 ? -5.620  6.075   -6.487  1.00 15.00 ?  212 SER B CB   5  
ATOM 4006  O OG   . SER B 2 10 ? -6.298  5.307   -7.472  1.00 15.00 ?  212 SER B OG   5  
ATOM 4007  H H    . SER B 2 10 ? -3.733  4.191   -6.606  1.00 15.00 ?  212 SER B H    5  
ATOM 4008  H HA   . SER B 2 10 ? -4.010  6.926   -7.653  1.00 15.00 ?  212 SER B HA   5  
ATOM 4009  H HB2  . SER B 2 10 ? -5.712  5.578   -5.532  1.00 15.00 ?  212 SER B HB2  5  
ATOM 4010  H HB3  . SER B 2 10 ? -6.079  7.053   -6.429  1.00 15.00 ?  212 SER B HB3  5  
ATOM 4011  H HG   . SER B 2 10 ? -6.069  4.373   -7.362  1.00 15.00 ?  212 SER B HG   5  
ATOM 4012  N N    . ARG B 2 11 ? -3.178  7.994   -5.417  1.00 15.00 ?  213 ARG B N    5  
ATOM 4013  C CA   . ARG B 2 11 ? -2.358  8.443   -4.293  1.00 15.00 ?  213 ARG B CA   5  
ATOM 4014  C C    . ARG B 2 11 ? -2.969  7.909   -3.008  1.00 15.00 ?  213 ARG B C    5  
ATOM 4015  O O    . ARG B 2 11 ? -2.290  7.296   -2.190  1.00 15.00 ?  213 ARG B O    5  
ATOM 4016  C CB   . ARG B 2 11 ? -2.245  9.973   -4.176  1.00 15.00 ?  213 ARG B CB   5  
ATOM 4017  C CG   . ARG B 2 11 ? -2.331  10.761  -5.470  1.00 15.00 ?  213 ARG B CG   5  
ATOM 4018  C CD   . ARG B 2 11 ? -1.376  10.250  -6.541  1.00 15.00 ?  213 ARG B CD   5  
ATOM 4019  N NE   . ARG B 2 11 ? -1.479  11.040  -7.768  1.00 15.00 ?  213 ARG B NE   5  
ATOM 4020  C CZ   . ARG B 2 11 ? -1.015  10.658  -8.957  1.00 15.00 ?  213 ARG B CZ   5  
ATOM 4021  N NH1  . ARG B 2 11 ? -0.383  9.499   -9.094  1.00 15.00 1  213 ARG B NH1  5  
ATOM 4022  N NH2  . ARG B 2 11 ? -1.172  11.450  -10.011 1.00 15.00 ?  213 ARG B NH2  5  
ATOM 4023  H H    . ARG B 2 11 ? -3.620  8.651   -6.004  1.00 15.00 ?  213 ARG B H    5  
ATOM 4024  H HA   . ARG B 2 11 ? -1.371  8.019   -4.413  1.00 15.00 ?  213 ARG B HA   5  
ATOM 4025  H HB2  . ARG B 2 11 ? -3.038  10.323  -3.531  1.00 15.00 ?  213 ARG B HB2  5  
ATOM 4026  H HB3  . ARG B 2 11 ? -1.299  10.208  -3.706  1.00 15.00 ?  213 ARG B HB3  5  
ATOM 4027  H HG2  . ARG B 2 11 ? -3.339  10.706  -5.836  1.00 15.00 ?  213 ARG B HG2  5  
ATOM 4028  H HG3  . ARG B 2 11 ? -2.089  11.792  -5.258  1.00 15.00 ?  213 ARG B HG3  5  
ATOM 4029  H HD2  . ARG B 2 11 ? -0.364  10.312  -6.167  1.00 15.00 ?  213 ARG B HD2  5  
ATOM 4030  H HD3  . ARG B 2 11 ? -1.617  9.221   -6.763  1.00 15.00 ?  213 ARG B HD3  5  
ATOM 4031  H HE   . ARG B 2 11 ? -1.933  11.917  -7.700  1.00 15.00 ?  213 ARG B HE   5  
ATOM 4032  H HH11 . ARG B 2 11 ? -0.251  8.901   -8.306  1.00 15.00 ?  213 ARG B HH11 5  
ATOM 4033  H HH12 . ARG B 2 11 ? -0.033  9.217   -10.001 1.00 15.00 ?  213 ARG B HH12 5  
ATOM 4034  H HH21 . ARG B 2 11 ? -1.636  12.335  -9.913  1.00 15.00 ?  213 ARG B HH21 5  
ATOM 4035  H HH22 . ARG B 2 11 ? -0.837  11.164  -10.914 1.00 15.00 ?  213 ARG B HH22 5  
ATOM 4036  N N    . TYR B 2 12 ? -4.254  8.185   -2.828  1.00 15.00 ?  214 TYR B N    5  
ATOM 4037  C CA   . TYR B 2 12 ? -5.006  7.654   -1.703  1.00 15.00 ?  214 TYR B CA   5  
ATOM 4038  C C    . TYR B 2 12 ? -6.170  6.820   -2.213  1.00 15.00 ?  214 TYR B C    5  
ATOM 4039  O O    . TYR B 2 12 ? -7.279  7.321   -2.404  1.00 15.00 ?  214 TYR B O    5  
ATOM 4040  C CB   . TYR B 2 12 ? -5.461  8.800   -0.795  1.00 15.00 ?  214 TYR B CB   5  
ATOM 4041  C CG   . TYR B 2 12 ? -4.330  9.768   -0.532  1.00 15.00 ?  214 TYR B CG   5  
ATOM 4042  C CD1  . TYR B 2 12 ? -4.030  10.769  -1.448  1.00 15.00 ?  214 TYR B CD1  5  
ATOM 4043  C CD2  . TYR B 2 12 ? -3.520  9.637   0.587   1.00 15.00 ?  214 TYR B CD2  5  
ATOM 4044  C CE1  . TYR B 2 12 ? -2.954  11.609  -1.263  1.00 15.00 ?  214 TYR B CE1  5  
ATOM 4045  C CE2  . TYR B 2 12 ? -2.450  10.485  0.790   1.00 15.00 ?  214 TYR B CE2  5  
ATOM 4046  C CZ   . TYR B 2 12 ? -2.166  11.465  -0.137  1.00 15.00 ?  214 TYR B CZ   5  
ATOM 4047  O OH   . TYR B 2 12 ? -1.079  12.281  0.056   1.00 15.00 ?  214 TYR B OH   5  
ATOM 4048  H H    . TYR B 2 12 ? -4.716  8.757   -3.481  1.00 15.00 ?  214 TYR B H    5  
ATOM 4049  H HA   . TYR B 2 12 ? -4.344  7.000   -1.146  1.00 15.00 ?  214 TYR B HA   5  
ATOM 4050  H HB2  . TYR B 2 12 ? -6.269  9.338   -1.272  1.00 15.00 ?  214 TYR B HB2  5  
ATOM 4051  H HB3  . TYR B 2 12 ? -5.796  8.403   0.151   1.00 15.00 ?  214 TYR B HB3  5  
ATOM 4052  H HD1  . TYR B 2 12 ? -4.651  10.882  -2.323  1.00 15.00 ?  214 TYR B HD1  5  
ATOM 4053  H HD2  . TYR B 2 12 ? -3.743  8.868   1.311   1.00 15.00 ?  214 TYR B HD2  5  
ATOM 4054  H HE1  . TYR B 2 12 ? -2.736  12.372  -2.002  1.00 15.00 ?  214 TYR B HE1  5  
ATOM 4055  H HE2  . TYR B 2 12 ? -1.831  10.371  1.669   1.00 15.00 ?  214 TYR B HE2  5  
ATOM 4056  H HH   . TYR B 2 12 ? -0.327  11.733  0.344   1.00 15.00 ?  214 TYR B HH   5  
ATOM 4057  N N    . PRO B 2 13 ? -5.895  5.555   -2.525  1.00 15.00 ?  215 PRO B N    5  
ATOM 4058  C CA   . PRO B 2 13 ? -6.889  4.632   -3.072  1.00 15.00 ?  215 PRO B CA   5  
ATOM 4059  C C    . PRO B 2 13 ? -7.886  4.149   -2.023  1.00 15.00 ?  215 PRO B C    5  
ATOM 4060  O O    . PRO B 2 13 ? -7.609  3.213   -1.276  1.00 15.00 ?  215 PRO B O    5  
ATOM 4061  C CB   . PRO B 2 13 ? -6.039  3.471   -3.592  1.00 15.00 ?  215 PRO B CB   5  
ATOM 4062  C CG   . PRO B 2 13 ? -4.800  3.501   -2.758  1.00 15.00 ?  215 PRO B CG   5  
ATOM 4063  C CD   . PRO B 2 13 ? -4.569  4.930   -2.384  1.00 15.00 ?  215 PRO B CD   5  
ATOM 4064  H HA   . PRO B 2 13 ? -7.428  5.081   -3.895  1.00 15.00 ?  215 PRO B HA   5  
ATOM 4065  H HB2  . PRO B 2 13 ? -6.577  2.543   -3.467  1.00 15.00 ?  215 PRO B HB2  5  
ATOM 4066  H HB3  . PRO B 2 13 ? -5.814  3.626   -4.637  1.00 15.00 ?  215 PRO B HB3  5  
ATOM 4067  H HG2  . PRO B 2 13 ? -4.942  2.910   -1.865  1.00 15.00 ?  215 PRO B HG2  5  
ATOM 4068  H HG3  . PRO B 2 13 ? -3.960  3.125   -3.326  1.00 15.00 ?  215 PRO B HG3  5  
ATOM 4069  H HD2  . PRO B 2 13 ? -4.218  5.000   -1.365  1.00 15.00 ?  215 PRO B HD2  5  
ATOM 4070  H HD3  . PRO B 2 13 ? -3.858  5.384   -3.059  1.00 15.00 ?  215 PRO B HD3  5  
ATOM 4071  N N    . MET B 2 14 ? -9.029  4.813   -1.946  1.00 15.00 ?  216 MET B N    5  
ATOM 4072  C CA   . MET B 2 14 ? -10.037 4.481   -0.948  1.00 15.00 ?  216 MET B CA   5  
ATOM 4073  C C    . MET B 2 14 ? -10.923 3.341   -1.430  1.00 15.00 ?  216 MET B C    5  
ATOM 4074  O O    . MET B 2 14 ? -11.783 3.534   -2.290  1.00 15.00 ?  216 MET B O    5  
ATOM 4075  C CB   . MET B 2 14 ? -10.891 5.707   -0.617  1.00 15.00 ?  216 MET B CB   5  
ATOM 4076  C CG   . MET B 2 14 ? -10.102 6.847   0.004   1.00 15.00 ?  216 MET B CG   5  
ATOM 4077  S SD   . MET B 2 14 ? -11.112 8.309   0.308   1.00 15.00 ?  216 MET B SD   5  
ATOM 4078  C CE   . MET B 2 14 ? -9.907  9.387   1.083   1.00 15.00 ?  216 MET B CE   5  
ATOM 4079  H H    . MET B 2 14 ? -9.205  5.538   -2.582  1.00 15.00 ?  216 MET B H    5  
ATOM 4080  H HA   . MET B 2 14 ? -9.521  4.163   -0.054  1.00 15.00 ?  216 MET B HA   5  
ATOM 4081  H HB2  . MET B 2 14 ? -11.348 6.068   -1.526  1.00 15.00 ?  216 MET B HB2  5  
ATOM 4082  H HB3  . MET B 2 14 ? -11.667 5.416   0.075   1.00 15.00 ?  216 MET B HB3  5  
ATOM 4083  H HG2  . MET B 2 14 ? -9.689  6.512   0.944   1.00 15.00 ?  216 MET B HG2  5  
ATOM 4084  H HG3  . MET B 2 14 ? -9.297  7.116   -0.666  1.00 15.00 ?  216 MET B HG3  5  
ATOM 4085  H HE1  . MET B 2 14 ? -9.539  8.923   1.986   1.00 15.00 ?  216 MET B HE1  5  
ATOM 4086  H HE2  . MET B 2 14 ? -10.371 10.332  1.325   1.00 15.00 ?  216 MET B HE2  5  
ATOM 4087  H HE3  . MET B 2 14 ? -9.084  9.555   0.403   1.00 15.00 ?  216 MET B HE3  5  
ATOM 4088  N N    . ASP B 2 15 ? -10.685 2.152   -0.897  1.00 15.00 ?  217 ASP B N    5  
ATOM 4089  C CA   . ASP B 2 15 ? -11.449 0.969   -1.271  1.00 15.00 ?  217 ASP B CA   5  
ATOM 4090  C C    . ASP B 2 15 ? -11.780 0.138   -0.042  1.00 15.00 ?  217 ASP B C    5  
ATOM 4091  O O    . ASP B 2 15 ? -10.900 -0.607  0.432   1.00 15.00 ?  217 ASP B O    5  
ATOM 4092  C CB   . ASP B 2 15 ? -10.682 0.120   -2.292  1.00 15.00 ?  217 ASP B CB   5  
ATOM 4093  C CG   . ASP B 2 15 ? -10.787 0.661   -3.704  1.00 15.00 ?  217 ASP B CG   5  
ATOM 4094  O OD1  . ASP B 2 15 ? -11.803 0.375   -4.377  1.00 15.00 -1 217 ASP B OD1  5  
ATOM 4095  O OD2  . ASP B 2 15 ? -9.869  1.379   -4.153  1.00 15.00 ?  217 ASP B OD2  5  
ATOM 4096  O OXT  . ASP B 2 15 ? -12.923 0.246   0.454   1.00 15.00 ?  217 ASP B OXT  5  
ATOM 4097  H H    . ASP B 2 15 ? -9.977  2.062   -0.227  1.00 15.00 ?  217 ASP B H    5  
ATOM 4098  H HA   . ASP B 2 15 ? -12.373 1.305   -1.720  1.00 15.00 ?  217 ASP B HA   5  
ATOM 4099  H HB2  . ASP B 2 15 ? -9.638  0.092   -2.015  1.00 15.00 ?  217 ASP B HB2  5  
ATOM 4100  H HB3  . ASP B 2 15 ? -11.078 -0.886  -2.281  1.00 15.00 ?  217 ASP B HB3  5  
ATOM 4101  N N    . GLY A 1 1  ? 8.087   1.694   14.720  1.00 15.00 ?  297 GLY A N    6  
ATOM 4102  C CA   . GLY A 1 1  ? 8.448   2.249   13.394  1.00 15.00 ?  297 GLY A CA   6  
ATOM 4103  C C    . GLY A 1 1  ? 7.366   3.160   12.853  1.00 15.00 ?  297 GLY A C    6  
ATOM 4104  O O    . GLY A 1 1  ? 6.260   2.702   12.571  1.00 15.00 ?  297 GLY A O    6  
ATOM 4105  H H1   . GLY A 1 1  ? 8.019   2.464   15.423  1.00 15.00 ?  297 GLY A H1   6  
ATOM 4106  H H2   . GLY A 1 1  ? 8.807   1.009   15.037  1.00 15.00 ?  297 GLY A H2   6  
ATOM 4107  H H3   . GLY A 1 1  ? 7.171   1.214   14.664  1.00 15.00 ?  297 GLY A H3   6  
ATOM 4108  H HA2  . GLY A 1 1  ? 9.366   2.811   13.484  1.00 15.00 ?  297 GLY A HA2  6  
ATOM 4109  H HA3  . GLY A 1 1  ? 8.602   1.435   12.700  1.00 15.00 ?  297 GLY A HA3  6  
ATOM 4110  N N    . PRO A 1 2  ? 7.652   4.462   12.714  1.00 15.00 ?  298 PRO A N    6  
ATOM 4111  C CA   . PRO A 1 2  ? 6.688   5.431   12.187  1.00 15.00 ?  298 PRO A CA   6  
ATOM 4112  C C    . PRO A 1 2  ? 6.571   5.358   10.665  1.00 15.00 ?  298 PRO A C    6  
ATOM 4113  O O    . PRO A 1 2  ? 7.497   4.914   9.985   1.00 15.00 ?  298 PRO A O    6  
ATOM 4114  C CB   . PRO A 1 2  ? 7.285   6.772   12.613  1.00 15.00 ?  298 PRO A CB   6  
ATOM 4115  C CG   . PRO A 1 2  ? 8.755   6.535   12.661  1.00 15.00 ?  298 PRO A CG   6  
ATOM 4116  C CD   . PRO A 1 2  ? 8.939   5.095   13.063  1.00 15.00 ?  298 PRO A CD   6  
ATOM 4117  H HA   . PRO A 1 2  ? 5.712   5.307   12.633  1.00 15.00 ?  298 PRO A HA   6  
ATOM 4118  H HB2  . PRO A 1 2  ? 7.029   7.530   11.889  1.00 15.00 ?  298 PRO A HB2  6  
ATOM 4119  H HB3  . PRO A 1 2  ? 6.900   7.048   13.583  1.00 15.00 ?  298 PRO A HB3  6  
ATOM 4120  H HG2  . PRO A 1 2  ? 9.185   6.710   11.686  1.00 15.00 ?  298 PRO A HG2  6  
ATOM 4121  H HG3  . PRO A 1 2  ? 9.208   7.189   13.394  1.00 15.00 ?  298 PRO A HG3  6  
ATOM 4122  H HD2  . PRO A 1 2  ? 9.748   4.647   12.505  1.00 15.00 ?  298 PRO A HD2  6  
ATOM 4123  H HD3  . PRO A 1 2  ? 9.127   5.023   14.125  1.00 15.00 ?  298 PRO A HD3  6  
ATOM 4124  N N    . LEU A 1 3  ? 5.433   5.799   10.142  1.00 15.00 ?  299 LEU A N    6  
ATOM 4125  C CA   . LEU A 1 3  ? 5.212   5.837   8.702   1.00 15.00 ?  299 LEU A CA   6  
ATOM 4126  C C    . LEU A 1 3  ? 6.241   6.745   8.028   1.00 15.00 ?  299 LEU A C    6  
ATOM 4127  O O    . LEU A 1 3  ? 6.371   7.917   8.392   1.00 15.00 ?  299 LEU A O    6  
ATOM 4128  C CB   . LEU A 1 3  ? 3.798   6.347   8.399   1.00 15.00 ?  299 LEU A CB   6  
ATOM 4129  C CG   . LEU A 1 3  ? 3.429   6.404   6.916   1.00 15.00 ?  299 LEU A CG   6  
ATOM 4130  C CD1  . LEU A 1 3  ? 3.292   5.004   6.340   1.00 15.00 ?  299 LEU A CD1  6  
ATOM 4131  C CD2  . LEU A 1 3  ? 2.147   7.195   6.720   1.00 15.00 ?  299 LEU A CD2  6  
ATOM 4132  H H    . LEU A 1 3  ? 4.724   6.110   10.740  1.00 15.00 ?  299 LEU A H    6  
ATOM 4133  H HA   . LEU A 1 3  ? 5.319   4.835   8.317   1.00 15.00 ?  299 LEU A HA   6  
ATOM 4134  H HB2  . LEU A 1 3  ? 3.092   5.701   8.900   1.00 15.00 ?  299 LEU A HB2  6  
ATOM 4135  H HB3  . LEU A 1 3  ? 3.702   7.341   8.806   1.00 15.00 ?  299 LEU A HB3  6  
ATOM 4136  H HG   . LEU A 1 3  ? 4.218   6.909   6.378   1.00 15.00 ?  299 LEU A HG   6  
ATOM 4137  H HD11 . LEU A 1 3  ? 2.496   4.482   6.849   1.00 15.00 ?  299 LEU A HD11 6  
ATOM 4138  H HD12 . LEU A 1 3  ? 4.217   4.466   6.475   1.00 15.00 ?  299 LEU A HD12 6  
ATOM 4139  H HD13 . LEU A 1 3  ? 3.062   5.069   5.287   1.00 15.00 ?  299 LEU A HD13 6  
ATOM 4140  H HD21 . LEU A 1 3  ? 1.899   7.223   5.669   1.00 15.00 ?  299 LEU A HD21 6  
ATOM 4141  H HD22 . LEU A 1 3  ? 2.286   8.202   7.085   1.00 15.00 ?  299 LEU A HD22 6  
ATOM 4142  H HD23 . LEU A 1 3  ? 1.345   6.721   7.267   1.00 15.00 ?  299 LEU A HD23 6  
ATOM 4143  N N    . PRO A 1 4  ? 6.988   6.220   7.043   1.00 15.00 ?  300 PRO A N    6  
ATOM 4144  C CA   . PRO A 1 4  ? 7.988   7.006   6.314   1.00 15.00 ?  300 PRO A CA   6  
ATOM 4145  C C    . PRO A 1 4  ? 7.332   8.101   5.469   1.00 15.00 ?  300 PRO A C    6  
ATOM 4146  O O    . PRO A 1 4  ? 6.327   7.856   4.805   1.00 15.00 ?  300 PRO A O    6  
ATOM 4147  C CB   . PRO A 1 4  ? 8.686   5.972   5.422   1.00 15.00 ?  300 PRO A CB   6  
ATOM 4148  C CG   . PRO A 1 4  ? 8.297   4.643   5.978   1.00 15.00 ?  300 PRO A CG   6  
ATOM 4149  C CD   . PRO A 1 4  ? 6.928   4.834   6.549   1.00 15.00 ?  300 PRO A CD   6  
ATOM 4150  H HA   . PRO A 1 4  ? 8.707   7.455   6.987   1.00 15.00 ?  300 PRO A HA   6  
ATOM 4151  H HB2  . PRO A 1 4  ? 8.343   6.089   4.408   1.00 15.00 ?  300 PRO A HB2  6  
ATOM 4152  H HB3  . PRO A 1 4  ? 9.755   6.119   5.464   1.00 15.00 ?  300 PRO A HB3  6  
ATOM 4153  H HG2  . PRO A 1 4  ? 8.276   3.903   5.190   1.00 15.00 ?  300 PRO A HG2  6  
ATOM 4154  H HG3  . PRO A 1 4  ? 8.989   4.352   6.753   1.00 15.00 ?  300 PRO A HG3  6  
ATOM 4155  H HD2  . PRO A 1 4  ? 6.180   4.730   5.775   1.00 15.00 ?  300 PRO A HD2  6  
ATOM 4156  H HD3  . PRO A 1 4  ? 6.747   4.133   7.352   1.00 15.00 ?  300 PRO A HD3  6  
ATOM 4157  N N    . PRO A 1 5  ? 7.913   9.313   5.461   1.00 15.00 ?  301 PRO A N    6  
ATOM 4158  C CA   . PRO A 1 5  ? 7.309   10.496  4.820   1.00 15.00 ?  301 PRO A CA   6  
ATOM 4159  C C    . PRO A 1 5  ? 7.105   10.352  3.308   1.00 15.00 ?  301 PRO A C    6  
ATOM 4160  O O    . PRO A 1 5  ? 6.315   11.086  2.710   1.00 15.00 ?  301 PRO A O    6  
ATOM 4161  C CB   . PRO A 1 5  ? 8.310   11.621  5.112   1.00 15.00 ?  301 PRO A CB   6  
ATOM 4162  C CG   . PRO A 1 5  ? 9.136   11.125  6.248   1.00 15.00 ?  301 PRO A CG   6  
ATOM 4163  C CD   . PRO A 1 5  ? 9.206   9.636   6.084   1.00 15.00 ?  301 PRO A CD   6  
ATOM 4164  H HA   . PRO A 1 5  ? 6.361   10.740  5.277   1.00 15.00 ?  301 PRO A HA   6  
ATOM 4165  H HB2  . PRO A 1 5  ? 8.915   11.804  4.235   1.00 15.00 ?  301 PRO A HB2  6  
ATOM 4166  H HB3  . PRO A 1 5  ? 7.775   12.521  5.378   1.00 15.00 ?  301 PRO A HB3  6  
ATOM 4167  H HG2  . PRO A 1 5  ? 10.125  11.556  6.198   1.00 15.00 ?  301 PRO A HG2  6  
ATOM 4168  H HG3  . PRO A 1 5  ? 8.664   11.377  7.186   1.00 15.00 ?  301 PRO A HG3  6  
ATOM 4169  H HD2  . PRO A 1 5  ? 10.028  9.365   5.437   1.00 15.00 ?  301 PRO A HD2  6  
ATOM 4170  H HD3  . PRO A 1 5  ? 9.302   9.152   7.045   1.00 15.00 ?  301 PRO A HD3  6  
ATOM 4171  N N    . GLY A 1 6  ? 7.837   9.435   2.692   1.00 15.00 ?  302 GLY A N    6  
ATOM 4172  C CA   . GLY A 1 6  ? 7.701   9.207   1.263   1.00 15.00 ?  302 GLY A CA   6  
ATOM 4173  C C    . GLY A 1 6  ? 6.653   8.157   0.959   1.00 15.00 ?  302 GLY A C    6  
ATOM 4174  O O    . GLY A 1 6  ? 6.198   8.017   -0.179  1.00 15.00 ?  302 GLY A O    6  
ATOM 4175  H H    . GLY A 1 6  ? 8.477   8.909   3.211   1.00 15.00 ?  302 GLY A H    6  
ATOM 4176  H HA2  . GLY A 1 6  ? 7.419   10.133  0.786   1.00 15.00 ?  302 GLY A HA2  6  
ATOM 4177  H HA3  . GLY A 1 6  ? 8.651   8.880   0.867   1.00 15.00 ?  302 GLY A HA3  6  
ATOM 4178  N N    . TRP A 1 7  ? 6.277   7.426   1.992   1.00 15.00 ?  303 TRP A N    6  
ATOM 4179  C CA   . TRP A 1 7  ? 5.372   6.299   1.867   1.00 15.00 ?  303 TRP A CA   6  
ATOM 4180  C C    . TRP A 1 7  ? 3.922   6.712   2.067   1.00 15.00 ?  303 TRP A C    6  
ATOM 4181  O O    . TRP A 1 7  ? 3.632   7.642   2.821   1.00 15.00 ?  303 TRP A O    6  
ATOM 4182  C CB   . TRP A 1 7  ? 5.729   5.241   2.891   1.00 15.00 ?  303 TRP A CB   6  
ATOM 4183  C CG   . TRP A 1 7  ? 6.776   4.302   2.414   1.00 15.00 ?  303 TRP A CG   6  
ATOM 4184  C CD1  . TRP A 1 7  ? 8.119   4.525   2.332   1.00 15.00 ?  303 TRP A CD1  6  
ATOM 4185  C CD2  . TRP A 1 7  ? 6.556   2.979   1.943   1.00 15.00 ?  303 TRP A CD2  6  
ATOM 4186  N NE1  . TRP A 1 7  ? 8.747   3.407   1.857   1.00 15.00 ?  303 TRP A NE1  6  
ATOM 4187  C CE2  . TRP A 1 7  ? 7.804   2.446   1.611   1.00 15.00 ?  303 TRP A CE2  6  
ATOM 4188  C CE3  . TRP A 1 7  ? 5.422   2.186   1.776   1.00 15.00 ?  303 TRP A CE3  6  
ATOM 4189  C CZ2  . TRP A 1 7  ? 7.945   1.161   1.126   1.00 15.00 ?  303 TRP A CZ2  6  
ATOM 4190  C CZ3  . TRP A 1 7  ? 5.575   0.908   1.291   1.00 15.00 ?  303 TRP A CZ3  6  
ATOM 4191  C CH2  . TRP A 1 7  ? 6.826   0.405   0.971   1.00 15.00 ?  303 TRP A CH2  6  
ATOM 4192  H H    . TRP A 1 7  ? 6.603   7.667   2.886   1.00 15.00 ?  303 TRP A H    6  
ATOM 4193  H HA   . TRP A 1 7  ? 5.498   5.886   0.878   1.00 15.00 ?  303 TRP A HA   6  
ATOM 4194  H HB2  . TRP A 1 7  ? 6.093   5.722   3.786   1.00 15.00 ?  303 TRP A HB2  6  
ATOM 4195  H HB3  . TRP A 1 7  ? 4.846   4.666   3.129   1.00 15.00 ?  303 TRP A HB3  6  
ATOM 4196  H HD1  . TRP A 1 7  ? 8.602   5.448   2.608   1.00 15.00 ?  303 TRP A HD1  6  
ATOM 4197  H HE1  . TRP A 1 7  ? 9.714   3.310   1.714   1.00 15.00 ?  303 TRP A HE1  6  
ATOM 4198  H HE3  . TRP A 1 7  ? 4.435   2.553   2.012   1.00 15.00 ?  303 TRP A HE3  6  
ATOM 4199  H HZ2  . TRP A 1 7  ? 8.892   0.772   0.868   1.00 15.00 ?  303 TRP A HZ2  6  
ATOM 4200  H HZ3  . TRP A 1 7  ? 4.711   0.292   1.141   1.00 15.00 ?  303 TRP A HZ3  6  
ATOM 4201  H HH2  . TRP A 1 7  ? 6.899   -0.608  0.607   1.00 15.00 ?  303 TRP A HH2  6  
ATOM 4202  N N    . GLU A 1 8  ? 3.012   6.000   1.415   1.00 15.00 ?  304 GLU A N    6  
ATOM 4203  C CA   . GLU A 1 8  ? 1.585   6.293   1.558   1.00 15.00 ?  304 GLU A CA   6  
ATOM 4204  C C    . GLU A 1 8  ? 0.828   5.024   1.939   1.00 15.00 ?  304 GLU A C    6  
ATOM 4205  O O    . GLU A 1 8  ? 0.849   4.040   1.213   1.00 15.00 ?  304 GLU A O    6  
ATOM 4206  C CB   . GLU A 1 8  ? 1.052   6.903   0.257   1.00 15.00 ?  304 GLU A CB   6  
ATOM 4207  C CG   . GLU A 1 8  ? 1.544   8.317   0.009   1.00 15.00 ?  304 GLU A CG   6  
ATOM 4208  C CD   . GLU A 1 8  ? 0.719   9.373   0.719   1.00 15.00 ?  304 GLU A CD   6  
ATOM 4209  O OE1  . GLU A 1 8  ? 0.299   9.143   1.870   1.00 15.00 -1 304 GLU A OE1  6  
ATOM 4210  O OE2  . GLU A 1 8  ? 0.490   10.447  0.118   1.00 15.00 ?  304 GLU A OE2  6  
ATOM 4211  H H    . GLU A 1 8  ? 3.305   5.241   0.831   1.00 15.00 ?  304 GLU A H    6  
ATOM 4212  H HA   . GLU A 1 8  ? 1.477   7.013   2.357   1.00 15.00 ?  304 GLU A HA   6  
ATOM 4213  H HB2  . GLU A 1 8  ? 1.377   6.288   -0.568  1.00 15.00 ?  304 GLU A HB2  6  
ATOM 4214  H HB3  . GLU A 1 8  ? -0.022  6.918   0.274   1.00 15.00 ?  304 GLU A HB3  6  
ATOM 4215  H HG2  . GLU A 1 8  ? 2.564   8.391   0.353   1.00 15.00 ?  304 GLU A HG2  6  
ATOM 4216  H HG3  . GLU A 1 8  ? 1.510   8.511   -1.053  1.00 15.00 ?  304 GLU A HG3  6  
ATOM 4217  N N    . ILE A 1 9  ? 0.162   5.045   3.084   1.00 15.00 ?  305 ILE A N    6  
ATOM 4218  C CA   . ILE A 1 9  ? -0.443  3.834   3.629   1.00 15.00 ?  305 ILE A CA   6  
ATOM 4219  C C    . ILE A 1 9  ? -1.969  3.839   3.496   1.00 15.00 ?  305 ILE A C    6  
ATOM 4220  O O    . ILE A 1 9  ? -2.640  4.760   3.961   1.00 15.00 ?  305 ILE A O    6  
ATOM 4221  C CB   . ILE A 1 9  ? -0.062  3.632   5.117   1.00 15.00 ?  305 ILE A CB   6  
ATOM 4222  C CG1  . ILE A 1 9  ? -0.766  2.392   5.685   1.00 15.00 ?  305 ILE A CG1  6  
ATOM 4223  C CG2  . ILE A 1 9  ? -0.404  4.869   5.938   1.00 15.00 ?  305 ILE A CG2  6  
ATOM 4224  C CD1  . ILE A 1 9  ? -0.437  2.115   7.136   1.00 15.00 ?  305 ILE A CD1  6  
ATOM 4225  H H    . ILE A 1 9  ? 0.057   5.894   3.565   1.00 15.00 ?  305 ILE A H    6  
ATOM 4226  H HA   . ILE A 1 9  ? -0.049  2.998   3.072   1.00 15.00 ?  305 ILE A HA   6  
ATOM 4227  H HB   . ILE A 1 9  ? 1.006   3.485   5.171   1.00 15.00 ?  305 ILE A HB   6  
ATOM 4228  H HG12 . ILE A 1 9  ? -1.834  2.527   5.611   1.00 15.00 ?  305 ILE A HG12 6  
ATOM 4229  H HG13 . ILE A 1 9  ? -0.478  1.525   5.108   1.00 15.00 ?  305 ILE A HG13 6  
ATOM 4230  H HG21 . ILE A 1 9  ? -0.141  4.702   6.974   1.00 15.00 ?  305 ILE A HG21 6  
ATOM 4231  H HG22 . ILE A 1 9  ? -1.464  5.067   5.864   1.00 15.00 ?  305 ILE A HG22 6  
ATOM 4232  H HG23 . ILE A 1 9  ? 0.147   5.718   5.560   1.00 15.00 ?  305 ILE A HG23 6  
ATOM 4233  H HD11 . ILE A 1 9  ? 0.624   1.937   7.238   1.00 15.00 ?  305 ILE A HD11 6  
ATOM 4234  H HD12 . ILE A 1 9  ? -0.981  1.243   7.467   1.00 15.00 ?  305 ILE A HD12 6  
ATOM 4235  H HD13 . ILE A 1 9  ? -0.720  2.966   7.739   1.00 15.00 ?  305 ILE A HD13 6  
ATOM 4236  N N    . ARG A 1 10 ? -2.513  2.810   2.850   1.00 15.00 ?  306 ARG A N    6  
ATOM 4237  C CA   . ARG A 1 10 ? -3.955  2.609   2.811   1.00 15.00 ?  306 ARG A CA   6  
ATOM 4238  C C    . ARG A 1 10 ? -4.275  1.120   2.907   1.00 15.00 ?  306 ARG A C    6  
ATOM 4239  O O    . ARG A 1 10 ? -3.503  0.281   2.446   1.00 15.00 ?  306 ARG A O    6  
ATOM 4240  C CB   . ARG A 1 10 ? -4.570  3.209   1.542   1.00 15.00 ?  306 ARG A CB   6  
ATOM 4241  C CG   . ARG A 1 10 ? -4.371  4.711   1.423   1.00 15.00 ?  306 ARG A CG   6  
ATOM 4242  C CD   . ARG A 1 10 ? -5.504  5.372   0.667   1.00 15.00 ?  306 ARG A CD   6  
ATOM 4243  N NE   . ARG A 1 10 ? -5.639  6.783   1.025   1.00 15.00 ?  306 ARG A NE   6  
ATOM 4244  C CZ   . ARG A 1 10 ? -6.716  7.517   0.764   1.00 15.00 ?  306 ARG A CZ   6  
ATOM 4245  N NH1  . ARG A 1 10 ? -7.713  7.011   0.050   1.00 15.00 1  306 ARG A NH1  6  
ATOM 4246  N NH2  . ARG A 1 10 ? -6.794  8.762   1.205   1.00 15.00 ?  306 ARG A NH2  6  
ATOM 4247  H H    . ARG A 1 10 ? -1.934  2.170   2.382   1.00 15.00 ?  306 ARG A H    6  
ATOM 4248  H HA   . ARG A 1 10 ? -4.377  3.107   3.673   1.00 15.00 ?  306 ARG A HA   6  
ATOM 4249  H HB2  . ARG A 1 10 ? -4.119  2.738   0.682   1.00 15.00 ?  306 ARG A HB2  6  
ATOM 4250  H HB3  . ARG A 1 10 ? -5.632  3.005   1.539   1.00 15.00 ?  306 ARG A HB3  6  
ATOM 4251  H HG2  . ARG A 1 10 ? -4.310  5.140   2.411   1.00 15.00 ?  306 ARG A HG2  6  
ATOM 4252  H HG3  . ARG A 1 10 ? -3.449  4.891   0.888   1.00 15.00 ?  306 ARG A HG3  6  
ATOM 4253  H HD2  . ARG A 1 10 ? -5.308  5.295   -0.392  1.00 15.00 ?  306 ARG A HD2  6  
ATOM 4254  H HD3  . ARG A 1 10 ? -6.424  4.860   0.902   1.00 15.00 ?  306 ARG A HD3  6  
ATOM 4255  H HE   . ARG A 1 10 ? -4.891  7.199   1.525   1.00 15.00 ?  306 ARG A HE   6  
ATOM 4256  H HH11 . ARG A 1 10 ? -7.658  6.069   -0.300  1.00 15.00 ?  306 ARG A HH11 6  
ATOM 4257  H HH12 . ARG A 1 10 ? -8.528  7.568   -0.139  1.00 15.00 ?  306 ARG A HH12 6  
ATOM 4258  H HH21 . ARG A 1 10 ? -6.041  9.158   1.741   1.00 15.00 ?  306 ARG A HH21 6  
ATOM 4259  H HH22 . ARG A 1 10 ? -7.612  9.315   1.012   1.00 15.00 ?  306 ARG A HH22 6  
ATOM 4260  N N    . ASN A 1 11 ? -5.422  0.801   3.488   1.00 15.00 ?  307 ASN A N    6  
ATOM 4261  C CA   . ASN A 1 11 ? -5.800  -0.587  3.741   1.00 15.00 ?  307 ASN A CA   6  
ATOM 4262  C C    . ASN A 1 11 ? -7.164  -0.881  3.103   1.00 15.00 ?  307 ASN A C    6  
ATOM 4263  O O    . ASN A 1 11 ? -8.094  -0.088  3.251   1.00 15.00 ?  307 ASN A O    6  
ATOM 4264  C CB   . ASN A 1 11 ? -5.864  -0.817  5.258   1.00 15.00 ?  307 ASN A CB   6  
ATOM 4265  C CG   . ASN A 1 11 ? -5.993  -2.278  5.659   1.00 15.00 ?  307 ASN A CG   6  
ATOM 4266  O OD1  . ASN A 1 11 ? -6.539  -3.101  4.931   1.00 15.00 ?  307 ASN A OD1  6  
ATOM 4267  N ND2  . ASN A 1 11 ? -5.483  -2.608  6.834   1.00 15.00 ?  307 ASN A ND2  6  
ATOM 4268  H H    . ASN A 1 11 ? -6.040  1.514   3.749   1.00 15.00 ?  307 ASN A H    6  
ATOM 4269  H HA   . ASN A 1 11 ? -5.045  -1.227  3.310   1.00 15.00 ?  307 ASN A HA   6  
ATOM 4270  H HB2  . ASN A 1 11 ? -4.965  -0.425  5.708   1.00 15.00 ?  307 ASN A HB2  6  
ATOM 4271  H HB3  . ASN A 1 11 ? -6.715  -0.280  5.654   1.00 15.00 ?  307 ASN A HB3  6  
ATOM 4272  H HD21 . ASN A 1 11 ? -5.052  -1.904  7.372   1.00 15.00 ?  307 ASN A HD21 6  
ATOM 4273  H HD22 . ASN A 1 11 ? -5.560  -3.540  7.128   1.00 15.00 ?  307 ASN A HD22 6  
ATOM 4274  N N    . THR A 1 12 ? -7.295  -2.009  2.403   1.00 15.00 ?  308 THR A N    6  
ATOM 4275  C CA   . THR A 1 12 ? -8.573  -2.377  1.806   1.00 15.00 ?  308 THR A CA   6  
ATOM 4276  C C    . THR A 1 12 ? -9.398  -3.214  2.784   1.00 15.00 ?  308 THR A C    6  
ATOM 4277  O O    . THR A 1 12 ? -8.858  -4.069  3.493   1.00 15.00 ?  308 THR A O    6  
ATOM 4278  C CB   . THR A 1 12 ? -8.400  -3.168  0.486   1.00 15.00 ?  308 THR A CB   6  
ATOM 4279  O OG1  . THR A 1 12 ? -7.491  -4.262  0.679   1.00 15.00 ?  308 THR A OG1  6  
ATOM 4280  C CG2  . THR A 1 12 ? -7.900  -2.275  -0.646  1.00 15.00 ?  308 THR A CG2  6  
ATOM 4281  H H    . THR A 1 12 ? -6.532  -2.619  2.319   1.00 15.00 ?  308 THR A H    6  
ATOM 4282  H HA   . THR A 1 12 ? -9.110  -1.466  1.587   1.00 15.00 ?  308 THR A HA   6  
ATOM 4283  H HB   . THR A 1 12 ? -9.364  -3.567  0.203   1.00 15.00 ?  308 THR A HB   6  
ATOM 4284  H HG1  . THR A 1 12 ? -6.765  -3.982  1.254   1.00 15.00 ?  308 THR A HG1  6  
ATOM 4285  H HG21 . THR A 1 12 ? -7.884  -2.836  -1.571  1.00 15.00 ?  308 THR A HG21 6  
ATOM 4286  H HG22 . THR A 1 12 ? -6.903  -1.932  -0.422  1.00 15.00 ?  308 THR A HG22 6  
ATOM 4287  H HG23 . THR A 1 12 ? -8.557  -1.425  -0.755  1.00 15.00 ?  308 THR A HG23 6  
ATOM 4288  N N    . ALA A 1 13 ? -10.710 -2.991  2.783   1.00 15.00 ?  309 ALA A N    6  
ATOM 4289  C CA   . ALA A 1 13 ? -11.622 -3.663  3.708   1.00 15.00 ?  309 ALA A CA   6  
ATOM 4290  C C    . ALA A 1 13 ? -11.636 -5.169  3.476   1.00 15.00 ?  309 ALA A C    6  
ATOM 4291  O O    . ALA A 1 13 ? -12.122 -5.934  4.310   1.00 15.00 ?  309 ALA A O    6  
ATOM 4292  C CB   . ALA A 1 13 ? -13.028 -3.093  3.565   1.00 15.00 ?  309 ALA A CB   6  
ATOM 4293  H H    . ALA A 1 13 ? -11.084 -2.358  2.121   1.00 15.00 ?  309 ALA A H    6  
ATOM 4294  H HA   . ALA A 1 13 ? -11.283 -3.466  4.713   1.00 15.00 ?  309 ALA A HA   6  
ATOM 4295  H HB1  . ALA A 1 13 ? -13.396 -3.293  2.570   1.00 15.00 ?  309 ALA A HB1  6  
ATOM 4296  H HB2  . ALA A 1 13 ? -13.002 -2.026  3.730   1.00 15.00 ?  309 ALA A HB2  6  
ATOM 4297  H HB3  . ALA A 1 13 ? -13.681 -3.555  4.292   1.00 15.00 ?  309 ALA A HB3  6  
ATOM 4298  N N    . THR A 1 14 ? -11.102 -5.588  2.337   1.00 15.00 ?  310 THR A N    6  
ATOM 4299  C CA   . THR A 1 14 ? -10.971 -7.002  2.015   1.00 15.00 ?  310 THR A CA   6  
ATOM 4300  C C    . THR A 1 14 ? -10.001 -7.706  2.971   1.00 15.00 ?  310 THR A C    6  
ATOM 4301  O O    . THR A 1 14 ? -9.965  -8.937  3.041   1.00 15.00 ?  310 THR A O    6  
ATOM 4302  C CB   . THR A 1 14 ? -10.498 -7.197  0.562   1.00 15.00 ?  310 THR A CB   6  
ATOM 4303  O OG1  . THR A 1 14 ? -9.291  -6.454  0.327   1.00 15.00 ?  310 THR A OG1  6  
ATOM 4304  C CG2  . THR A 1 14 ? -11.572 -6.751  -0.420  1.00 15.00 ?  310 THR A CG2  6  
ATOM 4305  H H    . THR A 1 14 ? -10.799 -4.921  1.684   1.00 15.00 ?  310 THR A H    6  
ATOM 4306  H HA   . THR A 1 14 ? -11.949 -7.455  2.116   1.00 15.00 ?  310 THR A HA   6  
ATOM 4307  H HB   . THR A 1 14 ? -10.300 -8.247  0.401   1.00 15.00 ?  310 THR A HB   6  
ATOM 4308  H HG1  . THR A 1 14 ? -9.137  -5.844  1.057   1.00 15.00 ?  310 THR A HG1  6  
ATOM 4309  H HG21 . THR A 1 14 ? -12.466 -7.338  -0.267  1.00 15.00 ?  310 THR A HG21 6  
ATOM 4310  H HG22 . THR A 1 14 ? -11.217 -6.890  -1.430  1.00 15.00 ?  310 THR A HG22 6  
ATOM 4311  H HG23 . THR A 1 14 ? -11.797 -5.706  -0.258  1.00 15.00 ?  310 THR A HG23 6  
ATOM 4312  N N    . GLY A 1 15 ? -9.216  -6.917  3.700   1.00 15.00 ?  311 GLY A N    6  
ATOM 4313  C CA   . GLY A 1 15 ? -8.261  -7.475  4.638   1.00 15.00 ?  311 GLY A CA   6  
ATOM 4314  C C    . GLY A 1 15 ? -6.857  -7.561  4.067   1.00 15.00 ?  311 GLY A C    6  
ATOM 4315  O O    . GLY A 1 15 ? -6.137  -8.526  4.323   1.00 15.00 ?  311 GLY A O    6  
ATOM 4316  H H    . GLY A 1 15 ? -9.309  -5.943  3.619   1.00 15.00 ?  311 GLY A H    6  
ATOM 4317  H HA2  . GLY A 1 15 ? -8.240  -6.855  5.523   1.00 15.00 ?  311 GLY A HA2  6  
ATOM 4318  H HA3  . GLY A 1 15 ? -8.586  -8.467  4.917   1.00 15.00 ?  311 GLY A HA3  6  
ATOM 4319  N N    . ARG A 1 16 ? -6.465  -6.549  3.300   1.00 15.00 ?  312 ARG A N    6  
ATOM 4320  C CA   . ARG A 1 16 ? -5.146  -6.513  2.674   1.00 15.00 ?  312 ARG A CA   6  
ATOM 4321  C C    . ARG A 1 16 ? -4.647  -5.073  2.645   1.00 15.00 ?  312 ARG A C    6  
ATOM 4322  O O    . ARG A 1 16 ? -5.423  -4.160  2.346   1.00 15.00 ?  312 ARG A O    6  
ATOM 4323  C CB   . ARG A 1 16 ? -5.202  -7.037  1.235   1.00 15.00 ?  312 ARG A CB   6  
ATOM 4324  C CG   . ARG A 1 16 ? -5.900  -8.368  1.044   1.00 15.00 ?  312 ARG A CG   6  
ATOM 4325  C CD   . ARG A 1 16 ? -6.143  -8.624  -0.432  1.00 15.00 ?  312 ARG A CD   6  
ATOM 4326  N NE   . ARG A 1 16 ? -7.223  -7.789  -0.958  1.00 15.00 ?  312 ARG A NE   6  
ATOM 4327  C CZ   . ARG A 1 16 ? -7.444  -7.562  -2.253  1.00 15.00 ?  312 ARG A CZ   6  
ATOM 4328  N NH1  . ARG A 1 16 ? -6.690  -8.146  -3.179  1.00 15.00 1  312 ARG A NH1  6  
ATOM 4329  N NH2  . ARG A 1 16 ? -8.438  -6.762  -2.616  1.00 15.00 ?  312 ARG A NH2  6  
ATOM 4330  H H    . ARG A 1 16 ? -7.065  -5.785  3.175   1.00 15.00 ?  312 ARG A H    6  
ATOM 4331  H HA   . ARG A 1 16 ? -4.469  -7.121  3.258   1.00 15.00 ?  312 ARG A HA   6  
ATOM 4332  H HB2  . ARG A 1 16 ? -5.694  -6.303  0.611   1.00 15.00 ?  312 ARG A HB2  6  
ATOM 4333  H HB3  . ARG A 1 16 ? -4.186  -7.148  0.882   1.00 15.00 ?  312 ARG A HB3  6  
ATOM 4334  H HG2  . ARG A 1 16 ? -5.279  -9.155  1.445   1.00 15.00 ?  312 ARG A HG2  6  
ATOM 4335  H HG3  . ARG A 1 16 ? -6.847  -8.348  1.561   1.00 15.00 ?  312 ARG A HG3  6  
ATOM 4336  H HD2  . ARG A 1 16 ? -5.235  -8.390  -0.971  1.00 15.00 ?  312 ARG A HD2  6  
ATOM 4337  H HD3  . ARG A 1 16 ? -6.394  -9.665  -0.573  1.00 15.00 ?  312 ARG A HD3  6  
ATOM 4338  H HE   . ARG A 1 16 ? -7.821  -7.360  -0.298  1.00 15.00 ?  312 ARG A HE   6  
ATOM 4339  H HH11 . ARG A 1 16 ? -5.950  -8.770  -2.910  1.00 15.00 ?  312 ARG A HH11 6  
ATOM 4340  H HH12 . ARG A 1 16 ? -6.853  -7.963  -4.151  1.00 15.00 ?  312 ARG A HH12 6  
ATOM 4341  H HH21 . ARG A 1 16 ? -9.017  -6.333  -1.918  1.00 15.00 ?  312 ARG A HH21 6  
ATOM 4342  H HH22 . ARG A 1 16 ? -8.614  -6.574  -3.593  1.00 15.00 ?  312 ARG A HH22 6  
ATOM 4343  N N    . VAL A 1 17 ? -3.367  -4.860  2.911   1.00 15.00 ?  313 VAL A N    6  
ATOM 4344  C CA   . VAL A 1 17 ? -2.832  -3.509  2.958   1.00 15.00 ?  313 VAL A CA   6  
ATOM 4345  C C    . VAL A 1 17 ? -1.925  -3.235  1.753   1.00 15.00 ?  313 VAL A C    6  
ATOM 4346  O O    . VAL A 1 17 ? -1.118  -4.068  1.365   1.00 15.00 ?  313 VAL A O    6  
ATOM 4347  C CB   . VAL A 1 17 ? -2.059  -3.249  4.266   1.00 15.00 ?  313 VAL A CB   6  
ATOM 4348  C CG1  . VAL A 1 17 ? -1.915  -1.755  4.508   1.00 15.00 ?  313 VAL A CG1  6  
ATOM 4349  C CG2  . VAL A 1 17 ? -2.746  -3.926  5.444   1.00 15.00 ?  313 VAL A CG2  6  
ATOM 4350  H H    . VAL A 1 17 ? -2.765  -5.621  3.065   1.00 15.00 ?  313 VAL A H    6  
ATOM 4351  H HA   . VAL A 1 17 ? -3.670  -2.828  2.924   1.00 15.00 ?  313 VAL A HA   6  
ATOM 4352  H HB   . VAL A 1 17 ? -1.069  -3.670  4.163   1.00 15.00 ?  313 VAL A HB   6  
ATOM 4353  H HG11 . VAL A 1 17 ? -1.370  -1.309  3.689   1.00 15.00 ?  313 VAL A HG11 6  
ATOM 4354  H HG12 . VAL A 1 17 ? -1.380  -1.591  5.431   1.00 15.00 ?  313 VAL A HG12 6  
ATOM 4355  H HG13 . VAL A 1 17 ? -2.894  -1.305  4.576   1.00 15.00 ?  313 VAL A HG13 6  
ATOM 4356  H HG21 . VAL A 1 17 ? -3.746  -3.535  5.549   1.00 15.00 ?  313 VAL A HG21 6  
ATOM 4357  H HG22 . VAL A 1 17 ? -2.187  -3.733  6.348   1.00 15.00 ?  313 VAL A HG22 6  
ATOM 4358  H HG23 . VAL A 1 17 ? -2.791  -4.992  5.270   1.00 15.00 ?  313 VAL A HG23 6  
ATOM 4359  N N    . TYR A 1 18 ? -2.068  -2.050  1.187   1.00 15.00 ?  314 TYR A N    6  
ATOM 4360  C CA   . TYR A 1 18 ? -1.398  -1.646  -0.023  1.00 15.00 ?  314 TYR A CA   6  
ATOM 4361  C C    . TYR A 1 18 ? -0.813  -0.252  0.195   1.00 15.00 ?  314 TYR A C    6  
ATOM 4362  O O    . TYR A 1 18 ? -1.537  0.729   0.373   1.00 15.00 ?  314 TYR A O    6  
ATOM 4363  C CB   . TYR A 1 18 ? -2.376  -1.656  -1.222  1.00 15.00 ?  314 TYR A CB   6  
ATOM 4364  C CG   . TYR A 1 18 ? -3.521  -0.657  -1.107  1.00 15.00 ?  314 TYR A CG   6  
ATOM 4365  C CD1  . TYR A 1 18 ? -4.570  -0.868  -0.222  1.00 15.00 ?  314 TYR A CD1  6  
ATOM 4366  C CD2  . TYR A 1 18 ? -3.537  0.510   -1.872  1.00 15.00 ?  314 TYR A CD2  6  
ATOM 4367  C CE1  . TYR A 1 18 ? -5.595  0.049   -0.097  1.00 15.00 ?  314 TYR A CE1  6  
ATOM 4368  C CE2  . TYR A 1 18 ? -4.565  1.432   -1.748  1.00 15.00 ?  314 TYR A CE2  6  
ATOM 4369  C CZ   . TYR A 1 18 ? -5.587  1.194   -0.855  1.00 15.00 ?  314 TYR A CZ   6  
ATOM 4370  O OH   . TYR A 1 18 ? -6.610  2.103   -0.722  1.00 15.00 ?  314 TYR A OH   6  
ATOM 4371  H H    . TYR A 1 18 ? -2.603  -1.403  1.626   1.00 15.00 ?  314 TYR A H    6  
ATOM 4372  H HA   . TYR A 1 18 ? -0.593  -2.342  -0.211  1.00 15.00 ?  314 TYR A HA   6  
ATOM 4373  H HB2  . TYR A 1 18 ? -1.828  -1.425  -2.122  1.00 15.00 ?  314 TYR A HB2  6  
ATOM 4374  H HB3  . TYR A 1 18 ? -2.805  -2.643  -1.313  1.00 15.00 ?  314 TYR A HB3  6  
ATOM 4375  H HD1  . TYR A 1 18 ? -4.577  -1.764  0.378   1.00 15.00 ?  314 TYR A HD1  6  
ATOM 4376  H HD2  . TYR A 1 18 ? -2.741  0.682   -2.584  1.00 15.00 ?  314 TYR A HD2  6  
ATOM 4377  H HE1  . TYR A 1 18 ? -6.400  -0.133  0.600   1.00 15.00 ?  314 TYR A HE1  6  
ATOM 4378  H HE2  . TYR A 1 18 ? -4.556  2.352   -2.337  1.00 15.00 ?  314 TYR A HE2  6  
ATOM 4379  H HH   . TYR A 1 18 ? -6.856  2.439   -1.589  1.00 15.00 ?  314 TYR A HH   6  
ATOM 4380  N N    . PHE A 1 19 ? 0.493   -0.178  0.262   1.00 15.00 ?  315 PHE A N    6  
ATOM 4381  C CA   . PHE A 1 19 ? 1.161   1.096   0.439   1.00 15.00 ?  315 PHE A CA   6  
ATOM 4382  C C    . PHE A 1 19 ? 1.558   1.654   -0.908  1.00 15.00 ?  315 PHE A C    6  
ATOM 4383  O O    . PHE A 1 19 ? 2.371   1.069   -1.602  1.00 15.00 ?  315 PHE A O    6  
ATOM 4384  C CB   . PHE A 1 19 ? 2.415   0.945   1.293   1.00 15.00 ?  315 PHE A CB   6  
ATOM 4385  C CG   . PHE A 1 19 ? 2.189   0.522   2.714   1.00 15.00 ?  315 PHE A CG   6  
ATOM 4386  C CD1  . PHE A 1 19 ? 1.532   -0.655  3.008   1.00 15.00 ?  315 PHE A CD1  6  
ATOM 4387  C CD2  . PHE A 1 19 ? 2.666   1.298   3.759   1.00 15.00 ?  315 PHE A CD2  6  
ATOM 4388  C CE1  . PHE A 1 19 ? 1.350   -1.051  4.313   1.00 15.00 ?  315 PHE A CE1  6  
ATOM 4389  C CE2  . PHE A 1 19 ? 2.493   0.900   5.068   1.00 15.00 ?  315 PHE A CE2  6  
ATOM 4390  C CZ   . PHE A 1 19 ? 1.832   -0.278  5.344   1.00 15.00 ?  315 PHE A CZ   6  
ATOM 4391  H H    . PHE A 1 19 ? 1.025   -1.001  0.199   1.00 15.00 ?  315 PHE A H    6  
ATOM 4392  H HA   . PHE A 1 19 ? 0.476   1.777   0.922   1.00 15.00 ?  315 PHE A HA   6  
ATOM 4393  H HB2  . PHE A 1 19 ? 3.057   0.207   0.837   1.00 15.00 ?  315 PHE A HB2  6  
ATOM 4394  H HB3  . PHE A 1 19 ? 2.934   1.892   1.312   1.00 15.00 ?  315 PHE A HB3  6  
ATOM 4395  H HD1  . PHE A 1 19 ? 1.153   -1.266  2.201   1.00 15.00 ?  315 PHE A HD1  6  
ATOM 4396  H HD2  . PHE A 1 19 ? 3.182   2.221   3.540   1.00 15.00 ?  315 PHE A HD2  6  
ATOM 4397  H HE1  . PHE A 1 19 ? 0.829   -1.972  4.528   1.00 15.00 ?  315 PHE A HE1  6  
ATOM 4398  H HE2  . PHE A 1 19 ? 2.869   1.511   5.874   1.00 15.00 ?  315 PHE A HE2  6  
ATOM 4399  H HZ   . PHE A 1 19 ? 1.703   -0.601  6.362   1.00 15.00 ?  315 PHE A HZ   6  
ATOM 4400  N N    . VAL A 1 20 ? 1.021   2.788   -1.275  1.00 15.00 ?  316 VAL A N    6  
ATOM 4401  C CA   . VAL A 1 20 ? 1.385   3.374   -2.536  1.00 15.00 ?  316 VAL A CA   6  
ATOM 4402  C C    . VAL A 1 20 ? 2.596   4.295   -2.333  1.00 15.00 ?  316 VAL A C    6  
ATOM 4403  O O    . VAL A 1 20 ? 2.539   5.255   -1.566  1.00 15.00 ?  316 VAL A O    6  
ATOM 4404  C CB   . VAL A 1 20 ? 0.207   4.141   -3.187  1.00 15.00 ?  316 VAL A CB   6  
ATOM 4405  C CG1  . VAL A 1 20 ? -0.817  3.159   -3.737  1.00 15.00 ?  316 VAL A CG1  6  
ATOM 4406  C CG2  . VAL A 1 20 ? -0.465  5.086   -2.209  1.00 15.00 ?  316 VAL A CG2  6  
ATOM 4407  H H    . VAL A 1 20 ? 0.392   3.248   -0.681  1.00 15.00 ?  316 VAL A H    6  
ATOM 4408  H HA   . VAL A 1 20 ? 1.654   2.562   -3.195  1.00 15.00 ?  316 VAL A HA   6  
ATOM 4409  H HB   . VAL A 1 20 ? 0.593   4.723   -4.011  1.00 15.00 ?  316 VAL A HB   6  
ATOM 4410  H HG11 . VAL A 1 20 ? -1.632  3.706   -4.188  1.00 15.00 ?  316 VAL A HG11 6  
ATOM 4411  H HG12 . VAL A 1 20 ? -1.197  2.546   -2.932  1.00 15.00 ?  316 VAL A HG12 6  
ATOM 4412  H HG13 . VAL A 1 20 ? -0.352  2.530   -4.480  1.00 15.00 ?  316 VAL A HG13 6  
ATOM 4413  H HG21 . VAL A 1 20 ? 0.285   5.676   -1.701  1.00 15.00 ?  316 VAL A HG21 6  
ATOM 4414  H HG22 . VAL A 1 20 ? -1.033  4.517   -1.486  1.00 15.00 ?  316 VAL A HG22 6  
ATOM 4415  H HG23 . VAL A 1 20 ? -1.129  5.742   -2.750  1.00 15.00 ?  316 VAL A HG23 6  
ATOM 4416  N N    . ASP A 1 21 ? 3.720   3.970   -2.964  1.00 15.00 ?  317 ASP A N    6  
ATOM 4417  C CA   . ASP A 1 21 ? 4.915   4.769   -2.806  1.00 15.00 ?  317 ASP A CA   6  
ATOM 4418  C C    . ASP A 1 21 ? 4.906   5.837   -3.875  1.00 15.00 ?  317 ASP A C    6  
ATOM 4419  O O    . ASP A 1 21 ? 4.832   5.515   -5.059  1.00 15.00 ?  317 ASP A O    6  
ATOM 4420  C CB   . ASP A 1 21 ? 6.183   3.934   -2.989  1.00 15.00 ?  317 ASP A CB   6  
ATOM 4421  C CG   . ASP A 1 21 ? 6.029   2.492   -2.589  1.00 15.00 ?  317 ASP A CG   6  
ATOM 4422  O OD1  . ASP A 1 21 ? 5.628   1.680   -3.447  1.00 15.00 -1 317 ASP A OD1  6  
ATOM 4423  O OD2  . ASP A 1 21 ? 6.370   2.155   -1.444  1.00 15.00 ?  317 ASP A OD2  6  
ATOM 4424  H H    . ASP A 1 21 ? 3.754   3.168   -3.532  1.00 15.00 ?  317 ASP A H    6  
ATOM 4425  H HA   . ASP A 1 21 ? 4.907   5.225   -1.829  1.00 15.00 ?  317 ASP A HA   6  
ATOM 4426  H HB2  . ASP A 1 21 ? 6.491   3.971   -4.020  1.00 15.00 ?  317 ASP A HB2  6  
ATOM 4427  H HB3  . ASP A 1 21 ? 6.960   4.357   -2.369  1.00 15.00 ?  317 ASP A HB3  6  
ATOM 4428  N N    . HIS A 1 22 ? 4.991   7.095   -3.474  1.00 15.00 ?  318 HIS A N    6  
ATOM 4429  C CA   . HIS A 1 22 ? 4.969   8.193   -4.437  1.00 15.00 ?  318 HIS A CA   6  
ATOM 4430  C C    . HIS A 1 22 ? 6.293   8.281   -5.194  1.00 15.00 ?  318 HIS A C    6  
ATOM 4431  O O    . HIS A 1 22 ? 6.390   8.956   -6.216  1.00 15.00 ?  318 HIS A O    6  
ATOM 4432  C CB   . HIS A 1 22 ? 4.651   9.529   -3.761  1.00 15.00 ?  318 HIS A CB   6  
ATOM 4433  C CG   . HIS A 1 22 ? 3.223   9.682   -3.313  1.00 15.00 ?  318 HIS A CG   6  
ATOM 4434  N ND1  . HIS A 1 22 ? 2.187   8.870   -3.739  1.00 15.00 ?  318 HIS A ND1  6  
ATOM 4435  C CD2  . HIS A 1 22 ? 2.662   10.579  -2.469  1.00 15.00 ?  318 HIS A CD2  6  
ATOM 4436  C CE1  . HIS A 1 22 ? 1.062   9.265   -3.175  1.00 15.00 ?  318 HIS A CE1  6  
ATOM 4437  N NE2  . HIS A 1 22 ? 1.317   10.301  -2.397  1.00 15.00 ?  318 HIS A NE2  6  
ATOM 4438  H H    . HIS A 1 22 ? 5.073   7.292   -2.514  1.00 15.00 ?  318 HIS A H    6  
ATOM 4439  H HA   . HIS A 1 22 ? 4.188   7.974   -5.152  1.00 15.00 ?  318 HIS A HA   6  
ATOM 4440  H HB2  . HIS A 1 22 ? 5.281   9.638   -2.891  1.00 15.00 ?  318 HIS A HB2  6  
ATOM 4441  H HB3  . HIS A 1 22 ? 4.869   10.330  -4.454  1.00 15.00 ?  318 HIS A HB3  6  
ATOM 4442  H HD1  . HIS A 1 22 ? 2.264   8.103   -4.365  1.00 15.00 ?  318 HIS A HD1  6  
ATOM 4443  H HD2  . HIS A 1 22 ? 3.179   11.369  -1.945  1.00 15.00 ?  318 HIS A HD2  6  
ATOM 4444  H HE1  . HIS A 1 22 ? 0.092   8.814   -3.325  1.00 15.00 ?  318 HIS A HE1  6  
ATOM 4445  H HE2  . HIS A 1 22 ? 0.737   10.574  -1.636  1.00 15.00 ?  318 HIS A HE2  6  
ATOM 4446  N N    . ASN A 1 23 ? 7.306   7.603   -4.670  1.00 15.00 ?  319 ASN A N    6  
ATOM 4447  C CA   . ASN A 1 23 ? 8.630   7.589   -5.285  1.00 15.00 ?  319 ASN A CA   6  
ATOM 4448  C C    . ASN A 1 23 ? 8.638   6.734   -6.551  1.00 15.00 ?  319 ASN A C    6  
ATOM 4449  O O    . ASN A 1 23 ? 8.618   7.261   -7.661  1.00 15.00 ?  319 ASN A O    6  
ATOM 4450  C CB   . ASN A 1 23 ? 9.672   7.069   -4.289  1.00 15.00 ?  319 ASN A CB   6  
ATOM 4451  C CG   . ASN A 1 23 ? 9.951   8.047   -3.162  1.00 15.00 ?  319 ASN A CG   6  
ATOM 4452  O OD1  . ASN A 1 23 ? 9.100   8.862   -2.801  1.00 15.00 ?  319 ASN A OD1  6  
ATOM 4453  N ND2  . ASN A 1 23 ? 11.139  7.961   -2.587  1.00 15.00 ?  319 ASN A ND2  6  
ATOM 4454  H H    . ASN A 1 23 ? 7.162   7.101   -3.842  1.00 15.00 ?  319 ASN A H    6  
ATOM 4455  H HA   . ASN A 1 23 ? 8.880   8.606   -5.553  1.00 15.00 ?  319 ASN A HA   6  
ATOM 4456  H HB2  . ASN A 1 23 ? 9.317   6.147   -3.855  1.00 15.00 ?  319 ASN A HB2  6  
ATOM 4457  H HB3  . ASN A 1 23 ? 10.598  6.880   -4.814  1.00 15.00 ?  319 ASN A HB3  6  
ATOM 4458  H HD21 . ASN A 1 23 ? 11.766  7.275   -2.914  1.00 15.00 ?  319 ASN A HD21 6  
ATOM 4459  H HD22 . ASN A 1 23 ? 11.350  8.591   -1.860  1.00 15.00 ?  319 ASN A HD22 6  
ATOM 4460  N N    . ASN A 1 24 ? 8.633   5.413   -6.381  1.00 15.00 ?  320 ASN A N    6  
ATOM 4461  C CA   . ASN A 1 24 ? 8.654   4.496   -7.522  1.00 15.00 ?  320 ASN A CA   6  
ATOM 4462  C C    . ASN A 1 24 ? 7.266   4.402   -8.148  1.00 15.00 ?  320 ASN A C    6  
ATOM 4463  O O    . ASN A 1 24 ? 7.105   3.928   -9.275  1.00 15.00 ?  320 ASN A O    6  
ATOM 4464  C CB   . ASN A 1 24 ? 9.138   3.105   -7.091  1.00 15.00 ?  320 ASN A CB   6  
ATOM 4465  C CG   . ASN A 1 24 ? 9.467   2.196   -8.266  1.00 15.00 ?  320 ASN A CG   6  
ATOM 4466  O OD1  . ASN A 1 24 ? 10.594  2.197   -8.763  1.00 15.00 ?  320 ASN A OD1  6  
ATOM 4467  N ND2  . ASN A 1 24 ? 8.503   1.403   -8.709  1.00 15.00 ?  320 ASN A ND2  6  
ATOM 4468  H H    . ASN A 1 24 ? 8.618   5.046   -5.473  1.00 15.00 ?  320 ASN A H    6  
ATOM 4469  H HA   . ASN A 1 24 ? 9.337   4.896   -8.255  1.00 15.00 ?  320 ASN A HA   6  
ATOM 4470  H HB2  . ASN A 1 24 ? 10.027  3.213   -6.489  1.00 15.00 ?  320 ASN A HB2  6  
ATOM 4471  H HB3  . ASN A 1 24 ? 8.366   2.632   -6.501  1.00 15.00 ?  320 ASN A HB3  6  
ATOM 4472  H HD21 . ASN A 1 24 ? 7.624   1.435   -8.259  1.00 15.00 ?  320 ASN A HD21 6  
ATOM 4473  H HD22 . ASN A 1 24 ? 8.699   0.816   -9.470  1.00 15.00 ?  320 ASN A HD22 6  
ATOM 4474  N N    . ARG A 1 25 ? 6.271   4.866   -7.392  1.00 15.00 ?  321 ARG A N    6  
ATOM 4475  C CA   . ARG A 1 25 ? 4.881   4.901   -7.835  1.00 15.00 ?  321 ARG A CA   6  
ATOM 4476  C C    . ARG A 1 25 ? 4.327   3.493   -7.993  1.00 15.00 ?  321 ARG A C    6  
ATOM 4477  O O    . ARG A 1 25 ? 3.945   3.063   -9.083  1.00 15.00 ?  321 ARG A O    6  
ATOM 4478  C CB   . ARG A 1 25 ? 4.751   5.730   -9.115  1.00 15.00 ?  321 ARG A CB   6  
ATOM 4479  C CG   . ARG A 1 25 ? 5.252   7.150   -8.916  1.00 15.00 ?  321 ARG A CG   6  
ATOM 4480  C CD   . ARG A 1 25 ? 5.344   7.922   -10.213 1.00 15.00 ?  321 ARG A CD   6  
ATOM 4481  N NE   . ARG A 1 25 ? 5.948   9.236   -10.001 1.00 15.00 ?  321 ARG A NE   6  
ATOM 4482  C CZ   . ARG A 1 25 ? 5.889   10.237  -10.875 1.00 15.00 ?  321 ARG A CZ   6  
ATOM 4483  N NH1  . ARG A 1 25 ? 5.289   10.067  -12.046 1.00 15.00 1  321 ARG A NH1  6  
ATOM 4484  N NH2  . ARG A 1 25 ? 6.448   11.402  -10.583 1.00 15.00 ?  321 ARG A NH2  6  
ATOM 4485  H H    . ARG A 1 25 ? 6.481   5.196   -6.494  1.00 15.00 ?  321 ARG A H    6  
ATOM 4486  H HA   . ARG A 1 25 ? 4.316   5.392   -7.056  1.00 15.00 ?  321 ARG A HA   6  
ATOM 4487  H HB2  . ARG A 1 25 ? 5.329   5.264   -9.901  1.00 15.00 ?  321 ARG A HB2  6  
ATOM 4488  H HB3  . ARG A 1 25 ? 3.714   5.770   -9.409  1.00 15.00 ?  321 ARG A HB3  6  
ATOM 4489  H HG2  . ARG A 1 25 ? 4.576   7.666   -8.254  1.00 15.00 ?  321 ARG A HG2  6  
ATOM 4490  H HG3  . ARG A 1 25 ? 6.233   7.110   -8.464  1.00 15.00 ?  321 ARG A HG3  6  
ATOM 4491  H HD2  . ARG A 1 25 ? 5.949   7.364   -10.911 1.00 15.00 ?  321 ARG A HD2  6  
ATOM 4492  H HD3  . ARG A 1 25 ? 4.351   8.051   -10.616 1.00 15.00 ?  321 ARG A HD3  6  
ATOM 4493  H HE   . ARG A 1 25 ? 6.420   9.377   -9.149  1.00 15.00 ?  321 ARG A HE   6  
ATOM 4494  H HH11 . ARG A 1 25 ? 4.880   9.175   -12.284 1.00 15.00 ?  321 ARG A HH11 6  
ATOM 4495  H HH12 . ARG A 1 25 ? 5.233   10.829  -12.703 1.00 15.00 ?  321 ARG A HH12 6  
ATOM 4496  H HH21 . ARG A 1 25 ? 6.918   11.534  -9.706  1.00 15.00 ?  321 ARG A HH21 6  
ATOM 4497  H HH22 . ARG A 1 25 ? 6.412   12.157  -11.239 1.00 15.00 ?  321 ARG A HH22 6  
ATOM 4498  N N    . THR A 1 26 ? 4.317   2.781   -6.876  1.00 15.00 ?  322 THR A N    6  
ATOM 4499  C CA   . THR A 1 26 ? 3.866   1.398   -6.828  1.00 15.00 ?  322 THR A CA   6  
ATOM 4500  C C    . THR A 1 26 ? 2.861   1.218   -5.697  1.00 15.00 ?  322 THR A C    6  
ATOM 4501  O O    . THR A 1 26 ? 2.910   1.949   -4.716  1.00 15.00 ?  322 THR A O    6  
ATOM 4502  C CB   . THR A 1 26 ? 5.049   0.440   -6.590  1.00 15.00 ?  322 THR A CB   6  
ATOM 4503  O OG1  . THR A 1 26 ? 6.236   0.959   -7.202  1.00 15.00 ?  322 THR A OG1  6  
ATOM 4504  C CG2  . THR A 1 26 ? 4.750   -0.941  -7.153  1.00 15.00 ?  322 THR A CG2  6  
ATOM 4505  H H    . THR A 1 26 ? 4.612   3.212   -6.040  1.00 15.00 ?  322 THR A H    6  
ATOM 4506  H HA   . THR A 1 26 ? 3.399   1.152   -7.771  1.00 15.00 ?  322 THR A HA   6  
ATOM 4507  H HB   . THR A 1 26 ? 5.212   0.351   -5.525  1.00 15.00 ?  322 THR A HB   6  
ATOM 4508  H HG1  . THR A 1 26 ? 6.911   1.082   -6.515  1.00 15.00 ?  322 THR A HG1  6  
ATOM 4509  H HG21 . THR A 1 26 ? 4.581   -0.867  -8.217  1.00 15.00 ?  322 THR A HG21 6  
ATOM 4510  H HG22 . THR A 1 26 ? 3.869   -1.342  -6.675  1.00 15.00 ?  322 THR A HG22 6  
ATOM 4511  H HG23 . THR A 1 26 ? 5.589   -1.595  -6.967  1.00 15.00 ?  322 THR A HG23 6  
ATOM 4512  N N    . THR A 1 27 ? 1.925   0.290   -5.839  1.00 15.00 ?  323 THR A N    6  
ATOM 4513  C CA   . THR A 1 27 ? 1.069   -0.060  -4.718  1.00 15.00 ?  323 THR A CA   6  
ATOM 4514  C C    . THR A 1 27 ? 1.592   -1.345  -4.064  1.00 15.00 ?  323 THR A C    6  
ATOM 4515  O O    . THR A 1 27 ? 1.963   -2.300  -4.752  1.00 15.00 ?  323 THR A O    6  
ATOM 4516  C CB   . THR A 1 27 ? -0.418  -0.203  -5.125  1.00 15.00 ?  323 THR A CB   6  
ATOM 4517  O OG1  . THR A 1 27 ? -1.236  -0.336  -3.958  1.00 15.00 ?  323 THR A OG1  6  
ATOM 4518  C CG2  . THR A 1 27 ? -0.653  -1.396  -6.032  1.00 15.00 ?  323 THR A CG2  6  
ATOM 4519  H H    . THR A 1 27 ? 1.816   -0.171  -6.695  1.00 15.00 ?  323 THR A H    6  
ATOM 4520  H HA   . THR A 1 27 ? 1.145   0.747   -4.000  1.00 15.00 ?  323 THR A HA   6  
ATOM 4521  H HB   . THR A 1 27 ? -0.712  0.693   -5.653  1.00 15.00 ?  323 THR A HB   6  
ATOM 4522  H HG1  . THR A 1 27 ? -2.069  0.122   -4.103  1.00 15.00 ?  323 THR A HG1  6  
ATOM 4523  H HG21 . THR A 1 27 ? -0.243  -1.199  -7.007  1.00 15.00 ?  323 THR A HG21 6  
ATOM 4524  H HG22 . THR A 1 27 ? -1.715  -1.572  -6.112  1.00 15.00 ?  323 THR A HG22 6  
ATOM 4525  H HG23 . THR A 1 27 ? -0.176  -2.269  -5.610  1.00 15.00 ?  323 THR A HG23 6  
ATOM 4526  N N    . GLN A 1 28 ? 1.643   -1.364  -2.739  1.00 15.00 ?  324 GLN A N    6  
ATOM 4527  C CA   . GLN A 1 28 ? 2.346   -2.411  -2.021  1.00 15.00 ?  324 GLN A CA   6  
ATOM 4528  C C    . GLN A 1 28 ? 1.420   -3.247  -1.148  1.00 15.00 ?  324 GLN A C    6  
ATOM 4529  O O    . GLN A 1 28 ? 1.171   -2.895  -0.002  1.00 15.00 ?  324 GLN A O    6  
ATOM 4530  C CB   . GLN A 1 28 ? 3.446   -1.809  -1.129  1.00 15.00 ?  324 GLN A CB   6  
ATOM 4531  C CG   . GLN A 1 28 ? 4.549   -1.079  -1.882  1.00 15.00 ?  324 GLN A CG   6  
ATOM 4532  C CD   . GLN A 1 28 ? 5.448   -2.017  -2.663  1.00 15.00 ?  324 GLN A CD   6  
ATOM 4533  O OE1  . GLN A 1 28 ? 5.964   -1.674  -3.727  1.00 15.00 ?  324 GLN A OE1  6  
ATOM 4534  N NE2  . GLN A 1 28 ? 5.684   -3.195  -2.109  1.00 15.00 ?  324 GLN A NE2  6  
ATOM 4535  H H    . GLN A 1 28 ? 1.205   -0.648  -2.231  1.00 15.00 ?  324 GLN A H    6  
ATOM 4536  H HA   . GLN A 1 28 ? 2.811   -3.055  -2.752  1.00 15.00 ?  324 GLN A HA   6  
ATOM 4537  H HB2  . GLN A 1 28 ? 2.990   -1.107  -0.446  1.00 15.00 ?  324 GLN A HB2  6  
ATOM 4538  H HB3  . GLN A 1 28 ? 3.902   -2.604  -0.557  1.00 15.00 ?  324 GLN A HB3  6  
ATOM 4539  H HG2  . GLN A 1 28 ? 4.099   -0.374  -2.563  1.00 15.00 ?  324 GLN A HG2  6  
ATOM 4540  H HG3  . GLN A 1 28 ? 5.154   -0.542  -1.165  1.00 15.00 ?  324 GLN A HG3  6  
ATOM 4541  H HE21 . GLN A 1 28 ? 5.274   -3.385  -1.236  1.00 15.00 ?  324 GLN A HE21 6  
ATOM 4542  H HE22 . GLN A 1 28 ? 6.258   -3.826  -2.590  1.00 15.00 ?  324 GLN A HE22 6  
ATOM 4543  N N    . PHE A 1 29 ? 0.898   -4.340  -1.705  1.00 15.00 ?  325 PHE A N    6  
ATOM 4544  C CA   . PHE A 1 29 ? 0.334   -5.428  -0.892  1.00 15.00 ?  325 PHE A CA   6  
ATOM 4545  C C    . PHE A 1 29 ? 1.468   -6.135  -0.200  1.00 15.00 ?  325 PHE A C    6  
ATOM 4546  O O    . PHE A 1 29 ? 1.295   -7.041  0.611   1.00 15.00 ?  325 PHE A O    6  
ATOM 4547  C CB   . PHE A 1 29 ? -0.479  -6.418  -1.713  1.00 15.00 ?  325 PHE A CB   6  
ATOM 4548  C CG   . PHE A 1 29 ? -1.932  -6.080  -1.722  1.00 15.00 ?  325 PHE A CG   6  
ATOM 4549  C CD1  . PHE A 1 29 ? -2.513  -5.466  -0.622  1.00 15.00 ?  325 PHE A CD1  6  
ATOM 4550  C CD2  . PHE A 1 29 ? -2.713  -6.362  -2.821  1.00 15.00 ?  325 PHE A CD2  6  
ATOM 4551  C CE1  . PHE A 1 29 ? -3.853  -5.137  -0.640  1.00 15.00 ?  325 PHE A CE1  6  
ATOM 4552  C CE2  . PHE A 1 29 ? -4.054  -6.041  -2.836  1.00 15.00 ?  325 PHE A CE2  6  
ATOM 4553  C CZ   . PHE A 1 29 ? -4.623  -5.425  -1.747  1.00 15.00 ?  325 PHE A CZ   6  
ATOM 4554  H H    . PHE A 1 29 ? 0.882   -4.415  -2.681  1.00 15.00 ?  325 PHE A H    6  
ATOM 4555  H HA   . PHE A 1 29 ? -0.302  -4.979  -0.142  1.00 15.00 ?  325 PHE A HA   6  
ATOM 4556  H HB2  . PHE A 1 29 ? -0.123  -6.422  -2.736  1.00 15.00 ?  325 PHE A HB2  6  
ATOM 4557  H HB3  . PHE A 1 29 ? -0.366  -7.403  -1.290  1.00 15.00 ?  325 PHE A HB3  6  
ATOM 4558  H HD1  . PHE A 1 29 ? -1.900  -5.241  0.272   1.00 15.00 ?  325 PHE A HD1  6  
ATOM 4559  H HD2  . PHE A 1 29 ? -2.267  -6.846  -3.675  1.00 15.00 ?  325 PHE A HD2  6  
ATOM 4560  H HE1  . PHE A 1 29 ? -4.305  -4.671  0.218   1.00 15.00 ?  325 PHE A HE1  6  
ATOM 4561  H HE2  . PHE A 1 29 ? -4.656  -6.270  -3.706  1.00 15.00 ?  325 PHE A HE2  6  
ATOM 4562  H HZ   . PHE A 1 29 ? -5.671  -5.167  -1.757  1.00 15.00 ?  325 PHE A HZ   6  
ATOM 4563  N N    . THR A 1 30 ? 2.634   -5.749  -0.631  1.00 15.00 ?  326 THR A N    6  
ATOM 4564  C CA   . THR A 1 30 ? 3.864   -6.228  -0.058  1.00 15.00 ?  326 THR A CA   6  
ATOM 4565  C C    . THR A 1 30 ? 4.287   -5.169  0.951   1.00 15.00 ?  326 THR A C    6  
ATOM 4566  O O    . THR A 1 30 ? 4.977   -4.203  0.615   1.00 15.00 ?  326 THR A O    6  
ATOM 4567  C CB   . THR A 1 30 ? 4.945   -6.452  -1.133  1.00 15.00 ?  326 THR A CB   6  
ATOM 4568  O OG1  . THR A 1 30 ? 4.451   -7.382  -2.108  1.00 15.00 ?  326 THR A OG1  6  
ATOM 4569  C CG2  . THR A 1 30 ? 6.231   -6.994  -0.518  1.00 15.00 ?  326 THR A CG2  6  
ATOM 4570  H H    . THR A 1 30 ? 2.647   -5.014  -1.280  1.00 15.00 ?  326 THR A H    6  
ATOM 4571  H HA   . THR A 1 30 ? 3.663   -7.171  0.436   1.00 15.00 ?  326 THR A HA   6  
ATOM 4572  H HB   . THR A 1 30 ? 5.158   -5.512  -1.617  1.00 15.00 ?  326 THR A HB   6  
ATOM 4573  H HG1  . THR A 1 30 ? 3.860   -8.013  -1.672  1.00 15.00 ?  326 THR A HG1  6  
ATOM 4574  H HG21 . THR A 1 30 ? 6.966   -7.142  -1.294  1.00 15.00 ?  326 THR A HG21 6  
ATOM 4575  H HG22 . THR A 1 30 ? 6.029   -7.935  -0.028  1.00 15.00 ?  326 THR A HG22 6  
ATOM 4576  H HG23 . THR A 1 30 ? 6.610   -6.286  0.205   1.00 15.00 ?  326 THR A HG23 6  
ATOM 4577  N N    . ASP A 1 31 ? 3.819   -5.343  2.173   1.00 15.00 ?  327 ASP A N    6  
ATOM 4578  C CA   . ASP A 1 31 ? 3.693   -4.264  3.116   1.00 15.00 ?  327 ASP A CA   6  
ATOM 4579  C C    . ASP A 1 31 ? 4.478   -4.473  4.358   1.00 15.00 ?  327 ASP A C    6  
ATOM 4580  O O    . ASP A 1 31 ? 4.733   -5.593  4.794   1.00 15.00 ?  327 ASP A O    6  
ATOM 4581  C CB   . ASP A 1 31 ? 2.252   -4.004  3.505   1.00 15.00 ?  327 ASP A CB   6  
ATOM 4582  C CG   . ASP A 1 31 ? 1.409   -5.258  3.677   1.00 15.00 ?  327 ASP A CG   6  
ATOM 4583  O OD1  . ASP A 1 31 ? 1.989   -6.340  3.898   1.00 15.00 ?  327 ASP A OD1  6  
ATOM 4584  O OD2  . ASP A 1 31 ? 0.172   -5.152  3.646   1.00 15.00 -1 327 ASP A OD2  6  
ATOM 4585  H H    . ASP A 1 31 ? 3.536   -6.237  2.467   1.00 15.00 ?  327 ASP A H    6  
ATOM 4586  H HA   . ASP A 1 31 ? 4.065   -3.371  2.639   1.00 15.00 ?  327 ASP A HA   6  
ATOM 4587  H HB2  . ASP A 1 31 ? 2.252   -3.478  4.450   1.00 15.00 ?  327 ASP A HB2  6  
ATOM 4588  H HB3  . ASP A 1 31 ? 1.822   -3.367  2.764   1.00 15.00 ?  327 ASP A HB3  6  
ATOM 4589  N N    . PRO A 1 32 ? 4.874   -3.357  4.940   1.00 15.00 ?  328 PRO A N    6  
ATOM 4590  C CA   . PRO A 1 32 ? 5.481   -3.336  6.251   1.00 15.00 ?  328 PRO A CA   6  
ATOM 4591  C C    . PRO A 1 32 ? 4.467   -3.888  7.266   1.00 15.00 ?  328 PRO A C    6  
ATOM 4592  O O    . PRO A 1 32 ? 4.803   -4.206  8.405   1.00 15.00 ?  328 PRO A O    6  
ATOM 4593  C CB   . PRO A 1 32 ? 5.810   -1.847  6.468   1.00 15.00 ?  328 PRO A CB   6  
ATOM 4594  C CG   . PRO A 1 32 ? 5.685   -1.222  5.105   1.00 15.00 ?  328 PRO A CG   6  
ATOM 4595  C CD   . PRO A 1 32 ? 4.644   -2.008  4.413   1.00 15.00 ?  328 PRO A CD   6  
ATOM 4596  H HA   . PRO A 1 32 ? 6.385   -3.930  6.281   1.00 15.00 ?  328 PRO A HA   6  
ATOM 4597  H HB2  . PRO A 1 32 ? 5.106   -1.417  7.166   1.00 15.00 ?  328 PRO A HB2  6  
ATOM 4598  H HB3  . PRO A 1 32 ? 6.814   -1.750  6.854   1.00 15.00 ?  328 PRO A HB3  6  
ATOM 4599  H HG2  . PRO A 1 32 ? 5.394   -0.185  5.189   1.00 15.00 ?  328 PRO A HG2  6  
ATOM 4600  H HG3  . PRO A 1 32 ? 6.597   -1.315  4.551   1.00 15.00 ?  328 PRO A HG3  6  
ATOM 4601  H HD2  . PRO A 1 32 ? 3.659   -1.648  4.675   1.00 15.00 ?  328 PRO A HD2  6  
ATOM 4602  H HD3  . PRO A 1 32 ? 4.792   -1.979  3.345   1.00 15.00 ?  328 PRO A HD3  6  
ATOM 4603  N N    . ARG A 1 33 ? 3.202   -3.966  6.815   1.00 15.00 ?  329 ARG A N    6  
ATOM 4604  C CA   . ARG A 1 33 ? 2.129   -4.630  7.550   1.00 15.00 ?  329 ARG A CA   6  
ATOM 4605  C C    . ARG A 1 33 ? 2.397   -6.127  7.678   1.00 15.00 ?  329 ARG A C    6  
ATOM 4606  O O    . ARG A 1 33 ? 2.077   -6.742  8.696   1.00 15.00 ?  329 ARG A O    6  
ATOM 4607  C CB   . ARG A 1 33 ? 0.757   -4.406  6.871   1.00 15.00 ?  329 ARG A CB   6  
ATOM 4608  C CG   . ARG A 1 33 ? 0.228   -2.991  7.033   1.00 15.00 ?  329 ARG A CG   6  
ATOM 4609  C CD   . ARG A 1 33 ? 0.192   -2.567  8.494   1.00 15.00 ?  329 ARG A CD   6  
ATOM 4610  N NE   . ARG A 1 33 ? -0.433  -3.572  9.355   1.00 15.00 ?  329 ARG A NE   6  
ATOM 4611  C CZ   . ARG A 1 33 ? -0.826  -3.342  10.607  1.00 15.00 ?  329 ARG A CZ   6  
ATOM 4612  N NH1  . ARG A 1 33 ? -0.769  -2.115  11.111  1.00 15.00 1  329 ARG A NH1  6  
ATOM 4613  N NH2  . ARG A 1 33 ? -1.298  -4.339  11.345  1.00 15.00 ?  329 ARG A NH2  6  
ATOM 4614  H H    . ARG A 1 33 ? 2.994   -3.569  5.944   1.00 15.00 ?  329 ARG A H    6  
ATOM 4615  H HA   . ARG A 1 33 ? 2.101   -4.201  8.541   1.00 15.00 ?  329 ARG A HA   6  
ATOM 4616  H HB2  . ARG A 1 33 ? 0.824   -4.625  5.791   1.00 15.00 ?  329 ARG A HB2  6  
ATOM 4617  H HB3  . ARG A 1 33 ? 0.044   -5.083  7.316   1.00 15.00 ?  329 ARG A HB3  6  
ATOM 4618  H HG2  . ARG A 1 33 ? 0.869   -2.315  6.488   1.00 15.00 ?  329 ARG A HG2  6  
ATOM 4619  H HG3  . ARG A 1 33 ? -0.773  -2.945  6.629   1.00 15.00 ?  329 ARG A HG3  6  
ATOM 4620  H HD2  . ARG A 1 33 ? 1.205   -2.401  8.831   1.00 15.00 ?  329 ARG A HD2  6  
ATOM 4621  H HD3  . ARG A 1 33 ? -0.365  -1.644  8.573   1.00 15.00 ?  329 ARG A HD3  6  
ATOM 4622  H HE   . ARG A 1 33 ? -0.535  -4.486  8.987   1.00 15.00 ?  329 ARG A HE   6  
ATOM 4623  H HH11 . ARG A 1 33 ? -0.436  -1.351  10.550  1.00 15.00 ?  329 ARG A HH11 6  
ATOM 4624  H HH12 . ARG A 1 33 ? -1.058  -1.941  12.063  1.00 15.00 ?  329 ARG A HH12 6  
ATOM 4625  H HH21 . ARG A 1 33 ? -1.359  -5.267  10.963  1.00 15.00 ?  329 ARG A HH21 6  
ATOM 4626  H HH22 . ARG A 1 33 ? -1.598  -4.172  12.292  1.00 15.00 ?  329 ARG A HH22 6  
ATOM 4627  N N    . LEU A 1 34 ? 2.975   -6.711  6.639   1.00 15.00 ?  330 LEU A N    6  
ATOM 4628  C CA   . LEU A 1 34 ? 3.283   -8.135  6.621   1.00 15.00 ?  330 LEU A CA   6  
ATOM 4629  C C    . LEU A 1 34 ? 4.435   -8.452  7.569   1.00 15.00 ?  330 LEU A C    6  
ATOM 4630  O O    . LEU A 1 34 ? 4.629   -9.599  7.969   1.00 15.00 ?  330 LEU A O    6  
ATOM 4631  C CB   . LEU A 1 34 ? 3.637   -8.573  5.198   1.00 15.00 ?  330 LEU A CB   6  
ATOM 4632  C CG   . LEU A 1 34 ? 3.817   -10.076 4.989   1.00 15.00 ?  330 LEU A CG   6  
ATOM 4633  C CD1  . LEU A 1 34 ? 2.509   -10.811 5.228   1.00 15.00 ?  330 LEU A CD1  6  
ATOM 4634  C CD2  . LEU A 1 34 ? 4.346   -10.352 3.590   1.00 15.00 ?  330 LEU A CD2  6  
ATOM 4635  H H    . LEU A 1 34 ? 3.186   -6.173  5.841   1.00 15.00 ?  330 LEU A H    6  
ATOM 4636  H HA   . LEU A 1 34 ? 2.405   -8.670  6.946   1.00 15.00 ?  330 LEU A HA   6  
ATOM 4637  H HB2  . LEU A 1 34 ? 2.853   -8.232  4.537   1.00 15.00 ?  330 LEU A HB2  6  
ATOM 4638  H HB3  . LEU A 1 34 ? 4.557   -8.083  4.915   1.00 15.00 ?  330 LEU A HB3  6  
ATOM 4639  H HG   . LEU A 1 34 ? 4.542   -10.446 5.699   1.00 15.00 ?  330 LEU A HG   6  
ATOM 4640  H HD11 . LEU A 1 34 ? 1.761   -10.453 4.537   1.00 15.00 ?  330 LEU A HD11 6  
ATOM 4641  H HD12 . LEU A 1 34 ? 2.177   -10.634 6.240   1.00 15.00 ?  330 LEU A HD12 6  
ATOM 4642  H HD13 . LEU A 1 34 ? 2.659   -11.870 5.079   1.00 15.00 ?  330 LEU A HD13 6  
ATOM 4643  H HD21 . LEU A 1 34 ? 4.475   -11.417 3.459   1.00 15.00 ?  330 LEU A HD21 6  
ATOM 4644  H HD22 . LEU A 1 34 ? 5.295   -9.855  3.461   1.00 15.00 ?  330 LEU A HD22 6  
ATOM 4645  H HD23 . LEU A 1 34 ? 3.643   -9.981  2.859   1.00 15.00 ?  330 LEU A HD23 6  
ATOM 4646  N N    . SER A 1 35 ? 5.203   -7.434  7.920   1.00 15.00 ?  331 SER A N    6  
ATOM 4647  C CA   . SER A 1 35 ? 6.336   -7.604  8.816   1.00 15.00 ?  331 SER A CA   6  
ATOM 4648  C C    . SER A 1 35 ? 5.911   -7.459  10.275  1.00 15.00 ?  331 SER A C    6  
ATOM 4649  O O    . SER A 1 35 ? 6.686   -7.746  11.187  1.00 15.00 ?  331 SER A O    6  
ATOM 4650  C CB   . SER A 1 35 ? 7.420   -6.583  8.481   1.00 15.00 ?  331 SER A CB   6  
ATOM 4651  O OG   . SER A 1 35 ? 7.826   -6.695  7.126   1.00 15.00 ?  331 SER A OG   6  
ATOM 4652  H H    . SER A 1 35 ? 5.011   -6.543  7.554   1.00 15.00 ?  331 SER A H    6  
ATOM 4653  H HA   . SER A 1 35 ? 6.731   -8.598  8.666   1.00 15.00 ?  331 SER A HA   6  
ATOM 4654  H HB2  . SER A 1 35 ? 7.038   -5.587  8.647   1.00 15.00 ?  331 SER A HB2  6  
ATOM 4655  H HB3  . SER A 1 35 ? 8.278   -6.749  9.116   1.00 15.00 ?  331 SER A HB3  6  
ATOM 4656  H HG   . SER A 1 35 ? 8.784   -6.827  7.092   1.00 15.00 ?  331 SER A HG   6  
ATOM 4657  N N    . ALA A 1 36 ? 4.680   -7.009  10.489  1.00 15.00 ?  332 ALA A N    6  
ATOM 4658  C CA   . ALA A 1 36 ? 4.189   -6.741  11.836  1.00 15.00 ?  332 ALA A CA   6  
ATOM 4659  C C    . ALA A 1 36 ? 3.639   -8.000  12.497  1.00 15.00 ?  332 ALA A C    6  
ATOM 4660  O O    . ALA A 1 36 ? 3.368   -8.011  13.701  1.00 15.00 ?  332 ALA A O    6  
ATOM 4661  C CB   . ALA A 1 36 ? 3.125   -5.656  11.800  1.00 15.00 ?  332 ALA A CB   6  
ATOM 4662  H H    . ALA A 1 36 ? 4.085   -6.858  9.724   1.00 15.00 ?  332 ALA A H    6  
ATOM 4663  H HA   . ALA A 1 36 ? 5.020   -6.373  12.423  1.00 15.00 ?  332 ALA A HA   6  
ATOM 4664  H HB1  . ALA A 1 36 ? 2.273   -6.005  11.235  1.00 15.00 ?  332 ALA A HB1  6  
ATOM 4665  H HB2  . ALA A 1 36 ? 3.530   -4.771  11.333  1.00 15.00 ?  332 ALA A HB2  6  
ATOM 4666  H HB3  . ALA A 1 36 ? 2.817   -5.422  12.808  1.00 15.00 ?  332 ALA A HB3  6  
ATOM 4667  N N    . ASN A 1 37 ? 3.479   -9.059  11.715  1.00 15.00 ?  333 ASN A N    6  
ATOM 4668  C CA   . ASN A 1 37 ? 2.920   -10.306 12.225  1.00 15.00 ?  333 ASN A CA   6  
ATOM 4669  C C    . ASN A 1 37 ? 3.575   -11.515 11.567  1.00 15.00 ?  333 ASN A C    6  
ATOM 4670  O O    . ASN A 1 37 ? 3.491   -11.650 10.332  1.00 15.00 ?  333 ASN A O    6  
ATOM 4671  C CB   . ASN A 1 37 ? 1.384   -10.340 12.064  1.00 15.00 ?  333 ASN A CB   6  
ATOM 4672  C CG   . ASN A 1 37 ? 0.868   -9.812  10.726  1.00 15.00 ?  333 ASN A CG   6  
ATOM 4673  O OD1  . ASN A 1 37 ? -0.201  -9.205  10.668  1.00 15.00 ?  333 ASN A OD1  6  
ATOM 4674  N ND2  . ASN A 1 37 ? 1.593   -10.055 9.647   1.00 15.00 ?  333 ASN A ND2  6  
ATOM 4675  O OXT  . ASN A 1 37 ? 4.168   -12.336 12.294  1.00 15.00 ?  333 ASN A OXT  6  
ATOM 4676  H H    . ASN A 1 37 ? 3.754   -9.010  10.775  1.00 15.00 ?  333 ASN A H    6  
ATOM 4677  H HA   . ASN A 1 37 ? 3.149   -10.340 13.280  1.00 15.00 ?  333 ASN A HA   6  
ATOM 4678  H HB2  . ASN A 1 37 ? 1.048   -11.360 12.167  1.00 15.00 ?  333 ASN A HB2  6  
ATOM 4679  H HB3  . ASN A 1 37 ? 0.942   -9.748  12.852  1.00 15.00 ?  333 ASN A HB3  6  
ATOM 4680  H HD21 . ASN A 1 37 ? 2.431   -10.571 9.757   1.00 15.00 ?  333 ASN A HD21 6  
ATOM 4681  H HD22 . ASN A 1 37 ? 1.273   -9.718  8.787   1.00 15.00 ?  333 ASN A HD22 6  
ATOM 4682  N N    . GLU B 2 1  ? 3.854   -8.358  -6.105  1.00 15.00 ?  203 GLU B N    6  
ATOM 4683  C CA   . GLU B 2 1  ? 3.113   -8.596  -4.845  1.00 15.00 ?  203 GLU B CA   6  
ATOM 4684  C C    . GLU B 2 1  ? 2.738   -10.070 -4.748  1.00 15.00 ?  203 GLU B C    6  
ATOM 4685  O O    . GLU B 2 1  ? 2.289   -10.662 -5.725  1.00 15.00 ?  203 GLU B O    6  
ATOM 4686  C CB   . GLU B 2 1  ? 1.837   -7.732  -4.774  1.00 15.00 ?  203 GLU B CB   6  
ATOM 4687  C CG   . GLU B 2 1  ? 2.077   -6.227  -4.853  1.00 15.00 ?  203 GLU B CG   6  
ATOM 4688  C CD   . GLU B 2 1  ? 2.589   -5.778  -6.210  1.00 15.00 ?  203 GLU B CD   6  
ATOM 4689  O OE1  . GLU B 2 1  ? 1.764   -5.505  -7.106  1.00 15.00 ?  203 GLU B OE1  6  
ATOM 4690  O OE2  . GLU B 2 1  ? 3.821   -5.730  -6.389  1.00 15.00 -1 203 GLU B OE2  6  
ATOM 4691  H H1   . GLU B 2 1  ? 4.114   -7.349  -6.187  1.00 15.00 ?  203 GLU B H1   6  
ATOM 4692  H H2   . GLU B 2 1  ? 3.264   -8.617  -6.923  1.00 15.00 ?  203 GLU B H2   6  
ATOM 4693  H H3   . GLU B 2 1  ? 4.724   -8.934  -6.124  1.00 15.00 ?  203 GLU B H3   6  
ATOM 4694  H HA   . GLU B 2 1  ? 3.760   -8.346  -4.017  1.00 15.00 ?  203 GLU B HA   6  
ATOM 4695  H HB2  . GLU B 2 1  ? 1.181   -8.009  -5.581  1.00 15.00 ?  203 GLU B HB2  6  
ATOM 4696  H HB3  . GLU B 2 1  ? 1.338   -7.940  -3.840  1.00 15.00 ?  203 GLU B HB3  6  
ATOM 4697  H HG2  . GLU B 2 1  ? 1.147   -5.716  -4.651  1.00 15.00 ?  203 GLU B HG2  6  
ATOM 4698  H HG3  . GLU B 2 1  ? 2.806   -5.953  -4.103  1.00 15.00 ?  203 GLU B HG3  6  
ATOM 4699  N N    . LEU B 2 2  ? 2.910   -10.656 -3.566  1.00 15.00 ?  204 LEU B N    6  
ATOM 4700  C CA   . LEU B 2 2  ? 2.592   -12.069 -3.358  1.00 15.00 ?  204 LEU B CA   6  
ATOM 4701  C C    . LEU B 2 2  ? 1.091   -12.252 -3.132  1.00 15.00 ?  204 LEU B C    6  
ATOM 4702  O O    . LEU B 2 2  ? 0.576   -13.371 -3.105  1.00 15.00 ?  204 LEU B O    6  
ATOM 4703  C CB   . LEU B 2 2  ? 3.387   -12.622 -2.171  1.00 15.00 ?  204 LEU B CB   6  
ATOM 4704  C CG   . LEU B 2 2  ? 3.252   -14.129 -1.932  1.00 15.00 ?  204 LEU B CG   6  
ATOM 4705  C CD1  . LEU B 2 2  ? 3.786   -14.913 -3.122  1.00 15.00 ?  204 LEU B CD1  6  
ATOM 4706  C CD2  . LEU B 2 2  ? 3.980   -14.532 -0.661  1.00 15.00 ?  204 LEU B CD2  6  
ATOM 4707  H H    . LEU B 2 2  ? 3.254   -10.128 -2.814  1.00 15.00 ?  204 LEU B H    6  
ATOM 4708  H HA   . LEU B 2 2  ? 2.876   -12.606 -4.252  1.00 15.00 ?  204 LEU B HA   6  
ATOM 4709  H HB2  . LEU B 2 2  ? 4.431   -12.397 -2.330  1.00 15.00 ?  204 LEU B HB2  6  
ATOM 4710  H HB3  . LEU B 2 2  ? 3.059   -12.109 -1.280  1.00 15.00 ?  204 LEU B HB3  6  
ATOM 4711  H HG   . LEU B 2 2  ? 2.206   -14.375 -1.813  1.00 15.00 ?  204 LEU B HG   6  
ATOM 4712  H HD11 . LEU B 2 2  ? 4.827   -14.671 -3.274  1.00 15.00 ?  204 LEU B HD11 6  
ATOM 4713  H HD12 . LEU B 2 2  ? 3.224   -14.653 -4.008  1.00 15.00 ?  204 LEU B HD12 6  
ATOM 4714  H HD13 . LEU B 2 2  ? 3.687   -15.971 -2.930  1.00 15.00 ?  204 LEU B HD13 6  
ATOM 4715  H HD21 . LEU B 2 2  ? 3.563   -13.996 0.179   1.00 15.00 ?  204 LEU B HD21 6  
ATOM 4716  H HD22 . LEU B 2 2  ? 5.029   -14.292 -0.756  1.00 15.00 ?  204 LEU B HD22 6  
ATOM 4717  H HD23 . LEU B 2 2  ? 3.867   -15.594 -0.503  1.00 15.00 ?  204 LEU B HD23 6  
ATOM 4718  N N    . GLU B 2 3  ? 0.406   -11.136 -2.958  1.00 15.00 ?  205 GLU B N    6  
ATOM 4719  C CA   . GLU B 2 3  ? -1.028  -11.133 -2.730  1.00 15.00 ?  205 GLU B CA   6  
ATOM 4720  C C    . GLU B 2 3  ? -1.757  -10.788 -4.029  1.00 15.00 ?  205 GLU B C    6  
ATOM 4721  O O    . GLU B 2 3  ? -1.144  -10.288 -4.975  1.00 15.00 ?  205 GLU B O    6  
ATOM 4722  C CB   . GLU B 2 3  ? -1.357  -10.115 -1.629  1.00 15.00 ?  205 GLU B CB   6  
ATOM 4723  C CG   . GLU B 2 3  ? -2.823  -10.074 -1.219  1.00 15.00 ?  205 GLU B CG   6  
ATOM 4724  C CD   . GLU B 2 3  ? -3.360  -11.436 -0.842  1.00 15.00 ?  205 GLU B CD   6  
ATOM 4725  O OE1  . GLU B 2 3  ? -3.154  -11.862 0.313   1.00 15.00 -1 205 GLU B OE1  6  
ATOM 4726  O OE2  . GLU B 2 3  ? -3.986  -12.087 -1.708  1.00 15.00 ?  205 GLU B OE2  6  
ATOM 4727  H H    . GLU B 2 3  ? 0.876   -10.282 -3.001  1.00 15.00 ?  205 GLU B H    6  
ATOM 4728  H HA   . GLU B 2 3  ? -1.322  -12.120 -2.406  1.00 15.00 ?  205 GLU B HA   6  
ATOM 4729  H HB2  . GLU B 2 3  ? -0.772  -10.352 -0.755  1.00 15.00 ?  205 GLU B HB2  6  
ATOM 4730  H HB3  . GLU B 2 3  ? -1.081  -9.134  -1.977  1.00 15.00 ?  205 GLU B HB3  6  
ATOM 4731  H HG2  . GLU B 2 3  ? -2.927  -9.415  -0.369  1.00 15.00 ?  205 GLU B HG2  6  
ATOM 4732  H HG3  . GLU B 2 3  ? -3.400  -9.689  -2.046  1.00 15.00 ?  205 GLU B HG3  6  
ATOM 4733  N N    . SER B 2 4  ? -3.059  -11.060 -4.054  1.00 15.00 ?  206 SER B N    6  
ATOM 4734  C CA   . SER B 2 4  ? -3.916  -10.734 -5.191  1.00 15.00 ?  206 SER B CA   6  
ATOM 4735  C C    . SER B 2 4  ? -3.749  -9.293  -5.661  1.00 15.00 ?  206 SER B C    6  
ATOM 4736  O O    . SER B 2 4  ? -3.320  -8.416  -4.913  1.00 15.00 ?  206 SER B O    6  
ATOM 4737  C CB   . SER B 2 4  ? -5.374  -11.002 -4.837  1.00 15.00 ?  206 SER B CB   6  
ATOM 4738  O OG   . SER B 2 4  ? -5.620  -10.859 -3.443  1.00 15.00 ?  206 SER B OG   6  
ATOM 4739  H H    . SER B 2 4  ? -3.458  -11.500 -3.272  1.00 15.00 ?  206 SER B H    6  
ATOM 4740  H HA   . SER B 2 4  ? -3.659  -11.379 -6.016  1.00 15.00 ?  206 SER B HA   6  
ATOM 4741  H HB2  . SER B 2 4  ? -5.990  -10.295 -5.375  1.00 15.00 ?  206 SER B HB2  6  
ATOM 4742  H HB3  . SER B 2 4  ? -5.626  -11.999 -5.154  1.00 15.00 ?  206 SER B HB3  6  
ATOM 4743  H HG   . SER B 2 4  ? -5.036  -11.457 -2.944  1.00 15.00 ?  206 SER B HG   6  
ATOM 4744  N N    . PRO B 2 5  ? -4.148  -9.062  -6.913  1.00 15.00 ?  207 PRO B N    6  
ATOM 4745  C CA   . PRO B 2 5  ? -3.972  -7.789  -7.614  1.00 15.00 ?  207 PRO B CA   6  
ATOM 4746  C C    . PRO B 2 5  ? -4.433  -6.591  -6.779  1.00 15.00 ?  207 PRO B C    6  
ATOM 4747  O O    . PRO B 2 5  ? -5.598  -6.514  -6.382  1.00 15.00 ?  207 PRO B O    6  
ATOM 4748  C CB   . PRO B 2 5  ? -4.842  -7.934  -8.876  1.00 15.00 ?  207 PRO B CB   6  
ATOM 4749  C CG   . PRO B 2 5  ? -5.535  -9.261  -8.777  1.00 15.00 ?  207 PRO B CG   6  
ATOM 4750  C CD   . PRO B 2 5  ? -4.818  -10.066 -7.727  1.00 15.00 ?  207 PRO B CD   6  
ATOM 4751  H HA   . PRO B 2 5  ? -2.945  -7.650  -7.908  1.00 15.00 ?  207 PRO B HA   6  
ATOM 4752  H HB2  . PRO B 2 5  ? -5.556  -7.124  -8.910  1.00 15.00 ?  207 PRO B HB2  6  
ATOM 4753  H HB3  . PRO B 2 5  ? -4.210  -7.889  -9.751  1.00 15.00 ?  207 PRO B HB3  6  
ATOM 4754  H HG2  . PRO B 2 5  ? -6.565  -9.112  -8.489  1.00 15.00 ?  207 PRO B HG2  6  
ATOM 4755  H HG3  . PRO B 2 5  ? -5.487  -9.767  -9.731  1.00 15.00 ?  207 PRO B HG3  6  
ATOM 4756  H HD2  . PRO B 2 5  ? -5.513  -10.624 -7.122  1.00 15.00 ?  207 PRO B HD2  6  
ATOM 4757  H HD3  . PRO B 2 5  ? -4.114  -10.740 -8.155  1.00 15.00 ?  207 PRO B HD3  6  
ATOM 4758  N N    . PRO B 2 6  ? -3.517  -5.647  -6.482  1.00 15.00 ?  208 PRO B N    6  
ATOM 4759  C CA   . PRO B 2 6  ? -3.817  -4.485  -5.652  1.00 15.00 ?  208 PRO B CA   6  
ATOM 4760  C C    . PRO B 2 6  ? -4.435  -3.324  -6.428  1.00 15.00 ?  208 PRO B C    6  
ATOM 4761  O O    . PRO B 2 6  ? -4.333  -3.254  -7.653  1.00 15.00 ?  208 PRO B O    6  
ATOM 4762  C CB   . PRO B 2 6  ? -2.446  -4.073  -5.091  1.00 15.00 ?  208 PRO B CB   6  
ATOM 4763  C CG   . PRO B 2 6  ? -1.426  -4.945  -5.756  1.00 15.00 ?  208 PRO B CG   6  
ATOM 4764  C CD   . PRO B 2 6  ? -2.111  -5.646  -6.896  1.00 15.00 ?  208 PRO B CD   6  
ATOM 4765  H HA   . PRO B 2 6  ? -4.469  -4.750  -4.834  1.00 15.00 ?  208 PRO B HA   6  
ATOM 4766  H HB2  . PRO B 2 6  ? -2.264  -3.028  -5.314  1.00 15.00 ?  208 PRO B HB2  6  
ATOM 4767  H HB3  . PRO B 2 6  ? -2.448  -4.221  -4.014  1.00 15.00 ?  208 PRO B HB3  6  
ATOM 4768  H HG2  . PRO B 2 6  ? -0.616  -4.338  -6.132  1.00 15.00 ?  208 PRO B HG2  6  
ATOM 4769  H HG3  . PRO B 2 6  ? -1.050  -5.668  -5.047  1.00 15.00 ?  208 PRO B HG3  6  
ATOM 4770  H HD2  . PRO B 2 6  ? -1.977  -5.097  -7.816  1.00 15.00 ?  208 PRO B HD2  6  
ATOM 4771  H HD3  . PRO B 2 6  ? -1.730  -6.650  -6.992  1.00 15.00 ?  208 PRO B HD3  6  
ATOM 4772  N N    . PRO B 2 7  ? -5.090  -2.406  -5.695  1.00 15.00 ?  209 PRO B N    6  
ATOM 4773  C CA   . PRO B 2 7  ? -5.657  -1.177  -6.255  1.00 15.00 ?  209 PRO B CA   6  
ATOM 4774  C C    . PRO B 2 7  ? -4.653  -0.424  -7.135  1.00 15.00 ?  209 PRO B C    6  
ATOM 4775  O O    . PRO B 2 7  ? -3.543  -0.122  -6.691  1.00 15.00 ?  209 PRO B O    6  
ATOM 4776  C CB   . PRO B 2 7  ? -6.006  -0.325  -5.024  1.00 15.00 ?  209 PRO B CB   6  
ATOM 4777  C CG   . PRO B 2 7  ? -5.845  -1.190  -3.818  1.00 15.00 ?  209 PRO B CG   6  
ATOM 4778  C CD   . PRO B 2 7  ? -5.339  -2.534  -4.254  1.00 15.00 ?  209 PRO B CD   6  
ATOM 4779  H HA   . PRO B 2 7  ? -6.553  -1.377  -6.824  1.00 15.00 ?  209 PRO B HA   6  
ATOM 4780  H HB2  . PRO B 2 7  ? -5.339  0.522   -4.979  1.00 15.00 ?  209 PRO B HB2  6  
ATOM 4781  H HB3  . PRO B 2 7  ? -7.020  0.028   -5.105  1.00 15.00 ?  209 PRO B HB3  6  
ATOM 4782  H HG2  . PRO B 2 7  ? -5.134  -0.737  -3.145  1.00 15.00 ?  209 PRO B HG2  6  
ATOM 4783  H HG3  . PRO B 2 7  ? -6.801  -1.296  -3.325  1.00 15.00 ?  209 PRO B HG3  6  
ATOM 4784  H HD2  . PRO B 2 7  ? -4.422  -2.767  -3.733  1.00 15.00 ?  209 PRO B HD2  6  
ATOM 4785  H HD3  . PRO B 2 7  ? -6.082  -3.293  -4.059  1.00 15.00 ?  209 PRO B HD3  6  
ATOM 4786  N N    . PRO B 2 8  ? -5.039  -0.116  -8.391  1.00 15.00 ?  210 PRO B N    6  
ATOM 4787  C CA   . PRO B 2 8  ? -4.183  0.615   -9.345  1.00 15.00 ?  210 PRO B CA   6  
ATOM 4788  C C    . PRO B 2 8  ? -3.628  1.900   -8.741  1.00 15.00 ?  210 PRO B C    6  
ATOM 4789  O O    . PRO B 2 8  ? -4.324  2.579   -7.982  1.00 15.00 ?  210 PRO B O    6  
ATOM 4790  C CB   . PRO B 2 8  ? -5.139  0.937   -10.494 1.00 15.00 ?  210 PRO B CB   6  
ATOM 4791  C CG   . PRO B 2 8  ? -6.176  -0.129  -10.434 1.00 15.00 ?  210 PRO B CG   6  
ATOM 4792  C CD   . PRO B 2 8  ? -6.347  -0.458  -8.977  1.00 15.00 ?  210 PRO B CD   6  
ATOM 4793  H HA   . PRO B 2 8  ? -3.370  0.000   -9.704  1.00 15.00 ?  210 PRO B HA   6  
ATOM 4794  H HB2  . PRO B 2 8  ? -5.567  1.918   -10.347 1.00 15.00 ?  210 PRO B HB2  6  
ATOM 4795  H HB3  . PRO B 2 8  ? -4.602  0.910   -11.430 1.00 15.00 ?  210 PRO B HB3  6  
ATOM 4796  H HG2  . PRO B 2 8  ? -7.105  0.237   -10.846 1.00 15.00 ?  210 PRO B HG2  6  
ATOM 4797  H HG3  . PRO B 2 8  ? -5.841  -1.000  -10.977 1.00 15.00 ?  210 PRO B HG3  6  
ATOM 4798  H HD2  . PRO B 2 8  ? -7.133  0.142   -8.544  1.00 15.00 ?  210 PRO B HD2  6  
ATOM 4799  H HD3  . PRO B 2 8  ? -6.562  -1.509  -8.851  1.00 15.00 ?  210 PRO B HD3  6  
ATOM 4800  N N    . TYR B 2 9  ? -2.391  2.247   -9.098  1.00 15.00 ?  211 TYR B N    6  
ATOM 4801  C CA   . TYR B 2 9  ? -1.700  3.350   -8.445  1.00 15.00 ?  211 TYR B CA   6  
ATOM 4802  C C    . TYR B 2 9  ? -2.377  4.700   -8.687  1.00 15.00 ?  211 TYR B C    6  
ATOM 4803  O O    . TYR B 2 9  ? -2.148  5.377   -9.693  1.00 15.00 ?  211 TYR B O    6  
ATOM 4804  C CB   . TYR B 2 9  ? -0.222  3.433   -8.841  1.00 15.00 ?  211 TYR B CB   6  
ATOM 4805  C CG   . TYR B 2 9  ? 0.523   4.486   -8.046  1.00 15.00 ?  211 TYR B CG   6  
ATOM 4806  C CD1  . TYR B 2 9  ? 0.799   4.294   -6.698  1.00 15.00 ?  211 TYR B CD1  6  
ATOM 4807  C CD2  . TYR B 2 9  ? 0.926   5.681   -8.630  1.00 15.00 ?  211 TYR B CD2  6  
ATOM 4808  C CE1  . TYR B 2 9  ? 1.451   5.261   -5.961  1.00 15.00 ?  211 TYR B CE1  6  
ATOM 4809  C CE2  . TYR B 2 9  ? 1.583   6.645   -7.889  1.00 15.00 ?  211 TYR B CE2  6  
ATOM 4810  C CZ   . TYR B 2 9  ? 1.836   6.431   -6.566  1.00 15.00 ?  211 TYR B CZ   6  
ATOM 4811  O OH   . TYR B 2 9  ? 2.481   7.404   -5.854  1.00 15.00 ?  211 TYR B OH   6  
ATOM 4812  H H    . TYR B 2 9  ? -1.935  1.743   -9.811  1.00 15.00 ?  211 TYR B H    6  
ATOM 4813  H HA   . TYR B 2 9  ? -1.743  3.151   -7.383  1.00 15.00 ?  211 TYR B HA   6  
ATOM 4814  H HB2  . TYR B 2 9  ? 0.251   2.478   -8.662  1.00 15.00 ?  211 TYR B HB2  6  
ATOM 4815  H HB3  . TYR B 2 9  ? -0.144  3.684   -9.887  1.00 15.00 ?  211 TYR B HB3  6  
ATOM 4816  H HD1  . TYR B 2 9  ? 0.492   3.374   -6.223  1.00 15.00 ?  211 TYR B HD1  6  
ATOM 4817  H HD2  . TYR B 2 9  ? 0.726   5.850   -9.678  1.00 15.00 ?  211 TYR B HD2  6  
ATOM 4818  H HE1  . TYR B 2 9  ? 1.659   5.093   -4.914  1.00 15.00 ?  211 TYR B HE1  6  
ATOM 4819  H HE2  . TYR B 2 9  ? 1.888   7.573   -8.342  1.00 15.00 ?  211 TYR B HE2  6  
ATOM 4820  H HH   . TYR B 2 9  ? 2.294   8.260   -6.261  1.00 15.00 ?  211 TYR B HH   6  
ATOM 4821  N N    . SER B 2 10 ? -3.259  5.029   -7.771  1.00 15.00 ?  212 SER B N    6  
ATOM 4822  C CA   . SER B 2 10 ? -3.777  6.365   -7.598  1.00 15.00 ?  212 SER B CA   6  
ATOM 4823  C C    . SER B 2 10 ? -3.154  6.892   -6.320  1.00 15.00 ?  212 SER B C    6  
ATOM 4824  O O    . SER B 2 10 ? -2.848  6.089   -5.437  1.00 15.00 ?  212 SER B O    6  
ATOM 4825  C CB   . SER B 2 10 ? -5.302  6.334   -7.489  1.00 15.00 ?  212 SER B CB   6  
ATOM 4826  O OG   . SER B 2 10 ? -5.875  5.689   -8.617  1.00 15.00 ?  212 SER B OG   6  
ATOM 4827  H H    . SER B 2 10 ? -3.587  4.326   -7.171  1.00 15.00 ?  212 SER B H    6  
ATOM 4828  H HA   . SER B 2 10 ? -3.469  6.973   -8.437  1.00 15.00 ?  212 SER B HA   6  
ATOM 4829  H HB2  . SER B 2 10 ? -5.587  5.794   -6.598  1.00 15.00 ?  212 SER B HB2  6  
ATOM 4830  H HB3  . SER B 2 10 ? -5.680  7.344   -7.438  1.00 15.00 ?  212 SER B HB3  6  
ATOM 4831  H HG   . SER B 2 10 ? -5.296  4.969   -8.899  1.00 15.00 ?  212 SER B HG   6  
ATOM 4832  N N    . ARG B 2 11 ? -2.948  8.200   -6.195  1.00 15.00 ?  213 ARG B N    6  
ATOM 4833  C CA   . ARG B 2 11 ? -2.232  8.709   -5.030  1.00 15.00 ?  213 ARG B CA   6  
ATOM 4834  C C    . ARG B 2 11 ? -2.987  8.305   -3.776  1.00 15.00 ?  213 ARG B C    6  
ATOM 4835  O O    . ARG B 2 11 ? -2.414  7.740   -2.846  1.00 15.00 ?  213 ARG B O    6  
ATOM 4836  C CB   . ARG B 2 11 ? -2.122  10.242  -5.028  1.00 15.00 ?  213 ARG B CB   6  
ATOM 4837  C CG   . ARG B 2 11 ? -1.630  10.871  -6.305  1.00 15.00 ?  213 ARG B CG   6  
ATOM 4838  C CD   . ARG B 2 11 ? -1.535  12.385  -6.185  1.00 15.00 ?  213 ARG B CD   6  
ATOM 4839  N NE   . ARG B 2 11 ? -1.089  13.007  -7.433  1.00 15.00 ?  213 ARG B NE   6  
ATOM 4840  C CZ   . ARG B 2 11 ? -1.282  14.290  -7.742  1.00 15.00 ?  213 ARG B CZ   6  
ATOM 4841  N NH1  . ARG B 2 11 ? -1.895  15.105  -6.892  1.00 15.00 1  213 ARG B NH1  6  
ATOM 4842  N NH2  . ARG B 2 11 ? -0.848  14.761  -8.903  1.00 15.00 ?  213 ARG B NH2  6  
ATOM 4843  H H    . ARG B 2 11 ? -3.283  8.820   -6.881  1.00 15.00 ?  213 ARG B H    6  
ATOM 4844  H HA   . ARG B 2 11 ? -1.244  8.272   -5.015  1.00 15.00 ?  213 ARG B HA   6  
ATOM 4845  H HB2  . ARG B 2 11 ? -3.096  10.652  -4.816  1.00 15.00 ?  213 ARG B HB2  6  
ATOM 4846  H HB3  . ARG B 2 11 ? -1.449  10.532  -4.232  1.00 15.00 ?  213 ARG B HB3  6  
ATOM 4847  H HG2  . ARG B 2 11 ? -0.658  10.479  -6.536  1.00 15.00 ?  213 ARG B HG2  6  
ATOM 4848  H HG3  . ARG B 2 11 ? -2.324  10.633  -7.087  1.00 15.00 ?  213 ARG B HG3  6  
ATOM 4849  H HD2  . ARG B 2 11 ? -2.508  12.776  -5.925  1.00 15.00 ?  213 ARG B HD2  6  
ATOM 4850  H HD3  . ARG B 2 11 ? -0.831  12.627  -5.401  1.00 15.00 ?  213 ARG B HD3  6  
ATOM 4851  H HE   . ARG B 2 11 ? -0.624  12.431  -8.081  1.00 15.00 ?  213 ARG B HE   6  
ATOM 4852  H HH11 . ARG B 2 11 ? -2.218  14.764  -6.000  1.00 15.00 ?  213 ARG B HH11 6  
ATOM 4853  H HH12 . ARG B 2 11 ? -2.049  16.071  -7.142  1.00 15.00 ?  213 ARG B HH12 6  
ATOM 4854  H HH21 . ARG B 2 11 ? -0.370  14.151  -9.551  1.00 15.00 ?  213 ARG B HH21 6  
ATOM 4855  H HH22 . ARG B 2 11 ? -1.000  15.725  -9.148  1.00 15.00 ?  213 ARG B HH22 6  
ATOM 4856  N N    . TYR B 2 12 ? -4.265  8.644   -3.743  1.00 15.00 ?  214 TYR B N    6  
ATOM 4857  C CA   . TYR B 2 12 ? -5.124  8.281   -2.631  1.00 15.00 ?  214 TYR B CA   6  
ATOM 4858  C C    . TYR B 2 12 ? -6.289  7.431   -3.122  1.00 15.00 ?  214 TYR B C    6  
ATOM 4859  O O    . TYR B 2 12 ? -7.352  7.943   -3.477  1.00 15.00 ?  214 TYR B O    6  
ATOM 4860  C CB   . TYR B 2 12 ? -5.586  9.549   -1.896  1.00 15.00 ?  214 TYR B CB   6  
ATOM 4861  C CG   . TYR B 2 12 ? -4.435  10.507  -1.651  1.00 15.00 ?  214 TYR B CG   6  
ATOM 4862  C CD1  . TYR B 2 12 ? -3.907  11.252  -2.697  1.00 15.00 ?  214 TYR B CD1  6  
ATOM 4863  C CD2  . TYR B 2 12 ? -3.842  10.624  -0.403  1.00 15.00 ?  214 TYR B CD2  6  
ATOM 4864  C CE1  . TYR B 2 12 ? -2.824  12.081  -2.517  1.00 15.00 ?  214 TYR B CE1  6  
ATOM 4865  C CE2  . TYR B 2 12 ? -2.761  11.463  -0.206  1.00 15.00 ?  214 TYR B CE2  6  
ATOM 4866  C CZ   . TYR B 2 12 ? -2.253  12.187  -1.265  1.00 15.00 ?  214 TYR B CZ   6  
ATOM 4867  O OH   . TYR B 2 12 ? -1.167  13.010  -1.069  1.00 15.00 ?  214 TYR B OH   6  
ATOM 4868  H H    . TYR B 2 12 ? -4.647  9.153   -4.496  1.00 15.00 ?  214 TYR B H    6  
ATOM 4869  H HA   . TYR B 2 12 ? -4.538  7.661   -1.953  1.00 15.00 ?  214 TYR B HA   6  
ATOM 4870  H HB2  . TYR B 2 12 ? -6.332  10.059  -2.488  1.00 15.00 ?  214 TYR B HB2  6  
ATOM 4871  H HB3  . TYR B 2 12 ? -6.008  9.279   -0.939  1.00 15.00 ?  214 TYR B HB3  6  
ATOM 4872  H HD1  . TYR B 2 12 ? -4.356  11.168  -3.677  1.00 15.00 ?  214 TYR B HD1  6  
ATOM 4873  H HD2  . TYR B 2 12 ? -4.240  10.056  0.425   1.00 15.00 ?  214 TYR B HD2  6  
ATOM 4874  H HE1  . TYR B 2 12 ? -2.423  12.631  -3.368  1.00 15.00 ?  214 TYR B HE1  6  
ATOM 4875  H HE2  . TYR B 2 12 ? -2.313  11.544  0.772   1.00 15.00 ?  214 TYR B HE2  6  
ATOM 4876  H HH   . TYR B 2 12 ? -0.564  12.592  -0.441  1.00 15.00 ?  214 TYR B HH   6  
ATOM 4877  N N    . PRO B 2 13 ? -6.059  6.125   -3.210  1.00 15.00 ?  215 PRO B N    6  
ATOM 4878  C CA   . PRO B 2 13 ? -7.059  5.164   -3.659  1.00 15.00 ?  215 PRO B CA   6  
ATOM 4879  C C    . PRO B 2 13 ? -7.968  4.722   -2.516  1.00 15.00 ?  215 PRO B C    6  
ATOM 4880  O O    . PRO B 2 13 ? -7.537  4.642   -1.368  1.00 15.00 ?  215 PRO B O    6  
ATOM 4881  C CB   . PRO B 2 13 ? -6.200  4.003   -4.157  1.00 15.00 ?  215 PRO B CB   6  
ATOM 4882  C CG   . PRO B 2 13 ? -4.946  4.063   -3.343  1.00 15.00 ?  215 PRO B CG   6  
ATOM 4883  C CD   . PRO B 2 13 ? -4.778  5.479   -2.881  1.00 15.00 ?  215 PRO B CD   6  
ATOM 4884  H HA   . PRO B 2 13 ? -7.655  5.557   -4.469  1.00 15.00 ?  215 PRO B HA   6  
ATOM 4885  H HB2  . PRO B 2 13 ? -6.726  3.072   -4.002  1.00 15.00 ?  215 PRO B HB2  6  
ATOM 4886  H HB3  . PRO B 2 13 ? -5.991  4.133   -5.208  1.00 15.00 ?  215 PRO B HB3  6  
ATOM 4887  H HG2  . PRO B 2 13 ? -5.033  3.409   -2.485  1.00 15.00 ?  215 PRO B HG2  6  
ATOM 4888  H HG3  . PRO B 2 13 ? -4.101  3.768   -3.948  1.00 15.00 ?  215 PRO B HG3  6  
ATOM 4889  H HD2  . PRO B 2 13 ? -4.598  5.507   -1.815  1.00 15.00 ?  215 PRO B HD2  6  
ATOM 4890  H HD3  . PRO B 2 13 ? -3.964  5.952   -3.411  1.00 15.00 ?  215 PRO B HD3  6  
ATOM 4891  N N    . MET B 2 14 ? -9.220  4.427   -2.816  1.00 15.00 ?  216 MET B N    6  
ATOM 4892  C CA   . MET B 2 14 ? -10.142 3.981   -1.783  1.00 15.00 ?  216 MET B CA   6  
ATOM 4893  C C    . MET B 2 14 ? -10.702 2.601   -2.103  1.00 15.00 ?  216 MET B C    6  
ATOM 4894  O O    . MET B 2 14 ? -11.638 2.463   -2.892  1.00 15.00 ?  216 MET B O    6  
ATOM 4895  C CB   . MET B 2 14 ? -11.272 4.996   -1.557  1.00 15.00 ?  216 MET B CB   6  
ATOM 4896  C CG   . MET B 2 14 ? -11.996 5.427   -2.823  1.00 15.00 ?  216 MET B CG   6  
ATOM 4897  S SD   . MET B 2 14 ? -13.426 6.473   -2.484  1.00 15.00 ?  216 MET B SD   6  
ATOM 4898  C CE   . MET B 2 14 ? -12.665 7.825   -1.586  1.00 15.00 ?  216 MET B CE   6  
ATOM 4899  H H    . MET B 2 14 ? -9.524  4.487   -3.746  1.00 15.00 ?  216 MET B H    6  
ATOM 4900  H HA   . MET B 2 14 ? -9.573  3.901   -0.869  1.00 15.00 ?  216 MET B HA   6  
ATOM 4901  H HB2  . MET B 2 14 ? -12.000 4.560   -0.888  1.00 15.00 ?  216 MET B HB2  6  
ATOM 4902  H HB3  . MET B 2 14 ? -10.856 5.877   -1.091  1.00 15.00 ?  216 MET B HB3  6  
ATOM 4903  H HG2  . MET B 2 14 ? -11.306 5.977   -3.447  1.00 15.00 ?  216 MET B HG2  6  
ATOM 4904  H HG3  . MET B 2 14 ? -12.329 4.544   -3.349  1.00 15.00 ?  216 MET B HG3  6  
ATOM 4905  H HE1  . MET B 2 14 ? -13.423 8.543   -1.306  1.00 15.00 ?  216 MET B HE1  6  
ATOM 4906  H HE2  . MET B 2 14 ? -11.930 8.304   -2.213  1.00 15.00 ?  216 MET B HE2  6  
ATOM 4907  H HE3  . MET B 2 14 ? -12.186 7.442   -0.698  1.00 15.00 ?  216 MET B HE3  6  
ATOM 4908  N N    . ASP B 2 15 ? -10.071 1.591   -1.511  1.00 15.00 ?  217 ASP B N    6  
ATOM 4909  C CA   . ASP B 2 15 ? -10.504 0.197   -1.621  1.00 15.00 ?  217 ASP B CA   6  
ATOM 4910  C C    . ASP B 2 15 ? -10.612 -0.247  -3.081  1.00 15.00 ?  217 ASP B C    6  
ATOM 4911  O O    . ASP B 2 15 ? -9.567  -0.563  -3.687  1.00 15.00 ?  217 ASP B O    6  
ATOM 4912  C CB   . ASP B 2 15 ? -11.842 0.001   -0.909  1.00 15.00 ?  217 ASP B CB   6  
ATOM 4913  C CG   . ASP B 2 15 ? -12.046 -1.427  -0.454  1.00 15.00 ?  217 ASP B CG   6  
ATOM 4914  O OD1  . ASP B 2 15 ? -11.618 -1.753  0.671   1.00 15.00 ?  217 ASP B OD1  6  
ATOM 4915  O OD2  . ASP B 2 15 ? -12.646 -2.222  -1.206  1.00 15.00 -1 217 ASP B OD2  6  
ATOM 4916  O OXT  . ASP B 2 15 ? -11.739 -0.279  -3.624  1.00 15.00 ?  217 ASP B OXT  6  
ATOM 4917  H H    . ASP B 2 15 ? -9.274  1.788   -0.979  1.00 15.00 ?  217 ASP B H    6  
ATOM 4918  H HA   . ASP B 2 15 ? -9.760  -0.414  -1.132  1.00 15.00 ?  217 ASP B HA   6  
ATOM 4919  H HB2  . ASP B 2 15 ? -11.883 0.645   -0.043  1.00 15.00 ?  217 ASP B HB2  6  
ATOM 4920  H HB3  . ASP B 2 15 ? -12.645 0.263   -1.584  1.00 15.00 ?  217 ASP B HB3  6  
ATOM 4921  N N    . GLY A 1 1  ? 5.981   8.808   13.868  1.00 15.00 ?  297 GLY A N    7  
ATOM 4922  C CA   . GLY A 1 1  ? 5.293   7.757   13.082  1.00 15.00 ?  297 GLY A CA   7  
ATOM 4923  C C    . GLY A 1 1  ? 6.264   6.732   12.529  1.00 15.00 ?  297 GLY A C    7  
ATOM 4924  O O    . GLY A 1 1  ? 7.336   7.099   12.047  1.00 15.00 ?  297 GLY A O    7  
ATOM 4925  H H1   . GLY A 1 1  ? 6.411   8.393   14.724  1.00 15.00 ?  297 GLY A H1   7  
ATOM 4926  H H2   . GLY A 1 1  ? 5.302   9.546   14.153  1.00 15.00 ?  297 GLY A H2   7  
ATOM 4927  H H3   . GLY A 1 1  ? 6.733   9.247   13.295  1.00 15.00 ?  297 GLY A H3   7  
ATOM 4928  H HA2  . GLY A 1 1  ? 4.577   7.257   13.716  1.00 15.00 ?  297 GLY A HA2  7  
ATOM 4929  H HA3  . GLY A 1 1  ? 4.769   8.223   12.260  1.00 15.00 ?  297 GLY A HA3  7  
ATOM 4930  N N    . PRO A 1 2  ? 5.923   5.432   12.586  1.00 15.00 ?  298 PRO A N    7  
ATOM 4931  C CA   . PRO A 1 2  ? 6.775   4.360   12.058  1.00 15.00 ?  298 PRO A CA   7  
ATOM 4932  C C    . PRO A 1 2  ? 6.719   4.268   10.534  1.00 15.00 ?  298 PRO A C    7  
ATOM 4933  O O    . PRO A 1 2  ? 7.467   3.510   9.915   1.00 15.00 ?  298 PRO A O    7  
ATOM 4934  C CB   . PRO A 1 2  ? 6.200   3.080   12.689  1.00 15.00 ?  298 PRO A CB   7  
ATOM 4935  C CG   . PRO A 1 2  ? 5.157   3.534   13.660  1.00 15.00 ?  298 PRO A CG   7  
ATOM 4936  C CD   . PRO A 1 2  ? 4.704   4.887   13.192  1.00 15.00 ?  298 PRO A CD   7  
ATOM 4937  H HA   . PRO A 1 2  ? 7.801   4.488   12.371  1.00 15.00 ?  298 PRO A HA   7  
ATOM 4938  H HB2  . PRO A 1 2  ? 5.774   2.459   11.916  1.00 15.00 ?  298 PRO A HB2  7  
ATOM 4939  H HB3  . PRO A 1 2  ? 6.991   2.542   13.191  1.00 15.00 ?  298 PRO A HB3  7  
ATOM 4940  H HG2  . PRO A 1 2  ? 4.329   2.842   13.657  1.00 15.00 ?  298 PRO A HG2  7  
ATOM 4941  H HG3  . PRO A 1 2  ? 5.583   3.604   14.650  1.00 15.00 ?  298 PRO A HG3  7  
ATOM 4942  H HD2  . PRO A 1 2  ? 3.913   4.793   12.462  1.00 15.00 ?  298 PRO A HD2  7  
ATOM 4943  H HD3  . PRO A 1 2  ? 4.383   5.490   14.027  1.00 15.00 ?  298 PRO A HD3  7  
ATOM 4944  N N    . LEU A 1 3  ? 5.808   5.026   9.941   1.00 15.00 ?  299 LEU A N    7  
ATOM 4945  C CA   . LEU A 1 3  ? 5.658   5.058   8.496   1.00 15.00 ?  299 LEU A CA   7  
ATOM 4946  C C    . LEU A 1 3  ? 6.686   6.009   7.888   1.00 15.00 ?  299 LEU A C    7  
ATOM 4947  O O    . LEU A 1 3  ? 6.822   7.147   8.343   1.00 15.00 ?  299 LEU A O    7  
ATOM 4948  C CB   . LEU A 1 3  ? 4.243   5.520   8.130   1.00 15.00 ?  299 LEU A CB   7  
ATOM 4949  C CG   . LEU A 1 3  ? 3.918   5.512   6.634   1.00 15.00 ?  299 LEU A CG   7  
ATOM 4950  C CD1  . LEU A 1 3  ? 3.731   4.087   6.129   1.00 15.00 ?  299 LEU A CD1  7  
ATOM 4951  C CD2  . LEU A 1 3  ? 2.678   6.346   6.355   1.00 15.00 ?  299 LEU A CD2  7  
ATOM 4952  H H    . LEU A 1 3  ? 5.224   5.579   10.493  1.00 15.00 ?  299 LEU A H    7  
ATOM 4953  H HA   . LEU A 1 3  ? 5.820   4.063   8.116   1.00 15.00 ?  299 LEU A HA   7  
ATOM 4954  H HB2  . LEU A 1 3  ? 3.537   4.875   8.632   1.00 15.00 ?  299 LEU A HB2  7  
ATOM 4955  H HB3  . LEU A 1 3  ? 4.108   6.526   8.498   1.00 15.00 ?  299 LEU A HB3  7  
ATOM 4956  H HG   . LEU A 1 3  ? 4.744   5.950   6.092   1.00 15.00 ?  299 LEU A HG   7  
ATOM 4957  H HD11 . LEU A 1 3  ? 2.882   3.639   6.625   1.00 15.00 ?  299 LEU A HD11 7  
ATOM 4958  H HD12 . LEU A 1 3  ? 4.618   3.510   6.343   1.00 15.00 ?  299 LEU A HD12 7  
ATOM 4959  H HD13 . LEU A 1 3  ? 3.559   4.102   5.062   1.00 15.00 ?  299 LEU A HD13 7  
ATOM 4960  H HD21 . LEU A 1 3  ? 2.465   6.330   5.298   1.00 15.00 ?  299 LEU A HD21 7  
ATOM 4961  H HD22 . LEU A 1 3  ? 2.850   7.364   6.674   1.00 15.00 ?  299 LEU A HD22 7  
ATOM 4962  H HD23 . LEU A 1 3  ? 1.840   5.936   6.898   1.00 15.00 ?  299 LEU A HD23 7  
ATOM 4963  N N    . PRO A 1 4  ? 7.424   5.565   6.862   1.00 15.00 ?  300 PRO A N    7  
ATOM 4964  C CA   . PRO A 1 4  ? 8.392   6.418   6.172   1.00 15.00 ?  300 PRO A CA   7  
ATOM 4965  C C    . PRO A 1 4  ? 7.685   7.497   5.345   1.00 15.00 ?  300 PRO A C    7  
ATOM 4966  O O    . PRO A 1 4  ? 6.660   7.229   4.722   1.00 15.00 ?  300 PRO A O    7  
ATOM 4967  C CB   . PRO A 1 4  ? 9.157   5.448   5.263   1.00 15.00 ?  300 PRO A CB   7  
ATOM 4968  C CG   . PRO A 1 4  ? 8.742   4.073   5.683   1.00 15.00 ?  300 PRO A CG   7  
ATOM 4969  C CD   . PRO A 1 4  ? 7.373   4.218   6.273   1.00 15.00 ?  300 PRO A CD   7  
ATOM 4970  H HA   . PRO A 1 4  ? 9.073   6.887   6.868   1.00 15.00 ?  300 PRO A HA   7  
ATOM 4971  H HB2  . PRO A 1 4  ? 8.891   5.643   4.240   1.00 15.00 ?  300 PRO A HB2  7  
ATOM 4972  H HB3  . PRO A 1 4  ? 10.220  5.595   5.395   1.00 15.00 ?  300 PRO A HB3  7  
ATOM 4973  H HG2  . PRO A 1 4  ? 8.710   3.417   4.823   1.00 15.00 ?  300 PRO A HG2  7  
ATOM 4974  H HG3  . PRO A 1 4  ? 9.430   3.691   6.421   1.00 15.00 ?  300 PRO A HG3  7  
ATOM 4975  H HD2  . PRO A 1 4  ? 6.621   4.163   5.499   1.00 15.00 ?  300 PRO A HD2  7  
ATOM 4976  H HD3  . PRO A 1 4  ? 7.201   3.461   7.026   1.00 15.00 ?  300 PRO A HD3  7  
ATOM 4977  N N    . PRO A 1 5  ? 8.240   8.723   5.306   1.00 15.00 ?  301 PRO A N    7  
ATOM 4978  C CA   . PRO A 1 5  ? 7.585   9.880   4.671   1.00 15.00 ?  301 PRO A CA   7  
ATOM 4979  C C    . PRO A 1 5  ? 7.383   9.732   3.158   1.00 15.00 ?  301 PRO A C    7  
ATOM 4980  O O    . PRO A 1 5  ? 6.620   10.487  2.552   1.00 15.00 ?  301 PRO A O    7  
ATOM 4981  C CB   . PRO A 1 5  ? 8.535   11.045  4.968   1.00 15.00 ?  301 PRO A CB   7  
ATOM 4982  C CG   . PRO A 1 5  ? 9.853   10.410  5.249   1.00 15.00 ?  301 PRO A CG   7  
ATOM 4983  C CD   . PRO A 1 5  ? 9.549   9.080   5.878   1.00 15.00 ?  301 PRO A CD   7  
ATOM 4984  H HA   . PRO A 1 5  ? 6.628   10.080  5.129   1.00 15.00 ?  301 PRO A HA   7  
ATOM 4985  H HB2  . PRO A 1 5  ? 8.585   11.698  4.109   1.00 15.00 ?  301 PRO A HB2  7  
ATOM 4986  H HB3  . PRO A 1 5  ? 8.173   11.596  5.823   1.00 15.00 ?  301 PRO A HB3  7  
ATOM 4987  H HG2  . PRO A 1 5  ? 10.399  10.273  4.329   1.00 15.00 ?  301 PRO A HG2  7  
ATOM 4988  H HG3  . PRO A 1 5  ? 10.419  11.027  5.934   1.00 15.00 ?  301 PRO A HG3  7  
ATOM 4989  H HD2  . PRO A 1 5  ? 10.300  8.354   5.604   1.00 15.00 ?  301 PRO A HD2  7  
ATOM 4990  H HD3  . PRO A 1 5  ? 9.487   9.175   6.950   1.00 15.00 ?  301 PRO A HD3  7  
ATOM 4991  N N    . GLY A 1 6  ? 8.086   8.791   2.546   1.00 15.00 ?  302 GLY A N    7  
ATOM 4992  C CA   . GLY A 1 6  ? 7.914   8.548   1.127   1.00 15.00 ?  302 GLY A CA   7  
ATOM 4993  C C    . GLY A 1 6  ? 6.853   7.501   0.866   1.00 15.00 ?  302 GLY A C    7  
ATOM 4994  O O    . GLY A 1 6  ? 6.363   7.352   -0.259  1.00 15.00 ?  302 GLY A O    7  
ATOM 4995  H H    . GLY A 1 6  ? 8.732   8.257   3.059   1.00 15.00 ?  302 GLY A H    7  
ATOM 4996  H HA2  . GLY A 1 6  ? 7.625   9.472   0.644   1.00 15.00 ?  302 GLY A HA2  7  
ATOM 4997  H HA3  . GLY A 1 6  ? 8.852   8.212   0.709   1.00 15.00 ?  302 GLY A HA3  7  
ATOM 4998  N N    . TRP A 1 7  ? 6.503   6.786   1.920   1.00 15.00 ?  303 TRP A N    7  
ATOM 4999  C CA   . TRP A 1 7  ? 5.576   5.673   1.843   1.00 15.00 ?  303 TRP A CA   7  
ATOM 5000  C C    . TRP A 1 7  ? 4.157   6.096   2.183   1.00 15.00 ?  303 TRP A C    7  
ATOM 5001  O O    . TRP A 1 7  ? 3.944   7.003   2.990   1.00 15.00 ?  303 TRP A O    7  
ATOM 5002  C CB   . TRP A 1 7  ? 6.008   4.573   2.792   1.00 15.00 ?  303 TRP A CB   7  
ATOM 5003  C CG   . TRP A 1 7  ? 7.021   3.657   2.204   1.00 15.00 ?  303 TRP A CG   7  
ATOM 5004  C CD1  . TRP A 1 7  ? 8.374   3.830   2.169   1.00 15.00 ?  303 TRP A CD1  7  
ATOM 5005  C CD2  . TRP A 1 7  ? 6.758   2.416   1.557   1.00 15.00 ?  303 TRP A CD2  7  
ATOM 5006  N NE1  . TRP A 1 7  ? 8.966   2.757   1.565   1.00 15.00 ?  303 TRP A NE1  7  
ATOM 5007  C CE2  . TRP A 1 7  ? 7.991   1.879   1.178   1.00 15.00 ?  303 TRP A CE2  7  
ATOM 5008  C CE3  . TRP A 1 7  ? 5.598   1.697   1.265   1.00 15.00 ?  303 TRP A CE3  7  
ATOM 5009  C CZ2  . TRP A 1 7  ? 8.096   0.667   0.533   1.00 15.00 ?  303 TRP A CZ2  7  
ATOM 5010  C CZ3  . TRP A 1 7  ? 5.714   0.489   0.620   1.00 15.00 ?  303 TRP A CZ3  7  
ATOM 5011  C CH2  . TRP A 1 7  ? 6.954   -0.017  0.261   1.00 15.00 ?  303 TRP A CH2  7  
ATOM 5012  H H    . TRP A 1 7  ? 6.869   7.031   2.799   1.00 15.00 ?  303 TRP A H    7  
ATOM 5013  H HA   . TRP A 1 7  ? 5.607   5.297   0.833   1.00 15.00 ?  303 TRP A HA   7  
ATOM 5014  H HB2  . TRP A 1 7  ? 6.435   5.017   3.679   1.00 15.00 ?  303 TRP A HB2  7  
ATOM 5015  H HB3  . TRP A 1 7  ? 5.144   3.986   3.069   1.00 15.00 ?  303 TRP A HB3  7  
ATOM 5016  H HD1  . TRP A 1 7  ? 8.889   4.683   2.571   1.00 15.00 ?  303 TRP A HD1  7  
ATOM 5017  H HE1  . TRP A 1 7  ? 9.933   2.639   1.429   1.00 15.00 ?  303 TRP A HE1  7  
ATOM 5018  H HE3  . TRP A 1 7  ? 4.621   2.068   1.528   1.00 15.00 ?  303 TRP A HE3  7  
ATOM 5019  H HZ2  . TRP A 1 7  ? 9.033   0.273   0.248   1.00 15.00 ?  303 TRP A HZ2  7  
ATOM 5020  H HZ3  . TRP A 1 7  ? 4.831   -0.073  0.377   1.00 15.00 ?  303 TRP A HZ3  7  
ATOM 5021  H HH2  . TRP A 1 7  ? 6.999   -0.973  -0.228  1.00 15.00 ?  303 TRP A HH2  7  
ATOM 5022  N N    . GLU A 1 8  ? 3.185   5.413   1.592   1.00 15.00 ?  304 GLU A N    7  
ATOM 5023  C CA   . GLU A 1 8  ? 1.775   5.744   1.823   1.00 15.00 ?  304 GLU A CA   7  
ATOM 5024  C C    . GLU A 1 8  ? 0.976   4.481   2.135   1.00 15.00 ?  304 GLU A C    7  
ATOM 5025  O O    . GLU A 1 8  ? 0.933   3.566   1.338   1.00 15.00 ?  304 GLU A O    7  
ATOM 5026  C CB   . GLU A 1 8  ? 1.209   6.470   0.598   1.00 15.00 ?  304 GLU A CB   7  
ATOM 5027  C CG   . GLU A 1 8  ? 1.760   7.874   0.427   1.00 15.00 ?  304 GLU A CG   7  
ATOM 5028  C CD   . GLU A 1 8  ? 1.028   8.912   1.258   1.00 15.00 ?  304 GLU A CD   7  
ATOM 5029  O OE1  . GLU A 1 8  ? 0.928   8.739   2.486   1.00 15.00 -1 304 GLU A OE1  7  
ATOM 5030  O OE2  . GLU A 1 8  ? 0.557   9.916   0.673   1.00 15.00 ?  304 GLU A OE2  7  
ATOM 5031  H H    . GLU A 1 8  ? 3.422   4.648   0.991   1.00 15.00 ?  304 GLU A H    7  
ATOM 5032  H HA   . GLU A 1 8  ? 1.728   6.404   2.677   1.00 15.00 ?  304 GLU A HA   7  
ATOM 5033  H HB2  . GLU A 1 8  ? 1.457   5.901   -0.286  1.00 15.00 ?  304 GLU A HB2  7  
ATOM 5034  H HB3  . GLU A 1 8  ? 0.138   6.536   0.680   1.00 15.00 ?  304 GLU A HB3  7  
ATOM 5035  H HG2  . GLU A 1 8  ? 2.800   7.875   0.719   1.00 15.00 ?  304 GLU A HG2  7  
ATOM 5036  H HG3  . GLU A 1 8  ? 1.682   8.150   -0.615  1.00 15.00 ?  304 GLU A HG3  7  
ATOM 5037  N N    . ILE A 1 9  ? 0.339   4.431   3.295   1.00 15.00 ?  305 ILE A N    7  
ATOM 5038  C CA   . ILE A 1 9  ? -0.295  3.193   3.750   1.00 15.00 ?  305 ILE A CA   7  
ATOM 5039  C C    . ILE A 1 9  ? -1.824  3.254   3.693   1.00 15.00 ?  305 ILE A C    7  
ATOM 5040  O O    . ILE A 1 9  ? -2.435  4.211   4.172   1.00 15.00 ?  305 ILE A O    7  
ATOM 5041  C CB   . ILE A 1 9  ? 0.147   2.840   5.192   1.00 15.00 ?  305 ILE A CB   7  
ATOM 5042  C CG1  . ILE A 1 9  ? -0.583  1.585   5.687   1.00 15.00 ?  305 ILE A CG1  7  
ATOM 5043  C CG2  . ILE A 1 9  ? -0.091  4.013   6.136   1.00 15.00 ?  305 ILE A CG2  7  
ATOM 5044  C CD1  . ILE A 1 9  ? -0.219  1.180   7.100   1.00 15.00 ?  305 ILE A CD1  7  
ATOM 5045  H H    . ILE A 1 9  ? 0.282   5.235   3.852   1.00 15.00 ?  305 ILE A H    7  
ATOM 5046  H HA   . ILE A 1 9  ? 0.042   2.398   3.100   1.00 15.00 ?  305 ILE A HA   7  
ATOM 5047  H HB   . ILE A 1 9  ? 1.207   2.640   5.174   1.00 15.00 ?  305 ILE A HB   7  
ATOM 5048  H HG12 . ILE A 1 9  ? -1.647  1.763   5.657   1.00 15.00 ?  305 ILE A HG12 7  
ATOM 5049  H HG13 . ILE A 1 9  ? -0.343  0.760   5.033   1.00 15.00 ?  305 ILE A HG13 7  
ATOM 5050  H HG21 . ILE A 1 9  ? 0.219   3.740   7.135   1.00 15.00 ?  305 ILE A HG21 7  
ATOM 5051  H HG22 . ILE A 1 9  ? -1.140  4.266   6.141   1.00 15.00 ?  305 ILE A HG22 7  
ATOM 5052  H HG23 . ILE A 1 9  ? 0.484   4.864   5.802   1.00 15.00 ?  305 ILE A HG23 7  
ATOM 5053  H HD11 . ILE A 1 9  ? 0.845   1.004   7.164   1.00 15.00 ?  305 ILE A HD11 7  
ATOM 5054  H HD12 . ILE A 1 9  ? -0.750  0.275   7.362   1.00 15.00 ?  305 ILE A HD12 7  
ATOM 5055  H HD13 . ILE A 1 9  ? -0.495  1.970   7.784   1.00 15.00 ?  305 ILE A HD13 7  
ATOM 5056  N N    . ARG A 1 10 ? -2.436  2.232   3.089   1.00 15.00 ?  306 ARG A N    7  
ATOM 5057  C CA   . ARG A 1 10 ? -3.875  2.026   3.205   1.00 15.00 ?  306 ARG A CA   7  
ATOM 5058  C C    . ARG A 1 10 ? -4.204  0.540   3.287   1.00 15.00 ?  306 ARG A C    7  
ATOM 5059  O O    . ARG A 1 10 ? -3.551  -0.301  2.655   1.00 15.00 ?  306 ARG A O    7  
ATOM 5060  C CB   . ARG A 1 10 ? -4.663  2.619   2.036   1.00 15.00 ?  306 ARG A CB   7  
ATOM 5061  C CG   . ARG A 1 10 ? -4.620  4.127   1.913   1.00 15.00 ?  306 ARG A CG   7  
ATOM 5062  C CD   . ARG A 1 10 ? -5.909  4.638   1.293   1.00 15.00 ?  306 ARG A CD   7  
ATOM 5063  N NE   . ARG A 1 10 ? -7.042  4.502   2.216   1.00 15.00 ?  306 ARG A NE   7  
ATOM 5064  C CZ   . ARG A 1 10 ? -7.966  3.533   2.160   1.00 15.00 ?  306 ARG A CZ   7  
ATOM 5065  N NH1  . ARG A 1 10 ? -7.920  2.598   1.223   1.00 15.00 1  306 ARG A NH1  7  
ATOM 5066  N NH2  . ARG A 1 10 ? -8.947  3.497   3.052   1.00 15.00 ?  306 ARG A NH2  7  
ATOM 5067  H H    . ARG A 1 10 ? -1.907  1.600   2.549   1.00 15.00 ?  306 ARG A H    7  
ATOM 5068  H HA   . ARG A 1 10 ? -4.198  2.501   4.120   1.00 15.00 ?  306 ARG A HA   7  
ATOM 5069  H HB2  . ARG A 1 10 ? -4.276  2.204   1.118   1.00 15.00 ?  306 ARG A HB2  7  
ATOM 5070  H HB3  . ARG A 1 10 ? -5.698  2.322   2.138   1.00 15.00 ?  306 ARG A HB3  7  
ATOM 5071  H HG2  . ARG A 1 10 ? -4.491  4.562   2.892   1.00 15.00 ?  306 ARG A HG2  7  
ATOM 5072  H HG3  . ARG A 1 10 ? -3.791  4.401   1.273   1.00 15.00 ?  306 ARG A HG3  7  
ATOM 5073  H HD2  . ARG A 1 10 ? -5.784  5.679   1.035   1.00 15.00 ?  306 ARG A HD2  7  
ATOM 5074  H HD3  . ARG A 1 10 ? -6.115  4.066   0.399   1.00 15.00 ?  306 ARG A HD3  7  
ATOM 5075  H HE   . ARG A 1 10 ? -7.116  5.178   2.937   1.00 15.00 ?  306 ARG A HE   7  
ATOM 5076  H HH11 . ARG A 1 10 ? -7.186  2.603   0.529   1.00 15.00 ?  306 ARG A HH11 7  
ATOM 5077  H HH12 . ARG A 1 10 ? -8.621  1.867   1.204   1.00 15.00 ?  306 ARG A HH12 7  
ATOM 5078  H HH21 . ARG A 1 10 ? -9.003  4.195   3.771   1.00 15.00 ?  306 ARG A HH21 7  
ATOM 5079  H HH22 . ARG A 1 10 ? -9.634  2.764   3.014   1.00 15.00 ?  306 ARG A HH22 7  
ATOM 5080  N N    . ASN A 1 11 ? -5.241  0.230   4.044   1.00 15.00 ?  307 ASN A N    7  
ATOM 5081  C CA   . ASN A 1 11 ? -5.749  -1.125  4.124   1.00 15.00 ?  307 ASN A CA   7  
ATOM 5082  C C    . ASN A 1 11 ? -7.057  -1.211  3.328   1.00 15.00 ?  307 ASN A C    7  
ATOM 5083  O O    . ASN A 1 11 ? -7.916  -0.341  3.463   1.00 15.00 ?  307 ASN A O    7  
ATOM 5084  C CB   . ASN A 1 11 ? -6.002  -1.496  5.590   1.00 15.00 ?  307 ASN A CB   7  
ATOM 5085  C CG   . ASN A 1 11 ? -6.168  -2.991  5.809   1.00 15.00 ?  307 ASN A CG   7  
ATOM 5086  O OD1  . ASN A 1 11 ? -6.594  -3.727  4.921   1.00 15.00 ?  307 ASN A OD1  7  
ATOM 5087  N ND2  . ASN A 1 11 ? -5.831  -3.450  7.005   1.00 15.00 ?  307 ASN A ND2  7  
ATOM 5088  H H    . ASN A 1 11 ? -5.688  0.936   4.565   1.00 15.00 ?  307 ASN A H    7  
ATOM 5089  H HA   . ASN A 1 11 ? -5.008  -1.788  3.704   1.00 15.00 ?  307 ASN A HA   7  
ATOM 5090  H HB2  . ASN A 1 11 ? -5.174  -1.156  6.188   1.00 15.00 ?  307 ASN A HB2  7  
ATOM 5091  H HB3  . ASN A 1 11 ? -6.905  -1.002  5.922   1.00 15.00 ?  307 ASN A HB3  7  
ATOM 5092  H HD21 . ASN A 1 11 ? -5.496  -2.810  7.676   1.00 15.00 ?  307 ASN A HD21 7  
ATOM 5093  H HD22 . ASN A 1 11 ? -5.933  -4.416  7.179   1.00 15.00 ?  307 ASN A HD22 7  
ATOM 5094  N N    . THR A 1 12 ? -7.221  -2.258  2.527   1.00 15.00 ?  308 THR A N    7  
ATOM 5095  C CA   . THR A 1 12 ? -8.430  -2.444  1.741   1.00 15.00 ?  308 THR A CA   7  
ATOM 5096  C C    . THR A 1 12 ? -9.441  -3.233  2.548   1.00 15.00 ?  308 THR A C    7  
ATOM 5097  O O    . THR A 1 12 ? -9.058  -4.144  3.292   1.00 15.00 ?  308 THR A O    7  
ATOM 5098  C CB   . THR A 1 12 ? -8.155  -3.221  0.432   1.00 15.00 ?  308 THR A CB   7  
ATOM 5099  O OG1  . THR A 1 12 ? -7.365  -4.388  0.713   1.00 15.00 ?  308 THR A OG1  7  
ATOM 5100  C CG2  . THR A 1 12 ? -7.443  -2.365  -0.599  1.00 15.00 ?  308 THR A CG2  7  
ATOM 5101  H H    . THR A 1 12 ? -6.517  -2.940  2.478   1.00 15.00 ?  308 THR A H    7  
ATOM 5102  H HA   . THR A 1 12 ? -8.837  -1.474  1.496   1.00 15.00 ?  308 THR A HA   7  
ATOM 5103  H HB   . THR A 1 12 ? -9.101  -3.538  0.019   1.00 15.00 ?  308 THR A HB   7  
ATOM 5104  H HG1  . THR A 1 12 ? -6.485  -4.113  1.010   1.00 15.00 ?  308 THR A HG1  7  
ATOM 5105  H HG21 . THR A 1 12 ? -8.020  -1.474  -0.787  1.00 15.00 ?  308 THR A HG21 7  
ATOM 5106  H HG22 . THR A 1 12 ? -7.337  -2.925  -1.518  1.00 15.00 ?  308 THR A HG22 7  
ATOM 5107  H HG23 . THR A 1 12 ? -6.467  -2.093  -0.229  1.00 15.00 ?  308 THR A HG23 7  
ATOM 5108  N N    . ALA A 1 13 ? -10.722 -2.910  2.375   1.00 15.00 ?  309 ALA A N    7  
ATOM 5109  C CA   . ALA A 1 13 ? -11.797 -3.575  3.109   1.00 15.00 ?  309 ALA A CA   7  
ATOM 5110  C C    . ALA A 1 13 ? -11.815 -5.080  2.831   1.00 15.00 ?  309 ALA A C    7  
ATOM 5111  O O    . ALA A 1 13 ? -12.418 -5.854  3.574   1.00 15.00 ?  309 ALA A O    7  
ATOM 5112  C CB   . ALA A 1 13 ? -13.142 -2.956  2.751   1.00 15.00 ?  309 ALA A CB   7  
ATOM 5113  H H    . ALA A 1 13 ? -10.951 -2.182  1.746   1.00 15.00 ?  309 ALA A H    7  
ATOM 5114  H HA   . ALA A 1 13 ? -11.623 -3.418  4.163   1.00 15.00 ?  309 ALA A HA   7  
ATOM 5115  H HB1  . ALA A 1 13 ? -13.114 -1.895  2.949   1.00 15.00 ?  309 ALA A HB1  7  
ATOM 5116  H HB2  . ALA A 1 13 ? -13.919 -3.414  3.346   1.00 15.00 ?  309 ALA A HB2  7  
ATOM 5117  H HB3  . ALA A 1 13 ? -13.348 -3.122  1.703   1.00 15.00 ?  309 ALA A HB3  7  
ATOM 5118  N N    . THR A 1 14 ? -11.145 -5.482  1.755   1.00 15.00 ?  310 THR A N    7  
ATOM 5119  C CA   . THR A 1 14 ? -10.987 -6.890  1.421   1.00 15.00 ?  310 THR A CA   7  
ATOM 5120  C C    . THR A 1 14 ? -10.029 -7.590  2.390   1.00 15.00 ?  310 THR A C    7  
ATOM 5121  O O    . THR A 1 14 ? -9.973  -8.817  2.446   1.00 15.00 ?  310 THR A O    7  
ATOM 5122  C CB   . THR A 1 14 ? -10.469 -7.047  -0.021  1.00 15.00 ?  310 THR A CB   7  
ATOM 5123  O OG1  . THR A 1 14 ? -9.363  -6.159  -0.243  1.00 15.00 ?  310 THR A OG1  7  
ATOM 5124  C CG2  . THR A 1 14 ? -11.568 -6.751  -1.030  1.00 15.00 ?  310 THR A CG2  7  
ATOM 5125  H H    . THR A 1 14 ? -10.752 -4.807  1.164   1.00 15.00 ?  310 THR A H    7  
ATOM 5126  H HA   . THR A 1 14 ? -11.958 -7.357  1.487   1.00 15.00 ?  310 THR A HA   7  
ATOM 5127  H HB   . THR A 1 14 ? -10.136 -8.065  -0.160  1.00 15.00 ?  310 THR A HB   7  
ATOM 5128  H HG1  . THR A 1 14 ? -9.003  -5.870  0.603   1.00 15.00 ?  310 THR A HG1  7  
ATOM 5129  H HG21 . THR A 1 14 ? -12.388 -7.441  -0.882  1.00 15.00 ?  310 THR A HG21 7  
ATOM 5130  H HG22 . THR A 1 14 ? -11.179 -6.864  -2.030  1.00 15.00 ?  310 THR A HG22 7  
ATOM 5131  H HG23 . THR A 1 14 ? -11.919 -5.740  -0.892  1.00 15.00 ?  310 THR A HG23 7  
ATOM 5132  N N    . GLY A 1 15 ? -9.278  -6.797  3.148   1.00 15.00 ?  311 GLY A N    7  
ATOM 5133  C CA   . GLY A 1 15 ? -8.372  -7.346  4.139   1.00 15.00 ?  311 GLY A CA   7  
ATOM 5134  C C    . GLY A 1 15 ? -6.944  -7.444  3.642   1.00 15.00 ?  311 GLY A C    7  
ATOM 5135  O O    . GLY A 1 15 ? -6.289  -8.470  3.821   1.00 15.00 ?  311 GLY A O    7  
ATOM 5136  H H    . GLY A 1 15 ? -9.349  -5.821  3.046   1.00 15.00 ?  311 GLY A H    7  
ATOM 5137  H HA2  . GLY A 1 15 ? -8.393  -6.715  5.015   1.00 15.00 ?  311 GLY A HA2  7  
ATOM 5138  H HA3  . GLY A 1 15 ? -8.713  -8.333  4.412   1.00 15.00 ?  311 GLY A HA3  7  
ATOM 5139  N N    . ARG A 1 16 ? -6.446  -6.379  3.024   1.00 15.00 ?  312 ARG A N    7  
ATOM 5140  C CA   . ARG A 1 16 ? -5.082  -6.392  2.474   1.00 15.00 ?  312 ARG A CA   7  
ATOM 5141  C C    . ARG A 1 16 ? -4.455  -5.000  2.575   1.00 15.00 ?  312 ARG A C    7  
ATOM 5142  O O    . ARG A 1 16 ? -5.094  -4.020  2.208   1.00 15.00 ?  312 ARG A O    7  
ATOM 5143  C CB   . ARG A 1 16 ? -5.085  -6.804  0.999   1.00 15.00 ?  312 ARG A CB   7  
ATOM 5144  C CG   . ARG A 1 16 ? -5.870  -8.050  0.643   1.00 15.00 ?  312 ARG A CG   7  
ATOM 5145  C CD   . ARG A 1 16 ? -5.985  -8.159  -0.866  1.00 15.00 ?  312 ARG A CD   7  
ATOM 5146  N NE   . ARG A 1 16 ? -7.067  -7.330  -1.399  1.00 15.00 ?  312 ARG A NE   7  
ATOM 5147  C CZ   . ARG A 1 16 ? -7.201  -7.001  -2.685  1.00 15.00 ?  312 ARG A CZ   7  
ATOM 5148  N NH1  . ARG A 1 16 ? -6.387  -7.511  -3.606  1.00 15.00 1  312 ARG A NH1  7  
ATOM 5149  N NH2  . ARG A 1 16 ? -8.175  -6.183  -3.054  1.00 15.00 ?  312 ARG A NH2  7  
ATOM 5150  H H    . ARG A 1 16 ? -6.995  -5.556  2.956   1.00 15.00 ?  312 ARG A H    7  
ATOM 5151  H HA   . ARG A 1 16 ? -4.491  -7.093  3.044   1.00 15.00 ?  312 ARG A HA   7  
ATOM 5152  H HB2  . ARG A 1 16 ? -5.478  -5.986  0.409   1.00 15.00 ?  312 ARG A HB2  7  
ATOM 5153  H HB3  . ARG A 1 16 ? -4.061  -6.968  0.698   1.00 15.00 ?  312 ARG A HB3  7  
ATOM 5154  H HG2  . ARG A 1 16 ? -5.356  -8.919  1.027   1.00 15.00 ?  312 ARG A HG2  7  
ATOM 5155  H HG3  . ARG A 1 16 ? -6.858  -7.985  1.071   1.00 15.00 ?  312 ARG A HG3  7  
ATOM 5156  H HD2  . ARG A 1 16 ? -5.052  -7.812  -1.294  1.00 15.00 ?  312 ARG A HD2  7  
ATOM 5157  H HD3  . ARG A 1 16 ? -6.154  -9.191  -1.138  1.00 15.00 ?  312 ARG A HD3  7  
ATOM 5158  H HE   . ARG A 1 16 ? -7.724  -6.980  -0.754  1.00 15.00 ?  312 ARG A HE   7  
ATOM 5159  H HH11 . ARG A 1 16 ? -5.664  -8.155  -3.342  1.00 15.00 ?  312 ARG A HH11 7  
ATOM 5160  H HH12 . ARG A 1 16 ? -6.490  -7.249  -4.571  1.00 15.00 ?  312 ARG A HH12 7  
ATOM 5161  H HH21 . ARG A 1 16 ? -8.810  -5.816  -2.372  1.00 15.00 ?  312 ARG A HH21 7  
ATOM 5162  H HH22 . ARG A 1 16 ? -8.283  -5.924  -4.029  1.00 15.00 ?  312 ARG A HH22 7  
ATOM 5163  N N    . VAL A 1 17 ? -3.195  -4.907  2.992   1.00 15.00 ?  313 VAL A N    7  
ATOM 5164  C CA   . VAL A 1 17 ? -2.575  -3.599  3.206   1.00 15.00 ?  313 VAL A CA   7  
ATOM 5165  C C    . VAL A 1 17 ? -1.575  -3.235  2.093   1.00 15.00 ?  313 VAL A C    7  
ATOM 5166  O O    . VAL A 1 17 ? -0.425  -3.656  2.107   1.00 15.00 ?  313 VAL A O    7  
ATOM 5167  C CB   . VAL A 1 17 ? -1.860  -3.523  4.568   1.00 15.00 ?  313 VAL A CB   7  
ATOM 5168  C CG1  . VAL A 1 17 ? -1.622  -2.072  4.957   1.00 15.00 ?  313 VAL A CG1  7  
ATOM 5169  C CG2  . VAL A 1 17 ? -2.657  -4.242  5.645   1.00 15.00 ?  313 VAL A CG2  7  
ATOM 5170  H H    . VAL A 1 17 ? -2.667  -5.720  3.145   1.00 15.00 ?  313 VAL A H    7  
ATOM 5171  H HA   . VAL A 1 17 ? -3.367  -2.864  3.210   1.00 15.00 ?  313 VAL A HA   7  
ATOM 5172  H HB   . VAL A 1 17 ? -0.900  -4.009  4.474   1.00 15.00 ?  313 VAL A HB   7  
ATOM 5173  H HG11 . VAL A 1 17 ? -1.013  -1.591  4.205   1.00 15.00 ?  313 VAL A HG11 7  
ATOM 5174  H HG12 . VAL A 1 17 ? -1.115  -2.035  5.909   1.00 15.00 ?  313 VAL A HG12 7  
ATOM 5175  H HG13 . VAL A 1 17 ? -2.570  -1.559  5.034   1.00 15.00 ?  313 VAL A HG13 7  
ATOM 5176  H HG21 . VAL A 1 17 ? -2.797  -5.275  5.362   1.00 15.00 ?  313 VAL A HG21 7  
ATOM 5177  H HG22 . VAL A 1 17 ? -3.620  -3.767  5.760   1.00 15.00 ?  313 VAL A HG22 7  
ATOM 5178  H HG23 . VAL A 1 17 ? -2.119  -4.197  6.581   1.00 15.00 ?  313 VAL A HG23 7  
ATOM 5179  N N    . TYR A 1 18 ? -2.046  -2.460  1.127   1.00 15.00 ?  314 TYR A N    7  
ATOM 5180  C CA   . TYR A 1 18 ? -1.232  -1.947  0.045   1.00 15.00 ?  314 TYR A CA   7  
ATOM 5181  C C    . TYR A 1 18 ? -0.643  -0.590  0.426   1.00 15.00 ?  314 TYR A C    7  
ATOM 5182  O O    . TYR A 1 18 ? -1.358  0.335   0.827   1.00 15.00 ?  314 TYR A O    7  
ATOM 5183  C CB   . TYR A 1 18 ? -2.077  -1.804  -1.240  1.00 15.00 ?  314 TYR A CB   7  
ATOM 5184  C CG   . TYR A 1 18 ? -3.191  -0.774  -1.141  1.00 15.00 ?  314 TYR A CG   7  
ATOM 5185  C CD1  . TYR A 1 18 ? -4.237  -0.938  -0.242  1.00 15.00 ?  314 TYR A CD1  7  
ATOM 5186  C CD2  . TYR A 1 18 ? -3.189  0.373   -1.935  1.00 15.00 ?  314 TYR A CD2  7  
ATOM 5187  C CE1  . TYR A 1 18 ? -5.236  0.003   -0.130  1.00 15.00 ?  314 TYR A CE1  7  
ATOM 5188  C CE2  . TYR A 1 18 ? -4.191  1.318   -1.823  1.00 15.00 ?  314 TYR A CE2  7  
ATOM 5189  C CZ   . TYR A 1 18 ? -5.205  1.127   -0.917  1.00 15.00 ?  314 TYR A CZ   7  
ATOM 5190  O OH   . TYR A 1 18 ? -6.202  2.058   -0.804  1.00 15.00 ?  314 TYR A OH   7  
ATOM 5191  H H    . TYR A 1 18 ? -2.967  -2.229  1.138   1.00 15.00 ?  314 TYR A H    7  
ATOM 5192  H HA   . TYR A 1 18 ? -0.429  -2.646  -0.133  1.00 15.00 ?  314 TYR A HA   7  
ATOM 5193  H HB2  . TYR A 1 18 ? -1.430  -1.511  -2.052  1.00 15.00 ?  314 TYR A HB2  7  
ATOM 5194  H HB3  . TYR A 1 18 ? -2.526  -2.759  -1.471  1.00 15.00 ?  314 TYR A HB3  7  
ATOM 5195  H HD1  . TYR A 1 18 ? -4.259  -1.819  0.384   1.00 15.00 ?  314 TYR A HD1  7  
ATOM 5196  H HD2  . TYR A 1 18 ? -2.401  0.513   -2.660  1.00 15.00 ?  314 TYR A HD2  7  
ATOM 5197  H HE1  . TYR A 1 18 ? -6.040  -0.143  0.577   1.00 15.00 ?  314 TYR A HE1  7  
ATOM 5198  H HE2  . TYR A 1 18 ? -4.166  2.221   -2.431  1.00 15.00 ?  314 TYR A HE2  7  
ATOM 5199  H HH   . TYR A 1 18 ? -6.601  2.208   -1.672  1.00 15.00 ?  314 TYR A HH   7  
ATOM 5200  N N    . PHE A 1 19 ? 0.659   -0.482  0.320   1.00 15.00 ?  315 PHE A N    7  
ATOM 5201  C CA   . PHE A 1 19 ? 1.331   0.782   0.508   1.00 15.00 ?  315 PHE A CA   7  
ATOM 5202  C C    . PHE A 1 19 ? 1.712   1.339   -0.848  1.00 15.00 ?  315 PHE A C    7  
ATOM 5203  O O    . PHE A 1 19 ? 2.490   0.733   -1.561  1.00 15.00 ?  315 PHE A O    7  
ATOM 5204  C CB   . PHE A 1 19 ? 2.603   0.613   1.336   1.00 15.00 ?  315 PHE A CB   7  
ATOM 5205  C CG   . PHE A 1 19 ? 2.420   0.085   2.726   1.00 15.00 ?  315 PHE A CG   7  
ATOM 5206  C CD1  . PHE A 1 19 ? 1.782   -1.118  2.950   1.00 15.00 ?  315 PHE A CD1  7  
ATOM 5207  C CD2  . PHE A 1 19 ? 2.926   0.785   3.809   1.00 15.00 ?  315 PHE A CD2  7  
ATOM 5208  C CE1  . PHE A 1 19 ? 1.645   -1.615  4.225   1.00 15.00 ?  315 PHE A CE1  7  
ATOM 5209  C CE2  . PHE A 1 19 ? 2.798   0.287   5.088   1.00 15.00 ?  315 PHE A CE2  7  
ATOM 5210  C CZ   . PHE A 1 19 ? 2.155   -0.916  5.293   1.00 15.00 ?  315 PHE A CZ   7  
ATOM 5211  H H    . PHE A 1 19 ? 1.192   -1.282  0.116   1.00 15.00 ?  315 PHE A H    7  
ATOM 5212  H HA   . PHE A 1 19 ? 0.657   1.464   1.007   1.00 15.00 ?  315 PHE A HA   7  
ATOM 5213  H HB2  . PHE A 1 19 ? 3.258   -0.071  0.820   1.00 15.00 ?  315 PHE A HB2  7  
ATOM 5214  H HB3  . PHE A 1 19 ? 3.096   1.574   1.410   1.00 15.00 ?  315 PHE A HB3  7  
ATOM 5215  H HD1  . PHE A 1 19 ? 1.382   -1.669  2.110   1.00 15.00 ?  315 PHE A HD1  7  
ATOM 5216  H HD2  . PHE A 1 19 ? 3.426   1.727   3.645   1.00 15.00 ?  315 PHE A HD2  7  
ATOM 5217  H HE1  . PHE A 1 19 ? 1.142   -2.557  4.386   1.00 15.00 ?  315 PHE A HE1  7  
ATOM 5218  H HE2  . PHE A 1 19 ? 3.195   0.839   5.924   1.00 15.00 ?  315 PHE A HE2  7  
ATOM 5219  H HZ   . PHE A 1 19 ? 2.061   -1.316  6.287   1.00 15.00 ?  315 PHE A HZ   7  
ATOM 5220  N N    . VAL A 1 20 ? 1.180   2.479   -1.207  1.00 15.00 ?  316 VAL A N    7  
ATOM 5221  C CA   . VAL A 1 20 ? 1.535   3.083   -2.467  1.00 15.00 ?  316 VAL A CA   7  
ATOM 5222  C C    . VAL A 1 20 ? 2.747   3.998   -2.270  1.00 15.00 ?  316 VAL A C    7  
ATOM 5223  O O    . VAL A 1 20 ? 2.733   4.882   -1.412  1.00 15.00 ?  316 VAL A O    7  
ATOM 5224  C CB   . VAL A 1 20 ? 0.359   3.871   -3.093  1.00 15.00 ?  316 VAL A CB   7  
ATOM 5225  C CG1  . VAL A 1 20 ? -0.647  2.918   -3.717  1.00 15.00 ?  316 VAL A CG1  7  
ATOM 5226  C CG2  . VAL A 1 20 ? -0.336  4.750   -2.068  1.00 15.00 ?  316 VAL A CG2  7  
ATOM 5227  H H    . VAL A 1 20 ? 0.559   2.940   -0.604  1.00 15.00 ?  316 VAL A H    7  
ATOM 5228  H HA   . VAL A 1 20 ? 1.795   2.280   -3.143  1.00 15.00 ?  316 VAL A HA   7  
ATOM 5229  H HB   . VAL A 1 20 ? 0.752   4.506   -3.874  1.00 15.00 ?  316 VAL A HB   7  
ATOM 5230  H HG11 . VAL A 1 20 ? -0.173  2.370   -4.518  1.00 15.00 ?  316 VAL A HG11 7  
ATOM 5231  H HG12 . VAL A 1 20 ? -1.481  3.479   -4.109  1.00 15.00 ?  316 VAL A HG12 7  
ATOM 5232  H HG13 . VAL A 1 20 ? -0.997  2.224   -2.971  1.00 15.00 ?  316 VAL A HG13 7  
ATOM 5233  H HG21 . VAL A 1 20 ? 0.399   5.335   -1.536  1.00 15.00 ?  316 VAL A HG21 7  
ATOM 5234  H HG22 . VAL A 1 20 ? -0.882  4.131   -1.373  1.00 15.00 ?  316 VAL A HG22 7  
ATOM 5235  H HG23 . VAL A 1 20 ? -1.023  5.413   -2.576  1.00 15.00 ?  316 VAL A HG23 7  
ATOM 5236  N N    . ASP A 1 21 ? 3.814   3.776   -3.031  1.00 15.00 ?  317 ASP A N    7  
ATOM 5237  C CA   . ASP A 1 21 ? 4.992   4.607   -2.916  1.00 15.00 ?  317 ASP A CA   7  
ATOM 5238  C C    . ASP A 1 21 ? 4.843   5.765   -3.869  1.00 15.00 ?  317 ASP A C    7  
ATOM 5239  O O    . ASP A 1 21 ? 4.646   5.556   -5.069  1.00 15.00 ?  317 ASP A O    7  
ATOM 5240  C CB   . ASP A 1 21 ? 6.282   3.871   -3.306  1.00 15.00 ?  317 ASP A CB   7  
ATOM 5241  C CG   . ASP A 1 21 ? 6.267   2.387   -3.048  1.00 15.00 ?  317 ASP A CG   7  
ATOM 5242  O OD1  . ASP A 1 21 ? 5.540   1.672   -3.762  1.00 15.00 ?  317 ASP A OD1  7  
ATOM 5243  O OD2  . ASP A 1 21 ? 7.036   1.932   -2.180  1.00 15.00 -1 317 ASP A OD2  7  
ATOM 5244  H H    . ASP A 1 21 ? 3.822   3.019   -3.665  1.00 15.00 ?  317 ASP A H    7  
ATOM 5245  H HA   . ASP A 1 21 ? 5.067   4.970   -1.901  1.00 15.00 ?  317 ASP A HA   7  
ATOM 5246  H HB2  . ASP A 1 21 ? 6.475   4.027   -4.355  1.00 15.00 ?  317 ASP A HB2  7  
ATOM 5247  H HB3  . ASP A 1 21 ? 7.096   4.289   -2.732  1.00 15.00 ?  317 ASP A HB3  7  
ATOM 5248  N N    . HIS A 1 22 ? 4.926   6.983   -3.354  1.00 15.00 ?  318 HIS A N    7  
ATOM 5249  C CA   . HIS A 1 22 ? 4.906   8.160   -4.213  1.00 15.00 ?  318 HIS A CA   7  
ATOM 5250  C C    . HIS A 1 22 ? 6.241   8.281   -4.933  1.00 15.00 ?  318 HIS A C    7  
ATOM 5251  O O    . HIS A 1 22 ? 6.380   9.028   -5.899  1.00 15.00 ?  318 HIS A O    7  
ATOM 5252  C CB   . HIS A 1 22 ? 4.604   9.435   -3.416  1.00 15.00 ?  318 HIS A CB   7  
ATOM 5253  C CG   . HIS A 1 22 ? 3.200   9.511   -2.878  1.00 15.00 ?  318 HIS A CG   7  
ATOM 5254  N ND1  . HIS A 1 22 ? 2.179   8.679   -3.288  1.00 15.00 ?  318 HIS A ND1  7  
ATOM 5255  C CD2  . HIS A 1 22 ? 2.651   10.333  -1.951  1.00 15.00 ?  318 HIS A CD2  7  
ATOM 5256  C CE1  . HIS A 1 22 ? 1.074   8.985   -2.642  1.00 15.00 ?  318 HIS A CE1  7  
ATOM 5257  N NE2  . HIS A 1 22 ? 1.327   9.984   -1.817  1.00 15.00 ?  318 HIS A NE2  7  
ATOM 5258  H H    . HIS A 1 22 ? 5.007   7.091   -2.381  1.00 15.00 ?  318 HIS A H    7  
ATOM 5259  H HA   . HIS A 1 22 ? 4.129   8.015   -4.950  1.00 15.00 ?  318 HIS A HA   7  
ATOM 5260  H HB2  . HIS A 1 22 ? 5.282   9.495   -2.578  1.00 15.00 ?  318 HIS A HB2  7  
ATOM 5261  H HB3  . HIS A 1 22 ? 4.760   10.291  -4.057  1.00 15.00 ?  318 HIS A HB3  7  
ATOM 5262  H HD1  . HIS A 1 22 ? 2.248   7.967   -3.964  1.00 15.00 ?  318 HIS A HD1  7  
ATOM 5263  H HD2  . HIS A 1 22 ? 3.158   11.126  -1.419  1.00 15.00 ?  318 HIS A HD2  7  
ATOM 5264  H HE1  . HIS A 1 22 ? 0.120   8.496   -2.761  1.00 15.00 ?  318 HIS A HE1  7  
ATOM 5265  H HE2  . HIS A 1 22 ? 0.787   10.169  -1.002  1.00 15.00 ?  318 HIS A HE2  7  
ATOM 5266  N N    . ASN A 1 23 ? 7.216   7.530   -4.438  1.00 15.00 ?  319 ASN A N    7  
ATOM 5267  C CA   . ASN A 1 23 ? 8.545   7.477   -5.026  1.00 15.00 ?  319 ASN A CA   7  
ATOM 5268  C C    . ASN A 1 23 ? 8.501   6.828   -6.410  1.00 15.00 ?  319 ASN A C    7  
ATOM 5269  O O    . ASN A 1 23 ? 8.695   7.495   -7.425  1.00 15.00 ?  319 ASN A O    7  
ATOM 5270  C CB   . ASN A 1 23 ? 9.485   6.690   -4.105  1.00 15.00 ?  319 ASN A CB   7  
ATOM 5271  C CG   . ASN A 1 23 ? 9.634   7.327   -2.736  1.00 15.00 ?  319 ASN A CG   7  
ATOM 5272  O OD1  . ASN A 1 23 ? 9.610   8.551   -2.596  1.00 15.00 ?  319 ASN A OD1  7  
ATOM 5273  N ND2  . ASN A 1 23 ? 9.764   6.499   -1.710  1.00 15.00 ?  319 ASN A ND2  7  
ATOM 5274  H H    . ASN A 1 23 ? 7.034   6.995   -3.638  1.00 15.00 ?  319 ASN A H    7  
ATOM 5275  H HA   . ASN A 1 23 ? 8.911   8.486   -5.124  1.00 15.00 ?  319 ASN A HA   7  
ATOM 5276  H HB2  . ASN A 1 23 ? 9.094   5.694   -3.972  1.00 15.00 ?  319 ASN A HB2  7  
ATOM 5277  H HB3  . ASN A 1 23 ? 10.460  6.630   -4.562  1.00 15.00 ?  319 ASN A HB3  7  
ATOM 5278  H HD21 . ASN A 1 23 ? 9.756   5.526   -1.890  1.00 15.00 ?  319 ASN A HD21 7  
ATOM 5279  H HD22 . ASN A 1 23 ? 9.866   6.880   -0.817  1.00 15.00 ?  319 ASN A HD22 7  
ATOM 5280  N N    . ASN A 1 24 ? 8.208   5.535   -6.448  1.00 15.00 ?  320 ASN A N    7  
ATOM 5281  C CA   . ASN A 1 24 ? 8.214   4.783   -7.704  1.00 15.00 ?  320 ASN A CA   7  
ATOM 5282  C C    . ASN A 1 24 ? 6.828   4.780   -8.349  1.00 15.00 ?  320 ASN A C    7  
ATOM 5283  O O    . ASN A 1 24 ? 6.679   4.419   -9.517  1.00 15.00 ?  320 ASN A O    7  
ATOM 5284  C CB   . ASN A 1 24 ? 8.711   3.351   -7.470  1.00 15.00 ?  320 ASN A CB   7  
ATOM 5285  C CG   . ASN A 1 24 ? 9.033   2.621   -8.764  1.00 15.00 ?  320 ASN A CG   7  
ATOM 5286  O OD1  . ASN A 1 24 ? 10.105  2.803   -9.340  1.00 15.00 ?  320 ASN A OD1  7  
ATOM 5287  N ND2  . ASN A 1 24 ? 8.133   1.762   -9.212  1.00 15.00 ?  320 ASN A ND2  7  
ATOM 5288  H H    . ASN A 1 24 ? 7.991   5.068   -5.613  1.00 15.00 ?  320 ASN A H    7  
ATOM 5289  H HA   . ASN A 1 24 ? 8.897   5.282   -8.373  1.00 15.00 ?  320 ASN A HA   7  
ATOM 5290  H HB2  . ASN A 1 24 ? 9.607   3.383   -6.867  1.00 15.00 ?  320 ASN A HB2  7  
ATOM 5291  H HB3  . ASN A 1 24 ? 7.949   2.795   -6.943  1.00 15.00 ?  320 ASN A HB3  7  
ATOM 5292  H HD21 . ASN A 1 24 ? 7.305   1.636   -8.691  1.00 15.00 ?  320 ASN A HD21 7  
ATOM 5293  H HD22 . ASN A 1 24 ? 8.325   1.285   -10.045 1.00 15.00 ?  320 ASN A HD22 7  
ATOM 5294  N N    . ARG A 1 25 ? 5.823   5.161   -7.560  1.00 15.00 ?  321 ARG A N    7  
ATOM 5295  C CA   . ARG A 1 25 ? 4.424   5.205   -8.003  1.00 15.00 ?  321 ARG A CA   7  
ATOM 5296  C C    . ARG A 1 25 ? 3.873   3.796   -8.165  1.00 15.00 ?  321 ARG A C    7  
ATOM 5297  O O    . ARG A 1 25 ? 3.325   3.441   -9.205  1.00 15.00 ?  321 ARG A O    7  
ATOM 5298  C CB   . ARG A 1 25 ? 4.261   5.994   -9.308  1.00 15.00 ?  321 ARG A CB   7  
ATOM 5299  C CG   . ARG A 1 25 ? 4.778   7.418   -9.222  1.00 15.00 ?  321 ARG A CG   7  
ATOM 5300  C CD   . ARG A 1 25 ? 4.590   8.159   -10.534 1.00 15.00 ?  321 ARG A CD   7  
ATOM 5301  N NE   . ARG A 1 25 ? 5.182   9.494   -10.494 1.00 15.00 ?  321 ARG A NE   7  
ATOM 5302  C CZ   . ARG A 1 25 ? 4.633   10.565  -11.060 1.00 15.00 ?  321 ARG A CZ   7  
ATOM 5303  N NH1  . ARG A 1 25 ? 3.472   10.459  -11.697 1.00 15.00 1  321 ARG A NH1  7  
ATOM 5304  N NH2  . ARG A 1 25 ? 5.246   11.738  -10.991 1.00 15.00 ?  321 ARG A NH2  7  
ATOM 5305  H H    . ARG A 1 25 ? 6.029   5.419   -6.638  1.00 15.00 ?  321 ARG A H    7  
ATOM 5306  H HA   . ARG A 1 25 ? 3.860   5.703   -7.226  1.00 15.00 ?  321 ARG A HA   7  
ATOM 5307  H HB2  . ARG A 1 25 ? 4.798   5.484   -10.094 1.00 15.00 ?  321 ARG A HB2  7  
ATOM 5308  H HB3  . ARG A 1 25 ? 3.208   6.030   -9.565  1.00 15.00 ?  321 ARG A HB3  7  
ATOM 5309  H HG2  . ARG A 1 25 ? 4.237   7.940   -8.447  1.00 15.00 ?  321 ARG A HG2  7  
ATOM 5310  H HG3  . ARG A 1 25 ? 5.830   7.396   -8.977  1.00 15.00 ?  321 ARG A HG3  7  
ATOM 5311  H HD2  . ARG A 1 25 ? 5.059   7.591   -11.325 1.00 15.00 ?  321 ARG A HD2  7  
ATOM 5312  H HD3  . ARG A 1 25 ? 3.534   8.250   -10.733 1.00 15.00 ?  321 ARG A HD3  7  
ATOM 5313  H HE   . ARG A 1 25 ? 6.046   9.591   -10.021 1.00 15.00 ?  321 ARG A HE   7  
ATOM 5314  H HH11 . ARG A 1 25 ? 3.002   9.569   -11.755 1.00 15.00 ?  321 ARG A HH11 7  
ATOM 5315  H HH12 . ARG A 1 25 ? 3.056   11.265  -12.127 1.00 15.00 ?  321 ARG A HH12 7  
ATOM 5316  H HH21 . ARG A 1 25 ? 6.125   11.822  -10.513 1.00 15.00 ?  321 ARG A HH21 7  
ATOM 5317  H HH22 . ARG A 1 25 ? 4.828   12.554  -11.411 1.00 15.00 ?  321 ARG A HH22 7  
ATOM 5318  N N    . THR A 1 26 ? 4.018   3.003   -7.118  1.00 15.00 ?  322 THR A N    7  
ATOM 5319  C CA   . THR A 1 26 ? 3.595   1.608   -7.150  1.00 15.00 ?  322 THR A CA   7  
ATOM 5320  C C    . THR A 1 26 ? 2.737   1.282   -5.929  1.00 15.00 ?  322 THR A C    7  
ATOM 5321  O O    . THR A 1 26 ? 2.881   1.916   -4.894  1.00 15.00 ?  322 THR A O    7  
ATOM 5322  C CB   . THR A 1 26 ? 4.822   0.681   -7.206  1.00 15.00 ?  322 THR A CB   7  
ATOM 5323  O OG1  . THR A 1 26 ? 5.693   1.134   -8.252  1.00 15.00 ?  322 THR A OG1  7  
ATOM 5324  C CG2  . THR A 1 26 ? 4.416   -0.764  -7.471  1.00 15.00 ?  322 THR A CG2  7  
ATOM 5325  H H    . THR A 1 26 ? 4.410   3.367   -6.289  1.00 15.00 ?  322 THR A H    7  
ATOM 5326  H HA   . THR A 1 26 ? 3.009   1.456   -8.045  1.00 15.00 ?  322 THR A HA   7  
ATOM 5327  H HB   . THR A 1 26 ? 5.343   0.732   -6.260  1.00 15.00 ?  322 THR A HB   7  
ATOM 5328  H HG1  . THR A 1 26 ? 5.190   1.686   -8.862  1.00 15.00 ?  322 THR A HG1  7  
ATOM 5329  H HG21 . THR A 1 26 ? 3.762   -1.104  -6.681  1.00 15.00 ?  322 THR A HG21 7  
ATOM 5330  H HG22 . THR A 1 26 ? 5.296   -1.389  -7.503  1.00 15.00 ?  322 THR A HG22 7  
ATOM 5331  H HG23 . THR A 1 26 ? 3.897   -0.826  -8.417  1.00 15.00 ?  322 THR A HG23 7  
ATOM 5332  N N    . THR A 1 27 ? 1.808   0.343   -6.061  1.00 15.00 ?  323 THR A N    7  
ATOM 5333  C CA   . THR A 1 27 ? 1.025   -0.090  -4.916  1.00 15.00 ?  323 THR A CA   7  
ATOM 5334  C C    . THR A 1 27 ? 1.579   -1.418  -4.375  1.00 15.00 ?  323 THR A C    7  
ATOM 5335  O O    . THR A 1 27 ? 1.846   -2.348  -5.143  1.00 15.00 ?  323 THR A O    7  
ATOM 5336  C CB   . THR A 1 27 ? -0.478  -0.216  -5.262  1.00 15.00 ?  323 THR A CB   7  
ATOM 5337  O OG1  . THR A 1 27 ? -1.223  -0.628  -4.113  1.00 15.00 ?  323 THR A OG1  7  
ATOM 5338  C CG2  . THR A 1 27 ? -0.723  -1.196  -6.388  1.00 15.00 ?  323 THR A CG2  7  
ATOM 5339  H H    . THR A 1 27 ? 1.655   -0.069  -6.936  1.00 15.00 ?  323 THR A H    7  
ATOM 5340  H HA   . THR A 1 27 ? 1.130   0.670   -4.155  1.00 15.00 ?  323 THR A HA   7  
ATOM 5341  H HB   . THR A 1 27 ? -0.836  0.755   -5.574  1.00 15.00 ?  323 THR A HB   7  
ATOM 5342  H HG1  . THR A 1 27 ? -2.139  -0.358  -4.220  1.00 15.00 ?  323 THR A HG1  7  
ATOM 5343  H HG21 . THR A 1 27 ? -0.316  -0.807  -7.306  1.00 15.00 ?  323 THR A HG21 7  
ATOM 5344  H HG22 . THR A 1 27 ? -1.788  -1.348  -6.496  1.00 15.00 ?  323 THR A HG22 7  
ATOM 5345  H HG23 . THR A 1 27 ? -0.249  -2.138  -6.153  1.00 15.00 ?  323 THR A HG23 7  
ATOM 5346  N N    . GLN A 1 28 ? 1.764   -1.503  -3.059  1.00 15.00 ?  324 GLN A N    7  
ATOM 5347  C CA   . GLN A 1 28 ? 2.493   -2.611  -2.462  1.00 15.00 ?  324 GLN A CA   7  
ATOM 5348  C C    . GLN A 1 28 ? 1.635   -3.394  -1.464  1.00 15.00 ?  324 GLN A C    7  
ATOM 5349  O O    . GLN A 1 28 ? 1.579   -3.041  -0.294  1.00 15.00 ?  324 GLN A O    7  
ATOM 5350  C CB   . GLN A 1 28 ? 3.743   -2.083  -1.732  1.00 15.00 ?  324 GLN A CB   7  
ATOM 5351  C CG   . GLN A 1 28 ? 4.626   -1.169  -2.574  1.00 15.00 ?  324 GLN A CG   7  
ATOM 5352  C CD   . GLN A 1 28 ? 5.602   -1.917  -3.460  1.00 15.00 ?  324 GLN A CD   7  
ATOM 5353  O OE1  . GLN A 1 28 ? 5.898   -1.503  -4.579  1.00 15.00 ?  324 GLN A OE1  7  
ATOM 5354  N NE2  . GLN A 1 28 ? 6.163   -2.997  -2.945  1.00 15.00 ?  324 GLN A NE2  7  
ATOM 5355  H H    . GLN A 1 28 ? 1.413   -0.799  -2.474  1.00 15.00 ?  324 GLN A H    7  
ATOM 5356  H HA   . GLN A 1 28 ? 2.805   -3.275  -3.255  1.00 15.00 ?  324 GLN A HA   7  
ATOM 5357  H HB2  . GLN A 1 28 ? 3.424   -1.528  -0.862  1.00 15.00 ?  324 GLN A HB2  7  
ATOM 5358  H HB3  . GLN A 1 28 ? 4.339   -2.918  -1.405  1.00 15.00 ?  324 GLN A HB3  7  
ATOM 5359  H HG2  . GLN A 1 28 ? 3.996   -0.555  -3.195  1.00 15.00 ?  324 GLN A HG2  7  
ATOM 5360  H HG3  . GLN A 1 28 ? 5.190   -0.532  -1.906  1.00 15.00 ?  324 GLN A HG3  7  
ATOM 5361  H HE21 . GLN A 1 28 ? 5.924   -3.250  -2.030  1.00 15.00 ?  324 GLN A HE21 7  
ATOM 5362  H HE22 . GLN A 1 28 ? 6.801   -3.492  -3.497  1.00 15.00 ?  324 GLN A HE22 7  
ATOM 5363  N N    . PHE A 1 29 ? 0.948   -4.439  -1.929  1.00 15.00 ?  325 PHE A N    7  
ATOM 5364  C CA   . PHE A 1 29 ? 0.353   -5.429  -1.014  1.00 15.00 ?  325 PHE A CA   7  
ATOM 5365  C C    . PHE A 1 29 ? 1.449   -6.251  -0.409  1.00 15.00 ?  325 PHE A C    7  
ATOM 5366  O O    . PHE A 1 29 ? 1.253   -7.072  0.481   1.00 15.00 ?  325 PHE A O    7  
ATOM 5367  C CB   . PHE A 1 29 ? -0.625  -6.347  -1.711  1.00 15.00 ?  325 PHE A CB   7  
ATOM 5368  C CG   . PHE A 1 29 ? -2.005  -5.807  -1.709  1.00 15.00 ?  325 PHE A CG   7  
ATOM 5369  C CD1  . PHE A 1 29 ? -2.512  -5.182  -0.580  1.00 15.00 ?  325 PHE A CD1  7  
ATOM 5370  C CD2  . PHE A 1 29 ? -2.798  -5.921  -2.830  1.00 15.00 ?  325 PHE A CD2  7  
ATOM 5371  C CE1  . PHE A 1 29 ? -3.796  -4.673  -0.599  1.00 15.00 ?  325 PHE A CE1  7  
ATOM 5372  C CE2  . PHE A 1 29 ? -4.078  -5.418  -2.841  1.00 15.00 ?  325 PHE A CE2  7  
ATOM 5373  C CZ   . PHE A 1 29 ? -4.577  -4.792  -1.726  1.00 15.00 ?  325 PHE A CZ   7  
ATOM 5374  H H    . PHE A 1 29 ? 0.828   -4.545  -2.896  1.00 15.00 ?  325 PHE A H    7  
ATOM 5375  H HA   . PHE A 1 29 ? -0.157  -4.892  -0.227  1.00 15.00 ?  325 PHE A HA   7  
ATOM 5376  H HB2  . PHE A 1 29 ? -0.314  -6.489  -2.738  1.00 15.00 ?  325 PHE A HB2  7  
ATOM 5377  H HB3  . PHE A 1 29 ? -0.636  -7.297  -1.204  1.00 15.00 ?  325 PHE A HB3  7  
ATOM 5378  H HD1  . PHE A 1 29 ? -1.886  -5.085  0.329   1.00 15.00 ?  325 PHE A HD1  7  
ATOM 5379  H HD2  . PHE A 1 29 ? -2.406  -6.413  -3.706  1.00 15.00 ?  325 PHE A HD2  7  
ATOM 5380  H HE1  . PHE A 1 29 ? -4.199  -4.203  0.275   1.00 15.00 ?  325 PHE A HE1  7  
ATOM 5381  H HE2  . PHE A 1 29 ? -4.689  -5.514  -3.725  1.00 15.00 ?  325 PHE A HE2  7  
ATOM 5382  H HZ   . PHE A 1 29 ? -5.581  -4.392  -1.733  1.00 15.00 ?  325 PHE A HZ   7  
ATOM 5383  N N    . THR A 1 30 ? 2.595   -6.035  -0.976  1.00 15.00 ?  326 THR A N    7  
ATOM 5384  C CA   . THR A 1 30 ? 3.813   -6.620  -0.482  1.00 15.00 ?  326 THR A CA   7  
ATOM 5385  C C    . THR A 1 30 ? 4.352   -5.638  0.554   1.00 15.00 ?  326 THR A C    7  
ATOM 5386  O O    . THR A 1 30 ? 5.099   -4.709  0.236   1.00 15.00 ?  326 THR A O    7  
ATOM 5387  C CB   . THR A 1 30 ? 4.828   -6.892  -1.619  1.00 15.00 ?  326 THR A CB   7  
ATOM 5388  O OG1  . THR A 1 30 ? 6.134   -7.153  -1.091  1.00 15.00 ?  326 THR A OG1  7  
ATOM 5389  C CG2  . THR A 1 30 ? 4.882   -5.742  -2.613  1.00 15.00 ?  326 THR A CG2  7  
ATOM 5390  H H    . THR A 1 30 ? 2.615   -5.372  -1.691  1.00 15.00 ?  326 THR A H    7  
ATOM 5391  H HA   . THR A 1 30 ? 3.561   -7.561  -0.013  1.00 15.00 ?  326 THR A HA   7  
ATOM 5392  H HB   . THR A 1 30 ? 4.497   -7.775  -2.150  1.00 15.00 ?  326 THR A HB   7  
ATOM 5393  H HG1  . THR A 1 30 ? 6.378   -6.452  -0.471  1.00 15.00 ?  326 THR A HG1  7  
ATOM 5394  H HG21 . THR A 1 30 ? 5.617   -5.957  -3.374  1.00 15.00 ?  326 THR A HG21 7  
ATOM 5395  H HG22 . THR A 1 30 ? 5.153   -4.835  -2.095  1.00 15.00 ?  326 THR A HG22 7  
ATOM 5396  H HG23 . THR A 1 30 ? 3.912   -5.618  -3.072  1.00 15.00 ?  326 THR A HG23 7  
ATOM 5397  N N    . ASP A 1 31 ? 3.930   -5.836  1.788   1.00 15.00 ?  327 ASP A N    7  
ATOM 5398  C CA   . ASP A 1 31 ? 3.897   -4.779  2.765   1.00 15.00 ?  327 ASP A CA   7  
ATOM 5399  C C    . ASP A 1 31 ? 4.872   -4.937  3.872   1.00 15.00 ?  327 ASP A C    7  
ATOM 5400  O O    . ASP A 1 31 ? 5.260   -6.036  4.269   1.00 15.00 ?  327 ASP A O    7  
ATOM 5401  C CB   . ASP A 1 31 ? 2.518   -4.596  3.367   1.00 15.00 ?  327 ASP A CB   7  
ATOM 5402  C CG   . ASP A 1 31 ? 1.767   -5.893  3.623   1.00 15.00 ?  327 ASP A CG   7  
ATOM 5403  O OD1  . ASP A 1 31 ? 2.428   -6.927  3.862   1.00 15.00 ?  327 ASP A OD1  7  
ATOM 5404  O OD2  . ASP A 1 31 ? 0.520   -5.871  3.646   1.00 15.00 -1 327 ASP A OD2  7  
ATOM 5405  H H    . ASP A 1 31 ? 3.627   -6.729  2.068   1.00 15.00 ?  327 ASP A H    7  
ATOM 5406  H HA   . ASP A 1 31 ? 4.142   -3.863  2.251   1.00 15.00 ?  327 ASP A HA   7  
ATOM 5407  H HB2  . ASP A 1 31 ? 2.630   -4.089  4.316   1.00 15.00 ?  327 ASP A HB2  7  
ATOM 5408  H HB3  . ASP A 1 31 ? 1.960   -3.966  2.711   1.00 15.00 ?  327 ASP A HB3  7  
ATOM 5409  N N    . PRO A 1 32 ? 5.272   -3.792  4.387   1.00 15.00 ?  328 PRO A N    7  
ATOM 5410  C CA   . PRO A 1 32 ? 6.006   -3.713  5.620   1.00 15.00 ?  328 PRO A CA   7  
ATOM 5411  C C    . PRO A 1 32 ? 5.086   -4.214  6.744   1.00 15.00 ?  328 PRO A C    7  
ATOM 5412  O O    . PRO A 1 32 ? 5.520   -4.500  7.861   1.00 15.00 ?  328 PRO A O    7  
ATOM 5413  C CB   . PRO A 1 32 ? 6.355   -2.216  5.735   1.00 15.00 ?  328 PRO A CB   7  
ATOM 5414  C CG   . PRO A 1 32 ? 6.045   -1.639  4.383   1.00 15.00 ?  328 PRO A CG   7  
ATOM 5415  C CD   . PRO A 1 32 ? 4.938   -2.464  3.855   1.00 15.00 ?  328 PRO A CD   7  
ATOM 5416  H HA   . PRO A 1 32 ? 6.906   -4.312  5.588   1.00 15.00 ?  328 PRO A HA   7  
ATOM 5417  H HB2  . PRO A 1 32 ? 5.751   -1.760  6.508   1.00 15.00 ?  328 PRO A HB2  7  
ATOM 5418  H HB3  . PRO A 1 32 ? 7.401   -2.107  5.979   1.00 15.00 ?  328 PRO A HB3  7  
ATOM 5419  H HG2  . PRO A 1 32 ? 5.746   -0.601  4.474   1.00 15.00 ?  328 PRO A HG2  7  
ATOM 5420  H HG3  . PRO A 1 32 ? 6.881   -1.734  3.719   1.00 15.00 ?  328 PRO A HG3  7  
ATOM 5421  H HD2  . PRO A 1 32 ? 3.988   -2.118  4.236   1.00 15.00 ?  328 PRO A HD2  7  
ATOM 5422  H HD3  . PRO A 1 32 ? 4.945   -2.466  2.776   1.00 15.00 ?  328 PRO A HD3  7  
ATOM 5423  N N    . ARG A 1 33 ? 3.784   -4.299  6.406   1.00 15.00 ?  329 ARG A N    7  
ATOM 5424  C CA   . ARG A 1 33 ? 2.772   -4.910  7.265   1.00 15.00 ?  329 ARG A CA   7  
ATOM 5425  C C    . ARG A 1 33 ? 3.058   -6.390  7.502   1.00 15.00 ?  329 ARG A C    7  
ATOM 5426  O O    . ARG A 1 33 ? 2.650   -6.944  8.519   1.00 15.00 ?  329 ARG A O    7  
ATOM 5427  C CB   . ARG A 1 33 ? 1.346   -4.751  6.685   1.00 15.00 ?  329 ARG A CB   7  
ATOM 5428  C CG   . ARG A 1 33 ? 0.669   -3.459  7.101   1.00 15.00 ?  329 ARG A CG   7  
ATOM 5429  C CD   . ARG A 1 33 ? 0.470   -3.390  8.610   1.00 15.00 ?  329 ARG A CD   7  
ATOM 5430  N NE   . ARG A 1 33 ? -0.294  -4.531  9.121   1.00 15.00 ?  329 ARG A NE   7  
ATOM 5431  C CZ   . ARG A 1 33 ? -1.543  -4.449  9.581   1.00 15.00 ?  329 ARG A CZ   7  
ATOM 5432  N NH1  . ARG A 1 33 ? -2.185  -3.290  9.575   1.00 15.00 1  329 ARG A NH1  7  
ATOM 5433  N NH2  . ARG A 1 33 ? -2.145  -5.530  10.057  1.00 15.00 ?  329 ARG A NH2  7  
ATOM 5434  H H    . ARG A 1 33 ? 3.506   -3.946  5.535   1.00 15.00 ?  329 ARG A H    7  
ATOM 5435  H HA   . ARG A 1 33 ? 2.812   -4.404  8.218   1.00 15.00 ?  329 ARG A HA   7  
ATOM 5436  H HB2  . ARG A 1 33 ? 1.371   -4.787  5.583   1.00 15.00 ?  329 ARG A HB2  7  
ATOM 5437  H HB3  . ARG A 1 33 ? 0.742   -5.574  7.041   1.00 15.00 ?  329 ARG A HB3  7  
ATOM 5438  H HG2  . ARG A 1 33 ? 1.282   -2.626  6.792   1.00 15.00 ?  329 ARG A HG2  7  
ATOM 5439  H HG3  . ARG A 1 33 ? -0.294  -3.398  6.617   1.00 15.00 ?  329 ARG A HG3  7  
ATOM 5440  H HD2  . ARG A 1 33 ? 1.439   -3.377  9.086   1.00 15.00 ?  329 ARG A HD2  7  
ATOM 5441  H HD3  . ARG A 1 33 ? -0.059  -2.479  8.849   1.00 15.00 ?  329 ARG A HD3  7  
ATOM 5442  H HE   . ARG A 1 33 ? 0.157   -5.407  9.137   1.00 15.00 ?  329 ARG A HE   7  
ATOM 5443  H HH11 . ARG A 1 33 ? -1.735  -2.465  9.230   1.00 15.00 ?  329 ARG A HH11 7  
ATOM 5444  H HH12 . ARG A 1 33 ? -3.125  -3.232  9.927   1.00 15.00 ?  329 ARG A HH12 7  
ATOM 5445  H HH21 . ARG A 1 33 ? -1.655  -6.417  10.079  1.00 15.00 ?  329 ARG A HH21 7  
ATOM 5446  H HH22 . ARG A 1 33 ? -3.086  -5.472  10.409  1.00 15.00 ?  329 ARG A HH22 7  
ATOM 5447  N N    . LEU A 1 34 ? 3.747   -7.030  6.563   1.00 15.00 ?  330 LEU A N    7  
ATOM 5448  C CA   . LEU A 1 34 ? 4.092   -8.441  6.697   1.00 15.00 ?  330 LEU A CA   7  
ATOM 5449  C C    . LEU A 1 34 ? 4.995   -8.654  7.911   1.00 15.00 ?  330 LEU A C    7  
ATOM 5450  O O    . LEU A 1 34 ? 4.920   -9.681  8.584   1.00 15.00 ?  330 LEU A O    7  
ATOM 5451  C CB   . LEU A 1 34 ? 4.767   -8.947  5.408   1.00 15.00 ?  330 LEU A CB   7  
ATOM 5452  C CG   . LEU A 1 34 ? 5.107   -10.443 5.351   1.00 15.00 ?  330 LEU A CG   7  
ATOM 5453  C CD1  . LEU A 1 34 ? 5.082   -10.934 3.913   1.00 15.00 ?  330 LEU A CD1  7  
ATOM 5454  C CD2  . LEU A 1 34 ? 6.479   -10.714 5.957   1.00 15.00 ?  330 LEU A CD2  7  
ATOM 5455  H H    . LEU A 1 34 ? 4.011   -6.548  5.744   1.00 15.00 ?  330 LEU A H    7  
ATOM 5456  H HA   . LEU A 1 34 ? 3.174   -8.990  6.850   1.00 15.00 ?  330 LEU A HA   7  
ATOM 5457  H HB2  . LEU A 1 34 ? 4.113   -8.721  4.578   1.00 15.00 ?  330 LEU A HB2  7  
ATOM 5458  H HB3  . LEU A 1 34 ? 5.684   -8.393  5.274   1.00 15.00 ?  330 LEU A HB3  7  
ATOM 5459  H HG   . LEU A 1 34 ? 4.371   -11.001 5.912   1.00 15.00 ?  330 LEU A HG   7  
ATOM 5460  H HD11 . LEU A 1 34 ? 5.809   -10.385 3.331   1.00 15.00 ?  330 LEU A HD11 7  
ATOM 5461  H HD12 . LEU A 1 34 ? 4.098   -10.778 3.496   1.00 15.00 ?  330 LEU A HD12 7  
ATOM 5462  H HD13 . LEU A 1 34 ? 5.322   -11.986 3.888   1.00 15.00 ?  330 LEU A HD13 7  
ATOM 5463  H HD21 . LEU A 1 34 ? 7.229   -10.157 5.415   1.00 15.00 ?  330 LEU A HD21 7  
ATOM 5464  H HD22 . LEU A 1 34 ? 6.699   -11.770 5.894   1.00 15.00 ?  330 LEU A HD22 7  
ATOM 5465  H HD23 . LEU A 1 34 ? 6.481   -10.408 6.993   1.00 15.00 ?  330 LEU A HD23 7  
ATOM 5466  N N    . SER A 1 35 ? 5.841   -7.673  8.194   1.00 15.00 ?  331 SER A N    7  
ATOM 5467  C CA   . SER A 1 35 ? 6.767   -7.771  9.311   1.00 15.00 ?  331 SER A CA   7  
ATOM 5468  C C    . SER A 1 35 ? 6.104   -7.307  10.609  1.00 15.00 ?  331 SER A C    7  
ATOM 5469  O O    . SER A 1 35 ? 6.637   -7.514  11.700  1.00 15.00 ?  331 SER A O    7  
ATOM 5470  C CB   . SER A 1 35 ? 8.026   -6.943  9.023   1.00 15.00 ?  331 SER A CB   7  
ATOM 5471  O OG   . SER A 1 35 ? 8.997   -7.100  10.042  1.00 15.00 ?  331 SER A OG   7  
ATOM 5472  H H    . SER A 1 35 ? 5.846   -6.867  7.635   1.00 15.00 ?  331 SER A H    7  
ATOM 5473  H HA   . SER A 1 35 ? 7.046   -8.808  9.417   1.00 15.00 ?  331 SER A HA   7  
ATOM 5474  H HB2  . SER A 1 35 ? 8.454   -7.262  8.085   1.00 15.00 ?  331 SER A HB2  7  
ATOM 5475  H HB3  . SER A 1 35 ? 7.756   -5.899  8.957   1.00 15.00 ?  331 SER A HB3  7  
ATOM 5476  H HG   . SER A 1 35 ? 8.945   -6.347  10.654  1.00 15.00 ?  331 SER A HG   7  
ATOM 5477  N N    . ALA A 1 36 ? 4.937   -6.685  10.488  1.00 15.00 ?  332 ALA A N    7  
ATOM 5478  C CA   . ALA A 1 36 ? 4.227   -6.160  11.649  1.00 15.00 ?  332 ALA A CA   7  
ATOM 5479  C C    . ALA A 1 36 ? 3.079   -7.079  12.059  1.00 15.00 ?  332 ALA A C    7  
ATOM 5480  O O    . ALA A 1 36 ? 2.746   -7.166  13.242  1.00 15.00 ?  332 ALA A O    7  
ATOM 5481  C CB   . ALA A 1 36 ? 3.709   -4.760  11.359  1.00 15.00 ?  332 ALA A CB   7  
ATOM 5482  H H    . ALA A 1 36 ? 4.544   -6.575  9.596   1.00 15.00 ?  332 ALA A H    7  
ATOM 5483  H HA   . ALA A 1 36 ? 4.929   -6.095  12.467  1.00 15.00 ?  332 ALA A HA   7  
ATOM 5484  H HB1  . ALA A 1 36 ? 2.993   -4.799  10.552  1.00 15.00 ?  332 ALA A HB1  7  
ATOM 5485  H HB2  . ALA A 1 36 ? 4.535   -4.123  11.078  1.00 15.00 ?  332 ALA A HB2  7  
ATOM 5486  H HB3  . ALA A 1 36 ? 3.234   -4.361  12.244  1.00 15.00 ?  332 ALA A HB3  7  
ATOM 5487  N N    . ASN A 1 37 ? 2.496   -7.760  11.067  1.00 15.00 ?  333 ASN A N    7  
ATOM 5488  C CA   . ASN A 1 37 ? 1.354   -8.661  11.266  1.00 15.00 ?  333 ASN A CA   7  
ATOM 5489  C C    . ASN A 1 37 ? 0.074   -7.866  11.484  1.00 15.00 ?  333 ASN A C    7  
ATOM 5490  O O    . ASN A 1 37 ? -0.674  -7.674  10.502  1.00 15.00 ?  333 ASN A O    7  
ATOM 5491  C CB   . ASN A 1 37 ? 1.579   -9.639  12.430  1.00 15.00 ?  333 ASN A CB   7  
ATOM 5492  C CG   . ASN A 1 37 ? 2.530   -10.776 12.091  1.00 15.00 ?  333 ASN A CG   7  
ATOM 5493  O OD1  . ASN A 1 37 ? 2.427   -11.866 12.651  1.00 15.00 ?  333 ASN A OD1  7  
ATOM 5494  N ND2  . ASN A 1 37 ? 3.461   -10.538 11.180  1.00 15.00 ?  333 ASN A ND2  7  
ATOM 5495  O OXT  . ASN A 1 37 ? -0.178  -7.423  12.624  1.00 15.00 ?  333 ASN A OXT  7  
ATOM 5496  H H    . ASN A 1 37 ? 2.832   -7.634  10.153  1.00 15.00 ?  333 ASN A H    7  
ATOM 5497  H HA   . ASN A 1 37 ? 1.241   -9.233  10.356  1.00 15.00 ?  333 ASN A HA   7  
ATOM 5498  H HB2  . ASN A 1 37 ? 1.988   -9.096  13.268  1.00 15.00 ?  333 ASN A HB2  7  
ATOM 5499  H HB3  . ASN A 1 37 ? 0.630   -10.066 12.717  1.00 15.00 ?  333 ASN A HB3  7  
ATOM 5500  H HD21 . ASN A 1 37 ? 3.494   -9.647  10.773  1.00 15.00 ?  333 ASN A HD21 7  
ATOM 5501  H HD22 . ASN A 1 37 ? 4.077   -11.264 10.946  1.00 15.00 ?  333 ASN A HD22 7  
ATOM 5502  N N    . GLU B 2 1  ? 4.462   -9.958  -6.187  1.00 15.00 ?  203 GLU B N    7  
ATOM 5503  C CA   . GLU B 2 1  ? 3.742   -9.770  -4.908  1.00 15.00 ?  203 GLU B CA   7  
ATOM 5504  C C    . GLU B 2 1  ? 3.036   -11.063 -4.517  1.00 15.00 ?  203 GLU B C    7  
ATOM 5505  O O    . GLU B 2 1  ? 2.475   -11.756 -5.365  1.00 15.00 ?  203 GLU B O    7  
ATOM 5506  C CB   . GLU B 2 1  ? 2.744   -8.595  -4.997  1.00 15.00 ?  203 GLU B CB   7  
ATOM 5507  C CG   . GLU B 2 1  ? 1.610   -8.780  -5.998  1.00 15.00 ?  203 GLU B CG   7  
ATOM 5508  C CD   . GLU B 2 1  ? 2.087   -8.869  -7.429  1.00 15.00 ?  203 GLU B CD   7  
ATOM 5509  O OE1  . GLU B 2 1  ? 2.475   -7.834  -7.999  1.00 15.00 -1 203 GLU B OE1  7  
ATOM 5510  O OE2  . GLU B 2 1  ? 2.117   -9.990  -7.972  1.00 15.00 ?  203 GLU B OE2  7  
ATOM 5511  H H1   . GLU B 2 1  ? 4.843   -9.052  -6.526  1.00 15.00 ?  203 GLU B H1   7  
ATOM 5512  H H2   . GLU B 2 1  ? 3.816   -10.346 -6.907  1.00 15.00 ?  203 GLU B H2   7  
ATOM 5513  H H3   . GLU B 2 1  ? 5.251   -10.623 -6.056  1.00 15.00 ?  203 GLU B H3   7  
ATOM 5514  H HA   . GLU B 2 1  ? 4.476   -9.547  -4.147  1.00 15.00 ?  203 GLU B HA   7  
ATOM 5515  H HB2  . GLU B 2 1  ? 2.302   -8.441  -4.021  1.00 15.00 ?  203 GLU B HB2  7  
ATOM 5516  H HB3  . GLU B 2 1  ? 3.291   -7.705  -5.271  1.00 15.00 ?  203 GLU B HB3  7  
ATOM 5517  H HG2  . GLU B 2 1  ? 1.084   -9.692  -5.758  1.00 15.00 ?  203 GLU B HG2  7  
ATOM 5518  H HG3  . GLU B 2 1  ? 0.933   -7.942  -5.910  1.00 15.00 ?  203 GLU B HG3  7  
ATOM 5519  N N    . LEU B 2 2  ? 3.066   -11.380 -3.230  1.00 15.00 ?  204 LEU B N    7  
ATOM 5520  C CA   . LEU B 2 2  ? 2.482   -12.623 -2.726  1.00 15.00 ?  204 LEU B CA   7  
ATOM 5521  C C    . LEU B 2 2  ? 0.955   -12.536 -2.664  1.00 15.00 ?  204 LEU B C    7  
ATOM 5522  O O    . LEU B 2 2  ? 0.272   -13.539 -2.479  1.00 15.00 ?  204 LEU B O    7  
ATOM 5523  C CB   . LEU B 2 2  ? 3.046   -12.940 -1.335  1.00 15.00 ?  204 LEU B CB   7  
ATOM 5524  C CG   . LEU B 2 2  ? 2.584   -14.265 -0.727  1.00 15.00 ?  204 LEU B CG   7  
ATOM 5525  C CD1  . LEU B 2 2  ? 3.069   -15.438 -1.565  1.00 15.00 ?  204 LEU B CD1  7  
ATOM 5526  C CD2  . LEU B 2 2  ? 3.075   -14.392 0.706   1.00 15.00 ?  204 LEU B CD2  7  
ATOM 5527  H H    . LEU B 2 2  ? 3.501   -10.768 -2.598  1.00 15.00 ?  204 LEU B H    7  
ATOM 5528  H HA   . LEU B 2 2  ? 2.758   -13.417 -3.404  1.00 15.00 ?  204 LEU B HA   7  
ATOM 5529  H HB2  . LEU B 2 2  ? 4.123   -12.955 -1.400  1.00 15.00 ?  204 LEU B HB2  7  
ATOM 5530  H HB3  . LEU B 2 2  ? 2.755   -12.144 -0.664  1.00 15.00 ?  204 LEU B HB3  7  
ATOM 5531  H HG   . LEU B 2 2  ? 1.503   -14.288 -0.714  1.00 15.00 ?  204 LEU B HG   7  
ATOM 5532  H HD11 . LEU B 2 2  ? 4.149   -15.434 -1.597  1.00 15.00 ?  204 LEU B HD11 7  
ATOM 5533  H HD12 . LEU B 2 2  ? 2.679   -15.351 -2.568  1.00 15.00 ?  204 LEU B HD12 7  
ATOM 5534  H HD13 . LEU B 2 2  ? 2.726   -16.362 -1.123  1.00 15.00 ?  204 LEU B HD13 7  
ATOM 5535  H HD21 . LEU B 2 2  ? 2.680   -13.578 1.296   1.00 15.00 ?  204 LEU B HD21 7  
ATOM 5536  H HD22 . LEU B 2 2  ? 4.154   -14.358 0.722   1.00 15.00 ?  204 LEU B HD22 7  
ATOM 5537  H HD23 . LEU B 2 2  ? 2.738   -15.332 1.120   1.00 15.00 ?  204 LEU B HD23 7  
ATOM 5538  N N    . GLU B 2 3  ? 0.430   -11.333 -2.809  1.00 15.00 ?  205 GLU B N    7  
ATOM 5539  C CA   . GLU B 2 3  ? -1.001  -11.102 -2.686  1.00 15.00 ?  205 GLU B CA   7  
ATOM 5540  C C    . GLU B 2 3  ? -1.620  -10.786 -4.050  1.00 15.00 ?  205 GLU B C    7  
ATOM 5541  O O    . GLU B 2 3  ? -0.911  -10.433 -4.996  1.00 15.00 ?  205 GLU B O    7  
ATOM 5542  C CB   . GLU B 2 3  ? -1.235  -9.952  -1.700  1.00 15.00 ?  205 GLU B CB   7  
ATOM 5543  C CG   . GLU B 2 3  ? -2.700  -9.632  -1.424  1.00 15.00 ?  205 GLU B CG   7  
ATOM 5544  C CD   . GLU B 2 3  ? -3.489  -10.828 -0.930  1.00 15.00 ?  205 GLU B CD   7  
ATOM 5545  O OE1  . GLU B 2 3  ? -3.554  -11.037 0.293   1.00 15.00 -1 205 GLU B OE1  7  
ATOM 5546  O OE2  . GLU B 2 3  ? -4.059  -11.554 -1.774  1.00 15.00 ?  205 GLU B OE2  7  
ATOM 5547  H H    . GLU B 2 3  ? 1.015   -10.582 -3.014  1.00 15.00 ?  205 GLU B H    7  
ATOM 5548  H HA   . GLU B 2 3  ? -1.452  -12.000 -2.296  1.00 15.00 ?  205 GLU B HA   7  
ATOM 5549  H HB2  . GLU B 2 3  ? -0.764  -10.198 -0.762  1.00 15.00 ?  205 GLU B HB2  7  
ATOM 5550  H HB3  . GLU B 2 3  ? -0.769  -9.068  -2.102  1.00 15.00 ?  205 GLU B HB3  7  
ATOM 5551  H HG2  . GLU B 2 3  ? -2.748  -8.857  -0.674  1.00 15.00 ?  205 GLU B HG2  7  
ATOM 5552  H HG3  . GLU B 2 3  ? -3.152  -9.274  -2.337  1.00 15.00 ?  205 GLU B HG3  7  
ATOM 5553  N N    . SER B 2 4  ? -2.938  -10.932 -4.129  1.00 15.00 ?  206 SER B N    7  
ATOM 5554  C CA   . SER B 2 4  ? -3.725  -10.568 -5.305  1.00 15.00 ?  206 SER B CA   7  
ATOM 5555  C C    . SER B 2 4  ? -3.406  -9.172  -5.824  1.00 15.00 ?  206 SER B C    7  
ATOM 5556  O O    . SER B 2 4  ? -2.935  -8.292  -5.100  1.00 15.00 ?  206 SER B O    7  
ATOM 5557  C CB   . SER B 2 4  ? -5.210  -10.672 -4.975  1.00 15.00 ?  206 SER B CB   7  
ATOM 5558  O OG   . SER B 2 4  ? -5.478  -10.306 -3.628  1.00 15.00 ?  206 SER B OG   7  
ATOM 5559  H H    . SER B 2 4  ? -3.410  -11.300 -3.345  1.00 15.00 ?  206 SER B H    7  
ATOM 5560  H HA   . SER B 2 4  ? -3.519  -11.269 -6.104  1.00 15.00 ?  206 SER B HA   7  
ATOM 5561  H HB2  . SER B 2 4  ? -5.760  -10.011 -5.629  1.00 15.00 ?  206 SER B HB2  7  
ATOM 5562  H HB3  . SER B 2 4  ? -5.529  -11.686 -5.145  1.00 15.00 ?  206 SER B HB3  7  
ATOM 5563  H HG   . SER B 2 4  ? -4.982  -10.889 -3.026  1.00 15.00 ?  206 SER B HG   7  
ATOM 5564  N N    . PRO B 2 5  ? -3.720  -8.990  -7.101  1.00 15.00 ?  207 PRO B N    7  
ATOM 5565  C CA   . PRO B 2 5  ? -3.525  -7.741  -7.834  1.00 15.00 ?  207 PRO B CA   7  
ATOM 5566  C C    . PRO B 2 5  ? -4.067  -6.535  -7.060  1.00 15.00 ?  207 PRO B C    7  
ATOM 5567  O O    . PRO B 2 5  ? -5.252  -6.492  -6.722  1.00 15.00 ?  207 PRO B O    7  
ATOM 5568  C CB   . PRO B 2 5  ? -4.360  -7.951  -9.102  1.00 15.00 ?  207 PRO B CB   7  
ATOM 5569  C CG   . PRO B 2 5  ? -4.480  -9.434  -9.278  1.00 15.00 ?  207 PRO B CG   7  
ATOM 5570  C CD   . PRO B 2 5  ? -4.244  -10.069 -7.931  1.00 15.00 ?  207 PRO B CD   7  
ATOM 5571  H HA   . PRO B 2 5  ? -2.496  -7.590  -8.101  1.00 15.00 ?  207 PRO B HA   7  
ATOM 5572  H HB2  . PRO B 2 5  ? -5.328  -7.491  -8.973  1.00 15.00 ?  207 PRO B HB2  7  
ATOM 5573  H HB3  . PRO B 2 5  ? -3.855  -7.499  -9.944  1.00 15.00 ?  207 PRO B HB3  7  
ATOM 5574  H HG2  . PRO B 2 5  ? -5.470  -9.678  -9.630  1.00 15.00 ?  207 PRO B HG2  7  
ATOM 5575  H HG3  . PRO B 2 5  ? -3.739  -9.778  -9.985  1.00 15.00 ?  207 PRO B HG3  7  
ATOM 5576  H HD2  . PRO B 2 5  ? -5.151  -10.454 -7.501  1.00 15.00 ?  207 PRO B HD2  7  
ATOM 5577  H HD3  . PRO B 2 5  ? -3.528  -10.867 -8.003  1.00 15.00 ?  207 PRO B HD3  7  
ATOM 5578  N N    . PRO B 2 6  ? -3.198  -5.557  -6.733  1.00 15.00 ?  208 PRO B N    7  
ATOM 5579  C CA   . PRO B 2 6  ? -3.564  -4.428  -5.884  1.00 15.00 ?  208 PRO B CA   7  
ATOM 5580  C C    . PRO B 2 6  ? -4.288  -3.293  -6.615  1.00 15.00 ?  208 PRO B C    7  
ATOM 5581  O O    . PRO B 2 6  ? -4.276  -3.209  -7.845  1.00 15.00 ?  208 PRO B O    7  
ATOM 5582  C CB   . PRO B 2 6  ? -2.213  -3.931  -5.338  1.00 15.00 ?  208 PRO B CB   7  
ATOM 5583  C CG   . PRO B 2 6  ? -1.160  -4.804  -5.944  1.00 15.00 ?  208 PRO B CG   7  
ATOM 5584  C CD   . PRO B 2 6  ? -1.788  -5.476  -7.128  1.00 15.00 ?  208 PRO B CD   7  
ATOM 5585  H HA   . PRO B 2 6  ? -4.176  -4.754  -5.059  1.00 15.00 ?  208 PRO B HA   7  
ATOM 5586  H HB2  . PRO B 2 6  ? -2.070  -2.896  -5.619  1.00 15.00 ?  208 PRO B HB2  7  
ATOM 5587  H HB3  . PRO B 2 6  ? -2.219  -4.016  -4.255  1.00 15.00 ?  208 PRO B HB3  7  
ATOM 5588  H HG2  . PRO B 2 6  ? -0.322  -4.200  -6.260  1.00 15.00 ?  208 PRO B HG2  7  
ATOM 5589  H HG3  . PRO B 2 6  ? -0.839  -5.541  -5.225  1.00 15.00 ?  208 PRO B HG3  7  
ATOM 5590  H HD2  . PRO B 2 6  ? -1.665  -4.873  -8.018  1.00 15.00 ?  208 PRO B HD2  7  
ATOM 5591  H HD3  . PRO B 2 6  ? -1.358  -6.453  -7.265  1.00 15.00 ?  208 PRO B HD3  7  
ATOM 5592  N N    . PRO B 2 7  ? -4.923  -2.405  -5.821  1.00 15.00 ?  209 PRO B N    7  
ATOM 5593  C CA   . PRO B 2 7  ? -5.612  -1.201  -6.304  1.00 15.00 ?  209 PRO B CA   7  
ATOM 5594  C C    . PRO B 2 7  ? -4.774  -0.372  -7.276  1.00 15.00 ?  209 PRO B C    7  
ATOM 5595  O O    . PRO B 2 7  ? -3.571  -0.206  -7.078  1.00 15.00 ?  209 PRO B O    7  
ATOM 5596  C CB   . PRO B 2 7  ? -5.816  -0.368  -5.030  1.00 15.00 ?  209 PRO B CB   7  
ATOM 5597  C CG   . PRO B 2 7  ? -5.639  -1.284  -3.871  1.00 15.00 ?  209 PRO B CG   7  
ATOM 5598  C CD   . PRO B 2 7  ? -5.062  -2.574  -4.370  1.00 15.00 ?  209 PRO B CD   7  
ATOM 5599  H HA   . PRO B 2 7  ? -6.569  -1.435  -6.743  1.00 15.00 ?  209 PRO B HA   7  
ATOM 5600  H HB2  . PRO B 2 7  ? -5.083  0.424   -5.005  1.00 15.00 ?  209 PRO B HB2  7  
ATOM 5601  H HB3  . PRO B 2 7  ? -6.800  0.063   -5.032  1.00 15.00 ?  209 PRO B HB3  7  
ATOM 5602  H HG2  . PRO B 2 7  ? -4.957  -0.835  -3.165  1.00 15.00 ?  209 PRO B HG2  7  
ATOM 5603  H HG3  . PRO B 2 7  ? -6.596  -1.460  -3.401  1.00 15.00 ?  209 PRO B HG3  7  
ATOM 5604  H HD2  . PRO B 2 7  ? -4.099  -2.748  -3.914  1.00 15.00 ?  209 PRO B HD2  7  
ATOM 5605  H HD3  . PRO B 2 7  ? -5.733  -3.390  -4.144  1.00 15.00 ?  209 PRO B HD3  7  
ATOM 5606  N N    . PRO B 2 8  ? -5.413  0.184   -8.324  1.00 15.00 ?  210 PRO B N    7  
ATOM 5607  C CA   . PRO B 2 8  ? -4.762  1.122   -9.252  1.00 15.00 ?  210 PRO B CA   7  
ATOM 5608  C C    . PRO B 2 8  ? -4.109  2.280   -8.501  1.00 15.00 ?  210 PRO B C    7  
ATOM 5609  O O    . PRO B 2 8  ? -4.648  2.754   -7.494  1.00 15.00 ?  210 PRO B O    7  
ATOM 5610  C CB   . PRO B 2 8  ? -5.925  1.625   -10.113 1.00 15.00 ?  210 PRO B CB   7  
ATOM 5611  C CG   . PRO B 2 8  ? -6.930  0.528   -10.064 1.00 15.00 ?  210 PRO B CG   7  
ATOM 5612  C CD   . PRO B 2 8  ? -6.820  -0.065  -8.689  1.00 15.00 ?  210 PRO B CD   7  
ATOM 5613  H HA   . PRO B 2 8  ? -4.027  0.629   -9.873  1.00 15.00 ?  210 PRO B HA   7  
ATOM 5614  H HB2  . PRO B 2 8  ? -6.315  2.541   -9.695  1.00 15.00 ?  210 PRO B HB2  7  
ATOM 5615  H HB3  . PRO B 2 8  ? -5.583  1.801   -11.122 1.00 15.00 ?  210 PRO B HB3  7  
ATOM 5616  H HG2  . PRO B 2 8  ? -7.919  0.931   -10.223 1.00 15.00 ?  210 PRO B HG2  7  
ATOM 5617  H HG3  . PRO B 2 8  ? -6.700  -0.216  -10.815 1.00 15.00 ?  210 PRO B HG3  7  
ATOM 5618  H HD2  . PRO B 2 8  ? -7.490  0.437   -8.006  1.00 15.00 ?  210 PRO B HD2  7  
ATOM 5619  H HD3  . PRO B 2 8  ? -7.030  -1.123  -8.716  1.00 15.00 ?  210 PRO B HD3  7  
ATOM 5620  N N    . TYR B 2 9  ? -2.970  2.754   -8.997  1.00 15.00 ?  211 TYR B N    7  
ATOM 5621  C CA   . TYR B 2 9  ? -2.169  3.709   -8.247  1.00 15.00 ?  211 TYR B CA   7  
ATOM 5622  C C    . TYR B 2 9  ? -2.835  5.084   -8.150  1.00 15.00 ?  211 TYR B C    7  
ATOM 5623  O O    . TYR B 2 9  ? -2.842  5.862   -9.103  1.00 15.00 ?  211 TYR B O    7  
ATOM 5624  C CB   . TYR B 2 9  ? -0.765  3.864   -8.831  1.00 15.00 ?  211 TYR B CB   7  
ATOM 5625  C CG   . TYR B 2 9  ? 0.115   4.744   -7.970  1.00 15.00 ?  211 TYR B CG   7  
ATOM 5626  C CD1  . TYR B 2 9  ? 0.521   4.310   -6.718  1.00 15.00 ?  211 TYR B CD1  7  
ATOM 5627  C CD2  . TYR B 2 9  ? 0.521   6.008   -8.390  1.00 15.00 ?  211 TYR B CD2  7  
ATOM 5628  C CE1  . TYR B 2 9  ? 1.302   5.104   -5.909  1.00 15.00 ?  211 TYR B CE1  7  
ATOM 5629  C CE2  . TYR B 2 9  ? 1.307   6.808   -7.580  1.00 15.00 ?  211 TYR B CE2  7  
ATOM 5630  C CZ   . TYR B 2 9  ? 1.691   6.348   -6.342  1.00 15.00 ?  211 TYR B CZ   7  
ATOM 5631  O OH   . TYR B 2 9  ? 2.475   7.130   -5.532  1.00 15.00 ?  211 TYR B OH   7  
ATOM 5632  H H    . TYR B 2 9  ? -2.672  2.466   -9.891  1.00 15.00 ?  211 TYR B H    7  
ATOM 5633  H HA   . TYR B 2 9  ? -2.066  3.308   -7.249  1.00 15.00 ?  211 TYR B HA   7  
ATOM 5634  H HB2  . TYR B 2 9  ? -0.299  2.892   -8.900  1.00 15.00 ?  211 TYR B HB2  7  
ATOM 5635  H HB3  . TYR B 2 9  ? -0.828  4.307   -9.813  1.00 15.00 ?  211 TYR B HB3  7  
ATOM 5636  H HD1  . TYR B 2 9  ? 0.214   3.334   -6.375  1.00 15.00 ?  211 TYR B HD1  7  
ATOM 5637  H HD2  . TYR B 2 9  ? 0.224   6.361   -9.365  1.00 15.00 ?  211 TYR B HD2  7  
ATOM 5638  H HE1  . TYR B 2 9  ? 1.607   4.746   -4.936  1.00 15.00 ?  211 TYR B HE1  7  
ATOM 5639  H HE2  . TYR B 2 9  ? 1.613   7.787   -7.915  1.00 15.00 ?  211 TYR B HE2  7  
ATOM 5640  H HH   . TYR B 2 9  ? 3.269   6.629   -5.295  1.00 15.00 ?  211 TYR B HH   7  
ATOM 5641  N N    . SER B 2 10 ? -3.434  5.341   -7.002  1.00 15.00 ?  212 SER B N    7  
ATOM 5642  C CA   . SER B 2 10 ? -3.897  6.658   -6.622  1.00 15.00 ?  212 SER B CA   7  
ATOM 5643  C C    . SER B 2 10 ? -3.106  7.051   -5.383  1.00 15.00 ?  212 SER B C    7  
ATOM 5644  O O    . SER B 2 10 ? -2.702  6.162   -4.631  1.00 15.00 ?  212 SER B O    7  
ATOM 5645  C CB   . SER B 2 10 ? -5.403  6.620   -6.326  1.00 15.00 ?  212 SER B CB   7  
ATOM 5646  O OG   . SER B 2 10 ? -5.918  7.914   -6.054  1.00 15.00 ?  212 SER B OG   7  
ATOM 5647  H H    . SER B 2 10 ? -3.587  4.605   -6.375  1.00 15.00 ?  212 SER B H    7  
ATOM 5648  H HA   . SER B 2 10 ? -3.688  7.349   -7.427  1.00 15.00 ?  212 SER B HA   7  
ATOM 5649  H HB2  . SER B 2 10 ? -5.924  6.214   -7.181  1.00 15.00 ?  212 SER B HB2  7  
ATOM 5650  H HB3  . SER B 2 10 ? -5.580  5.989   -5.468  1.00 15.00 ?  212 SER B HB3  7  
ATOM 5651  H HG   . SER B 2 10 ? -6.105  7.994   -5.109  1.00 15.00 ?  212 SER B HG   7  
ATOM 5652  N N    . ARG B 2 11 ? -2.861  8.342   -5.158  1.00 15.00 ?  213 ARG B N    7  
ATOM 5653  C CA   . ARG B 2 11 ? -2.072  8.739   -3.993  1.00 15.00 ?  213 ARG B CA   7  
ATOM 5654  C C    . ARG B 2 11 ? -2.791  8.236   -2.755  1.00 15.00 ?  213 ARG B C    7  
ATOM 5655  O O    . ARG B 2 11 ? -2.211  7.557   -1.910  1.00 15.00 ?  213 ARG B O    7  
ATOM 5656  C CB   . ARG B 2 11 ? -1.917  10.267  -3.852  1.00 15.00 ?  213 ARG B CB   7  
ATOM 5657  C CG   . ARG B 2 11 ? -1.897  11.061  -5.142  1.00 15.00 ?  213 ARG B CG   7  
ATOM 5658  C CD   . ARG B 2 11 ? -0.693  10.730  -6.003  1.00 15.00 ?  213 ARG B CD   7  
ATOM 5659  N NE   . ARG B 2 11 ? 0.543   11.262  -5.432  1.00 15.00 ?  213 ARG B NE   7  
ATOM 5660  C CZ   . ARG B 2 11 ? 1.650   11.503  -6.136  1.00 15.00 ?  213 ARG B CZ   7  
ATOM 5661  N NH1  . ARG B 2 11 ? 1.671   11.306  -7.449  1.00 15.00 1  213 ARG B NH1  7  
ATOM 5662  N NH2  . ARG B 2 11 ? 2.726   11.984  -5.521  1.00 15.00 ?  213 ARG B NH2  7  
ATOM 5663  H H    . ARG B 2 11 ? -3.221  9.022   -5.772  1.00 15.00 ?  213 ARG B H    7  
ATOM 5664  H HA   . ARG B 2 11 ? -1.097  8.275   -4.061  1.00 15.00 ?  213 ARG B HA   7  
ATOM 5665  H HB2  . ARG B 2 11 ? -2.736  10.634  -3.254  1.00 15.00 ?  213 ARG B HB2  7  
ATOM 5666  H HB3  . ARG B 2 11 ? -0.994  10.466  -3.325  1.00 15.00 ?  213 ARG B HB3  7  
ATOM 5667  H HG2  . ARG B 2 11 ? -2.798  10.857  -5.688  1.00 15.00 ?  213 ARG B HG2  7  
ATOM 5668  H HG3  . ARG B 2 11 ? -1.866  12.112  -4.895  1.00 15.00 ?  213 ARG B HG3  7  
ATOM 5669  H HD2  . ARG B 2 11 ? -0.608  9.658   -6.087  1.00 15.00 ?  213 ARG B HD2  7  
ATOM 5670  H HD3  . ARG B 2 11 ? -0.839  11.159  -6.984  1.00 15.00 ?  213 ARG B HD3  7  
ATOM 5671  H HE   . ARG B 2 11 ? 0.547   11.458  -4.466  1.00 15.00 ?  213 ARG B HE   7  
ATOM 5672  H HH11 . ARG B 2 11 ? 0.848   10.968  -7.927  1.00 15.00 ?  213 ARG B HH11 7  
ATOM 5673  H HH12 . ARG B 2 11 ? 2.504   11.512  -7.977  1.00 15.00 ?  213 ARG B HH12 7  
ATOM 5674  H HH21 . ARG B 2 11 ? 2.704   12.172  -4.536  1.00 15.00 ?  213 ARG B HH21 7  
ATOM 5675  H HH22 . ARG B 2 11 ? 3.579   12.151  -6.041  1.00 15.00 ?  213 ARG B HH22 7  
ATOM 5676  N N    . TYR B 2 12 ? -4.054  8.608   -2.653  1.00 15.00 ?  214 TYR B N    7  
ATOM 5677  C CA   . TYR B 2 12 ? -4.926  8.108   -1.613  1.00 15.00 ?  214 TYR B CA   7  
ATOM 5678  C C    . TYR B 2 12 ? -6.104  7.406   -2.265  1.00 15.00 ?  214 TYR B C    7  
ATOM 5679  O O    . TYR B 2 12 ? -7.070  8.039   -2.687  1.00 15.00 ?  214 TYR B O    7  
ATOM 5680  C CB   . TYR B 2 12 ? -5.376  9.262   -0.705  1.00 15.00 ?  214 TYR B CB   7  
ATOM 5681  C CG   . TYR B 2 12 ? -4.249  10.232  -0.427  1.00 15.00 ?  214 TYR B CG   7  
ATOM 5682  C CD1  . TYR B 2 12 ? -3.901  11.190  -1.371  1.00 15.00 ?  214 TYR B CD1  7  
ATOM 5683  C CD2  . TYR B 2 12 ? -3.505  10.162  0.742   1.00 15.00 ?  214 TYR B CD2  7  
ATOM 5684  C CE1  . TYR B 2 12 ? -2.847  12.050  -1.165  1.00 15.00 ?  214 TYR B CE1  7  
ATOM 5685  C CE2  . TYR B 2 12 ? -2.451  11.027  0.963   1.00 15.00 ?  214 TYR B CE2  7  
ATOM 5686  C CZ   . TYR B 2 12 ? -2.123  11.965  0.008   1.00 15.00 ?  214 TYR B CZ   7  
ATOM 5687  O OH   . TYR B 2 12 ? -1.063  12.817  0.229   1.00 15.00 ?  214 TYR B OH   7  
ATOM 5688  H H    . TYR B 2 12 ? -4.418  9.244   -3.313  1.00 15.00 ?  214 TYR B H    7  
ATOM 5689  H HA   . TYR B 2 12 ? -4.371  7.375   -1.033  1.00 15.00 ?  214 TYR B HA   7  
ATOM 5690  H HB2  . TYR B 2 12 ? -6.178  9.803   -1.187  1.00 15.00 ?  214 TYR B HB2  7  
ATOM 5691  H HB3  . TYR B 2 12 ? -5.722  8.866   0.238   1.00 15.00 ?  214 TYR B HB3  7  
ATOM 5692  H HD1  . TYR B 2 12 ? -4.471  11.252  -2.285  1.00 15.00 ?  214 TYR B HD1  7  
ATOM 5693  H HD2  . TYR B 2 12 ? -3.763  9.426   1.488   1.00 15.00 ?  214 TYR B HD2  7  
ATOM 5694  H HE1  . TYR B 2 12 ? -2.591  12.776  -1.928  1.00 15.00 ?  214 TYR B HE1  7  
ATOM 5695  H HE2  . TYR B 2 12 ? -1.883  10.959  1.877   1.00 15.00 ?  214 TYR B HE2  7  
ATOM 5696  H HH   . TYR B 2 12 ? -0.356  12.331  0.681   1.00 15.00 ?  214 TYR B HH   7  
ATOM 5697  N N    . PRO B 2 13 ? -5.987  6.093   -2.428  1.00 15.00 ?  215 PRO B N    7  
ATOM 5698  C CA   . PRO B 2 13 ? -6.990  5.276   -3.086  1.00 15.00 ?  215 PRO B CA   7  
ATOM 5699  C C    . PRO B 2 13 ? -8.084  4.835   -2.123  1.00 15.00 ?  215 PRO B C    7  
ATOM 5700  O O    . PRO B 2 13 ? -7.804  4.224   -1.097  1.00 15.00 ?  215 PRO B O    7  
ATOM 5701  C CB   . PRO B 2 13 ? -6.185  4.064   -3.585  1.00 15.00 ?  215 PRO B CB   7  
ATOM 5702  C CG   . PRO B 2 13 ? -4.809  4.188   -2.988  1.00 15.00 ?  215 PRO B CG   7  
ATOM 5703  C CD   . PRO B 2 13 ? -4.858  5.290   -1.979  1.00 15.00 ?  215 PRO B CD   7  
ATOM 5704  H HA   . PRO B 2 13 ? -7.434  5.790   -3.927  1.00 15.00 ?  215 PRO B HA   7  
ATOM 5705  H HB2  . PRO B 2 13 ? -6.670  3.156   -3.259  1.00 15.00 ?  215 PRO B HB2  7  
ATOM 5706  H HB3  . PRO B 2 13 ? -6.144  4.081   -4.665  1.00 15.00 ?  215 PRO B HB3  7  
ATOM 5707  H HG2  . PRO B 2 13 ? -4.540  3.265   -2.499  1.00 15.00 ?  215 PRO B HG2  7  
ATOM 5708  H HG3  . PRO B 2 13 ? -4.089  4.422   -3.759  1.00 15.00 ?  215 PRO B HG3  7  
ATOM 5709  H HD2  . PRO B 2 13 ? -5.038  4.890   -0.991  1.00 15.00 ?  215 PRO B HD2  7  
ATOM 5710  H HD3  . PRO B 2 13 ? -3.944  5.863   -1.998  1.00 15.00 ?  215 PRO B HD3  7  
ATOM 5711  N N    . MET B 2 14 ? -9.325  5.160   -2.441  1.00 15.00 ?  216 MET B N    7  
ATOM 5712  C CA   . MET B 2 14 ? -10.446 4.774   -1.598  1.00 15.00 ?  216 MET B CA   7  
ATOM 5713  C C    . MET B 2 14 ? -10.776 3.295   -1.790  1.00 15.00 ?  216 MET B C    7  
ATOM 5714  O O    . MET B 2 14 ? -11.428 2.904   -2.760  1.00 15.00 ?  216 MET B O    7  
ATOM 5715  C CB   . MET B 2 14 ? -11.682 5.655   -1.851  1.00 15.00 ?  216 MET B CB   7  
ATOM 5716  C CG   . MET B 2 14 ? -12.104 5.771   -3.313  1.00 15.00 ?  216 MET B CG   7  
ATOM 5717  S SD   . MET B 2 14 ? -10.967 6.769   -4.303  1.00 15.00 ?  216 MET B SD   7  
ATOM 5718  C CE   . MET B 2 14 ? -11.084 8.352   -3.467  1.00 15.00 ?  216 MET B CE   7  
ATOM 5719  H H    . MET B 2 14 ? -9.493  5.667   -3.265  1.00 15.00 ?  216 MET B H    7  
ATOM 5720  H HA   . MET B 2 14 ? -10.133 4.915   -0.573  1.00 15.00 ?  216 MET B HA   7  
ATOM 5721  H HB2  . MET B 2 14 ? -12.513 5.245   -1.298  1.00 15.00 ?  216 MET B HB2  7  
ATOM 5722  H HB3  . MET B 2 14 ? -11.478 6.649   -1.482  1.00 15.00 ?  216 MET B HB3  7  
ATOM 5723  H HG2  . MET B 2 14 ? -12.152 4.781   -3.739  1.00 15.00 ?  216 MET B HG2  7  
ATOM 5724  H HG3  . MET B 2 14 ? -13.083 6.224   -3.352  1.00 15.00 ?  216 MET B HG3  7  
ATOM 5725  H HE1  . MET B 2 14 ? -10.774 8.239   -2.438  1.00 15.00 ?  216 MET B HE1  7  
ATOM 5726  H HE2  . MET B 2 14 ? -12.105 8.703   -3.500  1.00 15.00 ?  216 MET B HE2  7  
ATOM 5727  H HE3  . MET B 2 14 ? -10.443 9.067   -3.959  1.00 15.00 ?  216 MET B HE3  7  
ATOM 5728  N N    . ASP B 2 15 ? -10.278 2.477   -0.877  1.00 15.00 ?  217 ASP B N    7  
ATOM 5729  C CA   . ASP B 2 15 ? -10.452 1.032   -0.939  1.00 15.00 ?  217 ASP B CA   7  
ATOM 5730  C C    . ASP B 2 15 ? -10.647 0.486   0.463   1.00 15.00 ?  217 ASP B C    7  
ATOM 5731  O O    . ASP B 2 15 ? -10.100 1.097   1.405   1.00 15.00 ?  217 ASP B O    7  
ATOM 5732  C CB   . ASP B 2 15 ? -9.237  0.354   -1.584  1.00 15.00 ?  217 ASP B CB   7  
ATOM 5733  C CG   . ASP B 2 15 ? -9.158  0.563   -3.085  1.00 15.00 ?  217 ASP B CG   7  
ATOM 5734  O OD1  . ASP B 2 15 ? -9.735  -0.258  -3.835  1.00 15.00 ?  217 ASP B OD1  7  
ATOM 5735  O OD2  . ASP B 2 15 ? -8.509  1.538   -3.522  1.00 15.00 -1 217 ASP B OD2  7  
ATOM 5736  O OXT  . ASP B 2 15 ? -11.324 -0.554  0.619   1.00 15.00 ?  217 ASP B OXT  7  
ATOM 5737  H H    . ASP B 2 15 ? -9.776  2.856   -0.126  1.00 15.00 ?  217 ASP B H    7  
ATOM 5738  H HA   . ASP B 2 15 ? -11.334 0.824   -1.525  1.00 15.00 ?  217 ASP B HA   7  
ATOM 5739  H HB2  . ASP B 2 15 ? -8.337  0.753   -1.141  1.00 15.00 ?  217 ASP B HB2  7  
ATOM 5740  H HB3  . ASP B 2 15 ? -9.285  -0.708  -1.391  1.00 15.00 ?  217 ASP B HB3  7  
ATOM 5741  N N    . GLY A 1 1  ? 4.709   2.347   15.206  1.00 15.00 ?  297 GLY A N    8  
ATOM 5742  C CA   . GLY A 1 1  ? 5.703   2.418   14.109  1.00 15.00 ?  297 GLY A CA   8  
ATOM 5743  C C    . GLY A 1 1  ? 5.511   3.653   13.252  1.00 15.00 ?  297 GLY A C    8  
ATOM 5744  O O    . GLY A 1 1  ? 4.453   3.828   12.645  1.00 15.00 ?  297 GLY A O    8  
ATOM 5745  H H1   . GLY A 1 1  ? 3.743   2.310   14.812  1.00 15.00 ?  297 GLY A H1   8  
ATOM 5746  H H2   . GLY A 1 1  ? 4.791   3.190   15.817  1.00 15.00 ?  297 GLY A H2   8  
ATOM 5747  H H3   . GLY A 1 1  ? 4.869   1.494   15.785  1.00 15.00 ?  297 GLY A H3   8  
ATOM 5748  H HA2  . GLY A 1 1  ? 6.696   2.440   14.535  1.00 15.00 ?  297 GLY A HA2  8  
ATOM 5749  H HA3  . GLY A 1 1  ? 5.607   1.540   13.489  1.00 15.00 ?  297 GLY A HA3  8  
ATOM 5750  N N    . PRO A 1 2  ? 6.518   4.541   13.195  1.00 15.00 ?  298 PRO A N    8  
ATOM 5751  C CA   . PRO A 1 2  ? 6.446   5.772   12.402  1.00 15.00 ?  298 PRO A CA   8  
ATOM 5752  C C    . PRO A 1 2  ? 6.398   5.489   10.890  1.00 15.00 ?  298 PRO A C    8  
ATOM 5753  O O    . PRO A 1 2  ? 7.250   4.762   10.370  1.00 15.00 ?  298 PRO A O    8  
ATOM 5754  C CB   . PRO A 1 2  ? 7.745   6.514   12.755  1.00 15.00 ?  298 PRO A CB   8  
ATOM 5755  C CG   . PRO A 1 2  ? 8.262   5.849   13.985  1.00 15.00 ?  298 PRO A CG   8  
ATOM 5756  C CD   . PRO A 1 2  ? 7.801   4.425   13.904  1.00 15.00 ?  298 PRO A CD   8  
ATOM 5757  H HA   . PRO A 1 2  ? 5.600   6.372   12.700  1.00 15.00 ?  298 PRO A HA   8  
ATOM 5758  H HB2  . PRO A 1 2  ? 8.446   6.426   11.937  1.00 15.00 ?  298 PRO A HB2  8  
ATOM 5759  H HB3  . PRO A 1 2  ? 7.526   7.556   12.934  1.00 15.00 ?  298 PRO A HB3  8  
ATOM 5760  H HG2  . PRO A 1 2  ? 9.340   5.895   14.001  1.00 15.00 ?  298 PRO A HG2  8  
ATOM 5761  H HG3  . PRO A 1 2  ? 7.850   6.326   14.862  1.00 15.00 ?  298 PRO A HG3  8  
ATOM 5762  H HD2  . PRO A 1 2  ? 8.506   3.829   13.340  1.00 15.00 ?  298 PRO A HD2  8  
ATOM 5763  H HD3  . PRO A 1 2  ? 7.660   4.014   14.892  1.00 15.00 ?  298 PRO A HD3  8  
ATOM 5764  N N    . LEU A 1 3  ? 5.409   6.046   10.185  1.00 15.00 ?  299 LEU A N    8  
ATOM 5765  C CA   . LEU A 1 3  ? 5.328   5.911   8.738   1.00 15.00 ?  299 LEU A CA   8  
ATOM 5766  C C    . LEU A 1 3  ? 6.383   6.794   8.079   1.00 15.00 ?  299 LEU A C    8  
ATOM 5767  O O    . LEU A 1 3  ? 6.498   7.975   8.416   1.00 15.00 ?  299 LEU A O    8  
ATOM 5768  C CB   . LEU A 1 3  ? 3.935   6.328   8.257   1.00 15.00 ?  299 LEU A CB   8  
ATOM 5769  C CG   . LEU A 1 3  ? 3.709   6.241   6.746   1.00 15.00 ?  299 LEU A CG   8  
ATOM 5770  C CD1  . LEU A 1 3  ? 3.553   4.793   6.305   1.00 15.00 ?  299 LEU A CD1  8  
ATOM 5771  C CD2  . LEU A 1 3  ? 2.494   7.062   6.341   1.00 15.00 ?  299 LEU A CD2  8  
ATOM 5772  H H    . LEU A 1 3  ? 4.714   6.567   10.646  1.00 15.00 ?  299 LEU A H    8  
ATOM 5773  H HA   . LEU A 1 3  ? 5.508   4.879   8.480   1.00 15.00 ?  299 LEU A HA   8  
ATOM 5774  H HB2  . LEU A 1 3  ? 3.206   5.699   8.746   1.00 15.00 ?  299 LEU A HB2  8  
ATOM 5775  H HB3  . LEU A 1 3  ? 3.766   7.349   8.564   1.00 15.00 ?  299 LEU A HB3  8  
ATOM 5776  H HG   . LEU A 1 3  ? 4.570   6.649   6.239   1.00 15.00 ?  299 LEU A HG   8  
ATOM 5777  H HD11 . LEU A 1 3  ? 2.708   4.349   6.812   1.00 15.00 ?  299 LEU A HD11 8  
ATOM 5778  H HD12 . LEU A 1 3  ? 4.449   4.243   6.553   1.00 15.00 ?  299 LEU A HD12 8  
ATOM 5779  H HD13 . LEU A 1 3  ? 3.393   4.757   5.237   1.00 15.00 ?  299 LEU A HD13 8  
ATOM 5780  H HD21 . LEU A 1 3  ? 2.653   8.096   6.611   1.00 15.00 ?  299 LEU A HD21 8  
ATOM 5781  H HD22 . LEU A 1 3  ? 1.620   6.687   6.852   1.00 15.00 ?  299 LEU A HD22 8  
ATOM 5782  H HD23 . LEU A 1 3  ? 2.348   6.986   5.275   1.00 15.00 ?  299 LEU A HD23 8  
ATOM 5783  N N    . PRO A 1 4  ? 7.161   6.256   7.129   1.00 15.00 ?  300 PRO A N    8  
ATOM 5784  C CA   . PRO A 1 4  ? 8.192   7.032   6.433   1.00 15.00 ?  300 PRO A CA   8  
ATOM 5785  C C    . PRO A 1 4  ? 7.569   8.111   5.542   1.00 15.00 ?  300 PRO A C    8  
ATOM 5786  O O    . PRO A 1 4  ? 6.588   7.854   4.845   1.00 15.00 ?  300 PRO A O    8  
ATOM 5787  C CB   . PRO A 1 4  ? 8.931   5.985   5.588   1.00 15.00 ?  300 PRO A CB   8  
ATOM 5788  C CG   . PRO A 1 4  ? 8.487   4.658   6.113   1.00 15.00 ?  300 PRO A CG   8  
ATOM 5789  C CD   . PRO A 1 4  ? 7.097   4.871   6.630   1.00 15.00 ?  300 PRO A CD   8  
ATOM 5790  H HA   . PRO A 1 4  ? 8.878   7.494   7.128   1.00 15.00 ?  300 PRO A HA   8  
ATOM 5791  H HB2  . PRO A 1 4  ? 8.658   6.109   4.555   1.00 15.00 ?  300 PRO A HB2  8  
ATOM 5792  H HB3  . PRO A 1 4  ? 9.996   6.117   5.701   1.00 15.00 ?  300 PRO A HB3  8  
ATOM 5793  H HG2  . PRO A 1 4  ? 8.484   3.927   5.318   1.00 15.00 ?  300 PRO A HG2  8  
ATOM 5794  H HG3  . PRO A 1 4  ? 9.140   4.342   6.914   1.00 15.00 ?  300 PRO A HG3  8  
ATOM 5795  H HD2  . PRO A 1 4  ? 6.381   4.781   5.824   1.00 15.00 ?  300 PRO A HD2  8  
ATOM 5796  H HD3  . PRO A 1 4  ? 6.869   4.169   7.420   1.00 15.00 ?  300 PRO A HD3  8  
ATOM 5797  N N    . PRO A 1 5  ? 8.144   9.328   5.538   1.00 15.00 ?  301 PRO A N    8  
ATOM 5798  C CA   . PRO A 1 5  ? 7.565   10.494  4.844   1.00 15.00 ?  301 PRO A CA   8  
ATOM 5799  C C    . PRO A 1 5  ? 7.456   10.327  3.325   1.00 15.00 ?  301 PRO A C    8  
ATOM 5800  O O    . PRO A 1 5  ? 6.748   11.082  2.663   1.00 15.00 ?  301 PRO A O    8  
ATOM 5801  C CB   . PRO A 1 5  ? 8.528   11.639  5.184   1.00 15.00 ?  301 PRO A CB   8  
ATOM 5802  C CG   . PRO A 1 5  ? 9.296   11.165  6.370   1.00 15.00 ?  301 PRO A CG   8  
ATOM 5803  C CD   . PRO A 1 5  ? 9.398   9.675   6.223   1.00 15.00 ?  301 PRO A CD   8  
ATOM 5804  H HA   . PRO A 1 5  ? 6.588   10.726  5.237   1.00 15.00 ?  301 PRO A HA   8  
ATOM 5805  H HB2  . PRO A 1 5  ? 9.178   11.825  4.342   1.00 15.00 ?  301 PRO A HB2  8  
ATOM 5806  H HB3  . PRO A 1 5  ? 7.962   12.531  5.411   1.00 15.00 ?  301 PRO A HB3  8  
ATOM 5807  H HG2  . PRO A 1 5  ? 10.279  11.610  6.373   1.00 15.00 ?  301 PRO A HG2  8  
ATOM 5808  H HG3  . PRO A 1 5  ? 8.766   11.416  7.277   1.00 15.00 ?  301 PRO A HG3  8  
ATOM 5809  H HD2  . PRO A 1 5  ? 10.257  9.412   5.622   1.00 15.00 ?  301 PRO A HD2  8  
ATOM 5810  H HD3  . PRO A 1 5  ? 9.453   9.200   7.193   1.00 15.00 ?  301 PRO A HD3  8  
ATOM 5811  N N    . GLY A 1 6  ? 8.184   9.371   2.776   1.00 15.00 ?  302 GLY A N    8  
ATOM 5812  C CA   . GLY A 1 6  ? 8.112   9.109   1.350   1.00 15.00 ?  302 GLY A CA   8  
ATOM 5813  C C    . GLY A 1 6  ? 7.060   8.072   1.015   1.00 15.00 ?  302 GLY A C    8  
ATOM 5814  O O    . GLY A 1 6  ? 6.666   7.918   -0.143  1.00 15.00 ?  302 GLY A O    8  
ATOM 5815  H H    . GLY A 1 6  ? 8.790   8.843   3.340   1.00 15.00 ?  302 GLY A H    8  
ATOM 5816  H HA2  . GLY A 1 6  ? 7.872   10.030  0.839   1.00 15.00 ?  302 GLY A HA2  8  
ATOM 5817  H HA3  . GLY A 1 6  ? 9.073   8.758   1.009   1.00 15.00 ?  302 GLY A HA3  8  
ATOM 5818  N N    . TRP A 1 7  ? 6.614   7.363   2.039   1.00 15.00 ?  303 TRP A N    8  
ATOM 5819  C CA   . TRP A 1 7  ? 5.687   6.256   1.879   1.00 15.00 ?  303 TRP A CA   8  
ATOM 5820  C C    . TRP A 1 7  ? 4.244   6.701   2.030   1.00 15.00 ?  303 TRP A C    8  
ATOM 5821  O O    . TRP A 1 7  ? 3.951   7.629   2.785   1.00 15.00 ?  303 TRP A O    8  
ATOM 5822  C CB   . TRP A 1 7  ? 5.973   5.190   2.917   1.00 15.00 ?  303 TRP A CB   8  
ATOM 5823  C CG   . TRP A 1 7  ? 7.012   4.222   2.490   1.00 15.00 ?  303 TRP A CG   8  
ATOM 5824  C CD1  . TRP A 1 7  ? 8.364   4.398   2.499   1.00 15.00 ?  303 TRP A CD1  8  
ATOM 5825  C CD2  . TRP A 1 7  ? 6.778   2.912   1.983   1.00 15.00 ?  303 TRP A CD2  8  
ATOM 5826  N NE1  . TRP A 1 7  ? 8.982   3.264   2.057   1.00 15.00 ?  303 TRP A NE1  8  
ATOM 5827  C CE2  . TRP A 1 7  ? 8.028   2.343   1.731   1.00 15.00 ?  303 TRP A CE2  8  
ATOM 5828  C CE3  . TRP A 1 7  ? 5.635   2.154   1.724   1.00 15.00 ?  303 TRP A CE3  8  
ATOM 5829  C CZ2  . TRP A 1 7  ? 8.163   1.064   1.240   1.00 15.00 ?  303 TRP A CZ2  8  
ATOM 5830  C CZ3  . TRP A 1 7  ? 5.782   0.881   1.234   1.00 15.00 ?  303 TRP A CZ3  8  
ATOM 5831  C CH2  . TRP A 1 7  ? 7.037   0.347   0.998   1.00 15.00 ?  303 TRP A CH2  8  
ATOM 5832  H H    . TRP A 1 7  ? 6.897   7.610   2.945   1.00 15.00 ?  303 TRP A H    8  
ATOM 5833  H HA   . TRP A 1 7  ? 5.841   5.839   0.896   1.00 15.00 ?  303 TRP A HA   8  
ATOM 5834  H HB2  . TRP A 1 7  ? 6.314   5.662   3.825   1.00 15.00 ?  303 TRP A HB2  8  
ATOM 5835  H HB3  . TRP A 1 7  ? 5.067   4.639   3.120   1.00 15.00 ?  303 TRP A HB3  8  
ATOM 5836  H HD1  . TRP A 1 7  ? 8.861   5.297   2.820   1.00 15.00 ?  303 TRP A HD1  8  
ATOM 5837  H HE1  . TRP A 1 7  ? 9.956   3.131   1.984   1.00 15.00 ?  303 TRP A HE1  8  
ATOM 5838  H HE3  . TRP A 1 7  ? 4.646   2.545   1.889   1.00 15.00 ?  303 TRP A HE3  8  
ATOM 5839  H HZ2  . TRP A 1 7  ? 9.113   0.648   1.045   1.00 15.00 ?  303 TRP A HZ2  8  
ATOM 5840  H HZ3  . TRP A 1 7  ? 4.911   0.286   1.019   1.00 15.00 ?  303 TRP A HZ3  8  
ATOM 5841  H HH2  . TRP A 1 7  ? 7.106   -0.656  0.626   1.00 15.00 ?  303 TRP A HH2  8  
ATOM 5842  N N    . GLU A 1 8  ? 3.339   6.011   1.342   1.00 15.00 ?  304 GLU A N    8  
ATOM 5843  C CA   . GLU A 1 8  ? 1.910   6.324   1.444   1.00 15.00 ?  304 GLU A CA   8  
ATOM 5844  C C    . GLU A 1 8  ? 1.135   5.057   1.801   1.00 15.00 ?  304 GLU A C    8  
ATOM 5845  O O    . GLU A 1 8  ? 1.391   4.001   1.242   1.00 15.00 ?  304 GLU A O    8  
ATOM 5846  C CB   . GLU A 1 8  ? 1.422   6.933   0.125   1.00 15.00 ?  304 GLU A CB   8  
ATOM 5847  C CG   . GLU A 1 8  ? 2.066   8.274   -0.189  1.00 15.00 ?  304 GLU A CG   8  
ATOM 5848  C CD   . GLU A 1 8  ? 1.420   9.441   0.538   1.00 15.00 ?  304 GLU A CD   8  
ATOM 5849  O OE1  . GLU A 1 8  ? 1.526   9.520   1.775   1.00 15.00 -1 304 GLU A OE1  8  
ATOM 5850  O OE2  . GLU A 1 8  ? 0.809   10.296  -0.145  1.00 15.00 ?  304 GLU A OE2  8  
ATOM 5851  H H    . GLU A 1 8  ? 3.636   5.249   0.759   1.00 15.00 ?  304 GLU A H    8  
ATOM 5852  H HA   . GLU A 1 8  ? 1.785   7.046   2.237   1.00 15.00 ?  304 GLU A HA   8  
ATOM 5853  H HB2  . GLU A 1 8  ? 1.655   6.253   -0.681  1.00 15.00 ?  304 GLU A HB2  8  
ATOM 5854  H HB3  . GLU A 1 8  ? 0.355   7.073   0.164   1.00 15.00 ?  304 GLU A HB3  8  
ATOM 5855  H HG2  . GLU A 1 8  ? 3.107   8.232   0.096   1.00 15.00 ?  304 GLU A HG2  8  
ATOM 5856  H HG3  . GLU A 1 8  ? 1.996   8.452   -1.253  1.00 15.00 ?  304 GLU A HG3  8  
ATOM 5857  N N    . ILE A 1 9  ? 0.190   5.151   2.729   1.00 15.00 ?  305 ILE A N    8  
ATOM 5858  C CA   . ILE A 1 9  ? -0.453  3.951   3.265   1.00 15.00 ?  305 ILE A CA   8  
ATOM 5859  C C    . ILE A 1 9  ? -1.982  4.035   3.263   1.00 15.00 ?  305 ILE A C    8  
ATOM 5860  O O    . ILE A 1 9  ? -2.561  5.044   3.669   1.00 15.00 ?  305 ILE A O    8  
ATOM 5861  C CB   . ILE A 1 9  ? 0.025   3.662   4.711   1.00 15.00 ?  305 ILE A CB   8  
ATOM 5862  C CG1  . ILE A 1 9  ? -0.690  2.430   5.282   1.00 15.00 ?  305 ILE A CG1  8  
ATOM 5863  C CG2  . ILE A 1 9  ? -0.200  4.874   5.608   1.00 15.00 ?  305 ILE A CG2  8  
ATOM 5864  C CD1  . ILE A 1 9  ? -0.330  2.126   6.723   1.00 15.00 ?  305 ILE A CD1  8  
ATOM 5865  H H    . ILE A 1 9  ? -0.086  6.034   3.052   1.00 15.00 ?  305 ILE A H    8  
ATOM 5866  H HA   . ILE A 1 9  ? -0.151  3.120   2.646   1.00 15.00 ?  305 ILE A HA   8  
ATOM 5867  H HB   . ILE A 1 9  ? 1.086   3.466   4.679   1.00 15.00 ?  305 ILE A HB   8  
ATOM 5868  H HG12 . ILE A 1 9  ? -1.756  2.588   5.235   1.00 15.00 ?  305 ILE A HG12 8  
ATOM 5869  H HG13 . ILE A 1 9  ? -0.434  1.565   4.686   1.00 15.00 ?  305 ILE A HG13 8  
ATOM 5870  H HG21 . ILE A 1 9  ? -1.254  5.112   5.637   1.00 15.00 ?  305 ILE A HG21 8  
ATOM 5871  H HG22 . ILE A 1 9  ? 0.348   5.719   5.218   1.00 15.00 ?  305 ILE A HG22 8  
ATOM 5872  H HG23 . ILE A 1 9  ? 0.146   4.650   6.606   1.00 15.00 ?  305 ILE A HG23 8  
ATOM 5873  H HD11 . ILE A 1 9  ? 0.730   1.933   6.794   1.00 15.00 ?  305 ILE A HD11 8  
ATOM 5874  H HD12 . ILE A 1 9  ? -0.877  1.257   7.056   1.00 15.00 ?  305 ILE A HD12 8  
ATOM 5875  H HD13 . ILE A 1 9  ? -0.586  2.972   7.344   1.00 15.00 ?  305 ILE A HD13 8  
ATOM 5876  N N    . ARG A 1 10 ? -2.628  2.967   2.792   1.00 15.00 ?  306 ARG A N    8  
ATOM 5877  C CA   . ARG A 1 10 ? -4.059  2.765   3.002   1.00 15.00 ?  306 ARG A CA   8  
ATOM 5878  C C    . ARG A 1 10 ? -4.352  1.280   3.183   1.00 15.00 ?  306 ARG A C    8  
ATOM 5879  O O    . ARG A 1 10 ? -3.665  0.431   2.616   1.00 15.00 ?  306 ARG A O    8  
ATOM 5880  C CB   . ARG A 1 10 ? -4.916  3.304   1.852   1.00 15.00 ?  306 ARG A CB   8  
ATOM 5881  C CG   . ARG A 1 10 ? -5.017  4.817   1.792   1.00 15.00 ?  306 ARG A CG   8  
ATOM 5882  C CD   . ARG A 1 10 ? -6.350  5.245   1.199   1.00 15.00 ?  306 ARG A CD   8  
ATOM 5883  N NE   . ARG A 1 10 ? -7.450  5.035   2.150   1.00 15.00 ?  306 ARG A NE   8  
ATOM 5884  C CZ   . ARG A 1 10 ? -8.404  4.105   2.023   1.00 15.00 ?  306 ARG A CZ   8  
ATOM 5885  N NH1  . ARG A 1 10 ? -8.432  3.308   0.964   1.00 15.00 1  306 ARG A NH1  8  
ATOM 5886  N NH2  . ARG A 1 10 ? -9.347  3.981   2.949   1.00 15.00 ?  306 ARG A NH2  8  
ATOM 5887  H H    . ARG A 1 10 ? -2.127  2.284   2.290   1.00 15.00 ?  306 ARG A H    8  
ATOM 5888  H HA   . ARG A 1 10 ? -4.330  3.281   3.912   1.00 15.00 ?  306 ARG A HA   8  
ATOM 5889  H HB2  . ARG A 1 10 ? -4.498  2.961   0.918   1.00 15.00 ?  306 ARG A HB2  8  
ATOM 5890  H HB3  . ARG A 1 10 ? -5.915  2.906   1.952   1.00 15.00 ?  306 ARG A HB3  8  
ATOM 5891  H HG2  . ARG A 1 10 ? -4.930  5.218   2.792   1.00 15.00 ?  306 ARG A HG2  8  
ATOM 5892  H HG3  . ARG A 1 10 ? -4.217  5.202   1.175   1.00 15.00 ?  306 ARG A HG3  8  
ATOM 5893  H HD2  . ARG A 1 10 ? -6.298  6.292   0.945   1.00 15.00 ?  306 ARG A HD2  8  
ATOM 5894  H HD3  . ARG A 1 10 ? -6.540  4.663   0.309   1.00 15.00 ?  306 ARG A HD3  8  
ATOM 5895  H HE   . ARG A 1 10 ? -7.472  5.630   2.945   1.00 15.00 ?  306 ARG A HE   8  
ATOM 5896  H HH11 . ARG A 1 10 ? -7.739  3.404   0.236   1.00 15.00 ?  306 ARG A HH11 8  
ATOM 5897  H HH12 . ARG A 1 10 ? -9.143  2.602   0.882   1.00 15.00 ?  306 ARG A HH12 8  
ATOM 5898  H HH21 . ARG A 1 10 ? -9.354  4.587   3.751   1.00 15.00 ?  306 ARG A HH21 8  
ATOM 5899  H HH22 . ARG A 1 10 ? -10.062 3.272   2.853   1.00 15.00 ?  306 ARG A HH22 8  
ATOM 5900  N N    . ASN A 1 11 ? -5.378  0.978   3.961   1.00 15.00 ?  307 ASN A N    8  
ATOM 5901  C CA   . ASN A 1 11 ? -5.787  -0.401  4.207   1.00 15.00 ?  307 ASN A CA   8  
ATOM 5902  C C    . ASN A 1 11 ? -7.046  -0.721  3.390   1.00 15.00 ?  307 ASN A C    8  
ATOM 5903  O O    . ASN A 1 11 ? -8.002  0.055   3.412   1.00 15.00 ?  307 ASN A O    8  
ATOM 5904  C CB   . ASN A 1 11 ? -6.073  -0.577  5.703   1.00 15.00 ?  307 ASN A CB   8  
ATOM 5905  C CG   . ASN A 1 11 ? -6.227  -2.025  6.139   1.00 15.00 ?  307 ASN A CG   8  
ATOM 5906  O OD1  . ASN A 1 11 ? -6.642  -2.891  5.372   1.00 15.00 ?  307 ASN A OD1  8  
ATOM 5907  N ND2  . ASN A 1 11 ? -5.897  -2.294  7.393   1.00 15.00 ?  307 ASN A ND2  8  
ATOM 5908  H H    . ASN A 1 11 ? -5.879  1.706   4.392   1.00 15.00 ?  307 ASN A H    8  
ATOM 5909  H HA   . ASN A 1 11 ? -4.979  -1.052  3.915   1.00 15.00 ?  307 ASN A HA   8  
ATOM 5910  H HB2  . ASN A 1 11 ? -5.261  -0.145  6.268   1.00 15.00 ?  307 ASN A HB2  8  
ATOM 5911  H HB3  . ASN A 1 11 ? -6.986  -0.054  5.948   1.00 15.00 ?  307 ASN A HB3  8  
ATOM 5912  H HD21 . ASN A 1 11 ? -5.581  -1.557  7.955   1.00 15.00 ?  307 ASN A HD21 8  
ATOM 5913  H HD22 . ASN A 1 11 ? -5.989  -3.216  7.707   1.00 15.00 ?  307 ASN A HD22 8  
ATOM 5914  N N    . THR A 1 12 ? -7.057  -1.845  2.672   1.00 15.00 ?  308 THR A N    8  
ATOM 5915  C CA   . THR A 1 12 ? -8.241  -2.243  1.917   1.00 15.00 ?  308 THR A CA   8  
ATOM 5916  C C    . THR A 1 12 ? -9.158  -3.109  2.773   1.00 15.00 ?  308 THR A C    8  
ATOM 5917  O O    . THR A 1 12 ? -8.686  -3.964  3.537   1.00 15.00 ?  308 THR A O    8  
ATOM 5918  C CB   . THR A 1 12 ? -7.887  -3.019  0.626   1.00 15.00 ?  308 THR A CB   8  
ATOM 5919  O OG1  . THR A 1 12 ? -6.495  -3.358  0.612   1.00 15.00 ?  308 THR A OG1  8  
ATOM 5920  C CG2  . THR A 1 12 ? -8.238  -2.212  -0.621  1.00 15.00 ?  308 THR A CG2  8  
ATOM 5921  H H    . THR A 1 12 ? -6.267  -2.427  2.663   1.00 15.00 ?  308 THR A H    8  
ATOM 5922  H HA   . THR A 1 12 ? -8.772  -1.344  1.638   1.00 15.00 ?  308 THR A HA   8  
ATOM 5923  H HB   . THR A 1 12 ? -8.464  -3.931  0.614   1.00 15.00 ?  308 THR A HB   8  
ATOM 5924  H HG1  . THR A 1 12 ? -6.238  -3.710  1.474   1.00 15.00 ?  308 THR A HG1  8  
ATOM 5925  H HG21 . THR A 1 12 ? -9.299  -2.021  -0.637  1.00 15.00 ?  308 THR A HG21 8  
ATOM 5926  H HG22 . THR A 1 12 ? -7.959  -2.771  -1.504  1.00 15.00 ?  308 THR A HG22 8  
ATOM 5927  H HG23 . THR A 1 12 ? -7.704  -1.274  -0.611  1.00 15.00 ?  308 THR A HG23 8  
ATOM 5928  N N    . ALA A 1 13 ? -10.463 -2.903  2.612   1.00 15.00 ?  309 ALA A N    8  
ATOM 5929  C CA   . ALA A 1 13 ? -11.485 -3.608  3.388   1.00 15.00 ?  309 ALA A CA   8  
ATOM 5930  C C    . ALA A 1 13 ? -11.411 -5.122  3.193   1.00 15.00 ?  309 ALA A C    8  
ATOM 5931  O O    . ALA A 1 13 ? -11.999 -5.883  3.960   1.00 15.00 ?  309 ALA A O    8  
ATOM 5932  C CB   . ALA A 1 13 ? -12.869 -3.097  3.021   1.00 15.00 ?  309 ALA A CB   8  
ATOM 5933  H H    . ALA A 1 13 ? -10.757 -2.234  1.939   1.00 15.00 ?  309 ALA A H    8  
ATOM 5934  H HA   . ALA A 1 13 ? -11.316 -3.386  4.432   1.00 15.00 ?  309 ALA A HA   8  
ATOM 5935  H HB1  . ALA A 1 13 ? -13.073 -3.325  1.985   1.00 15.00 ?  309 ALA A HB1  8  
ATOM 5936  H HB2  . ALA A 1 13 ? -12.909 -2.028  3.169   1.00 15.00 ?  309 ALA A HB2  8  
ATOM 5937  H HB3  . ALA A 1 13 ? -13.607 -3.575  3.647   1.00 15.00 ?  309 ALA A HB3  8  
ATOM 5938  N N    . THR A 1 14 ? -10.690 -5.546  2.161   1.00 15.00 ?  310 THR A N    8  
ATOM 5939  C CA   . THR A 1 14 ? -10.458 -6.963  1.909   1.00 15.00 ?  310 THR A CA   8  
ATOM 5940  C C    . THR A 1 14 ? -9.648  -7.598  3.041   1.00 15.00 ?  310 THR A C    8  
ATOM 5941  O O    . THR A 1 14 ? -9.582  -8.821  3.165   1.00 15.00 ?  310 THR A O    8  
ATOM 5942  C CB   . THR A 1 14 ? -9.711  -7.157  0.575   1.00 15.00 ?  310 THR A CB   8  
ATOM 5943  O OG1  . THR A 1 14 ? -8.592  -6.260  0.506   1.00 15.00 ?  310 THR A OG1  8  
ATOM 5944  C CG2  . THR A 1 14 ? -10.635 -6.911  -0.608  1.00 15.00 ?  310 THR A CG2  8  
ATOM 5945  H H    . THR A 1 14 ? -10.299 -4.888  1.555   1.00 15.00 ?  310 THR A H    8  
ATOM 5946  H HA   . THR A 1 14 ? -11.414 -7.454  1.839   1.00 15.00 ?  310 THR A HA   8  
ATOM 5947  H HB   . THR A 1 14 ? -9.351  -8.174  0.527   1.00 15.00 ?  310 THR A HB   8  
ATOM 5948  H HG1  . THR A 1 14 ? -8.390  -6.071  -0.415  1.00 15.00 ?  310 THR A HG1  8  
ATOM 5949  H HG21 . THR A 1 14 ? -11.016 -5.900  -0.564  1.00 15.00 ?  310 THR A HG21 8  
ATOM 5950  H HG22 . THR A 1 14 ? -11.460 -7.608  -0.572  1.00 15.00 ?  310 THR A HG22 8  
ATOM 5951  H HG23 . THR A 1 14 ? -10.087 -7.047  -1.527  1.00 15.00 ?  310 THR A HG23 8  
ATOM 5952  N N    . GLY A 1 15 ? -9.046  -6.755  3.873   1.00 15.00 ?  311 GLY A N    8  
ATOM 5953  C CA   . GLY A 1 15 ? -8.241  -7.240  4.974   1.00 15.00 ?  311 GLY A CA   8  
ATOM 5954  C C    . GLY A 1 15 ? -6.770  -7.332  4.625   1.00 15.00 ?  311 GLY A C    8  
ATOM 5955  O O    . GLY A 1 15 ? -6.064  -8.205  5.126   1.00 15.00 ?  311 GLY A O    8  
ATOM 5956  H H    . GLY A 1 15 ? -9.169  -5.787  3.742   1.00 15.00 ?  311 GLY A H    8  
ATOM 5957  H HA2  . GLY A 1 15 ? -8.361  -6.572  5.815   1.00 15.00 ?  311 GLY A HA2  8  
ATOM 5958  H HA3  . GLY A 1 15 ? -8.595  -8.222  5.257   1.00 15.00 ?  311 GLY A HA3  8  
ATOM 5959  N N    . ARG A 1 16 ? -6.302  -6.434  3.767   1.00 15.00 ?  312 ARG A N    8  
ATOM 5960  C CA   . ARG A 1 16 ? -4.903  -6.426  3.356   1.00 15.00 ?  312 ARG A CA   8  
ATOM 5961  C C    . ARG A 1 16 ? -4.441  -4.988  3.189   1.00 15.00 ?  312 ARG A C    8  
ATOM 5962  O O    . ARG A 1 16 ? -5.242  -4.122  2.823   1.00 15.00 ?  312 ARG A O    8  
ATOM 5963  C CB   . ARG A 1 16 ? -4.692  -7.168  2.030   1.00 15.00 ?  312 ARG A CB   8  
ATOM 5964  C CG   . ARG A 1 16 ? -5.525  -8.422  1.839   1.00 15.00 ?  312 ARG A CG   8  
ATOM 5965  C CD   . ARG A 1 16 ? -5.028  -9.194  0.632   1.00 15.00 ?  312 ARG A CD   8  
ATOM 5966  N NE   . ARG A 1 16 ? -6.009  -10.141 0.112   1.00 15.00 ?  312 ARG A NE   8  
ATOM 5967  C CZ   . ARG A 1 16 ? -6.032  -10.545 -1.156  1.00 15.00 ?  312 ARG A CZ   8  
ATOM 5968  N NH1  . ARG A 1 16 ? -5.180  -10.026 -2.031  1.00 15.00 1  312 ARG A NH1  8  
ATOM 5969  N NH2  . ARG A 1 16 ? -6.915  -11.448 -1.560  1.00 15.00 ?  312 ARG A NH2  8  
ATOM 5970  H H    . ARG A 1 16 ? -6.902  -5.736  3.420   1.00 15.00 ?  312 ARG A H    8  
ATOM 5971  H HA   . ARG A 1 16 ? -4.321  -6.900  4.130   1.00 15.00 ?  312 ARG A HA   8  
ATOM 5972  H HB2  . ARG A 1 16 ? -4.916  -6.493  1.215   1.00 15.00 ?  312 ARG A HB2  8  
ATOM 5973  H HB3  . ARG A 1 16 ? -3.651  -7.448  1.964   1.00 15.00 ?  312 ARG A HB3  8  
ATOM 5974  H HG2  . ARG A 1 16 ? -5.439  -9.043  2.720   1.00 15.00 ?  312 ARG A HG2  8  
ATOM 5975  H HG3  . ARG A 1 16 ? -6.557  -8.145  1.683   1.00 15.00 ?  312 ARG A HG3  8  
ATOM 5976  H HD2  . ARG A 1 16 ? -4.773  -8.492  -0.148  1.00 15.00 ?  312 ARG A HD2  8  
ATOM 5977  H HD3  . ARG A 1 16 ? -4.144  -9.738  0.925   1.00 15.00 ?  312 ARG A HD3  8  
ATOM 5978  H HE   . ARG A 1 16 ? -6.676  -10.514 0.750   1.00 15.00 ?  312 ARG A HE   8  
ATOM 5979  H HH11 . ARG A 1 16 ? -4.524  -9.329  -1.742  1.00 15.00 ?  312 ARG A HH11 8  
ATOM 5980  H HH12 . ARG A 1 16 ? -5.178  -10.350 -2.986  1.00 15.00 ?  312 ARG A HH12 8  
ATOM 5981  H HH21 . ARG A 1 16 ? -7.580  -11.838 -0.908  1.00 15.00 ?  312 ARG A HH21 8  
ATOM 5982  H HH22 . ARG A 1 16 ? -6.921  -11.755 -2.515  1.00 15.00 ?  312 ARG A HH22 8  
ATOM 5983  N N    . VAL A 1 17 ? -3.164  -4.729  3.420   1.00 15.00 ?  313 VAL A N    8  
ATOM 5984  C CA   . VAL A 1 17 ? -2.659  -3.375  3.328   1.00 15.00 ?  313 VAL A CA   8  
ATOM 5985  C C    . VAL A 1 17 ? -1.713  -3.212  2.126   1.00 15.00 ?  313 VAL A C    8  
ATOM 5986  O O    . VAL A 1 17 ? -0.918  -4.087  1.814   1.00 15.00 ?  313 VAL A O    8  
ATOM 5987  C CB   . VAL A 1 17 ? -1.948  -2.947  4.631   1.00 15.00 ?  313 VAL A CB   8  
ATOM 5988  C CG1  . VAL A 1 17 ? -1.726  -1.441  4.660   1.00 15.00 ?  313 VAL A CG1  8  
ATOM 5989  C CG2  . VAL A 1 17 ? -2.745  -3.391  5.850   1.00 15.00 ?  313 VAL A CG2  8  
ATOM 5990  H H    . VAL A 1 17 ? -2.546  -5.460  3.646   1.00 15.00 ?  313 VAL A H    8  
ATOM 5991  H HA   . VAL A 1 17 ? -3.513  -2.726  3.188   1.00 15.00 ?  313 VAL A HA   8  
ATOM 5992  H HB   . VAL A 1 17 ? -0.983  -3.430  4.664   1.00 15.00 ?  313 VAL A HB   8  
ATOM 5993  H HG11 . VAL A 1 17 ? -1.078  -1.156  3.846   1.00 15.00 ?  313 VAL A HG11 8  
ATOM 5994  H HG12 . VAL A 1 17 ? -1.269  -1.165  5.598   1.00 15.00 ?  313 VAL A HG12 8  
ATOM 5995  H HG13 . VAL A 1 17 ? -2.676  -0.936  4.559   1.00 15.00 ?  313 VAL A HG13 8  
ATOM 5996  H HG21 . VAL A 1 17 ? -3.722  -2.930  5.830   1.00 15.00 ?  313 VAL A HG21 8  
ATOM 5997  H HG22 . VAL A 1 17 ? -2.225  -3.094  6.748   1.00 15.00 ?  313 VAL A HG22 8  
ATOM 5998  H HG23 . VAL A 1 17 ? -2.855  -4.467  5.838   1.00 15.00 ?  313 VAL A HG23 8  
ATOM 5999  N N    . TYR A 1 18 ? -1.832  -2.076  1.466   1.00 15.00 ?  314 TYR A N    8  
ATOM 6000  C CA   . TYR A 1 18 ? -1.113  -1.742  0.268   1.00 15.00 ?  314 TYR A CA   8  
ATOM 6001  C C    . TYR A 1 18 ? -0.536  -0.341  0.440   1.00 15.00 ?  314 TYR A C    8  
ATOM 6002  O O    . TYR A 1 18 ? -1.267  0.635   0.625   1.00 15.00 ?  314 TYR A O    8  
ATOM 6003  C CB   . TYR A 1 18 ? -2.051  -1.794  -0.952  1.00 15.00 ?  314 TYR A CB   8  
ATOM 6004  C CG   . TYR A 1 18 ? -3.267  -0.888  -0.829  1.00 15.00 ?  314 TYR A CG   8  
ATOM 6005  C CD1  . TYR A 1 18 ? -4.330  -1.239  -0.012  1.00 15.00 ?  314 TYR A CD1  8  
ATOM 6006  C CD2  . TYR A 1 18 ? -3.339  0.328   -1.508  1.00 15.00 ?  314 TYR A CD2  8  
ATOM 6007  C CE1  . TYR A 1 18 ? -5.426  -0.416  0.129   1.00 15.00 ?  314 TYR A CE1  8  
ATOM 6008  C CE2  . TYR A 1 18 ? -4.438  1.158   -1.370  1.00 15.00 ?  314 TYR A CE2  8  
ATOM 6009  C CZ   . TYR A 1 18 ? -5.476  0.779   -0.547  1.00 15.00 ?  314 TYR A CZ   8  
ATOM 6010  O OH   . TYR A 1 18 ? -6.573  1.596   -0.396  1.00 15.00 ?  314 TYR A OH   8  
ATOM 6011  H H    . TYR A 1 18 ? -2.405  -1.416  1.814   1.00 15.00 ?  314 TYR A H    8  
ATOM 6012  H HA   . TYR A 1 18 ? -0.307  -2.450  0.143   1.00 15.00 ?  314 TYR A HA   8  
ATOM 6013  H HB2  . TYR A 1 18 ? -1.500  -1.495  -1.831  1.00 15.00 ?  314 TYR A HB2  8  
ATOM 6014  H HB3  . TYR A 1 18 ? -2.402  -2.808  -1.081  1.00 15.00 ?  314 TYR A HB3  8  
ATOM 6015  H HD1  . TYR A 1 18 ? -4.293  -2.179  0.522   1.00 15.00 ?  314 TYR A HD1  8  
ATOM 6016  H HD2  . TYR A 1 18 ? -2.527  0.617   -2.158  1.00 15.00 ?  314 TYR A HD2  8  
ATOM 6017  H HE1  . TYR A 1 18 ? -6.239  -0.712  0.774   1.00 15.00 ?  314 TYR A HE1  8  
ATOM 6018  H HE2  . TYR A 1 18 ? -4.475  2.107   -1.898  1.00 15.00 ?  314 TYR A HE2  8  
ATOM 6019  H HH   . TYR A 1 18 ? -6.928  1.488   0.492   1.00 15.00 ?  314 TYR A HH   8  
ATOM 6020  N N    . PHE A 1 19 ? 0.767   -0.247  0.445   1.00 15.00 ?  315 PHE A N    8  
ATOM 6021  C CA   . PHE A 1 19 ? 1.419   1.037   0.579   1.00 15.00 ?  315 PHE A CA   8  
ATOM 6022  C C    . PHE A 1 19 ? 1.815   1.541   -0.790  1.00 15.00 ?  315 PHE A C    8  
ATOM 6023  O O    . PHE A 1 19 ? 2.624   0.928   -1.461  1.00 15.00 ?  315 PHE A O    8  
ATOM 6024  C CB   . PHE A 1 19 ? 2.670   0.929   1.441   1.00 15.00 ?  315 PHE A CB   8  
ATOM 6025  C CG   . PHE A 1 19 ? 2.444   0.563   2.879   1.00 15.00 ?  315 PHE A CG   8  
ATOM 6026  C CD1  . PHE A 1 19 ? 1.740   -0.575  3.219   1.00 15.00 ?  315 PHE A CD1  8  
ATOM 6027  C CD2  . PHE A 1 19 ? 2.969   1.350   3.892   1.00 15.00 ?  315 PHE A CD2  8  
ATOM 6028  C CE1  . PHE A 1 19 ? 1.560   -0.922  4.538   1.00 15.00 ?  315 PHE A CE1  8  
ATOM 6029  C CE2  . PHE A 1 19 ? 2.799   1.002   5.215   1.00 15.00 ?  315 PHE A CE2  8  
ATOM 6030  C CZ   . PHE A 1 19 ? 2.091   -0.138  5.537   1.00 15.00 ?  315 PHE A CZ   8  
ATOM 6031  H H    . PHE A 1 19 ? 1.311   -1.062  0.360   1.00 15.00 ?  315 PHE A H    8  
ATOM 6032  H HA   . PHE A 1 19 ? 0.727   1.730   1.032   1.00 15.00 ?  315 PHE A HA   8  
ATOM 6033  H HB2  . PHE A 1 19 ? 3.315   0.176   1.019   1.00 15.00 ?  315 PHE A HB2  8  
ATOM 6034  H HB3  . PHE A 1 19 ? 3.185   1.879   1.421   1.00 15.00 ?  315 PHE A HB3  8  
ATOM 6035  H HD1  . PHE A 1 19 ? 1.322   -1.193  2.437   1.00 15.00 ?  315 PHE A HD1  8  
ATOM 6036  H HD2  . PHE A 1 19 ? 3.520   2.243   3.637   1.00 15.00 ?  315 PHE A HD2  8  
ATOM 6037  H HE1  . PHE A 1 19 ? 1.006   -1.813  4.790   1.00 15.00 ?  315 PHE A HE1  8  
ATOM 6038  H HE2  . PHE A 1 19 ? 3.214   1.620   5.996   1.00 15.00 ?  315 PHE A HE2  8  
ATOM 6039  H HZ   . PHE A 1 19 ? 1.962   -0.425  6.565   1.00 15.00 ?  315 PHE A HZ   8  
ATOM 6040  N N    . VAL A 1 20 ? 1.274   2.661   -1.200  1.00 15.00 ?  316 VAL A N    8  
ATOM 6041  C CA   . VAL A 1 20 ? 1.612   3.181   -2.496  1.00 15.00 ?  316 VAL A CA   8  
ATOM 6042  C C    . VAL A 1 20 ? 2.833   4.098   -2.372  1.00 15.00 ?  316 VAL A C    8  
ATOM 6043  O O    . VAL A 1 20 ? 2.816   5.075   -1.620  1.00 15.00 ?  316 VAL A O    8  
ATOM 6044  C CB   . VAL A 1 20 ? 0.425   3.918   -3.168  1.00 15.00 ?  316 VAL A CB   8  
ATOM 6045  C CG1  . VAL A 1 20 ? -0.604  2.913   -3.659  1.00 15.00 ?  316 VAL A CG1  8  
ATOM 6046  C CG2  . VAL A 1 20 ? -0.247  4.900   -2.222  1.00 15.00 ?  316 VAL A CG2  8  
ATOM 6047  H H    . VAL A 1 20 ? 0.668   3.159   -0.611  1.00 15.00 ?  316 VAL A H    8  
ATOM 6048  H HA   . VAL A 1 20 ? 1.863   2.335   -3.111  1.00 15.00 ?  316 VAL A HA   8  
ATOM 6049  H HB   . VAL A 1 20 ? 0.799   4.464   -4.020  1.00 15.00 ?  316 VAL A HB   8  
ATOM 6050  H HG11 . VAL A 1 20 ? -1.083  2.444   -2.811  1.00 15.00 ?  316 VAL A HG11 8  
ATOM 6051  H HG12 . VAL A 1 20 ? -0.113  2.157   -4.253  1.00 15.00 ?  316 VAL A HG12 8  
ATOM 6052  H HG13 . VAL A 1 20 ? -1.345  3.420   -4.260  1.00 15.00 ?  316 VAL A HG13 8  
ATOM 6053  H HG21 . VAL A 1 20 ? 0.504   5.417   -1.640  1.00 15.00 ?  316 VAL A HG21 8  
ATOM 6054  H HG22 . VAL A 1 20 ? -0.919  4.365   -1.564  1.00 15.00 ?  316 VAL A HG22 8  
ATOM 6055  H HG23 . VAL A 1 20 ? -0.811  5.617   -2.801  1.00 15.00 ?  316 VAL A HG23 8  
ATOM 6056  N N    . ASP A 1 21 ? 3.926   3.749   -3.048  1.00 15.00 ?  317 ASP A N    8  
ATOM 6057  C CA   . ASP A 1 21 ? 5.118   4.564   -3.002  1.00 15.00 ?  317 ASP A CA   8  
ATOM 6058  C C    . ASP A 1 21 ? 5.030   5.570   -4.131  1.00 15.00 ?  317 ASP A C    8  
ATOM 6059  O O    . ASP A 1 21 ? 4.956   5.177   -5.299  1.00 15.00 ?  317 ASP A O    8  
ATOM 6060  C CB   . ASP A 1 21 ? 6.391   3.724   -3.187  1.00 15.00 ?  317 ASP A CB   8  
ATOM 6061  C CG   . ASP A 1 21 ? 6.265   2.309   -2.687  1.00 15.00 ?  317 ASP A CG   8  
ATOM 6062  O OD1  . ASP A 1 21 ? 5.798   1.453   -3.460  1.00 15.00 ?  317 ASP A OD1  8  
ATOM 6063  O OD2  . ASP A 1 21 ? 6.684   2.045   -1.546  1.00 15.00 -1 317 ASP A OD2  8  
ATOM 6064  H H    . ASP A 1 21 ? 3.940   2.917   -3.579  1.00 15.00 ?  317 ASP A H    8  
ATOM 6065  H HA   . ASP A 1 21 ? 5.150   5.080   -2.053  1.00 15.00 ?  317 ASP A HA   8  
ATOM 6066  H HB2  . ASP A 1 21 ? 6.651   3.693   -4.233  1.00 15.00 ?  317 ASP A HB2  8  
ATOM 6067  H HB3  . ASP A 1 21 ? 7.193   4.189   -2.635  1.00 15.00 ?  317 ASP A HB3  8  
ATOM 6068  N N    . HIS A 1 22 ? 5.021   6.859   -3.796  1.00 15.00 ?  318 HIS A N    8  
ATOM 6069  C CA   . HIS A 1 22 ? 4.952   7.906   -4.818  1.00 15.00 ?  318 HIS A CA   8  
ATOM 6070  C C    . HIS A 1 22 ? 6.251   7.965   -5.608  1.00 15.00 ?  318 HIS A C    8  
ATOM 6071  O O    . HIS A 1 22 ? 6.323   8.588   -6.665  1.00 15.00 ?  318 HIS A O    8  
ATOM 6072  C CB   . HIS A 1 22 ? 4.668   9.286   -4.208  1.00 15.00 ?  318 HIS A CB   8  
ATOM 6073  C CG   . HIS A 1 22 ? 3.273   9.473   -3.686  1.00 15.00 ?  318 HIS A CG   8  
ATOM 6074  N ND1  . HIS A 1 22 ? 2.200   8.695   -4.060  1.00 15.00 ?  318 HIS A ND1  8  
ATOM 6075  C CD2  . HIS A 1 22 ? 2.788   10.373  -2.804  1.00 15.00 ?  318 HIS A CD2  8  
ATOM 6076  C CE1  . HIS A 1 22 ? 1.120   9.107   -3.428  1.00 15.00 ?  318 HIS A CE1  8  
ATOM 6077  N NE2  . HIS A 1 22 ? 1.444   10.127  -2.654  1.00 15.00 ?  318 HIS A NE2  8  
ATOM 6078  H H    . HIS A 1 22 ? 5.064   7.109   -2.847  1.00 15.00 ?  318 HIS A H    8  
ATOM 6079  H HA   . HIS A 1 22 ? 4.149   7.652   -5.494  1.00 15.00 ?  318 HIS A HA   8  
ATOM 6080  H HB2  . HIS A 1 22 ? 5.347   9.453   -3.387  1.00 15.00 ?  318 HIS A HB2  8  
ATOM 6081  H HB3  . HIS A 1 22 ? 4.841   10.042  -4.963  1.00 15.00 ?  318 HIS A HB3  8  
ATOM 6082  H HD1  . HIS A 1 22 ? 2.220   7.949   -4.717  1.00 15.00 ?  318 HIS A HD1  8  
ATOM 6083  H HD2  . HIS A 1 22 ? 3.355   11.148  -2.308  1.00 15.00 ?  318 HIS A HD2  8  
ATOM 6084  H HE1  . HIS A 1 22 ? 0.133   8.682   -3.529  1.00 15.00 ?  318 HIS A HE1  8  
ATOM 6085  H HE2  . HIS A 1 22 ? 0.928   10.388  -1.847  1.00 15.00 ?  318 HIS A HE2  8  
ATOM 6086  N N    . ASN A 1 23 ? 7.282   7.328   -5.075  1.00 15.00 ?  319 ASN A N    8  
ATOM 6087  C CA   . ASN A 1 23 ? 8.585   7.310   -5.721  1.00 15.00 ?  319 ASN A CA   8  
ATOM 6088  C C    . ASN A 1 23 ? 8.614   6.273   -6.834  1.00 15.00 ?  319 ASN A C    8  
ATOM 6089  O O    . ASN A 1 23 ? 9.225   6.487   -7.882  1.00 15.00 ?  319 ASN A O    8  
ATOM 6090  C CB   . ASN A 1 23 ? 9.685   7.008   -4.702  1.00 15.00 ?  319 ASN A CB   8  
ATOM 6091  C CG   . ASN A 1 23 ? 9.764   8.043   -3.595  1.00 15.00 ?  319 ASN A CG   8  
ATOM 6092  O OD1  . ASN A 1 23 ? 9.486   9.223   -3.806  1.00 15.00 ?  319 ASN A OD1  8  
ATOM 6093  N ND2  . ASN A 1 23 ? 10.120  7.601   -2.401  1.00 15.00 ?  319 ASN A ND2  8  
ATOM 6094  H H    . ASN A 1 23 ? 7.163   6.861   -4.222  1.00 15.00 ?  319 ASN A H    8  
ATOM 6095  H HA   . ASN A 1 23 ? 8.758   8.285   -6.148  1.00 15.00 ?  319 ASN A HA   8  
ATOM 6096  H HB2  . ASN A 1 23 ? 9.495   6.045   -4.252  1.00 15.00 ?  319 ASN A HB2  8  
ATOM 6097  H HB3  . ASN A 1 23 ? 10.636  6.980   -5.210  1.00 15.00 ?  319 ASN A HB3  8  
ATOM 6098  H HD21 . ASN A 1 23 ? 10.306  6.637   -2.297  1.00 15.00 ?  319 ASN A HD21 8  
ATOM 6099  H HD22 . ASN A 1 23 ? 10.186  8.247   -1.670  1.00 15.00 ?  319 ASN A HD22 8  
ATOM 6100  N N    . ASN A 1 24 ? 7.970   5.138   -6.595  1.00 15.00 ?  320 ASN A N    8  
ATOM 6101  C CA   . ASN A 1 24 ? 7.939   4.060   -7.578  1.00 15.00 ?  320 ASN A CA   8  
ATOM 6102  C C    . ASN A 1 24 ? 6.625   4.052   -8.357  1.00 15.00 ?  320 ASN A C    8  
ATOM 6103  O O    . ASN A 1 24 ? 6.514   3.391   -9.386  1.00 15.00 ?  320 ASN A O    8  
ATOM 6104  C CB   . ASN A 1 24 ? 8.136   2.709   -6.894  1.00 15.00 ?  320 ASN A CB   8  
ATOM 6105  C CG   . ASN A 1 24 ? 8.717   1.663   -7.827  1.00 15.00 ?  320 ASN A CG   8  
ATOM 6106  O OD1  . ASN A 1 24 ? 7.997   0.971   -8.542  1.00 15.00 ?  320 ASN A OD1  8  
ATOM 6107  N ND2  . ASN A 1 24 ? 10.032  1.530   -7.805  1.00 15.00 ?  320 ASN A ND2  8  
ATOM 6108  H H    . ASN A 1 24 ? 7.527   5.011   -5.730  1.00 15.00 ?  320 ASN A H    8  
ATOM 6109  H HA   . ASN A 1 24 ? 8.751   4.224   -8.271  1.00 15.00 ?  320 ASN A HA   8  
ATOM 6110  H HB2  . ASN A 1 24 ? 8.807   2.830   -6.058  1.00 15.00 ?  320 ASN A HB2  8  
ATOM 6111  H HB3  . ASN A 1 24 ? 7.182   2.353   -6.534  1.00 15.00 ?  320 ASN A HB3  8  
ATOM 6112  H HD21 . ASN A 1 24 ? 10.545  2.103   -7.198  1.00 15.00 ?  320 ASN A HD21 8  
ATOM 6113  H HD22 . ASN A 1 24 ? 10.442  0.861   -8.393  1.00 15.00 ?  320 ASN A HD22 8  
ATOM 6114  N N    . ARG A 1 25 ? 5.624   4.772   -7.841  1.00 15.00 ?  321 ARG A N    8  
ATOM 6115  C CA   . ARG A 1 25 ? 4.285   4.795   -8.428  1.00 15.00 ?  321 ARG A CA   8  
ATOM 6116  C C    . ARG A 1 25 ? 3.692   3.390   -8.435  1.00 15.00 ?  321 ARG A C    8  
ATOM 6117  O O    . ARG A 1 25 ? 2.975   2.997   -9.358  1.00 15.00 ?  321 ARG A O    8  
ATOM 6118  C CB   . ARG A 1 25 ? 4.322   5.393   -9.837  1.00 15.00 ?  321 ARG A CB   8  
ATOM 6119  C CG   . ARG A 1 25 ? 4.801   6.835   -9.848  1.00 15.00 ?  321 ARG A CG   8  
ATOM 6120  C CD   . ARG A 1 25 ? 4.759   7.446   -11.236 1.00 15.00 ?  321 ARG A CD   8  
ATOM 6121  N NE   . ARG A 1 25 ? 5.237   8.827   -11.220 1.00 15.00 ?  321 ARG A NE   8  
ATOM 6122  C CZ   . ARG A 1 25 ? 4.971   9.726   -12.164 1.00 15.00 ?  321 ARG A CZ   8  
ATOM 6123  N NH1  . ARG A 1 25 ? 4.260   9.393   -13.234 1.00 15.00 1  321 ARG A NH1  8  
ATOM 6124  N NH2  . ARG A 1 25 ? 5.430   10.964  -12.039 1.00 15.00 ?  321 ARG A NH2  8  
ATOM 6125  H H    . ARG A 1 25 ? 5.789   5.301   -7.036  1.00 15.00 ?  321 ARG A H    8  
ATOM 6126  H HA   . ARG A 1 25 ? 3.668   5.421   -7.799  1.00 15.00 ?  321 ARG A HA   8  
ATOM 6127  H HB2  . ARG A 1 25 ? 4.988   4.805   -10.452 1.00 15.00 ?  321 ARG A HB2  8  
ATOM 6128  H HB3  . ARG A 1 25 ? 3.328   5.362   -10.259 1.00 15.00 ?  321 ARG A HB3  8  
ATOM 6129  H HG2  . ARG A 1 25 ? 4.168   7.415   -9.194  1.00 15.00 ?  321 ARG A HG2  8  
ATOM 6130  H HG3  . ARG A 1 25 ? 5.818   6.864   -9.482  1.00 15.00 ?  321 ARG A HG3  8  
ATOM 6131  H HD2  . ARG A 1 25 ? 5.384   6.862   -11.895 1.00 15.00 ?  321 ARG A HD2  8  
ATOM 6132  H HD3  . ARG A 1 25 ? 3.740   7.432   -11.596 1.00 15.00 ?  321 ARG A HD3  8  
ATOM 6133  H HE   . ARG A 1 25 ? 5.789   9.100   -10.450 1.00 15.00 ?  321 ARG A HE   8  
ATOM 6134  H HH11 . ARG A 1 25 ? 3.912   8.453   -13.342 1.00 15.00 ?  321 ARG A HH11 8  
ATOM 6135  H HH12 . ARG A 1 25 ? 4.064   10.080  -13.948 1.00 15.00 ?  321 ARG A HH12 8  
ATOM 6136  H HH21 . ARG A 1 25 ? 5.979   11.219  -11.234 1.00 15.00 ?  321 ARG A HH21 8  
ATOM 6137  H HH22 . ARG A 1 25 ? 5.229   11.652  -12.742 1.00 15.00 ?  321 ARG A HH22 8  
ATOM 6138  N N    . THR A 1 26 ? 3.960   2.663   -7.362  1.00 15.00 ?  322 THR A N    8  
ATOM 6139  C CA   . THR A 1 26 ? 3.523   1.276   -7.238  1.00 15.00 ?  322 THR A CA   8  
ATOM 6140  C C    . THR A 1 26 ? 2.821   1.058   -5.897  1.00 15.00 ?  322 THR A C    8  
ATOM 6141  O O    . THR A 1 26 ? 3.107   1.759   -4.928  1.00 15.00 ?  322 THR A O    8  
ATOM 6142  C CB   . THR A 1 26 ? 4.725   0.315   -7.383  1.00 15.00 ?  322 THR A CB   8  
ATOM 6143  O OG1  . THR A 1 26 ? 5.360   0.533   -8.650  1.00 15.00 ?  322 THR A OG1  8  
ATOM 6144  C CG2  . THR A 1 26 ? 4.297   -1.142  -7.285  1.00 15.00 ?  322 THR A CG2  8  
ATOM 6145  H H    . THR A 1 26 ? 4.454   3.080   -6.615  1.00 15.00 ?  322 THR A H    8  
ATOM 6146  H HA   . THR A 1 26 ? 2.824   1.073   -8.037  1.00 15.00 ?  322 THR A HA   8  
ATOM 6147  H HB   . THR A 1 26 ? 5.433   0.525   -6.593  1.00 15.00 ?  322 THR A HB   8  
ATOM 6148  H HG1  . THR A 1 26 ? 6.305   0.689   -8.513  1.00 15.00 ?  322 THR A HG1  8  
ATOM 6149  H HG21 . THR A 1 26 ? 3.843   -1.319  -6.321  1.00 15.00 ?  322 THR A HG21 8  
ATOM 6150  H HG22 . THR A 1 26 ? 5.161   -1.779  -7.398  1.00 15.00 ?  322 THR A HG22 8  
ATOM 6151  H HG23 . THR A 1 26 ? 3.583   -1.360  -8.064  1.00 15.00 ?  322 THR A HG23 8  
ATOM 6152  N N    . THR A 1 27 ? 1.872   0.124   -5.853  1.00 15.00 ?  323 THR A N    8  
ATOM 6153  C CA   . THR A 1 27 ? 1.187   -0.193  -4.612  1.00 15.00 ?  323 THR A CA   8  
ATOM 6154  C C    . THR A 1 27 ? 1.770   -1.466  -3.986  1.00 15.00 ?  323 THR A C    8  
ATOM 6155  O O    . THR A 1 27 ? 2.107   -2.420  -4.694  1.00 15.00 ?  323 THR A O    8  
ATOM 6156  C CB   . THR A 1 27 ? -0.340  -0.333  -4.814  1.00 15.00 ?  323 THR A CB   8  
ATOM 6157  O OG1  . THR A 1 27 ? -0.990  -0.508  -3.555  1.00 15.00 ?  323 THR A OG1  8  
ATOM 6158  C CG2  . THR A 1 27 ? -0.687  -1.499  -5.722  1.00 15.00 ?  323 THR A CG2  8  
ATOM 6159  H H    . THR A 1 27 ? 1.638   -0.365  -6.668  1.00 15.00 ?  323 THR A H    8  
ATOM 6160  H HA   . THR A 1 27 ? 1.356   0.631   -3.937  1.00 15.00 ?  323 THR A HA   8  
ATOM 6161  H HB   . THR A 1 27 ? -0.707  0.575   -5.270  1.00 15.00 ?  323 THR A HB   8  
ATOM 6162  H HG1  . THR A 1 27 ? -1.553  0.251   -3.377  1.00 15.00 ?  323 THR A HG1  8  
ATOM 6163  H HG21 . THR A 1 27 ? -0.311  -1.309  -6.716  1.00 15.00 ?  323 THR A HG21 8  
ATOM 6164  H HG22 . THR A 1 27 ? -1.763  -1.614  -5.757  1.00 15.00 ?  323 THR A HG22 8  
ATOM 6165  H HG23 . THR A 1 27 ? -0.241  -2.403  -5.335  1.00 15.00 ?  323 THR A HG23 8  
ATOM 6166  N N    . GLN A 1 28 ? 1.884   -1.471  -2.664  1.00 15.00 ?  324 GLN A N    8  
ATOM 6167  C CA   . GLN A 1 28 ? 2.587   -2.527  -1.953  1.00 15.00 ?  324 GLN A CA   8  
ATOM 6168  C C    . GLN A 1 28 ? 1.657   -3.326  -1.048  1.00 15.00 ?  324 GLN A C    8  
ATOM 6169  O O    . GLN A 1 28 ? 1.428   -2.940  0.092   1.00 15.00 ?  324 GLN A O    8  
ATOM 6170  C CB   . GLN A 1 28 ? 3.716   -1.929  -1.094  1.00 15.00 ?  324 GLN A CB   8  
ATOM 6171  C CG   . GLN A 1 28 ? 4.834   -1.280  -1.894  1.00 15.00 ?  324 GLN A CG   8  
ATOM 6172  C CD   . GLN A 1 28 ? 5.636   -2.297  -2.685  1.00 15.00 ?  324 GLN A CD   8  
ATOM 6173  O OE1  . GLN A 1 28 ? 6.121   -2.023  -3.782  1.00 15.00 ?  324 GLN A OE1  8  
ATOM 6174  N NE2  . GLN A 1 28 ? 5.815   -3.473  -2.106  1.00 15.00 ?  324 GLN A NE2  8  
ATOM 6175  H H    . GLN A 1 28 ? 1.496   -0.735  -2.148  1.00 15.00 ?  324 GLN A H    8  
ATOM 6176  H HA   . GLN A 1 28 ? 3.022   -3.191  -2.684  1.00 15.00 ?  324 GLN A HA   8  
ATOM 6177  H HB2  . GLN A 1 28 ? 3.294   -1.179  -0.442  1.00 15.00 ?  324 GLN A HB2  8  
ATOM 6178  H HB3  . GLN A 1 28 ? 4.145   -2.712  -0.487  1.00 15.00 ?  324 GLN A HB3  8  
ATOM 6179  H HG2  . GLN A 1 28 ? 4.405   -0.560  -2.574  1.00 15.00 ?  324 GLN A HG2  8  
ATOM 6180  H HG3  . GLN A 1 28 ? 5.499   -0.772  -1.208  1.00 15.00 ?  324 GLN A HG3  8  
ATOM 6181  H HE21 . GLN A 1 28 ? 5.431   -3.607  -1.215  1.00 15.00 ?  324 GLN A HE21 8  
ATOM 6182  H HE22 . GLN A 1 28 ? 6.308   -4.166  -2.600  1.00 15.00 ?  324 GLN A HE22 8  
ATOM 6183  N N    . PHE A 1 29 ? 1.116   -4.432  -1.558  1.00 15.00 ?  325 PHE A N    8  
ATOM 6184  C CA   . PHE A 1 29 ? 0.449   -5.423  -0.704  1.00 15.00 ?  325 PHE A CA   8  
ATOM 6185  C C    . PHE A 1 29 ? 1.502   -6.147  0.087   1.00 15.00 ?  325 PHE A C    8  
ATOM 6186  O O    . PHE A 1 29 ? 1.234   -6.955  0.971   1.00 15.00 ?  325 PHE A O    8  
ATOM 6187  C CB   . PHE A 1 29 ? -0.407  -6.411  -1.487  1.00 15.00 ?  325 PHE A CB   8  
ATOM 6188  C CG   . PHE A 1 29 ? -1.862  -6.082  -1.379  1.00 15.00 ?  325 PHE A CG   8  
ATOM 6189  C CD1  . PHE A 1 29 ? -2.360  -5.466  -0.235  1.00 15.00 ?  325 PHE A CD1  8  
ATOM 6190  C CD2  . PHE A 1 29 ? -2.728  -6.372  -2.415  1.00 15.00 ?  325 PHE A CD2  8  
ATOM 6191  C CE1  . PHE A 1 29 ? -3.701  -5.144  -0.146  1.00 15.00 ?  325 PHE A CE1  8  
ATOM 6192  C CE2  . PHE A 1 29 ? -4.069  -6.056  -2.325  1.00 15.00 ?  325 PHE A CE2  8  
ATOM 6193  C CZ   . PHE A 1 29 ? -4.556  -5.440  -1.190  1.00 15.00 ?  325 PHE A CZ   8  
ATOM 6194  H H    . PHE A 1 29 ? 1.186   -4.597  -2.522  1.00 15.00 ?  325 PHE A H    8  
ATOM 6195  H HA   . PHE A 1 29 ? -0.180  -4.880  -0.012  1.00 15.00 ?  325 PHE A HA   8  
ATOM 6196  H HB2  . PHE A 1 29 ? -0.125  -6.392  -2.535  1.00 15.00 ?  325 PHE A HB2  8  
ATOM 6197  H HB3  . PHE A 1 29 ? -0.255  -7.404  -1.093  1.00 15.00 ?  325 PHE A HB3  8  
ATOM 6198  H HD1  . PHE A 1 29 ? -1.681  -5.234  0.607   1.00 15.00 ?  325 PHE A HD1  8  
ATOM 6199  H HD2  . PHE A 1 29 ? -2.347  -6.854  -3.301  1.00 15.00 ?  325 PHE A HD2  8  
ATOM 6200  H HE1  . PHE A 1 29 ? -4.082  -4.666  0.746   1.00 15.00 ?  325 PHE A HE1  8  
ATOM 6201  H HE2  . PHE A 1 29 ? -4.735  -6.289  -3.143  1.00 15.00 ?  325 PHE A HE2  8  
ATOM 6202  H HZ   . PHE A 1 29 ? -5.603  -5.188  -1.119  1.00 15.00 ?  325 PHE A HZ   8  
ATOM 6203  N N    . THR A 1 30 ? 2.708   -5.865  -0.313  1.00 15.00 ?  326 THR A N    8  
ATOM 6204  C CA   . THR A 1 30 ? 3.880   -6.388  0.345   1.00 15.00 ?  326 THR A CA   8  
ATOM 6205  C C    . THR A 1 30 ? 4.299   -5.315  1.331   1.00 15.00 ?  326 THR A C    8  
ATOM 6206  O O    . THR A 1 30 ? 5.061   -4.404  0.997   1.00 15.00 ?  326 THR A O    8  
ATOM 6207  C CB   . THR A 1 30 ? 5.031   -6.681  -0.638  1.00 15.00 ?  326 THR A CB   8  
ATOM 6208  O OG1  . THR A 1 30 ? 4.523   -7.351  -1.800  1.00 15.00 ?  326 THR A OG1  8  
ATOM 6209  C CG2  . THR A 1 30 ? 6.097   -7.544  0.020   1.00 15.00 ?  326 THR A CG2  8  
ATOM 6210  H H    . THR A 1 30 ? 2.798   -5.176  -1.004  1.00 15.00 ?  326 THR A H    8  
ATOM 6211  H HA   . THR A 1 30 ? 3.611   -7.301  0.858   1.00 15.00 ?  326 THR A HA   8  
ATOM 6212  H HB   . THR A 1 30 ? 5.480   -5.748  -0.936  1.00 15.00 ?  326 THR A HB   8  
ATOM 6213  H HG1  . THR A 1 30 ? 3.922   -6.746  -2.270  1.00 15.00 ?  326 THR A HG1  8  
ATOM 6214  H HG21 . THR A 1 30 ? 5.656   -8.474  0.344   1.00 15.00 ?  326 THR A HG21 8  
ATOM 6215  H HG22 . THR A 1 30 ? 6.505   -7.022  0.874   1.00 15.00 ?  326 THR A HG22 8  
ATOM 6216  H HG23 . THR A 1 30 ? 6.886   -7.746  -0.689  1.00 15.00 ?  326 THR A HG23 8  
ATOM 6217  N N    . ASP A 1 31 ? 3.762   -5.403  2.526   1.00 15.00 ?  327 ASP A N    8  
ATOM 6218  C CA   . ASP A 1 31 ? 3.720   -4.287  3.426   1.00 15.00 ?  327 ASP A CA   8  
ATOM 6219  C C    . ASP A 1 31 ? 4.557   -4.472  4.637   1.00 15.00 ?  327 ASP A C    8  
ATOM 6220  O O    . ASP A 1 31 ? 4.796   -5.582  5.118   1.00 15.00 ?  327 ASP A O    8  
ATOM 6221  C CB   . ASP A 1 31 ? 2.312   -3.948  3.861   1.00 15.00 ?  327 ASP A CB   8  
ATOM 6222  C CG   . ASP A 1 31 ? 1.437   -5.156  4.139   1.00 15.00 ?  327 ASP A CG   8  
ATOM 6223  O OD1  . ASP A 1 31 ? 1.991   -6.248  4.372   1.00 15.00 -1 327 ASP A OD1  8  
ATOM 6224  O OD2  . ASP A 1 31 ? 0.203   -5.004  4.184   1.00 15.00 ?  327 ASP A OD2  8  
ATOM 6225  H H    . ASP A 1 31 ? 3.363   -6.249  2.826   1.00 15.00 ?  327 ASP A H    8  
ATOM 6226  H HA   . ASP A 1 31 ? 4.104   -3.432  2.892   1.00 15.00 ?  327 ASP A HA   8  
ATOM 6227  H HB2  . ASP A 1 31 ? 2.376   -3.374  4.775   1.00 15.00 ?  327 ASP A HB2  8  
ATOM 6228  H HB3  . ASP A 1 31 ? 1.873   -3.334  3.104   1.00 15.00 ?  327 ASP A HB3  8  
ATOM 6229  N N    . PRO A 1 32 ? 5.015   -3.342  5.143   1.00 15.00 ?  328 PRO A N    8  
ATOM 6230  C CA   . PRO A 1 32 ? 5.676   -3.274  6.423   1.00 15.00 ?  328 PRO A CA   8  
ATOM 6231  C C    . PRO A 1 32 ? 4.688   -3.762  7.499   1.00 15.00 ?  328 PRO A C    8  
ATOM 6232  O O    . PRO A 1 32 ? 5.058   -4.044  8.637   1.00 15.00 ?  328 PRO A O    8  
ATOM 6233  C CB   . PRO A 1 32 ? 6.051   -1.784  6.553   1.00 15.00 ?  328 PRO A CB   8  
ATOM 6234  C CG   . PRO A 1 32 ? 5.884   -1.213  5.170   1.00 15.00 ?  328 PRO A CG   8  
ATOM 6235  C CD   . PRO A 1 32 ? 4.809   -2.011  4.546   1.00 15.00 ?  328 PRO A CD   8  
ATOM 6236  H HA   . PRO A 1 32 ? 6.566   -3.890  6.442   1.00 15.00 ?  328 PRO A HA   8  
ATOM 6237  H HB2  . PRO A 1 32 ? 5.390   -1.305  7.261   1.00 15.00 ?  328 PRO A HB2  8  
ATOM 6238  H HB3  . PRO A 1 32 ? 7.074   -1.697  6.892   1.00 15.00 ?  328 PRO A HB3  8  
ATOM 6239  H HG2  . PRO A 1 32 ? 5.606   -0.165  5.227   1.00 15.00 ?  328 PRO A HG2  8  
ATOM 6240  H HG3  . PRO A 1 32 ? 6.775   -1.332  4.581   1.00 15.00 ?  328 PRO A HG3  8  
ATOM 6241  H HD2  . PRO A 1 32 ? 3.838   -1.613  4.807   1.00 15.00 ?  328 PRO A HD2  8  
ATOM 6242  H HD3  . PRO A 1 32 ? 4.935   -2.045  3.473   1.00 15.00 ?  328 PRO A HD3  8  
ATOM 6243  N N    . ARG A 1 33 ? 3.405   -3.830  7.093   1.00 15.00 ?  329 ARG A N    8  
ATOM 6244  C CA   . ARG A 1 33 ? 2.329   -4.433  7.878   1.00 15.00 ?  329 ARG A CA   8  
ATOM 6245  C C    . ARG A 1 33 ? 2.574   -5.928  8.111   1.00 15.00 ?  329 ARG A C    8  
ATOM 6246  O O    . ARG A 1 33 ? 2.636   -6.378  9.257   1.00 15.00 ?  329 ARG A O    8  
ATOM 6247  C CB   . ARG A 1 33 ? 0.964   -4.227  7.183   1.00 15.00 ?  329 ARG A CB   8  
ATOM 6248  C CG   . ARG A 1 33 ? 0.448   -2.804  7.297   1.00 15.00 ?  329 ARG A CG   8  
ATOM 6249  C CD   . ARG A 1 33 ? -0.025  -2.497  8.708   1.00 15.00 ?  329 ARG A CD   8  
ATOM 6250  N NE   . ARG A 1 33 ? -1.140  -3.359  9.106   1.00 15.00 ?  329 ARG A NE   8  
ATOM 6251  C CZ   . ARG A 1 33 ? -2.147  -2.968  9.886   1.00 15.00 ?  329 ARG A CZ   8  
ATOM 6252  N NH1  . ARG A 1 33 ? -2.176  -1.733  10.381  1.00 15.00 1  329 ARG A NH1  8  
ATOM 6253  N NH2  . ARG A 1 33 ? -3.129  -3.814  10.168  1.00 15.00 ?  329 ARG A NH2  8  
ATOM 6254  H H    . ARG A 1 33 ? 3.184   -3.468  6.210   1.00 15.00 ?  329 ARG A H    8  
ATOM 6255  H HA   . ARG A 1 33 ? 2.307   -3.936  8.837   1.00 15.00 ?  329 ARG A HA   8  
ATOM 6256  H HB2  . ARG A 1 33 ? 1.034   -4.482  6.112   1.00 15.00 ?  329 ARG A HB2  8  
ATOM 6257  H HB3  . ARG A 1 33 ? 0.240   -4.883  7.645   1.00 15.00 ?  329 ARG A HB3  8  
ATOM 6258  H HG2  . ARG A 1 33 ? 1.244   -2.122  7.038   1.00 15.00 ?  329 ARG A HG2  8  
ATOM 6259  H HG3  . ARG A 1 33 ? -0.377  -2.675  6.612   1.00 15.00 ?  329 ARG A HG3  8  
ATOM 6260  H HD2  . ARG A 1 33 ? 0.796   -2.647  9.392   1.00 15.00 ?  329 ARG A HD2  8  
ATOM 6261  H HD3  . ARG A 1 33 ? -0.347  -1.466  8.749   1.00 15.00 ?  329 ARG A HD3  8  
ATOM 6262  H HE   . ARG A 1 33 ? -1.141  -4.282  8.760   1.00 15.00 ?  329 ARG A HE   8  
ATOM 6263  H HH11 . ARG A 1 33 ? -1.442  -1.087  10.173  1.00 15.00 ?  329 ARG A HH11 8  
ATOM 6264  H HH12 . ARG A 1 33 ? -2.949  -1.440  10.964  1.00 15.00 ?  329 ARG A HH12 8  
ATOM 6265  H HH21 . ARG A 1 33 ? -3.115  -4.752  9.793   1.00 15.00 ?  329 ARG A HH21 8  
ATOM 6266  H HH22 . ARG A 1 33 ? -3.894  -3.526  10.752  1.00 15.00 ?  329 ARG A HH22 8  
ATOM 6267  N N    . LEU A 1 34 ? 2.719   -6.691  7.028   1.00 15.00 ?  330 LEU A N    8  
ATOM 6268  C CA   . LEU A 1 34 ? 2.909   -8.140  7.118   1.00 15.00 ?  330 LEU A CA   8  
ATOM 6269  C C    . LEU A 1 34 ? 4.215   -8.487  7.834   1.00 15.00 ?  330 LEU A C    8  
ATOM 6270  O O    . LEU A 1 34 ? 4.392   -9.604  8.320   1.00 15.00 ?  330 LEU A O    8  
ATOM 6271  C CB   . LEU A 1 34 ? 2.897   -8.771  5.721   1.00 15.00 ?  330 LEU A CB   8  
ATOM 6272  C CG   . LEU A 1 34 ? 2.939   -10.301 5.688   1.00 15.00 ?  330 LEU A CG   8  
ATOM 6273  C CD1  . LEU A 1 34 ? 1.680   -10.885 6.312   1.00 15.00 ?  330 LEU A CD1  8  
ATOM 6274  C CD2  . LEU A 1 34 ? 3.102   -10.796 4.259   1.00 15.00 ?  330 LEU A CD2  8  
ATOM 6275  H H    . LEU A 1 34 ? 2.681   -6.273  6.131   1.00 15.00 ?  330 LEU A H    8  
ATOM 6276  H HA   . LEU A 1 34 ? 2.085   -8.542  7.690   1.00 15.00 ?  330 LEU A HA   8  
ATOM 6277  H HB2  . LEU A 1 34 ? 2.001   -8.446  5.212   1.00 15.00 ?  330 LEU A HB2  8  
ATOM 6278  H HB3  . LEU A 1 34 ? 3.753   -8.400  5.177   1.00 15.00 ?  330 LEU A HB3  8  
ATOM 6279  H HG   . LEU A 1 34 ? 3.788   -10.644 6.262   1.00 15.00 ?  330 LEU A HG   8  
ATOM 6280  H HD11 . LEU A 1 34 ? 1.732   -11.963 6.286   1.00 15.00 ?  330 LEU A HD11 8  
ATOM 6281  H HD12 . LEU A 1 34 ? 0.816   -10.553 5.756   1.00 15.00 ?  330 LEU A HD12 8  
ATOM 6282  H HD13 . LEU A 1 34 ? 1.598   -10.551 7.337   1.00 15.00 ?  330 LEU A HD13 8  
ATOM 6283  H HD21 . LEU A 1 34 ? 4.027   -10.416 3.849   1.00 15.00 ?  330 LEU A HD21 8  
ATOM 6284  H HD22 . LEU A 1 34 ? 2.274   -10.446 3.662   1.00 15.00 ?  330 LEU A HD22 8  
ATOM 6285  H HD23 . LEU A 1 34 ? 3.123   -11.875 4.252   1.00 15.00 ?  330 LEU A HD23 8  
ATOM 6286  N N    . SER A 1 35 ? 5.128   -7.527  7.892   1.00 15.00 ?  331 SER A N    8  
ATOM 6287  C CA   . SER A 1 35 ? 6.402   -7.725  8.565   1.00 15.00 ?  331 SER A CA   8  
ATOM 6288  C C    . SER A 1 35 ? 6.196   -7.855  10.076  1.00 15.00 ?  331 SER A C    8  
ATOM 6289  O O    . SER A 1 35 ? 7.044   -8.396  10.786  1.00 15.00 ?  331 SER A O    8  
ATOM 6290  C CB   . SER A 1 35 ? 7.353   -6.564  8.249   1.00 15.00 ?  331 SER A CB   8  
ATOM 6291  O OG   . SER A 1 35 ? 8.668   -6.820  8.718   1.00 15.00 ?  331 SER A OG   8  
ATOM 6292  H H    . SER A 1 35 ? 4.942   -6.667  7.460   1.00 15.00 ?  331 SER A H    8  
ATOM 6293  H HA   . SER A 1 35 ? 6.834   -8.643  8.194   1.00 15.00 ?  331 SER A HA   8  
ATOM 6294  H HB2  . SER A 1 35 ? 7.390   -6.415  7.180   1.00 15.00 ?  331 SER A HB2  8  
ATOM 6295  H HB3  . SER A 1 35 ? 6.985   -5.665  8.722   1.00 15.00 ?  331 SER A HB3  8  
ATOM 6296  H HG   . SER A 1 35 ? 8.697   -6.701  9.683   1.00 15.00 ?  331 SER A HG   8  
ATOM 6297  N N    . ALA A 1 36 ? 5.069   -7.349  10.564  1.00 15.00 ?  332 ALA A N    8  
ATOM 6298  C CA   . ALA A 1 36 ? 4.757   -7.416  11.983  1.00 15.00 ?  332 ALA A CA   8  
ATOM 6299  C C    . ALA A 1 36 ? 3.679   -8.455  12.269  1.00 15.00 ?  332 ALA A C    8  
ATOM 6300  O O    . ALA A 1 36 ? 3.512   -8.892  13.410  1.00 15.00 ?  332 ALA A O    8  
ATOM 6301  C CB   . ALA A 1 36 ? 4.323   -6.051  12.493  1.00 15.00 ?  332 ALA A CB   8  
ATOM 6302  H H    . ALA A 1 36 ? 4.433   -6.915  9.952   1.00 15.00 ?  332 ALA A H    8  
ATOM 6303  H HA   . ALA A 1 36 ? 5.659   -7.697  12.507  1.00 15.00 ?  332 ALA A HA   8  
ATOM 6304  H HB1  . ALA A 1 36 ? 5.095   -5.326  12.281  1.00 15.00 ?  332 ALA A HB1  8  
ATOM 6305  H HB2  . ALA A 1 36 ? 4.158   -6.098  13.560  1.00 15.00 ?  332 ALA A HB2  8  
ATOM 6306  H HB3  . ALA A 1 36 ? 3.408   -5.754  12.000  1.00 15.00 ?  332 ALA A HB3  8  
ATOM 6307  N N    . ASN A 1 37 ? 2.945   -8.849  11.235  1.00 15.00 ?  333 ASN A N    8  
ATOM 6308  C CA   . ASN A 1 37 ? 1.854   -9.802  11.399  1.00 15.00 ?  333 ASN A CA   8  
ATOM 6309  C C    . ASN A 1 37 ? 2.231   -11.144 10.780  1.00 15.00 ?  333 ASN A C    8  
ATOM 6310  O O    . ASN A 1 37 ? 3.151   -11.801 11.312  1.00 15.00 ?  333 ASN A O    8  
ATOM 6311  C CB   . ASN A 1 37 ? 0.576   -9.256  10.753  1.00 15.00 ?  333 ASN A CB   8  
ATOM 6312  C CG   . ASN A 1 37 ? -0.653  -10.093 11.069  1.00 15.00 ?  333 ASN A CG   8  
ATOM 6313  O OD1  . ASN A 1 37 ? -0.763  -10.686 12.145  1.00 15.00 ?  333 ASN A OD1  8  
ATOM 6314  N ND2  . ASN A 1 37 ? -1.588  -10.149 10.133  1.00 15.00 ?  333 ASN A ND2  8  
ATOM 6315  O OXT  . ASN A 1 37 ? 1.618   -11.541 9.767   1.00 15.00 ?  333 ASN A OXT  8  
ATOM 6316  H H    . ASN A 1 37 ? 3.148   -8.504  10.343  1.00 15.00 ?  333 ASN A H    8  
ATOM 6317  H HA   . ASN A 1 37 ? 1.685   -9.939  12.456  1.00 15.00 ?  333 ASN A HA   8  
ATOM 6318  H HB2  . ASN A 1 37 ? 0.403   -8.252  11.110  1.00 15.00 ?  333 ASN A HB2  8  
ATOM 6319  H HB3  . ASN A 1 37 ? 0.705   -9.233  9.681   1.00 15.00 ?  333 ASN A HB3  8  
ATOM 6320  H HD21 . ASN A 1 37 ? -1.436  -9.657  9.301   1.00 15.00 ?  333 ASN A HD21 8  
ATOM 6321  H HD22 . ASN A 1 37 ? -2.396  -10.678 10.312  1.00 15.00 ?  333 ASN A HD22 8  
ATOM 6322  N N    . GLU B 2 1  ? 3.693   -7.775  -6.625  1.00 15.00 ?  203 GLU B N    8  
ATOM 6323  C CA   . GLU B 2 1  ? 3.266   -8.504  -5.412  1.00 15.00 ?  203 GLU B CA   8  
ATOM 6324  C C    . GLU B 2 1  ? 2.943   -9.952  -5.762  1.00 15.00 ?  203 GLU B C    8  
ATOM 6325  O O    . GLU B 2 1  ? 2.268   -10.220 -6.755  1.00 15.00 ?  203 GLU B O    8  
ATOM 6326  C CB   . GLU B 2 1  ? 2.033   -7.828  -4.783  1.00 15.00 ?  203 GLU B CB   8  
ATOM 6327  C CG   . GLU B 2 1  ? 2.068   -6.309  -4.840  1.00 15.00 ?  203 GLU B CG   8  
ATOM 6328  C CD   . GLU B 2 1  ? 3.345   -5.742  -4.270  1.00 15.00 ?  203 GLU B CD   8  
ATOM 6329  O OE1  . GLU B 2 1  ? 4.340   -5.665  -5.017  1.00 15.00 -1 203 GLU B OE1  8  
ATOM 6330  O OE2  . GLU B 2 1  ? 3.362   -5.406  -3.074  1.00 15.00 ?  203 GLU B OE2  8  
ATOM 6331  H H1   . GLU B 2 1  ? 3.973   -6.803  -6.374  1.00 15.00 ?  203 GLU B H1   8  
ATOM 6332  H H2   . GLU B 2 1  ? 2.909   -7.733  -7.313  1.00 15.00 ?  203 GLU B H2   8  
ATOM 6333  H H3   . GLU B 2 1  ? 4.506   -8.259  -7.067  1.00 15.00 ?  203 GLU B H3   8  
ATOM 6334  H HA   . GLU B 2 1  ? 4.081   -8.490  -4.702  1.00 15.00 ?  203 GLU B HA   8  
ATOM 6335  H HB2  . GLU B 2 1  ? 1.143   -8.161  -5.293  1.00 15.00 ?  203 GLU B HB2  8  
ATOM 6336  H HB3  . GLU B 2 1  ? 1.970   -8.122  -3.747  1.00 15.00 ?  203 GLU B HB3  8  
ATOM 6337  H HG2  . GLU B 2 1  ? 1.982   -5.996  -5.870  1.00 15.00 ?  203 GLU B HG2  8  
ATOM 6338  H HG3  . GLU B 2 1  ? 1.233   -5.921  -4.275  1.00 15.00 ?  203 GLU B HG3  8  
ATOM 6339  N N    . LEU B 2 2  ? 3.432   -10.880 -4.945  1.00 15.00 ?  204 LEU B N    8  
ATOM 6340  C CA   . LEU B 2 2  ? 3.121   -12.299 -5.111  1.00 15.00 ?  204 LEU B CA   8  
ATOM 6341  C C    . LEU B 2 2  ? 1.656   -12.528 -4.740  1.00 15.00 ?  204 LEU B C    8  
ATOM 6342  O O    . LEU B 2 2  ? 1.026   -13.506 -5.146  1.00 15.00 ?  204 LEU B O    8  
ATOM 6343  C CB   . LEU B 2 2  ? 4.069   -13.143 -4.236  1.00 15.00 ?  204 LEU B CB   8  
ATOM 6344  C CG   . LEU B 2 2  ? 4.099   -14.660 -4.496  1.00 15.00 ?  204 LEU B CG   8  
ATOM 6345  C CD1  . LEU B 2 2  ? 2.960   -15.372 -3.781  1.00 15.00 ?  204 LEU B CD1  8  
ATOM 6346  C CD2  . LEU B 2 2  ? 4.054   -14.947 -5.990  1.00 15.00 ?  204 LEU B CD2  8  
ATOM 6347  H H    . LEU B 2 2  ? 4.023   -10.602 -4.203  1.00 15.00 ?  204 LEU B H    8  
ATOM 6348  H HA   . LEU B 2 2  ? 3.266   -12.555 -6.151  1.00 15.00 ?  204 LEU B HA   8  
ATOM 6349  H HB2  . LEU B 2 2  ? 5.072   -12.765 -4.374  1.00 15.00 ?  204 LEU B HB2  8  
ATOM 6350  H HB3  . LEU B 2 2  ? 3.792   -12.988 -3.204  1.00 15.00 ?  204 LEU B HB3  8  
ATOM 6351  H HG   . LEU B 2 2  ? 5.026   -15.060 -4.113  1.00 15.00 ?  204 LEU B HG   8  
ATOM 6352  H HD11 . LEU B 2 2  ? 3.006   -16.429 -3.992  1.00 15.00 ?  204 LEU B HD11 8  
ATOM 6353  H HD12 . LEU B 2 2  ? 2.015   -14.976 -4.124  1.00 15.00 ?  204 LEU B HD12 8  
ATOM 6354  H HD13 . LEU B 2 2  ? 3.049   -15.215 -2.716  1.00 15.00 ?  204 LEU B HD13 8  
ATOM 6355  H HD21 . LEU B 2 2  ? 4.071   -16.014 -6.153  1.00 15.00 ?  204 LEU B HD21 8  
ATOM 6356  H HD22 . LEU B 2 2  ? 4.910   -14.497 -6.469  1.00 15.00 ?  204 LEU B HD22 8  
ATOM 6357  H HD23 . LEU B 2 2  ? 3.149   -14.532 -6.410  1.00 15.00 ?  204 LEU B HD23 8  
ATOM 6358  N N    . GLU B 2 3  ? 1.139   -11.603 -3.949  1.00 15.00 ?  205 GLU B N    8  
ATOM 6359  C CA   . GLU B 2 3  ? -0.258  -11.593 -3.558  1.00 15.00 ?  205 GLU B CA   8  
ATOM 6360  C C    . GLU B 2 3  ? -1.120  -11.130 -4.733  1.00 15.00 ?  205 GLU B C    8  
ATOM 6361  O O    . GLU B 2 3  ? -0.636  -10.429 -5.622  1.00 15.00 ?  205 GLU B O    8  
ATOM 6362  C CB   . GLU B 2 3  ? -0.423  -10.656 -2.358  1.00 15.00 ?  205 GLU B CB   8  
ATOM 6363  C CG   . GLU B 2 3  ? -1.844  -10.544 -1.832  1.00 15.00 ?  205 GLU B CG   8  
ATOM 6364  C CD   . GLU B 2 3  ? -2.426  -11.879 -1.413  1.00 15.00 ?  205 GLU B CD   8  
ATOM 6365  O OE1  . GLU B 2 3  ? -2.270  -12.255 -0.233  1.00 15.00 ?  205 GLU B OE1  8  
ATOM 6366  O OE2  . GLU B 2 3  ? -3.053  -12.550 -2.262  1.00 15.00 -1 205 GLU B OE2  8  
ATOM 6367  H H    . GLU B 2 3  ? 1.721   -10.890 -3.622  1.00 15.00 ?  205 GLU B H    8  
ATOM 6368  H HA   . GLU B 2 3  ? -0.543  -12.595 -3.277  1.00 15.00 ?  205 GLU B HA   8  
ATOM 6369  H HB2  . GLU B 2 3  ? 0.202   -11.013 -1.554  1.00 15.00 ?  205 GLU B HB2  8  
ATOM 6370  H HB3  . GLU B 2 3  ? -0.091  -9.668  -2.644  1.00 15.00 ?  205 GLU B HB3  8  
ATOM 6371  H HG2  . GLU B 2 3  ? -1.841  -9.886  -0.978  1.00 15.00 ?  205 GLU B HG2  8  
ATOM 6372  H HG3  . GLU B 2 3  ? -2.470  -10.122 -2.606  1.00 15.00 ?  205 GLU B HG3  8  
ATOM 6373  N N    . SER B 2 4  ? -2.392  -11.520 -4.719  1.00 15.00 ?  206 SER B N    8  
ATOM 6374  C CA   . SER B 2 4  ? -3.338  -11.142 -5.765  1.00 15.00 ?  206 SER B CA   8  
ATOM 6375  C C    . SER B 2 4  ? -3.361  -9.638  -6.017  1.00 15.00 ?  206 SER B C    8  
ATOM 6376  O O    . SER B 2 4  ? -3.050  -8.828  -5.139  1.00 15.00 ?  206 SER B O    8  
ATOM 6377  C CB   . SER B 2 4  ? -4.736  -11.649 -5.437  1.00 15.00 ?  206 SER B CB   8  
ATOM 6378  O OG   . SER B 2 4  ? -4.957  -11.755 -4.039  1.00 15.00 ?  206 SER B OG   8  
ATOM 6379  H H    . SER B 2 4  ? -2.704  -12.074 -3.971  1.00 15.00 ?  206 SER B H    8  
ATOM 6380  H HA   . SER B 2 4  ? -3.031  -11.616 -6.687  1.00 15.00 ?  206 SER B HA   8  
ATOM 6381  H HB2  . SER B 2 4  ? -5.455  -10.958 -5.852  1.00 15.00 ?  206 SER B HB2  8  
ATOM 6382  H HB3  . SER B 2 4  ? -4.871  -12.614 -5.898  1.00 15.00 ?  206 SER B HB3  8  
ATOM 6383  H HG   . SER B 2 4  ? -4.229  -12.248 -3.630  1.00 15.00 ?  206 SER B HG   8  
ATOM 6384  N N    . PRO B 2 5  ? -3.796  -9.288  -7.231  1.00 15.00 ?  207 PRO B N    8  
ATOM 6385  C CA   . PRO B 2 5  ? -3.729  -7.931  -7.782  1.00 15.00 ?  207 PRO B CA   8  
ATOM 6386  C C    . PRO B 2 5  ? -4.264  -6.861  -6.826  1.00 15.00 ?  207 PRO B C    8  
ATOM 6387  O O    . PRO B 2 5  ? -5.426  -6.901  -6.416  1.00 15.00 ?  207 PRO B O    8  
ATOM 6388  C CB   . PRO B 2 5  ? -4.608  -8.001  -9.044  1.00 15.00 ?  207 PRO B CB   8  
ATOM 6389  C CG   . PRO B 2 5  ? -5.211  -9.373  -9.076  1.00 15.00 ?  207 PRO B CG   8  
ATOM 6390  C CD   . PRO B 2 5  ? -4.387  -10.236 -8.166  1.00 15.00 ?  207 PRO B CD   8  
ATOM 6391  H HA   . PRO B 2 5  ? -2.724  -7.681  -8.072  1.00 15.00 ?  207 PRO B HA   8  
ATOM 6392  H HB2  . PRO B 2 5  ? -5.373  -7.242  -8.988  1.00 15.00 ?  207 PRO B HB2  8  
ATOM 6393  H HB3  . PRO B 2 5  ? -3.993  -7.825  -9.913  1.00 15.00 ?  207 PRO B HB3  8  
ATOM 6394  H HG2  . PRO B 2 5  ? -6.231  -9.333  -8.725  1.00 15.00 ?  207 PRO B HG2  8  
ATOM 6395  H HG3  . PRO B 2 5  ? -5.180  -9.761  -10.085 1.00 15.00 ?  207 PRO B HG3  8  
ATOM 6396  H HD2  . PRO B 2 5  ? -5.000  -10.943 -7.634  1.00 15.00 ?  207 PRO B HD2  8  
ATOM 6397  H HD3  . PRO B 2 5  ? -3.629  -10.764 -8.700  1.00 15.00 ?  207 PRO B HD3  8  
ATOM 6398  N N    . PRO B 2 6  ? -3.403  -5.895  -6.452  1.00 15.00 ?  208 PRO B N    8  
ATOM 6399  C CA   . PRO B 2 6  ? -3.772  -4.798  -5.566  1.00 15.00 ?  208 PRO B CA   8  
ATOM 6400  C C    . PRO B 2 6  ? -4.439  -3.637  -6.309  1.00 15.00 ?  208 PRO B C    8  
ATOM 6401  O O    . PRO B 2 6  ? -4.484  -3.619  -7.541  1.00 15.00 ?  208 PRO B O    8  
ATOM 6402  C CB   . PRO B 2 6  ? -2.424  -4.348  -4.969  1.00 15.00 ?  208 PRO B CB   8  
ATOM 6403  C CG   . PRO B 2 6  ? -1.361  -5.157  -5.642  1.00 15.00 ?  208 PRO B CG   8  
ATOM 6404  C CD   . PRO B 2 6  ? -1.992  -5.808  -6.836  1.00 15.00 ?  208 PRO B CD   8  
ATOM 6405  H HA   . PRO B 2 6  ? -4.422  -5.134  -4.772  1.00 15.00 ?  208 PRO B HA   8  
ATOM 6406  H HB2  . PRO B 2 6  ? -2.286  -3.293  -5.157  1.00 15.00 ?  208 PRO B HB2  8  
ATOM 6407  H HB3  . PRO B 2 6  ? -2.433  -4.527  -3.900  1.00 15.00 ?  208 PRO B HB3  8  
ATOM 6408  H HG2  . PRO B 2 6  ? -0.556  -4.510  -5.955  1.00 15.00 ?  208 PRO B HG2  8  
ATOM 6409  H HG3  . PRO B 2 6  ? -0.991  -5.909  -4.960  1.00 15.00 ?  208 PRO B HG3  8  
ATOM 6410  H HD2  . PRO B 2 6  ? -1.864  -5.194  -7.715  1.00 15.00 ?  208 PRO B HD2  8  
ATOM 6411  H HD3  . PRO B 2 6  ? -1.566  -6.786  -6.988  1.00 15.00 ?  208 PRO B HD3  8  
ATOM 6412  N N    . PRO B 2 7  ? -4.972  -2.662  -5.548  1.00 15.00 ?  209 PRO B N    8  
ATOM 6413  C CA   . PRO B 2 7  ? -5.578  -1.440  -6.100  1.00 15.00 ?  209 PRO B CA   8  
ATOM 6414  C C    . PRO B 2 7  ? -4.681  -0.743  -7.134  1.00 15.00 ?  209 PRO B C    8  
ATOM 6415  O O    . PRO B 2 7  ? -3.488  -0.550  -6.892  1.00 15.00 ?  209 PRO B O    8  
ATOM 6416  C CB   . PRO B 2 7  ? -5.731  -0.537  -4.870  1.00 15.00 ?  209 PRO B CB   8  
ATOM 6417  C CG   . PRO B 2 7  ? -5.766  -1.448  -3.694  1.00 15.00 ?  209 PRO B CG   8  
ATOM 6418  C CD   . PRO B 2 7  ? -5.037  -2.701  -4.077  1.00 15.00 ?  209 PRO B CD   8  
ATOM 6419  H HA   . PRO B 2 7  ? -6.547  -1.637  -6.533  1.00 15.00 ?  209 PRO B HA   8  
ATOM 6420  H HB2  . PRO B 2 7  ? -4.892  0.139   -4.814  1.00 15.00 ?  209 PRO B HB2  8  
ATOM 6421  H HB3  . PRO B 2 7  ? -6.645  0.030   -4.943  1.00 15.00 ?  209 PRO B HB3  8  
ATOM 6422  H HG2  . PRO B 2 7  ? -5.271  -0.976  -2.858  1.00 15.00 ?  209 PRO B HG2  8  
ATOM 6423  H HG3  . PRO B 2 7  ? -6.791  -1.675  -3.438  1.00 15.00 ?  209 PRO B HG3  8  
ATOM 6424  H HD2  . PRO B 2 7  ? -4.043  -2.699  -3.654  1.00 15.00 ?  209 PRO B HD2  8  
ATOM 6425  H HD3  . PRO B 2 7  ? -5.584  -3.569  -3.741  1.00 15.00 ?  209 PRO B HD3  8  
ATOM 6426  N N    . PRO B 2 8  ? -5.246  -0.347  -8.295  1.00 15.00 ?  210 PRO B N    8  
ATOM 6427  C CA   . PRO B 2 8  ? -4.508  0.403   -9.325  1.00 15.00 ?  210 PRO B CA   8  
ATOM 6428  C C    . PRO B 2 8  ? -3.935  1.700   -8.759  1.00 15.00 ?  210 PRO B C    8  
ATOM 6429  O O    . PRO B 2 8  ? -4.565  2.341   -7.912  1.00 15.00 ?  210 PRO B O    8  
ATOM 6430  C CB   . PRO B 2 8  ? -5.566  0.699   -10.396 1.00 15.00 ?  210 PRO B CB   8  
ATOM 6431  C CG   . PRO B 2 8  ? -6.882  0.463   -9.733  1.00 15.00 ?  210 PRO B CG   8  
ATOM 6432  C CD   . PRO B 2 8  ? -6.641  -0.591  -8.692  1.00 15.00 ?  210 PRO B CD   8  
ATOM 6433  H HA   . PRO B 2 8  ? -3.709  -0.188  -9.750  1.00 15.00 ?  210 PRO B HA   8  
ATOM 6434  H HB2  . PRO B 2 8  ? -5.469  1.724   -10.723 1.00 15.00 ?  210 PRO B HB2  8  
ATOM 6435  H HB3  . PRO B 2 8  ? -5.426  0.034   -11.235 1.00 15.00 ?  210 PRO B HB3  8  
ATOM 6436  H HG2  . PRO B 2 8  ? -7.228  1.376   -9.269  1.00 15.00 ?  210 PRO B HG2  8  
ATOM 6437  H HG3  . PRO B 2 8  ? -7.602  0.115   -10.459 1.00 15.00 ?  210 PRO B HG3  8  
ATOM 6438  H HD2  . PRO B 2 8  ? -7.311  -0.454  -7.857  1.00 15.00 ?  210 PRO B HD2  8  
ATOM 6439  H HD3  . PRO B 2 8  ? -6.756  -1.576  -9.116  1.00 15.00 ?  210 PRO B HD3  8  
ATOM 6440  N N    . TYR B 2 9  ? -2.760  2.102   -9.239  1.00 15.00 ?  211 TYR B N    8  
ATOM 6441  C CA   . TYR B 2 9  ? -2.041  3.208   -8.620  1.00 15.00 ?  211 TYR B CA   8  
ATOM 6442  C C    . TYR B 2 9  ? -2.713  4.563   -8.837  1.00 15.00 ?  211 TYR B C    8  
ATOM 6443  O O    . TYR B 2 9  ? -2.556  5.208   -9.877  1.00 15.00 ?  211 TYR B O    8  
ATOM 6444  C CB   . TYR B 2 9  ? -0.583  3.290   -9.074  1.00 15.00 ?  211 TYR B CB   8  
ATOM 6445  C CG   . TYR B 2 9  ? 0.195   4.342   -8.305  1.00 15.00 ?  211 TYR B CG   8  
ATOM 6446  C CD1  . TYR B 2 9  ? 0.512   4.147   -6.966  1.00 15.00 ?  211 TYR B CD1  8  
ATOM 6447  C CD2  . TYR B 2 9  ? 0.598   5.529   -8.905  1.00 15.00 ?  211 TYR B CD2  8  
ATOM 6448  C CE1  . TYR B 2 9  ? 1.207   5.103   -6.250  1.00 15.00 ?  211 TYR B CE1  8  
ATOM 6449  C CE2  . TYR B 2 9  ? 1.294   6.486   -8.188  1.00 15.00 ?  211 TYR B CE2  8  
ATOM 6450  C CZ   . TYR B 2 9  ? 1.591   6.267   -6.870  1.00 15.00 ?  211 TYR B CZ   8  
ATOM 6451  O OH   . TYR B 2 9  ? 2.291   7.222   -6.178  1.00 15.00 ?  211 TYR B OH   8  
ATOM 6452  H H    . TYR B 2 9  ? -2.373  1.646   -10.021 1.00 15.00 ?  211 TYR B H    8  
ATOM 6453  H HA   . TYR B 2 9  ? -2.039  3.010   -7.558  1.00 15.00 ?  211 TYR B HA   8  
ATOM 6454  H HB2  . TYR B 2 9  ? -0.103  2.334   -8.921  1.00 15.00 ?  211 TYR B HB2  8  
ATOM 6455  H HB3  . TYR B 2 9  ? -0.548  3.546   -10.122 1.00 15.00 ?  211 TYR B HB3  8  
ATOM 6456  H HD1  . TYR B 2 9  ? 0.206   3.233   -6.483  1.00 15.00 ?  211 TYR B HD1  8  
ATOM 6457  H HD2  . TYR B 2 9  ? 0.364   5.699   -9.946  1.00 15.00 ?  211 TYR B HD2  8  
ATOM 6458  H HE1  . TYR B 2 9  ? 1.445   4.934   -5.209  1.00 15.00 ?  211 TYR B HE1  8  
ATOM 6459  H HE2  . TYR B 2 9  ? 1.599   7.406   -8.656  1.00 15.00 ?  211 TYR B HE2  8  
ATOM 6460  H HH   . TYR B 2 9  ? 2.169   8.085   -6.613  1.00 15.00 ?  211 TYR B HH   8  
ATOM 6461  N N    . SER B 2 10 ? -3.499  4.938   -7.853  1.00 15.00 ?  212 SER B N    8  
ATOM 6462  C CA   . SER B 2 10 ? -3.927  6.305   -7.650  1.00 15.00 ?  212 SER B CA   8  
ATOM 6463  C C    . SER B 2 10 ? -3.263  6.744   -6.356  1.00 15.00 ?  212 SER B C    8  
ATOM 6464  O O    . SER B 2 10 ? -3.013  5.892   -5.505  1.00 15.00 ?  212 SER B O    8  
ATOM 6465  C CB   . SER B 2 10 ? -5.454  6.401   -7.553  1.00 15.00 ?  212 SER B CB   8  
ATOM 6466  O OG   . SER B 2 10 ? -5.880  7.752   -7.640  1.00 15.00 ?  212 SER B OG   8  
ATOM 6467  H H    . SER B 2 10 ? -3.817  4.255   -7.223  1.00 15.00 ?  212 SER B H    8  
ATOM 6468  H HA   . SER B 2 10 ? -3.563  6.910   -8.469  1.00 15.00 ?  212 SER B HA   8  
ATOM 6469  H HB2  . SER B 2 10 ? -5.900  5.842   -8.361  1.00 15.00 ?  212 SER B HB2  8  
ATOM 6470  H HB3  . SER B 2 10 ? -5.781  5.993   -6.607  1.00 15.00 ?  212 SER B HB3  8  
ATOM 6471  H HG   . SER B 2 10 ? -6.670  7.882   -7.090  1.00 15.00 ?  212 SER B HG   8  
ATOM 6472  N N    . ARG B 2 11 ? -2.962  8.030   -6.186  1.00 15.00 ?  213 ARG B N    8  
ATOM 6473  C CA   . ARG B 2 11 ? -2.134  8.440   -5.053  1.00 15.00 ?  213 ARG B CA   8  
ATOM 6474  C C    . ARG B 2 11 ? -2.815  8.031   -3.758  1.00 15.00 ?  213 ARG B C    8  
ATOM 6475  O O    . ARG B 2 11 ? -2.201  7.414   -2.890  1.00 15.00 ?  213 ARG B O    8  
ATOM 6476  C CB   . ARG B 2 11 ? -1.928  9.960   -4.997  1.00 15.00 ?  213 ARG B CB   8  
ATOM 6477  C CG   . ARG B 2 11 ? -1.487  10.617  -6.281  1.00 15.00 ?  213 ARG B CG   8  
ATOM 6478  C CD   . ARG B 2 11 ? -1.221  12.104  -6.089  1.00 15.00 ?  213 ARG B CD   8  
ATOM 6479  N NE   . ARG B 2 11 ? -2.333  12.790  -5.424  1.00 15.00 ?  213 ARG B NE   8  
ATOM 6480  C CZ   . ARG B 2 11 ? -3.148  13.659  -6.024  1.00 15.00 ?  213 ARG B CZ   8  
ATOM 6481  N NH1  . ARG B 2 11 ? -3.024  13.911  -7.322  1.00 15.00 1  213 ARG B NH1  8  
ATOM 6482  N NH2  . ARG B 2 11 ? -4.088  14.277  -5.318  1.00 15.00 ?  213 ARG B NH2  8  
ATOM 6483  H H    . ARG B 2 11 ? -3.304  8.699   -6.814  1.00 15.00 ?  213 ARG B H    8  
ATOM 6484  H HA   . ARG B 2 11 ? -1.177  7.946   -5.128  1.00 15.00 ?  213 ARG B HA   8  
ATOM 6485  H HB2  . ARG B 2 11 ? -2.859  10.419  -4.697  1.00 15.00 ?  213 ARG B HB2  8  
ATOM 6486  H HB3  . ARG B 2 11 ? -1.184  10.173  -4.241  1.00 15.00 ?  213 ARG B HB3  8  
ATOM 6487  H HG2  . ARG B 2 11 ? -0.584  10.146  -6.617  1.00 15.00 ?  213 ARG B HG2  8  
ATOM 6488  H HG3  . ARG B 2 11 ? -2.263  10.496  -7.010  1.00 15.00 ?  213 ARG B HG3  8  
ATOM 6489  H HD2  . ARG B 2 11 ? -0.331  12.222  -5.490  1.00 15.00 ?  213 ARG B HD2  8  
ATOM 6490  H HD3  . ARG B 2 11 ? -1.063  12.554  -7.059  1.00 15.00 ?  213 ARG B HD3  8  
ATOM 6491  H HE   . ARG B 2 11 ? -2.465  12.609  -4.467  1.00 15.00 ?  213 ARG B HE   8  
ATOM 6492  H HH11 . ARG B 2 11 ? -2.310  13.449  -7.867  1.00 15.00 ?  213 ARG B HH11 8  
ATOM 6493  H HH12 . ARG B 2 11 ? -3.644  14.570  -7.775  1.00 15.00 ?  213 ARG B HH12 8  
ATOM 6494  H HH21 . ARG B 2 11 ? -4.180  14.097  -4.330  1.00 15.00 ?  213 ARG B HH21 8  
ATOM 6495  H HH22 . ARG B 2 11 ? -4.718  14.928  -5.764  1.00 15.00 ?  213 ARG B HH22 8  
ATOM 6496  N N    . TYR B 2 12 ? -4.068  8.420   -3.617  1.00 15.00 ?  214 TYR B N    8  
ATOM 6497  C CA   . TYR B 2 12 ? -4.857  8.052   -2.457  1.00 15.00 ?  214 TYR B CA   8  
ATOM 6498  C C    . TYR B 2 12 ? -6.081  7.274   -2.904  1.00 15.00 ?  214 TYR B C    8  
ATOM 6499  O O    . TYR B 2 12 ? -7.143  7.847   -3.153  1.00 15.00 ?  214 TYR B O    8  
ATOM 6500  C CB   . TYR B 2 12 ? -5.224  9.307   -1.643  1.00 15.00 ?  214 TYR B CB   8  
ATOM 6501  C CG   . TYR B 2 12 ? -4.017  10.192  -1.409  1.00 15.00 ?  214 TYR B CG   8  
ATOM 6502  C CD1  . TYR B 2 12 ? -3.454  10.898  -2.459  1.00 15.00 ?  214 TYR B CD1  8  
ATOM 6503  C CD2  . TYR B 2 12 ? -3.405  10.268  -0.169  1.00 15.00 ?  214 TYR B CD2  8  
ATOM 6504  C CE1  . TYR B 2 12 ? -2.317  11.650  -2.299  1.00 15.00 ?  214 TYR B CE1  8  
ATOM 6505  C CE2  . TYR B 2 12 ? -2.269  11.035  0.014   1.00 15.00 ?  214 TYR B CE2  8  
ATOM 6506  C CZ   . TYR B 2 12 ? -1.727  11.720  -1.056  1.00 15.00 ?  214 TYR B CZ   8  
ATOM 6507  O OH   . TYR B 2 12 ? -0.583  12.462  -0.879  1.00 15.00 ?  214 TYR B OH   8  
ATOM 6508  H H    . TYR B 2 12 ? -4.484  8.971   -4.324  1.00 15.00 ?  214 TYR B H    8  
ATOM 6509  H HA   . TYR B 2 12 ? -4.248  7.395   -1.843  1.00 15.00 ?  214 TYR B HA   8  
ATOM 6510  H HB2  . TYR B 2 12 ? -5.966  9.880   -2.180  1.00 15.00 ?  214 TYR B HB2  8  
ATOM 6511  H HB3  . TYR B 2 12 ? -5.620  9.011   -0.683  1.00 15.00 ?  214 TYR B HB3  8  
ATOM 6512  H HD1  . TYR B 2 12 ? -3.922  10.844  -3.431  1.00 15.00 ?  214 TYR B HD1  8  
ATOM 6513  H HD2  . TYR B 2 12 ? -3.832  9.730   0.665   1.00 15.00 ?  214 TYR B HD2  8  
ATOM 6514  H HE1  . TYR B 2 12 ? -1.897  12.173  -3.157  1.00 15.00 ?  214 TYR B HE1  8  
ATOM 6515  H HE2  . TYR B 2 12 ? -1.805  11.089  0.988   1.00 15.00 ?  214 TYR B HE2  8  
ATOM 6516  H HH   . TYR B 2 12 ? 0.062   11.928  -0.376  1.00 15.00 ?  214 TYR B HH   8  
ATOM 6517  N N    . PRO B 2 13 ? -5.915  5.961   -3.083  1.00 15.00 ?  215 PRO B N    8  
ATOM 6518  C CA   . PRO B 2 13 ? -6.988  5.089   -3.546  1.00 15.00 ?  215 PRO B CA   8  
ATOM 6519  C C    . PRO B 2 13 ? -8.034  4.887   -2.459  1.00 15.00 ?  215 PRO B C    8  
ATOM 6520  O O    . PRO B 2 13 ? -7.732  4.369   -1.387  1.00 15.00 ?  215 PRO B O    8  
ATOM 6521  C CB   . PRO B 2 13 ? -6.266  3.779   -3.879  1.00 15.00 ?  215 PRO B CB   8  
ATOM 6522  C CG   . PRO B 2 13 ? -5.027  3.792   -3.046  1.00 15.00 ?  215 PRO B CG   8  
ATOM 6523  C CD   . PRO B 2 13 ? -4.662  5.230   -2.833  1.00 15.00 ?  215 PRO B CD   8  
ATOM 6524  H HA   . PRO B 2 13 ? -7.462  5.482   -4.435  1.00 15.00 ?  215 PRO B HA   8  
ATOM 6525  H HB2  . PRO B 2 13 ? -6.903  2.945   -3.627  1.00 15.00 ?  215 PRO B HB2  8  
ATOM 6526  H HB3  . PRO B 2 13 ? -6.031  3.752   -4.932  1.00 15.00 ?  215 PRO B HB3  8  
ATOM 6527  H HG2  . PRO B 2 13 ? -5.224  3.317   -2.095  1.00 15.00 ?  215 PRO B HG2  8  
ATOM 6528  H HG3  . PRO B 2 13 ? -4.224  3.280   -3.558  1.00 15.00 ?  215 PRO B HG3  8  
ATOM 6529  H HD2  . PRO B 2 13 ? -4.324  5.383   -1.819  1.00 15.00 ?  215 PRO B HD2  8  
ATOM 6530  H HD3  . PRO B 2 13 ? -3.898  5.529   -3.535  1.00 15.00 ?  215 PRO B HD3  8  
ATOM 6531  N N    . MET B 2 14 ? -9.257  5.316   -2.729  1.00 15.00 ?  216 MET B N    8  
ATOM 6532  C CA   . MET B 2 14 ? -10.298 5.318   -1.713  1.00 15.00 ?  216 MET B CA   8  
ATOM 6533  C C    . MET B 2 14 ? -10.979 3.959   -1.614  1.00 15.00 ?  216 MET B C    8  
ATOM 6534  O O    . MET B 2 14 ? -11.430 3.391   -2.612  1.00 15.00 ?  216 MET B O    8  
ATOM 6535  C CB   . MET B 2 14 ? -11.329 6.422   -1.984  1.00 15.00 ?  216 MET B CB   8  
ATOM 6536  C CG   . MET B 2 14 ? -12.073 6.284   -3.302  1.00 15.00 ?  216 MET B CG   8  
ATOM 6537  S SD   . MET B 2 14 ? -13.297 7.586   -3.535  1.00 15.00 ?  216 MET B SD   8  
ATOM 6538  C CE   . MET B 2 14 ? -13.954 7.146   -5.142  1.00 15.00 ?  216 MET B CE   8  
ATOM 6539  H H    . MET B 2 14 ? -9.468  5.620   -3.643  1.00 15.00 ?  216 MET B H    8  
ATOM 6540  H HA   . MET B 2 14 ? -9.819  5.523   -0.767  1.00 15.00 ?  216 MET B HA   8  
ATOM 6541  H HB2  . MET B 2 14 ? -12.056 6.416   -1.188  1.00 15.00 ?  216 MET B HB2  8  
ATOM 6542  H HB3  . MET B 2 14 ? -10.820 7.375   -1.984  1.00 15.00 ?  216 MET B HB3  8  
ATOM 6543  H HG2  . MET B 2 14 ? -11.360 6.333   -4.112  1.00 15.00 ?  216 MET B HG2  8  
ATOM 6544  H HG3  . MET B 2 14 ? -12.575 5.328   -3.323  1.00 15.00 ?  216 MET B HG3  8  
ATOM 6545  H HE1  . MET B 2 14 ? -14.728 7.846   -5.419  1.00 15.00 ?  216 MET B HE1  8  
ATOM 6546  H HE2  . MET B 2 14 ? -14.368 6.150   -5.101  1.00 15.00 ?  216 MET B HE2  8  
ATOM 6547  H HE3  . MET B 2 14 ? -13.162 7.176   -5.876  1.00 15.00 ?  216 MET B HE3  8  
ATOM 6548  N N    . ASP B 2 15 ? -11.042 3.453   -0.393  1.00 15.00 ?  217 ASP B N    8  
ATOM 6549  C CA   . ASP B 2 15 ? -11.686 2.182   -0.105  1.00 15.00 ?  217 ASP B CA   8  
ATOM 6550  C C    . ASP B 2 15 ? -12.174 2.193   1.332   1.00 15.00 ?  217 ASP B C    8  
ATOM 6551  O O    . ASP B 2 15 ? -13.401 2.237   1.545   1.00 15.00 ?  217 ASP B O    8  
ATOM 6552  C CB   . ASP B 2 15 ? -10.726 1.010   -0.327  1.00 15.00 ?  217 ASP B CB   8  
ATOM 6553  C CG   . ASP B 2 15 ? -11.411 -0.334  -0.162  1.00 15.00 ?  217 ASP B CG   8  
ATOM 6554  O OD1  . ASP B 2 15 ? -12.175 -0.725  -1.073  1.00 15.00 -1 217 ASP B OD1  8  
ATOM 6555  O OD2  . ASP B 2 15 ? -11.182 -1.005  0.864   1.00 15.00 ?  217 ASP B OD2  8  
ATOM 6556  O OXT  . ASP B 2 15 ? -11.318 2.238   2.244   1.00 15.00 ?  217 ASP B OXT  8  
ATOM 6557  H H    . ASP B 2 15 ? -10.649 3.957   0.348   1.00 15.00 ?  217 ASP B H    8  
ATOM 6558  H HA   . ASP B 2 15 ? -12.535 2.080   -0.765  1.00 15.00 ?  217 ASP B HA   8  
ATOM 6559  H HB2  . ASP B 2 15 ? -10.322 1.068   -1.326  1.00 15.00 ?  217 ASP B HB2  8  
ATOM 6560  H HB3  . ASP B 2 15 ? -9.919  1.074   0.388   1.00 15.00 ?  217 ASP B HB3  8  
ATOM 6561  N N    . GLY A 1 1  ? 3.230   9.043   12.337  1.00 15.00 ?  297 GLY A N    9  
ATOM 6562  C CA   . GLY A 1 1  ? 3.412   7.635   12.769  1.00 15.00 ?  297 GLY A CA   9  
ATOM 6563  C C    . GLY A 1 1  ? 4.739   7.072   12.309  1.00 15.00 ?  297 GLY A C    9  
ATOM 6564  O O    . GLY A 1 1  ? 5.581   7.818   11.813  1.00 15.00 ?  297 GLY A O    9  
ATOM 6565  H H1   . GLY A 1 1  ? 4.012   9.633   12.698  1.00 15.00 ?  297 GLY A H1   9  
ATOM 6566  H H2   . GLY A 1 1  ? 2.331   9.416   12.704  1.00 15.00 ?  297 GLY A H2   9  
ATOM 6567  H H3   . GLY A 1 1  ? 3.217   9.100   11.298  1.00 15.00 ?  297 GLY A H3   9  
ATOM 6568  H HA2  . GLY A 1 1  ? 3.368   7.590   13.847  1.00 15.00 ?  297 GLY A HA2  9  
ATOM 6569  H HA3  . GLY A 1 1  ? 2.614   7.035   12.359  1.00 15.00 ?  297 GLY A HA3  9  
ATOM 6570  N N    . PRO A 1 2  ? 4.956   5.754   12.459  1.00 15.00 ?  298 PRO A N    9  
ATOM 6571  C CA   . PRO A 1 2  ? 6.204   5.104   12.053  1.00 15.00 ?  298 PRO A CA   9  
ATOM 6572  C C    . PRO A 1 2  ? 6.298   4.904   10.541  1.00 15.00 ?  298 PRO A C    9  
ATOM 6573  O O    . PRO A 1 2  ? 7.279   4.357   10.037  1.00 15.00 ?  298 PRO A O    9  
ATOM 6574  C CB   . PRO A 1 2  ? 6.147   3.758   12.773  1.00 15.00 ?  298 PRO A CB   9  
ATOM 6575  C CG   . PRO A 1 2  ? 4.693   3.461   12.892  1.00 15.00 ?  298 PRO A CG   9  
ATOM 6576  C CD   . PRO A 1 2  ? 4.005   4.792   13.051  1.00 15.00 ?  298 PRO A CD   9  
ATOM 6577  H HA   . PRO A 1 2  ? 7.067   5.660   12.392  1.00 15.00 ?  298 PRO A HA   9  
ATOM 6578  H HB2  . PRO A 1 2  ? 6.659   3.010   12.186  1.00 15.00 ?  298 PRO A HB2  9  
ATOM 6579  H HB3  . PRO A 1 2  ? 6.613   3.844   13.743  1.00 15.00 ?  298 PRO A HB3  9  
ATOM 6580  H HG2  . PRO A 1 2  ? 4.347   2.965   11.998  1.00 15.00 ?  298 PRO A HG2  9  
ATOM 6581  H HG3  . PRO A 1 2  ? 4.516   2.842   13.759  1.00 15.00 ?  298 PRO A HG3  9  
ATOM 6582  H HD2  . PRO A 1 2  ? 3.068   4.798   12.515  1.00 15.00 ?  298 PRO A HD2  9  
ATOM 6583  H HD3  . PRO A 1 2  ? 3.842   5.008   14.098  1.00 15.00 ?  298 PRO A HD3  9  
ATOM 6584  N N    . LEU A 1 3  ? 5.258   5.322   9.830   1.00 15.00 ?  299 LEU A N    9  
ATOM 6585  C CA   . LEU A 1 3  ? 5.258   5.288   8.376   1.00 15.00 ?  299 LEU A CA   9  
ATOM 6586  C C    . LEU A 1 3  ? 6.401   6.143   7.839   1.00 15.00 ?  299 LEU A C    9  
ATOM 6587  O O    . LEU A 1 3  ? 6.544   7.304   8.232   1.00 15.00 ?  299 LEU A O    9  
ATOM 6588  C CB   . LEU A 1 3  ? 3.925   5.820   7.842   1.00 15.00 ?  299 LEU A CB   9  
ATOM 6589  C CG   . LEU A 1 3  ? 3.782   5.815   6.319   1.00 15.00 ?  299 LEU A CG   9  
ATOM 6590  C CD1  . LEU A 1 3  ? 3.615   4.395   5.799   1.00 15.00 ?  299 LEU A CD1  9  
ATOM 6591  C CD2  . LEU A 1 3  ? 2.616   6.687   5.889   1.00 15.00 ?  299 LEU A CD2  9  
ATOM 6592  H H    . LEU A 1 3  ? 4.469   5.665   10.298  1.00 15.00 ?  299 LEU A H    9  
ATOM 6593  H HA   . LEU A 1 3  ? 5.391   4.266   8.056   1.00 15.00 ?  299 LEU A HA   9  
ATOM 6594  H HB2  . LEU A 1 3  ? 3.129   5.219   8.259   1.00 15.00 ?  299 LEU A HB2  9  
ATOM 6595  H HB3  . LEU A 1 3  ? 3.802   6.836   8.188   1.00 15.00 ?  299 LEU A HB3  9  
ATOM 6596  H HG   . LEU A 1 3  ? 4.683   6.222   5.882   1.00 15.00 ?  299 LEU A HG   9  
ATOM 6597  H HD11 . LEU A 1 3  ? 2.717   3.963   6.216   1.00 15.00 ?  299 LEU A HD11 9  
ATOM 6598  H HD12 . LEU A 1 3  ? 4.468   3.801   6.092   1.00 15.00 ?  299 LEU A HD12 9  
ATOM 6599  H HD13 . LEU A 1 3  ? 3.540   4.413   4.722   1.00 15.00 ?  299 LEU A HD13 9  
ATOM 6600  H HD21 . LEU A 1 3  ? 1.705   6.315   6.334   1.00 15.00 ?  299 LEU A HD21 9  
ATOM 6601  H HD22 . LEU A 1 3  ? 2.527   6.663   4.812   1.00 15.00 ?  299 LEU A HD22 9  
ATOM 6602  H HD23 . LEU A 1 3  ? 2.787   7.703   6.213   1.00 15.00 ?  299 LEU A HD23 9  
ATOM 6603  N N    . PRO A 1 4  ? 7.232   5.593   6.943   1.00 15.00 ?  300 PRO A N    9  
ATOM 6604  C CA   . PRO A 1 4  ? 8.327   6.349   6.341   1.00 15.00 ?  300 PRO A CA   9  
ATOM 6605  C C    . PRO A 1 4  ? 7.786   7.401   5.373   1.00 15.00 ?  300 PRO A C    9  
ATOM 6606  O O    . PRO A 1 4  ? 6.825   7.142   4.652   1.00 15.00 ?  300 PRO A O    9  
ATOM 6607  C CB   . PRO A 1 4  ? 9.148   5.286   5.595   1.00 15.00 ?  300 PRO A CB   9  
ATOM 6608  C CG   . PRO A 1 4  ? 8.586   3.961   6.010   1.00 15.00 ?  300 PRO A CG   9  
ATOM 6609  C CD   . PRO A 1 4  ? 7.168   4.219   6.420   1.00 15.00 ?  300 PRO A CD   9  
ATOM 6610  H HA   . PRO A 1 4  ? 8.938   6.829   7.092   1.00 15.00 ?  300 PRO A HA   9  
ATOM 6611  H HB2  . PRO A 1 4  ? 9.048   5.442   4.535   1.00 15.00 ?  300 PRO A HB2  9  
ATOM 6612  H HB3  . PRO A 1 4  ? 10.187  5.375   5.875   1.00 15.00 ?  300 PRO A HB3  9  
ATOM 6613  H HG2  . PRO A 1 4  ? 8.614   3.271   5.177   1.00 15.00 ?  300 PRO A HG2  9  
ATOM 6614  H HG3  . PRO A 1 4  ? 9.152   3.568   6.842   1.00 15.00 ?  300 PRO A HG3  9  
ATOM 6615  H HD2  . PRO A 1 4  ? 6.513   4.161   5.562   1.00 15.00 ?  300 PRO A HD2  9  
ATOM 6616  H HD3  . PRO A 1 4  ? 6.858   3.519   7.183   1.00 15.00 ?  300 PRO A HD3  9  
ATOM 6617  N N    . PRO A 1 5  ? 8.412   8.592   5.322   1.00 15.00 ?  301 PRO A N    9  
ATOM 6618  C CA   . PRO A 1 5  ? 7.898   9.740   4.551   1.00 15.00 ?  301 PRO A CA   9  
ATOM 6619  C C    . PRO A 1 5  ? 7.829   9.498   3.039   1.00 15.00 ?  301 PRO A C    9  
ATOM 6620  O O    . PRO A 1 5  ? 7.288   10.321  2.299   1.00 15.00 ?  301 PRO A O    9  
ATOM 6621  C CB   . PRO A 1 5  ? 8.896   10.862  4.861   1.00 15.00 ?  301 PRO A CB   9  
ATOM 6622  C CG   . PRO A 1 5  ? 10.134  10.164  5.311   1.00 15.00 ?  301 PRO A CG   9  
ATOM 6623  C CD   . PRO A 1 5  ? 9.674   8.915   6.008   1.00 15.00 ?  301 PRO A CD   9  
ATOM 6624  H HA   . PRO A 1 5  ? 6.919   10.033  4.903   1.00 15.00 ?  301 PRO A HA   9  
ATOM 6625  H HB2  . PRO A 1 5  ? 9.073   11.444  3.969   1.00 15.00 ?  301 PRO A HB2  9  
ATOM 6626  H HB3  . PRO A 1 5  ? 8.499   11.497  5.638   1.00 15.00 ?  301 PRO A HB3  9  
ATOM 6627  H HG2  . PRO A 1 5  ? 10.744  9.913   4.455   1.00 15.00 ?  301 PRO A HG2  9  
ATOM 6628  H HG3  . PRO A 1 5  ? 10.684  10.794  5.993   1.00 15.00 ?  301 PRO A HG3  9  
ATOM 6629  H HD2  . PRO A 1 5  ? 10.397  8.124   5.881   1.00 15.00 ?  301 PRO A HD2  9  
ATOM 6630  H HD3  . PRO A 1 5  ? 9.505   9.109   7.057   1.00 15.00 ?  301 PRO A HD3  9  
ATOM 6631  N N    . GLY A 1 6  ? 8.408   8.397   2.580   1.00 15.00 ?  302 GLY A N    9  
ATOM 6632  C CA   . GLY A 1 6  ? 8.332   8.046   1.172   1.00 15.00 ?  302 GLY A CA   9  
ATOM 6633  C C    . GLY A 1 6  ? 7.187   7.095   0.889   1.00 15.00 ?  302 GLY A C    9  
ATOM 6634  O O    . GLY A 1 6  ? 6.791   6.899   -0.262  1.00 15.00 ?  302 GLY A O    9  
ATOM 6635  H H    . GLY A 1 6  ? 8.898   7.818   3.202   1.00 15.00 ?  302 GLY A H    9  
ATOM 6636  H HA2  . GLY A 1 6  ? 8.194   8.947   0.593   1.00 15.00 ?  302 GLY A HA2  9  
ATOM 6637  H HA3  . GLY A 1 6  ? 9.258   7.576   0.877   1.00 15.00 ?  302 GLY A HA3  9  
ATOM 6638  N N    . TRP A 1 7  ? 6.658   6.513   1.952   1.00 15.00 ?  303 TRP A N    9  
ATOM 6639  C CA   . TRP A 1 7  ? 5.660   5.463   1.853   1.00 15.00 ?  303 TRP A CA   9  
ATOM 6640  C C    . TRP A 1 7  ? 4.257   5.984   2.083   1.00 15.00 ?  303 TRP A C    9  
ATOM 6641  O O    . TRP A 1 7  ? 4.056   6.922   2.852   1.00 15.00 ?  303 TRP A O    9  
ATOM 6642  C CB   . TRP A 1 7  ? 5.954   4.377   2.863   1.00 15.00 ?  303 TRP A CB   9  
ATOM 6643  C CG   . TRP A 1 7  ? 6.979   3.422   2.390   1.00 15.00 ?  303 TRP A CG   9  
ATOM 6644  C CD1  . TRP A 1 7  ? 8.330   3.549   2.488   1.00 15.00 ?  303 TRP A CD1  9  
ATOM 6645  C CD2  . TRP A 1 7  ? 6.734   2.192   1.724   1.00 15.00 ?  303 TRP A CD2  9  
ATOM 6646  N NE1  . TRP A 1 7  ? 8.940   2.458   1.942   1.00 15.00 ?  303 TRP A NE1  9  
ATOM 6647  C CE2  . TRP A 1 7  ? 7.974   1.609   1.471   1.00 15.00 ?  303 TRP A CE2  9  
ATOM 6648  C CE3  . TRP A 1 7  ? 5.581   1.516   1.325   1.00 15.00 ?  303 TRP A CE3  9  
ATOM 6649  C CZ2  . TRP A 1 7  ? 8.090   0.391   0.841   1.00 15.00 ?  303 TRP A CZ2  9  
ATOM 6650  C CZ3  . TRP A 1 7  ? 5.707   0.303   0.697   1.00 15.00 ?  303 TRP A CZ3  9  
ATOM 6651  C CH2  . TRP A 1 7  ? 6.955   -0.251  0.464   1.00 15.00 ?  303 TRP A CH2  9  
ATOM 6652  H H    . TRP A 1 7  ? 6.925   6.820   2.844   1.00 15.00 ?  303 TRP A H    9  
ATOM 6653  H HA   . TRP A 1 7  ? 5.730   5.043   0.861   1.00 15.00 ?  303 TRP A HA   9  
ATOM 6654  H HB2  . TRP A 1 7  ? 6.312   4.828   3.778   1.00 15.00 ?  303 TRP A HB2  9  
ATOM 6655  H HB3  . TRP A 1 7  ? 5.049   3.825   3.067   1.00 15.00 ?  303 TRP A HB3  9  
ATOM 6656  H HD1  . TRP A 1 7  ? 8.830   4.390   2.936   1.00 15.00 ?  303 TRP A HD1  9  
ATOM 6657  H HE1  . TRP A 1 7  ? 9.910   2.309   1.896   1.00 15.00 ?  303 TRP A HE1  9  
ATOM 6658  H HE3  . TRP A 1 7  ? 4.601   1.928   1.488   1.00 15.00 ?  303 TRP A HE3  9  
ATOM 6659  H HZ2  . TRP A 1 7  ? 9.031   -0.037  0.647   1.00 15.00 ?  303 TRP A HZ2  9  
ATOM 6660  H HZ3  . TRP A 1 7  ? 4.829   -0.227  0.373   1.00 15.00 ?  303 TRP A HZ3  9  
ATOM 6661  H HH2  . TRP A 1 7  ? 7.011   -1.208  -0.017  1.00 15.00 ?  303 TRP A HH2  9  
ATOM 6662  N N    . GLU A 1 8  ? 3.284   5.340   1.453   1.00 15.00 ?  304 GLU A N    9  
ATOM 6663  C CA   . GLU A 1 8  ? 1.892   5.799   1.542   1.00 15.00 ?  304 GLU A CA   9  
ATOM 6664  C C    . GLU A 1 8  ? 0.949   4.641   1.876   1.00 15.00 ?  304 GLU A C    9  
ATOM 6665  O O    . GLU A 1 8  ? 0.675   3.793   1.044   1.00 15.00 ?  304 GLU A O    9  
ATOM 6666  C CB   . GLU A 1 8  ? 1.504   6.492   0.231   1.00 15.00 ?  304 GLU A CB   9  
ATOM 6667  C CG   . GLU A 1 8  ? 2.229   7.811   0.036   1.00 15.00 ?  304 GLU A CG   9  
ATOM 6668  C CD   . GLU A 1 8  ? 1.672   8.937   0.891   1.00 15.00 ?  304 GLU A CD   9  
ATOM 6669  O OE1  . GLU A 1 8  ? 1.821   8.899   2.126   1.00 15.00 -1 304 GLU A OE1  9  
ATOM 6670  O OE2  . GLU A 1 8  ? 1.096   9.886   0.316   1.00 15.00 ?  304 GLU A OE2  9  
ATOM 6671  H H    . GLU A 1 8  ? 3.507   4.519   0.923   1.00 15.00 ?  304 GLU A H    9  
ATOM 6672  H HA   . GLU A 1 8  ? 1.840   6.521   2.344   1.00 15.00 ?  304 GLU A HA   9  
ATOM 6673  H HB2  . GLU A 1 8  ? 1.762   5.842   -0.593  1.00 15.00 ?  304 GLU A HB2  9  
ATOM 6674  H HB3  . GLU A 1 8  ? 0.446   6.681   0.208   1.00 15.00 ?  304 GLU A HB3  9  
ATOM 6675  H HG2  . GLU A 1 8  ? 3.270   7.673   0.291   1.00 15.00 ?  304 GLU A HG2  9  
ATOM 6676  H HG3  . GLU A 1 8  ? 2.152   8.098   -1.003  1.00 15.00 ?  304 GLU A HG3  9  
ATOM 6677  N N    . ILE A 1 9  ? 0.456   4.610   3.106   1.00 15.00 ?  305 ILE A N    9  
ATOM 6678  C CA   . ILE A 1 9  ? -0.240  3.429   3.620   1.00 15.00 ?  305 ILE A CA   9  
ATOM 6679  C C    . ILE A 1 9  ? -1.767  3.517   3.510   1.00 15.00 ?  305 ILE A C    9  
ATOM 6680  O O    . ILE A 1 9  ? -2.381  4.502   3.930   1.00 15.00 ?  305 ILE A O    9  
ATOM 6681  C CB   . ILE A 1 9  ? 0.136   3.171   5.101   1.00 15.00 ?  305 ILE A CB   9  
ATOM 6682  C CG1  . ILE A 1 9  ? -0.645  1.975   5.661   1.00 15.00 ?  305 ILE A CG1  9  
ATOM 6683  C CG2  . ILE A 1 9  ? -0.112  4.415   5.949   1.00 15.00 ?  305 ILE A CG2  9  
ATOM 6684  C CD1  . ILE A 1 9  ? -0.347  1.673   7.115   1.00 15.00 ?  305 ILE A CD1  9  
ATOM 6685  H H    . ILE A 1 9  ? 0.557   5.396   3.680   1.00 15.00 ?  305 ILE A H    9  
ATOM 6686  H HA   . ILE A 1 9  ? 0.099   2.580   3.045   1.00 15.00 ?  305 ILE A HA   9  
ATOM 6687  H HB   . ILE A 1 9  ? 1.191   2.949   5.144   1.00 15.00 ?  305 ILE A HB   9  
ATOM 6688  H HG12 . ILE A 1 9  ? -1.704  2.174   5.578   1.00 15.00 ?  305 ILE A HG12 9  
ATOM 6689  H HG13 . ILE A 1 9  ? -0.403  1.094   5.081   1.00 15.00 ?  305 ILE A HG13 9  
ATOM 6690  H HG21 . ILE A 1 9  ? 0.145   4.206   6.977   1.00 15.00 ?  305 ILE A HG21 9  
ATOM 6691  H HG22 . ILE A 1 9  ? -1.155  4.690   5.887   1.00 15.00 ?  305 ILE A HG22 9  
ATOM 6692  H HG23 . ILE A 1 9  ? 0.498   5.228   5.583   1.00 15.00 ?  305 ILE A HG23 9  
ATOM 6693  H HD11 . ILE A 1 9  ? 0.704   1.444   7.227   1.00 15.00 ?  305 ILE A HD11 9  
ATOM 6694  H HD12 . ILE A 1 9  ? -0.936  0.826   7.435   1.00 15.00 ?  305 ILE A HD12 9  
ATOM 6695  H HD13 . ILE A 1 9  ? -0.595  2.533   7.719   1.00 15.00 ?  305 ILE A HD13 9  
ATOM 6696  N N    . ARG A 1 10 ? -2.373  2.475   2.935   1.00 15.00 ?  306 ARG A N    9  
ATOM 6697  C CA   . ARG A 1 10 ? -3.808  2.251   3.071   1.00 15.00 ?  306 ARG A CA   9  
ATOM 6698  C C    . ARG A 1 10 ? -4.106  0.762   3.220   1.00 15.00 ?  306 ARG A C    9  
ATOM 6699  O O    . ARG A 1 10 ? -3.566  -0.079  2.489   1.00 15.00 ?  306 ARG A O    9  
ATOM 6700  C CB   . ARG A 1 10 ? -4.623  2.787   1.892   1.00 15.00 ?  306 ARG A CB   9  
ATOM 6701  C CG   . ARG A 1 10 ? -4.672  4.298   1.774   1.00 15.00 ?  306 ARG A CG   9  
ATOM 6702  C CD   . ARG A 1 10 ? -5.982  4.746   1.146   1.00 15.00 ?  306 ARG A CD   9  
ATOM 6703  N NE   . ARG A 1 10 ? -7.097  4.676   2.100   1.00 15.00 ?  306 ARG A NE   9  
ATOM 6704  C CZ   . ARG A 1 10 ? -8.016  3.701   2.133   1.00 15.00 ?  306 ARG A CZ   9  
ATOM 6705  N NH1  . ARG A 1 10 ? -7.971  2.696   1.270   1.00 15.00 1  306 ARG A NH1  9  
ATOM 6706  N NH2  . ARG A 1 10 ? -8.994  3.742   3.028   1.00 15.00 ?  306 ARG A NH2  9  
ATOM 6707  H H    . ARG A 1 10 ? -1.843  1.843   2.398   1.00 15.00 ?  306 ARG A H    9  
ATOM 6708  H HA   . ARG A 1 10 ? -4.126  2.758   3.970   1.00 15.00 ?  306 ARG A HA   9  
ATOM 6709  H HB2  . ARG A 1 10 ? -4.200  2.396   0.979   1.00 15.00 ?  306 ARG A HB2  9  
ATOM 6710  H HB3  . ARG A 1 10 ? -5.637  2.424   1.985   1.00 15.00 ?  306 ARG A HB3  9  
ATOM 6711  H HG2  . ARG A 1 10 ? -4.580  4.735   2.757   1.00 15.00 ?  306 ARG A HG2  9  
ATOM 6712  H HG3  . ARG A 1 10 ? -3.858  4.625   1.147   1.00 15.00 ?  306 ARG A HG3  9  
ATOM 6713  H HD2  . ARG A 1 10 ? -5.874  5.766   0.805   1.00 15.00 ?  306 ARG A HD2  9  
ATOM 6714  H HD3  . ARG A 1 10 ? -6.201  4.107   0.303   1.00 15.00 ?  306 ARG A HD3  9  
ATOM 6715  H HE   . ARG A 1 10 ? -7.164  5.404   2.755   1.00 15.00 ?  306 ARG A HE   9  
ATOM 6716  H HH11 . ARG A 1 10 ? -7.245  2.654   0.573   1.00 15.00 ?  306 ARG A HH11 9  
ATOM 6717  H HH12 . ARG A 1 10 ? -8.666  1.957   1.309   1.00 15.00 ?  306 ARG A HH12 9  
ATOM 6718  H HH21 . ARG A 1 10 ? -9.052  4.502   3.684   1.00 15.00 ?  306 ARG A HH21 9  
ATOM 6719  H HH22 . ARG A 1 10 ? -9.682  3.005   3.061   1.00 15.00 ?  306 ARG A HH22 9  
ATOM 6720  N N    . ASN A 1 11 ? -4.984  0.443   4.156   1.00 15.00 ?  307 ASN A N    9  
ATOM 6721  C CA   . ASN A 1 11 ? -5.466  -0.916  4.322   1.00 15.00 ?  307 ASN A CA   9  
ATOM 6722  C C    . ASN A 1 11 ? -6.798  -1.055  3.575   1.00 15.00 ?  307 ASN A C    9  
ATOM 6723  O O    . ASN A 1 11 ? -7.703  -0.245  3.780   1.00 15.00 ?  307 ASN A O    9  
ATOM 6724  C CB   . ASN A 1 11 ? -5.658  -1.223  5.816   1.00 15.00 ?  307 ASN A CB   9  
ATOM 6725  C CG   . ASN A 1 11 ? -5.913  -2.696  6.106   1.00 15.00 ?  307 ASN A CG   9  
ATOM 6726  O OD1  . ASN A 1 11 ? -6.473  -3.427  5.292   1.00 15.00 ?  307 ASN A OD1  9  
ATOM 6727  N ND2  . ASN A 1 11 ? -5.505  -3.144  7.284   1.00 15.00 ?  307 ASN A ND2  9  
ATOM 6728  H H    . ASN A 1 11 ? -5.329  1.143   4.749   1.00 15.00 ?  307 ASN A H    9  
ATOM 6729  H HA   . ASN A 1 11 ? -4.728  -1.587  3.906   1.00 15.00 ?  307 ASN A HA   9  
ATOM 6730  H HB2  . ASN A 1 11 ? -4.770  -0.923  6.352   1.00 15.00 ?  307 ASN A HB2  9  
ATOM 6731  H HB3  . ASN A 1 11 ? -6.500  -0.654  6.184   1.00 15.00 ?  307 ASN A HB3  9  
ATOM 6732  H HD21 . ASN A 1 11 ? -5.069  -2.512  7.898   1.00 15.00 ?  307 ASN A HD21 9  
ATOM 6733  H HD22 . ASN A 1 11 ? -5.653  -4.088  7.496   1.00 15.00 ?  307 ASN A HD22 9  
ATOM 6734  N N    . THR A 1 12 ? -6.931  -2.066  2.723   1.00 15.00 ?  308 THR A N    9  
ATOM 6735  C CA   . THR A 1 12 ? -8.168  -2.269  1.989   1.00 15.00 ?  308 THR A CA   9  
ATOM 6736  C C    . THR A 1 12 ? -9.091  -3.163  2.800   1.00 15.00 ?  308 THR A C    9  
ATOM 6737  O O    . THR A 1 12 ? -8.625  -4.104  3.453   1.00 15.00 ?  308 THR A O    9  
ATOM 6738  C CB   . THR A 1 12 ? -7.912  -2.913  0.608   1.00 15.00 ?  308 THR A CB   9  
ATOM 6739  O OG1  . THR A 1 12 ? -6.515  -3.200  0.441   1.00 15.00 ?  308 THR A OG1  9  
ATOM 6740  C CG2  . THR A 1 12 ? -8.382  -2.002  -0.519  1.00 15.00 ?  308 THR A CG2  9  
ATOM 6741  H H    . THR A 1 12 ? -6.194  -2.697  2.598   1.00 15.00 ?  308 THR A H    9  
ATOM 6742  H HA   . THR A 1 12 ? -8.641  -1.308  1.842   1.00 15.00 ?  308 THR A HA   9  
ATOM 6743  H HB   . THR A 1 12 ? -8.468  -3.838  0.554   1.00 15.00 ?  308 THR A HB   9  
ATOM 6744  H HG1  . THR A 1 12 ? -6.160  -3.575  1.256   1.00 15.00 ?  308 THR A HG1  9  
ATOM 6745  H HG21 . THR A 1 12 ? -8.170  -2.464  -1.472  1.00 15.00 ?  308 THR A HG21 9  
ATOM 6746  H HG22 . THR A 1 12 ? -7.865  -1.055  -0.457  1.00 15.00 ?  308 THR A HG22 9  
ATOM 6747  H HG23 . THR A 1 12 ? -9.446  -1.837  -0.429  1.00 15.00 ?  308 THR A HG23 9  
ATOM 6748  N N    . ALA A 1 13 ? -10.392 -2.887  2.738   1.00 15.00 ?  309 ALA A N    9  
ATOM 6749  C CA   . ALA A 1 13 ? -11.379 -3.558  3.590   1.00 15.00 ?  309 ALA A CA   9  
ATOM 6750  C C    . ALA A 1 13 ? -11.403 -5.071  3.382   1.00 15.00 ?  309 ALA A C    9  
ATOM 6751  O O    . ALA A 1 13 ? -11.963 -5.802  4.200   1.00 15.00 ?  309 ALA A O    9  
ATOM 6752  C CB   . ALA A 1 13 ? -12.761 -2.982  3.339   1.00 15.00 ?  309 ALA A CB   9  
ATOM 6753  H H    . ALA A 1 13 ? -10.701 -2.188  2.112   1.00 15.00 ?  309 ALA A H    9  
ATOM 6754  H HA   . ALA A 1 13 ? -11.118 -3.353  4.617   1.00 15.00 ?  309 ALA A HA   9  
ATOM 6755  H HB1  . ALA A 1 13 ? -13.063 -3.195  2.324   1.00 15.00 ?  309 ALA A HB1  9  
ATOM 6756  H HB2  . ALA A 1 13 ? -12.739 -1.911  3.489   1.00 15.00 ?  309 ALA A HB2  9  
ATOM 6757  H HB3  . ALA A 1 13 ? -13.467 -3.425  4.025   1.00 15.00 ?  309 ALA A HB3  9  
ATOM 6758  N N    . THR A 1 14 ? -10.797 -5.537  2.300   1.00 15.00 ?  310 THR A N    9  
ATOM 6759  C CA   . THR A 1 14 ? -10.680 -6.965  2.038   1.00 15.00 ?  310 THR A CA   9  
ATOM 6760  C C    . THR A 1 14 ? -9.739  -7.625  3.054   1.00 15.00 ?  310 THR A C    9  
ATOM 6761  O O    . THR A 1 14 ? -9.756  -8.840  3.244   1.00 15.00 ?  310 THR A O    9  
ATOM 6762  C CB   . THR A 1 14 ? -10.156 -7.208  0.611   1.00 15.00 ?  310 THR A CB   9  
ATOM 6763  O OG1  . THR A 1 14 ? -10.728 -6.237  -0.275  1.00 15.00 ?  310 THR A OG1  9  
ATOM 6764  C CG2  . THR A 1 14 ? -10.512 -8.607  0.128   1.00 15.00 ?  310 THR A CG2  9  
ATOM 6765  H H    . THR A 1 14 ? -10.427 -4.905  1.649   1.00 15.00 ?  310 THR A H    9  
ATOM 6766  H HA   . THR A 1 14 ? -11.661 -7.407  2.124   1.00 15.00 ?  310 THR A HA   9  
ATOM 6767  H HB   . THR A 1 14 ? -9.080  -7.102  0.612   1.00 15.00 ?  310 THR A HB   9  
ATOM 6768  H HG1  . THR A 1 14 ? -11.675 -6.417  -0.383  1.00 15.00 ?  310 THR A HG1  9  
ATOM 6769  H HG21 . THR A 1 14 ? -10.144 -8.744  -0.878  1.00 15.00 ?  310 THR A HG21 9  
ATOM 6770  H HG22 . THR A 1 14 ? -11.585 -8.729  0.140   1.00 15.00 ?  310 THR A HG22 9  
ATOM 6771  H HG23 . THR A 1 14 ? -10.059 -9.340  0.779   1.00 15.00 ?  310 THR A HG23 9  
ATOM 6772  N N    . GLY A 1 15 ? -8.933  -6.804  3.723   1.00 15.00 ?  311 GLY A N    9  
ATOM 6773  C CA   . GLY A 1 15 ? -8.020  -7.308  4.732   1.00 15.00 ?  311 GLY A CA   9  
ATOM 6774  C C    . GLY A 1 15 ? -6.588  -7.439  4.244   1.00 15.00 ?  311 GLY A C    9  
ATOM 6775  O O    . GLY A 1 15 ? -5.901  -8.401  4.587   1.00 15.00 ?  311 GLY A O    9  
ATOM 6776  H H    . GLY A 1 15 ? -8.983  -5.837  3.545   1.00 15.00 ?  311 GLY A H    9  
ATOM 6777  H HA2  . GLY A 1 15 ? -8.036  -6.637  5.577   1.00 15.00 ?  311 GLY A HA2  9  
ATOM 6778  H HA3  . GLY A 1 15 ? -8.367  -8.279  5.055   1.00 15.00 ?  311 GLY A HA3  9  
ATOM 6779  N N    . ARG A 1 16 ? -6.129  -6.475  3.448   1.00 15.00 ?  312 ARG A N    9  
ATOM 6780  C CA   . ARG A 1 16 ? -4.753  -6.475  2.938   1.00 15.00 ?  312 ARG A CA   9  
ATOM 6781  C C    . ARG A 1 16 ? -4.272  -5.028  2.849   1.00 15.00 ?  312 ARG A C    9  
ATOM 6782  O O    . ARG A 1 16 ? -5.072  -4.143  2.543   1.00 15.00 ?  312 ARG A O    9  
ATOM 6783  C CB   . ARG A 1 16 ? -4.666  -7.122  1.547   1.00 15.00 ?  312 ARG A CB   9  
ATOM 6784  C CG   . ARG A 1 16 ? -5.675  -8.225  1.273   1.00 15.00 ?  312 ARG A CG   9  
ATOM 6785  C CD   . ARG A 1 16 ? -5.503  -8.771  -0.132  1.00 15.00 ?  312 ARG A CD   9  
ATOM 6786  N NE   . ARG A 1 16 ? -6.685  -9.481  -0.606  1.00 15.00 ?  312 ARG A NE   9  
ATOM 6787  C CZ   . ARG A 1 16 ? -7.254  -9.265  -1.792  1.00 15.00 ?  312 ARG A CZ   9  
ATOM 6788  N NH1  . ARG A 1 16 ? -6.762  -8.341  -2.612  1.00 15.00 1  312 ARG A NH1  9  
ATOM 6789  N NH2  . ARG A 1 16 ? -8.309  -9.978  -2.164  1.00 15.00 ?  312 ARG A NH2  9  
ATOM 6790  H H    . ARG A 1 16 ? -6.718  -5.722  3.219   1.00 15.00 ?  312 ARG A H    9  
ATOM 6791  H HA   . ARG A 1 16 ? -4.130  -7.019  3.634   1.00 15.00 ?  312 ARG A HA   9  
ATOM 6792  H HB2  . ARG A 1 16 ? -4.803  -6.354  0.798   1.00 15.00 ?  312 ARG A HB2  9  
ATOM 6793  H HB3  . ARG A 1 16 ? -3.676  -7.541  1.430   1.00 15.00 ?  312 ARG A HB3  9  
ATOM 6794  H HG2  . ARG A 1 16 ? -5.526  -9.024  1.983   1.00 15.00 ?  312 ARG A HG2  9  
ATOM 6795  H HG3  . ARG A 1 16 ? -6.674  -7.825  1.377   1.00 15.00 ?  312 ARG A HG3  9  
ATOM 6796  H HD2  . ARG A 1 16 ? -5.295  -7.950  -0.801  1.00 15.00 ?  312 ARG A HD2  9  
ATOM 6797  H HD3  . ARG A 1 16 ? -4.668  -9.451  -0.135  1.00 15.00 ?  312 ARG A HD3  9  
ATOM 6798  H HE   . ARG A 1 16 ? -7.073  -10.171 -0.007  1.00 15.00 ?  312 ARG A HE   9  
ATOM 6799  H HH11 . ARG A 1 16 ? -5.963  -7.804  -2.341  1.00 15.00 ?  312 ARG A HH11 9  
ATOM 6800  H HH12 . ARG A 1 16 ? -7.187  -8.182  -3.505  1.00 15.00 ?  312 ARG A HH12 9  
ATOM 6801  H HH21 . ARG A 1 16 ? -8.684  -10.690 -1.554  1.00 15.00 ?  312 ARG A HH21 9  
ATOM 6802  H HH22 . ARG A 1 16 ? -8.748  -9.804  -3.054  1.00 15.00 ?  312 ARG A HH22 9  
ATOM 6803  N N    . VAL A 1 17 ? -2.985  -4.778  3.071   1.00 15.00 ?  313 VAL A N    9  
ATOM 6804  C CA   . VAL A 1 17 ? -2.506  -3.401  3.171   1.00 15.00 ?  313 VAL A CA   9  
ATOM 6805  C C    . VAL A 1 17 ? -1.538  -3.026  2.032   1.00 15.00 ?  313 VAL A C    9  
ATOM 6806  O O    . VAL A 1 17 ? -0.371  -3.398  2.043   1.00 15.00 ?  313 VAL A O    9  
ATOM 6807  C CB   . VAL A 1 17 ? -1.817  -3.148  4.526   1.00 15.00 ?  313 VAL A CB   9  
ATOM 6808  C CG1  . VAL A 1 17 ? -1.707  -1.655  4.799   1.00 15.00 ?  313 VAL A CG1  9  
ATOM 6809  C CG2  . VAL A 1 17 ? -2.565  -3.845  5.652   1.00 15.00 ?  313 VAL A CG2  9  
ATOM 6810  H H    . VAL A 1 17 ? -2.345  -5.520  3.158   1.00 15.00 ?  313 VAL A H    9  
ATOM 6811  H HA   . VAL A 1 17 ? -3.372  -2.756  3.119   1.00 15.00 ?  313 VAL A HA   9  
ATOM 6812  H HB   . VAL A 1 17 ? -0.817  -3.555  4.481   1.00 15.00 ?  313 VAL A HB   9  
ATOM 6813  H HG11 . VAL A 1 17 ? -1.126  -1.188  4.017   1.00 15.00 ?  313 VAL A HG11 9  
ATOM 6814  H HG12 . VAL A 1 17 ? -1.222  -1.499  5.751   1.00 15.00 ?  313 VAL A HG12 9  
ATOM 6815  H HG13 . VAL A 1 17 ? -2.696  -1.220  4.822   1.00 15.00 ?  313 VAL A HG13 9  
ATOM 6816  H HG21 . VAL A 1 17 ? -2.053  -3.671  6.586   1.00 15.00 ?  313 VAL A HG21 9  
ATOM 6817  H HG22 . VAL A 1 17 ? -2.604  -4.907  5.454   1.00 15.00 ?  313 VAL A HG22 9  
ATOM 6818  H HG23 . VAL A 1 17 ? -3.570  -3.454  5.713   1.00 15.00 ?  313 VAL A HG23 9  
ATOM 6819  N N    . TYR A 1 18 ? -2.046  -2.284  1.055   1.00 15.00 ?  314 TYR A N    9  
ATOM 6820  C CA   . TYR A 1 18 ? -1.261  -1.777  -0.045  1.00 15.00 ?  314 TYR A CA   9  
ATOM 6821  C C    . TYR A 1 18 ? -0.677  -0.408  0.308   1.00 15.00 ?  314 TYR A C    9  
ATOM 6822  O O    . TYR A 1 18 ? -1.401  0.563   0.545   1.00 15.00 ?  314 TYR A O    9  
ATOM 6823  C CB   . TYR A 1 18 ? -2.127  -1.675  -1.321  1.00 15.00 ?  314 TYR A CB   9  
ATOM 6824  C CG   . TYR A 1 18 ? -3.286  -0.696  -1.210  1.00 15.00 ?  314 TYR A CG   9  
ATOM 6825  C CD1  . TYR A 1 18 ? -4.335  -0.936  -0.334  1.00 15.00 ?  314 TYR A CD1  9  
ATOM 6826  C CD2  . TYR A 1 18 ? -3.321  0.479   -1.965  1.00 15.00 ?  314 TYR A CD2  9  
ATOM 6827  C CE1  . TYR A 1 18 ? -5.378  -0.042  -0.204  1.00 15.00 ?  314 TYR A CE1  9  
ATOM 6828  C CE2  . TYR A 1 18 ? -4.366  1.377   -1.839  1.00 15.00 ?  314 TYR A CE2  9  
ATOM 6829  C CZ   . TYR A 1 18 ? -5.387  1.111   -0.954  1.00 15.00 ?  314 TYR A CZ   9  
ATOM 6830  O OH   . TYR A 1 18 ? -6.425  2.000   -0.821  1.00 15.00 ?  314 TYR A OH   9  
ATOM 6831  H H    . TYR A 1 18 ? -2.972  -2.076  1.068   1.00 15.00 ?  314 TYR A H    9  
ATOM 6832  H HA   . TYR A 1 18 ? -0.452  -2.472  -0.224  1.00 15.00 ?  314 TYR A HA   9  
ATOM 6833  H HB2  . TYR A 1 18 ? -1.505  -1.355  -2.143  1.00 15.00 ?  314 TYR A HB2  9  
ATOM 6834  H HB3  . TYR A 1 18 ? -2.536  -2.650  -1.545  1.00 15.00 ?  314 TYR A HB3  9  
ATOM 6835  H HD1  . TYR A 1 18 ? -4.327  -1.838  0.259   1.00 15.00 ?  314 TYR A HD1  9  
ATOM 6836  H HD2  . TYR A 1 18 ? -2.530  0.674   -2.672  1.00 15.00 ?  314 TYR A HD2  9  
ATOM 6837  H HE1  . TYR A 1 18 ? -6.183  -0.249  0.486   1.00 15.00 ?  314 TYR A HE1  9  
ATOM 6838  H HE2  . TYR A 1 18 ? -4.372  2.298   -2.419  1.00 15.00 ?  314 TYR A HE2  9  
ATOM 6839  H HH   . TYR A 1 18 ? -6.753  2.244   -1.694  1.00 15.00 ?  314 TYR A HH   9  
ATOM 6840  N N    . PHE A 1 19 ? 0.632   -0.351  0.390   1.00 15.00 ?  315 PHE A N    9  
ATOM 6841  C CA   . PHE A 1 19 ? 1.333   0.902   0.540   1.00 15.00 ?  315 PHE A CA   9  
ATOM 6842  C C    . PHE A 1 19 ? 1.811   1.334   -0.830  1.00 15.00 ?  315 PHE A C    9  
ATOM 6843  O O    . PHE A 1 19 ? 2.565   0.615   -1.471  1.00 15.00 ?  315 PHE A O    9  
ATOM 6844  C CB   . PHE A 1 19 ? 2.557   0.757   1.443   1.00 15.00 ?  315 PHE A CB   9  
ATOM 6845  C CG   . PHE A 1 19 ? 2.313   0.235   2.830   1.00 15.00 ?  315 PHE A CG   9  
ATOM 6846  C CD1  . PHE A 1 19 ? 1.743   -1.007  3.033   1.00 15.00 ?  315 PHE A CD1  9  
ATOM 6847  C CD2  . PHE A 1 19 ? 2.697   0.979   3.932   1.00 15.00 ?  315 PHE A CD2  9  
ATOM 6848  C CE1  . PHE A 1 19 ? 1.553   -1.495  4.306   1.00 15.00 ?  315 PHE A CE1  9  
ATOM 6849  C CE2  . PHE A 1 19 ? 2.516   0.491   5.211   1.00 15.00 ?  315 PHE A CE2  9  
ATOM 6850  C CZ   . PHE A 1 19 ? 1.942   -0.749  5.396   1.00 15.00 ?  315 PHE A CZ   9  
ATOM 6851  H H    . PHE A 1 19 ? 1.151   -1.185  0.340   1.00 15.00 ?  315 PHE A H    9  
ATOM 6852  H HA   . PHE A 1 19 ? 0.657   1.639   0.944   1.00 15.00 ?  315 PHE A HA   9  
ATOM 6853  H HB2  . PHE A 1 19 ? 3.256   0.086   0.970   1.00 15.00 ?  315 PHE A HB2  9  
ATOM 6854  H HB3  . PHE A 1 19 ? 3.026   1.727   1.540   1.00 15.00 ?  315 PHE A HB3  9  
ATOM 6855  H HD1  . PHE A 1 19 ? 1.437   -1.596  2.181   1.00 15.00 ?  315 PHE A HD1  9  
ATOM 6856  H HD2  . PHE A 1 19 ? 3.143   1.953   3.787   1.00 15.00 ?  315 PHE A HD2  9  
ATOM 6857  H HE1  . PHE A 1 19 ? 1.104   -2.466  4.450   1.00 15.00 ?  315 PHE A HE1  9  
ATOM 6858  H HE2  . PHE A 1 19 ? 2.821   1.080   6.064   1.00 15.00 ?  315 PHE A HE2  9  
ATOM 6859  H HZ   . PHE A 1 19 ? 1.804   -1.139  6.390   1.00 15.00 ?  315 PHE A HZ   9  
ATOM 6860  N N    . VAL A 1 20 ? 1.376   2.476   -1.298  1.00 15.00 ?  316 VAL A N    9  
ATOM 6861  C CA   . VAL A 1 20 ? 1.848   2.949   -2.570  1.00 15.00 ?  316 VAL A CA   9  
ATOM 6862  C C    . VAL A 1 20 ? 3.097   3.794   -2.369  1.00 15.00 ?  316 VAL A C    9  
ATOM 6863  O O    . VAL A 1 20 ? 3.103   4.708   -1.546  1.00 15.00 ?  316 VAL A O    9  
ATOM 6864  C CB   . VAL A 1 20 ? 0.786   3.767   -3.339  1.00 15.00 ?  316 VAL A CB   9  
ATOM 6865  C CG1  . VAL A 1 20 ? 1.297   4.095   -4.727  1.00 15.00 ?  316 VAL A CG1  9  
ATOM 6866  C CG2  . VAL A 1 20 ? -0.537  3.019   -3.417  1.00 15.00 ?  316 VAL A CG2  9  
ATOM 6867  H H    . VAL A 1 20 ? 0.749   3.018   -0.770  1.00 15.00 ?  316 VAL A H    9  
ATOM 6868  H HA   . VAL A 1 20 ? 2.098   2.086   -3.155  1.00 15.00 ?  316 VAL A HA   9  
ATOM 6869  H HB   . VAL A 1 20 ? 0.620   4.697   -2.817  1.00 15.00 ?  316 VAL A HB   9  
ATOM 6870  H HG11 . VAL A 1 20 ? 0.551   4.669   -5.258  1.00 15.00 ?  316 VAL A HG11 9  
ATOM 6871  H HG12 . VAL A 1 20 ? 1.494   3.178   -5.264  1.00 15.00 ?  316 VAL A HG12 9  
ATOM 6872  H HG13 . VAL A 1 20 ? 2.207   4.671   -4.651  1.00 15.00 ?  316 VAL A HG13 9  
ATOM 6873  H HG21 . VAL A 1 20 ? -0.363  2.020   -3.786  1.00 15.00 ?  316 VAL A HG21 9  
ATOM 6874  H HG22 . VAL A 1 20 ? -1.203  3.539   -4.090  1.00 15.00 ?  316 VAL A HG22 9  
ATOM 6875  H HG23 . VAL A 1 20 ? -0.987  2.969   -2.436  1.00 15.00 ?  316 VAL A HG23 9  
ATOM 6876  N N    . ASP A 1 21 ? 4.167   3.486   -3.088  1.00 15.00 ?  317 ASP A N    9  
ATOM 6877  C CA   . ASP A 1 21 ? 5.354   4.304   -3.017  1.00 15.00 ?  317 ASP A CA   9  
ATOM 6878  C C    . ASP A 1 21 ? 5.231   5.379   -4.072  1.00 15.00 ?  317 ASP A C    9  
ATOM 6879  O O    . ASP A 1 21 ? 5.151   5.061   -5.262  1.00 15.00 ?  317 ASP A O    9  
ATOM 6880  C CB   . ASP A 1 21 ? 6.631   3.499   -3.294  1.00 15.00 ?  317 ASP A CB   9  
ATOM 6881  C CG   . ASP A 1 21 ? 6.550   2.049   -2.893  1.00 15.00 ?  317 ASP A CG   9  
ATOM 6882  O OD1  . ASP A 1 21 ? 5.914   1.268   -3.623  1.00 15.00 ?  317 ASP A OD1  9  
ATOM 6883  O OD2  . ASP A 1 21 ? 7.179   1.683   -1.883  1.00 15.00 -1 317 ASP A OD2  9  
ATOM 6884  H H    . ASP A 1 21 ? 4.169   2.685   -3.664  1.00 15.00 ?  317 ASP A H    9  
ATOM 6885  H HA   . ASP A 1 21 ? 5.407   4.758   -2.038  1.00 15.00 ?  317 ASP A HA   9  
ATOM 6886  H HB2  . ASP A 1 21 ? 6.859   3.545   -4.345  1.00 15.00 ?  317 ASP A HB2  9  
ATOM 6887  H HB3  . ASP A 1 21 ? 7.441   3.939   -2.734  1.00 15.00 ?  317 ASP A HB3  9  
ATOM 6888  N N    . HIS A 1 22 ? 5.185   6.640   -3.656  1.00 15.00 ?  318 HIS A N    9  
ATOM 6889  C CA   . HIS A 1 22 ? 5.138   7.742   -4.616  1.00 15.00 ?  318 HIS A CA   9  
ATOM 6890  C C    . HIS A 1 22 ? 6.445   7.789   -5.397  1.00 15.00 ?  318 HIS A C    9  
ATOM 6891  O O    . HIS A 1 22 ? 6.508   8.336   -6.495  1.00 15.00 ?  318 HIS A O    9  
ATOM 6892  C CB   . HIS A 1 22 ? 4.902   9.096   -3.936  1.00 15.00 ?  318 HIS A CB   9  
ATOM 6893  C CG   . HIS A 1 22 ? 3.535   9.291   -3.337  1.00 15.00 ?  318 HIS A CG   9  
ATOM 6894  N ND1  . HIS A 1 22 ? 2.397   8.656   -3.786  1.00 15.00 ?  318 HIS A ND1  9  
ATOM 6895  C CD2  . HIS A 1 22 ? 3.133   10.082  -2.316  1.00 15.00 ?  318 HIS A CD2  9  
ATOM 6896  C CE1  . HIS A 1 22 ? 1.362   9.048   -3.067  1.00 15.00 ?  318 HIS A CE1  9  
ATOM 6897  N NE2  . HIS A 1 22 ? 1.776   9.913   -2.162  1.00 15.00 ?  318 HIS A NE2  9  
ATOM 6898  H H    . HIS A 1 22 ? 5.188   6.830   -2.692  1.00 15.00 ?  318 HIS A H    9  
ATOM 6899  H HA   . HIS A 1 22 ? 4.328   7.544   -5.304  1.00 15.00 ?  318 HIS A HA   9  
ATOM 6900  H HB2  . HIS A 1 22 ? 5.621   9.214   -3.141  1.00 15.00 ?  318 HIS A HB2  9  
ATOM 6901  H HB3  . HIS A 1 22 ? 5.057   9.879   -4.665  1.00 15.00 ?  318 HIS A HB3  9  
ATOM 6902  H HD1  . HIS A 1 22 ? 2.338   8.041   -4.560  1.00 15.00 ?  318 HIS A HD1  9  
ATOM 6903  H HD2  . HIS A 1 22 ? 3.765   10.729  -1.722  1.00 15.00 ?  318 HIS A HD2  9  
ATOM 6904  H HE1  . HIS A 1 22 ? 0.343   8.714   -3.197  1.00 15.00 ?  318 HIS A HE1  9  
ATOM 6905  H HE2  . HIS A 1 22 ? 1.287   10.099  -1.313  1.00 15.00 ?  318 HIS A HE2  9  
ATOM 6906  N N    . ASN A 1 23 ? 7.483   7.213   -4.801  1.00 15.00 ?  319 ASN A N    9  
ATOM 6907  C CA   . ASN A 1 23 ? 8.801   7.135   -5.420  1.00 15.00 ?  319 ASN A CA   9  
ATOM 6908  C C    . ASN A 1 23 ? 8.749   6.270   -6.672  1.00 15.00 ?  319 ASN A C    9  
ATOM 6909  O O    . ASN A 1 23 ? 9.309   6.614   -7.712  1.00 15.00 ?  319 ASN A O    9  
ATOM 6910  C CB   . ASN A 1 23 ? 9.818   6.528   -4.445  1.00 15.00 ?  319 ASN A CB   9  
ATOM 6911  C CG   . ASN A 1 23 ? 10.002  7.325   -3.164  1.00 15.00 ?  319 ASN A CG   9  
ATOM 6912  O OD1  . ASN A 1 23 ? 9.110   8.060   -2.729  1.00 15.00 ?  319 ASN A OD1  9  
ATOM 6913  N ND2  . ASN A 1 23 ? 11.156  7.160   -2.539  1.00 15.00 ?  319 ASN A ND2  9  
ATOM 6914  H H    . ASN A 1 23 ? 7.362   6.840   -3.903  1.00 15.00 ?  319 ASN A H    9  
ATOM 6915  H HA   . ASN A 1 23 ? 9.112   8.133   -5.686  1.00 15.00 ?  319 ASN A HA   9  
ATOM 6916  H HB2  . ASN A 1 23 ? 9.495   5.534   -4.176  1.00 15.00 ?  319 ASN A HB2  9  
ATOM 6917  H HB3  . ASN A 1 23 ? 10.776  6.461   -4.940  1.00 15.00 ?  319 ASN A HB3  9  
ATOM 6918  H HD21 . ASN A 1 23 ? 11.816  6.542   -2.939  1.00 15.00 ?  319 ASN A HD21 9  
ATOM 6919  H HD22 . ASN A 1 23 ? 11.312  7.652   -1.702  1.00 15.00 ?  319 ASN A HD22 9  
ATOM 6920  N N    . ASN A 1 24 ? 8.083   5.129   -6.551  1.00 15.00 ?  320 ASN A N    9  
ATOM 6921  C CA   . ASN A 1 24 ? 8.010   4.158   -7.636  1.00 15.00 ?  320 ASN A CA   9  
ATOM 6922  C C    . ASN A 1 24 ? 6.704   4.306   -8.423  1.00 15.00 ?  320 ASN A C    9  
ATOM 6923  O O    . ASN A 1 24 ? 6.559   3.748   -9.510  1.00 15.00 ?  320 ASN A O    9  
ATOM 6924  C CB   . ASN A 1 24 ? 8.145   2.737   -7.070  1.00 15.00 ?  320 ASN A CB   9  
ATOM 6925  C CG   . ASN A 1 24 ? 8.266   1.670   -8.144  1.00 15.00 ?  320 ASN A CG   9  
ATOM 6926  O OD1  . ASN A 1 24 ? 8.725   1.933   -9.253  1.00 15.00 ?  320 ASN A OD1  9  
ATOM 6927  N ND2  . ASN A 1 24 ? 7.881   0.449   -7.808  1.00 15.00 ?  320 ASN A ND2  9  
ATOM 6928  H H    . ASN A 1 24 ? 7.639   4.928   -5.701  1.00 15.00 ?  320 ASN A H    9  
ATOM 6929  H HA   . ASN A 1 24 ? 8.838   4.346   -8.302  1.00 15.00 ?  320 ASN A HA   9  
ATOM 6930  H HB2  . ASN A 1 24 ? 9.026   2.690   -6.448  1.00 15.00 ?  320 ASN A HB2  9  
ATOM 6931  H HB3  . ASN A 1 24 ? 7.275   2.517   -6.467  1.00 15.00 ?  320 ASN A HB3  9  
ATOM 6932  H HD21 . ASN A 1 24 ? 7.547   0.300   -6.890  1.00 15.00 ?  320 ASN A HD21 9  
ATOM 6933  H HD22 . ASN A 1 24 ? 7.945   -0.261  -8.481  1.00 15.00 ?  320 ASN A HD22 9  
ATOM 6934  N N    . ARG A 1 25 ? 5.746   5.035   -7.845  1.00 15.00 ?  321 ARG A N    9  
ATOM 6935  C CA   . ARG A 1 25 ? 4.430   5.240   -8.455  1.00 15.00 ?  321 ARG A CA   9  
ATOM 6936  C C    . ARG A 1 25 ? 3.686   3.914   -8.562  1.00 15.00 ?  321 ARG A C    9  
ATOM 6937  O O    . ARG A 1 25 ? 2.809   3.744   -9.409  1.00 15.00 ?  321 ARG A O    9  
ATOM 6938  C CB   . ARG A 1 25 ? 4.566   5.886   -9.838  1.00 15.00 ?  321 ARG A CB   9  
ATOM 6939  C CG   . ARG A 1 25 ? 5.185   7.274   -9.812  1.00 15.00 ?  321 ARG A CG   9  
ATOM 6940  C CD   . ARG A 1 25 ? 5.276   7.863   -11.211 1.00 15.00 ?  321 ARG A CD   9  
ATOM 6941  N NE   . ARG A 1 25 ? 6.065   7.018   -12.110 1.00 15.00 ?  321 ARG A NE   9  
ATOM 6942  C CZ   . ARG A 1 25 ? 5.832   6.894   -13.417 1.00 15.00 ?  321 ARG A CZ   9  
ATOM 6943  N NH1  . ARG A 1 25 ? 4.871   7.604   -13.997 1.00 15.00 1  321 ARG A NH1  9  
ATOM 6944  N NH2  . ARG A 1 25 ? 6.573   6.068   -14.148 1.00 15.00 ?  321 ARG A NH2  9  
ATOM 6945  H H    . ARG A 1 25 ? 5.925   5.444   -6.973  1.00 15.00 ?  321 ARG A H    9  
ATOM 6946  H HA   . ARG A 1 25 ? 3.868   5.900   -7.813  1.00 15.00 ?  321 ARG A HA   9  
ATOM 6947  H HB2  . ARG A 1 25 ? 5.185   5.253   -10.458 1.00 15.00 ?  321 ARG A HB2  9  
ATOM 6948  H HB3  . ARG A 1 25 ? 3.587   5.962   -10.285 1.00 15.00 ?  321 ARG A HB3  9  
ATOM 6949  H HG2  . ARG A 1 25 ? 4.574   7.921   -9.199  1.00 15.00 ?  321 ARG A HG2  9  
ATOM 6950  H HG3  . ARG A 1 25 ? 6.178   7.210   -9.392  1.00 15.00 ?  321 ARG A HG3  9  
ATOM 6951  H HD2  . ARG A 1 25 ? 4.276   7.961   -11.610 1.00 15.00 ?  321 ARG A HD2  9  
ATOM 6952  H HD3  . ARG A 1 25 ? 5.734   8.838   -11.149 1.00 15.00 ?  321 ARG A HD3  9  
ATOM 6953  H HE   . ARG A 1 25 ? 6.799   6.503   -11.709 1.00 15.00 ?  321 ARG A HE   9  
ATOM 6954  H HH11 . ARG A 1 25 ? 4.315   8.247   -13.453 1.00 15.00 ?  321 ARG A HH11 9  
ATOM 6955  H HH12 . ARG A 1 25 ? 4.684   7.496   -14.982 1.00 15.00 ?  321 ARG A HH12 9  
ATOM 6956  H HH21 . ARG A 1 25 ? 7.311   5.533   -13.722 1.00 15.00 ?  321 ARG A HH21 9  
ATOM 6957  H HH22 . ARG A 1 25 ? 6.393   5.961   -15.135 1.00 15.00 ?  321 ARG A HH22 9  
ATOM 6958  N N    . THR A 1 26 ? 4.000   2.999   -7.661  1.00 15.00 ?  322 THR A N    9  
ATOM 6959  C CA   . THR A 1 26 ? 3.444   1.656   -7.719  1.00 15.00 ?  322 THR A CA   9  
ATOM 6960  C C    . THR A 1 26 ? 2.867   1.255   -6.362  1.00 15.00 ?  322 THR A C    9  
ATOM 6961  O O    . THR A 1 26 ? 3.394   1.646   -5.322  1.00 15.00 ?  322 THR A O    9  
ATOM 6962  C CB   . THR A 1 26 ? 4.521   0.642   -8.168  1.00 15.00 ?  322 THR A CB   9  
ATOM 6963  O OG1  . THR A 1 26 ? 5.130   1.093   -9.392  1.00 15.00 ?  322 THR A OG1  9  
ATOM 6964  C CG2  . THR A 1 26 ? 3.921   -0.742  -8.383  1.00 15.00 ?  322 THR A CG2  9  
ATOM 6965  H H    . THR A 1 26 ? 4.601   3.243   -6.916  1.00 15.00 ?  322 THR A H    9  
ATOM 6966  H HA   . THR A 1 26 ? 2.649   1.658   -8.452  1.00 15.00 ?  322 THR A HA   9  
ATOM 6967  H HB   . THR A 1 26 ? 5.278   0.578   -7.400  1.00 15.00 ?  322 THR A HB   9  
ATOM 6968  H HG1  . THR A 1 26 ? 5.524   1.964   -9.255  1.00 15.00 ?  322 THR A HG1  9  
ATOM 6969  H HG21 . THR A 1 26 ? 3.482   -1.089  -7.460  1.00 15.00 ?  322 THR A HG21 9  
ATOM 6970  H HG22 . THR A 1 26 ? 4.696   -1.428  -8.693  1.00 15.00 ?  322 THR A HG22 9  
ATOM 6971  H HG23 . THR A 1 26 ? 3.159   -0.690  -9.147  1.00 15.00 ?  322 THR A HG23 9  
ATOM 6972  N N    . THR A 1 27 ? 1.771   0.504   -6.377  1.00 15.00 ?  323 THR A N    9  
ATOM 6973  C CA   . THR A 1 27 ? 1.127   0.073   -5.145  1.00 15.00 ?  323 THR A CA   9  
ATOM 6974  C C    . THR A 1 27 ? 1.759   -1.219  -4.627  1.00 15.00 ?  323 THR A C    9  
ATOM 6975  O O    . THR A 1 27 ? 2.201   -2.060  -5.412  1.00 15.00 ?  323 THR A O    9  
ATOM 6976  C CB   . THR A 1 27 ? -0.390  -0.114  -5.339  1.00 15.00 ?  323 THR A CB   9  
ATOM 6977  O OG1  . THR A 1 27 ? -1.011  -0.457  -4.098  1.00 15.00 ?  323 THR A OG1  9  
ATOM 6978  C CG2  . THR A 1 27 ? -0.691  -1.187  -6.368  1.00 15.00 ?  323 THR A CG2  9  
ATOM 6979  H H    . THR A 1 27 ? 1.391   0.227   -7.235  1.00 15.00 ?  323 THR A H    9  
ATOM 6980  H HA   . THR A 1 27 ? 1.273   0.843   -4.415  1.00 15.00 ?  323 THR A HA   9  
ATOM 6981  H HB   . THR A 1 27 ? -0.807  0.819   -5.691  1.00 15.00 ?  323 THR A HB   9  
ATOM 6982  H HG1  . THR A 1 27 ? -1.795  0.085   -3.977  1.00 15.00 ?  323 THR A HG1  9  
ATOM 6983  H HG21 . THR A 1 27 ? -0.354  -0.865  -7.339  1.00 15.00 ?  323 THR A HG21 9  
ATOM 6984  H HG22 . THR A 1 27 ? -1.758  -1.361  -6.391  1.00 15.00 ?  323 THR A HG22 9  
ATOM 6985  H HG23 . THR A 1 27 ? -0.184  -2.102  -6.094  1.00 15.00 ?  323 THR A HG23 9  
ATOM 6986  N N    . GLN A 1 28 ? 1.823   -1.363  -3.308  1.00 15.00 ?  324 GLN A N    9  
ATOM 6987  C CA   . GLN A 1 28 ? 2.463   -2.520  -2.698  1.00 15.00 ?  324 GLN A CA   9  
ATOM 6988  C C    . GLN A 1 28 ? 1.541   -3.246  -1.726  1.00 15.00 ?  324 GLN A C    9  
ATOM 6989  O O    . GLN A 1 28 ? 1.411   -2.840  -0.581  1.00 15.00 ?  324 GLN A O    9  
ATOM 6990  C CB   . GLN A 1 28 ? 3.721   -2.110  -1.920  1.00 15.00 ?  324 GLN A CB   9  
ATOM 6991  C CG   . GLN A 1 28 ? 4.767   -1.376  -2.736  1.00 15.00 ?  324 GLN A CG   9  
ATOM 6992  C CD   . GLN A 1 28 ? 5.520   -2.284  -3.690  1.00 15.00 ?  324 GLN A CD   9  
ATOM 6993  O OE1  . GLN A 1 28 ? 6.563   -2.843  -3.344  1.00 15.00 ?  324 GLN A OE1  9  
ATOM 6994  N NE2  . GLN A 1 28 ? 4.993   -2.454  -4.894  1.00 15.00 ?  324 GLN A NE2  9  
ATOM 6995  H H    . GLN A 1 28 ? 1.443   -0.668  -2.729  1.00 15.00 ?  324 GLN A H    9  
ATOM 6996  H HA   . GLN A 1 28 ? 2.748   -3.199  -3.487  1.00 15.00 ?  324 GLN A HA   9  
ATOM 6997  H HB2  . GLN A 1 28 ? 3.425   -1.467  -1.105  1.00 15.00 ?  324 GLN A HB2  9  
ATOM 6998  H HB3  . GLN A 1 28 ? 4.177   -2.999  -1.512  1.00 15.00 ?  324 GLN A HB3  9  
ATOM 6999  H HG2  . GLN A 1 28 ? 4.277   -0.602  -3.308  1.00 15.00 ?  324 GLN A HG2  9  
ATOM 7000  H HG3  . GLN A 1 28 ? 5.475   -0.918  -2.054  1.00 15.00 ?  324 GLN A HG3  9  
ATOM 7001  H HE21 . GLN A 1 28 ? 4.151   -1.990  -5.101  1.00 15.00 ?  324 GLN A HE21 9  
ATOM 7002  H HE22 . GLN A 1 28 ? 5.467   -3.030  -5.534  1.00 15.00 ?  324 GLN A HE22 9  
ATOM 7003  N N    . PHE A 1 29 ? 0.903   -4.321  -2.176  1.00 15.00 ?  325 PHE A N    9  
ATOM 7004  C CA   . PHE A 1 29 ? 0.332   -5.300  -1.242  1.00 15.00 ?  325 PHE A CA   9  
ATOM 7005  C C    . PHE A 1 29 ? 1.466   -6.023  -0.571  1.00 15.00 ?  325 PHE A C    9  
ATOM 7006  O O    . PHE A 1 29 ? 1.294   -6.830  0.337   1.00 15.00 ?  325 PHE A O    9  
ATOM 7007  C CB   . PHE A 1 29 ? -0.609  -6.284  -1.913  1.00 15.00 ?  325 PHE A CB   9  
ATOM 7008  C CG   . PHE A 1 29 ? -2.033  -5.885  -1.725  1.00 15.00 ?  325 PHE A CG   9  
ATOM 7009  C CD1  . PHE A 1 29 ? -2.438  -5.254  -0.551  1.00 15.00 ?  325 PHE A CD1  9  
ATOM 7010  C CD2  . PHE A 1 29 ? -2.960  -6.112  -2.722  1.00 15.00 ?  325 PHE A CD2  9  
ATOM 7011  C CE1  . PHE A 1 29 ? -3.754  -4.861  -0.398  1.00 15.00 ?  325 PHE A CE1  9  
ATOM 7012  C CE2  . PHE A 1 29 ? -4.273  -5.728  -2.566  1.00 15.00 ?  325 PHE A CE2  9  
ATOM 7013  C CZ   . PHE A 1 29 ? -4.672  -5.099  -1.404  1.00 15.00 ?  325 PHE A CZ   9  
ATOM 7014  H H    . PHE A 1 29 ? 0.810   -4.462  -3.140  1.00 15.00 ?  325 PHE A H    9  
ATOM 7015  H HA   . PHE A 1 29 ? -0.212  -4.746  -0.488  1.00 15.00 ?  325 PHE A HA   9  
ATOM 7016  H HB2  . PHE A 1 29 ? -0.399  -6.320  -2.973  1.00 15.00 ?  325 PHE A HB2  9  
ATOM 7017  H HB3  . PHE A 1 29 ? -0.472  -7.265  -1.485  1.00 15.00 ?  325 PHE A HB3  9  
ATOM 7018  H HD1  . PHE A 1 29 ? -1.711  -5.073  0.259   1.00 15.00 ?  325 PHE A HD1  9  
ATOM 7019  H HD2  . PHE A 1 29 ? -2.648  -6.604  -3.630  1.00 15.00 ?  325 PHE A HD2  9  
ATOM 7020  H HE1  . PHE A 1 29 ? -4.068  -4.375  0.513   1.00 15.00 ?  325 PHE A HE1  9  
ATOM 7021  H HE2  . PHE A 1 29 ? -4.988  -5.916  -3.356  1.00 15.00 ?  325 PHE A HE2  9  
ATOM 7022  H HZ   . PHE A 1 29 ? -5.699  -4.791  -1.283  1.00 15.00 ?  325 PHE A HZ   9  
ATOM 7023  N N    . THR A 1 30 ? 2.624   -5.752  -1.112  1.00 15.00 ?  326 THR A N    9  
ATOM 7024  C CA   . THR A 1 30 ? 3.864   -6.237  -0.554  1.00 15.00 ?  326 THR A CA   9  
ATOM 7025  C C    . THR A 1 30 ? 4.190   -5.315  0.601   1.00 15.00 ?  326 THR A C    9  
ATOM 7026  O O    . THR A 1 30 ? 4.861   -4.294  0.428   1.00 15.00 ?  326 THR A O    9  
ATOM 7027  C CB   . THR A 1 30 ? 5.015   -6.188  -1.584  1.00 15.00 ?  326 THR A CB   9  
ATOM 7028  O OG1  . THR A 1 30 ? 4.575   -6.698  -2.849  1.00 15.00 ?  326 THR A OG1  9  
ATOM 7029  C CG2  . THR A 1 30 ? 6.205   -7.004  -1.102  1.00 15.00 ?  326 THR A CG2  9  
ATOM 7030  H H    . THR A 1 30 ? 2.628   -5.115  -1.848  1.00 15.00 ?  326 THR A H    9  
ATOM 7031  H HA   . THR A 1 30 ? 3.727   -7.251  -0.207  1.00 15.00 ?  326 THR A HA   9  
ATOM 7032  H HB   . THR A 1 30 ? 5.328   -5.162  -1.706  1.00 15.00 ?  326 THR A HB   9  
ATOM 7033  H HG1  . THR A 1 30 ? 5.089   -6.285  -3.556  1.00 15.00 ?  326 THR A HG1  9  
ATOM 7034  H HG21 . THR A 1 30 ? 5.902   -8.032  -0.964  1.00 15.00 ?  326 THR A HG21 9  
ATOM 7035  H HG22 . THR A 1 30 ? 6.561   -6.604  -0.166  1.00 15.00 ?  326 THR A HG22 9  
ATOM 7036  H HG23 . THR A 1 30 ? 6.993   -6.957  -1.838  1.00 15.00 ?  326 THR A HG23 9  
ATOM 7037  N N    . ASP A 1 31 ? 3.704   -5.658  1.769   1.00 15.00 ?  327 ASP A N    9  
ATOM 7038  C CA   . ASP A 1 31 ? 3.661   -4.709  2.844   1.00 15.00 ?  327 ASP A CA   9  
ATOM 7039  C C    . ASP A 1 31 ? 4.638   -4.988  3.931   1.00 15.00 ?  327 ASP A C    9  
ATOM 7040  O O    . ASP A 1 31 ? 5.021   -6.125  4.215   1.00 15.00 ?  327 ASP A O    9  
ATOM 7041  C CB   . ASP A 1 31 ? 2.275   -4.560  3.453   1.00 15.00 ?  327 ASP A CB   9  
ATOM 7042  C CG   . ASP A 1 31 ? 1.523   -5.867  3.646   1.00 15.00 ?  327 ASP A CG   9  
ATOM 7043  O OD1  . ASP A 1 31 ? 2.080   -6.774  4.297   1.00 15.00 -1 327 ASP A OD1  9  
ATOM 7044  O OD2  . ASP A 1 31 ? 0.369   -5.976  3.185   1.00 15.00 ?  327 ASP A OD2  9  
ATOM 7045  H H    . ASP A 1 31 ? 3.350   -6.564  1.911   1.00 15.00 ?  327 ASP A H    9  
ATOM 7046  H HA   . ASP A 1 31 ? 3.922   -3.751  2.421   1.00 15.00 ?  327 ASP A HA   9  
ATOM 7047  H HB2  . ASP A 1 31 ? 2.384   -4.100  4.424   1.00 15.00 ?  327 ASP A HB2  9  
ATOM 7048  H HB3  . ASP A 1 31 ? 1.713   -3.899  2.827   1.00 15.00 ?  327 ASP A HB3  9  
ATOM 7049  N N    . PRO A 1 32 ? 5.044   -3.898  4.554   1.00 15.00 ?  328 PRO A N    9  
ATOM 7050  C CA   . PRO A 1 32 ? 5.799   -3.918  5.779   1.00 15.00 ?  328 PRO A CA   9  
ATOM 7051  C C    . PRO A 1 32 ? 4.876   -4.425  6.891   1.00 15.00 ?  328 PRO A C    9  
ATOM 7052  O O    . PRO A 1 32 ? 5.308   -4.770  7.990   1.00 15.00 ?  328 PRO A O    9  
ATOM 7053  C CB   . PRO A 1 32 ? 6.231   -2.447  5.959   1.00 15.00 ?  328 PRO A CB   9  
ATOM 7054  C CG   . PRO A 1 32 ? 5.884   -1.774  4.656   1.00 15.00 ?  328 PRO A CG   9  
ATOM 7055  C CD   . PRO A 1 32 ? 4.724   -2.526  4.136   1.00 15.00 ?  328 PRO A CD   9  
ATOM 7056  H HA   . PRO A 1 32 ? 6.668   -4.560  5.704   1.00 15.00 ?  328 PRO A HA   9  
ATOM 7057  H HB2  . PRO A 1 32 ? 5.689   -2.010  6.785   1.00 15.00 ?  328 PRO A HB2  9  
ATOM 7058  H HB3  . PRO A 1 32 ? 7.292   -2.403  6.155   1.00 15.00 ?  328 PRO A HB3  9  
ATOM 7059  H HG2  . PRO A 1 32 ? 5.630   -0.732  4.822   1.00 15.00 ?  328 PRO A HG2  9  
ATOM 7060  H HG3  . PRO A 1 32 ? 6.688   -1.859  3.943   1.00 15.00 ?  328 PRO A HG3  9  
ATOM 7061  H HD2  . PRO A 1 32 ? 3.807   -2.180  4.591   1.00 15.00 ?  328 PRO A HD2  9  
ATOM 7062  H HD3  . PRO A 1 32 ? 4.673   -2.451  3.059   1.00 15.00 ?  328 PRO A HD3  9  
ATOM 7063  N N    . ARG A 1 33 ? 3.571   -4.427  6.566   1.00 15.00 ?  329 ARG A N    9  
ATOM 7064  C CA   . ARG A 1 33 ? 2.525   -4.963  7.430   1.00 15.00 ?  329 ARG A CA   9  
ATOM 7065  C C    . ARG A 1 33 ? 2.739   -6.444  7.728   1.00 15.00 ?  329 ARG A C    9  
ATOM 7066  O O    . ARG A 1 33 ? 2.462   -6.897  8.835   1.00 15.00 ?  329 ARG A O    9  
ATOM 7067  C CB   . ARG A 1 33 ? 1.127   -4.760  6.806   1.00 15.00 ?  329 ARG A CB   9  
ATOM 7068  C CG   . ARG A 1 33 ? 0.495   -3.434  7.187   1.00 15.00 ?  329 ARG A CG   9  
ATOM 7069  C CD   . ARG A 1 33 ? 0.253   -3.345  8.686   1.00 15.00 ?  329 ARG A CD   9  
ATOM 7070  N NE   . ARG A 1 33 ? -0.535  -4.476  9.186   1.00 15.00 ?  329 ARG A NE   9  
ATOM 7071  C CZ   . ARG A 1 33 ? -1.020  -4.557  10.426  1.00 15.00 ?  329 ARG A CZ   9  
ATOM 7072  N NH1  . ARG A 1 33 ? -0.829  -3.560  11.282  1.00 15.00 1  329 ARG A NH1  9  
ATOM 7073  N NH2  . ARG A 1 33 ? -1.706  -5.630  10.807  1.00 15.00 ?  329 ARG A NH2  9  
ATOM 7074  H H    . ARG A 1 33 ? 3.313   -4.066  5.692   1.00 15.00 ?  329 ARG A H    9  
ATOM 7075  H HA   . ARG A 1 33 ? 2.565   -4.419  8.361   1.00 15.00 ?  329 ARG A HA   9  
ATOM 7076  H HB2  . ARG A 1 33 ? 1.188   -4.809  5.707   1.00 15.00 ?  329 ARG A HB2  9  
ATOM 7077  H HB3  . ARG A 1 33 ? 0.478   -5.552  7.151   1.00 15.00 ?  329 ARG A HB3  9  
ATOM 7078  H HG2  . ARG A 1 33 ? 1.155   -2.633  6.890   1.00 15.00 ?  329 ARG A HG2  9  
ATOM 7079  H HG3  . ARG A 1 33 ? -0.450  -3.335  6.671   1.00 15.00 ?  329 ARG A HG3  9  
ATOM 7080  H HD2  . ARG A 1 33 ? 1.208   -3.335  9.192   1.00 15.00 ?  329 ARG A HD2  9  
ATOM 7081  H HD3  . ARG A 1 33 ? -0.275  -2.428  8.898   1.00 15.00 ?  329 ARG A HD3  9  
ATOM 7082  H HE   . ARG A 1 33 ? -0.704  -5.217  8.562   1.00 15.00 ?  329 ARG A HE   9  
ATOM 7083  H HH11 . ARG A 1 33 ? -0.327  -2.744  10.999  1.00 15.00 ?  329 ARG A HH11 9  
ATOM 7084  H HH12 . ARG A 1 33 ? -1.188  -3.622  12.224  1.00 15.00 ?  329 ARG A HH12 9  
ATOM 7085  H HH21 . ARG A 1 33 ? -1.868  -6.388  10.162  1.00 15.00 ?  329 ARG A HH21 9  
ATOM 7086  H HH22 . ARG A 1 33 ? -2.080  -5.690  11.743  1.00 15.00 ?  329 ARG A HH22 9  
ATOM 7087  N N    . LEU A 1 34 ? 3.215   -7.195  6.742   1.00 15.00 ?  330 LEU A N    9  
ATOM 7088  C CA   . LEU A 1 34 ? 3.466   -8.625  6.914   1.00 15.00 ?  330 LEU A CA   9  
ATOM 7089  C C    . LEU A 1 34 ? 4.509   -8.880  8.002   1.00 15.00 ?  330 LEU A C    9  
ATOM 7090  O O    . LEU A 1 34 ? 4.565   -9.960  8.586   1.00 15.00 ?  330 LEU A O    9  
ATOM 7091  C CB   . LEU A 1 34 ? 3.921   -9.250  5.590   1.00 15.00 ?  330 LEU A CB   9  
ATOM 7092  C CG   . LEU A 1 34 ? 4.104   -10.771 5.610   1.00 15.00 ?  330 LEU A CG   9  
ATOM 7093  C CD1  . LEU A 1 34 ? 2.783   -11.466 5.905   1.00 15.00 ?  330 LEU A CD1  9  
ATOM 7094  C CD2  . LEU A 1 34 ? 4.679   -11.257 4.288   1.00 15.00 ?  330 LEU A CD2  9  
ATOM 7095  H H    . LEU A 1 34 ? 3.362   -6.788  5.854   1.00 15.00 ?  330 LEU A H    9  
ATOM 7096  H HA   . LEU A 1 34 ? 2.537   -9.086  7.213   1.00 15.00 ?  330 LEU A HA   9  
ATOM 7097  H HB2  . LEU A 1 34 ? 3.190   -9.007  4.833   1.00 15.00 ?  330 LEU A HB2  9  
ATOM 7098  H HB3  . LEU A 1 34 ? 4.864   -8.803  5.310   1.00 15.00 ?  330 LEU A HB3  9  
ATOM 7099  H HG   . LEU A 1 34 ? 4.801   -11.031 6.394   1.00 15.00 ?  330 LEU A HG   9  
ATOM 7100  H HD11 . LEU A 1 34 ? 2.063   -11.214 5.140   1.00 15.00 ?  330 LEU A HD11 9  
ATOM 7101  H HD12 . LEU A 1 34 ? 2.413   -11.144 6.867   1.00 15.00 ?  330 LEU A HD12 9  
ATOM 7102  H HD13 . LEU A 1 34 ? 2.934   -12.536 5.918   1.00 15.00 ?  330 LEU A HD13 9  
ATOM 7103  H HD21 . LEU A 1 34 ? 5.639   -10.792 4.119   1.00 15.00 ?  330 LEU A HD21 9  
ATOM 7104  H HD22 . LEU A 1 34 ? 4.005   -10.995 3.485   1.00 15.00 ?  330 LEU A HD22 9  
ATOM 7105  H HD23 . LEU A 1 34 ? 4.799   -12.329 4.321   1.00 15.00 ?  330 LEU A HD23 9  
ATOM 7106  N N    . SER A 1 35 ? 5.329   -7.876  8.278   1.00 15.00 ?  331 SER A N    9  
ATOM 7107  C CA   . SER A 1 35 ? 6.363   -7.993  9.291   1.00 15.00 ?  331 SER A CA   9  
ATOM 7108  C C    . SER A 1 35 ? 5.760   -7.790  10.684  1.00 15.00 ?  331 SER A C    9  
ATOM 7109  O O    . SER A 1 35 ? 6.421   -8.015  11.701  1.00 15.00 ?  331 SER A O    9  
ATOM 7110  C CB   . SER A 1 35 ? 7.476   -6.974  9.025   1.00 15.00 ?  331 SER A CB   9  
ATOM 7111  O OG   . SER A 1 35 ? 8.619   -7.224  9.826   1.00 15.00 ?  331 SER A OG   9  
ATOM 7112  H H    . SER A 1 35 ? 5.233   -7.033  7.789   1.00 15.00 ?  331 SER A H    9  
ATOM 7113  H HA   . SER A 1 35 ? 6.774   -8.990  9.233   1.00 15.00 ?  331 SER A HA   9  
ATOM 7114  H HB2  . SER A 1 35 ? 7.764   -7.028  7.985   1.00 15.00 ?  331 SER A HB2  9  
ATOM 7115  H HB3  . SER A 1 35 ? 7.108   -5.981  9.242   1.00 15.00 ?  331 SER A HB3  9  
ATOM 7116  H HG   . SER A 1 35 ? 8.399   -7.867  10.512  1.00 15.00 ?  331 SER A HG   9  
ATOM 7117  N N    . ALA A 1 36 ? 4.505   -7.355  10.719  1.00 15.00 ?  332 ALA A N    9  
ATOM 7118  C CA   . ALA A 1 36 ? 3.805   -7.122  11.975  1.00 15.00 ?  332 ALA A CA   9  
ATOM 7119  C C    . ALA A 1 36 ? 2.887   -8.292  12.305  1.00 15.00 ?  332 ALA A C    9  
ATOM 7120  O O    . ALA A 1 36 ? 2.336   -8.379  13.404  1.00 15.00 ?  332 ALA A O    9  
ATOM 7121  C CB   . ALA A 1 36 ? 3.009   -5.828  11.902  1.00 15.00 ?  332 ALA A CB   9  
ATOM 7122  H H    . ALA A 1 36 ? 4.032   -7.194  9.873   1.00 15.00 ?  332 ALA A H    9  
ATOM 7123  H HA   . ALA A 1 36 ? 4.544   -7.023  12.757  1.00 15.00 ?  332 ALA A HA   9  
ATOM 7124  H HB1  . ALA A 1 36 ? 2.262   -5.908  11.126  1.00 15.00 ?  332 ALA A HB1  9  
ATOM 7125  H HB2  . ALA A 1 36 ? 3.675   -5.009  11.677  1.00 15.00 ?  332 ALA A HB2  9  
ATOM 7126  H HB3  . ALA A 1 36 ? 2.526   -5.649  12.851  1.00 15.00 ?  332 ALA A HB3  9  
ATOM 7127  N N    . ASN A 1 37 ? 2.719   -9.189  11.344  1.00 15.00 ?  333 ASN A N    9  
ATOM 7128  C CA   . ASN A 1 37 ? 1.864   -10.349 11.529  1.00 15.00 ?  333 ASN A CA   9  
ATOM 7129  C C    . ASN A 1 37 ? 2.701   -11.594 11.771  1.00 15.00 ?  333 ASN A C    9  
ATOM 7130  O O    . ASN A 1 37 ? 3.095   -11.829 12.933  1.00 15.00 ?  333 ASN A O    9  
ATOM 7131  C CB   . ASN A 1 37 ? 0.946   -10.556 10.320  1.00 15.00 ?  333 ASN A CB   9  
ATOM 7132  C CG   . ASN A 1 37 ? -0.089  -9.458  10.171  1.00 15.00 ?  333 ASN A CG   9  
ATOM 7133  O OD1  . ASN A 1 37 ? 0.114   -8.482  9.447   1.00 15.00 ?  333 ASN A OD1  9  
ATOM 7134  N ND2  . ASN A 1 37 ? -1.203  -9.602  10.869  1.00 15.00 ?  333 ASN A ND2  9  
ATOM 7135  O OXT  . ASN A 1 37 ? 2.956   -12.345 10.806  1.00 15.00 ?  333 ASN A OXT  9  
ATOM 7136  H H    . ASN A 1 37 ? 3.191   -9.075  10.492  1.00 15.00 ?  333 ASN A H    9  
ATOM 7137  H HA   . ASN A 1 37 ? 1.253   -10.169 12.402  1.00 15.00 ?  333 ASN A HA   9  
ATOM 7138  H HB2  . ASN A 1 37 ? 1.545   -10.582 9.422   1.00 15.00 ?  333 ASN A HB2  9  
ATOM 7139  H HB3  . ASN A 1 37 ? 0.430   -11.498 10.428  1.00 15.00 ?  333 ASN A HB3  9  
ATOM 7140  H HD21 . ASN A 1 37 ? -1.293  -10.397 11.437  1.00 15.00 ?  333 ASN A HD21 9  
ATOM 7141  H HD22 . ASN A 1 37 ? -1.895  -8.908  10.787  1.00 15.00 ?  333 ASN A HD22 9  
ATOM 7142  N N    . GLU B 2 1  ? 5.131   -8.699  -6.000  1.00 15.00 ?  203 GLU B N    9  
ATOM 7143  C CA   . GLU B 2 1  ? 4.149   -8.984  -4.932  1.00 15.00 ?  203 GLU B CA   9  
ATOM 7144  C C    . GLU B 2 1  ? 3.719   -10.445 -4.986  1.00 15.00 ?  203 GLU B C    9  
ATOM 7145  O O    . GLU B 2 1  ? 3.336   -10.957 -6.038  1.00 15.00 ?  203 GLU B O    9  
ATOM 7146  C CB   . GLU B 2 1  ? 2.917   -8.056  -5.048  1.00 15.00 ?  203 GLU B CB   9  
ATOM 7147  C CG   . GLU B 2 1  ? 2.081   -8.239  -6.311  1.00 15.00 ?  203 GLU B CG   9  
ATOM 7148  C CD   . GLU B 2 1  ? 2.783   -7.764  -7.568  1.00 15.00 ?  203 GLU B CD   9  
ATOM 7149  O OE1  . GLU B 2 1  ? 3.611   -8.521  -8.117  1.00 15.00 -1 203 GLU B OE1  9  
ATOM 7150  O OE2  . GLU B 2 1  ? 2.530   -6.625  -8.001  1.00 15.00 ?  203 GLU B OE2  9  
ATOM 7151  H H1   . GLU B 2 1  ? 5.924   -9.374  -5.946  1.00 15.00 ?  203 GLU B H1   9  
ATOM 7152  H H2   . GLU B 2 1  ? 5.504   -7.731  -5.897  1.00 15.00 ?  203 GLU B H2   9  
ATOM 7153  H H3   . GLU B 2 1  ? 4.674   -8.788  -6.936  1.00 15.00 ?  203 GLU B H3   9  
ATOM 7154  H HA   . GLU B 2 1  ? 4.631   -8.806  -3.982  1.00 15.00 ?  203 GLU B HA   9  
ATOM 7155  H HB2  . GLU B 2 1  ? 2.273   -8.229  -4.197  1.00 15.00 ?  203 GLU B HB2  9  
ATOM 7156  H HB3  . GLU B 2 1  ? 3.259   -7.032  -5.019  1.00 15.00 ?  203 GLU B HB3  9  
ATOM 7157  H HG2  . GLU B 2 1  ? 1.852   -9.289  -6.424  1.00 15.00 ?  203 GLU B HG2  9  
ATOM 7158  H HG3  . GLU B 2 1  ? 1.162   -7.683  -6.196  1.00 15.00 ?  203 GLU B HG3  9  
ATOM 7159  N N    . LEU B 2 2  ? 3.800   -11.117 -3.848  1.00 15.00 ?  204 LEU B N    9  
ATOM 7160  C CA   . LEU B 2 2  ? 3.370   -12.504 -3.747  1.00 15.00 ?  204 LEU B CA   9  
ATOM 7161  C C    . LEU B 2 2  ? 1.859   -12.569 -3.541  1.00 15.00 ?  204 LEU B C    9  
ATOM 7162  O O    . LEU B 2 2  ? 1.243   -13.633 -3.611  1.00 15.00 ?  204 LEU B O    9  
ATOM 7163  C CB   . LEU B 2 2  ? 4.099   -13.193 -2.588  1.00 15.00 ?  204 LEU B CB   9  
ATOM 7164  C CG   . LEU B 2 2  ? 3.894   -14.704 -2.484  1.00 15.00 ?  204 LEU B CG   9  
ATOM 7165  C CD1  . LEU B 2 2  ? 4.410   -15.393 -3.736  1.00 15.00 ?  204 LEU B CD1  9  
ATOM 7166  C CD2  . LEU B 2 2  ? 4.589   -15.249 -1.247  1.00 15.00 ?  204 LEU B CD2  9  
ATOM 7167  H H    . LEU B 2 2  ? 4.172   -10.675 -3.056  1.00 15.00 ?  204 LEU B H    9  
ATOM 7168  H HA   . LEU B 2 2  ? 3.621   -13.003 -4.672  1.00 15.00 ?  204 LEU B HA   9  
ATOM 7169  H HB2  . LEU B 2 2  ? 5.157   -13.003 -2.694  1.00 15.00 ?  204 LEU B HB2  9  
ATOM 7170  H HB3  . LEU B 2 2  ? 3.763   -12.745 -1.664  1.00 15.00 ?  204 LEU B HB3  9  
ATOM 7171  H HG   . LEU B 2 2  ? 2.837   -14.914 -2.397  1.00 15.00 ?  204 LEU B HG   9  
ATOM 7172  H HD11 . LEU B 2 2  ? 4.257   -16.458 -3.651  1.00 15.00 ?  204 LEU B HD11 9  
ATOM 7173  H HD12 . LEU B 2 2  ? 5.464   -15.187 -3.850  1.00 15.00 ?  204 LEU B HD12 9  
ATOM 7174  H HD13 . LEU B 2 2  ? 3.875   -15.020 -4.598  1.00 15.00 ?  204 LEU B HD13 9  
ATOM 7175  H HD21 . LEU B 2 2  ? 4.184   -14.774 -0.365  1.00 15.00 ?  204 LEU B HD21 9  
ATOM 7176  H HD22 . LEU B 2 2  ? 5.648   -15.046 -1.311  1.00 15.00 ?  204 LEU B HD22 9  
ATOM 7177  H HD23 . LEU B 2 2  ? 4.431   -16.316 -1.186  1.00 15.00 ?  204 LEU B HD23 9  
ATOM 7178  N N    . GLU B 2 3  ? 1.274   -11.410 -3.289  1.00 15.00 ?  205 GLU B N    9  
ATOM 7179  C CA   . GLU B 2 3  ? -0.140  -11.308 -2.984  1.00 15.00 ?  205 GLU B CA   9  
ATOM 7180  C C    . GLU B 2 3  ? -0.941  -10.934 -4.235  1.00 15.00 ?  205 GLU B C    9  
ATOM 7181  O O    . GLU B 2 3  ? -0.369  -10.553 -5.260  1.00 15.00 ?  205 GLU B O    9  
ATOM 7182  C CB   . GLU B 2 3  ? -0.329  -10.263 -1.877  1.00 15.00 ?  205 GLU B CB   9  
ATOM 7183  C CG   . GLU B 2 3  ? -1.720  -10.233 -1.273  1.00 15.00 ?  205 GLU B CG   9  
ATOM 7184  C CD   . GLU B 2 3  ? -2.228  -11.616 -0.926  1.00 15.00 ?  205 GLU B CD   9  
ATOM 7185  O OE1  . GLU B 2 3  ? -1.808  -12.167 0.109   1.00 15.00 ?  205 GLU B OE1  9  
ATOM 7186  O OE2  . GLU B 2 3  ? -3.053  -12.158 -1.699  1.00 15.00 -1 205 GLU B OE2  9  
ATOM 7187  H H    . GLU B 2 3  ? 1.810   -10.595 -3.314  1.00 15.00 ?  205 GLU B H    9  
ATOM 7188  H HA   . GLU B 2 3  ? -0.474  -12.269 -2.625  1.00 15.00 ?  205 GLU B HA   9  
ATOM 7189  H HB2  . GLU B 2 3  ? 0.376   -10.468 -1.085  1.00 15.00 ?  205 GLU B HB2  9  
ATOM 7190  H HB3  . GLU B 2 3  ? -0.118  -9.286  -2.287  1.00 15.00 ?  205 GLU B HB3  9  
ATOM 7191  H HG2  . GLU B 2 3  ? -1.691  -9.638  -0.372  1.00 15.00 ?  205 GLU B HG2  9  
ATOM 7192  H HG3  . GLU B 2 3  ? -2.398  -9.781  -1.981  1.00 15.00 ?  205 GLU B HG3  9  
ATOM 7193  N N    . SER B 2 4  ? -2.259  -11.067 -4.139  1.00 15.00 ?  206 SER B N    9  
ATOM 7194  C CA   . SER B 2 4  ? -3.176  -10.686 -5.207  1.00 15.00 ?  206 SER B CA   9  
ATOM 7195  C C    . SER B 2 4  ? -2.991  -9.241  -5.643  1.00 15.00 ?  206 SER B C    9  
ATOM 7196  O O    . SER B 2 4  ? -2.552  -8.378  -4.879  1.00 15.00 ?  206 SER B O    9  
ATOM 7197  C CB   . SER B 2 4  ? -4.614  -10.932 -4.770  1.00 15.00 ?  206 SER B CB   9  
ATOM 7198  O OG   . SER B 2 4  ? -4.801  -10.670 -3.388  1.00 15.00 ?  206 SER B OG   9  
ATOM 7199  H H    . SER B 2 4  ? -2.633  -11.434 -3.306  1.00 15.00 ?  206 SER B H    9  
ATOM 7200  H HA   . SER B 2 4  ? -2.988  -11.308 -6.072  1.00 15.00 ?  206 SER B HA   9  
ATOM 7201  H HB2  . SER B 2 4  ? -5.263  -10.283 -5.339  1.00 15.00 ?  206 SER B HB2  9  
ATOM 7202  H HB3  . SER B 2 4  ? -4.865  -11.957 -4.981  1.00 15.00 ?  206 SER B HB3  9  
ATOM 7203  H HG   . SER B 2 4  ? -4.295  -11.309 -2.865  1.00 15.00 ?  206 SER B HG   9  
ATOM 7204  N N    . PRO B 2 5  ? -3.368  -9.007  -6.896  1.00 15.00 ?  207 PRO B N    9  
ATOM 7205  C CA   . PRO B 2 5  ? -3.265  -7.715  -7.573  1.00 15.00 ?  207 PRO B CA   9  
ATOM 7206  C C    . PRO B 2 5  ? -3.821  -6.563  -6.737  1.00 15.00 ?  207 PRO B C    9  
ATOM 7207  O O    . PRO B 2 5  ? -4.995  -6.566  -6.357  1.00 15.00 ?  207 PRO B O    9  
ATOM 7208  C CB   . PRO B 2 5  ? -4.130  -7.904  -8.825  1.00 15.00 ?  207 PRO B CB   9  
ATOM 7209  C CG   . PRO B 2 5  ? -4.207  -9.379  -9.061  1.00 15.00 ?  207 PRO B CG   9  
ATOM 7210  C CD   . PRO B 2 5  ? -3.882  -10.065 -7.759  1.00 15.00 ?  207 PRO B CD   9  
ATOM 7211  H HA   . PRO B 2 5  ? -2.253  -7.499  -7.865  1.00 15.00 ?  207 PRO B HA   9  
ATOM 7212  H HB2  . PRO B 2 5  ? -5.110  -7.485  -8.649  1.00 15.00 ?  207 PRO B HB2  9  
ATOM 7213  H HB3  . PRO B 2 5  ? -3.668  -7.398  -9.660  1.00 15.00 ?  207 PRO B HB3  9  
ATOM 7214  H HG2  . PRO B 2 5  ? -5.204  -9.644  -9.379  1.00 15.00 ?  207 PRO B HG2  9  
ATOM 7215  H HG3  . PRO B 2 5  ? -3.489  -9.660  -9.819  1.00 15.00 ?  207 PRO B HG3  9  
ATOM 7216  H HD2  . PRO B 2 5  ? -4.750  -10.512 -7.313  1.00 15.00 ?  207 PRO B HD2  9  
ATOM 7217  H HD3  . PRO B 2 5  ? -3.135  -10.824 -7.901  1.00 15.00 ?  207 PRO B HD3  9  
ATOM 7218  N N    . PRO B 2 6  ? -2.968  -5.574  -6.418  1.00 15.00 ?  208 PRO B N    9  
ATOM 7219  C CA   . PRO B 2 6  ? -3.355  -4.423  -5.611  1.00 15.00 ?  208 PRO B CA   9  
ATOM 7220  C C    . PRO B 2 6  ? -4.062  -3.322  -6.407  1.00 15.00 ?  208 PRO B C    9  
ATOM 7221  O O    . PRO B 2 6  ? -3.948  -3.247  -7.635  1.00 15.00 ?  208 PRO B O    9  
ATOM 7222  C CB   . PRO B 2 6  ? -2.020  -3.900  -5.056  1.00 15.00 ?  208 PRO B CB   9  
ATOM 7223  C CG   . PRO B 2 6  ? -0.944  -4.775  -5.619  1.00 15.00 ?  208 PRO B CG   9  
ATOM 7224  C CD   . PRO B 2 6  ? -1.546  -5.519  -6.774  1.00 15.00 ?  208 PRO B CD   9  
ATOM 7225  H HA   . PRO B 2 6  ? -3.986  -4.722  -4.789  1.00 15.00 ?  208 PRO B HA   9  
ATOM 7226  H HB2  . PRO B 2 6  ? -1.883  -2.872  -5.364  1.00 15.00 ?  208 PRO B HB2  9  
ATOM 7227  H HB3  . PRO B 2 6  ? -2.041  -3.954  -3.974  1.00 15.00 ?  208 PRO B HB3  9  
ATOM 7228  H HG2  . PRO B 2 6  ? -0.121  -4.167  -5.960  1.00 15.00 ?  208 PRO B HG2  9  
ATOM 7229  H HG3  . PRO B 2 6  ? -0.608  -5.470  -4.863  1.00 15.00 ?  208 PRO B HG3  9  
ATOM 7230  H HD2  . PRO B 2 6  ? -1.395  -4.977  -7.698  1.00 15.00 ?  208 PRO B HD2  9  
ATOM 7231  H HD3  . PRO B 2 6  ? -1.121  -6.508  -6.838  1.00 15.00 ?  208 PRO B HD3  9  
ATOM 7232  N N    . PRO B 2 7  ? -4.796  -2.458  -5.680  1.00 15.00 ?  209 PRO B N    9  
ATOM 7233  C CA   . PRO B 2 7  ? -5.485  -1.283  -6.233  1.00 15.00 ?  209 PRO B CA   9  
ATOM 7234  C C    . PRO B 2 7  ? -4.598  -0.423  -7.139  1.00 15.00 ?  209 PRO B C    9  
ATOM 7235  O O    . PRO B 2 7  ? -3.454  -0.131  -6.794  1.00 15.00 ?  209 PRO B O    9  
ATOM 7236  C CB   . PRO B 2 7  ? -5.847  -0.454  -4.993  1.00 15.00 ?  209 PRO B CB   9  
ATOM 7237  C CG   . PRO B 2 7  ? -5.640  -1.319  -3.798  1.00 15.00 ?  209 PRO B CG   9  
ATOM 7238  C CD   . PRO B 2 7  ? -5.057  -2.625  -4.246  1.00 15.00 ?  209 PRO B CD   9  
ATOM 7239  H HA   . PRO B 2 7  ? -6.386  -1.558  -6.762  1.00 15.00 ?  209 PRO B HA   9  
ATOM 7240  H HB2  . PRO B 2 7  ? -5.206  0.414   -4.952  1.00 15.00 ?  209 PRO B HB2  9  
ATOM 7241  H HB3  . PRO B 2 7  ? -6.870  -0.131  -5.058  1.00 15.00 ?  209 PRO B HB3  9  
ATOM 7242  H HG2  . PRO B 2 7  ? -4.956  -0.832  -3.120  1.00 15.00 ?  209 PRO B HG2  9  
ATOM 7243  H HG3  . PRO B 2 7  ? -6.587  -1.485  -3.307  1.00 15.00 ?  209 PRO B HG3  9  
ATOM 7244  H HD2  . PRO B 2 7  ? -4.139  -2.824  -3.716  1.00 15.00 ?  209 PRO B HD2  9  
ATOM 7245  H HD3  . PRO B 2 7  ? -5.765  -3.425  -4.080  1.00 15.00 ?  209 PRO B HD3  9  
ATOM 7246  N N    . PRO B 2 8  ? -5.142  0.019   -8.292  1.00 15.00 ?  210 PRO B N    9  
ATOM 7247  C CA   . PRO B 2 8  ? -4.440  0.922   -9.224  1.00 15.00 ?  210 PRO B CA   9  
ATOM 7248  C C    . PRO B 2 8  ? -3.948  2.190   -8.526  1.00 15.00 ?  210 PRO B C    9  
ATOM 7249  O O    . PRO B 2 8  ? -4.548  2.638   -7.543  1.00 15.00 ?  210 PRO B O    9  
ATOM 7250  C CB   . PRO B 2 8  ? -5.518  1.268   -10.256 1.00 15.00 ?  210 PRO B CB   9  
ATOM 7251  C CG   . PRO B 2 8  ? -6.476  0.132   -10.203 1.00 15.00 ?  210 PRO B CG   9  
ATOM 7252  C CD   . PRO B 2 8  ? -6.491  -0.328  -8.773  1.00 15.00 ?  210 PRO B CD   9  
ATOM 7253  H HA   . PRO B 2 8  ? -3.610  0.429   -9.709  1.00 15.00 ?  210 PRO B HA   9  
ATOM 7254  H HB2  . PRO B 2 8  ? -5.993  2.200   -9.985  1.00 15.00 ?  210 PRO B HB2  9  
ATOM 7255  H HB3  . PRO B 2 8  ? -5.067  1.359   -11.233 1.00 15.00 ?  210 PRO B HB3  9  
ATOM 7256  H HG2  . PRO B 2 8  ? -7.459  0.465   -10.500 1.00 15.00 ?  210 PRO B HG2  9  
ATOM 7257  H HG3  . PRO B 2 8  ? -6.138  -0.665  -10.848 1.00 15.00 ?  210 PRO B HG3  9  
ATOM 7258  H HD2  . PRO B 2 8  ? -7.249  0.202   -8.215  1.00 15.00 ?  210 PRO B HD2  9  
ATOM 7259  H HD3  . PRO B 2 8  ? -6.656  -1.394  -8.720  1.00 15.00 ?  210 PRO B HD3  9  
ATOM 7260  N N    . TYR B 2 9  ? -2.884  2.797   -9.050  1.00 15.00 ?  211 TYR B N    9  
ATOM 7261  C CA   . TYR B 2 9  ? -2.253  3.909   -8.357  1.00 15.00 ?  211 TYR B CA   9  
ATOM 7262  C C    . TYR B 2 9  ? -3.057  5.200   -8.458  1.00 15.00 ?  211 TYR B C    9  
ATOM 7263  O O    . TYR B 2 9  ? -2.971  5.949   -9.435  1.00 15.00 ?  211 TYR B O    9  
ATOM 7264  C CB   . TYR B 2 9  ? -0.806  4.156   -8.817  1.00 15.00 ?  211 TYR B CB   9  
ATOM 7265  C CG   . TYR B 2 9  ? -0.146  5.340   -8.115  1.00 15.00 ?  211 TYR B CG   9  
ATOM 7266  C CD1  . TYR B 2 9  ? -0.527  5.717   -6.828  1.00 15.00 ?  211 TYR B CD1  9  
ATOM 7267  C CD2  . TYR B 2 9  ? 0.844   6.093   -8.740  1.00 15.00 ?  211 TYR B CD2  9  
ATOM 7268  C CE1  . TYR B 2 9  ? 0.052   6.798   -6.196  1.00 15.00 ?  211 TYR B CE1  9  
ATOM 7269  C CE2  . TYR B 2 9  ? 1.429   7.174   -8.098  1.00 15.00 ?  211 TYR B CE2  9  
ATOM 7270  C CZ   . TYR B 2 9  ? 1.030   7.516   -6.838  1.00 15.00 ?  211 TYR B CZ   9  
ATOM 7271  O OH   . TYR B 2 9  ? 1.607   8.595   -6.220  1.00 15.00 ?  211 TYR B OH   9  
ATOM 7272  H H    . TYR B 2 9  ? -2.533  2.500   -9.923  1.00 15.00 ?  211 TYR B H    9  
ATOM 7273  H HA   . TYR B 2 9  ? -2.221  3.634   -7.313  1.00 15.00 ?  211 TYR B HA   9  
ATOM 7274  H HB2  . TYR B 2 9  ? -0.215  3.277   -8.613  1.00 15.00 ?  211 TYR B HB2  9  
ATOM 7275  H HB3  . TYR B 2 9  ? -0.801  4.352   -9.879  1.00 15.00 ?  211 TYR B HB3  9  
ATOM 7276  H HD1  . TYR B 2 9  ? -1.289  5.147   -6.316  1.00 15.00 ?  211 TYR B HD1  9  
ATOM 7277  H HD2  . TYR B 2 9  ? 1.162   5.823   -9.737  1.00 15.00 ?  211 TYR B HD2  9  
ATOM 7278  H HE1  . TYR B 2 9  ? -0.259  7.071   -5.199  1.00 15.00 ?  211 TYR B HE1  9  
ATOM 7279  H HE2  . TYR B 2 9  ? 2.204   7.744   -8.578  1.00 15.00 ?  211 TYR B HE2  9  
ATOM 7280  H HH   . TYR B 2 9  ? 1.627   9.350   -6.835  1.00 15.00 ?  211 TYR B HH   9  
ATOM 7281  N N    . SER B 2 10 ? -3.877  5.401   -7.453  1.00 15.00 ?  212 SER B N    9  
ATOM 7282  C CA   . SER B 2 10 ? -4.340  6.716   -7.080  1.00 15.00 ?  212 SER B CA   9  
ATOM 7283  C C    . SER B 2 10 ? -3.565  7.060   -5.821  1.00 15.00 ?  212 SER B C    9  
ATOM 7284  O O    . SER B 2 10 ? -3.231  6.145   -5.070  1.00 15.00 ?  212 SER B O    9  
ATOM 7285  C CB   . SER B 2 10 ? -5.846  6.685   -6.812  1.00 15.00 ?  212 SER B CB   9  
ATOM 7286  O OG   . SER B 2 10 ? -6.533  6.069   -7.889  1.00 15.00 ?  212 SER B OG   9  
ATOM 7287  H H    . SER B 2 10 ? -4.180  4.626   -6.932  1.00 15.00 ?  212 SER B H    9  
ATOM 7288  H HA   . SER B 2 10 ? -4.105  7.415   -7.870  1.00 15.00 ?  212 SER B HA   9  
ATOM 7289  H HB2  . SER B 2 10 ? -6.038  6.126   -5.908  1.00 15.00 ?  212 SER B HB2  9  
ATOM 7290  H HB3  . SER B 2 10 ? -6.211  7.696   -6.697  1.00 15.00 ?  212 SER B HB3  9  
ATOM 7291  H HG   . SER B 2 10 ? -5.894  5.801   -8.560  1.00 15.00 ?  212 SER B HG   9  
ATOM 7292  N N    . ARG B 2 11 ? -3.269  8.331   -5.565  1.00 15.00 ?  213 ARG B N    9  
ATOM 7293  C CA   . ARG B 2 11 ? -2.406  8.653   -4.430  1.00 15.00 ?  213 ARG B CA   9  
ATOM 7294  C C    . ARG B 2 11 ? -3.044  8.146   -3.152  1.00 15.00 ?  213 ARG B C    9  
ATOM 7295  O O    . ARG B 2 11 ? -2.460  7.347   -2.420  1.00 15.00 ?  213 ARG B O    9  
ATOM 7296  C CB   . ARG B 2 11 ? -2.166  10.159  -4.272  1.00 15.00 ?  213 ARG B CB   9  
ATOM 7297  C CG   . ARG B 2 11 ? -1.567  10.852  -5.466  1.00 15.00 ?  213 ARG B CG   9  
ATOM 7298  C CD   . ARG B 2 11 ? -1.060  12.243  -5.114  1.00 15.00 ?  213 ARG B CD   9  
ATOM 7299  N NE   . ARG B 2 11 ? -2.141  13.135  -4.701  1.00 15.00 ?  213 ARG B NE   9  
ATOM 7300  C CZ   . ARG B 2 11 ? -2.025  14.063  -3.750  1.00 15.00 ?  213 ARG B CZ   9  
ATOM 7301  N NH1  . ARG B 2 11 ? -0.865  14.248  -3.126  1.00 15.00 1  213 ARG B NH1  9  
ATOM 7302  N NH2  . ARG B 2 11 ? -3.070  14.809  -3.426  1.00 15.00 ?  213 ARG B NH2  9  
ATOM 7303  H H    . ARG B 2 11 ? -3.638  9.047   -6.121  1.00 15.00 ?  213 ARG B H    9  
ATOM 7304  H HA   . ARG B 2 11 ? -1.461  8.152   -4.575  1.00 15.00 ?  213 ARG B HA   9  
ATOM 7305  H HB2  . ARG B 2 11 ? -3.111  10.633  -4.057  1.00 15.00 ?  213 ARG B HB2  9  
ATOM 7306  H HB3  . ARG B 2 11 ? -1.507  10.309  -3.430  1.00 15.00 ?  213 ARG B HB3  9  
ATOM 7307  H HG2  . ARG B 2 11 ? -0.748  10.266  -5.837  1.00 15.00 ?  213 ARG B HG2  9  
ATOM 7308  H HG3  . ARG B 2 11 ? -2.331  10.943  -6.213  1.00 15.00 ?  213 ARG B HG3  9  
ATOM 7309  H HD2  . ARG B 2 11 ? -0.349  12.159  -4.305  1.00 15.00 ?  213 ARG B HD2  9  
ATOM 7310  H HD3  . ARG B 2 11 ? -0.570  12.664  -5.980  1.00 15.00 ?  213 ARG B HD3  9  
ATOM 7311  H HE   . ARG B 2 11 ? -3.006  13.031  -5.162  1.00 15.00 ?  213 ARG B HE   9  
ATOM 7312  H HH11 . ARG B 2 11 ? -0.063  13.693  -3.370  1.00 15.00 ?  213 ARG B HH11 9  
ATOM 7313  H HH12 . ARG B 2 11 ? -0.787  14.938  -2.394  1.00 15.00 ?  213 ARG B HH12 9  
ATOM 7314  H HH21 . ARG B 2 11 ? -3.951  14.677  -3.898  1.00 15.00 ?  213 ARG B HH21 9  
ATOM 7315  H HH22 . ARG B 2 11 ? -2.994  15.509  -2.702  1.00 15.00 ?  213 ARG B HH22 9  
ATOM 7316  N N    . TYR B 2 12 ? -4.233  8.649   -2.879  1.00 15.00 ?  214 TYR B N    9  
ATOM 7317  C CA   . TYR B 2 12 ? -4.977  8.253   -1.704  1.00 15.00 ?  214 TYR B CA   9  
ATOM 7318  C C    . TYR B 2 12 ? -6.313  7.653   -2.120  1.00 15.00 ?  214 TYR B C    9  
ATOM 7319  O O    . TYR B 2 12 ? -7.328  8.346   -2.181  1.00 15.00 ?  214 TYR B O    9  
ATOM 7320  C CB   . TYR B 2 12 ? -5.147  9.461   -0.766  1.00 15.00 ?  214 TYR B CB   9  
ATOM 7321  C CG   . TYR B 2 12 ? -3.844  10.218  -0.567  1.00 15.00 ?  214 TYR B CG   9  
ATOM 7322  C CD1  . TYR B 2 12 ? -3.324  11.020  -1.580  1.00 15.00 ?  214 TYR B CD1  9  
ATOM 7323  C CD2  . TYR B 2 12 ? -3.108  10.092  0.604   1.00 15.00 ?  214 TYR B CD2  9  
ATOM 7324  C CE1  . TYR B 2 12 ? -2.118  11.667  -1.439  1.00 15.00 ?  214 TYR B CE1  9  
ATOM 7325  C CE2  . TYR B 2 12 ? -1.898  10.748  0.758   1.00 15.00 ?  214 TYR B CE2  9  
ATOM 7326  C CZ   . TYR B 2 12 ? -1.409  11.530  -0.266  1.00 15.00 ?  214 TYR B CZ   9  
ATOM 7327  O OH   . TYR B 2 12 ? -0.195  12.160  -0.116  1.00 15.00 ?  214 TYR B OH   9  
ATOM 7328  H H    . TYR B 2 12 ? -4.628  9.304   -3.497  1.00 15.00 ?  214 TYR B H    9  
ATOM 7329  H HA   . TYR B 2 12 ? -4.407  7.479   -1.197  1.00 15.00 ?  214 TYR B HA   9  
ATOM 7330  H HB2  . TYR B 2 12 ? -5.873  10.143  -1.187  1.00 15.00 ?  214 TYR B HB2  9  
ATOM 7331  H HB3  . TYR B 2 12 ? -5.489  9.121   0.199   1.00 15.00 ?  214 TYR B HB3  9  
ATOM 7332  H HD1  . TYR B 2 12 ? -3.878  11.127  -2.508  1.00 15.00 ?  214 TYR B HD1  9  
ATOM 7333  H HD2  . TYR B 2 12 ? -3.493  9.478   1.405   1.00 15.00 ?  214 TYR B HD2  9  
ATOM 7334  H HE1  . TYR B 2 12 ? -1.733  12.271  -2.258  1.00 15.00 ?  214 TYR B HE1  9  
ATOM 7335  H HE2  . TYR B 2 12 ? -1.336  10.640  1.671   1.00 15.00 ?  214 TYR B HE2  9  
ATOM 7336  H HH   . TYR B 2 12 ? 0.453   11.515  0.220   1.00 15.00 ?  214 TYR B HH   9  
ATOM 7337  N N    . PRO B 2 13 ? -6.303  6.368   -2.491  1.00 15.00 ?  215 PRO B N    9  
ATOM 7338  C CA   . PRO B 2 13 ? -7.496  5.671   -2.960  1.00 15.00 ?  215 PRO B CA   9  
ATOM 7339  C C    . PRO B 2 13 ? -8.398  5.227   -1.813  1.00 15.00 ?  215 PRO B C    9  
ATOM 7340  O O    . PRO B 2 13 ? -8.078  4.291   -1.090  1.00 15.00 ?  215 PRO B O    9  
ATOM 7341  C CB   . PRO B 2 13 ? -6.919  4.461   -3.699  1.00 15.00 ?  215 PRO B CB   9  
ATOM 7342  C CG   . PRO B 2 13 ? -5.620  4.182   -3.015  1.00 15.00 ?  215 PRO B CG   9  
ATOM 7343  C CD   . PRO B 2 13 ? -5.113  5.496   -2.492  1.00 15.00 ?  215 PRO B CD   9  
ATOM 7344  H HA   . PRO B 2 13 ? -8.065  6.280   -3.649  1.00 15.00 ?  215 PRO B HA   9  
ATOM 7345  H HB2  . PRO B 2 13 ? -7.599  3.627   -3.616  1.00 15.00 ?  215 PRO B HB2  9  
ATOM 7346  H HB3  . PRO B 2 13 ? -6.768  4.709   -4.738  1.00 15.00 ?  215 PRO B HB3  9  
ATOM 7347  H HG2  . PRO B 2 13 ? -5.775  3.497   -2.191  1.00 15.00 ?  215 PRO B HG2  9  
ATOM 7348  H HG3  . PRO B 2 13 ? -4.912  3.763   -3.719  1.00 15.00 ?  215 PRO B HG3  9  
ATOM 7349  H HD2  . PRO B 2 13 ? -4.723  5.377   -1.493  1.00 15.00 ?  215 PRO B HD2  9  
ATOM 7350  H HD3  . PRO B 2 13 ? -4.351  5.891   -3.148  1.00 15.00 ?  215 PRO B HD3  9  
ATOM 7351  N N    . MET B 2 14 ? -9.508  5.923   -1.625  1.00 15.00 ?  216 MET B N    9  
ATOM 7352  C CA   . MET B 2 14 ? -10.430 5.588   -0.551  1.00 15.00 ?  216 MET B CA   9  
ATOM 7353  C C    . MET B 2 14 ? -11.343 4.444   -0.962  1.00 15.00 ?  216 MET B C    9  
ATOM 7354  O O    . MET B 2 14 ? -12.113 4.562   -1.916  1.00 15.00 ?  216 MET B O    9  
ATOM 7355  C CB   . MET B 2 14 ? -11.262 6.806   -0.146  1.00 15.00 ?  216 MET B CB   9  
ATOM 7356  C CG   . MET B 2 14 ? -10.460 7.879   0.573   1.00 15.00 ?  216 MET B CG   9  
ATOM 7357  S SD   . MET B 2 14 ? -11.474 9.272   1.111   1.00 15.00 ?  216 MET B SD   9  
ATOM 7358  C CE   . MET B 2 14 ? -12.679 8.442   2.147   1.00 15.00 ?  216 MET B CE   9  
ATOM 7359  H H    . MET B 2 14 ? -9.715  6.679   -2.223  1.00 15.00 ?  216 MET B H    9  
ATOM 7360  H HA   . MET B 2 14 ? -9.842  5.272   0.298   1.00 15.00 ?  216 MET B HA   9  
ATOM 7361  H HB2  . MET B 2 14 ? -11.693 7.244   -1.034  1.00 15.00 ?  216 MET B HB2  9  
ATOM 7362  H HB3  . MET B 2 14 ? -12.059 6.483   0.508   1.00 15.00 ?  216 MET B HB3  9  
ATOM 7363  H HG2  . MET B 2 14 ? -9.993  7.437   1.440   1.00 15.00 ?  216 MET B HG2  9  
ATOM 7364  H HG3  . MET B 2 14 ? -9.695  8.245   -0.097  1.00 15.00 ?  216 MET B HG3  9  
ATOM 7365  H HE1  . MET B 2 14 ? -13.225 7.719   1.558   1.00 15.00 ?  216 MET B HE1  9  
ATOM 7366  H HE2  . MET B 2 14 ? -13.369 9.169   2.551   1.00 15.00 ?  216 MET B HE2  9  
ATOM 7367  H HE3  . MET B 2 14 ? -12.172 7.939   2.957   1.00 15.00 ?  216 MET B HE3  9  
ATOM 7368  N N    . ASP B 2 15 ? -11.235 3.332   -0.252  1.00 15.00 ?  217 ASP B N    9  
ATOM 7369  C CA   . ASP B 2 15 ? -12.084 2.179   -0.499  1.00 15.00 ?  217 ASP B CA   9  
ATOM 7370  C C    . ASP B 2 15 ? -13.091 2.048   0.631   1.00 15.00 ?  217 ASP B C    9  
ATOM 7371  O O    . ASP B 2 15 ? -14.231 1.612   0.371   1.00 15.00 ?  217 ASP B O    9  
ATOM 7372  C CB   . ASP B 2 15 ? -11.257 0.891   -0.626  1.00 15.00 ?  217 ASP B CB   9  
ATOM 7373  C CG   . ASP B 2 15 ? -10.822 0.319   0.713   1.00 15.00 ?  217 ASP B CG   9  
ATOM 7374  O OD1  . ASP B 2 15 ? -9.879  0.867   1.322   1.00 15.00 ?  217 ASP B OD1  9  
ATOM 7375  O OD2  . ASP B 2 15 ? -11.414 -0.696  1.154   1.00 15.00 -1 217 ASP B OD2  9  
ATOM 7376  O OXT  . ASP B 2 15 ? -12.747 2.410   1.777   1.00 15.00 ?  217 ASP B OXT  9  
ATOM 7377  H H    . ASP B 2 15 ? -10.573 3.287   0.467   1.00 15.00 ?  217 ASP B H    9  
ATOM 7378  H HA   . ASP B 2 15 ? -12.618 2.352   -1.423  1.00 15.00 ?  217 ASP B HA   9  
ATOM 7379  H HB2  . ASP B 2 15 ? -11.848 0.144   -1.135  1.00 15.00 ?  217 ASP B HB2  9  
ATOM 7380  H HB3  . ASP B 2 15 ? -10.373 1.098   -1.210  1.00 15.00 ?  217 ASP B HB3  9  
ATOM 7381  N N    . GLY A 1 1  ? 6.624   8.410   14.357  1.00 15.00 ?  297 GLY A N    10 
ATOM 7382  C CA   . GLY A 1 1  ? 5.576   7.622   13.669  1.00 15.00 ?  297 GLY A CA   10 
ATOM 7383  C C    . GLY A 1 1  ? 6.141   6.376   13.024  1.00 15.00 ?  297 GLY A C    10 
ATOM 7384  O O    . GLY A 1 1  ? 7.324   6.342   12.683  1.00 15.00 ?  297 GLY A O    10 
ATOM 7385  H H1   . GLY A 1 1  ? 7.387   8.653   13.689  1.00 15.00 ?  297 GLY A H1   10 
ATOM 7386  H H2   . GLY A 1 1  ? 7.033   7.859   15.142  1.00 15.00 ?  297 GLY A H2   10 
ATOM 7387  H H3   . GLY A 1 1  ? 6.220   9.291   14.741  1.00 15.00 ?  297 GLY A H3   10 
ATOM 7388  H HA2  . GLY A 1 1  ? 4.824   7.333   14.390  1.00 15.00 ?  297 GLY A HA2  10 
ATOM 7389  H HA3  . GLY A 1 1  ? 5.117   8.235   12.909  1.00 15.00 ?  297 GLY A HA3  10 
ATOM 7390  N N    . PRO A 1 2  ? 5.325   5.325   12.848  1.00 15.00 ?  298 PRO A N    10 
ATOM 7391  C CA   . PRO A 1 2  ? 5.774   4.070   12.246  1.00 15.00 ?  298 PRO A CA   10 
ATOM 7392  C C    . PRO A 1 2  ? 5.793   4.121   10.721  1.00 15.00 ?  298 PRO A C    10 
ATOM 7393  O O    . PRO A 1 2  ? 6.242   3.181   10.063  1.00 15.00 ?  298 PRO A O    10 
ATOM 7394  C CB   . PRO A 1 2  ? 4.734   3.067   12.736  1.00 15.00 ?  298 PRO A CB   10 
ATOM 7395  C CG   . PRO A 1 2  ? 3.482   3.862   12.894  1.00 15.00 ?  298 PRO A CG   10 
ATOM 7396  C CD   . PRO A 1 2  ? 3.901   5.269   13.244  1.00 15.00 ?  298 PRO A CD   10 
ATOM 7397  H HA   . PRO A 1 2  ? 6.752   3.786   12.608  1.00 15.00 ?  298 PRO A HA   10 
ATOM 7398  H HB2  . PRO A 1 2  ? 4.616   2.281   12.003  1.00 15.00 ?  298 PRO A HB2  10 
ATOM 7399  H HB3  . PRO A 1 2  ? 5.053   2.644   13.677  1.00 15.00 ?  298 PRO A HB3  10 
ATOM 7400  H HG2  . PRO A 1 2  ? 2.927   3.857   11.965  1.00 15.00 ?  298 PRO A HG2  10 
ATOM 7401  H HG3  . PRO A 1 2  ? 2.882   3.444   13.687  1.00 15.00 ?  298 PRO A HG3  10 
ATOM 7402  H HD2  . PRO A 1 2  ? 3.319   5.986   12.685  1.00 15.00 ?  298 PRO A HD2  10 
ATOM 7403  H HD3  . PRO A 1 2  ? 3.792   5.440   14.305  1.00 15.00 ?  298 PRO A HD3  10 
ATOM 7404  N N    . LEU A 1 3  ? 5.293   5.213   10.166  1.00 15.00 ?  299 LEU A N    10 
ATOM 7405  C CA   . LEU A 1 3  ? 5.221   5.375   8.725   1.00 15.00 ?  299 LEU A CA   10 
ATOM 7406  C C    . LEU A 1 3  ? 6.332   6.297   8.241   1.00 15.00 ?  299 LEU A C    10 
ATOM 7407  O O    . LEU A 1 3  ? 6.495   7.403   8.761   1.00 15.00 ?  299 LEU A O    10 
ATOM 7408  C CB   . LEU A 1 3  ? 3.860   5.961   8.332   1.00 15.00 ?  299 LEU A CB   10 
ATOM 7409  C CG   . LEU A 1 3  ? 3.609   6.086   6.826   1.00 15.00 ?  299 LEU A CG   10 
ATOM 7410  C CD1  . LEU A 1 3  ? 3.472   4.710   6.192   1.00 15.00 ?  299 LEU A CD1  10 
ATOM 7411  C CD2  . LEU A 1 3  ? 2.370   6.924   6.557   1.00 15.00 ?  299 LEU A CD2  10 
ATOM 7412  H H    . LEU A 1 3  ? 4.965   5.934   10.743  1.00 15.00 ?  299 LEU A H    10 
ATOM 7413  H HA   . LEU A 1 3  ? 5.337   4.403   8.269   1.00 15.00 ?  299 LEU A HA   10 
ATOM 7414  H HB2  . LEU A 1 3  ? 3.088   5.334   8.753   1.00 15.00 ?  299 LEU A HB2  10 
ATOM 7415  H HB3  . LEU A 1 3  ? 3.779   6.945   8.770   1.00 15.00 ?  299 LEU A HB3  10 
ATOM 7416  H HG   . LEU A 1 3  ? 4.455   6.582   6.368   1.00 15.00 ?  299 LEU A HG   10 
ATOM 7417  H HD11 . LEU A 1 3  ? 3.231   4.819   5.145   1.00 15.00 ?  299 LEU A HD11 10 
ATOM 7418  H HD12 . LEU A 1 3  ? 2.685   4.164   6.689   1.00 15.00 ?  299 LEU A HD12 10 
ATOM 7419  H HD13 . LEU A 1 3  ? 4.400   4.172   6.295   1.00 15.00 ?  299 LEU A HD13 10 
ATOM 7420  H HD21 . LEU A 1 3  ? 2.512   7.917   6.956   1.00 15.00 ?  299 LEU A HD21 10 
ATOM 7421  H HD22 . LEU A 1 3  ? 1.515   6.464   7.030   1.00 15.00 ?  299 LEU A HD22 10 
ATOM 7422  H HD23 . LEU A 1 3  ? 2.203   6.985   5.492   1.00 15.00 ?  299 LEU A HD23 10 
ATOM 7423  N N    . PRO A 1 4  ? 7.125   5.858   7.255   1.00 15.00 ?  300 PRO A N    10 
ATOM 7424  C CA   . PRO A 1 4  ? 8.149   6.701   6.637   1.00 15.00 ?  300 PRO A CA   10 
ATOM 7425  C C    . PRO A 1 4  ? 7.511   7.790   5.773   1.00 15.00 ?  300 PRO A C    10 
ATOM 7426  O O    . PRO A 1 4  ? 6.581   7.513   5.020   1.00 15.00 ?  300 PRO A O    10 
ATOM 7427  C CB   . PRO A 1 4  ? 8.952   5.720   5.765   1.00 15.00 ?  300 PRO A CB   10 
ATOM 7428  C CG   . PRO A 1 4  ? 8.509   4.356   6.182   1.00 15.00 ?  300 PRO A CG   10 
ATOM 7429  C CD   . PRO A 1 4  ? 7.096   4.518   6.650   1.00 15.00 ?  300 PRO A CD   10 
ATOM 7430  H HA   . PRO A 1 4  ? 8.794   7.154   7.376   1.00 15.00 ?  300 PRO A HA   10 
ATOM 7431  H HB2  . PRO A 1 4  ? 8.733   5.901   4.724   1.00 15.00 ?  300 PRO A HB2  10 
ATOM 7432  H HB3  . PRO A 1 4  ? 10.009  5.859   5.942   1.00 15.00 ?  300 PRO A HB3  10 
ATOM 7433  H HG2  . PRO A 1 4  ? 8.551   3.681   5.339   1.00 15.00 ?  300 PRO A HG2  10 
ATOM 7434  H HG3  . PRO A 1 4  ? 9.132   3.995   6.986   1.00 15.00 ?  300 PRO A HG3  10 
ATOM 7435  H HD2  . PRO A 1 4  ? 6.414   4.485   5.811   1.00 15.00 ?  300 PRO A HD2  10 
ATOM 7436  H HD3  . PRO A 1 4  ? 6.844   3.760   7.378   1.00 15.00 ?  300 PRO A HD3  10 
ATOM 7437  N N    . PRO A 1 5  ? 8.010   9.038   5.860   1.00 15.00 ?  301 PRO A N    10 
ATOM 7438  C CA   . PRO A 1 5  ? 7.438   10.187  5.131   1.00 15.00 ?  301 PRO A CA   10 
ATOM 7439  C C    . PRO A 1 5  ? 7.507   10.043  3.606   1.00 15.00 ?  301 PRO A C    10 
ATOM 7440  O O    . PRO A 1 5  ? 6.952   10.859  2.870   1.00 15.00 ?  301 PRO A O    10 
ATOM 7441  C CB   . PRO A 1 5  ? 8.296   11.373  5.592   1.00 15.00 ?  301 PRO A CB   10 
ATOM 7442  C CG   . PRO A 1 5  ? 8.945   10.916  6.853   1.00 15.00 ?  301 PRO A CG   10 
ATOM 7443  C CD   . PRO A 1 5  ? 9.153   9.438   6.692   1.00 15.00 ?  301 PRO A CD   10 
ATOM 7444  H HA   . PRO A 1 5  ? 6.411   10.358  5.420   1.00 15.00 ?  301 PRO A HA   10 
ATOM 7445  H HB2  . PRO A 1 5  ? 9.029   11.605  4.833   1.00 15.00 ?  301 PRO A HB2  10 
ATOM 7446  H HB3  . PRO A 1 5  ? 7.664   12.232  5.764   1.00 15.00 ?  301 PRO A HB3  10 
ATOM 7447  H HG2  . PRO A 1 5  ? 9.895   11.416  6.980   1.00 15.00 ?  301 PRO A HG2  10 
ATOM 7448  H HG3  . PRO A 1 5  ? 8.299   11.114  7.694   1.00 15.00 ?  301 PRO A HG3  10 
ATOM 7449  H HD2  . PRO A 1 5  ? 10.088  9.238   6.190   1.00 15.00 ?  301 PRO A HD2  10 
ATOM 7450  H HD3  . PRO A 1 5  ? 9.123   8.944   7.651   1.00 15.00 ?  301 PRO A HD3  10 
ATOM 7451  N N    . GLY A 1 6  ? 8.219   9.028   3.143   1.00 15.00 ?  302 GLY A N    10 
ATOM 7452  C CA   . GLY A 1 6  ? 8.279   8.736   1.724   1.00 15.00 ?  302 GLY A CA   10 
ATOM 7453  C C    . GLY A 1 6  ? 7.247   7.702   1.315   1.00 15.00 ?  302 GLY A C    10 
ATOM 7454  O O    . GLY A 1 6  ? 6.969   7.517   0.129   1.00 15.00 ?  302 GLY A O    10 
ATOM 7455  H H    . GLY A 1 6  ? 8.718   8.472   3.775   1.00 15.00 ?  302 GLY A H    10 
ATOM 7456  H HA2  . GLY A 1 6  ? 8.103   9.647   1.170   1.00 15.00 ?  302 GLY A HA2  10 
ATOM 7457  H HA3  . GLY A 1 6  ? 9.264   8.364   1.483   1.00 15.00 ?  302 GLY A HA3  10 
ATOM 7458  N N    . TRP A 1 7  ? 6.694   7.027   2.310   1.00 15.00 ?  303 TRP A N    10 
ATOM 7459  C CA   . TRP A 1 7  ? 5.766   5.927   2.100   1.00 15.00 ?  303 TRP A CA   10 
ATOM 7460  C C    . TRP A 1 7  ? 4.326   6.363   2.304   1.00 15.00 ?  303 TRP A C    10 
ATOM 7461  O O    . TRP A 1 7  ? 4.049   7.249   3.113   1.00 15.00 ?  303 TRP A O    10 
ATOM 7462  C CB   . TRP A 1 7  ? 6.071   4.799   3.066   1.00 15.00 ?  303 TRP A CB   10 
ATOM 7463  C CG   . TRP A 1 7  ? 7.119   3.875   2.568   1.00 15.00 ?  303 TRP A CG   10 
ATOM 7464  C CD1  . TRP A 1 7  ? 8.471   4.038   2.645   1.00 15.00 ?  303 TRP A CD1  10 
ATOM 7465  C CD2  . TRP A 1 7  ? 6.896   2.630   1.914   1.00 15.00 ?  303 TRP A CD2  10 
ATOM 7466  N NE1  . TRP A 1 7  ? 9.101   2.961   2.084   1.00 15.00 ?  303 TRP A NE1  10 
ATOM 7467  C CE2  . TRP A 1 7  ? 8.150   2.085   1.630   1.00 15.00 ?  303 TRP A CE2  10 
ATOM 7468  C CE3  . TRP A 1 7  ? 5.756   1.914   1.542   1.00 15.00 ?  303 TRP A CE3  10 
ATOM 7469  C CZ2  . TRP A 1 7  ? 8.291   0.868   0.999   1.00 15.00 ?  303 TRP A CZ2  10 
ATOM 7470  C CZ3  . TRP A 1 7  ? 5.910   0.699   0.918   1.00 15.00 ?  303 TRP A CZ3  10 
ATOM 7471  C CH2  . TRP A 1 7  ? 7.170   0.189   0.653   1.00 15.00 ?  303 TRP A CH2  10 
ATOM 7472  H H    . TRP A 1 7  ? 6.891   7.297   3.233   1.00 15.00 ?  303 TRP A H    10 
ATOM 7473  H HA   . TRP A 1 7  ? 5.898   5.573   1.090   1.00 15.00 ?  303 TRP A HA   10 
ATOM 7474  H HB2  . TRP A 1 7  ? 6.414   5.216   4.001   1.00 15.00 ?  303 TRP A HB2  10 
ATOM 7475  H HB3  . TRP A 1 7  ? 5.173   4.226   3.239   1.00 15.00 ?  303 TRP A HB3  10 
ATOM 7476  H HD1  . TRP A 1 7  ? 8.957   4.894   3.087   1.00 15.00 ?  303 TRP A HD1  10 
ATOM 7477  H HE1  . TRP A 1 7  ? 10.072  2.835   2.021   1.00 15.00 ?  303 TRP A HE1  10 
ATOM 7478  H HE3  . TRP A 1 7  ? 4.764   2.290   1.731   1.00 15.00 ?  303 TRP A HE3  10 
ATOM 7479  H HZ2  . TRP A 1 7  ? 9.240   0.470   0.777   1.00 15.00 ?  303 TRP A HZ2  10 
ATOM 7480  H HZ3  . TRP A 1 7  ? 5.042   0.135   0.620   1.00 15.00 ?  303 TRP A HZ3  10 
ATOM 7481  H HH2  . TRP A 1 7  ? 7.247   -0.773  0.179   1.00 15.00 ?  303 TRP A HH2  10 
ATOM 7482  N N    . GLU A 1 8  ? 3.408   5.718   1.596   1.00 15.00 ?  304 GLU A N    10 
ATOM 7483  C CA   . GLU A 1 8  ? 1.986   6.043   1.742   1.00 15.00 ?  304 GLU A CA   10 
ATOM 7484  C C    . GLU A 1 8  ? 1.182   4.783   2.063   1.00 15.00 ?  304 GLU A C    10 
ATOM 7485  O O    . GLU A 1 8  ? 1.203   3.822   1.310   1.00 15.00 ?  304 GLU A O    10 
ATOM 7486  C CB   . GLU A 1 8  ? 1.485   6.727   0.467   1.00 15.00 ?  304 GLU A CB   10 
ATOM 7487  C CG   . GLU A 1 8  ? 1.984   8.154   0.320   1.00 15.00 ?  304 GLU A CG   10 
ATOM 7488  C CD   . GLU A 1 8  ? 1.117   9.171   1.041   1.00 15.00 ?  304 GLU A CD   10 
ATOM 7489  O OE1  . GLU A 1 8  ? 0.939   9.051   2.270   1.00 15.00 ?  304 GLU A OE1  10 
ATOM 7490  O OE2  . GLU A 1 8  ? 0.620   10.108  0.372   1.00 15.00 -1 304 GLU A OE2  10 
ATOM 7491  H H    . GLU A 1 8  ? 3.690   4.988   0.967   1.00 15.00 ?  304 GLU A H    10 
ATOM 7492  H HA   . GLU A 1 8  ? 1.889   6.732   2.569   1.00 15.00 ?  304 GLU A HA   10 
ATOM 7493  H HB2  . GLU A 1 8  ? 1.828   6.160   -0.385  1.00 15.00 ?  304 GLU A HB2  10 
ATOM 7494  H HB3  . GLU A 1 8  ? 0.407   6.742   0.465   1.00 15.00 ?  304 GLU A HB3  10 
ATOM 7495  H HG2  . GLU A 1 8  ? 2.986   8.212   0.721   1.00 15.00 ?  304 GLU A HG2  10 
ATOM 7496  H HG3  . GLU A 1 8  ? 2.007   8.405   -0.730  1.00 15.00 ?  304 GLU A HG3  10 
ATOM 7497  N N    . ILE A 1 9  ? 0.475   4.781   3.186   1.00 15.00 ?  305 ILE A N    10 
ATOM 7498  C CA   . ILE A 1 9  ? -0.199  3.569   3.649   1.00 15.00 ?  305 ILE A CA   10 
ATOM 7499  C C    . ILE A 1 9  ? -1.724  3.670   3.545   1.00 15.00 ?  305 ILE A C    10 
ATOM 7500  O O    . ILE A 1 9  ? -2.330  4.635   4.019   1.00 15.00 ?  305 ILE A O    10 
ATOM 7501  C CB   . ILE A 1 9  ? 0.192   3.230   5.110   1.00 15.00 ?  305 ILE A CB   10 
ATOM 7502  C CG1  . ILE A 1 9  ? -0.524  1.956   5.578   1.00 15.00 ?  305 ILE A CG1  10 
ATOM 7503  C CG2  . ILE A 1 9  ? -0.124  4.393   6.044   1.00 15.00 ?  305 ILE A CG2  10 
ATOM 7504  C CD1  . ILE A 1 9  ? -0.161  1.535   6.986   1.00 15.00 ?  305 ILE A CD1  10 
ATOM 7505  H H    . ILE A 1 9  ? 0.397   5.608   3.707   1.00 15.00 ?  305 ILE A H    10 
ATOM 7506  H HA   . ILE A 1 9  ? 0.139   2.756   3.024   1.00 15.00 ?  305 ILE A HA   10 
ATOM 7507  H HB   . ILE A 1 9  ? 1.258   3.063   5.140   1.00 15.00 ?  305 ILE A HB   10 
ATOM 7508  H HG12 . ILE A 1 9  ? -1.591  2.119   5.547   1.00 15.00 ?  305 ILE A HG12 10 
ATOM 7509  H HG13 . ILE A 1 9  ? -0.270  1.144   4.913   1.00 15.00 ?  305 ILE A HG13 10 
ATOM 7510  H HG21 . ILE A 1 9  ? 0.140   4.122   7.056   1.00 15.00 ?  305 ILE A HG21 10 
ATOM 7511  H HG22 . ILE A 1 9  ? -1.179  4.616   5.995   1.00 15.00 ?  305 ILE A HG22 10 
ATOM 7512  H HG23 . ILE A 1 9  ? 0.443   5.261   5.745   1.00 15.00 ?  305 ILE A HG23 10 
ATOM 7513  H HD11 . ILE A 1 9  ? 0.879   1.246   7.020   1.00 15.00 ?  305 ILE A HD11 10 
ATOM 7514  H HD12 . ILE A 1 9  ? -0.776  0.698   7.283   1.00 15.00 ?  305 ILE A HD12 10 
ATOM 7515  H HD13 . ILE A 1 9  ? -0.324  2.361   7.662   1.00 15.00 ?  305 ILE A HD13 10 
ATOM 7516  N N    . ARG A 1 10 ? -2.342  2.674   2.910   1.00 15.00 ?  306 ARG A N    10 
ATOM 7517  C CA   . ARG A 1 10 ? -3.794  2.554   2.895   1.00 15.00 ?  306 ARG A CA   10 
ATOM 7518  C C    . ARG A 1 10 ? -4.191  1.086   2.990   1.00 15.00 ?  306 ARG A C    10 
ATOM 7519  O O    . ARG A 1 10 ? -3.454  0.207   2.537   1.00 15.00 ?  306 ARG A O    10 
ATOM 7520  C CB   . ARG A 1 10 ? -4.411  3.193   1.646   1.00 15.00 ?  306 ARG A CB   10 
ATOM 7521  C CG   . ARG A 1 10 ? -4.131  4.682   1.516   1.00 15.00 ?  306 ARG A CG   10 
ATOM 7522  C CD   . ARG A 1 10 ? -5.254  5.403   0.793   1.00 15.00 ?  306 ARG A CD   10 
ATOM 7523  N NE   . ARG A 1 10 ? -6.494  5.386   1.571   1.00 15.00 ?  306 ARG A NE   10 
ATOM 7524  C CZ   . ARG A 1 10 ? -7.309  6.431   1.708   1.00 15.00 ?  306 ARG A CZ   10 
ATOM 7525  N NH1  . ARG A 1 10 ? -7.019  7.582   1.116   1.00 15.00 1  306 ARG A NH1  10 
ATOM 7526  N NH2  . ARG A 1 10 ? -8.408  6.322   2.445   1.00 15.00 ?  306 ARG A NH2  10 
ATOM 7527  H H    . ARG A 1 10 ? -1.809  1.998   2.432   1.00 15.00 ?  306 ARG A H    10 
ATOM 7528  H HA   . ARG A 1 10 ? -4.170  3.065   3.771   1.00 15.00 ?  306 ARG A HA   10 
ATOM 7529  H HB2  . ARG A 1 10 ? -4.016  2.696   0.772   1.00 15.00 ?  306 ARG A HB2  10 
ATOM 7530  H HB3  . ARG A 1 10 ? -5.481  3.052   1.675   1.00 15.00 ?  306 ARG A HB3  10 
ATOM 7531  H HG2  . ARG A 1 10 ? -4.021  5.108   2.502   1.00 15.00 ?  306 ARG A HG2  10 
ATOM 7532  H HG3  . ARG A 1 10 ? -3.214  4.815   0.960   1.00 15.00 ?  306 ARG A HG3  10 
ATOM 7533  H HD2  . ARG A 1 10 ? -4.959  6.427   0.621   1.00 15.00 ?  306 ARG A HD2  10 
ATOM 7534  H HD3  . ARG A 1 10 ? -5.429  4.915   -0.153  1.00 15.00 ?  306 ARG A HD3  10 
ATOM 7535  H HE   . ARG A 1 10 ? -6.729  4.538   2.029   1.00 15.00 ?  306 ARG A HE   10 
ATOM 7536  H HH11 . ARG A 1 10 ? -6.191  7.670   0.568   1.00 15.00 ?  306 ARG A HH11 10 
ATOM 7537  H HH12 . ARG A 1 10 ? -7.636  8.378   1.217   1.00 15.00 ?  306 ARG A HH12 10 
ATOM 7538  H HH21 . ARG A 1 10 ? -8.629  5.452   2.904   1.00 15.00 ?  306 ARG A HH21 10 
ATOM 7539  H HH22 . ARG A 1 10 ? -9.027  7.113   2.557   1.00 15.00 ?  306 ARG A HH22 10 
ATOM 7540  N N    . ASN A 1 11 ? -5.346  0.824   3.583   1.00 15.00 ?  307 ASN A N    10 
ATOM 7541  C CA   . ASN A 1 11 ? -5.805  -0.542  3.806   1.00 15.00 ?  307 ASN A CA   10 
ATOM 7542  C C    . ASN A 1 11 ? -7.181  -0.755  3.152   1.00 15.00 ?  307 ASN A C    10 
ATOM 7543  O O    . ASN A 1 11 ? -8.105  0.028   3.388   1.00 15.00 ?  307 ASN A O    10 
ATOM 7544  C CB   . ASN A 1 11 ? -5.901  -0.812  5.315   1.00 15.00 ?  307 ASN A CB   10 
ATOM 7545  C CG   . ASN A 1 11 ? -6.084  -2.283  5.659   1.00 15.00 ?  307 ASN A CG   10 
ATOM 7546  O OD1  . ASN A 1 11 ? -6.605  -3.071  4.873   1.00 15.00 ?  307 ASN A OD1  10 
ATOM 7547  N ND2  . ASN A 1 11 ? -5.663  -2.663  6.857   1.00 15.00 ?  307 ASN A ND2  10 
ATOM 7548  H H    . ASN A 1 11 ? -5.917  1.571   3.859   1.00 15.00 ?  307 ASN A H    10 
ATOM 7549  H HA   . ASN A 1 11 ? -5.078  -1.211  3.372   1.00 15.00 ?  307 ASN A HA   10 
ATOM 7550  H HB2  . ASN A 1 11 ? -4.996  -0.468  5.790   1.00 15.00 ?  307 ASN A HB2  10 
ATOM 7551  H HB3  . ASN A 1 11 ? -6.740  -0.263  5.716   1.00 15.00 ?  307 ASN A HB3  10 
ATOM 7552  H HD21 . ASN A 1 11 ? -5.265  -1.985  7.444   1.00 15.00 ?  307 ASN A HD21 10 
ATOM 7553  H HD22 . ASN A 1 11 ? -5.773  -3.603  7.109   1.00 15.00 ?  307 ASN A HD22 10 
ATOM 7554  N N    . THR A 1 12 ? -7.334  -1.818  2.358   1.00 15.00 ?  308 THR A N    10 
ATOM 7555  C CA   . THR A 1 12 ? -8.616  -2.120  1.735   1.00 15.00 ?  308 THR A CA   10 
ATOM 7556  C C    . THR A 1 12 ? -9.445  -3.021  2.648   1.00 15.00 ?  308 THR A C    10 
ATOM 7557  O O    . THR A 1 12 ? -8.907  -3.934  3.280   1.00 15.00 ?  308 THR A O    10 
ATOM 7558  C CB   . THR A 1 12 ? -8.441  -2.811  0.362   1.00 15.00 ?  308 THR A CB   10 
ATOM 7559  O OG1  . THR A 1 12 ? -7.248  -3.612  0.352   1.00 15.00 ?  308 THR A OG1  10 
ATOM 7560  C CG2  . THR A 1 12 ? -8.404  -1.801  -0.780  1.00 15.00 ?  308 THR A CG2  10 
ATOM 7561  H H    . THR A 1 12 ? -6.578  -2.418  2.199   1.00 15.00 ?  308 THR A H    10 
ATOM 7562  H HA   . THR A 1 12 ? -9.144  -1.188  1.586   1.00 15.00 ?  308 THR A HA   10 
ATOM 7563  H HB   . THR A 1 12 ? -9.290  -3.463  0.208   1.00 15.00 ?  308 THR A HB   10 
ATOM 7564  H HG1  . THR A 1 12 ? -6.891  -3.670  1.244   1.00 15.00 ?  308 THR A HG1  10 
ATOM 7565  H HG21 . THR A 1 12 ? -9.334  -1.251  -0.803  1.00 15.00 ?  308 THR A HG21 10 
ATOM 7566  H HG22 . THR A 1 12 ? -8.273  -2.320  -1.719  1.00 15.00 ?  308 THR A HG22 10 
ATOM 7567  H HG23 . THR A 1 12 ? -7.586  -1.113  -0.635  1.00 15.00 ?  308 THR A HG23 10 
ATOM 7568  N N    . ALA A 1 13 ? -10.753 -2.770  2.690   1.00 15.00 ?  309 ALA A N    10 
ATOM 7569  C CA   . ALA A 1 13 ? -11.672 -3.477  3.586   1.00 15.00 ?  309 ALA A CA   10 
ATOM 7570  C C    . ALA A 1 13 ? -11.690 -4.982  3.319   1.00 15.00 ?  309 ALA A C    10 
ATOM 7571  O O    . ALA A 1 13 ? -12.183 -5.761  4.135   1.00 15.00 ?  309 ALA A O    10 
ATOM 7572  C CB   . ALA A 1 13 ? -13.073 -2.901  3.458   1.00 15.00 ?  309 ALA A CB   10 
ATOM 7573  H H    . ALA A 1 13 ? -11.123 -2.075  2.087   1.00 15.00 ?  309 ALA A H    10 
ATOM 7574  H HA   . ALA A 1 13 ? -11.337 -3.310  4.600   1.00 15.00 ?  309 ALA A HA   10 
ATOM 7575  H HB1  . ALA A 1 13 ? -13.442 -3.075  2.459   1.00 15.00 ?  309 ALA A HB1  10 
ATOM 7576  H HB2  . ALA A 1 13 ? -13.044 -1.838  3.650   1.00 15.00 ?  309 ALA A HB2  10 
ATOM 7577  H HB3  . ALA A 1 13 ? -13.726 -3.378  4.173   1.00 15.00 ?  309 ALA A HB3  10 
ATOM 7578  N N    . THR A 1 14 ? -11.153 -5.379  2.174   1.00 15.00 ?  310 THR A N    10 
ATOM 7579  C CA   . THR A 1 14 ? -10.989 -6.788  1.843   1.00 15.00 ?  310 THR A CA   10 
ATOM 7580  C C    . THR A 1 14 ? -10.016 -7.480  2.805   1.00 15.00 ?  310 THR A C    10 
ATOM 7581  O O    . THR A 1 14 ? -9.951  -8.709  2.864   1.00 15.00 ?  310 THR A O    10 
ATOM 7582  C CB   . THR A 1 14 ? -10.502 -6.951  0.391   1.00 15.00 ?  310 THR A CB   10 
ATOM 7583  O OG1  . THR A 1 14 ? -9.625  -5.865  0.047   1.00 15.00 ?  310 THR A OG1  10 
ATOM 7584  C CG2  . THR A 1 14 ? -11.678 -6.988  -0.572  1.00 15.00 ?  310 THR A CG2  10 
ATOM 7585  H H    . THR A 1 14 ? -10.857 -4.703  1.528   1.00 15.00 ?  310 THR A H    10 
ATOM 7586  H HA   . THR A 1 14 ? -11.956 -7.263  1.928   1.00 15.00 ?  310 THR A HA   10 
ATOM 7587  H HB   . THR A 1 14 ? -9.959  -7.882  0.311   1.00 15.00 ?  310 THR A HB   10 
ATOM 7588  H HG1  . THR A 1 14 ? -10.159 -5.100  -0.221  1.00 15.00 ?  310 THR A HG1  10 
ATOM 7589  H HG21 . THR A 1 14 ? -12.241 -6.070  -0.491  1.00 15.00 ?  310 THR A HG21 10 
ATOM 7590  H HG22 . THR A 1 14 ? -12.316 -7.825  -0.329  1.00 15.00 ?  310 THR A HG22 10 
ATOM 7591  H HG23 . THR A 1 14 ? -11.311 -7.097  -1.583  1.00 15.00 ?  310 THR A HG23 10 
ATOM 7592  N N    . GLY A 1 15 ? -9.260  -6.681  3.554   1.00 15.00 ?  311 GLY A N    10 
ATOM 7593  C CA   . GLY A 1 15 ? -8.344  -7.226  4.537   1.00 15.00 ?  311 GLY A CA   10 
ATOM 7594  C C    . GLY A 1 15 ? -6.929  -7.361  4.010   1.00 15.00 ?  311 GLY A C    10 
ATOM 7595  O O    . GLY A 1 15 ? -6.228  -8.320  4.335   1.00 15.00 ?  311 GLY A O    10 
ATOM 7596  H H    . GLY A 1 15 ? -9.340  -5.706  3.446   1.00 15.00 ?  311 GLY A H    10 
ATOM 7597  H HA2  . GLY A 1 15 ? -8.336  -6.576  5.400   1.00 15.00 ?  311 GLY A HA2  10 
ATOM 7598  H HA3  . GLY A 1 15 ? -8.698  -8.201  4.840   1.00 15.00 ?  311 GLY A HA3  10 
ATOM 7599  N N    . ARG A 1 16 ? -6.501  -6.395  3.207   1.00 15.00 ?  312 ARG A N    10 
ATOM 7600  C CA   . ARG A 1 16 ? -5.170  -6.422  2.612   1.00 15.00 ?  312 ARG A CA   10 
ATOM 7601  C C    . ARG A 1 16 ? -4.561  -5.027  2.670   1.00 15.00 ?  312 ARG A C    10 
ATOM 7602  O O    . ARG A 1 16 ? -5.263  -4.038  2.429   1.00 15.00 ?  312 ARG A O    10 
ATOM 7603  C CB   . ARG A 1 16 ? -5.238  -6.858  1.150   1.00 15.00 ?  312 ARG A CB   10 
ATOM 7604  C CG   . ARG A 1 16 ? -6.063  -8.098  0.874   1.00 15.00 ?  312 ARG A CG   10 
ATOM 7605  C CD   . ARG A 1 16 ? -6.296  -8.239  -0.619  1.00 15.00 ?  312 ARG A CD   10 
ATOM 7606  N NE   . ARG A 1 16 ? -7.213  -7.215  -1.127  1.00 15.00 ?  312 ARG A NE   10 
ATOM 7607  C CZ   . ARG A 1 16 ? -7.384  -6.938  -2.422  1.00 15.00 ?  312 ARG A CZ   10 
ATOM 7608  N NH1  . ARG A 1 16 ? -6.787  -7.676  -3.352  1.00 15.00 1  312 ARG A NH1  10 
ATOM 7609  N NH2  . ARG A 1 16 ? -8.178  -5.936  -2.783  1.00 15.00 ?  312 ARG A NH2  10 
ATOM 7610  H H    . ARG A 1 16 ? -7.085  -5.629  3.025   1.00 15.00 ?  312 ARG A H    10 
ATOM 7611  H HA   . ARG A 1 16 ? -4.554  -7.111  3.171   1.00 15.00 ?  312 ARG A HA   10 
ATOM 7612  H HB2  . ARG A 1 16 ? -5.640  -6.047  0.558   1.00 15.00 ?  312 ARG A HB2  10 
ATOM 7613  H HB3  . ARG A 1 16 ? -4.229  -7.054  0.812   1.00 15.00 ?  312 ARG A HB3  10 
ATOM 7614  H HG2  . ARG A 1 16 ? -5.531  -8.966  1.237   1.00 15.00 ?  312 ARG A HG2  10 
ATOM 7615  H HG3  . ARG A 1 16 ? -7.014  -8.011  1.376   1.00 15.00 ?  312 ARG A HG3  10 
ATOM 7616  H HD2  . ARG A 1 16 ? -5.341  -8.126  -1.123  1.00 15.00 ?  312 ARG A HD2  10 
ATOM 7617  H HD3  . ARG A 1 16 ? -6.704  -9.218  -0.822  1.00 15.00 ?  312 ARG A HD3  10 
ATOM 7618  H HE   . ARG A 1 16 ? -7.711  -6.686  -0.461  1.00 15.00 ?  312 ARG A HE   10 
ATOM 7619  H HH11 . ARG A 1 16 ? -6.202  -8.455  -3.085  1.00 15.00 ?  312 ARG A HH11 10 
ATOM 7620  H HH12 . ARG A 1 16 ? -6.916  -7.464  -4.323  1.00 15.00 ?  312 ARG A HH12 10 
ATOM 7621  H HH21 . ARG A 1 16 ? -8.650  -5.391  -2.088  1.00 15.00 ?  312 ARG A HH21 10 
ATOM 7622  H HH22 . ARG A 1 16 ? -8.303  -5.714  -3.762  1.00 15.00 ?  312 ARG A HH22 10 
ATOM 7623  N N    . VAL A 1 17 ? -3.263  -4.937  2.942   1.00 15.00 ?  313 VAL A N    10 
ATOM 7624  C CA   . VAL A 1 17 ? -2.608  -3.641  3.037   1.00 15.00 ?  313 VAL A CA   10 
ATOM 7625  C C    . VAL A 1 17 ? -1.645  -3.420  1.859   1.00 15.00 ?  313 VAL A C    10 
ATOM 7626  O O    . VAL A 1 17 ? -0.869  -4.296  1.500   1.00 15.00 ?  313 VAL A O    10 
ATOM 7627  C CB   . VAL A 1 17 ? -1.847  -3.468  4.367   1.00 15.00 ?  313 VAL A CB   10 
ATOM 7628  C CG1  . VAL A 1 17 ? -1.528  -1.998  4.602   1.00 15.00 ?  313 VAL A CG1  10 
ATOM 7629  C CG2  . VAL A 1 17 ? -2.650  -4.037  5.528   1.00 15.00 ?  313 VAL A CG2  10 
ATOM 7630  H H    . VAL A 1 17 ? -2.732  -5.754  3.068   1.00 15.00 ?  313 VAL A H    10 
ATOM 7631  H HA   . VAL A 1 17 ? -3.384  -2.889  2.998   1.00 15.00 ?  313 VAL A HA   10 
ATOM 7632  H HB   . VAL A 1 17 ? -0.915  -4.010  4.299   1.00 15.00 ?  313 VAL A HB   10 
ATOM 7633  H HG11 . VAL A 1 17 ? -0.912  -1.630  3.794   1.00 15.00 ?  313 VAL A HG11 10 
ATOM 7634  H HG12 . VAL A 1 17 ? -0.997  -1.890  5.536   1.00 15.00 ?  313 VAL A HG12 10 
ATOM 7635  H HG13 . VAL A 1 17 ? -2.446  -1.432  4.642   1.00 15.00 ?  313 VAL A HG13 10 
ATOM 7636  H HG21 . VAL A 1 17 ? -2.833  -5.088  5.358   1.00 15.00 ?  313 VAL A HG21 10 
ATOM 7637  H HG22 . VAL A 1 17 ? -3.593  -3.515  5.605   1.00 15.00 ?  313 VAL A HG22 10 
ATOM 7638  H HG23 . VAL A 1 17 ? -2.095  -3.911  6.446   1.00 15.00 ?  313 VAL A HG23 10 
ATOM 7639  N N    . TYR A 1 18 ? -1.699  -2.223  1.301   1.00 15.00 ?  314 TYR A N    10 
ATOM 7640  C CA   . TYR A 1 18 ? -1.016  -1.848  0.092   1.00 15.00 ?  314 TYR A CA   10 
ATOM 7641  C C    . TYR A 1 18 ? -0.449  -0.446  0.292   1.00 15.00 ?  314 TYR A C    10 
ATOM 7642  O O    . TYR A 1 18 ? -1.186  0.516   0.513   1.00 15.00 ?  314 TYR A O    10 
ATOM 7643  C CB   . TYR A 1 18 ? -1.989  -1.871  -1.105  1.00 15.00 ?  314 TYR A CB   10 
ATOM 7644  C CG   . TYR A 1 18 ? -3.228  -1.018  -0.896  1.00 15.00 ?  314 TYR A CG   10 
ATOM 7645  C CD1  . TYR A 1 18 ? -4.240  -1.446  -0.050  1.00 15.00 ?  314 TYR A CD1  10 
ATOM 7646  C CD2  . TYR A 1 18 ? -3.370  0.226   -1.511  1.00 15.00 ?  314 TYR A CD2  10 
ATOM 7647  C CE1  . TYR A 1 18 ? -5.350  -0.669  0.184   1.00 15.00 ?  314 TYR A CE1  10 
ATOM 7648  C CE2  . TYR A 1 18 ? -4.487  1.009   -1.283  1.00 15.00 ?  314 TYR A CE2  10 
ATOM 7649  C CZ   . TYR A 1 18 ? -5.473  0.555   -0.431  1.00 15.00 ?  314 TYR A CZ   10 
ATOM 7650  O OH   . TYR A 1 18 ? -6.581  1.331   -0.182  1.00 15.00 ?  314 TYR A OH   10 
ATOM 7651  H H    . TYR A 1 18 ? -2.182  -1.542  1.744   1.00 15.00 ?  314 TYR A H    10 
ATOM 7652  H HA   . TYR A 1 18 ? -0.209  -2.545  -0.076  1.00 15.00 ?  314 TYR A HA   10 
ATOM 7653  H HB2  . TYR A 1 18 ? -1.477  -1.503  -1.983  1.00 15.00 ?  314 TYR A HB2  10 
ATOM 7654  H HB3  . TYR A 1 18 ? -2.309  -2.888  -1.280  1.00 15.00 ?  314 TYR A HB3  10 
ATOM 7655  H HD1  . TYR A 1 18 ? -4.146  -2.407  0.434   1.00 15.00 ?  314 TYR A HD1  10 
ATOM 7656  H HD2  . TYR A 1 18 ? -2.600  0.571   -2.184  1.00 15.00 ?  314 TYR A HD2  10 
ATOM 7657  H HE1  . TYR A 1 18 ? -6.120  -1.023  0.852   1.00 15.00 ?  314 TYR A HE1  10 
ATOM 7658  H HE2  . TYR A 1 18 ? -4.580  1.979   -1.765  1.00 15.00 ?  314 TYR A HE2  10 
ATOM 7659  H HH   . TYR A 1 18 ? -6.806  1.839   -0.969  1.00 15.00 ?  314 TYR A HH   10 
ATOM 7660  N N    . PHE A 1 19 ? 0.853   -0.342  0.287   1.00 15.00 ?  315 PHE A N    10 
ATOM 7661  C CA   . PHE A 1 19 ? 1.500   0.941   0.454   1.00 15.00 ?  315 PHE A CA   10 
ATOM 7662  C C    . PHE A 1 19 ? 1.852   1.507   -0.899  1.00 15.00 ?  315 PHE A C    10 
ATOM 7663  O O    . PHE A 1 19 ? 2.602   0.901   -1.645  1.00 15.00 ?  315 PHE A O    10 
ATOM 7664  C CB   . PHE A 1 19 ? 2.777   0.806   1.273   1.00 15.00 ?  315 PHE A CB   10 
ATOM 7665  C CG   . PHE A 1 19 ? 2.595   0.363   2.692   1.00 15.00 ?  315 PHE A CG   10 
ATOM 7666  C CD1  . PHE A 1 19 ? 1.939   -0.816  2.986   1.00 15.00 ?  315 PHE A CD1  10 
ATOM 7667  C CD2  . PHE A 1 19 ? 3.113   1.118   3.731   1.00 15.00 ?  315 PHE A CD2  10 
ATOM 7668  C CE1  . PHE A 1 19 ? 1.795   -1.234  4.287   1.00 15.00 ?  315 PHE A CE1  10 
ATOM 7669  C CE2  . PHE A 1 19 ? 2.980   0.699   5.038   1.00 15.00 ?  315 PHE A CE2  10 
ATOM 7670  C CZ   . PHE A 1 19 ? 2.319   -0.480  5.314   1.00 15.00 ?  315 PHE A CZ   10 
ATOM 7671  H H    . PHE A 1 19 ? 1.401   -1.150  0.170   1.00 15.00 ?  315 PHE A H    10 
ATOM 7672  H HA   . PHE A 1 19 ? 0.818   1.607   0.958   1.00 15.00 ?  315 PHE A HA   10 
ATOM 7673  H HB2  . PHE A 1 19 ? 3.422   0.087   0.791   1.00 15.00 ?  315 PHE A HB2  10 
ATOM 7674  H HB3  . PHE A 1 19 ? 3.278   1.764   1.290   1.00 15.00 ?  315 PHE A HB3  10 
ATOM 7675  H HD1  . PHE A 1 19 ? 1.528   -1.409  2.183   1.00 15.00 ?  315 PHE A HD1  10 
ATOM 7676  H HD2  . PHE A 1 19 ? 3.627   2.042   3.512   1.00 15.00 ?  315 PHE A HD2  10 
ATOM 7677  H HE1  . PHE A 1 19 ? 1.278   -2.157  4.504   1.00 15.00 ?  315 PHE A HE1  10 
ATOM 7678  H HE2  . PHE A 1 19 ? 3.388   1.293   5.842   1.00 15.00 ?  315 PHE A HE2  10 
ATOM 7679  H HZ   . PHE A 1 19 ? 2.219   -0.819  6.329   1.00 15.00 ?  315 PHE A HZ   10 
ATOM 7680  N N    . VAL A 1 20 ? 1.347   2.667   -1.220  1.00 15.00 ?  316 VAL A N    10 
ATOM 7681  C CA   . VAL A 1 20 ? 1.679   3.255   -2.484  1.00 15.00 ?  316 VAL A CA   10 
ATOM 7682  C C    . VAL A 1 20 ? 2.935   4.116   -2.328  1.00 15.00 ?  316 VAL A C    10 
ATOM 7683  O O    . VAL A 1 20 ? 2.998   4.994   -1.459  1.00 15.00 ?  316 VAL A O    10 
ATOM 7684  C CB   . VAL A 1 20 ? 0.510   4.071   -3.088  1.00 15.00 ?  316 VAL A CB   10 
ATOM 7685  C CG1  . VAL A 1 20 ? -0.591  3.135   -3.560  1.00 15.00 ?  316 VAL A CG1  10 
ATOM 7686  C CG2  . VAL A 1 20 ? -0.061  5.063   -2.095  1.00 15.00 ?  316 VAL A CG2  10 
ATOM 7687  H H    . VAL A 1 20 ? 0.772   3.147   -0.587  1.00 15.00 ?  316 VAL A H    10 
ATOM 7688  H HA   . VAL A 1 20 ? 1.888   2.440   -3.154  1.00 15.00 ?  316 VAL A HA   10 
ATOM 7689  H HB   . VAL A 1 20 ? 0.881   4.617   -3.943  1.00 15.00 ?  316 VAL A HB   10 
ATOM 7690  H HG11 . VAL A 1 20 ? -1.036  2.644   -2.707  1.00 15.00 ?  316 VAL A HG11 10 
ATOM 7691  H HG12 . VAL A 1 20 ? -0.171  2.392   -4.222  1.00 15.00 ?  316 VAL A HG12 10 
ATOM 7692  H HG13 . VAL A 1 20 ? -1.345  3.702   -4.085  1.00 15.00 ?  316 VAL A HG13 10 
ATOM 7693  H HG21 . VAL A 1 20 ? 0.746   5.543   -1.559  1.00 15.00 ?  316 VAL A HG21 10 
ATOM 7694  H HG22 . VAL A 1 20 ? -0.708  4.547   -1.401  1.00 15.00 ?  316 VAL A HG22 10 
ATOM 7695  H HG23 . VAL A 1 20 ? -0.630  5.808   -2.630  1.00 15.00 ?  316 VAL A HG23 10 
ATOM 7696  N N    . ASP A 1 21 ? 3.972   3.820   -3.110  1.00 15.00 ?  317 ASP A N    10 
ATOM 7697  C CA   . ASP A 1 21 ? 5.184   4.599   -3.066  1.00 15.00 ?  317 ASP A CA   10 
ATOM 7698  C C    . ASP A 1 21 ? 5.057   5.719   -4.070  1.00 15.00 ?  317 ASP A C    10 
ATOM 7699  O O    . ASP A 1 21 ? 4.947   5.455   -5.269  1.00 15.00 ?  317 ASP A O    10 
ATOM 7700  C CB   . ASP A 1 21 ? 6.423   3.762   -3.425  1.00 15.00 ?  317 ASP A CB   10 
ATOM 7701  C CG   . ASP A 1 21 ? 6.323   2.305   -3.038  1.00 15.00 ?  317 ASP A CG   10 
ATOM 7702  O OD1  . ASP A 1 21 ? 5.854   1.498   -3.866  1.00 15.00 -1 317 ASP A OD1  10 
ATOM 7703  O OD2  . ASP A 1 21 ? 6.761   1.964   -1.922  1.00 15.00 ?  317 ASP A OD2  10 
ATOM 7704  H H    . ASP A 1 21 ? 3.926   3.054   -3.727  1.00 15.00 ?  317 ASP A H    10 
ATOM 7705  H HA   . ASP A 1 21 ? 5.295   5.008   -2.074  1.00 15.00 ?  317 ASP A HA   10 
ATOM 7706  H HB2  . ASP A 1 21 ? 6.592   3.816   -4.488  1.00 15.00 ?  317 ASP A HB2  10 
ATOM 7707  H HB3  . ASP A 1 21 ? 7.277   4.176   -2.909  1.00 15.00 ?  317 ASP A HB3  10 
ATOM 7708  N N    . HIS A 1 22 ? 5.056   6.962   -3.593  1.00 15.00 ?  318 HIS A N    10 
ATOM 7709  C CA   . HIS A 1 22 ? 5.013   8.114   -4.490  1.00 15.00 ?  318 HIS A CA   10 
ATOM 7710  C C    . HIS A 1 22 ? 6.330   8.231   -5.246  1.00 15.00 ?  318 HIS A C    10 
ATOM 7711  O O    . HIS A 1 22 ? 6.437   8.961   -6.230  1.00 15.00 ?  318 HIS A O    10 
ATOM 7712  C CB   . HIS A 1 22 ? 4.734   9.419   -3.730  1.00 15.00 ?  318 HIS A CB   10 
ATOM 7713  C CG   . HIS A 1 22 ? 3.342   9.548   -3.171  1.00 15.00 ?  318 HIS A CG   10 
ATOM 7714  N ND1  . HIS A 1 22 ? 2.267   8.789   -3.590  1.00 15.00 ?  318 HIS A ND1  10 
ATOM 7715  C CD2  . HIS A 1 22 ? 2.858   10.369  -2.208  1.00 15.00 ?  318 HIS A CD2  10 
ATOM 7716  C CE1  . HIS A 1 22 ? 1.192   9.141   -2.910  1.00 15.00 ?  318 HIS A CE1  10 
ATOM 7717  N NE2  . HIS A 1 22 ? 1.519   10.096  -2.062  1.00 15.00 ?  318 HIS A NE2  10 
ATOM 7718  H H    . HIS A 1 22 ? 5.081   7.104   -2.622  1.00 15.00 ?  318 HIS A H    10 
ATOM 7719  H HA   . HIS A 1 22 ? 4.220   7.946   -5.204  1.00 15.00 ?  318 HIS A HA   10 
ATOM 7720  H HB2  . HIS A 1 22 ? 5.424   9.495   -2.905  1.00 15.00 ?  318 HIS A HB2  10 
ATOM 7721  H HB3  . HIS A 1 22 ? 4.899   10.252  -4.400  1.00 15.00 ?  318 HIS A HB3  10 
ATOM 7722  H HD1  . HIS A 1 22 ? 2.285   8.095   -4.300  1.00 15.00 ?  318 HIS A HD1  10 
ATOM 7723  H HD2  . HIS A 1 22 ? 3.422   11.108  -1.655  1.00 15.00 ?  318 HIS A HD2  10 
ATOM 7724  H HE1  . HIS A 1 22 ? 0.206   8.715   -3.030  1.00 15.00 ?  318 HIS A HE1  10 
ATOM 7725  H HE2  . HIS A 1 22 ? 0.997   10.305  -1.238  1.00 15.00 ?  318 HIS A HE2  10 
ATOM 7726  N N    . ASN A 1 23 ? 7.338   7.514   -4.759  1.00 15.00 ?  319 ASN A N    10 
ATOM 7727  C CA   . ASN A 1 23 ? 8.651   7.513   -5.384  1.00 15.00 ?  319 ASN A CA   10 
ATOM 7728  C C    . ASN A 1 23 ? 8.651   6.621   -6.616  1.00 15.00 ?  319 ASN A C    10 
ATOM 7729  O O    . ASN A 1 23 ? 9.245   6.953   -7.639  1.00 15.00 ?  319 ASN A O    10 
ATOM 7730  C CB   . ASN A 1 23 ? 9.728   7.021   -4.408  1.00 15.00 ?  319 ASN A CB   10 
ATOM 7731  C CG   . ASN A 1 23 ? 9.626   7.666   -3.041  1.00 15.00 ?  319 ASN A CG   10 
ATOM 7732  O OD1  . ASN A 1 23 ? 10.131  8.765   -2.821  1.00 15.00 ?  319 ASN A OD1  10 
ATOM 7733  N ND2  . ASN A 1 23 ? 9.011   6.964   -2.097  1.00 15.00 ?  319 ASN A ND2  10 
ATOM 7734  H H    . ASN A 1 23 ? 7.191   6.979   -3.952  1.00 15.00 ?  319 ASN A H    10 
ATOM 7735  H HA   . ASN A 1 23 ? 8.878   8.525   -5.682  1.00 15.00 ?  319 ASN A HA   10 
ATOM 7736  H HB2  . ASN A 1 23 ? 9.631   5.953   -4.287  1.00 15.00 ?  319 ASN A HB2  10 
ATOM 7737  H HB3  . ASN A 1 23 ? 10.703  7.243   -4.818  1.00 15.00 ?  319 ASN A HB3  10 
ATOM 7738  H HD21 . ASN A 1 23 ? 8.667   6.070   -2.322  1.00 15.00 ?  319 ASN A HD21 10 
ATOM 7739  H HD22 . ASN A 1 23 ? 8.917   7.368   -1.208  1.00 15.00 ?  319 ASN A HD22 10 
ATOM 7740  N N    . ASN A 1 24 ? 8.001   5.471   -6.497  1.00 15.00 ?  320 ASN A N    10 
ATOM 7741  C CA   . ASN A 1 24 ? 7.978   4.496   -7.580  1.00 15.00 ?  320 ASN A CA   10 
ATOM 7742  C C    . ASN A 1 24 ? 6.657   4.542   -8.357  1.00 15.00 ?  320 ASN A C    10 
ATOM 7743  O O    . ASN A 1 24 ? 6.559   3.986   -9.449  1.00 15.00 ?  320 ASN A O    10 
ATOM 7744  C CB   . ASN A 1 24 ? 8.214   3.086   -7.024  1.00 15.00 ?  320 ASN A CB   10 
ATOM 7745  C CG   . ASN A 1 24 ? 8.429   2.049   -8.115  1.00 15.00 ?  320 ASN A CG   10 
ATOM 7746  O OD1  . ASN A 1 24 ? 8.015   0.897   -7.983  1.00 15.00 ?  320 ASN A OD1  10 
ATOM 7747  N ND2  . ASN A 1 24 ? 9.094   2.445   -9.191  1.00 15.00 ?  320 ASN A ND2  10 
ATOM 7748  H H    . ASN A 1 24 ? 7.546   5.262   -5.655  1.00 15.00 ?  320 ASN A H    10 
ATOM 7749  H HA   . ASN A 1 24 ? 8.781   4.739   -8.257  1.00 15.00 ?  320 ASN A HA   10 
ATOM 7750  H HB2  . ASN A 1 24 ? 9.089   3.098   -6.392  1.00 15.00 ?  320 ASN A HB2  10 
ATOM 7751  H HB3  . ASN A 1 24 ? 7.357   2.790   -6.436  1.00 15.00 ?  320 ASN A HB3  10 
ATOM 7752  H HD21 . ASN A 1 24 ? 9.414   3.371   -9.228  1.00 15.00 ?  320 ASN A HD21 10 
ATOM 7753  H HD22 . ASN A 1 24 ? 9.229   1.795   -9.919  1.00 15.00 ?  320 ASN A HD22 10 
ATOM 7754  N N    . ARG A 1 25 ? 5.647   5.197   -7.780  1.00 15.00 ?  321 ARG A N    10 
ATOM 7755  C CA   . ARG A 1 25 ? 4.311   5.262   -8.371  1.00 15.00 ?  321 ARG A CA   10 
ATOM 7756  C C    . ARG A 1 25 ? 3.687   3.869   -8.452  1.00 15.00 ?  321 ARG A C    10 
ATOM 7757  O O    . ARG A 1 25 ? 2.949   3.556   -9.387  1.00 15.00 ?  321 ARG A O    10 
ATOM 7758  C CB   . ARG A 1 25 ? 4.356   5.925   -9.754  1.00 15.00 ?  321 ARG A CB   10 
ATOM 7759  C CG   . ARG A 1 25 ? 4.577   7.431   -9.696  1.00 15.00 ?  321 ARG A CG   10 
ATOM 7760  C CD   . ARG A 1 25 ? 4.723   8.033   -11.084 1.00 15.00 ?  321 ARG A CD   10 
ATOM 7761  N NE   . ARG A 1 25 ? 4.635   9.494   -11.064 1.00 15.00 ?  321 ARG A NE   10 
ATOM 7762  C CZ   . ARG A 1 25 ? 5.652   10.314  -11.334 1.00 15.00 ?  321 ARG A CZ   10 
ATOM 7763  N NH1  . ARG A 1 25 ? 6.858   9.827   -11.590 1.00 15.00 1  321 ARG A NH1  10 
ATOM 7764  N NH2  . ARG A 1 25 ? 5.458   11.630  -11.340 1.00 15.00 ?  321 ARG A NH2  10 
ATOM 7765  H H    . ARG A 1 25 ? 5.798   5.645   -6.923  1.00 15.00 ?  321 ARG A H    10 
ATOM 7766  H HA   . ARG A 1 25 ? 3.700   5.866   -7.717  1.00 15.00 ?  321 ARG A HA   10 
ATOM 7767  H HB2  . ARG A 1 25 ? 5.160   5.485   -10.327 1.00 15.00 ?  321 ARG A HB2  10 
ATOM 7768  H HB3  . ARG A 1 25 ? 3.419   5.740   -10.260 1.00 15.00 ?  321 ARG A HB3  10 
ATOM 7769  H HG2  . ARG A 1 25 ? 3.733   7.891   -9.203  1.00 15.00 ?  321 ARG A HG2  10 
ATOM 7770  H HG3  . ARG A 1 25 ? 5.476   7.630   -9.132  1.00 15.00 ?  321 ARG A HG3  10 
ATOM 7771  H HD2  . ARG A 1 25 ? 5.681   7.745   -11.489 1.00 15.00 ?  321 ARG A HD2  10 
ATOM 7772  H HD3  . ARG A 1 25 ? 3.936   7.645   -11.715 1.00 15.00 ?  321 ARG A HD3  10 
ATOM 7773  H HE   . ARG A 1 25 ? 3.750   9.891   -10.859 1.00 15.00 ?  321 ARG A HE   10 
ATOM 7774  H HH11 . ARG A 1 25 ? 7.016   8.836   -11.582 1.00 15.00 ?  321 ARG A HH11 10 
ATOM 7775  H HH12 . ARG A 1 25 ? 7.624   10.450  -11.792 1.00 15.00 ?  321 ARG A HH12 10 
ATOM 7776  H HH21 . ARG A 1 25 ? 4.548   12.007  -11.140 1.00 15.00 ?  321 ARG A HH21 10 
ATOM 7777  H HH22 . ARG A 1 25 ? 6.217   12.255  -11.551 1.00 15.00 ?  321 ARG A HH22 10 
ATOM 7778  N N    . THR A 1 26 ? 3.947   3.061   -7.431  1.00 15.00 ?  322 THR A N    10 
ATOM 7779  C CA   . THR A 1 26 ? 3.458   1.683   -7.393  1.00 15.00 ?  322 THR A CA   10 
ATOM 7780  C C    . THR A 1 26 ? 2.768   1.383   -6.056  1.00 15.00 ?  322 THR A C    10 
ATOM 7781  O O    . THR A 1 26 ? 3.106   1.986   -5.039  1.00 15.00 ?  322 THR A O    10 
ATOM 7782  C CB   . THR A 1 26 ? 4.620   0.689   -7.621  1.00 15.00 ?  322 THR A CB   10 
ATOM 7783  O OG1  . THR A 1 26 ? 5.351   1.057   -8.798  1.00 15.00 ?  322 THR A OG1  10 
ATOM 7784  C CG2  . THR A 1 26 ? 4.112   -0.737  -7.779  1.00 15.00 ?  322 THR A CG2  10 
ATOM 7785  H H    . THR A 1 26 ? 4.464   3.411   -6.664  1.00 15.00 ?  322 THR A H    10 
ATOM 7786  H HA   . THR A 1 26 ? 2.743   1.560   -8.193  1.00 15.00 ?  322 THR A HA   10 
ATOM 7787  H HB   . THR A 1 26 ? 5.282   0.728   -6.767  1.00 15.00 ?  322 THR A HB   10 
ATOM 7788  H HG1  . THR A 1 26 ? 6.292   1.096   -8.591  1.00 15.00 ?  322 THR A HG1  10 
ATOM 7789  H HG21 . THR A 1 26 ? 3.456   -0.792  -8.635  1.00 15.00 ?  322 THR A HG21 10 
ATOM 7790  H HG22 . THR A 1 26 ? 3.569   -1.027  -6.890  1.00 15.00 ?  322 THR A HG22 10 
ATOM 7791  H HG23 . THR A 1 26 ? 4.949   -1.404  -7.923  1.00 15.00 ?  322 THR A HG23 10 
ATOM 7792  N N    . THR A 1 27 ? 1.783   0.480   -6.061  1.00 15.00 ?  323 THR A N    10 
ATOM 7793  C CA   . THR A 1 27 ? 1.144   0.050   -4.821  1.00 15.00 ?  323 THR A CA   10 
ATOM 7794  C C    . THR A 1 27 ? 1.792   -1.239  -4.309  1.00 15.00 ?  323 THR A C    10 
ATOM 7795  O O    . THR A 1 27 ? 2.277   -2.056  -5.097  1.00 15.00 ?  323 THR A O    10 
ATOM 7796  C CB   . THR A 1 27 ? -0.386  -0.134  -4.977  1.00 15.00 ?  323 THR A CB   10 
ATOM 7797  O OG1  . THR A 1 27 ? -0.981  -0.388  -3.702  1.00 15.00 ?  323 THR A OG1  10 
ATOM 7798  C CG2  . THR A 1 27 ? -0.725  -1.273  -5.920  1.00 15.00 ?  323 THR A CG2  10 
ATOM 7799  H H    . THR A 1 27 ? 1.487   0.095   -6.911  1.00 15.00 ?  323 THR A H    10 
ATOM 7800  H HA   . THR A 1 27 ? 1.311   0.820   -4.088  1.00 15.00 ?  323 THR A HA   10 
ATOM 7801  H HB   . THR A 1 27 ? -0.802  0.779   -5.377  1.00 15.00 ?  323 THR A HB   10 
ATOM 7802  H HG1  . THR A 1 27 ? -1.721  0.211   -3.571  1.00 15.00 ?  323 THR A HG1  10 
ATOM 7803  H HG21 . THR A 1 27 ? -0.419  -1.018  -6.922  1.00 15.00 ?  323 THR A HG21 10 
ATOM 7804  H HG22 . THR A 1 27 ? -1.794  -1.444  -5.899  1.00 15.00 ?  323 THR A HG22 10 
ATOM 7805  H HG23 . THR A 1 27 ? -0.211  -2.167  -5.602  1.00 15.00 ?  323 THR A HG23 10 
ATOM 7806  N N    . GLN A 1 28 ? 1.817   -1.406  -2.992  1.00 15.00 ?  324 GLN A N    10 
ATOM 7807  C CA   . GLN A 1 28 ? 2.568   -2.487  -2.366  1.00 15.00 ?  324 GLN A CA   10 
ATOM 7808  C C    . GLN A 1 28 ? 1.711   -3.319  -1.419  1.00 15.00 ?  324 GLN A C    10 
ATOM 7809  O O    . GLN A 1 28 ? 1.586   -2.984  -0.247  1.00 15.00 ?  324 GLN A O    10 
ATOM 7810  C CB   . GLN A 1 28 ? 3.764   -1.928  -1.569  1.00 15.00 ?  324 GLN A CB   10 
ATOM 7811  C CG   . GLN A 1 28 ? 4.777   -1.162  -2.397  1.00 15.00 ?  324 GLN A CG   10 
ATOM 7812  C CD   . GLN A 1 28 ? 5.554   -2.055  -3.347  1.00 15.00 ?  324 GLN A CD   10 
ATOM 7813  O OE1  . GLN A 1 28 ? 6.628   -2.547  -3.005  1.00 15.00 ?  324 GLN A OE1  10 
ATOM 7814  N NE2  . GLN A 1 28 ? 5.015   -2.293  -4.534  1.00 15.00 ?  324 GLN A NE2  10 
ATOM 7815  H H    . GLN A 1 28 ? 1.328   -0.774  -2.424  1.00 15.00 ?  324 GLN A H    10 
ATOM 7816  H HA   . GLN A 1 28 ? 2.943   -3.127  -3.149  1.00 15.00 ?  324 GLN A HA   10 
ATOM 7817  H HB2  . GLN A 1 28 ? 3.388   -1.261  -0.808  1.00 15.00 ?  324 GLN A HB2  10 
ATOM 7818  H HB3  . GLN A 1 28 ? 4.278   -2.745  -1.086  1.00 15.00 ?  324 GLN A HB3  10 
ATOM 7819  H HG2  . GLN A 1 28 ? 4.261   -0.404  -2.966  1.00 15.00 ?  324 GLN A HG2  10 
ATOM 7820  H HG3  . GLN A 1 28 ? 5.477   -0.685  -1.723  1.00 15.00 ?  324 GLN A HG3  10 
ATOM 7821  H HE21 . GLN A 1 28 ? 4.144   -1.886  -4.740  1.00 15.00 ?  324 GLN A HE21 10 
ATOM 7822  H HE22 . GLN A 1 28 ? 5.502   -2.872  -5.157  1.00 15.00 ?  324 GLN A HE22 10 
ATOM 7823  N N    . PHE A 1 29 ? 1.115   -4.396  -1.928  1.00 15.00 ?  325 PHE A N    10 
ATOM 7824  C CA   . PHE A 1 29 ? 0.593   -5.462  -1.058  1.00 15.00 ?  325 PHE A CA   10 
ATOM 7825  C C    . PHE A 1 29 ? 1.759   -6.153  -0.404  1.00 15.00 ?  325 PHE A C    10 
ATOM 7826  O O    . PHE A 1 29 ? 1.622   -7.016  0.459   1.00 15.00 ?  325 PHE A O    10 
ATOM 7827  C CB   . PHE A 1 29 ? -0.272  -6.469  -1.806  1.00 15.00 ?  325 PHE A CB   10 
ATOM 7828  C CG   . PHE A 1 29 ? -1.713  -6.092  -1.766  1.00 15.00 ?  325 PHE A CG   10 
ATOM 7829  C CD1  . PHE A 1 29 ? -2.238  -5.463  -0.647  1.00 15.00 ?  325 PHE A CD1  10 
ATOM 7830  C CD2  . PHE A 1 29 ? -2.541  -6.345  -2.838  1.00 15.00 ?  325 PHE A CD2  10 
ATOM 7831  C CE1  . PHE A 1 29 ? -3.565  -5.091  -0.620  1.00 15.00 ?  325 PHE A CE1  10 
ATOM 7832  C CE2  . PHE A 1 29 ? -3.870  -5.982  -2.808  1.00 15.00 ?  325 PHE A CE2  10 
ATOM 7833  C CZ   . PHE A 1 29 ? -4.381  -5.349  -1.700  1.00 15.00 ?  325 PHE A CZ   10 
ATOM 7834  H H    . PHE A 1 29 ? 1.016   -4.476  -2.899  1.00 15.00 ?  325 PHE A H    10 
ATOM 7835  H HA   . PHE A 1 29 ? -0.001  -4.990  -0.288  1.00 15.00 ?  325 PHE A HA   10 
ATOM 7836  H HB2  . PHE A 1 29 ? 0.042   -6.519  -2.842  1.00 15.00 ?  325 PHE A HB2  10 
ATOM 7837  H HB3  . PHE A 1 29 ? -0.164  -7.441  -1.348  1.00 15.00 ?  325 PHE A HB3  10 
ATOM 7838  H HD1  . PHE A 1 29 ? -1.588  -5.260  0.226   1.00 15.00 ?  325 PHE A HD1  10 
ATOM 7839  H HD2  . PHE A 1 29 ? -2.143  -6.845  -3.706  1.00 15.00 ?  325 PHE A HD2  10 
ATOM 7840  H HE1  . PHE A 1 29 ? -3.972  -4.611  0.253   1.00 15.00 ?  325 PHE A HE1  10 
ATOM 7841  H HE2  . PHE A 1 29 ? -4.506  -6.186  -3.656  1.00 15.00 ?  325 PHE A HE2  10 
ATOM 7842  H HZ   . PHE A 1 29 ? -5.421  -5.057  -1.674  1.00 15.00 ?  325 PHE A HZ   10 
ATOM 7843  N N    . THR A 1 30 ? 2.905   -5.783  -0.902  1.00 15.00 ?  326 THR A N    10 
ATOM 7844  C CA   . THR A 1 30 ? 4.163   -6.249  -0.378  1.00 15.00 ?  326 THR A CA   10 
ATOM 7845  C C    . THR A 1 30 ? 4.545   -5.252  0.696   1.00 15.00 ?  326 THR A C    10 
ATOM 7846  O O    . THR A 1 30 ? 5.193   -4.239  0.426   1.00 15.00 ?  326 THR A O    10 
ATOM 7847  C CB   . THR A 1 30 ? 5.249   -6.297  -1.470  1.00 15.00 ?  326 THR A CB   10 
ATOM 7848  O OG1  . THR A 1 30 ? 4.728   -6.943  -2.641  1.00 15.00 ?  326 THR A OG1  10 
ATOM 7849  C CG2  . THR A 1 30 ? 6.482   -7.044  -0.978  1.00 15.00 ?  326 THR A CG2  10 
ATOM 7850  H H    . THR A 1 30 ? 2.886   -5.071  -1.569  1.00 15.00 ?  326 THR A H    10 
ATOM 7851  H HA   . THR A 1 30 ? 4.029   -7.237  0.042   1.00 15.00 ?  326 THR A HA   10 
ATOM 7852  H HB   . THR A 1 30 ? 5.533   -5.285  -1.721  1.00 15.00 ?  326 THR A HB   10 
ATOM 7853  H HG1  . THR A 1 30 ? 4.789   -7.902  -2.535  1.00 15.00 ?  326 THR A HG1  10 
ATOM 7854  H HG21 . THR A 1 30 ? 6.888   -6.539  -0.114  1.00 15.00 ?  326 THR A HG21 10 
ATOM 7855  H HG22 . THR A 1 30 ? 7.224   -7.070  -1.762  1.00 15.00 ?  326 THR A HG22 10 
ATOM 7856  H HG23 . THR A 1 30 ? 6.208   -8.054  -0.707  1.00 15.00 ?  326 THR A HG23 10 
ATOM 7857  N N    . ASP A 1 31 ? 4.107   -5.521  1.904   1.00 15.00 ?  327 ASP A N    10 
ATOM 7858  C CA   . ASP A 1 31 ? 4.012   -4.498  2.907   1.00 15.00 ?  327 ASP A CA   10 
ATOM 7859  C C    . ASP A 1 31 ? 4.877   -4.732  4.092   1.00 15.00 ?  327 ASP A C    10 
ATOM 7860  O O    . ASP A 1 31 ? 5.185   -5.859  4.484   1.00 15.00 ?  327 ASP A O    10 
ATOM 7861  C CB   . ASP A 1 31 ? 2.588   -4.280  3.381   1.00 15.00 ?  327 ASP A CB   10 
ATOM 7862  C CG   . ASP A 1 31 ? 1.811   -5.558  3.642   1.00 15.00 ?  327 ASP A CG   10 
ATOM 7863  O OD1  . ASP A 1 31 ? 2.438   -6.632  3.748   1.00 15.00 ?  327 ASP A OD1  10 
ATOM 7864  O OD2  . ASP A 1 31 ? 0.578   -5.475  3.801   1.00 15.00 -1 327 ASP A OD2  10 
ATOM 7865  H H    . ASP A 1 31 ? 3.824   -6.434  2.136   1.00 15.00 ?  327 ASP A H    10 
ATOM 7866  H HA   . ASP A 1 31 ? 4.337   -3.575  2.450   1.00 15.00 ?  327 ASP A HA   10 
ATOM 7867  H HB2  . ASP A 1 31 ? 2.625   -3.725  4.309   1.00 15.00 ?  327 ASP A HB2  10 
ATOM 7868  H HB3  . ASP A 1 31 ? 2.087   -3.684  2.650   1.00 15.00 ?  327 ASP A HB3  10 
ATOM 7869  N N    . PRO A 1 32 ? 5.264   -3.617  4.675   1.00 15.00 ?  328 PRO A N    10 
ATOM 7870  C CA   . PRO A 1 32 ? 5.934   -3.582  5.949   1.00 15.00 ?  328 PRO A CA   10 
ATOM 7871  C C    . PRO A 1 32 ? 4.949   -4.082  7.016   1.00 15.00 ?  328 PRO A C    10 
ATOM 7872  O O    . PRO A 1 32 ? 5.318   -4.386  8.149   1.00 15.00 ?  328 PRO A O    10 
ATOM 7873  C CB   . PRO A 1 32 ? 6.320   -2.095  6.109   1.00 15.00 ?  328 PRO A CB   10 
ATOM 7874  C CG   . PRO A 1 32 ? 6.066   -1.474  4.759   1.00 15.00 ?  328 PRO A CG   10 
ATOM 7875  C CD   . PRO A 1 32 ? 4.979   -2.272  4.166   1.00 15.00 ?  328 PRO A CD   10 
ATOM 7876  H HA   . PRO A 1 32 ? 6.820   -4.203  5.950   1.00 15.00 ?  328 PRO A HA   10 
ATOM 7877  H HB2  . PRO A 1 32 ? 5.705   -1.644  6.874   1.00 15.00 ?  328 PRO A HB2  10 
ATOM 7878  H HB3  . PRO A 1 32 ? 7.360   -2.019  6.387   1.00 15.00 ?  328 PRO A HB3  10 
ATOM 7879  H HG2  . PRO A 1 32 ? 5.764   -0.442  4.869   1.00 15.00 ?  328 PRO A HG2  10 
ATOM 7880  H HG3  . PRO A 1 32 ? 6.929   -1.548  4.118   1.00 15.00 ?  328 PRO A HG3  10 
ATOM 7881  H HD2  . PRO A 1 32 ? 4.018   -1.920  4.509   1.00 15.00 ?  328 PRO A HD2  10 
ATOM 7882  H HD3  . PRO A 1 32 ? 5.034   -2.248  3.087   1.00 15.00 ?  328 PRO A HD3  10 
ATOM 7883  N N    . ARG A 1 33 ? 3.667   -4.133  6.614   1.00 15.00 ?  329 ARG A N    10 
ATOM 7884  C CA   . ARG A 1 33 ? 2.597   -4.715  7.420   1.00 15.00 ?  329 ARG A CA   10 
ATOM 7885  C C    . ARG A 1 33 ? 2.819   -6.209  7.649   1.00 15.00 ?  329 ARG A C    10 
ATOM 7886  O O    . ARG A 1 33 ? 2.475   -6.737  8.707   1.00 15.00 ?  329 ARG A O    10 
ATOM 7887  C CB   . ARG A 1 33 ? 1.214   -4.480  6.772   1.00 15.00 ?  329 ARG A CB   10 
ATOM 7888  C CG   . ARG A 1 33 ? 0.745   -3.044  6.886   1.00 15.00 ?  329 ARG A CG   10 
ATOM 7889  C CD   . ARG A 1 33 ? 0.578   -2.624  8.337   1.00 15.00 ?  329 ARG A CD   10 
ATOM 7890  N NE   . ARG A 1 33 ? -0.483  -3.373  9.010   1.00 15.00 ?  329 ARG A NE   10 
ATOM 7891  C CZ   . ARG A 1 33 ? -0.998  -3.032  10.192  1.00 15.00 ?  329 ARG A CZ   10 
ATOM 7892  N NH1  . ARG A 1 33 ? -0.508  -1.997  10.863  1.00 15.00 1  329 ARG A NH1  10 
ATOM 7893  N NH2  . ARG A 1 33 ? -1.990  -3.742  10.713  1.00 15.00 ?  329 ARG A NH2  10 
ATOM 7894  H H    . ARG A 1 33 ? 3.443   -3.776  5.730   1.00 15.00 ?  329 ARG A H    10 
ATOM 7895  H HA   . ARG A 1 33 ? 2.612   -4.220  8.380   1.00 15.00 ?  329 ARG A HA   10 
ATOM 7896  H HB2  . ARG A 1 33 ? 1.240   -4.748  5.701   1.00 15.00 ?  329 ARG A HB2  10 
ATOM 7897  H HB3  . ARG A 1 33 ? 0.490   -5.110  7.267   1.00 15.00 ?  329 ARG A HB3  10 
ATOM 7898  H HG2  . ARG A 1 33 ? 1.474   -2.399  6.420   1.00 15.00 ?  329 ARG A HG2  10 
ATOM 7899  H HG3  . ARG A 1 33 ? -0.204  -2.943  6.380   1.00 15.00 ?  329 ARG A HG3  10 
ATOM 7900  H HD2  . ARG A 1 33 ? 1.509   -2.794  8.858   1.00 15.00 ?  329 ARG A HD2  10 
ATOM 7901  H HD3  . ARG A 1 33 ? 0.338   -1.571  8.368   1.00 15.00 ?  329 ARG A HD3  10 
ATOM 7902  H HE   . ARG A 1 33 ? -0.838  -4.161  8.544   1.00 15.00 ?  329 ARG A HE   10 
ATOM 7903  H HH11 . ARG A 1 33 ? 0.261   -1.462  10.486  1.00 15.00 ?  329 ARG A HH11 10 
ATOM 7904  H HH12 . ARG A 1 33 ? -0.907  -1.729  11.748  1.00 15.00 ?  329 ARG A HH12 10 
ATOM 7905  H HH21 . ARG A 1 33 ? -2.360  -4.533  10.224  1.00 15.00 ?  329 ARG A HH21 10 
ATOM 7906  H HH22 . ARG A 1 33 ? -2.379  -3.484  11.613  1.00 15.00 ?  329 ARG A HH22 10 
ATOM 7907  N N    . LEU A 1 34 ? 3.381   -6.888  6.657   1.00 15.00 ?  330 LEU A N    10 
ATOM 7908  C CA   . LEU A 1 34 ? 3.660   -8.315  6.769   1.00 15.00 ?  330 LEU A CA   10 
ATOM 7909  C C    . LEU A 1 34 ? 4.815   -8.554  7.743   1.00 15.00 ?  330 LEU A C    10 
ATOM 7910  O O    . LEU A 1 34 ? 5.005   -9.661  8.247   1.00 15.00 ?  330 LEU A O    10 
ATOM 7911  C CB   . LEU A 1 34 ? 3.965   -8.907  5.383   1.00 15.00 ?  330 LEU A CB   10 
ATOM 7912  C CG   . LEU A 1 34 ? 4.145   -10.427 5.326   1.00 15.00 ?  330 LEU A CG   10 
ATOM 7913  C CD1  . LEU A 1 34 ? 3.498   -10.984 4.068   1.00 15.00 ?  330 LEU A CD1  10 
ATOM 7914  C CD2  . LEU A 1 34 ? 5.621   -10.799 5.361   1.00 15.00 ?  330 LEU A CD2  10 
ATOM 7915  H H    . LEU A 1 34 ? 3.596   -6.425  5.815   1.00 15.00 ?  330 LEU A H    10 
ATOM 7916  H HA   . LEU A 1 34 ? 2.772   -8.791  7.165   1.00 15.00 ?  330 LEU A HA   10 
ATOM 7917  H HB2  . LEU A 1 34 ? 3.156   -8.639  4.719   1.00 15.00 ?  330 LEU A HB2  10 
ATOM 7918  H HB3  . LEU A 1 34 ? 4.872   -8.448  5.015   1.00 15.00 ?  330 LEU A HB3  10 
ATOM 7919  H HG   . LEU A 1 34 ? 3.663   -10.876 6.182   1.00 15.00 ?  330 LEU A HG   10 
ATOM 7920  H HD11 . LEU A 1 34 ? 2.443   -10.754 4.074   1.00 15.00 ?  330 LEU A HD11 10 
ATOM 7921  H HD12 . LEU A 1 34 ? 3.633   -12.056 4.041   1.00 15.00 ?  330 LEU A HD12 10 
ATOM 7922  H HD13 . LEU A 1 34 ? 3.958   -10.541 3.199   1.00 15.00 ?  330 LEU A HD13 10 
ATOM 7923  H HD21 . LEU A 1 34 ? 6.065   -10.424 6.271   1.00 15.00 ?  330 LEU A HD21 10 
ATOM 7924  H HD22 . LEU A 1 34 ? 6.123   -10.362 4.510   1.00 15.00 ?  330 LEU A HD22 10 
ATOM 7925  H HD23 . LEU A 1 34 ? 5.722   -11.873 5.327   1.00 15.00 ?  330 LEU A HD23 10 
ATOM 7926  N N    . SER A 1 35 ? 5.580   -7.505  8.011   1.00 15.00 ?  331 SER A N    10 
ATOM 7927  C CA   . SER A 1 35 ? 6.690   -7.584  8.950   1.00 15.00 ?  331 SER A CA   10 
ATOM 7928  C C    . SER A 1 35 ? 6.198   -7.453  10.388  1.00 15.00 ?  331 SER A C    10 
ATOM 7929  O O    . SER A 1 35 ? 6.955   -7.662  11.337  1.00 15.00 ?  331 SER A O    10 
ATOM 7930  C CB   . SER A 1 35 ? 7.722   -6.502  8.643   1.00 15.00 ?  331 SER A CB   10 
ATOM 7931  O OG   . SER A 1 35 ? 8.182   -6.615  7.308   1.00 15.00 ?  331 SER A OG   10 
ATOM 7932  H H    . SER A 1 35 ? 5.402   -6.654  7.555   1.00 15.00 ?  331 SER A H    10 
ATOM 7933  H HA   . SER A 1 35 ? 7.153   -8.553  8.829   1.00 15.00 ?  331 SER A HA   10 
ATOM 7934  H HB2  . SER A 1 35 ? 7.275   -5.528  8.779   1.00 15.00 ?  331 SER A HB2  10 
ATOM 7935  H HB3  . SER A 1 35 ? 8.565   -6.608  9.313   1.00 15.00 ?  331 SER A HB3  10 
ATOM 7936  H HG   . SER A 1 35 ? 8.722   -5.840  7.086   1.00 15.00 ?  331 SER A HG   10 
ATOM 7937  N N    . ALA A 1 36 ? 4.930   -7.091  10.542  1.00 15.00 ?  332 ALA A N    10 
ATOM 7938  C CA   . ALA A 1 36 ? 4.334   -6.933  11.862  1.00 15.00 ?  332 ALA A CA   10 
ATOM 7939  C C    . ALA A 1 36 ? 3.753   -8.253  12.355  1.00 15.00 ?  332 ALA A C    10 
ATOM 7940  O O    . ALA A 1 36 ? 3.369   -8.379  13.517  1.00 15.00 ?  332 ALA A O    10 
ATOM 7941  C CB   . ALA A 1 36 ? 3.262   -5.850  11.836  1.00 15.00 ?  332 ALA A CB   10 
ATOM 7942  H H    . ALA A 1 36 ? 4.379   -6.929  9.746   1.00 15.00 ?  332 ALA A H    10 
ATOM 7943  H HA   . ALA A 1 36 ? 5.114   -6.619  12.542  1.00 15.00 ?  332 ALA A HA   10 
ATOM 7944  H HB1  . ALA A 1 36 ? 3.694   -4.924  11.486  1.00 15.00 ?  332 ALA A HB1  10 
ATOM 7945  H HB2  . ALA A 1 36 ? 2.867   -5.710  12.831  1.00 15.00 ?  332 ALA A HB2  10 
ATOM 7946  H HB3  . ALA A 1 36 ? 2.465   -6.148  11.172  1.00 15.00 ?  332 ALA A HB3  10 
ATOM 7947  N N    . ASN A 1 37 ? 3.693   -9.234  11.465  1.00 15.00 ?  333 ASN A N    10 
ATOM 7948  C CA   . ASN A 1 37 ? 3.154   -10.543 11.803  1.00 15.00 ?  333 ASN A CA   10 
ATOM 7949  C C    . ASN A 1 37 ? 4.138   -11.628 11.391  1.00 15.00 ?  333 ASN A C    10 
ATOM 7950  O O    . ASN A 1 37 ? 4.093   -12.069 10.224  1.00 15.00 ?  333 ASN A O    10 
ATOM 7951  C CB   . ASN A 1 37 ? 1.798   -10.755 11.121  1.00 15.00 ?  333 ASN A CB   10 
ATOM 7952  C CG   . ASN A 1 37 ? 1.140   -12.070 11.506  1.00 15.00 ?  333 ASN A CG   10 
ATOM 7953  O OD1  . ASN A 1 37 ? 0.447   -12.156 12.522  1.00 15.00 ?  333 ASN A OD1  10 
ATOM 7954  N ND2  . ASN A 1 37 ? 1.328   -13.095 10.688  1.00 15.00 ?  333 ASN A ND2  10 
ATOM 7955  O OXT  . ASN A 1 37 ? 4.972   -12.021 12.228  1.00 15.00 ?  333 ASN A OXT  10 
ATOM 7956  H H    . ASN A 1 37 ? 4.030   -9.080  10.558  1.00 15.00 ?  333 ASN A H    10 
ATOM 7957  H HA   . ASN A 1 37 ? 3.022   -10.579 12.874  1.00 15.00 ?  333 ASN A HA   10 
ATOM 7958  H HB2  . ASN A 1 37 ? 1.135   -9.951  11.398  1.00 15.00 ?  333 ASN A HB2  10 
ATOM 7959  H HB3  . ASN A 1 37 ? 1.939   -10.746 10.049  1.00 15.00 ?  333 ASN A HB3  10 
ATOM 7960  H HD21 . ASN A 1 37 ? 1.880   -12.957 9.885   1.00 15.00 ?  333 ASN A HD21 10 
ATOM 7961  H HD22 . ASN A 1 37 ? 0.899   -13.952 10.909  1.00 15.00 ?  333 ASN A HD22 10 
ATOM 7962  N N    . GLU B 2 1  ? 3.513   -9.064  -6.592  1.00 15.00 ?  203 GLU B N    10 
ATOM 7963  C CA   . GLU B 2 1  ? 2.945   -9.224  -5.237  1.00 15.00 ?  203 GLU B CA   10 
ATOM 7964  C C    . GLU B 2 1  ? 2.371   -10.626 -5.088  1.00 15.00 ?  203 GLU B C    10 
ATOM 7965  O O    . GLU B 2 1  ? 1.639   -11.096 -5.955  1.00 15.00 ?  203 GLU B O    10 
ATOM 7966  C CB   . GLU B 2 1  ? 1.847   -8.179  -4.958  1.00 15.00 ?  203 GLU B CB   10 
ATOM 7967  C CG   . GLU B 2 1  ? 2.325   -6.730  -4.984  1.00 15.00 ?  203 GLU B CG   10 
ATOM 7968  C CD   . GLU B 2 1  ? 2.795   -6.285  -6.353  1.00 15.00 ?  203 GLU B CD   10 
ATOM 7969  O OE1  . GLU B 2 1  ? 1.962   -5.817  -7.152  1.00 15.00 -1 203 GLU B OE1  10 
ATOM 7970  O OE2  . GLU B 2 1  ? 4.000   -6.435  -6.648  1.00 15.00 ?  203 GLU B OE2  10 
ATOM 7971  H H1   . GLU B 2 1  ? 2.775   -9.237  -7.312  1.00 15.00 ?  203 GLU B H1   10 
ATOM 7972  H H2   . GLU B 2 1  ? 4.290   -9.744  -6.736  1.00 15.00 ?  203 GLU B H2   10 
ATOM 7973  H H3   . GLU B 2 1  ? 3.884   -8.096  -6.713  1.00 15.00 ?  203 GLU B H3   10 
ATOM 7974  H HA   . GLU B 2 1  ? 3.745   -9.100  -4.519  1.00 15.00 ?  203 GLU B HA   10 
ATOM 7975  H HB2  . GLU B 2 1  ? 1.066   -8.286  -5.695  1.00 15.00 ?  203 GLU B HB2  10 
ATOM 7976  H HB3  . GLU B 2 1  ? 1.427   -8.375  -3.983  1.00 15.00 ?  203 GLU B HB3  10 
ATOM 7977  H HG2  . GLU B 2 1  ? 1.511   -6.090  -4.678  1.00 15.00 ?  203 GLU B HG2  10 
ATOM 7978  H HG3  . GLU B 2 1  ? 3.145   -6.623  -4.287  1.00 15.00 ?  203 GLU B HG3  10 
ATOM 7979  N N    . LEU B 2 2  ? 2.709   -11.291 -3.990  1.00 15.00 ?  204 LEU B N    10 
ATOM 7980  C CA   . LEU B 2 2  ? 2.201   -12.633 -3.723  1.00 15.00 ?  204 LEU B CA   10 
ATOM 7981  C C    . LEU B 2 2  ? 0.691   -12.578 -3.489  1.00 15.00 ?  204 LEU B C    10 
ATOM 7982  O O    . LEU B 2 2  ? -0.040  -13.515 -3.816  1.00 15.00 ?  204 LEU B O    10 
ATOM 7983  C CB   . LEU B 2 2  ? 2.936   -13.237 -2.510  1.00 15.00 ?  204 LEU B CB   10 
ATOM 7984  C CG   . LEU B 2 2  ? 2.749   -14.745 -2.259  1.00 15.00 ?  204 LEU B CG   10 
ATOM 7985  C CD1  . LEU B 2 2  ? 1.424   -15.037 -1.568  1.00 15.00 ?  204 LEU B CD1  10 
ATOM 7986  C CD2  . LEU B 2 2  ? 2.848   -15.517 -3.564  1.00 15.00 ?  204 LEU B CD2  10 
ATOM 7987  H H    . LEU B 2 2  ? 3.322   -10.872 -3.346  1.00 15.00 ?  204 LEU B H    10 
ATOM 7988  H HA   . LEU B 2 2  ? 2.395   -13.240 -4.594  1.00 15.00 ?  204 LEU B HA   10 
ATOM 7989  H HB2  . LEU B 2 2  ? 3.991   -13.051 -2.637  1.00 15.00 ?  204 LEU B HB2  10 
ATOM 7990  H HB3  . LEU B 2 2  ? 2.605   -12.710 -1.626  1.00 15.00 ?  204 LEU B HB3  10 
ATOM 7991  H HG   . LEU B 2 2  ? 3.542   -15.092 -1.611  1.00 15.00 ?  204 LEU B HG   10 
ATOM 7992  H HD11 . LEU B 2 2  ? 0.612   -14.686 -2.186  1.00 15.00 ?  204 LEU B HD11 10 
ATOM 7993  H HD12 . LEU B 2 2  ? 1.396   -14.530 -0.614  1.00 15.00 ?  204 LEU B HD12 10 
ATOM 7994  H HD13 . LEU B 2 2  ? 1.325   -16.101 -1.414  1.00 15.00 ?  204 LEU B HD13 10 
ATOM 7995  H HD21 . LEU B 2 2  ? 2.709   -16.571 -3.372  1.00 15.00 ?  204 LEU B HD21 10 
ATOM 7996  H HD22 . LEU B 2 2  ? 3.819   -15.355 -4.007  1.00 15.00 ?  204 LEU B HD22 10 
ATOM 7997  H HD23 . LEU B 2 2  ? 2.081   -15.172 -4.242  1.00 15.00 ?  204 LEU B HD23 10 
ATOM 7998  N N    . GLU B 2 3  ? 0.239   -11.466 -2.927  1.00 15.00 ?  205 GLU B N    10 
ATOM 7999  C CA   . GLU B 2 3  ? -1.170  -11.257 -2.630  1.00 15.00 ?  205 GLU B CA   10 
ATOM 8000  C C    . GLU B 2 3  ? -1.936  -10.880 -3.904  1.00 15.00 ?  205 GLU B C    10 
ATOM 8001  O O    . GLU B 2 3  ? -1.332  -10.527 -4.916  1.00 15.00 ?  205 GLU B O    10 
ATOM 8002  C CB   . GLU B 2 3  ? -1.300  -10.159 -1.561  1.00 15.00 ?  205 GLU B CB   10 
ATOM 8003  C CG   . GLU B 2 3  ? -2.723  -9.886  -1.091  1.00 15.00 ?  205 GLU B CG   10 
ATOM 8004  C CD   . GLU B 2 3  ? -3.436  -11.135 -0.618  1.00 15.00 ?  205 GLU B CD   10 
ATOM 8005  O OE1  . GLU B 2 3  ? -3.178  -11.579 0.516   1.00 15.00 ?  205 GLU B OE1  10 
ATOM 8006  O OE2  . GLU B 2 3  ? -4.266  -11.673 -1.381  1.00 15.00 -1 205 GLU B OE2  10 
ATOM 8007  H H    . GLU B 2 3  ? 0.876   -10.756 -2.709  1.00 15.00 ?  205 GLU B H    10 
ATOM 8008  H HA   . GLU B 2 3  ? -1.571  -12.180 -2.239  1.00 15.00 ?  205 GLU B HA   10 
ATOM 8009  H HB2  . GLU B 2 3  ? -0.716  -10.447 -0.701  1.00 15.00 ?  205 GLU B HB2  10 
ATOM 8010  H HB3  . GLU B 2 3  ? -0.897  -9.241  -1.963  1.00 15.00 ?  205 GLU B HB3  10 
ATOM 8011  H HG2  . GLU B 2 3  ? -2.690  -9.179  -0.276  1.00 15.00 ?  205 GLU B HG2  10 
ATOM 8012  H HG3  . GLU B 2 3  ? -3.283  -9.460  -1.912  1.00 15.00 ?  205 GLU B HG3  10 
ATOM 8013  N N    . SER B 2 4  ? -3.259  -10.965 -3.829  1.00 15.00 ?  206 SER B N    10 
ATOM 8014  C CA   . SER B 2 4  ? -4.156  -10.596 -4.924  1.00 15.00 ?  206 SER B CA   10 
ATOM 8015  C C    . SER B 2 4  ? -3.845  -9.235  -5.525  1.00 15.00 ?  206 SER B C    10 
ATOM 8016  O O    . SER B 2 4  ? -3.229  -8.368  -4.904  1.00 15.00 ?  206 SER B O    10 
ATOM 8017  C CB   . SER B 2 4  ? -5.594  -10.624 -4.428  1.00 15.00 ?  206 SER B CB   10 
ATOM 8018  O OG   . SER B 2 4  ? -5.689  -10.225 -3.068  1.00 15.00 ?  206 SER B OG   10 
ATOM 8019  H H    . SER B 2 4  ? -3.656  -11.290 -2.989  1.00 15.00 ?  206 SER B H    10 
ATOM 8020  H HA   . SER B 2 4  ? -4.073  -11.330 -5.714  1.00 15.00 ?  206 SER B HA   10 
ATOM 8021  H HB2  . SER B 2 4  ? -6.184  -9.947  -5.029  1.00 15.00 ?  206 SER B HB2  10 
ATOM 8022  H HB3  . SER B 2 4  ? -5.978  -11.622 -4.543  1.00 15.00 ?  206 SER B HB3  10 
ATOM 8023  H HG   . SER B 2 4  ? -5.289  -10.904 -2.500  1.00 15.00 ?  206 SER B HG   10 
ATOM 8024  N N    . PRO B 2 5  ? -4.321  -9.064  -6.754  1.00 15.00 ?  207 PRO B N    10 
ATOM 8025  C CA   . PRO B 2 5  ? -4.180  -7.836  -7.532  1.00 15.00 ?  207 PRO B CA   10 
ATOM 8026  C C    . PRO B 2 5  ? -4.567  -6.594  -6.722  1.00 15.00 ?  207 PRO B C    10 
ATOM 8027  O O    . PRO B 2 5  ? -5.698  -6.485  -6.238  1.00 15.00 ?  207 PRO B O    10 
ATOM 8028  C CB   . PRO B 2 5  ? -5.171  -8.027  -8.686  1.00 15.00 ?  207 PRO B CB   10 
ATOM 8029  C CG   . PRO B 2 5  ? -5.434  -9.498  -8.782  1.00 15.00 ?  207 PRO B CG   10 
ATOM 8030  C CD   . PRO B 2 5  ? -5.002  -10.130 -7.483  1.00 15.00 ?  207 PRO B CD   10 
ATOM 8031  H HA   . PRO B 2 5  ? -3.183  -7.724  -7.924  1.00 15.00 ?  207 PRO B HA   10 
ATOM 8032  H HB2  . PRO B 2 5  ? -6.080  -7.485  -8.470  1.00 15.00 ?  207 PRO B HB2  10 
ATOM 8033  H HB3  . PRO B 2 5  ? -4.735  -7.648  -9.599  1.00 15.00 ?  207 PRO B HB3  10 
ATOM 8034  H HG2  . PRO B 2 5  ? -6.488  -9.666  -8.940  1.00 15.00 ?  207 PRO B HG2  10 
ATOM 8035  H HG3  . PRO B 2 5  ? -4.867  -9.914  -9.603  1.00 15.00 ?  207 PRO B HG3  10 
ATOM 8036  H HD2  . PRO B 2 5  ? -5.841  -10.484 -6.911  1.00 15.00 ?  207 PRO B HD2  10 
ATOM 8037  H HD3  . PRO B 2 5  ? -4.330  -10.951 -7.656  1.00 15.00 ?  207 PRO B HD3  10 
ATOM 8038  N N    . PRO B 2 6  ? -3.621  -5.655  -6.542  1.00 15.00 ?  208 PRO B N    10 
ATOM 8039  C CA   . PRO B 2 6  ? -3.826  -4.474  -5.718  1.00 15.00 ?  208 PRO B CA   10 
ATOM 8040  C C    . PRO B 2 6  ? -4.425  -3.291  -6.474  1.00 15.00 ?  208 PRO B C    10 
ATOM 8041  O O    . PRO B 2 6  ? -4.370  -3.227  -7.705  1.00 15.00 ?  208 PRO B O    10 
ATOM 8042  C CB   . PRO B 2 6  ? -2.413  -4.137  -5.231  1.00 15.00 ?  208 PRO B CB   10 
ATOM 8043  C CG   . PRO B 2 6  ? -1.457  -4.872  -6.126  1.00 15.00 ?  208 PRO B CG   10 
ATOM 8044  C CD   . PRO B 2 6  ? -2.269  -5.675  -7.110  1.00 15.00 ?  208 PRO B CD   10 
ATOM 8045  H HA   . PRO B 2 6  ? -4.449  -4.698  -4.865  1.00 15.00 ?  208 PRO B HA   10 
ATOM 8046  H HB2  . PRO B 2 6  ? -2.259  -3.070  -5.292  1.00 15.00 ?  208 PRO B HB2  10 
ATOM 8047  H HB3  . PRO B 2 6  ? -2.311  -4.457  -4.200  1.00 15.00 ?  208 PRO B HB3  10 
ATOM 8048  H HG2  . PRO B 2 6  ? -0.840  -4.162  -6.654  1.00 15.00 ?  208 PRO B HG2  10 
ATOM 8049  H HG3  . PRO B 2 6  ? -0.839  -5.530  -5.532  1.00 15.00 ?  208 PRO B HG3  10 
ATOM 8050  H HD2  . PRO B 2 6  ? -2.253  -5.208  -8.084  1.00 15.00 ?  208 PRO B HD2  10 
ATOM 8051  H HD3  . PRO B 2 6  ? -1.888  -6.683  -7.169  1.00 15.00 ?  208 PRO B HD3  10 
ATOM 8052  N N    . PRO B 2 7  ? -4.995  -2.338  -5.713  1.00 15.00 ?  209 PRO B N    10 
ATOM 8053  C CA   . PRO B 2 7  ? -5.576  -1.099  -6.248  1.00 15.00 ?  209 PRO B CA   10 
ATOM 8054  C C    . PRO B 2 7  ? -4.642  -0.374  -7.223  1.00 15.00 ?  209 PRO B C    10 
ATOM 8055  O O    . PRO B 2 7  ? -3.471  -0.150  -6.911  1.00 15.00 ?  209 PRO B O    10 
ATOM 8056  C CB   . PRO B 2 7  ? -5.762  -0.227  -4.999  1.00 15.00 ?  209 PRO B CB   10 
ATOM 8057  C CG   . PRO B 2 7  ? -5.812  -1.161  -3.842  1.00 15.00 ?  209 PRO B CG   10 
ATOM 8058  C CD   . PRO B 2 7  ? -5.132  -2.433  -4.251  1.00 15.00 ?  209 PRO B CD   10 
ATOM 8059  H HA   . PRO B 2 7  ? -6.531  -1.274  -6.717  1.00 15.00 ?  209 PRO B HA   10 
ATOM 8060  H HB2  . PRO B 2 7  ? -4.931  0.455   -4.912  1.00 15.00 ?  209 PRO B HB2  10 
ATOM 8061  H HB3  . PRO B 2 7  ? -6.679  0.334   -5.082  1.00 15.00 ?  209 PRO B HB3  10 
ATOM 8062  H HG2  . PRO B 2 7  ? -5.287  -0.722  -3.008  1.00 15.00 ?  209 PRO B HG2  10 
ATOM 8063  H HG3  . PRO B 2 7  ? -6.841  -1.356  -3.574  1.00 15.00 ?  209 PRO B HG3  10 
ATOM 8064  H HD2  . PRO B 2 7  ? -4.161  -2.502  -3.783  1.00 15.00 ?  209 PRO B HD2  10 
ATOM 8065  H HD3  . PRO B 2 7  ? -5.739  -3.283  -3.978  1.00 15.00 ?  209 PRO B HD3  10 
ATOM 8066  N N    . PRO B 2 8  ? -5.154  -0.003  -8.413  1.00 15.00 ?  210 PRO B N    10 
ATOM 8067  C CA   . PRO B 2 8  ? -4.407  0.808   -9.391  1.00 15.00 ?  210 PRO B CA   10 
ATOM 8068  C C    . PRO B 2 8  ? -3.851  2.074   -8.747  1.00 15.00 ?  210 PRO B C    10 
ATOM 8069  O O    . PRO B 2 8  ? -4.467  2.628   -7.832  1.00 15.00 ?  210 PRO B O    10 
ATOM 8070  C CB   . PRO B 2 8  ? -5.466  1.151   -10.439 1.00 15.00 ?  210 PRO B CB   10 
ATOM 8071  C CG   . PRO B 2 8  ? -6.444  0.035   -10.357 1.00 15.00 ?  210 PRO B CG   10 
ATOM 8072  C CD   . PRO B 2 8  ? -6.499  -0.351  -8.905  1.00 15.00 ?  210 PRO B CD   10 
ATOM 8073  H HA   . PRO B 2 8  ? -3.604  0.248   -9.846  1.00 15.00 ?  210 PRO B HA   10 
ATOM 8074  H HB2  . PRO B 2 8  ? -5.922  2.100   -10.199 1.00 15.00 ?  210 PRO B HB2  10 
ATOM 8075  H HB3  . PRO B 2 8  ? -5.008  1.203   -11.416 1.00 15.00 ?  210 PRO B HB3  10 
ATOM 8076  H HG2  . PRO B 2 8  ? -7.415  0.369   -10.692 1.00 15.00 ?  210 PRO B HG2  10 
ATOM 8077  H HG3  . PRO B 2 8  ? -6.104  -0.799  -10.954 1.00 15.00 ?  210 PRO B HG3  10 
ATOM 8078  H HD2  . PRO B 2 8  ? -7.258  0.220   -8.391  1.00 15.00 ?  210 PRO B HD2  10 
ATOM 8079  H HD3  . PRO B 2 8  ? -6.685  -1.409  -8.802  1.00 15.00 ?  210 PRO B HD3  10 
ATOM 8080  N N    . TYR B 2 9  ? -2.711  2.552   -9.236  1.00 15.00 ?  211 TYR B N    10 
ATOM 8081  C CA   . TYR B 2 9  ? -1.990  3.604   -8.537  1.00 15.00 ?  211 TYR B CA   10 
ATOM 8082  C C    . TYR B 2 9  ? -2.699  4.953   -8.581  1.00 15.00 ?  211 TYR B C    10 
ATOM 8083  O O    . TYR B 2 9  ? -2.567  5.730   -9.529  1.00 15.00 ?  211 TYR B O    10 
ATOM 8084  C CB   . TYR B 2 9  ? -0.556  3.768   -9.032  1.00 15.00 ?  211 TYR B CB   10 
ATOM 8085  C CG   . TYR B 2 9  ? 0.229   4.739   -8.174  1.00 15.00 ?  211 TYR B CG   10 
ATOM 8086  C CD1  . TYR B 2 9  ? 0.497   4.444   -6.843  1.00 15.00 ?  211 TYR B CD1  10 
ATOM 8087  C CD2  . TYR B 2 9  ? 0.693   5.951   -8.681  1.00 15.00 ?  211 TYR B CD2  10 
ATOM 8088  C CE1  . TYR B 2 9  ? 1.199   5.322   -6.045  1.00 15.00 ?  211 TYR B CE1  10 
ATOM 8089  C CE2  . TYR B 2 9  ? 1.397   6.830   -7.879  1.00 15.00 ?  211 TYR B CE2  10 
ATOM 8090  C CZ   . TYR B 2 9  ? 1.643   6.510   -6.570  1.00 15.00 ?  211 TYR B CZ   10 
ATOM 8091  O OH   . TYR B 2 9  ? 2.353   7.383   -5.790  1.00 15.00 ?  211 TYR B OH   10 
ATOM 8092  H H    . TYR B 2 9  ? -2.351  2.188   -10.079 1.00 15.00 ?  211 TYR B H    10 
ATOM 8093  H HA   . TYR B 2 9  ? -1.945  3.300   -7.501  1.00 15.00 ?  211 TYR B HA   10 
ATOM 8094  H HB2  . TYR B 2 9  ? -0.055  2.810   -9.006  1.00 15.00 ?  211 TYR B HB2  10 
ATOM 8095  H HB3  . TYR B 2 9  ? -0.564  4.143   -10.045 1.00 15.00 ?  211 TYR B HB3  10 
ATOM 8096  H HD1  . TYR B 2 9  ? 0.144   3.511   -6.431  1.00 15.00 ?  211 TYR B HD1  10 
ATOM 8097  H HD2  . TYR B 2 9  ? 0.500   6.199   -9.715  1.00 15.00 ?  211 TYR B HD2  10 
ATOM 8098  H HE1  . TYR B 2 9  ? 1.397   5.072   -5.012  1.00 15.00 ?  211 TYR B HE1  10 
ATOM 8099  H HE2  . TYR B 2 9  ? 1.751   7.769   -8.273  1.00 15.00 ?  211 TYR B HE2  10 
ATOM 8100  H HH   . TYR B 2 9  ? 2.367   8.257   -6.220  1.00 15.00 ?  211 TYR B HH   10 
ATOM 8101  N N    . SER B 2 10 ? -3.489  5.182   -7.562  1.00 15.00 ?  212 SER B N    10 
ATOM 8102  C CA   . SER B 2 10 ? -3.943  6.503   -7.196  1.00 15.00 ?  212 SER B CA   10 
ATOM 8103  C C    . SER B 2 10 ? -3.175  6.868   -5.939  1.00 15.00 ?  212 SER B C    10 
ATOM 8104  O O    . SER B 2 10 ? -2.804  5.968   -5.185  1.00 15.00 ?  212 SER B O    10 
ATOM 8105  C CB   . SER B 2 10 ? -5.457  6.514   -6.947  1.00 15.00 ?  212 SER B CB   10 
ATOM 8106  O OG   . SER B 2 10 ? -5.934  7.837   -6.736  1.00 15.00 ?  212 SER B OG   10 
ATOM 8107  H H    . SER B 2 10 ? -3.787  4.418   -7.023  1.00 15.00 ?  212 SER B H    10 
ATOM 8108  H HA   . SER B 2 10 ? -3.689  7.191   -7.991  1.00 15.00 ?  212 SER B HA   10 
ATOM 8109  H HB2  . SER B 2 10 ? -5.963  6.094   -7.803  1.00 15.00 ?  212 SER B HB2  10 
ATOM 8110  H HB3  . SER B 2 10 ? -5.679  5.921   -6.071  1.00 15.00 ?  212 SER B HB3  10 
ATOM 8111  H HG   . SER B 2 10 ? -6.892  7.867   -6.902  1.00 15.00 ?  212 SER B HG   10 
ATOM 8112  N N    . ARG B 2 11 ? -2.913  8.148   -5.703  1.00 15.00 ?  213 ARG B N    10 
ATOM 8113  C CA   . ARG B 2 11 ? -2.092  8.526   -4.558  1.00 15.00 ?  213 ARG B CA   10 
ATOM 8114  C C    . ARG B 2 11 ? -2.760  8.025   -3.290  1.00 15.00 ?  213 ARG B C    10 
ATOM 8115  O O    . ARG B 2 11 ? -2.123  7.430   -2.424  1.00 15.00 ?  213 ARG B O    10 
ATOM 8116  C CB   . ARG B 2 11 ? -1.943  10.047  -4.431  1.00 15.00 ?  213 ARG B CB   10 
ATOM 8117  C CG   . ARG B 2 11 ? -1.563  10.777  -5.695  1.00 15.00 ?  213 ARG B CG   10 
ATOM 8118  C CD   . ARG B 2 11 ? -1.584  12.283  -5.493  1.00 15.00 ?  213 ARG B CD   10 
ATOM 8119  N NE   . ARG B 2 11 ? -2.936  12.774  -5.236  1.00 15.00 ?  213 ARG B NE   10 
ATOM 8120  C CZ   . ARG B 2 11 ? -3.224  13.801  -4.438  1.00 15.00 ?  213 ARG B CZ   10 
ATOM 8121  N NH1  . ARG B 2 11 ? -2.254  14.479  -3.832  1.00 15.00 1  213 ARG B NH1  10 
ATOM 8122  N NH2  . ARG B 2 11 ? -4.488  14.154  -4.252  1.00 15.00 ?  213 ARG B NH2  10 
ATOM 8123  H H    . ARG B 2 11 ? -3.279  8.840   -6.300  1.00 15.00 ?  213 ARG B H    10 
ATOM 8124  H HA   . ARG B 2 11 ? -1.119  8.070   -4.663  1.00 15.00 ?  213 ARG B HA   10 
ATOM 8125  H HB2  . ARG B 2 11 ? -2.882  10.453  -4.089  1.00 15.00 ?  213 ARG B HB2  10 
ATOM 8126  H HB3  . ARG B 2 11 ? -1.188  10.253  -3.685  1.00 15.00 ?  213 ARG B HB3  10 
ATOM 8127  H HG2  . ARG B 2 11 ? -0.576  10.476  -5.993  1.00 15.00 ?  213 ARG B HG2  10 
ATOM 8128  H HG3  . ARG B 2 11 ? -2.276  10.524  -6.453  1.00 15.00 ?  213 ARG B HG3  10 
ATOM 8129  H HD2  . ARG B 2 11 ? -0.954  12.531  -4.652  1.00 15.00 ?  213 ARG B HD2  10 
ATOM 8130  H HD3  . ARG B 2 11 ? -1.200  12.759  -6.383  1.00 15.00 ?  213 ARG B HD3  10 
ATOM 8131  H HE   . ARG B 2 11 ? -3.678  12.304  -5.684  1.00 15.00 ?  213 ARG B HE   10 
ATOM 8132  H HH11 . ARG B 2 11 ? -1.289  14.227  -3.972  1.00 15.00 ?  213 ARG B HH11 10 
ATOM 8133  H HH12 . ARG B 2 11 ? -2.485  15.245  -3.220  1.00 15.00 ?  213 ARG B HH12 10 
ATOM 8134  H HH21 . ARG B 2 11 ? -5.227  13.650  -4.712  1.00 15.00 ?  213 ARG B HH21 10 
ATOM 8135  H HH22 . ARG B 2 11 ? -4.713  14.921  -3.643  1.00 15.00 ?  213 ARG B HH22 10 
ATOM 8136  N N    . TYR B 2 12 ? -4.043  8.319   -3.174  1.00 15.00 ?  214 TYR B N    10 
ATOM 8137  C CA   . TYR B 2 12 ? -4.837  7.868   -2.049  1.00 15.00 ?  214 TYR B CA   10 
ATOM 8138  C C    . TYR B 2 12 ? -5.993  7.008   -2.542  1.00 15.00 ?  214 TYR B C    10 
ATOM 8139  O O    . TYR B 2 12 ? -7.109  7.490   -2.730  1.00 15.00 ?  214 TYR B O    10 
ATOM 8140  C CB   . TYR B 2 12 ? -5.306  9.084   -1.233  1.00 15.00 ?  214 TYR B CB   10 
ATOM 8141  C CG   . TYR B 2 12 ? -4.171  10.061  -0.983  1.00 15.00 ?  214 TYR B CG   10 
ATOM 8142  C CD1  . TYR B 2 12 ? -3.722  10.894  -2.002  1.00 15.00 ?  214 TYR B CD1  10 
ATOM 8143  C CD2  . TYR B 2 12 ? -3.513  10.111  0.239   1.00 15.00 ?  214 TYR B CD2  10 
ATOM 8144  C CE1  . TYR B 2 12 ? -2.656  11.744  -1.821  1.00 15.00 ?  214 TYR B CE1  10 
ATOM 8145  C CE2  . TYR B 2 12 ? -2.447  10.971  0.435   1.00 15.00 ?  214 TYR B CE2  10 
ATOM 8146  C CZ   . TYR B 2 12 ? -2.020  11.782  -0.597  1.00 15.00 ?  214 TYR B CZ   10 
ATOM 8147  O OH   . TYR B 2 12 ? -0.948  12.622  -0.402  1.00 15.00 ?  214 TYR B OH   10 
ATOM 8148  H H    . TYR B 2 12 ? -4.477  8.857   -3.877  1.00 15.00 ?  214 TYR B H    10 
ATOM 8149  H HA   . TYR B 2 12 ? -4.203  7.246   -1.426  1.00 15.00 ?  214 TYR B HA   10 
ATOM 8150  H HB2  . TYR B 2 12 ? -6.087  9.600   -1.775  1.00 15.00 ?  214 TYR B HB2  10 
ATOM 8151  H HB3  . TYR B 2 12 ? -5.685  8.754   -0.277  1.00 15.00 ?  214 TYR B HB3  10 
ATOM 8152  H HD1  . TYR B 2 12 ? -4.220  10.864  -2.963  1.00 15.00 ?  214 TYR B HD1  10 
ATOM 8153  H HD2  . TYR B 2 12 ? -3.848  9.475   1.045   1.00 15.00 ?  214 TYR B HD2  10 
ATOM 8154  H HE1  . TYR B 2 12 ? -2.320  12.365  -2.651  1.00 15.00 ?  214 TYR B HE1  10 
ATOM 8155  H HE2  . TYR B 2 12 ? -1.946  11.000  1.391   1.00 15.00 ?  214 TYR B HE2  10 
ATOM 8156  H HH   . TYR B 2 12 ? -0.249  12.137  0.064   1.00 15.00 ?  214 TYR B HH   10 
ATOM 8157  N N    . PRO B 2 13 ? -5.714  5.731   -2.821  1.00 15.00 ?  215 PRO B N    10 
ATOM 8158  C CA   . PRO B 2 13 ? -6.702  4.806   -3.365  1.00 15.00 ?  215 PRO B CA   10 
ATOM 8159  C C    . PRO B 2 13 ? -7.649  4.280   -2.292  1.00 15.00 ?  215 PRO B C    10 
ATOM 8160  O O    . PRO B 2 13 ? -7.220  3.653   -1.325  1.00 15.00 ?  215 PRO B O    10 
ATOM 8161  C CB   . PRO B 2 13 ? -5.842  3.680   -3.943  1.00 15.00 ?  215 PRO B CB   10 
ATOM 8162  C CG   . PRO B 2 13 ? -4.585  3.689   -3.132  1.00 15.00 ?  215 PRO B CG   10 
ATOM 8163  C CD   . PRO B 2 13 ? -4.399  5.091   -2.626  1.00 15.00 ?  215 PRO B CD   10 
ATOM 8164  H HA   . PRO B 2 13 ? -7.277  5.267   -4.156  1.00 15.00 ?  215 PRO B HA   10 
ATOM 8165  H HB2  . PRO B 2 13 ? -6.368  2.741   -3.847  1.00 15.00 ?  215 PRO B HB2  10 
ATOM 8166  H HB3  . PRO B 2 13 ? -5.640  3.880   -4.986  1.00 15.00 ?  215 PRO B HB3  10 
ATOM 8167  H HG2  . PRO B 2 13 ? -4.682  3.008   -2.300  1.00 15.00 ?  215 PRO B HG2  10 
ATOM 8168  H HG3  . PRO B 2 13 ? -3.746  3.403   -3.750  1.00 15.00 ?  215 PRO B HG3  10 
ATOM 8169  H HD2  . PRO B 2 13 ? -4.131  5.079   -1.580  1.00 15.00 ?  215 PRO B HD2  10 
ATOM 8170  H HD3  . PRO B 2 13 ? -3.638  5.597   -3.202  1.00 15.00 ?  215 PRO B HD3  10 
ATOM 8171  N N    . MET B 2 14 ? -8.937  4.543   -2.459  1.00 15.00 ?  216 MET B N    10 
ATOM 8172  C CA   . MET B 2 14 ? -9.930  4.130   -1.477  1.00 15.00 ?  216 MET B CA   10 
ATOM 8173  C C    . MET B 2 14 ? -10.682 2.895   -1.951  1.00 15.00 ?  216 MET B C    10 
ATOM 8174  O O    . MET B 2 14 ? -11.563 2.994   -2.806  1.00 15.00 ?  216 MET B O    10 
ATOM 8175  C CB   . MET B 2 14 ? -10.917 5.263   -1.185  1.00 15.00 ?  216 MET B CB   10 
ATOM 8176  C CG   . MET B 2 14 ? -10.283 6.462   -0.500  1.00 15.00 ?  216 MET B CG   10 
ATOM 8177  S SD   . MET B 2 14 ? -11.469 7.773   -0.141  1.00 15.00 ?  216 MET B SD   10 
ATOM 8178  C CE   . MET B 2 14 ? -11.919 8.294   -1.795  1.00 15.00 ?  216 MET B CE   10 
ATOM 8179  H H    . MET B 2 14 ? -9.229  5.018   -3.266  1.00 15.00 ?  216 MET B H    10 
ATOM 8180  H HA   . MET B 2 14 ? -9.405  3.882   -0.566  1.00 15.00 ?  216 MET B HA   10 
ATOM 8181  H HB2  . MET B 2 14 ? -11.351 5.596   -2.116  1.00 15.00 ?  216 MET B HB2  10 
ATOM 8182  H HB3  . MET B 2 14 ? -11.703 4.885   -0.547  1.00 15.00 ?  216 MET B HB3  10 
ATOM 8183  H HG2  . MET B 2 14 ? -9.842  6.135   0.430   1.00 15.00 ?  216 MET B HG2  10 
ATOM 8184  H HG3  . MET B 2 14 ? -9.511  6.861   -1.143  1.00 15.00 ?  216 MET B HG3  10 
ATOM 8185  H HE1  . MET B 2 14 ? -12.637 9.098   -1.737  1.00 15.00 ?  216 MET B HE1  10 
ATOM 8186  H HE2  . MET B 2 14 ? -12.353 7.461   -2.330  1.00 15.00 ?  216 MET B HE2  10 
ATOM 8187  H HE3  . MET B 2 14 ? -11.036 8.635   -2.318  1.00 15.00 ?  216 MET B HE3  10 
ATOM 8188  N N    . ASP B 2 15 ? -10.290 1.745   -1.406  1.00 15.00 ?  217 ASP B N    10 
ATOM 8189  C CA   . ASP B 2 15 ? -10.932 0.454   -1.688  1.00 15.00 ?  217 ASP B CA   10 
ATOM 8190  C C    . ASP B 2 15 ? -11.164 0.227   -3.177  1.00 15.00 ?  217 ASP B C    10 
ATOM 8191  O O    . ASP B 2 15 ? -10.202 -0.149  -3.874  1.00 15.00 ?  217 ASP B O    10 
ATOM 8192  C CB   . ASP B 2 15 ? -12.250 0.322   -0.920  1.00 15.00 ?  217 ASP B CB   10 
ATOM 8193  C CG   . ASP B 2 15 ? -12.027 -0.003  0.543   1.00 15.00 ?  217 ASP B CG   10 
ATOM 8194  O OD1  . ASP B 2 15 ? -11.811 -1.193  0.860   1.00 15.00 ?  217 ASP B OD1  10 
ATOM 8195  O OD2  . ASP B 2 15 ? -12.062 0.927   1.380   1.00 15.00 -1 217 ASP B OD2  10 
ATOM 8196  O OXT  . ASP B 2 15 ? -12.312 0.400   -3.639  1.00 15.00 ?  217 ASP B OXT  10 
ATOM 8197  H H    . ASP B 2 15 ? -9.535  1.759   -0.784  1.00 15.00 ?  217 ASP B H    10 
ATOM 8198  H HA   . ASP B 2 15 ? -10.259 -0.313  -1.336  1.00 15.00 ?  217 ASP B HA   10 
ATOM 8199  H HB2  . ASP B 2 15 ? -12.793 1.252   -0.986  1.00 15.00 ?  217 ASP B HB2  10 
ATOM 8200  H HB3  . ASP B 2 15 ? -12.840 -0.468  -1.362  1.00 15.00 ?  217 ASP B HB3  10 
ATOM 8201  N N    . GLY A 1 1  ? 4.653   2.791   15.381  1.00 15.00 ?  297 GLY A N    11 
ATOM 8202  C CA   . GLY A 1 1  ? 5.168   2.496   14.021  1.00 15.00 ?  297 GLY A CA   11 
ATOM 8203  C C    . GLY A 1 1  ? 5.151   3.723   13.134  1.00 15.00 ?  297 GLY A C    11 
ATOM 8204  O O    . GLY A 1 1  ? 4.116   4.059   12.559  1.00 15.00 ?  297 GLY A O    11 
ATOM 8205  H H1   . GLY A 1 1  ? 5.218   3.550   15.820  1.00 15.00 ?  297 GLY A H1   11 
ATOM 8206  H H2   . GLY A 1 1  ? 4.708   1.939   15.978  1.00 15.00 ?  297 GLY A H2   11 
ATOM 8207  H H3   . GLY A 1 1  ? 3.658   3.104   15.328  1.00 15.00 ?  297 GLY A H3   11 
ATOM 8208  H HA2  . GLY A 1 1  ? 6.182   2.134   14.101  1.00 15.00 ?  297 GLY A HA2  11 
ATOM 8209  H HA3  . GLY A 1 1  ? 4.554   1.729   13.572  1.00 15.00 ?  297 GLY A HA3  11 
ATOM 8210  N N    . PRO A 1 2  ? 6.292   4.417   13.007  1.00 15.00 ?  298 PRO A N    11 
ATOM 8211  C CA   . PRO A 1 2  ? 6.388   5.648   12.220  1.00 15.00 ?  298 PRO A CA   11 
ATOM 8212  C C    . PRO A 1 2  ? 6.261   5.383   10.711  1.00 15.00 ?  298 PRO A C    11 
ATOM 8213  O O    . PRO A 1 2  ? 7.026   4.591   10.157  1.00 15.00 ?  298 PRO A O    11 
ATOM 8214  C CB   . PRO A 1 2  ? 7.794   6.183   12.541  1.00 15.00 ?  298 PRO A CB   11 
ATOM 8215  C CG   . PRO A 1 2  ? 8.261   5.396   13.718  1.00 15.00 ?  298 PRO A CG   11 
ATOM 8216  C CD   . PRO A 1 2  ? 7.577   4.067   13.618  1.00 15.00 ?  298 PRO A CD   11 
ATOM 8217  H HA   . PRO A 1 2  ? 5.651   6.369   12.539  1.00 15.00 ?  298 PRO A HA   11 
ATOM 8218  H HB2  . PRO A 1 2  ? 8.438   6.036   11.688  1.00 15.00 ?  298 PRO A HB2  11 
ATOM 8219  H HB3  . PRO A 1 2  ? 7.733   7.237   12.774  1.00 15.00 ?  298 PRO A HB3  11 
ATOM 8220  H HG2  . PRO A 1 2  ? 9.333   5.270   13.676  1.00 15.00 ?  298 PRO A HG2  11 
ATOM 8221  H HG3  . PRO A 1 2  ? 7.975   5.895   14.631  1.00 15.00 ?  298 PRO A HG3  11 
ATOM 8222  H HD2  . PRO A 1 2  ? 8.140   3.396   12.983  1.00 15.00 ?  298 PRO A HD2  11 
ATOM 8223  H HD3  . PRO A 1 2  ? 7.436   3.636   14.598  1.00 15.00 ?  298 PRO A HD3  11 
ATOM 8224  N N    . LEU A 1 3  ? 5.292   6.022   10.052  1.00 15.00 ?  299 LEU A N    11 
ATOM 8225  C CA   . LEU A 1 3  ? 5.145   5.905   8.609   1.00 15.00 ?  299 LEU A CA   11 
ATOM 8226  C C    . LEU A 1 3  ? 6.140   6.831   7.915   1.00 15.00 ?  299 LEU A C    11 
ATOM 8227  O O    . LEU A 1 3  ? 6.208   8.017   8.238   1.00 15.00 ?  299 LEU A O    11 
ATOM 8228  C CB   . LEU A 1 3  ? 3.718   6.280   8.197   1.00 15.00 ?  299 LEU A CB   11 
ATOM 8229  C CG   . LEU A 1 3  ? 3.425   6.197   6.698   1.00 15.00 ?  299 LEU A CG   11 
ATOM 8230  C CD1  . LEU A 1 3  ? 3.305   4.748   6.253   1.00 15.00 ?  299 LEU A CD1  11 
ATOM 8231  C CD2  . LEU A 1 3  ? 2.162   6.972   6.364   1.00 15.00 ?  299 LEU A CD2  11 
ATOM 8232  H H    . LEU A 1 3  ? 4.657   6.584   10.540  1.00 15.00 ?  299 LEU A H    11 
ATOM 8233  H HA   . LEU A 1 3  ? 5.345   4.883   8.327   1.00 15.00 ?  299 LEU A HA   11 
ATOM 8234  H HB2  . LEU A 1 3  ? 3.034   5.621   8.712   1.00 15.00 ?  299 LEU A HB2  11 
ATOM 8235  H HB3  . LEU A 1 3  ? 3.528   7.292   8.521   1.00 15.00 ?  299 LEU A HB3  11 
ATOM 8236  H HG   . LEU A 1 3  ? 4.245   6.644   6.154   1.00 15.00 ?  299 LEU A HG   11 
ATOM 8237  H HD11 . LEU A 1 3  ? 2.474   4.284   6.761   1.00 15.00 ?  299 LEU A HD11 11 
ATOM 8238  H HD12 . LEU A 1 3  ? 4.215   4.221   6.496   1.00 15.00 ?  299 LEU A HD12 11 
ATOM 8239  H HD13 . LEU A 1 3  ? 3.141   4.711   5.186   1.00 15.00 ?  299 LEU A HD13 11 
ATOM 8240  H HD21 . LEU A 1 3  ? 1.330   6.557   6.912   1.00 15.00 ?  299 LEU A HD21 11 
ATOM 8241  H HD22 . LEU A 1 3  ? 1.967   6.900   5.304   1.00 15.00 ?  299 LEU A HD22 11 
ATOM 8242  H HD23 . LEU A 1 3  ? 2.293   8.009   6.637   1.00 15.00 ?  299 LEU A HD23 11 
ATOM 8243  N N    . PRO A 1 4  ? 6.914   6.320   6.945   1.00 15.00 ?  300 PRO A N    11 
ATOM 8244  C CA   . PRO A 1 4  ? 7.893   7.134   6.217   1.00 15.00 ?  300 PRO A CA   11 
ATOM 8245  C C    . PRO A 1 4  ? 7.206   8.163   5.313   1.00 15.00 ?  300 PRO A C    11 
ATOM 8246  O O    . PRO A 1 4  ? 6.158   7.879   4.734   1.00 15.00 ?  300 PRO A O    11 
ATOM 8247  C CB   . PRO A 1 4  ? 8.665   6.111   5.373   1.00 15.00 ?  300 PRO A CB   11 
ATOM 8248  C CG   . PRO A 1 4  ? 8.281   4.771   5.909   1.00 15.00 ?  300 PRO A CG   11 
ATOM 8249  C CD   . PRO A 1 4  ? 6.897   4.930   6.456   1.00 15.00 ?  300 PRO A CD   11 
ATOM 8250  H HA   . PRO A 1 4  ? 8.569   7.640   6.891   1.00 15.00 ?  300 PRO A HA   11 
ATOM 8251  H HB2  . PRO A 1 4  ? 8.380   6.218   4.341   1.00 15.00 ?  300 PRO A HB2  11 
ATOM 8252  H HB3  . PRO A 1 4  ? 9.727   6.286   5.475   1.00 15.00 ?  300 PRO A HB3  11 
ATOM 8253  H HG2  . PRO A 1 4  ? 8.287   4.037   5.115   1.00 15.00 ?  300 PRO A HG2  11 
ATOM 8254  H HG3  . PRO A 1 4  ? 8.963   4.481   6.695   1.00 15.00 ?  300 PRO A HG3  11 
ATOM 8255  H HD2  . PRO A 1 4  ? 6.164   4.804   5.669   1.00 15.00 ?  300 PRO A HD2  11 
ATOM 8256  H HD3  . PRO A 1 4  ? 6.718   4.226   7.258   1.00 15.00 ?  300 PRO A HD3  11 
ATOM 8257  N N    . PRO A 1 5  ? 7.802   9.359   5.159   1.00 15.00 ?  301 PRO A N    11 
ATOM 8258  C CA   . PRO A 1 5  ? 7.191   10.464  4.397   1.00 15.00 ?  301 PRO A CA   11 
ATOM 8259  C C    . PRO A 1 5  ? 7.057   10.178  2.898   1.00 15.00 ?  301 PRO A C    11 
ATOM 8260  O O    . PRO A 1 5  ? 6.301   10.852  2.196   1.00 15.00 ?  301 PRO A O    11 
ATOM 8261  C CB   . PRO A 1 5  ? 8.152   11.634  4.630   1.00 15.00 ?  301 PRO A CB   11 
ATOM 8262  C CG   . PRO A 1 5  ? 9.455   10.997  4.975   1.00 15.00 ?  301 PRO A CG   11 
ATOM 8263  C CD   . PRO A 1 5  ? 9.113   9.737   5.719   1.00 15.00 ?  301 PRO A CD   11 
ATOM 8264  H HA   . PRO A 1 5  ? 6.220   10.719  4.793   1.00 15.00 ?  301 PRO A HA   11 
ATOM 8265  H HB2  . PRO A 1 5  ? 8.227   12.226  3.729   1.00 15.00 ?  301 PRO A HB2  11 
ATOM 8266  H HB3  . PRO A 1 5  ? 7.787   12.246  5.441   1.00 15.00 ?  301 PRO A HB3  11 
ATOM 8267  H HG2  . PRO A 1 5  ? 9.998   10.763  4.071   1.00 15.00 ?  301 PRO A HG2  11 
ATOM 8268  H HG3  . PRO A 1 5  ? 10.033  11.659  5.602   1.00 15.00 ?  301 PRO A HG3  11 
ATOM 8269  H HD2  . PRO A 1 5  ? 9.850   8.971   5.524   1.00 15.00 ?  301 PRO A HD2  11 
ATOM 8270  H HD3  . PRO A 1 5  ? 9.038   9.931   6.779   1.00 15.00 ?  301 PRO A HD3  11 
ATOM 8271  N N    . GLY A 1 6  ? 7.812   9.205   2.411   1.00 15.00 ?  302 GLY A N    11 
ATOM 8272  C CA   . GLY A 1 6  ? 7.725   8.822   1.013   1.00 15.00 ?  302 GLY A CA   11 
ATOM 8273  C C    . GLY A 1 6  ? 6.680   7.752   0.788   1.00 15.00 ?  302 GLY A C    11 
ATOM 8274  O O    . GLY A 1 6  ? 6.271   7.489   -0.347  1.00 15.00 ?  302 GLY A O    11 
ATOM 8275  H H    . GLY A 1 6  ? 8.446   8.747   3.003   1.00 15.00 ?  302 GLY A H    11 
ATOM 8276  H HA2  . GLY A 1 6  ? 7.472   9.693   0.426   1.00 15.00 ?  302 GLY A HA2  11 
ATOM 8277  H HA3  . GLY A 1 6  ? 8.685   8.448   0.691   1.00 15.00 ?  302 GLY A HA3  11 
ATOM 8278  N N    . TRP A 1 7  ? 6.254   7.139   1.881   1.00 15.00 ?  303 TRP A N    11 
ATOM 8279  C CA   . TRP A 1 7  ? 5.342   6.010   1.834   1.00 15.00 ?  303 TRP A CA   11 
ATOM 8280  C C    . TRP A 1 7  ? 3.903   6.438   2.069   1.00 15.00 ?  303 TRP A C    11 
ATOM 8281  O O    . TRP A 1 7  ? 3.637   7.387   2.811   1.00 15.00 ?  303 TRP A O    11 
ATOM 8282  C CB   . TRP A 1 7  ? 5.743   4.982   2.872   1.00 15.00 ?  303 TRP A CB   11 
ATOM 8283  C CG   . TRP A 1 7  ? 6.814   4.068   2.394   1.00 15.00 ?  303 TRP A CG   11 
ATOM 8284  C CD1  . TRP A 1 7  ? 8.159   4.300   2.379   1.00 15.00 ?  303 TRP A CD1  11 
ATOM 8285  C CD2  . TRP A 1 7  ? 6.622   2.769   1.847   1.00 15.00 ?  303 TRP A CD2  11 
ATOM 8286  N NE1  . TRP A 1 7  ? 8.812   3.209   1.876   1.00 15.00 ?  303 TRP A NE1  11 
ATOM 8287  C CE2  . TRP A 1 7  ? 7.886   2.259   1.544   1.00 15.00 ?  303 TRP A CE2  11 
ATOM 8288  C CE3  . TRP A 1 7  ? 5.502   1.976   1.589   1.00 15.00 ?  303 TRP A CE3  11 
ATOM 8289  C CZ2  . TRP A 1 7  ? 8.059   1.003   1.005   1.00 15.00 ?  303 TRP A CZ2  11 
ATOM 8290  C CZ3  . TRP A 1 7  ? 5.687   0.727   1.049   1.00 15.00 ?  303 TRP A CZ3  11 
ATOM 8291  C CH2  . TRP A 1 7  ? 6.958   0.249   0.764   1.00 15.00 ?  303 TRP A CH2  11 
ATOM 8292  H H    . TRP A 1 7  ? 6.543   7.474   2.754   1.00 15.00 ?  303 TRP A H    11 
ATOM 8293  H HA   . TRP A 1 7  ? 5.427   5.567   0.853   1.00 15.00 ?  303 TRP A HA   11 
ATOM 8294  H HB2  . TRP A 1 7  ? 6.103   5.489   3.756   1.00 15.00 ?  303 TRP A HB2  11 
ATOM 8295  H HB3  . TRP A 1 7  ? 4.883   4.383   3.130   1.00 15.00 ?  303 TRP A HB3  11 
ATOM 8296  H HD1  . TRP A 1 7  ? 8.626   5.207   2.721   1.00 15.00 ?  303 TRP A HD1  11 
ATOM 8297  H HE1  . TRP A 1 7  ? 9.787   3.126   1.765   1.00 15.00 ?  303 TRP A HE1  11 
ATOM 8298  H HE3  . TRP A 1 7  ? 4.503   2.324   1.792   1.00 15.00 ?  303 TRP A HE3  11 
ATOM 8299  H HZ2  . TRP A 1 7  ? 9.020   0.632   0.774   1.00 15.00 ?  303 TRP A HZ2  11 
ATOM 8300  H HZ3  . TRP A 1 7  ? 4.838   0.111   0.829   1.00 15.00 ?  303 TRP A HZ3  11 
ATOM 8301  H HH2  . TRP A 1 7  ? 7.056   -0.742  0.353   1.00 15.00 ?  303 TRP A HH2  11 
ATOM 8302  N N    . GLU A 1 8  ? 2.978   5.697   1.476   1.00 15.00 ?  304 GLU A N    11 
ATOM 8303  C CA   . GLU A 1 8  ? 1.561   6.076   1.514   1.00 15.00 ?  304 GLU A CA   11 
ATOM 8304  C C    . GLU A 1 8  ? 0.679   4.890   1.902   1.00 15.00 ?  304 GLU A C    11 
ATOM 8305  O O    . GLU A 1 8  ? 0.418   4.011   1.095   1.00 15.00 ?  304 GLU A O    11 
ATOM 8306  C CB   . GLU A 1 8  ? 1.154   6.650   0.152   1.00 15.00 ?  304 GLU A CB   11 
ATOM 8307  C CG   . GLU A 1 8  ? 1.699   8.044   -0.091  1.00 15.00 ?  304 GLU A CG   11 
ATOM 8308  C CD   . GLU A 1 8  ? 0.834   9.135   0.513   1.00 15.00 ?  304 GLU A CD   11 
ATOM 8309  O OE1  . GLU A 1 8  ? 0.941   9.391   1.728   1.00 15.00 ?  304 GLU A OE1  11 
ATOM 8310  O OE2  . GLU A 1 8  ? 0.059   9.760   -0.243  1.00 15.00 -1 304 GLU A OE2  11 
ATOM 8311  H H    . GLU A 1 8  ? 3.255   4.861   1.007   1.00 15.00 ?  304 GLU A H    11 
ATOM 8312  H HA   . GLU A 1 8  ? 1.449   6.846   2.263   1.00 15.00 ?  304 GLU A HA   11 
ATOM 8313  H HB2  . GLU A 1 8  ? 1.534   6.000   -0.623  1.00 15.00 ?  304 GLU A HB2  11 
ATOM 8314  H HB3  . GLU A 1 8  ? 0.082   6.688   0.077   1.00 15.00 ?  304 GLU A HB3  11 
ATOM 8315  H HG2  . GLU A 1 8  ? 2.685   8.109   0.342   1.00 15.00 ?  304 GLU A HG2  11 
ATOM 8316  H HG3  . GLU A 1 8  ? 1.766   8.208   -1.157  1.00 15.00 ?  304 GLU A HG3  11 
ATOM 8317  N N    . ILE A 1 9  ? 0.218   4.870   3.144   1.00 15.00 ?  305 ILE A N    11 
ATOM 8318  C CA   . ILE A 1 9  ? -0.478  3.702   3.676   1.00 15.00 ?  305 ILE A CA   11 
ATOM 8319  C C    . ILE A 1 9  ? -1.993  3.766   3.441   1.00 15.00 ?  305 ILE A C    11 
ATOM 8320  O O    . ILE A 1 9  ? -2.663  4.705   3.870   1.00 15.00 ?  305 ILE A O    11 
ATOM 8321  C CB   . ILE A 1 9  ? -0.199  3.523   5.191   1.00 15.00 ?  305 ILE A CB   11 
ATOM 8322  C CG1  . ILE A 1 9  ? -0.971  2.322   5.748   1.00 15.00 ?  305 ILE A CG1  11 
ATOM 8323  C CG2  . ILE A 1 9  ? -0.549  4.789   5.964   1.00 15.00 ?  305 ILE A CG2  11 
ATOM 8324  C CD1  . ILE A 1 9  ? -0.704  2.053   7.214   1.00 15.00 ?  305 ILE A CD1  11 
ATOM 8325  H H    . ILE A 1 9  ? 0.338   5.659   3.713   1.00 15.00 ?  305 ILE A H    11 
ATOM 8326  H HA   . ILE A 1 9  ? -0.086  2.835   3.165   1.00 15.00 ?  305 ILE A HA   11 
ATOM 8327  H HB   . ILE A 1 9  ? 0.859   3.343   5.313   1.00 15.00 ?  305 ILE A HB   11 
ATOM 8328  H HG12 . ILE A 1 9  ? -2.030  2.500   5.633   1.00 15.00 ?  305 ILE A HG12 11 
ATOM 8329  H HG13 . ILE A 1 9  ? -0.699  1.436   5.191   1.00 15.00 ?  305 ILE A HG13 11 
ATOM 8330  H HG21 . ILE A 1 9  ? -0.346  4.634   7.014   1.00 15.00 ?  305 ILE A HG21 11 
ATOM 8331  H HG22 . ILE A 1 9  ? -1.595  5.016   5.828   1.00 15.00 ?  305 ILE A HG22 11 
ATOM 8332  H HG23 . ILE A 1 9  ? 0.049   5.611   5.599   1.00 15.00 ?  305 ILE A HG23 11 
ATOM 8333  H HD11 . ILE A 1 9  ? 0.353   1.876   7.362   1.00 15.00 ?  305 ILE A HD11 11 
ATOM 8334  H HD12 . ILE A 1 9  ? -1.262  1.183   7.528   1.00 15.00 ?  305 ILE A HD12 11 
ATOM 8335  H HD13 . ILE A 1 9  ? -1.010  2.908   7.799   1.00 15.00 ?  305 ILE A HD13 11 
ATOM 8336  N N    . ARG A 1 10 ? -2.529  2.765   2.740   1.00 15.00 ?  306 ARG A N    11 
ATOM 8337  C CA   . ARG A 1 10 ? -3.970  2.617   2.605   1.00 15.00 ?  306 ARG A CA   11 
ATOM 8338  C C    . ARG A 1 10 ? -4.350  1.145   2.748   1.00 15.00 ?  306 ARG A C    11 
ATOM 8339  O O    . ARG A 1 10 ? -3.582  0.252   2.378   1.00 15.00 ?  306 ARG A O    11 
ATOM 8340  C CB   . ARG A 1 10 ? -4.474  3.162   1.262   1.00 15.00 ?  306 ARG A CB   11 
ATOM 8341  C CG   . ARG A 1 10 ? -4.056  4.594   0.968   1.00 15.00 ?  306 ARG A CG   11 
ATOM 8342  C CD   . ARG A 1 10 ? -5.076  5.318   0.112   1.00 15.00 ?  306 ARG A CD   11 
ATOM 8343  N NE   . ARG A 1 10 ? -6.401  5.358   0.725   1.00 15.00 ?  306 ARG A NE   11 
ATOM 8344  C CZ   . ARG A 1 10 ? -6.979  6.475   1.168   1.00 15.00 ?  306 ARG A CZ   11 
ATOM 8345  N NH1  . ARG A 1 10 ? -6.312  7.623   1.145   1.00 15.00 1  306 ARG A NH1  11 
ATOM 8346  N NH2  . ARG A 1 10 ? -8.218  6.445   1.647   1.00 15.00 ?  306 ARG A NH2  11 
ATOM 8347  H H    . ARG A 1 10 ? -1.941  2.112   2.299   1.00 15.00 ?  306 ARG A H    11 
ATOM 8348  H HA   . ARG A 1 10 ? -4.434  3.173   3.407   1.00 15.00 ?  306 ARG A HA   11 
ATOM 8349  H HB2  . ARG A 1 10 ? -4.096  2.534   0.470   1.00 15.00 ?  306 ARG A HB2  11 
ATOM 8350  H HB3  . ARG A 1 10 ? -5.554  3.118   1.256   1.00 15.00 ?  306 ARG A HB3  11 
ATOM 8351  H HG2  . ARG A 1 10 ? -3.934  5.127   1.898   1.00 15.00 ?  306 ARG A HG2  11 
ATOM 8352  H HG3  . ARG A 1 10 ? -3.118  4.577   0.431   1.00 15.00 ?  306 ARG A HG3  11 
ATOM 8353  H HD2  . ARG A 1 10 ? -4.737  6.329   -0.047  1.00 15.00 ?  306 ARG A HD2  11 
ATOM 8354  H HD3  . ARG A 1 10 ? -5.146  4.810   -0.839  1.00 15.00 ?  306 ARG A HD3  11 
ATOM 8355  H HE   . ARG A 1 10 ? -6.898  4.513   0.772   1.00 15.00 ?  306 ARG A HE   11 
ATOM 8356  H HH11 . ARG A 1 10 ? -5.375  7.654   0.799   1.00 15.00 ?  306 ARG A HH11 11 
ATOM 8357  H HH12 . ARG A 1 10 ? -6.755  8.476   1.466   1.00 15.00 ?  306 ARG A HH12 11 
ATOM 8358  H HH21 . ARG A 1 10 ? -8.728  5.584   1.677   1.00 15.00 ?  306 ARG A HH21 11 
ATOM 8359  H HH22 . ARG A 1 10 ? -8.651  7.289   1.977   1.00 15.00 ?  306 ARG A HH22 11 
ATOM 8360  N N    . ASN A 1 11 ? -5.542  0.892   3.267   1.00 15.00 ?  307 ASN A N    11 
ATOM 8361  C CA   . ASN A 1 11 ? -5.990  -0.472  3.517   1.00 15.00 ?  307 ASN A CA   11 
ATOM 8362  C C    . ASN A 1 11 ? -7.289  -0.748  2.748   1.00 15.00 ?  307 ASN A C    11 
ATOM 8363  O O    . ASN A 1 11 ? -8.203  0.079   2.763   1.00 15.00 ?  307 ASN A O    11 
ATOM 8364  C CB   . ASN A 1 11 ? -6.211  -0.666  5.026   1.00 15.00 ?  307 ASN A CB   11 
ATOM 8365  C CG   . ASN A 1 11 ? -6.330  -2.126  5.441   1.00 15.00 ?  307 ASN A CG   11 
ATOM 8366  O OD1  . ASN A 1 11 ? -6.791  -2.977  4.684   1.00 15.00 ?  307 ASN A OD1  11 
ATOM 8367  N ND2  . ASN A 1 11 ? -5.906  -2.428  6.659   1.00 15.00 ?  307 ASN A ND2  11 
ATOM 8368  H H    . ASN A 1 11 ? -6.142  1.636   3.477   1.00 15.00 ?  307 ASN A H    11 
ATOM 8369  H HA   . ASN A 1 11 ? -5.213  -1.141  3.182   1.00 15.00 ?  307 ASN A HA   11 
ATOM 8370  H HB2  . ASN A 1 11 ? -5.382  -0.231  5.561   1.00 15.00 ?  307 ASN A HB2  11 
ATOM 8371  H HB3  . ASN A 1 11 ? -7.120  -0.158  5.312   1.00 15.00 ?  307 ASN A HB3  11 
ATOM 8372  H HD21 . ASN A 1 11 ? -5.543  -1.703  7.220   1.00 15.00 ?  307 ASN A HD21 11 
ATOM 8373  H HD22 . ASN A 1 11 ? -5.973  -3.357  6.953   1.00 15.00 ?  307 ASN A HD22 11 
ATOM 8374  N N    . THR A 1 12 ? -7.382  -1.910  2.101   1.00 15.00 ?  308 THR A N    11 
ATOM 8375  C CA   . THR A 1 12 ? -8.575  -2.280  1.353   1.00 15.00 ?  308 THR A CA   11 
ATOM 8376  C C    . THR A 1 12 ? -9.550  -3.018  2.261   1.00 15.00 ?  308 THR A C    11 
ATOM 8377  O O    . THR A 1 12 ? -9.130  -3.709  3.196   1.00 15.00 ?  308 THR A O    11 
ATOM 8378  C CB   . THR A 1 12 ? -8.243  -3.177  0.142   1.00 15.00 ?  308 THR A CB   11 
ATOM 8379  O OG1  . THR A 1 12 ? -7.268  -4.162  0.509   1.00 15.00 ?  308 THR A OG1  11 
ATOM 8380  C CG2  . THR A 1 12 ? -7.738  -2.363  -1.040  1.00 15.00 ?  308 THR A CG2  11 
ATOM 8381  H H    . THR A 1 12 ? -6.640  -2.550  2.149   1.00 15.00 ?  308 THR A H    11 
ATOM 8382  H HA   . THR A 1 12 ? -9.042  -1.374  0.994   1.00 15.00 ?  308 THR A HA   11 
ATOM 8383  H HB   . THR A 1 12 ? -9.148  -3.685  -0.157  1.00 15.00 ?  308 THR A HB   11 
ATOM 8384  H HG1  . THR A 1 12 ? -6.439  -3.722  0.736   1.00 15.00 ?  308 THR A HG1  11 
ATOM 8385  H HG21 . THR A 1 12 ? -8.430  -1.561  -1.250  1.00 15.00 ?  308 THR A HG21 11 
ATOM 8386  H HG22 . THR A 1 12 ? -7.659  -3.002  -1.908  1.00 15.00 ?  308 THR A HG22 11 
ATOM 8387  H HG23 . THR A 1 12 ? -6.768  -1.953  -0.809  1.00 15.00 ?  308 THR A HG23 11 
ATOM 8388  N N    . ALA A 1 13 ? -10.843 -2.882  1.967   1.00 15.00 ?  309 ALA A N    11 
ATOM 8389  C CA   . ALA A 1 13 ? -11.908 -3.422  2.814   1.00 15.00 ?  309 ALA A CA   11 
ATOM 8390  C C    . ALA A 1 13 ? -11.848 -4.945  2.931   1.00 15.00 ?  309 ALA A C    11 
ATOM 8391  O O    . ALA A 1 13 ? -12.497 -5.531  3.797   1.00 15.00 ?  309 ALA A O    11 
ATOM 8392  C CB   . ALA A 1 13 ? -13.268 -2.988  2.284   1.00 15.00 ?  309 ALA A CB   11 
ATOM 8393  H H    . ALA A 1 13 ? -11.092 -2.401  1.137   1.00 15.00 ?  309 ALA A H    11 
ATOM 8394  H HA   . ALA A 1 13 ? -11.788 -2.998  3.799   1.00 15.00 ?  309 ALA A HA   11 
ATOM 8395  H HB1  . ALA A 1 13 ? -14.040 -3.319  2.961   1.00 15.00 ?  309 ALA A HB1  11 
ATOM 8396  H HB2  . ALA A 1 13 ? -13.430 -3.424  1.309   1.00 15.00 ?  309 ALA A HB2  11 
ATOM 8397  H HB3  . ALA A 1 13 ? -13.294 -1.911  2.205   1.00 15.00 ?  309 ALA A HB3  11 
ATOM 8398  N N    . THR A 1 14 ? -11.084 -5.587  2.054   1.00 15.00 ?  310 THR A N    11 
ATOM 8399  C CA   . THR A 1 14 ? -10.884 -7.027  2.136   1.00 15.00 ?  310 THR A CA   11 
ATOM 8400  C C    . THR A 1 14 ? -9.901  -7.374  3.264   1.00 15.00 ?  310 THR A C    11 
ATOM 8401  O O    . THR A 1 14 ? -9.814  -8.522  3.701   1.00 15.00 ?  310 THR A O    11 
ATOM 8402  C CB   . THR A 1 14 ? -10.362 -7.584  0.793   1.00 15.00 ?  310 THR A CB   11 
ATOM 8403  O OG1  . THR A 1 14 ? -11.191 -7.117  -0.279  1.00 15.00 ?  310 THR A OG1  11 
ATOM 8404  C CG2  . THR A 1 14 ? -10.355 -9.107  0.795   1.00 15.00 ?  310 THR A CG2  11 
ATOM 8405  H H    . THR A 1 14 ? -10.657 -5.082  1.329   1.00 15.00 ?  310 THR A H    11 
ATOM 8406  H HA   . THR A 1 14 ? -11.839 -7.485  2.349   1.00 15.00 ?  310 THR A HA   11 
ATOM 8407  H HB   . THR A 1 14 ? -9.351  -7.233  0.640   1.00 15.00 ?  310 THR A HB   11 
ATOM 8408  H HG1  . THR A 1 14 ? -12.073 -6.904  0.064   1.00 15.00 ?  310 THR A HG1  11 
ATOM 8409  H HG21 . THR A 1 14 ? -9.979  -9.465  -0.153  1.00 15.00 ?  310 THR A HG21 11 
ATOM 8410  H HG22 . THR A 1 14 ? -11.360 -9.470  0.943   1.00 15.00 ?  310 THR A HG22 11 
ATOM 8411  H HG23 . THR A 1 14 ? -9.721  -9.463  1.592   1.00 15.00 ?  310 THR A HG23 11 
ATOM 8412  N N    . GLY A 1 15 ? -9.179  -6.367  3.746   1.00 15.00 ?  311 GLY A N    11 
ATOM 8413  C CA   . GLY A 1 15 ? -8.212  -6.584  4.804   1.00 15.00 ?  311 GLY A CA   11 
ATOM 8414  C C    . GLY A 1 15 ? -6.803  -6.727  4.270   1.00 15.00 ?  311 GLY A C    11 
ATOM 8415  O O    . GLY A 1 15 ? -6.080  -7.651  4.643   1.00 15.00 ?  311 GLY A O    11 
ATOM 8416  H H    . GLY A 1 15 ? -9.317  -5.463  3.388   1.00 15.00 ?  311 GLY A H    11 
ATOM 8417  H HA2  . GLY A 1 15 ? -8.245  -5.745  5.484   1.00 15.00 ?  311 GLY A HA2  11 
ATOM 8418  H HA3  . GLY A 1 15 ? -8.475  -7.483  5.341   1.00 15.00 ?  311 GLY A HA3  11 
ATOM 8419  N N    . ARG A 1 16 ? -6.409  -5.814  3.392   1.00 15.00 ?  312 ARG A N    11 
ATOM 8420  C CA   . ARG A 1 16 ? -5.083  -5.870  2.778   1.00 15.00 ?  312 ARG A CA   11 
ATOM 8421  C C    . ARG A 1 16 ? -4.470  -4.471  2.738   1.00 15.00 ?  312 ARG A C    11 
ATOM 8422  O O    . ARG A 1 16 ? -5.116  -3.532  2.277   1.00 15.00 ?  312 ARG A O    11 
ATOM 8423  C CB   . ARG A 1 16 ? -5.171  -6.401  1.349   1.00 15.00 ?  312 ARG A CB   11 
ATOM 8424  C CG   . ARG A 1 16 ? -6.111  -7.569  1.131   1.00 15.00 ?  312 ARG A CG   11 
ATOM 8425  C CD   . ARG A 1 16 ? -6.379  -7.745  -0.354  1.00 15.00 ?  312 ARG A CD   11 
ATOM 8426  N NE   . ARG A 1 16 ? -7.284  -6.719  -0.875  1.00 15.00 ?  312 ARG A NE   11 
ATOM 8427  C CZ   . ARG A 1 16 ? -7.671  -6.633  -2.151  1.00 15.00 ?  312 ARG A CZ   11 
ATOM 8428  N NH1  . ARG A 1 16 ? -7.251  -7.517  -3.047  1.00 15.00 1  312 ARG A NH1  11 
ATOM 8429  N NH2  . ARG A 1 16 ? -8.496  -5.668  -2.528  1.00 15.00 ?  312 ARG A NH2  11 
ATOM 8430  H H    . ARG A 1 16 ? -7.018  -5.070  3.165   1.00 15.00 ?  312 ARG A H    11 
ATOM 8431  H HA   . ARG A 1 16 ? -4.457  -6.521  3.369   1.00 15.00 ?  312 ARG A HA   11 
ATOM 8432  H HB2  . ARG A 1 16 ? -5.480  -5.595  0.696   1.00 15.00 ?  312 ARG A HB2  11 
ATOM 8433  H HB3  . ARG A 1 16 ? -4.180  -6.715  1.049   1.00 15.00 ?  312 ARG A HB3  11 
ATOM 8434  H HG2  . ARG A 1 16 ? -5.658  -8.468  1.521   1.00 15.00 ?  312 ARG A HG2  11 
ATOM 8435  H HG3  . ARG A 1 16 ? -7.045  -7.375  1.639   1.00 15.00 ?  312 ARG A HG3  11 
ATOM 8436  H HD2  . ARG A 1 16 ? -5.434  -7.664  -0.876  1.00 15.00 ?  312 ARG A HD2  11 
ATOM 8437  H HD3  . ARG A 1 16 ? -6.809  -8.721  -0.523  1.00 15.00 ?  312 ARG A HD3  11 
ATOM 8438  H HE   . ARG A 1 16 ? -7.619  -6.050  -0.234  1.00 15.00 ?  312 ARG A HE   11 
ATOM 8439  H HH11 . ARG A 1 16 ? -6.638  -8.270  -2.776  1.00 15.00 ?  312 ARG A HH11 11 
ATOM 8440  H HH12 . ARG A 1 16 ? -7.545  -7.442  -4.008  1.00 15.00 ?  312 ARG A HH12 11 
ATOM 8441  H HH21 . ARG A 1 16 ? -8.844  -5.004  -1.858  1.00 15.00 ?  312 ARG A HH21 11 
ATOM 8442  H HH22 . ARG A 1 16 ? -8.774  -5.586  -3.498  1.00 15.00 ?  312 ARG A HH22 11 
ATOM 8443  N N    . VAL A 1 17 ? -3.219  -4.331  3.158   1.00 15.00 ?  313 VAL A N    11 
ATOM 8444  C CA   . VAL A 1 17 ? -2.624  -3.005  3.291   1.00 15.00 ?  313 VAL A CA   11 
ATOM 8445  C C    . VAL A 1 17 ? -1.607  -2.707  2.177   1.00 15.00 ?  313 VAL A C    11 
ATOM 8446  O O    . VAL A 1 17 ? -0.449  -3.099  2.251   1.00 15.00 ?  313 VAL A O    11 
ATOM 8447  C CB   . VAL A 1 17 ? -1.946  -2.823  4.663   1.00 15.00 ?  313 VAL A CB   11 
ATOM 8448  C CG1  . VAL A 1 17 ? -1.758  -1.346  4.968   1.00 15.00 ?  313 VAL A CG1  11 
ATOM 8449  C CG2  . VAL A 1 17 ? -2.753  -3.496  5.763   1.00 15.00 ?  313 VAL A CG2  11 
ATOM 8450  H H    . VAL A 1 17 ? -2.680  -5.126  3.368   1.00 15.00 ?  313 VAL A H    11 
ATOM 8451  H HA   . VAL A 1 17 ? -3.426  -2.284  3.224   1.00 15.00 ?  313 VAL A HA   11 
ATOM 8452  H HB   . VAL A 1 17 ? -0.971  -3.287  4.623   1.00 15.00 ?  313 VAL A HB   11 
ATOM 8453  H HG11 . VAL A 1 17 ? -1.137  -0.899  4.206   1.00 15.00 ?  313 VAL A HG11 11 
ATOM 8454  H HG12 . VAL A 1 17 ? -1.282  -1.235  5.931   1.00 15.00 ?  313 VAL A HG12 11 
ATOM 8455  H HG13 . VAL A 1 17 ? -2.720  -0.856  4.983   1.00 15.00 ?  313 VAL A HG13 11 
ATOM 8456  H HG21 . VAL A 1 17 ? -2.835  -4.552  5.554   1.00 15.00 ?  313 VAL A HG21 11 
ATOM 8457  H HG22 . VAL A 1 17 ? -3.740  -3.059  5.803   1.00 15.00 ?  313 VAL A HG22 11 
ATOM 8458  H HG23 . VAL A 1 17 ? -2.258  -3.353  6.713   1.00 15.00 ?  313 VAL A HG23 11 
ATOM 8459  N N    . TYR A 1 18 ? -2.074  -2.013  1.148   1.00 15.00 ?  314 TYR A N    11 
ATOM 8460  C CA   . TYR A 1 18 ? -1.254  -1.535  0.061   1.00 15.00 ?  314 TYR A CA   11 
ATOM 8461  C C    . TYR A 1 18 ? -0.711  -0.141  0.378   1.00 15.00 ?  314 TYR A C    11 
ATOM 8462  O O    . TYR A 1 18 ? -1.458  0.831   0.510   1.00 15.00 ?  314 TYR A O    11 
ATOM 8463  C CB   . TYR A 1 18 ? -2.082  -1.496  -1.246  1.00 15.00 ?  314 TYR A CB   11 
ATOM 8464  C CG   . TYR A 1 18 ? -3.307  -0.591  -1.181  1.00 15.00 ?  314 TYR A CG   11 
ATOM 8465  C CD1  . TYR A 1 18 ? -4.367  -0.887  -0.332  1.00 15.00 ?  314 TYR A CD1  11 
ATOM 8466  C CD2  . TYR A 1 18 ? -3.395  0.570   -1.951  1.00 15.00 ?  314 TYR A CD2  11 
ATOM 8467  C CE1  . TYR A 1 18 ? -5.467  -0.062  -0.245  1.00 15.00 ?  314 TYR A CE1  11 
ATOM 8468  C CE2  . TYR A 1 18 ? -4.499  1.401   -1.867  1.00 15.00 ?  314 TYR A CE2  11 
ATOM 8469  C CZ   . TYR A 1 18 ? -5.529  1.079   -1.009  1.00 15.00 ?  314 TYR A CZ   11 
ATOM 8470  O OH   . TYR A 1 18 ? -6.630  1.896   -0.913  1.00 15.00 ?  314 TYR A OH   11 
ATOM 8471  H H    . TYR A 1 18 ? -3.004  -1.838  1.105   1.00 15.00 ?  314 TYR A H    11 
ATOM 8472  H HA   . TYR A 1 18 ? -0.428  -2.218  -0.064  1.00 15.00 ?  314 TYR A HA   11 
ATOM 8473  H HB2  . TYR A 1 18 ? -1.455  -1.144  -2.049  1.00 15.00 ?  314 TYR A HB2  11 
ATOM 8474  H HB3  . TYR A 1 18 ? -2.422  -2.496  -1.478  1.00 15.00 ?  314 TYR A HB3  11 
ATOM 8475  H HD1  . TYR A 1 18 ? -4.319  -1.782  0.271   1.00 15.00 ?  314 TYR A HD1  11 
ATOM 8476  H HD2  . TYR A 1 18 ? -2.594  0.811   -2.633  1.00 15.00 ?  314 TYR A HD2  11 
ATOM 8477  H HE1  . TYR A 1 18 ? -6.276  -0.312  0.426   1.00 15.00 ?  314 TYR A HE1  11 
ATOM 8478  H HE2  . TYR A 1 18 ? -4.543  2.313   -2.461  1.00 15.00 ?  314 TYR A HE2  11 
ATOM 8479  H HH   . TYR A 1 18 ? -7.040  1.982   -1.783  1.00 15.00 ?  314 TYR A HH   11 
ATOM 8480  N N    . PHE A 1 19 ? 0.586   -0.061  0.550   1.00 15.00 ?  315 PHE A N    11 
ATOM 8481  C CA   . PHE A 1 19 ? 1.257   1.210   0.686   1.00 15.00 ?  315 PHE A CA   11 
ATOM 8482  C C    . PHE A 1 19 ? 1.762   1.611   -0.682  1.00 15.00 ?  315 PHE A C    11 
ATOM 8483  O O    . PHE A 1 19 ? 2.545   0.892   -1.275  1.00 15.00 ?  315 PHE A O    11 
ATOM 8484  C CB   . PHE A 1 19 ? 2.459   1.121   1.627   1.00 15.00 ?  315 PHE A CB   11 
ATOM 8485  C CG   . PHE A 1 19 ? 2.194   0.569   2.998   1.00 15.00 ?  315 PHE A CG   11 
ATOM 8486  C CD1  . PHE A 1 19 ? 1.714   -0.716  3.164   1.00 15.00 ?  315 PHE A CD1  11 
ATOM 8487  C CD2  . PHE A 1 19 ? 2.473   1.326   4.124   1.00 15.00 ?  315 PHE A CD2  11 
ATOM 8488  C CE1  . PHE A 1 19 ? 1.507   -1.232  4.423   1.00 15.00 ?  315 PHE A CE1  11 
ATOM 8489  C CE2  . PHE A 1 19 ? 2.275   0.809   5.388   1.00 15.00 ?  315 PHE A CE2  11 
ATOM 8490  C CZ   . PHE A 1 19 ? 1.791   -0.474  5.535   1.00 15.00 ?  315 PHE A CZ   11 
ATOM 8491  H H    . PHE A 1 19 ? 1.117   -0.890  0.579   1.00 15.00 ?  315 PHE A H    11 
ATOM 8492  H HA   . PHE A 1 19 ? 0.553   1.944   1.049   1.00 15.00 ?  315 PHE A HA   11 
ATOM 8493  H HB2  . PHE A 1 19 ? 3.207   0.493   1.169   1.00 15.00 ?  315 PHE A HB2  11 
ATOM 8494  H HB3  . PHE A 1 19 ? 2.870   2.114   1.748   1.00 15.00 ?  315 PHE A HB3  11 
ATOM 8495  H HD1  . PHE A 1 19 ? 1.491   -1.316  2.295   1.00 15.00 ?  315 PHE A HD1  11 
ATOM 8496  H HD2  . PHE A 1 19 ? 2.847   2.333   4.007   1.00 15.00 ?  315 PHE A HD2  11 
ATOM 8497  H HE1  . PHE A 1 19 ? 1.127   -2.235  4.539   1.00 15.00 ?  315 PHE A HE1  11 
ATOM 8498  H HE2  . PHE A 1 19 ? 2.495   1.407   6.259   1.00 15.00 ?  315 PHE A HE2  11 
ATOM 8499  H HZ   . PHE A 1 19 ? 1.642   -0.889  6.515   1.00 15.00 ?  315 PHE A HZ   11 
ATOM 8500  N N    . VAL A 1 20 ? 1.326   2.728   -1.202  1.00 15.00 ?  316 VAL A N    11 
ATOM 8501  C CA   . VAL A 1 20 ? 1.833   3.147   -2.482  1.00 15.00 ?  316 VAL A CA   11 
ATOM 8502  C C    . VAL A 1 20 ? 3.067   4.009   -2.275  1.00 15.00 ?  316 VAL A C    11 
ATOM 8503  O O    . VAL A 1 20 ? 3.041   4.951   -1.484  1.00 15.00 ?  316 VAL A O    11 
ATOM 8504  C CB   . VAL A 1 20 ? 0.794   3.919   -3.327  1.00 15.00 ?  316 VAL A CB   11 
ATOM 8505  C CG1  . VAL A 1 20 ? 1.343   4.152   -4.718  1.00 15.00 ?  316 VAL A CG1  11 
ATOM 8506  C CG2  . VAL A 1 20 ? -0.531  3.175   -3.389  1.00 15.00 ?  316 VAL A CG2  11 
ATOM 8507  H H    . VAL A 1 20 ? 0.678   3.281   -0.716  1.00 15.00 ?  316 VAL A H    11 
ATOM 8508  H HA   . VAL A 1 20 ? 2.112   2.259   -3.019  1.00 15.00 ?  316 VAL A HA   11 
ATOM 8509  H HB   . VAL A 1 20 ? 0.619   4.884   -2.874  1.00 15.00 ?  316 VAL A HB   11 
ATOM 8510  H HG11 . VAL A 1 20 ? 0.607   4.674   -5.312  1.00 15.00 ?  316 VAL A HG11 11 
ATOM 8511  H HG12 . VAL A 1 20 ? 1.570   3.201   -5.179  1.00 15.00 ?  316 VAL A HG12 11 
ATOM 8512  H HG13 . VAL A 1 20 ? 2.241   4.745   -4.655  1.00 15.00 ?  316 VAL A HG13 11 
ATOM 8513  H HG21 . VAL A 1 20 ? -0.367  2.176   -3.767  1.00 15.00 ?  316 VAL A HG21 11 
ATOM 8514  H HG22 . VAL A 1 20 ? -1.207  3.701   -4.048  1.00 15.00 ?  316 VAL A HG22 11 
ATOM 8515  H HG23 . VAL A 1 20 ? -0.962  3.122   -2.403  1.00 15.00 ?  316 VAL A HG23 11 
ATOM 8516  N N    . ASP A 1 21 ? 4.152   3.699   -2.967  1.00 15.00 ?  317 ASP A N    11 
ATOM 8517  C CA   . ASP A 1 21 ? 5.343   4.504   -2.838  1.00 15.00 ?  317 ASP A CA   11 
ATOM 8518  C C    . ASP A 1 21 ? 5.232   5.588   -3.884  1.00 15.00 ?  317 ASP A C    11 
ATOM 8519  O O    . ASP A 1 21 ? 5.138   5.280   -5.072  1.00 15.00 ?  317 ASP A O    11 
ATOM 8520  C CB   . ASP A 1 21 ? 6.633   3.708   -3.104  1.00 15.00 ?  317 ASP A CB   11 
ATOM 8521  C CG   . ASP A 1 21 ? 6.561   2.238   -2.756  1.00 15.00 ?  317 ASP A CG   11 
ATOM 8522  O OD1  . ASP A 1 21 ? 6.216   1.914   -1.617  1.00 15.00 -1 317 ASP A OD1  11 
ATOM 8523  O OD2  . ASP A 1 21 ? 6.888   1.406   -3.636  1.00 15.00 ?  317 ASP A OD2  11 
ATOM 8524  H H    . ASP A 1 21 ? 4.159   2.915   -3.560  1.00 15.00 ?  317 ASP A H    11 
ATOM 8525  H HA   . ASP A 1 21 ? 5.367   4.945   -1.853  1.00 15.00 ?  317 ASP A HA   11 
ATOM 8526  H HB2  . ASP A 1 21 ? 6.899   3.796   -4.143  1.00 15.00 ?  317 ASP A HB2  11 
ATOM 8527  H HB3  . ASP A 1 21 ? 7.417   4.138   -2.501  1.00 15.00 ?  317 ASP A HB3  11 
ATOM 8528  N N    . HIS A 1 22 ? 5.199   6.845   -3.458  1.00 15.00 ?  318 HIS A N    11 
ATOM 8529  C CA   . HIS A 1 22 ? 5.066   7.954   -4.402  1.00 15.00 ?  318 HIS A CA   11 
ATOM 8530  C C    . HIS A 1 22 ? 6.365   8.182   -5.159  1.00 15.00 ?  318 HIS A C    11 
ATOM 8531  O O    . HIS A 1 22 ? 6.384   8.863   -6.180  1.00 15.00 ?  318 HIS A O    11 
ATOM 8532  C CB   . HIS A 1 22 ? 4.631   9.247   -3.704  1.00 15.00 ?  318 HIS A CB   11 
ATOM 8533  C CG   . HIS A 1 22 ? 3.166   9.314   -3.378  1.00 15.00 ?  318 HIS A CG   11 
ATOM 8534  N ND1  . HIS A 1 22 ? 2.224   8.452   -3.902  1.00 15.00 ?  318 HIS A ND1  11 
ATOM 8535  C CD2  . HIS A 1 22 ? 2.481   10.153  -2.565  1.00 15.00 ?  318 HIS A CD2  11 
ATOM 8536  C CE1  . HIS A 1 22 ? 1.035   8.758   -3.421  1.00 15.00 ?  318 HIS A CE1  11 
ATOM 8537  N NE2  . HIS A 1 22 ? 1.158   9.787   -2.606  1.00 15.00 ?  318 HIS A NE2  11 
ATOM 8538  H H    . HIS A 1 22 ? 5.263   7.031   -2.493  1.00 15.00 ?  318 HIS A H    11 
ATOM 8539  H HA   . HIS A 1 22 ? 4.304   7.675   -5.116  1.00 15.00 ?  318 HIS A HA   11 
ATOM 8540  H HB2  . HIS A 1 22 ? 5.179   9.346   -2.779  1.00 15.00 ?  318 HIS A HB2  11 
ATOM 8541  H HB3  . HIS A 1 22 ? 4.867   10.087  -4.344  1.00 15.00 ?  318 HIS A HB3  11 
ATOM 8542  H HD1  . HIS A 1 22 ? 2.391   7.749   -4.579  1.00 15.00 ?  318 HIS A HD1  11 
ATOM 8543  H HD2  . HIS A 1 22 ? 2.896   10.972  -1.996  1.00 15.00 ?  318 HIS A HD2  11 
ATOM 8544  H HE1  . HIS A 1 22 ? 0.111   8.249   -3.657  1.00 15.00 ?  318 HIS A HE1  11 
ATOM 8545  H HE2  . HIS A 1 22 ? 0.509   9.988   -1.879  1.00 15.00 ?  318 HIS A HE2  11 
ATOM 8546  N N    . ASN A 1 23 ? 7.452   7.620   -4.647  1.00 15.00 ?  319 ASN A N    11 
ATOM 8547  C CA   . ASN A 1 23 ? 8.739   7.700   -5.328  1.00 15.00 ?  319 ASN A CA   11 
ATOM 8548  C C    . ASN A 1 23 ? 8.864   6.576   -6.351  1.00 15.00 ?  319 ASN A C    11 
ATOM 8549  O O    . ASN A 1 23 ? 9.520   6.723   -7.379  1.00 15.00 ?  319 ASN A O    11 
ATOM 8550  C CB   . ASN A 1 23 ? 9.899   7.614   -4.331  1.00 15.00 ?  319 ASN A CB   11 
ATOM 8551  C CG   . ASN A 1 23 ? 9.810   8.642   -3.218  1.00 15.00 ?  319 ASN A CG   11 
ATOM 8552  O OD1  . ASN A 1 23 ? 9.275   9.735   -3.399  1.00 15.00 ?  319 ASN A OD1  11 
ATOM 8553  N ND2  . ASN A 1 23 ? 10.332  8.287   -2.054  1.00 15.00 ?  319 ASN A ND2  11 
ATOM 8554  H H    . ASN A 1 23 ? 7.393   7.162   -3.783  1.00 15.00 ?  319 ASN A H    11 
ATOM 8555  H HA   . ASN A 1 23 ? 8.785   8.649   -5.843  1.00 15.00 ?  319 ASN A HA   11 
ATOM 8556  H HB2  . ASN A 1 23 ? 9.907   6.633   -3.882  1.00 15.00 ?  319 ASN A HB2  11 
ATOM 8557  H HB3  . ASN A 1 23 ? 10.828  7.767   -4.861  1.00 15.00 ?  319 ASN A HB3  11 
ATOM 8558  H HD21 . ASN A 1 23 ? 10.742  7.392   -1.980  1.00 15.00 ?  319 ASN A HD21 11 
ATOM 8559  H HD22 . ASN A 1 23 ? 10.293  8.926   -1.314  1.00 15.00 ?  319 ASN A HD22 11 
ATOM 8560  N N    . ASN A 1 24 ? 8.250   5.442   -6.039  1.00 15.00 ?  320 ASN A N    11 
ATOM 8561  C CA   . ASN A 1 24 ? 8.284   4.268   -6.910  1.00 15.00 ?  320 ASN A CA   11 
ATOM 8562  C C    . ASN A 1 24 ? 7.055   4.237   -7.823  1.00 15.00 ?  320 ASN A C    11 
ATOM 8563  O O    . ASN A 1 24 ? 7.021   3.517   -8.822  1.00 15.00 ?  320 ASN A O    11 
ATOM 8564  C CB   . ASN A 1 24 ? 8.351   3.005   -6.041  1.00 15.00 ?  320 ASN A CB   11 
ATOM 8565  C CG   . ASN A 1 24 ? 8.348   1.704   -6.824  1.00 15.00 ?  320 ASN A CG   11 
ATOM 8566  O OD1  . ASN A 1 24 ? 8.859   1.622   -7.942  1.00 15.00 ?  320 ASN A OD1  11 
ATOM 8567  N ND2  . ASN A 1 24 ? 7.765   0.672   -6.232  1.00 15.00 ?  320 ASN A ND2  11 
ATOM 8568  H H    . ASN A 1 24 ? 7.774   5.382   -5.188  1.00 15.00 ?  320 ASN A H    11 
ATOM 8569  H HA   . ASN A 1 24 ? 9.173   4.329   -7.517  1.00 15.00 ?  320 ASN A HA   11 
ATOM 8570  H HB2  . ASN A 1 24 ? 9.255   3.036   -5.452  1.00 15.00 ?  320 ASN A HB2  11 
ATOM 8571  H HB3  . ASN A 1 24 ? 7.501   2.999   -5.373  1.00 15.00 ?  320 ASN A HB3  11 
ATOM 8572  H HD21 . ASN A 1 24 ? 7.376   0.809   -5.333  1.00 15.00 ?  320 ASN A HD21 11 
ATOM 8573  H HD22 . ASN A 1 24 ? 7.747   -0.186  -6.708  1.00 15.00 ?  320 ASN A HD22 11 
ATOM 8574  N N    . ARG A 1 25 ? 6.038   5.016   -7.452  1.00 15.00 ?  321 ARG A N    11 
ATOM 8575  C CA   . ARG A 1 25 ? 4.791   5.120   -8.207  1.00 15.00 ?  321 ARG A CA   11 
ATOM 8576  C C    . ARG A 1 25 ? 4.112   3.761   -8.335  1.00 15.00 ?  321 ARG A C    11 
ATOM 8577  O O    . ARG A 1 25 ? 3.392   3.495   -9.298  1.00 15.00 ?  321 ARG A O    11 
ATOM 8578  C CB   . ARG A 1 25 ? 5.062   5.753   -9.572  1.00 15.00 ?  321 ARG A CB   11 
ATOM 8579  C CG   . ARG A 1 25 ? 5.478   7.208   -9.452  1.00 15.00 ?  321 ARG A CG   11 
ATOM 8580  C CD   . ARG A 1 25 ? 5.807   7.828   -10.796 1.00 15.00 ?  321 ARG A CD   11 
ATOM 8581  N NE   . ARG A 1 25 ? 6.099   9.253   -10.662 1.00 15.00 ?  321 ARG A NE   11 
ATOM 8582  C CZ   . ARG A 1 25 ? 6.985   9.911   -11.402 1.00 15.00 ?  321 ARG A CZ   11 
ATOM 8583  N NH1  . ARG A 1 25 ? 7.716   9.266   -12.302 1.00 15.00 1  321 ARG A NH1  11 
ATOM 8584  N NH2  . ARG A 1 25 ? 7.160   11.214  -11.223 1.00 15.00 ?  321 ARG A NH2  11 
ATOM 8585  H H    . ARG A 1 25 ? 6.124   5.537   -6.628  1.00 15.00 ?  321 ARG A H    11 
ATOM 8586  H HA   . ARG A 1 25 ? 4.134   5.774   -7.651  1.00 15.00 ?  321 ARG A HA   11 
ATOM 8587  H HB2  . ARG A 1 25 ? 5.853   5.206   -10.064 1.00 15.00 ?  321 ARG A HB2  11 
ATOM 8588  H HB3  . ARG A 1 25 ? 4.166   5.702   -10.171 1.00 15.00 ?  321 ARG A HB3  11 
ATOM 8589  H HG2  . ARG A 1 25 ? 4.670   7.764   -9.003  1.00 15.00 ?  321 ARG A HG2  11 
ATOM 8590  H HG3  . ARG A 1 25 ? 6.351   7.267   -8.817  1.00 15.00 ?  321 ARG A HG3  11 
ATOM 8591  H HD2  . ARG A 1 25 ? 6.671   7.327   -11.212 1.00 15.00 ?  321 ARG A HD2  11 
ATOM 8592  H HD3  . ARG A 1 25 ? 4.962   7.701   -11.455 1.00 15.00 ?  321 ARG A HD3  11 
ATOM 8593  H HE   . ARG A 1 25 ? 5.592   9.753   -9.970  1.00 15.00 ?  321 ARG A HE   11 
ATOM 8594  H HH11 . ARG A 1 25 ? 7.602   8.273   -12.432 1.00 15.00 ?  321 ARG A HH11 11 
ATOM 8595  H HH12 . ARG A 1 25 ? 8.401   9.763   -12.849 1.00 15.00 ?  321 ARG A HH12 11 
ATOM 8596  H HH21 . ARG A 1 25 ? 6.629   11.708  -10.526 1.00 15.00 ?  321 ARG A HH21 11 
ATOM 8597  H HH22 . ARG A 1 25 ? 7.816   11.717  -11.795 1.00 15.00 ?  321 ARG A HH22 11 
ATOM 8598  N N    . THR A 1 26 ? 4.303   2.928   -7.322  1.00 15.00 ?  322 THR A N    11 
ATOM 8599  C CA   . THR A 1 26 ? 3.753   1.577   -7.327  1.00 15.00 ?  322 THR A CA   11 
ATOM 8600  C C    . THR A 1 26 ? 3.005   1.287   -6.025  1.00 15.00 ?  322 THR A C    11 
ATOM 8601  O O    . THR A 1 26 ? 3.424   1.741   -4.960  1.00 15.00 ?  322 THR A O    11 
ATOM 8602  C CB   . THR A 1 26 ? 4.868   0.534   -7.539  1.00 15.00 ?  322 THR A CB   11 
ATOM 8603  O OG1  . THR A 1 26 ? 5.641   0.881   -8.700  1.00 15.00 ?  322 THR A OG1  11 
ATOM 8604  C CG2  . THR A 1 26 ? 4.296   -0.866  -7.713  1.00 15.00 ?  322 THR A CG2  11 
ATOM 8605  H H    . THR A 1 26 ? 4.802   3.245   -6.529  1.00 15.00 ?  322 THR A H    11 
ATOM 8606  H HA   . THR A 1 26 ? 3.058   1.505   -8.153  1.00 15.00 ?  322 THR A HA   11 
ATOM 8607  H HB   . THR A 1 26 ? 5.514   0.539   -6.672  1.00 15.00 ?  322 THR A HB   11 
ATOM 8608  H HG1  . THR A 1 26 ? 6.096   1.718   -8.544  1.00 15.00 ?  322 THR A HG1  11 
ATOM 8609  H HG21 . THR A 1 26 ? 3.652   -0.888  -8.580  1.00 15.00 ?  322 THR A HG21 11 
ATOM 8610  H HG22 . THR A 1 26 ? 3.725   -1.133  -6.835  1.00 15.00 ?  322 THR A HG22 11 
ATOM 8611  H HG23 . THR A 1 26 ? 5.102   -1.572  -7.847  1.00 15.00 ?  322 THR A HG23 11 
ATOM 8612  N N    . THR A 1 27 ? 1.899   0.548   -6.110  1.00 15.00 ?  323 THR A N    11 
ATOM 8613  C CA   . THR A 1 27 ? 1.135   0.176   -4.925  1.00 15.00 ?  323 THR A CA   11 
ATOM 8614  C C    . THR A 1 27 ? 1.681   -1.124  -4.325  1.00 15.00 ?  323 THR A C    11 
ATOM 8615  O O    . THR A 1 27 ? 2.009   -2.062  -5.055  1.00 15.00 ?  323 THR A O    11 
ATOM 8616  C CB   . THR A 1 27 ? -0.372  0.040   -5.233  1.00 15.00 ?  323 THR A CB   11 
ATOM 8617  O OG1  . THR A 1 27 ? -1.100  -0.243  -4.033  1.00 15.00 ?  323 THR A OG1  11 
ATOM 8618  C CG2  . THR A 1 27 ? -0.642  -1.051  -6.252  1.00 15.00 ?  323 THR A CG2  11 
ATOM 8619  H H    . THR A 1 27 ? 1.597   0.235   -6.988  1.00 15.00 ?  323 THR A H    11 
ATOM 8620  H HA   . THR A 1 27 ? 1.257   0.964   -4.205  1.00 15.00 ?  323 THR A HA   11 
ATOM 8621  H HB   . THR A 1 27 ? -0.723  0.979   -5.637  1.00 15.00 ?  323 THR A HB   11 
ATOM 8622  H HG1  . THR A 1 27 ? -1.910  0.275   -4.020  1.00 15.00 ?  323 THR A HG1  11 
ATOM 8623  H HG21 . THR A 1 27 ? -0.229  -0.766  -7.209  1.00 15.00 ?  323 THR A HG21 11 
ATOM 8624  H HG22 . THR A 1 27 ? -1.712  -1.190  -6.343  1.00 15.00 ?  323 THR A HG22 11 
ATOM 8625  H HG23 . THR A 1 27 ? -0.187  -1.973  -5.920  1.00 15.00 ?  323 THR A HG23 11 
ATOM 8626  N N    . GLN A 1 28 ? 1.789   -1.178  -2.999  1.00 15.00 ?  324 GLN A N    11 
ATOM 8627  C CA   . GLN A 1 28 ? 2.460   -2.291  -2.343  1.00 15.00 ?  324 GLN A CA   11 
ATOM 8628  C C    . GLN A 1 28 ? 1.565   -3.037  -1.358  1.00 15.00 ?  324 GLN A C    11 
ATOM 8629  O O    . GLN A 1 28 ? 1.399   -2.609  -0.225  1.00 15.00 ?  324 GLN A O    11 
ATOM 8630  C CB   . GLN A 1 28 ? 3.693   -1.795  -1.574  1.00 15.00 ?  324 GLN A CB   11 
ATOM 8631  C CG   . GLN A 1 28 ? 4.677   -0.995  -2.407  1.00 15.00 ?  324 GLN A CG   11 
ATOM 8632  C CD   . GLN A 1 28 ? 5.500   -1.852  -3.346  1.00 15.00 ?  324 GLN A CD   11 
ATOM 8633  O OE1  . GLN A 1 28 ? 5.080   -2.929  -3.776  1.00 15.00 ?  324 GLN A OE1  11 
ATOM 8634  N NE2  . GLN A 1 28 ? 6.676   -1.362  -3.682  1.00 15.00 ?  324 GLN A NE2  11 
ATOM 8635  H H    . GLN A 1 28 ? 1.430   -0.448  -2.451  1.00 15.00 ?  324 GLN A H    11 
ATOM 8636  H HA   . GLN A 1 28 ? 2.785   -2.980  -3.107  1.00 15.00 ?  324 GLN A HA   11 
ATOM 8637  H HB2  . GLN A 1 28 ? 3.359   -1.169  -0.761  1.00 15.00 ?  324 GLN A HB2  11 
ATOM 8638  H HB3  . GLN A 1 28 ? 4.214   -2.646  -1.164  1.00 15.00 ?  324 GLN A HB3  11 
ATOM 8639  H HG2  . GLN A 1 28 ? 4.133   -0.264  -2.982  1.00 15.00 ?  324 GLN A HG2  11 
ATOM 8640  H HG3  . GLN A 1 28 ? 5.350   -0.482  -1.737  1.00 15.00 ?  324 GLN A HG3  11 
ATOM 8641  H HE21 . GLN A 1 28 ? 6.928   -0.480  -3.315  1.00 15.00 ?  324 GLN A HE21 11 
ATOM 8642  H HE22 . GLN A 1 28 ? 7.256   -1.894  -4.269  1.00 15.00 ?  324 GLN A HE22 11 
ATOM 8643  N N    . PHE A 1 29 ? 0.993   -4.155  -1.787  1.00 15.00 ?  325 PHE A N    11 
ATOM 8644  C CA   . PHE A 1 29 ? 0.526   -5.170  -0.836  1.00 15.00 ?  325 PHE A CA   11 
ATOM 8645  C C    . PHE A 1 29 ? 1.740   -5.810  -0.223  1.00 15.00 ?  325 PHE A C    11 
ATOM 8646  O O    . PHE A 1 29 ? 1.677   -6.627  0.690   1.00 15.00 ?  325 PHE A O    11 
ATOM 8647  C CB   . PHE A 1 29 ? -0.373  -6.215  -1.472  1.00 15.00 ?  325 PHE A CB   11 
ATOM 8648  C CG   . PHE A 1 29 ? -1.788  -5.761  -1.502  1.00 15.00 ?  325 PHE A CG   11 
ATOM 8649  C CD1  . PHE A 1 29 ? -2.319  -5.075  -0.421  1.00 15.00 ?  325 PHE A CD1  11 
ATOM 8650  C CD2  . PHE A 1 29 ? -2.581  -5.996  -2.605  1.00 15.00 ?  325 PHE A CD2  11 
ATOM 8651  C CE1  . PHE A 1 29 ? -3.625  -4.630  -0.463  1.00 15.00 ?  325 PHE A CE1  11 
ATOM 8652  C CE2  . PHE A 1 29 ? -3.888  -5.559  -2.640  1.00 15.00 ?  325 PHE A CE2  11 
ATOM 8653  C CZ   . PHE A 1 29 ? -4.408  -4.872  -1.571  1.00 15.00 ?  325 PHE A CZ   11 
ATOM 8654  H H    . PHE A 1 29 ? 0.878   -4.302  -2.749  1.00 15.00 ?  325 PHE A H    11 
ATOM 8655  H HA   . PHE A 1 29 ? -0.020  -4.656  -0.055  1.00 15.00 ?  325 PHE A HA   11 
ATOM 8656  H HB2  . PHE A 1 29 ? -0.050  -6.406  -2.488  1.00 15.00 ?  325 PHE A HB2  11 
ATOM 8657  H HB3  . PHE A 1 29 ? -0.323  -7.130  -0.901  1.00 15.00 ?  325 PHE A HB3  11 
ATOM 8658  H HD1  . PHE A 1 29 ? -1.694  -4.887  0.469   1.00 15.00 ?  325 PHE A HD1  11 
ATOM 8659  H HD2  . PHE A 1 29 ? -2.173  -6.538  -3.444  1.00 15.00 ?  325 PHE A HD2  11 
ATOM 8660  H HE1  . PHE A 1 29 ? -4.042  -4.109  0.379   1.00 15.00 ?  325 PHE A HE1  11 
ATOM 8661  H HE2  . PHE A 1 29 ? -4.500  -5.752  -3.509  1.00 15.00 ?  325 PHE A HE2  11 
ATOM 8662  H HZ   . PHE A 1 29 ? -5.431  -4.523  -1.597  1.00 15.00 ?  325 PHE A HZ   11 
ATOM 8663  N N    . THR A 1 30 ? 2.843   -5.449  -0.822  1.00 15.00 ?  326 THR A N    11 
ATOM 8664  C CA   . THR A 1 30 ? 4.148   -5.822  -0.330  1.00 15.00 ?  326 THR A CA   11 
ATOM 8665  C C    . THR A 1 30 ? 4.455   -4.858  0.800   1.00 15.00 ?  326 THR A C    11 
ATOM 8666  O O    . THR A 1 30 ? 5.023   -3.788  0.585   1.00 15.00 ?  326 THR A O    11 
ATOM 8667  C CB   . THR A 1 30 ? 5.227   -5.694  -1.428  1.00 15.00 ?  326 THR A CB   11 
ATOM 8668  O OG1  . THR A 1 30 ? 4.732   -6.206  -2.675  1.00 15.00 ?  326 THR A OG1  11 
ATOM 8669  C CG2  . THR A 1 30 ? 6.490   -6.450  -1.038  1.00 15.00 ?  326 THR A CG2  11 
ATOM 8670  H H    . THR A 1 30 ? 2.754   -4.815  -1.560  1.00 15.00 ?  326 THR A H    11 
ATOM 8671  H HA   . THR A 1 30 ? 4.115   -6.839  0.032   1.00 15.00 ?  326 THR A HA   11 
ATOM 8672  H HB   . THR A 1 30 ? 5.474   -4.649  -1.549  1.00 15.00 ?  326 THR A HB   11 
ATOM 8673  H HG1  . THR A 1 30 ? 4.641   -5.475  -3.302  1.00 15.00 ?  326 THR A HG1  11 
ATOM 8674  H HG21 . THR A 1 30 ? 7.236   -6.328  -1.808  1.00 15.00 ?  326 THR A HG21 11 
ATOM 8675  H HG22 . THR A 1 30 ? 6.261   -7.499  -0.921  1.00 15.00 ?  326 THR A HG22 11 
ATOM 8676  H HG23 . THR A 1 30 ? 6.868   -6.059  -0.105  1.00 15.00 ?  326 THR A HG23 11 
ATOM 8677  N N    . ASP A 1 31 ? 4.063   -5.229  1.998   1.00 15.00 ?  327 ASP A N    11 
ATOM 8678  C CA   . ASP A 1 31 ? 3.927   -4.268  3.064   1.00 15.00 ?  327 ASP A CA   11 
ATOM 8679  C C    . ASP A 1 31 ? 4.867   -4.468  4.198   1.00 15.00 ?  327 ASP A C    11 
ATOM 8680  O O    . ASP A 1 31 ? 5.308   -5.575  4.517   1.00 15.00 ?  327 ASP A O    11 
ATOM 8681  C CB   . ASP A 1 31 ? 2.518   -4.200  3.617   1.00 15.00 ?  327 ASP A CB   11 
ATOM 8682  C CG   . ASP A 1 31 ? 1.844   -5.551  3.789   1.00 15.00 ?  327 ASP A CG   11 
ATOM 8683  O OD1  . ASP A 1 31 ? 2.510   -6.490  4.275   1.00 15.00 -1 327 ASP A OD1  11 
ATOM 8684  O OD2  . ASP A 1 31 ? 0.638   -5.667  3.486   1.00 15.00 ?  327 ASP A OD2  11 
ATOM 8685  H H    . ASP A 1 31 ? 3.839   -6.169  2.172   1.00 15.00 ?  327 ASP A H    11 
ATOM 8686  H HA   . ASP A 1 31 ? 4.144   -3.299  2.639   1.00 15.00 ?  327 ASP A HA   11 
ATOM 8687  H HB2  . ASP A 1 31 ? 2.564   -3.731  4.590   1.00 15.00 ?  327 ASP A HB2  11 
ATOM 8688  H HB3  . ASP A 1 31 ? 1.942   -3.577  2.967   1.00 15.00 ?  327 ASP A HB3  11 
ATOM 8689  N N    . PRO A 1 32 ? 5.177   -3.344  4.823   1.00 15.00 ?  328 PRO A N    11 
ATOM 8690  C CA   . PRO A 1 32 ? 5.870   -3.304  6.086   1.00 15.00 ?  328 PRO A CA   11 
ATOM 8691  C C    . PRO A 1 32 ? 4.954   -3.905  7.155   1.00 15.00 ?  328 PRO A C    11 
ATOM 8692  O O    . PRO A 1 32 ? 5.370   -4.207  8.269   1.00 15.00 ?  328 PRO A O    11 
ATOM 8693  C CB   . PRO A 1 32 ? 6.144   -1.802  6.298   1.00 15.00 ?  328 PRO A CB   11 
ATOM 8694  C CG   . PRO A 1 32 ? 5.860   -1.169  4.966   1.00 15.00 ?  328 PRO A CG   11 
ATOM 8695  C CD   . PRO A 1 32 ? 4.792   -1.998  4.373   1.00 15.00 ?  328 PRO A CD   11 
ATOM 8696  H HA   . PRO A 1 32 ? 6.800   -3.856  6.049   1.00 15.00 ?  328 PRO A HA   11 
ATOM 8697  H HB2  . PRO A 1 32 ? 5.488   -1.418  7.067   1.00 15.00 ?  328 PRO A HB2  11 
ATOM 8698  H HB3  . PRO A 1 32 ? 7.173   -1.658  6.590   1.00 15.00 ?  328 PRO A HB3  11 
ATOM 8699  H HG2  . PRO A 1 32 ? 5.536   -0.143  5.092   1.00 15.00 ?  328 PRO A HG2  11 
ATOM 8700  H HG3  . PRO A 1 32 ? 6.718   -1.220  4.326   1.00 15.00 ?  328 PRO A HG3  11 
ATOM 8701  H HD2  . PRO A 1 32 ? 3.825   -1.714  4.762   1.00 15.00 ?  328 PRO A HD2  11 
ATOM 8702  H HD3  . PRO A 1 32 ? 4.812   -1.929  3.296   1.00 15.00 ?  328 PRO A HD3  11 
ATOM 8703  N N    . ARG A 1 33 ? 3.672   -4.038  6.783   1.00 15.00 ?  329 ARG A N    11 
ATOM 8704  C CA   . ARG A 1 33 ? 2.663   -4.707  7.601   1.00 15.00 ?  329 ARG A CA   11 
ATOM 8705  C C    . ARG A 1 33 ? 3.025   -6.172  7.865   1.00 15.00 ?  329 ARG A C    11 
ATOM 8706  O O    . ARG A 1 33 ? 2.650   -6.733  8.895   1.00 15.00 ?  329 ARG A O    11 
ATOM 8707  C CB   . ARG A 1 33 ? 1.268   -4.625  6.935   1.00 15.00 ?  329 ARG A CB   11 
ATOM 8708  C CG   . ARG A 1 33 ? 0.536   -3.328  7.221   1.00 15.00 ?  329 ARG A CG   11 
ATOM 8709  C CD   . ARG A 1 33 ? 0.246   -3.185  8.704   1.00 15.00 ?  329 ARG A CD   11 
ATOM 8710  N NE   . ARG A 1 33 ? -0.638  -2.056  8.994   1.00 15.00 ?  329 ARG A NE   11 
ATOM 8711  C CZ   . ARG A 1 33 ? -1.137  -1.802  10.203  1.00 15.00 ?  329 ARG A CZ   11 
ATOM 8712  N NH1  . ARG A 1 33 ? -0.829  -2.593  11.225  1.00 15.00 1  329 ARG A NH1  11 
ATOM 8713  N NH2  . ARG A 1 33 ? -1.952  -0.769  10.386  1.00 15.00 ?  329 ARG A NH2  11 
ATOM 8714  H H    . ARG A 1 33 ? 3.402   -3.679  5.912   1.00 15.00 ?  329 ARG A H    11 
ATOM 8715  H HA   . ARG A 1 33 ? 2.620   -4.191  8.548   1.00 15.00 ?  329 ARG A HA   11 
ATOM 8716  H HB2  . ARG A 1 33 ? 1.360   -4.726  5.844   1.00 15.00 ?  329 ARG A HB2  11 
ATOM 8717  H HB3  . ARG A 1 33 ? 0.662   -5.438  7.306   1.00 15.00 ?  329 ARG A HB3  11 
ATOM 8718  H HG2  . ARG A 1 33 ? 1.150   -2.499  6.901   1.00 15.00 ?  329 ARG A HG2  11 
ATOM 8719  H HG3  . ARG A 1 33 ? -0.396  -3.322  6.676   1.00 15.00 ?  329 ARG A HG3  11 
ATOM 8720  H HD2  . ARG A 1 33 ? -0.221  -4.094  9.054   1.00 15.00 ?  329 ARG A HD2  11 
ATOM 8721  H HD3  . ARG A 1 33 ? 1.181   -3.041  9.226   1.00 15.00 ?  329 ARG A HD3  11 
ATOM 8722  H HE   . ARG A 1 33 ? -0.878  -1.467  8.246   1.00 15.00 ?  329 ARG A HE   11 
ATOM 8723  H HH11 . ARG A 1 33 ? -0.227  -3.381  11.088  1.00 15.00 ?  329 ARG A HH11 11 
ATOM 8724  H HH12 . ARG A 1 33 ? -1.193  -2.401  12.150  1.00 15.00 ?  329 ARG A HH12 11 
ATOM 8725  H HH21 . ARG A 1 33 ? -2.196  -0.175  9.618   1.00 15.00 ?  329 ARG A HH21 11 
ATOM 8726  H HH22 . ARG A 1 33 ? -2.338  -0.582  11.303  1.00 15.00 ?  329 ARG A HH22 11 
ATOM 8727  N N    . LEU A 1 34 ? 3.744   -6.788  6.933   1.00 15.00 ?  330 LEU A N    11 
ATOM 8728  C CA   . LEU A 1 34 ? 4.079   -8.206  7.034   1.00 15.00 ?  330 LEU A CA   11 
ATOM 8729  C C    . LEU A 1 34 ? 5.272   -8.445  7.964   1.00 15.00 ?  330 LEU A C    11 
ATOM 8730  O O    . LEU A 1 34 ? 5.572   -9.587  8.317   1.00 15.00 ?  330 LEU A O    11 
ATOM 8731  C CB   . LEU A 1 34 ? 4.361   -8.783  5.641   1.00 15.00 ?  330 LEU A CB   11 
ATOM 8732  C CG   . LEU A 1 34 ? 4.596   -10.295 5.583   1.00 15.00 ?  330 LEU A CG   11 
ATOM 8733  C CD1  . LEU A 1 34 ? 3.397   -11.050 6.139   1.00 15.00 ?  330 LEU A CD1  11 
ATOM 8734  C CD2  . LEU A 1 34 ? 4.882   -10.733 4.156   1.00 15.00 ?  330 LEU A CD2  11 
ATOM 8735  H H    . LEU A 1 34 ? 4.038   -6.284  6.141   1.00 15.00 ?  330 LEU A H    11 
ATOM 8736  H HA   . LEU A 1 34 ? 3.219   -8.714  7.447   1.00 15.00 ?  330 LEU A HA   11 
ATOM 8737  H HB2  . LEU A 1 34 ? 3.524   -8.547  5.002   1.00 15.00 ?  330 LEU A HB2  11 
ATOM 8738  H HB3  . LEU A 1 34 ? 5.239   -8.293  5.247   1.00 15.00 ?  330 LEU A HB3  11 
ATOM 8739  H HG   . LEU A 1 34 ? 5.456   -10.543 6.189   1.00 15.00 ?  330 LEU A HG   11 
ATOM 8740  H HD11 . LEU A 1 34 ? 3.229   -10.753 7.164   1.00 15.00 ?  330 LEU A HD11 11 
ATOM 8741  H HD12 . LEU A 1 34 ? 3.589   -12.111 6.099   1.00 15.00 ?  330 LEU A HD12 11 
ATOM 8742  H HD13 . LEU A 1 34 ? 2.522   -10.820 5.549   1.00 15.00 ?  330 LEU A HD13 11 
ATOM 8743  H HD21 . LEU A 1 34 ? 4.039   -10.483 3.527   1.00 15.00 ?  330 LEU A HD21 11 
ATOM 8744  H HD22 . LEU A 1 34 ? 5.045   -11.800 4.132   1.00 15.00 ?  330 LEU A HD22 11 
ATOM 8745  H HD23 . LEU A 1 34 ? 5.765   -10.226 3.795   1.00 15.00 ?  330 LEU A HD23 11 
ATOM 8746  N N    . SER A 1 35 ? 5.951   -7.377  8.374   1.00 15.00 ?  331 SER A N    11 
ATOM 8747  C CA   . SER A 1 35 ? 7.135   -7.508  9.227   1.00 15.00 ?  331 SER A CA   11 
ATOM 8748  C C    . SER A 1 35 ? 6.760   -7.998  10.629  1.00 15.00 ?  331 SER A C    11 
ATOM 8749  O O    . SER A 1 35 ? 7.627   -8.319  11.439  1.00 15.00 ?  331 SER A O    11 
ATOM 8750  C CB   . SER A 1 35 ? 7.888   -6.179  9.322   1.00 15.00 ?  331 SER A CB   11 
ATOM 8751  O OG   . SER A 1 35 ? 7.090   -5.177  9.931   1.00 15.00 ?  331 SER A OG   11 
ATOM 8752  H H    . SER A 1 35 ? 5.653   -6.484  8.099   1.00 15.00 ?  331 SER A H    11 
ATOM 8753  H HA   . SER A 1 35 ? 7.784   -8.244  8.771   1.00 15.00 ?  331 SER A HA   11 
ATOM 8754  H HB2  . SER A 1 35 ? 8.780   -6.316  9.914   1.00 15.00 ?  331 SER A HB2  11 
ATOM 8755  H HB3  . SER A 1 35 ? 8.163   -5.851  8.330   1.00 15.00 ?  331 SER A HB3  11 
ATOM 8756  H HG   . SER A 1 35 ? 6.589   -4.708  9.249   1.00 15.00 ?  331 SER A HG   11 
ATOM 8757  N N    . ALA A 1 36 ? 5.464   -8.026  10.917  1.00 15.00 ?  332 ALA A N    11 
ATOM 8758  C CA   . ALA A 1 36 ? 4.978   -8.477  12.214  1.00 15.00 ?  332 ALA A CA   11 
ATOM 8759  C C    . ALA A 1 36 ? 4.803   -9.992  12.242  1.00 15.00 ?  332 ALA A C    11 
ATOM 8760  O O    . ALA A 1 36 ? 4.577   -10.579 13.299  1.00 15.00 ?  332 ALA A O    11 
ATOM 8761  C CB   . ALA A 1 36 ? 3.663   -7.787  12.550  1.00 15.00 ?  332 ALA A CB   11 
ATOM 8762  H H    . ALA A 1 36 ? 4.818   -7.737  10.240  1.00 15.00 ?  332 ALA A H    11 
ATOM 8763  H HA   . ALA A 1 36 ? 5.706   -8.194  12.959  1.00 15.00 ?  332 ALA A HA   11 
ATOM 8764  H HB1  . ALA A 1 36 ? 2.911   -8.068  11.828  1.00 15.00 ?  332 ALA A HB1  11 
ATOM 8765  H HB2  . ALA A 1 36 ? 3.803   -6.716  12.527  1.00 15.00 ?  332 ALA A HB2  11 
ATOM 8766  H HB3  . ALA A 1 36 ? 3.343   -8.087  13.537  1.00 15.00 ?  332 ALA A HB3  11 
ATOM 8767  N N    . ASN A 1 37 ? 4.906   -10.621 11.077  1.00 15.00 ?  333 ASN A N    11 
ATOM 8768  C CA   . ASN A 1 37 ? 4.714   -12.063 10.970  1.00 15.00 ?  333 ASN A CA   11 
ATOM 8769  C C    . ASN A 1 37 ? 6.040   -12.792 11.156  1.00 15.00 ?  333 ASN A C    11 
ATOM 8770  O O    . ASN A 1 37 ? 6.805   -12.910 10.175  1.00 15.00 ?  333 ASN A O    11 
ATOM 8771  C CB   . ASN A 1 37 ? 4.097   -12.423 9.615   1.00 15.00 ?  333 ASN A CB   11 
ATOM 8772  C CG   . ASN A 1 37 ? 3.766   -13.901 9.493   1.00 15.00 ?  333 ASN A CG   11 
ATOM 8773  O OD1  . ASN A 1 37 ? 2.664   -14.336 9.833   1.00 15.00 ?  333 ASN A OD1  11 
ATOM 8774  N ND2  . ASN A 1 37 ? 4.713   -14.686 9.007   1.00 15.00 ?  333 ASN A ND2  11 
ATOM 8775  O OXT  . ASN A 1 37 ? 6.317   -13.246 12.284  1.00 15.00 ?  333 ASN A OXT  11 
ATOM 8776  H H    . ASN A 1 37 ? 5.128   -10.106 10.271  1.00 15.00 ?  333 ASN A H    11 
ATOM 8777  H HA   . ASN A 1 37 ? 4.038   -12.365 11.755  1.00 15.00 ?  333 ASN A HA   11 
ATOM 8778  H HB2  . ASN A 1 37 ? 3.185   -11.860 9.481   1.00 15.00 ?  333 ASN A HB2  11 
ATOM 8779  H HB3  . ASN A 1 37 ? 4.792   -12.164 8.831   1.00 15.00 ?  333 ASN A HB3  11 
ATOM 8780  H HD21 . ASN A 1 37 ? 5.571   -14.275 8.756   1.00 15.00 ?  333 ASN A HD21 11 
ATOM 8781  H HD22 . ASN A 1 37 ? 4.525   -15.646 8.917   1.00 15.00 ?  333 ASN A HD22 11 
ATOM 8782  N N    . GLU B 2 1  ? 2.986   -9.769  -5.977  1.00 15.00 ?  203 GLU B N    11 
ATOM 8783  C CA   . GLU B 2 1  ? 2.554   -9.727  -4.563  1.00 15.00 ?  203 GLU B CA   11 
ATOM 8784  C C    . GLU B 2 1  ? 1.944   -11.071 -4.183  1.00 15.00 ?  203 GLU B C    11 
ATOM 8785  O O    . GLU B 2 1  ? 1.195   -11.661 -4.963  1.00 15.00 ?  203 GLU B O    11 
ATOM 8786  C CB   . GLU B 2 1  ? 1.529   -8.598  -4.330  1.00 15.00 ?  203 GLU B CB   11 
ATOM 8787  C CG   . GLU B 2 1  ? 2.074   -7.187  -4.540  1.00 15.00 ?  203 GLU B CG   11 
ATOM 8788  C CD   . GLU B 2 1  ? 2.575   -6.945  -5.950  1.00 15.00 ?  203 GLU B CD   11 
ATOM 8789  O OE1  . GLU B 2 1  ? 1.765   -6.596  -6.829  1.00 15.00 -1 203 GLU B OE1  11 
ATOM 8790  O OE2  . GLU B 2 1  ? 3.783   -7.145  -6.192  1.00 15.00 ?  203 GLU B OE2  11 
ATOM 8791  H H1   . GLU B 2 1  ? 2.163   -9.938  -6.595  1.00 15.00 ?  203 GLU B H1   11 
ATOM 8792  H H2   . GLU B 2 1  ? 3.676   -10.541 -6.114  1.00 15.00 ?  203 GLU B H2   11 
ATOM 8793  H H3   . GLU B 2 1  ? 3.432   -8.865  -6.244  1.00 15.00 ?  203 GLU B H3   11 
ATOM 8794  H HA   . GLU B 2 1  ? 3.424   -9.553  -3.945  1.00 15.00 ?  203 GLU B HA   11 
ATOM 8795  H HB2  . GLU B 2 1  ? 0.696   -8.738  -4.999  1.00 15.00 ?  203 GLU B HB2  11 
ATOM 8796  H HB3  . GLU B 2 1  ? 1.170   -8.668  -3.313  1.00 15.00 ?  203 GLU B HB3  11 
ATOM 8797  H HG2  . GLU B 2 1  ? 1.287   -6.478  -4.330  1.00 15.00 ?  203 GLU B HG2  11 
ATOM 8798  H HG3  . GLU B 2 1  ? 2.893   -7.026  -3.851  1.00 15.00 ?  203 GLU B HG3  11 
ATOM 8799  N N    . LEU B 2 2  ? 2.264   -11.551 -2.987  1.00 15.00 ?  204 LEU B N    11 
ATOM 8800  C CA   . LEU B 2 2  ? 1.733   -12.823 -2.503  1.00 15.00 ?  204 LEU B CA   11 
ATOM 8801  C C    . LEU B 2 2  ? 0.222   -12.721 -2.312  1.00 15.00 ?  204 LEU B C    11 
ATOM 8802  O O    . LEU B 2 2  ? -0.497  -13.722 -2.325  1.00 15.00 ?  204 LEU B O    11 
ATOM 8803  C CB   . LEU B 2 2  ? 2.414   -13.219 -1.188  1.00 15.00 ?  204 LEU B CB   11 
ATOM 8804  C CG   . LEU B 2 2  ? 2.011   -14.582 -0.620  1.00 15.00 ?  204 LEU B CG   11 
ATOM 8805  C CD1  . LEU B 2 2  ? 2.407   -15.698 -1.574  1.00 15.00 ?  204 LEU B CD1  11 
ATOM 8806  C CD2  . LEU B 2 2  ? 2.645   -14.793 0.747   1.00 15.00 ?  204 LEU B CD2  11 
ATOM 8807  H H    . LEU B 2 2  ? 2.878   -11.037 -2.411  1.00 15.00 ?  204 LEU B H    11 
ATOM 8808  H HA   . LEU B 2 2  ? 1.941   -13.576 -3.250  1.00 15.00 ?  204 LEU B HA   11 
ATOM 8809  H HB2  . LEU B 2 2  ? 3.483   -13.224 -1.350  1.00 15.00 ?  204 LEU B HB2  11 
ATOM 8810  H HB3  . LEU B 2 2  ? 2.185   -12.466 -0.449  1.00 15.00 ?  204 LEU B HB3  11 
ATOM 8811  H HG   . LEU B 2 2  ? 0.938   -14.611 -0.501  1.00 15.00 ?  204 LEU B HG   11 
ATOM 8812  H HD11 . LEU B 2 2  ? 1.908   -15.556 -2.521  1.00 15.00 ?  204 LEU B HD11 11 
ATOM 8813  H HD12 . LEU B 2 2  ? 2.118   -16.651 -1.155  1.00 15.00 ?  204 LEU B HD12 11 
ATOM 8814  H HD13 . LEU B 2 2  ? 3.475   -15.680 -1.724  1.00 15.00 ?  204 LEU B HD13 11 
ATOM 8815  H HD21 . LEU B 2 2  ? 3.720   -14.758 0.654   1.00 15.00 ?  204 LEU B HD21 11 
ATOM 8816  H HD22 . LEU B 2 2  ? 2.349   -15.755 1.137   1.00 15.00 ?  204 LEU B HD22 11 
ATOM 8817  H HD23 . LEU B 2 2  ? 2.316   -14.015 1.421   1.00 15.00 ?  204 LEU B HD23 11 
ATOM 8818  N N    . GLU B 2 3  ? -0.242  -11.498 -2.124  1.00 15.00 ?  205 GLU B N    11 
ATOM 8819  C CA   . GLU B 2 3  ? -1.658  -11.216 -1.981  1.00 15.00 ?  205 GLU B CA   11 
ATOM 8820  C C    . GLU B 2 3  ? -2.231  -10.811 -3.340  1.00 15.00 ?  205 GLU B C    11 
ATOM 8821  O O    . GLU B 2 3  ? -1.480  -10.491 -4.266  1.00 15.00 ?  205 GLU B O    11 
ATOM 8822  C CB   . GLU B 2 3  ? -1.849  -10.101 -0.936  1.00 15.00 ?  205 GLU B CB   11 
ATOM 8823  C CG   . GLU B 2 3  ? -3.297  -9.721  -0.651  1.00 15.00 ?  205 GLU B CG   11 
ATOM 8824  C CD   . GLU B 2 3  ? -4.159  -10.903 -0.253  1.00 15.00 ?  205 GLU B CD   11 
ATOM 8825  O OE1  . GLU B 2 3  ? -4.168  -11.272 0.940   1.00 15.00 ?  205 GLU B OE1  11 
ATOM 8826  O OE2  . GLU B 2 3  ? -4.846  -11.461 -1.134  1.00 15.00 -1 205 GLU B OE2  11 
ATOM 8827  H H    . GLU B 2 3  ? 0.392   -10.756 -2.094  1.00 15.00 ?  205 GLU B H    11 
ATOM 8828  H HA   . GLU B 2 3  ? -2.149  -12.115 -1.641  1.00 15.00 ?  205 GLU B HA   11 
ATOM 8829  H HB2  . GLU B 2 3  ? -1.401  -10.420 -0.007  1.00 15.00 ?  205 GLU B HB2  11 
ATOM 8830  H HB3  . GLU B 2 3  ? -1.333  -9.216  -1.281  1.00 15.00 ?  205 GLU B HB3  11 
ATOM 8831  H HG2  . GLU B 2 3  ? -3.315  -9.001  0.152   1.00 15.00 ?  205 GLU B HG2  11 
ATOM 8832  H HG3  . GLU B 2 3  ? -3.718  -9.274  -1.542  1.00 15.00 ?  205 GLU B HG3  11 
ATOM 8833  N N    . SER B 2 4  ? -3.553  -10.836 -3.445  1.00 15.00 ?  206 SER B N    11 
ATOM 8834  C CA   . SER B 2 4  ? -4.265  -10.426 -4.648  1.00 15.00 ?  206 SER B CA   11 
ATOM 8835  C C    . SER B 2 4  ? -3.792  -9.080  -5.173  1.00 15.00 ?  206 SER B C    11 
ATOM 8836  O O    . SER B 2 4  ? -3.344  -8.207  -4.432  1.00 15.00 ?  206 SER B O    11 
ATOM 8837  C CB   . SER B 2 4  ? -5.758  -10.389 -4.367  1.00 15.00 ?  206 SER B CB   11 
ATOM 8838  O OG   . SER B 2 4  ? -6.028  -9.935  -3.045  1.00 15.00 ?  206 SER B OG   11 
ATOM 8839  H H    . SER B 2 4  ? -4.078  -11.141 -2.669  1.00 15.00 ?  206 SER B H    11 
ATOM 8840  H HA   . SER B 2 4  ? -4.098  -11.156 -5.429  1.00 15.00 ?  206 SER B HA   11 
ATOM 8841  H HB2  . SER B 2 4  ? -6.226  -9.720  -5.073  1.00 15.00 ?  206 SER B HB2  11 
ATOM 8842  H HB3  . SER B 2 4  ? -6.158  -11.380 -4.495  1.00 15.00 ?  206 SER B HB3  11 
ATOM 8843  H HG   . SER B 2 4  ? -5.740  -10.607 -2.407  1.00 15.00 ?  206 SER B HG   11 
ATOM 8844  N N    . PRO B 2 5  ? -3.935  -8.942  -6.484  1.00 15.00 ?  207 PRO B N    11 
ATOM 8845  C CA   . PRO B 2 5  ? -3.523  -7.765  -7.251  1.00 15.00 ?  207 PRO B CA   11 
ATOM 8846  C C    . PRO B 2 5  ? -4.008  -6.462  -6.617  1.00 15.00 ?  207 PRO B C    11 
ATOM 8847  O O    . PRO B 2 5  ? -5.207  -6.285  -6.393  1.00 15.00 ?  207 PRO B O    11 
ATOM 8848  C CB   . PRO B 2 5  ? -4.216  -7.975  -8.602  1.00 15.00 ?  207 PRO B CB   11 
ATOM 8849  C CG   . PRO B 2 5  ? -4.456  -9.447  -8.712  1.00 15.00 ?  207 PRO B CG   11 
ATOM 8850  C CD   . PRO B 2 5  ? -4.498  -9.999  -7.311  1.00 15.00 ?  207 PRO B CD   11 
ATOM 8851  H HA   . PRO B 2 5  ? -2.457  -7.737  -7.393  1.00 15.00 ?  207 PRO B HA   11 
ATOM 8852  H HB2  . PRO B 2 5  ? -5.146  -7.422  -8.618  1.00 15.00 ?  207 PRO B HB2  11 
ATOM 8853  H HB3  . PRO B 2 5  ? -3.572  -7.622  -9.394  1.00 15.00 ?  207 PRO B HB3  11 
ATOM 8854  H HG2  . PRO B 2 5  ? -5.398  -9.626  -9.207  1.00 15.00 ?  207 PRO B HG2  11 
ATOM 8855  H HG3  . PRO B 2 5  ? -3.652  -9.905  -9.268  1.00 15.00 ?  207 PRO B HG3  11 
ATOM 8856  H HD2  . PRO B 2 5  ? -5.499  -10.220 -6.994  1.00 15.00 ?  207 PRO B HD2  11 
ATOM 8857  H HD3  . PRO B 2 5  ? -3.902  -10.889 -7.228  1.00 15.00 ?  207 PRO B HD3  11 
ATOM 8858  N N    . PRO B 2 6  ? -3.084  -5.537  -6.304  1.00 15.00 ?  208 PRO B N    11 
ATOM 8859  C CA   . PRO B 2 6  ? -3.415  -4.320  -5.577  1.00 15.00 ?  208 PRO B CA   11 
ATOM 8860  C C    . PRO B 2 6  ? -4.076  -3.247  -6.441  1.00 15.00 ?  208 PRO B C    11 
ATOM 8861  O O    . PRO B 2 6  ? -3.944  -3.239  -7.667  1.00 15.00 ?  208 PRO B O    11 
ATOM 8862  C CB   . PRO B 2 6  ? -2.064  -3.823  -5.040  1.00 15.00 ?  208 PRO B CB   11 
ATOM 8863  C CG   . PRO B 2 6  ? -1.021  -4.773  -5.541  1.00 15.00 ?  208 PRO B CG   11 
ATOM 8864  C CD   . PRO B 2 6  ? -1.652  -5.596  -6.626  1.00 15.00 ?  208 PRO B CD   11 
ATOM 8865  H HA   . PRO B 2 6  ? -4.065  -4.538  -4.742  1.00 15.00 ?  208 PRO B HA   11 
ATOM 8866  H HB2  . PRO B 2 6  ? -1.884  -2.821  -5.400  1.00 15.00 ?  208 PRO B HB2  11 
ATOM 8867  H HB3  . PRO B 2 6  ? -2.099  -3.817  -3.956  1.00 15.00 ?  208 PRO B HB3  11 
ATOM 8868  H HG2  . PRO B 2 6  ? -0.184  -4.219  -5.938  1.00 15.00 ?  208 PRO B HG2  11 
ATOM 8869  H HG3  . PRO B 2 6  ? -0.694  -5.411  -4.733  1.00 15.00 ?  208 PRO B HG3  11 
ATOM 8870  H HD2  . PRO B 2 6  ? -1.455  -5.159  -7.595  1.00 15.00 ?  208 PRO B HD2  11 
ATOM 8871  H HD3  . PRO B 2 6  ? -1.283  -6.607  -6.583  1.00 15.00 ?  208 PRO B HD3  11 
ATOM 8872  N N    . PRO B 2 7  ? -4.784  -2.321  -5.770  1.00 15.00 ?  209 PRO B N    11 
ATOM 8873  C CA   . PRO B 2 7  ? -5.449  -1.175  -6.401  1.00 15.00 ?  209 PRO B CA   11 
ATOM 8874  C C    . PRO B 2 7  ? -4.542  -0.406  -7.365  1.00 15.00 ?  209 PRO B C    11 
ATOM 8875  O O    . PRO B 2 7  ? -3.381  -0.152  -7.056  1.00 15.00 ?  209 PRO B O    11 
ATOM 8876  C CB   . PRO B 2 7  ? -5.774  -0.254  -5.218  1.00 15.00 ?  209 PRO B CB   11 
ATOM 8877  C CG   . PRO B 2 7  ? -5.680  -1.075  -3.980  1.00 15.00 ?  209 PRO B CG   11 
ATOM 8878  C CD   . PRO B 2 7  ? -5.031  -2.381  -4.324  1.00 15.00 ?  209 PRO B CD   11 
ATOM 8879  H HA   . PRO B 2 7  ? -6.361  -1.462  -6.901  1.00 15.00 ?  209 PRO B HA   11 
ATOM 8880  H HB2  . PRO B 2 7  ? -5.061  0.555   -5.195  1.00 15.00 ?  209 PRO B HB2  11 
ATOM 8881  H HB3  . PRO B 2 7  ? -6.762  0.150   -5.338  1.00 15.00 ?  209 PRO B HB3  11 
ATOM 8882  H HG2  . PRO B 2 7  ? -5.075  -0.554  -3.252  1.00 15.00 ?  209 PRO B HG2  11 
ATOM 8883  H HG3  . PRO B 2 7  ? -6.671  -1.246  -3.584  1.00 15.00 ?  209 PRO B HG3  11 
ATOM 8884  H HD2  . PRO B 2 7  ? -4.102  -2.488  -3.785  1.00 15.00 ?  209 PRO B HD2  11 
ATOM 8885  H HD3  . PRO B 2 7  ? -5.695  -3.199  -4.084  1.00 15.00 ?  209 PRO B HD3  11 
ATOM 8886  N N    . PRO B 2 8  ? -5.074  -0.016  -8.536  1.00 15.00 ?  210 PRO B N    11 
ATOM 8887  C CA   . PRO B 2 8  ? -4.346  0.830   -9.494  1.00 15.00 ?  210 PRO B CA   11 
ATOM 8888  C C    . PRO B 2 8  ? -3.879  2.123   -8.834  1.00 15.00 ?  210 PRO B C    11 
ATOM 8889  O O    . PRO B 2 8  ? -4.630  2.732   -8.069  1.00 15.00 ?  210 PRO B O    11 
ATOM 8890  C CB   . PRO B 2 8  ? -5.389  1.127   -10.576 1.00 15.00 ?  210 PRO B CB   11 
ATOM 8891  C CG   . PRO B 2 8  ? -6.379  0.019   -10.466 1.00 15.00 ?  210 PRO B CG   11 
ATOM 8892  C CD   . PRO B 2 8  ? -6.422  -0.357  -9.014  1.00 15.00 ?  210 PRO B CD   11 
ATOM 8893  H HA   . PRO B 2 8  ? -3.500  0.313   -9.925  1.00 15.00 ?  210 PRO B HA   11 
ATOM 8894  H HB2  . PRO B 2 8  ? -5.845  2.087   -10.384 1.00 15.00 ?  210 PRO B HB2  11 
ATOM 8895  H HB3  . PRO B 2 8  ? -4.914  1.136   -11.545 1.00 15.00 ?  210 PRO B HB3  11 
ATOM 8896  H HG2  . PRO B 2 8  ? -7.350  0.362   -10.794 1.00 15.00 ?  210 PRO B HG2  11 
ATOM 8897  H HG3  . PRO B 2 8  ? -6.056  -0.822  -11.063 1.00 15.00 ?  210 PRO B HG3  11 
ATOM 8898  H HD2  . PRO B 2 8  ? -7.174  0.219   -8.496  1.00 15.00 ?  210 PRO B HD2  11 
ATOM 8899  H HD3  . PRO B 2 8  ? -6.613  -1.414  -8.904  1.00 15.00 ?  210 PRO B HD3  11 
ATOM 8900  N N    . TYR B 2 9  ? -2.654  2.544   -9.129  1.00 15.00 ?  211 TYR B N    11 
ATOM 8901  C CA   . TYR B 2 9  ? -2.065  3.679   -8.434  1.00 15.00 ?  211 TYR B CA   11 
ATOM 8902  C C    . TYR B 2 9  ? -2.768  4.996   -8.758  1.00 15.00 ?  211 TYR B C    11 
ATOM 8903  O O    . TYR B 2 9  ? -2.487  5.665   -9.753  1.00 15.00 ?  211 TYR B O    11 
ATOM 8904  C CB   . TYR B 2 9  ? -0.555  3.797   -8.694  1.00 15.00 ?  211 TYR B CB   11 
ATOM 8905  C CG   . TYR B 2 9  ? 0.082   5.036   -8.073  1.00 15.00 ?  211 TYR B CG   11 
ATOM 8906  C CD1  . TYR B 2 9  ? -0.423  5.614   -6.906  1.00 15.00 ?  211 TYR B CD1  11 
ATOM 8907  C CD2  . TYR B 2 9  ? 1.180   5.643   -8.668  1.00 15.00 ?  211 TYR B CD2  11 
ATOM 8908  C CE1  . TYR B 2 9  ? 0.146   6.751   -6.368  1.00 15.00 ?  211 TYR B CE1  11 
ATOM 8909  C CE2  . TYR B 2 9  ? 1.752   6.775   -8.118  1.00 15.00 ?  211 TYR B CE2  11 
ATOM 8910  C CZ   . TYR B 2 9  ? 1.234   7.320   -6.984  1.00 15.00 ?  211 TYR B CZ   11 
ATOM 8911  O OH   . TYR B 2 9  ? 1.803   8.455   -6.474  1.00 15.00 ?  211 TYR B OH   11 
ATOM 8912  H H    . TYR B 2 9  ? -2.134  2.077   -9.823  1.00 15.00 ?  211 TYR B H    11 
ATOM 8913  H HA   . TYR B 2 9  ? -2.202  3.493   -7.380  1.00 15.00 ?  211 TYR B HA   11 
ATOM 8914  H HB2  . TYR B 2 9  ? -0.058  2.930   -8.283  1.00 15.00 ?  211 TYR B HB2  11 
ATOM 8915  H HB3  . TYR B 2 9  ? -0.382  3.833   -9.759  1.00 15.00 ?  211 TYR B HB3  11 
ATOM 8916  H HD1  . TYR B 2 9  ? -1.267  5.156   -6.410  1.00 15.00 ?  211 TYR B HD1  11 
ATOM 8917  H HD2  . TYR B 2 9  ? 1.593   5.215   -9.570  1.00 15.00 ?  211 TYR B HD2  11 
ATOM 8918  H HE1  . TYR B 2 9  ? -0.259  7.185   -5.465  1.00 15.00 ?  211 TYR B HE1  11 
ATOM 8919  H HE2  . TYR B 2 9  ? 2.612   7.229   -8.573  1.00 15.00 ?  211 TYR B HE2  11 
ATOM 8920  H HH   . TYR B 2 9  ? 2.019   9.055   -7.200  1.00 15.00 ?  211 TYR B HH   11 
ATOM 8921  N N    . SER B 2 10 ? -3.746  5.290   -7.934  1.00 15.00 ?  212 SER B N    11 
ATOM 8922  C CA   . SER B 2 10 ? -4.228  6.634   -7.720  1.00 15.00 ?  212 SER B CA   11 
ATOM 8923  C C    . SER B 2 10 ? -3.563  7.082   -6.430  1.00 15.00 ?  212 SER B C    11 
ATOM 8924  O O    . SER B 2 10 ? -3.271  6.227   -5.594  1.00 15.00 ?  212 SER B O    11 
ATOM 8925  C CB   . SER B 2 10 ? -5.755  6.645   -7.601  1.00 15.00 ?  212 SER B CB   11 
ATOM 8926  O OG   . SER B 2 10 ? -6.254  7.968   -7.514  1.00 15.00 ?  212 SER B OG   11 
ATOM 8927  H H    . SER B 2 10 ? -4.172  4.556   -7.438  1.00 15.00 ?  212 SER B H    11 
ATOM 8928  H HA   . SER B 2 10 ? -3.904  7.259   -8.540  1.00 15.00 ?  212 SER B HA   11 
ATOM 8929  H HB2  . SER B 2 10 ? -6.184  6.168   -8.469  1.00 15.00 ?  212 SER B HB2  11 
ATOM 8930  H HB3  . SER B 2 10 ? -6.046  6.104   -6.713  1.00 15.00 ?  212 SER B HB3  11 
ATOM 8931  H HG   . SER B 2 10 ? -7.054  7.969   -6.961  1.00 15.00 ?  212 SER B HG   11 
ATOM 8932  N N    . ARG B 2 11 ? -3.300  8.370   -6.247  1.00 15.00 ?  213 ARG B N    11 
ATOM 8933  C CA   . ARG B 2 11 ? -2.463  8.789   -5.124  1.00 15.00 ?  213 ARG B CA   11 
ATOM 8934  C C    . ARG B 2 11 ? -3.104  8.342   -3.820  1.00 15.00 ?  213 ARG B C    11 
ATOM 8935  O O    . ARG B 2 11 ? -2.457  7.716   -2.981  1.00 15.00 ?  213 ARG B O    11 
ATOM 8936  C CB   . ARG B 2 11 ? -2.273  10.311  -5.071  1.00 15.00 ?  213 ARG B CB   11 
ATOM 8937  C CG   . ARG B 2 11 ? -2.026  10.980  -6.405  1.00 15.00 ?  213 ARG B CG   11 
ATOM 8938  C CD   . ARG B 2 11 ? -0.857  10.352  -7.144  1.00 15.00 ?  213 ARG B CD   11 
ATOM 8939  N NE   . ARG B 2 11 ? -0.705  10.888  -8.495  1.00 15.00 ?  213 ARG B NE   11 
ATOM 8940  C CZ   . ARG B 2 11 ? 0.424   11.420  -8.958  1.00 15.00 ?  213 ARG B CZ   11 
ATOM 8941  N NH1  . ARG B 2 11 ? 1.461   11.583  -8.145  1.00 15.00 1  213 ARG B NH1  11 
ATOM 8942  N NH2  . ARG B 2 11 ? 0.511   11.813  -10.222 1.00 15.00 ?  213 ARG B NH2  11 
ATOM 8943  H H    . ARG B 2 11 ? -3.679  9.038   -6.854  1.00 15.00 ?  213 ARG B H    11 
ATOM 8944  H HA   . ARG B 2 11 ? -1.500  8.310   -5.227  1.00 15.00 ?  213 ARG B HA   11 
ATOM 8945  H HB2  . ARG B 2 11 ? -3.161  10.750  -4.641  1.00 15.00 ?  213 ARG B HB2  11 
ATOM 8946  H HB3  . ARG B 2 11 ? -1.435  10.529  -4.426  1.00 15.00 ?  213 ARG B HB3  11 
ATOM 8947  H HG2  . ARG B 2 11 ? -2.915  10.900  -7.001  1.00 15.00 ?  213 ARG B HG2  11 
ATOM 8948  H HG3  . ARG B 2 11 ? -1.808  12.023  -6.229  1.00 15.00 ?  213 ARG B HG3  11 
ATOM 8949  H HD2  . ARG B 2 11 ? 0.047   10.546  -6.588  1.00 15.00 ?  213 ARG B HD2  11 
ATOM 8950  H HD3  . ARG B 2 11 ? -1.018  9.286   -7.206  1.00 15.00 ?  213 ARG B HD3  11 
ATOM 8951  H HE   . ARG B 2 11 ? -1.487  10.821  -9.098  1.00 15.00 ?  213 ARG B HE   11 
ATOM 8952  H HH11 . ARG B 2 11 ? 1.399   11.311  -7.183  1.00 15.00 ?  213 ARG B HH11 11 
ATOM 8953  H HH12 . ARG B 2 11 ? 2.317   11.986  -8.494  1.00 15.00 ?  213 ARG B HH12 11 
ATOM 8954  H HH21 . ARG B 2 11 ? -0.275  11.708  -10.843 1.00 15.00 ?  213 ARG B HH21 11 
ATOM 8955  H HH22 . ARG B 2 11 ? 1.367   12.208  -10.571 1.00 15.00 ?  213 ARG B HH22 11 
ATOM 8956  N N    . TYR B 2 12 ? -4.364  8.693   -3.648  1.00 15.00 ?  214 TYR B N    11 
ATOM 8957  C CA   . TYR B 2 12 ? -5.129  8.254   -2.496  1.00 15.00 ?  214 TYR B CA   11 
ATOM 8958  C C    . TYR B 2 12 ? -6.342  7.459   -2.958  1.00 15.00 ?  214 TYR B C    11 
ATOM 8959  O O    . TYR B 2 12 ? -7.432  8.009   -3.123  1.00 15.00 ?  214 TYR B O    11 
ATOM 8960  C CB   . TYR B 2 12 ? -5.534  9.464   -1.641  1.00 15.00 ?  214 TYR B CB   11 
ATOM 8961  C CG   . TYR B 2 12 ? -4.402  10.455  -1.464  1.00 15.00 ?  214 TYR B CG   11 
ATOM 8962  C CD1  . TYR B 2 12 ? -4.022  11.290  -2.511  1.00 15.00 ?  214 TYR B CD1  11 
ATOM 8963  C CD2  . TYR B 2 12 ? -3.686  10.528  -0.279  1.00 15.00 ?  214 TYR B CD2  11 
ATOM 8964  C CE1  . TYR B 2 12 ? -2.970  12.165  -2.387  1.00 15.00 ?  214 TYR B CE1  11 
ATOM 8965  C CE2  . TYR B 2 12 ? -2.630  11.412  -0.140  1.00 15.00 ?  214 TYR B CE2  11 
ATOM 8966  C CZ   . TYR B 2 12 ? -2.273  12.226  -1.200  1.00 15.00 ?  214 TYR B CZ   11 
ATOM 8967  O OH   . TYR B 2 12 ? -1.217  13.101  -1.070  1.00 15.00 ?  214 TYR B OH   11 
ATOM 8968  H H    . TYR B 2 12 ? -4.802  9.263   -4.324  1.00 15.00 ?  214 TYR B H    11 
ATOM 8969  H HA   . TYR B 2 12 ? -4.498  7.592   -1.910  1.00 15.00 ?  214 TYR B HA   11 
ATOM 8970  H HB2  . TYR B 2 12 ? -6.359  9.976   -2.115  1.00 15.00 ?  214 TYR B HB2  11 
ATOM 8971  H HB3  . TYR B 2 12 ? -5.838  9.123   -0.662  1.00 15.00 ?  214 TYR B HB3  11 
ATOM 8972  H HD1  . TYR B 2 12 ? -4.569  11.243  -3.441  1.00 15.00 ?  214 TYR B HD1  11 
ATOM 8973  H HD2  . TYR B 2 12 ? -3.968  9.891   0.546   1.00 15.00 ?  214 TYR B HD2  11 
ATOM 8974  H HE1  . TYR B 2 12 ? -2.692  12.792  -3.229  1.00 15.00 ?  214 TYR B HE1  11 
ATOM 8975  H HE2  . TYR B 2 12 ? -2.085  11.458  0.790   1.00 15.00 ?  214 TYR B HE2  11 
ATOM 8976  H HH   . TYR B 2 12 ? -1.490  13.975  -1.387  1.00 15.00 ?  214 TYR B HH   11 
ATOM 8977  N N    . PRO B 2 13 ? -6.147  6.170   -3.248  1.00 15.00 ?  215 PRO B N    11 
ATOM 8978  C CA   . PRO B 2 13 ? -7.212  5.309   -3.757  1.00 15.00 ?  215 PRO B CA   11 
ATOM 8979  C C    . PRO B 2 13 ? -8.164  4.841   -2.663  1.00 15.00 ?  215 PRO B C    11 
ATOM 8980  O O    . PRO B 2 13 ? -7.737  4.319   -1.634  1.00 15.00 ?  215 PRO B O    11 
ATOM 8981  C CB   . PRO B 2 13 ? -6.448  4.126   -4.351  1.00 15.00 ?  215 PRO B CB   11 
ATOM 8982  C CG   . PRO B 2 13 ? -5.170  4.058   -3.583  1.00 15.00 ?  215 PRO B CG   11 
ATOM 8983  C CD   . PRO B 2 13 ? -4.861  5.453   -3.121  1.00 15.00 ?  215 PRO B CD   11 
ATOM 8984  H HA   . PRO B 2 13 ? -7.777  5.801   -4.534  1.00 15.00 ?  215 PRO B HA   11 
ATOM 8985  H HB2  . PRO B 2 13 ? -7.029  3.223   -4.229  1.00 15.00 ?  215 PRO B HB2  11 
ATOM 8986  H HB3  . PRO B 2 13 ? -6.267  4.303   -5.401  1.00 15.00 ?  215 PRO B HB3  11 
ATOM 8987  H HG2  . PRO B 2 13 ? -5.287  3.406   -2.729  1.00 15.00 ?  215 PRO B HG2  11 
ATOM 8988  H HG3  . PRO B 2 13 ? -4.380  3.695   -4.224  1.00 15.00 ?  215 PRO B HG3  11 
ATOM 8989  H HD2  . PRO B 2 13 ? -4.527  5.440   -2.089  1.00 15.00 ?  215 PRO B HD2  11 
ATOM 8990  H HD3  . PRO B 2 13 ? -4.110  5.900   -3.755  1.00 15.00 ?  215 PRO B HD3  11 
ATOM 8991  N N    . MET B 2 14 ? -9.453  5.050   -2.873  1.00 15.00 ?  216 MET B N    11 
ATOM 8992  C CA   . MET B 2 14 ? -10.454 4.540   -1.951  1.00 15.00 ?  216 MET B CA   11 
ATOM 8993  C C    . MET B 2 14 ? -10.733 3.078   -2.269  1.00 15.00 ?  216 MET B C    11 
ATOM 8994  O O    . MET B 2 14 ? -11.452 2.774   -3.224  1.00 15.00 ?  216 MET B O    11 
ATOM 8995  C CB   . MET B 2 14 ? -11.748 5.354   -2.030  1.00 15.00 ?  216 MET B CB   11 
ATOM 8996  C CG   . MET B 2 14 ? -12.746 5.019   -0.934  1.00 15.00 ?  216 MET B CG   11 
ATOM 8997  S SD   . MET B 2 14 ? -12.136 5.454   0.708   1.00 15.00 ?  216 MET B SD   11 
ATOM 8998  C CE   . MET B 2 14 ? -11.989 7.234   0.552   1.00 15.00 ?  216 MET B CE   11 
ATOM 8999  H H    . MET B 2 14 ? -9.740  5.561   -3.661  1.00 15.00 ?  216 MET B H    11 
ATOM 9000  H HA   . MET B 2 14 ? -10.050 4.609   -0.951  1.00 15.00 ?  216 MET B HA   11 
ATOM 9001  H HB2  . MET B 2 14 ? -11.504 6.403   -1.957  1.00 15.00 ?  216 MET B HB2  11 
ATOM 9002  H HB3  . MET B 2 14 ? -12.219 5.170   -2.984  1.00 15.00 ?  216 MET B HB3  11 
ATOM 9003  H HG2  . MET B 2 14 ? -13.660 5.565   -1.119  1.00 15.00 ?  216 MET B HG2  11 
ATOM 9004  H HG3  . MET B 2 14 ? -12.948 3.958   -0.960  1.00 15.00 ?  216 MET B HG3  11 
ATOM 9005  H HE1  . MET B 2 14 ? -11.299 7.471   -0.244  1.00 15.00 ?  216 MET B HE1  11 
ATOM 9006  H HE2  . MET B 2 14 ? -11.624 7.649   1.480   1.00 15.00 ?  216 MET B HE2  11 
ATOM 9007  H HE3  . MET B 2 14 ? -12.957 7.657   0.326   1.00 15.00 ?  216 MET B HE3  11 
ATOM 9008  N N    . ASP B 2 15 ? -10.111 2.193   -1.493  1.00 15.00 ?  217 ASP B N    11 
ATOM 9009  C CA   . ASP B 2 15 ? -10.212 0.745   -1.694  1.00 15.00 ?  217 ASP B CA   11 
ATOM 9010  C C    . ASP B 2 15 ? -9.748  0.369   -3.099  1.00 15.00 ?  217 ASP B C    11 
ATOM 9011  O O    . ASP B 2 15 ? -10.601 0.092   -3.969  1.00 15.00 ?  217 ASP B O    11 
ATOM 9012  C CB   . ASP B 2 15 ? -11.644 0.251   -1.439  1.00 15.00 ?  217 ASP B CB   11 
ATOM 9013  C CG   . ASP B 2 15 ? -11.765 -1.264  -1.483  1.00 15.00 ?  217 ASP B CG   11 
ATOM 9014  O OD1  . ASP B 2 15 ? -11.389 -1.931  -0.497  1.00 15.00 -1 217 ASP B OD1  11 
ATOM 9015  O OD2  . ASP B 2 15 ? -12.262 -1.801  -2.496  1.00 15.00 ?  217 ASP B OD2  11 
ATOM 9016  O OXT  . ASP B 2 15 ? -8.523  0.386   -3.337  1.00 15.00 ?  217 ASP B OXT  11 
ATOM 9017  H H    . ASP B 2 15 ? -9.546  2.523   -0.766  1.00 15.00 ?  217 ASP B H    11 
ATOM 9018  H HA   . ASP B 2 15 ? -9.552  0.273   -0.980  1.00 15.00 ?  217 ASP B HA   11 
ATOM 9019  H HB2  . ASP B 2 15 ? -11.966 0.588   -0.465  1.00 15.00 ?  217 ASP B HB2  11 
ATOM 9020  H HB3  . ASP B 2 15 ? -12.299 0.667   -2.192  1.00 15.00 ?  217 ASP B HB3  11 
ATOM 9021  N N    . GLY A 1 1  ? 5.180   1.168   13.989  1.00 15.00 ?  297 GLY A N    12 
ATOM 9022  C CA   . GLY A 1 1  ? 6.224   1.646   13.054  1.00 15.00 ?  297 GLY A CA   12 
ATOM 9023  C C    . GLY A 1 1  ? 5.882   3.000   12.475  1.00 15.00 ?  297 GLY A C    12 
ATOM 9024  O O    . GLY A 1 1  ? 4.752   3.218   12.034  1.00 15.00 ?  297 GLY A O    12 
ATOM 9025  H H1   . GLY A 1 1  ? 5.471   0.265   14.424  1.00 15.00 ?  297 GLY A H1   12 
ATOM 9026  H H2   . GLY A 1 1  ? 4.288   1.016   13.478  1.00 15.00 ?  297 GLY A H2   12 
ATOM 9027  H H3   . GLY A 1 1  ? 5.022   1.871   14.741  1.00 15.00 ?  297 GLY A H3   12 
ATOM 9028  H HA2  . GLY A 1 1  ? 7.163   1.717   13.582  1.00 15.00 ?  297 GLY A HA2  12 
ATOM 9029  H HA3  . GLY A 1 1  ? 6.325   0.935   12.248  1.00 15.00 ?  297 GLY A HA3  12 
ATOM 9030  N N    . PRO A 1 2  ? 6.835   3.942   12.481  1.00 15.00 ?  298 PRO A N    12 
ATOM 9031  C CA   . PRO A 1 2  ? 6.610   5.290   11.955  1.00 15.00 ?  298 PRO A CA   12 
ATOM 9032  C C    . PRO A 1 2  ? 6.414   5.285   10.432  1.00 15.00 ?  298 PRO A C    12 
ATOM 9033  O O    . PRO A 1 2  ? 7.238   4.718   9.707   1.00 15.00 ?  298 PRO A O    12 
ATOM 9034  C CB   . PRO A 1 2  ? 7.898   6.035   12.319  1.00 15.00 ?  298 PRO A CB   12 
ATOM 9035  C CG   . PRO A 1 2  ? 8.929   4.973   12.478  1.00 15.00 ?  298 PRO A CG   12 
ATOM 9036  C CD   . PRO A 1 2  ? 8.201   3.768   13.005  1.00 15.00 ?  298 PRO A CD   12 
ATOM 9037  H HA   . PRO A 1 2  ? 5.771   5.762   12.444  1.00 15.00 ?  298 PRO A HA   12 
ATOM 9038  H HB2  . PRO A 1 2  ? 8.155   6.720   11.524  1.00 15.00 ?  298 PRO A HB2  12 
ATOM 9039  H HB3  . PRO A 1 2  ? 7.753   6.582   13.239  1.00 15.00 ?  298 PRO A HB3  12 
ATOM 9040  H HG2  . PRO A 1 2  ? 9.380   4.752   11.521  1.00 15.00 ?  298 PRO A HG2  12 
ATOM 9041  H HG3  . PRO A 1 2  ? 9.681   5.294   13.184  1.00 15.00 ?  298 PRO A HG3  12 
ATOM 9042  H HD2  . PRO A 1 2  ? 8.649   2.861   12.624  1.00 15.00 ?  298 PRO A HD2  12 
ATOM 9043  H HD3  . PRO A 1 2  ? 8.204   3.769   14.084  1.00 15.00 ?  298 PRO A HD3  12 
ATOM 9044  N N    . LEU A 1 3  ? 5.331   5.899   9.944   1.00 15.00 ?  299 LEU A N    12 
ATOM 9045  C CA   . LEU A 1 3  ? 5.097   5.996   8.509   1.00 15.00 ?  299 LEU A CA   12 
ATOM 9046  C C    . LEU A 1 3  ? 6.175   6.864   7.866   1.00 15.00 ?  299 LEU A C    12 
ATOM 9047  O O    . LEU A 1 3  ? 6.344   8.025   8.245   1.00 15.00 ?  299 LEU A O    12 
ATOM 9048  C CB   . LEU A 1 3  ? 3.716   6.602   8.238   1.00 15.00 ?  299 LEU A CB   12 
ATOM 9049  C CG   . LEU A 1 3  ? 3.319   6.679   6.761   1.00 15.00 ?  299 LEU A CG   12 
ATOM 9050  C CD1  . LEU A 1 3  ? 3.024   5.290   6.214   1.00 15.00 ?  299 LEU A CD1  12 
ATOM 9051  C CD2  . LEU A 1 3  ? 2.118   7.594   6.584   1.00 15.00 ?  299 LEU A CD2  12 
ATOM 9052  H H    . LEU A 1 3  ? 4.673   6.294   10.557  1.00 15.00 ?  299 LEU A H    12 
ATOM 9053  H HA   . LEU A 1 3  ? 5.140   5.004   8.090   1.00 15.00 ?  299 LEU A HA   12 
ATOM 9054  H HB2  . LEU A 1 3  ? 2.977   6.008   8.755   1.00 15.00 ?  299 LEU A HB2  12 
ATOM 9055  H HB3  . LEU A 1 3  ? 3.696   7.604   8.644   1.00 15.00 ?  299 LEU A HB3  12 
ATOM 9056  H HG   . LEU A 1 3  ? 4.141   7.092   6.194   1.00 15.00 ?  299 LEU A HG   12 
ATOM 9057  H HD11 . LEU A 1 3  ? 2.099   4.929   6.635   1.00 15.00 ?  299 LEU A HD11 12 
ATOM 9058  H HD12 . LEU A 1 3  ? 3.822   4.617   6.488   1.00 15.00 ?  299 LEU A HD12 12 
ATOM 9059  H HD13 . LEU A 1 3  ? 2.940   5.334   5.138   1.00 15.00 ?  299 LEU A HD13 12 
ATOM 9060  H HD21 . LEU A 1 3  ? 1.849   7.640   5.538   1.00 15.00 ?  299 LEU A HD21 12 
ATOM 9061  H HD22 . LEU A 1 3  ? 2.366   8.585   6.936   1.00 15.00 ?  299 LEU A HD22 12 
ATOM 9062  H HD23 . LEU A 1 3  ? 1.284   7.210   7.153   1.00 15.00 ?  299 LEU A HD23 12 
ATOM 9063  N N    . PRO A 1 4  ? 6.922   6.321   6.889   1.00 15.00 ?  300 PRO A N    12 
ATOM 9064  C CA   . PRO A 1 4  ? 7.992   7.066   6.216   1.00 15.00 ?  300 PRO A CA   12 
ATOM 9065  C C    . PRO A 1 4  ? 7.433   8.214   5.371   1.00 15.00 ?  300 PRO A C    12 
ATOM 9066  O O    . PRO A 1 4  ? 6.386   8.074   4.740   1.00 15.00 ?  300 PRO A O    12 
ATOM 9067  C CB   . PRO A 1 4  ? 8.665   6.013   5.323   1.00 15.00 ?  300 PRO A CB   12 
ATOM 9068  C CG   . PRO A 1 4  ? 8.167   4.693   5.816   1.00 15.00 ?  300 PRO A CG   12 
ATOM 9069  C CD   . PRO A 1 4  ? 6.790   4.956   6.346   1.00 15.00 ?  300 PRO A CD   12 
ATOM 9070  H HA   . PRO A 1 4  ? 8.707   7.458   6.925   1.00 15.00 ?  300 PRO A HA   12 
ATOM 9071  H HB2  . PRO A 1 4  ? 8.383   6.182   4.298   1.00 15.00 ?  300 PRO A HB2  12 
ATOM 9072  H HB3  . PRO A 1 4  ? 9.737   6.089   5.421   1.00 15.00 ?  300 PRO A HB3  12 
ATOM 9073  H HG2  . PRO A 1 4  ? 8.127   3.987   4.999   1.00 15.00 ?  300 PRO A HG2  12 
ATOM 9074  H HG3  . PRO A 1 4  ? 8.810   4.326   6.602   1.00 15.00 ?  300 PRO A HG3  12 
ATOM 9075  H HD2  . PRO A 1 4  ? 6.066   4.926   5.544   1.00 15.00 ?  300 PRO A HD2  12 
ATOM 9076  H HD3  . PRO A 1 4  ? 6.533   4.241   7.117   1.00 15.00 ?  300 PRO A HD3  12 
ATOM 9077  N N    . PRO A 1 5  ? 8.143   9.357   5.326   1.00 15.00 ?  301 PRO A N    12 
ATOM 9078  C CA   . PRO A 1 5  ? 7.671   10.577  4.642   1.00 15.00 ?  301 PRO A CA   12 
ATOM 9079  C C    . PRO A 1 5  ? 7.446   10.396  3.135   1.00 15.00 ?  301 PRO A C    12 
ATOM 9080  O O    . PRO A 1 5  ? 6.787   11.220  2.494   1.00 15.00 ?  301 PRO A O    12 
ATOM 9081  C CB   . PRO A 1 5  ? 8.793   11.592  4.890   1.00 15.00 ?  301 PRO A CB   12 
ATOM 9082  C CG   . PRO A 1 5  ? 9.561   11.052  6.048   1.00 15.00 ?  301 PRO A CG   12 
ATOM 9083  C CD   . PRO A 1 5  ? 9.463   9.559   5.946   1.00 15.00 ?  301 PRO A CD   12 
ATOM 9084  H HA   . PRO A 1 5  ? 6.758   10.940  5.090   1.00 15.00 ?  301 PRO A HA   12 
ATOM 9085  H HB2  . PRO A 1 5  ? 9.411   11.671  4.008   1.00 15.00 ?  301 PRO A HB2  12 
ATOM 9086  H HB3  . PRO A 1 5  ? 8.362   12.557  5.120   1.00 15.00 ?  301 PRO A HB3  12 
ATOM 9087  H HG2  . PRO A 1 5  ? 10.593  11.367  5.984   1.00 15.00 ?  301 PRO A HG2  12 
ATOM 9088  H HG3  . PRO A 1 5  ? 9.120   11.394  6.972   1.00 15.00 ?  301 PRO A HG3  12 
ATOM 9089  H HD2  . PRO A 1 5  ? 10.250  9.168   5.317   1.00 15.00 ?  301 PRO A HD2  12 
ATOM 9090  H HD3  . PRO A 1 5  ? 9.502   9.107   6.927   1.00 15.00 ?  301 PRO A HD3  12 
ATOM 9091  N N    . GLY A 1 6  ? 8.025   9.345   2.573   1.00 15.00 ?  302 GLY A N    12 
ATOM 9092  C CA   . GLY A 1 6  ? 7.848   9.061   1.157   1.00 15.00 ?  302 GLY A CA   12 
ATOM 9093  C C    . GLY A 1 6  ? 6.758   8.037   0.907   1.00 15.00 ?  302 GLY A C    12 
ATOM 9094  O O    . GLY A 1 6  ? 6.290   7.868   -0.221  1.00 15.00 ?  302 GLY A O    12 
ATOM 9095  H H    . GLY A 1 6  ? 8.589   8.762   3.120   1.00 15.00 ?  302 GLY A H    12 
ATOM 9096  H HA2  . GLY A 1 6  ? 7.592   9.977   0.646   1.00 15.00 ?  302 GLY A HA2  12 
ATOM 9097  H HA3  . GLY A 1 6  ? 8.778   8.685   0.757   1.00 15.00 ?  302 GLY A HA3  12 
ATOM 9098  N N    . TRP A 1 7  ? 6.364   7.352   1.967   1.00 15.00 ?  303 TRP A N    12 
ATOM 9099  C CA   . TRP A 1 7  ? 5.438   6.239   1.877   1.00 15.00 ?  303 TRP A CA   12 
ATOM 9100  C C    . TRP A 1 7  ? 4.006   6.668   2.139   1.00 15.00 ?  303 TRP A C    12 
ATOM 9101  O O    . TRP A 1 7  ? 3.763   7.595   2.911   1.00 15.00 ?  303 TRP A O    12 
ATOM 9102  C CB   . TRP A 1 7  ? 5.811   5.173   2.885   1.00 15.00 ?  303 TRP A CB   12 
ATOM 9103  C CG   . TRP A 1 7  ? 6.836   4.227   2.382   1.00 15.00 ?  303 TRP A CG   12 
ATOM 9104  C CD1  . TRP A 1 7  ? 8.180   4.434   2.293   1.00 15.00 ?  303 TRP A CD1  12 
ATOM 9105  C CD2  . TRP A 1 7  ? 6.593   2.912   1.894   1.00 15.00 ?  303 TRP A CD2  12 
ATOM 9106  N NE1  . TRP A 1 7  ? 8.790   3.315   1.798   1.00 15.00 ?  303 TRP A NE1  12 
ATOM 9107  C CE2  . TRP A 1 7  ? 7.830   2.371   1.545   1.00 15.00 ?  303 TRP A CE2  12 
ATOM 9108  C CE3  . TRP A 1 7  ? 5.448   2.132   1.722   1.00 15.00 ?  303 TRP A CE3  12 
ATOM 9109  C CZ2  . TRP A 1 7  ? 7.956   1.094   1.044   1.00 15.00 ?  303 TRP A CZ2  12 
ATOM 9110  C CZ3  . TRP A 1 7  ? 5.585   0.860   1.220   1.00 15.00 ?  303 TRP A CZ3  12 
ATOM 9111  C CH2  . TRP A 1 7  ? 6.829   0.350   0.886   1.00 15.00 ?  303 TRP A CH2  12 
ATOM 9112  H H    . TRP A 1 7  ? 6.680   7.627   2.854   1.00 15.00 ?  303 TRP A H    12 
ATOM 9113  H HA   . TRP A 1 7  ? 5.519   5.826   0.883   1.00 15.00 ?  303 TRP A HA   12 
ATOM 9114  H HB2  . TRP A 1 7  ? 6.201   5.647   3.773   1.00 15.00 ?  303 TRP A HB2  12 
ATOM 9115  H HB3  . TRP A 1 7  ? 4.930   4.605   3.142   1.00 15.00 ?  303 TRP A HB3  12 
ATOM 9116  H HD1  . TRP A 1 7  ? 8.678   5.346   2.581   1.00 15.00 ?  303 TRP A HD1  12 
ATOM 9117  H HE1  . TRP A 1 7  ? 9.758   3.208   1.646   1.00 15.00 ?  303 TRP A HE1  12 
ATOM 9118  H HE3  . TRP A 1 7  ? 4.468   2.505   1.967   1.00 15.00 ?  303 TRP A HE3  12 
ATOM 9119  H HZ2  . TRP A 1 7  ? 8.894   0.701   0.775   1.00 15.00 ?  303 TRP A HZ2  12 
ATOM 9120  H HZ3  . TRP A 1 7  ? 4.714   0.250   1.067   1.00 15.00 ?  303 TRP A HZ3  12 
ATOM 9121  H HH2  . TRP A 1 7  ? 6.891   -0.658  0.508   1.00 15.00 ?  303 TRP A HH2  12 
ATOM 9122  N N    . GLU A 1 8  ? 3.062   5.972   1.524   1.00 15.00 ?  304 GLU A N    12 
ATOM 9123  C CA   . GLU A 1 8  ? 1.645   6.290   1.715   1.00 15.00 ?  304 GLU A CA   12 
ATOM 9124  C C    . GLU A 1 8  ? 0.874   5.025   2.093   1.00 15.00 ?  304 GLU A C    12 
ATOM 9125  O O    . GLU A 1 8  ? 0.911   4.039   1.378   1.00 15.00 ?  304 GLU A O    12 
ATOM 9126  C CB   . GLU A 1 8  ? 1.089   6.933   0.439   1.00 15.00 ?  304 GLU A CB   12 
ATOM 9127  C CG   . GLU A 1 8  ? 1.629   8.329   0.188   1.00 15.00 ?  304 GLU A CG   12 
ATOM 9128  C CD   . GLU A 1 8  ? 0.856   9.412   0.920   1.00 15.00 ?  304 GLU A CD   12 
ATOM 9129  O OE1  . GLU A 1 8  ? 0.776   9.365   2.164   1.00 15.00 -1 304 GLU A OE1  12 
ATOM 9130  O OE2  . GLU A 1 8  ? 0.337   10.330  0.244   1.00 15.00 ?  304 GLU A OE2  12 
ATOM 9131  H H    . GLU A 1 8  ? 3.323   5.199   0.940   1.00 15.00 ?  304 GLU A H    12 
ATOM 9132  H HA   . GLU A 1 8  ? 1.573   6.997   2.527   1.00 15.00 ?  304 GLU A HA   12 
ATOM 9133  H HB2  . GLU A 1 8  ? 1.358   6.314   -0.405  1.00 15.00 ?  304 GLU A HB2  12 
ATOM 9134  H HB3  . GLU A 1 8  ? 0.017   6.992   0.495   1.00 15.00 ?  304 GLU A HB3  12 
ATOM 9135  H HG2  . GLU A 1 8  ? 2.657   8.365   0.513   1.00 15.00 ?  304 GLU A HG2  12 
ATOM 9136  H HG3  . GLU A 1 8  ? 1.583   8.532   -0.872  1.00 15.00 ?  304 GLU A HG3  12 
ATOM 9137  N N    . ILE A 1 9  ? 0.180   5.042   3.222   1.00 15.00 ?  305 ILE A N    12 
ATOM 9138  C CA   . ILE A 1 9  ? -0.444  3.825   3.738   1.00 15.00 ?  305 ILE A CA   12 
ATOM 9139  C C    . ILE A 1 9  ? -1.970  3.851   3.610   1.00 15.00 ?  305 ILE A C    12 
ATOM 9140  O O    . ILE A 1 9  ? -2.624  4.787   4.071   1.00 15.00 ?  305 ILE A O    12 
ATOM 9141  C CB   . ILE A 1 9  ? -0.053  3.586   5.216   1.00 15.00 ?  305 ILE A CB   12 
ATOM 9142  C CG1  . ILE A 1 9  ? -0.744  2.336   5.770   1.00 15.00 ?  305 ILE A CG1  12 
ATOM 9143  C CG2  . ILE A 1 9  ? -0.387  4.804   6.071   1.00 15.00 ?  305 ILE A CG2  12 
ATOM 9144  C CD1  . ILE A 1 9  ? -0.284  1.958   7.163   1.00 15.00 ?  305 ILE A CD1  12 
ATOM 9145  H H    . ILE A 1 9  ? 0.077   5.883   3.715   1.00 15.00 ?  305 ILE A H    12 
ATOM 9146  H HA   . ILE A 1 9  ? -0.065  2.995   3.159   1.00 15.00 ?  305 ILE A HA   12 
ATOM 9147  H HB   . ILE A 1 9  ? 1.017   3.439   5.255   1.00 15.00 ?  305 ILE A HB   12 
ATOM 9148  H HG12 . ILE A 1 9  ? -1.810  2.508   5.809   1.00 15.00 ?  305 ILE A HG12 12 
ATOM 9149  H HG13 . ILE A 1 9  ? -0.541  1.502   5.115   1.00 15.00 ?  305 ILE A HG13 12 
ATOM 9150  H HG21 . ILE A 1 9  ? -1.448  5.003   6.018   1.00 15.00 ?  305 ILE A HG21 12 
ATOM 9151  H HG22 . ILE A 1 9  ? 0.157   5.662   5.704   1.00 15.00 ?  305 ILE A HG22 12 
ATOM 9152  H HG23 . ILE A 1 9  ? -0.106  4.612   7.095   1.00 15.00 ?  305 ILE A HG23 12 
ATOM 9153  H HD11 . ILE A 1 9  ? -0.231  2.845   7.778   1.00 15.00 ?  305 ILE A HD11 12 
ATOM 9154  H HD12 . ILE A 1 9  ? 0.691   1.500   7.109   1.00 15.00 ?  305 ILE A HD12 12 
ATOM 9155  H HD13 . ILE A 1 9  ? -0.987  1.259   7.595   1.00 15.00 ?  305 ILE A HD13 12 
ATOM 9156  N N    . ARG A 1 10 ? -2.536  2.825   2.969   1.00 15.00 ?  306 ARG A N    12 
ATOM 9157  C CA   . ARG A 1 10 ? -3.985  2.673   2.904   1.00 15.00 ?  306 ARG A CA   12 
ATOM 9158  C C    . ARG A 1 10 ? -4.394  1.203   2.989   1.00 15.00 ?  306 ARG A C    12 
ATOM 9159  O O    . ARG A 1 10 ? -3.756  0.314   2.405   1.00 15.00 ?  306 ARG A O    12 
ATOM 9160  C CB   . ARG A 1 10 ? -4.565  3.304   1.636   1.00 15.00 ?  306 ARG A CB   12 
ATOM 9161  C CG   . ARG A 1 10 ? -4.426  4.816   1.594   1.00 15.00 ?  306 ARG A CG   12 
ATOM 9162  C CD   . ARG A 1 10 ? -5.549  5.467   0.814   1.00 15.00 ?  306 ARG A CD   12 
ATOM 9163  N NE   . ARG A 1 10 ? -5.626  6.903   1.084   1.00 15.00 ?  306 ARG A NE   12 
ATOM 9164  C CZ   . ARG A 1 10 ? -6.668  7.673   0.770   1.00 15.00 ?  306 ARG A CZ   12 
ATOM 9165  N NH1  . ARG A 1 10 ? -7.699  7.171   0.097   1.00 15.00 1  306 ARG A NH1  12 
ATOM 9166  N NH2  . ARG A 1 10 ? -6.670  8.952   1.121   1.00 15.00 ?  306 ARG A NH2  12 
ATOM 9167  H H    . ARG A 1 10 ? -1.968  2.154   2.528   1.00 15.00 ?  306 ARG A H    12 
ATOM 9168  H HA   . ARG A 1 10 ? -4.398  3.186   3.761   1.00 15.00 ?  306 ARG A HA   12 
ATOM 9169  H HB2  . ARG A 1 10 ? -4.058  2.892   0.775   1.00 15.00 ?  306 ARG A HB2  12 
ATOM 9170  H HB3  . ARG A 1 10 ? -5.615  3.059   1.575   1.00 15.00 ?  306 ARG A HB3  12 
ATOM 9171  H HG2  . ARG A 1 10 ? -4.432  5.200   2.601   1.00 15.00 ?  306 ARG A HG2  12 
ATOM 9172  H HG3  . ARG A 1 10 ? -3.488  5.061   1.116   1.00 15.00 ?  306 ARG A HG3  12 
ATOM 9173  H HD2  . ARG A 1 10 ? -5.376  5.313   -0.242  1.00 15.00 ?  306 ARG A HD2  12 
ATOM 9174  H HD3  . ARG A 1 10 ? -6.482  5.005   1.099   1.00 15.00 ?  306 ARG A HD3  12 
ATOM 9175  H HE   . ARG A 1 10 ? -4.857  7.316   1.554   1.00 15.00 ?  306 ARG A HE   12 
ATOM 9176  H HH11 . ARG A 1 10 ? -7.699  6.203   -0.181  1.00 15.00 ?  306 ARG A HH11 12 
ATOM 9177  H HH12 . ARG A 1 10 ? -8.481  7.754   -0.135  1.00 15.00 ?  306 ARG A HH12 12 
ATOM 9178  H HH21 . ARG A 1 10 ? -5.892  9.339   1.623   1.00 15.00 ?  306 ARG A HH21 12 
ATOM 9179  H HH22 . ARG A 1 10 ? -7.452  9.544   0.877   1.00 15.00 ?  306 ARG A HH22 12 
ATOM 9180  N N    . ASN A 1 11 ? -5.480  0.961   3.707   1.00 15.00 ?  307 ASN A N    12 
ATOM 9181  C CA   . ASN A 1 11 ? -5.994  -0.384  3.900   1.00 15.00 ?  307 ASN A CA   12 
ATOM 9182  C C    . ASN A 1 11 ? -7.251  -0.587  3.040   1.00 15.00 ?  307 ASN A C    12 
ATOM 9183  O O    . ASN A 1 11 ? -8.144  0.260   3.042   1.00 15.00 ?  307 ASN A O    12 
ATOM 9184  C CB   . ASN A 1 11 ? -6.329  -0.591  5.383   1.00 15.00 ?  307 ASN A CB   12 
ATOM 9185  C CG   . ASN A 1 11 ? -6.391  -2.055  5.786   1.00 15.00 ?  307 ASN A CG   12 
ATOM 9186  O OD1  . ASN A 1 11 ? -6.706  -2.930  4.982   1.00 15.00 ?  307 ASN A OD1  12 
ATOM 9187  N ND2  . ASN A 1 11 ? -6.091  -2.328  7.047   1.00 15.00 ?  307 ASN A ND2  12 
ATOM 9188  H H    . ASN A 1 11 ? -5.955  1.716   4.120   1.00 15.00 ?  307 ASN A H    12 
ATOM 9189  H HA   . ASN A 1 11 ? -5.224  -1.079  3.607   1.00 15.00 ?  307 ASN A HA   12 
ATOM 9190  H HB2  . ASN A 1 11 ? -5.574  -0.105  5.983   1.00 15.00 ?  307 ASN A HB2  12 
ATOM 9191  H HB3  . ASN A 1 11 ? -7.289  -0.139  5.590   1.00 15.00 ?  307 ASN A HB3  12 
ATOM 9192  H HD21 . ASN A 1 11 ? -5.857  -1.582  7.642   1.00 15.00 ?  307 ASN A HD21 12 
ATOM 9193  H HD22 . ASN A 1 11 ? -6.107  -3.268  7.334   1.00 15.00 ?  307 ASN A HD22 12 
ATOM 9194  N N    . THR A 1 12 ? -7.331  -1.702  2.320   1.00 15.00 ?  308 THR A N    12 
ATOM 9195  C CA   . THR A 1 12 ? -8.493  -2.000  1.496   1.00 15.00 ?  308 THR A CA   12 
ATOM 9196  C C    . THR A 1 12 ? -9.503  -2.807  2.298   1.00 15.00 ?  308 THR A C    12 
ATOM 9197  O O    . THR A 1 12 ? -9.114  -3.635  3.134   1.00 15.00 ?  308 THR A O    12 
ATOM 9198  C CB   . THR A 1 12 ? -8.116  -2.792  0.224   1.00 15.00 ?  308 THR A CB   12 
ATOM 9199  O OG1  . THR A 1 12 ? -6.757  -3.247  0.289   1.00 15.00 ?  308 THR A OG1  12 
ATOM 9200  C CG2  . THR A 1 12 ? -8.317  -1.953  -1.027  1.00 15.00 ?  308 THR A CG2  12 
ATOM 9201  H H    . THR A 1 12 ? -6.609  -2.362  2.373   1.00 15.00 ?  308 THR A H    12 
ATOM 9202  H HA   . THR A 1 12 ? -8.944  -1.064  1.198   1.00 15.00 ?  308 THR A HA   12 
ATOM 9203  H HB   . THR A 1 12 ? -8.765  -3.654  0.160   1.00 15.00 ?  308 THR A HB   12 
ATOM 9204  H HG1  . THR A 1 12 ? -6.359  -2.968  1.118   1.00 15.00 ?  308 THR A HG1  12 
ATOM 9205  H HG21 . THR A 1 12 ? -8.017  -2.521  -1.895  1.00 15.00 ?  308 THR A HG21 12 
ATOM 9206  H HG22 . THR A 1 12 ? -7.725  -1.056  -0.962  1.00 15.00 ?  308 THR A HG22 12 
ATOM 9207  H HG23 . THR A 1 12 ? -9.359  -1.686  -1.116  1.00 15.00 ?  308 THR A HG23 12 
ATOM 9208  N N    . ALA A 1 13 ? -10.789 -2.591  2.017   1.00 15.00 ?  309 ALA A N    12 
ATOM 9209  C CA   . ALA A 1 13 ? -11.875 -3.226  2.765   1.00 15.00 ?  309 ALA A CA   12 
ATOM 9210  C C    . ALA A 1 13 ? -11.812 -4.750  2.681   1.00 15.00 ?  309 ALA A C    12 
ATOM 9211  O O    . ALA A 1 13 ? -12.368 -5.450  3.529   1.00 15.00 ?  309 ALA A O    12 
ATOM 9212  C CB   . ALA A 1 13 ? -13.219 -2.728  2.253   1.00 15.00 ?  309 ALA A CB   12 
ATOM 9213  H H    . ALA A 1 13 ? -11.017 -1.979  1.276   1.00 15.00 ?  309 ALA A H    12 
ATOM 9214  H HA   . ALA A 1 13 ? -11.783 -2.931  3.800   1.00 15.00 ?  309 ALA A HA   12 
ATOM 9215  H HB1  . ALA A 1 13 ? -14.012 -3.151  2.852   1.00 15.00 ?  309 ALA A HB1  12 
ATOM 9216  H HB2  . ALA A 1 13 ? -13.345 -3.028  1.224   1.00 15.00 ?  309 ALA A HB2  12 
ATOM 9217  H HB3  . ALA A 1 13 ? -13.252 -1.651  2.321   1.00 15.00 ?  309 ALA A HB3  12 
ATOM 9218  N N    . THR A 1 14 ? -11.129 -5.252  1.661   1.00 15.00 ?  310 THR A N    12 
ATOM 9219  C CA   . THR A 1 14 ? -10.927 -6.685  1.496   1.00 15.00 ?  310 THR A CA   12 
ATOM 9220  C C    . THR A 1 14 ? -10.035 -7.263  2.599   1.00 15.00 ?  310 THR A C    12 
ATOM 9221  O O    . THR A 1 14 ? -9.986  -8.478  2.795   1.00 15.00 ?  310 THR A O    12 
ATOM 9222  C CB   . THR A 1 14 ? -10.312 -6.994  0.119   1.00 15.00 ?  310 THR A CB   12 
ATOM 9223  O OG1  . THR A 1 14 ? -9.379  -5.961  -0.242  1.00 15.00 ?  310 THR A OG1  12 
ATOM 9224  C CG2  . THR A 1 14 ? -11.391 -7.108  -0.948  1.00 15.00 ?  310 THR A CG2  12 
ATOM 9225  H H    . THR A 1 14 ? -10.760 -4.637  0.989   1.00 15.00 ?  310 THR A H    12 
ATOM 9226  H HA   . THR A 1 14 ? -11.895 -7.163  1.546   1.00 15.00 ?  310 THR A HA   12 
ATOM 9227  H HB   . THR A 1 14 ? -9.786  -7.937  0.180   1.00 15.00 ?  310 THR A HB   12 
ATOM 9228  H HG1  . THR A 1 14 ? -9.873  -5.168  -0.512  1.00 15.00 ?  310 THR A HG1  12 
ATOM 9229  H HG21 . THR A 1 14 ? -12.076 -7.900  -0.684  1.00 15.00 ?  310 THR A HG21 12 
ATOM 9230  H HG22 . THR A 1 14 ? -10.935 -7.330  -1.902  1.00 15.00 ?  310 THR A HG22 12 
ATOM 9231  H HG23 . THR A 1 14 ? -11.931 -6.174  -1.016  1.00 15.00 ?  310 THR A HG23 12 
ATOM 9232  N N    . GLY A 1 15 ? -9.343  -6.390  3.324   1.00 15.00 ?  311 GLY A N    12 
ATOM 9233  C CA   . GLY A 1 15 ? -8.476  -6.834  4.398   1.00 15.00 ?  311 GLY A CA   12 
ATOM 9234  C C    . GLY A 1 15 ? -7.031  -6.951  3.958   1.00 15.00 ?  311 GLY A C    12 
ATOM 9235  O O    . GLY A 1 15 ? -6.346  -7.914  4.298   1.00 15.00 ?  311 GLY A O    12 
ATOM 9236  H H    . GLY A 1 15 ? -9.431  -5.428  3.130   1.00 15.00 ?  311 GLY A H    12 
ATOM 9237  H HA2  . GLY A 1 15 ? -8.538  -6.128  5.213   1.00 15.00 ?  311 GLY A HA2  12 
ATOM 9238  H HA3  . GLY A 1 15 ? -8.815  -7.799  4.745   1.00 15.00 ?  311 GLY A HA3  12 
ATOM 9239  N N    . ARG A 1 16 ? -6.562  -5.965  3.202   1.00 15.00 ?  312 ARG A N    12 
ATOM 9240  C CA   . ARG A 1 16 ? -5.192  -5.977  2.687   1.00 15.00 ?  312 ARG A CA   12 
ATOM 9241  C C    . ARG A 1 16 ? -4.608  -4.571  2.777   1.00 15.00 ?  312 ARG A C    12 
ATOM 9242  O O    . ARG A 1 16 ? -5.314  -3.606  2.518   1.00 15.00 ?  312 ARG A O    12 
ATOM 9243  C CB   . ARG A 1 16 ? -5.167  -6.425  1.227   1.00 15.00 ?  312 ARG A CB   12 
ATOM 9244  C CG   . ARG A 1 16 ? -5.880  -7.725  0.917   1.00 15.00 ?  312 ARG A CG   12 
ATOM 9245  C CD   . ARG A 1 16 ? -5.928  -7.939  -0.586  1.00 15.00 ?  312 ARG A CD   12 
ATOM 9246  N NE   . ARG A 1 16 ? -7.013  -7.186  -1.224  1.00 15.00 ?  312 ARG A NE   12 
ATOM 9247  C CZ   . ARG A 1 16 ? -7.153  -7.040  -2.545  1.00 15.00 ?  312 ARG A CZ   12 
ATOM 9248  N NH1  . ARG A 1 16 ? -6.275  -7.588  -3.380  1.00 15.00 1  312 ARG A NH1  12 
ATOM 9249  N NH2  . ARG A 1 16 ? -8.178  -6.348  -3.029  1.00 15.00 ?  312 ARG A NH2  12 
ATOM 9250  H H    . ARG A 1 16 ? -7.148  -5.196  2.997   1.00 15.00 ?  312 ARG A H    12 
ATOM 9251  H HA   . ARG A 1 16 ? -4.601  -6.654  3.286   1.00 15.00 ?  312 ARG A HA   12 
ATOM 9252  H HB2  . ARG A 1 16 ? -5.606  -5.650  0.614   1.00 15.00 ?  312 ARG A HB2  12 
ATOM 9253  H HB3  . ARG A 1 16 ? -4.132  -6.540  0.933   1.00 15.00 ?  312 ARG A HB3  12 
ATOM 9254  H HG2  . ARG A 1 16 ? -5.344  -8.542  1.376   1.00 15.00 ?  312 ARG A HG2  12 
ATOM 9255  H HG3  . ARG A 1 16 ? -6.887  -7.679  1.303   1.00 15.00 ?  312 ARG A HG3  12 
ATOM 9256  H HD2  . ARG A 1 16 ? -4.988  -7.597  -1.001  1.00 15.00 ?  312 ARG A HD2  12 
ATOM 9257  H HD3  . ARG A 1 16 ? -6.055  -8.991  -0.789  1.00 15.00 ?  312 ARG A HD3  12 
ATOM 9258  H HE   . ARG A 1 16 ? -7.682  -6.771  -0.630  1.00 15.00 ?  312 ARG A HE   12 
ATOM 9259  H HH11 . ARG A 1 16 ? -5.505  -8.122  -3.023  1.00 15.00 ?  312 ARG A HH11 12 
ATOM 9260  H HH12 . ARG A 1 16 ? -6.376  -7.469  -4.372  1.00 15.00 ?  312 ARG A HH12 12 
ATOM 9261  H HH21 . ARG A 1 16 ? -8.846  -5.935  -2.406  1.00 15.00 ?  312 ARG A HH21 12 
ATOM 9262  H HH22 . ARG A 1 16 ? -8.297  -6.244  -4.022  1.00 15.00 ?  312 ARG A HH22 12 
ATOM 9263  N N    . VAL A 1 17 ? -3.327  -4.434  3.093   1.00 15.00 ?  313 VAL A N    12 
ATOM 9264  C CA   . VAL A 1 17 ? -2.759  -3.101  3.285   1.00 15.00 ?  313 VAL A CA   12 
ATOM 9265  C C    . VAL A 1 17 ? -1.744  -2.738  2.189   1.00 15.00 ?  313 VAL A C    12 
ATOM 9266  O O    . VAL A 1 17 ? -0.575  -3.081  2.269   1.00 15.00 ?  313 VAL A O    12 
ATOM 9267  C CB   . VAL A 1 17 ? -2.097  -2.953  4.668   1.00 15.00 ?  313 VAL A CB   12 
ATOM 9268  C CG1  . VAL A 1 17 ? -1.885  -1.480  4.993   1.00 15.00 ?  313 VAL A CG1  12 
ATOM 9269  C CG2  . VAL A 1 17 ? -2.936  -3.630  5.743   1.00 15.00 ?  313 VAL A CG2  12 
ATOM 9270  H H    . VAL A 1 17 ? -2.754  -5.227  3.187   1.00 15.00 ?  313 VAL A H    12 
ATOM 9271  H HA   . VAL A 1 17 ? -3.579  -2.399  3.242   1.00 15.00 ?  313 VAL A HA   12 
ATOM 9272  H HB   . VAL A 1 17 ? -1.129  -3.434  4.636   1.00 15.00 ?  313 VAL A HB   12 
ATOM 9273  H HG11 . VAL A 1 17 ? -1.241  -1.036  4.247   1.00 15.00 ?  313 VAL A HG11 12 
ATOM 9274  H HG12 . VAL A 1 17 ? -1.425  -1.389  5.966   1.00 15.00 ?  313 VAL A HG12 12 
ATOM 9275  H HG13 . VAL A 1 17 ? -2.837  -0.971  4.996   1.00 15.00 ?  313 VAL A HG13 12 
ATOM 9276  H HG21 . VAL A 1 17 ? -3.041  -4.679  5.510   1.00 15.00 ?  313 VAL A HG21 12 
ATOM 9277  H HG22 . VAL A 1 17 ? -3.912  -3.170  5.781   1.00 15.00 ?  313 VAL A HG22 12 
ATOM 9278  H HG23 . VAL A 1 17 ? -2.451  -3.521  6.703   1.00 15.00 ?  313 VAL A HG23 12 
ATOM 9279  N N    . TYR A 1 18 ? -2.219  -2.027  1.177   1.00 15.00 ?  314 TYR A N    12 
ATOM 9280  C CA   . TYR A 1 18 ? -1.417  -1.571  0.067   1.00 15.00 ?  314 TYR A CA   12 
ATOM 9281  C C    . TYR A 1 18 ? -0.824  -0.200  0.375   1.00 15.00 ?  314 TYR A C    12 
ATOM 9282  O O    . TYR A 1 18 ? -1.539  0.778   0.611   1.00 15.00 ?  314 TYR A O    12 
ATOM 9283  C CB   . TYR A 1 18 ? -2.291  -1.495  -1.204  1.00 15.00 ?  314 TYR A CB   12 
ATOM 9284  C CG   . TYR A 1 18 ? -3.471  -0.541  -1.080  1.00 15.00 ?  314 TYR A CG   12 
ATOM 9285  C CD1  . TYR A 1 18 ? -4.565  -0.864  -0.289  1.00 15.00 ?  314 TYR A CD1  12 
ATOM 9286  C CD2  . TYR A 1 18 ? -3.474  0.696   -1.723  1.00 15.00 ?  314 TYR A CD2  12 
ATOM 9287  C CE1  . TYR A 1 18 ? -5.619  0.011   -0.135  1.00 15.00 ?  314 TYR A CE1  12 
ATOM 9288  C CE2  . TYR A 1 18 ? -4.534  1.575   -1.575  1.00 15.00 ?  314 TYR A CE2  12 
ATOM 9289  C CZ   . TYR A 1 18 ? -5.600  1.226   -0.777  1.00 15.00 ?  314 TYR A CZ   12 
ATOM 9290  O OH   . TYR A 1 18 ? -6.653  2.096   -0.615  1.00 15.00 ?  314 TYR A OH   12 
ATOM 9291  H H    . TYR A 1 18 ? -3.140  -1.805  1.172   1.00 15.00 ?  314 TYR A H    12 
ATOM 9292  H HA   . TYR A 1 18 ? -0.618  -2.280  -0.090  1.00 15.00 ?  314 TYR A HA   12 
ATOM 9293  H HB2  . TYR A 1 18 ? -1.682  -1.166  -2.032  1.00 15.00 ?  314 TYR A HB2  12 
ATOM 9294  H HB3  . TYR A 1 18 ? -2.681  -2.480  -1.419  1.00 15.00 ?  314 TYR A HB3  12 
ATOM 9295  H HD1  . TYR A 1 18 ? -4.581  -1.818  0.217   1.00 15.00 ?  314 TYR A HD1  12 
ATOM 9296  H HD2  . TYR A 1 18 ? -2.641  0.959   -2.360  1.00 15.00 ?  314 TYR A HD2  12 
ATOM 9297  H HE1  . TYR A 1 18 ? -6.455  -0.260  0.490   1.00 15.00 ?  314 TYR A HE1  12 
ATOM 9298  H HE2  . TYR A 1 18 ? -4.516  2.546   -2.072  1.00 15.00 ?  314 TYR A HE2  12 
ATOM 9299  H HH   . TYR A 1 18 ? -6.899  2.466   -1.466  1.00 15.00 ?  314 TYR A HH   12 
ATOM 9300  N N    . PHE A 1 19 ? 0.483   -0.136  0.413   1.00 15.00 ?  315 PHE A N    12 
ATOM 9301  C CA   . PHE A 1 19 ? 1.165   1.126   0.587   1.00 15.00 ?  315 PHE A CA   12 
ATOM 9302  C C    . PHE A 1 19 ? 1.541   1.688   -0.767  1.00 15.00 ?  315 PHE A C    12 
ATOM 9303  O O    . PHE A 1 19 ? 2.342   1.105   -1.477  1.00 15.00 ?  315 PHE A O    12 
ATOM 9304  C CB   . PHE A 1 19 ? 2.433   0.957   1.415   1.00 15.00 ?  315 PHE A CB   12 
ATOM 9305  C CG   . PHE A 1 19 ? 2.232   0.500   2.828   1.00 15.00 ?  315 PHE A CG   12 
ATOM 9306  C CD1  . PHE A 1 19 ? 1.568   -0.680  3.103   1.00 15.00 ?  315 PHE A CD1  12 
ATOM 9307  C CD2  . PHE A 1 19 ? 2.740   1.240   3.884   1.00 15.00 ?  315 PHE A CD2  12 
ATOM 9308  C CE1  . PHE A 1 19 ? 1.408   -1.112  4.398   1.00 15.00 ?  315 PHE A CE1  12 
ATOM 9309  C CE2  . PHE A 1 19 ? 2.592   0.804   5.185   1.00 15.00 ?  315 PHE A CE2  12 
ATOM 9310  C CZ   . PHE A 1 19 ? 1.921   -0.374  5.439   1.00 15.00 ?  315 PHE A CZ   12 
ATOM 9311  H H    . PHE A 1 19 ? 1.009   -0.966  0.340   1.00 15.00 ?  315 PHE A H    12 
ATOM 9312  H HA   . PHE A 1 19 ? 0.495   1.812   1.087   1.00 15.00 ?  315 PHE A HA   12 
ATOM 9313  H HB2  . PHE A 1 19 ? 3.066   0.232   0.931   1.00 15.00 ?  315 PHE A HB2  12 
ATOM 9314  H HB3  . PHE A 1 19 ? 2.952   1.905   1.448   1.00 15.00 ?  315 PHE A HB3  12 
ATOM 9315  H HD1  . PHE A 1 19 ? 1.164   -1.262  2.287   1.00 15.00 ?  315 PHE A HD1  12 
ATOM 9316  H HD2  . PHE A 1 19 ? 3.262   2.164   3.682   1.00 15.00 ?  315 PHE A HD2  12 
ATOM 9317  H HE1  . PHE A 1 19 ? 0.884   -2.034  4.597   1.00 15.00 ?  315 PHE A HE1  12 
ATOM 9318  H HE2  . PHE A 1 19 ? 2.992   1.388   6.000   1.00 15.00 ?  315 PHE A HE2  12 
ATOM 9319  H HZ   . PHE A 1 19 ? 1.811   -0.726  6.448   1.00 15.00 ?  315 PHE A HZ   12 
ATOM 9320  N N    . VAL A 1 20 ? 1.003   2.825   -1.121  1.00 15.00 ?  316 VAL A N    12 
ATOM 9321  C CA   . VAL A 1 20 ? 1.325   3.410   -2.393  1.00 15.00 ?  316 VAL A CA   12 
ATOM 9322  C C    . VAL A 1 20 ? 2.553   4.318   -2.230  1.00 15.00 ?  316 VAL A C    12 
ATOM 9323  O O    . VAL A 1 20 ? 2.538   5.272   -1.453  1.00 15.00 ?  316 VAL A O    12 
ATOM 9324  C CB   . VAL A 1 20 ? 0.129   4.192   -2.989  1.00 15.00 ?  316 VAL A CB   12 
ATOM 9325  C CG1  . VAL A 1 20 ? -0.935  3.227   -3.491  1.00 15.00 ?  316 VAL A CG1  12 
ATOM 9326  C CG2  . VAL A 1 20 ? -0.482  5.144   -1.974  1.00 15.00 ?  316 VAL A CG2  12 
ATOM 9327  H H    . VAL A 1 20 ? 0.400   3.293   -0.505  1.00 15.00 ?  316 VAL A H    12 
ATOM 9328  H HA   . VAL A 1 20 ? 1.558   2.599   -3.066  1.00 15.00 ?  316 VAL A HA   12 
ATOM 9329  H HB   . VAL A 1 20 ? 0.484   4.771   -3.828  1.00 15.00 ?  316 VAL A HB   12 
ATOM 9330  H HG11 . VAL A 1 20 ? -1.767  3.787   -3.895  1.00 15.00 ?  316 VAL A HG11 12 
ATOM 9331  H HG12 . VAL A 1 20 ? -1.280  2.612   -2.674  1.00 15.00 ?  316 VAL A HG12 12 
ATOM 9332  H HG13 . VAL A 1 20 ? -0.516  2.597   -4.263  1.00 15.00 ?  316 VAL A HG13 12 
ATOM 9333  H HG21 . VAL A 1 20 ? 0.287   5.792   -1.578  1.00 15.00 ?  316 VAL A HG21 12 
ATOM 9334  H HG22 . VAL A 1 20 ? -0.928  4.577   -1.171  1.00 15.00 ?  316 VAL A HG22 12 
ATOM 9335  H HG23 . VAL A 1 20 ? -1.241  5.742   -2.458  1.00 15.00 ?  316 VAL A HG23 12 
ATOM 9336  N N    . ASP A 1 21 ? 3.642   3.989   -2.912  1.00 15.00 ?  317 ASP A N    12 
ATOM 9337  C CA   . ASP A 1 21 ? 4.848   4.760   -2.799  1.00 15.00 ?  317 ASP A CA   12 
ATOM 9338  C C    . ASP A 1 21 ? 4.813   5.842   -3.849  1.00 15.00 ?  317 ASP A C    12 
ATOM 9339  O O    . ASP A 1 21 ? 4.794   5.538   -5.050  1.00 15.00 ?  317 ASP A O    12 
ATOM 9340  C CB   . ASP A 1 21 ? 6.098   3.913   -3.052  1.00 15.00 ?  317 ASP A CB   12 
ATOM 9341  C CG   . ASP A 1 21 ? 5.953   2.464   -2.672  1.00 15.00 ?  317 ASP A CG   12 
ATOM 9342  O OD1  . ASP A 1 21 ? 6.236   2.127   -1.514  1.00 15.00 -1 317 ASP A OD1  12 
ATOM 9343  O OD2  . ASP A 1 21 ? 5.623   1.651   -3.562  1.00 15.00 ?  317 ASP A OD2  12 
ATOM 9344  H H    . ASP A 1 21 ? 3.639   3.198   -3.500  1.00 15.00 ?  317 ASP A H    12 
ATOM 9345  H HA   . ASP A 1 21 ? 4.894   5.198   -1.814  1.00 15.00 ?  317 ASP A HA   12 
ATOM 9346  H HB2  . ASP A 1 21 ? 6.355   3.965   -4.097  1.00 15.00 ?  317 ASP A HB2  12 
ATOM 9347  H HB3  . ASP A 1 21 ? 6.909   4.322   -2.467  1.00 15.00 ?  317 ASP A HB3  12 
ATOM 9348  N N    . HIS A 1 22 ? 4.797   7.098   -3.413  1.00 15.00 ?  318 HIS A N    12 
ATOM 9349  C CA   . HIS A 1 22 ? 4.874   8.216   -4.342  1.00 15.00 ?  318 HIS A CA   12 
ATOM 9350  C C    . HIS A 1 22 ? 6.263   8.253   -4.970  1.00 15.00 ?  318 HIS A C    12 
ATOM 9351  O O    . HIS A 1 22 ? 6.496   8.932   -5.968  1.00 15.00 ?  318 HIS A O    12 
ATOM 9352  C CB   . HIS A 1 22 ? 4.563   9.551   -3.648  1.00 15.00 ?  318 HIS A CB   12 
ATOM 9353  C CG   . HIS A 1 22 ? 3.138   9.702   -3.184  1.00 15.00 ?  318 HIS A CG   12 
ATOM 9354  N ND1  . HIS A 1 22 ? 2.105   8.878   -3.588  1.00 15.00 ?  318 HIS A ND1  12 
ATOM 9355  C CD2  . HIS A 1 22 ? 2.582   10.598  -2.338  1.00 15.00 ?  318 HIS A CD2  12 
ATOM 9356  C CE1  . HIS A 1 22 ? 0.986   9.266   -3.011  1.00 15.00 ?  318 HIS A CE1  12 
ATOM 9357  N NE2  . HIS A 1 22 ? 1.240   10.307  -2.243  1.00 15.00 ?  318 HIS A NE2  12 
ATOM 9358  H H    . HIS A 1 22 ? 4.733   7.272   -2.448  1.00 15.00 ?  318 HIS A H    12 
ATOM 9359  H HA   . HIS A 1 22 ? 4.146   8.045   -5.123  1.00 15.00 ?  318 HIS A HA   12 
ATOM 9360  H HB2  . HIS A 1 22 ? 5.200   9.651   -2.783  1.00 15.00 ?  318 HIS A HB2  12 
ATOM 9361  H HB3  . HIS A 1 22 ? 4.775   10.358  -4.335  1.00 15.00 ?  318 HIS A HB3  12 
ATOM 9362  H HD1  . HIS A 1 22 ? 2.178   8.114   -4.219  1.00 15.00 ?  318 HIS A HD1  12 
ATOM 9363  H HD2  . HIS A 1 22 ? 3.097   11.398  -1.827  1.00 15.00 ?  318 HIS A HD2  12 
ATOM 9364  H HE1  . HIS A 1 22 ? 0.019   8.803   -3.141  1.00 15.00 ?  318 HIS A HE1  12 
ATOM 9365  H HE2  . HIS A 1 22 ? 0.675   10.565  -1.468  1.00 15.00 ?  318 HIS A HE2  12 
ATOM 9366  N N    . ASN A 1 23 ? 7.180   7.514   -4.354  1.00 15.00 ?  319 ASN A N    12 
ATOM 9367  C CA   . ASN A 1 23 ? 8.545   7.381   -4.846  1.00 15.00 ?  319 ASN A CA   12 
ATOM 9368  C C    . ASN A 1 23 ? 8.567   6.653   -6.182  1.00 15.00 ?  319 ASN A C    12 
ATOM 9369  O O    . ASN A 1 23 ? 9.090   7.159   -7.170  1.00 15.00 ?  319 ASN A O    12 
ATOM 9370  C CB   . ASN A 1 23 ? 9.399   6.584   -3.850  1.00 15.00 ?  319 ASN A CB   12 
ATOM 9371  C CG   . ASN A 1 23 ? 9.355   7.135   -2.441  1.00 15.00 ?  319 ASN A CG   12 
ATOM 9372  O OD1  . ASN A 1 23 ? 9.236   8.339   -2.232  1.00 15.00 ?  319 ASN A OD1  12 
ATOM 9373  N ND2  . ASN A 1 23 ? 9.433   6.249   -1.460  1.00 15.00 ?  319 ASN A ND2  12 
ATOM 9374  H H    . ASN A 1 23 ? 6.930   7.046   -3.530  1.00 15.00 ?  319 ASN A H    12 
ATOM 9375  H HA   . ASN A 1 23 ? 8.965   8.369   -4.966  1.00 15.00 ?  319 ASN A HA   12 
ATOM 9376  H HB2  . ASN A 1 23 ? 9.048   5.564   -3.825  1.00 15.00 ?  319 ASN A HB2  12 
ATOM 9377  H HB3  . ASN A 1 23 ? 10.426  6.594   -4.187  1.00 15.00 ?  319 ASN A HB3  12 
ATOM 9378  H HD21 . ASN A 1 23 ? 9.511   5.298   -1.695  1.00 15.00 ?  319 ASN A HD21 12 
ATOM 9379  H HD22 . ASN A 1 23 ? 9.412   6.578   -0.539  1.00 15.00 ?  319 ASN A HD22 12 
ATOM 9380  N N    . ASN A 1 24 ? 7.997   5.454   -6.190  1.00 15.00 ?  320 ASN A N    12 
ATOM 9381  C CA   . ASN A 1 24 ? 8.083   4.554   -7.340  1.00 15.00 ?  320 ASN A CA   12 
ATOM 9382  C C    . ASN A 1 24 ? 6.791   4.550   -8.167  1.00 15.00 ?  320 ASN A C    12 
ATOM 9383  O O    . ASN A 1 24 ? 6.772   4.047   -9.290  1.00 15.00 ?  320 ASN A O    12 
ATOM 9384  C CB   . ASN A 1 24 ? 8.410   3.138   -6.855  1.00 15.00 ?  320 ASN A CB   12 
ATOM 9385  C CG   . ASN A 1 24 ? 8.814   2.194   -7.973  1.00 15.00 ?  320 ASN A CG   12 
ATOM 9386  O OD1  . ASN A 1 24 ? 9.410   2.601   -8.969  1.00 15.00 ?  320 ASN A OD1  12 
ATOM 9387  N ND2  . ASN A 1 24 ? 8.495   0.919   -7.807  1.00 15.00 ?  320 ASN A ND2  12 
ATOM 9388  H H    . ASN A 1 24 ? 7.517   5.153   -5.389  1.00 15.00 ?  320 ASN A H    12 
ATOM 9389  H HA   . ASN A 1 24 ? 8.891   4.898   -7.967  1.00 15.00 ?  320 ASN A HA   12 
ATOM 9390  H HB2  . ASN A 1 24 ? 9.224   3.190   -6.148  1.00 15.00 ?  320 ASN A HB2  12 
ATOM 9391  H HB3  . ASN A 1 24 ? 7.540   2.726   -6.361  1.00 15.00 ?  320 ASN A HB3  12 
ATOM 9392  H HD21 . ASN A 1 24 ? 8.021   0.666   -6.982  1.00 15.00 ?  320 ASN A HD21 12 
ATOM 9393  H HD22 . ASN A 1 24 ? 8.736   0.281   -8.510  1.00 15.00 ?  320 ASN A HD22 12 
ATOM 9394  N N    . ARG A 1 25 ? 5.709   5.088   -7.592  1.00 15.00 ?  321 ARG A N    12 
ATOM 9395  C CA   . ARG A 1 25 ? 4.382   5.065   -8.216  1.00 15.00 ?  321 ARG A CA   12 
ATOM 9396  C C    . ARG A 1 25 ? 3.834   3.644   -8.219  1.00 15.00 ?  321 ARG A C    12 
ATOM 9397  O O    . ARG A 1 25 ? 3.189   3.209   -9.174  1.00 15.00 ?  321 ARG A O    12 
ATOM 9398  C CB   . ARG A 1 25 ? 4.391   5.630   -9.650  1.00 15.00 ?  321 ARG A CB   12 
ATOM 9399  C CG   . ARG A 1 25 ? 4.550   7.144   -9.739  1.00 15.00 ?  321 ARG A CG   12 
ATOM 9400  C CD   . ARG A 1 25 ? 6.005   7.566   -9.647  1.00 15.00 ?  321 ARG A CD   12 
ATOM 9401  N NE   . ARG A 1 25 ? 6.792   7.035   -10.764 1.00 15.00 ?  321 ARG A NE   12 
ATOM 9402  C CZ   . ARG A 1 25 ? 8.123   7.072   -10.847 1.00 15.00 ?  321 ARG A CZ   12 
ATOM 9403  N NH1  . ARG A 1 25 ? 8.851   7.616   -9.880  1.00 15.00 1  321 ARG A NH1  12 
ATOM 9404  N NH2  . ARG A 1 25 ? 8.725   6.558   -11.910 1.00 15.00 ?  321 ARG A NH2  12 
ATOM 9405  H H    . ARG A 1 25 ? 5.801   5.506   -6.711  1.00 15.00 ?  321 ARG A H    12 
ATOM 9406  H HA   . ARG A 1 25 ? 3.730   5.676   -7.607  1.00 15.00 ?  321 ARG A HA   12 
ATOM 9407  H HB2  . ARG A 1 25 ? 5.205   5.176   -10.194 1.00 15.00 ?  321 ARG A HB2  12 
ATOM 9408  H HB3  . ARG A 1 25 ? 3.461   5.361   -10.130 1.00 15.00 ?  321 ARG A HB3  12 
ATOM 9409  H HG2  . ARG A 1 25 ? 4.149   7.484   -10.682 1.00 15.00 ?  321 ARG A HG2  12 
ATOM 9410  H HG3  . ARG A 1 25 ? 4.001   7.599   -8.927  1.00 15.00 ?  321 ARG A HG3  12 
ATOM 9411  H HD2  . ARG A 1 25 ? 6.058   8.646   -9.661  1.00 15.00 ?  321 ARG A HD2  12 
ATOM 9412  H HD3  . ARG A 1 25 ? 6.410   7.197   -8.719  1.00 15.00 ?  321 ARG A HD3  12 
ATOM 9413  H HE   . ARG A 1 25 ? 6.291   6.620   -11.505 1.00 15.00 ?  321 ARG A HE   12 
ATOM 9414  H HH11 . ARG A 1 25 ? 8.407   8.003   -9.071  1.00 15.00 ?  321 ARG A HH11 12 
ATOM 9415  H HH12 . ARG A 1 25 ? 9.858   7.640   -9.954  1.00 15.00 ?  321 ARG A HH12 12 
ATOM 9416  H HH21 . ARG A 1 25 ? 8.175   6.148   -12.649 1.00 15.00 ?  321 ARG A HH21 12 
ATOM 9417  H HH22 . ARG A 1 25 ? 9.725   6.558   -11.975 1.00 15.00 ?  321 ARG A HH22 12 
ATOM 9418  N N    . THR A 1 26 ? 4.053   2.945   -7.116  1.00 15.00 ?  322 THR A N    12 
ATOM 9419  C CA   . THR A 1 26 ? 3.660   1.544   -6.995  1.00 15.00 ?  322 THR A CA   12 
ATOM 9420  C C    . THR A 1 26 ? 2.846   1.308   -5.735  1.00 15.00 ?  322 THR A C    12 
ATOM 9421  O O    . THR A 1 26 ? 2.997   2.028   -4.766  1.00 15.00 ?  322 THR A O    12 
ATOM 9422  C CB   . THR A 1 26 ? 4.887   0.616   -6.988  1.00 15.00 ?  322 THR A CB   12 
ATOM 9423  O OG1  . THR A 1 26 ? 5.937   1.193   -6.196  1.00 15.00 ?  322 THR A OG1  12 
ATOM 9424  C CG2  . THR A 1 26 ? 5.382   0.363   -8.403  1.00 15.00 ?  322 THR A CG2  12 
ATOM 9425  H H    . THR A 1 26 ? 4.482   3.393   -6.344  1.00 15.00 ?  322 THR A H    12 
ATOM 9426  H HA   . THR A 1 26 ? 3.053   1.296   -7.854  1.00 15.00 ?  322 THR A HA   12 
ATOM 9427  H HB   . THR A 1 26 ? 4.598   -0.330  -6.551  1.00 15.00 ?  322 THR A HB   12 
ATOM 9428  H HG1  . THR A 1 26 ? 5.662   1.221   -5.260  1.00 15.00 ?  322 THR A HG1  12 
ATOM 9429  H HG21 . THR A 1 26 ? 5.647   1.300   -8.866  1.00 15.00 ?  322 THR A HG21 12 
ATOM 9430  H HG22 . THR A 1 26 ? 4.600   -0.114  -8.978  1.00 15.00 ?  322 THR A HG22 12 
ATOM 9431  H HG23 . THR A 1 26 ? 6.249   -0.281  -8.372  1.00 15.00 ?  322 THR A HG23 12 
ATOM 9432  N N    . THR A 1 27 ? 1.947   0.338   -5.760  1.00 15.00 ?  323 THR A N    12 
ATOM 9433  C CA   . THR A 1 27 ? 1.179   0.013   -4.571  1.00 15.00 ?  323 THR A CA   12 
ATOM 9434  C C    . THR A 1 27 ? 1.679   -1.303  -3.955  1.00 15.00 ?  323 THR A C    12 
ATOM 9435  O O    . THR A 1 27 ? 2.008   -2.253  -4.670  1.00 15.00 ?  323 THR A O    12 
ATOM 9436  C CB   . THR A 1 27 ? -0.332  -0.049  -4.871  1.00 15.00 ?  323 THR A CB   12 
ATOM 9437  O OG1  . THR A 1 27 ? -1.070  -0.280  -3.670  1.00 15.00 ?  323 THR A OG1  12 
ATOM 9438  C CG2  . THR A 1 27 ? -0.660  -1.129  -5.879  1.00 15.00 ?  323 THR A CG2  12 
ATOM 9439  H H    . THR A 1 27 ? 1.808   -0.178  -6.580  1.00 15.00 ?  323 THR A H    12 
ATOM 9440  H HA   . THR A 1 27 ? 1.346   0.808   -3.859  1.00 15.00 ?  323 THR A HA   12 
ATOM 9441  H HB   . THR A 1 27 ? -0.633  0.904   -5.285  1.00 15.00 ?  323 THR A HB   12 
ATOM 9442  H HG1  . THR A 1 27 ? -1.500  0.537   -3.400  1.00 15.00 ?  323 THR A HG1  12 
ATOM 9443  H HG21 . THR A 1 27 ? -0.225  -0.877  -6.834  1.00 15.00 ?  323 THR A HG21 12 
ATOM 9444  H HG22 . THR A 1 27 ? -1.734  -1.204  -5.976  1.00 15.00 ?  323 THR A HG22 12 
ATOM 9445  H HG23 . THR A 1 27 ? -0.263  -2.073  -5.537  1.00 15.00 ?  323 THR A HG23 12 
ATOM 9446  N N    . GLN A 1 28 ? 1.740   -1.347  -2.630  1.00 15.00 ?  324 GLN A N    12 
ATOM 9447  C CA   . GLN A 1 28 ? 2.413   -2.425  -1.922  1.00 15.00 ?  324 GLN A CA   12 
ATOM 9448  C C    . GLN A 1 28 ? 1.463   -3.206  -1.013  1.00 15.00 ?  324 GLN A C    12 
ATOM 9449  O O    . GLN A 1 28 ? 1.241   -2.814  0.123   1.00 15.00 ?  324 GLN A O    12 
ATOM 9450  C CB   . GLN A 1 28 ? 3.553   -1.861  -1.051  1.00 15.00 ?  324 GLN A CB   12 
ATOM 9451  C CG   . GLN A 1 28 ? 4.602   -1.049  -1.803  1.00 15.00 ?  324 GLN A CG   12 
ATOM 9452  C CD   . GLN A 1 28 ? 5.693   -1.904  -2.432  1.00 15.00 ?  324 GLN A CD   12 
ATOM 9453  O OE1  . GLN A 1 28 ? 6.180   -1.620  -3.527  1.00 15.00 ?  324 GLN A OE1  12 
ATOM 9454  N NE2  . GLN A 1 28 ? 6.127   -2.930  -1.719  1.00 15.00 ?  324 GLN A NE2  12 
ATOM 9455  H H    . GLN A 1 28 ? 1.336   -0.619  -2.109  1.00 15.00 ?  324 GLN A H    12 
ATOM 9456  H HA   . GLN A 1 28 ? 2.832   -3.096  -2.654  1.00 15.00 ?  324 GLN A HA   12 
ATOM 9457  H HB2  . GLN A 1 28 ? 3.121   -1.222  -0.295  1.00 15.00 ?  324 GLN A HB2  12 
ATOM 9458  H HB3  . GLN A 1 28 ? 4.052   -2.683  -0.561  1.00 15.00 ?  324 GLN A HB3  12 
ATOM 9459  H HG2  . GLN A 1 28 ? 4.115   -0.477  -2.573  1.00 15.00 ?  324 GLN A HG2  12 
ATOM 9460  H HG3  . GLN A 1 28 ? 5.068   -0.369  -1.105  1.00 15.00 ?  324 GLN A HG3  12 
ATOM 9461  H HE21 . GLN A 1 28 ? 5.725   -3.087  -0.834  1.00 15.00 ?  324 GLN A HE21 12 
ATOM 9462  H HE22 . GLN A 1 28 ? 6.844   -3.483  -2.095  1.00 15.00 ?  324 GLN A HE22 12 
ATOM 9463  N N    . PHE A 1 29 ? 0.878   -4.286  -1.530  1.00 15.00 ?  325 PHE A N    12 
ATOM 9464  C CA   . PHE A 1 29 ? 0.304   -5.339  -0.670  1.00 15.00 ?  325 PHE A CA   12 
ATOM 9465  C C    . PHE A 1 29 ? 1.434   -6.108  -0.055  1.00 15.00 ?  325 PHE A C    12 
ATOM 9466  O O    . PHE A 1 29 ? 1.275   -6.994  0.779   1.00 15.00 ?  325 PHE A O    12 
ATOM 9467  C CB   . PHE A 1 29 ? -0.621  -6.271  -1.426  1.00 15.00 ?  325 PHE A CB   12 
ATOM 9468  C CG   . PHE A 1 29 ? -1.998  -5.724  -1.488  1.00 15.00 ?  325 PHE A CG   12 
ATOM 9469  C CD1  . PHE A 1 29 ? -2.498  -4.990  -0.424  1.00 15.00 ?  325 PHE A CD1  12 
ATOM 9470  C CD2  . PHE A 1 29 ? -2.787  -5.922  -2.600  1.00 15.00 ?  325 PHE A CD2  12 
ATOM 9471  C CE1  . PHE A 1 29 ? -3.769  -4.459  -0.492  1.00 15.00 ?  325 PHE A CE1  12 
ATOM 9472  C CE2  . PHE A 1 29 ? -4.059  -5.400  -2.662  1.00 15.00 ?  325 PHE A CE2  12 
ATOM 9473  C CZ   . PHE A 1 29 ? -4.550  -4.664  -1.608  1.00 15.00 ?  325 PHE A CZ   12 
ATOM 9474  H H    . PHE A 1 29 ? 0.816   -4.375  -2.504  1.00 15.00 ?  325 PHE A H    12 
ATOM 9475  H HA   . PHE A 1 29 ? -0.252  -4.849  0.121   1.00 15.00 ?  325 PHE A HA   12 
ATOM 9476  H HB2  . PHE A 1 29 ? -0.257  -6.401  -2.436  1.00 15.00 ?  325 PHE A HB2  12 
ATOM 9477  H HB3  . PHE A 1 29 ? -0.657  -7.227  -0.929  1.00 15.00 ?  325 PHE A HB3  12 
ATOM 9478  H HD1  . PHE A 1 29 ? -1.876  -4.831  0.475   1.00 15.00 ?  325 PHE A HD1  12 
ATOM 9479  H HD2  . PHE A 1 29 ? -2.404  -6.501  -3.427  1.00 15.00 ?  325 PHE A HD2  12 
ATOM 9480  H HE1  . PHE A 1 29 ? -4.161  -3.900  0.338   1.00 15.00 ?  325 PHE A HE1  12 
ATOM 9481  H HE2  . PHE A 1 29 ? -4.669  -5.563  -3.538  1.00 15.00 ?  325 PHE A HE2  12 
ATOM 9482  H HZ   . PHE A 1 29 ? -5.544  -4.247  -1.657  1.00 15.00 ?  325 PHE A HZ   12 
ATOM 9483  N N    . THR A 1 30 ? 2.572   -5.786  -0.578  1.00 15.00 ?  326 THR A N    12 
ATOM 9484  C CA   . THR A 1 30 ? 3.826   -6.275  -0.066  1.00 15.00 ?  326 THR A CA   12 
ATOM 9485  C C    . THR A 1 30 ? 4.279   -5.228  0.949   1.00 15.00 ?  326 THR A C    12 
ATOM 9486  O O    . THR A 1 30 ? 4.946   -4.244  0.611   1.00 15.00 ?  326 THR A O    12 
ATOM 9487  C CB   . THR A 1 30 ? 4.864   -6.497  -1.197  1.00 15.00 ?  326 THR A CB   12 
ATOM 9488  O OG1  . THR A 1 30 ? 6.204   -6.367  -0.704  1.00 15.00 ?  326 THR A OG1  12 
ATOM 9489  C CG2  . THR A 1 30 ? 4.626   -5.547  -2.364  1.00 15.00 ?  326 THR A CG2  12 
ATOM 9490  H H    . THR A 1 30 ? 2.556   -5.091  -1.264  1.00 15.00 ?  326 THR A H    12 
ATOM 9491  H HA   . THR A 1 30 ? 3.641   -7.222  0.427   1.00 15.00 ?  326 THR A HA   12 
ATOM 9492  H HB   . THR A 1 30 ? 4.738   -7.506  -1.562  1.00 15.00 ?  326 THR A HB   12 
ATOM 9493  H HG1  . THR A 1 30 ? 6.810   -6.213  -1.444  1.00 15.00 ?  326 THR A HG1  12 
ATOM 9494  H HG21 . THR A 1 30 ? 5.420   -5.657  -3.087  1.00 15.00 ?  326 THR A HG21 12 
ATOM 9495  H HG22 . THR A 1 30 ? 4.600   -4.531  -2.002  1.00 15.00 ?  326 THR A HG22 12 
ATOM 9496  H HG23 . THR A 1 30 ? 3.680   -5.784  -2.831  1.00 15.00 ?  326 THR A HG23 12 
ATOM 9497  N N    . ASP A 1 31 ? 3.860   -5.425  2.189   1.00 15.00 ?  327 ASP A N    12 
ATOM 9498  C CA   . ASP A 1 31 ? 3.745   -4.343  3.137   1.00 15.00 ?  327 ASP A CA   12 
ATOM 9499  C C    . ASP A 1 31 ? 4.548   -4.542  4.378   1.00 15.00 ?  327 ASP A C    12 
ATOM 9500  O O    . ASP A 1 31 ? 4.810   -5.660  4.826   1.00 15.00 ?  327 ASP A O    12 
ATOM 9501  C CB   . ASP A 1 31 ? 2.306   -4.079  3.535   1.00 15.00 ?  327 ASP A CB   12 
ATOM 9502  C CG   . ASP A 1 31 ? 1.483   -5.338  3.744   1.00 15.00 ?  327 ASP A CG   12 
ATOM 9503  O OD1  . ASP A 1 31 ? 1.901   -6.172  4.571   1.00 15.00 ?  327 ASP A OD1  12 
ATOM 9504  O OD2  . ASP A 1 31 ? 0.414   -5.482  3.121   1.00 15.00 -1 327 ASP A OD2  12 
ATOM 9505  H H    . ASP A 1 31 ? 3.610   -6.327  2.484   1.00 15.00 ?  327 ASP A H    12 
ATOM 9506  H HA   . ASP A 1 31 ? 4.110   -3.451  2.652   1.00 15.00 ?  327 ASP A HA   12 
ATOM 9507  H HB2  . ASP A 1 31 ? 2.312   -3.535  4.470   1.00 15.00 ?  327 ASP A HB2  12 
ATOM 9508  H HB3  . ASP A 1 31 ? 1.861   -3.463  2.785   1.00 15.00 ?  327 ASP A HB3  12 
ATOM 9509  N N    . PRO A 1 32 ? 4.943   -3.412  4.939   1.00 15.00 ?  328 PRO A N    12 
ATOM 9510  C CA   . PRO A 1 32 ? 5.578   -3.345  6.237   1.00 15.00 ?  328 PRO A CA   12 
ATOM 9511  C C    . PRO A 1 32 ? 4.601   -3.865  7.304   1.00 15.00 ?  328 PRO A C    12 
ATOM 9512  O O    . PRO A 1 32 ? 4.970   -4.113  8.454   1.00 15.00 ?  328 PRO A O    12 
ATOM 9513  C CB   . PRO A 1 32 ? 5.910   -1.850  6.403   1.00 15.00 ?  328 PRO A CB   12 
ATOM 9514  C CG   . PRO A 1 32 ? 5.737   -1.257  5.034   1.00 15.00 ?  328 PRO A CG   12 
ATOM 9515  C CD   . PRO A 1 32 ? 4.697   -2.077  4.377   1.00 15.00 ?  328 PRO A CD   12 
ATOM 9516  H HA   . PRO A 1 32 ? 6.485   -3.933  6.265   1.00 15.00 ?  328 PRO A HA   12 
ATOM 9517  H HB2  . PRO A 1 32 ? 5.228   -1.405  7.114   1.00 15.00 ?  328 PRO A HB2  12 
ATOM 9518  H HB3  . PRO A 1 32 ? 6.925   -1.740  6.754   1.00 15.00 ?  328 PRO A HB3  12 
ATOM 9519  H HG2  . PRO A 1 32 ? 5.425   -0.221  5.108   1.00 15.00 ?  328 PRO A HG2  12 
ATOM 9520  H HG3  . PRO A 1 32 ? 6.640   -1.336  4.459   1.00 15.00 ?  328 PRO A HG3  12 
ATOM 9521  H HD2  . PRO A 1 32 ? 3.711   -1.721  4.637   1.00 15.00 ?  328 PRO A HD2  12 
ATOM 9522  H HD3  . PRO A 1 32 ? 4.835   -2.078  3.306   1.00 15.00 ?  328 PRO A HD3  12 
ATOM 9523  N N    . ARG A 1 33 ? 3.327   -3.970  6.899   1.00 15.00 ?  329 ARG A N    12 
ATOM 9524  C CA   . ARG A 1 33 ? 2.278   -4.573  7.713   1.00 15.00 ?  329 ARG A CA   12 
ATOM 9525  C C    . ARG A 1 33 ? 2.569   -6.051  7.985   1.00 15.00 ?  329 ARG A C    12 
ATOM 9526  O O    . ARG A 1 33 ? 2.504   -6.502  9.132   1.00 15.00 ?  329 ARG A O    12 
ATOM 9527  C CB   . ARG A 1 33 ? 0.899   -4.400  7.029   1.00 15.00 ?  329 ARG A CB   12 
ATOM 9528  C CG   . ARG A 1 33 ? 0.328   -3.003  7.204   1.00 15.00 ?  329 ARG A CG   12 
ATOM 9529  C CD   . ARG A 1 33 ? -0.531  -2.878  8.458   1.00 15.00 ?  329 ARG A CD   12 
ATOM 9530  N NE   . ARG A 1 33 ? 0.088   -3.493  9.632   1.00 15.00 ?  329 ARG A NE   12 
ATOM 9531  C CZ   . ARG A 1 33 ? 0.588   -2.819  10.665  1.00 15.00 ?  329 ARG A CZ   12 
ATOM 9532  N NH1  . ARG A 1 33 ? 0.580   -1.491  10.671  1.00 15.00 1  329 ARG A NH1  12 
ATOM 9533  N NH2  . ARG A 1 33 ? 1.092   -3.486  11.695  1.00 15.00 ?  329 ARG A NH2  12 
ATOM 9534  H H    . ARG A 1 33 ? 3.094   -3.645  6.005   1.00 15.00 ?  329 ARG A H    12 
ATOM 9535  H HA   . ARG A 1 33 ? 2.262   -4.051  8.658   1.00 15.00 ?  329 ARG A HA   12 
ATOM 9536  H HB2  . ARG A 1 33 ? 0.979   -4.602  5.950   1.00 15.00 ?  329 ARG A HB2  12 
ATOM 9537  H HB3  . ARG A 1 33 ? 0.206   -5.104  7.465   1.00 15.00 ?  329 ARG A HB3  12 
ATOM 9538  H HG2  . ARG A 1 33 ? 1.143   -2.299  7.269   1.00 15.00 ?  329 ARG A HG2  12 
ATOM 9539  H HG3  . ARG A 1 33 ? -0.280  -2.768  6.343   1.00 15.00 ?  329 ARG A HG3  12 
ATOM 9540  H HD2  . ARG A 1 33 ? -0.692  -1.830  8.662   1.00 15.00 ?  329 ARG A HD2  12 
ATOM 9541  H HD3  . ARG A 1 33 ? -1.481  -3.356  8.273   1.00 15.00 ?  329 ARG A HD3  12 
ATOM 9542  H HE   . ARG A 1 33 ? 0.113   -4.483  9.662   1.00 15.00 ?  329 ARG A HE   12 
ATOM 9543  H HH11 . ARG A 1 33 ? 0.200   -0.987  9.897   1.00 15.00 ?  329 ARG A HH11 12 
ATOM 9544  H HH12 . ARG A 1 33 ? 0.953   -0.985  11.462  1.00 15.00 ?  329 ARG A HH12 12 
ATOM 9545  H HH21 . ARG A 1 33 ? 1.087   -4.491  11.692  1.00 15.00 ?  329 ARG A HH21 12 
ATOM 9546  H HH22 . ARG A 1 33 ? 1.485   -2.992  12.485  1.00 15.00 ?  329 ARG A HH22 12 
ATOM 9547  N N    . LEU A 1 34 ? 2.890   -6.800  6.938   1.00 15.00 ?  330 LEU A N    12 
ATOM 9548  C CA   . LEU A 1 34 ? 3.218   -8.217  7.073   1.00 15.00 ?  330 LEU A CA   12 
ATOM 9549  C C    . LEU A 1 34 ? 4.561   -8.407  7.779   1.00 15.00 ?  330 LEU A C    12 
ATOM 9550  O O    . LEU A 1 34 ? 4.849   -9.482  8.310   1.00 15.00 ?  330 LEU A O    12 
ATOM 9551  C CB   . LEU A 1 34 ? 3.244   -8.890  5.695   1.00 15.00 ?  330 LEU A CB   12 
ATOM 9552  C CG   . LEU A 1 34 ? 3.485   -10.402 5.705   1.00 15.00 ?  330 LEU A CG   12 
ATOM 9553  C CD1  . LEU A 1 34 ? 2.350   -11.124 6.415   1.00 15.00 ?  330 LEU A CD1  12 
ATOM 9554  C CD2  . LEU A 1 34 ? 3.650   -10.924 4.286   1.00 15.00 ?  330 LEU A CD2  12 
ATOM 9555  H H    . LEU A 1 34 ? 2.871   -6.398  6.032   1.00 15.00 ?  330 LEU A H    12 
ATOM 9556  H HA   . LEU A 1 34 ? 2.445   -8.677  7.671   1.00 15.00 ?  330 LEU A HA   12 
ATOM 9557  H HB2  . LEU A 1 34 ? 2.297   -8.700  5.211   1.00 15.00 ?  330 LEU A HB2  12 
ATOM 9558  H HB3  . LEU A 1 34 ? 4.026   -8.430  5.108   1.00 15.00 ?  330 LEU A HB3  12 
ATOM 9559  H HG   . LEU A 1 34 ? 4.396   -10.608 6.245   1.00 15.00 ?  330 LEU A HG   12 
ATOM 9560  H HD11 . LEU A 1 34 ? 1.420   -10.927 5.902   1.00 15.00 ?  330 LEU A HD11 12 
ATOM 9561  H HD12 . LEU A 1 34 ? 2.280   -10.770 7.433   1.00 15.00 ?  330 LEU A HD12 12 
ATOM 9562  H HD13 . LEU A 1 34 ? 2.543   -12.187 6.416   1.00 15.00 ?  330 LEU A HD13 12 
ATOM 9563  H HD21 . LEU A 1 34 ? 4.499   -10.441 3.824   1.00 15.00 ?  330 LEU A HD21 12 
ATOM 9564  H HD22 . LEU A 1 34 ? 2.759   -10.709 3.716   1.00 15.00 ?  330 LEU A HD22 12 
ATOM 9565  H HD23 . LEU A 1 34 ? 3.814   -11.991 4.312   1.00 15.00 ?  330 LEU A HD23 12 
ATOM 9566  N N    . SER A 1 35 ? 5.376   -7.355  7.790   1.00 15.00 ?  331 SER A N    12 
ATOM 9567  C CA   . SER A 1 35 ? 6.691   -7.394  8.428   1.00 15.00 ?  331 SER A CA   12 
ATOM 9568  C C    . SER A 1 35 ? 6.575   -7.563  9.945   1.00 15.00 ?  331 SER A C    12 
ATOM 9569  O O    . SER A 1 35 ? 7.575   -7.783  10.632  1.00 15.00 ?  331 SER A O    12 
ATOM 9570  C CB   . SER A 1 35 ? 7.469   -6.119  8.105   1.00 15.00 ?  331 SER A CB   12 
ATOM 9571  O OG   . SER A 1 35 ? 7.531   -5.900  6.706   1.00 15.00 ?  331 SER A OG   12 
ATOM 9572  H H    . SER A 1 35 ? 5.091   -6.530  7.343   1.00 15.00 ?  331 SER A H    12 
ATOM 9573  H HA   . SER A 1 35 ? 7.227   -8.242  8.025   1.00 15.00 ?  331 SER A HA   12 
ATOM 9574  H HB2  . SER A 1 35 ? 6.979   -5.273  8.566   1.00 15.00 ?  331 SER A HB2  12 
ATOM 9575  H HB3  . SER A 1 35 ? 8.474   -6.205  8.489   1.00 15.00 ?  331 SER A HB3  12 
ATOM 9576  H HG   . SER A 1 35 ? 8.217   -6.468  6.326   1.00 15.00 ?  331 SER A HG   12 
ATOM 9577  N N    . ALA A 1 36 ? 5.355   -7.437  10.462  1.00 15.00 ?  332 ALA A N    12 
ATOM 9578  C CA   . ALA A 1 36 ? 5.105   -7.588  11.890  1.00 15.00 ?  332 ALA A CA   12 
ATOM 9579  C C    . ALA A 1 36 ? 5.399   -9.013  12.358  1.00 15.00 ?  332 ALA A C    12 
ATOM 9580  O O    . ALA A 1 36 ? 5.710   -9.238  13.526  1.00 15.00 ?  332 ALA A O    12 
ATOM 9581  C CB   . ALA A 1 36 ? 3.668   -7.209  12.212  1.00 15.00 ?  332 ALA A CB   12 
ATOM 9582  H H    . ALA A 1 36 ? 4.604   -7.240  9.865   1.00 15.00 ?  332 ALA A H    12 
ATOM 9583  H HA   . ALA A 1 36 ? 5.758   -6.907  12.417  1.00 15.00 ?  332 ALA A HA   12 
ATOM 9584  H HB1  . ALA A 1 36 ? 3.509   -7.267  13.278  1.00 15.00 ?  332 ALA A HB1  12 
ATOM 9585  H HB2  . ALA A 1 36 ? 2.995   -7.892  11.712  1.00 15.00 ?  332 ALA A HB2  12 
ATOM 9586  H HB3  . ALA A 1 36 ? 3.476   -6.203  11.873  1.00 15.00 ?  332 ALA A HB3  12 
ATOM 9587  N N    . ASN A 1 37 ? 5.295   -9.972  11.445  1.00 15.00 ?  333 ASN A N    12 
ATOM 9588  C CA   . ASN A 1 37 ? 5.592   -11.360 11.767  1.00 15.00 ?  333 ASN A CA   12 
ATOM 9589  C C    . ASN A 1 37 ? 6.916   -11.764 11.131  1.00 15.00 ?  333 ASN A C    12 
ATOM 9590  O O    . ASN A 1 37 ? 7.963   -11.626 11.795  1.00 15.00 ?  333 ASN A O    12 
ATOM 9591  C CB   . ASN A 1 37 ? 4.472   -12.288 11.287  1.00 15.00 ?  333 ASN A CB   12 
ATOM 9592  C CG   . ASN A 1 37 ? 4.674   -13.722 11.748  1.00 15.00 ?  333 ASN A CG   12 
ATOM 9593  O OD1  . ASN A 1 37 ? 4.180   -14.123 12.803  1.00 15.00 ?  333 ASN A OD1  12 
ATOM 9594  N ND2  . ASN A 1 37 ? 5.408   -14.502 10.970  1.00 15.00 ?  333 ASN A ND2  12 
ATOM 9595  O OXT  . ASN A 1 37 ? 6.912   -12.205 9.961   1.00 15.00 ?  333 ASN A OXT  12 
ATOM 9596  H H    . ASN A 1 37 ? 5.027   -9.739  10.530  1.00 15.00 ?  333 ASN A H    12 
ATOM 9597  H HA   . ASN A 1 37 ? 5.683   -11.440 12.842  1.00 15.00 ?  333 ASN A HA   12 
ATOM 9598  H HB2  . ASN A 1 37 ? 3.529   -11.934 11.676  1.00 15.00 ?  333 ASN A HB2  12 
ATOM 9599  H HB3  . ASN A 1 37 ? 4.440   -12.276 10.208  1.00 15.00 ?  333 ASN A HB3  12 
ATOM 9600  H HD21 . ASN A 1 37 ? 5.777   -14.114 10.144  1.00 15.00 ?  333 ASN A HD21 12 
ATOM 9601  H HD22 . ASN A 1 37 ? 5.561   -15.433 11.251  1.00 15.00 ?  333 ASN A HD22 12 
ATOM 9602  N N    . GLU B 2 1  ? 5.121   -9.918  -4.593  1.00 15.00 ?  203 GLU B N    12 
ATOM 9603  C CA   . GLU B 2 1  ? 3.909   -9.972  -3.747  1.00 15.00 ?  203 GLU B CA   12 
ATOM 9604  C C    . GLU B 2 1  ? 3.085   -11.216 -4.079  1.00 15.00 ?  203 GLU B C    12 
ATOM 9605  O O    . GLU B 2 1  ? 2.669   -11.422 -5.219  1.00 15.00 ?  203 GLU B O    12 
ATOM 9606  C CB   . GLU B 2 1  ? 3.060   -8.693  -3.917  1.00 15.00 ?  203 GLU B CB   12 
ATOM 9607  C CG   . GLU B 2 1  ? 2.494   -8.463  -5.319  1.00 15.00 ?  203 GLU B CG   12 
ATOM 9608  C CD   . GLU B 2 1  ? 3.557   -8.132  -6.349  1.00 15.00 ?  203 GLU B CD   12 
ATOM 9609  O OE1  . GLU B 2 1  ? 4.189   -9.071  -6.882  1.00 15.00 -1 203 GLU B OE1  12 
ATOM 9610  O OE2  . GLU B 2 1  ? 3.788   -6.936  -6.610  1.00 15.00 ?  203 GLU B OE2  12 
ATOM 9611  H H1   . GLU B 2 1  ? 5.638   -10.821 -4.531  1.00 15.00 ?  203 GLU B H1   12 
ATOM 9612  H H2   . GLU B 2 1  ? 5.750   -9.149  -4.271  1.00 15.00 ?  203 GLU B H2   12 
ATOM 9613  H H3   . GLU B 2 1  ? 4.855   -9.746  -5.589  1.00 15.00 ?  203 GLU B H3   12 
ATOM 9614  H HA   . GLU B 2 1  ? 4.227   -10.044 -2.716  1.00 15.00 ?  203 GLU B HA   12 
ATOM 9615  H HB2  . GLU B 2 1  ? 2.229   -8.737  -3.227  1.00 15.00 ?  203 GLU B HB2  12 
ATOM 9616  H HB3  . GLU B 2 1  ? 3.677   -7.843  -3.661  1.00 15.00 ?  203 GLU B HB3  12 
ATOM 9617  H HG2  . GLU B 2 1  ? 1.980   -9.359  -5.635  1.00 15.00 ?  203 GLU B HG2  12 
ATOM 9618  H HG3  . GLU B 2 1  ? 1.789   -7.645  -5.274  1.00 15.00 ?  203 GLU B HG3  12 
ATOM 9619  N N    . LEU B 2 2  ? 2.872   -12.055 -3.077  1.00 15.00 ?  204 LEU B N    12 
ATOM 9620  C CA   . LEU B 2 2  ? 2.100   -13.279 -3.249  1.00 15.00 ?  204 LEU B CA   12 
ATOM 9621  C C    . LEU B 2 2  ? 0.610   -12.990 -3.084  1.00 15.00 ?  204 LEU B C    12 
ATOM 9622  O O    . LEU B 2 2  ? -0.243  -13.837 -3.360  1.00 15.00 ?  204 LEU B O    12 
ATOM 9623  C CB   . LEU B 2 2  ? 2.556   -14.329 -2.228  1.00 15.00 ?  204 LEU B CB   12 
ATOM 9624  C CG   . LEU B 2 2  ? 1.973   -15.732 -2.413  1.00 15.00 ?  204 LEU B CG   12 
ATOM 9625  C CD1  . LEU B 2 2  ? 2.452   -16.340 -3.722  1.00 15.00 ?  204 LEU B CD1  12 
ATOM 9626  C CD2  . LEU B 2 2  ? 2.351   -16.621 -1.239  1.00 15.00 ?  204 LEU B CD2  12 
ATOM 9627  H H    . LEU B 2 2  ? 3.252   -11.851 -2.189  1.00 15.00 ?  204 LEU B H    12 
ATOM 9628  H HA   . LEU B 2 2  ? 2.279   -13.652 -4.246  1.00 15.00 ?  204 LEU B HA   12 
ATOM 9629  H HB2  . LEU B 2 2  ? 3.633   -14.402 -2.279  1.00 15.00 ?  204 LEU B HB2  12 
ATOM 9630  H HB3  . LEU B 2 2  ? 2.285   -13.980 -1.244  1.00 15.00 ?  204 LEU B HB3  12 
ATOM 9631  H HG   . LEU B 2 2  ? 0.896   -15.664 -2.452  1.00 15.00 ?  204 LEU B HG   12 
ATOM 9632  H HD11 . LEU B 2 2  ? 2.038   -17.331 -3.830  1.00 15.00 ?  204 LEU B HD11 12 
ATOM 9633  H HD12 . LEU B 2 2  ? 3.530   -16.398 -3.716  1.00 15.00 ?  204 LEU B HD12 12 
ATOM 9634  H HD13 . LEU B 2 2  ? 2.129   -15.721 -4.548  1.00 15.00 ?  204 LEU B HD13 12 
ATOM 9635  H HD21 . LEU B 2 2  ? 1.954   -16.202 -0.326  1.00 15.00 ?  204 LEU B HD21 12 
ATOM 9636  H HD22 . LEU B 2 2  ? 3.425   -16.686 -1.168  1.00 15.00 ?  204 LEU B HD22 12 
ATOM 9637  H HD23 . LEU B 2 2  ? 1.941   -17.610 -1.390  1.00 15.00 ?  204 LEU B HD23 12 
ATOM 9638  N N    . GLU B 2 3  ? 0.313   -11.784 -2.624  1.00 15.00 ?  205 GLU B N    12 
ATOM 9639  C CA   . GLU B 2 3  ? -1.056  -11.367 -2.368  1.00 15.00 ?  205 GLU B CA   12 
ATOM 9640  C C    . GLU B 2 3  ? -1.756  -10.974 -3.670  1.00 15.00 ?  205 GLU B C    12 
ATOM 9641  O O    . GLU B 2 3  ? -1.105  -10.594 -4.647  1.00 15.00 ?  205 GLU B O    12 
ATOM 9642  C CB   . GLU B 2 3  ? -1.056  -10.196 -1.377  1.00 15.00 ?  205 GLU B CB   12 
ATOM 9643  C CG   . GLU B 2 3  ? -2.444  -9.744  -0.946  1.00 15.00 ?  205 GLU B CG   12 
ATOM 9644  C CD   . GLU B 2 3  ? -3.278  -10.874 -0.377  1.00 15.00 ?  205 GLU B CD   12 
ATOM 9645  O OE1  . GLU B 2 3  ? -3.159  -11.158 0.829   1.00 15.00 ?  205 GLU B OE1  12 
ATOM 9646  O OE2  . GLU B 2 3  ? -4.065  -11.479 -1.139  1.00 15.00 -1 205 GLU B OE2  12 
ATOM 9647  H H    . GLU B 2 3  ? 1.038   -11.150 -2.459  1.00 15.00 ?  205 GLU B H    12 
ATOM 9648  H HA   . GLU B 2 3  ? -1.582  -12.202 -1.928  1.00 15.00 ?  205 GLU B HA   12 
ATOM 9649  H HB2  . GLU B 2 3  ? -0.511  -10.491 -0.493  1.00 15.00 ?  205 GLU B HB2  12 
ATOM 9650  H HB3  . GLU B 2 3  ? -0.556  -9.356  -1.833  1.00 15.00 ?  205 GLU B HB3  12 
ATOM 9651  H HG2  . GLU B 2 3  ? -2.341  -8.979  -0.192  1.00 15.00 ?  205 GLU B HG2  12 
ATOM 9652  H HG3  . GLU B 2 3  ? -2.956  -9.335  -1.804  1.00 15.00 ?  205 GLU B HG3  12 
ATOM 9653  N N    . SER B 2 4  ? -3.079  -11.073 -3.652  1.00 15.00 ?  206 SER B N    12 
ATOM 9654  C CA   . SER B 2 4  ? -3.933  -10.699 -4.777  1.00 15.00 ?  206 SER B CA   12 
ATOM 9655  C C    . SER B 2 4  ? -3.620  -9.317  -5.326  1.00 15.00 ?  206 SER B C    12 
ATOM 9656  O O    . SER B 2 4  ? -3.134  -8.428  -4.623  1.00 15.00 ?  206 SER B O    12 
ATOM 9657  C CB   . SER B 2 4  ? -5.395  -10.773 -4.356  1.00 15.00 ?  206 SER B CB   12 
ATOM 9658  O OG   . SER B 2 4  ? -5.575  -10.370 -3.005  1.00 15.00 ?  206 SER B OG   12 
ATOM 9659  H H    . SER B 2 4  ? -3.506  -11.410 -2.832  1.00 15.00 ?  206 SER B H    12 
ATOM 9660  H HA   . SER B 2 4  ? -3.792  -11.408 -5.583  1.00 15.00 ?  206 SER B HA   12 
ATOM 9661  H HB2  . SER B 2 4  ? -5.975  -10.121 -4.994  1.00 15.00 ?  206 SER B HB2  12 
ATOM 9662  H HB3  . SER B 2 4  ? -5.737  -11.787 -4.479  1.00 15.00 ?  206 SER B HB3  12 
ATOM 9663  H HG   . SER B 2 4  ? -5.047  -10.938 -2.422  1.00 15.00 ?  206 SER B HG   12 
ATOM 9664  N N    . PRO B 2 5  ? -3.967  -9.157  -6.598  1.00 15.00 ?  207 PRO B N    12 
ATOM 9665  C CA   . PRO B 2 5  ? -3.749  -7.937  -7.376  1.00 15.00 ?  207 PRO B CA   12 
ATOM 9666  C C    . PRO B 2 5  ? -4.217  -6.682  -6.628  1.00 15.00 ?  207 PRO B C    12 
ATOM 9667  O O    . PRO B 2 5  ? -5.371  -6.603  -6.194  1.00 15.00 ?  207 PRO B O    12 
ATOM 9668  C CB   . PRO B 2 5  ? -4.625  -8.150  -8.615  1.00 15.00 ?  207 PRO B CB   12 
ATOM 9669  C CG   . PRO B 2 5  ? -4.817  -9.630  -8.740  1.00 15.00 ?  207 PRO B CG   12 
ATOM 9670  C CD   . PRO B 2 5  ? -4.558  -10.237 -7.384  1.00 15.00 ?  207 PRO B CD   12 
ATOM 9671  H HA   . PRO B 2 5  ? -2.722  -7.833  -7.673  1.00 15.00 ?  207 PRO B HA   12 
ATOM 9672  H HB2  . PRO B 2 5  ? -5.569  -7.644  -8.479  1.00 15.00 ?  207 PRO B HB2  12 
ATOM 9673  H HB3  . PRO B 2 5  ? -4.121  -7.748  -9.483  1.00 15.00 ?  207 PRO B HB3  12 
ATOM 9674  H HG2  . PRO B 2 5  ? -5.829  -9.839  -9.049  1.00 15.00 ?  207 PRO B HG2  12 
ATOM 9675  H HG3  . PRO B 2 5  ? -4.120  -10.026 -9.464  1.00 15.00 ?  207 PRO B HG3  12 
ATOM 9676  H HD2  . PRO B 2 5  ? -5.464  -10.575 -6.918  1.00 15.00 ?  207 PRO B HD2  12 
ATOM 9677  H HD3  . PRO B 2 5  ? -3.874  -11.063 -7.454  1.00 15.00 ?  207 PRO B HD3  12 
ATOM 9678  N N    . PRO B 2 6  ? -3.315  -5.699  -6.442  1.00 15.00 ?  208 PRO B N    12 
ATOM 9679  C CA   . PRO B 2 6  ? -3.607  -4.495  -5.675  1.00 15.00 ?  208 PRO B CA   12 
ATOM 9680  C C    . PRO B 2 6  ? -4.272  -3.383  -6.491  1.00 15.00 ?  208 PRO B C    12 
ATOM 9681  O O    . PRO B 2 6  ? -4.300  -3.425  -7.723  1.00 15.00 ?  208 PRO B O    12 
ATOM 9682  C CB   . PRO B 2 6  ? -2.227  -4.042  -5.179  1.00 15.00 ?  208 PRO B CB   12 
ATOM 9683  C CG   . PRO B 2 6  ? -1.205  -4.846  -5.925  1.00 15.00 ?  208 PRO B CG   12 
ATOM 9684  C CD   . PRO B 2 6  ? -1.934  -5.680  -6.944  1.00 15.00 ?  208 PRO B CD   12 
ATOM 9685  H HA   . PRO B 2 6  ? -4.230  -4.721  -4.823  1.00 15.00 ?  208 PRO B HA   12 
ATOM 9686  H HB2  . PRO B 2 6  ? -2.110  -2.986  -5.375  1.00 15.00 ?  208 PRO B HB2  12 
ATOM 9687  H HB3  . PRO B 2 6  ? -2.163  -4.219  -4.111  1.00 15.00 ?  208 PRO B HB3  12 
ATOM 9688  H HG2  . PRO B 2 6  ? -0.513  -4.182  -6.420  1.00 15.00 ?  208 PRO B HG2  12 
ATOM 9689  H HG3  . PRO B 2 6  ? -0.674  -5.484  -5.234  1.00 15.00 ?  208 PRO B HG3  12 
ATOM 9690  H HD2  . PRO B 2 6  ? -1.883  -5.216  -7.918  1.00 15.00 ?  208 PRO B HD2  12 
ATOM 9691  H HD3  . PRO B 2 6  ? -1.513  -6.671  -6.972  1.00 15.00 ?  208 PRO B HD3  12 
ATOM 9692  N N    . PRO B 2 7  ? -4.821  -2.379  -5.781  1.00 15.00 ?  209 PRO B N    12 
ATOM 9693  C CA   . PRO B 2 7  ? -5.464  -1.202  -6.385  1.00 15.00 ?  209 PRO B CA   12 
ATOM 9694  C C    . PRO B 2 7  ? -4.574  -0.487  -7.404  1.00 15.00 ?  209 PRO B C    12 
ATOM 9695  O O    . PRO B 2 7  ? -3.377  -0.313  -7.174  1.00 15.00 ?  209 PRO B O    12 
ATOM 9696  C CB   . PRO B 2 7  ? -5.694  -0.270  -5.189  1.00 15.00 ?  209 PRO B CB   12 
ATOM 9697  C CG   . PRO B 2 7  ? -5.719  -1.148  -3.994  1.00 15.00 ?  209 PRO B CG   12 
ATOM 9698  C CD   . PRO B 2 7  ? -4.861  -2.336  -4.310  1.00 15.00 ?  209 PRO B CD   12 
ATOM 9699  H HA   . PRO B 2 7  ? -6.410  -1.452  -6.839  1.00 15.00 ?  209 PRO B HA   12 
ATOM 9700  H HB2  . PRO B 2 7  ? -4.887  0.445   -5.131  1.00 15.00 ?  209 PRO B HB2  12 
ATOM 9701  H HB3  . PRO B 2 7  ? -6.630  0.251   -5.307  1.00 15.00 ?  209 PRO B HB3  12 
ATOM 9702  H HG2  . PRO B 2 7  ? -5.310  -0.615  -3.149  1.00 15.00 ?  209 PRO B HG2  12 
ATOM 9703  H HG3  . PRO B 2 7  ? -6.732  -1.461  -3.788  1.00 15.00 ?  209 PRO B HG3  12 
ATOM 9704  H HD2  . PRO B 2 7  ? -3.871  -2.201  -3.904  1.00 15.00 ?  209 PRO B HD2  12 
ATOM 9705  H HD3  . PRO B 2 7  ? -5.308  -3.236  -3.914  1.00 15.00 ?  209 PRO B HD3  12 
ATOM 9706  N N    . PRO B 2 8  ? -5.156  -0.047  -8.535  1.00 15.00 ?  210 PRO B N    12 
ATOM 9707  C CA   . PRO B 2 8  ? -4.457  0.806   -9.505  1.00 15.00 ?  210 PRO B CA   12 
ATOM 9708  C C    . PRO B 2 8  ? -3.884  2.045   -8.820  1.00 15.00 ?  210 PRO B C    12 
ATOM 9709  O O    . PRO B 2 8  ? -4.528  2.615   -7.935  1.00 15.00 ?  210 PRO B O    12 
ATOM 9710  C CB   . PRO B 2 8  ? -5.557  1.199   -10.493 1.00 15.00 ?  210 PRO B CB   12 
ATOM 9711  C CG   . PRO B 2 8  ? -6.572  0.115   -10.384 1.00 15.00 ?  210 PRO B CG   12 
ATOM 9712  C CD   . PRO B 2 8  ? -6.537  -0.347  -8.954  1.00 15.00 ?  210 PRO B CD   12 
ATOM 9713  H HA   . PRO B 2 8  ? -3.669  0.272   -10.017 1.00 15.00 ?  210 PRO B HA   12 
ATOM 9714  H HB2  . PRO B 2 8  ? -5.970  2.157   -10.212 1.00 15.00 ?  210 PRO B HB2  12 
ATOM 9715  H HB3  . PRO B 2 8  ? -5.146  1.256   -11.490 1.00 15.00 ?  210 PRO B HB3  12 
ATOM 9716  H HG2  . PRO B 2 8  ? -7.550  0.501   -10.629 1.00 15.00 ?  210 PRO B HG2  12 
ATOM 9717  H HG3  . PRO B 2 8  ? -6.313  -0.699  -11.044 1.00 15.00 ?  210 PRO B HG3  12 
ATOM 9718  H HD2  . PRO B 2 8  ? -7.248  0.207   -8.361  1.00 15.00 ?  210 PRO B HD2  12 
ATOM 9719  H HD3  . PRO B 2 8  ? -6.736  -1.407  -8.893  1.00 15.00 ?  210 PRO B HD3  12 
ATOM 9720  N N    . TYR B 2 9  ? -2.693  2.474   -9.229  1.00 15.00 ?  211 TYR B N    12 
ATOM 9721  C CA   . TYR B 2 9  ? -1.999  3.529   -8.502  1.00 15.00 ?  211 TYR B CA   12 
ATOM 9722  C C    . TYR B 2 9  ? -2.670  4.888   -8.658  1.00 15.00 ?  211 TYR B C    12 
ATOM 9723  O O    . TYR B 2 9  ? -2.497  5.582   -9.663  1.00 15.00 ?  211 TYR B O    12 
ATOM 9724  C CB   . TYR B 2 9  ? -0.523  3.640   -8.896  1.00 15.00 ?  211 TYR B CB   12 
ATOM 9725  C CG   . TYR B 2 9  ? 0.236   4.637   -8.037  1.00 15.00 ?  211 TYR B CG   12 
ATOM 9726  C CD1  . TYR B 2 9  ? 0.366   4.437   -6.667  1.00 15.00 ?  211 TYR B CD1  12 
ATOM 9727  C CD2  . TYR B 2 9  ? 0.814   5.782   -8.585  1.00 15.00 ?  211 TYR B CD2  12 
ATOM 9728  C CE1  . TYR B 2 9  ? 1.043   5.342   -5.875  1.00 15.00 ?  211 TYR B CE1  12 
ATOM 9729  C CE2  . TYR B 2 9  ? 1.495   6.686   -7.785  1.00 15.00 ?  211 TYR B CE2  12 
ATOM 9730  C CZ   . TYR B 2 9  ? 1.602   6.459   -6.443  1.00 15.00 ?  211 TYR B CZ   12 
ATOM 9731  O OH   . TYR B 2 9  ? 2.275   7.367   -5.671  1.00 15.00 ?  211 TYR B OH   12 
ATOM 9732  H H    . TYR B 2 9  ? -2.283  2.080   -10.024 1.00 15.00 ?  211 TYR B H    12 
ATOM 9733  H HA   . TYR B 2 9  ? -2.041  3.261   -7.456  1.00 15.00 ?  211 TYR B HA   12 
ATOM 9734  H HB2  . TYR B 2 9  ? -0.050  2.675   -8.788  1.00 15.00 ?  211 TYR B HB2  12 
ATOM 9735  H HB3  . TYR B 2 9  ? -0.451  3.960   -9.924  1.00 15.00 ?  211 TYR B HB3  12 
ATOM 9736  H HD1  . TYR B 2 9  ? -0.075  3.559   -6.221  1.00 15.00 ?  211 TYR B HD1  12 
ATOM 9737  H HD2  . TYR B 2 9  ? 0.727   5.960   -9.647  1.00 15.00 ?  211 TYR B HD2  12 
ATOM 9738  H HE1  . TYR B 2 9  ? 1.133   5.168   -4.813  1.00 15.00 ?  211 TYR B HE1  12 
ATOM 9739  H HE2  . TYR B 2 9  ? 1.945   7.570   -8.208  1.00 15.00 ?  211 TYR B HE2  12 
ATOM 9740  H HH   . TYR B 2 9  ? 2.220   8.237   -6.090  1.00 15.00 ?  211 TYR B HH   12 
ATOM 9741  N N    . SER B 2 10 ? -3.481  5.219   -7.676  1.00 15.00 ?  212 SER B N    12 
ATOM 9742  C CA   . SER B 2 10 ? -3.914  6.576   -7.442  1.00 15.00 ?  212 SER B CA   12 
ATOM 9743  C C    . SER B 2 10 ? -3.158  7.051   -6.214  1.00 15.00 ?  212 SER B C    12 
ATOM 9744  O O    . SER B 2 10 ? -2.823  6.225   -5.363  1.00 15.00 ?  212 SER B O    12 
ATOM 9745  C CB   . SER B 2 10 ? -5.429  6.621   -7.213  1.00 15.00 ?  212 SER B CB   12 
ATOM 9746  O OG   . SER B 2 10 ? -5.903  7.957   -7.150  1.00 15.00 ?  212 SER B OG   12 
ATOM 9747  H H    . SER B 2 10 ? -3.809  4.513   -7.079  1.00 15.00 ?  212 SER B H    12 
ATOM 9748  H HA   . SER B 2 10 ? -3.643  7.182   -8.296  1.00 15.00 ?  212 SER B HA   12 
ATOM 9749  H HB2  . SER B 2 10 ? -5.928  6.114   -8.025  1.00 15.00 ?  212 SER B HB2  12 
ATOM 9750  H HB3  . SER B 2 10 ? -5.663  6.125   -6.282  1.00 15.00 ?  212 SER B HB3  12 
ATOM 9751  H HG   . SER B 2 10 ? -6.237  8.138   -6.263  1.00 15.00 ?  212 SER B HG   12 
ATOM 9752  N N    . ARG B 2 11 ? -2.872  8.343   -6.105  1.00 15.00 ?  213 ARG B N    12 
ATOM 9753  C CA   . ARG B 2 11 ? -2.077  8.821   -4.976  1.00 15.00 ?  213 ARG B CA   12 
ATOM 9754  C C    . ARG B 2 11 ? -2.805  8.479   -3.688  1.00 15.00 ?  213 ARG B C    12 
ATOM 9755  O O    . ARG B 2 11 ? -2.215  7.966   -2.738  1.00 15.00 ?  213 ARG B O    12 
ATOM 9756  C CB   . ARG B 2 11 ? -1.828  10.339  -5.019  1.00 15.00 ?  213 ARG B CB   12 
ATOM 9757  C CG   . ARG B 2 11 ? -1.690  10.934  -6.406  1.00 15.00 ?  213 ARG B CG   12 
ATOM 9758  C CD   . ARG B 2 11 ? -0.618  10.230  -7.225  1.00 15.00 ?  213 ARG B CD   12 
ATOM 9759  N NE   . ARG B 2 11 ? -0.692  10.582  -8.643  1.00 15.00 ?  213 ARG B NE   12 
ATOM 9760  C CZ   . ARG B 2 11 ? 0.364   10.710  -9.445  1.00 15.00 ?  213 ARG B CZ   12 
ATOM 9761  N NH1  . ARG B 2 11 ? 1.591   10.598  -8.957  1.00 15.00 1  213 ARG B NH1  12 
ATOM 9762  N NH2  . ARG B 2 11 ? 0.186   10.960  -10.735 1.00 15.00 ?  213 ARG B NH2  12 
ATOM 9763  H H    . ARG B 2 11 ? -3.206  8.974   -6.778  1.00 15.00 ?  213 ARG B H    12 
ATOM 9764  H HA   . ARG B 2 11 ? -1.130  8.302   -4.994  1.00 15.00 ?  213 ARG B HA   12 
ATOM 9765  H HB2  . ARG B 2 11 ? -2.651  10.836  -4.527  1.00 15.00 ?  213 ARG B HB2  12 
ATOM 9766  H HB3  . ARG B 2 11 ? -0.921  10.552  -4.471  1.00 15.00 ?  213 ARG B HB3  12 
ATOM 9767  H HG2  . ARG B 2 11 ? -2.636  10.857  -6.906  1.00 15.00 ?  213 ARG B HG2  12 
ATOM 9768  H HG3  . ARG B 2 11 ? -1.423  11.975  -6.308  1.00 15.00 ?  213 ARG B HG3  12 
ATOM 9769  H HD2  . ARG B 2 11 ? 0.352   10.511  -6.843  1.00 15.00 ?  213 ARG B HD2  12 
ATOM 9770  H HD3  . ARG B 2 11 ? -0.748  9.163   -7.120  1.00 15.00 ?  213 ARG B HD3  12 
ATOM 9771  H HE   . ARG B 2 11 ? -1.592  10.703  -9.027  1.00 15.00 ?  213 ARG B HE   12 
ATOM 9772  H HH11 . ARG B 2 11 ? 1.733   10.419  -7.981  1.00 15.00 ?  213 ARG B HH11 12 
ATOM 9773  H HH12 . ARG B 2 11 ? 2.393   10.693  -9.568  1.00 15.00 ?  213 ARG B HH12 12 
ATOM 9774  H HH21 . ARG B 2 11 ? -0.744  11.050  -11.108 1.00 15.00 ?  213 ARG B HH21 12 
ATOM 9775  H HH22 . ARG B 2 11 ? 0.977   11.064  -11.345 1.00 15.00 ?  213 ARG B HH22 12 
ATOM 9776  N N    . TYR B 2 12 ? -4.085  8.814   -3.661  1.00 15.00 ?  214 TYR B N    12 
ATOM 9777  C CA   . TYR B 2 12 ? -4.956  8.453   -2.557  1.00 15.00 ?  214 TYR B CA   12 
ATOM 9778  C C    . TYR B 2 12 ? -6.104  7.602   -3.075  1.00 15.00 ?  214 TYR B C    12 
ATOM 9779  O O    . TYR B 2 12 ? -7.139  8.112   -3.505  1.00 15.00 ?  214 TYR B O    12 
ATOM 9780  C CB   . TYR B 2 12 ? -5.463  9.714   -1.844  1.00 15.00 ?  214 TYR B CB   12 
ATOM 9781  C CG   . TYR B 2 12 ? -4.362  10.724  -1.593  1.00 15.00 ?  214 TYR B CG   12 
ATOM 9782  C CD1  . TYR B 2 12 ? -3.883  11.514  -2.631  1.00 15.00 ?  214 TYR B CD1  12 
ATOM 9783  C CD2  . TYR B 2 12 ? -3.780  10.867  -0.340  1.00 15.00 ?  214 TYR B CD2  12 
ATOM 9784  C CE1  . TYR B 2 12 ? -2.861  12.411  -2.437  1.00 15.00 ?  214 TYR B CE1  12 
ATOM 9785  C CE2  . TYR B 2 12 ? -2.758  11.773  -0.131  1.00 15.00 ?  214 TYR B CE2  12 
ATOM 9786  C CZ   . TYR B 2 12 ? -2.300  12.542  -1.182  1.00 15.00 ?  214 TYR B CZ   12 
ATOM 9787  O OH   . TYR B 2 12 ? -1.280  13.442  -0.977  1.00 15.00 ?  214 TYR B OH   12 
ATOM 9788  H H    . TYR B 2 12 ? -4.462  9.330   -4.413  1.00 15.00 ?  214 TYR B H    12 
ATOM 9789  H HA   . TYR B 2 12 ? -4.380  7.846   -1.862  1.00 15.00 ?  214 TYR B HA   12 
ATOM 9790  H HB2  . TYR B 2 12 ? -6.221  10.187  -2.451  1.00 15.00 ?  214 TYR B HB2  12 
ATOM 9791  H HB3  . TYR B 2 12 ? -5.886  9.438   -0.890  1.00 15.00 ?  214 TYR B HB3  12 
ATOM 9792  H HD1  . TYR B 2 12 ? -4.325  11.412  -3.612  1.00 15.00 ?  214 TYR B HD1  12 
ATOM 9793  H HD2  . TYR B 2 12 ? -4.141  10.264  0.480   1.00 15.00 ?  214 TYR B HD2  12 
ATOM 9794  H HE1  . TYR B 2 12 ? -2.503  13.003  -3.271  1.00 15.00 ?  214 TYR B HE1  12 
ATOM 9795  H HE2  . TYR B 2 12 ? -2.316  11.874  0.849   1.00 15.00 ?  214 TYR B HE2  12 
ATOM 9796  H HH   . TYR B 2 12 ? -0.653  13.074  -0.344  1.00 15.00 ?  214 TYR B HH   12 
ATOM 9797  N N    . PRO B 2 13 ? -5.891  6.291   -3.111  1.00 15.00 ?  215 PRO B N    12 
ATOM 9798  C CA   . PRO B 2 13 ? -6.874  5.340   -3.603  1.00 15.00 ?  215 PRO B CA   12 
ATOM 9799  C C    . PRO B 2 13 ? -7.876  4.925   -2.529  1.00 15.00 ?  215 PRO B C    12 
ATOM 9800  O O    . PRO B 2 13 ? -7.516  4.730   -1.370  1.00 15.00 ?  215 PRO B O    12 
ATOM 9801  C CB   . PRO B 2 13 ? -6.011  4.155   -4.028  1.00 15.00 ?  215 PRO B CB   12 
ATOM 9802  C CG   . PRO B 2 13 ? -4.783  4.225   -3.174  1.00 15.00 ?  215 PRO B CG   12 
ATOM 9803  C CD   . PRO B 2 13 ? -4.648  5.635   -2.680  1.00 15.00 ?  215 PRO B CD   12 
ATOM 9804  H HA   . PRO B 2 13 ? -7.405  5.729   -4.460  1.00 15.00 ?  215 PRO B HA   12 
ATOM 9805  H HB2  . PRO B 2 13 ? -6.556  3.238   -3.862  1.00 15.00 ?  215 PRO B HB2  12 
ATOM 9806  H HB3  . PRO B 2 13 ? -5.766  4.248   -5.077  1.00 15.00 ?  215 PRO B HB3  12 
ATOM 9807  H HG2  . PRO B 2 13 ? -4.884  3.557   -2.329  1.00 15.00 ?  215 PRO B HG2  12 
ATOM 9808  H HG3  . PRO B 2 13 ? -3.917  3.953   -3.758  1.00 15.00 ?  215 PRO B HG3  12 
ATOM 9809  H HD2  . PRO B 2 13 ? -4.564  5.646   -1.603  1.00 15.00 ?  215 PRO B HD2  12 
ATOM 9810  H HD3  . PRO B 2 13 ? -3.787  6.107   -3.129  1.00 15.00 ?  215 PRO B HD3  12 
ATOM 9811  N N    . MET B 2 14 ? -9.129  4.789   -2.922  1.00 15.00 ?  216 MET B N    12 
ATOM 9812  C CA   . MET B 2 14 ? -10.180 4.367   -2.004  1.00 15.00 ?  216 MET B CA   12 
ATOM 9813  C C    . MET B 2 14 ? -10.875 3.122   -2.540  1.00 15.00 ?  216 MET B C    12 
ATOM 9814  O O    . MET B 2 14 ? -11.394 3.125   -3.660  1.00 15.00 ?  216 MET B O    12 
ATOM 9815  C CB   . MET B 2 14 ? -11.200 5.491   -1.811  1.00 15.00 ?  216 MET B CB   12 
ATOM 9816  C CG   . MET B 2 14 ? -12.344 5.124   -0.877  1.00 15.00 ?  216 MET B CG   12 
ATOM 9817  S SD   . MET B 2 14 ? -11.782 4.749   0.795   1.00 15.00 ?  216 MET B SD   12 
ATOM 9818  C CE   . MET B 2 14 ? -13.329 4.297   1.575   1.00 15.00 ?  216 MET B CE   12 
ATOM 9819  H H    . MET B 2 14 ? -9.358  4.972   -3.863  1.00 15.00 ?  216 MET B H    12 
ATOM 9820  H HA   . MET B 2 14 ? -9.723  4.133   -1.055  1.00 15.00 ?  216 MET B HA   12 
ATOM 9821  H HB2  . MET B 2 14 ? -10.695 6.354   -1.404  1.00 15.00 ?  216 MET B HB2  12 
ATOM 9822  H HB3  . MET B 2 14 ? -11.618 5.749   -2.772  1.00 15.00 ?  216 MET B HB3  12 
ATOM 9823  H HG2  . MET B 2 14 ? -13.034 5.953   -0.832  1.00 15.00 ?  216 MET B HG2  12 
ATOM 9824  H HG3  . MET B 2 14 ? -12.852 4.257   -1.276  1.00 15.00 ?  216 MET B HG3  12 
ATOM 9825  H HE1  . MET B 2 14 ? -13.759 3.452   1.059   1.00 15.00 ?  216 MET B HE1  12 
ATOM 9826  H HE2  . MET B 2 14 ? -14.012 5.132   1.530   1.00 15.00 ?  216 MET B HE2  12 
ATOM 9827  H HE3  . MET B 2 14 ? -13.148 4.036   2.608   1.00 15.00 ?  216 MET B HE3  12 
ATOM 9828  N N    . ASP B 2 15 ? -10.882 2.060   -1.749  1.00 15.00 ?  217 ASP B N    12 
ATOM 9829  C CA   . ASP B 2 15 ? -11.512 0.812   -2.156  1.00 15.00 ?  217 ASP B CA   12 
ATOM 9830  C C    . ASP B 2 15 ? -11.979 0.022   -0.939  1.00 15.00 ?  217 ASP B C    12 
ATOM 9831  O O    . ASP B 2 15 ? -13.206 -0.088  -0.743  1.00 15.00 ?  217 ASP B O    12 
ATOM 9832  C CB   . ASP B 2 15 ? -10.558 -0.031  -3.001  1.00 15.00 ?  217 ASP B CB   12 
ATOM 9833  C CG   . ASP B 2 15 ? -11.192 -1.324  -3.469  1.00 15.00 ?  217 ASP B CG   12 
ATOM 9834  O OD1  . ASP B 2 15 ? -12.031 -1.284  -4.397  1.00 15.00 ?  217 ASP B OD1  12 
ATOM 9835  O OD2  . ASP B 2 15 ? -10.847 -2.391  -2.929  1.00 15.00 -1 217 ASP B OD2  12 
ATOM 9836  O OXT  . ASP B 2 15 ? -11.121 -0.457  -0.168  1.00 15.00 ?  217 ASP B OXT  12 
ATOM 9837  H H    . ASP B 2 15 ? -10.460 2.116   -0.860  1.00 15.00 ?  217 ASP B H    12 
ATOM 9838  H HA   . ASP B 2 15 ? -12.377 1.061   -2.754  1.00 15.00 ?  217 ASP B HA   12 
ATOM 9839  H HB2  . ASP B 2 15 ? -10.259 0.538   -3.870  1.00 15.00 ?  217 ASP B HB2  12 
ATOM 9840  H HB3  . ASP B 2 15 ? -9.682  -0.271  -2.415  1.00 15.00 ?  217 ASP B HB3  12 
ATOM 9841  N N    . GLY A 1 1  ? 4.103   4.277   14.994  1.00 15.00 ?  297 GLY A N    13 
ATOM 9842  C CA   . GLY A 1 1  ? 4.927   3.590   13.971  1.00 15.00 ?  297 GLY A CA   13 
ATOM 9843  C C    . GLY A 1 1  ? 5.493   4.563   12.964  1.00 15.00 ?  297 GLY A C    13 
ATOM 9844  O O    . GLY A 1 1  ? 4.731   5.249   12.284  1.00 15.00 ?  297 GLY A O    13 
ATOM 9845  H H1   . GLY A 1 1  ? 3.370   4.858   14.530  1.00 15.00 ?  297 GLY A H1   13 
ATOM 9846  H H2   . GLY A 1 1  ? 4.702   4.897   15.580  1.00 15.00 ?  297 GLY A H2   13 
ATOM 9847  H H3   . GLY A 1 1  ? 3.638   3.577   15.607  1.00 15.00 ?  297 GLY A H3   13 
ATOM 9848  H HA2  . GLY A 1 1  ? 5.741   3.078   14.461  1.00 15.00 ?  297 GLY A HA2  13 
ATOM 9849  H HA3  . GLY A 1 1  ? 4.314   2.865   13.454  1.00 15.00 ?  297 GLY A HA3  13 
ATOM 9850  N N    . PRO A 1 2  ? 6.829   4.659   12.849  1.00 15.00 ?  298 PRO A N    13 
ATOM 9851  C CA   . PRO A 1 2  ? 7.473   5.572   11.904  1.00 15.00 ?  298 PRO A CA   13 
ATOM 9852  C C    . PRO A 1 2  ? 7.071   5.277   10.454  1.00 15.00 ?  298 PRO A C    13 
ATOM 9853  O O    . PRO A 1 2  ? 7.523   4.291   9.866   1.00 15.00 ?  298 PRO A O    13 
ATOM 9854  C CB   . PRO A 1 2  ? 8.972   5.316   12.105  1.00 15.00 ?  298 PRO A CB   13 
ATOM 9855  C CG   . PRO A 1 2  ? 9.078   4.680   13.449  1.00 15.00 ?  298 PRO A CG   13 
ATOM 9856  C CD   . PRO A 1 2  ? 7.813   3.890   13.628  1.00 15.00 ?  298 PRO A CD   13 
ATOM 9857  H HA   . PRO A 1 2  ? 7.253   6.601   12.143  1.00 15.00 ?  298 PRO A HA   13 
ATOM 9858  H HB2  . PRO A 1 2  ? 9.335   4.660   11.327  1.00 15.00 ?  298 PRO A HB2  13 
ATOM 9859  H HB3  . PRO A 1 2  ? 9.507   6.254   12.070  1.00 15.00 ?  298 PRO A HB3  13 
ATOM 9860  H HG2  . PRO A 1 2  ? 9.937   4.027   13.482  1.00 15.00 ?  298 PRO A HG2  13 
ATOM 9861  H HG3  . PRO A 1 2  ? 9.154   5.442   14.212  1.00 15.00 ?  298 PRO A HG3  13 
ATOM 9862  H HD2  . PRO A 1 2  ? 7.931   2.894   13.227  1.00 15.00 ?  298 PRO A HD2  13 
ATOM 9863  H HD3  . PRO A 1 2  ? 7.536   3.850   14.671  1.00 15.00 ?  298 PRO A HD3  13 
ATOM 9864  N N    . LEU A 1 3  ? 6.174   6.094   9.908   1.00 15.00 ?  299 LEU A N    13 
ATOM 9865  C CA   . LEU A 1 3  ? 5.764   5.959   8.524   1.00 15.00 ?  299 LEU A CA   13 
ATOM 9866  C C    . LEU A 1 3  ? 6.582   6.914   7.667   1.00 15.00 ?  299 LEU A C    13 
ATOM 9867  O O    . LEU A 1 3  ? 6.577   8.122   7.918   1.00 15.00 ?  299 LEU A O    13 
ATOM 9868  C CB   . LEU A 1 3  ? 4.274   6.280   8.376   1.00 15.00 ?  299 LEU A CB   13 
ATOM 9869  C CG   . LEU A 1 3  ? 3.711   6.120   6.962   1.00 15.00 ?  299 LEU A CG   13 
ATOM 9870  C CD1  . LEU A 1 3  ? 3.625   4.649   6.578   1.00 15.00 ?  299 LEU A CD1  13 
ATOM 9871  C CD2  . LEU A 1 3  ? 2.351   6.787   6.859   1.00 15.00 ?  299 LEU A CD2  13 
ATOM 9872  H H    . LEU A 1 3  ? 5.774   6.808   10.452  1.00 15.00 ?  299 LEU A H    13 
ATOM 9873  H HA   . LEU A 1 3  ? 5.946   4.942   8.211   1.00 15.00 ?  299 LEU A HA   13 
ATOM 9874  H HB2  . LEU A 1 3  ? 3.720   5.628   9.036   1.00 15.00 ?  299 LEU A HB2  13 
ATOM 9875  H HB3  . LEU A 1 3  ? 4.113   7.300   8.688   1.00 15.00 ?  299 LEU A HB3  13 
ATOM 9876  H HG   . LEU A 1 3  ? 4.378   6.606   6.264   1.00 15.00 ?  299 LEU A HG   13 
ATOM 9877  H HD11 . LEU A 1 3  ? 2.956   4.139   7.255   1.00 15.00 ?  299 LEU A HD11 13 
ATOM 9878  H HD12 . LEU A 1 3  ? 4.607   4.202   6.639   1.00 15.00 ?  299 LEU A HD12 13 
ATOM 9879  H HD13 . LEU A 1 3  ? 3.252   4.562   5.568   1.00 15.00 ?  299 LEU A HD13 13 
ATOM 9880  H HD21 . LEU A 1 3  ? 1.677   6.344   7.576   1.00 15.00 ?  299 LEU A HD21 13 
ATOM 9881  H HD22 . LEU A 1 3  ? 1.957   6.651   5.863   1.00 15.00 ?  299 LEU A HD22 13 
ATOM 9882  H HD23 . LEU A 1 3  ? 2.451   7.842   7.064   1.00 15.00 ?  299 LEU A HD23 13 
ATOM 9883  N N    . PRO A 1 4  ? 7.292   6.410   6.649   1.00 15.00 ?  300 PRO A N    13 
ATOM 9884  C CA   . PRO A 1 4  ? 8.148   7.252   5.810   1.00 15.00 ?  300 PRO A CA   13 
ATOM 9885  C C    . PRO A 1 4  ? 7.321   8.174   4.915   1.00 15.00 ?  300 PRO A C    13 
ATOM 9886  O O    . PRO A 1 4  ? 6.354   7.736   4.301   1.00 15.00 ?  300 PRO A O    13 
ATOM 9887  C CB   . PRO A 1 4  ? 8.935   6.245   4.961   1.00 15.00 ?  300 PRO A CB   13 
ATOM 9888  C CG   . PRO A 1 4  ? 8.652   4.900   5.550   1.00 15.00 ?  300 PRO A CG   13 
ATOM 9889  C CD   . PRO A 1 4  ? 7.306   5.008   6.197   1.00 15.00 ?  300 PRO A CD   13 
ATOM 9890  H HA   . PRO A 1 4  ? 8.828   7.841   6.405   1.00 15.00 ?  300 PRO A HA   13 
ATOM 9891  H HB2  . PRO A 1 4  ? 8.596   6.307   3.940   1.00 15.00 ?  300 PRO A HB2  13 
ATOM 9892  H HB3  . PRO A 1 4  ? 9.990   6.482   5.008   1.00 15.00 ?  300 PRO A HB3  13 
ATOM 9893  H HG2  . PRO A 1 4  ? 8.631   4.152   4.770   1.00 15.00 ?  300 PRO A HG2  13 
ATOM 9894  H HG3  . PRO A 1 4  ? 9.403   4.655   6.286   1.00 15.00 ?  300 PRO A HG3  13 
ATOM 9895  H HD2  . PRO A 1 4  ? 6.524   4.826   5.472   1.00 15.00 ?  300 PRO A HD2  13 
ATOM 9896  H HD3  . PRO A 1 4  ? 7.227   4.319   7.024   1.00 15.00 ?  300 PRO A HD3  13 
ATOM 9897  N N    . PRO A 1 5  ? 7.701   9.461   4.817   1.00 15.00 ?  301 PRO A N    13 
ATOM 9898  C CA   . PRO A 1 5  ? 6.939   10.469  4.056   1.00 15.00 ?  301 PRO A CA   13 
ATOM 9899  C C    . PRO A 1 5  ? 6.878   10.187  2.552   1.00 15.00 ?  301 PRO A C    13 
ATOM 9900  O O    . PRO A 1 5  ? 6.053   10.759  1.838   1.00 15.00 ?  301 PRO A O    13 
ATOM 9901  C CB   . PRO A 1 5  ? 7.694   11.779  4.319   1.00 15.00 ?  301 PRO A CB   13 
ATOM 9902  C CG   . PRO A 1 5  ? 8.533   11.508  5.521   1.00 15.00 ?  301 PRO A CG   13 
ATOM 9903  C CD   . PRO A 1 5  ? 8.884   10.051  5.459   1.00 15.00 ?  301 PRO A CD   13 
ATOM 9904  H HA   . PRO A 1 5  ? 5.931   10.559  4.436   1.00 15.00 ?  301 PRO A HA   13 
ATOM 9905  H HB2  . PRO A 1 5  ? 8.303   12.025  3.461   1.00 15.00 ?  301 PRO A HB2  13 
ATOM 9906  H HB3  . PRO A 1 5  ? 6.987   12.572  4.504   1.00 15.00 ?  301 PRO A HB3  13 
ATOM 9907  H HG2  . PRO A 1 5  ? 9.428   12.112  5.488   1.00 15.00 ?  301 PRO A HG2  13 
ATOM 9908  H HG3  . PRO A 1 5  ? 7.969   11.720  6.417   1.00 15.00 ?  301 PRO A HG3  13 
ATOM 9909  H HD2  . PRO A 1 5  ? 9.769   9.898   4.857   1.00 15.00 ?  301 PRO A HD2  13 
ATOM 9910  H HD3  . PRO A 1 5  ? 9.026   9.652   6.453   1.00 15.00 ?  301 PRO A HD3  13 
ATOM 9911  N N    . GLY A 1 6  ? 7.777   9.337   2.071   1.00 15.00 ?  302 GLY A N    13 
ATOM 9912  C CA   . GLY A 1 6  ? 7.746   8.934   0.675   1.00 15.00 ?  302 GLY A CA   13 
ATOM 9913  C C    . GLY A 1 6  ? 6.830   7.746   0.464   1.00 15.00 ?  302 GLY A C    13 
ATOM 9914  O O    . GLY A 1 6  ? 6.438   7.428   -0.662  1.00 15.00 ?  302 GLY A O    13 
ATOM 9915  H H    . GLY A 1 6  ? 8.471   8.987   2.665   1.00 15.00 ?  302 GLY A H    13 
ATOM 9916  H HA2  . GLY A 1 6  ? 7.396   9.763   0.075   1.00 15.00 ?  302 GLY A HA2  13 
ATOM 9917  H HA3  . GLY A 1 6  ? 8.745   8.669   0.363   1.00 15.00 ?  302 GLY A HA3  13 
ATOM 9918  N N    . TRP A 1 7  ? 6.486   7.109   1.571   1.00 15.00 ?  303 TRP A N    13 
ATOM 9919  C CA   . TRP A 1 7  ? 5.644   5.928   1.576   1.00 15.00 ?  303 TRP A CA   13 
ATOM 9920  C C    . TRP A 1 7  ? 4.204   6.298   1.868   1.00 15.00 ?  303 TRP A C    13 
ATOM 9921  O O    . TRP A 1 7  ? 3.939   7.259   2.592   1.00 15.00 ?  303 TRP A O    13 
ATOM 9922  C CB   . TRP A 1 7  ? 6.121   4.952   2.635   1.00 15.00 ?  303 TRP A CB   13 
ATOM 9923  C CG   . TRP A 1 7  ? 7.177   4.019   2.162   1.00 15.00 ?  303 TRP A CG   13 
ATOM 9924  C CD1  . TRP A 1 7  ? 8.525   4.231   2.143   1.00 15.00 ?  303 TRP A CD1  13 
ATOM 9925  C CD2  . TRP A 1 7  ? 6.968   2.713   1.639   1.00 15.00 ?  303 TRP A CD2  13 
ATOM 9926  N NE1  . TRP A 1 7  ? 9.162   3.121   1.665   1.00 15.00 ?  303 TRP A NE1  13 
ATOM 9927  C CE2  . TRP A 1 7  ? 8.225   2.181   1.347   1.00 15.00 ?  303 TRP A CE2  13 
ATOM 9928  C CE3  . TRP A 1 7  ? 5.838   1.932   1.397   1.00 15.00 ?  303 TRP A CE3  13 
ATOM 9929  C CZ2  . TRP A 1 7  ? 8.380   0.914   0.831   1.00 15.00 ?  303 TRP A CZ2  13 
ATOM 9930  C CZ3  . TRP A 1 7  ? 6.003   0.673   0.881   1.00 15.00 ?  303 TRP A CZ3  13 
ATOM 9931  C CH2  . TRP A 1 7  ? 7.265   0.173   0.605   1.00 15.00 ?  303 TRP A CH2  13 
ATOM 9932  H H    . TRP A 1 7  ? 6.794   7.464   2.432   1.00 15.00 ?  303 TRP A H    13 
ATOM 9933  H HA   . TRP A 1 7  ? 5.713   5.463   0.605   1.00 15.00 ?  303 TRP A HA   13 
ATOM 9934  H HB2  . TRP A 1 7  ? 6.519   5.507   3.471   1.00 15.00 ?  303 TRP A HB2  13 
ATOM 9935  H HB3  . TRP A 1 7  ? 5.281   4.363   2.972   1.00 15.00 ?  303 TRP A HB3  13 
ATOM 9936  H HD1  . TRP A 1 7  ? 9.005   5.138   2.467   1.00 15.00 ?  303 TRP A HD1  13 
ATOM 9937  H HE1  . TRP A 1 7  ? 10.140  3.016   1.568   1.00 15.00 ?  303 TRP A HE1  13 
ATOM 9938  H HE3  . TRP A 1 7  ? 4.847   2.297   1.597   1.00 15.00 ?  303 TRP A HE3  13 
ATOM 9939  H HZ2  . TRP A 1 7  ? 9.336   0.524   0.607   1.00 15.00 ?  303 TRP A HZ2  13 
ATOM 9940  H HZ3  . TRP A 1 7  ? 5.142   0.061   0.679   1.00 15.00 ?  303 TRP A HZ3  13 
ATOM 9941  H HH2  . TRP A 1 7  ? 7.349   -0.820  0.215   1.00 15.00 ?  303 TRP A HH2  13 
ATOM 9942  N N    . GLU A 1 8  ? 3.278   5.525   1.337   1.00 15.00 ?  304 GLU A N    13 
ATOM 9943  C CA   . GLU A 1 8  ? 1.860   5.821   1.543   1.00 15.00 ?  304 GLU A CA   13 
ATOM 9944  C C    . GLU A 1 8  ? 1.100   4.588   2.027   1.00 15.00 ?  304 GLU A C    13 
ATOM 9945  O O    . GLU A 1 8  ? 0.980   3.607   1.305   1.00 15.00 ?  304 GLU A O    13 
ATOM 9946  C CB   . GLU A 1 8  ? 1.260   6.371   0.246   1.00 15.00 ?  304 GLU A CB   13 
ATOM 9947  C CG   . GLU A 1 8  ? 1.675   7.801   -0.055  1.00 15.00 ?  304 GLU A CG   13 
ATOM 9948  C CD   . GLU A 1 8  ? 0.822   8.819   0.671   1.00 15.00 ?  304 GLU A CD   13 
ATOM 9949  O OE1  . GLU A 1 8  ? 0.397   8.539   1.804   1.00 15.00 -1 304 GLU A OE1  13 
ATOM 9950  O OE2  . GLU A 1 8  ? 0.551   9.896   0.090   1.00 15.00 ?  304 GLU A OE2  13 
ATOM 9951  H H    . GLU A 1 8  ? 3.551   4.729   0.796   1.00 15.00 ?  304 GLU A H    13 
ATOM 9952  H HA   . GLU A 1 8  ? 1.796   6.584   2.306   1.00 15.00 ?  304 GLU A HA   13 
ATOM 9953  H HB2  . GLU A 1 8  ? 1.585   5.750   -0.576  1.00 15.00 ?  304 GLU A HB2  13 
ATOM 9954  H HB3  . GLU A 1 8  ? 0.186   6.338   0.302   1.00 15.00 ?  304 GLU A HB3  13 
ATOM 9955  H HG2  . GLU A 1 8  ? 2.702   7.935   0.247   1.00 15.00 ?  304 GLU A HG2  13 
ATOM 9956  H HG3  . GLU A 1 8  ? 1.586   7.972   -1.117  1.00 15.00 ?  304 GLU A HG3  13 
ATOM 9957  N N    . ILE A 1 9  ? 0.565   4.657   3.245   1.00 15.00 ?  305 ILE A N    13 
ATOM 9958  C CA   . ILE A 1 9  ? -0.081  3.498   3.866   1.00 15.00 ?  305 ILE A CA   13 
ATOM 9959  C C    . ILE A 1 9  ? -1.573  3.458   3.519   1.00 15.00 ?  305 ILE A C    13 
ATOM 9960  O O    . ILE A 1 9  ? -2.320  4.393   3.809   1.00 15.00 ?  305 ILE A O    13 
ATOM 9961  C CB   . ILE A 1 9  ? 0.105   3.494   5.404   1.00 15.00 ?  305 ILE A CB   13 
ATOM 9962  C CG1  . ILE A 1 9  ? -0.604  2.286   6.028   1.00 15.00 ?  305 ILE A CG1  13 
ATOM 9963  C CG2  . ILE A 1 9  ? -0.398  4.794   6.022   1.00 15.00 ?  305 ILE A CG2  13 
ATOM 9964  C CD1  . ILE A 1 9  ? -0.385  2.156   7.520   1.00 15.00 ?  305 ILE A CD1  13 
ATOM 9965  H H    . ILE A 1 9  ? 0.597   5.507   3.733   1.00 15.00 ?  305 ILE A H    13 
ATOM 9966  H HA   . ILE A 1 9  ? 0.395   2.612   3.470   1.00 15.00 ?  305 ILE A HA   13 
ATOM 9967  H HB   . ILE A 1 9  ? 1.162   3.421   5.611   1.00 15.00 ?  305 ILE A HB   13 
ATOM 9968  H HG12 . ILE A 1 9  ? -1.667  2.372   5.858   1.00 15.00 ?  305 ILE A HG12 13 
ATOM 9969  H HG13 . ILE A 1 9  ? -0.241  1.383   5.559   1.00 15.00 ?  305 ILE A HG13 13 
ATOM 9970  H HG21 . ILE A 1 9  ? -0.260  4.759   7.092   1.00 15.00 ?  305 ILE A HG21 13 
ATOM 9971  H HG22 . ILE A 1 9  ? -1.448  4.917   5.797   1.00 15.00 ?  305 ILE A HG22 13 
ATOM 9972  H HG23 . ILE A 1 9  ? 0.158   5.627   5.614   1.00 15.00 ?  305 ILE A HG23 13 
ATOM 9973  H HD11 . ILE A 1 9  ? 0.673   2.074   7.721   1.00 15.00 ?  305 ILE A HD11 13 
ATOM 9974  H HD12 . ILE A 1 9  ? -0.889  1.272   7.882   1.00 15.00 ?  305 ILE A HD12 13 
ATOM 9975  H HD13 . ILE A 1 9  ? -0.781  3.027   8.020   1.00 15.00 ?  305 ILE A HD13 13 
ATOM 9976  N N    . ARG A 1 10 ? -2.001  2.372   2.885   1.00 15.00 ?  306 ARG A N    13 
ATOM 9977  C CA   . ARG A 1 10 ? -3.327  2.296   2.299   1.00 15.00 ?  306 ARG A CA   13 
ATOM 9978  C C    . ARG A 1 10 ? -3.860  0.870   2.359   1.00 15.00 ?  306 ARG A C    13 
ATOM 9979  O O    . ARG A 1 10 ? -3.196  -0.075  1.958   1.00 15.00 ?  306 ARG A O    13 
ATOM 9980  C CB   . ARG A 1 10 ? -3.165  2.866   0.890   1.00 15.00 ?  306 ARG A CB   13 
ATOM 9981  C CG   . ARG A 1 10 ? -3.408  4.363   0.878   1.00 15.00 ?  306 ARG A CG   13 
ATOM 9982  C CD   . ARG A 1 10 ? -2.594  5.110   -0.160  1.00 15.00 ?  306 ARG A CD   13 
ATOM 9983  N NE   . ARG A 1 10 ? -2.062  6.359   0.415   1.00 15.00 ?  306 ARG A NE   13 
ATOM 9984  C CZ   . ARG A 1 10 ? -2.804  7.294   1.039   1.00 15.00 ?  306 ARG A CZ   13 
ATOM 9985  N NH1  . ARG A 1 10 ? -4.135  7.231   1.032   1.00 15.00 1  306 ARG A NH1  13 
ATOM 9986  N NH2  . ARG A 1 10 ? -2.211  8.308   1.658   1.00 15.00 ?  306 ARG A NH2  13 
ATOM 9987  H H    . ARG A 1 10 ? -1.395  1.600   2.773   1.00 15.00 ?  306 ARG A H    13 
ATOM 9988  H HA   . ARG A 1 10 ? -3.981  2.940   2.866   1.00 15.00 ?  306 ARG A HA   13 
ATOM 9989  H HB2  . ARG A 1 10 ? -2.163  2.672   0.539   1.00 15.00 ?  306 ARG A HB2  13 
ATOM 9990  H HB3  . ARG A 1 10 ? -3.878  2.396   0.229   1.00 15.00 ?  306 ARG A HB3  13 
ATOM 9991  H HG2  . ARG A 1 10 ? -4.450  4.522   0.643   1.00 15.00 ?  306 ARG A HG2  13 
ATOM 9992  H HG3  . ARG A 1 10 ? -3.221  4.768   1.826   1.00 15.00 ?  306 ARG A HG3  13 
ATOM 9993  H HD2  . ARG A 1 10 ? -1.772  4.486   -0.483  1.00 15.00 ?  306 ARG A HD2  13 
ATOM 9994  H HD3  . ARG A 1 10 ? -3.222  5.350   -1.004  1.00 15.00 ?  306 ARG A HD3  13 
ATOM 9995  H HE   . ARG A 1 10 ? -1.089  6.482   0.383   1.00 15.00 ?  306 ARG A HE   13 
ATOM 9996  H HH11 . ARG A 1 10 ? -4.601  6.484   0.562   1.00 15.00 ?  306 ARG A HH11 13 
ATOM 9997  H HH12 . ARG A 1 10 ? -4.683  7.938   1.504   1.00 15.00 ?  306 ARG A HH12 13 
ATOM 9998  H HH21 . ARG A 1 10 ? -1.200  8.387   1.664   1.00 15.00 ?  306 ARG A HH21 13 
ATOM 9999  H HH22 . ARG A 1 10 ? -2.763  9.002   2.139   1.00 15.00 ?  306 ARG A HH22 13 
ATOM 10000 N N    . ASN A 1 11 ? -5.054  0.716   2.906   1.00 15.00 ?  307 ASN A N    13 
ATOM 10001 C CA   . ASN A 1 11 ? -5.585  -0.607  3.204   1.00 15.00 ?  307 ASN A CA   13 
ATOM 10002 C C    . ASN A 1 11 ? -6.912  -0.826  2.471   1.00 15.00 ?  307 ASN A C    13 
ATOM 10003 O O    . ASN A 1 11 ? -7.758  0.066   2.454   1.00 15.00 ?  307 ASN A O    13 
ATOM 10004 C CB   . ASN A 1 11 ? -5.785  -0.734  4.722   1.00 15.00 ?  307 ASN A CB   13 
ATOM 10005 C CG   . ASN A 1 11 ? -5.966  -2.168  5.195   1.00 15.00 ?  307 ASN A CG   13 
ATOM 10006 O OD1  . ASN A 1 11 ? -6.477  -3.025  4.479   1.00 15.00 ?  307 ASN A OD1  13 
ATOM 10007 N ND2  . ASN A 1 11 ? -5.550  -2.436  6.422   1.00 15.00 ?  307 ASN A ND2  13 
ATOM 10008 H H    . ASN A 1 11 ? -5.597  1.506   3.108   1.00 15.00 ?  307 ASN A H    13 
ATOM 10009 H HA   . ASN A 1 11 ? -4.859  -1.335  2.879   1.00 15.00 ?  307 ASN A HA   13 
ATOM 10010 H HB2  . ASN A 1 11 ? -4.924  -0.320  5.224   1.00 15.00 ?  307 ASN A HB2  13 
ATOM 10011 H HB3  . ASN A 1 11 ? -6.662  -0.171  5.007   1.00 15.00 ?  307 ASN A HB3  13 
ATOM 10012 H HD21 . ASN A 1 11 ? -5.156  -1.708  6.949   1.00 15.00 ?  307 ASN A HD21 13 
ATOM 10013 H HD22 . ASN A 1 11 ? -5.655  -3.352  6.755   1.00 15.00 ?  307 ASN A HD22 13 
ATOM 10014 N N    . THR A 1 12 ? -7.094  -2.000  1.869   1.00 15.00 ?  308 THR A N    13 
ATOM 10015 C CA   . THR A 1 12 ? -8.347  -2.324  1.208   1.00 15.00 ?  308 THR A CA   13 
ATOM 10016 C C    . THR A 1 12 ? -9.274  -3.050  2.173   1.00 15.00 ?  308 THR A C    13 
ATOM 10017 O O    . THR A 1 12 ? -8.804  -3.772  3.059   1.00 15.00 ?  308 THR A O    13 
ATOM 10018 C CB   . THR A 1 12 ? -8.121  -3.202  -0.041  1.00 15.00 ?  308 THR A CB   13 
ATOM 10019 O OG1  . THR A 1 12 ? -6.854  -3.873  0.046   1.00 15.00 ?  308 THR A OG1  13 
ATOM 10020 C CG2  . THR A 1 12 ? -8.194  -2.380  -1.325  1.00 15.00 ?  308 THR A CG2  13 
ATOM 10021 H H    . THR A 1 12 ? -6.385  -2.678  1.900   1.00 15.00 ?  308 THR A H    13 
ATOM 10022 H HA   . THR A 1 12 ? -8.813  -1.399  0.898   1.00 15.00 ?  308 THR A HA   13 
ATOM 10023 H HB   . THR A 1 12 ? -8.904  -3.948  -0.073  1.00 15.00 ?  308 THR A HB   13 
ATOM 10024 H HG1  . THR A 1 12 ? -6.154  -3.218  0.140   1.00 15.00 ?  308 THR A HG1  13 
ATOM 10025 H HG21 . THR A 1 12 ? -9.195  -1.993  -1.445  1.00 15.00 ?  308 THR A HG21 13 
ATOM 10026 H HG22 . THR A 1 12 ? -7.947  -3.007  -2.170  1.00 15.00 ?  308 THR A HG22 13 
ATOM 10027 H HG23 . THR A 1 12 ? -7.497  -1.560  -1.273  1.00 15.00 ?  308 THR A HG23 13 
ATOM 10028 N N    . ALA A 1 13 ? -10.581 -2.869  1.992   1.00 15.00 ?  309 ALA A N    13 
ATOM 10029 C CA   . ALA A 1 13 ? -11.585 -3.462  2.875   1.00 15.00 ?  309 ALA A CA   13 
ATOM 10030 C C    . ALA A 1 13 ? -11.501 -4.989  2.897   1.00 15.00 ?  309 ALA A C    13 
ATOM 10031 O O    . ALA A 1 13 ? -11.991 -5.631  3.826   1.00 15.00 ?  309 ALA A O    13 
ATOM 10032 C CB   . ALA A 1 13 ? -12.979 -3.015  2.463   1.00 15.00 ?  309 ALA A CB   13 
ATOM 10033 H H    . ALA A 1 13 ? -10.884 -2.308  1.235   1.00 15.00 ?  309 ALA A H    13 
ATOM 10034 H HA   . ALA A 1 13 ? -11.401 -3.095  3.873   1.00 15.00 ?  309 ALA A HA   13 
ATOM 10035 H HB1  . ALA A 1 13 ? -13.023 -1.937  2.447   1.00 15.00 ?  309 ALA A HB1  13 
ATOM 10036 H HB2  . ALA A 1 13 ? -13.700 -3.396  3.170   1.00 15.00 ?  309 ALA A HB2  13 
ATOM 10037 H HB3  . ALA A 1 13 ? -13.204 -3.399  1.478   1.00 15.00 ?  309 ALA A HB3  13 
ATOM 10038 N N    . THR A 1 14 ? -10.887 -5.564  1.871   1.00 15.00 ?  310 THR A N    13 
ATOM 10039 C CA   . THR A 1 14 ? -10.641 -6.999  1.834   1.00 15.00 ?  310 THR A CA   13 
ATOM 10040 C C    . THR A 1 14 ? -9.652  -7.410  2.937   1.00 15.00 ?  310 THR A C    13 
ATOM 10041 O O    . THR A 1 14 ? -9.542  -8.585  3.282   1.00 15.00 ?  310 THR A O    13 
ATOM 10042 C CB   . THR A 1 14 ? -10.100 -7.427  0.452   1.00 15.00 ?  310 THR A CB   13 
ATOM 10043 O OG1  . THR A 1 14 ? -10.927 -6.872  -0.578  1.00 15.00 ?  310 THR A OG1  13 
ATOM 10044 C CG2  . THR A 1 14 ? -10.072 -8.943  0.310   1.00 15.00 ?  310 THR A CG2  13 
ATOM 10045 H H    . THR A 1 14 ? -10.613 -5.009  1.104   1.00 15.00 ?  310 THR A H    13 
ATOM 10046 H HA   . THR A 1 14 ? -11.581 -7.503  2.002   1.00 15.00 ?  310 THR A HA   13 
ATOM 10047 H HB   . THR A 1 14 ? -9.093  -7.049  0.341   1.00 15.00 ?  310 THR A HB   13 
ATOM 10048 H HG1  . THR A 1 14 ? -11.833 -7.186  -0.466  1.00 15.00 ?  310 THR A HG1  13 
ATOM 10049 H HG21 . THR A 1 14 ? -9.424  -9.364  1.064   1.00 15.00 ?  310 THR A HG21 13 
ATOM 10050 H HG22 . THR A 1 14 ? -9.704  -9.208  -0.671  1.00 15.00 ?  310 THR A HG22 13 
ATOM 10051 H HG23 . THR A 1 14 ? -11.071 -9.334  0.437   1.00 15.00 ?  310 THR A HG23 13 
ATOM 10052 N N    . GLY A 1 15 ? -8.951  -6.430  3.498   1.00 15.00 ?  311 GLY A N    13 
ATOM 10053 C CA   . GLY A 1 15 ? -8.025  -6.699  4.581   1.00 15.00 ?  311 GLY A CA   13 
ATOM 10054 C C    . GLY A 1 15 ? -6.604  -6.871  4.098   1.00 15.00 ?  311 GLY A C    13 
ATOM 10055 O O    . GLY A 1 15 ? -5.920  -7.814  4.491   1.00 15.00 ?  311 GLY A O    13 
ATOM 10056 H H    . GLY A 1 15 ? -9.074  -5.508  3.182   1.00 15.00 ?  311 GLY A H    13 
ATOM 10057 H HA2  . GLY A 1 15 ? -8.059  -5.876  5.281   1.00 15.00 ?  311 GLY A HA2  13 
ATOM 10058 H HA3  . GLY A 1 15 ? -8.333  -7.601  5.088   1.00 15.00 ?  311 GLY A HA3  13 
ATOM 10059 N N    . ARG A 1 16 ? -6.153  -5.960  3.245   1.00 15.00 ?  312 ARG A N    13 
ATOM 10060 C CA   . ARG A 1 16 ? -4.805  -6.047  2.685   1.00 15.00 ?  312 ARG A CA   13 
ATOM 10061 C C    . ARG A 1 16 ? -4.168  -4.661  2.647   1.00 15.00 ?  312 ARG A C    13 
ATOM 10062 O O    . ARG A 1 16 ? -4.808  -3.700  2.211   1.00 15.00 ?  312 ARG A O    13 
ATOM 10063 C CB   . ARG A 1 16 ? -4.836  -6.601  1.262   1.00 15.00 ?  312 ARG A CB   13 
ATOM 10064 C CG   . ARG A 1 16 ? -5.722  -7.806  1.038   1.00 15.00 ?  312 ARG A CG   13 
ATOM 10065 C CD   . ARG A 1 16 ? -5.913  -8.027  -0.451  1.00 15.00 ?  312 ARG A CD   13 
ATOM 10066 N NE   . ARG A 1 16 ? -6.790  -7.021  -1.047  1.00 15.00 ?  312 ARG A NE   13 
ATOM 10067 C CZ   . ARG A 1 16 ? -7.021  -6.910  -2.357  1.00 15.00 ?  312 ARG A CZ   13 
ATOM 10068 N NH1  . ARG A 1 16 ? -6.486  -7.777  -3.212  1.00 15.00 1  312 ARG A NH1  13 
ATOM 10069 N NH2  . ARG A 1 16 ? -7.803  -5.936  -2.809  1.00 15.00 ?  312 ARG A NH2  13 
ATOM 10070 H H    . ARG A 1 16 ? -6.731  -5.194  3.007   1.00 15.00 ?  312 ARG A H    13 
ATOM 10071 H HA   . ARG A 1 16 ? -4.215  -6.697  3.313   1.00 15.00 ?  312 ARG A HA   13 
ATOM 10072 H HB2  . ARG A 1 16 ? -5.154  -5.818  0.584   1.00 15.00 ?  312 ARG A HB2  13 
ATOM 10073 H HB3  . ARG A 1 16 ? -3.828  -6.884  0.995   1.00 15.00 ?  312 ARG A HB3  13 
ATOM 10074 H HG2  . ARG A 1 16 ? -5.255  -8.678  1.472   1.00 15.00 ?  312 ARG A HG2  13 
ATOM 10075 H HG3  . ARG A 1 16 ? -6.683  -7.633  1.498   1.00 15.00 ?  312 ARG A HG3  13 
ATOM 10076 H HD2  . ARG A 1 16 ? -4.943  -7.954  -0.924  1.00 15.00 ?  312 ARG A HD2  13 
ATOM 10077 H HD3  . ARG A 1 16 ? -6.331  -9.009  -0.615  1.00 15.00 ?  312 ARG A HD3  13 
ATOM 10078 H HE   . ARG A 1 16 ? -7.215  -6.377  -0.437  1.00 15.00 ?  312 ARG A HE   13 
ATOM 10079 H HH11 . ARG A 1 16 ? -5.905  -8.528  -2.878  1.00 15.00 ?  312 ARG A HH11 13 
ATOM 10080 H HH12 . ARG A 1 16 ? -6.655  -7.686  -4.196  1.00 15.00 ?  312 ARG A HH12 13 
ATOM 10081 H HH21 . ARG A 1 16 ? -8.224  -5.289  -2.171  1.00 15.00 ?  312 ARG A HH21 13 
ATOM 10082 H HH22 . ARG A 1 16 ? -7.967  -5.835  -3.802  1.00 15.00 ?  312 ARG A HH22 13 
ATOM 10083 N N    . VAL A 1 17 ? -2.905  -4.555  3.046   1.00 15.00 ?  313 VAL A N    13 
ATOM 10084 C CA   . VAL A 1 17 ? -2.262  -3.252  3.144   1.00 15.00 ?  313 VAL A CA   13 
ATOM 10085 C C    . VAL A 1 17 ? -1.239  -3.015  2.021   1.00 15.00 ?  313 VAL A C    13 
ATOM 10086 O O    . VAL A 1 17 ? -0.097  -3.452  2.088   1.00 15.00 ?  313 VAL A O    13 
ATOM 10087 C CB   . VAL A 1 17 ? -1.579  -3.051  4.508   1.00 15.00 ?  313 VAL A CB   13 
ATOM 10088 C CG1  . VAL A 1 17 ? -1.408  -1.569  4.795   1.00 15.00 ?  313 VAL A CG1  13 
ATOM 10089 C CG2  . VAL A 1 17 ? -2.367  -3.725  5.622   1.00 15.00 ?  313 VAL A CG2  13 
ATOM 10090 H H    . VAL A 1 17 ? -2.394  -5.362  3.276   1.00 15.00 ?  313 VAL A H    13 
ATOM 10091 H HA   . VAL A 1 17 ? -3.040  -2.507  3.057   1.00 15.00 ?  313 VAL A HA   13 
ATOM 10092 H HB   . VAL A 1 17 ? -0.599  -3.502  4.465   1.00 15.00 ?  313 VAL A HB   13 
ATOM 10093 H HG11 . VAL A 1 17 ? -0.782  -1.124  4.036   1.00 15.00 ?  313 VAL A HG11 13 
ATOM 10094 H HG12 . VAL A 1 17 ? -0.947  -1.441  5.763   1.00 15.00 ?  313 VAL A HG12 13 
ATOM 10095 H HG13 . VAL A 1 17 ? -2.376  -1.087  4.790   1.00 15.00 ?  313 VAL A HG13 13 
ATOM 10096 H HG21 . VAL A 1 17 ? -2.434  -4.784  5.426   1.00 15.00 ?  313 VAL A HG21 13 
ATOM 10097 H HG22 . VAL A 1 17 ? -3.361  -3.303  5.666   1.00 15.00 ?  313 VAL A HG22 13 
ATOM 10098 H HG23 . VAL A 1 17 ? -1.867  -3.563  6.565   1.00 15.00 ?  313 VAL A HG23 13 
ATOM 10099 N N    . TYR A 1 18 ? -1.692  -2.329  0.986   1.00 15.00 ?  314 TYR A N    13 
ATOM 10100 C CA   . TYR A 1 18 ? -0.864  -1.840  -0.091  1.00 15.00 ?  314 TYR A CA   13 
ATOM 10101 C C    . TYR A 1 18 ? -0.344  -0.444  0.248   1.00 15.00 ?  314 TYR A C    13 
ATOM 10102 O O    . TYR A 1 18 ? -1.102  0.485   0.533   1.00 15.00 ?  314 TYR A O    13 
ATOM 10103 C CB   . TYR A 1 18 ? -1.694  -1.787  -1.396  1.00 15.00 ?  314 TYR A CB   13 
ATOM 10104 C CG   . TYR A 1 18 ? -2.952  -0.931  -1.285  1.00 15.00 ?  314 TYR A CG   13 
ATOM 10105 C CD1  . TYR A 1 18 ? -4.058  -1.400  -0.594  1.00 15.00 ?  314 TYR A CD1  13 
ATOM 10106 C CD2  . TYR A 1 18 ? -3.017  0.356   -1.831  1.00 15.00 ?  314 TYR A CD2  13 
ATOM 10107 C CE1  . TYR A 1 18 ? -5.187  -0.626  -0.440  1.00 15.00 ?  314 TYR A CE1  13 
ATOM 10108 C CE2  . TYR A 1 18 ? -4.156  1.141   -1.682  1.00 15.00 ?  314 TYR A CE2  13 
ATOM 10109 C CZ   . TYR A 1 18 ? -5.233  0.639   -0.975  1.00 15.00 ?  314 TYR A CZ   13 
ATOM 10110 O OH   . TYR A 1 18 ? -6.367  1.398   -0.810  1.00 15.00 ?  314 TYR A OH   13 
ATOM 10111 H H    . TYR A 1 18 ? -2.625  -2.190  0.915   1.00 15.00 ?  314 TYR A H    13 
ATOM 10112 H HA   . TYR A 1 18 ? -0.034  -2.518  -0.220  1.00 15.00 ?  314 TYR A HA   13 
ATOM 10113 H HB2  . TYR A 1 18 ? -1.082  -1.379  -2.187  1.00 15.00 ?  314 TYR A HB2  13 
ATOM 10114 H HB3  . TYR A 1 18 ? -1.996  -2.789  -1.663  1.00 15.00 ?  314 TYR A HB3  13 
ATOM 10115 H HD1  . TYR A 1 18 ? -4.027  -2.390  -0.165  1.00 15.00 ?  314 TYR A HD1  13 
ATOM 10116 H HD2  . TYR A 1 18 ? -2.178  0.729   -2.399  1.00 15.00 ?  314 TYR A HD2  13 
ATOM 10117 H HE1  . TYR A 1 18 ? -6.031  -1.014  0.107   1.00 15.00 ?  314 TYR A HE1  13 
ATOM 10118 H HE2  . TYR A 1 18 ? -4.189  2.166   -2.092  1.00 15.00 ?  314 TYR A HE2  13 
ATOM 10119 H HH   . TYR A 1 18 ? -6.655  1.350   0.109   1.00 15.00 ?  314 TYR A HH   13 
ATOM 10120 N N    . PHE A 1 19 ? 0.955   -0.309  0.261   1.00 15.00 ?  315 PHE A N    13 
ATOM 10121 C CA   . PHE A 1 19 ? 1.574   0.981   0.421   1.00 15.00 ?  315 PHE A CA   13 
ATOM 10122 C C    . PHE A 1 19 ? 1.966   1.496   -0.938  1.00 15.00 ?  315 PHE A C    13 
ATOM 10123 O O    . PHE A 1 19 ? 2.761   0.874   -1.624  1.00 15.00 ?  315 PHE A O    13 
ATOM 10124 C CB   . PHE A 1 19 ? 2.821   0.895   1.290   1.00 15.00 ?  315 PHE A CB   13 
ATOM 10125 C CG   . PHE A 1 19 ? 2.583   0.528   2.722   1.00 15.00 ?  315 PHE A CG   13 
ATOM 10126 C CD1  . PHE A 1 19 ? 1.979   -0.668  3.054   1.00 15.00 ?  315 PHE A CD1  13 
ATOM 10127 C CD2  . PHE A 1 19 ? 2.993   1.375   3.738   1.00 15.00 ?  315 PHE A CD2  13 
ATOM 10128 C CE1  . PHE A 1 19 ? 1.784   -1.013  4.371   1.00 15.00 ?  315 PHE A CE1  13 
ATOM 10129 C CE2  . PHE A 1 19 ? 2.805   1.029   5.060   1.00 15.00 ?  315 PHE A CE2  13 
ATOM 10130 C CZ   . PHE A 1 19 ? 2.200   -0.168  5.374   1.00 15.00 ?  315 PHE A CZ   13 
ATOM 10131 H H    . PHE A 1 19 ? 1.523   -1.108  0.161   1.00 15.00 ?  315 PHE A H    13 
ATOM 10132 H HA   . PHE A 1 19 ? 0.860   1.654   0.871   1.00 15.00 ?  315 PHE A HA   13 
ATOM 10133 H HB2  . PHE A 1 19 ? 3.484   0.153   0.873   1.00 15.00 ?  315 PHE A HB2  13 
ATOM 10134 H HB3  . PHE A 1 19 ? 3.319   1.855   1.274   1.00 15.00 ?  315 PHE A HB3  13 
ATOM 10135 H HD1  . PHE A 1 19 ? 1.649   -1.332  2.270   1.00 15.00 ?  315 PHE A HD1  13 
ATOM 10136 H HD2  . PHE A 1 19 ? 3.467   2.313   3.489   1.00 15.00 ?  315 PHE A HD2  13 
ATOM 10137 H HE1  . PHE A 1 19 ? 1.312   -1.953  4.619   1.00 15.00 ?  315 PHE A HE1  13 
ATOM 10138 H HE2  . PHE A 1 19 ? 3.128   1.696   5.845   1.00 15.00 ?  315 PHE A HE2  13 
ATOM 10139 H HZ   . PHE A 1 19 ? 2.060   -0.451  6.401   1.00 15.00 ?  315 PHE A HZ   13 
ATOM 10140 N N    . VAL A 1 20 ? 1.425   2.615   -1.344  1.00 15.00 ?  316 VAL A N    13 
ATOM 10141 C CA   . VAL A 1 20 ? 1.812   3.156   -2.621  1.00 15.00 ?  316 VAL A CA   13 
ATOM 10142 C C    . VAL A 1 20 ? 3.011   4.088   -2.434  1.00 15.00 ?  316 VAL A C    13 
ATOM 10143 O O    . VAL A 1 20 ? 2.965   5.017   -1.631  1.00 15.00 ?  316 VAL A O    13 
ATOM 10144 C CB   . VAL A 1 20 ? 0.646   3.867   -3.358  1.00 15.00 ?  316 VAL A CB   13 
ATOM 10145 C CG1  . VAL A 1 20 ? -0.379  2.849   -3.824  1.00 15.00 ?  316 VAL A CG1  13 
ATOM 10146 C CG2  . VAL A 1 20 ? -0.041  4.912   -2.502  1.00 15.00 ?  316 VAL A CG2  13 
ATOM 10147 H H    . VAL A 1 20 ? 0.780   3.087   -0.777  1.00 15.00 ?  316 VAL A H    13 
ATOM 10148 H HA   . VAL A 1 20 ? 2.116   2.319   -3.226  1.00 15.00 ?  316 VAL A HA   13 
ATOM 10149 H HB   . VAL A 1 20 ? 1.050   4.359   -4.232  1.00 15.00 ?  316 VAL A HB   13 
ATOM 10150 H HG11 . VAL A 1 20 ? -1.190  3.357   -4.324  1.00 15.00 ?  316 VAL A HG11 13 
ATOM 10151 H HG12 . VAL A 1 20 ? -0.764  2.310   -2.970  1.00 15.00 ?  316 VAL A HG12 13 
ATOM 10152 H HG13 . VAL A 1 20 ? 0.087   2.154   -4.508  1.00 15.00 ?  316 VAL A HG13 13 
ATOM 10153 H HG21 . VAL A 1 20 ? 0.700   5.494   -1.971  1.00 15.00 ?  316 VAL A HG21 13 
ATOM 10154 H HG22 . VAL A 1 20 ? -0.702  4.426   -1.797  1.00 15.00 ?  316 VAL A HG22 13 
ATOM 10155 H HG23 . VAL A 1 20 ? -0.619  5.563   -3.142  1.00 15.00 ?  316 VAL A HG23 13 
ATOM 10156 N N    . ASP A 1 21 ? 4.110   3.819   -3.134  1.00 15.00 ?  317 ASP A N    13 
ATOM 10157 C CA   . ASP A 1 21 ? 5.291   4.638   -2.989  1.00 15.00 ?  317 ASP A CA   13 
ATOM 10158 C C    . ASP A 1 21 ? 5.189   5.753   -4.004  1.00 15.00 ?  317 ASP A C    13 
ATOM 10159 O O    . ASP A 1 21 ? 5.062   5.487   -5.202  1.00 15.00 ?  317 ASP A O    13 
ATOM 10160 C CB   . ASP A 1 21 ? 6.581   3.852   -3.274  1.00 15.00 ?  317 ASP A CB   13 
ATOM 10161 C CG   . ASP A 1 21 ? 6.503   2.382   -2.956  1.00 15.00 ?  317 ASP A CG   13 
ATOM 10162 O OD1  . ASP A 1 21 ? 5.972   1.626   -3.791  1.00 15.00 ?  317 ASP A OD1  13 
ATOM 10163 O OD2  . ASP A 1 21 ? 7.035   1.975   -1.907  1.00 15.00 -1 317 ASP A OD2  13 
ATOM 10164 H H    . ASP A 1 21 ? 4.136   3.045   -3.744  1.00 15.00 ?  317 ASP A H    13 
ATOM 10165 H HA   . ASP A 1 21 ? 5.316   5.048   -1.991  1.00 15.00 ?  317 ASP A HA   13 
ATOM 10166 H HB2  . ASP A 1 21 ? 6.842   3.958   -4.314  1.00 15.00 ?  317 ASP A HB2  13 
ATOM 10167 H HB3  . ASP A 1 21 ? 7.373   4.263   -2.665  1.00 15.00 ?  317 ASP A HB3  13 
ATOM 10168 N N    . HIS A 1 22 ? 5.217   6.995   -3.541  1.00 15.00 ?  318 HIS A N    13 
ATOM 10169 C CA   . HIS A 1 22 ? 5.145   8.136   -4.447  1.00 15.00 ?  318 HIS A CA   13 
ATOM 10170 C C    . HIS A 1 22 ? 6.463   8.298   -5.194  1.00 15.00 ?  318 HIS A C    13 
ATOM 10171 O O    . HIS A 1 22 ? 6.548   9.024   -6.181  1.00 15.00 ?  318 HIS A O    13 
ATOM 10172 C CB   . HIS A 1 22 ? 4.790   9.429   -3.703  1.00 15.00 ?  318 HIS A CB   13 
ATOM 10173 C CG   . HIS A 1 22 ? 3.354   9.532   -3.261  1.00 15.00 ?  318 HIS A CG   13 
ATOM 10174 N ND1  . HIS A 1 22 ? 2.360   8.654   -3.645  1.00 15.00 ?  318 HIS A ND1  13 
ATOM 10175 C CD2  . HIS A 1 22 ? 2.751   10.441  -2.460  1.00 15.00 ?  318 HIS A CD2  13 
ATOM 10176 C CE1  . HIS A 1 22 ? 1.218   9.021   -3.102  1.00 15.00 ?  318 HIS A CE1  13 
ATOM 10177 N NE2  . HIS A 1 22 ? 1.421   10.103  -2.369  1.00 15.00 ?  318 HIS A NE2  13 
ATOM 10178 H H    . HIS A 1 22 ? 5.298   7.148   -2.570  1.00 15.00 ?  318 HIS A H    13 
ATOM 10179 H HA   . HIS A 1 22 ? 4.368   7.925   -5.169  1.00 15.00 ?  318 HIS A HA   13 
ATOM 10180 H HB2  . HIS A 1 22 ? 5.410   9.504   -2.823  1.00 15.00 ?  318 HIS A HB2  13 
ATOM 10181 H HB3  . HIS A 1 22 ? 4.996   10.270  -4.351  1.00 15.00 ?  318 HIS A HB3  13 
ATOM 10182 H HD1  . HIS A 1 22 ? 2.471   7.872   -4.231  1.00 15.00 ?  318 HIS A HD1  13 
ATOM 10183 H HD2  . HIS A 1 22 ? 3.228   11.282  -1.979  1.00 15.00 ?  318 HIS A HD2  13 
ATOM 10184 H HE1  . HIS A 1 22 ? 0.270   8.521   -3.234  1.00 15.00 ?  318 HIS A HE1  13 
ATOM 10185 H HE2  . HIS A 1 22 ? 0.843   10.353  -1.600  1.00 15.00 ?  318 HIS A HE2  13 
ATOM 10186 N N    . ASN A 1 23 ? 7.496   7.627   -4.695  1.00 15.00 ?  319 ASN A N    13 
ATOM 10187 C CA   . ASN A 1 23 ? 8.813   7.649   -5.322  1.00 15.00 ?  319 ASN A CA   13 
ATOM 10188 C C    . ASN A 1 23 ? 8.790   6.942   -6.673  1.00 15.00 ?  319 ASN A C    13 
ATOM 10189 O O    . ASN A 1 23 ? 9.062   7.552   -7.705  1.00 15.00 ?  319 ASN A O    13 
ATOM 10190 C CB   . ASN A 1 23 ? 9.851   6.988   -4.408  1.00 15.00 ?  319 ASN A CB   13 
ATOM 10191 C CG   . ASN A 1 23 ? 10.195  7.833   -3.194  1.00 15.00 ?  319 ASN A CG   13 
ATOM 10192 O OD1  . ASN A 1 23 ? 9.387   8.640   -2.730  1.00 15.00 ?  319 ASN A OD1  13 
ATOM 10193 N ND2  . ASN A 1 23 ? 11.392  7.644   -2.664  1.00 15.00 ?  319 ASN A ND2  13 
ATOM 10194 H H    . ASN A 1 23 ? 7.370   7.107   -3.875  1.00 15.00 ?  319 ASN A H    13 
ATOM 10195 H HA   . ASN A 1 23 ? 9.088   8.683   -5.475  1.00 15.00 ?  319 ASN A HA   13 
ATOM 10196 H HB2  . ASN A 1 23 ? 9.463   6.042   -4.063  1.00 15.00 ?  319 ASN A HB2  13 
ATOM 10197 H HB3  . ASN A 1 23 ? 10.757  6.816   -4.971  1.00 15.00 ?  319 ASN A HB3  13 
ATOM 10198 H HD21 . ASN A 1 23 ? 11.983  6.977   -3.074  1.00 15.00 ?  319 ASN A HD21 13 
ATOM 10199 H HD22 . ASN A 1 23 ? 11.642  8.180   -1.879  1.00 15.00 ?  319 ASN A HD22 13 
ATOM 10200 N N    . ASN A 1 24 ? 8.459   5.655   -6.663  1.00 15.00 ?  320 ASN A N    13 
ATOM 10201 C CA   . ASN A 1 24 ? 8.465   4.857   -7.888  1.00 15.00 ?  320 ASN A CA   13 
ATOM 10202 C C    . ASN A 1 24 ? 7.067   4.787   -8.506  1.00 15.00 ?  320 ASN A C    13 
ATOM 10203 O O    . ASN A 1 24 ? 6.910   4.388   -9.658  1.00 15.00 ?  320 ASN A O    13 
ATOM 10204 C CB   . ASN A 1 24 ? 9.012   3.448   -7.614  1.00 15.00 ?  320 ASN A CB   13 
ATOM 10205 C CG   . ASN A 1 24 ? 9.363   2.693   -8.888  1.00 15.00 ?  320 ASN A CG   13 
ATOM 10206 O OD1  . ASN A 1 24 ? 10.452  2.862   -9.442  1.00 15.00 ?  320 ASN A OD1  13 
ATOM 10207 N ND2  . ASN A 1 24 ? 8.465   1.837   -9.343  1.00 15.00 ?  320 ASN A ND2  13 
ATOM 10208 H H    . ASN A 1 24 ? 8.217   5.227   -5.813  1.00 15.00 ?  320 ASN A H    13 
ATOM 10209 H HA   . ASN A 1 24 ? 9.121   5.352   -8.591  1.00 15.00 ?  320 ASN A HA   13 
ATOM 10210 H HB2  . ASN A 1 24 ? 9.904   3.528   -7.012  1.00 15.00 ?  320 ASN A HB2  13 
ATOM 10211 H HB3  . ASN A 1 24 ? 8.270   2.879   -7.073  1.00 15.00 ?  320 ASN A HB3  13 
ATOM 10212 H HD21 . ASN A 1 24 ? 7.625   1.727   -8.841  1.00 15.00 ?  320 ASN A HD21 13 
ATOM 10213 H HD22 . ASN A 1 24 ? 8.671   1.338   -10.170 1.00 15.00 ?  320 ASN A HD22 13 
ATOM 10214 N N    . ARG A 1 25 ? 6.058   5.166   -7.716  1.00 15.00 ?  321 ARG A N    13 
ATOM 10215 C CA   . ARG A 1 25 ? 4.657   5.181   -8.155  1.00 15.00 ?  321 ARG A CA   13 
ATOM 10216 C C    . ARG A 1 25 ? 4.117   3.763   -8.305  1.00 15.00 ?  321 ARG A C    13 
ATOM 10217 O O    . ARG A 1 25 ? 3.527   3.407   -9.323  1.00 15.00 ?  321 ARG A O    13 
ATOM 10218 C CB   . ARG A 1 25 ? 4.494   5.965   -9.463  1.00 15.00 ?  321 ARG A CB   13 
ATOM 10219 C CG   . ARG A 1 25 ? 4.909   7.422   -9.347  1.00 15.00 ?  321 ARG A CG   13 
ATOM 10220 C CD   . ARG A 1 25 ? 4.927   8.100   -10.705 1.00 15.00 ?  321 ARG A CD   13 
ATOM 10221 N NE   . ARG A 1 25 ? 5.852   7.441   -11.624 1.00 15.00 ?  321 ARG A NE   13 
ATOM 10222 C CZ   . ARG A 1 25 ? 5.909   7.692   -12.930 1.00 15.00 ?  321 ARG A CZ   13 
ATOM 10223 N NH1  . ARG A 1 25 ? 5.104   8.595   -13.477 1.00 15.00 1  321 ARG A NH1  13 
ATOM 10224 N NH2  . ARG A 1 25 ? 6.775   7.040   -13.693 1.00 15.00 ?  321 ARG A NH2  13 
ATOM 10225 H H    . ARG A 1 25 ? 6.260   5.440   -6.797  1.00 15.00 ?  321 ARG A H    13 
ATOM 10226 H HA   . ARG A 1 25 ? 4.085   5.677   -7.383  1.00 15.00 ?  321 ARG A HA   13 
ATOM 10227 H HB2  . ARG A 1 25 ? 5.097   5.499   -10.228 1.00 15.00 ?  321 ARG A HB2  13 
ATOM 10228 H HB3  . ARG A 1 25 ? 3.452   5.932   -9.763  1.00 15.00 ?  321 ARG A HB3  13 
ATOM 10229 H HG2  . ARG A 1 25 ? 4.209   7.937   -8.706  1.00 15.00 ?  321 ARG A HG2  13 
ATOM 10230 H HG3  . ARG A 1 25 ? 5.899   7.470   -8.917  1.00 15.00 ?  321 ARG A HG3  13 
ATOM 10231 H HD2  . ARG A 1 25 ? 3.932   8.068   -11.123 1.00 15.00 ?  321 ARG A HD2  13 
ATOM 10232 H HD3  . ARG A 1 25 ? 5.231   9.128   -10.576 1.00 15.00 ?  321 ARG A HD3  13 
ATOM 10233 H HE   . ARG A 1 25 ? 6.460   6.770   -11.243 1.00 15.00 ?  321 ARG A HE   13 
ATOM 10234 H HH11 . ARG A 1 25 ? 4.445   9.096   -12.911 1.00 15.00 ?  321 ARG A HH11 13 
ATOM 10235 H HH12 . ARG A 1 25 ? 5.162   8.787   -14.465 1.00 15.00 ?  321 ARG A HH12 13 
ATOM 10236 H HH21 . ARG A 1 25 ? 7.394   6.361   -13.292 1.00 15.00 ?  321 ARG A HH21 13 
ATOM 10237 H HH22 . ARG A 1 25 ? 6.808   7.218   -14.685 1.00 15.00 ?  321 ARG A HH22 13 
ATOM 10238 N N    . THR A 1 26 ? 4.318   2.964   -7.269  1.00 15.00 ?  322 THR A N    13 
ATOM 10239 C CA   . THR A 1 26 ? 3.886   1.570   -7.273  1.00 15.00 ?  322 THR A CA   13 
ATOM 10240 C C    . THR A 1 26 ? 3.096   1.249   -6.003  1.00 15.00 ?  322 THR A C    13 
ATOM 10241 O O    . THR A 1 26 ? 3.308   1.883   -4.978  1.00 15.00 ?  322 THR A O    13 
ATOM 10242 C CB   . THR A 1 26 ? 5.103   0.636   -7.398  1.00 15.00 ?  322 THR A CB   13 
ATOM 10243 O OG1  . THR A 1 26 ? 5.954   1.112   -8.449  1.00 15.00 ?  322 THR A OG1  13 
ATOM 10244 C CG2  . THR A 1 26 ? 4.675   -0.792  -7.709  1.00 15.00 ?  322 THR A CG2  13 
ATOM 10245 H H    . THR A 1 26 ? 4.757   3.327   -6.464  1.00 15.00 ?  322 THR A H    13 
ATOM 10246 H HA   . THR A 1 26 ? 3.248   1.419   -8.133  1.00 15.00 ?  322 THR A HA   13 
ATOM 10247 H HB   . THR A 1 26 ? 5.648   0.645   -6.465  1.00 15.00 ?  322 THR A HB   13 
ATOM 10248 H HG1  . THR A 1 26 ? 5.431   1.638   -9.064  1.00 15.00 ?  322 THR A HG1  13 
ATOM 10249 H HG21 . THR A 1 26 ? 4.122   -0.808  -8.637  1.00 15.00 ?  322 THR A HG21 13 
ATOM 10250 H HG22 . THR A 1 26 ? 4.052   -1.163  -6.910  1.00 15.00 ?  322 THR A HG22 13 
ATOM 10251 H HG23 . THR A 1 26 ? 5.553   -1.416  -7.802  1.00 15.00 ?  322 THR A HG23 13 
ATOM 10252 N N    . THR A 1 27 ? 2.153   0.310   -6.072  1.00 15.00 ?  323 THR A N    13 
ATOM 10253 C CA   . THR A 1 27 ? 1.436   -0.104  -4.874  1.00 15.00 ?  323 THR A CA   13 
ATOM 10254 C C    . THR A 1 27 ? 2.036   -1.399  -4.315  1.00 15.00 ?  323 THR A C    13 
ATOM 10255 O O    . THR A 1 27 ? 2.408   -2.300  -5.070  1.00 15.00 ?  323 THR A O    13 
ATOM 10256 C CB   . THR A 1 27 ? -0.085  -0.262  -5.116  1.00 15.00 ?  323 THR A CB   13 
ATOM 10257 O OG1  . THR A 1 27 ? -0.766  -0.385  -3.868  1.00 15.00 ?  323 THR A OG1  13 
ATOM 10258 C CG2  . THR A 1 27 ? -0.410  -1.469  -5.968  1.00 15.00 ?  323 THR A CG2  13 
ATOM 10259 H H    . THR A 1 27 ? 1.946   -0.113  -6.931  1.00 15.00 ?  323 THR A H    13 
ATOM 10260 H HA   . THR A 1 27 ? 1.573   0.673   -4.142  1.00 15.00 ?  323 THR A HA   13 
ATOM 10261 H HB   . THR A 1 27 ? -0.445  0.623   -5.623  1.00 15.00 ?  323 THR A HB   13 
ATOM 10262 H HG1  . THR A 1 27 ? -1.196  0.447   -3.657  1.00 15.00 ?  323 THR A HG1  13 
ATOM 10263 H HG21 . THR A 1 27 ? -0.099  -1.291  -6.986  1.00 15.00 ?  323 THR A HG21 13 
ATOM 10264 H HG22 . THR A 1 27 ? -1.476  -1.640  -5.936  1.00 15.00 ?  323 THR A HG22 13 
ATOM 10265 H HG23 . THR A 1 27 ? 0.105   -2.334  -5.577  1.00 15.00 ?  323 THR A HG23 13 
ATOM 10266 N N    . GLN A 1 28 ? 2.143   -1.481  -2.992  1.00 15.00 ?  324 GLN A N    13 
ATOM 10267 C CA   . GLN A 1 28 ? 2.895   -2.548  -2.351  1.00 15.00 ?  324 GLN A CA   13 
ATOM 10268 C C    . GLN A 1 28 ? 2.061   -3.312  -1.323  1.00 15.00 ?  324 GLN A C    13 
ATOM 10269 O O    . GLN A 1 28 ? 1.935   -2.876  -0.186  1.00 15.00 ?  324 GLN A O    13 
ATOM 10270 C CB   . GLN A 1 28 ? 4.123   -1.957  -1.638  1.00 15.00 ?  324 GLN A CB   13 
ATOM 10271 C CG   . GLN A 1 28 ? 5.019   -1.106  -2.522  1.00 15.00 ?  324 GLN A CG   13 
ATOM 10272 C CD   . GLN A 1 28 ? 5.762   -1.904  -3.580  1.00 15.00 ?  324 GLN A CD   13 
ATOM 10273 O OE1  . GLN A 1 28 ? 6.058   -1.399  -4.661  1.00 15.00 ?  324 GLN A OE1  13 
ATOM 10274 N NE2  . GLN A 1 28 ? 6.077   -3.153  -3.281  1.00 15.00 ?  324 GLN A NE2  13 
ATOM 10275 H H    . GLN A 1 28 ? 1.720   -0.797  -2.433  1.00 15.00 ?  324 GLN A H    13 
ATOM 10276 H HA   . GLN A 1 28 ? 3.230   -3.231  -3.116  1.00 15.00 ?  324 GLN A HA   13 
ATOM 10277 H HB2  . GLN A 1 28 ? 3.779   -1.339  -0.822  1.00 15.00 ?  324 GLN A HB2  13 
ATOM 10278 H HB3  . GLN A 1 28 ? 4.715   -2.761  -1.233  1.00 15.00 ?  324 GLN A HB3  13 
ATOM 10279 H HG2  . GLN A 1 28 ? 4.407   -0.367  -3.021  1.00 15.00 ?  324 GLN A HG2  13 
ATOM 10280 H HG3  . GLN A 1 28 ? 5.742   -0.600  -1.892  1.00 15.00 ?  324 GLN A HG3  13 
ATOM 10281 H HE21 . GLN A 1 28 ? 5.818   -3.505  -2.401  1.00 15.00 ?  324 GLN A HE21 13 
ATOM 10282 H HE22 . GLN A 1 28 ? 6.561   -3.678  -3.949  1.00 15.00 ?  324 GLN A HE22 13 
ATOM 10283 N N    . PHE A 1 29 ? 1.489   -4.446  -1.716  1.00 15.00 ?  325 PHE A N    13 
ATOM 10284 C CA   . PHE A 1 29 ? 0.916   -5.381  -0.742  1.00 15.00 ?  325 PHE A CA   13 
ATOM 10285 C C    . PHE A 1 29 ? 2.036   -6.064  -0.013  1.00 15.00 ?  325 PHE A C    13 
ATOM 10286 O O    . PHE A 1 29 ? 1.842   -6.814  0.941   1.00 15.00 ?  325 PHE A O    13 
ATOM 10287 C CB   . PHE A 1 29 ? 0.020   -6.417  -1.389  1.00 15.00 ?  325 PHE A CB   13 
ATOM 10288 C CG   . PHE A 1 29 ? -1.387  -5.956  -1.479  1.00 15.00 ?  325 PHE A CG   13 
ATOM 10289 C CD1  . PHE A 1 29 ? -1.968  -5.273  -0.419  1.00 15.00 ?  325 PHE A CD1  13 
ATOM 10290 C CD2  . PHE A 1 29 ? -2.131  -6.194  -2.617  1.00 15.00 ?  325 PHE A CD2  13 
ATOM 10291 C CE1  . PHE A 1 29 ? -3.274  -4.836  -0.521  1.00 15.00 ?  325 PHE A CE1  13 
ATOM 10292 C CE2  . PHE A 1 29 ? -3.434  -5.760  -2.711  1.00 15.00 ?  325 PHE A CE2  13 
ATOM 10293 C CZ   . PHE A 1 29 ? -4.005  -5.079  -1.665  1.00 15.00 ?  325 PHE A CZ   13 
ATOM 10294 H H    . PHE A 1 29 ? 1.471   -4.672  -2.671  1.00 15.00 ?  325 PHE A H    13 
ATOM 10295 H HA   . PHE A 1 29 ? 0.339   -4.804  -0.032  1.00 15.00 ?  325 PHE A HA   13 
ATOM 10296 H HB2  . PHE A 1 29 ? 0.373   -6.622  -2.389  1.00 15.00 ?  325 PHE A HB2  13 
ATOM 10297 H HB3  . PHE A 1 29 ? 0.040   -7.325  -0.805  1.00 15.00 ?  325 PHE A HB3  13 
ATOM 10298 H HD1  . PHE A 1 29 ? -1.385  -5.077  0.504   1.00 15.00 ?  325 PHE A HD1  13 
ATOM 10299 H HD2  . PHE A 1 29 ? -1.682  -6.730  -3.440  1.00 15.00 ?  325 PHE A HD2  13 
ATOM 10300 H HE1  . PHE A 1 29 ? -3.732  -4.320  0.301   1.00 15.00 ?  325 PHE A HE1  13 
ATOM 10301 H HE2  . PHE A 1 29 ? -4.005  -5.951  -3.607  1.00 15.00 ?  325 PHE A HE2  13 
ATOM 10302 H HZ   . PHE A 1 29 ? -5.026  -4.734  -1.735  1.00 15.00 ?  325 PHE A HZ   13 
ATOM 10303 N N    . THR A 1 30 ? 3.204   -5.829  -0.538  1.00 15.00 ?  326 THR A N    13 
ATOM 10304 C CA   . THR A 1 30 ? 4.422   -6.242  0.113   1.00 15.00 ?  326 THR A CA   13 
ATOM 10305 C C    . THR A 1 30 ? 4.747   -5.157  1.126   1.00 15.00 ?  326 THR A C    13 
ATOM 10306 O O    . THR A 1 30 ? 5.445   -4.184  0.825   1.00 15.00 ?  326 THR A O    13 
ATOM 10307 C CB   . THR A 1 30 ? 5.580   -6.426  -0.887  1.00 15.00 ?  326 THR A CB   13 
ATOM 10308 O OG1  . THR A 1 30 ? 5.556   -5.383  -1.867  1.00 15.00 ?  326 THR A OG1  13 
ATOM 10309 C CG2  . THR A 1 30 ? 5.492   -7.782  -1.573  1.00 15.00 ?  326 THR A CG2  13 
ATOM 10310 H H    . THR A 1 30 ? 3.232   -5.282  -1.350  1.00 15.00 ?  326 THR A H    13 
ATOM 10311 H HA   . THR A 1 30 ? 4.239   -7.185  0.612   1.00 15.00 ?  326 THR A HA   13 
ATOM 10312 H HB   . THR A 1 30 ? 6.514   -6.376  -0.345  1.00 15.00 ?  326 THR A HB   13 
ATOM 10313 H HG1  . THR A 1 30 ? 4.794   -5.514  -2.463  1.00 15.00 ?  326 THR A HG1  13 
ATOM 10314 H HG21 . THR A 1 30 ? 5.539   -8.565  -0.831  1.00 15.00 ?  326 THR A HG21 13 
ATOM 10315 H HG22 . THR A 1 30 ? 6.315   -7.892  -2.263  1.00 15.00 ?  326 THR A HG22 13 
ATOM 10316 H HG23 . THR A 1 30 ? 4.559   -7.852  -2.111  1.00 15.00 ?  326 THR A HG23 13 
ATOM 10317 N N    . ASP A 1 31 ? 4.223   -5.321  2.323   1.00 15.00 ?  327 ASP A N    13 
ATOM 10318 C CA   . ASP A 1 31 ? 4.087   -4.228  3.244   1.00 15.00 ?  327 ASP A CA   13 
ATOM 10319 C C    . ASP A 1 31 ? 4.996   -4.304  4.409   1.00 15.00 ?  327 ASP A C    13 
ATOM 10320 O O    . ASP A 1 31 ? 5.401   -5.368  4.870   1.00 15.00 ?  327 ASP A O    13 
ATOM 10321 C CB   . ASP A 1 31 ? 2.668   -4.056  3.752   1.00 15.00 ?  327 ASP A CB   13 
ATOM 10322 C CG   . ASP A 1 31 ? 1.930   -5.354  4.050   1.00 15.00 ?  327 ASP A CG   13 
ATOM 10323 O OD1  . ASP A 1 31 ? 2.588   -6.410  4.158   1.00 15.00 -1 327 ASP A OD1  13 
ATOM 10324 O OD2  . ASP A 1 31 ? 0.695   -5.309  4.227   1.00 15.00 ?  327 ASP A OD2  13 
ATOM 10325 H H    . ASP A 1 31 ? 3.898   -6.207  2.604   1.00 15.00 ?  327 ASP A H    13 
ATOM 10326 H HA   . ASP A 1 31 ? 4.339   -3.328  2.704   1.00 15.00 ?  327 ASP A HA   13 
ATOM 10327 H HB2  . ASP A 1 31 ? 2.709   -3.489  4.672   1.00 15.00 ?  327 ASP A HB2  13 
ATOM 10328 H HB3  . ASP A 1 31 ? 2.132   -3.482  3.029   1.00 15.00 ?  327 ASP A HB3  13 
ATOM 10329 N N    . PRO A 1 32 ? 5.324   -3.126  4.893   1.00 15.00 ?  328 PRO A N    13 
ATOM 10330 C CA   . PRO A 1 32 ? 5.963   -2.954  6.174   1.00 15.00 ?  328 PRO A CA   13 
ATOM 10331 C C    . PRO A 1 32 ? 4.989   -3.447  7.262   1.00 15.00 ?  328 PRO A C    13 
ATOM 10332 O O    . PRO A 1 32 ? 5.343   -3.607  8.429   1.00 15.00 ?  328 PRO A O    13 
ATOM 10333 C CB   . PRO A 1 32 ? 6.251   -1.440  6.225   1.00 15.00 ?  328 PRO A CB   13 
ATOM 10334 C CG   . PRO A 1 32 ? 6.047   -0.958  4.811   1.00 15.00 ?  328 PRO A CG   13 
ATOM 10335 C CD   . PRO A 1 32 ? 5.001   -1.839  4.260   1.00 15.00 ?  328 PRO A CD   13 
ATOM 10336 H HA   . PRO A 1 32 ? 6.888   -3.515  6.234   1.00 15.00 ?  328 PRO A HA   13 
ATOM 10337 H HB2  . PRO A 1 32 ? 5.562   -0.962  6.908   1.00 15.00 ?  328 PRO A HB2  13 
ATOM 10338 H HB3  . PRO A 1 32 ? 7.265   -1.273  6.555   1.00 15.00 ?  328 PRO A HB3  13 
ATOM 10339 H HG2  . PRO A 1 32 ? 5.727   0.076   4.807   1.00 15.00 ?  328 PRO A HG2  13 
ATOM 10340 H HG3  . PRO A 1 32 ? 6.934   -1.081  4.217   1.00 15.00 ?  328 PRO A HG3  13 
ATOM 10341 H HD2  . PRO A 1 32 ? 4.020   -1.493  4.550   1.00 15.00 ?  328 PRO A HD2  13 
ATOM 10342 H HD3  . PRO A 1 32 ? 5.086   -1.905  3.187   1.00 15.00 ?  328 PRO A HD3  13 
ATOM 10343 N N    . ARG A 1 33 ? 3.719   -3.620  6.842   1.00 15.00 ?  329 ARG A N    13 
ATOM 10344 C CA   . ARG A 1 33 ? 2.670   -4.225  7.665   1.00 15.00 ?  329 ARG A CA   13 
ATOM 10345 C C    . ARG A 1 33 ? 2.834   -5.742  7.792   1.00 15.00 ?  329 ARG A C    13 
ATOM 10346 O O    . ARG A 1 33 ? 2.186   -6.368  8.630   1.00 15.00 ?  329 ARG A O    13 
ATOM 10347 C CB   . ARG A 1 33 ? 1.264   -3.901  7.110   1.00 15.00 ?  329 ARG A CB   13 
ATOM 10348 C CG   . ARG A 1 33 ? 0.818   -2.474  7.405   1.00 15.00 ?  329 ARG A CG   13 
ATOM 10349 C CD   . ARG A 1 33 ? 0.688   -2.211  8.905   1.00 15.00 ?  329 ARG A CD   13 
ATOM 10350 N NE   . ARG A 1 33 ? 1.985   -2.218  9.594   1.00 15.00 ?  329 ARG A NE   13 
ATOM 10351 C CZ   . ARG A 1 33 ? 2.148   -2.497  10.892  1.00 15.00 ?  329 ARG A CZ   13 
ATOM 10352 N NH1  . ARG A 1 33 ? 1.101   -2.750  11.667  1.00 15.00 1  329 ARG A NH1  13 
ATOM 10353 N NH2  . ARG A 1 33 ? 3.372   -2.521  11.412  1.00 15.00 ?  329 ARG A NH2  13 
ATOM 10354 H H    . ARG A 1 33 ? 3.491   -3.343  5.930   1.00 15.00 ?  329 ARG A H    13 
ATOM 10355 H HA   . ARG A 1 33 ? 2.752   -3.797  8.654   1.00 15.00 ?  329 ARG A HA   13 
ATOM 10356 H HB2  . ARG A 1 33 ? 1.238   -4.057  6.015   1.00 15.00 ?  329 ARG A HB2  13 
ATOM 10357 H HB3  . ARG A 1 33 ? 0.553   -4.572  7.570   1.00 15.00 ?  329 ARG A HB3  13 
ATOM 10358 H HG2  . ARG A 1 33 ? 1.544   -1.789  6.994   1.00 15.00 ?  329 ARG A HG2  13 
ATOM 10359 H HG3  . ARG A 1 33 ? -0.141  -2.306  6.937   1.00 15.00 ?  329 ARG A HG3  13 
ATOM 10360 H HD2  . ARG A 1 33 ? 0.225   -1.248  9.047   1.00 15.00 ?  329 ARG A HD2  13 
ATOM 10361 H HD3  . ARG A 1 33 ? 0.060   -2.977  9.338   1.00 15.00 ?  329 ARG A HD3  13 
ATOM 10362 H HE   . ARG A 1 33 ? 2.778   -2.018  9.053   1.00 15.00 ?  329 ARG A HE   13 
ATOM 10363 H HH11 . ARG A 1 33 ? 0.163   -2.735  11.284  1.00 15.00 ?  329 ARG A HH11 13 
ATOM 10364 H HH12 . ARG A 1 33 ? 1.231   -2.961  12.646  1.00 15.00 ?  329 ARG A HH12 13 
ATOM 10365 H HH21 . ARG A 1 33 ? 4.171   -2.332  10.837  1.00 15.00 ?  329 ARG A HH21 13 
ATOM 10366 H HH22 . ARG A 1 33 ? 3.503   -2.734  12.388  1.00 15.00 ?  329 ARG A HH22 13 
ATOM 10367 N N    . LEU A 1 34 ? 3.707   -6.327  6.976   1.00 15.00 ?  330 LEU A N    13 
ATOM 10368 C CA   . LEU A 1 34 ? 3.935   -7.775  6.988   1.00 15.00 ?  330 LEU A CA   13 
ATOM 10369 C C    . LEU A 1 34 ? 4.493   -8.233  8.339   1.00 15.00 ?  330 LEU A C    13 
ATOM 10370 O O    . LEU A 1 34 ? 4.466   -9.419  8.669   1.00 15.00 ?  330 LEU A O    13 
ATOM 10371 C CB   . LEU A 1 34 ? 4.877   -8.165  5.835   1.00 15.00 ?  330 LEU A CB   13 
ATOM 10372 C CG   . LEU A 1 34 ? 5.183   -9.659  5.683   1.00 15.00 ?  330 LEU A CG   13 
ATOM 10373 C CD1  . LEU A 1 34 ? 5.179   -10.053 4.213   1.00 15.00 ?  330 LEU A CD1  13 
ATOM 10374 C CD2  . LEU A 1 34 ? 6.534   -9.993  6.305   1.00 15.00 ?  330 LEU A CD2  13 
ATOM 10375 H H    . LEU A 1 34 ? 4.198   -5.777  6.326   1.00 15.00 ?  330 LEU A H    13 
ATOM 10376 H HA   . LEU A 1 34 ? 2.980   -8.256  6.834   1.00 15.00 ?  330 LEU A HA   13 
ATOM 10377 H HB2  . LEU A 1 34 ? 4.435   -7.819  4.913   1.00 15.00 ?  330 LEU A HB2  13 
ATOM 10378 H HB3  . LEU A 1 34 ? 5.813   -7.646  5.978   1.00 15.00 ?  330 LEU A HB3  13 
ATOM 10379 H HG   . LEU A 1 34 ? 4.424   -10.233 6.190   1.00 15.00 ?  330 LEU A HG   13 
ATOM 10380 H HD11 . LEU A 1 34 ? 5.945   -9.501  3.688   1.00 15.00 ?  330 LEU A HD11 13 
ATOM 10381 H HD12 . LEU A 1 34 ? 4.215   -9.828  3.783   1.00 15.00 ?  330 LEU A HD12 13 
ATOM 10382 H HD13 . LEU A 1 34 ? 5.374   -11.112 4.124   1.00 15.00 ?  330 LEU A HD13 13 
ATOM 10383 H HD21 . LEU A 1 34 ? 7.309   -9.433  5.804   1.00 15.00 ?  330 LEU A HD21 13 
ATOM 10384 H HD22 . LEU A 1 34 ? 6.727   -11.050 6.203   1.00 15.00 ?  330 LEU A HD22 13 
ATOM 10385 H HD23 . LEU A 1 34 ? 6.520   -9.729  7.353   1.00 15.00 ?  330 LEU A HD23 13 
ATOM 10386 N N    . SER A 1 35 ? 4.980   -7.279  9.123   1.00 15.00 ?  331 SER A N    13 
ATOM 10387 C CA   . SER A 1 35 ? 5.506   -7.567  10.450  1.00 15.00 ?  331 SER A CA   13 
ATOM 10388 C C    . SER A 1 35 ? 4.391   -7.974  11.420  1.00 15.00 ?  331 SER A C    13 
ATOM 10389 O O    . SER A 1 35 ? 4.662   -8.417  12.537  1.00 15.00 ?  331 SER A O    13 
ATOM 10390 C CB   . SER A 1 35 ? 6.243   -6.341  10.990  1.00 15.00 ?  331 SER A CB   13 
ATOM 10391 O OG   . SER A 1 35 ? 7.231   -5.898  10.076  1.00 15.00 ?  331 SER A OG   13 
ATOM 10392 H H    . SER A 1 35 ? 5.001   -6.357  8.794   1.00 15.00 ?  331 SER A H    13 
ATOM 10393 H HA   . SER A 1 35 ? 6.204   -8.383  10.360  1.00 15.00 ?  331 SER A HA   13 
ATOM 10394 H HB2  . SER A 1 35 ? 5.538   -5.542  11.156  1.00 15.00 ?  331 SER A HB2  13 
ATOM 10395 H HB3  . SER A 1 35 ? 6.723   -6.598  11.923  1.00 15.00 ?  331 SER A HB3  13 
ATOM 10396 H HG   . SER A 1 35 ? 7.901   -5.381  10.551  1.00 15.00 ?  331 SER A HG   13 
ATOM 10397 N N    . ALA A 1 36 ? 3.141   -7.815  10.994  1.00 15.00 ?  332 ALA A N    13 
ATOM 10398 C CA   . ALA A 1 36 ? 1.996   -8.157  11.830  1.00 15.00 ?  332 ALA A CA   13 
ATOM 10399 C C    . ALA A 1 36 ? 1.910   -9.665  12.056  1.00 15.00 ?  332 ALA A C    13 
ATOM 10400 O O    . ALA A 1 36 ? 1.444   -10.120 13.105  1.00 15.00 ?  332 ALA A O    13 
ATOM 10401 C CB   . ALA A 1 36 ? 0.707   -7.642  11.204  1.00 15.00 ?  332 ALA A CB   13 
ATOM 10402 H H    . ALA A 1 36 ? 2.983   -7.460  10.091  1.00 15.00 ?  332 ALA A H    13 
ATOM 10403 H HA   . ALA A 1 36 ? 2.123   -7.667  12.785  1.00 15.00 ?  332 ALA A HA   13 
ATOM 10404 H HB1  . ALA A 1 36 ? -0.122  -7.847  11.863  1.00 15.00 ?  332 ALA A HB1  13 
ATOM 10405 H HB2  . ALA A 1 36 ? 0.546   -8.136  10.258  1.00 15.00 ?  332 ALA A HB2  13 
ATOM 10406 H HB3  . ALA A 1 36 ? 0.786   -6.576  11.046  1.00 15.00 ?  332 ALA A HB3  13 
ATOM 10407 N N    . ASN A 1 37 ? 2.369   -10.436 11.079  1.00 15.00 ?  333 ASN A N    13 
ATOM 10408 C CA   . ASN A 1 37 ? 2.353   -11.889 11.187  1.00 15.00 ?  333 ASN A CA   13 
ATOM 10409 C C    . ASN A 1 37 ? 3.759   -12.419 11.411  1.00 15.00 ?  333 ASN A C    13 
ATOM 10410 O O    . ASN A 1 37 ? 4.509   -12.567 10.427  1.00 15.00 ?  333 ASN A O    13 
ATOM 10411 C CB   . ASN A 1 37 ? 1.732   -12.533 9.943   1.00 15.00 ?  333 ASN A CB   13 
ATOM 10412 C CG   . ASN A 1 37 ? 0.216   -12.432 9.918   1.00 15.00 ?  333 ASN A CG   13 
ATOM 10413 O OD1  . ASN A 1 37 ? -0.369  -11.471 10.422  1.00 15.00 ?  333 ASN A OD1  13 
ATOM 10414 N ND2  . ASN A 1 37 ? -0.433  -13.436 9.347   1.00 15.00 ?  333 ASN A ND2  13 
ATOM 10415 O OXT  . ASN A 1 37 ? 4.114   -12.671 12.578  1.00 15.00 ?  333 ASN A OXT  13 
ATOM 10416 H H    . ASN A 1 37 ? 2.740   -10.020 10.271  1.00 15.00 ?  333 ASN A H    13 
ATOM 10417 H HA   . ASN A 1 37 ? 1.751   -12.143 12.047  1.00 15.00 ?  333 ASN A HA   13 
ATOM 10418 H HB2  . ASN A 1 37 ? 2.120   -12.044 9.063   1.00 15.00 ?  333 ASN A HB2  13 
ATOM 10419 H HB3  . ASN A 1 37 ? 2.004   -13.579 9.916   1.00 15.00 ?  333 ASN A HB3  13 
ATOM 10420 H HD21 . ASN A 1 37 ? 0.093   -14.180 8.979   1.00 15.00 ?  333 ASN A HD21 13 
ATOM 10421 H HD22 . ASN A 1 37 ? -1.414  -13.400 9.320   1.00 15.00 ?  333 ASN A HD22 13 
ATOM 10422 N N    . GLU B 2 1  ? 3.308   -8.461  -6.705  1.00 15.00 ?  203 GLU B N    13 
ATOM 10423 C CA   . GLU B 2 1  ? 2.904   -8.683  -5.301  1.00 15.00 ?  203 GLU B CA   13 
ATOM 10424 C C    . GLU B 2 1  ? 2.521   -10.139 -5.076  1.00 15.00 ?  203 GLU B C    13 
ATOM 10425 O O    . GLU B 2 1  ? 1.858   -10.752 -5.911  1.00 15.00 ?  203 GLU B O    13 
ATOM 10426 C CB   . GLU B 2 1  ? 1.734   -7.768  -4.937  1.00 15.00 ?  203 GLU B CB   13 
ATOM 10427 C CG   . GLU B 2 1  ? 2.047   -6.295  -5.141  1.00 15.00 ?  203 GLU B CG   13 
ATOM 10428 C CD   . GLU B 2 1  ? 3.384   -5.909  -4.546  1.00 15.00 ?  203 GLU B CD   13 
ATOM 10429 O OE1  . GLU B 2 1  ? 3.427   -5.566  -3.353  1.00 15.00 -1 203 GLU B OE1  13 
ATOM 10430 O OE2  . GLU B 2 1  ? 4.397   -5.971  -5.273  1.00 15.00 ?  203 GLU B OE2  13 
ATOM 10431 H H1   . GLU B 2 1  ? 4.096   -9.099  -6.954  1.00 15.00 ?  203 GLU B H1   13 
ATOM 10432 H H2   . GLU B 2 1  ? 3.620   -7.479  -6.836  1.00 15.00 ?  203 GLU B H2   13 
ATOM 10433 H H3   . GLU B 2 1  ? 2.510   -8.645  -7.345  1.00 15.00 ?  203 GLU B H3   13 
ATOM 10434 H HA   . GLU B 2 1  ? 3.747   -8.447  -4.668  1.00 15.00 ?  203 GLU B HA   13 
ATOM 10435 H HB2  . GLU B 2 1  ? 0.883   -8.025  -5.549  1.00 15.00 ?  203 GLU B HB2  13 
ATOM 10436 H HB3  . GLU B 2 1  ? 1.482   -7.922  -3.899  1.00 15.00 ?  203 GLU B HB3  13 
ATOM 10437 H HG2  . GLU B 2 1  ? 2.064   -6.083  -6.199  1.00 15.00 ?  203 GLU B HG2  13 
ATOM 10438 H HG3  . GLU B 2 1  ? 1.274   -5.706  -4.667  1.00 15.00 ?  203 GLU B HG3  13 
ATOM 10439 N N    . LEU B 2 2  ? 2.937   -10.677 -3.934  1.00 15.00 ?  204 LEU B N    13 
ATOM 10440 C CA   . LEU B 2 2  ? 2.655   -12.066 -3.578  1.00 15.00 ?  204 LEU B CA   13 
ATOM 10441 C C    . LEU B 2 2  ? 1.176   -12.246 -3.235  1.00 15.00 ?  204 LEU B C    13 
ATOM 10442 O O    . LEU B 2 2  ? 0.647   -13.359 -3.258  1.00 15.00 ?  204 LEU B O    13 
ATOM 10443 C CB   . LEU B 2 2  ? 3.555   -12.488 -2.401  1.00 15.00 ?  204 LEU B CB   13 
ATOM 10444 C CG   . LEU B 2 2  ? 3.401   -13.931 -1.905  1.00 15.00 ?  204 LEU B CG   13 
ATOM 10445 C CD1  . LEU B 2 2  ? 4.754   -14.484 -1.477  1.00 15.00 ?  204 LEU B CD1  13 
ATOM 10446 C CD2  . LEU B 2 2  ? 2.427   -13.994 -0.734  1.00 15.00 ?  204 LEU B CD2  13 
ATOM 10447 H H    . LEU B 2 2  ? 3.456   -10.126 -3.313  1.00 15.00 ?  204 LEU B H    13 
ATOM 10448 H HA   . LEU B 2 2  ? 2.889   -12.680 -4.436  1.00 15.00 ?  204 LEU B HA   13 
ATOM 10449 H HB2  . LEU B 2 2  ? 4.582   -12.346 -2.698  1.00 15.00 ?  204 LEU B HB2  13 
ATOM 10450 H HB3  . LEU B 2 2  ? 3.348   -11.828 -1.571  1.00 15.00 ?  204 LEU B HB3  13 
ATOM 10451 H HG   . LEU B 2 2  ? 3.017   -14.550 -2.704  1.00 15.00 ?  204 LEU B HG   13 
ATOM 10452 H HD11 . LEU B 2 2  ? 4.632   -15.492 -1.110  1.00 15.00 ?  204 LEU B HD11 13 
ATOM 10453 H HD12 . LEU B 2 2  ? 5.166   -13.863 -0.694  1.00 15.00 ?  204 LEU B HD12 13 
ATOM 10454 H HD13 . LEU B 2 2  ? 5.424   -14.487 -2.323  1.00 15.00 ?  204 LEU B HD13 13 
ATOM 10455 H HD21 . LEU B 2 2  ? 2.333   -15.015 -0.398  1.00 15.00 ?  204 LEU B HD21 13 
ATOM 10456 H HD22 . LEU B 2 2  ? 1.463   -13.628 -1.049  1.00 15.00 ?  204 LEU B HD22 13 
ATOM 10457 H HD23 . LEU B 2 2  ? 2.798   -13.381 0.076   1.00 15.00 ?  204 LEU B HD23 13 
ATOM 10458 N N    . GLU B 2 3  ? 0.518   -11.145 -2.912  1.00 15.00 ?  205 GLU B N    13 
ATOM 10459 C CA   . GLU B 2 3  ? -0.896  -11.164 -2.568  1.00 15.00 ?  205 GLU B CA   13 
ATOM 10460 C C    . GLU B 2 3  ? -1.741  -10.924 -3.825  1.00 15.00 ?  205 GLU B C    13 
ATOM 10461 O O    . GLU B 2 3  ? -1.199  -10.627 -4.894  1.00 15.00 ?  205 GLU B O    13 
ATOM 10462 C CB   . GLU B 2 3  ? -1.169  -10.098 -1.489  1.00 15.00 ?  205 GLU B CB   13 
ATOM 10463 C CG   . GLU B 2 3  ? -2.599  -10.065 -0.960  1.00 15.00 ?  205 GLU B CG   13 
ATOM 10464 C CD   . GLU B 2 3  ? -3.101  -11.428 -0.524  1.00 15.00 ?  205 GLU B CD   13 
ATOM 10465 O OE1  . GLU B 2 3  ? -2.723  -11.885 0.569   1.00 15.00 -1 205 GLU B OE1  13 
ATOM 10466 O OE2  . GLU B 2 3  ? -3.880  -12.045 -1.286  1.00 15.00 ?  205 GLU B OE2  13 
ATOM 10467 H H    . GLU B 2 3  ? 0.994   -10.292 -2.910  1.00 15.00 ?  205 GLU B H    13 
ATOM 10468 H HA   . GLU B 2 3  ? -1.128  -12.141 -2.170  1.00 15.00 ?  205 GLU B HA   13 
ATOM 10469 H HB2  . GLU B 2 3  ? -0.511  -10.281 -0.653  1.00 15.00 ?  205 GLU B HB2  13 
ATOM 10470 H HB3  . GLU B 2 3  ? -0.942  -9.127  -1.902  1.00 15.00 ?  205 GLU B HB3  13 
ATOM 10471 H HG2  . GLU B 2 3  ? -2.640  -9.398  -0.112  1.00 15.00 ?  205 GLU B HG2  13 
ATOM 10472 H HG3  . GLU B 2 3  ? -3.248  -9.692  -1.741  1.00 15.00 ?  205 GLU B HG3  13 
ATOM 10473 N N    . SER B 2 4  ? -3.053  -11.090 -3.692  1.00 15.00 ?  206 SER B N    13 
ATOM 10474 C CA   . SER B 2 4  ? -4.003  -10.830 -4.769  1.00 15.00 ?  206 SER B CA   13 
ATOM 10475 C C    . SER B 2 4  ? -3.787  -9.479  -5.426  1.00 15.00 ?  206 SER B C    13 
ATOM 10476 O O    . SER B 2 4  ? -3.227  -8.550  -4.837  1.00 15.00 ?  206 SER B O    13 
ATOM 10477 C CB   . SER B 2 4  ? -5.427  -10.926 -4.241  1.00 15.00 ?  206 SER B CB   13 
ATOM 10478 O OG   . SER B 2 4  ? -5.507  -10.557 -2.870  1.00 15.00 ?  206 SER B OG   13 
ATOM 10479 H H    . SER B 2 4  ? -3.400  -11.405 -2.825  1.00 15.00 ?  206 SER B H    13 
ATOM 10480 H HA   . SER B 2 4  ? -3.883  -11.589 -5.527  1.00 15.00 ?  206 SER B HA   13 
ATOM 10481 H HB2  . SER B 2 4  ? -6.056  -10.261 -4.817  1.00 15.00 ?  206 SER B HB2  13 
ATOM 10482 H HB3  . SER B 2 4  ? -5.772  -11.937 -4.370  1.00 15.00 ?  206 SER B HB3  13 
ATOM 10483 H HG   . SER B 2 4  ? -5.058  -11.228 -2.326  1.00 15.00 ?  206 SER B HG   13 
ATOM 10484 N N    . PRO B 2 5  ? -4.290  -9.376  -6.657  1.00 15.00 ?  207 PRO B N    13 
ATOM 10485 C CA   . PRO B 2 5  ? -4.123  -8.207  -7.517  1.00 15.00 ?  207 PRO B CA   13 
ATOM 10486 C C    . PRO B 2 5  ? -4.458  -6.911  -6.782  1.00 15.00 ?  207 PRO B C    13 
ATOM 10487 O O    . PRO B 2 5  ? -5.584  -6.728  -6.304  1.00 15.00 ?  207 PRO B O    13 
ATOM 10488 C CB   . PRO B 2 5  ? -5.102  -8.446  -8.675  1.00 15.00 ?  207 PRO B CB   13 
ATOM 10489 C CG   . PRO B 2 5  ? -5.815  -9.736  -8.391  1.00 15.00 ?  207 PRO B CG   13 
ATOM 10490 C CD   . PRO B 2 5  ? -5.087  -10.427 -7.272  1.00 15.00 ?  207 PRO B CD   13 
ATOM 10491 H HA   . PRO B 2 5  ? -3.119  -8.150  -7.904  1.00 15.00 ?  207 PRO B HA   13 
ATOM 10492 H HB2  . PRO B 2 5  ? -5.802  -7.622  -8.725  1.00 15.00 ?  207 PRO B HB2  13 
ATOM 10493 H HB3  . PRO B 2 5  ? -4.551  -8.501  -9.601  1.00 15.00 ?  207 PRO B HB3  13 
ATOM 10494 H HG2  . PRO B 2 5  ? -6.831  -9.529  -8.094  1.00 15.00 ?  207 PRO B HG2  13 
ATOM 10495 H HG3  . PRO B 2 5  ? -5.808  -10.354 -9.278  1.00 15.00 ?  207 PRO B HG3  13 
ATOM 10496 H HD2  . PRO B 2 5  ? -5.777  -10.830 -6.550  1.00 15.00 ?  207 PRO B HD2  13 
ATOM 10497 H HD3  . PRO B 2 5  ? -4.461  -11.216 -7.634  1.00 15.00 ?  207 PRO B HD3  13 
ATOM 10498 N N    . PRO B 2 6  ? -3.479  -5.997  -6.676  1.00 15.00 ?  208 PRO B N    13 
ATOM 10499 C CA   . PRO B 2 6  ? -3.621  -4.786  -5.889  1.00 15.00 ?  208 PRO B CA   13 
ATOM 10500 C C    . PRO B 2 6  ? -4.236  -3.620  -6.655  1.00 15.00 ?  208 PRO B C    13 
ATOM 10501 O O    . PRO B 2 6  ? -4.287  -3.618  -7.889  1.00 15.00 ?  208 PRO B O    13 
ATOM 10502 C CB   . PRO B 2 6  ? -2.181  -4.464  -5.480  1.00 15.00 ?  208 PRO B CB   13 
ATOM 10503 C CG   . PRO B 2 6  ? -1.287  -5.183  -6.446  1.00 15.00 ?  208 PRO B CG   13 
ATOM 10504 C CD   . PRO B 2 6  ? -2.149  -6.082  -7.297  1.00 15.00 ?  208 PRO B CD   13 
ATOM 10505 H HA   . PRO B 2 6  ? -4.207  -4.968  -5.000  1.00 15.00 ?  208 PRO B HA   13 
ATOM 10506 H HB2  . PRO B 2 6  ? -2.028  -3.394  -5.529  1.00 15.00 ?  208 PRO B HB2  13 
ATOM 10507 H HB3  . PRO B 2 6  ? -2.022  -4.805  -4.461  1.00 15.00 ?  208 PRO B HB3  13 
ATOM 10508 H HG2  . PRO B 2 6  ? -0.778  -4.464  -7.070  1.00 15.00 ?  208 PRO B HG2  13 
ATOM 10509 H HG3  . PRO B 2 6  ? -0.565  -5.772  -5.898  1.00 15.00 ?  208 PRO B HG3  13 
ATOM 10510 H HD2  . PRO B 2 6  ? -2.175  -5.722  -8.315  1.00 15.00 ?  208 PRO B HD2  13 
ATOM 10511 H HD3  . PRO B 2 6  ? -1.772  -7.093  -7.267  1.00 15.00 ?  208 PRO B HD3  13 
ATOM 10512 N N    . PRO B 2 7  ? -4.709  -2.614  -5.902  1.00 15.00 ?  209 PRO B N    13 
ATOM 10513 C CA   . PRO B 2 7  ? -5.283  -1.380  -6.451  1.00 15.00 ?  209 PRO B CA   13 
ATOM 10514 C C    . PRO B 2 7  ? -4.386  -0.730  -7.501  1.00 15.00 ?  209 PRO B C    13 
ATOM 10515 O O    . PRO B 2 7  ? -3.177  -0.601  -7.296  1.00 15.00 ?  209 PRO B O    13 
ATOM 10516 C CB   . PRO B 2 7  ? -5.369  -0.465  -5.221  1.00 15.00 ?  209 PRO B CB   13 
ATOM 10517 C CG   . PRO B 2 7  ? -5.473  -1.380  -4.059  1.00 15.00 ?  209 PRO B CG   13 
ATOM 10518 C CD   . PRO B 2 7  ? -4.721  -2.622  -4.426  1.00 15.00 ?  209 PRO B CD   13 
ATOM 10519 H HA   . PRO B 2 7  ? -6.270  -1.541  -6.857  1.00 15.00 ?  209 PRO B HA   13 
ATOM 10520 H HB2  . PRO B 2 7  ? -4.478  0.143   -5.163  1.00 15.00 ?  209 PRO B HB2  13 
ATOM 10521 H HB3  . PRO B 2 7  ? -6.235  0.169   -5.293  1.00 15.00 ?  209 PRO B HB3  13 
ATOM 10522 H HG2  . PRO B 2 7  ? -5.023  -0.917  -3.195  1.00 15.00 ?  209 PRO B HG2  13 
ATOM 10523 H HG3  . PRO B 2 7  ? -6.510  -1.612  -3.864  1.00 15.00 ?  209 PRO B HG3  13 
ATOM 10524 H HD2  . PRO B 2 7  ? -3.713  -2.579  -4.037  1.00 15.00 ?  209 PRO B HD2  13 
ATOM 10525 H HD3  . PRO B 2 7  ? -5.233  -3.495  -4.052  1.00 15.00 ?  209 PRO B HD3  13 
ATOM 10526 N N    . PRO B 2 8  ? -4.964  -0.318  -8.646  1.00 15.00 ?  210 PRO B N    13 
ATOM 10527 C CA   . PRO B 2 8  ? -4.254  0.514   -9.625  1.00 15.00 ?  210 PRO B CA   13 
ATOM 10528 C C    . PRO B 2 8  ? -3.719  1.771   -8.946  1.00 15.00 ?  210 PRO B C    13 
ATOM 10529 O O    . PRO B 2 8  ? -4.320  2.246   -7.981  1.00 15.00 ?  210 PRO B O    13 
ATOM 10530 C CB   . PRO B 2 8  ? -5.340  0.868   -10.644 1.00 15.00 ?  210 PRO B CB   13 
ATOM 10531 C CG   . PRO B 2 8  ? -6.347  -0.221  -10.522 1.00 15.00 ?  210 PRO B CG   13 
ATOM 10532 C CD   . PRO B 2 8  ? -6.338  -0.633  -9.076  1.00 15.00 ?  210 PRO B CD   13 
ATOM 10533 H HA   . PRO B 2 8  ? -3.447  -0.022  -10.104 1.00 15.00 ?  210 PRO B HA   13 
ATOM 10534 H HB2  . PRO B 2 8  ? -5.764  1.830   -10.401 1.00 15.00 ?  210 PRO B HB2  13 
ATOM 10535 H HB3  . PRO B 2 8  ? -4.912  0.898   -11.636 1.00 15.00 ?  210 PRO B HB3  13 
ATOM 10536 H HG2  . PRO B 2 8  ? -7.324  0.149   -10.799 1.00 15.00 ?  210 PRO B HG2  13 
ATOM 10537 H HG3  . PRO B 2 8  ? -6.068  -1.054  -11.151 1.00 15.00 ?  210 PRO B HG3  13 
ATOM 10538 H HD2  . PRO B 2 8  ? -7.060  -0.058  -8.514  1.00 15.00 ?  210 PRO B HD2  13 
ATOM 10539 H HD3  . PRO B 2 8  ? -6.537  -1.690  -8.982  1.00 15.00 ?  210 PRO B HD3  13 
ATOM 10540 N N    . TYR B 2 9  ? -2.618  2.321   -9.445  1.00 15.00 ?  211 TYR B N    13 
ATOM 10541 C CA   . TYR B 2 9  ? -1.941  3.397   -8.734  1.00 15.00 ?  211 TYR B CA   13 
ATOM 10542 C C    . TYR B 2 9  ? -2.755  4.687   -8.717  1.00 15.00 ?  211 TYR B C    13 
ATOM 10543 O O    . TYR B 2 9  ? -2.706  5.500   -9.645  1.00 15.00 ?  211 TYR B O    13 
ATOM 10544 C CB   . TYR B 2 9  ? -0.539  3.669   -9.285  1.00 15.00 ?  211 TYR B CB   13 
ATOM 10545 C CG   . TYR B 2 9  ? 0.295   4.532   -8.357  1.00 15.00 ?  211 TYR B CG   13 
ATOM 10546 C CD1  . TYR B 2 9  ? 0.656   4.066   -7.099  1.00 15.00 ?  211 TYR B CD1  13 
ATOM 10547 C CD2  . TYR B 2 9  ? 0.723   5.803   -8.729  1.00 15.00 ?  211 TYR B CD2  13 
ATOM 10548 C CE1  . TYR B 2 9  ? 1.415   4.835   -6.243  1.00 15.00 ?  211 TYR B CE1  13 
ATOM 10549 C CE2  . TYR B 2 9  ? 1.483   6.580   -7.868  1.00 15.00 ?  211 TYR B CE2  13 
ATOM 10550 C CZ   . TYR B 2 9  ? 1.825   6.086   -6.628  1.00 15.00 ?  211 TYR B CZ   13 
ATOM 10551 O OH   . TYR B 2 9  ? 2.593   6.839   -5.769  1.00 15.00 ?  211 TYR B OH   13 
ATOM 10552 H H    . TYR B 2 9  ? -2.260  2.004   -10.308 1.00 15.00 ?  211 TYR B H    13 
ATOM 10553 H HA   . TYR B 2 9  ? -1.835  3.069   -7.709  1.00 15.00 ?  211 TYR B HA   13 
ATOM 10554 H HB2  . TYR B 2 9  ? -0.024  2.732   -9.426  1.00 15.00 ?  211 TYR B HB2  13 
ATOM 10555 H HB3  . TYR B 2 9  ? -0.622  4.180   -10.233 1.00 15.00 ?  211 TYR B HB3  13 
ATOM 10556 H HD1  . TYR B 2 9  ? 0.330   3.086   -6.787  1.00 15.00 ?  211 TYR B HD1  13 
ATOM 10557 H HD2  . TYR B 2 9  ? 0.458   6.185   -9.703  1.00 15.00 ?  211 TYR B HD2  13 
ATOM 10558 H HE1  . TYR B 2 9  ? 1.684   4.450   -5.271  1.00 15.00 ?  211 TYR B HE1  13 
ATOM 10559 H HE2  . TYR B 2 9  ? 1.803   7.566   -8.168  1.00 15.00 ?  211 TYR B HE2  13 
ATOM 10560 H HH   . TYR B 2 9  ? 3.362   6.317   -5.494  1.00 15.00 ?  211 TYR B HH   13 
ATOM 10561 N N    . SER B 2 10 ? -3.553  4.813   -7.680  1.00 15.00 ?  212 SER B N    13 
ATOM 10562 C CA   . SER B 2 10 ? -4.172  6.063   -7.313  1.00 15.00 ?  212 SER B CA   13 
ATOM 10563 C C    . SER B 2 10 ? -3.480  6.544   -6.051  1.00 15.00 ?  212 SER B C    13 
ATOM 10564 O O    . SER B 2 10 ? -3.109  5.719   -5.212  1.00 15.00 ?  212 SER B O    13 
ATOM 10565 C CB   . SER B 2 10 ? -5.669  5.858   -7.067  1.00 15.00 ?  212 SER B CB   13 
ATOM 10566 O OG   . SER B 2 10 ? -6.305  5.321   -8.218  1.00 15.00 ?  212 SER B OG   13 
ATOM 10567 H H    . SER B 2 10 ? -3.744  4.018   -7.137  1.00 15.00 ?  212 SER B H    13 
ATOM 10568 H HA   . SER B 2 10 ? -4.019  6.776   -8.111  1.00 15.00 ?  212 SER B HA   13 
ATOM 10569 H HB2  . SER B 2 10 ? -5.807  5.174   -6.243  1.00 15.00 ?  212 SER B HB2  13 
ATOM 10570 H HB3  . SER B 2 10 ? -6.127  6.807   -6.829  1.00 15.00 ?  212 SER B HB3  13 
ATOM 10571 H HG   . SER B 2 10 ? -6.598  6.044   -8.785  1.00 15.00 ?  212 SER B HG   13 
ATOM 10572 N N    . ARG B 2 11 ? -3.296  7.847   -5.903  1.00 15.00 ?  213 ARG B N    13 
ATOM 10573 C CA   . ARG B 2 11 ? -2.553  8.359   -4.761  1.00 15.00 ?  213 ARG B CA   13 
ATOM 10574 C C    . ARG B 2 11 ? -3.235  7.945   -3.466  1.00 15.00 ?  213 ARG B C    13 
ATOM 10575 O O    . ARG B 2 11 ? -2.633  7.290   -2.618  1.00 15.00 ?  213 ARG B O    13 
ATOM 10576 C CB   . ARG B 2 11 ? -2.437  9.886   -4.788  1.00 15.00 ?  213 ARG B CB   13 
ATOM 10577 C CG   . ARG B 2 11 ? -1.888  10.464  -6.068  1.00 15.00 ?  213 ARG B CG   13 
ATOM 10578 C CD   . ARG B 2 11 ? -1.693  11.973  -5.981  1.00 15.00 ?  213 ARG B CD   13 
ATOM 10579 N NE   . ARG B 2 11 ? -1.093  12.398  -4.713  1.00 15.00 ?  213 ARG B NE   13 
ATOM 10580 C CZ   . ARG B 2 11 ? -0.298  13.462  -4.578  1.00 15.00 ?  213 ARG B CZ   13 
ATOM 10581 N NH1  . ARG B 2 11 ? 0.141   14.115  -5.647  1.00 15.00 1  213 ARG B NH1  13 
ATOM 10582 N NH2  . ARG B 2 11 ? 0.078   13.857  -3.367  1.00 15.00 ?  213 ARG B NH2  13 
ATOM 10583 H H    . ARG B 2 11 ? -3.669  8.471   -6.563  1.00 15.00 ?  213 ARG B H    13 
ATOM 10584 H HA   . ARG B 2 11 ? -1.564  7.927   -4.788  1.00 15.00 ?  213 ARG B HA   13 
ATOM 10585 H HB2  . ARG B 2 11 ? -3.418  10.306  -4.630  1.00 15.00 ?  213 ARG B HB2  13 
ATOM 10586 H HB3  . ARG B 2 11 ? -1.794  10.196  -3.976  1.00 15.00 ?  213 ARG B HB3  13 
ATOM 10587 H HG2  . ARG B 2 11 ? -0.947  9.997   -6.299  1.00 15.00 ?  213 ARG B HG2  13 
ATOM 10588 H HG3  . ARG B 2 11 ? -2.601  10.262  -6.840  1.00 15.00 ?  213 ARG B HG3  13 
ATOM 10589 H HD2  . ARG B 2 11 ? -1.050  12.285  -6.791  1.00 15.00 ?  213 ARG B HD2  13 
ATOM 10590 H HD3  . ARG B 2 11 ? -2.656  12.451  -6.088  1.00 15.00 ?  213 ARG B HD3  13 
ATOM 10591 H HE   . ARG B 2 11 ? -1.342  11.893  -3.910  1.00 15.00 ?  213 ARG B HE   13 
ATOM 10592 H HH11 . ARG B 2 11 ? -0.114  13.809  -6.570  1.00 15.00 ?  213 ARG B HH11 13 
ATOM 10593 H HH12 . ARG B 2 11 ? 0.725   14.933  -5.538  1.00 15.00 ?  213 ARG B HH12 13 
ATOM 10594 H HH21 . ARG B 2 11 ? -0.238  13.362  -2.547  1.00 15.00 ?  213 ARG B HH21 13 
ATOM 10595 H HH22 . ARG B 2 11 ? 0.680   14.660  -3.259  1.00 15.00 ?  213 ARG B HH22 13 
ATOM 10596 N N    . TYR B 2 12 ? -4.486  8.355   -3.307  1.00 15.00 ?  214 TYR B N    13 
ATOM 10597 C CA   . TYR B 2 12 ? -5.215  8.080   -2.080  1.00 15.00 ?  214 TYR B CA   13 
ATOM 10598 C C    . TYR B 2 12 ? -6.469  7.270   -2.350  1.00 15.00 ?  214 TYR B C    13 
ATOM 10599 O O    . TYR B 2 12 ? -7.494  7.781   -2.803  1.00 15.00 ?  214 TYR B O    13 
ATOM 10600 C CB   . TYR B 2 12 ? -5.543  9.388   -1.345  1.00 15.00 ?  214 TYR B CB   13 
ATOM 10601 C CG   . TYR B 2 12 ? -4.358  10.332  -1.249  1.00 15.00 ?  214 TYR B CG   13 
ATOM 10602 C CD1  . TYR B 2 12 ? -3.909  11.029  -2.365  1.00 15.00 ?  214 TYR B CD1  13 
ATOM 10603 C CD2  . TYR B 2 12 ? -3.670  10.503  -0.057  1.00 15.00 ?  214 TYR B CD2  13 
ATOM 10604 C CE1  . TYR B 2 12 ? -2.814  11.857  -2.298  1.00 15.00 ?  214 TYR B CE1  13 
ATOM 10605 C CE2  . TYR B 2 12 ? -2.571  11.340  0.019   1.00 15.00 ?  214 TYR B CE2  13 
ATOM 10606 C CZ   . TYR B 2 12 ? -2.145  12.010  -1.106  1.00 15.00 ?  214 TYR B CZ   13 
ATOM 10607 O OH   . TYR B 2 12 ? -1.042  12.832  -1.041  1.00 15.00 ?  214 TYR B OH   13 
ATOM 10608 H H    . TYR B 2 12 ? -4.931  8.847   -4.036  1.00 15.00 ?  214 TYR B H    13 
ATOM 10609 H HA   . TYR B 2 12 ? -4.570  7.455   -1.456  1.00 15.00 ?  214 TYR B HA   13 
ATOM 10610 H HB2  . TYR B 2 12 ? -6.338  9.900   -1.868  1.00 15.00 ?  214 TYR B HB2  13 
ATOM 10611 H HB3  . TYR B 2 12 ? -5.868  9.157   -0.340  1.00 15.00 ?  214 TYR B HB3  13 
ATOM 10612 H HD1  . TYR B 2 12 ? -4.425  10.904  -3.313  1.00 15.00 ?  214 TYR B HD1  13 
ATOM 10613 H HD2  . TYR B 2 12 ? -4.005  9.975   0.824   1.00 15.00 ?  214 TYR B HD2  13 
ATOM 10614 H HE1  . TYR B 2 12 ? -2.483  12.377  -3.191  1.00 15.00 ?  214 TYR B HE1  13 
ATOM 10615 H HE2  . TYR B 2 12 ? -2.042  11.457  0.953   1.00 15.00 ?  214 TYR B HE2  13 
ATOM 10616 H HH   . TYR B 2 12 ? -0.448  12.512  -0.349  1.00 15.00 ?  214 TYR B HH   13 
ATOM 10617 N N    . PRO B 2 13 ? -6.347  5.978   -2.098  1.00 15.00 ?  215 PRO B N    13 
ATOM 10618 C CA   . PRO B 2 13 ? -7.392  4.996   -2.269  1.00 15.00 ?  215 PRO B CA   13 
ATOM 10619 C C    . PRO B 2 13 ? -8.114  4.672   -0.958  1.00 15.00 ?  215 PRO B C    13 
ATOM 10620 O O    . PRO B 2 13 ? -7.500  4.215   0.008   1.00 15.00 ?  215 PRO B O    13 
ATOM 10621 C CB   . PRO B 2 13 ? -6.594  3.787   -2.766  1.00 15.00 ?  215 PRO B CB   13 
ATOM 10622 C CG   . PRO B 2 13 ? -5.191  3.986   -2.247  1.00 15.00 ?  215 PRO B CG   13 
ATOM 10623 C CD   . PRO B 2 13 ? -5.114  5.354   -1.664  1.00 15.00 ?  215 PRO B CD   13 
ATOM 10624 H HA   . PRO B 2 13 ? -8.108  5.295   -3.019  1.00 15.00 ?  215 PRO B HA   13 
ATOM 10625 H HB2  . PRO B 2 13 ? -7.033  2.881   -2.375  1.00 15.00 ?  215 PRO B HB2  13 
ATOM 10626 H HB3  . PRO B 2 13 ? -6.612  3.761   -3.845  1.00 15.00 ?  215 PRO B HB3  13 
ATOM 10627 H HG2  . PRO B 2 13 ? -4.974  3.262   -1.469  1.00 15.00 ?  215 PRO B HG2  13 
ATOM 10628 H HG3  . PRO B 2 13 ? -4.475  3.889   -3.056  1.00 15.00 ?  215 PRO B HG3  13 
ATOM 10629 H HD2  . PRO B 2 13 ? -5.038  5.301   -0.567  1.00 15.00 ?  215 PRO B HD2  13 
ATOM 10630 H HD3  . PRO B 2 13 ? -4.258  5.878   -2.066  1.00 15.00 ?  215 PRO B HD3  13 
ATOM 10631 N N    . MET B 2 14 ? -9.409  4.941   -0.924  1.00 15.00 ?  216 MET B N    13 
ATOM 10632 C CA   . MET B 2 14 ? -10.230 4.615   0.234   1.00 15.00 ?  216 MET B CA   13 
ATOM 10633 C C    . MET B 2 14 ? -11.482 3.865   -0.209  1.00 15.00 ?  216 MET B C    13 
ATOM 10634 O O    . MET B 2 14 ? -12.338 4.412   -0.906  1.00 15.00 ?  216 MET B O    13 
ATOM 10635 C CB   . MET B 2 14 ? -10.592 5.878   1.031   1.00 15.00 ?  216 MET B CB   13 
ATOM 10636 C CG   . MET B 2 14 ? -11.232 6.983   0.205   1.00 15.00 ?  216 MET B CG   13 
ATOM 10637 S SD   . MET B 2 14 ? -11.574 8.464   1.181   1.00 15.00 ?  216 MET B SD   13 
ATOM 10638 C CE   . MET B 2 14 ? -12.237 9.557   -0.076  1.00 15.00 ?  216 MET B CE   13 
ATOM 10639 H H    . MET B 2 14 ? -9.831  5.349   -1.707  1.00 15.00 ?  216 MET B H    13 
ATOM 10640 H HA   . MET B 2 14 ? -9.649  3.960   0.867   1.00 15.00 ?  216 MET B HA   13 
ATOM 10641 H HB2  . MET B 2 14 ? -11.281 5.606   1.817   1.00 15.00 ?  216 MET B HB2  13 
ATOM 10642 H HB3  . MET B 2 14 ? -9.692  6.273   1.478   1.00 15.00 ?  216 MET B HB3  13 
ATOM 10643 H HG2  . MET B 2 14 ? -10.563 7.246   -0.600  1.00 15.00 ?  216 MET B HG2  13 
ATOM 10644 H HG3  . MET B 2 14 ? -12.162 6.617   -0.205  1.00 15.00 ?  216 MET B HG3  13 
ATOM 10645 H HE1  . MET B 2 14 ? -11.490 9.722   -0.839  1.00 15.00 ?  216 MET B HE1  13 
ATOM 10646 H HE2  . MET B 2 14 ? -12.505 10.500  0.374   1.00 15.00 ?  216 MET B HE2  13 
ATOM 10647 H HE3  . MET B 2 14 ? -13.112 9.107   -0.522  1.00 15.00 ?  216 MET B HE3  13 
ATOM 10648 N N    . ASP B 2 15 ? -11.568 2.601   0.172   1.00 15.00 ?  217 ASP B N    13 
ATOM 10649 C CA   . ASP B 2 15 ? -12.674 1.748   -0.237  1.00 15.00 ?  217 ASP B CA   13 
ATOM 10650 C C    . ASP B 2 15 ? -13.365 1.169   0.986   1.00 15.00 ?  217 ASP B C    13 
ATOM 10651 O O    . ASP B 2 15 ? -14.571 0.860   0.901   1.00 15.00 ?  217 ASP B O    13 
ATOM 10652 C CB   . ASP B 2 15 ? -12.179 0.617   -1.146  1.00 15.00 ?  217 ASP B CB   13 
ATOM 10653 C CG   . ASP B 2 15 ? -11.351 -0.410  -0.399  1.00 15.00 ?  217 ASP B CG   13 
ATOM 10654 O OD1  . ASP B 2 15 ? -10.216 -0.083  0.004   1.00 15.00 ?  217 ASP B OD1  13 
ATOM 10655 O OD2  . ASP B 2 15 ? -11.828 -1.554  -0.226  1.00 15.00 -1 217 ASP B OD2  13 
ATOM 10656 O OXT  . ASP B 2 15 ? -12.707 1.055   2.040   1.00 15.00 ?  217 ASP B OXT  13 
ATOM 10657 H H    . ASP B 2 15 ? -10.872 2.226   0.753   1.00 15.00 ?  217 ASP B H    13 
ATOM 10658 H HA   . ASP B 2 15 ? -13.380 2.358   -0.782  1.00 15.00 ?  217 ASP B HA   13 
ATOM 10659 H HB2  . ASP B 2 15 ? -13.030 0.115   -1.580  1.00 15.00 ?  217 ASP B HB2  13 
ATOM 10660 H HB3  . ASP B 2 15 ? -11.572 1.036   -1.935  1.00 15.00 ?  217 ASP B HB3  13 
ATOM 10661 N N    . GLY A 1 1  ? 4.825   9.629   12.237  1.00 15.00 ?  297 GLY A N    14 
ATOM 10662 C CA   . GLY A 1 1  ? 4.933   8.260   12.793  1.00 15.00 ?  297 GLY A CA   14 
ATOM 10663 C C    . GLY A 1 1  ? 6.151   7.526   12.273  1.00 15.00 ?  297 GLY A C    14 
ATOM 10664 O O    . GLY A 1 1  ? 6.973   8.113   11.572  1.00 15.00 ?  297 GLY A O    14 
ATOM 10665 H H1   . GLY A 1 1  ? 3.943   10.079  12.563  1.00 15.00 ?  297 GLY A H1   14 
ATOM 10666 H H2   . GLY A 1 1  ? 4.820   9.593   11.195  1.00 15.00 ?  297 GLY A H2   14 
ATOM 10667 H H3   . GLY A 1 1  ? 5.634   10.209  12.546  1.00 15.00 ?  297 GLY A H3   14 
ATOM 10668 H HA2  . GLY A 1 1  ? 4.996   8.320   13.869  1.00 15.00 ?  297 GLY A HA2  14 
ATOM 10669 H HA3  . GLY A 1 1  ? 4.048   7.702   12.525  1.00 15.00 ?  297 GLY A HA3  14 
ATOM 10670 N N    . PRO A 1 2  ? 6.291   6.228   12.601  1.00 15.00 ?  298 PRO A N    14 
ATOM 10671 C CA   . PRO A 1 2  ? 7.410   5.400   12.134  1.00 15.00 ?  298 PRO A CA   14 
ATOM 10672 C C    . PRO A 1 2  ? 7.331   5.102   10.635  1.00 15.00 ?  298 PRO A C    14 
ATOM 10673 O O    . PRO A 1 2  ? 8.252   4.526   10.054  1.00 15.00 ?  298 PRO A O    14 
ATOM 10674 C CB   . PRO A 1 2  ? 7.275   4.097   12.938  1.00 15.00 ?  298 PRO A CB   14 
ATOM 10675 C CG   . PRO A 1 2  ? 6.267   4.378   14.003  1.00 15.00 ?  298 PRO A CG   14 
ATOM 10676 C CD   . PRO A 1 2  ? 5.384   5.469   13.472  1.00 15.00 ?  298 PRO A CD   14 
ATOM 10677 H HA   . PRO A 1 2  ? 8.360   5.864   12.354  1.00 15.00 ?  298 PRO A HA   14 
ATOM 10678 H HB2  . PRO A 1 2  ? 6.943   3.305   12.284  1.00 15.00 ?  298 PRO A HB2  14 
ATOM 10679 H HB3  . PRO A 1 2  ? 8.233   3.836   13.364  1.00 15.00 ?  298 PRO A HB3  14 
ATOM 10680 H HG2  . PRO A 1 2  ? 5.684   3.489   14.198  1.00 15.00 ?  298 PRO A HG2  14 
ATOM 10681 H HG3  . PRO A 1 2  ? 6.765   4.704   14.904  1.00 15.00 ?  298 PRO A HG3  14 
ATOM 10682 H HD2  . PRO A 1 2  ? 4.562   5.054   12.909  1.00 15.00 ?  298 PRO A HD2  14 
ATOM 10683 H HD3  . PRO A 1 2  ? 5.019   6.087   14.279  1.00 15.00 ?  298 PRO A HD3  14 
ATOM 10684 N N    . LEU A 1 3  ? 6.218   5.485   10.023  1.00 15.00 ?  299 LEU A N    14 
ATOM 10685 C CA   . LEU A 1 3  ? 6.012   5.290   8.595   1.00 15.00 ?  299 LEU A CA   14 
ATOM 10686 C C    . LEU A 1 3  ? 6.966   6.189   7.811   1.00 15.00 ?  299 LEU A C    14 
ATOM 10687 O O    . LEU A 1 3  ? 7.115   7.370   8.138   1.00 15.00 ?  299 LEU A O    14 
ATOM 10688 C CB   . LEU A 1 3  ? 4.562   5.631   8.236   1.00 15.00 ?  299 LEU A CB   14 
ATOM 10689 C CG   . LEU A 1 3  ? 4.078   5.119   6.877   1.00 15.00 ?  299 LEU A CG   14 
ATOM 10690 C CD1  . LEU A 1 3  ? 3.818   3.620   6.934   1.00 15.00 ?  299 LEU A CD1  14 
ATOM 10691 C CD2  . LEU A 1 3  ? 2.830   5.869   6.442   1.00 15.00 ?  299 LEU A CD2  14 
ATOM 10692 H H    . LEU A 1 3  ? 5.518   5.923   10.548  1.00 15.00 ?  299 LEU A H    14 
ATOM 10693 H HA   . LEU A 1 3  ? 6.211   4.256   8.356   1.00 15.00 ?  299 LEU A HA   14 
ATOM 10694 H HB2  . LEU A 1 3  ? 3.919   5.219   9.001   1.00 15.00 ?  299 LEU A HB2  14 
ATOM 10695 H HB3  . LEU A 1 3  ? 4.458   6.706   8.246   1.00 15.00 ?  299 LEU A HB3  14 
ATOM 10696 H HG   . LEU A 1 3  ? 4.849   5.293   6.139   1.00 15.00 ?  299 LEU A HG   14 
ATOM 10697 H HD11 . LEU A 1 3  ? 3.320   3.303   6.028   1.00 15.00 ?  299 LEU A HD11 14 
ATOM 10698 H HD12 . LEU A 1 3  ? 3.192   3.396   7.785   1.00 15.00 ?  299 LEU A HD12 14 
ATOM 10699 H HD13 . LEU A 1 3  ? 4.756   3.094   7.031   1.00 15.00 ?  299 LEU A HD13 14 
ATOM 10700 H HD21 . LEU A 1 3  ? 3.053   6.924   6.363   1.00 15.00 ?  299 LEU A HD21 14 
ATOM 10701 H HD22 . LEU A 1 3  ? 2.047   5.718   7.171   1.00 15.00 ?  299 LEU A HD22 14 
ATOM 10702 H HD23 . LEU A 1 3  ? 2.503   5.497   5.481   1.00 15.00 ?  299 LEU A HD23 14 
ATOM 10703 N N    . PRO A 1 4  ? 7.623   5.657   6.769   1.00 15.00 ?  300 PRO A N    14 
ATOM 10704 C CA   . PRO A 1 4  ? 8.552   6.442   5.951   1.00 15.00 ?  300 PRO A CA   14 
ATOM 10705 C C    . PRO A 1 4  ? 7.825   7.567   5.215   1.00 15.00 ?  300 PRO A C    14 
ATOM 10706 O O    . PRO A 1 4  ? 6.768   7.346   4.633   1.00 15.00 ?  300 PRO A O    14 
ATOM 10707 C CB   . PRO A 1 4  ? 9.120   5.418   4.959   1.00 15.00 ?  300 PRO A CB   14 
ATOM 10708 C CG   . PRO A 1 4  ? 8.791   4.082   5.539   1.00 15.00 ?  300 PRO A CG   14 
ATOM 10709 C CD   . PRO A 1 4  ? 7.504   4.273   6.281   1.00 15.00 ?  300 PRO A CD   14 
ATOM 10710 H HA   . PRO A 1 4  ? 9.352   6.858   6.546   1.00 15.00 ?  300 PRO A HA   14 
ATOM 10711 H HB2  . PRO A 1 4  ? 8.652   5.555   3.995   1.00 15.00 ?  300 PRO A HB2  14 
ATOM 10712 H HB3  . PRO A 1 4  ? 10.187  5.557   4.868   1.00 15.00 ?  300 PRO A HB3  14 
ATOM 10713 H HG2  . PRO A 1 4  ? 8.665   3.358   4.748   1.00 15.00 ?  300 PRO A HG2  14 
ATOM 10714 H HG3  . PRO A 1 4  ? 9.572   3.771   6.216   1.00 15.00 ?  300 PRO A HG3  14 
ATOM 10715 H HD2  . PRO A 1 4  ? 6.665   4.172   5.606   1.00 15.00 ?  300 PRO A HD2  14 
ATOM 10716 H HD3  . PRO A 1 4  ? 7.422   3.569   7.096   1.00 15.00 ?  300 PRO A HD3  14 
ATOM 10717 N N    . PRO A 1 5  ? 8.388   8.787   5.226   1.00 15.00 ?  301 PRO A N    14 
ATOM 10718 C CA   . PRO A 1 5  ? 7.741   9.975   4.644   1.00 15.00 ?  301 PRO A CA   14 
ATOM 10719 C C    . PRO A 1 5  ? 7.461   9.850   3.144   1.00 15.00 ?  301 PRO A C    14 
ATOM 10720 O O    . PRO A 1 5  ? 6.648   10.591  2.591   1.00 15.00 ?  301 PRO A O    14 
ATOM 10721 C CB   . PRO A 1 5  ? 8.744   11.104  4.906   1.00 15.00 ?  301 PRO A CB   14 
ATOM 10722 C CG   . PRO A 1 5  ? 9.621   10.599  6.000   1.00 15.00 ?  301 PRO A CG   14 
ATOM 10723 C CD   . PRO A 1 5  ? 9.693   9.112   5.821   1.00 15.00 ?  301 PRO A CD   14 
ATOM 10724 H HA   . PRO A 1 5  ? 6.816   10.198  5.154   1.00 15.00 ?  301 PRO A HA   14 
ATOM 10725 H HB2  . PRO A 1 5  ? 9.310   11.300  4.007   1.00 15.00 ?  301 PRO A HB2  14 
ATOM 10726 H HB3  . PRO A 1 5  ? 8.216   11.997  5.206   1.00 15.00 ?  301 PRO A HB3  14 
ATOM 10727 H HG2  . PRO A 1 5  ? 10.605  11.035  5.911   1.00 15.00 ?  301 PRO A HG2  14 
ATOM 10728 H HG3  . PRO A 1 5  ? 9.188   10.842  6.959   1.00 15.00 ?  301 PRO A HG3  14 
ATOM 10729 H HD2  . PRO A 1 5  ? 10.500  8.848   5.151   1.00 15.00 ?  301 PRO A HD2  14 
ATOM 10730 H HD3  . PRO A 1 5  ? 9.815   8.621   6.775   1.00 15.00 ?  301 PRO A HD3  14 
ATOM 10731 N N    . GLY A 1 6  ? 8.153   8.934   2.484   1.00 15.00 ?  302 GLY A N    14 
ATOM 10732 C CA   . GLY A 1 6  ? 7.917   8.698   1.072   1.00 15.00 ?  302 GLY A CA   14 
ATOM 10733 C C    . GLY A 1 6  ? 6.827   7.671   0.846   1.00 15.00 ?  302 GLY A C    14 
ATOM 10734 O O    . GLY A 1 6  ? 6.296   7.535   -0.262  1.00 15.00 ?  302 GLY A O    14 
ATOM 10735 H H    . GLY A 1 6  ? 8.843   8.416   2.958   1.00 15.00 ?  302 GLY A H    14 
ATOM 10736 H HA2  . GLY A 1 6  ? 7.627   9.628   0.603   1.00 15.00 ?  302 GLY A HA2  14 
ATOM 10737 H HA3  . GLY A 1 6  ? 8.830   8.346   0.615   1.00 15.00 ?  302 GLY A HA3  14 
ATOM 10738 N N    . TRP A 1 7  ? 6.505   6.953   1.909   1.00 15.00 ?  303 TRP A N    14 
ATOM 10739 C CA   . TRP A 1 7  ? 5.566   5.848   1.852   1.00 15.00 ?  303 TRP A CA   14 
ATOM 10740 C C    . TRP A 1 7  ? 4.163   6.281   2.238   1.00 15.00 ?  303 TRP A C    14 
ATOM 10741 O O    . TRP A 1 7  ? 3.982   7.187   3.054   1.00 15.00 ?  303 TRP A O    14 
ATOM 10742 C CB   . TRP A 1 7  ? 6.017   4.730   2.775   1.00 15.00 ?  303 TRP A CB   14 
ATOM 10743 C CG   . TRP A 1 7  ? 6.997   3.826   2.127   1.00 15.00 ?  303 TRP A CG   14 
ATOM 10744 C CD1  . TRP A 1 7  ? 8.309   4.085   1.869   1.00 15.00 ?  303 TRP A CD1  14 
ATOM 10745 C CD2  . TRP A 1 7  ? 6.738   2.512   1.640   1.00 15.00 ?  303 TRP A CD2  14 
ATOM 10746 N NE1  . TRP A 1 7  ? 8.883   3.007   1.251   1.00 15.00 ?  303 TRP A NE1  14 
ATOM 10747 C CE2  . TRP A 1 7  ? 7.934   2.029   1.103   1.00 15.00 ?  303 TRP A CE2  14 
ATOM 10748 C CE3  . TRP A 1 7  ? 5.608   1.690   1.605   1.00 15.00 ?  303 TRP A CE3  14 
ATOM 10749 C CZ2  . TRP A 1 7  ? 8.033   0.772   0.544   1.00 15.00 ?  303 TRP A CZ2  14 
ATOM 10750 C CZ3  . TRP A 1 7  ? 5.715   0.436   1.049   1.00 15.00 ?  303 TRP A CZ3  14 
ATOM 10751 C CH2  . TRP A 1 7  ? 6.921   -0.014  0.525   1.00 15.00 ?  303 TRP A CH2  14 
ATOM 10752 H H    . TRP A 1 7  ? 6.895   7.192   2.777   1.00 15.00 ?  303 TRP A H    14 
ATOM 10753 H HA   . TRP A 1 7  ? 5.564   5.482   0.837   1.00 15.00 ?  303 TRP A HA   14 
ATOM 10754 H HB2  . TRP A 1 7  ? 6.481   5.155   3.653   1.00 15.00 ?  303 TRP A HB2  14 
ATOM 10755 H HB3  . TRP A 1 7  ? 5.160   4.142   3.070   1.00 15.00 ?  303 TRP A HB3  14 
ATOM 10756 H HD1  . TRP A 1 7  ? 8.808   5.011   2.120   1.00 15.00 ?  303 TRP A HD1  14 
ATOM 10757 H HE1  . TRP A 1 7  ? 9.821   2.947   0.961   1.00 15.00 ?  303 TRP A HE1  14 
ATOM 10758 H HE3  . TRP A 1 7  ? 4.661   2.021   1.996   1.00 15.00 ?  303 TRP A HE3  14 
ATOM 10759 H HZ2  . TRP A 1 7  ? 8.941   0.423   0.133   1.00 15.00 ?  303 TRP A HZ2  14 
ATOM 10760 H HZ3  . TRP A 1 7  ? 4.854   -0.208  1.010   1.00 15.00 ?  303 TRP A HZ3  14 
ATOM 10761 H HH2  . TRP A 1 7  ? 6.963   -1.008  0.105   1.00 15.00 ?  303 TRP A HH2  14 
ATOM 10762 N N    . GLU A 1 8  ? 3.174   5.607   1.670   1.00 15.00 ?  304 GLU A N    14 
ATOM 10763 C CA   . GLU A 1 8  ? 1.775   5.943   1.935   1.00 15.00 ?  304 GLU A CA   14 
ATOM 10764 C C    . GLU A 1 8  ? 0.983   4.674   2.228   1.00 15.00 ?  304 GLU A C    14 
ATOM 10765 O O    . GLU A 1 8  ? 1.016   3.729   1.459   1.00 15.00 ?  304 GLU A O    14 
ATOM 10766 C CB   . GLU A 1 8  ? 1.201   6.707   0.736   1.00 15.00 ?  304 GLU A CB   14 
ATOM 10767 C CG   . GLU A 1 8  ? 1.788   8.097   0.582   1.00 15.00 ?  304 GLU A CG   14 
ATOM 10768 C CD   . GLU A 1 8  ? 1.137   9.135   1.480   1.00 15.00 ?  304 GLU A CD   14 
ATOM 10769 O OE1  . GLU A 1 8  ? 1.119   8.949   2.714   1.00 15.00 ?  304 GLU A OE1  14 
ATOM 10770 O OE2  . GLU A 1 8  ? 0.660   10.161  0.946   1.00 15.00 -1 304 GLU A OE2  14 
ATOM 10771 H H    . GLU A 1 8  ? 3.389   4.836   1.069   1.00 15.00 ?  304 GLU A H    14 
ATOM 10772 H HA   . GLU A 1 8  ? 1.747   6.581   2.808   1.00 15.00 ?  304 GLU A HA   14 
ATOM 10773 H HB2  . GLU A 1 8  ? 1.416   6.149   -0.163  1.00 15.00 ?  304 GLU A HB2  14 
ATOM 10774 H HB3  . GLU A 1 8  ? 0.134   6.799   0.839   1.00 15.00 ?  304 GLU A HB3  14 
ATOM 10775 H HG2  . GLU A 1 8  ? 2.840   8.054   0.820   1.00 15.00 ?  304 GLU A HG2  14 
ATOM 10776 H HG3  . GLU A 1 8  ? 1.667   8.408   -0.446  1.00 15.00 ?  304 GLU A HG3  14 
ATOM 10777 N N    . ILE A 1 9  ? 0.276   4.648   3.346   1.00 15.00 ?  305 ILE A N    14 
ATOM 10778 C CA   . ILE A 1 9  ? -0.341  3.411   3.809   1.00 15.00 ?  305 ILE A CA   14 
ATOM 10779 C C    . ILE A 1 9  ? -1.865  3.417   3.637   1.00 15.00 ?  305 ILE A C    14 
ATOM 10780 O O    . ILE A 1 9  ? -2.542  4.354   4.054   1.00 15.00 ?  305 ILE A O    14 
ATOM 10781 C CB   . ILE A 1 9  ? 0.023   3.135   5.290   1.00 15.00 ?  305 ILE A CB   14 
ATOM 10782 C CG1  . ILE A 1 9  ? -0.589  1.815   5.762   1.00 15.00 ?  305 ILE A CG1  14 
ATOM 10783 C CG2  . ILE A 1 9  ? -0.425  4.284   6.188   1.00 15.00 ?  305 ILE A CG2  14 
ATOM 10784 C CD1  . ILE A 1 9  ? -0.180  1.432   7.168   1.00 15.00 ?  305 ILE A CD1  14 
ATOM 10785 H H    . ILE A 1 9  ? 0.156   5.476   3.865   1.00 15.00 ?  305 ILE A H    14 
ATOM 10786 H HA   . ILE A 1 9  ? 0.071   2.608   3.215   1.00 15.00 ?  305 ILE A HA   14 
ATOM 10787 H HB   . ILE A 1 9  ? 1.099   3.065   5.358   1.00 15.00 ?  305 ILE A HB   14 
ATOM 10788 H HG12 . ILE A 1 9  ? -1.664  1.896   5.742   1.00 15.00 ?  305 ILE A HG12 14 
ATOM 10789 H HG13 . ILE A 1 9  ? -0.279  1.022   5.097   1.00 15.00 ?  305 ILE A HG13 14 
ATOM 10790 H HG21 . ILE A 1 9  ? -1.495  4.410   6.106   1.00 15.00 ?  305 ILE A HG21 14 
ATOM 10791 H HG22 . ILE A 1 9  ? 0.069   5.194   5.884   1.00 15.00 ?  305 ILE A HG22 14 
ATOM 10792 H HG23 . ILE A 1 9  ? -0.167  4.061   7.214   1.00 15.00 ?  305 ILE A HG23 14 
ATOM 10793 H HD11 . ILE A 1 9  ? -0.588  2.144   7.867   1.00 15.00 ?  305 ILE A HD11 14 
ATOM 10794 H HD12 . ILE A 1 9  ? 0.897   1.432   7.241   1.00 15.00 ?  305 ILE A HD12 14 
ATOM 10795 H HD13 . ILE A 1 9  ? -0.554  0.446   7.398   1.00 15.00 ?  305 ILE A HD13 14 
ATOM 10796 N N    . ARG A 1 10 ? -2.394  2.370   3.000   1.00 15.00 ?  306 ARG A N    14 
ATOM 10797 C CA   . ARG A 1 10 ? -3.835  2.174   2.909   1.00 15.00 ?  306 ARG A CA   14 
ATOM 10798 C C    . ARG A 1 10 ? -4.192  0.693   2.992   1.00 15.00 ?  306 ARG A C    14 
ATOM 10799 O O    . ARG A 1 10 ? -3.434  -0.174  2.554   1.00 15.00 ?  306 ARG A O    14 
ATOM 10800 C CB   . ARG A 1 10 ? -4.413  2.757   1.619   1.00 15.00 ?  306 ARG A CB   14 
ATOM 10801 C CG   . ARG A 1 10 ? -4.572  4.267   1.631   1.00 15.00 ?  306 ARG A CG   14 
ATOM 10802 C CD   . ARG A 1 10 ? -5.738  4.698   0.764   1.00 15.00 ?  306 ARG A CD   14 
ATOM 10803 N NE   . ARG A 1 10 ? -6.875  3.792   0.921   1.00 15.00 ?  306 ARG A NE   14 
ATOM 10804 C CZ   . ARG A 1 10 ? -7.999  4.085   1.567   1.00 15.00 ?  306 ARG A CZ   14 
ATOM 10805 N NH1  . ARG A 1 10 ? -8.157  5.273   2.142   1.00 15.00 1  306 ARG A NH1  14 
ATOM 10806 N NH2  . ARG A 1 10 ? -8.962  3.172   1.640   1.00 15.00 ?  306 ARG A NH2  14 
ATOM 10807 H H    . ARG A 1 10 ? -1.801  1.712   2.576   1.00 15.00 ?  306 ARG A H    14 
ATOM 10808 H HA   . ARG A 1 10 ? -4.285  2.682   3.749   1.00 15.00 ?  306 ARG A HA   14 
ATOM 10809 H HB2  . ARG A 1 10 ? -3.762  2.496   0.798   1.00 15.00 ?  306 ARG A HB2  14 
ATOM 10810 H HB3  . ARG A 1 10 ? -5.385  2.317   1.446   1.00 15.00 ?  306 ARG A HB3  14 
ATOM 10811 H HG2  . ARG A 1 10 ? -4.737  4.602   2.644   1.00 15.00 ?  306 ARG A HG2  14 
ATOM 10812 H HG3  . ARG A 1 10 ? -3.670  4.710   1.238   1.00 15.00 ?  306 ARG A HG3  14 
ATOM 10813 H HD2  . ARG A 1 10 ? -6.036  5.696   1.049   1.00 15.00 ?  306 ARG A HD2  14 
ATOM 10814 H HD3  . ARG A 1 10 ? -5.423  4.693   -0.269  1.00 15.00 ?  306 ARG A HD3  14 
ATOM 10815 H HE   . ARG A 1 10 ? -6.790  2.897   0.508   1.00 15.00 ?  306 ARG A HE   14 
ATOM 10816 H HH11 . ARG A 1 10 ? -7.418  5.963   2.095   1.00 15.00 ?  306 ARG A HH11 14 
ATOM 10817 H HH12 . ARG A 1 10 ? -9.006  5.493   2.622   1.00 15.00 ?  306 ARG A HH12 14 
ATOM 10818 H HH21 . ARG A 1 10 ? -8.834  2.273   1.212   1.00 15.00 ?  306 ARG A HH21 14 
ATOM 10819 H HH22 . ARG A 1 10 ? -9.825  3.370   2.128   1.00 15.00 ?  306 ARG A HH22 14 
ATOM 10820 N N    . ASN A 1 11 ? -5.373  0.416   3.527   1.00 15.00 ?  307 ASN A N    14 
ATOM 10821 C CA   . ASN A 1 11 ? -5.853  -0.951  3.670   1.00 15.00 ?  307 ASN A CA   14 
ATOM 10822 C C    . ASN A 1 11 ? -7.170  -1.116  2.897   1.00 15.00 ?  307 ASN A C    14 
ATOM 10823 O O    . ASN A 1 11 ? -8.030  -0.237  2.945   1.00 15.00 ?  307 ASN A O    14 
ATOM 10824 C CB   . ASN A 1 11 ? -6.069  -1.263  5.159   1.00 15.00 ?  307 ASN A CB   14 
ATOM 10825 C CG   . ASN A 1 11 ? -6.236  -2.747  5.458   1.00 15.00 ?  307 ASN A CG   14 
ATOM 10826 O OD1  . ASN A 1 11 ? -6.720  -3.520  4.638   1.00 15.00 ?  307 ASN A OD1  14 
ATOM 10827 N ND2  . ASN A 1 11 ? -5.837  -3.147  6.654   1.00 15.00 ?  307 ASN A ND2  14 
ATOM 10828 H H    . ASN A 1 11 ? -5.945  1.153   3.826   1.00 15.00 ?  307 ASN A H    14 
ATOM 10829 H HA   . ASN A 1 11 ? -5.104  -1.613  3.267   1.00 15.00 ?  307 ASN A HA   14 
ATOM 10830 H HB2  . ASN A 1 11 ? -5.217  -0.905  5.717   1.00 15.00 ?  307 ASN A HB2  14 
ATOM 10831 H HB3  . ASN A 1 11 ? -6.953  -0.746  5.501   1.00 15.00 ?  307 ASN A HB3  14 
ATOM 10832 H HD21 . ASN A 1 11 ? -5.460  -2.472  7.266   1.00 15.00 ?  307 ASN A HD21 14 
ATOM 10833 H HD22 . ASN A 1 11 ? -5.934  -4.096  6.885   1.00 15.00 ?  307 ASN A HD22 14 
ATOM 10834 N N    . THR A 1 12 ? -7.329  -2.234  2.195   1.00 15.00 ?  308 THR A N    14 
ATOM 10835 C CA   . THR A 1 12 ? -8.563  -2.520  1.478   1.00 15.00 ?  308 THR A CA   14 
ATOM 10836 C C    . THR A 1 12 ? -9.522  -3.271  2.390   1.00 15.00 ?  308 THR A C    14 
ATOM 10837 O O    . THR A 1 12 ? -9.082  -4.040  3.251   1.00 15.00 ?  308 THR A O    14 
ATOM 10838 C CB   . THR A 1 12 ? -8.315  -3.366  0.208   1.00 15.00 ?  308 THR A CB   14 
ATOM 10839 O OG1  . THR A 1 12 ? -7.250  -4.302  0.436   1.00 15.00 ?  308 THR A OG1  14 
ATOM 10840 C CG2  . THR A 1 12 ? -7.988  -2.501  -1.000  1.00 15.00 ?  308 THR A CG2  14 
ATOM 10841 H H    . THR A 1 12 ? -6.612  -2.903  2.186   1.00 15.00 ?  308 THR A H    14 
ATOM 10842 H HA   . THR A 1 12 ? -9.011  -1.580  1.188   1.00 15.00 ?  308 THR A HA   14 
ATOM 10843 H HB   . THR A 1 12 ? -9.218  -3.920  -0.007  1.00 15.00 ?  308 THR A HB   14 
ATOM 10844 H HG1  . THR A 1 12 ? -6.492  -3.841  0.813   1.00 15.00 ?  308 THR A HG1  14 
ATOM 10845 H HG21 . THR A 1 12 ? -7.019  -2.048  -0.868  1.00 15.00 ?  308 THR A HG21 14 
ATOM 10846 H HG22 . THR A 1 12 ? -8.734  -1.726  -1.102  1.00 15.00 ?  308 THR A HG22 14 
ATOM 10847 H HG23 . THR A 1 12 ? -7.982  -3.112  -1.891  1.00 15.00 ?  308 THR A HG23 14 
ATOM 10848 N N    . ALA A 1 13 ? -10.820 -3.075  2.174   1.00 15.00 ?  309 ALA A N    14 
ATOM 10849 C CA   . ALA A 1 13 ? -11.857 -3.685  3.010   1.00 15.00 ?  309 ALA A CA   14 
ATOM 10850 C C    . ALA A 1 13 ? -11.781 -5.208  2.976   1.00 15.00 ?  309 ALA A C    14 
ATOM 10851 O O    . ALA A 1 13 ? -12.331 -5.890  3.840   1.00 15.00 ?  309 ALA A O    14 
ATOM 10852 C CB   . ALA A 1 13 ? -13.232 -3.219  2.553   1.00 15.00 ?  309 ALA A CB   14 
ATOM 10853 H H    . ALA A 1 13 ? -11.094 -2.492  1.423   1.00 15.00 ?  309 ALA A H    14 
ATOM 10854 H HA   . ALA A 1 13 ? -11.710 -3.349  4.025   1.00 15.00 ?  309 ALA A HA   14 
ATOM 10855 H HB1  . ALA A 1 13 ? -13.276 -2.141  2.589   1.00 15.00 ?  309 ALA A HB1  14 
ATOM 10856 H HB2  . ALA A 1 13 ? -13.986 -3.633  3.206   1.00 15.00 ?  309 ALA A HB2  14 
ATOM 10857 H HB3  . ALA A 1 13 ? -13.409 -3.554  1.542   1.00 15.00 ?  309 ALA A HB3  14 
ATOM 10858 N N    . THR A 1 14 ? -11.095 -5.730  1.973   1.00 15.00 ?  310 THR A N    14 
ATOM 10859 C CA   . THR A 1 14 ? -10.864 -7.158  1.854   1.00 15.00 ?  310 THR A CA   14 
ATOM 10860 C C    . THR A 1 14 ? -9.878  -7.656  2.918   1.00 15.00 ?  310 THR A C    14 
ATOM 10861 O O    . THR A 1 14 ? -9.758  -8.859  3.153   1.00 15.00 ?  310 THR A O    14 
ATOM 10862 C CB   . THR A 1 14 ? -10.338 -7.497  0.449   1.00 15.00 ?  310 THR A CB   14 
ATOM 10863 O OG1  . THR A 1 14 ? -9.638  -6.363  -0.087  1.00 15.00 ?  310 THR A OG1  14 
ATOM 10864 C CG2  . THR A 1 14 ? -11.481 -7.884  -0.479  1.00 15.00 ?  310 THR A CG2  14 
ATOM 10865 H H    . THR A 1 14 ? -10.732 -5.134  1.287   1.00 15.00 ?  310 THR A H    14 
ATOM 10866 H HA   . THR A 1 14 ? -11.811 -7.662  1.991   1.00 15.00 ?  310 THR A HA   14 
ATOM 10867 H HB   . THR A 1 14 ? -9.655  -8.332  0.528   1.00 15.00 ?  310 THR A HB   14 
ATOM 10868 H HG1  . THR A 1 14 ? -10.283 -5.715  -0.415  1.00 15.00 ?  310 THR A HG1  14 
ATOM 10869 H HG21 . THR A 1 14 ? -12.171 -7.058  -0.563  1.00 15.00 ?  310 THR A HG21 14 
ATOM 10870 H HG22 . THR A 1 14 ? -11.997 -8.745  -0.077  1.00 15.00 ?  310 THR A HG22 14 
ATOM 10871 H HG23 . THR A 1 14 ? -11.087 -8.126  -1.455  1.00 15.00 ?  310 THR A HG23 14 
ATOM 10872 N N    . GLY A 1 15 ? -9.174  -6.722  3.550   1.00 15.00 ?  311 GLY A N    14 
ATOM 10873 C CA   . GLY A 1 15 ? -8.243  -7.071  4.603   1.00 15.00 ?  311 GLY A CA   14 
ATOM 10874 C C    . GLY A 1 15 ? -6.824  -7.184  4.094   1.00 15.00 ?  311 GLY A C    14 
ATOM 10875 O O    . GLY A 1 15 ? -6.110  -8.126  4.435   1.00 15.00 ?  311 GLY A O    14 
ATOM 10876 H H    . GLY A 1 15 ? -9.291  -5.778  3.299   1.00 15.00 ?  311 GLY A H    14 
ATOM 10877 H HA2  . GLY A 1 15 ? -8.282  -6.313  5.370   1.00 15.00 ?  311 GLY A HA2  14 
ATOM 10878 H HA3  . GLY A 1 15 ? -8.537  -8.018  5.029   1.00 15.00 ?  311 GLY A HA3  14 
ATOM 10879 N N    . ARG A 1 16 ? -6.407  -6.222  3.281   1.00 15.00 ?  312 ARG A N    14 
ATOM 10880 C CA   . ARG A 1 16 ? -5.074  -6.257  2.679   1.00 15.00 ?  312 ARG A CA   14 
ATOM 10881 C C    . ARG A 1 16 ? -4.464  -4.859  2.676   1.00 15.00 ?  312 ARG A C    14 
ATOM 10882 O O    . ARG A 1 16 ? -5.102  -3.911  2.230   1.00 15.00 ?  312 ARG A O    14 
ATOM 10883 C CB   . ARG A 1 16 ? -5.144  -6.755  1.239   1.00 15.00 ?  312 ARG A CB   14 
ATOM 10884 C CG   . ARG A 1 16 ? -5.909  -8.041  1.016   1.00 15.00 ?  312 ARG A CG   14 
ATOM 10885 C CD   . ARG A 1 16 ? -6.108  -8.262  -0.472  1.00 15.00 ?  312 ARG A CD   14 
ATOM 10886 N NE   . ARG A 1 16 ? -7.073  -7.318  -1.036  1.00 15.00 ?  312 ARG A NE   14 
ATOM 10887 C CZ   . ARG A 1 16 ? -7.254  -7.115  -2.341  1.00 15.00 ?  312 ARG A CZ   14 
ATOM 10888 N NH1  . ARG A 1 16 ? -6.621  -7.864  -3.240  1.00 15.00 1  312 ARG A NH1  14 
ATOM 10889 N NH2  . ARG A 1 16 ? -8.095  -6.175  -2.748  1.00 15.00 ?  312 ARG A NH2  14 
ATOM 10890 H H    . ARG A 1 16 ? -7.004  -5.452  3.100   1.00 15.00 ?  312 ARG A H    14 
ATOM 10891 H HA   . ARG A 1 16 ? -4.453  -6.920  3.262   1.00 15.00 ?  312 ARG A HA   14 
ATOM 10892 H HB2  . ARG A 1 16 ? -5.597  -5.988  0.626   1.00 15.00 ?  312 ARG A HB2  14 
ATOM 10893 H HB3  . ARG A 1 16 ? -4.132  -6.911  0.890   1.00 15.00 ?  312 ARG A HB3  14 
ATOM 10894 H HG2  . ARG A 1 16 ? -5.348  -8.867  1.427   1.00 15.00 ?  312 ARG A HG2  14 
ATOM 10895 H HG3  . ARG A 1 16 ? -6.874  -7.972  1.498   1.00 15.00 ?  312 ARG A HG3  14 
ATOM 10896 H HD2  . ARG A 1 16 ? -5.157  -8.108  -0.963  1.00 15.00 ?  312 ARG A HD2  14 
ATOM 10897 H HD3  . ARG A 1 16 ? -6.452  -9.271  -0.639  1.00 15.00 ?  312 ARG A HD3  14 
ATOM 10898 H HE   . ARG A 1 16 ? -7.601  -6.780  -0.400  1.00 15.00 ?  312 ARG A HE   14 
ATOM 10899 H HH11 . ARG A 1 16 ? -6.000  -8.600  -2.948  1.00 15.00 ?  312 ARG A HH11 14 
ATOM 10900 H HH12 . ARG A 1 16 ? -6.760  -7.697  -4.219  1.00 15.00 ?  312 ARG A HH12 14 
ATOM 10901 H HH21 . ARG A 1 16 ? -8.594  -5.625  -2.078  1.00 15.00 ?  312 ARG A HH21 14 
ATOM 10902 H HH22 . ARG A 1 16 ? -8.225  -6.002  -3.736  1.00 15.00 ?  312 ARG A HH22 14 
ATOM 10903 N N    . VAL A 1 17 ? -3.216  -4.733  3.109   1.00 15.00 ?  313 VAL A N    14 
ATOM 10904 C CA   . VAL A 1 17 ? -2.611  -3.415  3.267   1.00 15.00 ?  313 VAL A CA   14 
ATOM 10905 C C    . VAL A 1 17 ? -1.625  -3.086  2.133   1.00 15.00 ?  313 VAL A C    14 
ATOM 10906 O O    . VAL A 1 17 ? -0.459  -3.450  2.175   1.00 15.00 ?  313 VAL A O    14 
ATOM 10907 C CB   . VAL A 1 17 ? -1.897  -3.280  4.626   1.00 15.00 ?  313 VAL A CB   14 
ATOM 10908 C CG1  . VAL A 1 17 ? -1.658  -1.817  4.960   1.00 15.00 ?  313 VAL A CG1  14 
ATOM 10909 C CG2  . VAL A 1 17 ? -2.701  -3.961  5.726   1.00 15.00 ?  313 VAL A CG2  14 
ATOM 10910 H H    . VAL A 1 17 ? -2.688  -5.533  3.314   1.00 15.00 ?  313 VAL A H    14 
ATOM 10911 H HA   . VAL A 1 17 ? -3.413  -2.691  3.246   1.00 15.00 ?  313 VAL A HA   14 
ATOM 10912 H HB   . VAL A 1 17 ? -0.937  -3.770  4.556   1.00 15.00 ?  313 VAL A HB   14 
ATOM 10913 H HG11 . VAL A 1 17 ? -1.047  -1.367  4.191   1.00 15.00 ?  313 VAL A HG11 14 
ATOM 10914 H HG12 . VAL A 1 17 ? -1.154  -1.744  5.912   1.00 15.00 ?  313 VAL A HG12 14 
ATOM 10915 H HG13 . VAL A 1 17 ? -2.606  -1.303  5.014   1.00 15.00 ?  313 VAL A HG13 14 
ATOM 10916 H HG21 . VAL A 1 17 ? -3.676  -3.504  5.795   1.00 15.00 ?  313 VAL A HG21 14 
ATOM 10917 H HG22 . VAL A 1 17 ? -2.186  -3.853  6.670   1.00 15.00 ?  313 VAL A HG22 14 
ATOM 10918 H HG23 . VAL A 1 17 ? -2.812  -5.010  5.495   1.00 15.00 ?  313 VAL A HG23 14 
ATOM 10919 N N    . TYR A 1 18 ? -2.131  -2.388  1.127   1.00 15.00 ?  314 TYR A N    14 
ATOM 10920 C CA   . TYR A 1 18 ? -1.358  -1.909  0.005   1.00 15.00 ?  314 TYR A CA   14 
ATOM 10921 C C    . TYR A 1 18 ? -0.794  -0.521  0.309   1.00 15.00 ?  314 TYR A C    14 
ATOM 10922 O O    . TYR A 1 18 ? -1.531  0.449   0.488   1.00 15.00 ?  314 TYR A O    14 
ATOM 10923 C CB   . TYR A 1 18 ? -2.249  -1.854  -1.255  1.00 15.00 ?  314 TYR A CB   14 
ATOM 10924 C CG   . TYR A 1 18 ? -3.460  -0.941  -1.106  1.00 15.00 ?  314 TYR A CG   14 
ATOM 10925 C CD1  . TYR A 1 18 ? -4.493  -1.268  -0.238  1.00 15.00 ?  314 TYR A CD1  14 
ATOM 10926 C CD2  . TYR A 1 18 ? -3.554  0.261   -1.808  1.00 15.00 ?  314 TYR A CD2  14 
ATOM 10927 C CE1  . TYR A 1 18 ? -5.576  -0.433  -0.069  1.00 15.00 ?  314 TYR A CE1  14 
ATOM 10928 C CE2  . TYR A 1 18 ? -4.643  1.100   -1.641  1.00 15.00 ?  314 TYR A CE2  14 
ATOM 10929 C CZ   . TYR A 1 18 ? -5.645  0.747   -0.766  1.00 15.00 ?  314 TYR A CZ   14 
ATOM 10930 O OH   . TYR A 1 18 ? -6.729  1.572   -0.589  1.00 15.00 ?  314 TYR A OH   14 
ATOM 10931 H H    . TYR A 1 18 ? -3.062  -2.208  1.126   1.00 15.00 ?  314 TYR A H    14 
ATOM 10932 H HA   . TYR A 1 18 ? -0.543  -2.597  -0.165  1.00 15.00 ?  314 TYR A HA   14 
ATOM 10933 H HB2  . TYR A 1 18 ? -1.663  -1.494  -2.087  1.00 15.00 ?  314 TYR A HB2  14 
ATOM 10934 H HB3  . TYR A 1 18 ? -2.608  -2.849  -1.477  1.00 15.00 ?  314 TYR A HB3  14 
ATOM 10935 H HD1  . TYR A 1 18 ? -4.439  -2.194  0.316   1.00 15.00 ?  314 TYR A HD1  14 
ATOM 10936 H HD2  . TYR A 1 18 ? -2.775  0.527   -2.507  1.00 15.00 ?  314 TYR A HD2  14 
ATOM 10937 H HE1  . TYR A 1 18 ? -6.365  -0.706  0.613   1.00 15.00 ?  314 TYR A HE1  14 
ATOM 10938 H HE2  . TYR A 1 18 ? -4.696  2.042   -2.181  1.00 15.00 ?  314 TYR A HE2  14 
ATOM 10939 H HH   . TYR A 1 18 ? -7.055  1.867   -1.448  1.00 15.00 ?  314 TYR A HH   14 
ATOM 10940 N N    . PHE A 1 19 ? 0.512   -0.445  0.404   1.00 15.00 ?  315 PHE A N    14 
ATOM 10941 C CA   . PHE A 1 19 ? 1.186   0.823   0.587   1.00 15.00 ?  315 PHE A CA   14 
ATOM 10942 C C    . PHE A 1 19 ? 1.526   1.410   -0.767  1.00 15.00 ?  315 PHE A C    14 
ATOM 10943 O O    . PHE A 1 19 ? 2.277   0.819   -1.525  1.00 15.00 ?  315 PHE A O    14 
ATOM 10944 C CB   . PHE A 1 19 ? 2.481   0.651   1.375   1.00 15.00 ?  315 PHE A CB   14 
ATOM 10945 C CG   . PHE A 1 19 ? 2.325   0.138   2.776   1.00 15.00 ?  315 PHE A CG   14 
ATOM 10946 C CD1  . PHE A 1 19 ? 1.727   -1.082  3.024   1.00 15.00 ?  315 PHE A CD1  14 
ATOM 10947 C CD2  . PHE A 1 19 ? 2.812   0.870   3.846   1.00 15.00 ?  315 PHE A CD2  14 
ATOM 10948 C CE1  . PHE A 1 19 ? 1.611   -1.562  4.308   1.00 15.00 ?  315 PHE A CE1  14 
ATOM 10949 C CE2  . PHE A 1 19 ? 2.706   0.389   5.135   1.00 15.00 ?  315 PHE A CE2  14 
ATOM 10950 C CZ   . PHE A 1 19 ? 2.103   -0.830  5.363   1.00 15.00 ?  315 PHE A CZ   14 
ATOM 10951 H H    . PHE A 1 19 ? 1.045   -1.270  0.354   1.00 15.00 ?  315 PHE A H    14 
ATOM 10952 H HA   . PHE A 1 19 ? 0.525   1.493   1.114   1.00 15.00 ?  315 PHE A HA   14 
ATOM 10953 H HB2  . PHE A 1 19 ? 3.119   -0.041  0.846   1.00 15.00 ?  315 PHE A HB2  14 
ATOM 10954 H HB3  . PHE A 1 19 ? 2.979   1.609   1.430   1.00 15.00 ?  315 PHE A HB3  14 
ATOM 10955 H HD1  . PHE A 1 19 ? 1.340   -1.660  2.197   1.00 15.00 ?  315 PHE A HD1  14 
ATOM 10956 H HD2  . PHE A 1 19 ? 3.281   1.826   3.664   1.00 15.00 ?  315 PHE A HD2  14 
ATOM 10957 H HE1  . PHE A 1 19 ? 1.138   -2.516  4.487   1.00 15.00 ?  315 PHE A HE1  14 
ATOM 10958 H HE2  . PHE A 1 19 ? 3.088   0.968   5.962   1.00 15.00 ?  315 PHE A HE2  14 
ATOM 10959 H HZ   . PHE A 1 19 ? 2.026   -1.218  6.363   1.00 15.00 ?  315 PHE A HZ   14 
ATOM 10960 N N    . VAL A 1 20 ? 1.001   2.567   -1.072  1.00 15.00 ?  316 VAL A N    14 
ATOM 10961 C CA   . VAL A 1 20 ? 1.330   3.203   -2.319  1.00 15.00 ?  316 VAL A CA   14 
ATOM 10962 C C    . VAL A 1 20 ? 2.565   4.091   -2.116  1.00 15.00 ?  316 VAL A C    14 
ATOM 10963 O O    . VAL A 1 20 ? 2.556   5.006   -1.292  1.00 15.00 ?  316 VAL A O    14 
ATOM 10964 C CB   . VAL A 1 20 ? 0.147   4.025   -2.884  1.00 15.00 ?  316 VAL A CB   14 
ATOM 10965 C CG1  . VAL A 1 20 ? -0.885  3.100   -3.508  1.00 15.00 ?  316 VAL A CG1  14 
ATOM 10966 C CG2  . VAL A 1 20 ? -0.512  4.872   -1.807  1.00 15.00 ?  316 VAL A CG2  14 
ATOM 10967 H H    . VAL A 1 20 ? 0.409   3.016   -0.433  1.00 15.00 ?  316 VAL A H    14 
ATOM 10968 H HA   . VAL A 1 20 ? 1.558   2.417   -3.026  1.00 15.00 ?  316 VAL A HA   14 
ATOM 10969 H HB   . VAL A 1 20 ? 0.524   4.682   -3.653  1.00 15.00 ?  316 VAL A HB   14 
ATOM 10970 H HG11 . VAL A 1 20 ? -0.426  2.535   -4.307  1.00 15.00 ?  316 VAL A HG11 14 
ATOM 10971 H HG12 . VAL A 1 20 ? -1.700  3.687   -3.905  1.00 15.00 ?  316 VAL A HG12 14 
ATOM 10972 H HG13 . VAL A 1 20 ? -1.262  2.421   -2.758  1.00 15.00 ?  316 VAL A HG13 14 
ATOM 10973 H HG21 . VAL A 1 20 ? 0.247   5.358   -1.211  1.00 15.00 ?  316 VAL A HG21 14 
ATOM 10974 H HG22 . VAL A 1 20 ? -1.126  4.243   -1.178  1.00 15.00 ?  316 VAL A HG22 14 
ATOM 10975 H HG23 . VAL A 1 20 ? -1.132  5.621   -2.278  1.00 15.00 ?  316 VAL A HG23 14 
ATOM 10976 N N    . ASP A 1 21 ? 3.643   3.805   -2.838  1.00 15.00 ?  317 ASP A N    14 
ATOM 10977 C CA   . ASP A 1 21 ? 4.880   4.526   -2.657  1.00 15.00 ?  317 ASP A CA   14 
ATOM 10978 C C    . ASP A 1 21 ? 4.862   5.712   -3.584  1.00 15.00 ?  317 ASP A C    14 
ATOM 10979 O O    . ASP A 1 21 ? 4.750   5.531   -4.798  1.00 15.00 ?  317 ASP A O    14 
ATOM 10980 C CB   . ASP A 1 21 ? 6.103   3.676   -3.035  1.00 15.00 ?  317 ASP A CB   14 
ATOM 10981 C CG   . ASP A 1 21 ? 5.918   2.192   -2.829  1.00 15.00 ?  317 ASP A CG   14 
ATOM 10982 O OD1  . ASP A 1 21 ? 5.704   1.774   -1.685  1.00 15.00 ?  317 ASP A OD1  14 
ATOM 10983 O OD2  . ASP A 1 21 ? 6.025   1.444   -3.829  1.00 15.00 -1 317 ASP A OD2  14 
ATOM 10984 H H    . ASP A 1 21 ? 3.610   3.084   -3.502  1.00 15.00 ?  317 ASP A H    14 
ATOM 10985 H HA   . ASP A 1 21 ? 4.956   4.853   -1.630  1.00 15.00 ?  317 ASP A HA   14 
ATOM 10986 H HB2  . ASP A 1 21 ? 6.340   3.845   -4.072  1.00 15.00 ?  317 ASP A HB2  14 
ATOM 10987 H HB3  . ASP A 1 21 ? 6.937   3.991   -2.426  1.00 15.00 ?  317 ASP A HB3  14 
ATOM 10988 N N    . HIS A 1 22 ? 4.973   6.914   -3.029  1.00 15.00 ?  318 HIS A N    14 
ATOM 10989 C CA   . HIS A 1 22 ? 5.053   8.118   -3.847  1.00 15.00 ?  318 HIS A CA   14 
ATOM 10990 C C    . HIS A 1 22 ? 6.393   8.158   -4.577  1.00 15.00 ?  318 HIS A C    14 
ATOM 10991 O O    . HIS A 1 22 ? 6.585   8.935   -5.508  1.00 15.00 ?  318 HIS A O    14 
ATOM 10992 C CB   . HIS A 1 22 ? 4.876   9.391   -3.006  1.00 15.00 ?  318 HIS A CB   14 
ATOM 10993 C CG   . HIS A 1 22 ? 3.473   9.643   -2.516  1.00 15.00 ?  318 HIS A CG   14 
ATOM 10994 N ND1  . HIS A 1 22 ? 2.355   9.008   -3.017  1.00 15.00 ?  318 HIS A ND1  14 
ATOM 10995 C CD2  . HIS A 1 22 ? 3.017   10.489  -1.561  1.00 15.00 ?  318 HIS A CD2  14 
ATOM 10996 C CE1  . HIS A 1 22 ? 1.282   9.454   -2.396  1.00 15.00 ?  318 HIS A CE1  14 
ATOM 10997 N NE2  . HIS A 1 22 ? 1.648   10.353  -1.502  1.00 15.00 ?  318 HIS A NE2  14 
ATOM 10998 H H    . HIS A 1 22 ? 4.997   6.990   -2.050  1.00 15.00 ?  318 HIS A H    14 
ATOM 10999 H HA   . HIS A 1 22 ? 4.262   8.068   -4.581  1.00 15.00 ?  318 HIS A HA   14 
ATOM 11000 H HB2  . HIS A 1 22 ? 5.516   9.328   -2.140  1.00 15.00 ?  318 HIS A HB2  14 
ATOM 11001 H HB3  . HIS A 1 22 ? 5.174   10.243  -3.599  1.00 15.00 ?  318 HIS A HB3  14 
ATOM 11002 H HD1  . HIS A 1 22 ? 2.345   8.321   -3.734  1.00 15.00 ?  318 HIS A HD1  14 
ATOM 11003 H HD2  . HIS A 1 22 ? 3.619   11.149  -0.953  1.00 15.00 ?  318 HIS A HD2  14 
ATOM 11004 H HE1  . HIS A 1 22 ? 0.269   9.133   -2.586  1.00 15.00 ?  318 HIS A HE1  14 
ATOM 11005 H HE2  . HIS A 1 22 ? 1.103   10.583  -0.702  1.00 15.00 ?  318 HIS A HE2  14 
ATOM 11006 N N    . ASN A 1 23 ? 7.327   7.320   -4.128  1.00 15.00 ?  319 ASN A N    14 
ATOM 11007 C CA   . ASN A 1 23 ? 8.644   7.220   -4.753  1.00 15.00 ?  319 ASN A CA   14 
ATOM 11008 C C    . ASN A 1 23 ? 8.555   6.498   -6.092  1.00 15.00 ?  319 ASN A C    14 
ATOM 11009 O O    . ASN A 1 23 ? 8.814   7.079   -7.141  1.00 15.00 ?  319 ASN A O    14 
ATOM 11010 C CB   . ASN A 1 23 ? 9.628   6.477   -3.842  1.00 15.00 ?  319 ASN A CB   14 
ATOM 11011 C CG   . ASN A 1 23 ? 10.192  7.339   -2.724  1.00 15.00 ?  319 ASN A CG   14 
ATOM 11012 O OD1  . ASN A 1 23 ? 11.315  7.118   -2.273  1.00 15.00 ?  319 ASN A OD1  14 
ATOM 11013 N ND2  . ASN A 1 23 ? 9.429   8.322   -2.270  1.00 15.00 ?  319 ASN A ND2  14 
ATOM 11014 H H    . ASN A 1 23 ? 7.120   6.746   -3.360  1.00 15.00 ?  319 ASN A H    14 
ATOM 11015 H HA   . ASN A 1 23 ? 9.009   8.223   -4.919  1.00 15.00 ?  319 ASN A HA   14 
ATOM 11016 H HB2  . ASN A 1 23 ? 9.124   5.634   -3.395  1.00 15.00 ?  319 ASN A HB2  14 
ATOM 11017 H HB3  . ASN A 1 23 ? 10.452  6.115   -4.441  1.00 15.00 ?  319 ASN A HB3  14 
ATOM 11018 H HD21 . ASN A 1 23 ? 8.546   8.449   -2.670  1.00 15.00 ?  319 ASN A HD21 14 
ATOM 11019 H HD22 . ASN A 1 23 ? 9.786   8.888   -1.543  1.00 15.00 ?  319 ASN A HD22 14 
ATOM 11020 N N    . ASN A 1 24 ? 8.166   5.228   -6.044  1.00 15.00 ?  320 ASN A N    14 
ATOM 11021 C CA   . ASN A 1 24 ? 8.113   4.395   -7.241  1.00 15.00 ?  320 ASN A CA   14 
ATOM 11022 C C    . ASN A 1 24 ? 6.768   4.552   -7.940  1.00 15.00 ?  320 ASN A C    14 
ATOM 11023 O O    . ASN A 1 24 ? 6.599   4.131   -9.086  1.00 15.00 ?  320 ASN A O    14 
ATOM 11024 C CB   . ASN A 1 24 ? 8.356   2.924   -6.879  1.00 15.00 ?  320 ASN A CB   14 
ATOM 11025 C CG   . ASN A 1 24 ? 8.924   2.116   -8.034  1.00 15.00 ?  320 ASN A CG   14 
ATOM 11026 O OD1  . ASN A 1 24 ? 10.137  2.079   -8.238  1.00 15.00 ?  320 ASN A OD1  14 
ATOM 11027 N ND2  . ASN A 1 24 ? 8.068   1.440   -8.779  1.00 15.00 ?  320 ASN A ND2  14 
ATOM 11028 H H    . ASN A 1 24 ? 7.908   4.838   -5.183  1.00 15.00 ?  320 ASN A H    14 
ATOM 11029 H HA   . ASN A 1 24 ? 8.894   4.726   -7.909  1.00 15.00 ?  320 ASN A HA   14 
ATOM 11030 H HB2  . ASN A 1 24 ? 9.051   2.873   -6.055  1.00 15.00 ?  320 ASN A HB2  14 
ATOM 11031 H HB3  . ASN A 1 24 ? 7.419   2.477   -6.579  1.00 15.00 ?  320 ASN A HB3  14 
ATOM 11032 H HD21 . ASN A 1 24 ? 7.107   1.491   -8.552  1.00 15.00 ?  320 ASN A HD21 14 
ATOM 11033 H HD22 . ASN A 1 24 ? 8.421   0.902   -9.518  1.00 15.00 ?  320 ASN A HD22 14 
ATOM 11034 N N    . ARG A 1 25 ? 5.809   5.134   -7.219  1.00 15.00 ?  321 ARG A N    14 
ATOM 11035 C CA   . ARG A 1 25 ? 4.441   5.307   -7.709  1.00 15.00 ?  321 ARG A CA   14 
ATOM 11036 C C    . ARG A 1 25 ? 3.798   3.945   -7.910  1.00 15.00 ?  321 ARG A C    14 
ATOM 11037 O O    . ARG A 1 25 ? 3.143   3.688   -8.919  1.00 15.00 ?  321 ARG A O    14 
ATOM 11038 C CB   . ARG A 1 25 ? 4.413   6.123   -9.004  1.00 15.00 ?  321 ARG A CB   14 
ATOM 11039 C CG   . ARG A 1 25 ? 4.924   7.543   -8.836  1.00 15.00 ?  321 ARG A CG   14 
ATOM 11040 C CD   . ARG A 1 25 ? 4.824   8.320   -10.135 1.00 15.00 ?  321 ARG A CD   14 
ATOM 11041 N NE   . ARG A 1 25 ? 5.545   7.653   -11.217 1.00 15.00 ?  321 ARG A NE   14 
ATOM 11042 C CZ   . ARG A 1 25 ? 5.117   7.603   -12.477 1.00 15.00 ?  321 ARG A CZ   14 
ATOM 11043 N NH1  . ARG A 1 25 ? 3.994   8.221   -12.824 1.00 15.00 1  321 ARG A NH1  14 
ATOM 11044 N NH2  . ARG A 1 25 ? 5.811   6.937   -13.389 1.00 15.00 ?  321 ARG A NH2  14 
ATOM 11045 H H    . ARG A 1 25 ? 6.025   5.450   -6.318  1.00 15.00 ?  321 ARG A H    14 
ATOM 11046 H HA   . ARG A 1 25 ? 3.888   5.838   -6.946  1.00 15.00 ?  321 ARG A HA   14 
ATOM 11047 H HB2  . ARG A 1 25 ? 5.024   5.627   -9.745  1.00 15.00 ?  321 ARG A HB2  14 
ATOM 11048 H HB3  . ARG A 1 25 ? 3.395   6.171   -9.365  1.00 15.00 ?  321 ARG A HB3  14 
ATOM 11049 H HG2  . ARG A 1 25 ? 4.334   8.043   -8.082  1.00 15.00 ?  321 ARG A HG2  14 
ATOM 11050 H HG3  . ARG A 1 25 ? 5.959   7.510   -8.523  1.00 15.00 ?  321 ARG A HG3  14 
ATOM 11051 H HD2  . ARG A 1 25 ? 3.784   8.410   -10.409 1.00 15.00 ?  321 ARG A HD2  14 
ATOM 11052 H HD3  . ARG A 1 25 ? 5.245   9.303   -9.986  1.00 15.00 ?  321 ARG A HD3  14 
ATOM 11053 H HE   . ARG A 1 25 ? 6.396   7.202   -10.980 1.00 15.00 ?  321 ARG A HE   14 
ATOM 11054 H HH11 . ARG A 1 25 ? 3.458   8.728   -12.137 1.00 15.00 ?  321 ARG A HH11 14 
ATOM 11055 H HH12 . ARG A 1 25 ? 3.672   8.194   -13.777 1.00 15.00 ?  321 ARG A HH12 14 
ATOM 11056 H HH21 . ARG A 1 25 ? 6.666   6.463   -13.134 1.00 15.00 ?  321 ARG A HH21 14 
ATOM 11057 H HH22 . ARG A 1 25 ? 5.484   6.894   -14.344 1.00 15.00 ?  321 ARG A HH22 14 
ATOM 11058 N N    . THR A 1 26 ? 3.995   3.078   -6.931  1.00 15.00 ?  322 THR A N    14 
ATOM 11059 C CA   . THR A 1 26 ? 3.511   1.700   -7.015  1.00 15.00 ?  322 THR A CA   14 
ATOM 11060 C C    . THR A 1 26 ? 2.741   1.311   -5.752  1.00 15.00 ?  322 THR A C    14 
ATOM 11061 O O    . THR A 1 26 ? 3.018   1.828   -4.685  1.00 15.00 ?  322 THR A O    14 
ATOM 11062 C CB   . THR A 1 26 ? 4.693   0.737   -7.249  1.00 15.00 ?  322 THR A CB   14 
ATOM 11063 O OG1  . THR A 1 26 ? 5.438   1.186   -8.390  1.00 15.00 ?  322 THR A OG1  14 
ATOM 11064 C CG2  . THR A 1 26 ? 4.214   -0.689  -7.490  1.00 15.00 ?  322 THR A CG2  14 
ATOM 11065 H H    . THR A 1 26 ? 4.455   3.384   -6.106  1.00 15.00 ?  322 THR A H    14 
ATOM 11066 H HA   . THR A 1 26 ? 2.846   1.632   -7.864  1.00 15.00 ?  322 THR A HA   14 
ATOM 11067 H HB   . THR A 1 26 ? 5.332   0.750   -6.376  1.00 15.00 ?  322 THR A HB   14 
ATOM 11068 H HG1  . THR A 1 26 ? 4.892   1.787   -8.911  1.00 15.00 ?  322 THR A HG1  14 
ATOM 11069 H HG21 . THR A 1 26 ? 3.652   -1.031  -6.634  1.00 15.00 ?  322 THR A HG21 14 
ATOM 11070 H HG22 . THR A 1 26 ? 5.067   -1.334  -7.642  1.00 15.00 ?  322 THR A HG22 14 
ATOM 11071 H HG23 . THR A 1 26 ? 3.584   -0.712  -8.367  1.00 15.00 ?  322 THR A HG23 14 
ATOM 11072 N N    . THR A 1 27 ? 1.767   0.420   -5.875  1.00 15.00 ?  323 THR A N    14 
ATOM 11073 C CA   . THR A 1 27 ? 1.018   -0.037  -4.711  1.00 15.00 ?  323 THR A CA   14 
ATOM 11074 C C    . THR A 1 27 ? 1.597   -1.357  -4.188  1.00 15.00 ?  323 THR A C    14 
ATOM 11075 O O    . THR A 1 27 ? 2.038   -2.204  -4.971  1.00 15.00 ?  323 THR A O    14 
ATOM 11076 C CB   . THR A 1 27 ? -0.482  -0.189  -5.034  1.00 15.00 ?  323 THR A CB   14 
ATOM 11077 O OG1  . THR A 1 27 ? -1.209  -0.549  -3.858  1.00 15.00 ?  323 THR A OG1  14 
ATOM 11078 C CG2  . THR A 1 27 ? -0.711  -1.230  -6.113  1.00 15.00 ?  323 THR A CG2  14 
ATOM 11079 H H    . THR A 1 27 ? 1.548   0.060   -6.757  1.00 15.00 ?  323 THR A H    14 
ATOM 11080 H HA   . THR A 1 27 ? 1.123   0.714   -3.939  1.00 15.00 ?  323 THR A HA   14 
ATOM 11081 H HB   . THR A 1 27 ? -0.851  0.761   -5.394  1.00 15.00 ?  323 THR A HB   14 
ATOM 11082 H HG1  . THR A 1 27 ? -1.949  0.055   -3.746  1.00 15.00 ?  323 THR A HG1  14 
ATOM 11083 H HG21 . THR A 1 27 ? -0.283  -0.890  -7.042  1.00 15.00 ?  323 THR A HG21 14 
ATOM 11084 H HG22 . THR A 1 27 ? -1.773  -1.381  -6.239  1.00 15.00 ?  323 THR A HG22 14 
ATOM 11085 H HG23 . THR A 1 27 ? -0.248  -2.160  -5.820  1.00 15.00 ?  323 THR A HG23 14 
ATOM 11086 N N    . GLN A 1 28 ? 1.604   -1.521  -2.870  1.00 15.00 ?  324 GLN A N    14 
ATOM 11087 C CA   . GLN A 1 28 ? 2.313   -2.622  -2.233  1.00 15.00 ?  324 GLN A CA   14 
ATOM 11088 C C    . GLN A 1 28 ? 1.429   -3.442  -1.300  1.00 15.00 ?  324 GLN A C    14 
ATOM 11089 O O    . GLN A 1 28 ? 1.250   -3.079  -0.148  1.00 15.00 ?  324 GLN A O    14 
ATOM 11090 C CB   . GLN A 1 28 ? 3.495   -2.098  -1.403  1.00 15.00 ?  324 GLN A CB   14 
ATOM 11091 C CG   . GLN A 1 28 ? 4.565   -1.364  -2.191  1.00 15.00 ?  324 GLN A CG   14 
ATOM 11092 C CD   . GLN A 1 28 ? 5.312   -2.276  -3.145  1.00 15.00 ?  324 GLN A CD   14 
ATOM 11093 O OE1  . GLN A 1 28 ? 6.328   -2.872  -2.785  1.00 15.00 ?  324 GLN A OE1  14 
ATOM 11094 N NE2  . GLN A 1 28 ? 4.807   -2.409  -4.361  1.00 15.00 ?  324 GLN A NE2  14 
ATOM 11095 H H    . GLN A 1 28 ? 1.136   -0.867  -2.306  1.00 15.00 ?  324 GLN A H    14 
ATOM 11096 H HA   . GLN A 1 28 ? 2.694   -3.265  -3.009  1.00 15.00 ?  324 GLN A HA   14 
ATOM 11097 H HB2  . GLN A 1 28 ? 3.115   -1.420  -0.653  1.00 15.00 ?  324 GLN A HB2  14 
ATOM 11098 H HB3  . GLN A 1 28 ? 3.961   -2.936  -0.905  1.00 15.00 ?  324 GLN A HB3  14 
ATOM 11099 H HG2  . GLN A 1 28 ? 4.101   -0.569  -2.753  1.00 15.00 ?  324 GLN A HG2  14 
ATOM 11100 H HG3  . GLN A 1 28 ? 5.274   -0.938  -1.494  1.00 15.00 ?  324 GLN A HG3  14 
ATOM 11101 H HE21 . GLN A 1 28 ? 3.986   -1.917  -4.578  1.00 15.00 ?  324 GLN A HE21 14 
ATOM 11102 H HE22 . GLN A 1 28 ? 5.272   -2.991  -4.993  1.00 15.00 ?  324 GLN A HE22 14 
ATOM 11103 N N    . PHE A 1 29 ? 0.873   -4.539  -1.799  1.00 15.00 ?  325 PHE A N    14 
ATOM 11104 C CA   . PHE A 1 29 ? 0.377   -5.602  -0.916  1.00 15.00 ?  325 PHE A CA   14 
ATOM 11105 C C    . PHE A 1 29 ? 1.566   -6.321  -0.340  1.00 15.00 ?  325 PHE A C    14 
ATOM 11106 O O    . PHE A 1 29 ? 1.469   -7.203  0.507   1.00 15.00 ?  325 PHE A O    14 
ATOM 11107 C CB   . PHE A 1 29 ? -0.543  -6.574  -1.634  1.00 15.00 ?  325 PHE A CB   14 
ATOM 11108 C CG   . PHE A 1 29 ? -1.938  -6.070  -1.676  1.00 15.00 ?  325 PHE A CG   14 
ATOM 11109 C CD1  . PHE A 1 29 ? -2.461  -5.396  -0.585  1.00 15.00 ?  325 PHE A CD1  14 
ATOM 11110 C CD2  . PHE A 1 29 ? -2.724  -6.253  -2.795  1.00 15.00 ?  325 PHE A CD2  14 
ATOM 11111 C CE1  . PHE A 1 29 ? -3.752  -4.912  -0.628  1.00 15.00 ?  325 PHE A CE1  14 
ATOM 11112 C CE2  . PHE A 1 29 ? -4.015  -5.775  -2.836  1.00 15.00 ?  325 PHE A CE2  14 
ATOM 11113 C CZ   . PHE A 1 29 ? -4.529  -5.101  -1.751  1.00 15.00 ?  325 PHE A CZ   14 
ATOM 11114 H H    . PHE A 1 29 ? 0.786   -4.636  -2.769  1.00 15.00 ?  325 PHE A H    14 
ATOM 11115 H HA   . PHE A 1 29 ? -0.163  -5.130  -0.106  1.00 15.00 ?  325 PHE A HA   14 
ATOM 11116 H HB2  . PHE A 1 29 ? -0.199  -6.714  -2.648  1.00 15.00 ?  325 PHE A HB2  14 
ATOM 11117 H HB3  . PHE A 1 29 ? -0.542  -7.521  -1.115  1.00 15.00 ?  325 PHE A HB3  14 
ATOM 11118 H HD1  . PHE A 1 29 ? -1.842  -5.250  0.316   1.00 15.00 ?  325 PHE A HD1  14 
ATOM 11119 H HD2  . PHE A 1 29 ? -2.318  -6.781  -3.646  1.00 15.00 ?  325 PHE A HD2  14 
ATOM 11120 H HE1  . PHE A 1 29 ? -4.161  -4.400  0.224   1.00 15.00 ?  325 PHE A HE1  14 
ATOM 11121 H HE2  . PHE A 1 29 ? -4.621  -5.924  -3.718  1.00 15.00 ?  325 PHE A HE2  14 
ATOM 11122 H HZ   . PHE A 1 29 ? -5.540  -4.721  -1.782  1.00 15.00 ?  325 PHE A HZ   14 
ATOM 11123 N N    . THR A 1 30 ? 2.682   -5.958  -0.903  1.00 15.00 ?  326 THR A N    14 
ATOM 11124 C CA   . THR A 1 30 ? 3.967   -6.425  -0.442  1.00 15.00 ?  326 THR A CA   14 
ATOM 11125 C C    . THR A 1 30 ? 4.427   -5.419  0.602   1.00 15.00 ?  326 THR A C    14 
ATOM 11126 O O    . THR A 1 30 ? 5.076   -4.421  0.286   1.00 15.00 ?  326 THR A O    14 
ATOM 11127 C CB   . THR A 1 30 ? 4.973   -6.512  -1.599  1.00 15.00 ?  326 THR A CB   14 
ATOM 11128 O OG1  . THR A 1 30 ? 4.336   -7.140  -2.718  1.00 15.00 ?  326 THR A OG1  14 
ATOM 11129 C CG2  . THR A 1 30 ? 6.199   -7.317  -1.197  1.00 15.00 ?  326 THR A CG2  14 
ATOM 11130 H H    . THR A 1 30 ? 2.628   -5.260  -1.587  1.00 15.00 ?  326 THR A H    14 
ATOM 11131 H HA   . THR A 1 30 ? 3.844   -7.405  0.000   1.00 15.00 ?  326 THR A HA   14 
ATOM 11132 H HB   . THR A 1 30 ? 5.281   -5.513  -1.875  1.00 15.00 ?  326 THR A HB   14 
ATOM 11133 H HG1  . THR A 1 30 ? 3.444   -7.396  -2.464  1.00 15.00 ?  326 THR A HG1  14 
ATOM 11134 H HG21 . THR A 1 30 ? 6.883   -7.373  -2.031  1.00 15.00 ?  326 THR A HG21 14 
ATOM 11135 H HG22 . THR A 1 30 ? 5.897   -8.315  -0.911  1.00 15.00 ?  326 THR A HG22 14 
ATOM 11136 H HG23 . THR A 1 30 ? 6.687   -6.837  -0.362  1.00 15.00 ?  326 THR A HG23 14 
ATOM 11137 N N    . ASP A 1 31 ? 4.056   -5.678  1.840   1.00 15.00 ?  327 ASP A N    14 
ATOM 11138 C CA   . ASP A 1 31 ? 3.955   -4.637  2.832   1.00 15.00 ?  327 ASP A CA   14 
ATOM 11139 C C    . ASP A 1 31 ? 4.864   -4.809  3.996   1.00 15.00 ?  327 ASP A C    14 
ATOM 11140 O O    . ASP A 1 31 ? 5.236   -5.913  4.389   1.00 15.00 ?  327 ASP A O    14 
ATOM 11141 C CB   . ASP A 1 31 ? 2.544   -4.480  3.358   1.00 15.00 ?  327 ASP A CB   14 
ATOM 11142 C CG   . ASP A 1 31 ? 1.792   -5.790  3.502   1.00 15.00 ?  327 ASP A CG   14 
ATOM 11143 O OD1  . ASP A 1 31 ? 2.321   -6.702  4.173   1.00 15.00 -1 327 ASP A OD1  14 
ATOM 11144 O OD2  . ASP A 1 31 ? 0.675   -5.914  2.965   1.00 15.00 ?  327 ASP A OD2  14 
ATOM 11145 H H    . ASP A 1 31 ? 3.833   -6.599  2.101   1.00 15.00 ?  327 ASP A H    14 
ATOM 11146 H HA   . ASP A 1 31 ? 4.218   -3.709  2.351   1.00 15.00 ?  327 ASP A HA   14 
ATOM 11147 H HB2  . ASP A 1 31 ? 2.600   -4.021  4.336   1.00 15.00 ?  327 ASP A HB2  14 
ATOM 11148 H HB3  . ASP A 1 31 ? 2.023   -3.818  2.701   1.00 15.00 ?  327 ASP A HB3  14 
ATOM 11149 N N    . PRO A 1 32 ? 5.223   -3.665  4.556   1.00 15.00 ?  328 PRO A N    14 
ATOM 11150 C CA   . PRO A 1 32 ? 5.880   -3.586  5.840   1.00 15.00 ?  328 PRO A CA   14 
ATOM 11151 C C    . PRO A 1 32 ? 4.933   -4.148  6.910   1.00 15.00 ?  328 PRO A C    14 
ATOM 11152 O O    . PRO A 1 32 ? 5.329   -4.405  8.044   1.00 15.00 ?  328 PRO A O    14 
ATOM 11153 C CB   . PRO A 1 32 ? 6.152   -2.082  6.018   1.00 15.00 ?  328 PRO A CB   14 
ATOM 11154 C CG   . PRO A 1 32 ? 5.936   -1.486  4.659   1.00 15.00 ?  328 PRO A CG   14 
ATOM 11155 C CD   . PRO A 1 32 ? 4.917   -2.336  4.011   1.00 15.00 ?  328 PRO A CD   14 
ATOM 11156 H HA   . PRO A 1 32 ? 6.809   -4.140  5.848   1.00 15.00 ?  328 PRO A HA   14 
ATOM 11157 H HB2  . PRO A 1 32 ? 5.464   -1.670  6.743   1.00 15.00 ?  328 PRO A HB2  14 
ATOM 11158 H HB3  . PRO A 1 32 ? 7.168   -1.934  6.354   1.00 15.00 ?  328 PRO A HB3  14 
ATOM 11159 H HG2  . PRO A 1 32 ? 5.589   -0.466  4.747   1.00 15.00 ?  328 PRO A HG2  14 
ATOM 11160 H HG3  . PRO A 1 32 ? 6.830   -1.530  4.079   1.00 15.00 ?  328 PRO A HG3  14 
ATOM 11161 H HD2  . PRO A 1 32 ? 3.923   -2.017  4.291   1.00 15.00 ?  328 PRO A HD2  14 
ATOM 11162 H HD3  . PRO A 1 32 ? 5.037   -2.320  2.937   1.00 15.00 ?  328 PRO A HD3  14 
ATOM 11163 N N    . ARG A 1 33 ? 3.653   -4.291  6.523   1.00 15.00 ?  329 ARG A N    14 
ATOM 11164 C CA   . ARG A 1 33 ? 2.646   -4.962  7.343   1.00 15.00 ?  329 ARG A CA   14 
ATOM 11165 C C    . ARG A 1 33 ? 3.002   -6.427  7.571   1.00 15.00 ?  329 ARG A C    14 
ATOM 11166 O O    . ARG A 1 33 ? 2.607   -7.021  8.574   1.00 15.00 ?  329 ARG A O    14 
ATOM 11167 C CB   . ARG A 1 33 ? 1.238   -4.856  6.717   1.00 15.00 ?  329 ARG A CB   14 
ATOM 11168 C CG   . ARG A 1 33 ? 0.517   -3.579  7.097   1.00 15.00 ?  329 ARG A CG   14 
ATOM 11169 C CD   . ARG A 1 33 ? 0.342   -3.478  8.602   1.00 15.00 ?  329 ARG A CD   14 
ATOM 11170 N NE   . ARG A 1 33 ? -0.449  -2.313  8.992   1.00 15.00 ?  329 ARG A NE   14 
ATOM 11171 C CZ   . ARG A 1 33 ? -0.196  -1.570  10.067  1.00 15.00 ?  329 ARG A CZ   14 
ATOM 11172 N NH1  . ARG A 1 33 ? 0.878   -1.803  10.811  1.00 15.00 1  329 ARG A NH1  14 
ATOM 11173 N NH2  . ARG A 1 33 ? -1.005  -0.573  10.385  1.00 15.00 ?  329 ARG A NH2  14 
ATOM 11174 H H    . ARG A 1 33 ? 3.387   -3.944  5.645   1.00 15.00 ?  329 ARG A H    14 
ATOM 11175 H HA   . ARG A 1 33 ? 2.633   -4.465  8.303   1.00 15.00 ?  329 ARG A HA   14 
ATOM 11176 H HB2  . ARG A 1 33 ? 1.306   -4.899  5.621   1.00 15.00 ?  329 ARG A HB2  14 
ATOM 11177 H HB3  . ARG A 1 33 ? 0.646   -5.692  7.061   1.00 15.00 ?  329 ARG A HB3  14 
ATOM 11178 H HG2  . ARG A 1 33 ? 1.094   -2.734  6.754   1.00 15.00 ?  329 ARG A HG2  14 
ATOM 11179 H HG3  . ARG A 1 33 ? -0.456  -3.571  6.627   1.00 15.00 ?  329 ARG A HG3  14 
ATOM 11180 H HD2  . ARG A 1 33 ? -0.155  -4.370  8.955   1.00 15.00 ?  329 ARG A HD2  14 
ATOM 11181 H HD3  . ARG A 1 33 ? 1.318   -3.407  9.059   1.00 15.00 ?  329 ARG A HD3  14 
ATOM 11182 H HE   . ARG A 1 33 ? -1.229  -2.087  8.433   1.00 15.00 ?  329 ARG A HE   14 
ATOM 11183 H HH11 . ARG A 1 33 ? 1.516   -2.543  10.567  1.00 15.00 ?  329 ARG A HH11 14 
ATOM 11184 H HH12 . ARG A 1 33 ? 1.060   -1.235  11.622  1.00 15.00 ?  329 ARG A HH12 14 
ATOM 11185 H HH21 . ARG A 1 33 ? -1.813  -0.375  9.811   1.00 15.00 ?  329 ARG A HH21 14 
ATOM 11186 H HH22 . ARG A 1 33 ? -0.818  -0.011  11.199  1.00 15.00 ?  329 ARG A HH22 14 
ATOM 11187 N N    . LEU A 1 34 ? 3.741   -7.008  6.633   1.00 15.00 ?  330 LEU A N    14 
ATOM 11188 C CA   . LEU A 1 34 ? 4.195   -8.390  6.750   1.00 15.00 ?  330 LEU A CA   14 
ATOM 11189 C C    . LEU A 1 34 ? 5.180   -8.519  7.915   1.00 15.00 ?  330 LEU A C    14 
ATOM 11190 O O    . LEU A 1 34 ? 5.372   -9.596  8.476   1.00 15.00 ?  330 LEU A O    14 
ATOM 11191 C CB   . LEU A 1 34 ? 4.823   -8.836  5.417   1.00 15.00 ?  330 LEU A CB   14 
ATOM 11192 C CG   . LEU A 1 34 ? 5.113   -10.333 5.262   1.00 15.00 ?  330 LEU A CG   14 
ATOM 11193 C CD1  . LEU A 1 34 ? 5.013   -10.735 3.798   1.00 15.00 ?  330 LEU A CD1  14 
ATOM 11194 C CD2  . LEU A 1 34 ? 6.493   -10.679 5.794   1.00 15.00 ?  330 LEU A CD2  14 
ATOM 11195 H H    . LEU A 1 34 ? 3.965   -6.503  5.818   1.00 15.00 ?  330 LEU A H    14 
ATOM 11196 H HA   . LEU A 1 34 ? 3.331   -9.004  6.956   1.00 15.00 ?  330 LEU A HA   14 
ATOM 11197 H HB2  . LEU A 1 34 ? 4.156   -8.543  4.621   1.00 15.00 ?  330 LEU A HB2  14 
ATOM 11198 H HB3  . LEU A 1 34 ? 5.754   -8.301  5.292   1.00 15.00 ?  330 LEU A HB3  14 
ATOM 11199 H HG   . LEU A 1 34 ? 4.382   -10.899 5.820   1.00 15.00 ?  330 LEU A HG   14 
ATOM 11200 H HD11 . LEU A 1 34 ? 5.737   -10.179 3.221   1.00 15.00 ?  330 LEU A HD11 14 
ATOM 11201 H HD12 . LEU A 1 34 ? 4.019   -10.522 3.432   1.00 15.00 ?  330 LEU A HD12 14 
ATOM 11202 H HD13 . LEU A 1 34 ? 5.213   -11.792 3.702   1.00 15.00 ?  330 LEU A HD13 14 
ATOM 11203 H HD21 . LEU A 1 34 ? 7.240   -10.118 5.250   1.00 15.00 ?  330 LEU A HD21 14 
ATOM 11204 H HD22 . LEU A 1 34 ? 6.673   -11.737 5.668   1.00 15.00 ?  330 LEU A HD22 14 
ATOM 11205 H HD23 . LEU A 1 34 ? 6.548   -10.426 6.842   1.00 15.00 ?  330 LEU A HD23 14 
ATOM 11206 N N    . SER A 1 35 ? 5.783   -7.396  8.289   1.00 15.00 ?  331 SER A N    14 
ATOM 11207 C CA   . SER A 1 35 ? 6.715   -7.359  9.406   1.00 15.00 ?  331 SER A CA   14 
ATOM 11208 C C    . SER A 1 35 ? 5.958   -7.384  10.734  1.00 15.00 ?  331 SER A C    14 
ATOM 11209 O O    . SER A 1 35 ? 6.543   -7.596  11.797  1.00 15.00 ?  331 SER A O    14 
ATOM 11210 C CB   . SER A 1 35 ? 7.593   -6.105  9.311   1.00 15.00 ?  331 SER A CB   14 
ATOM 11211 O OG   . SER A 1 35 ? 8.572   -6.067  10.336  1.00 15.00 ?  331 SER A OG   14 
ATOM 11212 H H    . SER A 1 35 ? 5.591   -6.569  7.799   1.00 15.00 ?  331 SER A H    14 
ATOM 11213 H HA   . SER A 1 35 ? 7.343   -8.236  9.344   1.00 15.00 ?  331 SER A HA   14 
ATOM 11214 H HB2  . SER A 1 35 ? 8.097   -6.094  8.355   1.00 15.00 ?  331 SER A HB2  14 
ATOM 11215 H HB3  . SER A 1 35 ? 6.970   -5.227  9.395   1.00 15.00 ?  331 SER A HB3  14 
ATOM 11216 H HG   . SER A 1 35 ? 9.362   -6.548  10.042  1.00 15.00 ?  331 SER A HG   14 
ATOM 11217 N N    . ALA A 1 36 ? 4.649   -7.172  10.666  1.00 15.00 ?  332 ALA A N    14 
ATOM 11218 C CA   . ALA A 1 36 ? 3.816   -7.155  11.858  1.00 15.00 ?  332 ALA A CA   14 
ATOM 11219 C C    . ALA A 1 36 ? 3.307   -8.555  12.184  1.00 15.00 ?  332 ALA A C    14 
ATOM 11220 O O    . ALA A 1 36 ? 2.842   -8.815  13.292  1.00 15.00 ?  332 ALA A O    14 
ATOM 11221 C CB   . ALA A 1 36 ? 2.654   -6.189  11.679  1.00 15.00 ?  332 ALA A CB   14 
ATOM 11222 H H    . ALA A 1 36 ? 4.230   -7.032  9.788   1.00 15.00 ?  332 ALA A H    14 
ATOM 11223 H HA   . ALA A 1 36 ? 4.422   -6.805  12.682  1.00 15.00 ?  332 ALA A HA   14 
ATOM 11224 H HB1  . ALA A 1 36 ? 3.035   -5.206  11.449  1.00 15.00 ?  332 ALA A HB1  14 
ATOM 11225 H HB2  . ALA A 1 36 ? 2.077   -6.146  12.592  1.00 15.00 ?  332 ALA A HB2  14 
ATOM 11226 H HB3  . ALA A 1 36 ? 2.023   -6.530  10.872  1.00 15.00 ?  332 ALA A HB3  14 
ATOM 11227 N N    . ASN A 1 37 ? 3.405   -9.454  11.216  1.00 15.00 ?  333 ASN A N    14 
ATOM 11228 C CA   . ASN A 1 37 ? 2.971   -10.829 11.411  1.00 15.00 ?  333 ASN A CA   14 
ATOM 11229 C C    . ASN A 1 37 ? 4.158   -11.773 11.293  1.00 15.00 ?  333 ASN A C    14 
ATOM 11230 O O    . ASN A 1 37 ? 4.568   -12.088 10.157  1.00 15.00 ?  333 ASN A O    14 
ATOM 11231 C CB   . ASN A 1 37 ? 1.881   -11.210 10.403  1.00 15.00 ?  333 ASN A CB   14 
ATOM 11232 C CG   . ASN A 1 37 ? 1.399   -12.636 10.593  1.00 15.00 ?  333 ASN A CG   14 
ATOM 11233 O OD1  . ASN A 1 37 ? 1.895   -13.568 9.958   1.00 15.00 ?  333 ASN A OD1  14 
ATOM 11234 N ND2  . ASN A 1 37 ? 0.427   -12.818 11.471  1.00 15.00 ?  333 ASN A ND2  14 
ATOM 11235 O OXT  . ASN A 1 37 ? 4.693   -12.179 12.346  1.00 15.00 ?  333 ASN A OXT  14 
ATOM 11236 H H    . ASN A 1 37 ? 3.790   -9.193  10.353  1.00 15.00 ?  333 ASN A H    14 
ATOM 11237 H HA   . ASN A 1 37 ? 2.567   -10.906 12.409  1.00 15.00 ?  333 ASN A HA   14 
ATOM 11238 H HB2  . ASN A 1 37 ? 1.040   -10.544 10.525  1.00 15.00 ?  333 ASN A HB2  14 
ATOM 11239 H HB3  . ASN A 1 37 ? 2.273   -11.110 9.402   1.00 15.00 ?  333 ASN A HB3  14 
ATOM 11240 H HD21 . ASN A 1 37 ? 0.074   -12.035 11.942  1.00 15.00 ?  333 ASN A HD21 14 
ATOM 11241 H HD22 . ASN A 1 37 ? 0.109   -13.738 11.628  1.00 15.00 ?  333 ASN A HD22 14 
ATOM 11242 N N    . GLU B 2 1  ? 3.305   -9.776  -7.177  1.00 15.00 ?  203 GLU B N    14 
ATOM 11243 C CA   . GLU B 2 1  ? 3.245   -9.774  -5.698  1.00 15.00 ?  203 GLU B CA   14 
ATOM 11244 C C    . GLU B 2 1  ? 2.618   -11.067 -5.191  1.00 15.00 ?  203 GLU B C    14 
ATOM 11245 O O    . GLU B 2 1  ? 1.849   -11.716 -5.898  1.00 15.00 ?  203 GLU B O    14 
ATOM 11246 C CB   . GLU B 2 1  ? 2.478   -8.545  -5.165  1.00 15.00 ?  203 GLU B CB   14 
ATOM 11247 C CG   . GLU B 2 1  ? 1.122   -8.293  -5.816  1.00 15.00 ?  203 GLU B CG   14 
ATOM 11248 C CD   . GLU B 2 1  ? 1.237   -7.768  -7.232  1.00 15.00 ?  203 GLU B CD   14 
ATOM 11249 O OE1  . GLU B 2 1  ? 1.534   -6.568  -7.406  1.00 15.00 -1 203 GLU B OE1  14 
ATOM 11250 O OE2  . GLU B 2 1  ? 1.062   -8.563  -8.176  1.00 15.00 ?  203 GLU B OE2  14 
ATOM 11251 H H1   . GLU B 2 1  ? 2.341   -9.786  -7.573  1.00 15.00 ?  203 GLU B H1   14 
ATOM 11252 H H2   . GLU B 2 1  ? 3.813   -10.621 -7.513  1.00 15.00 ?  203 GLU B H2   14 
ATOM 11253 H H3   . GLU B 2 1  ? 3.801   -8.924  -7.521  1.00 15.00 ?  203 GLU B H3   14 
ATOM 11254 H HA   . GLU B 2 1  ? 4.260   -9.732  -5.332  1.00 15.00 ?  203 GLU B HA   14 
ATOM 11255 H HB2  . GLU B 2 1  ? 2.315   -8.672  -4.105  1.00 15.00 ?  203 GLU B HB2  14 
ATOM 11256 H HB3  . GLU B 2 1  ? 3.090   -7.666  -5.316  1.00 15.00 ?  203 GLU B HB3  14 
ATOM 11257 H HG2  . GLU B 2 1  ? 0.575   -9.223  -5.839  1.00 15.00 ?  203 GLU B HG2  14 
ATOM 11258 H HG3  . GLU B 2 1  ? 0.579   -7.572  -5.222  1.00 15.00 ?  203 GLU B HG3  14 
ATOM 11259 N N    . LEU B 2 2  ? 2.959   -11.437 -3.960  1.00 15.00 ?  204 LEU B N    14 
ATOM 11260 C CA   . LEU B 2 2  ? 2.509   -12.697 -3.369  1.00 15.00 ?  204 LEU B CA   14 
ATOM 11261 C C    . LEU B 2 2  ? 0.993   -12.713 -3.152  1.00 15.00 ?  204 LEU B C    14 
ATOM 11262 O O    . LEU B 2 2  ? 0.385   -13.778 -3.033  1.00 15.00 ?  204 LEU B O    14 
ATOM 11263 C CB   . LEU B 2 2  ? 3.230   -12.928 -2.036  1.00 15.00 ?  204 LEU B CB   14 
ATOM 11264 C CG   . LEU B 2 2  ? 2.975   -14.283 -1.369  1.00 15.00 ?  204 LEU B CG   14 
ATOM 11265 C CD1  . LEU B 2 2  ? 3.541   -15.412 -2.217  1.00 15.00 ?  204 LEU B CD1  14 
ATOM 11266 C CD2  . LEU B 2 2  ? 3.577   -14.310 0.029   1.00 15.00 ?  204 LEU B CD2  14 
ATOM 11267 H H    . LEU B 2 2  ? 3.542   -10.851 -3.435  1.00 15.00 ?  204 LEU B H    14 
ATOM 11268 H HA   . LEU B 2 2  ? 2.772   -13.492 -4.049  1.00 15.00 ?  204 LEU B HA   14 
ATOM 11269 H HB2  . LEU B 2 2  ? 4.291   -12.830 -2.206  1.00 15.00 ?  204 LEU B HB2  14 
ATOM 11270 H HB3  . LEU B 2 2  ? 2.921   -12.153 -1.349  1.00 15.00 ?  204 LEU B HB3  14 
ATOM 11271 H HG   . LEU B 2 2  ? 1.909   -14.436 -1.277  1.00 15.00 ?  204 LEU B HG   14 
ATOM 11272 H HD11 . LEU B 2 2  ? 3.347   -16.359 -1.733  1.00 15.00 ?  204 LEU B HD11 14 
ATOM 11273 H HD12 . LEU B 2 2  ? 4.607   -15.277 -2.330  1.00 15.00 ?  204 LEU B HD12 14 
ATOM 11274 H HD13 . LEU B 2 2  ? 3.072   -15.402 -3.190  1.00 15.00 ?  204 LEU B HD13 14 
ATOM 11275 H HD21 . LEU B 2 2  ? 3.381   -15.266 0.488   1.00 15.00 ?  204 LEU B HD21 14 
ATOM 11276 H HD22 . LEU B 2 2  ? 3.136   -13.525 0.626   1.00 15.00 ?  204 LEU B HD22 14 
ATOM 11277 H HD23 . LEU B 2 2  ? 4.645   -14.154 -0.037  1.00 15.00 ?  204 LEU B HD23 14 
ATOM 11278 N N    . GLU B 2 3  ? 0.395   -11.534 -3.076  1.00 15.00 ?  205 GLU B N    14 
ATOM 11279 C CA   . GLU B 2 3  ? -1.036  -11.412 -2.843  1.00 15.00 ?  205 GLU B CA   14 
ATOM 11280 C C    . GLU B 2 3  ? -1.734  -10.928 -4.116  1.00 15.00 ?  205 GLU B C    14 
ATOM 11281 O O    . GLU B 2 3  ? -1.076  -10.462 -5.047  1.00 15.00 ?  205 GLU B O    14 
ATOM 11282 C CB   . GLU B 2 3  ? -1.281  -10.454 -1.664  1.00 15.00 ?  205 GLU B CB   14 
ATOM 11283 C CG   . GLU B 2 3  ? -2.738  -10.328 -1.227  1.00 15.00 ?  205 GLU B CG   14 
ATOM 11284 C CD   . GLU B 2 3  ? -3.416  -11.668 -1.010  1.00 15.00 ?  205 GLU B CD   14 
ATOM 11285 O OE1  . GLU B 2 3  ? -3.170  -12.311 0.028   1.00 15.00 -1 205 GLU B OE1  14 
ATOM 11286 O OE2  . GLU B 2 3  ? -4.202  -12.082 -1.892  1.00 15.00 ?  205 GLU B OE2  14 
ATOM 11287 H H    . GLU B 2 3  ? 0.927   -10.723 -3.198  1.00 15.00 ?  205 GLU B H    14 
ATOM 11288 H HA   . GLU B 2 3  ? -1.416  -12.391 -2.589  1.00 15.00 ?  205 GLU B HA   14 
ATOM 11289 H HB2  . GLU B 2 3  ? -0.709  -10.798 -0.815  1.00 15.00 ?  205 GLU B HB2  14 
ATOM 11290 H HB3  . GLU B 2 3  ? -0.928  -9.471  -1.940  1.00 15.00 ?  205 GLU B HB3  14 
ATOM 11291 H HG2  . GLU B 2 3  ? -2.774  -9.773  -0.302  1.00 15.00 ?  205 GLU B HG2  14 
ATOM 11292 H HG3  . GLU B 2 3  ? -3.279  -9.785  -1.988  1.00 15.00 ?  205 GLU B HG3  14 
ATOM 11293 N N    . SER B 2 4  ? -3.056  -11.055 -4.142  1.00 15.00 ?  206 SER B N    14 
ATOM 11294 C CA   . SER B 2 4  ? -3.882  -10.619 -5.261  1.00 15.00 ?  206 SER B CA   14 
ATOM 11295 C C    . SER B 2 4  ? -3.571  -9.202  -5.711  1.00 15.00 ?  206 SER B C    14 
ATOM 11296 O O    . SER B 2 4  ? -3.155  -8.341  -4.934  1.00 15.00 ?  206 SER B O    14 
ATOM 11297 C CB   . SER B 2 4  ? -5.351  -10.738 -4.885  1.00 15.00 ?  206 SER B CB   14 
ATOM 11298 O OG   . SER B 2 4  ? -5.571  -10.409 -3.518  1.00 15.00 ?  206 SER B OG   14 
ATOM 11299 H H    . SER B 2 4  ? -3.499  -11.463 -3.366  1.00 15.00 ?  206 SER B H    14 
ATOM 11300 H HA   . SER B 2 4  ? -3.710  -11.272 -6.107  1.00 15.00 ?  206 SER B HA   14 
ATOM 11301 H HB2  . SER B 2 4  ? -5.923  -10.065 -5.507  1.00 15.00 ?  206 SER B HB2  14 
ATOM 11302 H HB3  . SER B 2 4  ? -5.671  -11.749 -5.067  1.00 15.00 ?  206 SER B HB3  14 
ATOM 11303 H HG   . SER B 2 4  ? -5.187  -11.099 -2.952  1.00 15.00 ?  206 SER B HG   14 
ATOM 11304 N N    . PRO B 2 5  ? -3.838  -8.981  -6.993  1.00 15.00 ?  207 PRO B N    14 
ATOM 11305 C CA   . PRO B 2 5  ? -3.595  -7.720  -7.695  1.00 15.00 ?  207 PRO B CA   14 
ATOM 11306 C C    . PRO B 2 5  ? -4.132  -6.510  -6.925  1.00 15.00 ?  207 PRO B C    14 
ATOM 11307 O O    . PRO B 2 5  ? -5.330  -6.431  -6.633  1.00 15.00 ?  207 PRO B O    14 
ATOM 11308 C CB   . PRO B 2 5  ? -4.389  -7.896  -8.994  1.00 15.00 ?  207 PRO B CB   14 
ATOM 11309 C CG   . PRO B 2 5  ? -4.481  -9.372  -9.215  1.00 15.00 ?  207 PRO B CG   14 
ATOM 11310 C CD   . PRO B 2 5  ? -4.357  -10.029 -7.866  1.00 15.00 ?  207 PRO B CD   14 
ATOM 11311 H HA   . PRO B 2 5  ? -2.555  -7.586  -7.926  1.00 15.00 ?  207 PRO B HA   14 
ATOM 11312 H HB2  . PRO B 2 5  ? -5.369  -7.455  -8.879  1.00 15.00 ?  207 PRO B HB2  14 
ATOM 11313 H HB3  . PRO B 2 5  ? -3.867  -7.410  -9.804  1.00 15.00 ?  207 PRO B HB3  14 
ATOM 11314 H HG2  . PRO B 2 5  ? -5.434  -9.616  -9.660  1.00 15.00 ?  207 PRO B HG2  14 
ATOM 11315 H HG3  . PRO B 2 5  ? -3.675  -9.694  -9.861  1.00 15.00 ?  207 PRO B HG3  14 
ATOM 11316 H HD2  . PRO B 2 5  ? -5.305  -10.375 -7.498  1.00 15.00 ?  207 PRO B HD2  14 
ATOM 11317 H HD3  . PRO B 2 5  ? -3.674  -10.856 -7.899  1.00 15.00 ?  207 PRO B HD3  14 
ATOM 11318 N N    . PRO B 2 6  ? -3.245  -5.562  -6.563  1.00 15.00 ?  208 PRO B N    14 
ATOM 11319 C CA   . PRO B 2 6  ? -3.606  -4.408  -5.748  1.00 15.00 ?  208 PRO B CA   14 
ATOM 11320 C C    . PRO B 2 6  ? -4.222  -3.258  -6.541  1.00 15.00 ?  208 PRO B C    14 
ATOM 11321 O O    . PRO B 2 6  ? -4.055  -3.158  -7.758  1.00 15.00 ?  208 PRO B O    14 
ATOM 11322 C CB   . PRO B 2 6  ? -2.271  -3.965  -5.127  1.00 15.00 ?  208 PRO B CB   14 
ATOM 11323 C CG   . PRO B 2 6  ? -1.206  -4.831  -5.726  1.00 15.00 ?  208 PRO B CG   14 
ATOM 11324 C CD   . PRO B 2 6  ? -1.818  -5.540  -6.899  1.00 15.00 ?  208 PRO B CD   14 
ATOM 11325 H HA   . PRO B 2 6  ? -4.285  -4.689  -4.957  1.00 15.00 ?  208 PRO B HA   14 
ATOM 11326 H HB2  . PRO B 2 6  ? -2.096  -2.923  -5.356  1.00 15.00 ?  208 PRO B HB2  14 
ATOM 11327 H HB3  . PRO B 2 6  ? -2.322  -4.096  -4.052  1.00 15.00 ?  208 PRO B HB3  14 
ATOM 11328 H HG2  . PRO B 2 6  ? -0.380  -4.219  -6.055  1.00 15.00 ?  208 PRO B HG2  14 
ATOM 11329 H HG3  . PRO B 2 6  ? -0.868  -5.549  -4.993  1.00 15.00 ?  208 PRO B HG3  14 
ATOM 11330 H HD2  . PRO B 2 6  ? -1.642  -4.988  -7.812  1.00 15.00 ?  208 PRO B HD2  14 
ATOM 11331 H HD3  . PRO B 2 6  ? -1.418  -6.537  -6.974  1.00 15.00 ?  208 PRO B HD3  14 
ATOM 11332 N N    . PRO B 2 7  ? -4.945  -2.378  -5.824  1.00 15.00 ?  209 PRO B N    14 
ATOM 11333 C CA   . PRO B 2 7  ? -5.537  -1.157  -6.383  1.00 15.00 ?  209 PRO B CA   14 
ATOM 11334 C C    . PRO B 2 7  ? -4.544  -0.336  -7.214  1.00 15.00 ?  209 PRO B C    14 
ATOM 11335 O O    . PRO B 2 7  ? -3.425  -0.079  -6.768  1.00 15.00 ?  209 PRO B O    14 
ATOM 11336 C CB   . PRO B 2 7  ? -5.935  -0.340  -5.144  1.00 15.00 ?  209 PRO B CB   14 
ATOM 11337 C CG   . PRO B 2 7  ? -5.849  -1.246  -3.961  1.00 15.00 ?  209 PRO B CG   14 
ATOM 11338 C CD   . PRO B 2 7  ? -5.284  -2.562  -4.408  1.00 15.00 ?  209 PRO B CD   14 
ATOM 11339 H HA   . PRO B 2 7  ? -6.415  -1.374  -6.974  1.00 15.00 ?  209 PRO B HA   14 
ATOM 11340 H HB2  . PRO B 2 7  ? -5.258  0.492   -5.037  1.00 15.00 ?  209 PRO B HB2  14 
ATOM 11341 H HB3  . PRO B 2 7  ? -6.935  0.033   -5.265  1.00 15.00 ?  209 PRO B HB3  14 
ATOM 11342 H HG2  . PRO B 2 7  ? -5.200  -0.806  -3.217  1.00 15.00 ?  209 PRO B HG2  14 
ATOM 11343 H HG3  . PRO B 2 7  ? -6.837  -1.389  -3.547  1.00 15.00 ?  209 PRO B HG3  14 
ATOM 11344 H HD2  . PRO B 2 7  ? -4.400  -2.802  -3.835  1.00 15.00 ?  209 PRO B HD2  14 
ATOM 11345 H HD3  . PRO B 2 7  ? -6.023  -3.342  -4.292  1.00 15.00 ?  209 PRO B HD3  14 
ATOM 11346 N N    . PRO B 2 8  ? -4.953  0.095   -8.426  1.00 15.00 ?  210 PRO B N    14 
ATOM 11347 C CA   . PRO B 2 8  ? -4.132  0.953   -9.303  1.00 15.00 ?  210 PRO B CA   14 
ATOM 11348 C C    . PRO B 2 8  ? -3.617  2.188   -8.568  1.00 15.00 ?  210 PRO B C    14 
ATOM 11349 O O    . PRO B 2 8  ? -4.278  2.689   -7.652  1.00 15.00 ?  210 PRO B O    14 
ATOM 11350 C CB   . PRO B 2 8  ? -5.108  1.358   -10.410 1.00 15.00 ?  210 PRO B CB   14 
ATOM 11351 C CG   . PRO B 2 8  ? -6.101  0.252   -10.456 1.00 15.00 ?  210 PRO B CG   14 
ATOM 11352 C CD   . PRO B 2 8  ? -6.256  -0.223  -9.038  1.00 15.00 ?  210 PRO B CD   14 
ATOM 11353 H HA   . PRO B 2 8  ? -3.299  0.410   -9.727  1.00 15.00 ?  210 PRO B HA   14 
ATOM 11354 H HB2  . PRO B 2 8  ? -5.574  2.299   -10.156 1.00 15.00 ?  210 PRO B HB2  14 
ATOM 11355 H HB3  . PRO B 2 8  ? -4.578  1.453   -11.346 1.00 15.00 ?  210 PRO B HB3  14 
ATOM 11356 H HG2  . PRO B 2 8  ? -7.044  0.619   -10.835 1.00 15.00 ?  210 PRO B HG2  14 
ATOM 11357 H HG3  . PRO B 2 8  ? -5.730  -0.549  -11.079 1.00 15.00 ?  210 PRO B HG3  14 
ATOM 11358 H HD2  . PRO B 2 8  ? -7.053  0.315   -8.544  1.00 15.00 ?  210 PRO B HD2  14 
ATOM 11359 H HD3  . PRO B 2 8  ? -6.443  -1.286  -9.014  1.00 15.00 ?  210 PRO B HD3  14 
ATOM 11360 N N    . TYR B 2 9  ? -2.463  2.704   -8.982  1.00 15.00 ?  211 TYR B N    14 
ATOM 11361 C CA   . TYR B 2 9  ? -1.809  3.753   -8.220  1.00 15.00 ?  211 TYR B CA   14 
ATOM 11362 C C    . TYR B 2 9  ? -2.511  5.096   -8.352  1.00 15.00 ?  211 TYR B C    14 
ATOM 11363 O O    . TYR B 2 9  ? -2.286  5.861   -9.291  1.00 15.00 ?  211 TYR B O    14 
ATOM 11364 C CB   . TYR B 2 9  ? -0.331  3.912   -8.577  1.00 15.00 ?  211 TYR B CB   14 
ATOM 11365 C CG   . TYR B 2 9  ? 0.376   4.919   -7.683  1.00 15.00 ?  211 TYR B CG   14 
ATOM 11366 C CD1  . TYR B 2 9  ? 0.702   4.598   -6.369  1.00 15.00 ?  211 TYR B CD1  14 
ATOM 11367 C CD2  . TYR B 2 9  ? 0.710   6.190   -8.145  1.00 15.00 ?  211 TYR B CD2  14 
ATOM 11368 C CE1  . TYR B 2 9  ? 1.338   5.510   -5.548  1.00 15.00 ?  211 TYR B CE1  14 
ATOM 11369 C CE2  . TYR B 2 9  ? 1.345   7.102   -7.319  1.00 15.00 ?  211 TYR B CE2  14 
ATOM 11370 C CZ   . TYR B 2 9  ? 1.653   6.757   -6.033  1.00 15.00 ?  211 TYR B CZ   14 
ATOM 11371 O OH   . TYR B 2 9  ? 2.289   7.670   -5.233  1.00 15.00 ?  211 TYR B OH   14 
ATOM 11372 H H    . TYR B 2 9  ? -2.060  2.384   -9.823  1.00 15.00 ?  211 TYR B H    14 
ATOM 11373 H HA   . TYR B 2 9  ? -1.867  3.458   -7.184  1.00 15.00 ?  211 TYR B HA   14 
ATOM 11374 H HB2  . TYR B 2 9  ? 0.167   2.960   -8.470  1.00 15.00 ?  211 TYR B HB2  14 
ATOM 11375 H HB3  . TYR B 2 9  ? -0.244  4.252   -9.598  1.00 15.00 ?  211 TYR B HB3  14 
ATOM 11376 H HD1  . TYR B 2 9  ? 0.451   3.618   -5.989  1.00 15.00 ?  211 TYR B HD1  14 
ATOM 11377 H HD2  . TYR B 2 9  ? 0.463   6.463   -9.161  1.00 15.00 ?  211 TYR B HD2  14 
ATOM 11378 H HE1  . TYR B 2 9  ? 1.584   5.241   -4.531  1.00 15.00 ?  211 TYR B HE1  14 
ATOM 11379 H HE2  . TYR B 2 9  ? 1.597   8.086   -7.681  1.00 15.00 ?  211 TYR B HE2  14 
ATOM 11380 H HH   . TYR B 2 9  ? 2.078   8.569   -5.544  1.00 15.00 ?  211 TYR B HH   14 
ATOM 11381 N N    . SER B 2 10 ? -3.412  5.320   -7.429  1.00 15.00 ?  212 SER B N    14 
ATOM 11382 C CA   . SER B 2 10 ? -3.889  6.639   -7.100  1.00 15.00 ?  212 SER B CA   14 
ATOM 11383 C C    . SER B 2 10 ? -3.241  6.973   -5.768  1.00 15.00 ?  212 SER B C    14 
ATOM 11384 O O    . SER B 2 10 ? -2.960  6.051   -4.999  1.00 15.00 ?  212 SER B O    14 
ATOM 11385 C CB   . SER B 2 10 ? -5.419  6.657   -6.994  1.00 15.00 ?  212 SER B CB   14 
ATOM 11386 O OG   . SER B 2 10 ? -5.909  7.982   -6.863  1.00 15.00 ?  212 SER B OG   14 
ATOM 11387 H H    . SER B 2 10 ? -3.778  4.552   -6.940  1.00 15.00 ?  212 SER B H    14 
ATOM 11388 H HA   . SER B 2 10 ? -3.553  7.333   -7.857  1.00 15.00 ?  212 SER B HA   14 
ATOM 11389 H HB2  . SER B 2 10 ? -5.846  6.218   -7.883  1.00 15.00 ?  212 SER B HB2  14 
ATOM 11390 H HB3  . SER B 2 10 ? -5.725  6.086   -6.129  1.00 15.00 ?  212 SER B HB3  14 
ATOM 11391 H HG   . SER B 2 10 ? -6.838  8.009   -7.123  1.00 15.00 ?  212 SER B HG   14 
ATOM 11392 N N    . ARG B 2 11 ? -2.982  8.243   -5.481  1.00 15.00 ?  213 ARG B N    14 
ATOM 11393 C CA   . ARG B 2 11 ? -2.236  8.575   -4.272  1.00 15.00 ?  213 ARG B CA   14 
ATOM 11394 C C    . ARG B 2 11 ? -2.981  8.052   -3.058  1.00 15.00 ?  213 ARG B C    14 
ATOM 11395 O O    . ARG B 2 11 ? -2.416  7.355   -2.219  1.00 15.00 ?  213 ARG B O    14 
ATOM 11396 C CB   . ARG B 2 11 ? -2.057  10.084  -4.095  1.00 15.00 ?  213 ARG B CB   14 
ATOM 11397 C CG   . ARG B 2 11 ? -1.473  10.811  -5.276  1.00 15.00 ?  213 ARG B CG   14 
ATOM 11398 C CD   . ARG B 2 11 ? -1.222  12.279  -4.964  1.00 15.00 ?  213 ARG B CD   14 
ATOM 11399 N NE   . ARG B 2 11 ? -2.465  13.042  -4.866  1.00 15.00 ?  213 ARG B NE   14 
ATOM 11400 C CZ   . ARG B 2 11 ? -2.615  14.139  -4.122  1.00 15.00 ?  213 ARG B CZ   14 
ATOM 11401 N NH1  . ARG B 2 11 ? -1.629  14.560  -3.337  1.00 15.00 1  213 ARG B NH1  14 
ATOM 11402 N NH2  . ARG B 2 11 ? -3.764  14.798  -4.146  1.00 15.00 ?  213 ARG B NH2  14 
ATOM 11403 H H    . ARG B 2 11 ? -3.301  8.959   -6.076  1.00 15.00 ?  213 ARG B H    14 
ATOM 11404 H HA   . ARG B 2 11 ? -1.267  8.100   -4.330  1.00 15.00 ?  213 ARG B HA   14 
ATOM 11405 H HB2  . ARG B 2 11 ? -3.021  10.520  -3.884  1.00 15.00 ?  213 ARG B HB2  14 
ATOM 11406 H HB3  . ARG B 2 11 ? -1.411  10.254  -3.246  1.00 15.00 ?  213 ARG B HB3  14 
ATOM 11407 H HG2  . ARG B 2 11 ? -0.544  10.348  -5.548  1.00 15.00 ?  213 ARG B HG2  14 
ATOM 11408 H HG3  . ARG B 2 11 ? -2.175  10.747  -6.084  1.00 15.00 ?  213 ARG B HG3  14 
ATOM 11409 H HD2  . ARG B 2 11 ? -0.692  12.349  -4.026  1.00 15.00 ?  213 ARG B HD2  14 
ATOM 11410 H HD3  . ARG B 2 11 ? -0.614  12.699  -5.751  1.00 15.00 ?  213 ARG B HD3  14 
ATOM 11411 H HE   . ARG B 2 11 ? -3.227  12.733  -5.410  1.00 15.00 ?  213 ARG B HE   14 
ATOM 11412 H HH11 . ARG B 2 11 ? -0.762  14.053  -3.293  1.00 15.00 ?  213 ARG B HH11 14 
ATOM 11413 H HH12 . ARG B 2 11 ? -1.740  15.401  -2.789  1.00 15.00 ?  213 ARG B HH12 14 
ATOM 11414 H HH21 . ARG B 2 11 ? -4.521  14.468  -4.729  1.00 15.00 ?  213 ARG B HH21 14 
ATOM 11415 H HH22 . ARG B 2 11 ? -3.892  15.626  -3.585  1.00 15.00 ?  213 ARG B HH22 14 
ATOM 11416 N N    . TYR B 2 12 ? -4.241  8.438   -2.950  1.00 15.00 ?  214 TYR B N    14 
ATOM 11417 C CA   . TYR B 2 12 ? -5.090  7.987   -1.864  1.00 15.00 ?  214 TYR B CA   14 
ATOM 11418 C C    . TYR B 2 12 ? -6.301  7.249   -2.425  1.00 15.00 ?  214 TYR B C    14 
ATOM 11419 O O    . TYR B 2 12 ? -7.383  7.816   -2.588  1.00 15.00 ?  214 TYR B O    14 
ATOM 11420 C CB   . TYR B 2 12 ? -5.469  9.188   -0.984  1.00 15.00 ?  214 TYR B CB   14 
ATOM 11421 C CG   . TYR B 2 12 ? -4.255  10.047  -0.659  1.00 15.00 ?  214 TYR B CG   14 
ATOM 11422 C CD1  . TYR B 2 12 ? -3.700  10.889  -1.623  1.00 15.00 ?  214 TYR B CD1  14 
ATOM 11423 C CD2  . TYR B 2 12 ? -3.629  9.977   0.578   1.00 15.00 ?  214 TYR B CD2  14 
ATOM 11424 C CE1  . TYR B 2 12 ? -2.564  11.625  -1.368  1.00 15.00 ?  214 TYR B CE1  14 
ATOM 11425 C CE2  . TYR B 2 12 ? -2.494  10.725  0.845   1.00 15.00 ?  214 TYR B CE2  14 
ATOM 11426 C CZ   . TYR B 2 12 ? -1.965  11.542  -0.131  1.00 15.00 ?  214 TYR B CZ   14 
ATOM 11427 O OH   . TYR B 2 12 ? -0.822  12.262  0.129   1.00 15.00 ?  214 TYR B OH   14 
ATOM 11428 H H    . TYR B 2 12 ? -4.616  9.053   -3.623  1.00 15.00 ?  214 TYR B H    14 
ATOM 11429 H HA   . TYR B 2 12 ? -4.518  7.275   -1.275  1.00 15.00 ?  214 TYR B HA   14 
ATOM 11430 H HB2  . TYR B 2 12 ? -6.190  9.803   -1.506  1.00 15.00 ?  214 TYR B HB2  14 
ATOM 11431 H HB3  . TYR B 2 12 ? -5.894  8.838   -0.056  1.00 15.00 ?  214 TYR B HB3  14 
ATOM 11432 H HD1  . TYR B 2 12 ? -4.165  10.952  -2.601  1.00 15.00 ?  214 TYR B HD1  14 
ATOM 11433 H HD2  . TYR B 2 12 ? -4.044  9.337   1.342   1.00 15.00 ?  214 TYR B HD2  14 
ATOM 11434 H HE1  . TYR B 2 12 ? -2.149  12.257  -2.149  1.00 15.00 ?  214 TYR B HE1  14 
ATOM 11435 H HE2  . TYR B 2 12 ? -2.018  10.660  1.810   1.00 15.00 ?  214 TYR B HE2  14 
ATOM 11436 H HH   . TYR B 2 12 ? -0.214  11.709  0.651   1.00 15.00 ?  214 TYR B HH   14 
ATOM 11437 N N    . PRO B 2 13 ? -6.086  5.981   -2.790  1.00 15.00 ?  215 PRO B N    14 
ATOM 11438 C CA   . PRO B 2 13 ? -7.100  5.139   -3.428  1.00 15.00 ?  215 PRO B CA   14 
ATOM 11439 C C    . PRO B 2 13 ? -8.203  4.699   -2.469  1.00 15.00 ?  215 PRO B C    14 
ATOM 11440 O O    . PRO B 2 13 ? -7.992  3.833   -1.623  1.00 15.00 ?  215 PRO B O    14 
ATOM 11441 C CB   . PRO B 2 13 ? -6.298  3.930   -3.916  1.00 15.00 ?  215 PRO B CB   14 
ATOM 11442 C CG   . PRO B 2 13 ? -5.107  3.870   -3.014  1.00 15.00 ?  215 PRO B CG   14 
ATOM 11443 C CD   . PRO B 2 13 ? -4.804  5.276   -2.619  1.00 15.00 ?  215 PRO B CD   14 
ATOM 11444 H HA   . PRO B 2 13 ? -7.547  5.638   -4.276  1.00 15.00 ?  215 PRO B HA   14 
ATOM 11445 H HB2  . PRO B 2 13 ? -6.901  3.039   -3.834  1.00 15.00 ?  215 PRO B HB2  14 
ATOM 11446 H HB3  . PRO B 2 13 ? -6.005  4.081   -4.944  1.00 15.00 ?  215 PRO B HB3  14 
ATOM 11447 H HG2  . PRO B 2 13 ? -5.335  3.287   -2.130  1.00 15.00 ?  215 PRO B HG2  14 
ATOM 11448 H HG3  . PRO B 2 13 ? -4.263  3.444   -3.538  1.00 15.00 ?  215 PRO B HG3  14 
ATOM 11449 H HD2  . PRO B 2 13 ? -4.481  5.314   -1.589  1.00 15.00 ?  215 PRO B HD2  14 
ATOM 11450 H HD3  . PRO B 2 13 ? -4.046  5.693   -3.266  1.00 15.00 ?  215 PRO B HD3  14 
ATOM 11451 N N    . MET B 2 14 ? -9.372  5.309   -2.595  1.00 15.00 ?  216 MET B N    14 
ATOM 11452 C CA   . MET B 2 14 ? -10.490 5.002   -1.712  1.00 15.00 ?  216 MET B CA   14 
ATOM 11453 C C    . MET B 2 14 ? -11.123 3.665   -2.076  1.00 15.00 ?  216 MET B C    14 
ATOM 11454 O O    . MET B 2 14 ? -11.610 3.476   -3.194  1.00 15.00 ?  216 MET B O    14 
AT