data_2LUC
# 
_entry.id   2LUC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LUC         
RCSB  RCSB102843   
BMRB  18425        
WWPDB D_1000102843 
# 
_pdbx_database_related.db_id          18425 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LUC 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-06-12 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hung, K.W.'  1 
'Chang, Y.M.' 2 
'Yu, C.'      3 
# 
_citation.id                        primary 
_citation.title                     'NMR structure note: the structure of human calcium-bound S100A11.' 
_citation.journal_abbrev            J.Biomol.Nmr 
_citation.journal_volume            54 
_citation.page_first                211 
_citation.page_last                 215 
_citation.year                      2012 
_citation.journal_id_ASTM           JBNME9 
_citation.country                   NE 
_citation.journal_id_ISSN           0925-2738 
_citation.journal_id_CSD            0800 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22903637 
_citation.pdbx_database_id_DOI      10.1007/s10858-012-9661-2 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hung, K.W.'  1 
primary 'Chang, Y.M.' 2 
primary 'Yu, C.'      3 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Protein S100-A11' 
_entity.formula_weight             11754.437 
_entity.pdbx_number_of_molecules   2 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'Calgizzarin, Metastatic lymph node gene 70 protein, MLN 70, Protein S100-C, S100 calcium-binding protein A11' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEF
LNLIGGLAMACHDSFLKAVPSQKRT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEF
LNLIGGLAMACHDSFLKAVPSQKRT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   LYS n 
1 4   ILE n 
1 5   SER n 
1 6   SER n 
1 7   PRO n 
1 8   THR n 
1 9   GLU n 
1 10  THR n 
1 11  GLU n 
1 12  ARG n 
1 13  CYS n 
1 14  ILE n 
1 15  GLU n 
1 16  SER n 
1 17  LEU n 
1 18  ILE n 
1 19  ALA n 
1 20  VAL n 
1 21  PHE n 
1 22  GLN n 
1 23  LYS n 
1 24  TYR n 
1 25  ALA n 
1 26  GLY n 
1 27  LYS n 
1 28  ASP n 
1 29  GLY n 
1 30  TYR n 
1 31  ASN n 
1 32  TYR n 
1 33  THR n 
1 34  LEU n 
1 35  SER n 
1 36  LYS n 
1 37  THR n 
1 38  GLU n 
1 39  PHE n 
1 40  LEU n 
1 41  SER n 
1 42  PHE n 
1 43  MET n 
1 44  ASN n 
1 45  THR n 
1 46  GLU n 
1 47  LEU n 
1 48  ALA n 
1 49  ALA n 
1 50  PHE n 
1 51  THR n 
1 52  LYS n 
1 53  ASN n 
1 54  GLN n 
1 55  LYS n 
1 56  ASP n 
1 57  PRO n 
1 58  GLY n 
1 59  VAL n 
1 60  LEU n 
1 61  ASP n 
1 62  ARG n 
1 63  MET n 
1 64  MET n 
1 65  LYS n 
1 66  LYS n 
1 67  LEU n 
1 68  ASP n 
1 69  THR n 
1 70  ASN n 
1 71  SER n 
1 72  ASP n 
1 73  GLY n 
1 74  GLN n 
1 75  LEU n 
1 76  ASP n 
1 77  PHE n 
1 78  SER n 
1 79  GLU n 
1 80  PHE n 
1 81  LEU n 
1 82  ASN n 
1 83  LEU n 
1 84  ILE n 
1 85  GLY n 
1 86  GLY n 
1 87  LEU n 
1 88  ALA n 
1 89  MET n 
1 90  ALA n 
1 91  CYS n 
1 92  HIS n 
1 93  ASP n 
1 94  SER n 
1 95  PHE n 
1 96  LEU n 
1 97  LYS n 
1 98  ALA n 
1 99  VAL n 
1 100 PRO n 
1 101 SER n 
1 102 GLN n 
1 103 LYS n 
1 104 ARG n 
1 105 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S100A11, MLN70, S100C' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET20b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10AB_HUMAN 
_struct_ref.pdbx_db_accession          P31949 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MAKISSPTETERCIESLIAVFQKYAGKDGYNYTLSKTEFLSFMNTELAAFTKNQKDPGVLDRMMKKLDTNSDGQLDFSEF
LNLIGGLAMACHDSFLKAVPSQKRT
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LUC A 1 ? 105 ? P31949 1 ? 105 ? 1 105 
2 1 2LUC B 1 ? 105 ? P31949 1 ? 105 ? 1 105 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                           
1 2  1 '2D 1H-13C HSQC'                           
1 3  1 '3D HNCA'                                  
1 4  1 '3D HN(CO)CA'                              
1 5  1 '3D HNCACB'                                
1 6  1 '3D CBCA(CO)NH'                            
1 7  1 '3D HNCO'                                  
1 8  1 '3D HN(CA)CO'                              
1 9  1 '3D HCCH-TOCSY'                            
1 10 1 '3D HCCH-COSY'                             
1 11 1 '3D 15N-edited NOESY-HSQC'                 
1 12 1 '3D 13C-edited NOESY-HSQC'                 
1 13 1 '3D 13C F1-filtered, F3-edited NOESY-HSQC' 
1 14 1 '3D HBHA(CO)NH'                            
1 15 1 '3D H(CCO)NH'                              
1 16 1 '3D C(CO)NH'                               
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.0725 
_pdbx_nmr_exptl_sample_conditions.pH                  7.5 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         
;1 mM [U-100% 13C; U-100% 15N] S100A11, 25 mM TRIS, 100 mM sodium chloride, 5 mM calcium chloride, 90 % H2O, 10 % D2O, 90% H2O/10% D2O
;
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
700 Varian VNMRS  1 'Varian VNMRS'  
800 Bruker Avance 2 'Bruker Avance' 
# 
_pdbx_nmr_refine.entry_id           2LUC 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            200 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LUC 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LUC 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Varian                         collection                  VNMRJ   ? 1 
Varian                         processing                  VNMRJ   ? 2 
'Bruker Biospin'               collection                  TOPSPIN ? 3 
'Bruker Biospin'               processing                  TOPSPIN ? 4 
Goddard                        'data analysis'             SPARKY  ? 5 
Goddard                        'peak picking'              SPARKY  ? 6 
Goddard                        'chemical shift assignment' SPARKY  ? 7 
;Linge, O'Donoghue and Nilges
;
'structure solution'        ARIA    ? 8 
;Linge, O'Donoghue and Nilges
;
refinement                  ARIA    ? 9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LUC 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LUC 
_struct.title                     'Solution Structure of human S100 calcium-binding protein A11' 
_struct.pdbx_descriptor           'Protein S100-A11' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LUC 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'EF-hand motif, homodimer, calcium-binding protein, METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 8  ? GLY A 29 ? THR A 8  GLY A 29 1 ? 22 
HELX_P HELX_P2  2  LYS A 36 ? GLU A 46 ? LYS A 36 GLU A 46 1 ? 11 
HELX_P HELX_P3  3  LEU A 47 ? LYS A 55 ? LEU A 47 LYS A 55 1 ? 9  
HELX_P HELX_P4  4  PRO A 57 ? ASP A 68 ? PRO A 57 ASP A 68 1 ? 12 
HELX_P HELX_P5  5  ASP A 76 ? LYS A 97 ? ASP A 76 LYS A 97 1 ? 22 
HELX_P HELX_P6  6  THR B 8  ? GLY B 29 ? THR B 8  GLY B 29 1 ? 22 
HELX_P HELX_P7  7  LYS B 36 ? GLU B 46 ? LYS B 36 GLU B 46 1 ? 11 
HELX_P HELX_P8  8  LEU B 47 ? LYS B 55 ? LEU B 47 LYS B 55 1 ? 9  
HELX_P HELX_P9  9  PRO B 57 ? ASP B 68 ? PRO B 57 ASP B 68 1 ? 12 
HELX_P HELX_P10 10 ASP B 76 ? LYS B 97 ? ASP B 76 LYS B 97 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 34 ? SER A 35 ? LEU A 34 SER A 35 
A 2 GLN A 74 ? LEU A 75 ? GLN A 74 LEU A 75 
B 1 LEU B 34 ? SER B 35 ? LEU B 34 SER B 35 
B 2 GLN B 74 ? LEU B 75 ? GLN B 74 LEU B 75 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 34 ? N LEU A 34 O LEU A 75 ? O LEU A 75 
B 1 2 N LEU B 34 ? N LEU B 34 O LEU B 75 ? O LEU B 75 
# 
_atom_sites.entry_id                    2LUC 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . MET A 1 1   ? -12.002 9.201   25.046  1.00 7.63  ? 1   MET A N    1  
ATOM 2     C CA   . MET A 1 1   ? -11.470 9.541   23.707  1.00 7.05  ? 1   MET A CA   1  
ATOM 3     C C    . MET A 1 1   ? -11.663 8.375   22.741  1.00 6.84  ? 1   MET A C    1  
ATOM 4     O O    . MET A 1 1   ? -10.961 7.363   22.806  1.00 7.12  ? 1   MET A O    1  
ATOM 5     C CB   . MET A 1 1   ? -9.987  9.933   23.794  1.00 7.11  ? 1   MET A CB   1  
ATOM 6     C CG   . MET A 1 1   ? -9.109  8.903   24.487  1.00 7.39  ? 1   MET A CG   1  
ATOM 7     S SD   . MET A 1 1   ? -7.369  9.364   24.493  1.00 7.66  ? 1   MET A SD   1  
ATOM 8     C CE   . MET A 1 1   ? -6.647  7.941   25.306  1.00 7.91  ? 1   MET A CE   1  
ATOM 9     H H1   . MET A 1 1   ? -11.520 8.363   25.421  1.00 7.95  ? 1   MET A H1   1  
ATOM 10    H H2   . MET A 1 1   ? -13.020 8.997   24.982  1.00 7.75  ? 1   MET A H2   1  
ATOM 11    H H3   . MET A 1 1   ? -11.860 9.994   25.703  1.00 7.88  ? 1   MET A H3   1  
ATOM 12    H HA   . MET A 1 1   ? -12.031 10.386  23.333  1.00 7.07  ? 1   MET A HA   1  
ATOM 13    H HB2  . MET A 1 1   ? -9.607  10.077  22.794  1.00 7.26  ? 1   MET A HB2  1  
ATOM 14    H HB3  . MET A 1 1   ? -9.905  10.864  24.335  1.00 7.17  ? 1   MET A HB3  1  
ATOM 15    H HG2  . MET A 1 1   ? -9.441  8.796   25.509  1.00 7.57  ? 1   MET A HG2  1  
ATOM 16    H HG3  . MET A 1 1   ? -9.215  7.956   23.976  1.00 7.61  ? 1   MET A HG3  1  
ATOM 17    H HE1  . MET A 1 1   ? -5.578  8.077   25.386  1.00 8.15  ? 1   MET A HE1  1  
ATOM 18    H HE2  . MET A 1 1   ? -6.854  7.053   24.729  1.00 8.15  ? 1   MET A HE2  1  
ATOM 19    H HE3  . MET A 1 1   ? -7.071  7.838   26.293  1.00 7.92  ? 1   MET A HE3  1  
ATOM 20    N N    . ALA A 1 2   ? -12.632 8.514   21.853  1.00 6.67  ? 2   ALA A N    1  
ATOM 21    C CA   . ALA A 1 2   ? -12.934 7.473   20.885  1.00 6.74  ? 2   ALA A CA   1  
ATOM 22    C C    . ALA A 1 2   ? -12.046 7.603   19.656  1.00 6.14  ? 2   ALA A C    1  
ATOM 23    O O    . ALA A 1 2   ? -11.593 6.607   19.093  1.00 6.28  ? 2   ALA A O    1  
ATOM 24    C CB   . ALA A 1 2   ? -14.400 7.533   20.489  1.00 7.31  ? 2   ALA A CB   1  
ATOM 25    H H    . ALA A 1 2   ? -13.163 9.342   21.849  1.00 6.72  ? 2   ALA A H    1  
ATOM 26    H HA   . ALA A 1 2   ? -12.749 6.517   21.353  1.00 7.13  ? 2   ALA A HA   1  
ATOM 27    H HB1  . ALA A 1 2   ? -14.619 6.730   19.803  1.00 7.69  ? 2   ALA A HB1  1  
ATOM 28    H HB2  . ALA A 1 2   ? -14.605 8.481   20.013  1.00 7.46  ? 2   ALA A HB2  1  
ATOM 29    H HB3  . ALA A 1 2   ? -15.014 7.433   21.371  1.00 7.49  ? 2   ALA A HB3  1  
ATOM 30    N N    . LYS A 1 3   ? -11.785 8.839   19.257  1.00 5.79  ? 3   LYS A N    1  
ATOM 31    C CA   . LYS A 1 3   ? -10.990 9.106   18.069  1.00 5.52  ? 3   LYS A CA   1  
ATOM 32    C C    . LYS A 1 3   ? -9.511  9.226   18.433  1.00 5.00  ? 3   LYS A C    1  
ATOM 33    O O    . LYS A 1 3   ? -8.925  10.308  18.381  1.00 5.14  ? 3   LYS A O    1  
ATOM 34    C CB   . LYS A 1 3   ? -11.489 10.386  17.386  1.00 6.00  ? 3   LYS A CB   1  
ATOM 35    C CG   . LYS A 1 3   ? -10.850 10.669  16.031  1.00 6.27  ? 3   LYS A CG   1  
ATOM 36    C CD   . LYS A 1 3   ? -11.135 9.561   15.029  1.00 6.96  ? 3   LYS A CD   1  
ATOM 37    C CE   . LYS A 1 3   ? -10.605 9.912   13.648  1.00 7.45  ? 3   LYS A CE   1  
ATOM 38    N NZ   . LYS A 1 3   ? -10.794 8.802   12.678  1.00 7.92  ? 3   LYS A NZ   1  
ATOM 39    H H    . LYS A 1 3   ? -12.128 9.594   19.782  1.00 5.95  ? 3   LYS A H    1  
ATOM 40    H HA   . LYS A 1 3   ? -11.117 8.275   17.393  1.00 5.71  ? 3   LYS A HA   1  
ATOM 41    H HB2  . LYS A 1 3   ? -12.557 10.310  17.243  1.00 6.29  ? 3   LYS A HB2  1  
ATOM 42    H HB3  . LYS A 1 3   ? -11.285 11.225  18.035  1.00 6.28  ? 3   LYS A HB3  1  
ATOM 43    H HG2  . LYS A 1 3   ? -11.244 11.597  15.645  1.00 6.42  ? 3   LYS A HG2  1  
ATOM 44    H HG3  . LYS A 1 3   ? -9.781  10.759  16.161  1.00 6.21  ? 3   LYS A HG3  1  
ATOM 45    H HD2  . LYS A 1 3   ? -10.659 8.652   15.364  1.00 7.10  ? 3   LYS A HD2  1  
ATOM 46    H HD3  . LYS A 1 3   ? -12.203 9.409   14.968  1.00 7.33  ? 3   LYS A HD3  1  
ATOM 47    H HE2  . LYS A 1 3   ? -11.131 10.783  13.287  1.00 7.69  ? 3   LYS A HE2  1  
ATOM 48    H HE3  . LYS A 1 3   ? -9.552  10.135  13.726  1.00 7.56  ? 3   LYS A HE3  1  
ATOM 49    H HZ1  . LYS A 1 3   ? -10.455 9.087   11.738  1.00 7.97  ? 3   LYS A HZ1  1  
ATOM 50    H HZ2  . LYS A 1 3   ? -11.802 8.554   12.609  1.00 8.25  ? 3   LYS A HZ2  1  
ATOM 51    H HZ3  . LYS A 1 3   ? -10.262 7.962   12.985  1.00 8.16  ? 3   LYS A HZ3  1  
ATOM 52    N N    . ILE A 1 4   ? -8.916  8.107   18.821  1.00 4.74  ? 4   ILE A N    1  
ATOM 53    C CA   . ILE A 1 4   ? -7.502  8.076   19.170  1.00 4.41  ? 4   ILE A CA   1  
ATOM 54    C C    . ILE A 1 4   ? -6.648  7.925   17.919  1.00 3.66  ? 4   ILE A C    1  
ATOM 55    O O    . ILE A 1 4   ? -5.471  8.287   17.904  1.00 3.90  ? 4   ILE A O    1  
ATOM 56    C CB   . ILE A 1 4   ? -7.175  6.932   20.155  1.00 5.14  ? 4   ILE A CB   1  
ATOM 57    C CG1  . ILE A 1 4   ? -7.590  5.578   19.571  1.00 5.77  ? 4   ILE A CG1  1  
ATOM 58    C CG2  . ILE A 1 4   ? -7.861  7.174   21.491  1.00 5.58  ? 4   ILE A CG2  1  
ATOM 59    C CD1  . ILE A 1 4   ? -7.201  4.398   20.436  1.00 6.53  ? 4   ILE A CD1  1  
ATOM 60    H H    . ILE A 1 4   ? -9.443  7.278   18.867  1.00 5.01  ? 4   ILE A H    1  
ATOM 61    H HA   . ILE A 1 4   ? -7.260  9.015   19.647  1.00 4.58  ? 4   ILE A HA   1  
ATOM 62    H HB   . ILE A 1 4   ? -6.108  6.931   20.324  1.00 5.37  ? 4   ILE A HB   1  
ATOM 63    H HG12 . ILE A 1 4   ? -8.664  5.559   19.450  1.00 5.98  ? 4   ILE A HG12 1  
ATOM 64    H HG13 . ILE A 1 4   ? -7.122  5.452   18.605  1.00 5.87  ? 4   ILE A HG13 1  
ATOM 65    H HG21 . ILE A 1 4   ? -7.516  8.107   21.911  1.00 5.92  ? 4   ILE A HG21 1  
ATOM 66    H HG22 . ILE A 1 4   ? -7.626  6.367   22.168  1.00 5.99  ? 4   ILE A HG22 1  
ATOM 67    H HG23 . ILE A 1 4   ? -8.931  7.220   21.344  1.00 5.54  ? 4   ILE A HG23 1  
ATOM 68    H HD11 . ILE A 1 4   ? -6.127  4.375   20.551  1.00 6.97  ? 4   ILE A HD11 1  
ATOM 69    H HD12 . ILE A 1 4   ? -7.533  3.483   19.968  1.00 6.74  ? 4   ILE A HD12 1  
ATOM 70    H HD13 . ILE A 1 4   ? -7.665  4.495   21.406  1.00 6.72  ? 4   ILE A HD13 1  
ATOM 71    N N    . SER A 1 5   ? -7.252  7.395   16.869  1.00 3.24  ? 5   SER A N    1  
ATOM 72    C CA   . SER A 1 5   ? -6.564  7.202   15.611  1.00 2.93  ? 5   SER A CA   1  
ATOM 73    C C    . SER A 1 5   ? -7.028  8.229   14.590  1.00 2.01  ? 5   SER A C    1  
ATOM 74    O O    . SER A 1 5   ? -8.092  8.082   13.982  1.00 2.25  ? 5   SER A O    1  
ATOM 75    C CB   . SER A 1 5   ? -6.818  5.787   15.087  1.00 3.70  ? 5   SER A CB   1  
ATOM 76    O OG   . SER A 1 5   ? -6.431  4.813   16.044  1.00 4.46  ? 5   SER A OG   1  
ATOM 77    H H    . SER A 1 5   ? -8.193  7.125   16.943  1.00 3.53  ? 5   SER A H    1  
ATOM 78    H HA   . SER A 1 5   ? -5.508  7.331   15.785  1.00 3.38  ? 5   SER A HA   1  
ATOM 79    H HB2  . SER A 1 5   ? -7.870  5.667   14.874  1.00 3.91  ? 5   SER A HB2  1  
ATOM 80    H HB3  . SER A 1 5   ? -6.247  5.632   14.183  1.00 4.03  ? 5   SER A HB3  1  
ATOM 81    H HG   . SER A 1 5   ? -5.531  4.999   16.340  1.00 4.64  ? 5   SER A HG   1  
ATOM 82    N N    . SER A 1 6   ? -6.246  9.293   14.436  1.00 1.51  ? 6   SER A N    1  
ATOM 83    C CA   . SER A 1 6   ? -6.498  10.279  13.398  1.00 1.03  ? 6   SER A CA   1  
ATOM 84    C C    . SER A 1 6   ? -6.486  9.612   12.016  1.00 0.82  ? 6   SER A C    1  
ATOM 85    O O    . SER A 1 6   ? -7.392  9.844   11.214  1.00 0.85  ? 6   SER A O    1  
ATOM 86    C CB   . SER A 1 6   ? -5.474  11.416  13.474  1.00 1.67  ? 6   SER A CB   1  
ATOM 87    O OG   . SER A 1 6   ? -5.474  12.007  14.765  1.00 2.25  ? 6   SER A OG   1  
ATOM 88    H H    . SER A 1 6   ? -5.485  9.419   15.039  1.00 1.99  ? 6   SER A H    1  
ATOM 89    H HA   . SER A 1 6   ? -7.483  10.686  13.571  1.00 1.21  ? 6   SER A HA   1  
ATOM 90    H HB2  . SER A 1 6   ? -4.489  11.028  13.270  1.00 2.13  ? 6   SER A HB2  1  
ATOM 91    H HB3  . SER A 1 6   ? -5.722  12.173  12.745  1.00 2.15  ? 6   SER A HB3  1  
ATOM 92    H HG   . SER A 1 6   ? -6.251  12.576  14.854  1.00 2.50  ? 6   SER A HG   1  
ATOM 93    N N    . PRO A 1 7   ? -5.470  8.774   11.702  1.00 0.69  ? 7   PRO A N    1  
ATOM 94    C CA   . PRO A 1 7   ? -5.497  7.941   10.503  1.00 0.54  ? 7   PRO A CA   1  
ATOM 95    C C    . PRO A 1 7   ? -6.222  6.628   10.760  1.00 0.44  ? 7   PRO A C    1  
ATOM 96    O O    . PRO A 1 7   ? -6.263  6.136   11.890  1.00 0.56  ? 7   PRO A O    1  
ATOM 97    C CB   . PRO A 1 7   ? -4.019  7.677   10.264  1.00 0.61  ? 7   PRO A CB   1  
ATOM 98    C CG   . PRO A 1 7   ? -3.491  7.521   11.639  1.00 0.75  ? 7   PRO A CG   1  
ATOM 99    C CD   . PRO A 1 7   ? -4.203  8.573   12.451  1.00 0.82  ? 7   PRO A CD   1  
ATOM 100   H HA   . PRO A 1 7   ? -5.930  8.450   9.657   1.00 0.57  ? 7   PRO A HA   1  
ATOM 101   H HB2  . PRO A 1 7   ? -3.894  6.778   9.678   1.00 0.60  ? 7   PRO A HB2  1  
ATOM 102   H HB3  . PRO A 1 7   ? -3.569  8.519   9.758   1.00 0.68  ? 7   PRO A HB3  1  
ATOM 103   H HG2  . PRO A 1 7   ? -3.734  6.531   12.007  1.00 0.75  ? 7   PRO A HG2  1  
ATOM 104   H HG3  . PRO A 1 7   ? -2.427  7.685   11.652  1.00 0.87  ? 7   PRO A HG3  1  
ATOM 105   H HD2  . PRO A 1 7   ? -4.395  8.213   13.451  1.00 0.93  ? 7   PRO A HD2  1  
ATOM 106   H HD3  . PRO A 1 7   ? -3.623  9.483   12.479  1.00 0.90  ? 7   PRO A HD3  1  
ATOM 107   N N    . THR A 1 8   ? -6.803  6.070   9.722   1.00 0.34  ? 8   THR A N    1  
ATOM 108   C CA   . THR A 1 8   ? -7.424  4.769   9.828   1.00 0.27  ? 8   THR A CA   1  
ATOM 109   C C    . THR A 1 8   ? -6.392  3.693   9.558   1.00 0.28  ? 8   THR A C    1  
ATOM 110   O O    . THR A 1 8   ? -5.221  4.001   9.358   1.00 0.35  ? 8   THR A O    1  
ATOM 111   C CB   . THR A 1 8   ? -8.567  4.624   8.828   1.00 0.28  ? 8   THR A CB   1  
ATOM 112   O OG1  . THR A 1 8   ? -8.028  4.547   7.507   1.00 0.36  ? 8   THR A OG1  1  
ATOM 113   C CG2  . THR A 1 8   ? -9.514  5.802   8.949   1.00 0.32  ? 8   THR A CG2  1  
ATOM 114   H H    . THR A 1 8   ? -6.827  6.551   8.863   1.00 0.42  ? 8   THR A H    1  
ATOM 115   H HA   . THR A 1 8   ? -7.815  4.652   10.827  1.00 0.31  ? 8   THR A HA   1  
ATOM 116   H HB   . THR A 1 8   ? -9.112  3.720   9.041   1.00 0.32  ? 8   THR A HB   1  
ATOM 117   H HG1  . THR A 1 8   ? -8.528  5.135   6.920   1.00 0.31  ? 8   THR A HG1  1  
ATOM 118   H HG21 . THR A 1 8   ? -10.133 5.673   9.823   1.00 1.05  ? 8   THR A HG21 1  
ATOM 119   H HG22 . THR A 1 8   ? -10.132 5.859   8.069   1.00 1.08  ? 8   THR A HG22 1  
ATOM 120   H HG23 . THR A 1 8   ? -8.942  6.709   9.047   1.00 1.04  ? 8   THR A HG23 1  
ATOM 121   N N    . GLU A 1 9   ? -6.819  2.450   9.509   1.00 0.28  ? 9   GLU A N    1  
ATOM 122   C CA   . GLU A 1 9   ? -5.897  1.340   9.310   1.00 0.33  ? 9   GLU A CA   1  
ATOM 123   C C    . GLU A 1 9   ? -5.193  1.432   7.950   1.00 0.36  ? 9   GLU A C    1  
ATOM 124   O O    . GLU A 1 9   ? -4.016  1.090   7.827   1.00 0.52  ? 9   GLU A O    1  
ATOM 125   C CB   . GLU A 1 9   ? -6.647  0.023   9.460   1.00 0.40  ? 9   GLU A CB   1  
ATOM 126   C CG   . GLU A 1 9   ? -5.763  -1.200  9.369   1.00 0.56  ? 9   GLU A CG   1  
ATOM 127   C CD   . GLU A 1 9   ? -6.283  -2.355  10.194  1.00 1.73  ? 9   GLU A CD   1  
ATOM 128   O OE1  . GLU A 1 9   ? -7.508  -2.581  10.205  1.00 2.47  ? 9   GLU A OE1  1  
ATOM 129   O OE2  . GLU A 1 9   ? -5.463  -3.040  10.839  1.00 2.48  ? 9   GLU A OE2  1  
ATOM 130   H H    . GLU A 1 9   ? -7.781  2.271   9.607   1.00 0.29  ? 9   GLU A H    1  
ATOM 131   H HA   . GLU A 1 9   ? -5.144  1.398   10.084  1.00 0.37  ? 9   GLU A HA   1  
ATOM 132   H HB2  . GLU A 1 9   ? -7.140  0.011   10.418  1.00 0.44  ? 9   GLU A HB2  1  
ATOM 133   H HB3  . GLU A 1 9   ? -7.393  -0.042  8.678   1.00 0.38  ? 9   GLU A HB3  1  
ATOM 134   H HG2  . GLU A 1 9   ? -5.712  -1.511  8.334   1.00 0.94  ? 9   GLU A HG2  1  
ATOM 135   H HG3  . GLU A 1 9   ? -4.773  -0.941  9.716   1.00 0.73  ? 9   GLU A HG3  1  
ATOM 136   N N    . THR A 1 10  ? -5.893  1.931   6.941   1.00 0.26  ? 10  THR A N    1  
ATOM 137   C CA   . THR A 1 10  ? -5.290  2.112   5.626   1.00 0.27  ? 10  THR A CA   1  
ATOM 138   C C    . THR A 1 10  ? -4.442  3.365   5.600   1.00 0.27  ? 10  THR A C    1  
ATOM 139   O O    . THR A 1 10  ? -3.372  3.380   5.007   1.00 0.31  ? 10  THR A O    1  
ATOM 140   C CB   . THR A 1 10  ? -6.335  2.155   4.479   1.00 0.27  ? 10  THR A CB   1  
ATOM 141   O OG1  . THR A 1 10  ? -5.894  3.026   3.432   1.00 0.40  ? 10  THR A OG1  1  
ATOM 142   C CG2  . THR A 1 10  ? -7.698  2.606   4.980   1.00 0.25  ? 10  THR A CG2  1  
ATOM 143   H H    . THR A 1 10  ? -6.821  2.206   7.088   1.00 0.22  ? 10  THR A H    1  
ATOM 144   H HA   . THR A 1 10  ? -4.637  1.273   5.449   1.00 0.31  ? 10  THR A HA   1  
ATOM 145   H HB   . THR A 1 10  ? -6.432  1.157   4.070   1.00 0.34  ? 10  THR A HB   1  
ATOM 146   H HG1  . THR A 1 10  ? -4.933  3.008   3.378   1.00 1.00  ? 10  THR A HG1  1  
ATOM 147   H HG21 . THR A 1 10  ? -7.594  3.540   5.513   1.00 1.12  ? 10  THR A HG21 1  
ATOM 148   H HG22 . THR A 1 10  ? -8.106  1.855   5.640   1.00 0.94  ? 10  THR A HG22 1  
ATOM 149   H HG23 . THR A 1 10  ? -8.360  2.743   4.139   1.00 1.00  ? 10  THR A HG23 1  
ATOM 150   N N    . GLU A 1 11  ? -4.895  4.403   6.273   1.00 0.25  ? 11  GLU A N    1  
ATOM 151   C CA   . GLU A 1 11  ? -4.168  5.656   6.283   1.00 0.27  ? 11  GLU A CA   1  
ATOM 152   C C    . GLU A 1 11  ? -2.877  5.515   7.069   1.00 0.30  ? 11  GLU A C    1  
ATOM 153   O O    . GLU A 1 11  ? -1.831  6.011   6.659   1.00 0.32  ? 11  GLU A O    1  
ATOM 154   C CB   . GLU A 1 11  ? -5.033  6.760   6.861   1.00 0.29  ? 11  GLU A CB   1  
ATOM 155   C CG   . GLU A 1 11  ? -6.408  6.800   6.233   1.00 0.41  ? 11  GLU A CG   1  
ATOM 156   C CD   . GLU A 1 11  ? -7.247  7.962   6.716   1.00 1.11  ? 11  GLU A CD   1  
ATOM 157   O OE1  . GLU A 1 11  ? -7.262  8.221   7.938   1.00 1.71  ? 11  GLU A OE1  1  
ATOM 158   O OE2  . GLU A 1 11  ? -7.892  8.618   5.878   1.00 1.85  ? 11  GLU A OE2  1  
ATOM 159   H H    . GLU A 1 11  ? -5.741  4.330   6.766   1.00 0.23  ? 11  GLU A H    1  
ATOM 160   H HA   . GLU A 1 11  ? -3.927  5.897   5.265   1.00 0.30  ? 11  GLU A HA   1  
ATOM 161   H HB2  . GLU A 1 11  ? -5.140  6.598   7.920   1.00 0.41  ? 11  GLU A HB2  1  
ATOM 162   H HB3  . GLU A 1 11  ? -4.553  7.710   6.690   1.00 0.42  ? 11  GLU A HB3  1  
ATOM 163   H HG2  . GLU A 1 11  ? -6.289  6.870   5.166   1.00 0.40  ? 11  GLU A HG2  1  
ATOM 164   H HG3  . GLU A 1 11  ? -6.921  5.880   6.474   1.00 0.71  ? 11  GLU A HG3  1  
ATOM 165   N N    . ARG A 1 12  ? -2.949  4.802   8.182   1.00 0.35  ? 12  ARG A N    1  
ATOM 166   C CA   . ARG A 1 12  ? -1.766  4.540   8.982   1.00 0.42  ? 12  ARG A CA   1  
ATOM 167   C C    . ARG A 1 12  ? -0.837  3.599   8.234   1.00 0.43  ? 12  ARG A C    1  
ATOM 168   O O    . ARG A 1 12  ? 0.377   3.660   8.394   1.00 0.47  ? 12  ARG A O    1  
ATOM 169   C CB   . ARG A 1 12  ? -2.133  3.991   10.374  1.00 0.48  ? 12  ARG A CB   1  
ATOM 170   C CG   . ARG A 1 12  ? -2.852  2.645   10.396  1.00 0.49  ? 12  ARG A CG   1  
ATOM 171   C CD   . ARG A 1 12  ? -1.905  1.482   10.160  1.00 0.56  ? 12  ARG A CD   1  
ATOM 172   N NE   . ARG A 1 12  ? -2.513  0.197   10.507  1.00 1.08  ? 12  ARG A NE   1  
ATOM 173   C CZ   . ARG A 1 12  ? -2.506  -0.324  11.736  1.00 1.35  ? 12  ARG A CZ   1  
ATOM 174   N NH1  . ARG A 1 12  ? -1.897  0.313   12.729  1.00 1.86  ? 12  ARG A NH1  1  
ATOM 175   N NH2  . ARG A 1 12  ? -3.103  -1.486  11.966  1.00 1.95  ? 12  ARG A NH2  1  
ATOM 176   H H    . ARG A 1 12  ? -3.821  4.455   8.473   1.00 0.35  ? 12  ARG A H    1  
ATOM 177   H HA   . ARG A 1 12  ? -1.253  5.481   9.110   1.00 0.44  ? 12  ARG A HA   1  
ATOM 178   H HB2  . ARG A 1 12  ? -1.226  3.884   10.944  1.00 0.56  ? 12  ARG A HB2  1  
ATOM 179   H HB3  . ARG A 1 12  ? -2.766  4.713   10.866  1.00 0.48  ? 12  ARG A HB3  1  
ATOM 180   H HG2  . ARG A 1 12  ? -3.327  2.517   11.356  1.00 0.53  ? 12  ARG A HG2  1  
ATOM 181   H HG3  . ARG A 1 12  ? -3.605  2.643   9.618   1.00 0.45  ? 12  ARG A HG3  1  
ATOM 182   H HD2  . ARG A 1 12  ? -1.642  1.471   9.108   1.00 0.91  ? 12  ARG A HD2  1  
ATOM 183   H HD3  . ARG A 1 12  ? -1.016  1.629   10.752  1.00 0.84  ? 12  ARG A HD3  1  
ATOM 184   H HE   . ARG A 1 12  ? -2.951  -0.305  9.783   1.00 1.80  ? 12  ARG A HE   1  
ATOM 185   H HH11 . ARG A 1 12  ? -1.441  1.191   12.564  1.00 2.09  ? 12  ARG A HH11 1  
ATOM 186   H HH12 . ARG A 1 12  ? -1.886  -0.084  13.651  1.00 2.43  ? 12  ARG A HH12 1  
ATOM 187   H HH21 . ARG A 1 12  ? -3.561  -1.979  11.218  1.00 2.48  ? 12  ARG A HH21 1  
ATOM 188   H HH22 . ARG A 1 12  ? -3.106  -1.878  12.891  1.00 2.20  ? 12  ARG A HH22 1  
ATOM 189   N N    . CYS A 1 13  ? -1.421  2.737   7.400   1.00 0.42  ? 13  CYS A N    1  
ATOM 190   C CA   . CYS A 1 13  ? -0.641  1.851   6.545   1.00 0.44  ? 13  CYS A CA   1  
ATOM 191   C C    . CYS A 1 13  ? 0.171   2.696   5.591   1.00 0.30  ? 13  CYS A C    1  
ATOM 192   O O    . CYS A 1 13  ? 1.349   2.447   5.332   1.00 0.29  ? 13  CYS A O    1  
ATOM 193   C CB   . CYS A 1 13  ? -1.569  0.927   5.745   1.00 0.57  ? 13  CYS A CB   1  
ATOM 194   S SG   . CYS A 1 13  ? -1.375  1.063   3.953   1.00 2.16  ? 13  CYS A SG   1  
ATOM 195   H H    . CYS A 1 13  ? -2.404  2.710   7.349   1.00 0.41  ? 13  CYS A H    1  
ATOM 196   H HA   . CYS A 1 13  ? 0.024   1.264   7.158   1.00 0.55  ? 13  CYS A HA   1  
ATOM 197   H HB2  . CYS A 1 13  ? -1.369  -0.094  6.005   1.00 1.00  ? 13  CYS A HB2  1  
ATOM 198   H HB3  . CYS A 1 13  ? -2.599  1.159   5.988   1.00 0.84  ? 13  CYS A HB3  1  
ATOM 199   H HG   . CYS A 1 13  ? -1.151  -0.154  3.474   1.00 2.85  ? 13  CYS A HG   1  
ATOM 200   N N    . ILE A 1 14  ? -0.489  3.719   5.107   1.00 0.26  ? 14  ILE A N    1  
ATOM 201   C CA   . ILE A 1 14  ? 0.061   4.620   4.137   1.00 0.24  ? 14  ILE A CA   1  
ATOM 202   C C    . ILE A 1 14  ? 1.180   5.467   4.733   1.00 0.21  ? 14  ILE A C    1  
ATOM 203   O O    . ILE A 1 14  ? 2.203   5.710   4.087   1.00 0.23  ? 14  ILE A O    1  
ATOM 204   C CB   . ILE A 1 14  ? -1.070  5.504   3.597   1.00 0.24  ? 14  ILE A CB   1  
ATOM 205   C CG1  . ILE A 1 14  ? -1.973  4.679   2.677   1.00 0.25  ? 14  ILE A CG1  1  
ATOM 206   C CG2  . ILE A 1 14  ? -0.519  6.723   2.891   1.00 0.27  ? 14  ILE A CG2  1  
ATOM 207   C CD1  . ILE A 1 14  ? -3.278  5.363   2.356   1.00 0.27  ? 14  ILE A CD1  1  
ATOM 208   H H    . ILE A 1 14  ? -1.410  3.866   5.411   1.00 0.27  ? 14  ILE A H    1  
ATOM 209   H HA   . ILE A 1 14  ? 0.454   4.032   3.325   1.00 0.27  ? 14  ILE A HA   1  
ATOM 210   H HB   . ILE A 1 14  ? -1.657  5.842   4.439   1.00 0.25  ? 14  ILE A HB   1  
ATOM 211   H HG12 . ILE A 1 14  ? -1.459  4.491   1.746   1.00 0.26  ? 14  ILE A HG12 1  
ATOM 212   H HG13 . ILE A 1 14  ? -2.200  3.732   3.156   1.00 0.27  ? 14  ILE A HG13 1  
ATOM 213   H HG21 . ILE A 1 14  ? -1.308  7.200   2.329   1.00 1.02  ? 14  ILE A HG21 1  
ATOM 214   H HG22 . ILE A 1 14  ? 0.273   6.415   2.225   1.00 1.02  ? 14  ILE A HG22 1  
ATOM 215   H HG23 . ILE A 1 14  ? -0.127  7.414   3.621   1.00 1.01  ? 14  ILE A HG23 1  
ATOM 216   H HD11 . ILE A 1 14  ? -3.074  6.332   1.924   1.00 1.06  ? 14  ILE A HD11 1  
ATOM 217   H HD12 . ILE A 1 14  ? -3.850  5.484   3.265   1.00 0.96  ? 14  ILE A HD12 1  
ATOM 218   H HD13 . ILE A 1 14  ? -3.837  4.763   1.654   1.00 1.12  ? 14  ILE A HD13 1  
ATOM 219   N N    . GLU A 1 15  ? 1.005   5.877   5.979   1.00 0.24  ? 15  GLU A N    1  
ATOM 220   C CA   . GLU A 1 15  ? 1.999   6.683   6.653   1.00 0.28  ? 15  GLU A CA   1  
ATOM 221   C C    . GLU A 1 15  ? 3.133   5.790   7.104   1.00 0.30  ? 15  GLU A C    1  
ATOM 222   O O    . GLU A 1 15  ? 4.259   6.239   7.304   1.00 0.34  ? 15  GLU A O    1  
ATOM 223   C CB   . GLU A 1 15  ? 1.391   7.410   7.843   1.00 0.32  ? 15  GLU A CB   1  
ATOM 224   C CG   . GLU A 1 15  ? 0.185   8.259   7.487   1.00 0.33  ? 15  GLU A CG   1  
ATOM 225   C CD   . GLU A 1 15  ? -0.348  9.018   8.679   1.00 0.38  ? 15  GLU A CD   1  
ATOM 226   O OE1  . GLU A 1 15  ? -0.889  8.378   9.601   1.00 1.26  ? 15  GLU A OE1  1  
ATOM 227   O OE2  . GLU A 1 15  ? -0.221  10.261  8.702   1.00 1.06  ? 15  GLU A OE2  1  
ATOM 228   H H    . GLU A 1 15  ? 0.197   5.613   6.464   1.00 0.26  ? 15  GLU A H    1  
ATOM 229   H HA   . GLU A 1 15  ? 2.380   7.407   5.947   1.00 0.29  ? 15  GLU A HA   1  
ATOM 230   H HB2  . GLU A 1 15  ? 1.087   6.679   8.577   1.00 0.33  ? 15  GLU A HB2  1  
ATOM 231   H HB3  . GLU A 1 15  ? 2.144   8.053   8.273   1.00 0.37  ? 15  GLU A HB3  1  
ATOM 232   H HG2  . GLU A 1 15  ? 0.472   8.970   6.726   1.00 0.33  ? 15  GLU A HG2  1  
ATOM 233   H HG3  . GLU A 1 15  ? -0.598  7.617   7.104   1.00 0.31  ? 15  GLU A HG3  1  
ATOM 234   N N    . SER A 1 16  ? 2.817   4.514   7.257   1.00 0.31  ? 16  SER A N    1  
ATOM 235   C CA   . SER A 1 16  ? 3.823   3.514   7.525   1.00 0.38  ? 16  SER A CA   1  
ATOM 236   C C    . SER A 1 16  ? 4.760   3.404   6.339   1.00 0.29  ? 16  SER A C    1  
ATOM 237   O O    . SER A 1 16  ? 5.977   3.385   6.491   1.00 0.28  ? 16  SER A O    1  
ATOM 238   C CB   . SER A 1 16  ? 3.170   2.161   7.812   1.00 0.54  ? 16  SER A CB   1  
ATOM 239   O OG   . SER A 1 16  ? 2.460   2.181   9.036   1.00 0.97  ? 16  SER A OG   1  
ATOM 240   H H    . SER A 1 16  ? 1.877   4.243   7.193   1.00 0.31  ? 16  SER A H    1  
ATOM 241   H HA   . SER A 1 16  ? 4.383   3.833   8.381   1.00 0.45  ? 16  SER A HA   1  
ATOM 242   H HB2  . SER A 1 16  ? 2.479   1.925   7.017   1.00 0.77  ? 16  SER A HB2  1  
ATOM 243   H HB3  . SER A 1 16  ? 3.932   1.400   7.862   1.00 0.80  ? 16  SER A HB3  1  
ATOM 244   H HG   . SER A 1 16  ? 1.842   2.926   9.036   1.00 1.17  ? 16  SER A HG   1  
ATOM 245   N N    . LEU A 1 17  ? 4.177   3.360   5.153   1.00 0.27  ? 17  LEU A N    1  
ATOM 246   C CA   . LEU A 1 17  ? 4.951   3.322   3.928   1.00 0.28  ? 17  LEU A CA   1  
ATOM 247   C C    . LEU A 1 17  ? 5.770   4.586   3.796   1.00 0.27  ? 17  LEU A C    1  
ATOM 248   O O    . LEU A 1 17  ? 6.884   4.553   3.308   1.00 0.32  ? 17  LEU A O    1  
ATOM 249   C CB   . LEU A 1 17  ? 4.028   3.163   2.733   1.00 0.29  ? 17  LEU A CB   1  
ATOM 250   C CG   . LEU A 1 17  ? 3.109   1.954   2.830   1.00 0.33  ? 17  LEU A CG   1  
ATOM 251   C CD1  . LEU A 1 17  ? 2.124   1.918   1.677   1.00 0.33  ? 17  LEU A CD1  1  
ATOM 252   C CD2  . LEU A 1 17  ? 3.935   0.677   2.889   1.00 0.46  ? 17  LEU A CD2  1  
ATOM 253   H H    . LEU A 1 17  ? 3.196   3.345   5.101   1.00 0.28  ? 17  LEU A H    1  
ATOM 254   H HA   . LEU A 1 17  ? 5.616   2.475   3.978   1.00 0.31  ? 17  LEU A HA   1  
ATOM 255   H HB2  . LEU A 1 17  ? 3.427   4.057   2.650   1.00 0.27  ? 17  LEU A HB2  1  
ATOM 256   H HB3  . LEU A 1 17  ? 4.632   3.063   1.842   1.00 0.36  ? 17  LEU A HB3  1  
ATOM 257   H HG   . LEU A 1 17  ? 2.540   2.024   3.742   1.00 0.33  ? 17  LEU A HG   1  
ATOM 258   H HD11 . LEU A 1 17  ? 1.588   2.855   1.635   1.00 1.09  ? 17  LEU A HD11 1  
ATOM 259   H HD12 . LEU A 1 17  ? 1.424   1.110   1.830   1.00 1.06  ? 17  LEU A HD12 1  
ATOM 260   H HD13 . LEU A 1 17  ? 2.658   1.766   0.752   1.00 1.06  ? 17  LEU A HD13 1  
ATOM 261   H HD21 . LEU A 1 17  ? 4.598   0.637   2.037   1.00 1.08  ? 17  LEU A HD21 1  
ATOM 262   H HD22 . LEU A 1 17  ? 3.276   -0.180  2.872   1.00 1.10  ? 17  LEU A HD22 1  
ATOM 263   H HD23 . LEU A 1 17  ? 4.516   0.665   3.803   1.00 1.21  ? 17  LEU A HD23 1  
ATOM 264   N N    . ILE A 1 18  ? 5.207   5.700   4.237   1.00 0.27  ? 18  ILE A N    1  
ATOM 265   C CA   . ILE A 1 18  ? 5.941   6.950   4.294   1.00 0.30  ? 18  ILE A CA   1  
ATOM 266   C C    . ILE A 1 18  ? 7.155   6.806   5.198   1.00 0.28  ? 18  ILE A C    1  
ATOM 267   O O    . ILE A 1 18  ? 8.272   7.140   4.809   1.00 0.30  ? 18  ILE A O    1  
ATOM 268   C CB   . ILE A 1 18  ? 5.055   8.106   4.805   1.00 0.36  ? 18  ILE A CB   1  
ATOM 269   C CG1  . ILE A 1 18  ? 3.963   8.427   3.784   1.00 0.63  ? 18  ILE A CG1  1  
ATOM 270   C CG2  . ILE A 1 18  ? 5.898   9.336   5.105   1.00 0.47  ? 18  ILE A CG2  1  
ATOM 271   C CD1  . ILE A 1 18  ? 3.049   9.551   4.209   1.00 1.37  ? 18  ILE A CD1  1  
ATOM 272   H H    . ILE A 1 18  ? 4.274   5.680   4.530   1.00 0.29  ? 18  ILE A H    1  
ATOM 273   H HA   . ILE A 1 18  ? 6.274   7.186   3.294   1.00 0.33  ? 18  ILE A HA   1  
ATOM 274   H HB   . ILE A 1 18  ? 4.587   7.789   5.728   1.00 0.36  ? 18  ILE A HB   1  
ATOM 275   H HG12 . ILE A 1 18  ? 4.426   8.711   2.850   1.00 0.98  ? 18  ILE A HG12 1  
ATOM 276   H HG13 . ILE A 1 18  ? 3.358   7.546   3.626   1.00 1.37  ? 18  ILE A HG13 1  
ATOM 277   H HG21 . ILE A 1 18  ? 6.628   9.090   5.865   1.00 1.13  ? 18  ILE A HG21 1  
ATOM 278   H HG22 . ILE A 1 18  ? 5.259   10.134  5.459   1.00 1.10  ? 18  ILE A HG22 1  
ATOM 279   H HG23 . ILE A 1 18  ? 6.407   9.652   4.204   1.00 1.11  ? 18  ILE A HG23 1  
ATOM 280   H HD11 . ILE A 1 18  ? 2.555   9.286   5.131   1.00 1.87  ? 18  ILE A HD11 1  
ATOM 281   H HD12 . ILE A 1 18  ? 2.309   9.722   3.441   1.00 1.89  ? 18  ILE A HD12 1  
ATOM 282   H HD13 . ILE A 1 18  ? 3.628   10.451  4.357   1.00 1.99  ? 18  ILE A HD13 1  
ATOM 283   N N    . ALA A 1 19  ? 6.919   6.282   6.391   1.00 0.25  ? 19  ALA A N    1  
ATOM 284   C CA   . ALA A 1 19  ? 7.968   6.096   7.377   1.00 0.25  ? 19  ALA A CA   1  
ATOM 285   C C    . ALA A 1 19  ? 9.084   5.203   6.847   1.00 0.23  ? 19  ALA A C    1  
ATOM 286   O O    . ALA A 1 19  ? 10.246  5.601   6.829   1.00 0.28  ? 19  ALA A O    1  
ATOM 287   C CB   . ALA A 1 19  ? 7.378   5.510   8.649   1.00 0.28  ? 19  ALA A CB   1  
ATOM 288   H H    . ALA A 1 19  ? 6.001   6.014   6.619   1.00 0.26  ? 19  ALA A H    1  
ATOM 289   H HA   . ALA A 1 19  ? 8.379   7.065   7.615   1.00 0.29  ? 19  ALA A HA   1  
ATOM 290   H HB1  . ALA A 1 19  ? 7.005   4.514   8.448   1.00 1.04  ? 19  ALA A HB1  1  
ATOM 291   H HB2  . ALA A 1 19  ? 6.566   6.137   8.989   1.00 1.06  ? 19  ALA A HB2  1  
ATOM 292   H HB3  . ALA A 1 19  ? 8.141   5.462   9.412   1.00 0.97  ? 19  ALA A HB3  1  
ATOM 293   N N    . VAL A 1 20  ? 8.723   4.006   6.401   1.00 0.20  ? 20  VAL A N    1  
ATOM 294   C CA   . VAL A 1 20  ? 9.710   3.026   5.968   1.00 0.22  ? 20  VAL A CA   1  
ATOM 295   C C    . VAL A 1 20  ? 10.374  3.458   4.668   1.00 0.23  ? 20  VAL A C    1  
ATOM 296   O O    . VAL A 1 20  ? 11.590  3.312   4.499   1.00 0.27  ? 20  VAL A O    1  
ATOM 297   C CB   . VAL A 1 20  ? 9.084   1.618   5.810   1.00 0.27  ? 20  VAL A CB   1  
ATOM 298   C CG1  . VAL A 1 20  ? 8.133   1.360   6.939   1.00 0.87  ? 20  VAL A CG1  1  
ATOM 299   C CG2  . VAL A 1 20  ? 8.370   1.438   4.481   1.00 0.87  ? 20  VAL A CG2  1  
ATOM 300   H H    . VAL A 1 20  ? 7.767   3.774   6.368   1.00 0.21  ? 20  VAL A H    1  
ATOM 301   H HA   . VAL A 1 20  ? 10.467  2.970   6.734   1.00 0.24  ? 20  VAL A HA   1  
ATOM 302   H HB   . VAL A 1 20  ? 9.872   0.887   5.878   1.00 0.52  ? 20  VAL A HB   1  
ATOM 303   H HG11 . VAL A 1 20  ? 7.690   0.385   6.819   1.00 1.36  ? 20  VAL A HG11 1  
ATOM 304   H HG12 . VAL A 1 20  ? 7.360   2.116   6.918   1.00 1.57  ? 20  VAL A HG12 1  
ATOM 305   H HG13 . VAL A 1 20  ? 8.664   1.410   7.876   1.00 1.42  ? 20  VAL A HG13 1  
ATOM 306   H HG21 . VAL A 1 20  ? 7.589   2.178   4.389   1.00 1.45  ? 20  VAL A HG21 1  
ATOM 307   H HG22 . VAL A 1 20  ? 7.937   0.450   4.437   1.00 1.40  ? 20  VAL A HG22 1  
ATOM 308   H HG23 . VAL A 1 20  ? 9.076   1.559   3.673   1.00 1.53  ? 20  VAL A HG23 1  
ATOM 309   N N    . PHE A 1 21  ? 9.581   4.012   3.763   1.00 0.23  ? 21  PHE A N    1  
ATOM 310   C CA   . PHE A 1 21  ? 10.117  4.452   2.481   1.00 0.25  ? 21  PHE A CA   1  
ATOM 311   C C    . PHE A 1 21  ? 11.121  5.571   2.678   1.00 0.29  ? 21  PHE A C    1  
ATOM 312   O O    . PHE A 1 21  ? 12.256  5.477   2.236   1.00 0.35  ? 21  PHE A O    1  
ATOM 313   C CB   . PHE A 1 21  ? 9.014   4.928   1.536   1.00 0.26  ? 21  PHE A CB   1  
ATOM 314   C CG   . PHE A 1 21  ? 9.538   5.439   0.227   1.00 0.91  ? 21  PHE A CG   1  
ATOM 315   C CD1  . PHE A 1 21  ? 10.076  4.567   -0.699  1.00 1.85  ? 21  PHE A CD1  1  
ATOM 316   C CD2  . PHE A 1 21  ? 9.506   6.790   -0.068  1.00 1.59  ? 21  PHE A CD2  1  
ATOM 317   C CE1  . PHE A 1 21  ? 10.571  5.030   -1.899  1.00 2.48  ? 21  PHE A CE1  1  
ATOM 318   C CE2  . PHE A 1 21  ? 10.002  7.260   -1.265  1.00 2.17  ? 21  PHE A CE2  1  
ATOM 319   C CZ   . PHE A 1 21  ? 10.534  6.378   -2.182  1.00 2.40  ? 21  PHE A CZ   1  
ATOM 320   H H    . PHE A 1 21  ? 8.606   4.110   3.962   1.00 0.23  ? 21  PHE A H    1  
ATOM 321   H HA   . PHE A 1 21  ? 10.623  3.610   2.032   1.00 0.27  ? 21  PHE A HA   1  
ATOM 322   H HB2  . PHE A 1 21  ? 8.340   4.111   1.330   1.00 0.64  ? 21  PHE A HB2  1  
ATOM 323   H HB3  . PHE A 1 21  ? 8.466   5.729   2.010   1.00 0.62  ? 21  PHE A HB3  1  
ATOM 324   H HD1  . PHE A 1 21  ? 10.102  3.511   -0.478  1.00 2.42  ? 21  PHE A HD1  1  
ATOM 325   H HD2  . PHE A 1 21  ? 9.089   7.481   0.648   1.00 2.15  ? 21  PHE A HD2  1  
ATOM 326   H HE1  . PHE A 1 21  ? 10.987  4.338   -2.615  1.00 3.33  ? 21  PHE A HE1  1  
ATOM 327   H HE2  . PHE A 1 21  ? 9.972   8.316   -1.487  1.00 2.85  ? 21  PHE A HE2  1  
ATOM 328   H HZ   . PHE A 1 21  ? 10.924  6.743   -3.121  1.00 2.98  ? 21  PHE A HZ   1  
ATOM 329   N N    . GLN A 1 22  ? 10.705  6.610   3.377   1.00 0.30  ? 22  GLN A N    1  
ATOM 330   C CA   . GLN A 1 22  ? 11.489  7.826   3.481   1.00 0.37  ? 22  GLN A CA   1  
ATOM 331   C C    . GLN A 1 22  ? 12.694  7.668   4.401   1.00 0.36  ? 22  GLN A C    1  
ATOM 332   O O    . GLN A 1 22  ? 13.627  8.468   4.338   1.00 0.44  ? 22  GLN A O    1  
ATOM 333   C CB   . GLN A 1 22  ? 10.585  8.984   3.907   1.00 0.47  ? 22  GLN A CB   1  
ATOM 334   C CG   . GLN A 1 22  ? 9.764   9.530   2.747   1.00 1.12  ? 22  GLN A CG   1  
ATOM 335   C CD   . GLN A 1 22  ? 8.671   10.494  3.171   1.00 1.98  ? 22  GLN A CD   1  
ATOM 336   O OE1  . GLN A 1 22  ? 7.637   10.599  2.511   1.00 2.68  ? 22  GLN A OE1  1  
ATOM 337   N NE2  . GLN A 1 22  ? 8.886   11.203  4.265   1.00 2.66  ? 22  GLN A NE2  1  
ATOM 338   H H    . GLN A 1 22  ? 9.847   6.555   3.853   1.00 0.28  ? 22  GLN A H    1  
ATOM 339   H HA   . GLN A 1 22  ? 11.863  8.042   2.492   1.00 0.42  ? 22  GLN A HA   1  
ATOM 340   H HB2  . GLN A 1 22  ? 9.901   8.633   4.671   1.00 0.83  ? 22  GLN A HB2  1  
ATOM 341   H HB3  . GLN A 1 22  ? 11.192  9.782   4.306   1.00 0.94  ? 22  GLN A HB3  1  
ATOM 342   H HG2  . GLN A 1 22  ? 10.427  10.044  2.068   1.00 1.54  ? 22  GLN A HG2  1  
ATOM 343   H HG3  . GLN A 1 22  ? 9.306   8.699   2.233   1.00 1.68  ? 22  GLN A HG3  1  
ATOM 344   H HE21 . GLN A 1 22  ? 9.734   11.073  4.740   1.00 2.74  ? 22  GLN A HE21 1  
ATOM 345   H HE22 . GLN A 1 22  ? 8.190   11.825  4.558   1.00 3.38  ? 22  GLN A HE22 1  
ATOM 346   N N    . LYS A 1 23  ? 12.695  6.645   5.249   1.00 0.35  ? 23  LYS A N    1  
ATOM 347   C CA   . LYS A 1 23  ? 13.853  6.402   6.093   1.00 0.39  ? 23  LYS A CA   1  
ATOM 348   C C    . LYS A 1 23  ? 14.961  5.694   5.307   1.00 0.40  ? 23  LYS A C    1  
ATOM 349   O O    . LYS A 1 23  ? 16.141  5.996   5.486   1.00 0.49  ? 23  LYS A O    1  
ATOM 350   C CB   . LYS A 1 23  ? 13.471  5.599   7.341   1.00 0.41  ? 23  LYS A CB   1  
ATOM 351   C CG   . LYS A 1 23  ? 13.056  4.182   7.065   1.00 0.42  ? 23  LYS A CG   1  
ATOM 352   C CD   . LYS A 1 23  ? 12.393  3.581   8.278   1.00 0.63  ? 23  LYS A CD   1  
ATOM 353   C CE   . LYS A 1 23  ? 12.423  2.078   8.199   1.00 0.63  ? 23  LYS A CE   1  
ATOM 354   N NZ   . LYS A 1 23  ? 11.693  1.427   9.316   1.00 0.91  ? 23  LYS A NZ   1  
ATOM 355   H H    . LYS A 1 23  ? 11.908  6.059   5.318   1.00 0.35  ? 23  LYS A H    1  
ATOM 356   H HA   . LYS A 1 23  ? 14.223  7.367   6.403   1.00 0.42  ? 23  LYS A HA   1  
ATOM 357   H HB2  . LYS A 1 23  ? 14.316  5.559   8.009   1.00 0.45  ? 23  LYS A HB2  1  
ATOM 358   H HB3  . LYS A 1 23  ? 12.653  6.092   7.840   1.00 0.45  ? 23  LYS A HB3  1  
ATOM 359   H HG2  . LYS A 1 23  ? 12.361  4.171   6.239   1.00 0.53  ? 23  LYS A HG2  1  
ATOM 360   H HG3  . LYS A 1 23  ? 13.931  3.599   6.815   1.00 0.57  ? 23  LYS A HG3  1  
ATOM 361   H HD2  . LYS A 1 23  ? 12.916  3.905   9.164   1.00 0.97  ? 23  LYS A HD2  1  
ATOM 362   H HD3  . LYS A 1 23  ? 11.368  3.917   8.312   1.00 0.85  ? 23  LYS A HD3  1  
ATOM 363   H HE2  . LYS A 1 23  ? 11.984  1.776   7.264   1.00 0.72  ? 23  LYS A HE2  1  
ATOM 364   H HE3  . LYS A 1 23  ? 13.455  1.772   8.224   1.00 0.85  ? 23  LYS A HE3  1  
ATOM 365   H HZ1  . LYS A 1 23  ? 11.604  0.401   9.136   1.00 1.42  ? 23  LYS A HZ1  1  
ATOM 366   H HZ2  . LYS A 1 23  ? 10.743  1.831   9.414   1.00 1.25  ? 23  LYS A HZ2  1  
ATOM 367   H HZ3  . LYS A 1 23  ? 12.206  1.564   10.208  1.00 1.47  ? 23  LYS A HZ3  1  
ATOM 368   N N    . TYR A 1 24  ? 14.586  4.761   4.429   1.00 0.36  ? 24  TYR A N    1  
ATOM 369   C CA   . TYR A 1 24  ? 15.571  4.045   3.619   1.00 0.39  ? 24  TYR A CA   1  
ATOM 370   C C    . TYR A 1 24  ? 15.922  4.815   2.354   1.00 0.34  ? 24  TYR A C    1  
ATOM 371   O O    . TYR A 1 24  ? 17.090  4.927   1.991   1.00 0.40  ? 24  TYR A O    1  
ATOM 372   C CB   . TYR A 1 24  ? 15.077  2.647   3.264   1.00 0.46  ? 24  TYR A CB   1  
ATOM 373   C CG   . TYR A 1 24  ? 15.416  1.612   4.310   1.00 0.86  ? 24  TYR A CG   1  
ATOM 374   C CD1  . TYR A 1 24  ? 16.643  0.963   4.285   1.00 1.67  ? 24  TYR A CD1  1  
ATOM 375   C CD2  . TYR A 1 24  ? 14.522  1.281   5.318   1.00 1.52  ? 24  TYR A CD2  1  
ATOM 376   C CE1  . TYR A 1 24  ? 16.970  0.016   5.233   1.00 1.99  ? 24  TYR A CE1  1  
ATOM 377   C CE2  . TYR A 1 24  ? 14.842  0.333   6.272   1.00 1.83  ? 24  TYR A CE2  1  
ATOM 378   C CZ   . TYR A 1 24  ? 16.068  -0.295  6.224   1.00 1.72  ? 24  TYR A CZ   1  
ATOM 379   O OH   . TYR A 1 24  ? 16.393  -1.243  7.167   1.00 2.15  ? 24  TYR A OH   1  
ATOM 380   H H    . TYR A 1 24  ? 13.627  4.550   4.324   1.00 0.33  ? 24  TYR A H    1  
ATOM 381   H HA   . TYR A 1 24  ? 16.469  3.949   4.215   1.00 0.50  ? 24  TYR A HA   1  
ATOM 382   H HB2  . TYR A 1 24  ? 14.003  2.668   3.147   1.00 0.51  ? 24  TYR A HB2  1  
ATOM 383   H HB3  . TYR A 1 24  ? 15.530  2.341   2.334   1.00 0.45  ? 24  TYR A HB3  1  
ATOM 384   H HD1  . TYR A 1 24  ? 17.351  1.208   3.506   1.00 2.37  ? 24  TYR A HD1  1  
ATOM 385   H HD2  . TYR A 1 24  ? 13.562  1.777   5.353   1.00 2.22  ? 24  TYR A HD2  1  
ATOM 386   H HE1  . TYR A 1 24  ? 17.929  -0.477  5.194   1.00 2.80  ? 24  TYR A HE1  1  
ATOM 387   H HE2  . TYR A 1 24  ? 14.132  0.089   7.050   1.00 2.59  ? 24  TYR A HE2  1  
ATOM 388   H HH   . TYR A 1 24  ? 15.767  -1.986  7.107   1.00 2.39  ? 24  TYR A HH   1  
ATOM 389   N N    . ALA A 1 25  ? 14.913  5.350   1.690   1.00 0.29  ? 25  ALA A N    1  
ATOM 390   C CA   . ALA A 1 25  ? 15.126  6.162   0.502   1.00 0.34  ? 25  ALA A CA   1  
ATOM 391   C C    . ALA A 1 25  ? 15.848  7.446   0.877   1.00 0.47  ? 25  ALA A C    1  
ATOM 392   O O    . ALA A 1 25  ? 16.560  8.042   0.068   1.00 0.58  ? 25  ALA A O    1  
ATOM 393   C CB   . ALA A 1 25  ? 13.798  6.473   -0.167  1.00 0.37  ? 25  ALA A CB   1  
ATOM 394   H H    . ALA A 1 25  ? 13.995  5.197   2.006   1.00 0.28  ? 25  ALA A H    1  
ATOM 395   H HA   . ALA A 1 25  ? 15.735  5.597   -0.189  1.00 0.34  ? 25  ALA A HA   1  
ATOM 396   H HB1  . ALA A 1 25  ? 13.311  5.549   -0.444  1.00 1.04  ? 25  ALA A HB1  1  
ATOM 397   H HB2  . ALA A 1 25  ? 13.969  7.070   -1.051  1.00 0.98  ? 25  ALA A HB2  1  
ATOM 398   H HB3  . ALA A 1 25  ? 13.167  7.019   0.521   1.00 1.09  ? 25  ALA A HB3  1  
ATOM 399   N N    . GLY A 1 26  ? 15.674  7.847   2.130   1.00 0.49  ? 26  GLY A N    1  
ATOM 400   C CA   . GLY A 1 26  ? 16.326  9.033   2.636   1.00 0.64  ? 26  GLY A CA   1  
ATOM 401   C C    . GLY A 1 26  ? 17.791  8.797   2.953   1.00 0.75  ? 26  GLY A C    1  
ATOM 402   O O    . GLY A 1 26  ? 18.481  9.698   3.424   1.00 0.96  ? 26  GLY A O    1  
ATOM 403   H H    . GLY A 1 26  ? 15.083  7.327   2.719   1.00 0.45  ? 26  GLY A H    1  
ATOM 404   H HA2  . GLY A 1 26  ? 16.248  9.817   1.898   1.00 0.73  ? 26  GLY A HA2  1  
ATOM 405   H HA3  . GLY A 1 26  ? 15.822  9.351   3.537   1.00 0.64  ? 26  GLY A HA3  1  
ATOM 406   N N    . LYS A 1 27  ? 18.266  7.579   2.718   1.00 0.69  ? 27  LYS A N    1  
ATOM 407   C CA   . LYS A 1 27  ? 19.672  7.261   2.923   1.00 0.82  ? 27  LYS A CA   1  
ATOM 408   C C    . LYS A 1 27  ? 20.490  7.650   1.701   1.00 0.95  ? 27  LYS A C    1  
ATOM 409   O O    . LYS A 1 27  ? 21.637  8.078   1.821   1.00 1.11  ? 27  LYS A O    1  
ATOM 410   C CB   . LYS A 1 27  ? 19.860  5.771   3.209   1.00 0.77  ? 27  LYS A CB   1  
ATOM 411   C CG   . LYS A 1 27  ? 19.185  5.296   4.484   1.00 0.81  ? 27  LYS A CG   1  
ATOM 412   C CD   . LYS A 1 27  ? 19.465  3.826   4.745   1.00 0.85  ? 27  LYS A CD   1  
ATOM 413   C CE   . LYS A 1 27  ? 18.888  3.380   6.078   1.00 1.11  ? 27  LYS A CE   1  
ATOM 414   N NZ   . LYS A 1 27  ? 19.461  2.083   6.533   1.00 1.72  ? 27  LYS A NZ   1  
ATOM 415   H H    . LYS A 1 27  ? 17.655  6.875   2.406   1.00 0.60  ? 27  LYS A H    1  
ATOM 416   H HA   . LYS A 1 27  ? 20.021  7.830   3.772   1.00 0.92  ? 27  LYS A HA   1  
ATOM 417   H HB2  . LYS A 1 27  ? 19.456  5.206   2.382   1.00 0.68  ? 27  LYS A HB2  1  
ATOM 418   H HB3  . LYS A 1 27  ? 20.917  5.564   3.290   1.00 0.89  ? 27  LYS A HB3  1  
ATOM 419   H HG2  . LYS A 1 27  ? 19.557  5.877   5.314   1.00 0.95  ? 27  LYS A HG2  1  
ATOM 420   H HG3  . LYS A 1 27  ? 18.118  5.440   4.390   1.00 0.78  ? 27  LYS A HG3  1  
ATOM 421   H HD2  . LYS A 1 27  ? 19.015  3.240   3.954   1.00 1.08  ? 27  LYS A HD2  1  
ATOM 422   H HD3  . LYS A 1 27  ? 20.533  3.666   4.750   1.00 1.11  ? 27  LYS A HD3  1  
ATOM 423   H HE2  . LYS A 1 27  ? 19.099  4.135   6.817   1.00 1.65  ? 27  LYS A HE2  1  
ATOM 424   H HE3  . LYS A 1 27  ? 17.818  3.271   5.970   1.00 1.47  ? 27  LYS A HE3  1  
ATOM 425   H HZ1  . LYS A 1 27  ? 20.478  2.188   6.725   1.00 2.17  ? 27  LYS A HZ1  1  
ATOM 426   H HZ2  . LYS A 1 27  ? 19.337  1.357   5.801   1.00 2.11  ? 27  LYS A HZ2  1  
ATOM 427   H HZ3  . LYS A 1 27  ? 18.986  1.767   7.405   1.00 2.19  ? 27  LYS A HZ3  1  
ATOM 428   N N    . ASP A 1 28  ? 19.891  7.517   0.523   1.00 1.00  ? 28  ASP A N    1  
ATOM 429   C CA   . ASP A 1 28  ? 20.598  7.808   -0.717  1.00 1.19  ? 28  ASP A CA   1  
ATOM 430   C C    . ASP A 1 28  ? 20.581  9.305   -1.005  1.00 1.26  ? 28  ASP A C    1  
ATOM 431   O O    . ASP A 1 28  ? 21.491  9.845   -1.634  1.00 1.58  ? 28  ASP A O    1  
ATOM 432   C CB   . ASP A 1 28  ? 19.971  7.034   -1.878  1.00 1.33  ? 28  ASP A CB   1  
ATOM 433   C CG   . ASP A 1 28  ? 20.764  7.169   -3.160  1.00 1.65  ? 28  ASP A CG   1  
ATOM 434   O OD1  . ASP A 1 28  ? 21.748  6.415   -3.335  1.00 2.08  ? 28  ASP A OD1  1  
ATOM 435   O OD2  . ASP A 1 28  ? 20.403  8.021   -3.998  1.00 2.16  ? 28  ASP A OD2  1  
ATOM 436   H H    . ASP A 1 28  ? 18.959  7.218   0.488   1.00 0.99  ? 28  ASP A H    1  
ATOM 437   H HA   . ASP A 1 28  ? 21.622  7.489   -0.596  1.00 1.28  ? 28  ASP A HA   1  
ATOM 438   H HB2  . ASP A 1 28  ? 19.920  5.987   -1.618  1.00 1.33  ? 28  ASP A HB2  1  
ATOM 439   H HB3  . ASP A 1 28  ? 18.973  7.407   -2.053  1.00 1.44  ? 28  ASP A HB3  1  
ATOM 440   N N    . GLY A 1 29  ? 19.553  9.972   -0.492  1.00 1.15  ? 29  GLY A N    1  
ATOM 441   C CA   . GLY A 1 29  ? 19.484  11.424  -0.540  1.00 1.32  ? 29  GLY A CA   1  
ATOM 442   C C    . GLY A 1 29  ? 19.307  11.996  -1.935  1.00 1.51  ? 29  GLY A C    1  
ATOM 443   O O    . GLY A 1 29  ? 19.533  13.190  -2.143  1.00 1.64  ? 29  GLY A O    1  
ATOM 444   H H    . GLY A 1 29  ? 18.825  9.470   -0.073  1.00 1.14  ? 29  GLY A H    1  
ATOM 445   H HA2  . GLY A 1 29  ? 18.653  11.747  0.068   1.00 1.60  ? 29  GLY A HA2  1  
ATOM 446   H HA3  . GLY A 1 29  ? 20.394  11.824  -0.116  1.00 1.54  ? 29  GLY A HA3  1  
ATOM 447   N N    . TYR A 1 30  ? 18.905  11.162  -2.887  1.00 2.07  ? 30  TYR A N    1  
ATOM 448   C CA   . TYR A 1 30  ? 18.691  11.616  -4.257  1.00 2.80  ? 30  TYR A CA   1  
ATOM 449   C C    . TYR A 1 30  ? 17.431  12.483  -4.351  1.00 2.61  ? 30  TYR A C    1  
ATOM 450   O O    . TYR A 1 30  ? 17.493  13.705  -4.192  1.00 3.02  ? 30  TYR A O    1  
ATOM 451   C CB   . TYR A 1 30  ? 18.607  10.409  -5.204  1.00 3.68  ? 30  TYR A CB   1  
ATOM 452   C CG   . TYR A 1 30  ? 18.339  10.763  -6.652  1.00 4.52  ? 30  TYR A CG   1  
ATOM 453   C CD1  . TYR A 1 30  ? 19.271  11.460  -7.409  1.00 5.11  ? 30  TYR A CD1  1  
ATOM 454   C CD2  . TYR A 1 30  ? 17.148  10.390  -7.261  1.00 5.12  ? 30  TYR A CD2  1  
ATOM 455   C CE1  . TYR A 1 30  ? 19.023  11.777  -8.731  1.00 6.04  ? 30  TYR A CE1  1  
ATOM 456   C CE2  . TYR A 1 30  ? 16.892  10.702  -8.578  1.00 6.09  ? 30  TYR A CE2  1  
ATOM 457   C CZ   . TYR A 1 30  ? 17.830  11.395  -9.310  1.00 6.45  ? 30  TYR A CZ   1  
ATOM 458   O OH   . TYR A 1 30  ? 17.572  11.707  -10.624 1.00 7.51  ? 30  TYR A OH   1  
ATOM 459   H H    . TYR A 1 30  ? 18.760  10.220  -2.667  1.00 2.21  ? 30  TYR A H    1  
ATOM 460   H HA   . TYR A 1 30  ? 19.544  12.219  -4.536  1.00 3.26  ? 30  TYR A HA   1  
ATOM 461   H HB2  . TYR A 1 30  ? 19.540  9.868   -5.168  1.00 3.86  ? 30  TYR A HB2  1  
ATOM 462   H HB3  . TYR A 1 30  ? 17.811  9.758   -4.870  1.00 3.95  ? 30  TYR A HB3  1  
ATOM 463   H HD1  . TYR A 1 30  ? 20.203  11.758  -6.950  1.00 5.09  ? 30  TYR A HD1  1  
ATOM 464   H HD2  . TYR A 1 30  ? 16.413  9.848   -6.686  1.00 5.07  ? 30  TYR A HD2  1  
ATOM 465   H HE1  . TYR A 1 30  ? 19.760  12.318  -9.304  1.00 6.63  ? 30  TYR A HE1  1  
ATOM 466   H HE2  . TYR A 1 30  ? 15.960  10.404  -9.031  1.00 6.74  ? 30  TYR A HE2  1  
ATOM 467   H HH   . TYR A 1 30  ? 18.313  11.416  -11.174 1.00 7.75  ? 30  TYR A HH   1  
ATOM 468   N N    . ASN A 1 31  ? 16.293  11.849  -4.589  1.00 2.62  ? 31  ASN A N    1  
ATOM 469   C CA   . ASN A 1 31  ? 15.009  12.542  -4.648  1.00 2.78  ? 31  ASN A CA   1  
ATOM 470   C C    . ASN A 1 31  ? 14.011  11.804  -3.777  1.00 1.96  ? 31  ASN A C    1  
ATOM 471   O O    . ASN A 1 31  ? 12.835  11.677  -4.129  1.00 2.53  ? 31  ASN A O    1  
ATOM 472   C CB   . ASN A 1 31  ? 14.473  12.608  -6.088  1.00 3.85  ? 31  ASN A CB   1  
ATOM 473   C CG   . ASN A 1 31  ? 15.152  13.655  -6.956  1.00 4.61  ? 31  ASN A CG   1  
ATOM 474   O OD1  . ASN A 1 31  ? 16.329  13.969  -6.786  1.00 4.92  ? 31  ASN A OD1  1  
ATOM 475   N ND2  . ASN A 1 31  ? 14.406  14.207  -7.900  1.00 5.33  ? 31  ASN A ND2  1  
ATOM 476   H H    . ASN A 1 31  ? 16.311  10.880  -4.738  1.00 2.93  ? 31  ASN A H    1  
ATOM 477   H HA   . ASN A 1 31  ? 15.145  13.543  -4.267  1.00 3.24  ? 31  ASN A HA   1  
ATOM 478   H HB2  . ASN A 1 31  ? 14.614  11.647  -6.556  1.00 4.17  ? 31  ASN A HB2  1  
ATOM 479   H HB3  . ASN A 1 31  ? 13.417  12.828  -6.055  1.00 4.22  ? 31  ASN A HB3  1  
ATOM 480   H HD21 . ASN A 1 31  ? 13.472  13.914  -7.985  1.00 5.37  ? 31  ASN A HD21 1  
ATOM 481   H HD22 . ASN A 1 31  ? 14.815  14.887  -8.477  1.00 5.97  ? 31  ASN A HD22 1  
ATOM 482   N N    . TYR A 1 32  ? 14.496  11.331  -2.631  1.00 1.18  ? 32  TYR A N    1  
ATOM 483   C CA   . TYR A 1 32  ? 13.745  10.411  -1.788  1.00 1.18  ? 32  TYR A CA   1  
ATOM 484   C C    . TYR A 1 32  ? 13.335  9.191   -2.601  1.00 0.92  ? 32  TYR A C    1  
ATOM 485   O O    . TYR A 1 32  ? 12.156  8.881   -2.756  1.00 1.05  ? 32  TYR A O    1  
ATOM 486   C CB   . TYR A 1 32  ? 12.536  11.098  -1.145  1.00 1.78  ? 32  TYR A CB   1  
ATOM 487   C CG   . TYR A 1 32  ? 12.925  12.103  -0.086  1.00 2.38  ? 32  TYR A CG   1  
ATOM 488   C CD1  . TYR A 1 32  ? 13.319  11.683  1.179   1.00 3.08  ? 32  TYR A CD1  1  
ATOM 489   C CD2  . TYR A 1 32  ? 12.911  13.466  -0.350  1.00 2.99  ? 32  TYR A CD2  1  
ATOM 490   C CE1  . TYR A 1 32  ? 13.689  12.594  2.150   1.00 3.93  ? 32  TYR A CE1  1  
ATOM 491   C CE2  . TYR A 1 32  ? 13.278  14.384  0.617   1.00 3.86  ? 32  TYR A CE2  1  
ATOM 492   C CZ   . TYR A 1 32  ? 13.667  13.942  1.865   1.00 4.19  ? 32  TYR A CZ   1  
ATOM 493   O OH   . TYR A 1 32  ? 14.036  14.854  2.832   1.00 5.19  ? 32  TYR A OH   1  
ATOM 494   H H    . TYR A 1 32  ? 15.386  11.623  -2.336  1.00 1.45  ? 32  TYR A H    1  
ATOM 495   H HA   . TYR A 1 32  ? 14.411  10.081  -1.003  1.00 1.86  ? 32  TYR A HA   1  
ATOM 496   H HB2  . TYR A 1 32  ? 11.975  11.616  -1.909  1.00 2.16  ? 32  TYR A HB2  1  
ATOM 497   H HB3  . TYR A 1 32  ? 11.906  10.351  -0.683  1.00 2.32  ? 32  TYR A HB3  1  
ATOM 498   H HD1  . TYR A 1 32  ? 13.335  10.626  1.399   1.00 3.32  ? 32  TYR A HD1  1  
ATOM 499   H HD2  . TYR A 1 32  ? 12.605  13.809  -1.328  1.00 3.17  ? 32  TYR A HD2  1  
ATOM 500   H HE1  . TYR A 1 32  ? 13.992  12.247  3.127   1.00 4.65  ? 32  TYR A HE1  1  
ATOM 501   H HE2  . TYR A 1 32  ? 13.260  15.439  0.392   1.00 4.54  ? 32  TYR A HE2  1  
ATOM 502   H HH   . TYR A 1 32  ? 14.896  14.601  3.196   1.00 5.57  ? 32  TYR A HH   1  
ATOM 503   N N    . THR A 1 33  ? 14.345  8.522   -3.130  1.00 0.67  ? 33  THR A N    1  
ATOM 504   C CA   . THR A 1 33  ? 14.175  7.332   -3.942  1.00 0.46  ? 33  THR A CA   1  
ATOM 505   C C    . THR A 1 33  ? 14.995  6.212   -3.326  1.00 0.38  ? 33  THR A C    1  
ATOM 506   O O    . THR A 1 33  ? 16.113  6.433   -2.857  1.00 0.44  ? 33  THR A O    1  
ATOM 507   C CB   . THR A 1 33  ? 14.639  7.602   -5.389  1.00 0.45  ? 33  THR A CB   1  
ATOM 508   O OG1  . THR A 1 33  ? 14.467  8.993   -5.701  1.00 0.66  ? 33  THR A OG1  1  
ATOM 509   C CG2  . THR A 1 33  ? 13.857  6.767   -6.392  1.00 0.43  ? 33  THR A CG2  1  
ATOM 510   H H    . THR A 1 33  ? 15.253  8.842   -2.964  1.00 0.73  ? 33  THR A H    1  
ATOM 511   H HA   . THR A 1 33  ? 13.134  7.038   -3.949  1.00 0.50  ? 33  THR A HA   1  
ATOM 512   H HB   . THR A 1 33  ? 15.683  7.349   -5.471  1.00 0.56  ? 33  THR A HB   1  
ATOM 513   H HG1  . THR A 1 33  ? 13.719  9.096   -6.299  1.00 1.28  ? 33  THR A HG1  1  
ATOM 514   H HG21 . THR A 1 33  ? 12.811  7.031   -6.347  1.00 1.10  ? 33  THR A HG21 1  
ATOM 515   H HG22 . THR A 1 33  ? 13.972  5.716   -6.158  1.00 0.99  ? 33  THR A HG22 1  
ATOM 516   H HG23 . THR A 1 33  ? 14.232  6.952   -7.389  1.00 1.14  ? 33  THR A HG23 1  
ATOM 517   N N    . LEU A 1 34  ? 14.434  5.023   -3.304  1.00 0.32  ? 34  LEU A N    1  
ATOM 518   C CA   . LEU A 1 34  ? 15.057  3.902   -2.634  1.00 0.30  ? 34  LEU A CA   1  
ATOM 519   C C    . LEU A 1 34  ? 16.040  3.235   -3.566  1.00 0.31  ? 34  LEU A C    1  
ATOM 520   O O    . LEU A 1 34  ? 15.666  2.504   -4.481  1.00 0.34  ? 34  LEU A O    1  
ATOM 521   C CB   . LEU A 1 34  ? 13.967  2.928   -2.182  1.00 0.30  ? 34  LEU A CB   1  
ATOM 522   C CG   . LEU A 1 34  ? 13.932  2.619   -0.687  1.00 0.29  ? 34  LEU A CG   1  
ATOM 523   C CD1  . LEU A 1 34  ? 12.647  1.897   -0.317  1.00 0.45  ? 34  LEU A CD1  1  
ATOM 524   C CD2  . LEU A 1 34  ? 15.131  1.783   -0.293  1.00 0.28  ? 34  LEU A CD2  1  
ATOM 525   H H    . LEU A 1 34  ? 13.561  4.894   -3.743  1.00 0.32  ? 34  LEU A H    1  
ATOM 526   H HA   . LEU A 1 34  ? 15.599  4.267   -1.777  1.00 0.32  ? 34  LEU A HA   1  
ATOM 527   H HB2  . LEU A 1 34  ? 13.004  3.356   -2.453  1.00 0.34  ? 34  LEU A HB2  1  
ATOM 528   H HB3  . LEU A 1 34  ? 14.107  1.996   -2.721  1.00 0.34  ? 34  LEU A HB3  1  
ATOM 529   H HG   . LEU A 1 34  ? 13.970  3.547   -0.135  1.00 0.32  ? 34  LEU A HG   1  
ATOM 530   H HD11 . LEU A 1 34  ? 12.632  1.712   0.748   1.00 1.03  ? 34  LEU A HD11 1  
ATOM 531   H HD12 . LEU A 1 34  ? 12.595  0.958   -0.847  1.00 1.18  ? 34  LEU A HD12 1  
ATOM 532   H HD13 . LEU A 1 34  ? 11.802  2.510   -0.588  1.00 1.08  ? 34  LEU A HD13 1  
ATOM 533   H HD21 . LEU A 1 34  ? 16.024  2.381   -0.370  1.00 1.05  ? 34  LEU A HD21 1  
ATOM 534   H HD22 . LEU A 1 34  ? 15.209  0.933   -0.956  1.00 1.09  ? 34  LEU A HD22 1  
ATOM 535   H HD23 . LEU A 1 34  ? 15.012  1.435   0.721   1.00 1.01  ? 34  LEU A HD23 1  
ATOM 536   N N    . SER A 1 35  ? 17.308  3.513   -3.314  1.00 0.32  ? 35  SER A N    1  
ATOM 537   C CA   . SER A 1 35  ? 18.382  3.066   -4.167  1.00 0.33  ? 35  SER A CA   1  
ATOM 538   C C    . SER A 1 35  ? 18.577  1.565   -4.044  1.00 0.32  ? 35  SER A C    1  
ATOM 539   O O    . SER A 1 35  ? 18.011  0.938   -3.152  1.00 0.30  ? 35  SER A O    1  
ATOM 540   C CB   . SER A 1 35  ? 19.661  3.822   -3.818  1.00 0.37  ? 35  SER A CB   1  
ATOM 541   O OG   . SER A 1 35  ? 20.669  3.626   -4.796  1.00 0.40  ? 35  SER A OG   1  
ATOM 542   H H    . SER A 1 35  ? 17.525  4.047   -2.522  1.00 0.33  ? 35  SER A H    1  
ATOM 543   H HA   . SER A 1 35  ? 18.108  3.290   -5.175  1.00 0.35  ? 35  SER A HA   1  
ATOM 544   H HB2  . SER A 1 35  ? 19.443  4.878   -3.754  1.00 0.39  ? 35  SER A HB2  1  
ATOM 545   H HB3  . SER A 1 35  ? 20.029  3.474   -2.864  1.00 0.38  ? 35  SER A HB3  1  
ATOM 546   H HG   . SER A 1 35  ? 21.308  4.349   -4.741  1.00 0.68  ? 35  SER A HG   1  
ATOM 547   N N    . LYS A 1 36  ? 19.376  1.002   -4.943  1.00 0.38  ? 36  LYS A N    1  
ATOM 548   C CA   . LYS A 1 36  ? 19.570  -0.437  -5.010  1.00 0.42  ? 36  LYS A CA   1  
ATOM 549   C C    . LYS A 1 36  ? 19.942  -0.999  -3.646  1.00 0.36  ? 36  LYS A C    1  
ATOM 550   O O    . LYS A 1 36  ? 19.180  -1.761  -3.063  1.00 0.35  ? 36  LYS A O    1  
ATOM 551   C CB   . LYS A 1 36  ? 20.653  -0.780  -6.033  1.00 0.53  ? 36  LYS A CB   1  
ATOM 552   C CG   . LYS A 1 36  ? 20.745  -2.260  -6.357  1.00 0.62  ? 36  LYS A CG   1  
ATOM 553   C CD   . LYS A 1 36  ? 19.488  -2.752  -7.054  1.00 0.66  ? 36  LYS A CD   1  
ATOM 554   C CE   . LYS A 1 36  ? 19.598  -4.214  -7.453  1.00 0.61  ? 36  LYS A CE   1  
ATOM 555   N NZ   . LYS A 1 36  ? 20.721  -4.452  -8.395  1.00 0.65  ? 36  LYS A NZ   1  
ATOM 556   H H    . LYS A 1 36  ? 19.852  1.578   -5.581  1.00 0.43  ? 36  LYS A H    1  
ATOM 557   H HA   . LYS A 1 36  ? 18.641  -0.881  -5.323  1.00 0.46  ? 36  LYS A HA   1  
ATOM 558   H HB2  . LYS A 1 36  ? 20.446  -0.247  -6.949  1.00 0.58  ? 36  LYS A HB2  1  
ATOM 559   H HB3  . LYS A 1 36  ? 21.608  -0.458  -5.648  1.00 0.56  ? 36  LYS A HB3  1  
ATOM 560   H HG2  . LYS A 1 36  ? 21.592  -2.428  -7.004  1.00 1.06  ? 36  LYS A HG2  1  
ATOM 561   H HG3  . LYS A 1 36  ? 20.876  -2.813  -5.438  1.00 1.21  ? 36  LYS A HG3  1  
ATOM 562   H HD2  . LYS A 1 36  ? 18.649  -2.637  -6.384  1.00 1.25  ? 36  LYS A HD2  1  
ATOM 563   H HD3  . LYS A 1 36  ? 19.326  -2.158  -7.941  1.00 1.12  ? 36  LYS A HD3  1  
ATOM 564   H HE2  . LYS A 1 36  ? 19.756  -4.805  -6.564  1.00 0.66  ? 36  LYS A HE2  1  
ATOM 565   H HE3  . LYS A 1 36  ? 18.674  -4.514  -7.924  1.00 0.58  ? 36  LYS A HE3  1  
ATOM 566   H HZ1  . LYS A 1 36  ? 21.632  -4.350  -7.905  1.00 1.18  ? 36  LYS A HZ1  1  
ATOM 567   H HZ2  . LYS A 1 36  ? 20.686  -3.771  -9.177  1.00 1.14  ? 36  LYS A HZ2  1  
ATOM 568   H HZ3  . LYS A 1 36  ? 20.657  -5.419  -8.789  1.00 1.16  ? 36  LYS A HZ3  1  
ATOM 569   N N    . THR A 1 37  ? 21.080  -0.577  -3.119  1.00 0.37  ? 37  THR A N    1  
ATOM 570   C CA   . THR A 1 37  ? 21.578  -1.097  -1.854  1.00 0.38  ? 37  THR A CA   1  
ATOM 571   C C    . THR A 1 37  ? 20.649  -0.745  -0.691  1.00 0.36  ? 37  THR A C    1  
ATOM 572   O O    . THR A 1 37  ? 20.504  -1.515  0.264   1.00 0.38  ? 37  THR A O    1  
ATOM 573   C CB   . THR A 1 37  ? 22.978  -0.551  -1.561  1.00 0.44  ? 37  THR A CB   1  
ATOM 574   O OG1  . THR A 1 37  ? 23.823  -0.745  -2.704  1.00 0.48  ? 37  THR A OG1  1  
ATOM 575   C CG2  . THR A 1 37  ? 23.577  -1.256  -0.355  1.00 0.49  ? 37  THR A CG2  1  
ATOM 576   H H    . THR A 1 37  ? 21.606  0.103   -3.595  1.00 0.39  ? 37  THR A H    1  
ATOM 577   H HA   . THR A 1 37  ? 21.644  -2.172  -1.937  1.00 0.39  ? 37  THR A HA   1  
ATOM 578   H HB   . THR A 1 37  ? 22.897  0.508   -1.351  1.00 0.44  ? 37  THR A HB   1  
ATOM 579   H HG1  . THR A 1 37  ? 24.227  0.095   -2.948  1.00 0.80  ? 37  THR A HG1  1  
ATOM 580   H HG21 . THR A 1 37  ? 23.612  -2.320  -0.544  1.00 1.15  ? 37  THR A HG21 1  
ATOM 581   H HG22 . THR A 1 37  ? 22.960  -1.069  0.513   1.00 1.09  ? 37  THR A HG22 1  
ATOM 582   H HG23 . THR A 1 37  ? 24.575  -0.886  -0.178  1.00 1.13  ? 37  THR A HG23 1  
ATOM 583   N N    . GLU A 1 38  ? 20.006  0.408   -0.787  1.00 0.34  ? 38  GLU A N    1  
ATOM 584   C CA   . GLU A 1 38  ? 19.081  0.855   0.242   1.00 0.34  ? 38  GLU A CA   1  
ATOM 585   C C    . GLU A 1 38  ? 17.869  -0.055  0.254   1.00 0.34  ? 38  GLU A C    1  
ATOM 586   O O    . GLU A 1 38  ? 17.310  -0.357  1.305   1.00 0.48  ? 38  GLU A O    1  
ATOM 587   C CB   . GLU A 1 38  ? 18.654  2.305   0.002   1.00 0.35  ? 38  GLU A CB   1  
ATOM 588   C CG   . GLU A 1 38  ? 19.689  3.344   0.419   1.00 0.47  ? 38  GLU A CG   1  
ATOM 589   C CD   . GLU A 1 38  ? 21.072  3.082   -0.139  1.00 1.27  ? 38  GLU A CD   1  
ATOM 590   O OE1  . GLU A 1 38  ? 21.217  2.993   -1.372  1.00 1.96  ? 38  GLU A OE1  1  
ATOM 591   O OE2  . GLU A 1 38  ? 22.024  2.956   0.658   1.00 2.16  ? 38  GLU A OE2  1  
ATOM 592   H H    . GLU A 1 38  ? 20.143  0.966   -1.582  1.00 0.34  ? 38  GLU A H    1  
ATOM 593   H HA   . GLU A 1 38  ? 19.579  0.791   1.196   1.00 0.35  ? 38  GLU A HA   1  
ATOM 594   H HB2  . GLU A 1 38  ? 18.446  2.436   -1.048  1.00 0.41  ? 38  GLU A HB2  1  
ATOM 595   H HB3  . GLU A 1 38  ? 17.750  2.492   0.561   1.00 0.45  ? 38  GLU A HB3  1  
ATOM 596   H HG2  . GLU A 1 38  ? 19.362  4.313   0.075   1.00 1.16  ? 38  GLU A HG2  1  
ATOM 597   H HG3  . GLU A 1 38  ? 19.750  3.351   1.498   1.00 1.30  ? 38  GLU A HG3  1  
ATOM 598   N N    . PHE A 1 39  ? 17.495  -0.511  -0.931  1.00 0.29  ? 39  PHE A N    1  
ATOM 599   C CA   . PHE A 1 39  ? 16.357  -1.391  -1.101  1.00 0.31  ? 39  PHE A CA   1  
ATOM 600   C C    . PHE A 1 39  ? 16.744  -2.804  -0.724  1.00 0.28  ? 39  PHE A C    1  
ATOM 601   O O    . PHE A 1 39  ? 15.932  -3.567  -0.211  1.00 0.27  ? 39  PHE A O    1  
ATOM 602   C CB   . PHE A 1 39  ? 15.882  -1.343  -2.550  1.00 0.53  ? 39  PHE A CB   1  
ATOM 603   C CG   . PHE A 1 39  ? 14.551  -1.993  -2.777  1.00 0.81  ? 39  PHE A CG   1  
ATOM 604   C CD1  . PHE A 1 39  ? 13.447  -1.611  -2.036  1.00 1.78  ? 39  PHE A CD1  1  
ATOM 605   C CD2  . PHE A 1 39  ? 14.403  -2.978  -3.740  1.00 1.76  ? 39  PHE A CD2  1  
ATOM 606   C CE1  . PHE A 1 39  ? 12.217  -2.199  -2.249  1.00 2.66  ? 39  PHE A CE1  1  
ATOM 607   C CE2  . PHE A 1 39  ? 13.177  -3.570  -3.957  1.00 2.62  ? 39  PHE A CE2  1  
ATOM 608   C CZ   . PHE A 1 39  ? 12.081  -3.180  -3.211  1.00 2.88  ? 39  PHE A CZ   1  
ATOM 609   H H    . PHE A 1 39  ? 18.009  -0.246  -1.728  1.00 0.34  ? 39  PHE A H    1  
ATOM 610   H HA   . PHE A 1 39  ? 15.565  -1.053  -0.449  1.00 0.35  ? 39  PHE A HA   1  
ATOM 611   H HB2  . PHE A 1 39  ? 15.808  -0.316  -2.860  1.00 1.23  ? 39  PHE A HB2  1  
ATOM 612   H HB3  . PHE A 1 39  ? 16.607  -1.847  -3.172  1.00 1.41  ? 39  PHE A HB3  1  
ATOM 613   H HD1  . PHE A 1 39  ? 13.553  -0.844  -1.284  1.00 2.31  ? 39  PHE A HD1  1  
ATOM 614   H HD2  . PHE A 1 39  ? 15.259  -3.282  -4.324  1.00 2.31  ? 39  PHE A HD2  1  
ATOM 615   H HE1  . PHE A 1 39  ? 11.365  -1.892  -1.663  1.00 3.51  ? 39  PHE A HE1  1  
ATOM 616   H HE2  . PHE A 1 39  ? 13.073  -4.335  -4.709  1.00 3.45  ? 39  PHE A HE2  1  
ATOM 617   H HZ   . PHE A 1 39  ? 11.120  -3.644  -3.380  1.00 3.70  ? 39  PHE A HZ   1  
ATOM 618   N N    . LEU A 1 40  ? 17.997  -3.144  -0.983  1.00 0.33  ? 40  LEU A N    1  
ATOM 619   C CA   . LEU A 1 40  ? 18.537  -4.429  -0.586  1.00 0.37  ? 40  LEU A CA   1  
ATOM 620   C C    . LEU A 1 40  ? 18.474  -4.554  0.927   1.00 0.40  ? 40  LEU A C    1  
ATOM 621   O O    . LEU A 1 40  ? 17.941  -5.523  1.466   1.00 0.43  ? 40  LEU A O    1  
ATOM 622   C CB   . LEU A 1 40  ? 19.982  -4.571  -1.062  1.00 0.43  ? 40  LEU A CB   1  
ATOM 623   C CG   . LEU A 1 40  ? 20.217  -4.346  -2.560  1.00 0.50  ? 40  LEU A CG   1  
ATOM 624   C CD1  . LEU A 1 40  ? 21.533  -4.964  -3.000  1.00 1.07  ? 40  LEU A CD1  1  
ATOM 625   C CD2  . LEU A 1 40  ? 19.059  -4.881  -3.384  1.00 0.46  ? 40  LEU A CD2  1  
ATOM 626   H H    . LEU A 1 40  ? 18.572  -2.513  -1.470  1.00 0.37  ? 40  LEU A H    1  
ATOM 627   H HA   . LEU A 1 40  ? 17.933  -5.201  -1.034  1.00 0.38  ? 40  LEU A HA   1  
ATOM 628   H HB2  . LEU A 1 40  ? 20.577  -3.846  -0.520  1.00 0.65  ? 40  LEU A HB2  1  
ATOM 629   H HB3  . LEU A 1 40  ? 20.326  -5.560  -0.808  1.00 0.47  ? 40  LEU A HB3  1  
ATOM 630   H HG   . LEU A 1 40  ? 20.282  -3.283  -2.743  1.00 0.80  ? 40  LEU A HG   1  
ATOM 631   H HD11 . LEU A 1 40  ? 22.344  -4.518  -2.443  1.00 1.87  ? 40  LEU A HD11 1  
ATOM 632   H HD12 . LEU A 1 40  ? 21.679  -4.784  -4.055  1.00 1.41  ? 40  LEU A HD12 1  
ATOM 633   H HD13 . LEU A 1 40  ? 21.511  -6.027  -2.815  1.00 1.46  ? 40  LEU A HD13 1  
ATOM 634   H HD21 . LEU A 1 40  ? 19.294  -4.794  -4.434  1.00 1.02  ? 40  LEU A HD21 1  
ATOM 635   H HD22 . LEU A 1 40  ? 18.175  -4.295  -3.165  1.00 0.97  ? 40  LEU A HD22 1  
ATOM 636   H HD23 . LEU A 1 40  ? 18.880  -5.915  -3.134  1.00 1.09  ? 40  LEU A HD23 1  
ATOM 637   N N    . SER A 1 41  ? 19.004  -3.546  1.601   1.00 0.42  ? 41  SER A N    1  
ATOM 638   C CA   . SER A 1 41  ? 18.952  -3.478  3.049   1.00 0.52  ? 41  SER A CA   1  
ATOM 639   C C    . SER A 1 41  ? 17.501  -3.438  3.514   1.00 0.45  ? 41  SER A C    1  
ATOM 640   O O    . SER A 1 41  ? 17.119  -4.157  4.434   1.00 0.47  ? 41  SER A O    1  
ATOM 641   C CB   . SER A 1 41  ? 19.702  -2.240  3.538   1.00 0.67  ? 41  SER A CB   1  
ATOM 642   O OG   . SER A 1 41  ? 21.027  -2.213  3.030   1.00 1.40  ? 41  SER A OG   1  
ATOM 643   H H    . SER A 1 41  ? 19.449  -2.828  1.105   1.00 0.42  ? 41  SER A H    1  
ATOM 644   H HA   . SER A 1 41  ? 19.427  -4.363  3.445   1.00 0.60  ? 41  SER A HA   1  
ATOM 645   H HB2  . SER A 1 41  ? 19.183  -1.353  3.206   1.00 1.27  ? 41  SER A HB2  1  
ATOM 646   H HB3  . SER A 1 41  ? 19.743  -2.251  4.617   1.00 1.19  ? 41  SER A HB3  1  
ATOM 647   H HG   . SER A 1 41  ? 21.017  -1.875  2.124   1.00 1.97  ? 41  SER A HG   1  
ATOM 648   N N    . PHE A 1 42  ? 16.700  -2.602  2.852   1.00 0.42  ? 42  PHE A N    1  
ATOM 649   C CA   . PHE A 1 42  ? 15.273  -2.494  3.137   1.00 0.46  ? 42  PHE A CA   1  
ATOM 650   C C    . PHE A 1 42  ? 14.608  -3.850  3.084   1.00 0.29  ? 42  PHE A C    1  
ATOM 651   O O    . PHE A 1 42  ? 14.050  -4.307  4.062   1.00 0.43  ? 42  PHE A O    1  
ATOM 652   C CB   . PHE A 1 42  ? 14.592  -1.570  2.124   1.00 0.80  ? 42  PHE A CB   1  
ATOM 653   C CG   . PHE A 1 42  ? 13.124  -1.392  2.378   1.00 1.89  ? 42  PHE A CG   1  
ATOM 654   C CD1  . PHE A 1 42  ? 12.675  -0.406  3.235   1.00 2.69  ? 42  PHE A CD1  1  
ATOM 655   C CD2  . PHE A 1 42  ? 12.195  -2.223  1.774   1.00 2.77  ? 42  PHE A CD2  1  
ATOM 656   C CE1  . PHE A 1 42  ? 11.330  -0.247  3.487   1.00 3.73  ? 42  PHE A CE1  1  
ATOM 657   C CE2  . PHE A 1 42  ? 10.847  -2.072  2.025   1.00 3.80  ? 42  PHE A CE2  1  
ATOM 658   C CZ   . PHE A 1 42  ? 10.414  -1.082  2.883   1.00 4.13  ? 42  PHE A CZ   1  
ATOM 659   H H    . PHE A 1 42  ? 17.084  -2.035  2.146   1.00 0.44  ? 42  PHE A H    1  
ATOM 660   H HA   . PHE A 1 42  ? 15.147  -2.087  4.128   1.00 0.66  ? 42  PHE A HA   1  
ATOM 661   H HB2  . PHE A 1 42  ? 15.059  -0.590  2.158   1.00 0.53  ? 42  PHE A HB2  1  
ATOM 662   H HB3  . PHE A 1 42  ? 14.712  -1.998  1.134   1.00 1.30  ? 42  PHE A HB3  1  
ATOM 663   H HD1  . PHE A 1 42  ? 13.392  0.249   3.708   1.00 2.86  ? 42  PHE A HD1  1  
ATOM 664   H HD2  . PHE A 1 42  ? 12.533  -2.998  1.102   1.00 3.00  ? 42  PHE A HD2  1  
ATOM 665   H HE1  . PHE A 1 42  ? 10.994  0.530   4.159   1.00 4.49  ? 42  PHE A HE1  1  
ATOM 666   H HE2  . PHE A 1 42  ? 10.131  -2.725  1.548   1.00 4.58  ? 42  PHE A HE2  1  
ATOM 667   H HZ   . PHE A 1 42  ? 9.360   -0.961  3.081   1.00 5.02  ? 42  PHE A HZ   1  
ATOM 668   N N    . MET A 1 43  ? 14.672  -4.496  1.945   1.00 0.26  ? 43  MET A N    1  
ATOM 669   C CA   . MET A 1 43  ? 13.972  -5.754  1.767   1.00 0.29  ? 43  MET A CA   1  
ATOM 670   C C    . MET A 1 43  ? 14.497  -6.852  2.681   1.00 0.29  ? 43  MET A C    1  
ATOM 671   O O    . MET A 1 43  ? 13.741  -7.722  3.085   1.00 0.37  ? 43  MET A O    1  
ATOM 672   C CB   . MET A 1 43  ? 14.036  -6.219  0.327   1.00 0.39  ? 43  MET A CB   1  
ATOM 673   C CG   . MET A 1 43  ? 13.189  -5.388  -0.622  1.00 0.62  ? 43  MET A CG   1  
ATOM 674   S SD   . MET A 1 43  ? 12.690  -6.294  -2.101  1.00 1.22  ? 43  MET A SD   1  
ATOM 675   C CE   . MET A 1 43  ? 11.585  -7.521  -1.402  1.00 2.26  ? 43  MET A CE   1  
ATOM 676   H H    . MET A 1 43  ? 15.192  -4.110  1.195   1.00 0.29  ? 43  MET A H    1  
ATOM 677   H HA   . MET A 1 43  ? 12.938  -5.577  2.019   1.00 0.35  ? 43  MET A HA   1  
ATOM 678   H HB2  . MET A 1 43  ? 15.062  -6.162  0.004   1.00 0.75  ? 43  MET A HB2  1  
ATOM 679   H HB3  . MET A 1 43  ? 13.705  -7.243  0.281   1.00 0.69  ? 43  MET A HB3  1  
ATOM 680   H HG2  . MET A 1 43  ? 12.301  -5.066  -0.101  1.00 1.11  ? 43  MET A HG2  1  
ATOM 681   H HG3  . MET A 1 43  ? 13.757  -4.520  -0.925  1.00 1.23  ? 43  MET A HG3  1  
ATOM 682   H HE1  . MET A 1 43  ? 11.194  -8.145  -2.191  1.00 2.63  ? 43  MET A HE1  1  
ATOM 683   H HE2  . MET A 1 43  ? 10.769  -7.024  -0.898  1.00 2.66  ? 43  MET A HE2  1  
ATOM 684   H HE3  . MET A 1 43  ? 12.126  -8.132  -0.695  1.00 2.85  ? 43  MET A HE3  1  
ATOM 685   N N    . ASN A 1 44  ? 15.776  -6.829  3.015   1.00 0.29  ? 44  ASN A N    1  
ATOM 686   C CA   . ASN A 1 44  ? 16.309  -7.847  3.914   1.00 0.33  ? 44  ASN A CA   1  
ATOM 687   C C    . ASN A 1 44  ? 15.937  -7.565  5.365   1.00 0.32  ? 44  ASN A C    1  
ATOM 688   O O    . ASN A 1 44  ? 16.057  -8.441  6.219   1.00 0.39  ? 44  ASN A O    1  
ATOM 689   C CB   . ASN A 1 44  ? 17.823  -7.977  3.809   1.00 0.42  ? 44  ASN A CB   1  
ATOM 690   C CG   . ASN A 1 44  ? 18.280  -8.787  2.612   1.00 1.05  ? 44  ASN A CG   1  
ATOM 691   O OD1  . ASN A 1 44  ? 18.303  -10.017 2.653   1.00 1.54  ? 44  ASN A OD1  1  
ATOM 692   N ND2  . ASN A 1 44  ? 18.684  -8.108  1.557   1.00 1.83  ? 44  ASN A ND2  1  
ATOM 693   H H    . ASN A 1 44  ? 16.369  -6.134  2.649   1.00 0.30  ? 44  ASN A H    1  
ATOM 694   H HA   . ASN A 1 44  ? 15.865  -8.789  3.626   1.00 0.37  ? 44  ASN A HA   1  
ATOM 695   H HB2  . ASN A 1 44  ? 18.254  -6.996  3.741   1.00 1.03  ? 44  ASN A HB2  1  
ATOM 696   H HB3  . ASN A 1 44  ? 18.184  -8.459  4.697   1.00 0.89  ? 44  ASN A HB3  1  
ATOM 697   H HD21 . ASN A 1 44  ? 18.663  -7.124  1.600   1.00 1.98  ? 44  ASN A HD21 1  
ATOM 698   H HD22 . ASN A 1 44  ? 18.997  -8.610  0.775   1.00 2.46  ? 44  ASN A HD22 1  
ATOM 699   N N    . THR A 1 45  ? 15.507  -6.346  5.653   1.00 0.26  ? 45  THR A N    1  
ATOM 700   C CA   . THR A 1 45  ? 15.104  -5.996  7.016   1.00 0.29  ? 45  THR A CA   1  
ATOM 701   C C    . THR A 1 45  ? 13.593  -5.899  7.145   1.00 0.28  ? 45  THR A C    1  
ATOM 702   O O    . THR A 1 45  ? 12.953  -6.665  7.869   1.00 0.34  ? 45  THR A O    1  
ATOM 703   C CB   . THR A 1 45  ? 15.713  -4.654  7.465   1.00 0.29  ? 45  THR A CB   1  
ATOM 704   O OG1  . THR A 1 45  ? 15.552  -3.669  6.437   1.00 0.34  ? 45  THR A OG1  1  
ATOM 705   C CG2  . THR A 1 45  ? 17.187  -4.806  7.795   1.00 0.34  ? 45  THR A CG2  1  
ATOM 706   H H    . THR A 1 45  ? 15.453  -5.668  4.935   1.00 0.24  ? 45  THR A H    1  
ATOM 707   H HA   . THR A 1 45  ? 15.463  -6.770  7.679   1.00 0.33  ? 45  THR A HA   1  
ATOM 708   H HB   . THR A 1 45  ? 15.188  -4.320  8.351   1.00 0.29  ? 45  THR A HB   1  
ATOM 709   H HG1  . THR A 1 45  ? 16.207  -3.827  5.741   1.00 1.03  ? 45  THR A HG1  1  
ATOM 710   H HG21 . THR A 1 45  ? 17.714  -5.156  6.920   1.00 1.04  ? 45  THR A HG21 1  
ATOM 711   H HG22 . THR A 1 45  ? 17.306  -5.517  8.598   1.00 1.14  ? 45  THR A HG22 1  
ATOM 712   H HG23 . THR A 1 45  ? 17.588  -3.849  8.097   1.00 1.05  ? 45  THR A HG23 1  
ATOM 713   N N    . GLU A 1 46  ? 13.040  -4.968  6.400   1.00 0.23  ? 46  GLU A N    1  
ATOM 714   C CA   . GLU A 1 46  ? 11.644  -4.622  6.481   1.00 0.25  ? 46  GLU A CA   1  
ATOM 715   C C    . GLU A 1 46  ? 10.787  -5.637  5.730   1.00 0.25  ? 46  GLU A C    1  
ATOM 716   O O    . GLU A 1 46  ? 9.587   -5.711  5.934   1.00 0.34  ? 46  GLU A O    1  
ATOM 717   C CB   . GLU A 1 46  ? 11.433  -3.223  5.904   1.00 0.29  ? 46  GLU A CB   1  
ATOM 718   C CG   . GLU A 1 46  ? 12.346  -2.161  6.502   1.00 0.58  ? 46  GLU A CG   1  
ATOM 719   C CD   . GLU A 1 46  ? 12.065  -1.887  7.966   1.00 1.17  ? 46  GLU A CD   1  
ATOM 720   O OE1  . GLU A 1 46  ? 11.236  -1.002  8.261   1.00 1.70  ? 46  GLU A OE1  1  
ATOM 721   O OE2  . GLU A 1 46  ? 12.681  -2.537  8.833   1.00 1.68  ? 46  GLU A OE2  1  
ATOM 722   H H    . GLU A 1 46  ? 13.606  -4.482  5.760   1.00 0.20  ? 46  GLU A H    1  
ATOM 723   H HA   . GLU A 1 46  ? 11.364  -4.618  7.520   1.00 0.28  ? 46  GLU A HA   1  
ATOM 724   H HB2  . GLU A 1 46  ? 11.603  -3.257  4.844   1.00 0.43  ? 46  GLU A HB2  1  
ATOM 725   H HB3  . GLU A 1 46  ? 10.417  -2.927  6.081   1.00 0.54  ? 46  GLU A HB3  1  
ATOM 726   H HG2  . GLU A 1 46  ? 13.369  -2.493  6.407   1.00 0.66  ? 46  GLU A HG2  1  
ATOM 727   H HG3  . GLU A 1 46  ? 12.216  -1.242  5.949   1.00 0.71  ? 46  GLU A HG3  1  
ATOM 728   N N    . LEU A 1 47  ? 11.395  -6.420  4.856   1.00 0.25  ? 47  LEU A N    1  
ATOM 729   C CA   . LEU A 1 47  ? 10.640  -7.423  4.118   1.00 0.26  ? 47  LEU A CA   1  
ATOM 730   C C    . LEU A 1 47  ? 11.343  -8.760  4.138   1.00 0.28  ? 47  LEU A C    1  
ATOM 731   O O    . LEU A 1 47  ? 11.207  -9.557  3.211   1.00 0.30  ? 47  LEU A O    1  
ATOM 732   C CB   . LEU A 1 47  ? 10.416  -6.982  2.678   1.00 0.26  ? 47  LEU A CB   1  
ATOM 733   C CG   . LEU A 1 47  ? 9.607   -5.702  2.517   1.00 0.27  ? 47  LEU A CG   1  
ATOM 734   C CD1  . LEU A 1 47  ? 9.577   -5.281  1.062   1.00 0.32  ? 47  LEU A CD1  1  
ATOM 735   C CD2  . LEU A 1 47  ? 8.199   -5.904  3.057   1.00 0.27  ? 47  LEU A CD2  1  
ATOM 736   H H    . LEU A 1 47  ? 12.357  -6.321  4.698   1.00 0.29  ? 47  LEU A H    1  
ATOM 737   H HA   . LEU A 1 47  ? 9.681   -7.532  4.601   1.00 0.29  ? 47  LEU A HA   1  
ATOM 738   H HB2  . LEU A 1 47  ? 11.379  -6.844  2.209   1.00 0.27  ? 47  LEU A HB2  1  
ATOM 739   H HB3  . LEU A 1 47  ? 9.895   -7.775  2.166   1.00 0.27  ? 47  LEU A HB3  1  
ATOM 740   H HG   . LEU A 1 47  ? 10.077  -4.912  3.084   1.00 0.29  ? 47  LEU A HG   1  
ATOM 741   H HD11 . LEU A 1 47  ? 9.170   -6.085  0.463   1.00 1.00  ? 47  LEU A HD11 1  
ATOM 742   H HD12 . LEU A 1 47  ? 10.580  -5.060  0.732   1.00 0.93  ? 47  LEU A HD12 1  
ATOM 743   H HD13 . LEU A 1 47  ? 8.959   -4.403  0.955   1.00 0.95  ? 47  LEU A HD13 1  
ATOM 744   H HD21 . LEU A 1 47  ? 7.709   -6.692  2.504   1.00 0.92  ? 47  LEU A HD21 1  
ATOM 745   H HD22 . LEU A 1 47  ? 7.636   -4.988  2.955   1.00 1.01  ? 47  LEU A HD22 1  
ATOM 746   H HD23 . LEU A 1 47  ? 8.252   -6.179  4.102   1.00 1.12  ? 47  LEU A HD23 1  
ATOM 747   N N    . ALA A 1 48  ? 12.108  -8.997  5.191   1.00 0.32  ? 48  ALA A N    1  
ATOM 748   C CA   . ALA A 1 48  ? 12.820  -10.249 5.351   1.00 0.36  ? 48  ALA A CA   1  
ATOM 749   C C    . ALA A 1 48  ? 11.858  -11.431 5.350   1.00 0.39  ? 48  ALA A C    1  
ATOM 750   O O    . ALA A 1 48  ? 12.229  -12.541 4.980   1.00 0.44  ? 48  ALA A O    1  
ATOM 751   C CB   . ALA A 1 48  ? 13.641  -10.212 6.624   1.00 0.41  ? 48  ALA A CB   1  
ATOM 752   H H    . ALA A 1 48  ? 12.205  -8.304  5.878   1.00 0.34  ? 48  ALA A H    1  
ATOM 753   H HA   . ALA A 1 48  ? 13.497  -10.353 4.517   1.00 0.39  ? 48  ALA A HA   1  
ATOM 754   H HB1  . ALA A 1 48  ? 12.982  -10.135 7.475   1.00 1.06  ? 48  ALA A HB1  1  
ATOM 755   H HB2  . ALA A 1 48  ? 14.297  -9.351  6.596   1.00 1.14  ? 48  ALA A HB2  1  
ATOM 756   H HB3  . ALA A 1 48  ? 14.230  -11.113 6.701   1.00 1.02  ? 48  ALA A HB3  1  
ATOM 757   N N    . ALA A 1 49  ? 10.616  -11.174 5.741   1.00 0.38  ? 49  ALA A N    1  
ATOM 758   C CA   . ALA A 1 49  ? 9.562   -12.178 5.688   1.00 0.41  ? 49  ALA A CA   1  
ATOM 759   C C    . ALA A 1 49  ? 9.414   -12.726 4.276   1.00 0.41  ? 49  ALA A C    1  
ATOM 760   O O    . ALA A 1 49  ? 9.258   -13.928 4.075   1.00 0.47  ? 49  ALA A O    1  
ATOM 761   C CB   . ALA A 1 49  ? 8.250   -11.572 6.147   1.00 0.44  ? 49  ALA A CB   1  
ATOM 762   H H    . ALA A 1 49  ? 10.400  -10.276 6.077   1.00 0.37  ? 49  ALA A H    1  
ATOM 763   H HA   . ALA A 1 49  ? 9.823   -12.981 6.357   1.00 0.45  ? 49  ALA A HA   1  
ATOM 764   H HB1  . ALA A 1 49  ? 7.993   -10.740 5.501   1.00 1.16  ? 49  ALA A HB1  1  
ATOM 765   H HB2  . ALA A 1 49  ? 8.352   -11.221 7.162   1.00 1.10  ? 49  ALA A HB2  1  
ATOM 766   H HB3  . ALA A 1 49  ? 7.471   -12.317 6.098   1.00 1.07  ? 49  ALA A HB3  1  
ATOM 767   N N    . PHE A 1 50  ? 9.467   -11.827 3.309   1.00 0.36  ? 50  PHE A N    1  
ATOM 768   C CA   . PHE A 1 50  ? 9.358   -12.187 1.905   1.00 0.37  ? 50  PHE A CA   1  
ATOM 769   C C    . PHE A 1 50  ? 10.723  -12.580 1.350   1.00 0.38  ? 50  PHE A C    1  
ATOM 770   O O    . PHE A 1 50  ? 10.889  -13.645 0.757   1.00 0.44  ? 50  PHE A O    1  
ATOM 771   C CB   . PHE A 1 50  ? 8.812   -10.992 1.122   1.00 0.35  ? 50  PHE A CB   1  
ATOM 772   C CG   . PHE A 1 50  ? 8.583   -11.268 -0.340  1.00 0.70  ? 50  PHE A CG   1  
ATOM 773   C CD1  . PHE A 1 50  ? 7.429   -11.911 -0.764  1.00 1.32  ? 50  PHE A CD1  1  
ATOM 774   C CD2  . PHE A 1 50  ? 9.517   -10.883 -1.288  1.00 1.63  ? 50  PHE A CD2  1  
ATOM 775   C CE1  . PHE A 1 50  ? 7.214   -12.162 -2.106  1.00 1.66  ? 50  PHE A CE1  1  
ATOM 776   C CE2  . PHE A 1 50  ? 9.307   -11.133 -2.631  1.00 2.09  ? 50  PHE A CE2  1  
ATOM 777   C CZ   . PHE A 1 50  ? 8.154   -11.773 -3.040  1.00 1.80  ? 50  PHE A CZ   1  
ATOM 778   H H    . PHE A 1 50  ? 9.584   -10.884 3.547   1.00 0.32  ? 50  PHE A H    1  
ATOM 779   H HA   . PHE A 1 50  ? 8.678   -13.019 1.813   1.00 0.41  ? 50  PHE A HA   1  
ATOM 780   H HB2  . PHE A 1 50  ? 7.871   -10.688 1.557   1.00 0.61  ? 50  PHE A HB2  1  
ATOM 781   H HB3  . PHE A 1 50  ? 9.520   -10.177 1.202   1.00 0.56  ? 50  PHE A HB3  1  
ATOM 782   H HD1  . PHE A 1 50  ? 6.693   -12.215 -0.035  1.00 2.01  ? 50  PHE A HD1  1  
ATOM 783   H HD2  . PHE A 1 50  ? 10.420  -10.383 -0.970  1.00 2.27  ? 50  PHE A HD2  1  
ATOM 784   H HE1  . PHE A 1 50  ? 6.312   -12.663 -2.424  1.00 2.32  ? 50  PHE A HE1  1  
ATOM 785   H HE2  . PHE A 1 50  ? 10.043  -10.828 -3.359  1.00 2.96  ? 50  PHE A HE2  1  
ATOM 786   H HZ   . PHE A 1 50  ? 7.988   -11.969 -4.089  1.00 2.24  ? 50  PHE A HZ   1  
ATOM 787   N N    . THR A 1 51  ? 11.689  -11.706 1.578   1.00 0.36  ? 51  THR A N    1  
ATOM 788   C CA   . THR A 1 51  ? 13.029  -11.841 1.034   1.00 0.40  ? 51  THR A CA   1  
ATOM 789   C C    . THR A 1 51  ? 13.696  -13.153 1.437   1.00 0.45  ? 51  THR A C    1  
ATOM 790   O O    . THR A 1 51  ? 14.225  -13.878 0.592   1.00 0.54  ? 51  THR A O    1  
ATOM 791   C CB   . THR A 1 51  ? 13.891  -10.666 1.514   1.00 0.39  ? 51  THR A CB   1  
ATOM 792   O OG1  . THR A 1 51  ? 13.349  -9.436  1.025   1.00 0.39  ? 51  THR A OG1  1  
ATOM 793   C CG2  . THR A 1 51  ? 15.337  -10.815 1.069   1.00 0.49  ? 51  THR A CG2  1  
ATOM 794   H H    . THR A 1 51  ? 11.492  -10.922 2.140   1.00 0.36  ? 51  THR A H    1  
ATOM 795   H HA   . THR A 1 51  ? 12.964  -11.793 -0.042  1.00 0.44  ? 51  THR A HA   1  
ATOM 796   H HB   . THR A 1 51  ? 13.861  -10.652 2.593   1.00 0.36  ? 51  THR A HB   1  
ATOM 797   H HG1  . THR A 1 51  ? 13.249  -8.819  1.761   1.00 0.41  ? 51  THR A HG1  1  
ATOM 798   H HG21 . THR A 1 51  ? 15.782  -11.657 1.577   1.00 1.13  ? 51  THR A HG21 1  
ATOM 799   H HG22 . THR A 1 51  ? 15.883  -9.916  1.311   1.00 1.14  ? 51  THR A HG22 1  
ATOM 800   H HG23 . THR A 1 51  ? 15.370  -10.982 0.004   1.00 1.03  ? 51  THR A HG23 1  
ATOM 801   N N    . LYS A 1 52  ? 13.661  -13.464 2.723   1.00 0.48  ? 52  LYS A N    1  
ATOM 802   C CA   . LYS A 1 52  ? 14.351  -14.642 3.228   1.00 0.60  ? 52  LYS A CA   1  
ATOM 803   C C    . LYS A 1 52  ? 13.548  -15.899 2.924   1.00 0.69  ? 52  LYS A C    1  
ATOM 804   O O    . LYS A 1 52  ? 14.066  -17.014 2.989   1.00 0.84  ? 52  LYS A O    1  
ATOM 805   C CB   . LYS A 1 52  ? 14.585  -14.527 4.734   1.00 0.70  ? 52  LYS A CB   1  
ATOM 806   C CG   . LYS A 1 52  ? 15.340  -13.274 5.151   1.00 0.78  ? 52  LYS A CG   1  
ATOM 807   C CD   . LYS A 1 52  ? 16.756  -13.250 4.600   1.00 1.07  ? 52  LYS A CD   1  
ATOM 808   C CE   . LYS A 1 52  ? 17.533  -12.054 5.133   1.00 1.24  ? 52  LYS A CE   1  
ATOM 809   N NZ   . LYS A 1 52  ? 18.912  -11.992 4.582   1.00 1.82  ? 52  LYS A NZ   1  
ATOM 810   H H    . LYS A 1 52  ? 13.150  -12.899 3.346   1.00 0.45  ? 52  LYS A H    1  
ATOM 811   H HA   . LYS A 1 52  ? 15.304  -14.704 2.725   1.00 0.65  ? 52  LYS A HA   1  
ATOM 812   H HB2  . LYS A 1 52  ? 13.626  -14.525 5.233   1.00 0.71  ? 52  LYS A HB2  1  
ATOM 813   H HB3  . LYS A 1 52  ? 15.148  -15.387 5.064   1.00 0.79  ? 52  LYS A HB3  1  
ATOM 814   H HG2  . LYS A 1 52  ? 14.809  -12.410 4.777   1.00 1.34  ? 52  LYS A HG2  1  
ATOM 815   H HG3  . LYS A 1 52  ? 15.380  -13.233 6.230   1.00 1.23  ? 52  LYS A HG3  1  
ATOM 816   H HD2  . LYS A 1 52  ? 17.262  -14.157 4.895   1.00 1.64  ? 52  LYS A HD2  1  
ATOM 817   H HD3  . LYS A 1 52  ? 16.713  -13.191 3.523   1.00 1.63  ? 52  LYS A HD3  1  
ATOM 818   H HE2  . LYS A 1 52  ? 17.008  -11.150 4.862   1.00 1.50  ? 52  LYS A HE2  1  
ATOM 819   H HE3  . LYS A 1 52  ? 17.587  -12.128 6.209   1.00 1.67  ? 52  LYS A HE3  1  
ATOM 820   H HZ1  . LYS A 1 52  ? 19.437  -11.209 5.025   1.00 2.15  ? 52  LYS A HZ1  1  
ATOM 821   H HZ2  . LYS A 1 52  ? 18.882  -11.833 3.556   1.00 2.33  ? 52  LYS A HZ2  1  
ATOM 822   H HZ3  . LYS A 1 52  ? 19.418  -12.882 4.770   1.00 2.24  ? 52  LYS A HZ3  1  
ATOM 823   N N    . ASN A 1 53  ? 12.282  -15.708 2.585   1.00 0.68  ? 53  ASN A N    1  
ATOM 824   C CA   . ASN A 1 53  ? 11.395  -16.822 2.279   1.00 0.85  ? 53  ASN A CA   1  
ATOM 825   C C    . ASN A 1 53  ? 11.510  -17.204 0.808   1.00 1.00  ? 53  ASN A C    1  
ATOM 826   O O    . ASN A 1 53  ? 11.032  -18.258 0.385   1.00 1.22  ? 53  ASN A O    1  
ATOM 827   C CB   . ASN A 1 53  ? 9.949   -16.456 2.616   1.00 0.92  ? 53  ASN A CB   1  
ATOM 828   C CG   . ASN A 1 53  ? 8.988   -17.628 2.498   1.00 1.40  ? 53  ASN A CG   1  
ATOM 829   O OD1  . ASN A 1 53  ? 9.351   -18.780 2.743   1.00 1.94  ? 53  ASN A OD1  1  
ATOM 830   N ND2  . ASN A 1 53  ? 7.750   -17.340 2.122   1.00 2.05  ? 53  ASN A ND2  1  
ATOM 831   H H    . ASN A 1 53  ? 11.933  -14.792 2.538   1.00 0.63  ? 53  ASN A H    1  
ATOM 832   H HA   . ASN A 1 53  ? 11.697  -17.658 2.885   1.00 0.95  ? 53  ASN A HA   1  
ATOM 833   H HB2  . ASN A 1 53  ? 9.910   -16.084 3.629   1.00 1.05  ? 53  ASN A HB2  1  
ATOM 834   H HB3  . ASN A 1 53  ? 9.623   -15.680 1.943   1.00 1.23  ? 53  ASN A HB3  1  
ATOM 835   H HD21 . ASN A 1 53  ? 7.526   -16.402 1.944   1.00 2.35  ? 53  ASN A HD21 1  
ATOM 836   H HD22 . ASN A 1 53  ? 7.107   -18.076 2.036   1.00 2.52  ? 53  ASN A HD22 1  
ATOM 837   N N    . GLN A 1 54  ? 12.147  -16.340 0.029   1.00 1.02  ? 54  GLN A N    1  
ATOM 838   C CA   . GLN A 1 54  ? 12.343  -16.600 -1.387  1.00 1.29  ? 54  GLN A CA   1  
ATOM 839   C C    . GLN A 1 54  ? 13.417  -17.671 -1.577  1.00 1.33  ? 54  GLN A C    1  
ATOM 840   O O    . GLN A 1 54  ? 13.095  -18.851 -1.726  1.00 2.05  ? 54  GLN A O    1  
ATOM 841   C CB   . GLN A 1 54  ? 12.718  -15.309 -2.125  1.00 1.74  ? 54  GLN A CB   1  
ATOM 842   C CG   . GLN A 1 54  ? 12.788  -15.467 -3.636  1.00 2.17  ? 54  GLN A CG   1  
ATOM 843   C CD   . GLN A 1 54  ? 11.475  -15.923 -4.240  1.00 2.40  ? 54  GLN A CD   1  
ATOM 844   O OE1  . GLN A 1 54  ? 10.400  -15.615 -3.728  1.00 2.91  ? 54  GLN A OE1  1  
ATOM 845   N NE2  . GLN A 1 54  ? 11.554  -16.666 -5.329  1.00 2.71  ? 54  GLN A NE2  1  
ATOM 846   H H    . GLN A 1 54  ? 12.489  -15.506 0.416   1.00 0.93  ? 54  GLN A H    1  
ATOM 847   H HA   . GLN A 1 54  ? 11.411  -16.973 -1.785  1.00 1.53  ? 54  GLN A HA   1  
ATOM 848   H HB2  . GLN A 1 54  ? 11.982  -14.553 -1.899  1.00 2.09  ? 54  GLN A HB2  1  
ATOM 849   H HB3  . GLN A 1 54  ? 13.684  -14.976 -1.775  1.00 2.20  ? 54  GLN A HB3  1  
ATOM 850   H HG2  . GLN A 1 54  ? 13.053  -14.515 -4.071  1.00 2.68  ? 54  GLN A HG2  1  
ATOM 851   H HG3  . GLN A 1 54  ? 13.550  -16.193 -3.874  1.00 2.60  ? 54  GLN A HG3  1  
ATOM 852   H HE21 . GLN A 1 54  ? 12.444  -16.879 -5.684  1.00 2.94  ? 54  GLN A HE21 1  
ATOM 853   H HE22 . GLN A 1 54  ? 10.718  -16.974 -5.742  1.00 3.07  ? 54  GLN A HE22 1  
ATOM 854   N N    . LYS A 1 55  ? 14.685  -17.257 -1.542  1.00 1.44  ? 55  LYS A N    1  
ATOM 855   C CA   . LYS A 1 55  ? 15.818  -18.183 -1.642  1.00 1.87  ? 55  LYS A CA   1  
ATOM 856   C C    . LYS A 1 55  ? 17.142  -17.424 -1.659  1.00 1.59  ? 55  LYS A C    1  
ATOM 857   O O    . LYS A 1 55  ? 18.065  -17.757 -0.918  1.00 2.27  ? 55  LYS A O    1  
ATOM 858   C CB   . LYS A 1 55  ? 15.716  -19.085 -2.887  1.00 2.84  ? 55  LYS A CB   1  
ATOM 859   C CG   . LYS A 1 55  ? 15.544  -18.335 -4.199  1.00 3.60  ? 55  LYS A CG   1  
ATOM 860   C CD   . LYS A 1 55  ? 15.502  -19.279 -5.389  1.00 4.29  ? 55  LYS A CD   1  
ATOM 861   C CE   . LYS A 1 55  ? 16.808  -20.044 -5.546  1.00 5.02  ? 55  LYS A CE   1  
ATOM 862   N NZ   . LYS A 1 55  ? 16.787  -20.937 -6.732  1.00 5.58  ? 55  LYS A NZ   1  
ATOM 863   H H    . LYS A 1 55  ? 14.867  -16.300 -1.434  1.00 1.82  ? 55  LYS A H    1  
ATOM 864   H HA   . LYS A 1 55  ? 15.798  -18.809 -0.761  1.00 2.28  ? 55  LYS A HA   1  
ATOM 865   H HB2  . LYS A 1 55  ? 16.616  -19.677 -2.957  1.00 3.16  ? 55  LYS A HB2  1  
ATOM 866   H HB3  . LYS A 1 55  ? 14.872  -19.749 -2.764  1.00 3.23  ? 55  LYS A HB3  1  
ATOM 867   H HG2  . LYS A 1 55  ? 14.619  -17.781 -4.164  1.00 4.06  ? 55  LYS A HG2  1  
ATOM 868   H HG3  . LYS A 1 55  ? 16.371  -17.650 -4.322  1.00 3.78  ? 55  LYS A HG3  1  
ATOM 869   H HD2  . LYS A 1 55  ? 14.700  -19.986 -5.245  1.00 4.59  ? 55  LYS A HD2  1  
ATOM 870   H HD3  . LYS A 1 55  ? 15.322  -18.705 -6.286  1.00 4.44  ? 55  LYS A HD3  1  
ATOM 871   H HE2  . LYS A 1 55  ? 17.615  -19.334 -5.656  1.00 5.06  ? 55  LYS A HE2  1  
ATOM 872   H HE3  . LYS A 1 55  ? 16.972  -20.638 -4.661  1.00 5.52  ? 55  LYS A HE3  1  
ATOM 873   H HZ1  . LYS A 1 55  ? 16.007  -21.619 -6.654  1.00 5.86  ? 55  LYS A HZ1  1  
ATOM 874   H HZ2  . LYS A 1 55  ? 17.683  -21.459 -6.803  1.00 5.76  ? 55  LYS A HZ2  1  
ATOM 875   H HZ3  . LYS A 1 55  ? 16.659  -20.378 -7.599  1.00 5.87  ? 55  LYS A HZ3  1  
ATOM 876   N N    . ASP A 1 56  ? 17.224  -16.397 -2.495  1.00 1.36  ? 56  ASP A N    1  
ATOM 877   C CA   . ASP A 1 56  ? 18.455  -15.638 -2.657  1.00 1.50  ? 56  ASP A CA   1  
ATOM 878   C C    . ASP A 1 56  ? 18.131  -14.168 -2.897  1.00 1.27  ? 56  ASP A C    1  
ATOM 879   O O    . ASP A 1 56  ? 17.091  -13.844 -3.470  1.00 1.44  ? 56  ASP A O    1  
ATOM 880   C CB   . ASP A 1 56  ? 19.275  -16.198 -3.830  1.00 2.13  ? 56  ASP A CB   1  
ATOM 881   C CG   . ASP A 1 56  ? 18.712  -15.818 -5.190  1.00 2.83  ? 56  ASP A CG   1  
ATOM 882   O OD1  . ASP A 1 56  ? 17.671  -16.375 -5.593  1.00 3.39  ? 56  ASP A OD1  1  
ATOM 883   O OD2  . ASP A 1 56  ? 19.318  -14.959 -5.867  1.00 3.44  ? 56  ASP A OD2  1  
ATOM 884   H H    . ASP A 1 56  ? 16.438  -16.142 -3.021  1.00 1.71  ? 56  ASP A H    1  
ATOM 885   H HA   . ASP A 1 56  ? 19.028  -15.730 -1.745  1.00 1.84  ? 56  ASP A HA   1  
ATOM 886   H HB2  . ASP A 1 56  ? 20.284  -15.821 -3.766  1.00 2.43  ? 56  ASP A HB2  1  
ATOM 887   H HB3  . ASP A 1 56  ? 19.295  -17.276 -3.759  1.00 2.59  ? 56  ASP A HB3  1  
ATOM 888   N N    . PRO A 1 57  ? 19.023  -13.262 -2.454  1.00 1.06  ? 57  PRO A N    1  
ATOM 889   C CA   . PRO A 1 57  ? 18.822  -11.803 -2.545  1.00 1.02  ? 57  PRO A CA   1  
ATOM 890   C C    . PRO A 1 57  ? 18.761  -11.287 -3.976  1.00 0.75  ? 57  PRO A C    1  
ATOM 891   O O    . PRO A 1 57  ? 18.479  -10.109 -4.204  1.00 0.70  ? 57  PRO A O    1  
ATOM 892   C CB   . PRO A 1 57  ? 20.046  -11.229 -1.831  1.00 1.20  ? 57  PRO A CB   1  
ATOM 893   C CG   . PRO A 1 57  ? 21.069  -12.304 -1.931  1.00 1.20  ? 57  PRO A CG   1  
ATOM 894   C CD   . PRO A 1 57  ? 20.307  -13.587 -1.814  1.00 1.14  ? 57  PRO A CD   1  
ATOM 895   H HA   . PRO A 1 57  ? 17.928  -11.496 -2.025  1.00 1.22  ? 57  PRO A HA   1  
ATOM 896   H HB2  . PRO A 1 57  ? 20.369  -10.327 -2.331  1.00 1.21  ? 57  PRO A HB2  1  
ATOM 897   H HB3  . PRO A 1 57  ? 19.800  -11.012 -0.803  1.00 1.44  ? 57  PRO A HB3  1  
ATOM 898   H HG2  . PRO A 1 57  ? 21.567  -12.249 -2.888  1.00 1.15  ? 57  PRO A HG2  1  
ATOM 899   H HG3  . PRO A 1 57  ? 21.780  -12.214 -1.127  1.00 1.39  ? 57  PRO A HG3  1  
ATOM 900   H HD2  . PRO A 1 57  ? 20.815  -14.379 -2.342  1.00 1.16  ? 57  PRO A HD2  1  
ATOM 901   H HD3  . PRO A 1 57  ? 20.164  -13.850 -0.777  1.00 1.29  ? 57  PRO A HD3  1  
ATOM 902   N N    . GLY A 1 58  ? 19.014  -12.167 -4.937  1.00 0.67  ? 58  GLY A N    1  
ATOM 903   C CA   . GLY A 1 58  ? 18.887  -11.800 -6.331  1.00 0.56  ? 58  GLY A CA   1  
ATOM 904   C C    . GLY A 1 58  ? 17.460  -11.456 -6.684  1.00 0.49  ? 58  GLY A C    1  
ATOM 905   O O    . GLY A 1 58  ? 17.191  -10.835 -7.709  1.00 0.48  ? 58  GLY A O    1  
ATOM 906   H H    . GLY A 1 58  ? 19.286  -13.079 -4.697  1.00 0.74  ? 58  GLY A H    1  
ATOM 907   H HA2  . GLY A 1 58  ? 19.518  -10.946 -6.532  1.00 0.57  ? 58  GLY A HA2  1  
ATOM 908   H HA3  . GLY A 1 58  ? 19.207  -12.626 -6.942  1.00 0.61  ? 58  GLY A HA3  1  
ATOM 909   N N    . VAL A 1 59  ? 16.537  -11.864 -5.827  1.00 0.52  ? 59  VAL A N    1  
ATOM 910   C CA   . VAL A 1 59  ? 15.139  -11.521 -5.995  1.00 0.52  ? 59  VAL A CA   1  
ATOM 911   C C    . VAL A 1 59  ? 14.929  -10.028 -5.843  1.00 0.49  ? 59  VAL A C    1  
ATOM 912   O O    . VAL A 1 59  ? 14.168  -9.431  -6.593  1.00 0.49  ? 59  VAL A O    1  
ATOM 913   C CB   . VAL A 1 59  ? 14.237  -12.265 -4.991  1.00 0.61  ? 59  VAL A CB   1  
ATOM 914   C CG1  . VAL A 1 59  ? 14.686  -12.006 -3.561  1.00 0.65  ? 59  VAL A CG1  1  
ATOM 915   C CG2  . VAL A 1 59  ? 12.785  -11.850 -5.173  1.00 0.66  ? 59  VAL A CG2  1  
ATOM 916   H H    . VAL A 1 59  ? 16.807  -12.422 -5.064  1.00 0.58  ? 59  VAL A H    1  
ATOM 917   H HA   . VAL A 1 59  ? 14.849  -11.803 -6.995  1.00 0.53  ? 59  VAL A HA   1  
ATOM 918   H HB   . VAL A 1 59  ? 14.321  -13.320 -5.185  1.00 0.64  ? 59  VAL A HB   1  
ATOM 919   H HG11 . VAL A 1 59  ? 14.755  -10.941 -3.398  1.00 1.19  ? 59  VAL A HG11 1  
ATOM 920   H HG12 . VAL A 1 59  ? 15.653  -12.458 -3.400  1.00 1.14  ? 59  VAL A HG12 1  
ATOM 921   H HG13 . VAL A 1 59  ? 13.969  -12.430 -2.874  1.00 1.29  ? 59  VAL A HG13 1  
ATOM 922   H HG21 . VAL A 1 59  ? 12.702  -10.778 -5.032  1.00 1.21  ? 59  VAL A HG21 1  
ATOM 923   H HG22 . VAL A 1 59  ? 12.170  -12.359 -4.446  1.00 1.26  ? 59  VAL A HG22 1  
ATOM 924   H HG23 . VAL A 1 59  ? 12.458  -12.109 -6.168  1.00 1.19  ? 59  VAL A HG23 1  
ATOM 925   N N    . LEU A 1 60  ? 15.631  -9.424  -4.893  1.00 0.48  ? 60  LEU A N    1  
ATOM 926   C CA   . LEU A 1 60  ? 15.504  -7.992  -4.651  1.00 0.46  ? 60  LEU A CA   1  
ATOM 927   C C    . LEU A 1 60  ? 15.933  -7.243  -5.896  1.00 0.43  ? 60  LEU A C    1  
ATOM 928   O O    . LEU A 1 60  ? 15.483  -6.132  -6.176  1.00 0.41  ? 60  LEU A O    1  
ATOM 929   C CB   . LEU A 1 60  ? 16.371  -7.550  -3.471  1.00 0.48  ? 60  LEU A CB   1  
ATOM 930   C CG   . LEU A 1 60  ? 16.337  -8.468  -2.248  1.00 0.51  ? 60  LEU A CG   1  
ATOM 931   C CD1  . LEU A 1 60  ? 17.134  -7.863  -1.104  1.00 0.51  ? 60  LEU A CD1  1  
ATOM 932   C CD2  . LEU A 1 60  ? 14.908  -8.737  -1.824  1.00 0.52  ? 60  LEU A CD2  1  
ATOM 933   H H    . LEU A 1 60  ? 16.249  -9.953  -4.346  1.00 0.50  ? 60  LEU A H    1  
ATOM 934   H HA   . LEU A 1 60  ? 14.466  -7.781  -4.439  1.00 0.47  ? 60  LEU A HA   1  
ATOM 935   H HB2  . LEU A 1 60  ? 17.394  -7.471  -3.814  1.00 0.51  ? 60  LEU A HB2  1  
ATOM 936   H HB3  . LEU A 1 60  ? 16.038  -6.569  -3.165  1.00 0.48  ? 60  LEU A HB3  1  
ATOM 937   H HG   . LEU A 1 60  ? 16.792  -9.414  -2.507  1.00 0.57  ? 60  LEU A HG   1  
ATOM 938   H HD11 . LEU A 1 60  ? 16.767  -6.870  -0.897  1.00 1.00  ? 60  LEU A HD11 1  
ATOM 939   H HD12 . LEU A 1 60  ? 18.177  -7.809  -1.377  1.00 1.22  ? 60  LEU A HD12 1  
ATOM 940   H HD13 . LEU A 1 60  ? 17.024  -8.477  -0.217  1.00 1.18  ? 60  LEU A HD13 1  
ATOM 941   H HD21 . LEU A 1 60  ? 14.904  -9.355  -0.940  1.00 1.20  ? 60  LEU A HD21 1  
ATOM 942   H HD22 . LEU A 1 60  ? 14.386  -9.243  -2.621  1.00 1.11  ? 60  LEU A HD22 1  
ATOM 943   H HD23 . LEU A 1 60  ? 14.416  -7.801  -1.612  1.00 1.11  ? 60  LEU A HD23 1  
ATOM 944   N N    . ASP A 1 61  ? 16.800  -7.899  -6.646  1.00 0.46  ? 61  ASP A N    1  
ATOM 945   C CA   . ASP A 1 61  ? 17.304  -7.372  -7.903  1.00 0.46  ? 61  ASP A CA   1  
ATOM 946   C C    . ASP A 1 61  ? 16.197  -7.371  -8.938  1.00 0.47  ? 61  ASP A C    1  
ATOM 947   O O    . ASP A 1 61  ? 16.048  -6.431  -9.724  1.00 0.51  ? 61  ASP A O    1  
ATOM 948   C CB   . ASP A 1 61  ? 18.478  -8.221  -8.396  1.00 0.47  ? 61  ASP A CB   1  
ATOM 949   C CG   . ASP A 1 61  ? 19.149  -7.643  -9.626  1.00 0.48  ? 61  ASP A CG   1  
ATOM 950   O OD1  . ASP A 1 61  ? 20.017  -6.759  -9.476  1.00 1.22  ? 61  ASP A OD1  1  
ATOM 951   O OD2  . ASP A 1 61  ? 18.812  -8.069  -10.748 1.00 1.19  ? 61  ASP A OD2  1  
ATOM 952   H H    . ASP A 1 61  ? 17.097  -8.784  -6.340  1.00 0.49  ? 61  ASP A H    1  
ATOM 953   H HA   . ASP A 1 61  ? 17.633  -6.368  -7.737  1.00 0.48  ? 61  ASP A HA   1  
ATOM 954   H HB2  . ASP A 1 61  ? 19.208  -8.304  -7.609  1.00 0.48  ? 61  ASP A HB2  1  
ATOM 955   H HB3  . ASP A 1 61  ? 18.114  -9.209  -8.642  1.00 0.51  ? 61  ASP A HB3  1  
ATOM 956   N N    . ARG A 1 62  ? 15.409  -8.430  -8.903  1.00 0.47  ? 62  ARG A N    1  
ATOM 957   C CA   . ARG A 1 62  ? 14.291  -8.597  -9.811  1.00 0.51  ? 62  ARG A CA   1  
ATOM 958   C C    . ARG A 1 62  ? 13.174  -7.635  -9.441  1.00 0.50  ? 62  ARG A C    1  
ATOM 959   O O    . ARG A 1 62  ? 12.529  -7.053  -10.312 1.00 0.56  ? 62  ARG A O    1  
ATOM 960   C CB   . ARG A 1 62  ? 13.792  -10.039 -9.747  1.00 0.55  ? 62  ARG A CB   1  
ATOM 961   C CG   . ARG A 1 62  ? 14.910  -11.061 -9.876  1.00 0.55  ? 62  ARG A CG   1  
ATOM 962   C CD   . ARG A 1 62  ? 14.385  -12.481 -9.829  1.00 0.62  ? 62  ARG A CD   1  
ATOM 963   N NE   . ARG A 1 62  ? 13.358  -12.722 -10.842 1.00 1.45  ? 62  ARG A NE   1  
ATOM 964   C CZ   . ARG A 1 62  ? 12.888  -13.927 -11.158 1.00 1.97  ? 62  ARG A CZ   1  
ATOM 965   N NH1  . ARG A 1 62  ? 13.383  -15.013 -10.575 1.00 1.66  ? 62  ARG A NH1  1  
ATOM 966   N NH2  . ARG A 1 62  ? 11.929  -14.046 -12.067 1.00 3.02  ? 62  ARG A NH2  1  
ATOM 967   H H    . ARG A 1 62  ? 15.584  -9.126  -8.233  1.00 0.47  ? 62  ARG A H    1  
ATOM 968   H HA   . ARG A 1 62  ? 14.631  -8.380  -10.811 1.00 0.53  ? 62  ARG A HA   1  
ATOM 969   H HB2  . ARG A 1 62  ? 13.294  -10.195 -8.801  1.00 0.60  ? 62  ARG A HB2  1  
ATOM 970   H HB3  . ARG A 1 62  ? 13.087  -10.201 -10.548 1.00 0.60  ? 62  ARG A HB3  1  
ATOM 971   H HG2  . ARG A 1 62  ? 15.423  -10.908 -10.808 1.00 0.56  ? 62  ARG A HG2  1  
ATOM 972   H HG3  . ARG A 1 62  ? 15.604  -10.919 -9.059  1.00 0.56  ? 62  ARG A HG3  1  
ATOM 973   H HD2  . ARG A 1 62  ? 15.210  -13.158 -9.996  1.00 1.11  ? 62  ARG A HD2  1  
ATOM 974   H HD3  . ARG A 1 62  ? 13.967  -12.660 -8.853  1.00 0.98  ? 62  ARG A HD3  1  
ATOM 975   H HE   . ARG A 1 62  ? 12.989  -11.935 -11.305 1.00 1.91  ? 62  ARG A HE   1  
ATOM 976   H HH11 . ARG A 1 62  ? 14.115  -14.933 -9.897  1.00 1.23  ? 62  ARG A HH11 1  
ATOM 977   H HH12 . ARG A 1 62  ? 13.023  -15.919 -10.811 1.00 2.13  ? 62  ARG A HH12 1  
ATOM 978   H HH21 . ARG A 1 62  ? 11.556  -13.229 -12.519 1.00 3.45  ? 62  ARG A HH21 1  
ATOM 979   H HH22 . ARG A 1 62  ? 11.570  -14.951 -12.308 1.00 3.45  ? 62  ARG A HH22 1  
ATOM 980   N N    . MET A 1 63  ? 12.968  -7.462  -8.138  1.00 0.45  ? 63  MET A N    1  
ATOM 981   C CA   . MET A 1 63  ? 11.971  -6.524  -7.635  1.00 0.44  ? 63  MET A CA   1  
ATOM 982   C C    . MET A 1 63  ? 12.317  -5.134  -8.120  1.00 0.41  ? 63  MET A C    1  
ATOM 983   O O    . MET A 1 63  ? 11.528  -4.493  -8.807  1.00 0.42  ? 63  MET A O    1  
ATOM 984   C CB   . MET A 1 63  ? 11.929  -6.496  -6.105  1.00 0.43  ? 63  MET A CB   1  
ATOM 985   C CG   . MET A 1 63  ? 11.985  -7.863  -5.440  1.00 0.49  ? 63  MET A CG   1  
ATOM 986   S SD   . MET A 1 63  ? 10.497  -8.849  -5.707  1.00 0.64  ? 63  MET A SD   1  
ATOM 987   C CE   . MET A 1 63  ? 9.286   -7.899  -4.792  1.00 1.54  ? 63  MET A CE   1  
ATOM 988   H H    . MET A 1 63  ? 13.504  -7.983  -7.502  1.00 0.45  ? 63  MET A H    1  
ATOM 989   H HA   . MET A 1 63  ? 11.004  -6.810  -8.020  1.00 0.47  ? 63  MET A HA   1  
ATOM 990   H HB2  . MET A 1 63  ? 12.760  -5.906  -5.753  1.00 0.39  ? 63  MET A HB2  1  
ATOM 991   H HB3  . MET A 1 63  ? 11.013  -6.013  -5.799  1.00 0.46  ? 63  MET A HB3  1  
ATOM 992   H HG2  . MET A 1 63  ? 12.828  -8.404  -5.837  1.00 0.48  ? 63  MET A HG2  1  
ATOM 993   H HG3  . MET A 1 63  ? 12.130  -7.725  -4.382  1.00 0.54  ? 63  MET A HG3  1  
ATOM 994   H HE1  . MET A 1 63  ? 9.603   -7.805  -3.764  1.00 2.05  ? 63  MET A HE1  1  
ATOM 995   H HE2  . MET A 1 63  ? 8.332   -8.404  -4.829  1.00 2.05  ? 63  MET A HE2  1  
ATOM 996   H HE3  . MET A 1 63  ? 9.190   -6.917  -5.231  1.00 2.13  ? 63  MET A HE3  1  
ATOM 997   N N    . MET A 1 64  ? 13.527  -4.697  -7.768  1.00 0.41  ? 64  MET A N    1  
ATOM 998   C CA   . MET A 1 64  ? 14.020  -3.378  -8.138  1.00 0.42  ? 64  MET A CA   1  
ATOM 999   C C    . MET A 1 64  ? 13.770  -3.088  -9.608  1.00 0.44  ? 64  MET A C    1  
ATOM 1000  O O    . MET A 1 64  ? 13.082  -2.142  -9.934  1.00 0.41  ? 64  MET A O    1  
ATOM 1001  C CB   . MET A 1 64  ? 15.517  -3.255  -7.832  1.00 0.55  ? 64  MET A CB   1  
ATOM 1002  C CG   . MET A 1 64  ? 16.163  -2.001  -8.413  1.00 0.65  ? 64  MET A CG   1  
ATOM 1003  S SD   . MET A 1 64  ? 15.416  -0.473  -7.819  1.00 1.87  ? 64  MET A SD   1  
ATOM 1004  C CE   . MET A 1 64  ? 15.830  -0.531  -6.081  1.00 2.41  ? 64  MET A CE   1  
ATOM 1005  H H    . MET A 1 64  ? 14.106  -5.285  -7.230  1.00 0.42  ? 64  MET A H    1  
ATOM 1006  H HA   . MET A 1 64  ? 13.485  -2.650  -7.548  1.00 0.42  ? 64  MET A HA   1  
ATOM 1007  H HB2  . MET A 1 64  ? 15.654  -3.242  -6.761  1.00 0.60  ? 64  MET A HB2  1  
ATOM 1008  H HB3  . MET A 1 64  ? 16.026  -4.115  -8.240  1.00 0.64  ? 64  MET A HB3  1  
ATOM 1009  H HG2  . MET A 1 64  ? 17.208  -1.996  -8.146  1.00 1.29  ? 64  MET A HG2  1  
ATOM 1010  H HG3  . MET A 1 64  ? 16.070  -2.034  -9.488  1.00 1.05  ? 64  MET A HG3  1  
ATOM 1011  H HE1  . MET A 1 64  ? 16.901  -0.575  -5.969  1.00 2.83  ? 64  MET A HE1  1  
ATOM 1012  H HE2  . MET A 1 64  ? 15.384  -1.406  -5.633  1.00 2.83  ? 64  MET A HE2  1  
ATOM 1013  H HE3  . MET A 1 64  ? 15.454  0.356   -5.591  1.00 2.75  ? 64  MET A HE3  1  
ATOM 1014  N N    . LYS A 1 65  ? 14.279  -3.933  -10.489 1.00 0.52  ? 65  LYS A N    1  
ATOM 1015  C CA   . LYS A 1 65  ? 14.218  -3.643  -11.920 1.00 0.56  ? 65  LYS A CA   1  
ATOM 1016  C C    . LYS A 1 65  ? 12.798  -3.750  -12.475 1.00 0.54  ? 65  LYS A C    1  
ATOM 1017  O O    . LYS A 1 65  ? 12.494  -3.170  -13.516 1.00 0.60  ? 65  LYS A O    1  
ATOM 1018  C CB   . LYS A 1 65  ? 15.176  -4.540  -12.699 1.00 0.66  ? 65  LYS A CB   1  
ATOM 1019  C CG   . LYS A 1 65  ? 16.640  -4.300  -12.353 1.00 0.79  ? 65  LYS A CG   1  
ATOM 1020  C CD   . LYS A 1 65  ? 17.020  -2.822  -12.446 1.00 0.86  ? 65  LYS A CD   1  
ATOM 1021  C CE   . LYS A 1 65  ? 16.810  -2.259  -13.845 1.00 1.57  ? 65  LYS A CE   1  
ATOM 1022  N NZ   . LYS A 1 65  ? 17.119  -0.804  -13.911 1.00 2.49  ? 65  LYS A NZ   1  
ATOM 1023  H H    . LYS A 1 65  ? 14.691  -4.770  -10.176 1.00 0.56  ? 65  LYS A H    1  
ATOM 1024  H HA   . LYS A 1 65  ? 14.539  -2.620  -12.044 1.00 0.59  ? 65  LYS A HA   1  
ATOM 1025  H HB2  . LYS A 1 65  ? 14.941  -5.572  -12.485 1.00 0.75  ? 65  LYS A HB2  1  
ATOM 1026  H HB3  . LYS A 1 65  ? 15.043  -4.360  -13.755 1.00 0.66  ? 65  LYS A HB3  1  
ATOM 1027  H HG2  . LYS A 1 65  ? 16.821  -4.643  -11.344 1.00 0.86  ? 65  LYS A HG2  1  
ATOM 1028  H HG3  . LYS A 1 65  ? 17.256  -4.862  -13.038 1.00 0.89  ? 65  LYS A HG3  1  
ATOM 1029  H HD2  . LYS A 1 65  ? 16.417  -2.261  -11.750 1.00 1.29  ? 65  LYS A HD2  1  
ATOM 1030  H HD3  . LYS A 1 65  ? 18.062  -2.717  -12.181 1.00 1.25  ? 65  LYS A HD3  1  
ATOM 1031  H HE2  . LYS A 1 65  ? 17.457  -2.786  -14.531 1.00 1.92  ? 65  LYS A HE2  1  
ATOM 1032  H HE3  . LYS A 1 65  ? 15.782  -2.413  -14.132 1.00 2.11  ? 65  LYS A HE3  1  
ATOM 1033  H HZ1  . LYS A 1 65  ? 17.105  -0.479  -14.899 1.00 2.92  ? 65  LYS A HZ1  1  
ATOM 1034  H HZ2  . LYS A 1 65  ? 18.059  -0.616  -13.511 1.00 2.86  ? 65  LYS A HZ2  1  
ATOM 1035  H HZ3  . LYS A 1 65  ? 16.409  -0.256  -13.371 1.00 3.01  ? 65  LYS A HZ3  1  
ATOM 1036  N N    . LYS A 1 66  ? 11.938  -4.492  -11.791 1.00 0.50  ? 66  LYS A N    1  
ATOM 1037  C CA   . LYS A 1 66  ? 10.532  -4.565  -12.169 1.00 0.52  ? 66  LYS A CA   1  
ATOM 1038  C C    . LYS A 1 66  ? 9.816   -3.274  -11.796 1.00 0.48  ? 66  LYS A C    1  
ATOM 1039  O O    . LYS A 1 66  ? 8.982   -2.761  -12.544 1.00 0.55  ? 66  LYS A O    1  
ATOM 1040  C CB   . LYS A 1 66  ? 9.849   -5.736  -11.461 1.00 0.55  ? 66  LYS A CB   1  
ATOM 1041  C CG   . LYS A 1 66  ? 8.357   -5.817  -11.734 1.00 0.91  ? 66  LYS A CG   1  
ATOM 1042  C CD   . LYS A 1 66  ? 7.710   -7.005  -11.037 1.00 0.96  ? 66  LYS A CD   1  
ATOM 1043  C CE   . LYS A 1 66  ? 7.886   -6.944  -9.525  1.00 0.73  ? 66  LYS A CE   1  
ATOM 1044  N NZ   . LYS A 1 66  ? 7.193   -8.068  -8.845  1.00 1.47  ? 66  LYS A NZ   1  
ATOM 1045  H H    . LYS A 1 66  ? 12.254  -5.004  -11.016 1.00 0.50  ? 66  LYS A H    1  
ATOM 1046  H HA   . LYS A 1 66  ? 10.474  -4.710  -13.237 1.00 0.58  ? 66  LYS A HA   1  
ATOM 1047  H HB2  . LYS A 1 66  ? 10.308  -6.658  -11.784 1.00 0.84  ? 66  LYS A HB2  1  
ATOM 1048  H HB3  . LYS A 1 66  ? 9.990   -5.624  -10.394 1.00 0.87  ? 66  LYS A HB3  1  
ATOM 1049  H HG2  . LYS A 1 66  ? 7.891   -4.908  -11.382 1.00 1.33  ? 66  LYS A HG2  1  
ATOM 1050  H HG3  . LYS A 1 66  ? 8.204   -5.909  -12.799 1.00 1.31  ? 66  LYS A HG3  1  
ATOM 1051  H HD2  . LYS A 1 66  ? 6.655   -7.009  -11.262 1.00 1.50  ? 66  LYS A HD2  1  
ATOM 1052  H HD3  . LYS A 1 66  ? 8.162   -7.915  -11.405 1.00 1.60  ? 66  LYS A HD3  1  
ATOM 1053  H HE2  . LYS A 1 66  ? 8.940   -6.992  -9.295  1.00 1.11  ? 66  LYS A HE2  1  
ATOM 1054  H HE3  . LYS A 1 66  ? 7.481   -6.010  -9.163  1.00 0.98  ? 66  LYS A HE3  1  
ATOM 1055  H HZ1  . LYS A 1 66  ? 6.176   -8.051  -9.066  1.00 2.03  ? 66  LYS A HZ1  1  
ATOM 1056  H HZ2  . LYS A 1 66  ? 7.312   -7.993  -7.816  1.00 1.78  ? 66  LYS A HZ2  1  
ATOM 1057  H HZ3  . LYS A 1 66  ? 7.589   -8.976  -9.161  1.00 2.01  ? 66  LYS A HZ3  1  
ATOM 1058  N N    . LEU A 1 67  ? 10.158  -2.756  -10.632 1.00 0.41  ? 67  LEU A N    1  
ATOM 1059  C CA   . LEU A 1 67  ? 9.485   -1.600  -10.066 1.00 0.39  ? 67  LEU A CA   1  
ATOM 1060  C C    . LEU A 1 67  ? 10.119  -0.305  -10.546 1.00 0.40  ? 67  LEU A C    1  
ATOM 1061  O O    . LEU A 1 67  ? 9.442   0.717   -10.641 1.00 0.46  ? 67  LEU A O    1  
ATOM 1062  C CB   . LEU A 1 67  ? 9.581   -1.670  -8.559  1.00 0.34  ? 67  LEU A CB   1  
ATOM 1063  C CG   . LEU A 1 67  ? 9.162   -3.005  -7.948  1.00 0.33  ? 67  LEU A CG   1  
ATOM 1064  C CD1  . LEU A 1 67  ? 9.606   -3.078  -6.503  1.00 0.30  ? 67  LEU A CD1  1  
ATOM 1065  C CD2  . LEU A 1 67  ? 7.661   -3.214  -8.068  1.00 0.37  ? 67  LEU A CD2  1  
ATOM 1066  H H    . LEU A 1 67  ? 10.892  -3.171  -10.127 1.00 0.43  ? 67  LEU A H    1  
ATOM 1067  H HA   . LEU A 1 67  ? 8.451   -1.624  -10.358 1.00 0.44  ? 67  LEU A HA   1  
ATOM 1068  H HB2  . LEU A 1 67  ? 10.609  -1.479  -8.295  1.00 0.34  ? 67  LEU A HB2  1  
ATOM 1069  H HB3  . LEU A 1 67  ? 8.962   -0.889  -8.138  1.00 0.36  ? 67  LEU A HB3  1  
ATOM 1070  H HG   . LEU A 1 67  ? 9.654   -3.804  -8.484  1.00 0.36  ? 67  LEU A HG   1  
ATOM 1071  H HD11 . LEU A 1 67  ? 9.081   -3.880  -6.003  1.00 1.06  ? 67  LEU A HD11 1  
ATOM 1072  H HD12 . LEU A 1 67  ? 9.392   -2.136  -6.016  1.00 1.02  ? 67  LEU A HD12 1  
ATOM 1073  H HD13 . LEU A 1 67  ? 10.669  -3.267  -6.465  1.00 1.06  ? 67  LEU A HD13 1  
ATOM 1074  H HD21 . LEU A 1 67  ? 7.388   -4.143  -7.587  1.00 1.11  ? 67  LEU A HD21 1  
ATOM 1075  H HD22 . LEU A 1 67  ? 7.387   -3.257  -9.111  1.00 1.06  ? 67  LEU A HD22 1  
ATOM 1076  H HD23 . LEU A 1 67  ? 7.142   -2.396  -7.590  1.00 1.08  ? 67  LEU A HD23 1  
ATOM 1077  N N    . ASP A 1 68  ? 11.427  -0.371  -10.804 1.00 0.40  ? 68  ASP A N    1  
ATOM 1078  C CA   . ASP A 1 68  ? 12.217  0.754   -11.311 1.00 0.42  ? 68  ASP A CA   1  
ATOM 1079  C C    . ASP A 1 68  ? 11.719  1.158   -12.684 1.00 0.52  ? 68  ASP A C    1  
ATOM 1080  O O    . ASP A 1 68  ? 12.316  0.868   -13.724 1.00 0.56  ? 68  ASP A O    1  
ATOM 1081  C CB   . ASP A 1 68  ? 13.701  0.365   -11.338 1.00 0.43  ? 68  ASP A CB   1  
ATOM 1082  C CG   . ASP A 1 68  ? 14.600  1.345   -12.079 1.00 0.46  ? 68  ASP A CG   1  
ATOM 1083  O OD1  . ASP A 1 68  ? 14.668  2.530   -11.695 1.00 1.23  ? 68  ASP A OD1  1  
ATOM 1084  O OD2  . ASP A 1 68  ? 15.271  0.912   -13.047 1.00 1.13  ? 68  ASP A OD2  1  
ATOM 1085  H H    . ASP A 1 68  ? 11.891  -1.218  -10.630 1.00 0.40  ? 68  ASP A H    1  
ATOM 1086  H HA   . ASP A 1 68  ? 12.081  1.591   -10.630 1.00 0.41  ? 68  ASP A HA   1  
ATOM 1087  H HB2  . ASP A 1 68  ? 14.053  0.289   -10.319 1.00 0.41  ? 68  ASP A HB2  1  
ATOM 1088  H HB3  . ASP A 1 68  ? 13.790  -0.601  -11.811 1.00 0.47  ? 68  ASP A HB3  1  
ATOM 1089  N N    . THR A 1 69  ? 10.587  1.802   -12.657 1.00 0.59  ? 69  THR A N    1  
ATOM 1090  C CA   . THR A 1 69  ? 9.918   2.269   -13.837 1.00 0.74  ? 69  THR A CA   1  
ATOM 1091  C C    . THR A 1 69  ? 10.504  3.607   -14.256 1.00 0.84  ? 69  THR A C    1  
ATOM 1092  O O    . THR A 1 69  ? 10.370  4.038   -15.403 1.00 0.99  ? 69  THR A O    1  
ATOM 1093  C CB   . THR A 1 69  ? 8.408   2.380   -13.559 1.00 0.79  ? 69  THR A CB   1  
ATOM 1094  O OG1  . THR A 1 69  ? 7.669   2.388   -14.788 1.00 0.90  ? 69  THR A OG1  1  
ATOM 1095  C CG2  . THR A 1 69  ? 8.089   3.640   -12.769 1.00 0.83  ? 69  THR A CG2  1  
ATOM 1096  H H    . THR A 1 69  ? 10.172  1.967   -11.770 1.00 0.55  ? 69  THR A H    1  
ATOM 1097  H HA   . THR A 1 69  ? 10.075  1.555   -14.622 1.00 0.80  ? 69  THR A HA   1  
ATOM 1098  H HB   . THR A 1 69  ? 8.117   1.517   -12.963 1.00 0.76  ? 69  THR A HB   1  
ATOM 1099  H HG1  . THR A 1 69  ? 7.499   3.302   -15.051 1.00 1.25  ? 69  THR A HG1  1  
ATOM 1100  H HG21 . THR A 1 69  ? 7.054   3.624   -12.463 1.00 1.41  ? 69  THR A HG21 1  
ATOM 1101  H HG22 . THR A 1 69  ? 8.269   4.506   -13.388 1.00 1.35  ? 69  THR A HG22 1  
ATOM 1102  H HG23 . THR A 1 69  ? 8.726   3.687   -11.897 1.00 1.12  ? 69  THR A HG23 1  
ATOM 1103  N N    . ASN A 1 70  ? 11.179  4.240   -13.307 1.00 0.80  ? 70  ASN A N    1  
ATOM 1104  C CA   . ASN A 1 70  ? 11.891  5.479   -13.551 1.00 0.94  ? 70  ASN A CA   1  
ATOM 1105  C C    . ASN A 1 70  ? 13.198  5.179   -14.260 1.00 0.86  ? 70  ASN A C    1  
ATOM 1106  O O    . ASN A 1 70  ? 13.847  6.056   -14.832 1.00 0.97  ? 70  ASN A O    1  
ATOM 1107  C CB   . ASN A 1 70  ? 12.166  6.160   -12.218 1.00 1.01  ? 70  ASN A CB   1  
ATOM 1108  C CG   . ASN A 1 70  ? 12.753  7.551   -12.360 1.00 1.25  ? 70  ASN A CG   1  
ATOM 1109  O OD1  . ASN A 1 70  ? 12.460  8.274   -13.311 1.00 1.46  ? 70  ASN A OD1  1  
ATOM 1110  N ND2  . ASN A 1 70  ? 13.599  7.930   -11.413 1.00 1.66  ? 70  ASN A ND2  1  
ATOM 1111  H H    . ASN A 1 70  ? 11.185  3.858   -12.390 1.00 0.72  ? 70  ASN A H    1  
ATOM 1112  H HA   . ASN A 1 70  ? 11.277  6.116   -14.168 1.00 1.12  ? 70  ASN A HA   1  
ATOM 1113  H HB2  . ASN A 1 70  ? 11.240  6.226   -11.676 1.00 1.07  ? 70  ASN A HB2  1  
ATOM 1114  H HB3  . ASN A 1 70  ? 12.858  5.553   -11.653 1.00 0.89  ? 70  ASN A HB3  1  
ATOM 1115  H HD21 . ASN A 1 70  ? 13.791  7.300   -10.687 1.00 1.94  ? 70  ASN A HD21 1  
ATOM 1116  H HD22 . ASN A 1 70  ? 13.994  8.825   -11.475 1.00 1.86  ? 70  ASN A HD22 1  
ATOM 1117  N N    . SER A 1 71  ? 13.552  3.897   -14.211 1.00 0.70  ? 71  SER A N    1  
ATOM 1118  C CA   . SER A 1 71  ? 14.709  3.355   -14.901 1.00 0.66  ? 71  SER A CA   1  
ATOM 1119  C C    . SER A 1 71  ? 15.992  4.052   -14.475 1.00 0.61  ? 71  SER A C    1  
ATOM 1120  O O    . SER A 1 71  ? 16.878  4.312   -15.291 1.00 0.65  ? 71  SER A O    1  
ATOM 1121  C CB   . SER A 1 71  ? 14.510  3.446   -16.413 1.00 0.82  ? 71  SER A CB   1  
ATOM 1122  O OG   . SER A 1 71  ? 13.297  2.817   -16.793 1.00 1.47  ? 71  SER A OG   1  
ATOM 1123  H H    . SER A 1 71  ? 13.011  3.289   -13.663 1.00 0.65  ? 71  SER A H    1  
ATOM 1124  H HA   . SER A 1 71  ? 14.780  2.317   -14.622 1.00 0.61  ? 71  SER A HA   1  
ATOM 1125  H HB2  . SER A 1 71  ? 14.474  4.484   -16.708 1.00 1.19  ? 71  SER A HB2  1  
ATOM 1126  H HB3  . SER A 1 71  ? 15.330  2.956   -16.915 1.00 1.15  ? 71  SER A HB3  1  
ATOM 1127  H HG   . SER A 1 71  ? 12.808  2.568   -16.000 1.00 2.02  ? 71  SER A HG   1  
ATOM 1128  N N    . ASP A 1 72  ? 16.089  4.334   -13.189 1.00 0.58  ? 72  ASP A N    1  
ATOM 1129  C CA   . ASP A 1 72  ? 17.264  4.988   -12.639 1.00 0.65  ? 72  ASP A CA   1  
ATOM 1130  C C    . ASP A 1 72  ? 18.014  4.020   -11.738 1.00 0.56  ? 72  ASP A C    1  
ATOM 1131  O O    . ASP A 1 72  ? 19.204  4.189   -11.469 1.00 0.66  ? 72  ASP A O    1  
ATOM 1132  C CB   . ASP A 1 72  ? 16.863  6.243   -11.855 1.00 0.80  ? 72  ASP A CB   1  
ATOM 1133  C CG   . ASP A 1 72  ? 18.062  7.012   -11.332 1.00 0.93  ? 72  ASP A CG   1  
ATOM 1134  O OD1  . ASP A 1 72  ? 18.665  7.780   -12.111 1.00 1.56  ? 72  ASP A OD1  1  
ATOM 1135  O OD2  . ASP A 1 72  ? 18.406  6.857   -10.144 1.00 1.53  ? 72  ASP A OD2  1  
ATOM 1136  H H    . ASP A 1 72  ? 15.354  4.068   -12.585 1.00 0.56  ? 72  ASP A H    1  
ATOM 1137  H HA   . ASP A 1 72  ? 17.905  5.271   -13.460 1.00 0.76  ? 72  ASP A HA   1  
ATOM 1138  H HB2  . ASP A 1 72  ? 16.295  6.897   -12.500 1.00 1.15  ? 72  ASP A HB2  1  
ATOM 1139  H HB3  . ASP A 1 72  ? 16.249  5.954   -11.014 1.00 1.00  ? 72  ASP A HB3  1  
ATOM 1140  N N    . GLY A 1 73  ? 17.325  2.974   -11.313 1.00 0.45  ? 73  GLY A N    1  
ATOM 1141  C CA   . GLY A 1 73  ? 17.928  2.003   -10.427 1.00 0.46  ? 73  GLY A CA   1  
ATOM 1142  C C    . GLY A 1 73  ? 17.537  2.259   -8.993  1.00 0.41  ? 73  GLY A C    1  
ATOM 1143  O O    . GLY A 1 73  ? 18.219  1.825   -8.061  1.00 0.44  ? 73  GLY A O    1  
ATOM 1144  H H    . GLY A 1 73  ? 16.379  2.863   -11.596 1.00 0.42  ? 73  GLY A H    1  
ATOM 1145  H HA2  . GLY A 1 73  ? 17.603  1.014   -10.712 1.00 0.48  ? 73  GLY A HA2  1  
ATOM 1146  H HA3  . GLY A 1 73  ? 19.001  2.064   -10.515 1.00 0.55  ? 73  GLY A HA3  1  
ATOM 1147  N N    . GLN A 1 74  ? 16.444  2.985   -8.825  1.00 0.38  ? 74  GLN A N    1  
ATOM 1148  C CA   . GLN A 1 74  ? 15.914  3.304   -7.518  1.00 0.37  ? 74  GLN A CA   1  
ATOM 1149  C C    . GLN A 1 74  ? 14.404  3.212   -7.575  1.00 0.36  ? 74  GLN A C    1  
ATOM 1150  O O    . GLN A 1 74  ? 13.822  3.238   -8.656  1.00 0.39  ? 74  GLN A O    1  
ATOM 1151  C CB   . GLN A 1 74  ? 16.302  4.720   -7.084  1.00 0.38  ? 74  GLN A CB   1  
ATOM 1152  C CG   . GLN A 1 74  ? 17.784  5.028   -7.192  1.00 0.42  ? 74  GLN A CG   1  
ATOM 1153  C CD   . GLN A 1 74  ? 18.170  6.327   -6.516  1.00 0.50  ? 74  GLN A CD   1  
ATOM 1154  O OE1  . GLN A 1 74  ? 17.394  7.277   -6.473  1.00 1.03  ? 74  GLN A OE1  1  
ATOM 1155  N NE2  . GLN A 1 74  ? 19.374  6.370   -5.974  1.00 1.25  ? 74  GLN A NE2  1  
ATOM 1156  H H    . GLN A 1 74  ? 15.952  3.297   -9.614  1.00 0.39  ? 74  GLN A H    1  
ATOM 1157  H HA   . GLN A 1 74  ? 16.295  2.586   -6.806  1.00 0.40  ? 74  GLN A HA   1  
ATOM 1158  H HB2  . GLN A 1 74  ? 15.758  5.426   -7.694  1.00 0.39  ? 74  GLN A HB2  1  
ATOM 1159  H HB3  . GLN A 1 74  ? 16.006  4.856   -6.053  1.00 0.38  ? 74  GLN A HB3  1  
ATOM 1160  H HG2  . GLN A 1 74  ? 18.338  4.227   -6.736  1.00 0.42  ? 74  GLN A HG2  1  
ATOM 1161  H HG3  . GLN A 1 74  ? 18.044  5.094   -8.236  1.00 0.44  ? 74  GLN A HG3  1  
ATOM 1162  H HE21 . GLN A 1 74  ? 19.943  5.574   -6.044  1.00 1.91  ? 74  GLN A HE21 1  
ATOM 1163  H HE22 . GLN A 1 74  ? 19.648  7.195   -5.503  1.00 1.32  ? 74  GLN A HE22 1  
ATOM 1164  N N    . LEU A 1 75  ? 13.777  3.116   -6.424  1.00 0.33  ? 75  LEU A N    1  
ATOM 1165  C CA   . LEU A 1 75  ? 12.330  3.055   -6.367  1.00 0.32  ? 75  LEU A CA   1  
ATOM 1166  C C    . LEU A 1 75  ? 11.763  4.279   -5.709  1.00 0.32  ? 75  LEU A C    1  
ATOM 1167  O O    . LEU A 1 75  ? 12.008  4.541   -4.533  1.00 0.32  ? 75  LEU A O    1  
ATOM 1168  C CB   . LEU A 1 75  ? 11.861  1.818   -5.625  1.00 0.31  ? 75  LEU A CB   1  
ATOM 1169  C CG   . LEU A 1 75  ? 12.335  0.508   -6.232  1.00 0.33  ? 75  LEU A CG   1  
ATOM 1170  C CD1  . LEU A 1 75  ? 11.717  -0.663  -5.497  1.00 0.35  ? 75  LEU A CD1  1  
ATOM 1171  C CD2  . LEU A 1 75  ? 11.995  0.465   -7.713  1.00 0.35  ? 75  LEU A CD2  1  
ATOM 1172  H H    . LEU A 1 75  ? 14.299  3.078   -5.596  1.00 0.33  ? 75  LEU A H    1  
ATOM 1173  H HA   . LEU A 1 75  ? 11.965  3.014   -7.380  1.00 0.33  ? 75  LEU A HA   1  
ATOM 1174  H HB2  . LEU A 1 75  ? 12.213  1.877   -4.603  1.00 0.33  ? 75  LEU A HB2  1  
ATOM 1175  H HB3  . LEU A 1 75  ? 10.779  1.818   -5.622  1.00 0.32  ? 75  LEU A HB3  1  
ATOM 1176  H HG   . LEU A 1 75  ? 13.408  0.438   -6.132  1.00 0.36  ? 75  LEU A HG   1  
ATOM 1177  H HD11 . LEU A 1 75  ? 10.640  -0.592  -5.549  1.00 1.08  ? 75  LEU A HD11 1  
ATOM 1178  H HD12 . LEU A 1 75  ? 12.030  -0.644  -4.463  1.00 0.98  ? 75  LEU A HD12 1  
ATOM 1179  H HD13 . LEU A 1 75  ? 12.040  -1.586  -5.955  1.00 1.09  ? 75  LEU A HD13 1  
ATOM 1180  H HD21 . LEU A 1 75  ? 12.437  1.317   -8.210  1.00 1.10  ? 75  LEU A HD21 1  
ATOM 1181  H HD22 . LEU A 1 75  ? 10.922  0.495   -7.840  1.00 1.05  ? 75  LEU A HD22 1  
ATOM 1182  H HD23 . LEU A 1 75  ? 12.384  -0.445  -8.147  1.00 1.06  ? 75  LEU A HD23 1  
ATOM 1183  N N    . ASP A 1 76  ? 11.020  5.033   -6.480  1.00 0.35  ? 76  ASP A N    1  
ATOM 1184  C CA   . ASP A 1 76  ? 10.373  6.220   -5.980  1.00 0.36  ? 76  ASP A CA   1  
ATOM 1185  C C    . ASP A 1 76  ? 9.107   5.868   -5.243  1.00 0.33  ? 76  ASP A C    1  
ATOM 1186  O O    . ASP A 1 76  ? 8.745   4.700   -5.110  1.00 0.32  ? 76  ASP A O    1  
ATOM 1187  C CB   . ASP A 1 76  ? 10.100  7.197   -7.126  1.00 0.44  ? 76  ASP A CB   1  
ATOM 1188  C CG   . ASP A 1 76  ? 8.643   7.258   -7.574  1.00 0.91  ? 76  ASP A CG   1  
ATOM 1189  O OD1  . ASP A 1 76  ? 8.080   6.223   -7.991  1.00 1.45  ? 76  ASP A OD1  1  
ATOM 1190  O OD2  . ASP A 1 76  ? 8.056   8.357   -7.510  1.00 1.68  ? 76  ASP A OD2  1  
ATOM 1191  H H    . ASP A 1 76  ? 10.912  4.788   -7.434  1.00 0.41  ? 76  ASP A H    1  
ATOM 1192  H HA   . ASP A 1 76  ? 11.031  6.696   -5.279  1.00 0.37  ? 76  ASP A HA   1  
ATOM 1193  H HB2  . ASP A 1 76  ? 10.384  8.188   -6.796  1.00 0.74  ? 76  ASP A HB2  1  
ATOM 1194  H HB3  . ASP A 1 76  ? 10.716  6.903   -7.979  1.00 0.64  ? 76  ASP A HB3  1  
ATOM 1195  N N    . PHE A 1 77  ? 8.477   6.903   -4.747  1.00 0.41  ? 77  PHE A N    1  
ATOM 1196  C CA   . PHE A 1 77  ? 7.231   6.830   -4.028  1.00 0.49  ? 77  PHE A CA   1  
ATOM 1197  C C    . PHE A 1 77  ? 6.272   5.790   -4.621  1.00 0.39  ? 77  PHE A C    1  
ATOM 1198  O O    . PHE A 1 77  ? 5.866   4.856   -3.935  1.00 0.39  ? 77  PHE A O    1  
ATOM 1199  C CB   . PHE A 1 77  ? 6.632   8.218   -4.099  1.00 0.72  ? 77  PHE A CB   1  
ATOM 1200  C CG   . PHE A 1 77  ? 7.486   9.265   -3.447  1.00 1.76  ? 77  PHE A CG   1  
ATOM 1201  C CD1  . PHE A 1 77  ? 7.481   9.432   -2.075  1.00 2.56  ? 77  PHE A CD1  1  
ATOM 1202  C CD2  . PHE A 1 77  ? 8.308   10.077  -4.214  1.00 2.66  ? 77  PHE A CD2  1  
ATOM 1203  C CE1  . PHE A 1 77  ? 8.278   10.389  -1.477  1.00 3.67  ? 77  PHE A CE1  1  
ATOM 1204  C CE2  . PHE A 1 77  ? 9.108   11.034  -3.623  1.00 3.77  ? 77  PHE A CE2  1  
ATOM 1205  C CZ   . PHE A 1 77  ? 9.093   11.190  -2.253  1.00 4.15  ? 77  PHE A CZ   1  
ATOM 1206  H H    . PHE A 1 77  ? 8.877   7.788   -4.883  1.00 0.47  ? 77  PHE A H    1  
ATOM 1207  H HA   . PHE A 1 77  ? 7.440   6.586   -2.999  1.00 0.57  ? 77  PHE A HA   1  
ATOM 1208  H HB2  . PHE A 1 77  ? 6.545   8.482   -5.140  1.00 1.26  ? 77  PHE A HB2  1  
ATOM 1209  H HB3  . PHE A 1 77  ? 5.665   8.225   -3.637  1.00 1.00  ? 77  PHE A HB3  1  
ATOM 1210  H HD1  . PHE A 1 77  ? 6.844   8.807   -1.467  1.00 2.72  ? 77  PHE A HD1  1  
ATOM 1211  H HD2  . PHE A 1 77  ? 8.320   9.955   -5.287  1.00 2.85  ? 77  PHE A HD2  1  
ATOM 1212  H HE1  . PHE A 1 77  ? 8.264   10.510  -0.405  1.00 4.42  ? 77  PHE A HE1  1  
ATOM 1213  H HE2  . PHE A 1 77  ? 9.745   11.658  -4.232  1.00 4.59  ? 77  PHE A HE2  1  
ATOM 1214  H HZ   . PHE A 1 77  ? 9.717   11.936  -1.786  1.00 5.09  ? 77  PHE A HZ   1  
ATOM 1215  N N    . SER A 1 78  ? 5.943   5.942   -5.898  1.00 0.39  ? 78  SER A N    1  
ATOM 1216  C CA   . SER A 1 78  ? 5.014   5.040   -6.568  1.00 0.38  ? 78  SER A CA   1  
ATOM 1217  C C    . SER A 1 78  ? 5.647   3.685   -6.895  1.00 0.38  ? 78  SER A C    1  
ATOM 1218  O O    . SER A 1 78  ? 4.961   2.668   -6.899  1.00 0.44  ? 78  SER A O    1  
ATOM 1219  C CB   . SER A 1 78  ? 4.478   5.696   -7.842  1.00 0.45  ? 78  SER A CB   1  
ATOM 1220  O OG   . SER A 1 78  ? 5.508   6.366   -8.557  1.00 1.31  ? 78  SER A OG   1  
ATOM 1221  H H    . SER A 1 78  ? 6.329   6.681   -6.400  1.00 0.45  ? 78  SER A H    1  
ATOM 1222  H HA   . SER A 1 78  ? 4.187   4.875   -5.896  1.00 0.40  ? 78  SER A HA   1  
ATOM 1223  H HB2  . SER A 1 78  ? 4.051   4.938   -8.481  1.00 1.07  ? 78  SER A HB2  1  
ATOM 1224  H HB3  . SER A 1 78  ? 3.715   6.415   -7.578  1.00 0.94  ? 78  SER A HB3  1  
ATOM 1225  H HG   . SER A 1 78  ? 6.380   6.056   -8.251  1.00 1.76  ? 78  SER A HG   1  
ATOM 1226  N N    . GLU A 1 79  ? 6.948   3.665   -7.156  1.00 0.36  ? 79  GLU A N    1  
ATOM 1227  C CA   . GLU A 1 79  ? 7.635   2.426   -7.501  1.00 0.42  ? 79  GLU A CA   1  
ATOM 1228  C C    . GLU A 1 79  ? 7.724   1.513   -6.283  1.00 0.33  ? 79  GLU A C    1  
ATOM 1229  O O    . GLU A 1 79  ? 7.572   0.295   -6.387  1.00 0.33  ? 79  GLU A O    1  
ATOM 1230  C CB   . GLU A 1 79  ? 9.020   2.745   -8.055  1.00 0.51  ? 79  GLU A CB   1  
ATOM 1231  C CG   . GLU A 1 79  ? 8.957   3.615   -9.295  1.00 0.64  ? 79  GLU A CG   1  
ATOM 1232  C CD   . GLU A 1 79  ? 10.308  4.118   -9.754  1.00 1.81  ? 79  GLU A CD   1  
ATOM 1233  O OE1  . GLU A 1 79  ? 10.804  5.103   -9.178  1.00 2.54  ? 79  GLU A OE1  1  
ATOM 1234  O OE2  . GLU A 1 79  ? 10.853  3.556   -10.715 1.00 2.57  ? 79  GLU A OE2  1  
ATOM 1235  H H    . GLU A 1 79  ? 7.465   4.499   -7.113  1.00 0.35  ? 79  GLU A H    1  
ATOM 1236  H HA   . GLU A 1 79  ? 7.057   1.929   -8.265  1.00 0.51  ? 79  GLU A HA   1  
ATOM 1237  H HB2  . GLU A 1 79  ? 9.593   3.262   -7.299  1.00 0.48  ? 79  GLU A HB2  1  
ATOM 1238  H HB3  . GLU A 1 79  ? 9.518   1.823   -8.311  1.00 0.60  ? 79  GLU A HB3  1  
ATOM 1239  H HG2  . GLU A 1 79  ? 8.519   3.036   -10.094 1.00 0.89  ? 79  GLU A HG2  1  
ATOM 1240  H HG3  . GLU A 1 79  ? 8.324   4.465   -9.086  1.00 1.04  ? 79  GLU A HG3  1  
ATOM 1241  N N    . PHE A 1 80  ? 7.944   2.122   -5.129  1.00 0.28  ? 80  PHE A N    1  
ATOM 1242  C CA   . PHE A 1 80  ? 7.925   1.411   -3.860  1.00 0.25  ? 80  PHE A CA   1  
ATOM 1243  C C    . PHE A 1 80  ? 6.519   0.916   -3.554  1.00 0.23  ? 80  PHE A C    1  
ATOM 1244  O O    . PHE A 1 80  ? 6.330   -0.139  -2.957  1.00 0.26  ? 80  PHE A O    1  
ATOM 1245  C CB   . PHE A 1 80  ? 8.395   2.339   -2.742  1.00 0.31  ? 80  PHE A CB   1  
ATOM 1246  C CG   . PHE A 1 80  ? 8.246   1.754   -1.372  1.00 0.71  ? 80  PHE A CG   1  
ATOM 1247  C CD1  . PHE A 1 80  ? 9.097   0.757   -0.936  1.00 1.26  ? 80  PHE A CD1  1  
ATOM 1248  C CD2  . PHE A 1 80  ? 7.248   2.202   -0.520  1.00 1.60  ? 80  PHE A CD2  1  
ATOM 1249  C CE1  . PHE A 1 80  ? 8.956   0.214   0.323   1.00 1.56  ? 80  PHE A CE1  1  
ATOM 1250  C CE2  . PHE A 1 80  ? 7.105   1.665   0.741   1.00 1.98  ? 80  PHE A CE2  1  
ATOM 1251  C CZ   . PHE A 1 80  ? 7.959   0.668   1.163   1.00 1.64  ? 80  PHE A CZ   1  
ATOM 1252  H H    . PHE A 1 80  ? 8.133   3.090   -5.130  1.00 0.28  ? 80  PHE A H    1  
ATOM 1253  H HA   . PHE A 1 80  ? 8.593   0.566   -3.929  1.00 0.29  ? 80  PHE A HA   1  
ATOM 1254  H HB2  . PHE A 1 80  ? 9.438   2.575   -2.892  1.00 0.38  ? 80  PHE A HB2  1  
ATOM 1255  H HB3  . PHE A 1 80  ? 7.814   3.247   -2.779  1.00 0.47  ? 80  PHE A HB3  1  
ATOM 1256  H HD1  . PHE A 1 80  ? 9.877   0.400   -1.592  1.00 1.92  ? 80  PHE A HD1  1  
ATOM 1257  H HD2  . PHE A 1 80  ? 6.580   2.983   -0.852  1.00 2.25  ? 80  PHE A HD2  1  
ATOM 1258  H HE1  . PHE A 1 80  ? 9.627   -0.566  0.653   1.00 2.20  ? 80  PHE A HE1  1  
ATOM 1259  H HE2  . PHE A 1 80  ? 6.325   2.021   1.396   1.00 2.80  ? 80  PHE A HE2  1  
ATOM 1260  H HZ   . PHE A 1 80  ? 7.849   0.244   2.149   1.00 2.01  ? 80  PHE A HZ   1  
ATOM 1261  N N    . LEU A 1 81  ? 5.535   1.687   -3.968  1.00 0.25  ? 81  LEU A N    1  
ATOM 1262  C CA   . LEU A 1 81  ? 4.151   1.333   -3.726  1.00 0.26  ? 81  LEU A CA   1  
ATOM 1263  C C    . LEU A 1 81  ? 3.678   0.282   -4.707  1.00 0.26  ? 81  LEU A C    1  
ATOM 1264  O O    . LEU A 1 81  ? 2.797   -0.515  -4.394  1.00 0.27  ? 81  LEU A O    1  
ATOM 1265  C CB   . LEU A 1 81  ? 3.279   2.567   -3.800  1.00 0.29  ? 81  LEU A CB   1  
ATOM 1266  C CG   . LEU A 1 81  ? 3.537   3.585   -2.687  1.00 0.28  ? 81  LEU A CG   1  
ATOM 1267  C CD1  . LEU A 1 81  ? 2.649   4.796   -2.874  1.00 0.34  ? 81  LEU A CD1  1  
ATOM 1268  C CD2  . LEU A 1 81  ? 3.340   2.954   -1.303  1.00 0.29  ? 81  LEU A CD2  1  
ATOM 1269  H H    . LEU A 1 81  ? 5.743   2.520   -4.443  1.00 0.27  ? 81  LEU A H    1  
ATOM 1270  H HA   . LEU A 1 81  ? 4.088   0.922   -2.732  1.00 0.26  ? 81  LEU A HA   1  
ATOM 1271  H HB2  . LEU A 1 81  ? 3.461   3.052   -4.755  1.00 0.31  ? 81  LEU A HB2  1  
ATOM 1272  H HB3  . LEU A 1 81  ? 2.246   2.256   -3.759  1.00 0.32  ? 81  LEU A HB3  1  
ATOM 1273  H HG   . LEU A 1 81  ? 4.560   3.924   -2.757  1.00 0.28  ? 81  LEU A HG   1  
ATOM 1274  H HD11 . LEU A 1 81  ? 2.811   5.212   -3.857  1.00 1.05  ? 81  LEU A HD11 1  
ATOM 1275  H HD12 . LEU A 1 81  ? 2.891   5.536   -2.126  1.00 1.03  ? 81  LEU A HD12 1  
ATOM 1276  H HD13 . LEU A 1 81  ? 1.617   4.502   -2.774  1.00 1.12  ? 81  LEU A HD13 1  
ATOM 1277  H HD21 . LEU A 1 81  ? 4.060   2.157   -1.157  1.00 0.94  ? 81  LEU A HD21 1  
ATOM 1278  H HD22 . LEU A 1 81  ? 2.343   2.547   -1.226  1.00 0.98  ? 81  LEU A HD22 1  
ATOM 1279  H HD23 . LEU A 1 81  ? 3.479   3.701   -0.534  1.00 0.98  ? 81  LEU A HD23 1  
ATOM 1280  N N    . ASN A 1 82  ? 4.264   0.282   -5.892  1.00 0.26  ? 82  ASN A N    1  
ATOM 1281  C CA   . ASN A 1 82  ? 4.052   -0.796  -6.835  1.00 0.26  ? 82  ASN A CA   1  
ATOM 1282  C C    . ASN A 1 82  ? 4.483   -2.098  -6.192  1.00 0.23  ? 82  ASN A C    1  
ATOM 1283  O O    . ASN A 1 82  ? 3.806   -3.124  -6.283  1.00 0.25  ? 82  ASN A O    1  
ATOM 1284  C CB   . ASN A 1 82  ? 4.872   -0.568  -8.106  1.00 0.30  ? 82  ASN A CB   1  
ATOM 1285  C CG   . ASN A 1 82  ? 4.197   0.359   -9.097  1.00 0.79  ? 82  ASN A CG   1  
ATOM 1286  O OD1  . ASN A 1 82  ? 2.973   0.443   -9.151  1.00 1.51  ? 82  ASN A OD1  1  
ATOM 1287  N ND2  . ASN A 1 82  ? 4.991   1.054   -9.899  1.00 1.42  ? 82  ASN A ND2  1  
ATOM 1288  H H    . ASN A 1 82  ? 4.838   1.036   -6.146  1.00 0.28  ? 82  ASN A H    1  
ATOM 1289  H HA   . ASN A 1 82  ? 2.998   -0.828  -7.068  1.00 0.30  ? 82  ASN A HA   1  
ATOM 1290  H HB2  . ASN A 1 82  ? 5.822   -0.133  -7.829  1.00 0.58  ? 82  ASN A HB2  1  
ATOM 1291  H HB3  . ASN A 1 82  ? 5.050   -1.516  -8.582  1.00 0.65  ? 82  ASN A HB3  1  
ATOM 1292  H HD21 . ASN A 1 82  ? 5.960   0.934   -9.813  1.00 1.89  ? 82  ASN A HD21 1  
ATOM 1293  H HD22 . ASN A 1 82  ? 4.574   1.654   -10.554 1.00 1.76  ? 82  ASN A HD22 1  
ATOM 1294  N N    . LEU A 1 83  ? 5.633   -2.025  -5.542  1.00 0.23  ? 83  LEU A N    1  
ATOM 1295  C CA   . LEU A 1 83  ? 6.149   -3.106  -4.730  1.00 0.24  ? 83  LEU A CA   1  
ATOM 1296  C C    . LEU A 1 83  ? 5.141   -3.527  -3.680  1.00 0.23  ? 83  LEU A C    1  
ATOM 1297  O O    . LEU A 1 83  ? 4.777   -4.698  -3.583  1.00 0.25  ? 83  LEU A O    1  
ATOM 1298  C CB   . LEU A 1 83  ? 7.407   -2.635  -4.030  1.00 0.27  ? 83  LEU A CB   1  
ATOM 1299  C CG   . LEU A 1 83  ? 7.776   -3.447  -2.803  1.00 0.31  ? 83  LEU A CG   1  
ATOM 1300  C CD1  . LEU A 1 83  ? 8.308   -4.811  -3.210  1.00 0.35  ? 83  LEU A CD1  1  
ATOM 1301  C CD2  . LEU A 1 83  ? 8.768   -2.694  -1.939  1.00 0.36  ? 83  LEU A CD2  1  
ATOM 1302  H H    . LEU A 1 83  ? 6.161   -1.201  -5.616  1.00 0.24  ? 83  LEU A H    1  
ATOM 1303  H HA   . LEU A 1 83  ? 6.383   -3.941  -5.369  1.00 0.25  ? 83  LEU A HA   1  
ATOM 1304  H HB2  . LEU A 1 83  ? 8.217   -2.678  -4.735  1.00 0.30  ? 83  LEU A HB2  1  
ATOM 1305  H HB3  . LEU A 1 83  ? 7.264   -1.609  -3.727  1.00 0.29  ? 83  LEU A HB3  1  
ATOM 1306  H HG   . LEU A 1 83  ? 6.875   -3.597  -2.219  1.00 0.30  ? 83  LEU A HG   1  
ATOM 1307  H HD11 . LEU A 1 83  ? 7.540   -5.343  -3.756  1.00 1.01  ? 83  LEU A HD11 1  
ATOM 1308  H HD12 . LEU A 1 83  ? 8.579   -5.372  -2.330  1.00 1.02  ? 83  LEU A HD12 1  
ATOM 1309  H HD13 . LEU A 1 83  ? 9.175   -4.686  -3.842  1.00 1.12  ? 83  LEU A HD13 1  
ATOM 1310  H HD21 . LEU A 1 83  ? 9.644   -2.458  -2.521  1.00 1.09  ? 83  LEU A HD21 1  
ATOM 1311  H HD22 . LEU A 1 83  ? 9.049   -3.307  -1.095  1.00 1.01  ? 83  LEU A HD22 1  
ATOM 1312  H HD23 . LEU A 1 83  ? 8.313   -1.780  -1.584  1.00 1.14  ? 83  LEU A HD23 1  
ATOM 1313  N N    . ILE A 1 84  ? 4.720   -2.555  -2.883  1.00 0.24  ? 84  ILE A N    1  
ATOM 1314  C CA   . ILE A 1 84  ? 3.745   -2.774  -1.832  1.00 0.26  ? 84  ILE A CA   1  
ATOM 1315  C C    . ILE A 1 84  ? 2.494   -3.448  -2.391  1.00 0.27  ? 84  ILE A C    1  
ATOM 1316  O O    . ILE A 1 84  ? 1.868   -4.265  -1.722  1.00 0.29  ? 84  ILE A O    1  
ATOM 1317  C CB   . ILE A 1 84  ? 3.385   -1.437  -1.149  1.00 0.29  ? 84  ILE A CB   1  
ATOM 1318  C CG1  . ILE A 1 84  ? 4.599   -0.875  -0.403  1.00 0.55  ? 84  ILE A CG1  1  
ATOM 1319  C CG2  . ILE A 1 84  ? 2.195   -1.594  -0.205  1.00 0.47  ? 84  ILE A CG2  1  
ATOM 1320  C CD1  . ILE A 1 84  ? 5.148   -1.796  0.663   1.00 0.62  ? 84  ILE A CD1  1  
ATOM 1321  H H    . ILE A 1 84  ? 5.090   -1.651  -3.005  1.00 0.25  ? 84  ILE A H    1  
ATOM 1322  H HA   . ILE A 1 84  ? 4.191   -3.424  -1.094  1.00 0.28  ? 84  ILE A HA   1  
ATOM 1323  H HB   . ILE A 1 84  ? 3.114   -0.740  -1.925  1.00 0.29  ? 84  ILE A HB   1  
ATOM 1324  H HG12 . ILE A 1 84  ? 5.391   -0.684  -1.112  1.00 1.22  ? 84  ILE A HG12 1  
ATOM 1325  H HG13 . ILE A 1 84  ? 4.319   0.053   0.073   1.00 1.29  ? 84  ILE A HG13 1  
ATOM 1326  H HG21 . ILE A 1 84  ? 2.429   -2.332  0.551   1.00 1.12  ? 84  ILE A HG21 1  
ATOM 1327  H HG22 . ILE A 1 84  ? 1.331   -1.918  -0.766  1.00 1.09  ? 84  ILE A HG22 1  
ATOM 1328  H HG23 . ILE A 1 84  ? 1.984   -0.648  0.269   1.00 1.17  ? 84  ILE A HG23 1  
ATOM 1329  H HD11 . ILE A 1 84  ? 5.942   -1.295  1.197   1.00 1.22  ? 84  ILE A HD11 1  
ATOM 1330  H HD12 . ILE A 1 84  ? 5.537   -2.690  0.202   1.00 1.15  ? 84  ILE A HD12 1  
ATOM 1331  H HD13 . ILE A 1 84  ? 4.361   -2.059  1.354   1.00 1.31  ? 84  ILE A HD13 1  
ATOM 1332  N N    . GLY A 1 85  ? 2.163   -3.120  -3.634  1.00 0.26  ? 85  GLY A N    1  
ATOM 1333  C CA   . GLY A 1 85  ? 1.066   -3.770  -4.314  1.00 0.29  ? 85  GLY A CA   1  
ATOM 1334  C C    . GLY A 1 85  ? 1.302   -5.259  -4.473  1.00 0.29  ? 85  GLY A C    1  
ATOM 1335  O O    . GLY A 1 85  ? 0.432   -6.064  -4.156  1.00 0.33  ? 85  GLY A O    1  
ATOM 1336  H H    . GLY A 1 85  ? 2.672   -2.424  -4.098  1.00 0.25  ? 85  GLY A H    1  
ATOM 1337  H HA2  . GLY A 1 85  ? 0.162   -3.613  -3.748  1.00 0.33  ? 85  GLY A HA2  1  
ATOM 1338  H HA3  . GLY A 1 85  ? 0.948   -3.327  -5.292  1.00 0.31  ? 85  GLY A HA3  1  
ATOM 1339  N N    . GLY A 1 86  ? 2.500   -5.630  -4.917  1.00 0.28  ? 86  GLY A N    1  
ATOM 1340  C CA   . GLY A 1 86  ? 2.800   -7.031  -5.150  1.00 0.31  ? 86  GLY A CA   1  
ATOM 1341  C C    . GLY A 1 86  ? 2.965   -7.776  -3.849  1.00 0.29  ? 86  GLY A C    1  
ATOM 1342  O O    . GLY A 1 86  ? 2.585   -8.942  -3.726  1.00 0.35  ? 86  GLY A O    1  
ATOM 1343  H H    . GLY A 1 86  ? 3.202   -4.949  -5.048  1.00 0.28  ? 86  GLY A H    1  
ATOM 1344  H HA2  . GLY A 1 86  ? 1.992   -7.475  -5.713  1.00 0.34  ? 86  GLY A HA2  1  
ATOM 1345  H HA3  . GLY A 1 86  ? 3.713   -7.108  -5.718  1.00 0.33  ? 86  GLY A HA3  1  
ATOM 1346  N N    . LEU A 1 87  ? 3.524   -7.084  -2.874  1.00 0.25  ? 87  LEU A N    1  
ATOM 1347  C CA   . LEU A 1 87  ? 3.688   -7.612  -1.532  1.00 0.25  ? 87  LEU A CA   1  
ATOM 1348  C C    . LEU A 1 87  ? 2.334   -7.897  -0.914  1.00 0.26  ? 87  LEU A C    1  
ATOM 1349  O O    . LEU A 1 87  ? 2.069   -9.000  -0.436  1.00 0.29  ? 87  LEU A O    1  
ATOM 1350  C CB   . LEU A 1 87  ? 4.423   -6.599  -0.666  1.00 0.25  ? 87  LEU A CB   1  
ATOM 1351  C CG   . LEU A 1 87  ? 5.927   -6.500  -0.874  1.00 0.26  ? 87  LEU A CG   1  
ATOM 1352  C CD1  . LEU A 1 87  ? 6.451   -5.258  -0.182  1.00 0.26  ? 87  LEU A CD1  1  
ATOM 1353  C CD2  . LEU A 1 87  ? 6.628   -7.735  -0.330  1.00 0.35  ? 87  LEU A CD2  1  
ATOM 1354  H H    . LEU A 1 87  ? 3.830   -6.169  -3.066  1.00 0.26  ? 87  LEU A H    1  
ATOM 1355  H HA   . LEU A 1 87  ? 4.261   -8.525  -1.588  1.00 0.28  ? 87  LEU A HA   1  
ATOM 1356  H HB2  . LEU A 1 87  ? 3.995   -5.627  -0.866  1.00 0.25  ? 87  LEU A HB2  1  
ATOM 1357  H HB3  . LEU A 1 87  ? 4.242   -6.848  0.368   1.00 0.28  ? 87  LEU A HB3  1  
ATOM 1358  H HG   . LEU A 1 87  ? 6.143   -6.419  -1.928  1.00 0.25  ? 87  LEU A HG   1  
ATOM 1359  H HD11 . LEU A 1 87  ? 7.511   -5.166  -0.360  1.00 1.02  ? 87  LEU A HD11 1  
ATOM 1360  H HD12 . LEU A 1 87  ? 6.269   -5.333  0.881   1.00 1.05  ? 87  LEU A HD12 1  
ATOM 1361  H HD13 . LEU A 1 87  ? 5.945   -4.391  -0.573  1.00 1.06  ? 87  LEU A HD13 1  
ATOM 1362  H HD21 . LEU A 1 87  ? 6.244   -8.616  -0.823  1.00 0.97  ? 87  LEU A HD21 1  
ATOM 1363  H HD22 . LEU A 1 87  ? 6.449   -7.811  0.734   1.00 1.10  ? 87  LEU A HD22 1  
ATOM 1364  H HD23 . LEU A 1 87  ? 7.688   -7.655  -0.510  1.00 1.13  ? 87  LEU A HD23 1  
ATOM 1365  N N    . ALA A 1 88  ? 1.478   -6.887  -0.939  1.00 0.25  ? 88  ALA A N    1  
ATOM 1366  C CA   . ALA A 1 88  ? 0.148   -6.998  -0.380  1.00 0.27  ? 88  ALA A CA   1  
ATOM 1367  C C    . ALA A 1 88  ? -0.631  -8.079  -1.068  1.00 0.30  ? 88  ALA A C    1  
ATOM 1368  O O    . ALA A 1 88  ? -1.383  -8.804  -0.437  1.00 0.35  ? 88  ALA A O    1  
ATOM 1369  C CB   . ALA A 1 88  ? -0.607  -5.696  -0.506  1.00 0.27  ? 88  ALA A CB   1  
ATOM 1370  H H    . ALA A 1 88  ? 1.757   -6.032  -1.345  1.00 0.26  ? 88  ALA A H    1  
ATOM 1371  H HA   . ALA A 1 88  ? 0.243   -7.241  0.663   1.00 0.29  ? 88  ALA A HA   1  
ATOM 1372  H HB1  . ALA A 1 88  ? 0.011   -4.881  -0.165  1.00 1.06  ? 88  ALA A HB1  1  
ATOM 1373  H HB2  . ALA A 1 88  ? -1.507  -5.745  0.087   1.00 1.04  ? 88  ALA A HB2  1  
ATOM 1374  H HB3  . ALA A 1 88  ? -0.869  -5.548  -1.544  1.00 1.06  ? 88  ALA A HB3  1  
ATOM 1375  N N    . MET A 1 89  ? -0.458  -8.172  -2.368  1.00 0.29  ? 89  MET A N    1  
ATOM 1376  C CA   . MET A 1 89  ? -1.160  -9.164  -3.145  1.00 0.33  ? 89  MET A CA   1  
ATOM 1377  C C    . MET A 1 89  ? -0.673  -10.562 -2.807  1.00 0.34  ? 89  MET A C    1  
ATOM 1378  O O    . MET A 1 89  ? -1.429  -11.524 -2.882  1.00 0.39  ? 89  MET A O    1  
ATOM 1379  C CB   . MET A 1 89  ? -1.009  -8.877  -4.631  1.00 0.35  ? 89  MET A CB   1  
ATOM 1380  C CG   . MET A 1 89  ? -1.847  -7.701  -5.083  1.00 0.42  ? 89  MET A CG   1  
ATOM 1381  S SD   . MET A 1 89  ? -2.005  -7.609  -6.877  1.00 1.03  ? 89  MET A SD   1  
ATOM 1382  C CE   . MET A 1 89  ? -0.301  -7.344  -7.356  1.00 1.89  ? 89  MET A CE   1  
ATOM 1383  H H    . MET A 1 89  ? 0.154   -7.545  -2.821  1.00 0.28  ? 89  MET A H    1  
ATOM 1384  H HA   . MET A 1 89  ? -2.203  -9.088  -2.882  1.00 0.37  ? 89  MET A HA   1  
ATOM 1385  H HB2  . MET A 1 89  ? 0.031   -8.652  -4.837  1.00 0.32  ? 89  MET A HB2  1  
ATOM 1386  H HB3  . MET A 1 89  ? -1.304  -9.748  -5.194  1.00 0.39  ? 89  MET A HB3  1  
ATOM 1387  H HG2  . MET A 1 89  ? -2.830  -7.794  -4.643  1.00 0.56  ? 89  MET A HG2  1  
ATOM 1388  H HG3  . MET A 1 89  ? -1.378  -6.786  -4.728  1.00 0.43  ? 89  MET A HG3  1  
ATOM 1389  H HE1  . MET A 1 89  ? -0.242  -7.242  -8.430  1.00 2.52  ? 89  MET A HE1  1  
ATOM 1390  H HE2  . MET A 1 89  ? 0.298   -8.186  -7.041  1.00 2.34  ? 89  MET A HE2  1  
ATOM 1391  H HE3  . MET A 1 89  ? 0.069   -6.444  -6.889  1.00 2.22  ? 89  MET A HE3  1  
ATOM 1392  N N    . ALA A 1 90  ? 0.587   -10.664 -2.411  1.00 0.34  ? 90  ALA A N    1  
ATOM 1393  C CA   . ALA A 1 90  ? 1.157   -11.939 -2.007  1.00 0.40  ? 90  ALA A CA   1  
ATOM 1394  C C    . ALA A 1 90  ? 0.593   -12.373 -0.659  1.00 0.42  ? 90  ALA A C    1  
ATOM 1395  O O    . ALA A 1 90  ? 0.232   -13.536 -0.470  1.00 0.49  ? 90  ALA A O    1  
ATOM 1396  C CB   . ALA A 1 90  ? 2.673   -11.848 -1.953  1.00 0.46  ? 90  ALA A CB   1  
ATOM 1397  H H    . ALA A 1 90  ? 1.149   -9.859  -2.390  1.00 0.32  ? 90  ALA A H    1  
ATOM 1398  H HA   . ALA A 1 90  ? 0.888   -12.675 -2.750  1.00 0.42  ? 90  ALA A HA   1  
ATOM 1399  H HB1  . ALA A 1 90  ? 3.047   -11.517 -2.911  1.00 1.20  ? 90  ALA A HB1  1  
ATOM 1400  H HB2  . ALA A 1 90  ? 3.084   -12.819 -1.721  1.00 1.13  ? 90  ALA A HB2  1  
ATOM 1401  H HB3  . ALA A 1 90  ? 2.963   -11.142 -1.189  1.00 1.03  ? 90  ALA A HB3  1  
ATOM 1402  N N    . CYS A 1 91  ? 0.506   -11.427 0.271   1.00 0.41  ? 91  CYS A N    1  
ATOM 1403  C CA   . CYS A 1 91  ? -0.035  -11.703 1.597   1.00 0.47  ? 91  CYS A CA   1  
ATOM 1404  C C    . CYS A 1 91  ? -1.550  -11.889 1.518   1.00 0.45  ? 91  CYS A C    1  
ATOM 1405  O O    . CYS A 1 91  ? -2.122  -12.716 2.226   1.00 0.51  ? 91  CYS A O    1  
ATOM 1406  C CB   . CYS A 1 91  ? 0.327   -10.573 2.571   1.00 0.55  ? 91  CYS A CB   1  
ATOM 1407  S SG   . CYS A 1 91  ? 0.080   -10.989 4.314   1.00 1.76  ? 91  CYS A SG   1  
ATOM 1408  H H    . CYS A 1 91  ? 0.824   -10.522 0.062   1.00 0.40  ? 91  CYS A H    1  
ATOM 1409  H HA   . CYS A 1 91  ? 0.406   -12.624 1.946   1.00 0.53  ? 91  CYS A HA   1  
ATOM 1410  H HB2  . CYS A 1 91  ? 1.367   -10.315 2.442   1.00 1.09  ? 91  CYS A HB2  1  
ATOM 1411  H HB3  . CYS A 1 91  ? -0.282  -9.708  2.352   1.00 0.94  ? 91  CYS A HB3  1  
ATOM 1412  H HG   . CYS A 1 91  ? 0.570   -9.997  5.044   1.00 2.29  ? 91  CYS A HG   1  
ATOM 1413  N N    . HIS A 1 92  ? -2.194  -11.128 0.639   1.00 0.41  ? 92  HIS A N    1  
ATOM 1414  C CA   . HIS A 1 92  ? -3.613  -11.311 0.364   1.00 0.46  ? 92  HIS A CA   1  
ATOM 1415  C C    . HIS A 1 92  ? -3.843  -12.711 -0.165  1.00 0.45  ? 92  HIS A C    1  
ATOM 1416  O O    . HIS A 1 92  ? -4.674  -13.444 0.347   1.00 0.49  ? 92  HIS A O    1  
ATOM 1417  C CB   . HIS A 1 92  ? -4.129  -10.301 -0.666  1.00 0.54  ? 92  HIS A CB   1  
ATOM 1418  C CG   . HIS A 1 92  ? -4.679  -9.031  -0.090  1.00 1.21  ? 92  HIS A CG   1  
ATOM 1419  N ND1  . HIS A 1 92  ? -5.896  -8.964  0.556   1.00 2.13  ? 92  HIS A ND1  1  
ATOM 1420  C CD2  . HIS A 1 92  ? -4.204  -7.763  -0.120  1.00 1.96  ? 92  HIS A CD2  1  
ATOM 1421  C CE1  . HIS A 1 92  ? -6.148  -7.714  0.890   1.00 2.74  ? 92  HIS A CE1  1  
ATOM 1422  N NE2  . HIS A 1 92  ? -5.138  -6.964  0.494   1.00 2.62  ? 92  HIS A NE2  1  
ATOM 1423  H H    . HIS A 1 92  ? -1.699  -10.430 0.159   1.00 0.40  ? 92  HIS A H    1  
ATOM 1424  H HA   . HIS A 1 92  ? -4.155  -11.189 1.290   1.00 0.53  ? 92  HIS A HA   1  
ATOM 1425  H HB2  . HIS A 1 92  ? -3.320  -10.034 -1.327  1.00 1.06  ? 92  HIS A HB2  1  
ATOM 1426  H HB3  . HIS A 1 92  ? -4.914  -10.767 -1.242  1.00 0.91  ? 92  HIS A HB3  1  
ATOM 1427  H HD1  . HIS A 1 92  ? -6.485  -9.729  0.761   1.00 2.63  ? 92  HIS A HD1  1  
ATOM 1428  H HD2  . HIS A 1 92  ? -3.265  -7.440  -0.546  1.00 2.49  ? 92  HIS A HD2  1  
ATOM 1429  H HE1  . HIS A 1 92  ? -7.037  -7.362  1.391   1.00 3.56  ? 92  HIS A HE1  1  
ATOM 1430  H HE2  . HIS A 1 92  ? -5.121  -5.984  0.516   1.00 3.27  ? 92  HIS A HE2  1  
ATOM 1431  N N    . ASP A 1 93  ? -3.077  -13.071 -1.185  1.00 0.45  ? 93  ASP A N    1  
ATOM 1432  C CA   . ASP A 1 93  ? -3.142  -14.398 -1.785  1.00 0.52  ? 93  ASP A CA   1  
ATOM 1433  C C    . ASP A 1 93  ? -2.914  -15.480 -0.736  1.00 0.56  ? 93  ASP A C    1  
ATOM 1434  O O    . ASP A 1 93  ? -3.530  -16.540 -0.780  1.00 0.65  ? 93  ASP A O    1  
ATOM 1435  C CB   . ASP A 1 93  ? -2.099  -14.507 -2.892  1.00 0.54  ? 93  ASP A CB   1  
ATOM 1436  C CG   . ASP A 1 93  ? -2.106  -15.856 -3.580  1.00 0.93  ? 93  ASP A CG   1  
ATOM 1437  O OD1  . ASP A 1 93  ? -2.998  -16.094 -4.419  1.00 1.48  ? 93  ASP A OD1  1  
ATOM 1438  O OD2  . ASP A 1 93  ? -1.205  -16.675 -3.290  1.00 1.75  ? 93  ASP A OD2  1  
ATOM 1439  H H    . ASP A 1 93  ? -2.451  -12.414 -1.564  1.00 0.44  ? 93  ASP A H    1  
ATOM 1440  H HA   . ASP A 1 93  ? -4.124  -14.525 -2.212  1.00 0.56  ? 93  ASP A HA   1  
ATOM 1441  H HB2  . ASP A 1 93  ? -2.293  -13.742 -3.628  1.00 0.94  ? 93  ASP A HB2  1  
ATOM 1442  H HB3  . ASP A 1 93  ? -1.119  -14.347 -2.466  1.00 0.78  ? 93  ASP A HB3  1  
ATOM 1443  N N    . SER A 1 94  ? -2.041  -15.191 0.218   1.00 0.54  ? 94  SER A N    1  
ATOM 1444  C CA   . SER A 1 94  ? -1.799  -16.093 1.334   1.00 0.60  ? 94  SER A CA   1  
ATOM 1445  C C    . SER A 1 94  ? -3.093  -16.317 2.105   1.00 0.63  ? 94  SER A C    1  
ATOM 1446  O O    . SER A 1 94  ? -3.464  -17.448 2.404   1.00 0.70  ? 94  SER A O    1  
ATOM 1447  C CB   . SER A 1 94  ? -0.738  -15.506 2.262   1.00 0.65  ? 94  SER A CB   1  
ATOM 1448  O OG   . SER A 1 94  ? 0.486   -15.290 1.574   1.00 1.27  ? 94  SER A OG   1  
ATOM 1449  H H    . SER A 1 94  ? -1.557  -14.343 0.177   1.00 0.52  ? 94  SER A H    1  
ATOM 1450  H HA   . SER A 1 94  ? -1.449  -17.036 0.941   1.00 0.65  ? 94  SER A HA   1  
ATOM 1451  H HB2  . SER A 1 94  ? -1.095  -14.558 2.645   1.00 0.97  ? 94  SER A HB2  1  
ATOM 1452  H HB3  . SER A 1 94  ? -0.565  -16.184 3.083   1.00 1.04  ? 94  SER A HB3  1  
ATOM 1453  H HG   . SER A 1 94  ? 0.314   -14.800 0.760   1.00 1.85  ? 94  SER A HG   1  
ATOM 1454  N N    . PHE A 1 95  ? -3.785  -15.221 2.385   1.00 0.60  ? 95  PHE A N    1  
ATOM 1455  C CA   . PHE A 1 95  ? -5.058  -15.262 3.086   1.00 0.66  ? 95  PHE A CA   1  
ATOM 1456  C C    . PHE A 1 95  ? -6.124  -15.940 2.243   1.00 0.72  ? 95  PHE A C    1  
ATOM 1457  O O    . PHE A 1 95  ? -6.937  -16.691 2.749   1.00 0.84  ? 95  PHE A O    1  
ATOM 1458  C CB   . PHE A 1 95  ? -5.507  -13.848 3.449   1.00 0.64  ? 95  PHE A CB   1  
ATOM 1459  C CG   . PHE A 1 95  ? -4.991  -13.383 4.780   1.00 0.78  ? 95  PHE A CG   1  
ATOM 1460  C CD1  . PHE A 1 95  ? -3.696  -12.911 4.913   1.00 1.80  ? 95  PHE A CD1  1  
ATOM 1461  C CD2  . PHE A 1 95  ? -5.802  -13.427 5.901   1.00 1.30  ? 95  PHE A CD2  1  
ATOM 1462  C CE1  . PHE A 1 95  ? -3.219  -12.492 6.139   1.00 2.35  ? 95  PHE A CE1  1  
ATOM 1463  C CE2  . PHE A 1 95  ? -5.331  -13.011 7.130   1.00 1.76  ? 95  PHE A CE2  1  
ATOM 1464  C CZ   . PHE A 1 95  ? -4.038  -12.542 7.249   1.00 2.08  ? 95  PHE A CZ   1  
ATOM 1465  H H    . PHE A 1 95  ? -3.429  -14.352 2.100   1.00 0.55  ? 95  PHE A H    1  
ATOM 1466  H HA   . PHE A 1 95  ? -4.920  -15.830 3.994   1.00 0.75  ? 95  PHE A HA   1  
ATOM 1467  H HB2  . PHE A 1 95  ? -5.145  -13.166 2.693   1.00 0.99  ? 95  PHE A HB2  1  
ATOM 1468  H HB3  . PHE A 1 95  ? -6.585  -13.813 3.472   1.00 0.98  ? 95  PHE A HB3  1  
ATOM 1469  H HD1  . PHE A 1 95  ? -3.054  -12.871 4.045   1.00 2.46  ? 95  PHE A HD1  1  
ATOM 1470  H HD2  . PHE A 1 95  ? -6.813  -13.794 5.810   1.00 1.96  ? 95  PHE A HD2  1  
ATOM 1471  H HE1  . PHE A 1 95  ? -2.207  -12.125 6.229   1.00 3.27  ? 95  PHE A HE1  1  
ATOM 1472  H HE2  . PHE A 1 95  ? -5.973  -13.051 7.997   1.00 2.41  ? 95  PHE A HE2  1  
ATOM 1473  H HZ   . PHE A 1 95  ? -3.668  -12.216 8.209   1.00 2.63  ? 95  PHE A HZ   1  
ATOM 1474  N N    . LEU A 1 96  ? -6.111  -15.680 0.954   1.00 0.69  ? 96  LEU A N    1  
ATOM 1475  C CA   . LEU A 1 96  ? -7.079  -16.276 0.048   1.00 0.81  ? 96  LEU A CA   1  
ATOM 1476  C C    . LEU A 1 96  ? -6.862  -17.778 -0.041  1.00 0.90  ? 96  LEU A C    1  
ATOM 1477  O O    . LEU A 1 96  ? -7.794  -18.542 -0.279  1.00 1.09  ? 96  LEU A O    1  
ATOM 1478  C CB   . LEU A 1 96  ? -6.981  -15.627 -1.333  1.00 0.83  ? 96  LEU A CB   1  
ATOM 1479  C CG   . LEU A 1 96  ? -7.833  -14.370 -1.530  1.00 0.87  ? 96  LEU A CG   1  
ATOM 1480  C CD1  . LEU A 1 96  ? -9.308  -14.724 -1.563  1.00 1.21  ? 96  LEU A CD1  1  
ATOM 1481  C CD2  . LEU A 1 96  ? -7.555  -13.342 -0.443  1.00 1.08  ? 96  LEU A CD2  1  
ATOM 1482  H H    . LEU A 1 96  ? -5.433  -15.066 0.598   1.00 0.62  ? 96  LEU A H    1  
ATOM 1483  H HA   . LEU A 1 96  ? -8.061  -16.094 0.453   1.00 0.86  ? 96  LEU A HA   1  
ATOM 1484  H HB2  . LEU A 1 96  ? -5.950  -15.365 -1.509  1.00 0.76  ? 96  LEU A HB2  1  
ATOM 1485  H HB3  . LEU A 1 96  ? -7.278  -16.354 -2.071  1.00 0.93  ? 96  LEU A HB3  1  
ATOM 1486  H HG   . LEU A 1 96  ? -7.578  -13.925 -2.472  1.00 0.92  ? 96  LEU A HG   1  
ATOM 1487  H HD11 . LEU A 1 96  ? -9.487  -15.437 -2.353  1.00 1.70  ? 96  LEU A HD11 1  
ATOM 1488  H HD12 . LEU A 1 96  ? -9.889  -13.832 -1.743  1.00 1.64  ? 96  LEU A HD12 1  
ATOM 1489  H HD13 . LEU A 1 96  ? -9.595  -15.156 -0.617  1.00 1.64  ? 96  LEU A HD13 1  
ATOM 1490  H HD21 . LEU A 1 96  ? -6.600  -12.873 -0.629  1.00 1.68  ? 96  LEU A HD21 1  
ATOM 1491  H HD22 . LEU A 1 96  ? -7.528  -13.834 0.518   1.00 1.41  ? 96  LEU A HD22 1  
ATOM 1492  H HD23 . LEU A 1 96  ? -8.333  -12.593 -0.445  1.00 1.51  ? 96  LEU A HD23 1  
ATOM 1493  N N    . LYS A 1 97  ? -5.622  -18.187 0.167   1.00 0.83  ? 97  LYS A N    1  
ATOM 1494  C CA   . LYS A 1 97  ? -5.258  -19.594 0.179   1.00 0.93  ? 97  LYS A CA   1  
ATOM 1495  C C    . LYS A 1 97  ? -5.273  -20.136 1.610   1.00 0.97  ? 97  LYS A C    1  
ATOM 1496  O O    . LYS A 1 97  ? -4.783  -21.233 1.874   1.00 1.12  ? 97  LYS A O    1  
ATOM 1497  C CB   . LYS A 1 97  ? -3.863  -19.782 -0.438  1.00 0.93  ? 97  LYS A CB   1  
ATOM 1498  C CG   . LYS A 1 97  ? -3.822  -19.921 -1.966  1.00 0.99  ? 97  LYS A CG   1  
ATOM 1499  C CD   . LYS A 1 97  ? -4.415  -18.729 -2.709  1.00 1.25  ? 97  LYS A CD   1  
ATOM 1500  C CE   . LYS A 1 97  ? -5.903  -18.901 -2.990  1.00 2.06  ? 97  LYS A CE   1  
ATOM 1501  N NZ   . LYS A 1 97  ? -6.187  -20.095 -3.828  1.00 2.65  ? 97  LYS A NZ   1  
ATOM 1502  H H    . LYS A 1 97  ? -4.920  -17.516 0.313   1.00 0.75  ? 97  LYS A H    1  
ATOM 1503  H HA   . LYS A 1 97  ? -5.982  -20.135 -0.410  1.00 1.01  ? 97  LYS A HA   1  
ATOM 1504  H HB2  . LYS A 1 97  ? -3.255  -18.930 -0.169  1.00 0.89  ? 97  LYS A HB2  1  
ATOM 1505  H HB3  . LYS A 1 97  ? -3.417  -20.667 -0.010  1.00 1.04  ? 97  LYS A HB3  1  
ATOM 1506  H HG2  . LYS A 1 97  ? -2.792  -20.023 -2.270  1.00 1.50  ? 97  LYS A HG2  1  
ATOM 1507  H HG3  . LYS A 1 97  ? -4.365  -20.811 -2.245  1.00 1.64  ? 97  LYS A HG3  1  
ATOM 1508  H HD2  . LYS A 1 97  ? -4.276  -17.841 -2.109  1.00 1.86  ? 97  LYS A HD2  1  
ATOM 1509  H HD3  . LYS A 1 97  ? -3.892  -18.611 -3.647  1.00 1.74  ? 97  LYS A HD3  1  
ATOM 1510  H HE2  . LYS A 1 97  ? -6.423  -19.001 -2.050  1.00 2.59  ? 97  LYS A HE2  1  
ATOM 1511  H HE3  . LYS A 1 97  ? -6.260  -18.019 -3.503  1.00 2.52  ? 97  LYS A HE3  1  
ATOM 1512  H HZ1  . LYS A 1 97  ? -7.213  -20.181 -3.987  1.00 3.00  ? 97  LYS A HZ1  1  
ATOM 1513  H HZ2  . LYS A 1 97  ? -5.853  -20.956 -3.352  1.00 2.88  ? 97  LYS A HZ2  1  
ATOM 1514  H HZ3  . LYS A 1 97  ? -5.710  -20.011 -4.748  1.00 3.15  ? 97  LYS A HZ3  1  
ATOM 1515  N N    . ALA A 1 98  ? -5.833  -19.357 2.532   1.00 0.99  ? 98  ALA A N    1  
ATOM 1516  C CA   . ALA A 1 98  ? -5.879  -19.746 3.936   1.00 1.06  ? 98  ALA A CA   1  
ATOM 1517  C C    . ALA A 1 98  ? -7.246  -19.444 4.549   1.00 1.09  ? 98  ALA A C    1  
ATOM 1518  O O    . ALA A 1 98  ? -8.054  -20.347 4.773   1.00 1.23  ? 98  ALA A O    1  
ATOM 1519  C CB   . ALA A 1 98  ? -4.779  -19.042 4.719   1.00 1.00  ? 98  ALA A CB   1  
ATOM 1520  H H    . ALA A 1 98  ? -6.227  -18.501 2.260   1.00 1.04  ? 98  ALA A H    1  
ATOM 1521  H HA   . ALA A 1 98  ? -5.700  -20.806 3.987   1.00 1.17  ? 98  ALA A HA   1  
ATOM 1522  H HB1  . ALA A 1 98  ? -3.819  -19.270 4.275   1.00 1.37  ? 98  ALA A HB1  1  
ATOM 1523  H HB2  . ALA A 1 98  ? -4.791  -19.382 5.743   1.00 1.46  ? 98  ALA A HB2  1  
ATOM 1524  H HB3  . ALA A 1 98  ? -4.942  -17.975 4.691   1.00 1.42  ? 98  ALA A HB3  1  
ATOM 1525  N N    . VAL A 1 99  ? -7.498  -18.167 4.793   1.00 1.00  ? 99  VAL A N    1  
ATOM 1526  C CA   . VAL A 1 99  ? -8.754  -17.704 5.362   1.00 1.06  ? 99  VAL A CA   1  
ATOM 1527  C C    . VAL A 1 99  ? -8.906  -16.195 5.131   1.00 1.00  ? 99  VAL A C    1  
ATOM 1528  O O    . VAL A 1 99  ? -8.455  -15.371 5.927   1.00 1.01  ? 99  VAL A O    1  
ATOM 1529  C CB   . VAL A 1 99  ? -8.870  -18.046 6.872   1.00 1.16  ? 99  VAL A CB   1  
ATOM 1530  C CG1  . VAL A 1 99  ? -7.646  -17.578 7.651   1.00 1.13  ? 99  VAL A CG1  1  
ATOM 1531  C CG2  . VAL A 1 99  ? -10.146 -17.454 7.456   1.00 1.24  ? 99  VAL A CG2  1  
ATOM 1532  H H    . VAL A 1 99  ? -6.820  -17.500 4.553   1.00 0.92  ? 99  VAL A H    1  
ATOM 1533  H HA   . VAL A 1 99  ? -9.553  -18.212 4.840   1.00 1.12  ? 99  VAL A HA   1  
ATOM 1534  H HB   . VAL A 1 99  ? -8.930  -19.121 6.965   1.00 1.24  ? 99  VAL A HB   1  
ATOM 1535  H HG11 . VAL A 1 99  ? -7.768  -17.824 8.696   1.00 1.64  ? 99  VAL A HG11 1  
ATOM 1536  H HG12 . VAL A 1 99  ? -7.538  -16.508 7.543   1.00 1.48  ? 99  VAL A HG12 1  
ATOM 1537  H HG13 . VAL A 1 99  ? -6.765  -18.069 7.266   1.00 1.41  ? 99  VAL A HG13 1  
ATOM 1538  H HG21 . VAL A 1 99  ? -10.211 -17.701 8.505   1.00 1.52  ? 99  VAL A HG21 1  
ATOM 1539  H HG22 . VAL A 1 99  ? -11.001 -17.859 6.937   1.00 1.65  ? 99  VAL A HG22 1  
ATOM 1540  H HG23 . VAL A 1 99  ? -10.131 -16.380 7.339   1.00 1.63  ? 99  VAL A HG23 1  
ATOM 1541  N N    . PRO A 1 100 ? -9.532  -15.808 4.013   1.00 1.00  ? 100 PRO A N    1  
ATOM 1542  C CA   . PRO A 1 100 ? -9.673  -14.411 3.635   1.00 1.02  ? 100 PRO A CA   1  
ATOM 1543  C C    . PRO A 1 100 ? -10.903 -13.760 4.246   1.00 1.28  ? 100 PRO A C    1  
ATOM 1544  O O    . PRO A 1 100 ? -11.233 -12.614 3.940   1.00 1.60  ? 100 PRO A O    1  
ATOM 1545  C CB   . PRO A 1 100 ? -9.794  -14.484 2.122   1.00 1.04  ? 100 PRO A CB   1  
ATOM 1546  C CG   . PRO A 1 100 ? -10.433 -15.805 1.839   1.00 1.03  ? 100 PRO A CG   1  
ATOM 1547  C CD   . PRO A 1 100 ? -10.147 -16.706 3.019   1.00 1.06  ? 100 PRO A CD   1  
ATOM 1548  H HA   . PRO A 1 100 ? -8.796  -13.838 3.901   1.00 0.95  ? 100 PRO A HA   1  
ATOM 1549  H HB2  . PRO A 1 100 ? -10.405 -13.666 1.769   1.00 1.23  ? 100 PRO A HB2  1  
ATOM 1550  H HB3  . PRO A 1 100 ? -8.814  -14.422 1.681   1.00 1.05  ? 100 PRO A HB3  1  
ATOM 1551  H HG2  . PRO A 1 100 ? -11.497 -15.676 1.721   1.00 1.10  ? 100 PRO A HG2  1  
ATOM 1552  H HG3  . PRO A 1 100 ? -10.008 -16.227 0.939   1.00 1.03  ? 100 PRO A HG3  1  
ATOM 1553  H HD2  . PRO A 1 100 ? -11.065 -17.127 3.400   1.00 1.19  ? 100 PRO A HD2  1  
ATOM 1554  H HD3  . PRO A 1 100 ? -9.463  -17.489 2.737   1.00 1.04  ? 100 PRO A HD3  1  
ATOM 1555  N N    . SER A 1 101 ? -11.570 -14.486 5.125   1.00 1.57  ? 101 SER A N    1  
ATOM 1556  C CA   . SER A 1 101 ? -12.752 -13.979 5.793   1.00 1.88  ? 101 SER A CA   1  
ATOM 1557  C C    . SER A 1 101 ? -12.364 -13.067 6.958   1.00 1.62  ? 101 SER A C    1  
ATOM 1558  O O    . SER A 1 101 ? -12.829 -13.237 8.084   1.00 1.94  ? 101 SER A O    1  
ATOM 1559  C CB   . SER A 1 101 ? -13.607 -15.151 6.273   1.00 2.76  ? 101 SER A CB   1  
ATOM 1560  O OG   . SER A 1 101 ? -13.884 -16.036 5.196   1.00 3.39  ? 101 SER A OG   1  
ATOM 1561  H H    . SER A 1 101 ? -11.258 -15.392 5.329   1.00 1.80  ? 101 SER A H    1  
ATOM 1562  H HA   . SER A 1 101 ? -13.317 -13.404 5.075   1.00 2.06  ? 101 SER A HA   1  
ATOM 1563  H HB2  . SER A 1 101 ? -13.077 -15.691 7.045   1.00 3.14  ? 101 SER A HB2  1  
ATOM 1564  H HB3  . SER A 1 101 ? -14.540 -14.777 6.667   1.00 3.02  ? 101 SER A HB3  1  
ATOM 1565  H HG   . SER A 1 101 ? -13.704 -15.585 4.360   1.00 3.74  ? 101 SER A HG   1  
ATOM 1566  N N    . GLN A 1 102 ? -11.512 -12.090 6.664   1.00 1.61  ? 102 GLN A N    1  
ATOM 1567  C CA   . GLN A 1 102 ? -11.069 -11.111 7.651   1.00 2.12  ? 102 GLN A CA   1  
ATOM 1568  C C    . GLN A 1 102 ? -12.153 -10.048 7.845   1.00 2.74  ? 102 GLN A C    1  
ATOM 1569  O O    . GLN A 1 102 ? -11.919 -8.850  7.695   1.00 3.39  ? 102 GLN A O    1  
ATOM 1570  C CB   . GLN A 1 102 ? -9.751  -10.464 7.196   1.00 2.47  ? 102 GLN A CB   1  
ATOM 1571  C CG   . GLN A 1 102 ? -9.089  -9.581  8.246   1.00 3.02  ? 102 GLN A CG   1  
ATOM 1572  C CD   . GLN A 1 102 ? -8.617  -10.360 9.458   1.00 3.87  ? 102 GLN A CD   1  
ATOM 1573  O OE1  . GLN A 1 102 ? -9.361  -10.552 10.419  1.00 4.45  ? 102 GLN A OE1  1  
ATOM 1574  N NE2  . GLN A 1 102 ? -7.367  -10.791 9.431   1.00 4.44  ? 102 GLN A NE2  1  
ATOM 1575  H H    . GLN A 1 102 ? -11.174 -12.026 5.745   1.00 1.67  ? 102 GLN A H    1  
ATOM 1576  H HA   . GLN A 1 102 ? -10.909 -11.627 8.587   1.00 2.52  ? 102 GLN A HA   1  
ATOM 1577  H HB2  . GLN A 1 102 ? -9.056  -11.247 6.930   1.00 2.90  ? 102 GLN A HB2  1  
ATOM 1578  H HB3  . GLN A 1 102 ? -9.945  -9.861  6.321   1.00 2.74  ? 102 GLN A HB3  1  
ATOM 1579  H HG2  . GLN A 1 102 ? -8.237  -9.092  7.799   1.00 3.38  ? 102 GLN A HG2  1  
ATOM 1580  H HG3  . GLN A 1 102 ? -9.801  -8.836  8.570   1.00 3.09  ? 102 GLN A HG3  1  
ATOM 1581  H HE21 . GLN A 1 102 ? -6.822  -10.580 8.642   1.00 4.34  ? 102 GLN A HE21 1  
ATOM 1582  H HE22 . GLN A 1 102 ? -7.038  -11.310 10.195  1.00 5.19  ? 102 GLN A HE22 1  
ATOM 1583  N N    . LYS A 1 103 ? -13.349 -10.509 8.172   1.00 3.15  ? 103 LYS A N    1  
ATOM 1584  C CA   . LYS A 1 103 ? -14.494 -9.632  8.346   1.00 4.06  ? 103 LYS A CA   1  
ATOM 1585  C C    . LYS A 1 103 ? -14.582 -9.164  9.791   1.00 4.57  ? 103 LYS A C    1  
ATOM 1586  O O    . LYS A 1 103 ? -15.531 -9.494  10.506  1.00 5.24  ? 103 LYS A O    1  
ATOM 1587  C CB   . LYS A 1 103 ? -15.773 -10.367 7.939   1.00 4.73  ? 103 LYS A CB   1  
ATOM 1588  C CG   . LYS A 1 103 ? -15.812 -10.745 6.464   1.00 5.30  ? 103 LYS A CG   1  
ATOM 1589  C CD   . LYS A 1 103 ? -16.894 -11.775 6.168   1.00 6.25  ? 103 LYS A CD   1  
ATOM 1590  C CE   . LYS A 1 103 ? -18.287 -11.270 6.520   1.00 6.82  ? 103 LYS A CE   1  
ATOM 1591  N NZ   . LYS A 1 103 ? -18.700 -10.115 5.678   1.00 7.43  ? 103 LYS A NZ   1  
ATOM 1592  H H    . LYS A 1 103 ? -13.464 -11.474 8.311   1.00 3.17  ? 103 LYS A H    1  
ATOM 1593  H HA   . LYS A 1 103 ? -14.360 -8.775  7.705   1.00 4.39  ? 103 LYS A HA   1  
ATOM 1594  H HB2  . LYS A 1 103 ? -15.859 -11.271 8.523   1.00 4.96  ? 103 LYS A HB2  1  
ATOM 1595  H HB3  . LYS A 1 103 ? -16.621 -9.732  8.148   1.00 5.08  ? 103 LYS A HB3  1  
ATOM 1596  H HG2  . LYS A 1 103 ? -16.010 -9.857  5.883   1.00 5.38  ? 103 LYS A HG2  1  
ATOM 1597  H HG3  . LYS A 1 103 ? -14.851 -11.153 6.183   1.00 5.39  ? 103 LYS A HG3  1  
ATOM 1598  H HD2  . LYS A 1 103 ? -16.868 -12.013 5.116   1.00 6.63  ? 103 LYS A HD2  1  
ATOM 1599  H HD3  . LYS A 1 103 ? -16.691 -12.667 6.742   1.00 6.48  ? 103 LYS A HD3  1  
ATOM 1600  H HE2  . LYS A 1 103 ? -18.992 -12.073 6.380   1.00 6.94  ? 103 LYS A HE2  1  
ATOM 1601  H HE3  . LYS A 1 103 ? -18.292 -10.967 7.557   1.00 7.02  ? 103 LYS A HE3  1  
ATOM 1602  H HZ1  . LYS A 1 103 ? -19.685 -9.858  5.888   1.00 7.62  ? 103 LYS A HZ1  1  
ATOM 1603  H HZ2  . LYS A 1 103 ? -18.625 -10.357 4.667   1.00 7.72  ? 103 LYS A HZ2  1  
ATOM 1604  H HZ3  . LYS A 1 103 ? -18.094 -9.294  5.874   1.00 7.66  ? 103 LYS A HZ3  1  
ATOM 1605  N N    . ARG A 1 104 ? -13.577 -8.404  10.210  1.00 4.68  ? 104 ARG A N    1  
ATOM 1606  C CA   . ARG A 1 104 ? -13.505 -7.896  11.574  1.00 5.53  ? 104 ARG A CA   1  
ATOM 1607  C C    . ARG A 1 104 ? -14.722 -7.042  11.899  1.00 5.66  ? 104 ARG A C    1  
ATOM 1608  O O    . ARG A 1 104 ? -14.967 -6.018  11.257  1.00 5.96  ? 104 ARG A O    1  
ATOM 1609  C CB   . ARG A 1 104 ? -12.224 -7.082  11.781  1.00 6.11  ? 104 ARG A CB   1  
ATOM 1610  C CG   . ARG A 1 104 ? -10.954 -7.913  11.685  1.00 6.81  ? 104 ARG A CG   1  
ATOM 1611  C CD   . ARG A 1 104 ? -9.710  -7.060  11.878  1.00 7.63  ? 104 ARG A CD   1  
ATOM 1612  N NE   . ARG A 1 104 ? -8.485  -7.861  11.839  1.00 8.13  ? 104 ARG A NE   1  
ATOM 1613  C CZ   . ARG A 1 104 ? -7.257  -7.346  11.760  1.00 8.95  ? 104 ARG A CZ   1  
ATOM 1614  N NH1  . ARG A 1 104 ? -7.083  -6.032  11.719  1.00 9.34  ? 104 ARG A NH1  1  
ATOM 1615  N NH2  . ARG A 1 104 ? -6.201  -8.148  11.732  1.00 9.59  ? 104 ARG A NH2  1  
ATOM 1616  H H    . ARG A 1 104 ? -12.861 -8.177  9.578   1.00 4.48  ? 104 ARG A H    1  
ATOM 1617  H HA   . ARG A 1 104 ? -13.490 -8.745  12.241  1.00 6.02  ? 104 ARG A HA   1  
ATOM 1618  H HB2  . ARG A 1 104 ? -12.177 -6.307  11.031  1.00 6.43  ? 104 ARG A HB2  1  
ATOM 1619  H HB3  . ARG A 1 104 ? -12.255 -6.623  12.758  1.00 6.10  ? 104 ARG A HB3  1  
ATOM 1620  H HG2  . ARG A 1 104 ? -10.976 -8.676  12.449  1.00 6.95  ? 104 ARG A HG2  1  
ATOM 1621  H HG3  . ARG A 1 104 ? -10.913 -8.379  10.712  1.00 6.93  ? 104 ARG A HG3  1  
ATOM 1622  H HD2  . ARG A 1 104 ? -9.670  -6.322  11.091  1.00 7.90  ? 104 ARG A HD2  1  
ATOM 1623  H HD3  . ARG A 1 104 ? -9.774  -6.562  12.834  1.00 7.87  ? 104 ARG A HD3  1  
ATOM 1624  H HE   . ARG A 1 104 ? -8.588  -8.838  11.874  1.00 8.02  ? 104 ARG A HE   1  
ATOM 1625  H HH11 . ARG A 1 104 ? -7.875  -5.418  11.749  1.00 9.05  ? 104 ARG A HH11 1  
ATOM 1626  H HH12 . ARG A 1 104 ? -6.159  -5.646  11.651  1.00 10.06 ? 104 ARG A HH12 1  
ATOM 1627  H HH21 . ARG A 1 104 ? -6.323  -9.143  11.773  1.00 9.50  ? 104 ARG A HH21 1  
ATOM 1628  H HH22 . ARG A 1 104 ? -5.273  -7.765  11.656  1.00 10.30 ? 104 ARG A HH22 1  
ATOM 1629  N N    . THR A 1 105 ? -15.489 -7.487  12.881  1.00 5.79  ? 105 THR A N    1  
ATOM 1630  C CA   . THR A 1 105 ? -16.679 -6.781  13.309  1.00 6.20  ? 105 THR A CA   1  
ATOM 1631  C C    . THR A 1 105 ? -16.319 -5.597  14.199  1.00 6.46  ? 105 THR A C    1  
ATOM 1632  O O    . THR A 1 105 ? -15.991 -5.816  15.382  1.00 6.80  ? 105 THR A O    1  
ATOM 1633  C CB   . THR A 1 105 ? -17.635 -7.732  14.055  1.00 6.59  ? 105 THR A CB   1  
ATOM 1634  O OG1  . THR A 1 105 ? -16.885 -8.607  14.909  1.00 6.66  ? 105 THR A OG1  1  
ATOM 1635  C CG2  . THR A 1 105 ? -18.458 -8.556  13.078  1.00 7.00  ? 105 THR A CG2  1  
ATOM 1636  O OXT  . THR A 1 105 ? -16.366 -4.447  13.711  1.00 6.62  ? 105 THR A OXT  1  
ATOM 1637  H H    . THR A 1 105 ? -15.249 -8.324  13.332  1.00 5.84  ? 105 THR A H    1  
ATOM 1638  H HA   . THR A 1 105 ? -17.185 -6.416  12.427  1.00 6.42  ? 105 THR A HA   1  
ATOM 1639  H HB   . THR A 1 105 ? -18.308 -7.141  14.661  1.00 6.92  ? 105 THR A HB   1  
ATOM 1640  H HG1  . THR A 1 105 ? -16.386 -8.080  15.548  1.00 6.49  ? 105 THR A HG1  1  
ATOM 1641  H HG21 . THR A 1 105 ? -17.797 -9.134  12.451  1.00 7.20  ? 105 THR A HG21 1  
ATOM 1642  H HG22 . THR A 1 105 ? -19.054 -7.898  12.464  1.00 7.26  ? 105 THR A HG22 1  
ATOM 1643  H HG23 . THR A 1 105 ? -19.107 -9.223  13.626  1.00 7.15  ? 105 THR A HG23 1  
ATOM 1644  N N    . MET B 1 1   ? 11.774  -9.497  25.052  1.00 7.64  ? 1   MET B N    1  
ATOM 1645  C CA   . MET B 1 1   ? 11.266  -9.809  23.699  1.00 7.05  ? 1   MET B CA   1  
ATOM 1646  C C    . MET B 1 1   ? 11.478  -8.624  22.761  1.00 6.85  ? 1   MET B C    1  
ATOM 1647  O O    . MET B 1 1   ? 10.780  -7.612  22.840  1.00 7.13  ? 1   MET B O    1  
ATOM 1648  C CB   . MET B 1 1   ? 9.782   -10.202 23.752  1.00 7.11  ? 1   MET B CB   1  
ATOM 1649  C CG   . MET B 1 1   ? 8.891   -9.185  24.448  1.00 7.39  ? 1   MET B CG   1  
ATOM 1650  S SD   . MET B 1 1   ? 7.149   -9.645  24.408  1.00 7.66  ? 1   MET B SD   1  
ATOM 1651  C CE   . MET B 1 1   ? 6.417   -8.243  25.248  1.00 7.91  ? 1   MET B CE   1  
ATOM 1652  H H1   . MET B 1 1   ? 11.286  -8.662  25.436  1.00 7.96  ? 1   MET B H1   1  
ATOM 1653  H H2   . MET B 1 1   ? 12.793  -9.299  25.010  1.00 7.75  ? 1   MET B H2   1  
ATOM 1654  H H3   . MET B 1 1   ? 11.619  -10.302 25.691  1.00 7.88  ? 1   MET B H3   1  
ATOM 1655  H HA   . MET B 1 1   ? 11.833  -10.647 23.321  1.00 7.07  ? 1   MET B HA   1  
ATOM 1656  H HB2  . MET B 1 1   ? 9.421   -10.329 22.743  1.00 7.26  ? 1   MET B HB2  1  
ATOM 1657  H HB3  . MET B 1 1   ? 9.691   -11.143 24.275  1.00 7.17  ? 1   MET B HB3  1  
ATOM 1658  H HG2  . MET B 1 1   ? 9.201   -9.099  25.479  1.00 7.57  ? 1   MET B HG2  1  
ATOM 1659  H HG3  . MET B 1 1   ? 9.008   -8.229  23.959  1.00 7.61  ? 1   MET B HG3  1  
ATOM 1660  H HE1  . MET B 1 1   ? 5.347   -8.378  25.309  1.00 8.15  ? 1   MET B HE1  1  
ATOM 1661  H HE2  . MET B 1 1   ? 6.634   -7.340  24.698  1.00 8.15  ? 1   MET B HE2  1  
ATOM 1662  H HE3  . MET B 1 1   ? 6.826   -8.165  26.244  1.00 7.91  ? 1   MET B HE3  1  
ATOM 1663  N N    . ALA B 1 2   ? 12.462  -8.747  21.883  1.00 6.68  ? 2   ALA B N    1  
ATOM 1664  C CA   . ALA B 1 2   ? 12.777  -7.686  20.938  1.00 6.74  ? 2   ALA B CA   1  
ATOM 1665  C C    . ALA B 1 2   ? 11.907  -7.795  19.692  1.00 6.15  ? 2   ALA B C    1  
ATOM 1666  O O    . ALA B 1 2   ? 11.465  -6.789  19.136  1.00 6.28  ? 2   ALA B O    1  
ATOM 1667  C CB   . ALA B 1 2   ? 14.249  -7.735  20.562  1.00 7.32  ? 2   ALA B CB   1  
ATOM 1668  H H    . ALA B 1 2   ? 12.991  -9.574  21.870  1.00 6.72  ? 2   ALA B H    1  
ATOM 1669  H HA   . ALA B 1 2   ? 12.583  -6.741  21.422  1.00 7.13  ? 2   ALA B HA   1  
ATOM 1670  H HB1  . ALA B 1 2   ? 14.477  -6.917  19.896  1.00 7.70  ? 2   ALA B HB1  1  
ATOM 1671  H HB2  . ALA B 1 2   ? 14.463  -8.672  20.070  1.00 7.47  ? 2   ALA B HB2  1  
ATOM 1672  H HB3  . ALA B 1 2   ? 14.851  -7.652  21.455  1.00 7.50  ? 2   ALA B HB3  1  
ATOM 1673  N N    . LYS B 1 3   ? 11.650  -9.023  19.267  1.00 5.79  ? 3   LYS B N    1  
ATOM 1674  C CA   . LYS B 1 3   ? 10.875  -9.271  18.063  1.00 5.53  ? 3   LYS B CA   1  
ATOM 1675  C C    . LYS B 1 3   ? 9.391   -9.396  18.404  1.00 5.00  ? 3   LYS B C    1  
ATOM 1676  O O    . LYS B 1 3   ? 8.801   -10.476 18.319  1.00 5.14  ? 3   LYS B O    1  
ATOM 1677  C CB   . LYS B 1 3   ? 11.385  -10.540 17.364  1.00 6.01  ? 3   LYS B CB   1  
ATOM 1678  C CG   . LYS B 1 3   ? 10.770  -10.796 15.993  1.00 6.28  ? 3   LYS B CG   1  
ATOM 1679  C CD   . LYS B 1 3   ? 11.072  -9.667  15.021  1.00 6.97  ? 3   LYS B CD   1  
ATOM 1680  C CE   . LYS B 1 3   ? 10.569  -9.988  13.623  1.00 7.46  ? 3   LYS B CE   1  
ATOM 1681  N NZ   . LYS B 1 3   ? 10.773  -8.855  12.681  1.00 7.93  ? 3   LYS B NZ   1  
ATOM 1682  H H    . LYS B 1 3   ? 11.983  -9.786  19.786  1.00 5.96  ? 3   LYS B H    1  
ATOM 1683  H HA   . LYS B 1 3   ? 11.011  -8.428  17.403  1.00 5.72  ? 3   LYS B HA   1  
ATOM 1684  H HB2  . LYS B 1 3   ? 12.454  -10.459 17.241  1.00 6.29  ? 3   LYS B HB2  1  
ATOM 1685  H HB3  . LYS B 1 3   ? 11.170  -11.391 17.994  1.00 6.28  ? 3   LYS B HB3  1  
ATOM 1686  H HG2  . LYS B 1 3   ? 11.171  -11.715 15.596  1.00 6.42  ? 3   LYS B HG2  1  
ATOM 1687  H HG3  . LYS B 1 3   ? 9.700   -10.887 16.103  1.00 6.22  ? 3   LYS B HG3  1  
ATOM 1688  H HD2  . LYS B 1 3   ? 10.589  -8.766  15.368  1.00 7.10  ? 3   LYS B HD2  1  
ATOM 1689  H HD3  . LYS B 1 3   ? 12.140  -9.514  14.983  1.00 7.33  ? 3   LYS B HD3  1  
ATOM 1690  H HE2  . LYS B 1 3   ? 11.100  -10.851 13.252  1.00 7.70  ? 3   LYS B HE2  1  
ATOM 1691  H HE3  . LYS B 1 3   ? 9.514   -10.213 13.678  1.00 7.56  ? 3   LYS B HE3  1  
ATOM 1692  H HZ1  . LYS B 1 3   ? 10.452  -9.118  11.729  1.00 7.98  ? 3   LYS B HZ1  1  
ATOM 1693  H HZ2  . LYS B 1 3   ? 11.779  -8.597  12.640  1.00 8.25  ? 3   LYS B HZ2  1  
ATOM 1694  H HZ3  . LYS B 1 3   ? 10.231  -8.025  13.000  1.00 8.16  ? 3   LYS B HZ3  1  
ATOM 1695  N N    . ILE B 1 4   ? 8.792   -8.283  18.803  1.00 4.75  ? 4   ILE B N    1  
ATOM 1696  C CA   . ILE B 1 4   ? 7.372   -8.256  19.131  1.00 4.41  ? 4   ILE B CA   1  
ATOM 1697  C C    . ILE B 1 4   ? 6.537   -8.073  17.874  1.00 3.66  ? 4   ILE B C    1  
ATOM 1698  O O    . ILE B 1 4   ? 5.354   -8.408  17.842  1.00 3.91  ? 4   ILE B O    1  
ATOM 1699  C CB   . ILE B 1 4   ? 7.031   -7.132  20.133  1.00 5.15  ? 4   ILE B CB   1  
ATOM 1700  C CG1  . ILE B 1 4   ? 7.454   -5.768  19.580  1.00 5.78  ? 4   ILE B CG1  1  
ATOM 1701  C CG2  . ILE B 1 4   ? 7.696   -7.399  21.475  1.00 5.59  ? 4   ILE B CG2  1  
ATOM 1702  C CD1  . ILE B 1 4   ? 7.050   -4.603  20.457  1.00 6.54  ? 4   ILE B CD1  1  
ATOM 1703  H H    . ILE B 1 4   ? 9.319   -7.459  18.878  1.00 5.02  ? 4   ILE B H    1  
ATOM 1704  H HA   . ILE B 1 4   ? 7.118   -9.203  19.586  1.00 4.58  ? 4   ILE B HA   1  
ATOM 1705  H HB   . ILE B 1 4   ? 5.962   -7.132  20.286  1.00 5.38  ? 4   ILE B HB   1  
ATOM 1706  H HG12 . ILE B 1 4   ? 8.530   -5.745  19.477  1.00 5.98  ? 4   ILE B HG12 1  
ATOM 1707  H HG13 . ILE B 1 4   ? 7.003   -5.625  18.609  1.00 5.88  ? 4   ILE B HG13 1  
ATOM 1708  H HG21 . ILE B 1 4   ? 7.344   -8.339  21.871  1.00 5.93  ? 4   ILE B HG21 1  
ATOM 1709  H HG22 . ILE B 1 4   ? 7.450   -6.604  22.163  1.00 6.00  ? 4   ILE B HG22 1  
ATOM 1710  H HG23 . ILE B 1 4   ? 8.768   -7.442  21.342  1.00 5.54  ? 4   ILE B HG23 1  
ATOM 1711  H HD11 . ILE B 1 4   ? 5.974   -4.584  20.556  1.00 6.97  ? 4   ILE B HD11 1  
ATOM 1712  H HD12 . ILE B 1 4   ? 7.387   -3.680  20.009  1.00 6.74  ? 4   ILE B HD12 1  
ATOM 1713  H HD13 . ILE B 1 4   ? 7.499   -4.716  21.433  1.00 6.73  ? 4   ILE B HD13 1  
ATOM 1714  N N    . SER B 1 5   ? 7.162   -7.539  16.839  1.00 3.24  ? 5   SER B N    1  
ATOM 1715  C CA   . SER B 1 5   ? 6.493   -7.321  15.575  1.00 2.93  ? 5   SER B CA   1  
ATOM 1716  C C    . SER B 1 5   ? 6.971   -8.330  14.540  1.00 2.01  ? 5   SER B C    1  
ATOM 1717  O O    . SER B 1 5   ? 8.041   -8.171  13.949  1.00 2.25  ? 5   SER B O    1  
ATOM 1718  C CB   . SER B 1 5   ? 6.754   -5.896  15.085  1.00 3.70  ? 5   SER B CB   1  
ATOM 1719  O OG   . SER B 1 5   ? 6.361   -4.946  16.064  1.00 4.46  ? 5   SER B OG   1  
ATOM 1720  H H    . SER B 1 5   ? 8.105   -7.283  16.929  1.00 3.53  ? 5   SER B H    1  
ATOM 1721  H HA   . SER B 1 5   ? 5.432   -7.452  15.731  1.00 3.38  ? 5   SER B HA   1  
ATOM 1722  H HB2  . SER B 1 5   ? 7.807   -5.773  14.883  1.00 3.90  ? 5   SER B HB2  1  
ATOM 1723  H HB3  . SER B 1 5   ? 6.190   -5.718  14.181  1.00 4.02  ? 5   SER B HB3  1  
ATOM 1724  H HG   . SER B 1 5   ? 5.446   -5.105  16.311  1.00 4.65  ? 5   SER B HG   1  
ATOM 1725  N N    . SER B 1 6   ? 6.190   -9.389  14.355  1.00 1.51  ? 6   SER B N    1  
ATOM 1726  C CA   . SER B 1 6   ? 6.457   -10.354 13.300  1.00 1.03  ? 6   SER B CA   1  
ATOM 1727  C C    . SER B 1 6   ? 6.469   -9.657  11.931  1.00 0.82  ? 6   SER B C    1  
ATOM 1728  O O    . SER B 1 6   ? 7.393   -9.867  11.142  1.00 0.86  ? 6   SER B O    1  
ATOM 1729  C CB   . SER B 1 6   ? 5.431   -11.492 13.335  1.00 1.67  ? 6   SER B CB   1  
ATOM 1730  O OG   . SER B 1 6   ? 5.409   -12.112 14.611  1.00 2.25  ? 6   SER B OG   1  
ATOM 1731  H H    . SER B 1 6   ? 5.418   -9.527  14.944  1.00 2.00  ? 6   SER B H    1  
ATOM 1732  H HA   . SER B 1 6   ? 7.441   -10.766 13.480  1.00 1.21  ? 6   SER B HA   1  
ATOM 1733  H HB2  . SER B 1 6   ? 4.450   -11.097 13.125  1.00 2.14  ? 6   SER B HB2  1  
ATOM 1734  H HB3  . SER B 1 6   ? 5.689   -12.232 12.591  1.00 2.15  ? 6   SER B HB3  1  
ATOM 1735  H HG   . SER B 1 6   ? 6.180   -12.688 14.699  1.00 2.50  ? 6   SER B HG   1  
ATOM 1736  N N    . PRO B 1 7   ? 5.459   -8.815  11.617  1.00 0.70  ? 7   PRO B N    1  
ATOM 1737  C CA   . PRO B 1 7   ? 5.502   -7.959  10.436  1.00 0.54  ? 7   PRO B CA   1  
ATOM 1738  C C    . PRO B 1 7   ? 6.225   -6.653  10.729  1.00 0.45  ? 7   PRO B C    1  
ATOM 1739  O O    . PRO B 1 7   ? 6.251   -6.185  11.871  1.00 0.57  ? 7   PRO B O    1  
ATOM 1740  C CB   . PRO B 1 7   ? 4.028   -7.689  10.180  1.00 0.62  ? 7   PRO B CB   1  
ATOM 1741  C CG   . PRO B 1 7   ? 3.482   -7.559  11.550  1.00 0.75  ? 7   PRO B CG   1  
ATOM 1742  C CD   . PRO B 1 7   ? 4.180   -8.628  12.350  1.00 0.82  ? 7   PRO B CD   1  
ATOM 1743  H HA   . PRO B 1 7   ? 5.947   -8.452  9.586   1.00 0.57  ? 7   PRO B HA   1  
ATOM 1744  H HB2  . PRO B 1 7   ? 3.913   -6.778  9.610   1.00 0.60  ? 7   PRO B HB2  1  
ATOM 1745  H HB3  . PRO B 1 7   ? 3.585   -8.520  9.652   1.00 0.68  ? 7   PRO B HB3  1  
ATOM 1746  H HG2  . PRO B 1 7   ? 3.721   -6.577  11.942  1.00 0.75  ? 7   PRO B HG2  1  
ATOM 1747  H HG3  . PRO B 1 7   ? 2.416   -7.722  11.545  1.00 0.87  ? 7   PRO B HG3  1  
ATOM 1748  H HD2  . PRO B 1 7   ? 4.359   -8.289  13.360  1.00 0.93  ? 7   PRO B HD2  1  
ATOM 1749  H HD3  . PRO B 1 7   ? 3.600   -9.537  12.351  1.00 0.91  ? 7   PRO B HD3  1  
ATOM 1750  N N    . THR B 1 8   ? 6.820   -6.074  9.712   1.00 0.34  ? 8   THR B N    1  
ATOM 1751  C CA   . THR B 1 8   ? 7.439   -4.775  9.853   1.00 0.27  ? 8   THR B CA   1  
ATOM 1752  C C    . THR B 1 8   ? 6.412   -3.694  9.585   1.00 0.28  ? 8   THR B C    1  
ATOM 1753  O O    . THR B 1 8   ? 5.245   -3.997  9.361   1.00 0.34  ? 8   THR B O    1  
ATOM 1754  C CB   . THR B 1 8   ? 8.597   -4.612  8.875   1.00 0.29  ? 8   THR B CB   1  
ATOM 1755  O OG1  . THR B 1 8   ? 8.078   -4.517  7.546   1.00 0.37  ? 8   THR B OG1  1  
ATOM 1756  C CG2  . THR B 1 8   ? 9.544   -5.790  8.994   1.00 0.33  ? 8   THR B CG2  1  
ATOM 1757  H H    . THR B 1 8   ? 6.857   -6.538  8.843   1.00 0.43  ? 8   THR B H    1  
ATOM 1758  H HA   . THR B 1 8   ? 7.813   -4.678  10.859  1.00 0.31  ? 8   THR B HA   1  
ATOM 1759  H HB   . THR B 1 8   ? 9.137   -3.710  9.111   1.00 0.33  ? 8   THR B HB   1  
ATOM 1760  H HG1  . THR B 1 8   ? 8.602   -5.078  6.954   1.00 0.32  ? 8   THR B HG1  1  
ATOM 1761  H HG21 . THR B 1 8   ? 10.143  -5.675  9.882   1.00 1.05  ? 8   THR B HG21 1  
ATOM 1762  H HG22 . THR B 1 8   ? 10.179  -5.830  8.125   1.00 1.08  ? 8   THR B HG22 1  
ATOM 1763  H HG23 . THR B 1 8   ? 8.970   -6.701  9.063   1.00 1.05  ? 8   THR B HG23 1  
ATOM 1764  N N    . GLU B 1 9   ? 6.841   -2.450  9.568   1.00 0.28  ? 9   GLU B N    1  
ATOM 1765  C CA   . GLU B 1 9   ? 5.925   -1.335  9.375   1.00 0.33  ? 9   GLU B CA   1  
ATOM 1766  C C    . GLU B 1 9   ? 5.241   -1.400  8.001   1.00 0.36  ? 9   GLU B C    1  
ATOM 1767  O O    . GLU B 1 9   ? 4.067   -1.054  7.866   1.00 0.52  ? 9   GLU B O    1  
ATOM 1768  C CB   . GLU B 1 9   ? 6.675   -0.021  9.563   1.00 0.40  ? 9   GLU B CB   1  
ATOM 1769  C CG   . GLU B 1 9   ? 5.797   1.209   9.486   1.00 0.56  ? 9   GLU B CG   1  
ATOM 1770  C CD   . GLU B 1 9   ? 6.310   2.344   10.349  1.00 1.73  ? 9   GLU B CD   1  
ATOM 1771  O OE1  . GLU B 1 9   ? 7.542   2.545   10.411  1.00 2.47  ? 9   GLU B OE1  1  
ATOM 1772  O OE2  . GLU B 1 9   ? 5.479   3.035   10.975  1.00 2.48  ? 9   GLU B OE2  1  
ATOM 1773  H H    . GLU B 1 9   ? 7.801   -2.274  9.688   1.00 0.29  ? 9   GLU B H    1  
ATOM 1774  H HA   . GLU B 1 9   ? 5.159   -1.408  10.135  1.00 0.37  ? 9   GLU B HA   1  
ATOM 1775  H HB2  . GLU B 1 9   ? 7.156   -0.031  10.527  1.00 0.44  ? 9   GLU B HB2  1  
ATOM 1776  H HB3  . GLU B 1 9   ? 7.430   0.057   8.792   1.00 0.37  ? 9   GLU B HB3  1  
ATOM 1777  H HG2  . GLU B 1 9   ? 5.764   1.543   8.458   1.00 0.94  ? 9   GLU B HG2  1  
ATOM 1778  H HG3  . GLU B 1 9   ? 4.800   0.946   9.810   1.00 0.74  ? 9   GLU B HG3  1  
ATOM 1779  N N    . THR B 1 10  ? 5.956   -1.882  6.995   1.00 0.26  ? 10  THR B N    1  
ATOM 1780  C CA   . THR B 1 10  ? 5.375   -2.037  5.667   1.00 0.27  ? 10  THR B CA   1  
ATOM 1781  C C    . THR B 1 10  ? 4.525   -3.289  5.606   1.00 0.27  ? 10  THR B C    1  
ATOM 1782  O O    . THR B 1 10  ? 3.462   -3.291  4.996   1.00 0.31  ? 10  THR B O    1  
ATOM 1783  C CB   . THR B 1 10  ? 6.437   -2.060  4.537   1.00 0.27  ? 10  THR B CB   1  
ATOM 1784  O OG1  . THR B 1 10  ? 6.014   -2.912  3.468   1.00 0.40  ? 10  THR B OG1  1  
ATOM 1785  C CG2  . THR B 1 10  ? 7.793   -2.520  5.052   1.00 0.26  ? 10  THR B CG2  1  
ATOM 1786  H H    . THR B 1 10  ? 6.882   -2.159  7.152   1.00 0.22  ? 10  THR B H    1  
ATOM 1787  H HA   . THR B 1 10  ? 4.725   -1.194  5.496   1.00 0.30  ? 10  THR B HA   1  
ATOM 1788  H HB   . THR B 1 10  ? 6.542   -1.055  4.146   1.00 0.33  ? 10  THR B HB   1  
ATOM 1789  H HG1  . THR B 1 10  ? 5.053   -2.888  3.396   1.00 1.00  ? 10  THR B HG1  1  
ATOM 1790  H HG21 . THR B 1 10  ? 7.680   -3.464  5.568   1.00 1.12  ? 10  THR B HG21 1  
ATOM 1791  H HG22 . THR B 1 10  ? 8.189   -1.781  5.732   1.00 0.94  ? 10  THR B HG22 1  
ATOM 1792  H HG23 . THR B 1 10  ? 8.470   -2.643  4.221   1.00 0.99  ? 10  THR B HG23 1  
ATOM 1793  N N    . GLU B 1 11  ? 4.967   -4.340  6.266   1.00 0.24  ? 11  GLU B N    1  
ATOM 1794  C CA   . GLU B 1 11  ? 4.238   -5.592  6.238   1.00 0.27  ? 11  GLU B CA   1  
ATOM 1795  C C    . GLU B 1 11  ? 2.936   -5.465  7.007   1.00 0.30  ? 11  GLU B C    1  
ATOM 1796  O O    . GLU B 1 11  ? 1.896   -5.954  6.572   1.00 0.32  ? 11  GLU B O    1  
ATOM 1797  C CB   . GLU B 1 11  ? 5.092   -6.707  6.808   1.00 0.29  ? 11  GLU B CB   1  
ATOM 1798  C CG   . GLU B 1 11  ? 6.474   -6.735  6.198   1.00 0.41  ? 11  GLU B CG   1  
ATOM 1799  C CD   . GLU B 1 11  ? 7.300   -7.906  6.670   1.00 1.11  ? 11  GLU B CD   1  
ATOM 1800  O OE1  . GLU B 1 11  ? 7.294   -8.187  7.884   1.00 1.71  ? 11  GLU B OE1  1  
ATOM 1801  O OE2  . GLU B 1 11  ? 7.963   -8.546  5.833   1.00 1.85  ? 11  GLU B OE2  1  
ATOM 1802  H H    . GLU B 1 11  ? 5.804   -4.276  6.776   1.00 0.23  ? 11  GLU B H    1  
ATOM 1803  H HA   . GLU B 1 11  ? 4.013   -5.814  5.213   1.00 0.29  ? 11  GLU B HA   1  
ATOM 1804  H HB2  . GLU B 1 11  ? 5.186   -6.565  7.871   1.00 0.40  ? 11  GLU B HB2  1  
ATOM 1805  H HB3  . GLU B 1 11  ? 4.615   -7.654  6.613   1.00 0.42  ? 11  GLU B HB3  1  
ATOM 1806  H HG2  . GLU B 1 11  ? 6.371   -6.784  5.127   1.00 0.40  ? 11  GLU B HG2  1  
ATOM 1807  H HG3  . GLU B 1 11  ? 6.985   -5.822  6.465   1.00 0.71  ? 11  GLU B HG3  1  
ATOM 1808  N N    . ARG B 1 12  ? 2.991   -4.773  8.134   1.00 0.35  ? 12  ARG B N    1  
ATOM 1809  C CA   . ARG B 1 12  ? 1.797   -4.526  8.920   1.00 0.42  ? 12  ARG B CA   1  
ATOM 1810  C C    . ARG B 1 12  ? 0.881   -3.569  8.176   1.00 0.43  ? 12  ARG B C    1  
ATOM 1811  O O    . ARG B 1 12  ? -0.338  -3.633  8.315   1.00 0.47  ? 12  ARG B O    1  
ATOM 1812  C CB   . ARG B 1 12  ? 2.143   -4.006  10.327  1.00 0.48  ? 12  ARG B CB   1  
ATOM 1813  C CG   . ARG B 1 12  ? 2.858   -2.659  10.385  1.00 0.49  ? 12  ARG B CG   1  
ATOM 1814  C CD   . ARG B 1 12  ? 1.917   -1.491  10.154  1.00 0.56  ? 12  ARG B CD   1  
ATOM 1815  N NE   . ARG B 1 12  ? 2.517   -0.215  10.537  1.00 1.08  ? 12  ARG B NE   1  
ATOM 1816  C CZ   . ARG B 1 12  ? 2.491   0.281   11.775  1.00 1.34  ? 12  ARG B CZ   1  
ATOM 1817  N NH1  . ARG B 1 12  ? 1.866   -0.376  12.746  1.00 1.86  ? 12  ARG B NH1  1  
ATOM 1818  N NH2  . ARG B 1 12  ? 3.079   1.443   12.037  1.00 1.95  ? 12  ARG B NH2  1  
ATOM 1819  H H    . ARG B 1 12  ? 3.859   -4.431  8.445   1.00 0.34  ? 12  ARG B H    1  
ATOM 1820  H HA   . ARG B 1 12  ? 1.282   -5.470  9.021   1.00 0.44  ? 12  ARG B HA   1  
ATOM 1821  H HB2  . ARG B 1 12  ? 1.229   -3.915  10.889  1.00 0.55  ? 12  ARG B HB2  1  
ATOM 1822  H HB3  . ARG B 1 12  ? 2.772   -4.736  10.812  1.00 0.48  ? 12  ARG B HB3  1  
ATOM 1823  H HG2  . ARG B 1 12  ? 3.318   -2.547  11.355  1.00 0.52  ? 12  ARG B HG2  1  
ATOM 1824  H HG3  . ARG B 1 12  ? 3.624   -2.643  9.620   1.00 0.45  ? 12  ARG B HG3  1  
ATOM 1825  H HD2  . ARG B 1 12  ? 1.674   -1.460  9.098   1.00 0.91  ? 12  ARG B HD2  1  
ATOM 1826  H HD3  . ARG B 1 12  ? 1.018   -1.647  10.724  1.00 0.83  ? 12  ARG B HD3  1  
ATOM 1827  H HE   . ARG B 1 12  ? 2.965   0.303   9.828   1.00 1.80  ? 12  ARG B HE   1  
ATOM 1828  H HH11 . ARG B 1 12  ? 1.405   -1.248  12.557  1.00 2.09  ? 12  ARG B HH11 1  
ATOM 1829  H HH12 . ARG B 1 12  ? 1.851   -0.002  13.677  1.00 2.42  ? 12  ARG B HH12 1  
ATOM 1830  H HH21 . ARG B 1 12  ? 3.545   1.952   11.306  1.00 2.48  ? 12  ARG B HH21 1  
ATOM 1831  H HH22 . ARG B 1 12  ? 3.069   1.816   12.969  1.00 2.20  ? 12  ARG B HH22 1  
ATOM 1832  N N    . CYS B 1 13  ? 1.477   -2.692  7.369   1.00 0.42  ? 13  CYS B N    1  
ATOM 1833  C CA   . CYS B 1 13  ? 0.711   -1.790  6.519   1.00 0.44  ? 13  CYS B CA   1  
ATOM 1834  C C    . CYS B 1 13  ? -0.086  -2.616  5.536   1.00 0.30  ? 13  CYS B C    1  
ATOM 1835  O O    . CYS B 1 13  ? -1.260  -2.364  5.264   1.00 0.29  ? 13  CYS B O    1  
ATOM 1836  C CB   . CYS B 1 13  ? 1.651   -0.848  5.752   1.00 0.57  ? 13  CYS B CB   1  
ATOM 1837  S SG   . CYS B 1 13  ? 1.489   -0.953  3.955   1.00 2.16  ? 13  CYS B SG   1  
ATOM 1838  H H    . CYS B 1 13  ? 2.461   -2.665  7.333   1.00 0.41  ? 13  CYS B H    1  
ATOM 1839  H HA   . CYS B 1 13  ? 0.035   -1.215  7.134   1.00 0.54  ? 13  CYS B HA   1  
ATOM 1840  H HB2  . CYS B 1 13  ? 1.446   0.167   6.028   1.00 1.00  ? 13  CYS B HB2  1  
ATOM 1841  H HB3  . CYS B 1 13  ? 2.679   -1.086  6.008   1.00 0.84  ? 13  CYS B HB3  1  
ATOM 1842  H HG   . CYS B 1 13  ? 1.266   0.270   3.495   1.00 2.85  ? 13  CYS B HG   1  
ATOM 1843  N N    . ILE B 1 14  ? 0.581   -3.632  5.045   1.00 0.26  ? 14  ILE B N    1  
ATOM 1844  C CA   . ILE B 1 14  ? 0.045   -4.515  4.050   1.00 0.24  ? 14  ILE B CA   1  
ATOM 1845  C C    . ILE B 1 14  ? -1.084  -5.371  4.612   1.00 0.21  ? 14  ILE B C    1  
ATOM 1846  O O    . ILE B 1 14  ? -2.097  -5.600  3.945   1.00 0.23  ? 14  ILE B O    1  
ATOM 1847  C CB   . ILE B 1 14  ? 1.184   -5.388  3.509   1.00 0.24  ? 14  ILE B CB   1  
ATOM 1848  C CG1  . ILE B 1 14  ? 2.102   -4.547  2.619   1.00 0.25  ? 14  ILE B CG1  1  
ATOM 1849  C CG2  . ILE B 1 14  ? 0.644   -6.592  2.771   1.00 0.27  ? 14  ILE B CG2  1  
ATOM 1850  C CD1  . ILE B 1 14  ? 3.411   -5.226  2.306   1.00 0.27  ? 14  ILE B CD1  1  
ATOM 1851  H H    . ILE B 1 14  ? 1.497   -3.787  5.361   1.00 0.27  ? 14  ILE B H    1  
ATOM 1852  H HA   . ILE B 1 14  ? -0.335  -3.910  3.243   1.00 0.27  ? 14  ILE B HA   1  
ATOM 1853  H HB   . ILE B 1 14  ? 1.757   -5.743  4.353   1.00 0.25  ? 14  ILE B HB   1  
ATOM 1854  H HG12 . ILE B 1 14  ? 1.604   -4.342  1.683   1.00 0.26  ? 14  ILE B HG12 1  
ATOM 1855  H HG13 . ILE B 1 14  ? 2.323   -3.611  3.119   1.00 0.27  ? 14  ILE B HG13 1  
ATOM 1856  H HG21 . ILE B 1 14  ? 1.442   -7.060  2.212   1.00 1.01  ? 14  ILE B HG21 1  
ATOM 1857  H HG22 . ILE B 1 14  ? -0.137  -6.272  2.098   1.00 1.03  ? 14  ILE B HG22 1  
ATOM 1858  H HG23 . ILE B 1 14  ? 0.240   -7.298  3.481   1.00 1.01  ? 14  ILE B HG23 1  
ATOM 1859  H HD11 . ILE B 1 14  ? 3.216   -6.187  1.852   1.00 1.06  ? 14  ILE B HD11 1  
ATOM 1860  H HD12 . ILE B 1 14  ? 3.971   -5.366  3.221   1.00 0.96  ? 14  ILE B HD12 1  
ATOM 1861  H HD13 . ILE B 1 14  ? 3.982   -4.614  1.624   1.00 1.12  ? 14  ILE B HD13 1  
ATOM 1862  N N    . GLU B 1 15  ? -0.929  -5.805  5.853   1.00 0.24  ? 15  GLU B N    1  
ATOM 1863  C CA   . GLU B 1 15  ? -1.933  -6.625  6.496   1.00 0.28  ? 15  GLU B CA   1  
ATOM 1864  C C    . GLU B 1 15  ? -3.074  -5.741  6.951   1.00 0.30  ? 15  GLU B C    1  
ATOM 1865  O O    . GLU B 1 15  ? -4.202  -6.197  7.139   1.00 0.34  ? 15  GLU B O    1  
ATOM 1866  C CB   . GLU B 1 15  ? -1.343  -7.373  7.682   1.00 0.32  ? 15  GLU B CB   1  
ATOM 1867  C CG   . GLU B 1 15  ? -0.131  -8.216  7.329   1.00 0.32  ? 15  GLU B CG   1  
ATOM 1868  C CD   . GLU B 1 15  ? 0.380   -9.002  8.514   1.00 0.38  ? 15  GLU B CD   1  
ATOM 1869  O OE1  . GLU B 1 15  ? 0.868   -8.384  9.481   1.00 1.25  ? 15  GLU B OE1  1  
ATOM 1870  O OE2  . GLU B 1 15  ? 0.290   -10.248 8.486   1.00 1.06  ? 15  GLU B OE2  1  
ATOM 1871  H H    . GLU B 1 15  ? -0.129  -5.550  6.356   1.00 0.26  ? 15  GLU B H    1  
ATOM 1872  H HA   . GLU B 1 15  ? -2.303  -7.334  5.771   1.00 0.29  ? 15  GLU B HA   1  
ATOM 1873  H HB2  . GLU B 1 15  ? -1.051  -6.656  8.434   1.00 0.32  ? 15  GLU B HB2  1  
ATOM 1874  H HB3  . GLU B 1 15  ? -2.103  -8.024  8.089   1.00 0.37  ? 15  GLU B HB3  1  
ATOM 1875  H HG2  . GLU B 1 15  ? -0.405  -8.909  6.547   1.00 0.33  ? 15  GLU B HG2  1  
ATOM 1876  H HG3  . GLU B 1 15  ? 0.659   -7.566  6.975   1.00 0.31  ? 15  GLU B HG3  1  
ATOM 1877  N N    . SER B 1 16  ? -2.762  -4.468  7.126   1.00 0.31  ? 16  SER B N    1  
ATOM 1878  C CA   . SER B 1 16  ? -3.769  -3.472  7.399   1.00 0.37  ? 16  SER B CA   1  
ATOM 1879  C C    . SER B 1 16  ? -4.686  -3.335  6.201   1.00 0.28  ? 16  SER B C    1  
ATOM 1880  O O    . SER B 1 16  ? -5.904  -3.314  6.335   1.00 0.28  ? 16  SER B O    1  
ATOM 1881  C CB   . SER B 1 16  ? -3.118  -2.129  7.726   1.00 0.54  ? 16  SER B CB   1  
ATOM 1882  O OG   . SER B 1 16  ? -2.436  -2.180  8.964   1.00 0.97  ? 16  SER B OG   1  
ATOM 1883  H H    . SER B 1 16  ? -1.820  -4.195  7.077   1.00 0.31  ? 16  SER B H    1  
ATOM 1884  H HA   . SER B 1 16  ? -4.343  -3.808  8.240   1.00 0.45  ? 16  SER B HA   1  
ATOM 1885  H HB2  . SER B 1 16  ? -2.410  -1.879  6.951   1.00 0.76  ? 16  SER B HB2  1  
ATOM 1886  H HB3  . SER B 1 16  ? -3.877  -1.366  7.776   1.00 0.80  ? 16  SER B HB3  1  
ATOM 1887  H HG   . SER B 1 16  ? -1.783  -2.895  8.943   1.00 1.17  ? 16  SER B HG   1  
ATOM 1888  N N    . LEU B 1 17  ? -4.085  -3.271  5.025   1.00 0.27  ? 17  LEU B N    1  
ATOM 1889  C CA   . LEU B 1 17  ? -4.840  -3.209  3.789   1.00 0.28  ? 17  LEU B CA   1  
ATOM 1890  C C    . LEU B 1 17  ? -5.657  -4.471  3.620   1.00 0.27  ? 17  LEU B C    1  
ATOM 1891  O O    . LEU B 1 17  ? -6.764  -4.428  3.117   1.00 0.32  ? 17  LEU B O    1  
ATOM 1892  C CB   . LEU B 1 17  ? -3.899  -3.028  2.610   1.00 0.29  ? 17  LEU B CB   1  
ATOM 1893  C CG   . LEU B 1 17  ? -2.980  -1.821  2.743   1.00 0.33  ? 17  LEU B CG   1  
ATOM 1894  C CD1  . LEU B 1 17  ? -1.978  -1.764  1.607   1.00 0.33  ? 17  LEU B CD1  1  
ATOM 1895  C CD2  . LEU B 1 17  ? -3.807  -0.545  2.813   1.00 0.46  ? 17  LEU B CD2  1  
ATOM 1896  H H    . LEU B 1 17  ? -3.102  -3.258  4.987   1.00 0.27  ? 17  LEU B H    1  
ATOM 1897  H HA   . LEU B 1 17  ? -5.507  -2.363  3.845   1.00 0.31  ? 17  LEU B HA   1  
ATOM 1898  H HB2  . LEU B 1 17  ? -3.296  -3.920  2.518   1.00 0.26  ? 17  LEU B HB2  1  
ATOM 1899  H HB3  . LEU B 1 17  ? -4.488  -2.909  1.711   1.00 0.35  ? 17  LEU B HB3  1  
ATOM 1900  H HG   . LEU B 1 17  ? -2.426  -1.908  3.663   1.00 0.33  ? 17  LEU B HG   1  
ATOM 1901  H HD11 . LEU B 1 17  ? -1.442  -2.700  1.555   1.00 1.09  ? 17  LEU B HD11 1  
ATOM 1902  H HD12 . LEU B 1 17  ? -1.278  -0.959  1.788   1.00 1.06  ? 17  LEU B HD12 1  
ATOM 1903  H HD13 . LEU B 1 17  ? -2.495  -1.590  0.676   1.00 1.06  ? 17  LEU B HD13 1  
ATOM 1904  H HD21 . LEU B 1 17  ? -4.455  -0.488  1.952   1.00 1.07  ? 17  LEU B HD21 1  
ATOM 1905  H HD22 . LEU B 1 17  ? -3.146  0.311   2.823   1.00 1.10  ? 17  LEU B HD22 1  
ATOM 1906  H HD23 . LEU B 1 17  ? -4.402  -0.550  3.717   1.00 1.21  ? 17  LEU B HD23 1  
ATOM 1907  N N    . ILE B 1 18  ? -5.101  -5.593  4.047   1.00 0.27  ? 18  ILE B N    1  
ATOM 1908  C CA   . ILE B 1 18  ? -5.837  -6.843  4.068   1.00 0.30  ? 18  ILE B CA   1  
ATOM 1909  C C    . ILE B 1 18  ? -7.067  -6.714  4.953   1.00 0.28  ? 18  ILE B C    1  
ATOM 1910  O O    . ILE B 1 18  ? -8.178  -7.033  4.537   1.00 0.30  ? 18  ILE B O    1  
ATOM 1911  C CB   . ILE B 1 18  ? -4.960  -8.009  4.572   1.00 0.36  ? 18  ILE B CB   1  
ATOM 1912  C CG1  . ILE B 1 18  ? -3.850  -8.311  3.563   1.00 0.62  ? 18  ILE B CG1  1  
ATOM 1913  C CG2  . ILE B 1 18  ? -5.809  -9.244  4.833   1.00 0.47  ? 18  ILE B CG2  1  
ATOM 1914  C CD1  . ILE B 1 18  ? -2.943  -9.442  3.982   1.00 1.37  ? 18  ILE B CD1  1  
ATOM 1915  H H    . ILE B 1 18  ? -4.172  -5.579  4.354   1.00 0.29  ? 18  ILE B H    1  
ATOM 1916  H HA   . ILE B 1 18  ? -6.152  -7.059  3.059   1.00 0.33  ? 18  ILE B HA   1  
ATOM 1917  H HB   . ILE B 1 18  ? -4.509  -7.710  5.508   1.00 0.37  ? 18  ILE B HB   1  
ATOM 1918  H HG12 . ILE B 1 18  ? -4.296  -8.578  2.617   1.00 0.97  ? 18  ILE B HG12 1  
ATOM 1919  H HG13 . ILE B 1 18  ? -3.242  -7.428  3.431   1.00 1.37  ? 18  ILE B HG13 1  
ATOM 1920  H HG21 . ILE B 1 18  ? -6.554  -9.014  5.586   1.00 1.13  ? 18  ILE B HG21 1  
ATOM 1921  H HG22 . ILE B 1 18  ? -5.177  -10.050 5.184   1.00 1.10  ? 18  ILE B HG22 1  
ATOM 1922  H HG23 . ILE B 1 18  ? -6.301  -9.542  3.918   1.00 1.11  ? 18  ILE B HG23 1  
ATOM 1923  H HD11 . ILE B 1 18  ? -2.464  -9.193  4.917   1.00 1.87  ? 18  ILE B HD11 1  
ATOM 1924  H HD12 . ILE B 1 18  ? -2.191  -9.599  3.223   1.00 1.89  ? 18  ILE B HD12 1  
ATOM 1925  H HD13 . ILE B 1 18  ? -3.524  -10.343 4.105   1.00 1.99  ? 18  ILE B HD13 1  
ATOM 1926  N N    . ALA B 1 19  ? -6.849  -6.216  6.161   1.00 0.25  ? 19  ALA B N    1  
ATOM 1927  C CA   . ALA B 1 19  ? -7.913  -6.049  7.134   1.00 0.25  ? 19  ALA B CA   1  
ATOM 1928  C C    . ALA B 1 19  ? -9.019  -5.144  6.606   1.00 0.23  ? 19  ALA B C    1  
ATOM 1929  O O    . ALA B 1 19  ? -10.181 -5.539  6.561   1.00 0.27  ? 19  ALA B O    1  
ATOM 1930  C CB   . ALA B 1 19  ? -7.343  -5.486  8.426   1.00 0.28  ? 19  ALA B CB   1  
ATOM 1931  H H    . ALA B 1 19  ? -5.935  -5.955  6.409   1.00 0.25  ? 19  ALA B H    1  
ATOM 1932  H HA   . ALA B 1 19  ? -8.328  -7.023  7.347   1.00 0.29  ? 19  ALA B HA   1  
ATOM 1933  H HB1  . ALA B 1 19  ? -6.965  -4.487  8.249   1.00 1.03  ? 19  ALA B HB1  1  
ATOM 1934  H HB2  . ALA B 1 19  ? -6.537  -6.119  8.768   1.00 1.06  ? 19  ALA B HB2  1  
ATOM 1935  H HB3  . ALA B 1 19  ? -8.118  -5.450  9.177   1.00 0.97  ? 19  ALA B HB3  1  
ATOM 1936  N N    . VAL B 1 20  ? -8.649  -3.939  6.190   1.00 0.20  ? 20  VAL B N    1  
ATOM 1937  C CA   . VAL B 1 20  ? -9.629  -2.950  5.759   1.00 0.22  ? 20  VAL B CA   1  
ATOM 1938  C C    . VAL B 1 20  ? -10.273 -3.355  4.441   1.00 0.23  ? 20  VAL B C    1  
ATOM 1939  O O    . VAL B 1 20  ? -11.486 -3.202  4.255   1.00 0.27  ? 20  VAL B O    1  
ATOM 1940  C CB   . VAL B 1 20  ? -9.001  -1.538  5.639   1.00 0.27  ? 20  VAL B CB   1  
ATOM 1941  C CG1  . VAL B 1 20  ? -8.067  -1.304  6.787   1.00 0.87  ? 20  VAL B CG1  1  
ATOM 1942  C CG2  . VAL B 1 20  ? -8.266  -1.333  4.324   1.00 0.87  ? 20  VAL B CG2  1  
ATOM 1943  H H    . VAL B 1 20  ? -7.694  -3.706  6.180   1.00 0.21  ? 20  VAL B H    1  
ATOM 1944  H HA   . VAL B 1 20  ? -10.398 -2.908  6.515   1.00 0.24  ? 20  VAL B HA   1  
ATOM 1945  H HB   . VAL B 1 20  ? -9.790  -0.809  5.708   1.00 0.52  ? 20  VAL B HB   1  
ATOM 1946  H HG11 . VAL B 1 20  ? -7.621  -0.326  6.693   1.00 1.36  ? 20  VAL B HG11 1  
ATOM 1947  H HG12 . VAL B 1 20  ? -7.294  -2.060  6.763   1.00 1.57  ? 20  VAL B HG12 1  
ATOM 1948  H HG13 . VAL B 1 20  ? -8.613  -1.371  7.715   1.00 1.42  ? 20  VAL B HG13 1  
ATOM 1949  H HG21 . VAL B 1 20  ? -7.483  -2.070  4.231   1.00 1.45  ? 20  VAL B HG21 1  
ATOM 1950  H HG22 . VAL B 1 20  ? -7.833  -0.344  4.306   1.00 1.40  ? 20  VAL B HG22 1  
ATOM 1951  H HG23 . VAL B 1 20  ? -8.959  -1.438  3.502   1.00 1.53  ? 20  VAL B HG23 1  
ATOM 1952  N N    . PHE B 1 21  ? -9.466  -3.893  3.538   1.00 0.22  ? 21  PHE B N    1  
ATOM 1953  C CA   . PHE B 1 21  ? -9.983  -4.307  2.240   1.00 0.25  ? 21  PHE B CA   1  
ATOM 1954  C C    . PHE B 1 21  ? -10.992 -5.429  2.400   1.00 0.29  ? 21  PHE B C    1  
ATOM 1955  O O    . PHE B 1 21  ? -12.121 -5.322  1.947   1.00 0.35  ? 21  PHE B O    1  
ATOM 1956  C CB   . PHE B 1 21  ? -8.865  -4.766  1.301   1.00 0.26  ? 21  PHE B CB   1  
ATOM 1957  C CG   . PHE B 1 21  ? -9.368  -5.252  -0.024  1.00 0.91  ? 21  PHE B CG   1  
ATOM 1958  C CD1  . PHE B 1 21  ? -9.890  -4.362  -0.942  1.00 1.85  ? 21  PHE B CD1  1  
ATOM 1959  C CD2  . PHE B 1 21  ? -9.333  -6.598  -0.344  1.00 1.59  ? 21  PHE B CD2  1  
ATOM 1960  C CE1  . PHE B 1 21  ? -10.367 -4.801  -2.158  1.00 2.48  ? 21  PHE B CE1  1  
ATOM 1961  C CE2  . PHE B 1 21  ? -9.811  -7.044  -1.557  1.00 2.17  ? 21  PHE B CE2  1  
ATOM 1962  C CZ   . PHE B 1 21  ? -10.329 -6.144  -2.466  1.00 2.40  ? 21  PHE B CZ   1  
ATOM 1963  H H    . PHE B 1 21  ? -8.496  -3.999  3.752   1.00 0.22  ? 21  PHE B H    1  
ATOM 1964  H HA   . PHE B 1 21  ? -10.482 -3.456  1.799   1.00 0.27  ? 21  PHE B HA   1  
ATOM 1965  H HB2  . PHE B 1 21  ? -8.190  -3.943  1.120   1.00 0.64  ? 21  PHE B HB2  1  
ATOM 1966  H HB3  . PHE B 1 21  ? -8.322  -5.574  1.769   1.00 0.62  ? 21  PHE B HB3  1  
ATOM 1967  H HD1  . PHE B 1 21  ? -9.919  -3.310  -0.701  1.00 2.42  ? 21  PHE B HD1  1  
ATOM 1968  H HD2  . PHE B 1 21  ? -8.928  -7.301  0.365   1.00 2.15  ? 21  PHE B HD2  1  
ATOM 1969  H HE1  . PHE B 1 21  ? -10.771 -4.095  -2.867  1.00 3.33  ? 21  PHE B HE1  1  
ATOM 1970  H HE2  . PHE B 1 21  ? -9.780  -8.096  -1.797  1.00 2.85  ? 21  PHE B HE2  1  
ATOM 1971  H HZ   . PHE B 1 21  ? -10.703 -6.491  -3.417  1.00 2.98  ? 21  PHE B HZ   1  
ATOM 1972  N N    . GLN B 1 22  ? -10.586 -6.482  3.083   1.00 0.30  ? 22  GLN B N    1  
ATOM 1973  C CA   . GLN B 1 22  ? -11.371 -7.700  3.153   1.00 0.37  ? 22  GLN B CA   1  
ATOM 1974  C C    . GLN B 1 22  ? -12.590 -7.557  4.057   1.00 0.36  ? 22  GLN B C    1  
ATOM 1975  O O    . GLN B 1 22  ? -13.521 -8.357  3.967   1.00 0.44  ? 22  GLN B O    1  
ATOM 1976  C CB   . GLN B 1 22  ? -10.474 -8.865  3.572   1.00 0.47  ? 22  GLN B CB   1  
ATOM 1977  C CG   . GLN B 1 22  ? -9.637  -9.390  2.413   1.00 1.11  ? 22  GLN B CG   1  
ATOM 1978  C CD   . GLN B 1 22  ? -8.553  -10.365 2.832   1.00 1.98  ? 22  GLN B CD   1  
ATOM 1979  O OE1  . GLN B 1 22  ? -7.510  -10.460 2.184   1.00 2.68  ? 22  GLN B OE1  1  
ATOM 1980  N NE2  . GLN B 1 22  ? -8.784  -11.093 3.909   1.00 2.65  ? 22  GLN B NE2  1  
ATOM 1981  H H    . GLN B 1 22  ? -9.734  -6.436  3.573   1.00 0.28  ? 22  GLN B H    1  
ATOM 1982  H HA   . GLN B 1 22  ? -11.731 -7.897  2.155   1.00 0.43  ? 22  GLN B HA   1  
ATOM 1983  H HB2  . GLN B 1 22  ? -9.801  -8.529  4.352   1.00 0.83  ? 22  GLN B HB2  1  
ATOM 1984  H HB3  . GLN B 1 22  ? -11.086 -9.671  3.947   1.00 0.94  ? 22  GLN B HB3  1  
ATOM 1985  H HG2  . GLN B 1 22  ? -10.291 -9.889  1.714   1.00 1.54  ? 22  GLN B HG2  1  
ATOM 1986  H HG3  . GLN B 1 22  ? -9.170  -8.549  1.923   1.00 1.67  ? 22  GLN B HG3  1  
ATOM 1987  H HE21 . GLN B 1 22  ? -9.638  -10.972 4.374   1.00 2.74  ? 22  GLN B HE21 1  
ATOM 1988  H HE22 . GLN B 1 22  ? -8.091  -11.719 4.201   1.00 3.38  ? 22  GLN B HE22 1  
ATOM 1989  N N    . LYS B 1 23  ? -12.605 -6.551  4.923   1.00 0.35  ? 23  LYS B N    1  
ATOM 1990  C CA   . LYS B 1 23  ? -13.776 -6.321  5.753   1.00 0.39  ? 23  LYS B CA   1  
ATOM 1991  C C    . LYS B 1 23  ? -14.871 -5.595  4.962   1.00 0.41  ? 23  LYS B C    1  
ATOM 1992  O O    . LYS B 1 23  ? -16.054 -5.894  5.118   1.00 0.49  ? 23  LYS B O    1  
ATOM 1993  C CB   . LYS B 1 23  ? -13.411 -5.542  7.020   1.00 0.41  ? 23  LYS B CB   1  
ATOM 1994  C CG   . LYS B 1 23  ? -12.990 -4.121  6.778   1.00 0.42  ? 23  LYS B CG   1  
ATOM 1995  C CD   . LYS B 1 23  ? -12.343 -3.549  8.014   1.00 0.63  ? 23  LYS B CD   1  
ATOM 1996  C CE   . LYS B 1 23  ? -12.370 -2.045  7.970   1.00 0.64  ? 23  LYS B CE   1  
ATOM 1997  N NZ   . LYS B 1 23  ? -11.655 -1.424  9.115   1.00 0.91  ? 23  LYS B NZ   1  
ATOM 1998  H H    . LYS B 1 23  ? -11.818 -5.969  5.018   1.00 0.35  ? 23  LYS B H    1  
ATOM 1999  H HA   . LYS B 1 23  ? -14.152 -7.289  6.039   1.00 0.42  ? 23  LYS B HA   1  
ATOM 2000  H HB2  . LYS B 1 23  ? -14.264 -5.511  7.674   1.00 0.45  ? 23  LYS B HB2  1  
ATOM 2001  H HB3  . LYS B 1 23  ? -12.602 -6.046  7.523   1.00 0.45  ? 23  LYS B HB3  1  
ATOM 2002  H HG2  . LYS B 1 23  ? -12.281 -4.096  5.963   1.00 0.53  ? 23  LYS B HG2  1  
ATOM 2003  H HG3  . LYS B 1 23  ? -13.860 -3.531  6.527   1.00 0.57  ? 23  LYS B HG3  1  
ATOM 2004  H HD2  . LYS B 1 23  ? -12.883 -3.892  8.884   1.00 0.97  ? 23  LYS B HD2  1  
ATOM 2005  H HD3  . LYS B 1 23  ? -11.320 -3.889  8.057   1.00 0.85  ? 23  LYS B HD3  1  
ATOM 2006  H HE2  . LYS B 1 23  ? -11.917 -1.721  7.050   1.00 0.72  ? 23  LYS B HE2  1  
ATOM 2007  H HE3  . LYS B 1 23  ? -13.403 -1.736  7.988   1.00 0.85  ? 23  LYS B HE3  1  
ATOM 2008  H HZ1  . LYS B 1 23  ? -11.563 -0.393  8.964   1.00 1.42  ? 23  LYS B HZ1  1  
ATOM 2009  H HZ2  . LYS B 1 23  ? -10.706 -1.832  9.217   1.00 1.26  ? 23  LYS B HZ2  1  
ATOM 2010  H HZ3  . LYS B 1 23  ? -12.180 -1.582  9.999   1.00 1.47  ? 23  LYS B HZ3  1  
ATOM 2011  N N    . TYR B 1 24  ? -14.480 -4.649  4.107   1.00 0.36  ? 24  TYR B N    1  
ATOM 2012  C CA   . TYR B 1 24  ? -15.453 -3.918  3.295   1.00 0.39  ? 24  TYR B CA   1  
ATOM 2013  C C    . TYR B 1 24  ? -15.785 -4.664  2.011   1.00 0.34  ? 24  TYR B C    1  
ATOM 2014  O O    . TYR B 1 24  ? -16.947 -4.767  1.625   1.00 0.40  ? 24  TYR B O    1  
ATOM 2015  C CB   . TYR B 1 24  ? -14.955 -2.514  2.975   1.00 0.46  ? 24  TYR B CB   1  
ATOM 2016  C CG   . TYR B 1 24  ? -15.308 -1.499  4.036   1.00 0.86  ? 24  TYR B CG   1  
ATOM 2017  C CD1  . TYR B 1 24  ? -16.534 -0.847  4.010   1.00 1.66  ? 24  TYR B CD1  1  
ATOM 2018  C CD2  . TYR B 1 24  ? -14.426 -1.193  5.063   1.00 1.52  ? 24  TYR B CD2  1  
ATOM 2019  C CE1  . TYR B 1 24  ? -16.870 0.082   4.974   1.00 1.99  ? 24  TYR B CE1  1  
ATOM 2020  C CE2  . TYR B 1 24  ? -14.755 -0.264  6.031   1.00 1.83  ? 24  TYR B CE2  1  
ATOM 2021  C CZ   . TYR B 1 24  ? -15.977 0.369   5.983   1.00 1.71  ? 24  TYR B CZ   1  
ATOM 2022  O OH   . TYR B 1 24  ? -16.306 1.295   6.945   1.00 2.15  ? 24  TYR B OH   1  
ATOM 2023  H H    . TYR B 1 24  ? -13.520 -4.438  4.020   1.00 0.33  ? 24  TYR B H    1  
ATOM 2024  H HA   . TYR B 1 24  ? -16.361 -3.833  3.878   1.00 0.50  ? 24  TYR B HA   1  
ATOM 2025  H HB2  . TYR B 1 24  ? -13.879 -2.532  2.873   1.00 0.51  ? 24  TYR B HB2  1  
ATOM 2026  H HB3  . TYR B 1 24  ? -15.394 -2.190  2.045   1.00 0.45  ? 24  TYR B HB3  1  
ATOM 2027  H HD1  . TYR B 1 24  ? -17.232 -1.075  3.217   1.00 2.37  ? 24  TYR B HD1  1  
ATOM 2028  H HD2  . TYR B 1 24  ? -13.469 -1.691  5.099   1.00 2.22  ? 24  TYR B HD2  1  
ATOM 2029  H HE1  . TYR B 1 24  ? -17.828 0.578   4.935   1.00 2.79  ? 24  TYR B HE1  1  
ATOM 2030  H HE2  . TYR B 1 24  ? -14.056 -0.038  6.822   1.00 2.59  ? 24  TYR B HE2  1  
ATOM 2031  H HH   . TYR B 1 24  ? -15.730 2.073   6.852   1.00 2.39  ? 24  TYR B HH   1  
ATOM 2032  N N    . ALA B 1 25  ? -14.766 -5.187  1.352   1.00 0.29  ? 25  ALA B N    1  
ATOM 2033  C CA   . ALA B 1 25  ? -14.961 -5.976  0.146   1.00 0.34  ? 25  ALA B CA   1  
ATOM 2034  C C    . ALA B 1 25  ? -15.689 -7.267  0.484   1.00 0.47  ? 25  ALA B C    1  
ATOM 2035  O O    . ALA B 1 25  ? -16.390 -7.847  -0.348  1.00 0.58  ? 25  ALA B O    1  
ATOM 2036  C CB   . ALA B 1 25  ? -13.622 -6.274  -0.507  1.00 0.37  ? 25  ALA B CB   1  
ATOM 2037  H H    . ALA B 1 25  ? -13.852 -5.040  1.686   1.00 0.28  ? 25  ALA B H    1  
ATOM 2038  H HA   . ALA B 1 25  ? -15.559 -5.396  -0.543  1.00 0.34  ? 25  ALA B HA   1  
ATOM 2039  H HB1  . ALA B 1 25  ? -13.131 -5.344  -0.760  1.00 1.05  ? 25  ALA B HB1  1  
ATOM 2040  H HB2  . ALA B 1 25  ? -13.781 -6.855  -1.405  1.00 0.98  ? 25  ALA B HB2  1  
ATOM 2041  H HB3  . ALA B 1 25  ? -13.002 -6.832  0.180   1.00 1.09  ? 25  ALA B HB3  1  
ATOM 2042  N N    . GLY B 1 26  ? -15.535 -7.692  1.733   1.00 0.50  ? 26  GLY B N    1  
ATOM 2043  C CA   . GLY B 1 26  ? -16.196 -8.889  2.207   1.00 0.64  ? 26  GLY B CA   1  
ATOM 2044  C C    . GLY B 1 26  ? -17.666 -8.659  2.505   1.00 0.76  ? 26  GLY B C    1  
ATOM 2045  O O    . GLY B 1 26  ? -18.362 -9.570  2.946   1.00 0.96  ? 26  GLY B O    1  
ATOM 2046  H H    . GLY B 1 26  ? -14.956 -7.183  2.342   1.00 0.45  ? 26  GLY B H    1  
ATOM 2047  H HA2  . GLY B 1 26  ? -16.105 -9.658  1.455   1.00 0.74  ? 26  GLY B HA2  1  
ATOM 2048  H HA3  . GLY B 1 26  ? -15.706 -9.223  3.110   1.00 0.64  ? 26  GLY B HA3  1  
ATOM 2049  N N    . LYS B 1 27  ? -18.137 -7.436  2.285   1.00 0.69  ? 27  LYS B N    1  
ATOM 2050  C CA   . LYS B 1 27  ? -19.546 -7.119  2.476   1.00 0.82  ? 27  LYS B CA   1  
ATOM 2051  C C    . LYS B 1 27  ? -20.349 -7.480  1.234   1.00 0.95  ? 27  LYS B C    1  
ATOM 2052  O O    . LYS B 1 27  ? -21.508 -7.888  1.328   1.00 1.11  ? 27  LYS B O    1  
ATOM 2053  C CB   . LYS B 1 27  ? -19.737 -5.635  2.789   1.00 0.77  ? 27  LYS B CB   1  
ATOM 2054  C CG   . LYS B 1 27  ? -19.080 -5.185  4.083   1.00 0.81  ? 27  LYS B CG   1  
ATOM 2055  C CD   . LYS B 1 27  ? -19.365 -3.721  4.368   1.00 0.86  ? 27  LYS B CD   1  
ATOM 2056  C CE   . LYS B 1 27  ? -18.807 -3.303  5.718   1.00 1.11  ? 27  LYS B CE   1  
ATOM 2057  N NZ   . LYS B 1 27  ? -19.387 -2.018  6.189   1.00 1.72  ? 27  LYS B NZ   1  
ATOM 2058  H H    . LYS B 1 27  ? -17.522 -6.728  1.996   1.00 0.61  ? 27  LYS B H    1  
ATOM 2059  H HA   . LYS B 1 27  ? -19.909 -7.705  3.306   1.00 0.93  ? 27  LYS B HA   1  
ATOM 2060  H HB2  . LYS B 1 27  ? -19.321 -5.053  1.979   1.00 0.68  ? 27  LYS B HB2  1  
ATOM 2061  H HB3  . LYS B 1 27  ? -20.796 -5.428  2.859   1.00 0.89  ? 27  LYS B HB3  1  
ATOM 2062  H HG2  . LYS B 1 27  ? -19.464 -5.782  4.897   1.00 0.95  ? 27  LYS B HG2  1  
ATOM 2063  H HG3  . LYS B 1 27  ? -18.012 -5.327  4.001   1.00 0.79  ? 27  LYS B HG3  1  
ATOM 2064  H HD2  . LYS B 1 27  ? -18.903 -3.118  3.597   1.00 1.08  ? 27  LYS B HD2  1  
ATOM 2065  H HD3  . LYS B 1 27  ? -20.433 -3.561  4.363   1.00 1.11  ? 27  LYS B HD3  1  
ATOM 2066  H HE2  . LYS B 1 27  ? -19.029 -4.074  6.440   1.00 1.65  ? 27  LYS B HE2  1  
ATOM 2067  H HE3  . LYS B 1 27  ? -17.735 -3.191  5.629   1.00 1.47  ? 27  LYS B HE3  1  
ATOM 2068  H HZ1  . LYS B 1 27  ? -20.407 -2.129  6.359   1.00 2.17  ? 27  LYS B HZ1  1  
ATOM 2069  H HZ2  . LYS B 1 27  ? -19.252 -1.277  5.473   1.00 2.11  ? 27  LYS B HZ2  1  
ATOM 2070  H HZ3  . LYS B 1 27  ? -18.931 -1.720  7.073   1.00 2.19  ? 27  LYS B HZ3  1  
ATOM 2071  N N    . ASP B 1 28  ? -19.729 -7.331  0.066   1.00 1.00  ? 28  ASP B N    1  
ATOM 2072  C CA   . ASP B 1 28  ? -20.417 -7.599  -1.191  1.00 1.19  ? 28  ASP B CA   1  
ATOM 2073  C C    . ASP B 1 28  ? -20.394 -9.091  -1.505  1.00 1.26  ? 28  ASP B C    1  
ATOM 2074  O O    . ASP B 1 28  ? -21.282 -9.617  -2.173  1.00 1.58  ? 28  ASP B O    1  
ATOM 2075  C CB   . ASP B 1 28  ? -19.770 -6.807  -2.331  1.00 1.33  ? 28  ASP B CB   1  
ATOM 2076  C CG   . ASP B 1 28  ? -20.542 -6.917  -3.634  1.00 1.65  ? 28  ASP B CG   1  
ATOM 2077  O OD1  . ASP B 1 28  ? -21.502 -6.145  -3.823  1.00 2.09  ? 28  ASP B OD1  1  
ATOM 2078  O OD2  . ASP B 1 28  ? -20.189 -7.766  -4.481  1.00 2.15  ? 28  ASP B OD2  1  
ATOM 2079  H H    . ASP B 1 28  ? -18.795 -7.034  0.052   1.00 0.99  ? 28  ASP B H    1  
ATOM 2080  H HA   . ASP B 1 28  ? -21.443 -7.283  -1.081  1.00 1.28  ? 28  ASP B HA   1  
ATOM 2081  H HB2  . ASP B 1 28  ? -19.720 -5.764  -2.052  1.00 1.33  ? 28  ASP B HB2  1  
ATOM 2082  H HB3  . ASP B 1 28  ? -18.768 -7.178  -2.496  1.00 1.44  ? 28  ASP B HB3  1  
ATOM 2083  N N    . GLY B 1 29  ? -19.376 -9.766  -0.980  1.00 1.15  ? 29  GLY B N    1  
ATOM 2084  C CA   . GLY B 1 29  ? -19.303 -11.216 -1.055  1.00 1.32  ? 29  GLY B CA   1  
ATOM 2085  C C    . GLY B 1 29  ? -19.110 -11.759 -2.461  1.00 1.51  ? 29  GLY B C    1  
ATOM 2086  O O    . GLY B 1 29  ? -19.341 -12.945 -2.700  1.00 1.64  ? 29  GLY B O    1  
ATOM 2087  H H    . GLY B 1 29  ? -18.659 -9.271  -0.532  1.00 1.14  ? 29  GLY B H    1  
ATOM 2088  H HA2  . GLY B 1 29  ? -18.480 -11.551 -0.443  1.00 1.61  ? 29  GLY B HA2  1  
ATOM 2089  H HA3  . GLY B 1 29  ? -20.218 -11.626 -0.650  1.00 1.54  ? 29  GLY B HA3  1  
ATOM 2090  N N    . TYR B 1 30  ? -18.688 -10.906 -3.389  1.00 2.07  ? 30  TYR B N    1  
ATOM 2091  C CA   . TYR B 1 30  ? -18.453 -11.333 -4.765  1.00 2.80  ? 30  TYR B CA   1  
ATOM 2092  C C    . TYR B 1 30  ? -17.193 -12.198 -4.853  1.00 2.61  ? 30  TYR B C    1  
ATOM 2093  O O    . TYR B 1 30  ? -17.259 -13.417 -4.712  1.00 3.02  ? 30  TYR B O    1  
ATOM 2094  C CB   . TYR B 1 30  ? -18.350 -10.109 -5.689  1.00 3.68  ? 30  TYR B CB   1  
ATOM 2095  C CG   . TYR B 1 30  ? -18.063 -10.437 -7.139  1.00 4.52  ? 30  TYR B CG   1  
ATOM 2096  C CD1  . TYR B 1 30  ? -18.987 -11.118 -7.920  1.00 5.11  ? 30  TYR B CD1  1  
ATOM 2097  C CD2  . TYR B 1 30  ? -16.863 -10.057 -7.727  1.00 5.12  ? 30  TYR B CD2  1  
ATOM 2098  C CE1  . TYR B 1 30  ? -18.723 -11.412 -9.244  1.00 6.04  ? 30  TYR B CE1  1  
ATOM 2099  C CE2  . TYR B 1 30  ? -16.591 -10.346 -9.048  1.00 6.09  ? 30  TYR B CE2  1  
ATOM 2100  C CZ   . TYR B 1 30  ? -17.524 -11.024 -9.802  1.00 6.46  ? 30  TYR B CZ   1  
ATOM 2101  O OH   . TYR B 1 30  ? -17.254 -11.320 -11.118 1.00 7.51  ? 30  TYR B OH   1  
ATOM 2102  H H    . TYR B 1 30  ? -18.542 -9.970  -3.146  1.00 2.21  ? 30  TYR B H    1  
ATOM 2103  H HA   . TYR B 1 30  ? -19.299 -11.930 -5.069  1.00 3.26  ? 30  TYR B HA   1  
ATOM 2104  H HB2  . TYR B 1 30  ? -19.283 -9.566  -5.655  1.00 3.86  ? 30  TYR B HB2  1  
ATOM 2105  H HB3  . TYR B 1 30  ? -17.558 -9.468  -5.331  1.00 3.94  ? 30  TYR B HB3  1  
ATOM 2106  H HD1  . TYR B 1 30  ? -19.926 -11.422 -7.479  1.00 5.08  ? 30  TYR B HD1  1  
ATOM 2107  H HD2  . TYR B 1 30  ? -16.133 -9.526  -7.133  1.00 5.08  ? 30  TYR B HD2  1  
ATOM 2108  H HE1  . TYR B 1 30  ? -19.454 -11.942 -9.836  1.00 6.63  ? 30  TYR B HE1  1  
ATOM 2109  H HE2  . TYR B 1 30  ? -15.652 -10.042 -9.485  1.00 6.74  ? 30  TYR B HE2  1  
ATOM 2110  H HH   . TYR B 1 30  ? -17.986 -11.017 -11.673 1.00 7.75  ? 30  TYR B HH   1  
ATOM 2111  N N    . ASN B 1 31  ? -16.050 -11.561 -5.068  1.00 2.62  ? 31  ASN B N    1  
ATOM 2112  C CA   . ASN B 1 31  ? -14.766 -12.255 -5.119  1.00 2.78  ? 31  ASN B CA   1  
ATOM 2113  C C    . ASN B 1 31  ? -13.783 -11.535 -4.218  1.00 1.96  ? 31  ASN B C    1  
ATOM 2114  O O    . ASN B 1 31  ? -12.601 -11.400 -4.550  1.00 2.53  ? 31  ASN B O    1  
ATOM 2115  C CB   . ASN B 1 31  ? -14.203 -12.295 -6.551  1.00 3.85  ? 31  ASN B CB   1  
ATOM 2116  C CG   . ASN B 1 31  ? -14.868 -13.325 -7.448  1.00 4.61  ? 31  ASN B CG   1  
ATOM 2117  O OD1  . ASN B 1 31  ? -16.050 -13.630 -7.308  1.00 4.92  ? 31  ASN B OD1  1  
ATOM 2118  N ND2  . ASN B 1 31  ? -14.107 -13.865 -8.387  1.00 5.33  ? 31  ASN B ND2  1  
ATOM 2119  H H    . ASN B 1 31  ? -16.066 -10.590 -5.202  1.00 2.93  ? 31  ASN B H    1  
ATOM 2120  H HA   . ASN B 1 31  ? -14.909 -13.263 -4.759  1.00 3.24  ? 31  ASN B HA   1  
ATOM 2121  H HB2  . ASN B 1 31  ? -14.333 -11.324 -7.003  1.00 4.17  ? 31  ASN B HB2  1  
ATOM 2122  H HB3  . ASN B 1 31  ? -13.147 -12.520 -6.503  1.00 4.22  ? 31  ASN B HB3  1  
ATOM 2123  H HD21 . ASN B 1 31  ? -13.172 -13.577 -8.451  1.00 5.37  ? 31  ASN B HD21 1  
ATOM 2124  H HD22 . ASN B 1 31  ? -14.511 -14.532 -8.983  1.00 5.97  ? 31  ASN B HD22 1  
ATOM 2125  N N    . TYR B 1 32  ? -14.284 -11.086 -3.070  1.00 1.18  ? 32  TYR B N    1  
ATOM 2126  C CA   . TYR B 1 32  ? -13.544 -10.181 -2.199  1.00 1.18  ? 32  TYR B CA   1  
ATOM 2127  C C    . TYR B 1 32  ? -13.121 -8.947  -2.985  1.00 0.91  ? 32  TYR B C    1  
ATOM 2128  O O    . TYR B 1 32  ? -11.939 -8.640  -3.122  1.00 1.04  ? 32  TYR B O    1  
ATOM 2129  C CB   . TYR B 1 32  ? -12.346 -10.879 -1.551  1.00 1.78  ? 32  TYR B CB   1  
ATOM 2130  C CG   . TYR B 1 32  ? -12.753 -11.904 -0.516  1.00 2.38  ? 32  TYR B CG   1  
ATOM 2131  C CD1  . TYR B 1 32  ? -13.164 -11.506 0.750   1.00 3.08  ? 32  TYR B CD1  1  
ATOM 2132  C CD2  . TYR B 1 32  ? -12.737 -13.263 -0.804  1.00 2.99  ? 32  TYR B CD2  1  
ATOM 2133  C CE1  . TYR B 1 32  ? -13.548 -12.432 1.700   1.00 3.93  ? 32  TYR B CE1  1  
ATOM 2134  C CE2  . TYR B 1 32  ? -13.118 -14.196 0.142   1.00 3.86  ? 32  TYR B CE2  1  
ATOM 2135  C CZ   . TYR B 1 32  ? -13.523 -13.775 1.393   1.00 4.19  ? 32  TYR B CZ   1  
ATOM 2136  O OH   . TYR B 1 32  ? -13.906 -14.699 2.341   1.00 5.19  ? 32  TYR B OH   1  
ATOM 2137  H H    . TYR B 1 32  ? -15.176 -11.389 -2.791  1.00 1.45  ? 32  TYR B H    1  
ATOM 2138  H HA   . TYR B 1 32  ? -14.223 -9.864  -1.419  1.00 1.85  ? 32  TYR B HA   1  
ATOM 2139  H HB2  . TYR B 1 32  ? -11.774 -11.386 -2.315  1.00 2.15  ? 32  TYR B HB2  1  
ATOM 2140  H HB3  . TYR B 1 32  ? -11.723 -10.143 -1.066  1.00 2.32  ? 32  TYR B HB3  1  
ATOM 2141  H HD1  . TYR B 1 32  ? -13.181 -10.453 0.989   1.00 3.32  ? 32  TYR B HD1  1  
ATOM 2142  H HD2  . TYR B 1 32  ? -12.419 -13.589 -1.783  1.00 3.17  ? 32  TYR B HD2  1  
ATOM 2143  H HE1  . TYR B 1 32  ? -13.865 -12.102 2.678   1.00 4.65  ? 32  TYR B HE1  1  
ATOM 2144  H HE2  . TYR B 1 32  ? -13.100 -15.248 -0.100  1.00 4.54  ? 32  TYR B HE2  1  
ATOM 2145  H HH   . TYR B 1 32  ? -14.779 -14.460 2.682   1.00 5.57  ? 32  TYR B HH   1  
ATOM 2146  N N    . THR B 1 33  ? -14.123 -8.267  -3.513  1.00 0.66  ? 33  THR B N    1  
ATOM 2147  C CA   . THR B 1 33  ? -13.939 -7.063  -4.300  1.00 0.45  ? 33  THR B CA   1  
ATOM 2148  C C    . THR B 1 33  ? -14.770 -5.954  -3.678  1.00 0.37  ? 33  THR B C    1  
ATOM 2149  O O    . THR B 1 33  ? -15.898 -6.183  -3.238  1.00 0.44  ? 33  THR B O    1  
ATOM 2150  C CB   . THR B 1 33  ? -14.378 -7.308  -5.759  1.00 0.45  ? 33  THR B CB   1  
ATOM 2151  O OG1  . THR B 1 33  ? -14.190 -8.693  -6.092  1.00 0.66  ? 33  THR B OG1  1  
ATOM 2152  C CG2  . THR B 1 33  ? -13.583 -6.451  -6.734  1.00 0.43  ? 33  THR B CG2  1  
ATOM 2153  H H    . THR B 1 33  ? -15.034 -8.588  -3.366  1.00 0.73  ? 33  THR B H    1  
ATOM 2154  H HA   . THR B 1 33  ? -12.898 -6.769  -4.284  1.00 0.49  ? 33  THR B HA   1  
ATOM 2155  H HB   . THR B 1 33  ? -15.422 -7.060  -5.853  1.00 0.56  ? 33  THR B HB   1  
ATOM 2156  H HG1  . THR B 1 33  ? -13.468 -8.774  -6.722  1.00 1.28  ? 33  THR B HG1  1  
ATOM 2157  H HG21 . THR B 1 33  ? -12.538 -6.713  -6.679  1.00 1.10  ? 33  THR B HG21 1  
ATOM 2158  H HG22 . THR B 1 33  ? -13.706 -5.407  -6.480  1.00 0.99  ? 33  THR B HG22 1  
ATOM 2159  H HG23 . THR B 1 33  ? -13.945 -6.618  -7.739  1.00 1.14  ? 33  THR B HG23 1  
ATOM 2160  N N    . LEU B 1 34  ? -14.208 -4.766  -3.624  1.00 0.32  ? 34  LEU B N    1  
ATOM 2161  C CA   . LEU B 1 34  ? -14.842 -3.658  -2.943  1.00 0.30  ? 34  LEU B CA   1  
ATOM 2162  C C    . LEU B 1 34  ? -15.812 -2.974  -3.877  1.00 0.31  ? 34  LEU B C    1  
ATOM 2163  O O    . LEU B 1 34  ? -15.423 -2.231  -4.774  1.00 0.34  ? 34  LEU B O    1  
ATOM 2164  C CB   . LEU B 1 34  ? -13.759 -2.693  -2.456  1.00 0.29  ? 34  LEU B CB   1  
ATOM 2165  C CG   . LEU B 1 34  ? -13.747 -2.413  -0.955  1.00 0.29  ? 34  LEU B CG   1  
ATOM 2166  C CD1  . LEU B 1 34  ? -12.467 -1.699  -0.552  1.00 0.45  ? 34  LEU B CD1  1  
ATOM 2167  C CD2  . LEU B 1 34  ? -14.949 -1.583  -0.564  1.00 0.28  ? 34  LEU B CD2  1  
ATOM 2168  H H    . LEU B 1 34  ? -13.329 -4.628  -4.046  1.00 0.31  ? 34  LEU B H    1  
ATOM 2169  H HA   . LEU B 1 34  ? -15.396 -4.038  -2.100  1.00 0.32  ? 34  LEU B HA   1  
ATOM 2170  H HB2  . LEU B 1 34  ? -12.790 -3.115  -2.721  1.00 0.34  ? 34  LEU B HB2  1  
ATOM 2171  H HB3  . LEU B 1 34  ? -13.892 -1.750  -2.978  1.00 0.33  ? 34  LEU B HB3  1  
ATOM 2172  H HG   . LEU B 1 34  ? -13.793 -3.351  -0.421  1.00 0.32  ? 34  LEU B HG   1  
ATOM 2173  H HD11 . LEU B 1 34  ? -12.470 -1.531  0.516   1.00 1.03  ? 34  LEU B HD11 1  
ATOM 2174  H HD12 . LEU B 1 34  ? -12.405 -0.751  -1.065  1.00 1.18  ? 34  LEU B HD12 1  
ATOM 2175  H HD13 . LEU B 1 34  ? -11.616 -2.307  -0.816  1.00 1.09  ? 34  LEU B HD13 1  
ATOM 2176  H HD21 . LEU B 1 34  ? -15.843 -2.179  -0.667  1.00 1.05  ? 34  LEU B HD21 1  
ATOM 2177  H HD22 . LEU B 1 34  ? -15.016 -0.720  -1.211  1.00 1.09  ? 34  LEU B HD22 1  
ATOM 2178  H HD23 . LEU B 1 34  ? -14.846 -1.254  0.458   1.00 1.01  ? 34  LEU B HD23 1  
ATOM 2179  N N    . SER B 1 35  ? -17.082 -3.256  -3.648  1.00 0.31  ? 35  SER B N    1  
ATOM 2180  C CA   . SER B 1 35  ? -18.144 -2.791  -4.508  1.00 0.33  ? 35  SER B CA   1  
ATOM 2181  C C    . SER B 1 35  ? -18.340 -1.293  -4.360  1.00 0.32  ? 35  SER B C    1  
ATOM 2182  O O    . SER B 1 35  ? -17.790 -0.682  -3.446  1.00 0.30  ? 35  SER B O    1  
ATOM 2183  C CB   . SER B 1 35  ? -19.428 -3.553  -4.187  1.00 0.37  ? 35  SER B CB   1  
ATOM 2184  O OG   . SER B 1 35  ? -20.425 -3.341  -5.172  1.00 0.40  ? 35  SER B OG   1  
ATOM 2185  H H    . SER B 1 35  ? -17.312 -3.804  -2.870  1.00 0.33  ? 35  SER B H    1  
ATOM 2186  H HA   . SER B 1 35  ? -17.857 -2.998  -5.516  1.00 0.35  ? 35  SER B HA   1  
ATOM 2187  H HB2  . SER B 1 35  ? -19.212 -4.609  -4.138  1.00 0.38  ? 35  SER B HB2  1  
ATOM 2188  H HB3  . SER B 1 35  ? -19.806 -3.221  -3.232  1.00 0.38  ? 35  SER B HB3  1  
ATOM 2189  H HG   . SER B 1 35  ? -21.063 -4.066  -5.136  1.00 0.68  ? 35  SER B HG   1  
ATOM 2190  N N    . LYS B 1 36  ? -19.123 -0.713  -5.262  1.00 0.38  ? 36  LYS B N    1  
ATOM 2191  C CA   . LYS B 1 36  ? -19.313 0.728   -5.307  1.00 0.42  ? 36  LYS B CA   1  
ATOM 2192  C C    . LYS B 1 36  ? -19.708 1.268   -3.940  1.00 0.36  ? 36  LYS B C    1  
ATOM 2193  O O    . LYS B 1 36  ? -18.957 2.020   -3.333  1.00 0.35  ? 36  LYS B O    1  
ATOM 2194  C CB   . LYS B 1 36  ? -20.379 1.091   -6.341  1.00 0.53  ? 36  LYS B CB   1  
ATOM 2195  C CG   . LYS B 1 36  ? -20.467 2.580   -6.639  1.00 0.62  ? 36  LYS B CG   1  
ATOM 2196  C CD   . LYS B 1 36  ? -19.198 3.084   -7.308  1.00 0.66  ? 36  LYS B CD   1  
ATOM 2197  C CE   . LYS B 1 36  ? -19.300 4.553   -7.678  1.00 0.61  ? 36  LYS B CE   1  
ATOM 2198  N NZ   . LYS B 1 36  ? -20.410 4.817   -8.631  1.00 0.65  ? 36  LYS B NZ   1  
ATOM 2199  H H    . LYS B 1 36  ? -19.590 -1.277  -5.917  1.00 0.43  ? 36  LYS B H    1  
ATOM 2200  H HA   . LYS B 1 36  ? -18.378 1.176   -5.597  1.00 0.46  ? 36  LYS B HA   1  
ATOM 2201  H HB2  . LYS B 1 36  ? -20.158 0.576   -7.263  1.00 0.58  ? 36  LYS B HB2  1  
ATOM 2202  H HB3  . LYS B 1 36  ? -21.339 0.762   -5.978  1.00 0.56  ? 36  LYS B HB3  1  
ATOM 2203  H HG2  . LYS B 1 36  ? -21.305 2.758   -7.296  1.00 1.07  ? 36  LYS B HG2  1  
ATOM 2204  H HG3  . LYS B 1 36  ? -20.610 3.114   -5.712  1.00 1.21  ? 36  LYS B HG3  1  
ATOM 2205  H HD2  . LYS B 1 36  ? -18.368 2.952   -6.630  1.00 1.25  ? 36  LYS B HD2  1  
ATOM 2206  H HD3  . LYS B 1 36  ? -19.025 2.507   -8.206  1.00 1.12  ? 36  LYS B HD3  1  
ATOM 2207  H HE2  . LYS B 1 36  ? -19.468 5.127   -6.779  1.00 0.66  ? 36  LYS B HE2  1  
ATOM 2208  H HE3  . LYS B 1 36  ? -18.370 4.861   -8.130  1.00 0.58  ? 36  LYS B HE3  1  
ATOM 2209  H HZ1  . LYS B 1 36  ? -21.328 4.701   -8.157  1.00 1.18  ? 36  LYS B HZ1  1  
ATOM 2210  H HZ2  . LYS B 1 36  ? -20.362 4.156   -9.433  1.00 1.14  ? 36  LYS B HZ2  1  
ATOM 2211  H HZ3  . LYS B 1 36  ? -20.341 5.792   -8.998  1.00 1.16  ? 36  LYS B HZ3  1  
ATOM 2212  N N    . THR B 1 37  ? -20.854 0.835   -3.438  1.00 0.37  ? 37  THR B N    1  
ATOM 2213  C CA   . THR B 1 37  ? -21.371 1.334   -2.173  1.00 0.38  ? 37  THR B CA   1  
ATOM 2214  C C    . THR B 1 37  ? -20.462 0.958   -1.002  1.00 0.36  ? 37  THR B C    1  
ATOM 2215  O O    . THR B 1 37  ? -20.333 1.710   -0.030  1.00 0.38  ? 37  THR B O    1  
ATOM 2216  C CB   . THR B 1 37  ? -22.777 0.785   -1.911  1.00 0.44  ? 37  THR B CB   1  
ATOM 2217  O OG1  . THR B 1 37  ? -23.606 0.994   -3.066  1.00 0.47  ? 37  THR B OG1  1  
ATOM 2218  C CG2  . THR B 1 37  ? -23.395 1.467   -0.701  1.00 0.49  ? 37  THR B CG2  1  
ATOM 2219  H H    . THR B 1 37  ? -21.368 0.158   -3.930  1.00 0.39  ? 37  THR B H    1  
ATOM 2220  H HA   . THR B 1 37  ? -21.434 2.410   -2.239  1.00 0.39  ? 37  THR B HA   1  
ATOM 2221  H HB   . THR B 1 37  ? -22.698 -0.276  -1.717  1.00 0.44  ? 37  THR B HB   1  
ATOM 2222  H HG1  . THR B 1 37  ? -24.026 0.157   -3.310  1.00 0.79  ? 37  THR B HG1  1  
ATOM 2223  H HG21 . THR B 1 37  ? -23.430 2.535   -0.871  1.00 1.15  ? 37  THR B HG21 1  
ATOM 2224  H HG22 . THR B 1 37  ? -22.791 1.266   0.172   1.00 1.09  ? 37  THR B HG22 1  
ATOM 2225  H HG23 . THR B 1 37  ? -24.395 1.093   -0.545  1.00 1.12  ? 37  THR B HG23 1  
ATOM 2226  N N    . GLU B 1 38  ? -19.818 -0.194  -1.109  1.00 0.34  ? 38  GLU B N    1  
ATOM 2227  C CA   . GLU B 1 38  ? -18.908 -0.662  -0.072  1.00 0.33  ? 38  GLU B CA   1  
ATOM 2228  C C    . GLU B 1 38  ? -17.696 0.246   -0.024  1.00 0.33  ? 38  GLU B C    1  
ATOM 2229  O O    . GLU B 1 38  ? -17.151 0.524   1.042   1.00 0.48  ? 38  GLU B O    1  
ATOM 2230  C CB   . GLU B 1 38  ? -18.476 -2.107  -0.332  1.00 0.34  ? 38  GLU B CB   1  
ATOM 2231  C CG   . GLU B 1 38  ? -19.518 -3.151  0.052   1.00 0.47  ? 38  GLU B CG   1  
ATOM 2232  C CD   . GLU B 1 38  ? -20.895 -2.867  -0.509  1.00 1.27  ? 38  GLU B CD   1  
ATOM 2233  O OE1  . GLU B 1 38  ? -21.045 -2.812  -1.744  1.00 1.96  ? 38  GLU B OE1  1  
ATOM 2234  O OE2  . GLU B 1 38  ? -21.837 -2.685  0.286   1.00 2.16  ? 38  GLU B OE2  1  
ATOM 2235  H H    . GLU B 1 38  ? -19.941 -0.737  -1.916  1.00 0.34  ? 38  GLU B H    1  
ATOM 2236  H HA   . GLU B 1 38  ? -19.421 -0.615  0.875   1.00 0.35  ? 38  GLU B HA   1  
ATOM 2237  H HB2  . GLU B 1 38  ? -18.255 -2.219  -1.382  1.00 0.41  ? 38  GLU B HB2  1  
ATOM 2238  H HB3  . GLU B 1 38  ? -17.580 -2.305  0.237   1.00 0.45  ? 38  GLU B HB3  1  
ATOM 2239  H HG2  . GLU B 1 38  ? -19.193 -4.114  -0.314  1.00 1.15  ? 38  GLU B HG2  1  
ATOM 2240  H HG3  . GLU B 1 38  ? -19.588 -3.185  1.129   1.00 1.30  ? 38  GLU B HG3  1  
ATOM 2241  N N    . PHE B 1 39  ? -17.304 0.727   -1.194  1.00 0.29  ? 39  PHE B N    1  
ATOM 2242  C CA   . PHE B 1 39  ? -16.162 1.606   -1.330  1.00 0.31  ? 39  PHE B CA   1  
ATOM 2243  C C    . PHE B 1 39  ? -16.554 3.013   -0.931  1.00 0.28  ? 39  PHE B C    1  
ATOM 2244  O O    . PHE B 1 39  ? -15.747 3.764   -0.392  1.00 0.27  ? 39  PHE B O    1  
ATOM 2245  C CB   . PHE B 1 39  ? -15.664 1.585   -2.771  1.00 0.53  ? 39  PHE B CB   1  
ATOM 2246  C CG   . PHE B 1 39  ? -14.331 2.239   -2.967  1.00 0.81  ? 39  PHE B CG   1  
ATOM 2247  C CD1  . PHE B 1 39  ? -13.238 1.841   -2.217  1.00 1.78  ? 39  PHE B CD1  1  
ATOM 2248  C CD2  . PHE B 1 39  ? -14.169 3.240   -3.907  1.00 1.76  ? 39  PHE B CD2  1  
ATOM 2249  C CE1  . PHE B 1 39  ? -12.006 2.432   -2.399  1.00 2.66  ? 39  PHE B CE1  1  
ATOM 2250  C CE2  . PHE B 1 39  ? -12.939 3.836   -4.095  1.00 2.61  ? 39  PHE B CE2  1  
ATOM 2251  C CZ   . PHE B 1 39  ? -11.856 3.433   -3.340  1.00 2.87  ? 39  PHE B CZ   1  
ATOM 2252  H H    . PHE B 1 39  ? -17.805 0.476   -2.004  1.00 0.34  ? 39  PHE B H    1  
ATOM 2253  H HA   . PHE B 1 39  ? -15.382 1.254   -0.673  1.00 0.35  ? 39  PHE B HA   1  
ATOM 2254  H HB2  . PHE B 1 39  ? -15.587 0.564   -3.099  1.00 1.23  ? 39  PHE B HB2  1  
ATOM 2255  H HB3  . PHE B 1 39  ? -16.380 2.101   -3.395  1.00 1.41  ? 39  PHE B HB3  1  
ATOM 2256  H HD1  . PHE B 1 39  ? -13.356 1.061   -1.481  1.00 2.31  ? 39  PHE B HD1  1  
ATOM 2257  H HD2  . PHE B 1 39  ? -15.017 3.558   -4.497  1.00 2.30  ? 39  PHE B HD2  1  
ATOM 2258  H HE1  . PHE B 1 39  ? -11.162 2.114   -1.806  1.00 3.51  ? 39  PHE B HE1  1  
ATOM 2259  H HE2  . PHE B 1 39  ? -12.825 4.617   -4.830  1.00 3.44  ? 39  PHE B HE2  1  
ATOM 2260  H HZ   . PHE B 1 39  ? -10.892 3.899   -3.485  1.00 3.69  ? 39  PHE B HZ   1  
ATOM 2261  N N    . LEU B 1 40  ? -17.801 3.357   -1.203  1.00 0.33  ? 40  LEU B N    1  
ATOM 2262  C CA   . LEU B 1 40  ? -18.347 4.634   -0.791  1.00 0.37  ? 40  LEU B CA   1  
ATOM 2263  C C    . LEU B 1 40  ? -18.308 4.730   0.725   1.00 0.40  ? 40  LEU B C    1  
ATOM 2264  O O    . LEU B 1 40  ? -17.783 5.688   1.292   1.00 0.43  ? 40  LEU B O    1  
ATOM 2265  C CB   . LEU B 1 40  ? -19.785 4.786   -1.288  1.00 0.43  ? 40  LEU B CB   1  
ATOM 2266  C CG   . LEU B 1 40  ? -19.996 4.591   -2.793  1.00 0.50  ? 40  LEU B CG   1  
ATOM 2267  C CD1  . LEU B 1 40  ? -21.305 5.217   -3.243  1.00 1.07  ? 40  LEU B CD1  1  
ATOM 2268  C CD2  . LEU B 1 40  ? -18.824 5.139   -3.586  1.00 0.46  ? 40  LEU B CD2  1  
ATOM 2269  H H    . LEU B 1 40  ? -18.369 2.736   -1.712  1.00 0.37  ? 40  LEU B H    1  
ATOM 2270  H HA   . LEU B 1 40  ? -17.737 5.416   -1.213  1.00 0.38  ? 40  LEU B HA   1  
ATOM 2271  H HB2  . LEU B 1 40  ? -20.389 4.053   -0.769  1.00 0.65  ? 40  LEU B HB2  1  
ATOM 2272  H HB3  . LEU B 1 40  ? -20.130 5.771   -1.021  1.00 0.47  ? 40  LEU B HB3  1  
ATOM 2273  H HG   . LEU B 1 40  ? -20.059 3.530   -2.996  1.00 0.80  ? 40  LEU B HG   1  
ATOM 2274  H HD11 . LEU B 1 40  ? -22.126 4.761   -2.708  1.00 1.87  ? 40  LEU B HD11 1  
ATOM 2275  H HD12 . LEU B 1 40  ? -21.435 5.057   -4.303  1.00 1.41  ? 40  LEU B HD12 1  
ATOM 2276  H HD13 . LEU B 1 40  ? -21.286 6.277   -3.039  1.00 1.46  ? 40  LEU B HD13 1  
ATOM 2277  H HD21 . LEU B 1 40  ? -19.040 5.071   -4.641  1.00 1.02  ? 40  LEU B HD21 1  
ATOM 2278  H HD22 . LEU B 1 40  ? -17.944 4.548   -3.363  1.00 0.96  ? 40  LEU B HD22 1  
ATOM 2279  H HD23 . LEU B 1 40  ? -18.650 6.168   -3.314  1.00 1.09  ? 40  LEU B HD23 1  
ATOM 2280  N N    . SER B 1 41  ? -18.850 3.709   1.371   1.00 0.42  ? 41  SER B N    1  
ATOM 2281  C CA   . SER B 1 41  ? -18.822 3.613   2.818   1.00 0.52  ? 41  SER B CA   1  
ATOM 2282  C C    . SER B 1 41  ? -17.379 3.562   3.307   1.00 0.45  ? 41  SER B C    1  
ATOM 2283  O O    . SER B 1 41  ? -17.012 4.257   4.252   1.00 0.47  ? 41  SER B O    1  
ATOM 2284  C CB   . SER B 1 41  ? -19.582 2.367   3.272   1.00 0.67  ? 41  SER B CB   1  
ATOM 2285  O OG   . SER B 1 41  ? -20.894 2.347   2.734   1.00 1.40  ? 41  SER B OG   1  
ATOM 2286  H H    . SER B 1 41  ? -19.286 3.001   0.855   1.00 0.42  ? 41  SER B H    1  
ATOM 2287  H HA   . SER B 1 41  ? -19.301 4.491   3.223   1.00 0.60  ? 41  SER B HA   1  
ATOM 2288  H HB2  . SER B 1 41  ? -19.056 1.485   2.938   1.00 1.27  ? 41  SER B HB2  1  
ATOM 2289  H HB3  . SER B 1 41  ? -19.648 2.361   4.350   1.00 1.19  ? 41  SER B HB3  1  
ATOM 2290  H HG   . SER B 1 41  ? -20.867 2.005   1.830   1.00 1.96  ? 41  SER B HG   1  
ATOM 2291  N N    . PHE B 1 42  ? -16.567 2.744   2.639   1.00 0.42  ? 42  PHE B N    1  
ATOM 2292  C CA   . PHE B 1 42  ? -15.146 2.627   2.945   1.00 0.46  ? 42  PHE B CA   1  
ATOM 2293  C C    . PHE B 1 42  ? -14.479 3.984   2.929   1.00 0.29  ? 42  PHE B C    1  
ATOM 2294  O O    . PHE B 1 42  ? -13.933 4.420   3.924   1.00 0.42  ? 42  PHE B O    1  
ATOM 2295  C CB   . PHE B 1 42  ? -14.450 1.723   1.927   1.00 0.80  ? 42  PHE B CB   1  
ATOM 2296  C CG   . PHE B 1 42  ? -12.985 1.541   2.200   1.00 1.89  ? 42  PHE B CG   1  
ATOM 2297  C CD1  . PHE B 1 42  ? -12.550 0.536   3.043   1.00 2.69  ? 42  PHE B CD1  1  
ATOM 2298  C CD2  . PHE B 1 42  ? -12.046 2.383   1.627   1.00 2.77  ? 42  PHE B CD2  1  
ATOM 2299  C CE1  . PHE B 1 42  ? -11.210 0.372   3.313   1.00 3.73  ? 42  PHE B CE1  1  
ATOM 2300  C CE2  . PHE B 1 42  ? -10.702 2.226   1.895   1.00 3.80  ? 42  PHE B CE2  1  
ATOM 2301  C CZ   . PHE B 1 42  ? -10.283 1.218   2.740   1.00 4.13  ? 42  PHE B CZ   1  
ATOM 2302  H H    . PHE B 1 42  ? -16.941 2.193   1.915   1.00 0.44  ? 42  PHE B H    1  
ATOM 2303  H HA   . PHE B 1 42  ? -15.035 2.202   3.931   1.00 0.66  ? 42  PHE B HA   1  
ATOM 2304  H HB2  . PHE B 1 42  ? -14.918 0.743   1.936   1.00 0.53  ? 42  PHE B HB2  1  
ATOM 2305  H HB3  . PHE B 1 42  ? -14.554 2.170   0.943   1.00 1.30  ? 42  PHE B HB3  1  
ATOM 2306  H HD1  . PHE B 1 42  ? -13.274 -0.127  3.492   1.00 2.86  ? 42  PHE B HD1  1  
ATOM 2307  H HD2  . PHE B 1 42  ? -12.375 3.173   0.967   1.00 3.00  ? 42  PHE B HD2  1  
ATOM 2308  H HE1  . PHE B 1 42  ? -10.885 -0.418  3.974   1.00 4.49  ? 42  PHE B HE1  1  
ATOM 2309  H HE2  . PHE B 1 42  ? -9.980  2.888   1.443   1.00 4.59  ? 42  PHE B HE2  1  
ATOM 2310  H HZ   . PHE B 1 42  ? -9.232  1.093   2.952   1.00 5.02  ? 42  PHE B HZ   1  
ATOM 2311  N N    . MET B 1 43  ? -14.527 4.652   1.801   1.00 0.26  ? 43  MET B N    1  
ATOM 2312  C CA   . MET B 1 43  ? -13.824 5.912   1.657   1.00 0.29  ? 43  MET B CA   1  
ATOM 2313  C C    . MET B 1 43  ? -14.362 6.993   2.583   1.00 0.29  ? 43  MET B C    1  
ATOM 2314  O O    . MET B 1 43  ? -13.612 7.855   3.015   1.00 0.37  ? 43  MET B O    1  
ATOM 2315  C CB   . MET B 1 43  ? -13.864 6.404   0.226   1.00 0.38  ? 43  MET B CB   1  
ATOM 2316  C CG   . MET B 1 43  ? -13.002 5.590   -0.726  1.00 0.62  ? 43  MET B CG   1  
ATOM 2317  S SD   . MET B 1 43  ? -12.483 6.525   -2.181  1.00 1.22  ? 43  MET B SD   1  
ATOM 2318  C CE   . MET B 1 43  ? -11.387 7.736   -1.442  1.00 2.25  ? 43  MET B CE   1  
ATOM 2319  H H    . MET B 1 43  ? -15.036 4.281   1.036   1.00 0.29  ? 43  MET B H    1  
ATOM 2320  H HA   . MET B 1 43  ? -12.794 5.729   1.922   1.00 0.35  ? 43  MET B HA   1  
ATOM 2321  H HB2  . MET B 1 43  ? -14.885 6.357   -0.115  1.00 0.75  ? 43  MET B HB2  1  
ATOM 2322  H HB3  . MET B 1 43  ? -13.531 7.428   0.204   1.00 0.69  ? 43  MET B HB3  1  
ATOM 2323  H HG2  . MET B 1 43  ? -12.122 5.260   -0.198  1.00 1.11  ? 43  MET B HG2  1  
ATOM 2324  H HG3  . MET B 1 43  ? -13.567 4.730   -1.051  1.00 1.23  ? 43  MET B HG3  1  
ATOM 2325  H HE1  . MET B 1 43  ? -10.983 8.372   -2.214  1.00 2.63  ? 43  MET B HE1  1  
ATOM 2326  H HE2  . MET B 1 43  ? -10.580 7.228   -0.935  1.00 2.66  ? 43  MET B HE2  1  
ATOM 2327  H HE3  . MET B 1 43  ? -11.937 8.336   -0.733  1.00 2.85  ? 43  MET B HE3  1  
ATOM 2328  N N    . ASN B 1 44  ? -15.646 6.965   2.898   1.00 0.29  ? 44  ASN B N    1  
ATOM 2329  C CA   . ASN B 1 44  ? -16.192 7.967   3.807   1.00 0.33  ? 44  ASN B CA   1  
ATOM 2330  C C    . ASN B 1 44  ? -15.845 7.658   5.258   1.00 0.32  ? 44  ASN B C    1  
ATOM 2331  O O    . ASN B 1 44  ? -15.981 8.516   6.126   1.00 0.39  ? 44  ASN B O    1  
ATOM 2332  C CB   . ASN B 1 44  ? -17.705 8.103   3.681   1.00 0.42  ? 44  ASN B CB   1  
ATOM 2333  C CG   . ASN B 1 44  ? -18.139 8.934   2.490   1.00 1.05  ? 44  ASN B CG   1  
ATOM 2334  O OD1  . ASN B 1 44  ? -18.154 10.164  2.550   1.00 1.53  ? 44  ASN B OD1  1  
ATOM 2335  N ND2  . ASN B 1 44  ? -18.533 8.276   1.417   1.00 1.83  ? 44  ASN B ND2  1  
ATOM 2336  H H    . ASN B 1 44  ? -16.234 6.277   2.511   1.00 0.30  ? 44  ASN B H    1  
ATOM 2337  H HA   . ASN B 1 44  ? -15.741 8.913   3.544   1.00 0.37  ? 44  ASN B HA   1  
ATOM 2338  H HB2  . ASN B 1 44  ? -18.136 7.123   3.590   1.00 1.03  ? 44  ASN B HB2  1  
ATOM 2339  H HB3  . ASN B 1 44  ? -18.078 8.572   4.572   1.00 0.89  ? 44  ASN B HB3  1  
ATOM 2340  H HD21 . ASN B 1 44  ? -18.521 7.291   1.445   1.00 1.98  ? 44  ASN B HD21 1  
ATOM 2341  H HD22 . ASN B 1 44  ? -18.825 8.791   0.639   1.00 2.46  ? 44  ASN B HD22 1  
ATOM 2342  N N    . THR B 1 45  ? -15.421 6.432   5.529   1.00 0.27  ? 45  THR B N    1  
ATOM 2343  C CA   . THR B 1 45  ? -15.040 6.056   6.890   1.00 0.29  ? 45  THR B CA   1  
ATOM 2344  C C    . THR B 1 45  ? -13.532 5.957   7.041   1.00 0.28  ? 45  THR B C    1  
ATOM 2345  O O    . THR B 1 45  ? -12.907 6.713   7.787   1.00 0.34  ? 45  THR B O    1  
ATOM 2346  C CB   . THR B 1 45  ? -15.656 4.706   7.305   1.00 0.30  ? 45  THR B CB   1  
ATOM 2347  O OG1  . THR B 1 45  ? -15.479 3.739   6.262   1.00 0.34  ? 45  THR B OG1  1  
ATOM 2348  C CG2  . THR B 1 45  ? -17.134 4.854   7.616   1.00 0.34  ? 45  THR B CG2  1  
ATOM 2349  H H    . THR B 1 45  ? -15.359 5.767   4.801   1.00 0.24  ? 45  THR B H    1  
ATOM 2350  H HA   . THR B 1 45  ? -15.409 6.817   7.561   1.00 0.33  ? 45  THR B HA   1  
ATOM 2351  H HB   . THR B 1 45  ? -15.143 4.357   8.192   1.00 0.30  ? 45  THR B HB   1  
ATOM 2352  H HG1  . THR B 1 45  ? -16.118 3.913   5.554   1.00 1.03  ? 45  THR B HG1  1  
ATOM 2353  H HG21 . THR B 1 45  ? -17.649 5.220   6.740   1.00 1.04  ? 45  THR B HG21 1  
ATOM 2354  H HG22 . THR B 1 45  ? -17.264 5.551   8.430   1.00 1.14  ? 45  THR B HG22 1  
ATOM 2355  H HG23 . THR B 1 45  ? -17.539 3.892   7.896   1.00 1.05  ? 45  THR B HG23 1  
ATOM 2356  N N    . GLU B 1 46  ? -12.966 5.038   6.290   1.00 0.23  ? 46  GLU B N    1  
ATOM 2357  C CA   . GLU B 1 46  ? -11.569 4.689   6.386   1.00 0.25  ? 46  GLU B CA   1  
ATOM 2358  C C    . GLU B 1 46  ? -10.698 5.715   5.667   1.00 0.25  ? 46  GLU B C    1  
ATOM 2359  O O    . GLU B 1 46  ? -9.500  5.774   5.883   1.00 0.34  ? 46  GLU B O    1  
ATOM 2360  C CB   . GLU B 1 46  ? -11.348 3.301   5.787   1.00 0.29  ? 46  GLU B CB   1  
ATOM 2361  C CG   . GLU B 1 46  ? -12.270 2.228   6.351   1.00 0.57  ? 46  GLU B CG   1  
ATOM 2362  C CD   . GLU B 1 46  ? -12.022 1.936   7.818   1.00 1.17  ? 46  GLU B CD   1  
ATOM 2363  O OE1  . GLU B 1 46  ? -11.177 1.072   8.125   1.00 1.70  ? 46  GLU B OE1  1  
ATOM 2364  O OE2  . GLU B 1 46  ? -12.687 2.553   8.675   1.00 1.68  ? 46  GLU B OE2  1  
ATOM 2365  H H    . GLU B 1 46  ? -13.520 4.565   5.631   1.00 0.20  ? 46  GLU B H    1  
ATOM 2366  H HA   . GLU B 1 46  ? -11.305 4.664   7.430   1.00 0.28  ? 46  GLU B HA   1  
ATOM 2367  H HB2  . GLU B 1 46  ? -11.504 3.355   4.725   1.00 0.43  ? 46  GLU B HB2  1  
ATOM 2368  H HB3  . GLU B 1 46  ? -10.335 3.001   5.972   1.00 0.54  ? 46  GLU B HB3  1  
ATOM 2369  H HG2  . GLU B 1 46  ? -13.292 2.558   6.237   1.00 0.66  ? 46  GLU B HG2  1  
ATOM 2370  H HG3  . GLU B 1 46  ? -12.125 1.317   5.788   1.00 0.71  ? 46  GLU B HG3  1  
ATOM 2371  N N    . LEU B 1 47  ? -11.292 6.517   4.800   1.00 0.25  ? 47  LEU B N    1  
ATOM 2372  C CA   . LEU B 1 47  ? -10.525 7.532   4.093   1.00 0.26  ? 47  LEU B CA   1  
ATOM 2373  C C    . LEU B 1 47  ? -11.229 8.869   4.128   1.00 0.28  ? 47  LEU B C    1  
ATOM 2374  O O    . LEU B 1 47  ? -11.086 9.681   3.216   1.00 0.30  ? 47  LEU B O    1  
ATOM 2375  C CB   . LEU B 1 47  ? -10.281 7.119   2.648   1.00 0.26  ? 47  LEU B CB   1  
ATOM 2376  C CG   . LEU B 1 47  ? -9.472  5.841   2.475   1.00 0.27  ? 47  LEU B CG   1  
ATOM 2377  C CD1  . LEU B 1 47  ? -9.417  5.451   1.012   1.00 0.32  ? 47  LEU B CD1  1  
ATOM 2378  C CD2  . LEU B 1 47  ? -8.072  6.028   3.038   1.00 0.28  ? 47  LEU B CD2  1  
ATOM 2379  H H    . LEU B 1 47  ? -12.252 6.423   4.628   1.00 0.29  ? 47  LEU B H    1  
ATOM 2380  H HA   . LEU B 1 47  ? -9.574  7.633   4.592   1.00 0.29  ? 47  LEU B HA   1  
ATOM 2381  H HB2  . LEU B 1 47  ? -11.236 6.992   2.162   1.00 0.27  ? 47  LEU B HB2  1  
ATOM 2382  H HB3  . LEU B 1 47  ? -9.749  7.920   2.160   1.00 0.27  ? 47  LEU B HB3  1  
ATOM 2383  H HG   . LEU B 1 47  ? -9.951  5.040   3.019   1.00 0.29  ? 47  LEU B HG   1  
ATOM 2384  H HD11 . LEU B 1 47  ? -9.001  6.265   0.438   1.00 1.00  ? 47  LEU B HD11 1  
ATOM 2385  H HD12 . LEU B 1 47  ? -10.415 5.235   0.663   1.00 0.94  ? 47  LEU B HD12 1  
ATOM 2386  H HD13 . LEU B 1 47  ? -8.798  4.574   0.897   1.00 0.95  ? 47  LEU B HD13 1  
ATOM 2387  H HD21 . LEU B 1 47  ? -7.573  6.824   2.504   1.00 0.92  ? 47  LEU B HD21 1  
ATOM 2388  H HD22 . LEU B 1 47  ? -7.511  5.113   2.930   1.00 1.01  ? 47  LEU B HD22 1  
ATOM 2389  H HD23 . LEU B 1 47  ? -8.140  6.288   4.086   1.00 1.12  ? 47  LEU B HD23 1  
ATOM 2390  N N    . ALA B 1 48  ? -12.008 9.084   5.176   1.00 0.32  ? 48  ALA B N    1  
ATOM 2391  C CA   . ALA B 1 48  ? -12.722 10.334  5.348   1.00 0.37  ? 48  ALA B CA   1  
ATOM 2392  C C    . ALA B 1 48  ? -11.760 11.515  5.383   1.00 0.39  ? 48  ALA B C    1  
ATOM 2393  O O    . ALA B 1 48  ? -12.128 12.631  5.029   1.00 0.44  ? 48  ALA B O    1  
ATOM 2394  C CB   . ALA B 1 48  ? -13.562 10.275  6.606   1.00 0.41  ? 48  ALA B CB   1  
ATOM 2395  H H    . ALA B 1 48  ? -12.117 8.376   5.844   1.00 0.34  ? 48  ALA B H    1  
ATOM 2396  H HA   . ALA B 1 48  ? -13.385 10.453  4.505   1.00 0.39  ? 48  ALA B HA   1  
ATOM 2397  H HB1  . ALA B 1 48  ? -12.918 10.181  7.466   1.00 1.06  ? 48  ALA B HB1  1  
ATOM 2398  H HB2  . ALA B 1 48  ? -14.221 9.417   6.552   1.00 1.14  ? 48  ALA B HB2  1  
ATOM 2399  H HB3  . ALA B 1 48  ? -14.152 11.177  6.689   1.00 1.02  ? 48  ALA B HB3  1  
ATOM 2400  N N    . ALA B 1 49  ? -10.521 11.248  5.784   1.00 0.38  ? 49  ALA B N    1  
ATOM 2401  C CA   . ALA B 1 49  ? -9.469  12.255  5.769   1.00 0.41  ? 49  ALA B CA   1  
ATOM 2402  C C    . ALA B 1 49  ? -9.300  12.831  4.371   1.00 0.41  ? 49  ALA B C    1  
ATOM 2403  O O    . ALA B 1 49  ? -9.150  14.039  4.197   1.00 0.47  ? 49  ALA B O    1  
ATOM 2404  C CB   . ALA B 1 49  ? -8.162  11.641  6.237   1.00 0.44  ? 49  ALA B CB   1  
ATOM 2405  H H    . ALA B 1 49  ? -10.307 10.344  6.098   1.00 0.37  ? 49  ALA B H    1  
ATOM 2406  H HA   . ALA B 1 49  ? -9.741  13.044  6.450   1.00 0.45  ? 49  ALA B HA   1  
ATOM 2407  H HB1  . ALA B 1 49  ? -7.896  10.819  5.580   1.00 1.15  ? 49  ALA B HB1  1  
ATOM 2408  H HB2  . ALA B 1 49  ? -8.279  11.272  7.244   1.00 1.10  ? 49  ALA B HB2  1  
ATOM 2409  H HB3  . ALA B 1 49  ? -7.383  12.387  6.212   1.00 1.07  ? 49  ALA B HB3  1  
ATOM 2410  N N    . PHE B 1 50  ? -9.336  11.951  3.385   1.00 0.36  ? 50  PHE B N    1  
ATOM 2411  C CA   . PHE B 1 50  ? -9.207  12.339  1.990   1.00 0.37  ? 50  PHE B CA   1  
ATOM 2412  C C    . PHE B 1 50  ? -10.564 12.744  1.424   1.00 0.38  ? 50  PHE B C    1  
ATOM 2413  O O    . PHE B 1 50  ? -10.721 13.821  0.849   1.00 0.44  ? 50  PHE B O    1  
ATOM 2414  C CB   . PHE B 1 50  ? -8.649  11.161  1.191   1.00 0.35  ? 50  PHE B CB   1  
ATOM 2415  C CG   . PHE B 1 50  ? -8.398  11.464  -0.260  1.00 0.70  ? 50  PHE B CG   1  
ATOM 2416  C CD1  . PHE B 1 50  ? -7.239  12.114  -0.655  1.00 1.33  ? 50  PHE B CD1  1  
ATOM 2417  C CD2  . PHE B 1 50  ? -9.317  11.093  -1.231  1.00 1.63  ? 50  PHE B CD2  1  
ATOM 2418  C CE1  . PHE B 1 50  ? -7.003  12.390  -1.988  1.00 1.67  ? 50  PHE B CE1  1  
ATOM 2419  C CE2  . PHE B 1 50  ? -9.086  11.369  -2.564  1.00 2.10  ? 50  PHE B CE2  1  
ATOM 2420  C CZ   . PHE B 1 50  ? -7.927  12.018  -2.944  1.00 1.80  ? 50  PHE B CZ   1  
ATOM 2421  H H    . PHE B 1 50  ? -9.451  11.002  3.603   1.00 0.32  ? 50  PHE B H    1  
ATOM 2422  H HA   . PHE B 1 50  ? -8.526  13.172  1.926   1.00 0.41  ? 50  PHE B HA   1  
ATOM 2423  H HB2  . PHE B 1 50  ? -7.715  10.849  1.634   1.00 0.61  ? 50  PHE B HB2  1  
ATOM 2424  H HB3  . PHE B 1 50  ? -9.358  10.344  1.247   1.00 0.56  ? 50  PHE B HB3  1  
ATOM 2425  H HD1  . PHE B 1 50  ? -6.515  12.406  0.092   1.00 2.01  ? 50  PHE B HD1  1  
ATOM 2426  H HD2  . PHE B 1 50  ? -10.224 10.586  -0.935  1.00 2.27  ? 50  PHE B HD2  1  
ATOM 2427  H HE1  . PHE B 1 50  ? -6.096  12.898  -2.282  1.00 2.32  ? 50  PHE B HE1  1  
ATOM 2428  H HE2  . PHE B 1 50  ? -9.811  11.077  -3.309  1.00 2.96  ? 50  PHE B HE2  1  
ATOM 2429  H HZ   . PHE B 1 50  ? -7.744  12.232  -3.985  1.00 2.24  ? 50  PHE B HZ   1  
ATOM 2430  N N    . THR B 1 51  ? -11.534 11.867  1.619   1.00 0.36  ? 51  THR B N    1  
ATOM 2431  C CA   . THR B 1 51  ? -12.866 12.014  1.056   1.00 0.40  ? 51  THR B CA   1  
ATOM 2432  C C    . THR B 1 51  ? -13.540 13.317  1.473   1.00 0.45  ? 51  THR B C    1  
ATOM 2433  O O    . THR B 1 51  ? -14.063 14.053  0.634   1.00 0.53  ? 51  THR B O    1  
ATOM 2434  C CB   . THR B 1 51  ? -13.738 10.831  1.498   1.00 0.39  ? 51  THR B CB   1  
ATOM 2435  O OG1  . THR B 1 51  ? -13.190 9.610   0.993   1.00 0.39  ? 51  THR B OG1  1  
ATOM 2436  C CG2  . THR B 1 51  ? -15.176 10.991  1.033   1.00 0.49  ? 51  THR B CG2  1  
ATOM 2437  H H    . THR B 1 51  ? -11.347 11.073  2.168   1.00 0.36  ? 51  THR B H    1  
ATOM 2438  H HA   . THR B 1 51  ? -12.783 11.986  -0.020  1.00 0.44  ? 51  THR B HA   1  
ATOM 2439  H HB   . THR B 1 51  ? -13.725 10.795  2.577   1.00 0.36  ? 51  THR B HB   1  
ATOM 2440  H HG1  . THR B 1 51  ? -13.089 8.981   1.718   1.00 0.41  ? 51  THR B HG1  1  
ATOM 2441  H HG21 . THR B 1 51  ? -15.627 11.825  1.550   1.00 1.13  ? 51  THR B HG21 1  
ATOM 2442  H HG22 . THR B 1 51  ? -15.729 10.090  1.251   1.00 1.14  ? 51  THR B HG22 1  
ATOM 2443  H HG23 . THR B 1 51  ? -15.191 11.178  -0.029  1.00 1.03  ? 51  THR B HG23 1  
ATOM 2444  N N    . LYS B 1 52  ? -13.521 13.608  2.765   1.00 0.47  ? 52  LYS B N    1  
ATOM 2445  C CA   . LYS B 1 52  ? -14.220 14.776  3.281   1.00 0.60  ? 52  LYS B CA   1  
ATOM 2446  C C    . LYS B 1 52  ? -13.415 16.039  3.011   1.00 0.69  ? 52  LYS B C    1  
ATOM 2447  O O    . LYS B 1 52  ? -13.937 17.149  3.080   1.00 0.84  ? 52  LYS B O    1  
ATOM 2448  C CB   . LYS B 1 52  ? -14.477 14.634  4.782   1.00 0.70  ? 52  LYS B CB   1  
ATOM 2449  C CG   . LYS B 1 52  ? -15.240 13.372  5.163   1.00 0.78  ? 52  LYS B CG   1  
ATOM 2450  C CD   . LYS B 1 52  ? -16.649 13.360  4.591   1.00 1.07  ? 52  LYS B CD   1  
ATOM 2451  C CE   . LYS B 1 52  ? -17.434 12.154  5.085   1.00 1.24  ? 52  LYS B CE   1  
ATOM 2452  N NZ   . LYS B 1 52  ? -18.801 12.101  4.509   1.00 1.82  ? 52  LYS B NZ   1  
ATOM 2453  H H    . LYS B 1 52  ? -13.017 13.033  3.384   1.00 0.45  ? 52  LYS B H    1  
ATOM 2454  H HA   . LYS B 1 52  ? -15.167 14.846  2.766   1.00 0.65  ? 52  LYS B HA   1  
ATOM 2455  H HB2  . LYS B 1 52  ? -13.526 14.621  5.296   1.00 0.71  ? 52  LYS B HB2  1  
ATOM 2456  H HB3  . LYS B 1 52  ? -15.045 15.487  5.120   1.00 0.79  ? 52  LYS B HB3  1  
ATOM 2457  H HG2  . LYS B 1 52  ? -14.704 12.516  4.779   1.00 1.34  ? 52  LYS B HG2  1  
ATOM 2458  H HG3  . LYS B 1 52  ? -15.296 13.310  6.239   1.00 1.23  ? 52  LYS B HG3  1  
ATOM 2459  H HD2  . LYS B 1 52  ? -17.159 14.260  4.896   1.00 1.64  ? 52  LYS B HD2  1  
ATOM 2460  H HD3  . LYS B 1 52  ? -16.589 13.323  3.513   1.00 1.63  ? 52  LYS B HD3  1  
ATOM 2461  H HE2  . LYS B 1 52  ? -16.902 11.256  4.807   1.00 1.50  ? 52  LYS B HE2  1  
ATOM 2462  H HE3  . LYS B 1 52  ? -17.508 12.207  6.161   1.00 1.67  ? 52  LYS B HE3  1  
ATOM 2463  H HZ1  . LYS B 1 52  ? -19.334 11.310  4.925   1.00 2.15  ? 52  LYS B HZ1  1  
ATOM 2464  H HZ2  . LYS B 1 52  ? -18.753 11.961  3.479   1.00 2.33  ? 52  LYS B HZ2  1  
ATOM 2465  H HZ3  . LYS B 1 52  ? -19.312 12.986  4.705   1.00 2.24  ? 52  LYS B HZ3  1  
ATOM 2466  N N    . ASN B 1 53  ? -12.142 15.854  2.692   1.00 0.68  ? 53  ASN B N    1  
ATOM 2467  C CA   . ASN B 1 53  ? -11.252 16.973  2.421   1.00 0.85  ? 53  ASN B CA   1  
ATOM 2468  C C    . ASN B 1 53  ? -11.345 17.385  0.956   1.00 1.00  ? 53  ASN B C    1  
ATOM 2469  O O    . ASN B 1 53  ? -10.867 18.448  0.563   1.00 1.22  ? 53  ASN B O    1  
ATOM 2470  C CB   . ASN B 1 53  ? -9.810  16.598  2.772   1.00 0.92  ? 53  ASN B CB   1  
ATOM 2471  C CG   . ASN B 1 53  ? -8.843  17.770  2.695   1.00 1.40  ? 53  ASN B CG   1  
ATOM 2472  O OD1  . ASN B 1 53  ? -9.203  18.919  2.968   1.00 1.93  ? 53  ASN B OD1  1  
ATOM 2473  N ND2  . ASN B 1 53  ? -7.603  17.486  2.327   1.00 2.05  ? 53  ASN B ND2  1  
ATOM 2474  H H    . ASN B 1 53  ? -11.793 14.940  2.634   1.00 0.63  ? 53  ASN B H    1  
ATOM 2475  H HA   . ASN B 1 53  ? -11.561 17.797  3.039   1.00 0.95  ? 53  ASN B HA   1  
ATOM 2476  H HB2  . ASN B 1 53  ? -9.786  16.204  3.776   1.00 1.05  ? 53  ASN B HB2  1  
ATOM 2477  H HB3  . ASN B 1 53  ? -9.474  15.836  2.087   1.00 1.23  ? 53  ASN B HB3  1  
ATOM 2478  H HD21 . ASN B 1 53  ? -7.381  16.552  2.129   1.00 2.35  ? 53  ASN B HD21 1  
ATOM 2479  H HD22 . ASN B 1 53  ? -6.957  18.220  2.270   1.00 2.52  ? 53  ASN B HD22 1  
ATOM 2480  N N    . GLN B 1 54  ? -11.964 16.531  0.149   1.00 1.01  ? 54  GLN B N    1  
ATOM 2481  C CA   . GLN B 1 54  ? -12.140 16.818  -1.264  1.00 1.29  ? 54  GLN B CA   1  
ATOM 2482  C C    . GLN B 1 54  ? -13.210 17.893  -1.450  1.00 1.33  ? 54  GLN B C    1  
ATOM 2483  O O    . GLN B 1 54  ? -12.884 19.075  -1.571  1.00 2.05  ? 54  GLN B O    1  
ATOM 2484  C CB   . GLN B 1 54  ? -12.504 15.541  -2.033  1.00 1.74  ? 54  GLN B CB   1  
ATOM 2485  C CG   . GLN B 1 54  ? -12.550 15.726  -3.542  1.00 2.17  ? 54  GLN B CG   1  
ATOM 2486  C CD   . GLN B 1 54  ? -11.226 16.193  -4.116  1.00 2.39  ? 54  GLN B CD   1  
ATOM 2487  O OE1  . GLN B 1 54  ? -10.158 15.881  -3.588  1.00 2.90  ? 54  GLN B OE1  1  
ATOM 2488  N NE2  . GLN B 1 54  ? -11.285 16.950  -5.197  1.00 2.71  ? 54  GLN B NE2  1  
ATOM 2489  H H    . GLN B 1 54  ? -12.308 15.690  0.515   1.00 0.93  ? 54  GLN B H    1  
ATOM 2490  H HA   . GLN B 1 54  ? -11.202 17.198  -1.640  1.00 1.53  ? 54  GLN B HA   1  
ATOM 2491  H HB2  . GLN B 1 54  ? -11.770 14.781  -1.810  1.00 2.09  ? 54  GLN B HB2  1  
ATOM 2492  H HB3  . GLN B 1 54  ? -13.473 15.200  -1.704  1.00 2.20  ? 54  GLN B HB3  1  
ATOM 2493  H HG2  . GLN B 1 54  ? -12.808 14.784  -3.999  1.00 2.68  ? 54  GLN B HG2  1  
ATOM 2494  H HG3  . GLN B 1 54  ? -13.307 16.458  -3.778  1.00 2.59  ? 54  GLN B HG3  1  
ATOM 2495  H HE21 . GLN B 1 54  ? -12.168 17.166  -5.566  1.00 2.93  ? 54  GLN B HE21 1  
ATOM 2496  H HE22 . GLN B 1 54  ? -10.440 17.260  -5.593  1.00 3.06  ? 54  GLN B HE22 1  
ATOM 2497  N N    . LYS B 1 55  ? -14.479 17.480  -1.445  1.00 1.43  ? 55  LYS B N    1  
ATOM 2498  C CA   . LYS B 1 55  ? -15.608 18.409  -1.545  1.00 1.87  ? 55  LYS B CA   1  
ATOM 2499  C C    . LYS B 1 55  ? -16.932 17.652  -1.597  1.00 1.59  ? 55  LYS B C    1  
ATOM 2500  O O    . LYS B 1 55  ? -17.870 17.976  -0.871  1.00 2.27  ? 55  LYS B O    1  
ATOM 2501  C CB   . LYS B 1 55  ? -15.486 19.333  -2.772  1.00 2.84  ? 55  LYS B CB   1  
ATOM 2502  C CG   . LYS B 1 55  ? -15.295 18.605  -4.095  1.00 3.60  ? 55  LYS B CG   1  
ATOM 2503  C CD   . LYS B 1 55  ? -15.237 19.574  -5.266  1.00 4.28  ? 55  LYS B CD   1  
ATOM 2504  C CE   . LYS B 1 55  ? -16.542 20.338  -5.435  1.00 5.02  ? 55  LYS B CE   1  
ATOM 2505  N NZ   . LYS B 1 55  ? -16.503 21.249  -6.608  1.00 5.58  ? 55  LYS B NZ   1  
ATOM 2506  H H    . LYS B 1 55  ? -14.665 16.521  -1.360  1.00 1.82  ? 55  LYS B H    1  
ATOM 2507  H HA   . LYS B 1 55  ? -15.601 19.018  -0.653  1.00 2.27  ? 55  LYS B HA   1  
ATOM 2508  H HB2  . LYS B 1 55  ? -16.384 19.927  -2.843  1.00 3.16  ? 55  LYS B HB2  1  
ATOM 2509  H HB3  . LYS B 1 55  ? -14.644 19.993  -2.625  1.00 3.23  ? 55  LYS B HB3  1  
ATOM 2510  H HG2  . LYS B 1 55  ? -14.373 18.050  -4.057  1.00 4.06  ? 55  LYS B HG2  1  
ATOM 2511  H HG3  . LYS B 1 55  ? -16.121 17.924  -4.244  1.00 3.78  ? 55  LYS B HG3  1  
ATOM 2512  H HD2  . LYS B 1 55  ? -14.439 20.280  -5.095  1.00 4.58  ? 55  LYS B HD2  1  
ATOM 2513  H HD3  . LYS B 1 55  ? -15.037 19.017  -6.170  1.00 4.44  ? 55  LYS B HD3  1  
ATOM 2514  H HE2  . LYS B 1 55  ? -17.345 19.628  -5.568  1.00 5.05  ? 55  LYS B HE2  1  
ATOM 2515  H HE3  . LYS B 1 55  ? -16.721 20.920  -4.543  1.00 5.52  ? 55  LYS B HE3  1  
ATOM 2516  H HZ1  . LYS B 1 55  ? -15.721 21.930  -6.507  1.00 5.86  ? 55  LYS B HZ1  1  
ATOM 2517  H HZ2  . LYS B 1 55  ? -17.394 21.776  -6.681  1.00 5.76  ? 55  LYS B HZ2  1  
ATOM 2518  H HZ3  . LYS B 1 55  ? -16.361 20.705  -7.483  1.00 5.87  ? 55  LYS B HZ3  1  
ATOM 2519  N N    . ASP B 1 56  ? -17.000 16.640  -2.449  1.00 1.36  ? 56  ASP B N    1  
ATOM 2520  C CA   . ASP B 1 56  ? -18.229 15.882  -2.641  1.00 1.50  ? 56  ASP B CA   1  
ATOM 2521  C C    . ASP B 1 56  ? -17.903 14.414  -2.904  1.00 1.27  ? 56  ASP B C    1  
ATOM 2522  O O    . ASP B 1 56  ? -16.855 14.098  -3.464  1.00 1.44  ? 56  ASP B O    1  
ATOM 2523  C CB   . ASP B 1 56  ? -19.031 16.468  -3.813  1.00 2.13  ? 56  ASP B CB   1  
ATOM 2524  C CG   . ASP B 1 56  ? -18.448 16.118  -5.169  1.00 2.84  ? 56  ASP B CG   1  
ATOM 2525  O OD1  . ASP B 1 56  ? -17.411 16.697  -5.550  1.00 3.39  ? 56  ASP B OD1  1  
ATOM 2526  O OD2  . ASP B 1 56  ? -19.028 15.254  -5.862  1.00 3.44  ? 56  ASP B OD2  1  
ATOM 2527  H H    . ASP B 1 56  ? -16.207 16.393  -2.968  1.00 1.71  ? 56  ASP B H    1  
ATOM 2528  H HA   . ASP B 1 56  ? -18.814 15.957  -1.737  1.00 1.84  ? 56  ASP B HA   1  
ATOM 2529  H HB2  . ASP B 1 56  ? -20.042 16.092  -3.771  1.00 2.43  ? 56  ASP B HB2  1  
ATOM 2530  H HB3  . ASP B 1 56  ? -19.051 17.544  -3.719  1.00 2.59  ? 56  ASP B HB3  1  
ATOM 2531  N N    . PRO B 1 57  ? -18.807 13.499  -2.497  1.00 1.06  ? 57  PRO B N    1  
ATOM 2532  C CA   . PRO B 1 57  ? -18.606 12.041  -2.613  1.00 1.02  ? 57  PRO B CA   1  
ATOM 2533  C C    . PRO B 1 57  ? -18.525 11.553  -4.054  1.00 0.76  ? 57  PRO B C    1  
ATOM 2534  O O    . PRO B 1 57  ? -18.250 10.378  -4.301  1.00 0.70  ? 57  PRO B O    1  
ATOM 2535  C CB   . PRO B 1 57  ? -19.842 11.454  -1.928  1.00 1.20  ? 57  PRO B CB   1  
ATOM 2536  C CG   . PRO B 1 57  ? -20.863 12.529  -2.025  1.00 1.20  ? 57  PRO B CG   1  
ATOM 2537  C CD   . PRO B 1 57  ? -20.103 13.812  -1.872  1.00 1.14  ? 57  PRO B CD   1  
ATOM 2538  H HA   . PRO B 1 57  ? -17.719 11.724  -2.086  1.00 1.22  ? 57  PRO B HA   1  
ATOM 2539  H HB2  . PRO B 1 57  ? -20.156 10.560  -2.449  1.00 1.21  ? 57  PRO B HB2  1  
ATOM 2540  H HB3  . PRO B 1 57  ? -19.612 11.218  -0.900  1.00 1.44  ? 57  PRO B HB3  1  
ATOM 2541  H HG2  . PRO B 1 57  ? -21.345 12.491  -2.992  1.00 1.14  ? 57  PRO B HG2  1  
ATOM 2542  H HG3  . PRO B 1 57  ? -21.589 12.425  -1.233  1.00 1.39  ? 57  PRO B HG3  1  
ATOM 2543  H HD2  . PRO B 1 57  ? -20.602 14.614  -2.395  1.00 1.16  ? 57  PRO B HD2  1  
ATOM 2544  H HD3  . PRO B 1 57  ? -19.978 14.056  -0.829  1.00 1.29  ? 57  PRO B HD3  1  
ATOM 2545  N N    . GLY B 1 58  ? -18.755 12.455  -5.000  1.00 0.67  ? 58  GLY B N    1  
ATOM 2546  C CA   . GLY B 1 58  ? -18.607 12.115  -6.399  1.00 0.56  ? 58  GLY B CA   1  
ATOM 2547  C C    . GLY B 1 58  ? -17.173 11.775  -6.735  1.00 0.49  ? 58  GLY B C    1  
ATOM 2548  O O    . GLY B 1 58  ? -16.891 11.168  -7.763  1.00 0.48  ? 58  GLY B O    1  
ATOM 2549  H H    . GLY B 1 58  ? -19.022 13.364  -4.744  1.00 0.74  ? 58  GLY B H    1  
ATOM 2550  H HA2  . GLY B 1 58  ? -19.236 11.267  -6.626  1.00 0.57  ? 58  GLY B HA2  1  
ATOM 2551  H HA3  . GLY B 1 58  ? -18.915 12.955  -6.999  1.00 0.60  ? 58  GLY B HA3  1  
ATOM 2552  N N    . VAL B 1 59  ? -16.263 12.169  -5.858  1.00 0.52  ? 59  VAL B N    1  
ATOM 2553  C CA   . VAL B 1 59  ? -14.863 11.827  -6.013  1.00 0.52  ? 59  VAL B CA   1  
ATOM 2554  C C    . VAL B 1 59  ? -14.655 10.331  -5.886  1.00 0.49  ? 59  VAL B C    1  
ATOM 2555  O O    . VAL B 1 59  ? -13.880 9.748   -6.634  1.00 0.49  ? 59  VAL B O    1  
ATOM 2556  C CB   . VAL B 1 59  ? -13.976 12.550  -4.980  1.00 0.61  ? 59  VAL B CB   1  
ATOM 2557  C CG1  . VAL B 1 59  ? -14.449 12.264  -3.563  1.00 0.65  ? 59  VAL B CG1  1  
ATOM 2558  C CG2  . VAL B 1 59  ? -12.522 12.138  -5.145  1.00 0.66  ? 59  VAL B CG2  1  
ATOM 2559  H H    . VAL B 1 59  ? -16.543 12.715  -5.091  1.00 0.58  ? 59  VAL B H    1  
ATOM 2560  H HA   . VAL B 1 59  ? -14.558 12.128  -7.003  1.00 0.53  ? 59  VAL B HA   1  
ATOM 2561  H HB   . VAL B 1 59  ? -14.056 13.608  -5.154  1.00 0.64  ? 59  VAL B HB   1  
ATOM 2562  H HG11 . VAL B 1 59  ? -14.522 11.197  -3.422  1.00 1.19  ? 59  VAL B HG11 1  
ATOM 2563  H HG12 . VAL B 1 59  ? -15.419 12.714  -3.409  1.00 1.14  ? 59  VAL B HG12 1  
ATOM 2564  H HG13 . VAL B 1 59  ? -13.743 12.674  -2.856  1.00 1.29  ? 59  VAL B HG13 1  
ATOM 2565  H HG21 . VAL B 1 59  ? -12.442 11.063  -5.021  1.00 1.21  ? 59  VAL B HG21 1  
ATOM 2566  H HG22 . VAL B 1 59  ? -11.919 12.633  -4.399  1.00 1.26  ? 59  VAL B HG22 1  
ATOM 2567  H HG23 . VAL B 1 59  ? -12.179 12.413  -6.131  1.00 1.19  ? 59  VAL B HG23 1  
ATOM 2568  N N    . LEU B 1 60  ? -15.374 9.710   -4.959  1.00 0.48  ? 60  LEU B N    1  
ATOM 2569  C CA   . LEU B 1 60  ? -15.252 8.275   -4.741  1.00 0.46  ? 60  LEU B CA   1  
ATOM 2570  C C    . LEU B 1 60  ? -15.663 7.548   -6.007  1.00 0.43  ? 60  LEU B C    1  
ATOM 2571  O O    . LEU B 1 60  ? -15.211 6.442   -6.298  1.00 0.41  ? 60  LEU B O    1  
ATOM 2572  C CB   . LEU B 1 60  ? -16.138 7.809   -3.584  1.00 0.48  ? 60  LEU B CB   1  
ATOM 2573  C CG   . LEU B 1 60  ? -16.124 8.704   -2.343  1.00 0.52  ? 60  LEU B CG   1  
ATOM 2574  C CD1  . LEU B 1 60  ? -16.938 8.077   -1.223  1.00 0.51  ? 60  LEU B CD1  1  
ATOM 2575  C CD2  . LEU B 1 60  ? -14.701 8.965   -1.890  1.00 0.52  ? 60  LEU B CD2  1  
ATOM 2576  H H    . LEU B 1 60  ? -15.998 10.232  -4.411  1.00 0.50  ? 60  LEU B H    1  
ATOM 2577  H HA   . LEU B 1 60  ? -14.218 8.058   -4.517  1.00 0.47  ? 60  LEU B HA   1  
ATOM 2578  H HB2  . LEU B 1 60  ? -17.156 7.738   -3.943  1.00 0.51  ? 60  LEU B HB2  1  
ATOM 2579  H HB3  . LEU B 1 60  ? -15.810 6.822   -3.291  1.00 0.49  ? 60  LEU B HB3  1  
ATOM 2580  H HG   . LEU B 1 60  ? -16.574 9.654   -2.591  1.00 0.57  ? 60  LEU B HG   1  
ATOM 2581  H HD11 . LEU B 1 60  ? -16.573 7.081   -1.028  1.00 1.00  ? 60  LEU B HD11 1  
ATOM 2582  H HD12 . LEU B 1 60  ? -17.976 8.030   -1.514  1.00 1.22  ? 60  LEU B HD12 1  
ATOM 2583  H HD13 . LEU B 1 60  ? -16.843 8.675   -0.324  1.00 1.18  ? 60  LEU B HD13 1  
ATOM 2584  H HD21 . LEU B 1 60  ? -14.712 9.565   -0.994  1.00 1.20  ? 60  LEU B HD21 1  
ATOM 2585  H HD22 . LEU B 1 60  ? -14.166 9.486   -2.668  1.00 1.11  ? 60  LEU B HD22 1  
ATOM 2586  H HD23 . LEU B 1 60  ? -14.212 8.025   -1.687  1.00 1.11  ? 60  LEU B HD23 1  
ATOM 2587  N N    . ASP B 1 61  ? -16.518 8.219   -6.758  1.00 0.46  ? 61  ASP B N    1  
ATOM 2588  C CA   . ASP B 1 61  ? -17.003 7.716   -8.034  1.00 0.46  ? 61  ASP B CA   1  
ATOM 2589  C C    . ASP B 1 61  ? -15.877 7.732   -9.049  1.00 0.47  ? 61  ASP B C    1  
ATOM 2590  O O    . ASP B 1 61  ? -15.713 6.808   -9.849  1.00 0.51  ? 61  ASP B O    1  
ATOM 2591  C CB   . ASP B 1 61  ? -18.165 8.578   -8.531  1.00 0.47  ? 61  ASP B CB   1  
ATOM 2592  C CG   . ASP B 1 61  ? -18.821 8.025   -9.780  1.00 0.48  ? 61  ASP B CG   1  
ATOM 2593  O OD1  . ASP B 1 61  ? -19.710 7.159   -9.655  1.00 1.22  ? 61  ASP B OD1  1  
ATOM 2594  O OD2  . ASP B 1 61  ? -18.457 8.457   -10.894 1.00 1.19  ? 61  ASP B OD2  1  
ATOM 2595  H H    . ASP B 1 61  ? -16.820 9.097   -6.442  1.00 0.49  ? 61  ASP B H    1  
ATOM 2596  H HA   . ASP B 1 61  ? -17.336 6.709   -7.893  1.00 0.48  ? 61  ASP B HA   1  
ATOM 2597  H HB2  . ASP B 1 61  ? -18.907 8.649   -7.754  1.00 0.48  ? 61  ASP B HB2  1  
ATOM 2598  H HB3  . ASP B 1 61  ? -17.794 9.568   -8.752  1.00 0.51  ? 61  ASP B HB3  1  
ATOM 2599  N N    . ARG B 1 62  ? -15.091 8.790   -8.981  1.00 0.47  ? 62  ARG B N    1  
ATOM 2600  C CA   . ARG B 1 62  ? -13.958 8.976   -9.866  1.00 0.51  ? 62  ARG B CA   1  
ATOM 2601  C C    . ARG B 1 62  ? -12.846 8.006   -9.498  1.00 0.50  ? 62  ARG B C    1  
ATOM 2602  O O    . ARG B 1 62  ? -12.182 7.446   -10.368 1.00 0.56  ? 62  ARG B O    1  
ATOM 2603  C CB   . ARG B 1 62  ? -13.462 10.416  -9.769  1.00 0.55  ? 62  ARG B CB   1  
ATOM 2604  C CG   . ARG B 1 62  ? -14.580 11.439  -9.896  1.00 0.55  ? 62  ARG B CG   1  
ATOM 2605  C CD   . ARG B 1 62  ? -14.056 12.859  -9.817  1.00 0.62  ? 62  ARG B CD   1  
ATOM 2606  N NE   . ARG B 1 62  ? -13.019 13.118  -10.812 1.00 1.45  ? 62  ARG B NE   1  
ATOM 2607  C CZ   . ARG B 1 62  ? -12.536 14.326  -11.094 1.00 1.97  ? 62  ARG B CZ   1  
ATOM 2608  N NH1  . ARG B 1 62  ? -13.033 15.402  -10.498 1.00 1.66  ? 62  ARG B NH1  1  
ATOM 2609  N NH2  . ARG B 1 62  ? -11.565 14.457  -11.985 1.00 3.02  ? 62  ARG B NH2  1  
ATOM 2610  H H    . ARG B 1 62  ? -15.279 9.474   -8.303  1.00 0.47  ? 62  ARG B H    1  
ATOM 2611  H HA   . ARG B 1 62  ? -14.282 8.776   -10.874 1.00 0.53  ? 62  ARG B HA   1  
ATOM 2612  H HB2  . ARG B 1 62  ? -12.979 10.556  -8.812  1.00 0.60  ? 62  ARG B HB2  1  
ATOM 2613  H HB3  . ARG B 1 62  ? -12.745 10.594  -10.556 1.00 0.59  ? 62  ARG B HB3  1  
ATOM 2614  H HG2  . ARG B 1 62  ? -15.080 11.302  -10.838 1.00 0.56  ? 62  ARG B HG2  1  
ATOM 2615  H HG3  . ARG B 1 62  ? -15.285 11.283  -9.092  1.00 0.56  ? 62  ARG B HG3  1  
ATOM 2616  H HD2  . ARG B 1 62  ? -14.878 13.539  -9.979  1.00 1.11  ? 62  ARG B HD2  1  
ATOM 2617  H HD3  . ARG B 1 62  ? -13.648 13.018  -8.833  1.00 0.98  ? 62  ARG B HD3  1  
ATOM 2618  H HE   . ARG B 1 62  ? -12.649 12.340  -11.291 1.00 1.91  ? 62  ARG B HE   1  
ATOM 2619  H HH11 . ARG B 1 62  ? -13.777 15.314  -9.831  1.00 1.23  ? 62  ARG B HH11 1  
ATOM 2620  H HH12 . ARG B 1 62  ? -12.665 16.310  -10.709 1.00 2.13  ? 62  ARG B HH12 1  
ATOM 2621  H HH21 . ARG B 1 62  ? -11.195 13.647  -12.446 1.00 3.45  ? 62  ARG B HH21 1  
ATOM 2622  H HH22 . ARG B 1 62  ? -11.190 15.364  -12.198 1.00 3.46  ? 62  ARG B HH22 1  
ATOM 2623  N N    . MET B 1 63  ? -12.663 7.808   -8.196  1.00 0.45  ? 63  MET B N    1  
ATOM 2624  C CA   . MET B 1 63  ? -11.674 6.859   -7.696  1.00 0.44  ? 63  MET B CA   1  
ATOM 2625  C C    . MET B 1 63  ? -12.012 5.481   -8.214  1.00 0.41  ? 63  MET B C    1  
ATOM 2626  O O    . MET B 1 63  ? -11.212 4.853   -8.902  1.00 0.42  ? 63  MET B O    1  
ATOM 2627  C CB   . MET B 1 63  ? -11.657 6.801   -6.167  1.00 0.43  ? 63  MET B CB   1  
ATOM 2628  C CG   . MET B 1 63  ? -11.720 8.155   -5.477  1.00 0.49  ? 63  MET B CG   1  
ATOM 2629  S SD   . MET B 1 63  ? -10.227 9.141   -5.707  1.00 0.63  ? 63  MET B SD   1  
ATOM 2630  C CE   . MET B 1 63  ? -9.033  8.176   -4.787  1.00 1.54  ? 63  MET B CE   1  
ATOM 2631  H H    . MET B 1 63  ? -13.208 8.316   -7.558  1.00 0.45  ? 63  MET B H    1  
ATOM 2632  H HA   . MET B 1 63  ? -10.701 7.152   -8.060  1.00 0.47  ? 63  MET B HA   1  
ATOM 2633  H HB2  . MET B 1 63  ? -12.496 6.207   -5.839  1.00 0.39  ? 63  MET B HB2  1  
ATOM 2634  H HB3  . MET B 1 63  ? -10.747 6.309   -5.856  1.00 0.45  ? 63  MET B HB3  1  
ATOM 2635  H HG2  . MET B 1 63  ? -12.556 8.706   -5.875  1.00 0.48  ? 63  MET B HG2  1  
ATOM 2636  H HG3  . MET B 1 63  ? -11.879 7.998   -4.424  1.00 0.54  ? 63  MET B HG3  1  
ATOM 2637  H HE1  . MET B 1 63  ? -9.369  8.067   -3.767  1.00 2.05  ? 63  MET B HE1  1  
ATOM 2638  H HE2  . MET B 1 63  ? -8.079  8.682   -4.797  1.00 2.05  ? 63  MET B HE2  1  
ATOM 2639  H HE3  . MET B 1 63  ? -8.930  7.202   -5.240  1.00 2.14  ? 63  MET B HE3  1  
ATOM 2640  N N    . MET B 1 64  ? -13.226 5.035   -7.886  1.00 0.41  ? 64  MET B N    1  
ATOM 2641  C CA   . MET B 1 64  ? -13.713 3.724   -8.290  1.00 0.42  ? 64  MET B CA   1  
ATOM 2642  C C    . MET B 1 64  ? -13.440 3.460   -9.761  1.00 0.44  ? 64  MET B C    1  
ATOM 2643  O O    . MET B 1 64  ? -12.750 2.519   -10.094 1.00 0.41  ? 64  MET B O    1  
ATOM 2644  C CB   . MET B 1 64  ? -15.214 3.596   -8.010  1.00 0.55  ? 64  MET B CB   1  
ATOM 2645  C CG   . MET B 1 64  ? -15.853 2.353   -8.623  1.00 0.65  ? 64  MET B CG   1  
ATOM 2646  S SD   . MET B 1 64  ? -15.120 0.812   -8.047  1.00 1.87  ? 64  MET B SD   1  
ATOM 2647  C CE   . MET B 1 64  ? -15.560 0.837   -6.314  1.00 2.41  ? 64  MET B CE   1  
ATOM 2648  H H    . MET B 1 64  ? -13.812 5.613   -7.345  1.00 0.42  ? 64  MET B H    1  
ATOM 2649  H HA   . MET B 1 64  ? -13.187 2.984   -7.706  1.00 0.41  ? 64  MET B HA   1  
ATOM 2650  H HB2  . MET B 1 64  ? -15.368 3.563   -6.942  1.00 0.60  ? 64  MET B HB2  1  
ATOM 2651  H HB3  . MET B 1 64  ? -15.715 4.464   -8.410  1.00 0.63  ? 64  MET B HB3  1  
ATOM 2652  H HG2  . MET B 1 64  ? -16.903 2.347   -8.373  1.00 1.29  ? 64  MET B HG2  1  
ATOM 2653  H HG3  . MET B 1 64  ? -15.744 2.406   -9.697  1.00 1.05  ? 64  MET B HG3  1  
ATOM 2654  H HE1  . MET B 1 64  ? -16.632 0.879   -6.218  1.00 2.83  ? 64  MET B HE1  1  
ATOM 2655  H HE2  . MET B 1 64  ? -15.121 1.703   -5.843  1.00 2.83  ? 64  MET B HE2  1  
ATOM 2656  H HE3  . MET B 1 64  ? -15.192 -0.060  -5.836  1.00 2.75  ? 64  MET B HE3  1  
ATOM 2657  N N    . LYS B 1 65  ? -13.934 4.323   -10.634 1.00 0.52  ? 65  LYS B N    1  
ATOM 2658  C CA   . LYS B 1 65  ? -13.854 4.060   -12.069 1.00 0.56  ? 65  LYS B CA   1  
ATOM 2659  C C    . LYS B 1 65  ? -12.426 4.177   -12.600 1.00 0.54  ? 65  LYS B C    1  
ATOM 2660  O O    . LYS B 1 65  ? -12.102 3.616   -13.647 1.00 0.60  ? 65  LYS B O    1  
ATOM 2661  C CB   . LYS B 1 65  ? -14.801 4.971   -12.845 1.00 0.67  ? 65  LYS B CB   1  
ATOM 2662  C CG   . LYS B 1 65  ? -16.270 4.728   -12.526 1.00 0.79  ? 65  LYS B CG   1  
ATOM 2663  C CD   . LYS B 1 65  ? -16.652 3.254   -12.650 1.00 0.86  ? 65  LYS B CD   1  
ATOM 2664  C CE   . LYS B 1 65  ? -16.423 2.714   -14.057 1.00 1.57  ? 65  LYS B CE   1  
ATOM 2665  N NZ   . LYS B 1 65  ? -16.741 1.262   -14.156 1.00 2.49  ? 65  LYS B NZ   1  
ATOM 2666  H H    . LYS B 1 65  ? -14.347 5.156   -10.312 1.00 0.56  ? 65  LYS B H    1  
ATOM 2667  H HA   . LYS B 1 65  ? -14.173 3.039   -12.215 1.00 0.59  ? 65  LYS B HA   1  
ATOM 2668  H HB2  . LYS B 1 65  ? -14.568 5.998   -12.609 1.00 0.75  ? 65  LYS B HB2  1  
ATOM 2669  H HB3  . LYS B 1 65  ? -14.652 4.810   -13.902 1.00 0.66  ? 65  LYS B HB3  1  
ATOM 2670  H HG2  . LYS B 1 65  ? -16.466 5.054   -11.514 1.00 0.86  ? 65  LYS B HG2  1  
ATOM 2671  H HG3  . LYS B 1 65  ? -16.874 5.305   -13.211 1.00 0.89  ? 65  LYS B HG3  1  
ATOM 2672  H HD2  . LYS B 1 65  ? -16.060 2.678   -11.956 1.00 1.29  ? 65  LYS B HD2  1  
ATOM 2673  H HD3  . LYS B 1 65  ? -17.697 3.146   -12.403 1.00 1.25  ? 65  LYS B HD3  1  
ATOM 2674  H HE2  . LYS B 1 65  ? -17.053 3.258   -14.744 1.00 1.92  ? 65  LYS B HE2  1  
ATOM 2675  H HE3  . LYS B 1 65  ? -15.387 2.866   -14.322 1.00 2.11  ? 65  LYS B HE3  1  
ATOM 2676  H HZ1  . LYS B 1 65  ? -16.711 0.955   -15.149 1.00 2.91  ? 65  LYS B HZ1  1  
ATOM 2677  H HZ2  . LYS B 1 65  ? -17.690 1.074   -13.776 1.00 2.86  ? 65  LYS B HZ2  1  
ATOM 2678  H HZ3  . LYS B 1 65  ? -16.044 0.699   -13.614 1.00 3.01  ? 65  LYS B HZ3  1  
ATOM 2679  N N    . LYS B 1 66  ? -11.577 4.906   -11.888 1.00 0.50  ? 66  LYS B N    1  
ATOM 2680  C CA   . LYS B 1 66  ? -10.165 4.988   -12.242 1.00 0.52  ? 66  LYS B CA   1  
ATOM 2681  C C    . LYS B 1 66  ? -9.457  3.686   -11.887 1.00 0.48  ? 66  LYS B C    1  
ATOM 2682  O O    . LYS B 1 66  ? -8.619  3.185   -12.639 1.00 0.54  ? 66  LYS B O    1  
ATOM 2683  C CB   . LYS B 1 66  ? -9.492  6.143   -11.500 1.00 0.55  ? 66  LYS B CB   1  
ATOM 2684  C CG   . LYS B 1 66  ? -7.994  6.228   -11.749 1.00 0.91  ? 66  LYS B CG   1  
ATOM 2685  C CD   . LYS B 1 66  ? -7.361  7.405   -11.018 1.00 0.96  ? 66  LYS B CD   1  
ATOM 2686  C CE   . LYS B 1 66  ? -7.565  7.319   -9.511  1.00 0.73  ? 66  LYS B CE   1  
ATOM 2687  N NZ   . LYS B 1 66  ? -6.891  8.437   -8.799  1.00 1.47  ? 66  LYS B NZ   1  
ATOM 2688  H H    . LYS B 1 66  ? -11.906 5.404   -11.109 1.00 0.50  ? 66  LYS B H    1  
ATOM 2689  H HA   . LYS B 1 66  ? -10.091 5.155   -13.305 1.00 0.58  ? 66  LYS B HA   1  
ATOM 2690  H HB2  . LYS B 1 66  ? -9.944  7.072   -11.810 1.00 0.84  ? 66  LYS B HB2  1  
ATOM 2691  H HB3  . LYS B 1 66  ? -9.649  6.008   -10.437 1.00 0.87  ? 66  LYS B HB3  1  
ATOM 2692  H HG2  . LYS B 1 66  ? -7.533  5.313   -11.407 1.00 1.32  ? 66  LYS B HG2  1  
ATOM 2693  H HG3  . LYS B 1 66  ? -7.825  6.341   -12.810 1.00 1.31  ? 66  LYS B HG3  1  
ATOM 2694  H HD2  . LYS B 1 66  ? -6.301  7.411   -11.225 1.00 1.49  ? 66  LYS B HD2  1  
ATOM 2695  H HD3  . LYS B 1 66  ? -7.805  8.320   -11.380 1.00 1.60  ? 66  LYS B HD3  1  
ATOM 2696  H HE2  . LYS B 1 66  ? -8.622  7.359   -9.300  1.00 1.11  ? 66  LYS B HE2  1  
ATOM 2697  H HE3  . LYS B 1 66  ? -7.162  6.381   -9.156  1.00 0.98  ? 66  LYS B HE3  1  
ATOM 2698  H HZ1  . LYS B 1 66  ? -5.870  8.429   -9.002  1.00 2.03  ? 66  LYS B HZ1  1  
ATOM 2699  H HZ2  . LYS B 1 66  ? -7.026  8.341   -7.773  1.00 1.78  ? 66  LYS B HZ2  1  
ATOM 2700  H HZ3  . LYS B 1 66  ? -7.287  9.351   -9.104  1.00 2.01  ? 66  LYS B HZ3  1  
ATOM 2701  N N    . LEU B 1 67  ? -9.814  3.150   -10.737 1.00 0.41  ? 67  LEU B N    1  
ATOM 2702  C CA   . LEU B 1 67  ? -9.151  1.982   -10.183 1.00 0.39  ? 67  LEU B CA   1  
ATOM 2703  C C    . LEU B 1 67  ? -9.777  0.699   -10.696 1.00 0.40  ? 67  LEU B C    1  
ATOM 2704  O O    . LEU B 1 67  ? -9.098  -0.321  -10.800 1.00 0.46  ? 67  LEU B O    1  
ATOM 2705  C CB   . LEU B 1 67  ? -9.270  2.023   -8.677  1.00 0.34  ? 67  LEU B CB   1  
ATOM 2706  C CG   . LEU B 1 67  ? -8.861  3.347   -8.034  1.00 0.33  ? 67  LEU B CG   1  
ATOM 2707  C CD1  . LEU B 1 67  ? -9.327  3.393   -6.595  1.00 0.30  ? 67  LEU B CD1  1  
ATOM 2708  C CD2  . LEU B 1 67  ? -7.357  3.557   -8.125  1.00 0.37  ? 67  LEU B CD2  1  
ATOM 2709  H H    . LEU B 1 67  ? -10.556 3.556   -10.235 1.00 0.42  ? 67  LEU B H    1  
ATOM 2710  H HA   . LEU B 1 67  ? -8.112  2.012   -10.458 1.00 0.44  ? 67  LEU B HA   1  
ATOM 2711  H HB2  . LEU B 1 67  ? -10.303 1.827   -8.432  1.00 0.34  ? 67  LEU B HB2  1  
ATOM 2712  H HB3  . LEU B 1 67  ? -8.658  1.234   -8.261  1.00 0.35  ? 67  LEU B HB3  1  
ATOM 2713  H HG   . LEU B 1 67  ? -9.342  4.157   -8.563  1.00 0.36  ? 67  LEU B HG   1  
ATOM 2714  H HD11 . LEU B 1 67  ? -8.811  4.185   -6.071  1.00 1.06  ? 67  LEU B HD11 1  
ATOM 2715  H HD12 . LEU B 1 67  ? -9.123  2.442   -6.121  1.00 1.02  ? 67  LEU B HD12 1  
ATOM 2716  H HD13 . LEU B 1 67  ? -10.392 3.581   -6.571  1.00 1.06  ? 67  LEU B HD13 1  
ATOM 2717  H HD21 . LEU B 1 67  ? -7.090  4.477   -7.625  1.00 1.11  ? 67  LEU B HD21 1  
ATOM 2718  H HD22 . LEU B 1 67  ? -7.066  3.616   -9.163  1.00 1.06  ? 67  LEU B HD22 1  
ATOM 2719  H HD23 . LEU B 1 67  ? -6.847  2.730   -7.653  1.00 1.07  ? 67  LEU B HD23 1  
ATOM 2720  N N    . ASP B 1 68  ? -11.081 0.768   -10.971 1.00 0.39  ? 68  ASP B N    1  
ATOM 2721  C CA   . ASP B 1 68  ? -11.861 -0.348  -11.512 1.00 0.42  ? 68  ASP B CA   1  
ATOM 2722  C C    . ASP B 1 68  ? -11.336 -0.720  -12.886 1.00 0.52  ? 68  ASP B C    1  
ATOM 2723  O O    . ASP B 1 68  ? -11.905 -0.396  -13.929 1.00 0.57  ? 68  ASP B O    1  
ATOM 2724  C CB   . ASP B 1 68  ? -13.344 0.040   -11.556 1.00 0.43  ? 68  ASP B CB   1  
ATOM 2725  C CG   . ASP B 1 68  ? -14.230 -0.926  -12.329 1.00 0.46  ? 68  ASP B CG   1  
ATOM 2726  O OD1  . ASP B 1 68  ? -14.301 -2.121  -11.969 1.00 1.23  ? 68  ASP B OD1  1  
ATOM 2727  O OD2  . ASP B 1 68  ? -14.890 -0.478  -13.297 1.00 1.13  ? 68  ASP B OD2  1  
ATOM 2728  H H    . ASP B 1 68  ? -11.550 1.612   -10.787 1.00 0.40  ? 68  ASP B H    1  
ATOM 2729  H HA   . ASP B 1 68  ? -11.735 -1.198  -10.848 1.00 0.41  ? 68  ASP B HA   1  
ATOM 2730  H HB2  . ASP B 1 68  ? -13.713 0.099   -10.542 1.00 0.41  ? 68  ASP B HB2  1  
ATOM 2731  H HB3  . ASP B 1 68  ? -13.427 1.014   -12.015 1.00 0.47  ? 68  ASP B HB3  1  
ATOM 2732  N N    . THR B 1 69  ? -10.208 -1.370  -12.852 1.00 0.58  ? 69  THR B N    1  
ATOM 2733  C CA   . THR B 1 69  ? -9.523  -1.812  -14.032 1.00 0.74  ? 69  THR B CA   1  
ATOM 2734  C C    . THR B 1 69  ? -10.111 -3.139  -14.486 1.00 0.83  ? 69  THR B C    1  
ATOM 2735  O O    . THR B 1 69  ? -9.981  -3.541  -15.644 1.00 0.99  ? 69  THR B O    1  
ATOM 2736  C CB   . THR B 1 69  ? -8.017  -1.933  -13.732 1.00 0.79  ? 69  THR B CB   1  
ATOM 2737  O OG1  . THR B 1 69  ? -7.259  -1.924  -14.950 1.00 0.91  ? 69  THR B OG1  1  
ATOM 2738  C CG2  . THR B 1 69  ? -7.716  -3.207  -12.958 1.00 0.82  ? 69  THR B CG2  1  
ATOM 2739  H H    . THR B 1 69  ? -9.808  -1.554  -11.962 1.00 0.55  ? 69  THR B H    1  
ATOM 2740  H HA   . THR B 1 69  ? -9.667  -1.080  -14.802 1.00 0.80  ? 69  THR B HA   1  
ATOM 2741  H HB   . THR B 1 69  ? -7.733  -1.082  -13.118 1.00 0.76  ? 69  THR B HB   1  
ATOM 2742  H HG1  . THR B 1 69  ? -7.098  -2.835  -15.233 1.00 1.26  ? 69  THR B HG1  1  
ATOM 2743  H HG21 . THR B 1 69  ? -6.687  -3.199  -12.634 1.00 1.41  ? 69  THR B HG21 1  
ATOM 2744  H HG22 . THR B 1 69  ? -7.886  -4.061  -13.596 1.00 1.35  ? 69  THR B HG22 1  
ATOM 2745  H HG23 . THR B 1 69  ? -8.368  -3.266  -12.100 1.00 1.13  ? 69  THR B HG23 1  
ATOM 2746  N N    . ASN B 1 70  ? -10.793 -3.792  -13.557 1.00 0.80  ? 70  ASN B N    1  
ATOM 2747  C CA   . ASN B 1 70  ? -11.502 -5.027  -13.834 1.00 0.94  ? 70  ASN B CA   1  
ATOM 2748  C C    . ASN B 1 70  ? -12.800 -4.716  -14.556 1.00 0.86  ? 70  ASN B C    1  
ATOM 2749  O O    . ASN B 1 70  ? -13.438 -5.584  -15.154 1.00 0.98  ? 70  ASN B O    1  
ATOM 2750  C CB   . ASN B 1 70  ? -11.796 -5.732  -12.518 1.00 1.00  ? 70  ASN B CB   1  
ATOM 2751  C CG   . ASN B 1 70  ? -12.376 -7.121  -12.694 1.00 1.25  ? 70  ASN B CG   1  
ATOM 2752  O OD1  . ASN B 1 70  ? -12.059 -7.827  -13.650 1.00 1.46  ? 70  ASN B OD1  1  
ATOM 2753  N ND2  . ASN B 1 70  ? -13.238 -7.516  -11.771 1.00 1.66  ? 70  ASN B ND2  1  
ATOM 2754  H H    . ASN B 1 70  ? -10.808 -3.430  -12.632 1.00 0.72  ? 70  ASN B H    1  
ATOM 2755  H HA   . ASN B 1 70  ? -10.881 -5.655  -14.454 1.00 1.12  ? 70  ASN B HA   1  
ATOM 2756  H HB2  . ASN B 1 70  ? -10.880 -5.806  -11.962 1.00 1.07  ? 70  ASN B HB2  1  
ATOM 2757  H HB3  . ASN B 1 70  ? -12.501 -5.138  -11.955 1.00 0.89  ? 70  ASN B HB3  1  
ATOM 2758  H HD21 . ASN B 1 70  ? -13.447 -6.898  -11.038 1.00 1.93  ? 70  ASN B HD21 1  
ATOM 2759  H HD22 . ASN B 1 70  ? -13.635 -8.409  -11.858 1.00 1.85  ? 70  ASN B HD22 1  
ATOM 2760  N N    . SER B 1 71  ? -13.155 -3.437  -14.489 1.00 0.70  ? 71  SER B N    1  
ATOM 2761  C CA   . SER B 1 71  ? -14.301 -2.881  -15.188 1.00 0.66  ? 71  SER B CA   1  
ATOM 2762  C C    . SER B 1 71  ? -15.591 -3.585  -14.797 1.00 0.61  ? 71  SER B C    1  
ATOM 2763  O O    . SER B 1 71  ? -16.462 -3.836  -15.634 1.00 0.66  ? 71  SER B O    1  
ATOM 2764  C CB   . SER B 1 71  ? -14.076 -2.945  -16.697 1.00 0.82  ? 71  SER B CB   1  
ATOM 2765  O OG   . SER B 1 71  ? -12.853 -2.315  -17.046 1.00 1.48  ? 71  SER B OG   1  
ATOM 2766  H H    . SER B 1 71  ? -12.622 -2.838  -13.921 1.00 0.65  ? 71  SER B H    1  
ATOM 2767  H HA   . SER B 1 71  ? -14.376 -1.849  -14.890 1.00 0.61  ? 71  SER B HA   1  
ATOM 2768  H HB2  . SER B 1 71  ? -14.038 -3.977  -17.012 1.00 1.18  ? 71  SER B HB2  1  
ATOM 2769  H HB3  . SER B 1 71  ? -14.886 -2.441  -17.203 1.00 1.15  ? 71  SER B HB3  1  
ATOM 2770  H HG   . SER B 1 71  ? -12.388 -2.062  -16.240 1.00 2.03  ? 71  SER B HG   1  
ATOM 2771  N N    . ASP B 1 72  ? -15.710 -3.886  -13.516 1.00 0.58  ? 72  ASP B N    1  
ATOM 2772  C CA   . ASP B 1 72  ? -16.891 -4.552  -12.997 1.00 0.65  ? 72  ASP B CA   1  
ATOM 2773  C C    . ASP B 1 72  ? -17.658 -3.603  -12.089 1.00 0.56  ? 72  ASP B C    1  
ATOM 2774  O O    . ASP B 1 72  ? -18.850 -3.785  -11.836 1.00 0.66  ? 72  ASP B O    1  
ATOM 2775  C CB   . ASP B 1 72  ? -16.499 -5.822  -12.232 1.00 0.80  ? 72  ASP B CB   1  
ATOM 2776  C CG   . ASP B 1 72  ? -17.702 -6.607  -11.744 1.00 0.92  ? 72  ASP B CG   1  
ATOM 2777  O OD1  . ASP B 1 72  ? -18.269 -7.393  -12.535 1.00 1.56  ? 72  ASP B OD1  1  
ATOM 2778  O OD2  . ASP B 1 72  ? -18.090 -6.445  -10.572 1.00 1.53  ? 72  ASP B OD2  1  
ATOM 2779  H H    . ASP B 1 72  ? -14.988 -3.627  -12.894 1.00 0.56  ? 72  ASP B H    1  
ATOM 2780  H HA   . ASP B 1 72  ? -17.517 -4.821  -13.832 1.00 0.76  ? 72  ASP B HA   1  
ATOM 2781  H HB2  . ASP B 1 72  ? -15.918 -6.459  -12.881 1.00 1.15  ? 72  ASP B HB2  1  
ATOM 2782  H HB3  . ASP B 1 72  ? -15.900 -5.548  -11.376 1.00 1.00  ? 72  ASP B HB3  1  
ATOM 2783  N N    . GLY B 1 73  ? -16.977 -2.563  -11.637 1.00 0.45  ? 73  GLY B N    1  
ATOM 2784  C CA   . GLY B 1 73  ? -17.593 -1.611  -10.742 1.00 0.46  ? 73  GLY B CA   1  
ATOM 2785  C C    . GLY B 1 73  ? -17.226 -1.896  -9.306  1.00 0.41  ? 73  GLY B C    1  
ATOM 2786  O O    . GLY B 1 73  ? -17.927 -1.487  -8.376  1.00 0.44  ? 73  GLY B O    1  
ATOM 2787  H H    . GLY B 1 73  ? -16.028 -2.443  -11.906 1.00 0.42  ? 73  GLY B H    1  
ATOM 2788  H HA2  . GLY B 1 73  ? -17.263 -0.616  -11.000 1.00 0.48  ? 73  GLY B HA2  1  
ATOM 2789  H HA3  . GLY B 1 73  ? -18.666 -1.667  -10.847 1.00 0.55  ? 73  GLY B HA3  1  
ATOM 2790  N N    . GLN B 1 74  ? -16.132 -2.622  -9.135  1.00 0.38  ? 74  GLN B N    1  
ATOM 2791  C CA   . GLN B 1 74  ? -15.621 -2.967  -7.825  1.00 0.37  ? 74  GLN B CA   1  
ATOM 2792  C C    . GLN B 1 74  ? -14.112 -2.877  -7.860  1.00 0.36  ? 74  GLN B C    1  
ATOM 2793  O O    . GLN B 1 74  ? -13.514 -2.891  -8.932  1.00 0.39  ? 74  GLN B O    1  
ATOM 2794  C CB   . GLN B 1 74  ? -16.015 -4.388  -7.424  1.00 0.38  ? 74  GLN B CB   1  
ATOM 2795  C CG   . GLN B 1 74  ? -17.494 -4.692  -7.561  1.00 0.41  ? 74  GLN B CG   1  
ATOM 2796  C CD   . GLN B 1 74  ? -17.888 -6.001  -6.912  1.00 0.49  ? 74  GLN B CD   1  
ATOM 2797  O OE1  . GLN B 1 74  ? -17.114 -6.952  -6.874  1.00 1.02  ? 74  GLN B OE1  1  
ATOM 2798  N NE2  . GLN B 1 74  ? -19.099 -6.056  -6.391  1.00 1.25  ? 74  GLN B NE2  1  
ATOM 2799  H H    . GLN B 1 74  ? -15.626 -2.916  -9.922  1.00 0.39  ? 74  GLN B H    1  
ATOM 2800  H HA   . GLN B 1 74  ? -16.011 -2.261  -7.105  1.00 0.39  ? 74  GLN B HA   1  
ATOM 2801  H HB2  . GLN B 1 74  ? -15.463 -5.082  -8.041  1.00 0.39  ? 74  GLN B HB2  1  
ATOM 2802  H HB3  . GLN B 1 74  ? -15.735 -4.543  -6.393  1.00 0.38  ? 74  GLN B HB3  1  
ATOM 2803  H HG2  . GLN B 1 74  ? -18.054 -3.900  -7.099  1.00 0.42  ? 74  GLN B HG2  1  
ATOM 2804  H HG3  . GLN B 1 74  ? -17.738 -4.741  -8.609  1.00 0.44  ? 74  GLN B HG3  1  
ATOM 2805  H HE21 . GLN B 1 74  ? -19.668 -5.258  -6.455  1.00 1.91  ? 74  GLN B HE21 1  
ATOM 2806  H HE22 . GLN B 1 74  ? -19.378 -6.888  -5.941  1.00 1.32  ? 74  GLN B HE22 1  
ATOM 2807  N N    . LEU B 1 75  ? -13.502 -2.800  -6.697  1.00 0.33  ? 75  LEU B N    1  
ATOM 2808  C CA   . LEU B 1 75  ? -12.056 -2.742  -6.617  1.00 0.31  ? 75  LEU B CA   1  
ATOM 2809  C C    . LEU B 1 75  ? -11.501 -3.981  -5.973  1.00 0.32  ? 75  LEU B C    1  
ATOM 2810  O O    . LEU B 1 75  ? -11.767 -4.267  -4.807  1.00 0.32  ? 75  LEU B O    1  
ATOM 2811  C CB   . LEU B 1 75  ? -11.596 -1.519  -5.845  1.00 0.31  ? 75  LEU B CB   1  
ATOM 2812  C CG   . LEU B 1 75  ? -12.061 -0.198  -6.434  1.00 0.32  ? 75  LEU B CG   1  
ATOM 2813  C CD1  . LEU B 1 75  ? -11.454 0.958   -5.668  1.00 0.35  ? 75  LEU B CD1  1  
ATOM 2814  C CD2  . LEU B 1 75  ? -11.699 -0.127  -7.909  1.00 0.35  ? 75  LEU B CD2  1  
ATOM 2815  H H    . LEU B 1 75  ? -14.035 -2.774  -5.877  1.00 0.33  ? 75  LEU B H    1  
ATOM 2816  H HA   . LEU B 1 75  ? -11.676 -2.684  -7.623  1.00 0.33  ? 75  LEU B HA   1  
ATOM 2817  H HB2  . LEU B 1 75  ? -11.962 -1.599  -4.829  1.00 0.33  ? 75  LEU B HB2  1  
ATOM 2818  H HB3  . LEU B 1 75  ? -10.515 -1.521  -5.826  1.00 0.32  ? 75  LEU B HB3  1  
ATOM 2819  H HG   . LEU B 1 75  ? -13.136 -0.130  -6.348  1.00 0.36  ? 75  LEU B HG   1  
ATOM 2820  H HD11 . LEU B 1 75  ? -10.377 0.889   -5.706  1.00 1.08  ? 75  LEU B HD11 1  
ATOM 2821  H HD12 . LEU B 1 75  ? -11.781 0.919   -4.639  1.00 0.98  ? 75  LEU B HD12 1  
ATOM 2822  H HD13 . LEU B 1 75  ? -11.771 1.890   -6.112  1.00 1.09  ? 75  LEU B HD13 1  
ATOM 2823  H HD21 . LEU B 1 75  ? -12.134 -0.968  -8.430  1.00 1.10  ? 75  LEU B HD21 1  
ATOM 2824  H HD22 . LEU B 1 75  ? -10.624 -0.157  -8.020  1.00 1.05  ? 75  LEU B HD22 1  
ATOM 2825  H HD23 . LEU B 1 75  ? -12.079 0.793   -8.331  1.00 1.06  ? 75  LEU B HD23 1  
ATOM 2826  N N    . ASP B 1 76  ? -10.748 -4.721  -6.747  1.00 0.35  ? 76  ASP B N    1  
ATOM 2827  C CA   . ASP B 1 76  ? -10.108 -5.918  -6.260  1.00 0.36  ? 76  ASP B CA   1  
ATOM 2828  C C    . ASP B 1 76  ? -8.853  -5.579  -5.497  1.00 0.33  ? 76  ASP B C    1  
ATOM 2829  O O    . ASP B 1 76  ? -8.495  -4.414  -5.336  1.00 0.32  ? 76  ASP B O    1  
ATOM 2830  C CB   . ASP B 1 76  ? -9.820  -6.878  -7.421  1.00 0.44  ? 76  ASP B CB   1  
ATOM 2831  C CG   . ASP B 1 76  ? -8.357  -6.933  -7.850  1.00 0.91  ? 76  ASP B CG   1  
ATOM 2832  O OD1  . ASP B 1 76  ? -7.780  -5.891  -8.227  1.00 1.44  ? 76  ASP B OD1  1  
ATOM 2833  O OD2  . ASP B 1 76  ? -7.778  -8.041  -7.818  1.00 1.68  ? 76  ASP B OD2  1  
ATOM 2834  H H    . ASP B 1 76  ? -10.627 -4.458  -7.696  1.00 0.41  ? 76  ASP B H    1  
ATOM 2835  H HA   . ASP B 1 76  ? -10.777 -6.406  -5.577  1.00 0.37  ? 76  ASP B HA   1  
ATOM 2836  H HB2  . ASP B 1 76  ? -10.109 -7.873  -7.112  1.00 0.74  ? 76  ASP B HB2  1  
ATOM 2837  H HB3  . ASP B 1 76  ? -10.423 -6.569  -8.278  1.00 0.64  ? 76  ASP B HB3  1  
ATOM 2838  N N    . PHE B 1 77  ? -8.232  -6.623  -5.010  1.00 0.40  ? 77  PHE B N    1  
ATOM 2839  C CA   . PHE B 1 77  ? -6.998  -6.564  -4.269  1.00 0.49  ? 77  PHE B CA   1  
ATOM 2840  C C    . PHE B 1 77  ? -6.028  -5.515  -4.828  1.00 0.39  ? 77  PHE B C    1  
ATOM 2841  O O    . PHE B 1 77  ? -5.632  -4.595  -4.119  1.00 0.38  ? 77  PHE B O    1  
ATOM 2842  C CB   . PHE B 1 77  ? -6.397  -7.950  -4.355  1.00 0.72  ? 77  PHE B CB   1  
ATOM 2843  C CG   . PHE B 1 77  ? -7.263  -9.009  -3.735  1.00 1.75  ? 77  PHE B CG   1  
ATOM 2844  C CD1  . PHE B 1 77  ? -7.278  -9.202  -2.368  1.00 2.56  ? 77  PHE B CD1  1  
ATOM 2845  C CD2  . PHE B 1 77  ? -8.073  -9.804  -4.529  1.00 2.66  ? 77  PHE B CD2  1  
ATOM 2846  C CE1  . PHE B 1 77  ? -8.084  -10.169 -1.800  1.00 3.67  ? 77  PHE B CE1  1  
ATOM 2847  C CE2  . PHE B 1 77  ? -8.882  -10.770 -3.969  1.00 3.77  ? 77  PHE B CE2  1  
ATOM 2848  C CZ   . PHE B 1 77  ? -8.887  -10.954 -2.603  1.00 4.14  ? 77  PHE B CZ   1  
ATOM 2849  H H    . PHE B 1 77  ? -8.629  -7.504  -5.167  1.00 0.47  ? 77  PHE B H    1  
ATOM 2850  H HA   . PHE B 1 77  ? -7.223  -6.338  -3.240  1.00 0.56  ? 77  PHE B HA   1  
ATOM 2851  H HB2  . PHE B 1 77  ? -6.293  -8.196  -5.399  1.00 1.26  ? 77  PHE B HB2  1  
ATOM 2852  H HB3  . PHE B 1 77  ? -5.437  -7.965  -3.879  1.00 0.99  ? 77  PHE B HB3  1  
ATOM 2853  H HD1  . PHE B 1 77  ? -6.651  -8.589  -1.738  1.00 2.71  ? 77  PHE B HD1  1  
ATOM 2854  H HD2  . PHE B 1 77  ? -8.067  -9.660  -5.599  1.00 2.85  ? 77  PHE B HD2  1  
ATOM 2855  H HE1  . PHE B 1 77  ? -8.088  -10.310 -0.730  1.00 4.42  ? 77  PHE B HE1  1  
ATOM 2856  H HE2  . PHE B 1 77  ? -9.508  -11.383 -4.599  1.00 4.58  ? 77  PHE B HE2  1  
ATOM 2857  H HZ   . PHE B 1 77  ? -9.519  -11.709 -2.162  1.00 5.09  ? 77  PHE B HZ   1  
ATOM 2858  N N    . SER B 1 78  ? -5.681  -5.642  -6.101  1.00 0.38  ? 78  SER B N    1  
ATOM 2859  C CA   . SER B 1 78  ? -4.741  -4.730  -6.740  1.00 0.38  ? 78  SER B CA   1  
ATOM 2860  C C    . SER B 1 78  ? -5.369  -3.368  -7.050  1.00 0.38  ? 78  SER B C    1  
ATOM 2861  O O    . SER B 1 78  ? -4.683  -2.351  -7.022  1.00 0.44  ? 78  SER B O    1  
ATOM 2862  C CB   . SER B 1 78  ? -4.183  -5.362  -8.018  1.00 0.44  ? 78  SER B CB   1  
ATOM 2863  O OG   . SER B 1 78  ? -5.198  -6.017  -8.767  1.00 1.32  ? 78  SER B OG   1  
ATOM 2864  H H    . SER B 1 78  ? -6.059  -6.373  -6.624  1.00 0.44  ? 78  SER B H    1  
ATOM 2865  H HA   . SER B 1 78  ? -3.925  -4.576  -6.051  1.00 0.40  ? 78  SER B HA   1  
ATOM 2866  H HB2  . SER B 1 78  ? -3.742  -4.592  -8.632  1.00 1.06  ? 78  SER B HB2  1  
ATOM 2867  H HB3  . SER B 1 78  ? -3.426  -6.086  -7.753  1.00 0.94  ? 78  SER B HB3  1  
ATOM 2868  H HG   . SER B 1 78  ? -6.076  -5.719  -8.471  1.00 1.76  ? 78  SER B HG   1  
ATOM 2869  N N    . GLU B 1 79  ? -6.666  -3.341  -7.332  1.00 0.36  ? 79  GLU B N    1  
ATOM 2870  C CA   . GLU B 1 79  ? -7.345  -2.093  -7.663  1.00 0.42  ? 79  GLU B CA   1  
ATOM 2871  C C    . GLU B 1 79  ? -7.452  -1.205  -6.429  1.00 0.33  ? 79  GLU B C    1  
ATOM 2872  O O    . GLU B 1 79  ? -7.295  0.014   -6.507  1.00 0.33  ? 79  GLU B O    1  
ATOM 2873  C CB   . GLU B 1 79  ? -8.720  -2.398  -8.247  1.00 0.51  ? 79  GLU B CB   1  
ATOM 2874  C CG   . GLU B 1 79  ? -8.637  -3.243  -9.504  1.00 0.64  ? 79  GLU B CG   1  
ATOM 2875  C CD   . GLU B 1 79  ? -9.982  -3.733  -9.993  1.00 1.81  ? 79  GLU B CD   1  
ATOM 2876  O OE1  . GLU B 1 79  ? -10.493 -4.721  -9.437  1.00 2.54  ? 79  GLU B OE1  1  
ATOM 2877  O OE2  . GLU B 1 79  ? -10.510 -3.157  -10.955 1.00 2.57  ? 79  GLU B OE2  1  
ATOM 2878  H H    . GLU B 1 79  ? -7.184  -4.176  -7.316  1.00 0.34  ? 79  GLU B H    1  
ATOM 2879  H HA   . GLU B 1 79  ? -6.752  -1.583  -8.408  1.00 0.51  ? 79  GLU B HA   1  
ATOM 2880  H HB2  . GLU B 1 79  ? -9.306  -2.930  -7.511  1.00 0.48  ? 79  GLU B HB2  1  
ATOM 2881  H HB3  . GLU B 1 79  ? -9.212  -1.470  -8.492  1.00 0.60  ? 79  GLU B HB3  1  
ATOM 2882  H HG2  . GLU B 1 79  ? -8.185  -2.652  -10.284 1.00 0.89  ? 79  GLU B HG2  1  
ATOM 2883  H HG3  . GLU B 1 79  ? -8.012  -4.101  -9.300  1.00 1.04  ? 79  GLU B HG3  1  
ATOM 2884  N N    . PHE B 1 80  ? -7.689  -1.835  -5.291  1.00 0.28  ? 80  PHE B N    1  
ATOM 2885  C CA   . PHE B 1 80  ? -7.692  -1.148  -4.009  1.00 0.25  ? 80  PHE B CA   1  
ATOM 2886  C C    . PHE B 1 80  ? -6.290  -0.660  -3.674  1.00 0.23  ? 80  PHE B C    1  
ATOM 2887  O O    . PHE B 1 80  ? -6.108  0.384   -3.057  1.00 0.26  ? 80  PHE B O    1  
ATOM 2888  C CB   . PHE B 1 80  ? -8.179  -2.096  -2.917  1.00 0.31  ? 80  PHE B CB   1  
ATOM 2889  C CG   . PHE B 1 80  ? -8.052  -1.537  -1.533  1.00 0.71  ? 80  PHE B CG   1  
ATOM 2890  C CD1  . PHE B 1 80  ? -8.910  -0.548  -1.092  1.00 1.26  ? 80  PHE B CD1  1  
ATOM 2891  C CD2  . PHE B 1 80  ? -7.068  -2.002  -0.675  1.00 1.60  ? 80  PHE B CD2  1  
ATOM 2892  C CE1  . PHE B 1 80  ? -8.790  -0.031  0.179   1.00 1.56  ? 80  PHE B CE1  1  
ATOM 2893  C CE2  . PHE B 1 80  ? -6.944  -1.488  0.598   1.00 1.98  ? 80  PHE B CE2  1  
ATOM 2894  C CZ   . PHE B 1 80  ? -7.806  -0.501  1.025   1.00 1.64  ? 80  PHE B CZ   1  
ATOM 2895  H H    . PHE B 1 80  ? -7.878  -2.802  -5.314  1.00 0.28  ? 80  PHE B H    1  
ATOM 2896  H HA   . PHE B 1 80  ? -8.358  -0.302  -4.074  1.00 0.29  ? 80  PHE B HA   1  
ATOM 2897  H HB2  . PHE B 1 80  ? -9.219  -2.330  -3.089  1.00 0.38  ? 80  PHE B HB2  1  
ATOM 2898  H HB3  . PHE B 1 80  ? -7.598  -3.005  -2.961  1.00 0.47  ? 80  PHE B HB3  1  
ATOM 2899  H HD1  . PHE B 1 80  ? -9.680  -0.180  -1.753  1.00 1.92  ? 80  PHE B HD1  1  
ATOM 2900  H HD2  . PHE B 1 80  ? -6.393  -2.776  -1.011  1.00 2.25  ? 80  PHE B HD2  1  
ATOM 2901  H HE1  . PHE B 1 80  ? -9.466  0.742   0.513   1.00 2.20  ? 80  PHE B HE1  1  
ATOM 2902  H HE2  . PHE B 1 80  ? -6.174  -1.858  1.258   1.00 2.80  ? 80  PHE B HE2  1  
ATOM 2903  H HZ   . PHE B 1 80  ? -7.711  -0.095  2.022   1.00 2.01  ? 80  PHE B HZ   1  
ATOM 2904  N N    . LEU B 1 81  ? -5.299  -1.424  -4.087  1.00 0.25  ? 81  LEU B N    1  
ATOM 2905  C CA   . LEU B 1 81  ? -3.918  -1.075  -3.816  1.00 0.26  ? 81  LEU B CA   1  
ATOM 2906  C C    . LEU B 1 81  ? -3.431  -0.005  -4.769  1.00 0.26  ? 81  LEU B C    1  
ATOM 2907  O O    . LEU B 1 81  ? -2.557  0.786   -4.428  1.00 0.27  ? 81  LEU B O    1  
ATOM 2908  C CB   . LEU B 1 81  ? -3.045  -2.309  -3.898  1.00 0.29  ? 81  LEU B CB   1  
ATOM 2909  C CG   . LEU B 1 81  ? -3.321  -3.346  -2.810  1.00 0.28  ? 81  LEU B CG   1  
ATOM 2910  C CD1  . LEU B 1 81  ? -2.432  -4.554  -3.004  1.00 0.33  ? 81  LEU B CD1  1  
ATOM 2911  C CD2  . LEU B 1 81  ? -3.147  -2.741  -1.409  1.00 0.29  ? 81  LEU B CD2  1  
ATOM 2912  H H    . LEU B 1 81  ? -5.501  -2.248  -4.580  1.00 0.27  ? 81  LEU B H    1  
ATOM 2913  H HA   . LEU B 1 81  ? -3.872  -0.683  -2.815  1.00 0.26  ? 81  LEU B HA   1  
ATOM 2914  H HB2  . LEU B 1 81  ? -3.210  -2.775  -4.865  1.00 0.31  ? 81  LEU B HB2  1  
ATOM 2915  H HB3  . LEU B 1 81  ? -2.014  -1.997  -3.834  1.00 0.31  ? 81  LEU B HB3  1  
ATOM 2916  H HG   . LEU B 1 81  ? -4.344  -3.684  -2.901  1.00 0.28  ? 81  LEU B HG   1  
ATOM 2917  H HD11 . LEU B 1 81  ? -2.580  -4.952  -3.997  1.00 1.05  ? 81  LEU B HD11 1  
ATOM 2918  H HD12 . LEU B 1 81  ? -2.685  -5.307  -2.273  1.00 1.03  ? 81  LEU B HD12 1  
ATOM 2919  H HD13 . LEU B 1 81  ? -1.401  -4.262  -2.883  1.00 1.12  ? 81  LEU B HD13 1  
ATOM 2920  H HD21 . LEU B 1 81  ? -3.871  -1.947  -1.259  1.00 0.94  ? 81  LEU B HD21 1  
ATOM 2921  H HD22 . LEU B 1 81  ? -2.151  -2.336  -1.309  1.00 0.98  ? 81  LEU B HD22 1  
ATOM 2922  H HD23 . LEU B 1 81  ? -3.298  -3.503  -0.657  1.00 0.98  ? 81  LEU B HD23 1  
ATOM 2923  N N    . ASN B 1 82  ? -3.998  0.016   -5.963  1.00 0.26  ? 82  ASN B N    1  
ATOM 2924  C CA   . ASN B 1 82  ? -3.771  1.111   -6.882  1.00 0.26  ? 82  ASN B CA   1  
ATOM 2925  C C    . ASN B 1 82  ? -4.211  2.401   -6.222  1.00 0.23  ? 82  ASN B C    1  
ATOM 2926  O O    . ASN B 1 82  ? -3.533  3.429   -6.288  1.00 0.24  ? 82  ASN B O    1  
ATOM 2927  C CB   . ASN B 1 82  ? -4.569  0.909   -8.170  1.00 0.30  ? 82  ASN B CB   1  
ATOM 2928  C CG   . ASN B 1 82  ? -3.880  0.001   -9.167  1.00 0.78  ? 82  ASN B CG   1  
ATOM 2929  O OD1  . ASN B 1 82  ? -2.654  -0.082  -9.205  1.00 1.50  ? 82  ASN B OD1  1  
ATOM 2930  N ND2  . ASN B 1 82  ? -4.664  -0.678  -9.992  1.00 1.42  ? 82  ASN B ND2  1  
ATOM 2931  H H    . ASN B 1 82  ? -4.571  -0.731  -6.238  1.00 0.28  ? 82  ASN B H    1  
ATOM 2932  H HA   . ASN B 1 82  ? -2.712  1.148   -7.096  1.00 0.30  ? 82  ASN B HA   1  
ATOM 2933  H HB2  . ASN B 1 82  ? -5.523  0.469   -7.916  1.00 0.58  ? 82  ASN B HB2  1  
ATOM 2934  H HB3  . ASN B 1 82  ? -4.739  1.866   -8.630  1.00 0.65  ? 82  ASN B HB3  1  
ATOM 2935  H HD21 . ASN B 1 82  ? -5.634  -0.561  -9.913  1.00 1.90  ? 82  ASN B HD21 1  
ATOM 2936  H HD22 . ASN B 1 82  ? -4.240  -1.268  -10.654 1.00 1.75  ? 82  ASN B HD22 1  
ATOM 2937  N N    . LEU B 1 83  ? -5.370  2.316   -5.591  1.00 0.23  ? 83  LEU B N    1  
ATOM 2938  C CA   . LEU B 1 83  ? -5.900  3.381   -4.767  1.00 0.24  ? 83  LEU B CA   1  
ATOM 2939  C C    . LEU B 1 83  ? -4.908  3.784   -3.694  1.00 0.23  ? 83  LEU B C    1  
ATOM 2940  O O    . LEU B 1 83  ? -4.543  4.952   -3.573  1.00 0.25  ? 83  LEU B O    1  
ATOM 2941  C CB   . LEU B 1 83  ? -7.169  2.899   -4.095  1.00 0.27  ? 83  LEU B CB   1  
ATOM 2942  C CG   . LEU B 1 83  ? -7.558  3.689   -2.859  1.00 0.31  ? 83  LEU B CG   1  
ATOM 2943  C CD1  . LEU B 1 83  ? -8.084  5.061   -3.248  1.00 0.35  ? 83  LEU B CD1  1  
ATOM 2944  C CD2  . LEU B 1 83  ? -8.563  2.920   -2.024  1.00 0.36  ? 83  LEU B CD2  1  
ATOM 2945  H H    . LEU B 1 83  ? -5.897  1.492   -5.688  1.00 0.24  ? 83  LEU B H    1  
ATOM 2946  H HA   . LEU B 1 83  ? -6.125  4.227   -5.396  1.00 0.25  ? 83  LEU B HA   1  
ATOM 2947  H HB2  . LEU B 1 83  ? -7.969  2.952   -4.811  1.00 0.30  ? 83  LEU B HB2  1  
ATOM 2948  H HB3  . LEU B 1 83  ? -7.030  1.867   -3.806  1.00 0.28  ? 83  LEU B HB3  1  
ATOM 2949  H HG   . LEU B 1 83  ? -6.665  3.828   -2.259  1.00 0.30  ? 83  LEU B HG   1  
ATOM 2950  H HD11 . LEU B 1 83  ? -7.309  5.605   -3.771  1.00 1.01  ? 83  LEU B HD11 1  
ATOM 2951  H HD12 . LEU B 1 83  ? -8.371  5.604   -2.360  1.00 1.02  ? 83  LEU B HD12 1  
ATOM 2952  H HD13 . LEU B 1 83  ? -8.942  4.949   -3.896  1.00 1.12  ? 83  LEU B HD13 1  
ATOM 2953  H HD21 . LEU B 1 83  ? -9.432  2.699   -2.623  1.00 1.09  ? 83  LEU B HD21 1  
ATOM 2954  H HD22 . LEU B 1 83  ? -8.851  3.516   -1.171  1.00 1.01  ? 83  LEU B HD22 1  
ATOM 2955  H HD23 . LEU B 1 83  ? -8.114  1.997   -1.684  1.00 1.14  ? 83  LEU B HD23 1  
ATOM 2956  N N    . ILE B 1 84  ? -4.500  2.797   -2.908  1.00 0.24  ? 84  ILE B N    1  
ATOM 2957  C CA   . ILE B 1 84  ? -3.542  2.995   -1.837  1.00 0.26  ? 84  ILE B CA   1  
ATOM 2958  C C    . ILE B 1 84  ? -2.282  3.678   -2.365  1.00 0.27  ? 84  ILE B C    1  
ATOM 2959  O O    . ILE B 1 84  ? -1.666  4.484   -1.673  1.00 0.29  ? 84  ILE B O    1  
ATOM 2960  C CB   . ILE B 1 84  ? -3.193  1.646   -1.175  1.00 0.29  ? 84  ILE B CB   1  
ATOM 2961  C CG1  . ILE B 1 84  ? -4.417  1.069   -0.457  1.00 0.55  ? 84  ILE B CG1  1  
ATOM 2962  C CG2  . ILE B 1 84  ? -2.018  1.784   -0.210  1.00 0.47  ? 84  ILE B CG2  1  
ATOM 2963  C CD1  . ILE B 1 84  ? -4.983  1.972   0.617   1.00 0.62  ? 84  ILE B CD1  1  
ATOM 2964  H H    . ILE B 1 84  ? -4.869  1.895   -3.050  1.00 0.25  ? 84  ILE B H    1  
ATOM 2965  H HA   . ILE B 1 84  ? -3.998  3.632   -1.094  1.00 0.28  ? 84  ILE B HA   1  
ATOM 2966  H HB   . ILE B 1 84  ? -2.911  0.961   -1.959  1.00 0.29  ? 84  ILE B HB   1  
ATOM 2967  H HG12 . ILE B 1 84  ? -5.199  0.892   -1.180  1.00 1.22  ? 84  ILE B HG12 1  
ATOM 2968  H HG13 . ILE B 1 84  ? -4.144  0.132   0.006   1.00 1.29  ? 84  ILE B HG13 1  
ATOM 2969  H HG21 . ILE B 1 84  ? -2.263  2.507   0.556   1.00 1.12  ? 84  ILE B HG21 1  
ATOM 2970  H HG22 . ILE B 1 84  ? -1.146  2.117   -0.752  1.00 1.09  ? 84  ILE B HG22 1  
ATOM 2971  H HG23 . ILE B 1 84  ? -1.815  0.828   0.250   1.00 1.17  ? 84  ILE B HG23 1  
ATOM 2972  H HD11 . ILE B 1 84  ? -5.787  1.462   1.126   1.00 1.22  ? 84  ILE B HD11 1  
ATOM 2973  H HD12 . ILE B 1 84  ? -5.361  2.875   0.167   1.00 1.15  ? 84  ILE B HD12 1  
ATOM 2974  H HD13 . ILE B 1 84  ? -4.207  2.219   1.326   1.00 1.30  ? 84  ILE B HD13 1  
ATOM 2975  N N    . GLY B 1 85  ? -1.931  3.372   -3.609  1.00 0.26  ? 85  GLY B N    1  
ATOM 2976  C CA   . GLY B 1 85  ? -0.825  4.035   -4.258  1.00 0.29  ? 85  GLY B CA   1  
ATOM 2977  C C    . GLY B 1 85  ? -1.057  5.526   -4.391  1.00 0.28  ? 85  GLY B C    1  
ATOM 2978  O O    . GLY B 1 85  ? -0.192  6.322   -4.043  1.00 0.32  ? 85  GLY B O    1  
ATOM 2979  H H    . GLY B 1 85  ? -2.431  2.683   -4.091  1.00 0.25  ? 85  GLY B H    1  
ATOM 2980  H HA2  . GLY B 1 85  ? 0.072   3.867   -3.681  1.00 0.33  ? 85  GLY B HA2  1  
ATOM 2981  H HA3  . GLY B 1 85  ? -0.692  3.614   -5.243  1.00 0.31  ? 85  GLY B HA3  1  
ATOM 2982  N N    . GLY B 1 86  ? -2.248  5.907   -4.847  1.00 0.27  ? 86  GLY B N    1  
ATOM 2983  C CA   . GLY B 1 86  ? -2.542  7.311   -5.058  1.00 0.30  ? 86  GLY B CA   1  
ATOM 2984  C C    . GLY B 1 86  ? -2.730  8.035   -3.747  1.00 0.29  ? 86  GLY B C    1  
ATOM 2985  O O    . GLY B 1 86  ? -2.353  9.198   -3.600  1.00 0.34  ? 86  GLY B O    1  
ATOM 2986  H H    . GLY B 1 86  ? -2.949  5.232   -5.000  1.00 0.27  ? 86  GLY B H    1  
ATOM 2987  H HA2  . GLY B 1 86  ? -1.725  7.766   -5.600  1.00 0.33  ? 86  GLY B HA2  1  
ATOM 2988  H HA3  . GLY B 1 86  ? -3.446  7.400   -5.640  1.00 0.32  ? 86  GLY B HA3  1  
ATOM 2989  N N    . LEU B 1 87  ? -3.303  7.324   -2.793  1.00 0.25  ? 87  LEU B N    1  
ATOM 2990  C CA   . LEU B 1 87  ? -3.489  7.830   -1.444  1.00 0.25  ? 87  LEU B CA   1  
ATOM 2991  C C    . LEU B 1 87  ? -2.145  8.100   -0.798  1.00 0.26  ? 87  LEU B C    1  
ATOM 2992  O O    . LEU B 1 87  ? -1.883  9.193   -0.294  1.00 0.29  ? 87  LEU B O    1  
ATOM 2993  C CB   . LEU B 1 87  ? -4.236  6.801   -0.609  1.00 0.25  ? 87  LEU B CB   1  
ATOM 2994  C CG   . LEU B 1 87  ? -5.737  6.705   -0.843  1.00 0.26  ? 87  LEU B CG   1  
ATOM 2995  C CD1  . LEU B 1 87  ? -6.272  5.450   -0.183  1.00 0.26  ? 87  LEU B CD1  1  
ATOM 2996  C CD2  . LEU B 1 87  ? -6.446  7.930   -0.286  1.00 0.35  ? 87  LEU B CD2  1  
ATOM 2997  H H    . LEU B 1 87  ? -3.604  6.412   -3.005  1.00 0.26  ? 87  LEU B H    1  
ATOM 2998  H HA   . LEU B 1 87  ? -4.059  8.744   -1.492  1.00 0.28  ? 87  LEU B HA   1  
ATOM 2999  H HB2  . LEU B 1 87  ? -3.805  5.832   -0.821  1.00 0.25  ? 87  LEU B HB2  1  
ATOM 3000  H HB3  . LEU B 1 87  ? -4.072  7.029   0.432   1.00 0.28  ? 87  LEU B HB3  1  
ATOM 3001  H HG   . LEU B 1 87  ? -5.937  6.645   -1.903  1.00 0.26  ? 87  LEU B HG   1  
ATOM 3002  H HD11 . LEU B 1 87  ? -7.330  5.363   -0.378  1.00 1.02  ? 87  LEU B HD11 1  
ATOM 3003  H HD12 . LEU B 1 87  ? -6.105  5.505   0.883   1.00 1.05  ? 87  LEU B HD12 1  
ATOM 3004  H HD13 . LEU B 1 87  ? -5.761  4.590   -0.584  1.00 1.06  ? 87  LEU B HD13 1  
ATOM 3005  H HD21 . LEU B 1 87  ? -6.054  8.820   -0.754  1.00 0.97  ? 87  LEU B HD21 1  
ATOM 3006  H HD22 . LEU B 1 87  ? -6.285  7.981   0.782   1.00 1.10  ? 87  LEU B HD22 1  
ATOM 3007  H HD23 . LEU B 1 87  ? -7.505  7.854   -0.485  1.00 1.13  ? 87  LEU B HD23 1  
ATOM 3008  N N    . ALA B 1 88  ? -1.289  7.089   -0.828  1.00 0.25  ? 88  ALA B N    1  
ATOM 3009  C CA   . ALA B 1 88  ? 0.033   7.187   -0.246  1.00 0.27  ? 88  ALA B CA   1  
ATOM 3010  C C    . ALA B 1 88  ? 0.824   8.281   -0.899  1.00 0.29  ? 88  ALA B C    1  
ATOM 3011  O O    . ALA B 1 88  ? 1.566   8.992   -0.241  1.00 0.35  ? 88  ALA B O    1  
ATOM 3012  C CB   . ALA B 1 88  ? 0.789   5.887   -0.384  1.00 0.26  ? 88  ALA B CB   1  
ATOM 3013  H H    . ALA B 1 88  ? -1.561  6.242   -1.253  1.00 0.25  ? 88  ALA B H    1  
ATOM 3014  H HA   . ALA B 1 88  ? -0.080  7.411   0.800   1.00 0.28  ? 88  ALA B HA   1  
ATOM 3015  H HB1  . ALA B 1 88  ? 0.168   5.065   -0.067  1.00 1.06  ? 88  ALA B HB1  1  
ATOM 3016  H HB2  . ALA B 1 88  ? 1.681   5.926   0.224   1.00 1.04  ? 88  ALA B HB2  1  
ATOM 3017  H HB3  . ALA B 1 88  ? 1.069   5.758   -1.420  1.00 1.06  ? 88  ALA B HB3  1  
ATOM 3018  N N    . MET B 1 89  ? 0.671   8.400   -2.201  1.00 0.29  ? 89  MET B N    1  
ATOM 3019  C CA   . MET B 1 89  ? 1.385   9.405   -2.949  1.00 0.32  ? 89  MET B CA   1  
ATOM 3020  C C    . MET B 1 89  ? 0.894   10.797  -2.592  1.00 0.34  ? 89  MET B C    1  
ATOM 3021  O O    . MET B 1 89  ? 1.656   11.757  -2.628  1.00 0.39  ? 89  MET B O    1  
ATOM 3022  C CB   . MET B 1 89  ? 1.255   9.148   -4.443  1.00 0.34  ? 89  MET B CB   1  
ATOM 3023  C CG   . MET B 1 89  ? 2.100   7.979   -4.905  1.00 0.42  ? 89  MET B CG   1  
ATOM 3024  S SD   . MET B 1 89  ? 2.289   7.924   -6.697  1.00 1.03  ? 89  MET B SD   1  
ATOM 3025  C CE   . MET B 1 89  ? 0.593   7.665   -7.211  1.00 1.89  ? 89  MET B CE   1  
ATOM 3026  H H    . MET B 1 89  ? 0.064   7.786   -2.674  1.00 0.28  ? 89  MET B H    1  
ATOM 3027  H HA   . MET B 1 89  ? 2.423   9.323   -2.672  1.00 0.37  ? 89  MET B HA   1  
ATOM 3028  H HB2  . MET B 1 89  ? 0.218   8.926   -4.668  1.00 0.32  ? 89  MET B HB2  1  
ATOM 3029  H HB3  . MET B 1 89  ? 1.559   10.028  -4.985  1.00 0.38  ? 89  MET B HB3  1  
ATOM 3030  H HG2  . MET B 1 89  ? 3.076   8.061   -4.448  1.00 0.55  ? 89  MET B HG2  1  
ATOM 3031  H HG3  . MET B 1 89  ? 1.625   7.058   -4.577  1.00 0.42  ? 89  MET B HG3  1  
ATOM 3032  H HE1  . MET B 1 89  ? 0.551   7.586   -8.287  1.00 2.52  ? 89  MET B HE1  1  
ATOM 3033  H HE2  . MET B 1 89  ? -0.013  8.500   -6.889  1.00 2.34  ? 89  MET B HE2  1  
ATOM 3034  H HE3  . MET B 1 89  ? 0.217   6.756   -6.767  1.00 2.22  ? 89  MET B HE3  1  
ATOM 3035  N N    . ALA B 1 90  ? -0.372  10.894  -2.218  1.00 0.34  ? 90  ALA B N    1  
ATOM 3036  C CA   . ALA B 1 90  ? -0.946  12.160  -1.800  1.00 0.39  ? 90  ALA B CA   1  
ATOM 3037  C C    . ALA B 1 90  ? -0.404  12.568  -0.435  1.00 0.42  ? 90  ALA B C    1  
ATOM 3038  O O    . ALA B 1 90  ? -0.043  13.727  -0.220  1.00 0.49  ? 90  ALA B O    1  
ATOM 3039  C CB   . ALA B 1 90  ? -2.464  12.070  -1.770  1.00 0.46  ? 90  ALA B CB   1  
ATOM 3040  H H    . ALA B 1 90  ? -0.937  10.090  -2.224  1.00 0.32  ? 90  ALA B H    1  
ATOM 3041  H HA   . ALA B 1 90  ? -0.665  12.909  -2.527  1.00 0.42  ? 90  ALA B HA   1  
ATOM 3042  H HB1  . ALA B 1 90  ? -2.823  11.758  -2.740  1.00 1.20  ? 90  ALA B HB1  1  
ATOM 3043  H HB2  . ALA B 1 90  ? -2.878  13.036  -1.526  1.00 1.13  ? 90  ALA B HB2  1  
ATOM 3044  H HB3  . ALA B 1 90  ? -2.766  11.349  -1.025  1.00 1.03  ? 90  ALA B HB3  1  
ATOM 3045  N N    . CYS B 1 91  ? -0.333  11.605  0.479   1.00 0.41  ? 91  CYS B N    1  
ATOM 3046  C CA   . CYS B 1 91  ? 0.188   11.854  1.819   1.00 0.47  ? 91  CYS B CA   1  
ATOM 3047  C C    . CYS B 1 91  ? 1.703   12.043  1.767   1.00 0.44  ? 91  CYS B C    1  
ATOM 3048  O O    . CYS B 1 91  ? 2.265   12.852  2.503   1.00 0.51  ? 91  CYS B O    1  
ATOM 3049  C CB   . CYS B 1 91  ? -0.184  10.704  2.764   1.00 0.55  ? 91  CYS B CB   1  
ATOM 3050  S SG   . CYS B 1 91  ? 0.059   11.075  4.517   1.00 1.76  ? 91  CYS B SG   1  
ATOM 3051  H H    . CYS B 1 91  ? -0.653  10.705  0.250   1.00 0.40  ? 91  CYS B H    1  
ATOM 3052  H HA   . CYS B 1 91  ? -0.261  12.768  2.180   1.00 0.52  ? 91  CYS B HA   1  
ATOM 3053  H HB2  . CYS B 1 91  ? -1.224  10.453  2.624   1.00 1.09  ? 91  CYS B HB2  1  
ATOM 3054  H HB3  . CYS B 1 91  ? 0.423   9.842   2.527   1.00 0.94  ? 91  CYS B HB3  1  
ATOM 3055  H HG   . CYS B 1 91  ? -0.494  10.097  5.223   1.00 2.29  ? 91  CYS B HG   1  
ATOM 3056  N N    . HIS B 1 92  ? 2.360   11.297  0.883   1.00 0.41  ? 92  HIS B N    1  
ATOM 3057  C CA   . HIS B 1 92  ? 3.784   11.484  0.634   1.00 0.46  ? 92  HIS B CA   1  
ATOM 3058  C C    . HIS B 1 92  ? 4.023   12.892  0.134   1.00 0.45  ? 92  HIS B C    1  
ATOM 3059  O O    . HIS B 1 92  ? 4.847   13.614  0.671   1.00 0.49  ? 92  HIS B O    1  
ATOM 3060  C CB   . HIS B 1 92  ? 4.315   10.493  -0.406  1.00 0.54  ? 92  HIS B CB   1  
ATOM 3061  C CG   . HIS B 1 92  ? 4.856   9.212   0.153   1.00 1.21  ? 92  HIS B CG   1  
ATOM 3062  N ND1  . HIS B 1 92  ? 6.063   9.131   0.817   1.00 2.12  ? 92  HIS B ND1  1  
ATOM 3063  C CD2  . HIS B 1 92  ? 4.379   7.946   0.095   1.00 1.96  ? 92  HIS B CD2  1  
ATOM 3064  C CE1  . HIS B 1 92  ? 6.308   7.875   1.132   1.00 2.74  ? 92  HIS B CE1  1  
ATOM 3065  N NE2  . HIS B 1 92  ? 5.301   7.134   0.708   1.00 2.62  ? 92  HIS B NE2  1  
ATOM 3066  H H    . HIS B 1 92  ? 1.873   10.609  0.383   1.00 0.40  ? 92  HIS B H    1  
ATOM 3067  H HA   . HIS B 1 92  ? 4.312   11.344  1.566   1.00 0.53  ? 92  HIS B HA   1  
ATOM 3068  H HB2  . HIS B 1 92  ? 3.515   10.239  -1.083  1.00 1.05  ? 92  HIS B HB2  1  
ATOM 3069  H HB3  . HIS B 1 92  ? 5.108   10.969  -0.964  1.00 0.91  ? 92  HIS B HB3  1  
ATOM 3070  H HD1  . HIS B 1 92  ? 6.650   9.893   1.043   1.00 2.62  ? 92  HIS B HD1  1  
ATOM 3071  H HD2  . HIS B 1 92  ? 3.445   7.633   -0.351  1.00 2.49  ? 92  HIS B HD2  1  
ATOM 3072  H HE1  . HIS B 1 92  ? 7.188   7.512   1.641   1.00 3.56  ? 92  HIS B HE1  1  
ATOM 3073  H HE2  . HIS B 1 92  ? 5.284   6.154   0.711   1.00 3.27  ? 92  HIS B HE2  1  
ATOM 3074  N N    . ASP B 1 93  ? 3.269   13.272  -0.890  1.00 0.45  ? 93  ASP B N    1  
ATOM 3075  C CA   . ASP B 1 93  ? 3.346   14.610  -1.463  1.00 0.52  ? 93  ASP B CA   1  
ATOM 3076  C C    . ASP B 1 93  ? 3.106   15.671  -0.396  1.00 0.56  ? 93  ASP B C    1  
ATOM 3077  O O    . ASP B 1 93  ? 3.730   16.727  -0.409  1.00 0.65  ? 93  ASP B O    1  
ATOM 3078  C CB   . ASP B 1 93  ? 2.320   14.742  -2.585  1.00 0.54  ? 93  ASP B CB   1  
ATOM 3079  C CG   . ASP B 1 93  ? 2.349   16.098  -3.259  1.00 0.92  ? 93  ASP B CG   1  
ATOM 3080  O OD1  . ASP B 1 93  ? 3.235   16.325  -4.111  1.00 1.48  ? 93  ASP B OD1  1  
ATOM 3081  O OD2  . ASP B 1 93  ? 1.473   16.936  -2.955  1.00 1.74  ? 93  ASP B OD2  1  
ATOM 3082  H H    . ASP B 1 93  ? 2.649   12.624  -1.290  1.00 0.43  ? 93  ASP B H    1  
ATOM 3083  H HA   . ASP B 1 93  ? 4.335   14.742  -1.871  1.00 0.56  ? 93  ASP B HA   1  
ATOM 3084  H HB2  . ASP B 1 93  ? 2.520   13.986  -3.326  1.00 0.94  ? 93  ASP B HB2  1  
ATOM 3085  H HB3  . ASP B 1 93  ? 1.332   14.584  -2.178  1.00 0.77  ? 93  ASP B HB3  1  
ATOM 3086  N N    . SER B 1 94  ? 2.217   15.368  0.538   1.00 0.54  ? 94  SER B N    1  
ATOM 3087  C CA   . SER B 1 94  ? 1.959   16.247  1.667   1.00 0.60  ? 94  SER B CA   1  
ATOM 3088  C C    . SER B 1 94  ? 3.240   16.456  2.462   1.00 0.63  ? 94  SER B C    1  
ATOM 3089  O O    . SER B 1 94  ? 3.607   17.581  2.793   1.00 0.70  ? 94  SER B O    1  
ATOM 3090  C CB   . SER B 1 94  ? 0.887   15.640  2.570   1.00 0.65  ? 94  SER B CB   1  
ATOM 3091  O OG   . SER B 1 94  ? -0.325  15.426  1.862   1.00 1.26  ? 94  SER B OG   1  
ATOM 3092  H H    . SER B 1 94  ? 1.730   14.522  0.472   1.00 0.52  ? 94  SER B H    1  
ATOM 3093  H HA   . SER B 1 94  ? 1.614   17.197  1.288   1.00 0.66  ? 94  SER B HA   1  
ATOM 3094  H HB2  . SER B 1 94  ? 1.242   14.690  2.945   1.00 0.96  ? 94  SER B HB2  1  
ATOM 3095  H HB3  . SER B 1 94  ? 0.697   16.306  3.398   1.00 1.04  ? 94  SER B HB3  1  
ATOM 3096  H HG   . SER B 1 94  ? -0.136  14.979  1.027   1.00 1.85  ? 94  SER B HG   1  
ATOM 3097  N N    . PHE B 1 95  ? 3.929   15.356  2.731   1.00 0.60  ? 95  PHE B N    1  
ATOM 3098  C CA   . PHE B 1 95  ? 5.190   15.383  3.454   1.00 0.67  ? 95  PHE B CA   1  
ATOM 3099  C C    . PHE B 1 95  ? 6.269   16.076  2.641   1.00 0.73  ? 95  PHE B C    1  
ATOM 3100  O O    . PHE B 1 95  ? 7.073   16.819  3.174   1.00 0.84  ? 95  PHE B O    1  
ATOM 3101  C CB   . PHE B 1 95  ? 5.630   13.964  3.797   1.00 0.64  ? 95  PHE B CB   1  
ATOM 3102  C CG   . PHE B 1 95  ? 5.094   13.474  5.110   1.00 0.78  ? 95  PHE B CG   1  
ATOM 3103  C CD1  . PHE B 1 95  ? 3.797   12.999  5.215   1.00 1.80  ? 95  PHE B CD1  1  
ATOM 3104  C CD2  . PHE B 1 95  ? 5.888   13.497  6.245   1.00 1.29  ? 95  PHE B CD2  1  
ATOM 3105  C CE1  . PHE B 1 95  ? 3.303   12.558  6.427   1.00 2.35  ? 95  PHE B CE1  1  
ATOM 3106  C CE2  . PHE B 1 95  ? 5.398   13.060  7.459   1.00 1.76  ? 95  PHE B CE2  1  
ATOM 3107  C CZ   . PHE B 1 95  ? 4.105   12.589  7.550   1.00 2.07  ? 95  PHE B CZ   1  
ATOM 3108  H H    . PHE B 1 95  ? 3.578   14.493  2.422   1.00 0.56  ? 95  PHE B H    1  
ATOM 3109  H HA   . PHE B 1 95  ? 5.035   15.933  4.369   1.00 0.75  ? 95  PHE B HA   1  
ATOM 3110  H HB2  . PHE B 1 95  ? 5.281   13.295  3.023   1.00 0.99  ? 95  PHE B HB2  1  
ATOM 3111  H HB3  . PHE B 1 95  ? 6.709   13.927  3.837   1.00 0.98  ? 95  PHE B HB3  1  
ATOM 3112  H HD1  . PHE B 1 95  ? 3.168   12.974  4.337   1.00 2.46  ? 95  PHE B HD1  1  
ATOM 3113  H HD2  . PHE B 1 95  ? 6.900   13.865  6.175   1.00 1.96  ? 95  PHE B HD2  1  
ATOM 3114  H HE1  . PHE B 1 95  ? 2.290   12.188  6.496   1.00 3.27  ? 95  PHE B HE1  1  
ATOM 3115  H HE2  . PHE B 1 95  ? 6.027   13.084  8.337   1.00 2.40  ? 95  PHE B HE2  1  
ATOM 3116  H HZ   . PHE B 1 95  ? 3.721   12.247  8.498   1.00 2.63  ? 95  PHE B HZ   1  
ATOM 3117  N N    . LEU B 1 96  ? 6.274   15.840  1.349   1.00 0.69  ? 96  LEU B N    1  
ATOM 3118  C CA   . LEU B 1 96  ? 7.255   16.451  0.468   1.00 0.81  ? 96  LEU B CA   1  
ATOM 3119  C C    . LEU B 1 96  ? 7.037   17.952  0.399   1.00 0.91  ? 96  LEU B C    1  
ATOM 3120  O O    . LEU B 1 96  ? 7.968   18.721  0.179   1.00 1.09  ? 96  LEU B O    1  
ATOM 3121  C CB   . LEU B 1 96  ? 7.179   15.828  -0.925  1.00 0.83  ? 96  LEU B CB   1  
ATOM 3122  C CG   . LEU B 1 96  ? 8.033   14.574  -1.132  1.00 0.87  ? 96  LEU B CG   1  
ATOM 3123  C CD1  . LEU B 1 96  ? 9.508   14.928  -1.135  1.00 1.22  ? 96  LEU B CD1  1  
ATOM 3124  C CD2  . LEU B 1 96  ? 7.737   13.528  -0.070  1.00 1.08  ? 96  LEU B CD2  1  
ATOM 3125  H H    . LEU B 1 96  ? 5.597   15.237  0.971   1.00 0.62  ? 96  LEU B H    1  
ATOM 3126  H HA   . LEU B 1 96  ? 8.232   16.262  0.884   1.00 0.87  ? 96  LEU B HA   1  
ATOM 3127  H HB2  . LEU B 1 96  ? 6.150   15.570  -1.122  1.00 0.76  ? 96  LEU B HB2  1  
ATOM 3128  H HB3  . LEU B 1 96  ? 7.487   16.569  -1.645  1.00 0.93  ? 96  LEU B HB3  1  
ATOM 3129  H HG   . LEU B 1 96  ? 7.793   14.147  -2.087  1.00 0.92  ? 96  LEU B HG   1  
ATOM 3130  H HD11 . LEU B 1 96  ? 9.701   15.655  -1.909  1.00 1.70  ? 96  LEU B HD11 1  
ATOM 3131  H HD12 . LEU B 1 96  ? 10.091  14.040  -1.321  1.00 1.65  ? 96  LEU B HD12 1  
ATOM 3132  H HD13 . LEU B 1 96  ? 9.780   15.342  -0.177  1.00 1.64  ? 96  LEU B HD13 1  
ATOM 3133  H HD21 . LEU B 1 96  ? 6.784   13.064  -0.277  1.00 1.68  ? 96  LEU B HD21 1  
ATOM 3134  H HD22 . LEU B 1 96  ? 7.697   14.002  0.899   1.00 1.41  ? 96  LEU B HD22 1  
ATOM 3135  H HD23 . LEU B 1 96  ? 8.514   12.778  -0.074  1.00 1.51  ? 96  LEU B HD23 1  
ATOM 3136  N N    . LYS B 1 97  ? 5.796   18.356  0.601   1.00 0.83  ? 97  LYS B N    1  
ATOM 3137  C CA   . LYS B 1 97  ? 5.434   19.763  0.634   1.00 0.94  ? 97  LYS B CA   1  
ATOM 3138  C C    . LYS B 1 97  ? 5.435   20.281  2.074   1.00 0.98  ? 97  LYS B C    1  
ATOM 3139  O O    . LYS B 1 97  ? 4.957   21.380  2.348   1.00 1.14  ? 97  LYS B O    1  
ATOM 3140  C CB   . LYS B 1 97  ? 4.047   19.964  0.000   1.00 0.94  ? 97  LYS B CB   1  
ATOM 3141  C CG   . LYS B 1 97  ? 4.027   20.130  -1.526  1.00 0.99  ? 97  LYS B CG   1  
ATOM 3142  C CD   . LYS B 1 97  ? 4.636   18.955  -2.285  1.00 1.25  ? 97  LYS B CD   1  
ATOM 3143  C CE   . LYS B 1 97  ? 6.127   19.136  -2.538  1.00 2.06  ? 97  LYS B CE   1  
ATOM 3144  N NZ   . LYS B 1 97  ? 6.425   20.349  -3.347  1.00 2.65  ? 97  LYS B NZ   1  
ATOM 3145  H H    . LYS B 1 97  ? 5.090   17.682  0.724   1.00 0.75  ? 97  LYS B H    1  
ATOM 3146  H HA   . LYS B 1 97  ? 6.167   20.312  0.063   1.00 1.02  ? 97  LYS B HA   1  
ATOM 3147  H HB2  . LYS B 1 97  ? 3.433   19.112  0.246   1.00 0.90  ? 97  LYS B HB2  1  
ATOM 3148  H HB3  . LYS B 1 97  ? 3.599   20.843  0.437   1.00 1.04  ? 97  LYS B HB3  1  
ATOM 3149  H HG2  . LYS B 1 97  ? 3.002   20.236  -1.843  1.00 1.50  ? 97  LYS B HG2  1  
ATOM 3150  H HG3  . LYS B 1 97  ? 4.571   21.025  -1.781  1.00 1.64  ? 97  LYS B HG3  1  
ATOM 3151  H HD2  . LYS B 1 97  ? 4.490   18.055  -1.706  1.00 1.87  ? 97  LYS B HD2  1  
ATOM 3152  H HD3  . LYS B 1 97  ? 4.130   18.856  -3.234  1.00 1.74  ? 97  LYS B HD3  1  
ATOM 3153  H HE2  . LYS B 1 97  ? 6.632   19.219  -1.588  1.00 2.59  ? 97  LYS B HE2  1  
ATOM 3154  H HE3  . LYS B 1 97  ? 6.495   18.266  -3.062  1.00 2.52  ? 97  LYS B HE3  1  
ATOM 3155  H HZ1  . LYS B 1 97  ? 7.452   20.437  -3.488  1.00 3.01  ? 97  LYS B HZ1  1  
ATOM 3156  H HZ2  . LYS B 1 97  ? 6.080   21.200  -2.862  1.00 2.88  ? 97  LYS B HZ2  1  
ATOM 3157  H HZ3  . LYS B 1 97  ? 5.965   20.283  -4.277  1.00 3.15  ? 97  LYS B HZ3  1  
ATOM 3158  N N    . ALA B 1 98  ? 5.973   19.483  2.992   1.00 0.99  ? 98  ALA B N    1  
ATOM 3159  C CA   . ALA B 1 98  ? 5.998   19.850  4.403   1.00 1.07  ? 98  ALA B CA   1  
ATOM 3160  C C    . ALA B 1 98  ? 7.355   19.538  5.033   1.00 1.10  ? 98  ALA B C    1  
ATOM 3161  O O    . ALA B 1 98  ? 8.157   20.436  5.294   1.00 1.24  ? 98  ALA B O    1  
ATOM 3162  C CB   . ALA B 1 98  ? 4.884   19.134  5.157   1.00 1.01  ? 98  ALA B CB   1  
ATOM 3163  H H    . ALA B 1 98  ? 6.364   18.628  2.714   1.00 1.05  ? 98  ALA B H    1  
ATOM 3164  H HA   . ALA B 1 98  ? 5.819   20.909  4.468   1.00 1.18  ? 98  ALA B HA   1  
ATOM 3165  H HB1  . ALA B 1 98  ? 3.933   19.368  4.701   1.00 1.37  ? 98  ALA B HB1  1  
ATOM 3166  H HB2  . ALA B 1 98  ? 4.879   19.456  6.187   1.00 1.47  ? 98  ALA B HB2  1  
ATOM 3167  H HB3  . ALA B 1 98  ? 5.049   18.067  5.113   1.00 1.42  ? 98  ALA B HB3  1  
ATOM 3168  N N    . VAL B 1 99  ? 7.604   18.256  5.253   1.00 1.01  ? 99  VAL B N    1  
ATOM 3169  C CA   . VAL B 1 99  ? 8.849   17.779  5.834   1.00 1.07  ? 99  VAL B CA   1  
ATOM 3170  C C    . VAL B 1 99  ? 9.001   16.274  5.574   1.00 1.01  ? 99  VAL B C    1  
ATOM 3171  O O    . VAL B 1 99  ? 8.528   15.436  6.340   1.00 1.02  ? 99  VAL B O    1  
ATOM 3172  C CB   . VAL B 1 99  ? 8.941   18.089  7.353   1.00 1.17  ? 99  VAL B CB   1  
ATOM 3173  C CG1  . VAL B 1 99  ? 7.705   17.607  8.104   1.00 1.14  ? 99  VAL B CG1  1  
ATOM 3174  C CG2  . VAL B 1 99  ? 10.207  17.483  7.944   1.00 1.25  ? 99  VAL B CG2  1  
ATOM 3175  H H    . VAL B 1 99  ? 6.930   17.592  4.985   1.00 0.92  ? 99  VAL B H    1  
ATOM 3176  H HA   . VAL B 1 99  ? 9.658   18.296  5.334   1.00 1.12  ? 99  VAL B HA   1  
ATOM 3177  H HB   . VAL B 1 99  ? 9.001   19.162  7.470   1.00 1.25  ? 99  VAL B HB   1  
ATOM 3178  H HG11 . VAL B 1 99  ? 7.813   17.830  9.155   1.00 1.65  ? 99  VAL B HG11 1  
ATOM 3179  H HG12 . VAL B 1 99  ? 7.596   16.540  7.970   1.00 1.48  ? 99  VAL B HG12 1  
ATOM 3180  H HG13 . VAL B 1 99  ? 6.830   18.109  7.718   1.00 1.42  ? 99  VAL B HG13 1  
ATOM 3181  H HG21 . VAL B 1 99  ? 10.257  17.711  8.998   1.00 1.52  ? 99  VAL B HG21 1  
ATOM 3182  H HG22 . VAL B 1 99  ? 11.072  17.895  7.444   1.00 1.65  ? 99  VAL B HG22 1  
ATOM 3183  H HG23 . VAL B 1 99  ? 10.191  16.411  7.807   1.00 1.64  ? 99  VAL B HG23 1  
ATOM 3184  N N    . PRO B 1 100 ? 9.648   15.908  4.462   1.00 1.01  ? 100 PRO B N    1  
ATOM 3185  C CA   . PRO B 1 100 ? 9.794   14.518  4.060   1.00 1.02  ? 100 PRO B CA   1  
ATOM 3186  C C    . PRO B 1 100 ? 11.013  13.853  4.678   1.00 1.28  ? 100 PRO B C    1  
ATOM 3187  O O    . PRO B 1 100 ? 11.344  12.712  4.356   1.00 1.60  ? 100 PRO B O    1  
ATOM 3188  C CB   . PRO B 1 100 ? 9.939   14.619  2.550   1.00 1.04  ? 100 PRO B CB   1  
ATOM 3189  C CG   . PRO B 1 100 ? 10.582  15.946  2.303   1.00 1.04  ? 100 PRO B CG   1  
ATOM 3190  C CD   . PRO B 1 100 ? 10.281  16.823  3.496   1.00 1.07  ? 100 PRO B CD   1  
ATOM 3191  H HA   . PRO B 1 100 ? 8.912   13.942  4.302   1.00 0.95  ? 100 PRO B HA   1  
ATOM 3192  H HB2  . PRO B 1 100 ? 10.556  13.808  2.192   1.00 1.23  ? 100 PRO B HB2  1  
ATOM 3193  H HB3  . PRO B 1 100 ? 8.966   14.565  2.092   1.00 1.05  ? 100 PRO B HB3  1  
ATOM 3194  H HG2  . PRO B 1 100 ? 11.649  15.817  2.197   1.00 1.11  ? 100 PRO B HG2  1  
ATOM 3195  H HG3  . PRO B 1 100 ? 10.171  16.384  1.404   1.00 1.04  ? 100 PRO B HG3  1  
ATOM 3196  H HD2  . PRO B 1 100 ? 11.194  17.235  3.900   1.00 1.20  ? 100 PRO B HD2  1  
ATOM 3197  H HD3  . PRO B 1 100 ? 9.603   17.613  3.217   1.00 1.05  ? 100 PRO B HD3  1  
ATOM 3198  N N    . SER B 1 101 ? 11.666  14.563  5.579   1.00 1.57  ? 101 SER B N    1  
ATOM 3199  C CA   . SER B 1 101 ? 12.837  14.041  6.257   1.00 1.88  ? 101 SER B CA   1  
ATOM 3200  C C    . SER B 1 101 ? 12.427  13.109  7.397   1.00 1.62  ? 101 SER B C    1  
ATOM 3201  O O    . SER B 1 101 ? 12.865  13.263  8.537   1.00 1.94  ? 101 SER B O    1  
ATOM 3202  C CB   . SER B 1 101 ? 13.685  15.201  6.774   1.00 2.76  ? 101 SER B CB   1  
ATOM 3203  O OG   . SER B 1 101 ? 13.984  16.108  5.722   1.00 3.39  ? 101 SER B OG   1  
ATOM 3204  H H    . SER B 1 101 ? 11.351  15.464  5.797   1.00 1.80  ? 101 SER B H    1  
ATOM 3205  H HA   . SER B 1 101 ? 13.413  13.479  5.537   1.00 2.07  ? 101 SER B HA   1  
ATOM 3206  H HB2  . SER B 1 101 ? 13.142  15.727  7.545   1.00 3.14  ? 101 SER B HB2  1  
ATOM 3207  H HB3  . SER B 1 101 ? 14.610  14.818  7.178   1.00 3.02  ? 101 SER B HB3  1  
ATOM 3208  H HG   . SER B 1 101 ? 13.817  15.679  4.872   1.00 3.73  ? 101 SER B HG   1  
ATOM 3209  N N    . GLN B 1 102 ? 11.583  12.134  7.070   1.00 1.61  ? 102 GLN B N    1  
ATOM 3210  C CA   . GLN B 1 102 ? 11.125  11.137  8.031   1.00 2.12  ? 102 GLN B CA   1  
ATOM 3211  C C    . GLN B 1 102 ? 12.206  10.072  8.220   1.00 2.74  ? 102 GLN B C    1  
ATOM 3212  O O    . GLN B 1 102 ? 11.975  8.876   8.037   1.00 3.39  ? 102 GLN B O    1  
ATOM 3213  C CB   . GLN B 1 102 ? 9.813   10.502  7.543   1.00 2.47  ? 102 GLN B CB   1  
ATOM 3214  C CG   . GLN B 1 102 ? 9.133   9.600   8.566   1.00 3.01  ? 102 GLN B CG   1  
ATOM 3215  C CD   . GLN B 1 102 ? 8.645   10.356  9.784   1.00 3.87  ? 102 GLN B CD   1  
ATOM 3216  O OE1  . GLN B 1 102 ? 9.378   10.530  10.757  1.00 4.45  ? 102 GLN B OE1  1  
ATOM 3217  N NE2  . GLN B 1 102 ? 7.396   10.790  9.750   1.00 4.44  ? 102 GLN B NE2  1  
ATOM 3218  H H    . GLN B 1 102 ? 11.262  12.085  6.144   1.00 1.67  ? 102 GLN B H    1  
ATOM 3219  H HA   . GLN B 1 102 ? 10.952  11.635  8.974   1.00 2.52  ? 102 GLN B HA   1  
ATOM 3220  H HB2  . GLN B 1 102 ? 9.123   11.291  7.282   1.00 2.90  ? 102 GLN B HB2  1  
ATOM 3221  H HB3  . GLN B 1 102 ? 10.019  9.915   6.661   1.00 2.74  ? 102 GLN B HB3  1  
ATOM 3222  H HG2  . GLN B 1 102 ? 8.286   9.122   8.097   1.00 3.38  ? 102 GLN B HG2  1  
ATOM 3223  H HG3  . GLN B 1 102 ? 9.839   8.847   8.886   1.00 3.09  ? 102 GLN B HG3  1  
ATOM 3224  H HE21 . GLN B 1 102 ? 6.859   10.599  8.952   1.00 4.33  ? 102 GLN B HE21 1  
ATOM 3225  H HE22 . GLN B 1 102 ? 7.055   11.286  10.527  1.00 5.18  ? 102 GLN B HE22 1  
ATOM 3226  N N    . LYS B 1 103 ? 13.395  10.524  8.579   1.00 3.15  ? 103 LYS B N    1  
ATOM 3227  C CA   . LYS B 1 103 ? 14.535  9.644   8.755   1.00 4.07  ? 103 LYS B CA   1  
ATOM 3228  C C    . LYS B 1 103 ? 14.598  9.153   10.193  1.00 4.57  ? 103 LYS B C    1  
ATOM 3229  O O    . LYS B 1 103 ? 15.526  9.479   10.935  1.00 5.24  ? 103 LYS B O    1  
ATOM 3230  C CB   . LYS B 1 103 ? 15.822  10.382  8.379   1.00 4.74  ? 103 LYS B CB   1  
ATOM 3231  C CG   . LYS B 1 103 ? 15.885  10.789  6.913   1.00 5.31  ? 103 LYS B CG   1  
ATOM 3232  C CD   . LYS B 1 103 ? 16.971  11.825  6.659   1.00 6.26  ? 103 LYS B CD   1  
ATOM 3233  C CE   . LYS B 1 103 ? 18.358  11.316  7.028   1.00 6.83  ? 103 LYS B CE   1  
ATOM 3234  N NZ   . LYS B 1 103 ? 18.786  10.173  6.179   1.00 7.43  ? 103 LYS B NZ   1  
ATOM 3235  H H    . LYS B 1 103 ? 13.506  11.487  8.743   1.00 3.17  ? 103 LYS B H    1  
ATOM 3236  H HA   . LYS B 1 103 ? 14.408  8.797   8.098   1.00 4.39  ? 103 LYS B HA   1  
ATOM 3237  H HB2  . LYS B 1 103 ? 15.902  11.275  8.981   1.00 4.97  ? 103 LYS B HB2  1  
ATOM 3238  H HB3  . LYS B 1 103 ? 16.665  9.741   8.588   1.00 5.08  ? 103 LYS B HB3  1  
ATOM 3239  H HG2  . LYS B 1 103 ? 16.092  9.913   6.317   1.00 5.38  ? 103 LYS B HG2  1  
ATOM 3240  H HG3  . LYS B 1 103 ? 14.930  11.204  6.626   1.00 5.40  ? 103 LYS B HG3  1  
ATOM 3241  H HD2  . LYS B 1 103 ? 16.965  12.084  5.610   1.00 6.63  ? 103 LYS B HD2  1  
ATOM 3242  H HD3  . LYS B 1 103 ? 16.755  12.707  7.245   1.00 6.49  ? 103 LYS B HD3  1  
ATOM 3243  H HE2  . LYS B 1 103 ? 19.066  12.122  6.908   1.00 6.94  ? 103 LYS B HE2  1  
ATOM 3244  H HE3  . LYS B 1 103 ? 18.347  11.001  8.061   1.00 7.02  ? 103 LYS B HE3  1  
ATOM 3245  H HZ1  . LYS B 1 103 ? 19.770  9.917   6.400   1.00 7.63  ? 103 LYS B HZ1  1  
ATOM 3246  H HZ2  . LYS B 1 103 ? 18.727  10.430  5.171   1.00 7.73  ? 103 LYS B HZ2  1  
ATOM 3247  H HZ3  . LYS B 1 103 ? 18.180  9.350   6.355   1.00 7.66  ? 103 LYS B HZ3  1  
ATOM 3248  N N    . ARG B 1 104 ? 13.589  8.381   10.580  1.00 4.69  ? 104 ARG B N    1  
ATOM 3249  C CA   . ARG B 1 104 ? 13.498  7.848   11.932  1.00 5.54  ? 104 ARG B CA   1  
ATOM 3250  C C    . ARG B 1 104 ? 14.712  6.988   12.259  1.00 5.67  ? 104 ARG B C    1  
ATOM 3251  O O    . ARG B 1 104 ? 14.971  5.978   11.598  1.00 5.97  ? 104 ARG B O    1  
ATOM 3252  C CB   . ARG B 1 104 ? 12.213  7.034   12.104  1.00 6.11  ? 104 ARG B CB   1  
ATOM 3253  C CG   . ARG B 1 104 ? 10.944  7.868   12.006  1.00 6.81  ? 104 ARG B CG   1  
ATOM 3254  C CD   . ARG B 1 104 ? 9.697   7.012   12.163  1.00 7.63  ? 104 ARG B CD   1  
ATOM 3255  N NE   . ARG B 1 104 ? 8.474   7.816   12.123  1.00 8.12  ? 104 ARG B NE   1  
ATOM 3256  C CZ   . ARG B 1 104 ? 7.245   7.308   12.012  1.00 8.95  ? 104 ARG B CZ   1  
ATOM 3257  N NH1  . ARG B 1 104 ? 7.068   5.994   11.939  1.00 9.34  ? 104 ARG B NH1  1  
ATOM 3258  N NH2  . ARG B 1 104 ? 6.192   8.114   11.983  1.00 9.59  ? 104 ARG B NH2  1  
ATOM 3259  H H    . ARG B 1 104 ? 12.886  8.164   9.932   1.00 4.49  ? 104 ARG B H    1  
ATOM 3260  H HA   . ARG B 1 104 ? 13.475  8.685   12.613  1.00 6.02  ? 104 ARG B HA   1  
ATOM 3261  H HB2  . ARG B 1 104 ? 12.178  6.274   11.338  1.00 6.43  ? 104 ARG B HB2  1  
ATOM 3262  H HB3  . ARG B 1 104 ? 12.231  6.556   13.073  1.00 6.10  ? 104 ARG B HB3  1  
ATOM 3263  H HG2  . ARG B 1 104 ? 10.954  8.615   12.786  1.00 6.95  ? 104 ARG B HG2  1  
ATOM 3264  H HG3  . ARG B 1 104 ? 10.918  8.353   11.041  1.00 6.93  ? 104 ARG B HG3  1  
ATOM 3265  H HD2  . ARG B 1 104 ? 9.668   6.289   11.362  1.00 7.90  ? 104 ARG B HD2  1  
ATOM 3266  H HD3  . ARG B 1 104 ? 9.746   6.495   13.111  1.00 7.87  ? 104 ARG B HD3  1  
ATOM 3267  H HE   . ARG B 1 104 ? 8.578   8.792   12.181  1.00 8.01  ? 104 ARG B HE   1  
ATOM 3268  H HH11 . ARG B 1 104 ? 7.855   5.375   11.968  1.00 9.05  ? 104 ARG B HH11 1  
ATOM 3269  H HH12 . ARG B 1 104 ? 6.143   5.614   11.849  1.00 10.05 ? 104 ARG B HH12 1  
ATOM 3270  H HH21 . ARG B 1 104 ? 6.311   9.109   12.047  1.00 9.49  ? 104 ARG B HH21 1  
ATOM 3271  H HH22 . ARG B 1 104 ? 5.267   7.730   11.887  1.00 10.29 ? 104 ARG B HH22 1  
ATOM 3272  N N    . THR B 1 105 ? 15.459  7.412   13.262  1.00 5.80  ? 105 THR B N    1  
ATOM 3273  C CA   . THR B 1 105 ? 16.642  6.698   13.697  1.00 6.20  ? 105 THR B CA   1  
ATOM 3274  C C    . THR B 1 105 ? 16.261  5.501   14.560  1.00 6.46  ? 105 THR B C    1  
ATOM 3275  O O    . THR B 1 105 ? 15.893  5.703   15.736  1.00 6.81  ? 105 THR B O    1  
ATOM 3276  C CB   . THR B 1 105 ? 17.582  7.639   14.473  1.00 6.59  ? 105 THR B CB   1  
ATOM 3277  O OG1  . THR B 1 105 ? 16.809  8.495   15.330  1.00 6.66  ? 105 THR B OG1  1  
ATOM 3278  C CG2  . THR B 1 105 ? 18.416  8.482   13.521  1.00 7.01  ? 105 THR B CG2  1  
ATOM 3279  O OXT  . THR B 1 105 ? 16.305  4.361   14.055  1.00 6.62  ? 105 THR B OXT  1  
ATOM 3280  H H    . THR B 1 105 ? 15.207  8.237   13.728  1.00 5.85  ? 105 THR B H    1  
ATOM 3281  H HA   . THR B 1 105 ? 17.163  6.346   12.818  1.00 6.42  ? 105 THR B HA   1  
ATOM 3282  H HB   . THR B 1 105 ? 18.247  7.040   15.080  1.00 6.93  ? 105 THR B HB   1  
ATOM 3283  H HG1  . THR B 1 105 ? 16.338  7.957   15.977  1.00 6.49  ? 105 THR B HG1  1  
ATOM 3284  H HG21 . THR B 1 105 ? 17.763  9.068   12.892  1.00 7.21  ? 105 THR B HG21 1  
ATOM 3285  H HG22 . THR B 1 105 ? 19.025  7.836   12.906  1.00 7.27  ? 105 THR B HG22 1  
ATOM 3286  H HG23 . THR B 1 105 ? 19.055  9.142   14.089  1.00 7.16  ? 105 THR B HG23 1  
ATOM 3287  N N    . MET A 1 1   ? -18.474 13.072  14.405  1.00 7.63  ? 1   MET A N    2  
ATOM 3288  C CA   . MET A 1 1   ? -17.225 13.647  13.850  1.00 7.05  ? 1   MET A CA   2  
ATOM 3289  C C    . MET A 1 1   ? -17.531 14.895  13.031  1.00 6.84  ? 1   MET A C    2  
ATOM 3290  O O    . MET A 1 1   ? -18.688 15.163  12.704  1.00 7.12  ? 1   MET A O    2  
ATOM 3291  C CB   . MET A 1 1   ? -16.479 12.601  13.003  1.00 7.11  ? 1   MET A CB   2  
ATOM 3292  C CG   . MET A 1 1   ? -17.334 11.898  11.956  1.00 7.39  ? 1   MET A CG   2  
ATOM 3293  S SD   . MET A 1 1   ? -17.788 12.956  10.569  1.00 7.66  ? 1   MET A SD   2  
ATOM 3294  C CE   . MET A 1 1   ? -18.819 11.840  9.624   1.00 7.91  ? 1   MET A CE   2  
ATOM 3295  H H1   . MET A 1 1   ? -19.134 12.837  13.637  1.00 7.95  ? 1   MET A H1   2  
ATOM 3296  H H2   . MET A 1 1   ? -18.933 13.757  15.038  1.00 7.75  ? 1   MET A H2   2  
ATOM 3297  H H3   . MET A 1 1   ? -18.264 12.208  14.944  1.00 7.88  ? 1   MET A H3   2  
ATOM 3298  H HA   . MET A 1 1   ? -16.596 13.934  14.680  1.00 7.07  ? 1   MET A HA   2  
ATOM 3299  H HB2  . MET A 1 1   ? -15.663 13.089  12.494  1.00 7.26  ? 1   MET A HB2  2  
ATOM 3300  H HB3  . MET A 1 1   ? -16.075 11.849  13.665  1.00 7.17  ? 1   MET A HB3  2  
ATOM 3301  H HG2  . MET A 1 1   ? -16.783 11.053  11.572  1.00 7.57  ? 1   MET A HG2  2  
ATOM 3302  H HG3  . MET A 1 1   ? -18.238 11.546  12.429  1.00 7.61  ? 1   MET A HG3  2  
ATOM 3303  H HE1  . MET A 1 1   ? -19.671 11.547  10.221  1.00 8.15  ? 1   MET A HE1  2  
ATOM 3304  H HE2  . MET A 1 1   ? -18.249 10.963  9.356   1.00 8.15  ? 1   MET A HE2  2  
ATOM 3305  H HE3  . MET A 1 1   ? -19.160 12.335  8.728   1.00 7.92  ? 1   MET A HE3  2  
ATOM 3306  N N    . ALA A 1 2   ? -16.493 15.663  12.718  1.00 6.67  ? 2   ALA A N    2  
ATOM 3307  C CA   . ALA A 1 2   ? -16.651 16.892  11.952  1.00 6.74  ? 2   ALA A CA   2  
ATOM 3308  C C    . ALA A 1 2   ? -15.342 17.271  11.274  1.00 6.14  ? 2   ALA A C    2  
ATOM 3309  O O    . ALA A 1 2   ? -15.211 17.180  10.054  1.00 6.28  ? 2   ALA A O    2  
ATOM 3310  C CB   . ALA A 1 2   ? -17.128 18.025  12.852  1.00 7.31  ? 2   ALA A CB   2  
ATOM 3311  H H    . ALA A 1 2   ? -15.592 15.391  13.000  1.00 6.72  ? 2   ALA A H    2  
ATOM 3312  H HA   . ALA A 1 2   ? -17.402 16.722  11.195  1.00 7.13  ? 2   ALA A HA   2  
ATOM 3313  H HB1  . ALA A 1 2   ? -17.305 18.908  12.256  1.00 7.69  ? 2   ALA A HB1  2  
ATOM 3314  H HB2  . ALA A 1 2   ? -16.374 18.237  13.594  1.00 7.46  ? 2   ALA A HB2  2  
ATOM 3315  H HB3  . ALA A 1 2   ? -18.044 17.732  13.342  1.00 7.49  ? 2   ALA A HB3  2  
ATOM 3316  N N    . LYS A 1 3   ? -14.368 17.676  12.076  1.00 5.79  ? 3   LYS A N    2  
ATOM 3317  C CA   . LYS A 1 3   ? -13.062 18.053  11.560  1.00 5.52  ? 3   LYS A CA   2  
ATOM 3318  C C    . LYS A 1 3   ? -12.178 16.821  11.437  1.00 5.00  ? 3   LYS A C    2  
ATOM 3319  O O    . LYS A 1 3   ? -11.362 16.541  12.317  1.00 5.14  ? 3   LYS A O    2  
ATOM 3320  C CB   . LYS A 1 3   ? -12.397 19.077  12.480  1.00 6.00  ? 3   LYS A CB   2  
ATOM 3321  C CG   . LYS A 1 3   ? -13.208 20.345  12.686  1.00 6.27  ? 3   LYS A CG   2  
ATOM 3322  C CD   . LYS A 1 3   ? -12.489 21.304  13.620  1.00 6.96  ? 3   LYS A CD   2  
ATOM 3323  C CE   . LYS A 1 3   ? -13.290 22.573  13.847  1.00 7.45  ? 3   LYS A CE   2  
ATOM 3324  N NZ   . LYS A 1 3   ? -12.586 23.515  14.754  1.00 7.92  ? 3   LYS A NZ   2  
ATOM 3325  H H    . LYS A 1 3   ? -14.526 17.712  13.043  1.00 5.95  ? 3   LYS A H    2  
ATOM 3326  H HA   . LYS A 1 3   ? -13.201 18.489  10.582  1.00 5.71  ? 3   LYS A HA   2  
ATOM 3327  H HB2  . LYS A 1 3   ? -12.234 18.621  13.444  1.00 6.29  ? 3   LYS A HB2  2  
ATOM 3328  H HB3  . LYS A 1 3   ? -11.442 19.352  12.057  1.00 6.28  ? 3   LYS A HB3  2  
ATOM 3329  H HG2  . LYS A 1 3   ? -13.355 20.828  11.731  1.00 6.42  ? 3   LYS A HG2  2  
ATOM 3330  H HG3  . LYS A 1 3   ? -14.164 20.086  13.114  1.00 6.21  ? 3   LYS A HG3  2  
ATOM 3331  H HD2  . LYS A 1 3   ? -12.333 20.816  14.569  1.00 7.10  ? 3   LYS A HD2  2  
ATOM 3332  H HD3  . LYS A 1 3   ? -11.535 21.564  13.186  1.00 7.33  ? 3   LYS A HD3  2  
ATOM 3333  H HE2  . LYS A 1 3   ? -13.450 23.056  12.896  1.00 7.69  ? 3   LYS A HE2  2  
ATOM 3334  H HE3  . LYS A 1 3   ? -14.243 22.310  14.282  1.00 7.56  ? 3   LYS A HE3  2  
ATOM 3335  H HZ1  . LYS A 1 3   ? -11.655 23.763  14.361  1.00 7.97  ? 3   LYS A HZ1  2  
ATOM 3336  H HZ2  . LYS A 1 3   ? -12.450 23.081  15.687  1.00 8.25  ? 3   LYS A HZ2  2  
ATOM 3337  H HZ3  . LYS A 1 3   ? -13.142 24.387  14.868  1.00 8.16  ? 3   LYS A HZ3  2  
ATOM 3338  N N    . ILE A 1 4   ? -12.353 16.084  10.350  1.00 4.74  ? 4   ILE A N    2  
ATOM 3339  C CA   . ILE A 1 4   ? -11.613 14.851  10.134  1.00 4.41  ? 4   ILE A CA   2  
ATOM 3340  C C    . ILE A 1 4   ? -10.121 15.130  10.007  1.00 3.66  ? 4   ILE A C    2  
ATOM 3341  O O    . ILE A 1 4   ? -9.679  15.807  9.077   1.00 3.90  ? 4   ILE A O    2  
ATOM 3342  C CB   . ILE A 1 4   ? -12.099 14.106  8.873   1.00 5.14  ? 4   ILE A CB   2  
ATOM 3343  C CG1  . ILE A 1 4   ? -13.612 13.857  8.940   1.00 5.77  ? 4   ILE A CG1  2  
ATOM 3344  C CG2  . ILE A 1 4   ? -11.350 12.790  8.714   1.00 5.58  ? 4   ILE A CG2  2  
ATOM 3345  C CD1  . ILE A 1 4   ? -14.040 12.991  10.108  1.00 6.53  ? 4   ILE A CD1  2  
ATOM 3346  H H    . ILE A 1 4   ? -13.000 16.380  9.672   1.00 5.01  ? 4   ILE A H    2  
ATOM 3347  H HA   . ILE A 1 4   ? -11.776 14.211  10.989  1.00 4.58  ? 4   ILE A HA   2  
ATOM 3348  H HB   . ILE A 1 4   ? -11.881 14.721  8.013   1.00 5.37  ? 4   ILE A HB   2  
ATOM 3349  H HG12 . ILE A 1 4   ? -14.122 14.803  9.029   1.00 5.98  ? 4   ILE A HG12 2  
ATOM 3350  H HG13 . ILE A 1 4   ? -13.928 13.368  8.031   1.00 5.87  ? 4   ILE A HG13 2  
ATOM 3351  H HG21 . ILE A 1 4   ? -10.290 12.986  8.639   1.00 5.92  ? 4   ILE A HG21 2  
ATOM 3352  H HG22 . ILE A 1 4   ? -11.687 12.289  7.819   1.00 5.99  ? 4   ILE A HG22 2  
ATOM 3353  H HG23 . ILE A 1 4   ? -11.540 12.162  9.572   1.00 5.54  ? 4   ILE A HG23 2  
ATOM 3354  H HD11 . ILE A 1 4   ? -13.765 13.472  11.034  1.00 6.97  ? 4   ILE A HD11 2  
ATOM 3355  H HD12 . ILE A 1 4   ? -13.552 12.030  10.042  1.00 6.74  ? 4   ILE A HD12 2  
ATOM 3356  H HD13 . ILE A 1 4   ? -15.112 12.854  10.079  1.00 6.72  ? 4   ILE A HD13 2  
ATOM 3357  N N    . SER A 1 5   ? -9.357  14.650  10.974  1.00 3.24  ? 5   SER A N    2  
ATOM 3358  C CA   . SER A 1 5   ? -7.910  14.787  10.948  1.00 2.93  ? 5   SER A CA   2  
ATOM 3359  C C    . SER A 1 5   ? -7.246  13.576  11.593  1.00 2.01  ? 5   SER A C    2  
ATOM 3360  O O    . SER A 1 5   ? -6.027  13.528  11.746  1.00 2.25  ? 5   SER A O    2  
ATOM 3361  C CB   . SER A 1 5   ? -7.494  16.073  11.666  1.00 3.70  ? 5   SER A CB   2  
ATOM 3362  O OG   . SER A 1 5   ? -8.135  17.197  11.086  1.00 4.46  ? 5   SER A OG   2  
ATOM 3363  H H    . SER A 1 5   ? -9.780  14.204  11.738  1.00 3.53  ? 5   SER A H    2  
ATOM 3364  H HA   . SER A 1 5   ? -7.600  14.845  9.916   1.00 3.38  ? 5   SER A HA   2  
ATOM 3365  H HB2  . SER A 1 5   ? -7.775  16.009  12.707  1.00 3.91  ? 5   SER A HB2  2  
ATOM 3366  H HB3  . SER A 1 5   ? -6.424  16.200  11.587  1.00 4.03  ? 5   SER A HB3  2  
ATOM 3367  H HG   . SER A 1 5   ? -8.651  16.904  10.319  1.00 4.64  ? 5   SER A HG   2  
ATOM 3368  N N    . SER A 1 6   ? -8.058  12.601  11.974  1.00 1.51  ? 6   SER A N    2  
ATOM 3369  C CA   . SER A 1 6   ? -7.552  11.373  12.557  1.00 1.03  ? 6   SER A CA   2  
ATOM 3370  C C    . SER A 1 6   ? -7.489  10.295  11.481  1.00 0.82  ? 6   SER A C    2  
ATOM 3371  O O    . SER A 1 6   ? -8.466  10.075  10.763  1.00 0.85  ? 6   SER A O    2  
ATOM 3372  C CB   . SER A 1 6   ? -8.452  10.929  13.716  1.00 1.67  ? 6   SER A CB   2  
ATOM 3373  O OG   . SER A 1 6   ? -7.879  9.852   14.437  1.00 2.25  ? 6   SER A OG   2  
ATOM 3374  H H    . SER A 1 6   ? -9.023  12.705  11.853  1.00 1.99  ? 6   SER A H    2  
ATOM 3375  H HA   . SER A 1 6   ? -6.556  11.561  12.928  1.00 1.21  ? 6   SER A HA   2  
ATOM 3376  H HB2  . SER A 1 6   ? -8.598  11.757  14.392  1.00 2.13  ? 6   SER A HB2  2  
ATOM 3377  H HB3  . SER A 1 6   ? -9.408  10.615  13.324  1.00 2.15  ? 6   SER A HB3  2  
ATOM 3378  H HG   . SER A 1 6   ? -8.446  9.073   14.357  1.00 2.50  ? 6   SER A HG   2  
ATOM 3379  N N    . PRO A 1 7   ? -6.340  9.623   11.343  1.00 0.69  ? 7   PRO A N    2  
ATOM 3380  C CA   . PRO A 1 7   ? -6.138  8.611   10.307  1.00 0.54  ? 7   PRO A CA   2  
ATOM 3381  C C    . PRO A 1 7   ? -6.761  7.274   10.681  1.00 0.44  ? 7   PRO A C    2  
ATOM 3382  O O    . PRO A 1 7   ? -6.927  6.953   11.862  1.00 0.56  ? 7   PRO A O    2  
ATOM 3383  C CB   . PRO A 1 7   ? -4.620  8.486   10.271  1.00 0.61  ? 7   PRO A CB   2  
ATOM 3384  C CG   . PRO A 1 7   ? -4.241  8.673   11.691  1.00 0.75  ? 7   PRO A CG   2  
ATOM 3385  C CD   . PRO A 1 7   ? -5.140  9.773   12.191  1.00 0.82  ? 7   PRO A CD   2  
ATOM 3386  H HA   . PRO A 1 7   ? -6.506  8.935   9.346   1.00 0.57  ? 7   PRO A HA   2  
ATOM 3387  H HB2  . PRO A 1 7   ? -4.340  7.509   9.903   1.00 0.60  ? 7   PRO A HB2  2  
ATOM 3388  H HB3  . PRO A 1 7   ? -4.200  9.257   9.642   1.00 0.68  ? 7   PRO A HB3  2  
ATOM 3389  H HG2  . PRO A 1 7   ? -4.426  7.756   12.235  1.00 0.75  ? 7   PRO A HG2  2  
ATOM 3390  H HG3  . PRO A 1 7   ? -3.206  8.962   11.767  1.00 0.87  ? 7   PRO A HG3  2  
ATOM 3391  H HD2  . PRO A 1 7   ? -5.379  9.624   13.233  1.00 0.93  ? 7   PRO A HD2  2  
ATOM 3392  H HD3  . PRO A 1 7   ? -4.679  10.739  12.040  1.00 0.90  ? 7   PRO A HD3  2  
ATOM 3393  N N    . THR A 1 8   ? -7.112  6.506   9.674   1.00 0.34  ? 8   THR A N    2  
ATOM 3394  C CA   . THR A 1 8   ? -7.641  5.175   9.881   1.00 0.27  ? 8   THR A CA   2  
ATOM 3395  C C    . THR A 1 8   ? -6.533  4.150   9.720   1.00 0.28  ? 8   THR A C    2  
ATOM 3396  O O    . THR A 1 8   ? -5.369  4.520   9.558   1.00 0.35  ? 8   THR A O    2  
ATOM 3397  C CB   . THR A 1 8   ? -8.745  4.887   8.867   1.00 0.28  ? 8   THR A CB   2  
ATOM 3398  O OG1  . THR A 1 8   ? -8.172  4.775   7.561   1.00 0.36  ? 8   THR A OG1  2  
ATOM 3399  C CG2  . THR A 1 8   ? -9.771  6.002   8.897   1.00 0.32  ? 8   THR A CG2  2  
ATOM 3400  H H    . THR A 1 8   ? -7.030  6.851   8.757   1.00 0.42  ? 8   THR A H    2  
ATOM 3401  H HA   . THR A 1 8   ? -8.053  5.113   10.876  1.00 0.31  ? 8   THR A HA   2  
ATOM 3402  H HB   . THR A 1 8   ? -9.233  3.962   9.122   1.00 0.32  ? 8   THR A HB   2  
ATOM 3403  H HG1  . THR A 1 8   ? -8.643  5.361   6.949   1.00 0.31  ? 8   THR A HG1  2  
ATOM 3404  H HG21 . THR A 1 8   ? -10.557 5.747   9.592   1.00 1.05  ? 8   THR A HG21 2  
ATOM 3405  H HG22 . THR A 1 8   ? -10.181 6.140   7.911   1.00 1.08  ? 8   THR A HG22 2  
ATOM 3406  H HG23 . THR A 1 8   ? -9.292  6.914   9.216   1.00 1.04  ? 8   THR A HG23 2  
ATOM 3407  N N    . GLU A 1 9   ? -6.895  2.874   9.739   1.00 0.28  ? 9   GLU A N    2  
ATOM 3408  C CA   . GLU A 1 9   ? -5.923  1.800   9.585   1.00 0.33  ? 9   GLU A CA   2  
ATOM 3409  C C    . GLU A 1 9   ? -5.119  1.987   8.301   1.00 0.36  ? 9   GLU A C    2  
ATOM 3410  O O    . GLU A 1 9   ? -3.898  1.979   8.328   1.00 0.52  ? 9   GLU A O    2  
ATOM 3411  C CB   . GLU A 1 9   ? -6.624  0.441   9.564   1.00 0.40  ? 9   GLU A CB   2  
ATOM 3412  C CG   . GLU A 1 9   ? -5.669  -0.736  9.677   1.00 0.56  ? 9   GLU A CG   2  
ATOM 3413  C CD   . GLU A 1 9   ? -5.127  -0.893  11.078  1.00 1.73  ? 9   GLU A CD   2  
ATOM 3414  O OE1  . GLU A 1 9   ? -5.907  -1.249  11.984  1.00 2.48  ? 9   GLU A OE1  2  
ATOM 3415  O OE2  . GLU A 1 9   ? -3.926  -0.656  11.287  1.00 2.47  ? 9   GLU A OE2  2  
ATOM 3416  H H    . GLU A 1 9   ? -7.845  2.649   9.863   1.00 0.29  ? 9   GLU A H    2  
ATOM 3417  H HA   . GLU A 1 9   ? -5.244  1.836   10.425  1.00 0.37  ? 9   GLU A HA   2  
ATOM 3418  H HB2  . GLU A 1 9   ? -7.316  0.395   10.390  1.00 0.44  ? 9   GLU A HB2  2  
ATOM 3419  H HB3  . GLU A 1 9   ? -7.175  0.345   8.640   1.00 0.38  ? 9   GLU A HB3  2  
ATOM 3420  H HG2  . GLU A 1 9   ? -6.184  -1.646  9.398   1.00 0.94  ? 9   GLU A HG2  2  
ATOM 3421  H HG3  . GLU A 1 9   ? -4.839  -0.570  9.002   1.00 0.73  ? 9   GLU A HG3  2  
ATOM 3422  N N    . THR A 1 10  ? -5.812  2.203   7.191   1.00 0.26  ? 10  THR A N    2  
ATOM 3423  C CA   . THR A 1 10  ? -5.161  2.356   5.896   1.00 0.27  ? 10  THR A CA   2  
ATOM 3424  C C    . THR A 1 10  ? -4.347  3.635   5.847   1.00 0.27  ? 10  THR A C    2  
ATOM 3425  O O    . THR A 1 10  ? -3.228  3.637   5.354   1.00 0.31  ? 10  THR A O    2  
ATOM 3426  C CB   . THR A 1 10  ? -6.172  2.325   4.716   1.00 0.27  ? 10  THR A CB   2  
ATOM 3427  O OG1  . THR A 1 10  ? -5.720  3.159   3.648   1.00 0.40  ? 10  THR A OG1  2  
ATOM 3428  C CG2  . THR A 1 10  ? -7.564  2.764   5.148   1.00 0.25  ? 10  THR A CG2  2  
ATOM 3429  H H    . THR A 1 10  ? -6.777  2.292   7.246   1.00 0.22  ? 10  THR A H    2  
ATOM 3430  H HA   . THR A 1 10  ? -4.479  1.531   5.770   1.00 0.31  ? 10  THR A HA   2  
ATOM 3431  H HB   . THR A 1 10  ? -6.233  1.308   4.349   1.00 0.34  ? 10  THR A HB   2  
ATOM 3432  H HG1  . THR A 1 10  ? -6.448  3.699   3.333   1.00 1.00  ? 10  THR A HG1  2  
ATOM 3433  H HG21 . THR A 1 10  ? -7.494  3.693   5.695   1.00 1.12  ? 10  THR A HG21 2  
ATOM 3434  H HG22 . THR A 1 10  ? -8.005  2.005   5.775   1.00 0.94  ? 10  THR A HG22 2  
ATOM 3435  H HG23 . THR A 1 10  ? -8.181  2.908   4.274   1.00 1.00  ? 10  THR A HG23 2  
ATOM 3436  N N    . GLU A 1 11  ? -4.886  4.706   6.401   1.00 0.25  ? 11  GLU A N    2  
ATOM 3437  C CA   . GLU A 1 11  ? -4.229  5.997   6.324   1.00 0.27  ? 11  GLU A CA   2  
ATOM 3438  C C    . GLU A 1 11  ? -2.943  6.009   7.124   1.00 0.30  ? 11  GLU A C    2  
ATOM 3439  O O    . GLU A 1 11  ? -1.914  6.486   6.653   1.00 0.32  ? 11  GLU A O    2  
ATOM 3440  C CB   . GLU A 1 11  ? -5.161  7.089   6.804   1.00 0.29  ? 11  GLU A CB   2  
ATOM 3441  C CG   . GLU A 1 11  ? -6.497  7.023   6.116   1.00 0.41  ? 11  GLU A CG   2  
ATOM 3442  C CD   . GLU A 1 11  ? -7.349  8.243   6.365   1.00 1.11  ? 11  GLU A CD   2  
ATOM 3443  O OE1  . GLU A 1 11  ? -7.718  8.480   7.533   1.00 1.71  ? 11  GLU A OE1  2  
ATOM 3444  O OE2  . GLU A 1 11  ? -7.640  8.975   5.400   1.00 1.85  ? 11  GLU A OE2  2  
ATOM 3445  H H    . GLU A 1 11  ? -5.747  4.628   6.867   1.00 0.23  ? 11  GLU A H    2  
ATOM 3446  H HA   . GLU A 1 11  ? -3.990  6.175   5.291   1.00 0.30  ? 11  GLU A HA   2  
ATOM 3447  H HB2  . GLU A 1 11  ? -5.310  6.981   7.866   1.00 0.41  ? 11  GLU A HB2  2  
ATOM 3448  H HB3  . GLU A 1 11  ? -4.717  8.052   6.598   1.00 0.42  ? 11  GLU A HB3  2  
ATOM 3449  H HG2  . GLU A 1 11  ? -6.321  6.923   5.060   1.00 0.40  ? 11  GLU A HG2  2  
ATOM 3450  H HG3  . GLU A 1 11  ? -7.026  6.151   6.474   1.00 0.71  ? 11  GLU A HG3  2  
ATOM 3451  N N    . ARG A 1 12  ? -2.996  5.460   8.323   1.00 0.35  ? 12  ARG A N    2  
ATOM 3452  C CA   . ARG A 1 12  ? -1.809  5.379   9.157   1.00 0.42  ? 12  ARG A CA   2  
ATOM 3453  C C    . ARG A 1 12  ? -0.817  4.412   8.533   1.00 0.43  ? 12  ARG A C    2  
ATOM 3454  O O    . ARG A 1 12  ? 0.391   4.604   8.609   1.00 0.47  ? 12  ARG A O    2  
ATOM 3455  C CB   . ARG A 1 12  ? -2.162  4.978   10.602  1.00 0.48  ? 12  ARG A CB   2  
ATOM 3456  C CG   . ARG A 1 12  ? -2.787  3.596   10.780  1.00 0.49  ? 12  ARG A CG   2  
ATOM 3457  C CD   . ARG A 1 12  ? -1.767  2.476   10.646  1.00 0.56  ? 12  ARG A CD   2  
ATOM 3458  N NE   . ARG A 1 12  ? -2.139  1.303   11.431  1.00 1.08  ? 12  ARG A NE   2  
ATOM 3459  C CZ   . ARG A 1 12  ? -1.662  1.029   12.646  1.00 1.35  ? 12  ARG A CZ   2  
ATOM 3460  N NH1  . ARG A 1 12  ? -0.790  1.844   13.230  1.00 1.86  ? 12  ARG A NH1  2  
ATOM 3461  N NH2  . ARG A 1 12  ? -2.071  -0.064  13.276  1.00 1.95  ? 12  ARG A NH2  2  
ATOM 3462  H H    . ARG A 1 12  ? -3.850  5.099   8.648   1.00 0.35  ? 12  ARG A H    2  
ATOM 3463  H HA   . ARG A 1 12  ? -1.358  6.358   9.171   1.00 0.44  ? 12  ARG A HA   2  
ATOM 3464  H HB2  . ARG A 1 12  ? -1.261  5.008   11.192  1.00 0.56  ? 12  ARG A HB2  2  
ATOM 3465  H HB3  . ARG A 1 12  ? -2.854  5.708   10.995  1.00 0.48  ? 12  ARG A HB3  2  
ATOM 3466  H HG2  . ARG A 1 12  ? -3.237  3.538   11.758  1.00 0.53  ? 12  ARG A HG2  2  
ATOM 3467  H HG3  . ARG A 1 12  ? -3.550  3.461   10.024  1.00 0.45  ? 12  ARG A HG3  2  
ATOM 3468  H HD2  . ARG A 1 12  ? -1.706  2.194   9.591   1.00 0.91  ? 12  ARG A HD2  2  
ATOM 3469  H HD3  . ARG A 1 12  ? -0.805  2.839   10.972  1.00 0.84  ? 12  ARG A HD3  2  
ATOM 3470  H HE   . ARG A 1 12  ? -2.791  0.675   11.030  1.00 1.80  ? 12  ARG A HE   2  
ATOM 3471  H HH11 . ARG A 1 12  ? -0.481  2.674   12.760  1.00 2.09  ? 12  ARG A HH11 2  
ATOM 3472  H HH12 . ARG A 1 12  ? -0.439  1.634   14.147  1.00 2.43  ? 12  ARG A HH12 2  
ATOM 3473  H HH21 . ARG A 1 12  ? -2.736  -0.675  12.833  1.00 2.48  ? 12  ARG A HH21 2  
ATOM 3474  H HH22 . ARG A 1 12  ? -1.729  -0.280  14.194  1.00 2.20  ? 12  ARG A HH22 2  
ATOM 3475  N N    . CYS A 1 13  ? -1.355  3.386   7.890   1.00 0.42  ? 13  CYS A N    2  
ATOM 3476  C CA   . CYS A 1 13  ? -0.553  2.373   7.230   1.00 0.44  ? 13  CYS A CA   2  
ATOM 3477  C C    . CYS A 1 13  ? 0.139   2.980   6.029   1.00 0.30  ? 13  CYS A C    2  
ATOM 3478  O O    . CYS A 1 13  ? 1.301   2.693   5.744   1.00 0.29  ? 13  CYS A O    2  
ATOM 3479  C CB   . CYS A 1 13  ? -1.453  1.207   6.830   1.00 0.57  ? 13  CYS A CB   2  
ATOM 3480  S SG   . CYS A 1 13  ? -1.807  0.069   8.186   1.00 2.16  ? 13  CYS A SG   2  
ATOM 3481  H H    . CYS A 1 13  ? -2.335  3.313   7.850   1.00 0.41  ? 13  CYS A H    2  
ATOM 3482  H HA   . CYS A 1 13  ? 0.194   2.027   7.929   1.00 0.55  ? 13  CYS A HA   2  
ATOM 3483  H HB2  . CYS A 1 13  ? -2.397  1.602   6.484   1.00 1.00  ? 13  CYS A HB2  2  
ATOM 3484  H HB3  . CYS A 1 13  ? -1.002  0.649   6.042   1.00 0.84  ? 13  CYS A HB3  2  
ATOM 3485  H HG   . CYS A 1 13  ? -2.927  0.477   8.767   1.00 2.85  ? 13  CYS A HG   2  
ATOM 3486  N N    . ILE A 1 14  ? -0.590  3.846   5.355   1.00 0.26  ? 14  ILE A N    2  
ATOM 3487  C CA   . ILE A 1 14  ? -0.060  4.635   4.269   1.00 0.24  ? 14  ILE A CA   2  
ATOM 3488  C C    . ILE A 1 14  ? 1.134   5.467   4.731   1.00 0.21  ? 14  ILE A C    2  
ATOM 3489  O O    . ILE A 1 14  ? 2.167   5.525   4.061   1.00 0.23  ? 14  ILE A O    2  
ATOM 3490  C CB   . ILE A 1 14  ? -1.163  5.559   3.717   1.00 0.24  ? 14  ILE A CB   2  
ATOM 3491  C CG1  . ILE A 1 14  ? -2.072  4.802   2.749   1.00 0.25  ? 14  ILE A CG1  2  
ATOM 3492  C CG2  . ILE A 1 14  ? -0.578  6.797   3.058   1.00 0.27  ? 14  ILE A CG2  2  
ATOM 3493  C CD1  . ILE A 1 14  ? -3.284  5.601   2.345   1.00 0.27  ? 14  ILE A CD1  2  
ATOM 3494  H H    . ILE A 1 14  ? -1.541  3.949   5.589   1.00 0.27  ? 14  ILE A H    2  
ATOM 3495  H HA   . ILE A 1 14  ? 0.250   3.960   3.494   1.00 0.27  ? 14  ILE A HA   2  
ATOM 3496  H HB   . ILE A 1 14  ? -1.761  5.886   4.557   1.00 0.25  ? 14  ILE A HB   2  
ATOM 3497  H HG12 . ILE A 1 14  ? -1.521  4.559   1.853   1.00 0.26  ? 14  ILE A HG12 2  
ATOM 3498  H HG13 . ILE A 1 14  ? -2.417  3.891   3.218   1.00 0.27  ? 14  ILE A HG13 2  
ATOM 3499  H HG21 . ILE A 1 14  ? -0.081  7.400   3.804   1.00 1.02  ? 14  ILE A HG21 2  
ATOM 3500  H HG22 . ILE A 1 14  ? -1.370  7.372   2.600   1.00 1.02  ? 14  ILE A HG22 2  
ATOM 3501  H HG23 . ILE A 1 14  ? 0.134   6.498   2.305   1.00 1.01  ? 14  ILE A HG23 2  
ATOM 3502  H HD11 . ILE A 1 14  ? -3.872  5.825   3.225   1.00 1.06  ? 14  ILE A HD11 2  
ATOM 3503  H HD12 . ILE A 1 14  ? -3.877  5.031   1.647   1.00 0.96  ? 14  ILE A HD12 2  
ATOM 3504  H HD13 . ILE A 1 14  ? -2.962  6.524   1.882   1.00 1.12  ? 14  ILE A HD13 2  
ATOM 3505  N N    . GLU A 1 15  ? 0.996   6.075   5.900   1.00 0.24  ? 15  GLU A N    2  
ATOM 3506  C CA   . GLU A 1 15  ? 2.025   6.943   6.433   1.00 0.28  ? 15  GLU A CA   2  
ATOM 3507  C C    . GLU A 1 15  ? 3.178   6.117   6.929   1.00 0.30  ? 15  GLU A C    2  
ATOM 3508  O O    . GLU A 1 15  ? 4.305   6.588   7.031   1.00 0.34  ? 15  GLU A O    2  
ATOM 3509  C CB   . GLU A 1 15  ? 1.491   7.759   7.590   1.00 0.32  ? 15  GLU A CB   2  
ATOM 3510  C CG   . GLU A 1 15  ? 0.256   8.575   7.247   1.00 0.33  ? 15  GLU A CG   2  
ATOM 3511  C CD   . GLU A 1 15  ? -0.195  9.442   8.402   1.00 0.38  ? 15  GLU A CD   2  
ATOM 3512  O OE1  . GLU A 1 15  ? -0.253  8.933   9.542   1.00 1.26  ? 15  GLU A OE1  2  
ATOM 3513  O OE2  . GLU A 1 15  ? -0.471  10.641  8.181   1.00 1.06  ? 15  GLU A OE2  2  
ATOM 3514  H H    . GLU A 1 15  ? 0.190   5.916   6.430   1.00 0.26  ? 15  GLU A H    2  
ATOM 3515  H HA   . GLU A 1 15  ? 2.363   7.601   5.650   1.00 0.29  ? 15  GLU A HA   2  
ATOM 3516  H HB2  . GLU A 1 15  ? 1.249   7.082   8.399   1.00 0.33  ? 15  GLU A HB2  2  
ATOM 3517  H HB3  . GLU A 1 15  ? 2.268   8.432   7.918   1.00 0.37  ? 15  GLU A HB3  2  
ATOM 3518  H HG2  . GLU A 1 15  ? 0.486   9.215   6.406   1.00 0.33  ? 15  GLU A HG2  2  
ATOM 3519  H HG3  . GLU A 1 15  ? -0.550  7.898   6.976   1.00 0.31  ? 15  GLU A HG3  2  
ATOM 3520  N N    . SER A 1 16  ? 2.875   4.884   7.259   1.00 0.31  ? 16  SER A N    2  
ATOM 3521  C CA   . SER A 1 16  ? 3.878   3.982   7.738   1.00 0.38  ? 16  SER A CA   2  
ATOM 3522  C C    . SER A 1 16  ? 4.742   3.513   6.581   1.00 0.29  ? 16  SER A C    2  
ATOM 3523  O O    . SER A 1 16  ? 5.948   3.353   6.729   1.00 0.28  ? 16  SER A O    2  
ATOM 3524  C CB   . SER A 1 16  ? 3.229   2.818   8.467   1.00 0.54  ? 16  SER A CB   2  
ATOM 3525  O OG   . SER A 1 16  ? 2.420   3.282   9.532   1.00 0.97  ? 16  SER A OG   2  
ATOM 3526  H H    . SER A 1 16  ? 1.948   4.577   7.180   1.00 0.31  ? 16  SER A H    2  
ATOM 3527  H HA   . SER A 1 16  ? 4.492   4.531   8.428   1.00 0.45  ? 16  SER A HA   2  
ATOM 3528  H HB2  . SER A 1 16  ? 2.615   2.257   7.778   1.00 0.77  ? 16  SER A HB2  2  
ATOM 3529  H HB3  . SER A 1 16  ? 3.995   2.181   8.868   1.00 0.80  ? 16  SER A HB3  2  
ATOM 3530  H HG   . SER A 1 16  ? 1.680   3.793   9.174   1.00 1.17  ? 16  SER A HG   2  
ATOM 3531  N N    . LEU A 1 17  ? 4.127   3.326   5.418   1.00 0.27  ? 17  LEU A N    2  
ATOM 3532  C CA   . LEU A 1 17  ? 4.882   3.074   4.200   1.00 0.28  ? 17  LEU A CA   2  
ATOM 3533  C C    . LEU A 1 17  ? 5.737   4.290   3.897   1.00 0.27  ? 17  LEU A C    2  
ATOM 3534  O O    . LEU A 1 17  ? 6.880   4.168   3.483   1.00 0.32  ? 17  LEU A O    2  
ATOM 3535  C CB   . LEU A 1 17  ? 3.951   2.795   3.024   1.00 0.29  ? 17  LEU A CB   2  
ATOM 3536  C CG   . LEU A 1 17  ? 2.903   1.720   3.284   1.00 0.33  ? 17  LEU A CG   2  
ATOM 3537  C CD1  . LEU A 1 17  ? 1.917   1.632   2.133   1.00 0.33  ? 17  LEU A CD1  2  
ATOM 3538  C CD2  . LEU A 1 17  ? 3.562   0.368   3.527   1.00 0.46  ? 17  LEU A CD2  2  
ATOM 3539  H H    . LEU A 1 17  ? 3.143   3.348   5.382   1.00 0.28  ? 17  LEU A H    2  
ATOM 3540  H HA   . LEU A 1 17  ? 5.521   2.220   4.367   1.00 0.31  ? 17  LEU A HA   2  
ATOM 3541  H HB2  . LEU A 1 17  ? 3.446   3.716   2.772   1.00 0.27  ? 17  LEU A HB2  2  
ATOM 3542  H HB3  . LEU A 1 17  ? 4.552   2.484   2.179   1.00 0.36  ? 17  LEU A HB3  2  
ATOM 3543  H HG   . LEU A 1 17  ? 2.357   1.991   4.168   1.00 0.33  ? 17  LEU A HG   2  
ATOM 3544  H HD11 . LEU A 1 17  ? 1.192   0.858   2.338   1.00 1.09  ? 17  LEU A HD11 2  
ATOM 3545  H HD12 . LEU A 1 17  ? 2.446   1.398   1.222   1.00 1.06  ? 17  LEU A HD12 2  
ATOM 3546  H HD13 . LEU A 1 17  ? 1.409   2.579   2.023   1.00 1.06  ? 17  LEU A HD13 2  
ATOM 3547  H HD21 . LEU A 1 17  ? 4.249   0.445   4.359   1.00 1.08  ? 17  LEU A HD21 2  
ATOM 3548  H HD22 . LEU A 1 17  ? 4.100   0.065   2.641   1.00 1.10  ? 17  LEU A HD22 2  
ATOM 3549  H HD23 . LEU A 1 17  ? 2.803   -0.367  3.756   1.00 1.21  ? 17  LEU A HD23 2  
ATOM 3550  N N    . ILE A 1 18  ? 5.160   5.467   4.128   1.00 0.27  ? 18  ILE A N    2  
ATOM 3551  C CA   . ILE A 1 18  ? 5.893   6.721   4.025   1.00 0.30  ? 18  ILE A CA   2  
ATOM 3552  C C    . ILE A 1 18  ? 7.107   6.706   4.949   1.00 0.28  ? 18  ILE A C    2  
ATOM 3553  O O    . ILE A 1 18  ? 8.198   7.109   4.558   1.00 0.30  ? 18  ILE A O    2  
ATOM 3554  C CB   . ILE A 1 18  ? 4.985   7.931   4.369   1.00 0.36  ? 18  ILE A CB   2  
ATOM 3555  C CG1  . ILE A 1 18  ? 3.939   8.131   3.271   1.00 0.63  ? 18  ILE A CG1  2  
ATOM 3556  C CG2  . ILE A 1 18  ? 5.806   9.199   4.571   1.00 0.47  ? 18  ILE A CG2  2  
ATOM 3557  C CD1  . ILE A 1 18  ? 3.002   9.287   3.530   1.00 1.37  ? 18  ILE A CD1  2  
ATOM 3558  H H    . ILE A 1 18  ? 4.208   5.490   4.365   1.00 0.29  ? 18  ILE A H    2  
ATOM 3559  H HA   . ILE A 1 18  ? 6.231   6.828   3.004   1.00 0.33  ? 18  ILE A HA   2  
ATOM 3560  H HB   . ILE A 1 18  ? 4.472   7.717   5.298   1.00 0.36  ? 18  ILE A HB   2  
ATOM 3561  H HG12 . ILE A 1 18  ? 4.442   8.317   2.336   1.00 0.98  ? 18  ILE A HG12 2  
ATOM 3562  H HG13 . ILE A 1 18  ? 3.344   7.233   3.182   1.00 1.37  ? 18  ILE A HG13 2  
ATOM 3563  H HG21 . ILE A 1 18  ? 6.384   9.400   3.683   1.00 1.13  ? 18  ILE A HG21 2  
ATOM 3564  H HG22 . ILE A 1 18  ? 6.472   9.066   5.412   1.00 1.10  ? 18  ILE A HG22 2  
ATOM 3565  H HG23 . ILE A 1 18  ? 5.142   10.033  4.765   1.00 1.11  ? 18  ILE A HG23 2  
ATOM 3566  H HD11 . ILE A 1 18  ? 2.301   9.369   2.714   1.00 1.87  ? 18  ILE A HD11 2  
ATOM 3567  H HD12 . ILE A 1 18  ? 3.571   10.203  3.607   1.00 1.89  ? 18  ILE A HD12 2  
ATOM 3568  H HD13 . ILE A 1 18  ? 2.464   9.120   4.451   1.00 1.99  ? 18  ILE A HD13 2  
ATOM 3569  N N    . ALA A 1 19  ? 6.904   6.216   6.165   1.00 0.25  ? 19  ALA A N    2  
ATOM 3570  C CA   . ALA A 1 19  ? 7.958   6.163   7.167   1.00 0.25  ? 19  ALA A CA   2  
ATOM 3571  C C    . ALA A 1 19  ? 9.048   5.169   6.782   1.00 0.23  ? 19  ALA A C    2  
ATOM 3572  O O    . ALA A 1 19  ? 10.227  5.520   6.755   1.00 0.28  ? 19  ALA A O    2  
ATOM 3573  C CB   . ALA A 1 19  ? 7.368   5.808   8.524   1.00 0.28  ? 19  ALA A CB   2  
ATOM 3574  H H    . ALA A 1 19  ? 6.011   5.884   6.399   1.00 0.26  ? 19  ALA A H    2  
ATOM 3575  H HA   . ALA A 1 19  ? 8.396   7.148   7.239   1.00 0.29  ? 19  ALA A HA   2  
ATOM 3576  H HB1  . ALA A 1 19  ? 6.981   4.799   8.495   1.00 1.04  ? 19  ALA A HB1  2  
ATOM 3577  H HB2  . ALA A 1 19  ? 6.566   6.493   8.757   1.00 1.06  ? 19  ALA A HB2  2  
ATOM 3578  H HB3  . ALA A 1 19  ? 8.135   5.879   9.281   1.00 0.97  ? 19  ALA A HB3  2  
ATOM 3579  N N    . VAL A 1 20  ? 8.656   3.934   6.473   1.00 0.20  ? 20  VAL A N    2  
ATOM 3580  C CA   . VAL A 1 20  ? 9.617   2.895   6.118   1.00 0.22  ? 20  VAL A CA   2  
ATOM 3581  C C    . VAL A 1 20  ? 10.343  3.273   4.842   1.00 0.23  ? 20  VAL A C    2  
ATOM 3582  O O    . VAL A 1 20  ? 11.552  3.064   4.710   1.00 0.27  ? 20  VAL A O    2  
ATOM 3583  C CB   . VAL A 1 20  ? 8.948   1.508   5.953   1.00 0.27  ? 20  VAL A CB   2  
ATOM 3584  C CG1  . VAL A 1 20  ? 8.003   1.259   7.093   1.00 0.87  ? 20  VAL A CG1  2  
ATOM 3585  C CG2  . VAL A 1 20  ? 8.209   1.368   4.632   1.00 0.87  ? 20  VAL A CG2  2  
ATOM 3586  H H    . VAL A 1 20  ? 7.696   3.716   6.488   1.00 0.21  ? 20  VAL A H    2  
ATOM 3587  H HA   . VAL A 1 20  ? 10.338  2.830   6.919   1.00 0.24  ? 20  VAL A HA   2  
ATOM 3588  H HB   . VAL A 1 20  ? 9.719   0.754   5.994   1.00 0.52  ? 20  VAL A HB   2  
ATOM 3589  H HG11 . VAL A 1 20  ? 7.286   2.066   7.128   1.00 1.36  ? 20  VAL A HG11 2  
ATOM 3590  H HG12 . VAL A 1 20  ? 8.554   1.219   8.018   1.00 1.57  ? 20  VAL A HG12 2  
ATOM 3591  H HG13 . VAL A 1 20  ? 7.486   0.327   6.930   1.00 1.42  ? 20  VAL A HG13 2  
ATOM 3592  H HG21 . VAL A 1 20  ? 7.485   2.162   4.540   1.00 1.45  ? 20  VAL A HG21 2  
ATOM 3593  H HG22 . VAL A 1 20  ? 7.703   0.414   4.601   1.00 1.40  ? 20  VAL A HG22 2  
ATOM 3594  H HG23 . VAL A 1 20  ? 8.913   1.428   3.816   1.00 1.53  ? 20  VAL A HG23 2  
ATOM 3595  N N    . PHE A 1 21  ? 9.597   3.847   3.913   1.00 0.23  ? 21  PHE A N    2  
ATOM 3596  C CA   . PHE A 1 21  ? 10.184  4.331   2.677   1.00 0.25  ? 21  PHE A CA   2  
ATOM 3597  C C    . PHE A 1 21  ? 11.206  5.422   2.966   1.00 0.29  ? 21  PHE A C    2  
ATOM 3598  O O    . PHE A 1 21  ? 12.334  5.351   2.511   1.00 0.35  ? 21  PHE A O    2  
ATOM 3599  C CB   . PHE A 1 21  ? 9.109   4.861   1.726   1.00 0.26  ? 21  PHE A CB   2  
ATOM 3600  C CG   . PHE A 1 21  ? 9.668   5.392   0.440   1.00 0.91  ? 21  PHE A CG   2  
ATOM 3601  C CD1  . PHE A 1 21  ? 10.069  4.529   -0.561  1.00 1.85  ? 21  PHE A CD1  2  
ATOM 3602  C CD2  . PHE A 1 21  ? 9.806   6.754   0.240   1.00 1.59  ? 21  PHE A CD2  2  
ATOM 3603  C CE1  . PHE A 1 21  ? 10.597  5.012   -1.739  1.00 2.48  ? 21  PHE A CE1  2  
ATOM 3604  C CE2  . PHE A 1 21  ? 10.336  7.242   -0.936  1.00 2.17  ? 21  PHE A CE2  2  
ATOM 3605  C CZ   . PHE A 1 21  ? 10.731  6.371   -1.925  1.00 2.40  ? 21  PHE A CZ   2  
ATOM 3606  H H    . PHE A 1 21  ? 8.611   3.920   4.060   1.00 0.23  ? 21  PHE A H    2  
ATOM 3607  H HA   . PHE A 1 21  ? 10.689  3.500   2.207   1.00 0.27  ? 21  PHE A HA   2  
ATOM 3608  H HB2  . PHE A 1 21  ? 8.419   4.063   1.487   1.00 0.64  ? 21  PHE A HB2  2  
ATOM 3609  H HB3  . PHE A 1 21  ? 8.573   5.662   2.213   1.00 0.62  ? 21  PHE A HB3  2  
ATOM 3610  H HD1  . PHE A 1 21  ? 9.961   3.464   -0.416  1.00 2.42  ? 21  PHE A HD1  2  
ATOM 3611  H HD2  . PHE A 1 21  ? 9.496   7.438   1.016   1.00 2.15  ? 21  PHE A HD2  2  
ATOM 3612  H HE1  . PHE A 1 21  ? 10.907  4.327   -2.514  1.00 3.33  ? 21  PHE A HE1  2  
ATOM 3613  H HE2  . PHE A 1 21  ? 10.438  8.308   -1.081  1.00 2.85  ? 21  PHE A HE2  2  
ATOM 3614  H HZ   . PHE A 1 21  ? 11.147  6.751   -2.846  1.00 2.98  ? 21  PHE A HZ   2  
ATOM 3615  N N    . GLN A 1 22  ? 10.810  6.406   3.762   1.00 0.30  ? 22  GLN A N    2  
ATOM 3616  C CA   . GLN A 1 22  ? 11.633  7.581   4.011   1.00 0.37  ? 22  GLN A CA   2  
ATOM 3617  C C    . GLN A 1 22  ? 12.882  7.217   4.801   1.00 0.36  ? 22  GLN A C    2  
ATOM 3618  O O    . GLN A 1 22  ? 13.958  7.744   4.545   1.00 0.44  ? 22  GLN A O    2  
ATOM 3619  C CB   . GLN A 1 22  ? 10.808  8.625   4.768   1.00 0.47  ? 22  GLN A CB   2  
ATOM 3620  C CG   . GLN A 1 22  ? 11.248  10.068  4.565   1.00 1.12  ? 22  GLN A CG   2  
ATOM 3621  C CD   . GLN A 1 22  ? 12.507  10.444  5.327   1.00 1.98  ? 22  GLN A CD   2  
ATOM 3622  O OE1  . GLN A 1 22  ? 13.616  10.394  4.795   1.00 2.68  ? 22  GLN A OE1  2  
ATOM 3623  N NE2  . GLN A 1 22  ? 12.344  10.803  6.590   1.00 2.66  ? 22  GLN A NE2  2  
ATOM 3624  H H    . GLN A 1 22  ? 9.938   6.337   4.206   1.00 0.28  ? 22  GLN A H    2  
ATOM 3625  H HA   . GLN A 1 22  ? 11.934  7.989   3.059   1.00 0.42  ? 22  GLN A HA   2  
ATOM 3626  H HB2  . GLN A 1 22  ? 9.779   8.544   4.451   1.00 0.83  ? 22  GLN A HB2  2  
ATOM 3627  H HB3  . GLN A 1 22  ? 10.863  8.404   5.824   1.00 0.94  ? 22  GLN A HB3  2  
ATOM 3628  H HG2  . GLN A 1 22  ? 11.434  10.221  3.512   1.00 1.54  ? 22  GLN A HG2  2  
ATOM 3629  H HG3  . GLN A 1 22  ? 10.447  10.716  4.883   1.00 1.68  ? 22  GLN A HG3  2  
ATOM 3630  H HE21 . GLN A 1 22  ? 11.433  10.806  6.957   1.00 2.74  ? 22  GLN A HE21 2  
ATOM 3631  H HE22 . GLN A 1 22  ? 13.138  11.046  7.108   1.00 3.38  ? 22  GLN A HE22 2  
ATOM 3632  N N    . LYS A 1 23  ? 12.752  6.303   5.748   1.00 0.35  ? 23  LYS A N    2  
ATOM 3633  C CA   . LYS A 1 23  ? 13.881  5.962   6.593   1.00 0.39  ? 23  LYS A CA   2  
ATOM 3634  C C    . LYS A 1 23  ? 14.971  5.256   5.791   1.00 0.40  ? 23  LYS A C    2  
ATOM 3635  O O    . LYS A 1 23  ? 16.158  5.492   6.011   1.00 0.49  ? 23  LYS A O    2  
ATOM 3636  C CB   . LYS A 1 23  ? 13.435  5.108   7.779   1.00 0.41  ? 23  LYS A CB   2  
ATOM 3637  C CG   . LYS A 1 23  ? 12.911  3.756   7.401   1.00 0.42  ? 23  LYS A CG   2  
ATOM 3638  C CD   . LYS A 1 23  ? 12.242  3.109   8.582   1.00 0.63  ? 23  LYS A CD   2  
ATOM 3639  C CE   . LYS A 1 23  ? 12.165  1.617   8.391   1.00 0.63  ? 23  LYS A CE   2  
ATOM 3640  N NZ   . LYS A 1 23  ? 11.492  0.928   9.521   1.00 0.91  ? 23  LYS A NZ   2  
ATOM 3641  H H    . LYS A 1 23  ? 11.886  5.855   5.886   1.00 0.35  ? 23  LYS A H    2  
ATOM 3642  H HA   . LYS A 1 23  ? 14.281  6.889   6.967   1.00 0.42  ? 23  LYS A HA   2  
ATOM 3643  H HB2  . LYS A 1 23  ? 14.275  4.952   8.438   1.00 0.45  ? 23  LYS A HB2  2  
ATOM 3644  H HB3  . LYS A 1 23  ? 12.659  5.627   8.315   1.00 0.45  ? 23  LYS A HB3  2  
ATOM 3645  H HG2  . LYS A 1 23  ? 12.195  3.863   6.599   1.00 0.53  ? 23  LYS A HG2  2  
ATOM 3646  H HG3  . LYS A 1 23  ? 13.734  3.136   7.077   1.00 0.57  ? 23  LYS A HG3  2  
ATOM 3647  H HD2  . LYS A 1 23  ? 12.812  3.328   9.471   1.00 0.97  ? 23  LYS A HD2  2  
ATOM 3648  H HD3  . LYS A 1 23  ? 11.246  3.511   8.674   1.00 0.85  ? 23  LYS A HD3  2  
ATOM 3649  H HE2  . LYS A 1 23  ? 11.628  1.415   7.480   1.00 0.72  ? 23  LYS A HE2  2  
ATOM 3650  H HE3  . LYS A 1 23  ? 13.172  1.248   8.301   1.00 0.85  ? 23  LYS A HE3  2  
ATOM 3651  H HZ1  . LYS A 1 23  ? 11.314  -0.074  9.274   1.00 1.42  ? 23  LYS A HZ1  2  
ATOM 3652  H HZ2  . LYS A 1 23  ? 10.585  1.387   9.734   1.00 1.25  ? 23  LYS A HZ2  2  
ATOM 3653  H HZ3  . LYS A 1 23  ? 12.091  0.962   10.369  1.00 1.47  ? 23  LYS A HZ3  2  
ATOM 3654  N N    . TYR A 1 24  ? 14.571  4.398   4.857   1.00 0.36  ? 24  TYR A N    2  
ATOM 3655  C CA   . TYR A 1 24  ? 15.536  3.674   4.046   1.00 0.39  ? 24  TYR A CA   2  
ATOM 3656  C C    . TYR A 1 24  ? 15.959  4.459   2.812   1.00 0.34  ? 24  TYR A C    2  
ATOM 3657  O O    . TYR A 1 24  ? 17.103  4.372   2.391   1.00 0.40  ? 24  TYR A O    2  
ATOM 3658  C CB   . TYR A 1 24  ? 15.007  2.297   3.671   1.00 0.46  ? 24  TYR A CB   2  
ATOM 3659  C CG   . TYR A 1 24  ? 15.413  1.248   4.680   1.00 0.86  ? 24  TYR A CG   2  
ATOM 3660  C CD1  . TYR A 1 24  ? 16.604  0.552   4.533   1.00 1.67  ? 24  TYR A CD1  2  
ATOM 3661  C CD2  . TYR A 1 24  ? 14.631  0.978   5.794   1.00 1.52  ? 24  TYR A CD2  2  
ATOM 3662  C CE1  . TYR A 1 24  ? 17.007  -0.381  5.466   1.00 1.99  ? 24  TYR A CE1  2  
ATOM 3663  C CE2  . TYR A 1 24  ? 15.023  0.040   6.729   1.00 1.83  ? 24  TYR A CE2  2  
ATOM 3664  C CZ   . TYR A 1 24  ? 16.213  -0.634  6.561   1.00 1.72  ? 24  TYR A CZ   2  
ATOM 3665  O OH   . TYR A 1 24  ? 16.618  -1.553  7.500   1.00 2.15  ? 24  TYR A OH   2  
ATOM 3666  H H    . TYR A 1 24  ? 13.607  4.251   4.709   1.00 0.33  ? 24  TYR A H    2  
ATOM 3667  H HA   . TYR A 1 24  ? 16.414  3.536   4.661   1.00 0.50  ? 24  TYR A HA   2  
ATOM 3668  H HB2  . TYR A 1 24  ? 13.926  2.330   3.625   1.00 0.51  ? 24  TYR A HB2  2  
ATOM 3669  H HB3  . TYR A 1 24  ? 15.402  2.013   2.710   1.00 0.45  ? 24  TYR A HB3  2  
ATOM 3670  H HD1  . TYR A 1 24  ? 17.225  0.750   3.671   1.00 2.37  ? 24  TYR A HD1  2  
ATOM 3671  H HD2  . TYR A 1 24  ? 13.698  1.505   5.921   1.00 2.22  ? 24  TYR A HD2  2  
ATOM 3672  H HE1  . TYR A 1 24  ? 17.939  -0.911  5.333   1.00 2.80  ? 24  TYR A HE1  2  
ATOM 3673  H HE2  . TYR A 1 24  ? 14.401  -0.160  7.588   1.00 2.59  ? 24  TYR A HE2  2  
ATOM 3674  H HH   . TYR A 1 24  ? 17.560  -1.438  7.669   1.00 2.39  ? 24  TYR A HH   2  
ATOM 3675  N N    . ALA A 1 25  ? 15.041  5.225   2.244   1.00 0.29  ? 25  ALA A N    2  
ATOM 3676  C CA   . ALA A 1 25  ? 15.355  6.091   1.111   1.00 0.34  ? 25  ALA A CA   2  
ATOM 3677  C C    . ALA A 1 25  ? 16.151  7.298   1.582   1.00 0.47  ? 25  ALA A C    2  
ATOM 3678  O O    . ALA A 1 25  ? 16.757  8.029   0.792   1.00 0.58  ? 25  ALA A O    2  
ATOM 3679  C CB   . ALA A 1 25  ? 14.079  6.535   0.413   1.00 0.37  ? 25  ALA A CB   2  
ATOM 3680  H H    . ALA A 1 25  ? 14.119  5.205   2.584   1.00 0.28  ? 25  ALA A H    2  
ATOM 3681  H HA   . ALA A 1 25  ? 15.950  5.525   0.410   1.00 0.34  ? 25  ALA A HA   2  
ATOM 3682  H HB1  . ALA A 1 25  ? 13.491  5.664   0.156   1.00 1.04  ? 25  ALA A HB1  2  
ATOM 3683  H HB2  . ALA A 1 25  ? 14.329  7.079   -0.488  1.00 0.98  ? 25  ALA A HB2  2  
ATOM 3684  H HB3  . ALA A 1 25  ? 13.508  7.172   1.076   1.00 1.09  ? 25  ALA A HB3  2  
ATOM 3685  N N    . GLY A 1 26  ? 16.117  7.513   2.887   1.00 0.49  ? 26  GLY A N    2  
ATOM 3686  C CA   . GLY A 1 26  ? 16.833  8.615   3.482   1.00 0.64  ? 26  GLY A CA   2  
ATOM 3687  C C    . GLY A 1 26  ? 18.163  8.190   4.070   1.00 0.75  ? 26  GLY A C    2  
ATOM 3688  O O    . GLY A 1 26  ? 18.720  8.885   4.923   1.00 0.96  ? 26  GLY A O    2  
ATOM 3689  H H    . GLY A 1 26  ? 15.585  6.912   3.455   1.00 0.45  ? 26  GLY A H    2  
ATOM 3690  H HA2  . GLY A 1 26  ? 17.005  9.368   2.727   1.00 0.73  ? 26  GLY A HA2  2  
ATOM 3691  H HA3  . GLY A 1 26  ? 16.224  9.042   4.266   1.00 0.64  ? 26  GLY A HA3  2  
ATOM 3692  N N    . LYS A 1 27  ? 18.674  7.048   3.622   1.00 0.69  ? 27  LYS A N    2  
ATOM 3693  C CA   . LYS A 1 27  ? 19.965  6.557   4.086   1.00 0.82  ? 27  LYS A CA   2  
ATOM 3694  C C    . LYS A 1 27  ? 21.083  7.214   3.294   1.00 0.95  ? 27  LYS A C    2  
ATOM 3695  O O    . LYS A 1 27  ? 21.994  7.814   3.862   1.00 1.11  ? 27  LYS A O    2  
ATOM 3696  C CB   . LYS A 1 27  ? 20.051  5.035   3.946   1.00 0.77  ? 27  LYS A CB   2  
ATOM 3697  C CG   . LYS A 1 27  ? 19.126  4.284   4.888   1.00 0.81  ? 27  LYS A CG   2  
ATOM 3698  C CD   . LYS A 1 27  ? 19.141  2.786   4.624   1.00 0.85  ? 27  LYS A CD   2  
ATOM 3699  C CE   . LYS A 1 27  ? 20.519  2.175   4.839   1.00 1.11  ? 27  LYS A CE   2  
ATOM 3700  N NZ   . LYS A 1 27  ? 21.010  2.369   6.230   1.00 1.72  ? 27  LYS A NZ   2  
ATOM 3701  H H    . LYS A 1 27  ? 18.176  6.527   2.950   1.00 0.60  ? 27  LYS A H    2  
ATOM 3702  H HA   . LYS A 1 27  ? 20.069  6.824   5.126   1.00 0.92  ? 27  LYS A HA   2  
ATOM 3703  H HB2  . LYS A 1 27  ? 19.797  4.763   2.933   1.00 0.68  ? 27  LYS A HB2  2  
ATOM 3704  H HB3  . LYS A 1 27  ? 21.063  4.724   4.149   1.00 0.89  ? 27  LYS A HB3  2  
ATOM 3705  H HG2  . LYS A 1 27  ? 19.443  4.462   5.902   1.00 0.95  ? 27  LYS A HG2  2  
ATOM 3706  H HG3  . LYS A 1 27  ? 18.120  4.654   4.756   1.00 0.78  ? 27  LYS A HG3  2  
ATOM 3707  H HD2  . LYS A 1 27  ? 18.442  2.307   5.292   1.00 1.08  ? 27  LYS A HD2  2  
ATOM 3708  H HD3  . LYS A 1 27  ? 18.837  2.611   3.601   1.00 1.11  ? 27  LYS A HD3  2  
ATOM 3709  H HE2  . LYS A 1 27  ? 20.462  1.116   4.634   1.00 1.65  ? 27  LYS A HE2  2  
ATOM 3710  H HE3  . LYS A 1 27  ? 21.213  2.635   4.153   1.00 1.47  ? 27  LYS A HE3  2  
ATOM 3711  H HZ1  . LYS A 1 27  ? 20.359  1.921   6.907   1.00 2.17  ? 27  LYS A HZ1  2  
ATOM 3712  H HZ2  . LYS A 1 27  ? 21.076  3.384   6.450   1.00 2.11  ? 27  LYS A HZ2  2  
ATOM 3713  H HZ3  . LYS A 1 27  ? 21.952  1.945   6.338   1.00 2.19  ? 27  LYS A HZ3  2  
ATOM 3714  N N    . ASP A 1 28  ? 20.996  7.104   1.976   1.00 1.00  ? 28  ASP A N    2  
ATOM 3715  C CA   . ASP A 1 28  ? 21.951  7.746   1.087   1.00 1.19  ? 28  ASP A CA   2  
ATOM 3716  C C    . ASP A 1 28  ? 21.636  9.231   1.020   1.00 1.26  ? 28  ASP A C    2  
ATOM 3717  O O    . ASP A 1 28  ? 22.507  10.057  0.759   1.00 1.58  ? 28  ASP A O    2  
ATOM 3718  C CB   . ASP A 1 28  ? 21.879  7.136   -0.317  1.00 1.33  ? 28  ASP A CB   2  
ATOM 3719  C CG   . ASP A 1 28  ? 23.157  7.337   -1.107  1.00 1.65  ? 28  ASP A CG   2  
ATOM 3720  O OD1  . ASP A 1 28  ? 23.358  8.430   -1.669  1.00 2.16  ? 28  ASP A OD1  2  
ATOM 3721  O OD2  . ASP A 1 28  ? 23.969  6.390   -1.172  1.00 2.08  ? 28  ASP A OD2  2  
ATOM 3722  H H    . ASP A 1 28  ? 20.258  6.568   1.586   1.00 0.99  ? 28  ASP A H    2  
ATOM 3723  H HA   . ASP A 1 28  ? 22.942  7.608   1.492   1.00 1.28  ? 28  ASP A HA   2  
ATOM 3724  H HB2  . ASP A 1 28  ? 21.686  6.074   -0.241  1.00 1.33  ? 28  ASP A HB2  2  
ATOM 3725  H HB3  . ASP A 1 28  ? 21.068  7.602   -0.859  1.00 1.44  ? 28  ASP A HB3  2  
ATOM 3726  N N    . GLY A 1 29  ? 20.377  9.553   1.287   1.00 1.15  ? 29  GLY A N    2  
ATOM 3727  C CA   . GLY A 1 29  ? 19.956  10.936  1.344   1.00 1.32  ? 29  GLY A CA   2  
ATOM 3728  C C    . GLY A 1 29  ? 19.109  11.345  0.157   1.00 1.51  ? 29  GLY A C    2  
ATOM 3729  O O    . GLY A 1 29  ? 19.190  12.483  -0.307  1.00 1.64  ? 29  GLY A O    2  
ATOM 3730  H H    . GLY A 1 29  ? 19.727  8.836   1.448   1.00 1.14  ? 29  GLY A H    2  
ATOM 3731  H HA2  . GLY A 1 29  ? 19.385  11.087  2.246   1.00 1.60  ? 29  GLY A HA2  2  
ATOM 3732  H HA3  . GLY A 1 29  ? 20.834  11.564  1.378   1.00 1.54  ? 29  GLY A HA3  2  
ATOM 3733  N N    . TYR A 1 30  ? 18.292  10.428  -0.342  1.00 2.07  ? 30  TYR A N    2  
ATOM 3734  C CA   . TYR A 1 30  ? 17.428  10.733  -1.473  1.00 2.80  ? 30  TYR A CA   2  
ATOM 3735  C C    . TYR A 1 30  ? 16.044  11.164  -1.009  1.00 2.61  ? 30  TYR A C    2  
ATOM 3736  O O    . TYR A 1 30  ? 15.544  12.213  -1.426  1.00 3.02  ? 30  TYR A O    2  
ATOM 3737  C CB   . TYR A 1 30  ? 17.299  9.535   -2.410  1.00 3.68  ? 30  TYR A CB   2  
ATOM 3738  C CG   . TYR A 1 30  ? 18.568  9.181   -3.148  1.00 4.52  ? 30  TYR A CG   2  
ATOM 3739  C CD1  . TYR A 1 30  ? 18.986  9.929   -4.241  1.00 5.11  ? 30  TYR A CD1  2  
ATOM 3740  C CD2  . TYR A 1 30  ? 19.334  8.090   -2.764  1.00 5.12  ? 30  TYR A CD2  2  
ATOM 3741  C CE1  . TYR A 1 30  ? 20.136  9.597   -4.932  1.00 6.04  ? 30  TYR A CE1  2  
ATOM 3742  C CE2  . TYR A 1 30  ? 20.487  7.756   -3.448  1.00 6.09  ? 30  TYR A CE2  2  
ATOM 3743  C CZ   . TYR A 1 30  ? 20.882  8.511   -4.531  1.00 6.45  ? 30  TYR A CZ   2  
ATOM 3744  O OH   . TYR A 1 30  ? 22.026  8.173   -5.220  1.00 7.51  ? 30  TYR A OH   2  
ATOM 3745  H H    . TYR A 1 30  ? 18.266  9.531   0.057   1.00 2.21  ? 30  TYR A H    2  
ATOM 3746  H HA   . TYR A 1 30  ? 17.878  11.551  -2.017  1.00 3.26  ? 30  TYR A HA   2  
ATOM 3747  H HB2  . TYR A 1 30  ? 17.003  8.670   -1.836  1.00 3.86  ? 30  TYR A HB2  2  
ATOM 3748  H HB3  . TYR A 1 30  ? 16.536  9.746   -3.146  1.00 3.95  ? 30  TYR A HB3  2  
ATOM 3749  H HD1  . TYR A 1 30  ? 18.400  10.781  -4.550  1.00 5.09  ? 30  TYR A HD1  2  
ATOM 3750  H HD2  . TYR A 1 30  ? 19.022  7.501   -1.916  1.00 5.07  ? 30  TYR A HD2  2  
ATOM 3751  H HE1  . TYR A 1 30  ? 20.446  10.190  -5.780  1.00 6.63  ? 30  TYR A HE1  2  
ATOM 3752  H HE2  . TYR A 1 30  ? 21.071  6.905   -3.134  1.00 6.74  ? 30  TYR A HE2  2  
ATOM 3753  H HH   . TYR A 1 30  ? 22.575  8.960   -5.329  1.00 7.75  ? 30  TYR A HH   2  
ATOM 3754  N N    . ASN A 1 31  ? 15.429  10.332  -0.159  1.00 2.62  ? 31  ASN A N    2  
ATOM 3755  C CA   . ASN A 1 31  ? 14.088  10.582  0.402   1.00 2.78  ? 31  ASN A CA   2  
ATOM 3756  C C    . ASN A 1 31  ? 13.004  10.368  -0.660  1.00 1.96  ? 31  ASN A C    2  
ATOM 3757  O O    . ASN A 1 31  ? 11.963  9.764   -0.392  1.00 2.53  ? 31  ASN A O    2  
ATOM 3758  C CB   . ASN A 1 31  ? 13.996  11.997  0.997   1.00 3.85  ? 31  ASN A CB   2  
ATOM 3759  C CG   . ASN A 1 31  ? 12.761  12.219  1.859   1.00 4.61  ? 31  ASN A CG   2  
ATOM 3760  O OD1  . ASN A 1 31  ? 11.687  11.668  1.612   1.00 4.92  ? 31  ASN A OD1  2  
ATOM 3761  N ND2  . ASN A 1 31  ? 12.915  13.030  2.894   1.00 5.33  ? 31  ASN A ND2  2  
ATOM 3762  H H    . ASN A 1 31  ? 15.897  9.505   0.104   1.00 2.93  ? 31  ASN A H    2  
ATOM 3763  H HA   . ASN A 1 31  ? 13.932  9.863   1.193   1.00 3.24  ? 31  ASN A HA   2  
ATOM 3764  H HB2  . ASN A 1 31  ? 14.867  12.177  1.606   1.00 4.17  ? 31  ASN A HB2  2  
ATOM 3765  H HB3  . ASN A 1 31  ? 13.978  12.715  0.188   1.00 4.22  ? 31  ASN A HB3  2  
ATOM 3766  H HD21 . ASN A 1 31  ? 13.797  13.433  3.039   1.00 5.37  ? 31  ASN A HD21 2  
ATOM 3767  H HD22 . ASN A 1 31  ? 12.145  13.189  3.478   1.00 5.97  ? 31  ASN A HD22 2  
ATOM 3768  N N    . TYR A 1 32  ? 13.257  10.864  -1.861  1.00 1.18  ? 32  TYR A N    2  
ATOM 3769  C CA   . TYR A 1 32  ? 12.351  10.682  -2.981  1.00 1.18  ? 32  TYR A CA   2  
ATOM 3770  C C    . TYR A 1 32  ? 12.460  9.259   -3.522  1.00 0.92  ? 32  TYR A C    2  
ATOM 3771  O O    . TYR A 1 32  ? 11.468  8.673   -3.953  1.00 1.05  ? 32  TYR A O    2  
ATOM 3772  C CB   . TYR A 1 32  ? 12.680  11.697  -4.086  1.00 1.78  ? 32  TYR A CB   2  
ATOM 3773  C CG   . TYR A 1 32  ? 11.751  11.637  -5.281  1.00 2.38  ? 32  TYR A CG   2  
ATOM 3774  C CD1  . TYR A 1 32  ? 11.994  10.762  -6.333  1.00 3.08  ? 32  TYR A CD1  2  
ATOM 3775  C CD2  . TYR A 1 32  ? 10.635  12.459  -5.359  1.00 2.99  ? 32  TYR A CD2  2  
ATOM 3776  C CE1  . TYR A 1 32  ? 11.150  10.703  -7.424  1.00 3.93  ? 32  TYR A CE1  2  
ATOM 3777  C CE2  . TYR A 1 32  ? 9.786   12.407  -6.447  1.00 3.86  ? 32  TYR A CE2  2  
ATOM 3778  C CZ   . TYR A 1 32  ? 10.048  11.527  -7.476  1.00 4.19  ? 32  TYR A CZ   2  
ATOM 3779  O OH   . TYR A 1 32  ? 9.202   11.469  -8.561  1.00 5.19  ? 32  TYR A OH   2  
ATOM 3780  H H    . TYR A 1 32  ? 14.084  11.377  -1.994  1.00 1.45  ? 32  TYR A H    2  
ATOM 3781  H HA   . TYR A 1 32  ? 11.344  10.852  -2.631  1.00 1.86  ? 32  TYR A HA   2  
ATOM 3782  H HB2  . TYR A 1 32  ? 12.623  12.694  -3.677  1.00 2.16  ? 32  TYR A HB2  2  
ATOM 3783  H HB3  . TYR A 1 32  ? 13.685  11.517  -4.439  1.00 2.32  ? 32  TYR A HB3  2  
ATOM 3784  H HD1  . TYR A 1 32  ? 12.857  10.115  -6.287  1.00 3.32  ? 32  TYR A HD1  2  
ATOM 3785  H HD2  . TYR A 1 32  ? 10.432  13.147  -4.552  1.00 3.17  ? 32  TYR A HD2  2  
ATOM 3786  H HE1  . TYR A 1 32  ? 11.356  10.015  -8.230  1.00 4.65  ? 32  TYR A HE1  2  
ATOM 3787  H HE2  . TYR A 1 32  ? 8.923   13.054  -6.489  1.00 4.54  ? 32  TYR A HE2  2  
ATOM 3788  H HH   . TYR A 1 32  ? 8.957   10.548  -8.721  1.00 5.57  ? 32  TYR A HH   2  
ATOM 3789  N N    . THR A 1 33  ? 13.663  8.708   -3.476  1.00 0.67  ? 33  THR A N    2  
ATOM 3790  C CA   . THR A 1 33  ? 13.930  7.396   -4.046  1.00 0.46  ? 33  THR A CA   2  
ATOM 3791  C C    . THR A 1 33  ? 14.719  6.510   -3.101  1.00 0.38  ? 33  THR A C    2  
ATOM 3792  O O    . THR A 1 33  ? 15.651  6.952   -2.434  1.00 0.44  ? 33  THR A O    2  
ATOM 3793  C CB   . THR A 1 33  ? 14.698  7.516   -5.372  1.00 0.45  ? 33  THR A CB   2  
ATOM 3794  O OG1  . THR A 1 33  ? 15.290  8.820   -5.490  1.00 0.66  ? 33  THR A OG1  2  
ATOM 3795  C CG2  . THR A 1 33  ? 13.789  7.243   -6.557  1.00 0.43  ? 33  THR A CG2  2  
ATOM 3796  H H    . THR A 1 33  ? 14.395  9.192   -3.045  1.00 0.73  ? 33  THR A H    2  
ATOM 3797  H HA   . THR A 1 33  ? 12.985  6.912   -4.248  1.00 0.50  ? 33  THR A HA   2  
ATOM 3798  H HB   . THR A 1 33  ? 15.483  6.779   -5.372  1.00 0.56  ? 33  THR A HB   2  
ATOM 3799  H HG1  . THR A 1 33  ? 16.231  8.758   -5.290  1.00 1.28  ? 33  THR A HG1  2  
ATOM 3800  H HG21 . THR A 1 33  ? 13.383  6.245   -6.471  1.00 1.10  ? 33  THR A HG21 2  
ATOM 3801  H HG22 . THR A 1 33  ? 14.359  7.320   -7.472  1.00 0.99  ? 33  THR A HG22 2  
ATOM 3802  H HG23 . THR A 1 33  ? 12.983  7.962   -6.569  1.00 1.14  ? 33  THR A HG23 2  
ATOM 3803  N N    . LEU A 1 34  ? 14.305  5.261   -3.055  1.00 0.32  ? 34  LEU A N    2  
ATOM 3804  C CA   . LEU A 1 34  ? 15.000  4.218   -2.340  1.00 0.30  ? 34  LEU A CA   2  
ATOM 3805  C C    . LEU A 1 34  ? 16.021  3.605   -3.279  1.00 0.31  ? 34  LEU A C    2  
ATOM 3806  O O    . LEU A 1 34  ? 15.667  2.883   -4.216  1.00 0.34  ? 34  LEU A O    2  
ATOM 3807  C CB   . LEU A 1 34  ? 13.963  3.188   -1.871  1.00 0.30  ? 34  LEU A CB   2  
ATOM 3808  C CG   . LEU A 1 34  ? 13.983  2.842   -0.385  1.00 0.29  ? 34  LEU A CG   2  
ATOM 3809  C CD1  . LEU A 1 34  ? 12.656  2.238   0.042   1.00 0.45  ? 34  LEU A CD1  2  
ATOM 3810  C CD2  . LEU A 1 34  ? 15.100  1.875   -0.088  1.00 0.28  ? 34  LEU A CD2  2  
ATOM 3811  H H    . LEU A 1 34  ? 13.481  5.025   -3.529  1.00 0.32  ? 34  LEU A H    2  
ATOM 3812  H HA   . LEU A 1 34  ? 15.516  4.643   -1.495  1.00 0.32  ? 34  LEU A HA   2  
ATOM 3813  H HB2  . LEU A 1 34  ? 12.978  3.585   -2.101  1.00 0.34  ? 34  LEU A HB2  2  
ATOM 3814  H HB3  . LEU A 1 34  ? 14.119  2.271   -2.437  1.00 0.34  ? 34  LEU A HB3  2  
ATOM 3815  H HG   . LEU A 1 34  ? 14.148  3.742   0.187   1.00 0.32  ? 34  LEU A HG   2  
ATOM 3816  H HD11 . LEU A 1 34  ? 12.466  1.342   -0.529  1.00 1.03  ? 34  LEU A HD11 2  
ATOM 3817  H HD12 . LEU A 1 34  ? 11.865  2.951   -0.131  1.00 1.18  ? 34  LEU A HD12 2  
ATOM 3818  H HD13 . LEU A 1 34  ? 12.694  1.994   1.094   1.00 1.08  ? 34  LEU A HD13 2  
ATOM 3819  H HD21 . LEU A 1 34  ? 15.050  1.045   -0.777  1.00 1.05  ? 34  LEU A HD21 2  
ATOM 3820  H HD22 . LEU A 1 34  ? 14.999  1.505   0.921   1.00 1.09  ? 34  LEU A HD22 2  
ATOM 3821  H HD23 . LEU A 1 34  ? 16.048  2.377   -0.197  1.00 1.01  ? 34  LEU A HD23 2  
ATOM 3822  N N    . SER A 1 35  ? 17.282  3.948   -3.050  1.00 0.32  ? 35  SER A N    2  
ATOM 3823  C CA   . SER A 1 35  ? 18.363  3.551   -3.928  1.00 0.33  ? 35  SER A CA   2  
ATOM 3824  C C    . SER A 1 35  ? 18.514  2.036   -3.961  1.00 0.32  ? 35  SER A C    2  
ATOM 3825  O O    . SER A 1 35  ? 17.945  1.332   -3.126  1.00 0.30  ? 35  SER A O    2  
ATOM 3826  C CB   . SER A 1 35  ? 19.669  4.218   -3.488  1.00 0.37  ? 35  SER A CB   2  
ATOM 3827  O OG   . SER A 1 35  ? 20.726  3.965   -4.401  1.00 0.40  ? 35  SER A OG   2  
ATOM 3828  H H    . SER A 1 35  ? 17.493  4.497   -2.252  1.00 0.33  ? 35  SER A H    2  
ATOM 3829  H HA   . SER A 1 35  ? 18.116  3.895   -4.909  1.00 0.35  ? 35  SER A HA   2  
ATOM 3830  H HB2  . SER A 1 35  ? 19.517  5.286   -3.426  1.00 0.39  ? 35  SER A HB2  2  
ATOM 3831  H HB3  . SER A 1 35  ? 19.948  3.841   -2.517  1.00 0.38  ? 35  SER A HB3  2  
ATOM 3832  H HG   . SER A 1 35  ? 21.066  4.806   -4.730  1.00 0.68  ? 35  SER A HG   2  
ATOM 3833  N N    . LYS A 1 36  ? 19.288  1.543   -4.923  1.00 0.38  ? 36  LYS A N    2  
ATOM 3834  C CA   . LYS A 1 36  ? 19.459  0.111   -5.123  1.00 0.42  ? 36  LYS A CA   2  
ATOM 3835  C C    . LYS A 1 36  ? 19.819  -0.579  -3.813  1.00 0.36  ? 36  LYS A C    2  
ATOM 3836  O O    . LYS A 1 36  ? 19.056  -1.397  -3.309  1.00 0.35  ? 36  LYS A O    2  
ATOM 3837  C CB   . LYS A 1 36  ? 20.541  -0.153  -6.173  1.00 0.53  ? 36  LYS A CB   2  
ATOM 3838  C CG   . LYS A 1 36  ? 20.666  -1.617  -6.572  1.00 0.62  ? 36  LYS A CG   2  
ATOM 3839  C CD   . LYS A 1 36  ? 19.404  -2.120  -7.256  1.00 0.66  ? 36  LYS A CD   2  
ATOM 3840  C CE   . LYS A 1 36  ? 19.528  -3.580  -7.669  1.00 0.61  ? 36  LYS A CE   2  
ATOM 3841  N NZ   . LYS A 1 36  ? 20.600  -3.797  -8.677  1.00 0.65  ? 36  LYS A NZ   2  
ATOM 3842  H H    . LYS A 1 36  ? 19.761  2.166   -5.514  1.00 0.43  ? 36  LYS A H    2  
ATOM 3843  H HA   . LYS A 1 36  ? 18.524  -0.286  -5.476  1.00 0.46  ? 36  LYS A HA   2  
ATOM 3844  H HB2  . LYS A 1 36  ? 20.313  0.419   -7.060  1.00 0.58  ? 36  LYS A HB2  2  
ATOM 3845  H HB3  . LYS A 1 36  ? 21.494  0.172   -5.782  1.00 0.56  ? 36  LYS A HB3  2  
ATOM 3846  H HG2  . LYS A 1 36  ? 21.498  -1.726  -7.250  1.00 1.06  ? 36  LYS A HG2  2  
ATOM 3847  H HG3  . LYS A 1 36  ? 20.843  -2.207  -5.684  1.00 1.21  ? 36  LYS A HG3  2  
ATOM 3848  H HD2  . LYS A 1 36  ? 18.573  -2.020  -6.575  1.00 1.25  ? 36  LYS A HD2  2  
ATOM 3849  H HD3  . LYS A 1 36  ? 19.221  -1.519  -8.137  1.00 1.12  ? 36  LYS A HD3  2  
ATOM 3850  H HE2  . LYS A 1 36  ? 19.750  -4.171  -6.793  1.00 0.66  ? 36  LYS A HE2  2  
ATOM 3851  H HE3  . LYS A 1 36  ? 18.584  -3.903  -8.087  1.00 0.58  ? 36  LYS A HE3  2  
ATOM 3852  H HZ1  . LYS A 1 36  ? 20.595  -4.793  -8.995  1.00 1.18  ? 36  LYS A HZ1  2  
ATOM 3853  H HZ2  . LYS A 1 36  ? 21.530  -3.582  -8.265  1.00 1.14  ? 36  LYS A HZ2  2  
ATOM 3854  H HZ3  . LYS A 1 36  ? 20.449  -3.180  -9.502  1.00 1.16  ? 36  LYS A HZ3  2  
ATOM 3855  N N    . THR A 1 37  ? 20.954  -0.209  -3.247  1.00 0.37  ? 37  THR A N    2  
ATOM 3856  C CA   . THR A 1 37  ? 21.443  -0.826  -2.024  1.00 0.38  ? 37  THR A CA   2  
ATOM 3857  C C    . THR A 1 37  ? 20.541  -0.515  -0.831  1.00 0.36  ? 37  THR A C    2  
ATOM 3858  O O    . THR A 1 37  ? 20.427  -1.320  0.097   1.00 0.38  ? 37  THR A O    2  
ATOM 3859  C CB   . THR A 1 37  ? 22.870  -0.349  -1.720  1.00 0.44  ? 37  THR A CB   2  
ATOM 3860  O OG1  . THR A 1 37  ? 23.681  -0.489  -2.894  1.00 0.48  ? 37  THR A OG1  2  
ATOM 3861  C CG2  . THR A 1 37  ? 23.478  -1.149  -0.578  1.00 0.49  ? 37  THR A CG2  2  
ATOM 3862  H H    . THR A 1 37  ? 21.487  0.499   -3.666  1.00 0.39  ? 37  THR A H    2  
ATOM 3863  H HA   . THR A 1 37  ? 21.466  -1.898  -2.174  1.00 0.39  ? 37  THR A HA   2  
ATOM 3864  H HB   . THR A 1 37  ? 22.830  0.694   -1.439  1.00 0.44  ? 37  THR A HB   2  
ATOM 3865  H HG1  . THR A 1 37  ? 23.827  0.381   -3.284  1.00 0.80  ? 37  THR A HG1  2  
ATOM 3866  H HG21 . THR A 1 37  ? 24.461  -0.764  -0.352  1.00 1.15  ? 37  THR A HG21 2  
ATOM 3867  H HG22 . THR A 1 37  ? 23.554  -2.187  -0.867  1.00 1.09  ? 37  THR A HG22 2  
ATOM 3868  H HG23 . THR A 1 37  ? 22.848  -1.065  0.296   1.00 1.13  ? 37  THR A HG23 2  
ATOM 3869  N N    . GLU A 1 38  ? 19.879  0.635   -0.866  1.00 0.34  ? 38  GLU A N    2  
ATOM 3870  C CA   . GLU A 1 38  ? 18.970  1.008   0.207   1.00 0.34  ? 38  GLU A CA   2  
ATOM 3871  C C    . GLU A 1 38  ? 17.789  0.059   0.198   1.00 0.34  ? 38  GLU A C    2  
ATOM 3872  O O    . GLU A 1 38  ? 17.292  -0.355  1.242   1.00 0.48  ? 38  GLU A O    2  
ATOM 3873  C CB   . GLU A 1 38  ? 18.475  2.444   0.051   1.00 0.35  ? 38  GLU A CB   2  
ATOM 3874  C CG   . GLU A 1 38  ? 19.561  3.500   0.138   1.00 0.47  ? 38  GLU A CG   2  
ATOM 3875  C CD   . GLU A 1 38  ? 19.002  4.906   0.017   1.00 1.27  ? 38  GLU A CD   2  
ATOM 3876  O OE1  . GLU A 1 38  ? 18.427  5.228   -1.037  1.00 1.96  ? 38  GLU A OE1  2  
ATOM 3877  O OE2  . GLU A 1 38  ? 19.133  5.686   0.978   1.00 2.16  ? 38  GLU A OE2  2  
ATOM 3878  H H    . GLU A 1 38  ? 19.974  1.222   -1.642  1.00 0.34  ? 38  GLU A H    2  
ATOM 3879  H HA   . GLU A 1 38  ? 19.494  0.912   1.142   1.00 0.35  ? 38  GLU A HA   2  
ATOM 3880  H HB2  . GLU A 1 38  ? 17.994  2.537   -0.907  1.00 0.41  ? 38  GLU A HB2  2  
ATOM 3881  H HB3  . GLU A 1 38  ? 17.749  2.645   0.826   1.00 0.45  ? 38  GLU A HB3  2  
ATOM 3882  H HG2  . GLU A 1 38  ? 20.061  3.407   1.091   1.00 1.16  ? 38  GLU A HG2  2  
ATOM 3883  H HG3  . GLU A 1 38  ? 20.270  3.337   -0.657  1.00 1.30  ? 38  GLU A HG3  2  
ATOM 3884  N N    . PHE A 1 39  ? 17.373  -0.303  -1.008  1.00 0.29  ? 39  PHE A N    2  
ATOM 3885  C CA   . PHE A 1 39  ? 16.251  -1.194  -1.215  1.00 0.31  ? 39  PHE A CA   2  
ATOM 3886  C C    . PHE A 1 39  ? 16.659  -2.613  -0.893  1.00 0.28  ? 39  PHE A C    2  
ATOM 3887  O O    . PHE A 1 39  ? 15.864  -3.406  -0.392  1.00 0.27  ? 39  PHE A O    2  
ATOM 3888  C CB   . PHE A 1 39  ? 15.790  -1.094  -2.665  1.00 0.53  ? 39  PHE A CB   2  
ATOM 3889  C CG   . PHE A 1 39  ? 14.510  -1.813  -2.949  1.00 0.81  ? 39  PHE A CG   2  
ATOM 3890  C CD1  . PHE A 1 39  ? 13.330  -1.413  -2.347  1.00 1.76  ? 39  PHE A CD1  2  
ATOM 3891  C CD2  . PHE A 1 39  ? 14.488  -2.886  -3.820  1.00 1.78  ? 39  PHE A CD2  2  
ATOM 3892  C CE1  . PHE A 1 39  ? 12.149  -2.072  -2.610  1.00 2.62  ? 39  PHE A CE1  2  
ATOM 3893  C CE2  . PHE A 1 39  ? 13.311  -3.550  -4.088  1.00 2.66  ? 39  PHE A CE2  2  
ATOM 3894  C CZ   . PHE A 1 39  ? 12.138  -3.143  -3.483  1.00 2.88  ? 39  PHE A CZ   2  
ATOM 3895  H H    . PHE A 1 39  ? 17.844  0.048   -1.797  1.00 0.34  ? 39  PHE A H    2  
ATOM 3896  H HA   . PHE A 1 39  ? 15.448  -0.894  -0.558  1.00 0.35  ? 39  PHE A HA   2  
ATOM 3897  H HB2  . PHE A 1 39  ? 15.652  -0.058  -2.919  1.00 1.23  ? 39  PHE A HB2  2  
ATOM 3898  H HB3  . PHE A 1 39  ? 16.554  -1.514  -3.303  1.00 1.41  ? 39  PHE A HB3  2  
ATOM 3899  H HD1  . PHE A 1 39  ? 13.340  -0.576  -1.666  1.00 2.31  ? 39  PHE A HD1  2  
ATOM 3900  H HD2  . PHE A 1 39  ? 15.405  -3.206  -4.292  1.00 2.31  ? 39  PHE A HD2  2  
ATOM 3901  H HE1  . PHE A 1 39  ? 11.234  -1.751  -2.135  1.00 3.45  ? 39  PHE A HE1  2  
ATOM 3902  H HE2  . PHE A 1 39  ? 13.306  -4.385  -4.768  1.00 3.51  ? 39  PHE A HE2  2  
ATOM 3903  H HZ   . PHE A 1 39  ? 11.214  -3.662  -3.694  1.00 3.70  ? 39  PHE A HZ   2  
ATOM 3904  N N    . LEU A 1 40  ? 17.909  -2.920  -1.186  1.00 0.33  ? 40  LEU A N    2  
ATOM 3905  C CA   . LEU A 1 40  ? 18.472  -4.212  -0.861  1.00 0.37  ? 40  LEU A CA   2  
ATOM 3906  C C    . LEU A 1 40  ? 18.448  -4.411  0.645   1.00 0.40  ? 40  LEU A C    2  
ATOM 3907  O O    . LEU A 1 40  ? 17.976  -5.431  1.146   1.00 0.43  ? 40  LEU A O    2  
ATOM 3908  C CB   . LEU A 1 40  ? 19.905  -4.310  -1.380  1.00 0.43  ? 40  LEU A CB   2  
ATOM 3909  C CG   . LEU A 1 40  ? 20.089  -4.037  -2.876  1.00 0.50  ? 40  LEU A CG   2  
ATOM 3910  C CD1  . LEU A 1 40  ? 21.386  -4.642  -3.383  1.00 1.07  ? 40  LEU A CD1  2  
ATOM 3911  C CD2  . LEU A 1 40  ? 18.899  -4.539  -3.675  1.00 0.46  ? 40  LEU A CD2  2  
ATOM 3912  H H    . LEU A 1 40  ? 18.469  -2.259  -1.648  1.00 0.37  ? 40  LEU A H    2  
ATOM 3913  H HA   . LEU A 1 40  ? 17.871  -4.970  -1.332  1.00 0.38  ? 40  LEU A HA   2  
ATOM 3914  H HB2  . LEU A 1 40  ? 20.498  -3.590  -0.834  1.00 0.65  ? 40  LEU A HB2  2  
ATOM 3915  H HB3  . LEU A 1 40  ? 20.276  -5.299  -1.166  1.00 0.47  ? 40  LEU A HB3  2  
ATOM 3916  H HG   . LEU A 1 40  ? 20.149  -2.966  -3.026  1.00 0.80  ? 40  LEU A HG   2  
ATOM 3917  H HD11 . LEU A 1 40  ? 22.218  -4.213  -2.845  1.00 1.87  ? 40  LEU A HD11 2  
ATOM 3918  H HD12 . LEU A 1 40  ? 21.492  -4.433  -4.437  1.00 1.41  ? 40  LEU A HD12 2  
ATOM 3919  H HD13 . LEU A 1 40  ? 21.370  -5.711  -3.228  1.00 1.46  ? 40  LEU A HD13 2  
ATOM 3920  H HD21 . LEU A 1 40  ? 18.028  -3.952  -3.409  1.00 1.02  ? 40  LEU A HD21 2  
ATOM 3921  H HD22 . LEU A 1 40  ? 18.720  -5.578  -3.447  1.00 0.97  ? 40  LEU A HD22 2  
ATOM 3922  H HD23 . LEU A 1 40  ? 19.099  -4.426  -4.729  1.00 1.09  ? 40  LEU A HD23 2  
ATOM 3923  N N    . SER A 1 41  ? 18.941  -3.410  1.358   1.00 0.42  ? 41  SER A N    2  
ATOM 3924  C CA   . SER A 1 41  ? 18.928  -3.421  2.808   1.00 0.52  ? 41  SER A CA   2  
ATOM 3925  C C    . SER A 1 41  ? 17.488  -3.452  3.306   1.00 0.45  ? 41  SER A C    2  
ATOM 3926  O O    . SER A 1 41  ? 17.147  -4.235  4.190   1.00 0.47  ? 41  SER A O    2  
ATOM 3927  C CB   . SER A 1 41  ? 19.659  -2.189  3.355   1.00 0.67  ? 41  SER A CB   2  
ATOM 3928  O OG   . SER A 1 41  ? 19.795  -2.253  4.764   1.00 1.40  ? 41  SER A OG   2  
ATOM 3929  H H    . SER A 1 41  ? 19.323  -2.638  0.891   1.00 0.42  ? 41  SER A H    2  
ATOM 3930  H HA   . SER A 1 41  ? 19.435  -4.315  3.142   1.00 0.60  ? 41  SER A HA   2  
ATOM 3931  H HB2  . SER A 1 41  ? 20.643  -2.132  2.913   1.00 1.27  ? 41  SER A HB2  2  
ATOM 3932  H HB3  . SER A 1 41  ? 19.100  -1.301  3.100   1.00 1.19  ? 41  SER A HB3  2  
ATOM 3933  H HG   . SER A 1 41  ? 20.431  -2.939  4.993   1.00 1.97  ? 41  SER A HG   2  
ATOM 3934  N N    . PHE A 1 42  ? 16.647  -2.608  2.706   1.00 0.42  ? 42  PHE A N    2  
ATOM 3935  C CA   . PHE A 1 42  ? 15.227  -2.540  3.040   1.00 0.46  ? 42  PHE A CA   2  
ATOM 3936  C C    . PHE A 1 42  ? 14.576  -3.900  2.933   1.00 0.29  ? 42  PHE A C    2  
ATOM 3937  O O    . PHE A 1 42  ? 14.027  -4.405  3.893   1.00 0.43  ? 42  PHE A O    2  
ATOM 3938  C CB   . PHE A 1 42  ? 14.492  -1.576  2.108   1.00 0.80  ? 42  PHE A CB   2  
ATOM 3939  C CG   . PHE A 1 42  ? 13.046  -1.407  2.476   1.00 1.89  ? 42  PHE A CG   2  
ATOM 3940  C CD1  . PHE A 1 42  ? 12.078  -2.255  1.962   1.00 2.77  ? 42  PHE A CD1  2  
ATOM 3941  C CD2  . PHE A 1 42  ? 12.660  -0.418  3.362   1.00 2.69  ? 42  PHE A CD2  2  
ATOM 3942  C CE1  . PHE A 1 42  ? 10.754  -2.119  2.328   1.00 3.80  ? 42  PHE A CE1  2  
ATOM 3943  C CE2  . PHE A 1 42  ? 11.339  -0.273  3.727   1.00 3.73  ? 42  PHE A CE2  2  
ATOM 3944  C CZ   . PHE A 1 42  ? 10.385  -1.126  3.212   1.00 4.13  ? 42  PHE A CZ   2  
ATOM 3945  H H    . PHE A 1 42  ? 16.999  -1.999  2.018   1.00 0.44  ? 42  PHE A H    2  
ATOM 3946  H HA   . PHE A 1 42  ? 15.127  -2.190  4.056   1.00 0.66  ? 42  PHE A HA   2  
ATOM 3947  H HB2  . PHE A 1 42  ? 14.968  -0.600  2.147   1.00 0.53  ? 42  PHE A HB2  2  
ATOM 3948  H HB3  . PHE A 1 42  ? 14.539  -1.968  1.096   1.00 1.30  ? 42  PHE A HB3  2  
ATOM 3949  H HD1  . PHE A 1 42  ? 12.368  -3.032  1.269   1.00 3.00  ? 42  PHE A HD1  2  
ATOM 3950  H HD2  . PHE A 1 42  ? 13.405  0.250   3.766   1.00 2.86  ? 42  PHE A HD2  2  
ATOM 3951  H HE1  . PHE A 1 42  ? 10.009  -2.786  1.920   1.00 4.58  ? 42  PHE A HE1  2  
ATOM 3952  H HE2  . PHE A 1 42  ? 11.052  0.505   4.418   1.00 4.49  ? 42  PHE A HE2  2  
ATOM 3953  H HZ   . PHE A 1 42  ? 9.350   -1.018  3.500   1.00 5.02  ? 42  PHE A HZ   2  
ATOM 3954  N N    . MET A 1 43  ? 14.626  -4.490  1.760   1.00 0.26  ? 43  MET A N    2  
ATOM 3955  C CA   . MET A 1 43  ? 13.935  -5.744  1.539   1.00 0.29  ? 43  MET A CA   2  
ATOM 3956  C C    . MET A 1 43  ? 14.472  -6.863  2.417   1.00 0.29  ? 43  MET A C    2  
ATOM 3957  O O    . MET A 1 43  ? 13.714  -7.719  2.849   1.00 0.37  ? 43  MET A O    2  
ATOM 3958  C CB   . MET A 1 43  ? 13.995  -6.160  0.084   1.00 0.39  ? 43  MET A CB   2  
ATOM 3959  C CG   . MET A 1 43  ? 13.096  -5.332  -0.821  1.00 0.62  ? 43  MET A CG   2  
ATOM 3960  S SD   . MET A 1 43  ? 12.555  -6.228  -2.291  1.00 1.22  ? 43  MET A SD   2  
ATOM 3961  C CE   . MET A 1 43  ? 11.482  -7.471  -1.570  1.00 2.26  ? 43  MET A CE   2  
ATOM 3962  H H    . MET A 1 43  ? 15.125  -4.064  1.021   1.00 0.29  ? 43  MET A H    2  
ATOM 3963  H HA   . MET A 1 43  ? 12.900  -5.584  1.801   1.00 0.35  ? 43  MET A HA   2  
ATOM 3964  H HB2  . MET A 1 43  ? 15.012  -6.049  -0.254  1.00 0.75  ? 43  MET A HB2  2  
ATOM 3965  H HB3  . MET A 1 43  ? 13.705  -7.195  0.008   1.00 0.69  ? 43  MET A HB3  2  
ATOM 3966  H HG2  . MET A 1 43  ? 12.225  -5.033  -0.261  1.00 1.11  ? 43  MET A HG2  2  
ATOM 3967  H HG3  . MET A 1 43  ? 13.639  -4.453  -1.134  1.00 1.23  ? 43  MET A HG3  2  
ATOM 3968  H HE1  . MET A 1 43  ? 12.053  -8.090  -0.893  1.00 2.63  ? 43  MET A HE1  2  
ATOM 3969  H HE2  . MET A 1 43  ? 11.065  -8.086  -2.353  1.00 2.66  ? 43  MET A HE2  2  
ATOM 3970  H HE3  . MET A 1 43  ? 10.684  -6.987  -1.028  1.00 2.85  ? 43  MET A HE3  2  
ATOM 3971  N N    . ASN A 1 44  ? 15.765  -6.869  2.695   1.00 0.29  ? 44  ASN A N    2  
ATOM 3972  C CA   . ASN A 1 44  ? 16.322  -7.912  3.547   1.00 0.33  ? 44  ASN A CA   2  
ATOM 3973  C C    . ASN A 1 44  ? 15.980  -7.681  5.014   1.00 0.32  ? 44  ASN A C    2  
ATOM 3974  O O    . ASN A 1 44  ? 16.140  -8.581  5.836   1.00 0.39  ? 44  ASN A O    2  
ATOM 3975  C CB   . ASN A 1 44  ? 17.832  -8.022  3.412   1.00 0.42  ? 44  ASN A CB   2  
ATOM 3976  C CG   . ASN A 1 44  ? 18.281  -8.759  2.166   1.00 1.05  ? 44  ASN A CG   2  
ATOM 3977  O OD1  . ASN A 1 44  ? 18.337  -9.986  2.149   1.00 1.54  ? 44  ASN A OD1  2  
ATOM 3978  N ND2  . ASN A 1 44  ? 18.635  -8.023  1.130   1.00 1.83  ? 44  ASN A ND2  2  
ATOM 3979  H H    . ASN A 1 44  ? 16.351  -6.174  2.319   1.00 0.30  ? 44  ASN A H    2  
ATOM 3980  H HA   . ASN A 1 44  ? 15.881  -8.847  3.236   1.00 0.37  ? 44  ASN A HA   2  
ATOM 3981  H HB2  . ASN A 1 44  ? 18.253  -7.034  3.398   1.00 1.03  ? 44  ASN A HB2  2  
ATOM 3982  H HB3  . ASN A 1 44  ? 18.208  -8.550  4.268   1.00 0.89  ? 44  ASN A HB3  2  
ATOM 3983  H HD21 . ASN A 1 44  ? 18.586  -7.043  1.215   1.00 1.98  ? 44  ASN A HD21 2  
ATOM 3984  H HD22 . ASN A 1 44  ? 18.940  -8.485  0.320   1.00 2.46  ? 44  ASN A HD22 2  
ATOM 3985  N N    . THR A 1 45  ? 15.543  -6.476  5.355   1.00 0.26  ? 45  THR A N    2  
ATOM 3986  C CA   . THR A 1 45  ? 15.168  -6.180  6.739   1.00 0.29  ? 45  THR A CA   2  
ATOM 3987  C C    . THR A 1 45  ? 13.660  -6.105  6.914   1.00 0.28  ? 45  THR A C    2  
ATOM 3988  O O    . THR A 1 45  ? 13.053  -6.917  7.611   1.00 0.34  ? 45  THR A O    2  
ATOM 3989  C CB   . THR A 1 45  ? 15.767  -4.845  7.211   1.00 0.29  ? 45  THR A CB   2  
ATOM 3990  O OG1  . THR A 1 45  ? 15.566  -3.844  6.209   1.00 0.34  ? 45  THR A OG1  2  
ATOM 3991  C CG2  . THR A 1 45  ? 17.250  -4.985  7.513   1.00 0.34  ? 45  THR A CG2  2  
ATOM 3992  H H    . THR A 1 45  ? 15.471  -5.771  4.665   1.00 0.24  ? 45  THR A H    2  
ATOM 3993  H HA   . THR A 1 45  ? 15.556  -6.967  7.366   1.00 0.33  ? 45  THR A HA   2  
ATOM 3994  H HB   . THR A 1 45  ? 15.253  -4.541  8.113   1.00 0.29  ? 45  THR A HB   2  
ATOM 3995  H HG1  . THR A 1 45  ? 16.322  -3.838  5.604   1.00 1.03  ? 45  THR A HG1  2  
ATOM 3996  H HG21 . THR A 1 45  ? 17.770  -5.289  6.617   1.00 1.04  ? 45  THR A HG21 2  
ATOM 3997  H HG22 . THR A 1 45  ? 17.391  -5.729  8.283   1.00 1.14  ? 45  THR A HG22 2  
ATOM 3998  H HG23 . THR A 1 45  ? 17.639  -4.036  7.852   1.00 1.05  ? 45  THR A HG23 2  
ATOM 3999  N N    . GLU A 1 46  ? 13.072  -5.139  6.239   1.00 0.23  ? 46  GLU A N    2  
ATOM 4000  C CA   . GLU A 1 46  ? 11.670  -4.820  6.381   1.00 0.25  ? 46  GLU A CA   2  
ATOM 4001  C C    . GLU A 1 46  ? 10.801  -5.794  5.599   1.00 0.25  ? 46  GLU A C    2  
ATOM 4002  O O    . GLU A 1 46  ? 9.593   -5.835  5.779   1.00 0.34  ? 46  GLU A O    2  
ATOM 4003  C CB   . GLU A 1 46  ? 11.417  -3.390  5.909   1.00 0.29  ? 46  GLU A CB   2  
ATOM 4004  C CG   . GLU A 1 46  ? 12.243  -2.348  6.646   1.00 0.58  ? 46  GLU A CG   2  
ATOM 4005  C CD   . GLU A 1 46  ? 11.881  -2.250  8.113   1.00 1.17  ? 46  GLU A CD   2  
ATOM 4006  O OE1  . GLU A 1 46  ? 12.485  -2.969  8.934   1.00 1.70  ? 46  GLU A OE1  2  
ATOM 4007  O OE2  . GLU A 1 46  ? 10.998  -1.439  8.456   1.00 1.68  ? 46  GLU A OE2  2  
ATOM 4008  H H    . GLU A 1 46  ? 13.615  -4.605  5.614   1.00 0.20  ? 46  GLU A H    2  
ATOM 4009  H HA   . GLU A 1 46  ? 11.425  -4.887  7.427   1.00 0.28  ? 46  GLU A HA   2  
ATOM 4010  H HB2  . GLU A 1 46  ? 11.642  -3.323  4.860   1.00 0.43  ? 46  GLU A HB2  2  
ATOM 4011  H HB3  . GLU A 1 46  ? 10.380  -3.156  6.052   1.00 0.54  ? 46  GLU A HB3  2  
ATOM 4012  H HG2  . GLU A 1 46  ? 13.286  -2.615  6.567   1.00 0.66  ? 46  GLU A HG2  2  
ATOM 4013  H HG3  . GLU A 1 46  ? 12.082  -1.386  6.184   1.00 0.71  ? 46  GLU A HG3  2  
ATOM 4014  N N    . LEU A 1 47  ? 11.406  -6.566  4.716   1.00 0.25  ? 47  LEU A N    2  
ATOM 4015  C CA   . LEU A 1 47  ? 10.662  -7.572  3.974   1.00 0.26  ? 47  LEU A CA   2  
ATOM 4016  C C    . LEU A 1 47  ? 11.393  -8.894  3.991   1.00 0.28  ? 47  LEU A C    2  
ATOM 4017  O O    . LEU A 1 47  ? 11.259  -9.702  3.073   1.00 0.30  ? 47  LEU A O    2  
ATOM 4018  C CB   . LEU A 1 47  ? 10.431  -7.122  2.536   1.00 0.26  ? 47  LEU A CB   2  
ATOM 4019  C CG   . LEU A 1 47  ? 9.555   -5.884  2.389   1.00 0.27  ? 47  LEU A CG   2  
ATOM 4020  C CD1  . LEU A 1 47  ? 9.467   -5.470  0.935   1.00 0.32  ? 47  LEU A CD1  2  
ATOM 4021  C CD2  . LEU A 1 47  ? 8.171   -6.153  2.962   1.00 0.27  ? 47  LEU A CD2  2  
ATOM 4022  H H    . LEU A 1 47  ? 12.366  -6.454  4.550   1.00 0.29  ? 47  LEU A H    2  
ATOM 4023  H HA   . LEU A 1 47  ? 9.706   -7.699  4.459   1.00 0.29  ? 47  LEU A HA   2  
ATOM 4024  H HB2  . LEU A 1 47  ? 11.391  -6.920  2.084   1.00 0.27  ? 47  LEU A HB2  2  
ATOM 4025  H HB3  . LEU A 1 47  ? 9.961   -7.933  2.003   1.00 0.27  ? 47  LEU A HB3  2  
ATOM 4026  H HG   . LEU A 1 47  ? 9.995   -5.069  2.943   1.00 0.29  ? 47  LEU A HG   2  
ATOM 4027  H HD11 . LEU A 1 47  ? 8.793   -4.632  0.840   1.00 1.00  ? 47  LEU A HD11 2  
ATOM 4028  H HD12 . LEU A 1 47  ? 9.101   -6.299  0.347   1.00 0.93  ? 47  LEU A HD12 2  
ATOM 4029  H HD13 . LEU A 1 47  ? 10.448  -5.185  0.586   1.00 0.95  ? 47  LEU A HD13 2  
ATOM 4030  H HD21 . LEU A 1 47  ? 7.553   -5.276  2.848   1.00 0.92  ? 47  LEU A HD21 2  
ATOM 4031  H HD22 . LEU A 1 47  ? 8.260   -6.397  4.013   1.00 1.01  ? 47  LEU A HD22 2  
ATOM 4032  H HD23 . LEU A 1 47  ? 7.720   -6.985  2.441   1.00 1.12  ? 47  LEU A HD23 2  
ATOM 4033  N N    . ALA A 1 48  ? 12.185  -9.099  5.032   1.00 0.32  ? 48  ALA A N    2  
ATOM 4034  C CA   . ALA A 1 48  ? 12.943  -10.325 5.194   1.00 0.36  ? 48  ALA A CA   2  
ATOM 4035  C C    . ALA A 1 48  ? 12.031  -11.546 5.188   1.00 0.39  ? 48  ALA A C    2  
ATOM 4036  O O    . ALA A 1 48  ? 12.457  -12.643 4.824   1.00 0.44  ? 48  ALA A O    2  
ATOM 4037  C CB   . ALA A 1 48  ? 13.749  -10.256 6.474   1.00 0.41  ? 48  ALA A CB   2  
ATOM 4038  H H    . ALA A 1 48  ? 12.273  -8.395  5.708   1.00 0.34  ? 48  ALA A H    2  
ATOM 4039  H HA   . ALA A 1 48  ? 13.630  -10.401 4.367   1.00 0.39  ? 48  ALA A HA   2  
ATOM 4040  H HB1  . ALA A 1 48  ? 14.350  -11.145 6.571   1.00 1.06  ? 48  ALA A HB1  2  
ATOM 4041  H HB2  . ALA A 1 48  ? 13.079  -10.178 7.318   1.00 1.14  ? 48  ALA A HB2  2  
ATOM 4042  H HB3  . ALA A 1 48  ? 14.393  -9.386  6.440   1.00 1.02  ? 48  ALA A HB3  2  
ATOM 4043  N N    . ALA A 1 49  ? 10.781  -11.342 5.580   1.00 0.38  ? 49  ALA A N    2  
ATOM 4044  C CA   . ALA A 1 49  ? 9.772   -12.391 5.533   1.00 0.41  ? 49  ALA A CA   2  
ATOM 4045  C C    . ALA A 1 49  ? 9.629   -12.942 4.121   1.00 0.41  ? 49  ALA A C    2  
ATOM 4046  O O    . ALA A 1 49  ? 9.553   -14.153 3.914   1.00 0.47  ? 49  ALA A O    2  
ATOM 4047  C CB   . ALA A 1 49  ? 8.441   -11.840 6.015   1.00 0.44  ? 49  ALA A CB   2  
ATOM 4048  H H    . ALA A 1 49  ? 10.527  -10.455 5.914   1.00 0.37  ? 49  ALA A H    2  
ATOM 4049  H HA   . ALA A 1 49  ? 10.075  -13.184 6.196   1.00 0.45  ? 49  ALA A HA   2  
ATOM 4050  H HB1  . ALA A 1 49  ? 7.685   -12.608 5.945   1.00 1.16  ? 49  ALA A HB1  2  
ATOM 4051  H HB2  . ALA A 1 49  ? 8.158   -10.995 5.397   1.00 1.10  ? 49  ALA A HB2  2  
ATOM 4052  H HB3  . ALA A 1 49  ? 8.535   -11.518 7.041   1.00 1.07  ? 49  ALA A HB3  2  
ATOM 4053  N N    . PHE A 1 50  ? 9.588   -12.038 3.161   1.00 0.36  ? 50  PHE A N    2  
ATOM 4054  C CA   . PHE A 1 50  ? 9.453   -12.402 1.762   1.00 0.37  ? 50  PHE A CA   2  
ATOM 4055  C C    . PHE A 1 50  ? 10.820  -12.693 1.152   1.00 0.38  ? 50  PHE A C    2  
ATOM 4056  O O    . PHE A 1 50  ? 11.036  -13.733 0.529   1.00 0.44  ? 50  PHE A O    2  
ATOM 4057  C CB   . PHE A 1 50  ? 8.786   -11.252 1.012   1.00 0.35  ? 50  PHE A CB   2  
ATOM 4058  C CG   . PHE A 1 50  ? 8.357   -11.602 -0.386  1.00 0.70  ? 50  PHE A CG   2  
ATOM 4059  C CD1  . PHE A 1 50  ? 7.101   -12.139 -0.620  1.00 1.63  ? 50  PHE A CD1  2  
ATOM 4060  C CD2  . PHE A 1 50  ? 9.204   -11.396 -1.463  1.00 1.32  ? 50  PHE A CD2  2  
ATOM 4061  C CE1  . PHE A 1 50  ? 6.698   -12.464 -1.901  1.00 2.09  ? 50  PHE A CE1  2  
ATOM 4062  C CE2  . PHE A 1 50  ? 8.808   -11.720 -2.746  1.00 1.66  ? 50  PHE A CE2  2  
ATOM 4063  C CZ   . PHE A 1 50  ? 7.553   -12.256 -2.966  1.00 1.80  ? 50  PHE A CZ   2  
ATOM 4064  H H    . PHE A 1 50  ? 9.654   -11.089 3.402   1.00 0.32  ? 50  PHE A H    2  
ATOM 4065  H HA   . PHE A 1 50  ? 8.834   -13.282 1.694   1.00 0.41  ? 50  PHE A HA   2  
ATOM 4066  H HB2  . PHE A 1 50  ? 7.911   -10.936 1.561   1.00 0.61  ? 50  PHE A HB2  2  
ATOM 4067  H HB3  . PHE A 1 50  ? 9.484   -10.428 0.953   1.00 0.56  ? 50  PHE A HB3  2  
ATOM 4068  H HD1  . PHE A 1 50  ? 6.431   -12.302 0.211   1.00 2.27  ? 50  PHE A HD1  2  
ATOM 4069  H HD2  . PHE A 1 50  ? 10.185  -10.978 -1.292  1.00 2.01  ? 50  PHE A HD2  2  
ATOM 4070  H HE1  . PHE A 1 50  ? 5.717   -12.882 -2.070  1.00 2.96  ? 50  PHE A HE1  2  
ATOM 4071  H HE2  . PHE A 1 50  ? 9.478   -11.555 -3.577  1.00 2.32  ? 50  PHE A HE2  2  
ATOM 4072  H HZ   . PHE A 1 50  ? 7.241   -12.509 -3.967  1.00 2.24  ? 50  PHE A HZ   2  
ATOM 4073  N N    . THR A 1 51  ? 11.734  -11.758 1.364   1.00 0.36  ? 51  THR A N    2  
ATOM 4074  C CA   . THR A 1 51  ? 13.062  -11.786 0.770   1.00 0.40  ? 51  THR A CA   2  
ATOM 4075  C C    . THR A 1 51  ? 13.829  -13.059 1.103   1.00 0.45  ? 51  THR A C    2  
ATOM 4076  O O    . THR A 1 51  ? 14.296  -13.765 0.210   1.00 0.54  ? 51  THR A O    2  
ATOM 4077  C CB   . THR A 1 51  ? 13.862  -10.570 1.264   1.00 0.39  ? 51  THR A CB   2  
ATOM 4078  O OG1  . THR A 1 51  ? 13.260  -9.367  0.780   1.00 0.39  ? 51  THR A OG1  2  
ATOM 4079  C CG2  . THR A 1 51  ? 15.320  -10.640 0.838   1.00 0.49  ? 51  THR A CG2  2  
ATOM 4080  H H    . THR A 1 51  ? 11.506  -11.004 1.953   1.00 0.36  ? 51  THR A H    2  
ATOM 4081  H HA   . THR A 1 51  ? 12.957  -11.706 -0.300  1.00 0.44  ? 51  THR A HA   2  
ATOM 4082  H HB   . THR A 1 51  ? 13.820  -10.566 2.344   1.00 0.36  ? 51  THR A HB   2  
ATOM 4083  H HG1  . THR A 1 51  ? 13.164  -8.745  1.512   1.00 0.41  ? 51  THR A HG1  2  
ATOM 4084  H HG21 . THR A 1 51  ? 15.810  -9.711  1.084   1.00 1.13  ? 51  THR A HG21 2  
ATOM 4085  H HG22 . THR A 1 51  ? 15.379  -10.812 -0.225  1.00 1.14  ? 51  THR A HG22 2  
ATOM 4086  H HG23 . THR A 1 51  ? 15.806  -11.450 1.362   1.00 1.03  ? 51  THR A HG23 2  
ATOM 4087  N N    . LYS A 1 52  ? 13.942  -13.357 2.389   1.00 0.48  ? 52  LYS A N    2  
ATOM 4088  C CA   . LYS A 1 52  ? 14.766  -14.465 2.840   1.00 0.60  ? 52  LYS A CA   2  
ATOM 4089  C C    . LYS A 1 52  ? 14.074  -15.789 2.601   1.00 0.69  ? 52  LYS A C    2  
ATOM 4090  O O    . LYS A 1 52  ? 14.682  -16.854 2.708   1.00 0.84  ? 52  LYS A O    2  
ATOM 4091  C CB   . LYS A 1 52  ? 15.094  -14.309 4.316   1.00 0.70  ? 52  LYS A CB   2  
ATOM 4092  C CG   . LYS A 1 52  ? 15.972  -13.103 4.601   1.00 0.78  ? 52  LYS A CG   2  
ATOM 4093  C CD   . LYS A 1 52  ? 16.275  -12.960 6.080   1.00 1.07  ? 52  LYS A CD   2  
ATOM 4094  C CE   . LYS A 1 52  ? 17.219  -11.799 6.337   1.00 1.24  ? 52  LYS A CE   2  
ATOM 4095  N NZ   . LYS A 1 52  ? 18.594  -12.074 5.840   1.00 1.82  ? 52  LYS A NZ   2  
ATOM 4096  H H    . LYS A 1 52  ? 13.443  -12.828 3.050   1.00 0.45  ? 52  LYS A H    2  
ATOM 4097  H HA   . LYS A 1 52  ? 15.684  -14.442 2.274   1.00 0.65  ? 52  LYS A HA   2  
ATOM 4098  H HB2  . LYS A 1 52  ? 14.166  -14.203 4.865   1.00 0.71  ? 52  LYS A HB2  2  
ATOM 4099  H HB3  . LYS A 1 52  ? 15.607  -15.194 4.657   1.00 0.79  ? 52  LYS A HB3  2  
ATOM 4100  H HG2  . LYS A 1 52  ? 16.901  -13.213 4.064   1.00 1.34  ? 52  LYS A HG2  2  
ATOM 4101  H HG3  . LYS A 1 52  ? 15.461  -12.213 4.260   1.00 1.23  ? 52  LYS A HG3  2  
ATOM 4102  H HD2  . LYS A 1 52  ? 15.354  -12.790 6.613   1.00 1.64  ? 52  LYS A HD2  2  
ATOM 4103  H HD3  . LYS A 1 52  ? 16.733  -13.872 6.433   1.00 1.63  ? 52  LYS A HD3  2  
ATOM 4104  H HE2  . LYS A 1 52  ? 16.834  -10.924 5.827   1.00 1.50  ? 52  LYS A HE2  2  
ATOM 4105  H HE3  . LYS A 1 52  ? 17.258  -11.609 7.399   1.00 1.67  ? 52  LYS A HE3  2  
ATOM 4106  H HZ1  . LYS A 1 52  ? 18.577  -12.255 4.818   1.00 2.15  ? 52  LYS A HZ1  2  
ATOM 4107  H HZ2  . LYS A 1 52  ? 18.992  -12.907 6.319   1.00 2.33  ? 52  LYS A HZ2  2  
ATOM 4108  H HZ3  . LYS A 1 52  ? 19.213  -11.261 6.024   1.00 2.24  ? 52  LYS A HZ3  2  
ATOM 4109  N N    . ASN A 1 53  ? 12.802  -15.713 2.264   1.00 0.68  ? 53  ASN A N    2  
ATOM 4110  C CA   . ASN A 1 53  ? 12.014  -16.900 2.015   1.00 0.85  ? 53  ASN A CA   2  
ATOM 4111  C C    . ASN A 1 53  ? 12.377  -17.482 0.653   1.00 1.00  ? 53  ASN A C    2  
ATOM 4112  O O    . ASN A 1 53  ? 12.220  -18.680 0.409   1.00 1.22  ? 53  ASN A O    2  
ATOM 4113  C CB   . ASN A 1 53  ? 10.534  -16.554 2.104   1.00 0.92  ? 53  ASN A CB   2  
ATOM 4114  C CG   . ASN A 1 53  ? 9.622   -17.771 2.083   1.00 1.40  ? 53  ASN A CG   2  
ATOM 4115  O OD1  . ASN A 1 53  ? 8.493   -17.699 1.603   1.00 1.94  ? 53  ASN A OD1  2  
ATOM 4116  N ND2  . ASN A 1 53  ? 10.092  -18.888 2.617   1.00 2.05  ? 53  ASN A ND2  2  
ATOM 4117  H H    . ASN A 1 53  ? 12.383  -14.832 2.173   1.00 0.63  ? 53  ASN A H    2  
ATOM 4118  H HA   . ASN A 1 53  ? 12.255  -17.619 2.779   1.00 0.95  ? 53  ASN A HA   2  
ATOM 4119  H HB2  . ASN A 1 53  ? 10.366  -16.015 3.028   1.00 1.05  ? 53  ASN A HB2  2  
ATOM 4120  H HB3  . ASN A 1 53  ? 10.275  -15.917 1.273   1.00 1.23  ? 53  ASN A HB3  2  
ATOM 4121  H HD21 . ASN A 1 53  ? 10.996  -18.878 2.999   1.00 2.35  ? 53  ASN A HD21 2  
ATOM 4122  H HD22 . ASN A 1 53  ? 9.517   -19.684 2.609   1.00 2.52  ? 53  ASN A HD22 2  
ATOM 4123  N N    . GLN A 1 54  ? 12.881  -16.626 -0.226  1.00 1.02  ? 54  GLN A N    2  
ATOM 4124  C CA   . GLN A 1 54  ? 13.444  -17.071 -1.488  1.00 1.29  ? 54  GLN A CA   2  
ATOM 4125  C C    . GLN A 1 54  ? 14.962  -17.040 -1.383  1.00 1.33  ? 54  GLN A C    2  
ATOM 4126  O O    . GLN A 1 54  ? 15.544  -16.011 -1.047  1.00 2.05  ? 54  GLN A O    2  
ATOM 4127  C CB   . GLN A 1 54  ? 12.978  -16.189 -2.647  1.00 1.74  ? 54  GLN A CB   2  
ATOM 4128  C CG   . GLN A 1 54  ? 13.304  -16.778 -4.011  1.00 2.17  ? 54  GLN A CG   2  
ATOM 4129  C CD   . GLN A 1 54  ? 12.946  -15.854 -5.156  1.00 2.40  ? 54  GLN A CD   2  
ATOM 4130  O OE1  . GLN A 1 54  ? 13.773  -15.074 -5.622  1.00 2.91  ? 54  GLN A OE1  2  
ATOM 4131  N NE2  . GLN A 1 54  ? 11.709  -15.938 -5.620  1.00 2.71  ? 54  GLN A NE2  2  
ATOM 4132  H H    . GLN A 1 54  ? 12.886  -15.667 -0.012  1.00 0.93  ? 54  GLN A H    2  
ATOM 4133  H HA   . GLN A 1 54  ? 13.122  -18.088 -1.658  1.00 1.53  ? 54  GLN A HA   2  
ATOM 4134  H HB2  . GLN A 1 54  ? 11.907  -16.058 -2.580  1.00 2.09  ? 54  GLN A HB2  2  
ATOM 4135  H HB3  . GLN A 1 54  ? 13.457  -15.225 -2.569  1.00 2.20  ? 54  GLN A HB3  2  
ATOM 4136  H HG2  . GLN A 1 54  ? 14.364  -16.982 -4.055  1.00 2.68  ? 54  GLN A HG2  2  
ATOM 4137  H HG3  . GLN A 1 54  ? 12.757  -17.702 -4.129  1.00 2.60  ? 54  GLN A HG3  2  
ATOM 4138  H HE21 . GLN A 1 54  ? 11.098  -16.587 -5.206  1.00 2.94  ? 54  GLN A HE21 2  
ATOM 4139  H HE22 . GLN A 1 54  ? 11.451  -15.342 -6.355  1.00 3.07  ? 54  GLN A HE22 2  
ATOM 4140  N N    . LYS A 1 55  ? 15.603  -18.159 -1.667  1.00 1.44  ? 55  LYS A N    2  
ATOM 4141  C CA   . LYS A 1 55  ? 17.040  -18.289 -1.456  1.00 1.87  ? 55  LYS A CA   2  
ATOM 4142  C C    . LYS A 1 55  ? 17.822  -17.752 -2.655  1.00 1.59  ? 55  LYS A C    2  
ATOM 4143  O O    . LYS A 1 55  ? 18.636  -18.460 -3.251  1.00 2.27  ? 55  LYS A O    2  
ATOM 4144  C CB   . LYS A 1 55  ? 17.416  -19.754 -1.174  1.00 2.84  ? 55  LYS A CB   2  
ATOM 4145  C CG   . LYS A 1 55  ? 16.874  -20.302 0.147   1.00 3.60  ? 55  LYS A CG   2  
ATOM 4146  C CD   . LYS A 1 55  ? 15.370  -20.548 0.097   1.00 4.29  ? 55  LYS A CD   2  
ATOM 4147  C CE   . LYS A 1 55  ? 14.814  -20.971 1.451   1.00 5.02  ? 55  LYS A CE   2  
ATOM 4148  N NZ   . LYS A 1 55  ? 15.356  -22.281 1.902   1.00 5.58  ? 55  LYS A NZ   2  
ATOM 4149  H H    . LYS A 1 55  ? 15.103  -18.918 -2.039  1.00 1.82  ? 55  LYS A H    2  
ATOM 4150  H HA   . LYS A 1 55  ? 17.295  -17.695 -0.591  1.00 2.28  ? 55  LYS A HA   2  
ATOM 4151  H HB2  . LYS A 1 55  ? 17.033  -20.369 -1.975  1.00 3.16  ? 55  LYS A HB2  2  
ATOM 4152  H HB3  . LYS A 1 55  ? 18.493  -19.837 -1.157  1.00 3.23  ? 55  LYS A HB3  2  
ATOM 4153  H HG2  . LYS A 1 55  ? 17.370  -21.235 0.369   1.00 4.06  ? 55  LYS A HG2  2  
ATOM 4154  H HG3  . LYS A 1 55  ? 17.085  -19.589 0.931   1.00 3.78  ? 55  LYS A HG3  2  
ATOM 4155  H HD2  . LYS A 1 55  ? 14.880  -19.636 -0.211  1.00 4.59  ? 55  LYS A HD2  2  
ATOM 4156  H HD3  . LYS A 1 55  ? 15.168  -21.326 -0.625  1.00 4.44  ? 55  LYS A HD3  2  
ATOM 4157  H HE2  . LYS A 1 55  ? 15.071  -20.219 2.180   1.00 5.06  ? 55  LYS A HE2  2  
ATOM 4158  H HE3  . LYS A 1 55  ? 13.739  -21.043 1.375   1.00 5.52  ? 55  LYS A HE3  2  
ATOM 4159  H HZ1  . LYS A 1 55  ? 14.928  -22.552 2.811   1.00 5.86  ? 55  LYS A HZ1  2  
ATOM 4160  H HZ2  . LYS A 1 55  ? 16.386  -22.223 2.026   1.00 5.76  ? 55  LYS A HZ2  2  
ATOM 4161  H HZ3  . LYS A 1 55  ? 15.145  -23.021 1.200   1.00 5.87  ? 55  LYS A HZ3  2  
ATOM 4162  N N    . ASP A 1 56  ? 17.570  -16.495 -3.002  1.00 1.36  ? 56  ASP A N    2  
ATOM 4163  C CA   . ASP A 1 56  ? 18.243  -15.849 -4.124  1.00 1.50  ? 56  ASP A CA   2  
ATOM 4164  C C    . ASP A 1 56  ? 18.073  -14.333 -4.048  1.00 1.27  ? 56  ASP A C    2  
ATOM 4165  O O    . ASP A 1 56  ? 16.972  -13.818 -4.244  1.00 1.44  ? 56  ASP A O    2  
ATOM 4166  C CB   . ASP A 1 56  ? 17.689  -16.375 -5.452  1.00 2.13  ? 56  ASP A CB   2  
ATOM 4167  C CG   . ASP A 1 56  ? 18.283  -15.678 -6.658  1.00 2.83  ? 56  ASP A CG   2  
ATOM 4168  O OD1  . ASP A 1 56  ? 19.427  -15.180 -6.573  1.00 3.44  ? 56  ASP A OD1  2  
ATOM 4169  O OD2  . ASP A 1 56  ? 17.614  -15.641 -7.710  1.00 3.39  ? 56  ASP A OD2  2  
ATOM 4170  H H    . ASP A 1 56  ? 16.910  -15.983 -2.483  1.00 1.71  ? 56  ASP A H    2  
ATOM 4171  H HA   . ASP A 1 56  ? 19.293  -16.087 -4.061  1.00 1.84  ? 56  ASP A HA   2  
ATOM 4172  H HB2  . ASP A 1 56  ? 17.904  -17.431 -5.529  1.00 2.43  ? 56  ASP A HB2  2  
ATOM 4173  H HB3  . ASP A 1 56  ? 16.617  -16.231 -5.467  1.00 2.59  ? 56  ASP A HB3  2  
ATOM 4174  N N    . PRO A 1 57  ? 19.162  -13.597 -3.758  1.00 1.06  ? 57  PRO A N    2  
ATOM 4175  C CA   . PRO A 1 57  ? 19.134  -12.133 -3.626  1.00 1.02  ? 57  PRO A CA   2  
ATOM 4176  C C    . PRO A 1 57  ? 18.854  -11.417 -4.945  1.00 0.75  ? 57  PRO A C    2  
ATOM 4177  O O    . PRO A 1 57  ? 18.634  -10.205 -4.970  1.00 0.70  ? 57  PRO A O    2  
ATOM 4178  C CB   . PRO A 1 57  ? 20.537  -11.787 -3.122  1.00 1.20  ? 57  PRO A CB   2  
ATOM 4179  C CG   . PRO A 1 57  ? 21.388  -12.921 -3.570  1.00 1.20  ? 57  PRO A CG   2  
ATOM 4180  C CD   . PRO A 1 57  ? 20.510  -14.138 -3.512  1.00 1.14  ? 57  PRO A CD   2  
ATOM 4181  H HA   . PRO A 1 57  ? 18.406  -11.821 -2.897  1.00 1.22  ? 57  PRO A HA   2  
ATOM 4182  H HB2  . PRO A 1 57  ? 20.860  -10.853 -3.559  1.00 1.21  ? 57  PRO A HB2  2  
ATOM 4183  H HB3  . PRO A 1 57  ? 20.526  -11.704 -2.047  1.00 1.44  ? 57  PRO A HB3  2  
ATOM 4184  H HG2  . PRO A 1 57  ? 21.726  -12.749 -4.582  1.00 1.15  ? 57  PRO A HG2  2  
ATOM 4185  H HG3  . PRO A 1 57  ? 22.231  -13.033 -2.905  1.00 1.39  ? 57  PRO A HG3  2  
ATOM 4186  H HD2  . PRO A 1 57  ? 20.790  -14.842 -4.281  1.00 1.16  ? 57  PRO A HD2  2  
ATOM 4187  H HD3  . PRO A 1 57  ? 20.565  -14.595 -2.538  1.00 1.29  ? 57  PRO A HD3  2  
ATOM 4188  N N    . GLY A 1 58  ? 18.844  -12.170 -6.039  1.00 0.67  ? 58  GLY A N    2  
ATOM 4189  C CA   . GLY A 1 58  ? 18.570  -11.585 -7.336  1.00 0.56  ? 58  GLY A CA   2  
ATOM 4190  C C    . GLY A 1 58  ? 17.139  -11.120 -7.464  1.00 0.49  ? 58  GLY A C    2  
ATOM 4191  O O    . GLY A 1 58  ? 16.801  -10.381 -8.383  1.00 0.48  ? 58  GLY A O    2  
ATOM 4192  H H    . GLY A 1 58  ? 19.023  -13.134 -5.963  1.00 0.74  ? 58  GLY A H    2  
ATOM 4193  H HA2  . GLY A 1 58  ? 19.226  -10.740 -7.484  1.00 0.57  ? 58  GLY A HA2  2  
ATOM 4194  H HA3  . GLY A 1 58  ? 18.764  -12.318 -8.101  1.00 0.61  ? 58  GLY A HA3  2  
ATOM 4195  N N    . VAL A 1 59  ? 16.297  -11.543 -6.535  1.00 0.52  ? 59  VAL A N    2  
ATOM 4196  C CA   . VAL A 1 59  ? 14.890  -11.181 -6.567  1.00 0.52  ? 59  VAL A CA   2  
ATOM 4197  C C    . VAL A 1 59  ? 14.685  -9.702  -6.309  1.00 0.49  ? 59  VAL A C    2  
ATOM 4198  O O    . VAL A 1 59  ? 13.871  -9.064  -6.970  1.00 0.49  ? 59  VAL A O    2  
ATOM 4199  C CB   . VAL A 1 59  ? 14.067  -11.996 -5.550  1.00 0.61  ? 59  VAL A CB   2  
ATOM 4200  C CG1  . VAL A 1 59  ? 14.623  -11.830 -4.145  1.00 0.65  ? 59  VAL A CG1  2  
ATOM 4201  C CG2  . VAL A 1 59  ? 12.607  -11.583 -5.591  1.00 0.66  ? 59  VAL A CG2  2  
ATOM 4202  H H    . VAL A 1 59  ? 16.629  -12.122 -5.815  1.00 0.58  ? 59  VAL A H    2  
ATOM 4203  H HA   . VAL A 1 59  ? 14.523  -11.397 -7.557  1.00 0.53  ? 59  VAL A HA   2  
ATOM 4204  H HB   . VAL A 1 59  ? 14.137  -13.036 -5.817  1.00 0.64  ? 59  VAL A HB   2  
ATOM 4205  H HG11 . VAL A 1 59  ? 15.611  -12.263 -4.096  1.00 1.19  ? 59  VAL A HG11 2  
ATOM 4206  H HG12 . VAL A 1 59  ? 13.974  -12.324 -3.438  1.00 1.14  ? 59  VAL A HG12 2  
ATOM 4207  H HG13 . VAL A 1 59  ? 14.682  -10.776 -3.910  1.00 1.29  ? 59  VAL A HG13 2  
ATOM 4208  H HG21 . VAL A 1 59  ? 12.052  -12.143 -4.854  1.00 1.21  ? 59  VAL A HG21 2  
ATOM 4209  H HG22 . VAL A 1 59  ? 12.205  -11.780 -6.573  1.00 1.26  ? 59  VAL A HG22 2  
ATOM 4210  H HG23 . VAL A 1 59  ? 12.532  -10.525 -5.375  1.00 1.19  ? 59  VAL A HG23 2  
ATOM 4211  N N    . LEU A 1 60  ? 15.431  -9.149  -5.366  1.00 0.48  ? 60  LEU A N    2  
ATOM 4212  C CA   . LEU A 1 60  ? 15.300  -7.735  -5.055  1.00 0.46  ? 60  LEU A CA   2  
ATOM 4213  C C    . LEU A 1 60  ? 15.746  -6.930  -6.257  1.00 0.43  ? 60  LEU A C    2  
ATOM 4214  O O    . LEU A 1 60  ? 15.322  -5.795  -6.470  1.00 0.41  ? 60  LEU A O    2  
ATOM 4215  C CB   . LEU A 1 60  ? 16.138  -7.344  -3.844  1.00 0.48  ? 60  LEU A CB   2  
ATOM 4216  C CG   . LEU A 1 60  ? 16.156  -8.357  -2.699  1.00 0.51  ? 60  LEU A CG   2  
ATOM 4217  C CD1  . LEU A 1 60  ? 16.962  -7.821  -1.525  1.00 0.51  ? 60  LEU A CD1  2  
ATOM 4218  C CD2  . LEU A 1 60  ? 14.742  -8.700  -2.269  1.00 0.52  ? 60  LEU A CD2  2  
ATOM 4219  H H    . LEU A 1 60  ? 16.068  -9.704  -4.868  1.00 0.50  ? 60  LEU A H    2  
ATOM 4220  H HA   . LEU A 1 60  ? 14.259  -7.537  -4.853  1.00 0.47  ? 60  LEU A HA   2  
ATOM 4221  H HB2  . LEU A 1 60  ? 17.155  -7.175  -4.173  1.00 0.51  ? 60  LEU A HB2  2  
ATOM 4222  H HB3  . LEU A 1 60  ? 15.740  -6.414  -3.466  1.00 0.48  ? 60  LEU A HB3  2  
ATOM 4223  H HG   . LEU A 1 60  ? 16.628  -9.264  -3.042  1.00 0.57  ? 60  LEU A HG   2  
ATOM 4224  H HD11 . LEU A 1 60  ? 16.866  -8.492  -0.681  1.00 1.00  ? 60  LEU A HD11 2  
ATOM 4225  H HD12 . LEU A 1 60  ? 16.594  -6.844  -1.251  1.00 1.22  ? 60  LEU A HD12 2  
ATOM 4226  H HD13 . LEU A 1 60  ? 18.001  -7.746  -1.807  1.00 1.18  ? 60  LEU A HD13 2  
ATOM 4227  H HD21 . LEU A 1 60  ? 14.258  -7.814  -1.890  1.00 1.20  ? 60  LEU A HD21 2  
ATOM 4228  H HD22 . LEU A 1 60  ? 14.772  -9.454  -1.498  1.00 1.11  ? 60  LEU A HD22 2  
ATOM 4229  H HD23 . LEU A 1 60  ? 14.190  -9.073  -3.119  1.00 1.11  ? 60  LEU A HD23 2  
ATOM 4230  N N    . ASP A 1 61  ? 16.604  -7.557  -7.044  1.00 0.46  ? 61  ASP A N    2  
ATOM 4231  C CA   . ASP A 1 61  ? 17.112  -6.961  -8.267  1.00 0.46  ? 61  ASP A CA   2  
ATOM 4232  C C    . ASP A 1 61  ? 16.008  -6.924  -9.304  1.00 0.47  ? 61  ASP A C    2  
ATOM 4233  O O    . ASP A 1 61  ? 15.865  -5.959  -10.057 1.00 0.51  ? 61  ASP A O    2  
ATOM 4234  C CB   . ASP A 1 61  ? 18.294  -7.774  -8.793  1.00 0.47  ? 61  ASP A CB   2  
ATOM 4235  C CG   . ASP A 1 61  ? 19.220  -6.961  -9.677  1.00 0.48  ? 61  ASP A CG   2  
ATOM 4236  O OD1  . ASP A 1 61  ? 18.972  -6.882  -10.896 1.00 1.19  ? 61  ASP A OD1  2  
ATOM 4237  O OD2  . ASP A 1 61  ? 20.211  -6.404  -9.155  1.00 1.22  ? 61  ASP A OD2  2  
ATOM 4238  H H    . ASP A 1 61  ? 16.899  -8.461  -6.791  1.00 0.49  ? 61  ASP A H    2  
ATOM 4239  H HA   . ASP A 1 61  ? 17.424  -5.961  -8.051  1.00 0.48  ? 61  ASP A HA   2  
ATOM 4240  H HB2  . ASP A 1 61  ? 18.857  -8.162  -7.957  1.00 0.48  ? 61  ASP A HB2  2  
ATOM 4241  H HB3  . ASP A 1 61  ? 17.915  -8.602  -9.373  1.00 0.51  ? 61  ASP A HB3  2  
ATOM 4242  N N    . ARG A 1 62  ? 15.217  -7.982  -9.308  1.00 0.47  ? 62  ARG A N    2  
ATOM 4243  C CA   . ARG A 1 62  ? 14.078  -8.095  -10.198 1.00 0.51  ? 62  ARG A CA   2  
ATOM 4244  C C    . ARG A 1 62  ? 12.998  -7.114  -9.782  1.00 0.50  ? 62  ARG A C    2  
ATOM 4245  O O    . ARG A 1 62  ? 12.383  -6.470  -10.626 1.00 0.56  ? 62  ARG A O    2  
ATOM 4246  C CB   . ARG A 1 62  ? 13.546  -9.525  -10.176 1.00 0.55  ? 62  ARG A CB   2  
ATOM 4247  C CG   . ARG A 1 62  ? 14.626  -10.547 -10.466 1.00 0.55  ? 62  ARG A CG   2  
ATOM 4248  C CD   . ARG A 1 62  ? 14.149  -11.967 -10.263 1.00 0.62  ? 62  ARG A CD   2  
ATOM 4249  N NE   . ARG A 1 62  ? 15.226  -12.917 -10.521 1.00 1.45  ? 62  ARG A NE   2  
ATOM 4250  C CZ   . ARG A 1 62  ? 15.681  -13.794 -9.633  1.00 1.97  ? 62  ARG A CZ   2  
ATOM 4251  N NH1  . ARG A 1 62  ? 15.052  -13.974 -8.477  1.00 1.66  ? 62  ARG A NH1  2  
ATOM 4252  N NH2  . ARG A 1 62  ? 16.749  -14.519 -9.916  1.00 3.02  ? 62  ARG A NH2  2  
ATOM 4253  H H    . ARG A 1 62  ? 15.405  -8.715  -8.684  1.00 0.47  ? 62  ARG A H    2  
ATOM 4254  H HA   . ARG A 1 62  ? 14.409  -7.853  -11.196 1.00 0.53  ? 62  ARG A HA   2  
ATOM 4255  H HB2  . ARG A 1 62  ? 13.131  -9.731  -9.200  1.00 0.60  ? 62  ARG A HB2  2  
ATOM 4256  H HB3  . ARG A 1 62  ? 12.771  -9.626  -10.920 1.00 0.60  ? 62  ARG A HB3  2  
ATOM 4257  H HG2  . ARG A 1 62  ? 14.949  -10.435 -11.483 1.00 0.56  ? 62  ARG A HG2  2  
ATOM 4258  H HG3  . ARG A 1 62  ? 15.461  -10.363 -9.805  1.00 0.56  ? 62  ARG A HG3  2  
ATOM 4259  H HD2  . ARG A 1 62  ? 13.818  -12.076 -9.245  1.00 1.11  ? 62  ARG A HD2  2  
ATOM 4260  H HD3  . ARG A 1 62  ? 13.331  -12.165 -10.936 1.00 0.98  ? 62  ARG A HD3  2  
ATOM 4261  H HE   . ARG A 1 62  ? 15.667  -12.862 -11.401 1.00 1.91  ? 62  ARG A HE   2  
ATOM 4262  H HH11 . ARG A 1 62  ? 14.221  -13.452 -8.264  1.00 1.23  ? 62  ARG A HH11 2  
ATOM 4263  H HH12 . ARG A 1 62  ? 15.405  -14.637 -7.812  1.00 2.13  ? 62  ARG A HH12 2  
ATOM 4264  H HH21 . ARG A 1 62  ? 17.214  -14.415 -10.797 1.00 3.45  ? 62  ARG A HH21 2  
ATOM 4265  H HH22 . ARG A 1 62  ? 17.112  -15.171 -9.233  1.00 3.45  ? 62  ARG A HH22 2  
ATOM 4266  N N    . MET A 1 63  ? 12.782  -6.992  -8.472  1.00 0.45  ? 63  MET A N    2  
ATOM 4267  C CA   . MET A 1 63  ? 11.836  -6.016  -7.942  1.00 0.44  ? 63  MET A CA   2  
ATOM 4268  C C    . MET A 1 63  ? 12.228  -4.636  -8.397  1.00 0.41  ? 63  MET A C    2  
ATOM 4269  O O    . MET A 1 63  ? 11.434  -3.937  -9.013  1.00 0.42  ? 63  MET A O    2  
ATOM 4270  C CB   . MET A 1 63  ? 11.799  -6.019  -6.418  1.00 0.43  ? 63  MET A CB   2  
ATOM 4271  C CG   . MET A 1 63  ? 11.521  -7.376  -5.820  1.00 0.49  ? 63  MET A CG   2  
ATOM 4272  S SD   . MET A 1 63  ? 9.912   -8.017  -6.336  1.00 0.64  ? 63  MET A SD   2  
ATOM 4273  C CE   . MET A 1 63  ? 9.773   -9.484  -5.320  1.00 1.54  ? 63  MET A CE   2  
ATOM 4274  H H    . MET A 1 63  ? 13.266  -7.581  -7.851  1.00 0.45  ? 63  MET A H    2  
ATOM 4275  H HA   . MET A 1 63  ? 10.856  -6.253  -8.324  1.00 0.47  ? 63  MET A HA   2  
ATOM 4276  H HB2  . MET A 1 63  ? 12.745  -5.661  -6.049  1.00 0.39  ? 63  MET A HB2  2  
ATOM 4277  H HB3  . MET A 1 63  ? 11.023  -5.343  -6.092  1.00 0.46  ? 63  MET A HB3  2  
ATOM 4278  H HG2  . MET A 1 63  ? 12.299  -8.055  -6.145  1.00 0.48  ? 63  MET A HG2  2  
ATOM 4279  H HG3  . MET A 1 63  ? 11.540  -7.296  -4.745  1.00 0.54  ? 63  MET A HG3  2  
ATOM 4280  H HE1  . MET A 1 63  ? 8.821   -9.960  -5.503  1.00 2.05  ? 63  MET A HE1  2  
ATOM 4281  H HE2  . MET A 1 63  ? 9.844   -9.209  -4.278  1.00 2.05  ? 63  MET A HE2  2  
ATOM 4282  H HE3  . MET A 1 63  ? 10.570  -10.169 -5.566  1.00 2.13  ? 63  MET A HE3  2  
ATOM 4283  N N    . MET A 1 64  ? 13.469  -4.269  -8.097  1.00 0.41  ? 64  MET A N    2  
ATOM 4284  C CA   . MET A 1 64  ? 13.999  -2.971  -8.467  1.00 0.42  ? 64  MET A CA   2  
ATOM 4285  C C    . MET A 1 64  ? 13.663  -2.644  -9.907  1.00 0.44  ? 64  MET A C    2  
ATOM 4286  O O    . MET A 1 64  ? 13.001  -1.659  -10.172 1.00 0.41  ? 64  MET A O    2  
ATOM 4287  C CB   . MET A 1 64  ? 15.514  -2.924  -8.259  1.00 0.55  ? 64  MET A CB   2  
ATOM 4288  C CG   . MET A 1 64  ? 16.159  -1.640  -8.764  1.00 0.65  ? 64  MET A CG   2  
ATOM 4289  S SD   . MET A 1 64  ? 15.470  -0.157  -8.008  1.00 1.87  ? 64  MET A SD   2  
ATOM 4290  C CE   . MET A 1 64  ? 15.794  -0.463  -6.275  1.00 2.41  ? 64  MET A CE   2  
ATOM 4291  H H    . MET A 1 64  ? 14.046  -4.893  -7.602  1.00 0.42  ? 64  MET A H    2  
ATOM 4292  H HA   . MET A 1 64  ? 13.536  -2.233  -7.829  1.00 0.42  ? 64  MET A HA   2  
ATOM 4293  H HB2  . MET A 1 64  ? 15.725  -3.018  -7.205  1.00 0.60  ? 64  MET A HB2  2  
ATOM 4294  H HB3  . MET A 1 64  ? 15.961  -3.755  -8.783  1.00 0.64  ? 64  MET A HB3  2  
ATOM 4295  H HG2  . MET A 1 64  ? 17.215  -1.677  -8.547  1.00 1.29  ? 64  MET A HG2  2  
ATOM 4296  H HG3  . MET A 1 64  ? 16.016  -1.581  -9.834  1.00 1.05  ? 64  MET A HG3  2  
ATOM 4297  H HE1  . MET A 1 64  ? 15.185  -1.289  -5.935  1.00 2.83  ? 64  MET A HE1  2  
ATOM 4298  H HE2  . MET A 1 64  ? 15.558  0.420   -5.700  1.00 2.83  ? 64  MET A HE2  2  
ATOM 4299  H HE3  . MET A 1 64  ? 16.834  -0.710  -6.144  1.00 2.75  ? 64  MET A HE3  2  
ATOM 4300  N N    . LYS A 1 65  ? 14.056  -3.499  -10.834 1.00 0.52  ? 65  LYS A N    2  
ATOM 4301  C CA   . LYS A 1 65  ? 13.888  -3.171  -12.248 1.00 0.56  ? 65  LYS A CA   2  
ATOM 4302  C C    . LYS A 1 65  ? 12.446  -3.355  -12.721 1.00 0.54  ? 65  LYS A C    2  
ATOM 4303  O O    . LYS A 1 65  ? 12.032  -2.750  -13.711 1.00 0.60  ? 65  LYS A O    2  
ATOM 4304  C CB   . LYS A 1 65  ? 14.855  -3.963  -13.124 1.00 0.66  ? 65  LYS A CB   2  
ATOM 4305  C CG   . LYS A 1 65  ? 16.315  -3.570  -12.921 1.00 0.79  ? 65  LYS A CG   2  
ATOM 4306  C CD   . LYS A 1 65  ? 16.524  -2.055  -12.992 1.00 0.86  ? 65  LYS A CD   2  
ATOM 4307  C CE   . LYS A 1 65  ? 16.033  -1.466  -14.309 1.00 1.57  ? 65  LYS A CE   2  
ATOM 4308  N NZ   . LYS A 1 65  ? 16.217  0.010   -14.368 1.00 2.49  ? 65  LYS A NZ   2  
ATOM 4309  H H    . LYS A 1 65  ? 14.446  -4.368  -10.563 1.00 0.56  ? 65  LYS A H    2  
ATOM 4310  H HA   . LYS A 1 65  ? 14.127  -2.122  -12.350 1.00 0.59  ? 65  LYS A HA   2  
ATOM 4311  H HB2  . LYS A 1 65  ? 14.751  -5.014  -12.896 1.00 0.75  ? 65  LYS A HB2  2  
ATOM 4312  H HB3  . LYS A 1 65  ? 14.602  -3.802  -14.161 1.00 0.66  ? 65  LYS A HB3  2  
ATOM 4313  H HG2  . LYS A 1 65  ? 16.636  -3.918  -11.951 1.00 0.86  ? 65  LYS A HG2  2  
ATOM 4314  H HG3  . LYS A 1 65  ? 16.912  -4.042  -13.687 1.00 0.89  ? 65  LYS A HG3  2  
ATOM 4315  H HD2  . LYS A 1 65  ? 15.987  -1.588  -12.181 1.00 1.29  ? 65  LYS A HD2  2  
ATOM 4316  H HD3  . LYS A 1 65  ? 17.579  -1.847  -12.889 1.00 1.25  ? 65  LYS A HD3  2  
ATOM 4317  H HE2  . LYS A 1 65  ? 16.585  -1.918  -15.118 1.00 1.92  ? 65  LYS A HE2  2  
ATOM 4318  H HE3  . LYS A 1 65  ? 14.983  -1.693  -14.421 1.00 2.11  ? 65  LYS A HE3  2  
ATOM 4319  H HZ1  . LYS A 1 65  ? 17.216  0.255   -14.219 1.00 2.92  ? 65  LYS A HZ1  2  
ATOM 4320  H HZ2  . LYS A 1 65  ? 15.641  0.482   -13.632 1.00 2.86  ? 65  LYS A HZ2  2  
ATOM 4321  H HZ3  . LYS A 1 65  ? 15.920  0.370   -15.299 1.00 3.01  ? 65  LYS A HZ3  2  
ATOM 4322  N N    . LYS A 1 66  ? 11.683  -4.182  -12.020 1.00 0.50  ? 66  LYS A N    2  
ATOM 4323  C CA   . LYS A 1 66  ? 10.255  -4.316  -12.294 1.00 0.52  ? 66  LYS A CA   2  
ATOM 4324  C C    . LYS A 1 66  ? 9.531   -3.040  -11.901 1.00 0.48  ? 66  LYS A C    2  
ATOM 4325  O O    . LYS A 1 66  ? 8.713   -2.507  -12.652 1.00 0.55  ? 66  LYS A O    2  
ATOM 4326  C CB   . LYS A 1 66  ? 9.658   -5.484  -11.503 1.00 0.55  ? 66  LYS A CB   2  
ATOM 4327  C CG   . LYS A 1 66  ? 8.139   -5.569  -11.591 1.00 0.91  ? 66  LYS A CG   2  
ATOM 4328  C CD   . LYS A 1 66  ? 7.585   -6.712  -10.748 1.00 0.96  ? 66  LYS A CD   2  
ATOM 4329  C CE   . LYS A 1 66  ? 7.932   -6.557  -9.272  1.00 0.73  ? 66  LYS A CE   2  
ATOM 4330  N NZ   . LYS A 1 66  ? 7.396   -7.677  -8.454  1.00 1.47  ? 66  LYS A NZ   2  
ATOM 4331  H H    . LYS A 1 66  ? 12.089  -4.725  -11.308 1.00 0.50  ? 66  LYS A H    2  
ATOM 4332  H HA   . LYS A 1 66  ? 10.124  -4.492  -13.351 1.00 0.58  ? 66  LYS A HA   2  
ATOM 4333  H HB2  . LYS A 1 66  ? 10.072  -6.409  -11.875 1.00 0.84  ? 66  LYS A HB2  2  
ATOM 4334  H HB3  . LYS A 1 66  ? 9.927   -5.369  -10.462 1.00 0.87  ? 66  LYS A HB3  2  
ATOM 4335  H HG2  . LYS A 1 66  ? 7.718   -4.637  -11.238 1.00 1.33  ? 66  LYS A HG2  2  
ATOM 4336  H HG3  . LYS A 1 66  ? 7.858   -5.724  -12.622 1.00 1.31  ? 66  LYS A HG3  2  
ATOM 4337  H HD2  . LYS A 1 66  ? 6.511   -6.730  -10.851 1.00 1.50  ? 66  LYS A HD2  2  
ATOM 4338  H HD3  . LYS A 1 66  ? 7.997   -7.643  -11.109 1.00 1.60  ? 66  LYS A HD3  2  
ATOM 4339  H HE2  . LYS A 1 66  ? 9.005   -6.533  -9.167  1.00 1.11  ? 66  LYS A HE2  2  
ATOM 4340  H HE3  . LYS A 1 66  ? 7.515   -5.628  -8.910  1.00 0.98  ? 66  LYS A HE3  2  
ATOM 4341  H HZ1  . LYS A 1 66  ? 7.696   -7.573  -7.462  1.00 2.03  ? 66  LYS A HZ1  2  
ATOM 4342  H HZ2  . LYS A 1 66  ? 7.749   -8.584  -8.816  1.00 1.78  ? 66  LYS A HZ2  2  
ATOM 4343  H HZ3  . LYS A 1 66  ? 6.358   -7.685  -8.489  1.00 2.01  ? 66  LYS A HZ3  2  
ATOM 4344  N N    . LEU A 1 67  ? 9.856   -2.558  -10.719 1.00 0.41  ? 67  LEU A N    2  
ATOM 4345  C CA   . LEU A 1 67  ? 9.164   -1.435  -10.123 1.00 0.39  ? 67  LEU A CA   2  
ATOM 4346  C C    . LEU A 1 67  ? 9.705   -0.116  -10.635 1.00 0.40  ? 67  LEU A C    2  
ATOM 4347  O O    . LEU A 1 67  ? 8.937   0.821   -10.816 1.00 0.46  ? 67  LEU A O    2  
ATOM 4348  C CB   . LEU A 1 67  ? 9.320   -1.496  -8.618  1.00 0.34  ? 67  LEU A CB   2  
ATOM 4349  C CG   . LEU A 1 67  ? 8.950   -2.841  -7.994  1.00 0.33  ? 67  LEU A CG   2  
ATOM 4350  C CD1  . LEU A 1 67  ? 9.438   -2.916  -6.563  1.00 0.30  ? 67  LEU A CD1  2  
ATOM 4351  C CD2  . LEU A 1 67  ? 7.449   -3.077  -8.067  1.00 0.37  ? 67  LEU A CD2  2  
ATOM 4352  H H    . LEU A 1 67  ? 10.598  -2.977  -10.222 1.00 0.43  ? 67  LEU A H    2  
ATOM 4353  H HA   . LEU A 1 67  ? 8.121   -1.510  -10.370 1.00 0.44  ? 67  LEU A HA   2  
ATOM 4354  H HB2  . LEU A 1 67  ? 10.351  -1.278  -8.391  1.00 0.34  ? 67  LEU A HB2  2  
ATOM 4355  H HB3  . LEU A 1 67  ? 8.698   -0.728  -8.175  1.00 0.36  ? 67  LEU A HB3  2  
ATOM 4356  H HG   . LEU A 1 67  ? 9.437   -3.629  -8.550  1.00 0.36  ? 67  LEU A HG   2  
ATOM 4357  H HD11 . LEU A 1 67  ? 10.520  -2.913  -6.552  1.00 1.06  ? 67  LEU A HD11 2  
ATOM 4358  H HD12 . LEU A 1 67  ? 9.078   -3.825  -6.105  1.00 1.02  ? 67  LEU A HD12 2  
ATOM 4359  H HD13 . LEU A 1 67  ? 9.074   -2.058  -6.014  1.00 1.06  ? 67  LEU A HD13 2  
ATOM 4360  H HD21 . LEU A 1 67  ? 7.147   -3.149  -9.103  1.00 1.11  ? 67  LEU A HD21 2  
ATOM 4361  H HD22 . LEU A 1 67  ? 6.930   -2.254  -7.597  1.00 1.06  ? 67  LEU A HD22 2  
ATOM 4362  H HD23 . LEU A 1 67  ? 7.202   -3.997  -7.556  1.00 1.08  ? 67  LEU A HD23 2  
ATOM 4363  N N    . ASP A 1 68  ? 11.029  -0.063  -10.844 1.00 0.40  ? 68  ASP A N    2  
ATOM 4364  C CA   . ASP A 1 68  ? 11.729  1.143   -11.311 1.00 0.42  ? 68  ASP A CA   2  
ATOM 4365  C C    . ASP A 1 68  ? 11.213  1.557   -12.671 1.00 0.52  ? 68  ASP A C    2  
ATOM 4366  O O    . ASP A 1 68  ? 11.824  1.315   -13.715 1.00 0.56  ? 68  ASP A O    2  
ATOM 4367  C CB   . ASP A 1 68  ? 13.242  0.901   -11.355 1.00 0.43  ? 68  ASP A CB   2  
ATOM 4368  C CG   . ASP A 1 68  ? 14.030  2.027   -12.007 1.00 0.46  ? 68  ASP A CG   2  
ATOM 4369  O OD1  . ASP A 1 68  ? 13.764  3.212   -11.714 1.00 1.13  ? 68  ASP A OD1  2  
ATOM 4370  O OD2  . ASP A 1 68  ? 14.924  1.725   -12.827 1.00 1.23  ? 68  ASP A OD2  2  
ATOM 4371  H H    . ASP A 1 68  ? 11.564  -0.870  -10.669 1.00 0.40  ? 68  ASP A H    2  
ATOM 4372  H HA   . ASP A 1 68  ? 11.522  1.943   -10.605 1.00 0.41  ? 68  ASP A HA   2  
ATOM 4373  H HB2  . ASP A 1 68  ? 13.602  0.775   -10.345 1.00 0.41  ? 68  ASP A HB2  2  
ATOM 4374  H HB3  . ASP A 1 68  ? 13.429  -0.011  -11.906 1.00 0.47  ? 68  ASP A HB3  2  
ATOM 4375  N N    . THR A 1 69  ? 10.056  2.147   -12.630 1.00 0.59  ? 69  THR A N    2  
ATOM 4376  C CA   . THR A 1 69  ? 9.384   2.617   -13.809 1.00 0.74  ? 69  THR A CA   2  
ATOM 4377  C C    . THR A 1 69  ? 9.881   4.012   -14.154 1.00 0.84  ? 69  THR A C    2  
ATOM 4378  O O    . THR A 1 69  ? 9.673   4.517   -15.257 1.00 0.99  ? 69  THR A O    2  
ATOM 4379  C CB   . THR A 1 69  ? 7.870   2.606   -13.563 1.00 0.79  ? 69  THR A CB   2  
ATOM 4380  O OG1  . THR A 1 69  ? 7.150   2.618   -14.805 1.00 0.90  ? 69  THR A OG1  2  
ATOM 4381  C CG2  . THR A 1 69  ? 7.458   3.802   -12.732 1.00 0.83  ? 69  THR A CG2  2  
ATOM 4382  H H    . THR A 1 69  ? 9.610   2.235   -11.751 1.00 0.55  ? 69  THR A H    2  
ATOM 4383  H HA   . THR A 1 69  ? 9.611   1.949   -14.618 1.00 0.80  ? 69  THR A HA   2  
ATOM 4384  H HB   . THR A 1 69  ? 7.635   1.702   -13.006 1.00 0.76  ? 69  THR A HB   2  
ATOM 4385  H HG1  . THR A 1 69  ? 6.506   1.901   -14.807 1.00 1.25  ? 69  THR A HG1  2  
ATOM 4386  H HG21 . THR A 1 69  ? 6.390   3.793   -12.590 1.00 1.41  ? 69  THR A HG21 2  
ATOM 4387  H HG22 . THR A 1 69  ? 7.750   4.709   -13.240 1.00 1.35  ? 69  THR A HG22 2  
ATOM 4388  H HG23 . THR A 1 69  ? 7.952   3.756   -11.771 1.00 1.12  ? 69  THR A HG23 2  
ATOM 4389  N N    . ASN A 1 70  ? 10.566  4.614   -13.194 1.00 0.80  ? 70  ASN A N    2  
ATOM 4390  C CA   . ASN A 1 70  ? 11.197  5.902   -13.390 1.00 0.94  ? 70  ASN A CA   2  
ATOM 4391  C C    . ASN A 1 70  ? 12.476  5.709   -14.187 1.00 0.86  ? 70  ASN A C    2  
ATOM 4392  O O    . ASN A 1 70  ? 13.044  6.650   -14.742 1.00 0.97  ? 70  ASN A O    2  
ATOM 4393  C CB   . ASN A 1 70  ? 11.516  6.515   -12.029 1.00 1.01  ? 70  ASN A CB   2  
ATOM 4394  C CG   . ASN A 1 70  ? 11.876  7.988   -12.100 1.00 1.25  ? 70  ASN A CG   2  
ATOM 4395  O OD1  . ASN A 1 70  ? 13.038  8.350   -12.294 1.00 1.46  ? 70  ASN A OD1  2  
ATOM 4396  N ND2  . ASN A 1 70  ? 10.891  8.851   -11.912 1.00 1.66  ? 70  ASN A ND2  2  
ATOM 4397  H H    . ASN A 1 70  ? 10.642  4.176   -12.320 1.00 0.72  ? 70  ASN A H    2  
ATOM 4398  H HA   . ASN A 1 70  ? 10.521  6.543   -13.934 1.00 1.12  ? 70  ASN A HA   2  
ATOM 4399  H HB2  . ASN A 1 70  ? 10.655  6.398   -11.395 1.00 1.07  ? 70  ASN A HB2  2  
ATOM 4400  H HB3  . ASN A 1 70  ? 12.349  5.982   -11.594 1.00 0.89  ? 70  ASN A HB3  2  
ATOM 4401  H HD21 . ASN A 1 70  ? 9.991   8.496   -11.734 1.00 1.94  ? 70  ASN A HD21 2  
ATOM 4402  H HD22 . ASN A 1 70  ? 11.098  9.808   -11.953 1.00 1.86  ? 70  ASN A HD22 2  
ATOM 4403  N N    . SER A 1 71  ? 12.891  4.443   -14.241 1.00 0.70  ? 71  SER A N    2  
ATOM 4404  C CA   . SER A 1 71  ? 14.066  4.012   -14.978 1.00 0.66  ? 71  SER A CA   2  
ATOM 4405  C C    . SER A 1 71  ? 15.306  4.740   -14.487 1.00 0.61  ? 71  SER A C    2  
ATOM 4406  O O    . SER A 1 71  ? 16.196  5.089   -15.264 1.00 0.65  ? 71  SER A O    2  
ATOM 4407  C CB   . SER A 1 71  ? 13.859  4.216   -16.479 1.00 0.82  ? 71  SER A CB   2  
ATOM 4408  O OG   . SER A 1 71  ? 12.679  3.559   -16.918 1.00 1.47  ? 71  SER A OG   2  
ATOM 4409  H H    . SER A 1 71  ? 12.389  3.767   -13.739 1.00 0.65  ? 71  SER A H    2  
ATOM 4410  H HA   . SER A 1 71  ? 14.193  2.959   -14.781 1.00 0.61  ? 71  SER A HA   2  
ATOM 4411  H HB2  . SER A 1 71  ? 13.769  5.272   -16.689 1.00 1.19  ? 71  SER A HB2  2  
ATOM 4412  H HB3  . SER A 1 71  ? 14.704  3.812   -17.016 1.00 1.15  ? 71  SER A HB3  2  
ATOM 4413  H HG   . SER A 1 71  ? 11.917  3.929   -16.457 1.00 2.02  ? 71  SER A HG   2  
ATOM 4414  N N    . ASP A 1 72  ? 15.361  4.945   -13.182 1.00 0.58  ? 72  ASP A N    2  
ATOM 4415  C CA   . ASP A 1 72  ? 16.454  5.677   -12.569 1.00 0.65  ? 72  ASP A CA   2  
ATOM 4416  C C    . ASP A 1 72  ? 17.374  4.713   -11.836 1.00 0.56  ? 72  ASP A C    2  
ATOM 4417  O O    . ASP A 1 72  ? 18.528  5.028   -11.546 1.00 0.66  ? 72  ASP A O    2  
ATOM 4418  C CB   . ASP A 1 72  ? 15.904  6.724   -11.596 1.00 0.80  ? 72  ASP A CB   2  
ATOM 4419  C CG   . ASP A 1 72  ? 16.962  7.695   -11.112 1.00 0.93  ? 72  ASP A CG   2  
ATOM 4420  O OD1  . ASP A 1 72  ? 17.193  8.715   -11.796 1.00 1.56  ? 72  ASP A OD1  2  
ATOM 4421  O OD2  . ASP A 1 72  ? 17.557  7.456   -10.043 1.00 1.53  ? 72  ASP A OD2  2  
ATOM 4422  H H    . ASP A 1 72  ? 14.646  4.573   -12.610 1.00 0.56  ? 72  ASP A H    2  
ATOM 4423  H HA   . ASP A 1 72  ? 17.009  6.172   -13.350 1.00 0.76  ? 72  ASP A HA   2  
ATOM 4424  H HB2  . ASP A 1 72  ? 15.127  7.288   -12.088 1.00 1.15  ? 72  ASP A HB2  2  
ATOM 4425  H HB3  . ASP A 1 72  ? 15.484  6.221   -10.737 1.00 1.00  ? 72  ASP A HB3  2  
ATOM 4426  N N    . GLY A 1 73  ? 16.859  3.521   -11.560 1.00 0.45  ? 73  GLY A N    2  
ATOM 4427  C CA   . GLY A 1 73  ? 17.633  2.533   -10.835 1.00 0.46  ? 73  GLY A CA   2  
ATOM 4428  C C    . GLY A 1 73  ? 17.350  2.601   -9.355  1.00 0.41  ? 73  GLY A C    2  
ATOM 4429  O O    . GLY A 1 73  ? 18.067  2.017   -8.539  1.00 0.44  ? 73  GLY A O    2  
ATOM 4430  H H    . GLY A 1 73  ? 15.930  3.311   -11.842 1.00 0.42  ? 73  GLY A H    2  
ATOM 4431  H HA2  . GLY A 1 73  ? 17.381  1.547   -11.199 1.00 0.48  ? 73  GLY A HA2  2  
ATOM 4432  H HA3  . GLY A 1 73  ? 18.684  2.716   -11.001 1.00 0.55  ? 73  GLY A HA3  2  
ATOM 4433  N N    . GLN A 1 74  ? 16.304  3.337   -9.023  1.00 0.38  ? 74  GLN A N    2  
ATOM 4434  C CA   . GLN A 1 74  ? 15.843  3.486   -7.662  1.00 0.37  ? 74  GLN A CA   2  
ATOM 4435  C C    . GLN A 1 74  ? 14.341  3.342   -7.656  1.00 0.36  ? 74  GLN A C    2  
ATOM 4436  O O    . GLN A 1 74  ? 13.707  3.397   -8.708  1.00 0.39  ? 74  GLN A O    2  
ATOM 4437  C CB   . GLN A 1 74  ? 16.190  4.866   -7.111  1.00 0.38  ? 74  GLN A CB   2  
ATOM 4438  C CG   . GLN A 1 74  ? 17.654  5.232   -7.192  1.00 0.42  ? 74  GLN A CG   2  
ATOM 4439  C CD   . GLN A 1 74  ? 17.936  6.591   -6.593  1.00 0.50  ? 74  GLN A CD   2  
ATOM 4440  O OE1  . GLN A 1 74  ? 18.210  6.710   -5.404  1.00 1.03  ? 74  GLN A OE1  2  
ATOM 4441  N NE2  . GLN A 1 74  ? 17.862  7.626   -7.411  1.00 1.25  ? 74  GLN A NE2  2  
ATOM 4442  H H    . GLN A 1 74  ? 15.802  3.787   -9.732  1.00 0.39  ? 74  GLN A H    2  
ATOM 4443  H HA   . GLN A 1 74  ? 16.292  2.716   -7.048  1.00 0.40  ? 74  GLN A HA   2  
ATOM 4444  H HB2  . GLN A 1 74  ? 15.635  5.602   -7.666  1.00 0.39  ? 74  GLN A HB2  2  
ATOM 4445  H HB3  . GLN A 1 74  ? 15.886  4.912   -6.076  1.00 0.38  ? 74  GLN A HB3  2  
ATOM 4446  H HG2  . GLN A 1 74  ? 18.226  4.492   -6.662  1.00 0.42  ? 74  GLN A HG2  2  
ATOM 4447  H HG3  . GLN A 1 74  ? 17.946  5.244   -8.228  1.00 0.44  ? 74  GLN A HG3  2  
ATOM 4448  H HE21 . GLN A 1 74  ? 17.629  7.460   -8.358  1.00 1.91  ? 74  GLN A HE21 2  
ATOM 4449  H HE22 . GLN A 1 74  ? 18.040  8.519   -7.047  1.00 1.32  ? 74  GLN A HE22 2  
ATOM 4450  N N    . LEU A 1 75  ? 13.766  3.183   -6.490  1.00 0.33  ? 75  LEU A N    2  
ATOM 4451  C CA   . LEU A 1 75  ? 12.327  3.108   -6.386  1.00 0.32  ? 75  LEU A CA   2  
ATOM 4452  C C    . LEU A 1 75  ? 11.790  4.271   -5.609  1.00 0.32  ? 75  LEU A C    2  
ATOM 4453  O O    . LEU A 1 75  ? 12.092  4.444   -4.434  1.00 0.32  ? 75  LEU A O    2  
ATOM 4454  C CB   . LEU A 1 75  ? 11.890  1.811   -5.737  1.00 0.31  ? 75  LEU A CB   2  
ATOM 4455  C CG   . LEU A 1 75  ? 12.341  0.561   -6.477  1.00 0.33  ? 75  LEU A CG   2  
ATOM 4456  C CD1  . LEU A 1 75  ? 11.818  -0.679  -5.788  1.00 0.35  ? 75  LEU A CD1  2  
ATOM 4457  C CD2  . LEU A 1 75  ? 11.876  0.613   -7.924  1.00 0.35  ? 75  LEU A CD2  2  
ATOM 4458  H H    . LEU A 1 75  ? 14.319  3.114   -5.682  1.00 0.33  ? 75  LEU A H    2  
ATOM 4459  H HA   . LEU A 1 75  ? 11.922  3.154   -7.385  1.00 0.33  ? 75  LEU A HA   2  
ATOM 4460  H HB2  . LEU A 1 75  ? 12.282  1.786   -4.728  1.00 0.33  ? 75  LEU A HB2  2  
ATOM 4461  H HB3  . LEU A 1 75  ? 10.808  1.807   -5.692  1.00 0.32  ? 75  LEU A HB3  2  
ATOM 4462  H HG   . LEU A 1 75  ? 13.421  0.517   -6.474  1.00 0.36  ? 75  LEU A HG   2  
ATOM 4463  H HD11 . LEU A 1 75  ? 10.738  -0.656  -5.775  1.00 1.08  ? 75  LEU A HD11 2  
ATOM 4464  H HD12 . LEU A 1 75  ? 12.189  -0.711  -4.774  1.00 0.98  ? 75  LEU A HD12 2  
ATOM 4465  H HD13 . LEU A 1 75  ? 12.153  -1.555  -6.321  1.00 1.09  ? 75  LEU A HD13 2  
ATOM 4466  H HD21 . LEU A 1 75  ? 10.794  0.609   -7.960  1.00 1.10  ? 75  LEU A HD21 2  
ATOM 4467  H HD22 . LEU A 1 75  ? 12.255  -0.246  -8.457  1.00 1.05  ? 75  LEU A HD22 2  
ATOM 4468  H HD23 . LEU A 1 75  ? 12.243  1.516   -8.390  1.00 1.06  ? 75  LEU A HD23 2  
ATOM 4469  N N    . ASP A 1 76  ? 10.993  5.069   -6.274  1.00 0.35  ? 76  ASP A N    2  
ATOM 4470  C CA   . ASP A 1 76  ? 10.383  6.206   -5.635  1.00 0.36  ? 76  ASP A CA   2  
ATOM 4471  C C    . ASP A 1 76  ? 9.161   5.761   -4.868  1.00 0.33  ? 76  ASP A C    2  
ATOM 4472  O O    . ASP A 1 76  ? 8.899   4.567   -4.742  1.00 0.32  ? 76  ASP A O    2  
ATOM 4473  C CB   . ASP A 1 76  ? 10.071  7.296   -6.667  1.00 0.44  ? 76  ASP A CB   2  
ATOM 4474  C CG   . ASP A 1 76  ? 8.662   7.282   -7.241  1.00 0.91  ? 76  ASP A CG   2  
ATOM 4475  O OD1  . ASP A 1 76  ? 8.034   6.213   -7.308  1.00 1.45  ? 76  ASP A OD1  2  
ATOM 4476  O OD2  . ASP A 1 76  ? 8.184   8.366   -7.643  1.00 1.68  ? 76  ASP A OD2  2  
ATOM 4477  H H    . ASP A 1 76  ? 10.802  4.880   -7.219  1.00 0.41  ? 76  ASP A H    2  
ATOM 4478  H HA   . ASP A 1 76  ? 11.086  6.602   -4.919  1.00 0.37  ? 76  ASP A HA   2  
ATOM 4479  H HB2  . ASP A 1 76  ? 10.218  8.250   -6.189  1.00 0.74  ? 76  ASP A HB2  2  
ATOM 4480  H HB3  . ASP A 1 76  ? 10.774  7.190   -7.495  1.00 0.64  ? 76  ASP A HB3  2  
ATOM 4481  N N    . PHE A 1 77  ? 8.436   6.711   -4.342  1.00 0.41  ? 77  PHE A N    2  
ATOM 4482  C CA   . PHE A 1 77  ? 7.308   6.417   -3.498  1.00 0.49  ? 77  PHE A CA   2  
ATOM 4483  C C    . PHE A 1 77  ? 6.267   5.552   -4.205  1.00 0.39  ? 77  PHE A C    2  
ATOM 4484  O O    . PHE A 1 77  ? 5.812   4.554   -3.655  1.00 0.39  ? 77  PHE A O    2  
ATOM 4485  C CB   . PHE A 1 77  ? 6.729   7.719   -2.976  1.00 0.72  ? 77  PHE A CB   2  
ATOM 4486  C CG   . PHE A 1 77  ? 6.451   8.777   -4.010  1.00 1.76  ? 77  PHE A CG   2  
ATOM 4487  C CD1  . PHE A 1 77  ? 7.464   9.611   -4.457  1.00 2.66  ? 77  PHE A CD1  2  
ATOM 4488  C CD2  . PHE A 1 77  ? 5.176   8.959   -4.510  1.00 2.56  ? 77  PHE A CD2  2  
ATOM 4489  C CE1  . PHE A 1 77  ? 7.207   10.598  -5.384  1.00 3.77  ? 77  PHE A CE1  2  
ATOM 4490  C CE2  . PHE A 1 77  ? 4.913   9.943   -5.441  1.00 3.67  ? 77  PHE A CE2  2  
ATOM 4491  C CZ   . PHE A 1 77  ? 5.931   10.766  -5.878  1.00 4.15  ? 77  PHE A CZ   2  
ATOM 4492  H H    . PHE A 1 77  ? 8.665   7.643   -4.529  1.00 0.47  ? 77  PHE A H    2  
ATOM 4493  H HA   . PHE A 1 77  ? 7.684   5.855   -2.655  1.00 0.57  ? 77  PHE A HA   2  
ATOM 4494  H HB2  . PHE A 1 77  ? 5.809   7.514   -2.466  1.00 1.26  ? 77  PHE A HB2  2  
ATOM 4495  H HB3  . PHE A 1 77  ? 7.443   8.125   -2.287  1.00 1.00  ? 77  PHE A HB3  2  
ATOM 4496  H HD1  . PHE A 1 77  ? 8.465   9.479   -4.073  1.00 2.85  ? 77  PHE A HD1  2  
ATOM 4497  H HD2  . PHE A 1 77  ? 4.382   8.318   -4.167  1.00 2.72  ? 77  PHE A HD2  2  
ATOM 4498  H HE1  . PHE A 1 77  ? 8.006   11.241  -5.724  1.00 4.59  ? 77  PHE A HE1  2  
ATOM 4499  H HE2  . PHE A 1 77  ? 3.911   10.071  -5.824  1.00 4.42  ? 77  PHE A HE2  2  
ATOM 4500  H HZ   . PHE A 1 77  ? 5.728   11.539  -6.604  1.00 5.09  ? 77  PHE A HZ   2  
ATOM 4501  N N    . SER A 1 78  ? 5.924   5.910   -5.428  1.00 0.39  ? 78  SER A N    2  
ATOM 4502  C CA   . SER A 1 78  ? 4.999   5.119   -6.224  1.00 0.38  ? 78  SER A CA   2  
ATOM 4503  C C    . SER A 1 78  ? 5.606   3.767   -6.587  1.00 0.38  ? 78  SER A C    2  
ATOM 4504  O O    . SER A 1 78  ? 4.912   2.750   -6.617  1.00 0.44  ? 78  SER A O    2  
ATOM 4505  C CB   . SER A 1 78  ? 4.621   5.882   -7.490  1.00 0.45  ? 78  SER A CB   2  
ATOM 4506  O OG   . SER A 1 78  ? 5.554   6.913   -7.753  1.00 1.31  ? 78  SER A OG   2  
ATOM 4507  H H    . SER A 1 78  ? 6.309   6.722   -5.812  1.00 0.45  ? 78  SER A H    2  
ATOM 4508  H HA   . SER A 1 78  ? 4.110   4.955   -5.634  1.00 0.40  ? 78  SER A HA   2  
ATOM 4509  H HB2  . SER A 1 78  ? 4.609   5.201   -8.328  1.00 1.07  ? 78  SER A HB2  2  
ATOM 4510  H HB3  . SER A 1 78  ? 3.641   6.319   -7.366  1.00 0.94  ? 78  SER A HB3  2  
ATOM 4511  H HG   . SER A 1 78  ? 6.455   6.535   -7.789  1.00 1.76  ? 78  SER A HG   2  
ATOM 4512  N N    . GLU A 1 79  ? 6.906   3.759   -6.833  1.00 0.36  ? 79  GLU A N    2  
ATOM 4513  C CA   . GLU A 1 79  ? 7.605   2.544   -7.223  1.00 0.42  ? 79  GLU A CA   2  
ATOM 4514  C C    . GLU A 1 79  ? 7.644   1.558   -6.061  1.00 0.33  ? 79  GLU A C    2  
ATOM 4515  O O    . GLU A 1 79  ? 7.395   0.362   -6.226  1.00 0.33  ? 79  GLU A O    2  
ATOM 4516  C CB   . GLU A 1 79  ? 9.023   2.884   -7.682  1.00 0.51  ? 79  GLU A CB   2  
ATOM 4517  C CG   . GLU A 1 79  ? 9.150   3.193   -9.168  1.00 0.64  ? 79  GLU A CG   2  
ATOM 4518  C CD   . GLU A 1 79  ? 8.337   4.387   -9.634  1.00 1.81  ? 79  GLU A CD   2  
ATOM 4519  O OE1  . GLU A 1 79  ? 7.088   4.291   -9.677  1.00 2.54  ? 79  GLU A OE1  2  
ATOM 4520  O OE2  . GLU A 1 79  ? 8.950   5.413   -9.999  1.00 2.57  ? 79  GLU A OE2  2  
ATOM 4521  H H    . GLU A 1 79  ? 7.418   4.602   -6.743  1.00 0.35  ? 79  GLU A H    2  
ATOM 4522  H HA   . GLU A 1 79  ? 7.066   2.097   -8.044  1.00 0.51  ? 79  GLU A HA   2  
ATOM 4523  H HB2  . GLU A 1 79  ? 9.364   3.746   -7.131  1.00 0.48  ? 79  GLU A HB2  2  
ATOM 4524  H HB3  . GLU A 1 79  ? 9.667   2.049   -7.454  1.00 0.60  ? 79  GLU A HB3  2  
ATOM 4525  H HG2  . GLU A 1 79  ? 10.190  3.388   -9.386  1.00 0.89  ? 79  GLU A HG2  2  
ATOM 4526  H HG3  . GLU A 1 79  ? 8.832   2.323   -9.725  1.00 1.04  ? 79  GLU A HG3  2  
ATOM 4527  N N    . PHE A 1 80  ? 7.942   2.084   -4.886  1.00 0.28  ? 80  PHE A N    2  
ATOM 4528  C CA   . PHE A 1 80  ? 7.948   1.307   -3.655  1.00 0.25  ? 80  PHE A CA   2  
ATOM 4529  C C    . PHE A 1 80  ? 6.557   0.771   -3.351  1.00 0.23  ? 80  PHE A C    2  
ATOM 4530  O O    . PHE A 1 80  ? 6.396   -0.339  -2.853  1.00 0.26  ? 80  PHE A O    2  
ATOM 4531  C CB   . PHE A 1 80  ? 8.423   2.191   -2.505  1.00 0.31  ? 80  PHE A CB   2  
ATOM 4532  C CG   . PHE A 1 80  ? 8.288   1.559   -1.154  1.00 0.71  ? 80  PHE A CG   2  
ATOM 4533  C CD1  . PHE A 1 80  ? 9.088   0.493   -0.792  1.00 1.26  ? 80  PHE A CD1  2  
ATOM 4534  C CD2  . PHE A 1 80  ? 7.356   2.038   -0.247  1.00 1.60  ? 80  PHE A CD2  2  
ATOM 4535  C CE1  . PHE A 1 80  ? 8.962   -0.088  0.450   1.00 1.56  ? 80  PHE A CE1  2  
ATOM 4536  C CE2  . PHE A 1 80  ? 7.227   1.461   0.998   1.00 1.98  ? 80  PHE A CE2  2  
ATOM 4537  C CZ   . PHE A 1 80  ? 8.031   0.396   1.346   1.00 1.64  ? 80  PHE A CZ   2  
ATOM 4538  H H    . PHE A 1 80  ? 8.174   3.043   -4.843  1.00 0.28  ? 80  PHE A H    2  
ATOM 4539  H HA   . PHE A 1 80  ? 8.632   0.478   -3.775  1.00 0.29  ? 80  PHE A HA   2  
ATOM 4540  H HB2  . PHE A 1 80  ? 9.462   2.438   -2.652  1.00 0.38  ? 80  PHE A HB2  2  
ATOM 4541  H HB3  . PHE A 1 80  ? 7.837   3.098   -2.502  1.00 0.47  ? 80  PHE A HB3  2  
ATOM 4542  H HD1  . PHE A 1 80  ? 9.817   0.114   -1.493  1.00 1.92  ? 80  PHE A HD1  2  
ATOM 4543  H HD2  . PHE A 1 80  ? 6.727   2.871   -0.521  1.00 2.25  ? 80  PHE A HD2  2  
ATOM 4544  H HE1  . PHE A 1 80  ? 9.592   -0.921  0.722   1.00 2.20  ? 80  PHE A HE1  2  
ATOM 4545  H HE2  . PHE A 1 80  ? 6.499   1.841   1.698   1.00 2.80  ? 80  PHE A HE2  2  
ATOM 4546  H HZ   . PHE A 1 80  ? 7.932   -0.060  2.321   1.00 2.01  ? 80  PHE A HZ   2  
ATOM 4547  N N    . LEU A 1 81  ? 5.552   1.566   -3.659  1.00 0.25  ? 81  LEU A N    2  
ATOM 4548  C CA   . LEU A 1 81  ? 4.180   1.186   -3.385  1.00 0.26  ? 81  LEU A CA   2  
ATOM 4549  C C    . LEU A 1 81  ? 3.666   0.190   -4.403  1.00 0.26  ? 81  LEU A C    2  
ATOM 4550  O O    . LEU A 1 81  ? 2.734   -0.557  -4.127  1.00 0.27  ? 81  LEU A O    2  
ATOM 4551  C CB   . LEU A 1 81  ? 3.296   2.413   -3.352  1.00 0.29  ? 81  LEU A CB   2  
ATOM 4552  C CG   . LEU A 1 81  ? 3.591   3.361   -2.192  1.00 0.28  ? 81  LEU A CG   2  
ATOM 4553  C CD1  . LEU A 1 81  ? 2.753   4.609   -2.321  1.00 0.34  ? 81  LEU A CD1  2  
ATOM 4554  C CD2  . LEU A 1 81  ? 3.359   2.675   -0.842  1.00 0.29  ? 81  LEU A CD2  2  
ATOM 4555  H H    . LEU A 1 81  ? 5.737   2.437   -4.073  1.00 0.27  ? 81  LEU A H    2  
ATOM 4556  H HA   . LEU A 1 81  ? 4.161   0.720   -2.412  1.00 0.26  ? 81  LEU A HA   2  
ATOM 4557  H HB2  . LEU A 1 81  ? 3.436   2.956   -4.281  1.00 0.31  ? 81  LEU A HB2  2  
ATOM 4558  H HB3  . LEU A 1 81  ? 2.268   2.089   -3.288  1.00 0.32  ? 81  LEU A HB3  2  
ATOM 4559  H HG   . LEU A 1 81  ? 4.628   3.659   -2.241  1.00 0.28  ? 81  LEU A HG   2  
ATOM 4560  H HD11 . LEU A 1 81  ? 3.007   5.293   -1.526  1.00 1.05  ? 81  LEU A HD11 2  
ATOM 4561  H HD12 . LEU A 1 81  ? 1.710   4.346   -2.257  1.00 1.03  ? 81  LEU A HD12 2  
ATOM 4562  H HD13 . LEU A 1 81  ? 2.949   5.076   -3.275  1.00 1.12  ? 81  LEU A HD13 2  
ATOM 4563  H HD21 . LEU A 1 81  ? 4.042   1.842   -0.733  1.00 0.94  ? 81  LEU A HD21 2  
ATOM 4564  H HD22 . LEU A 1 81  ? 2.344   2.311   -0.788  1.00 0.98  ? 81  LEU A HD22 2  
ATOM 4565  H HD23 . LEU A 1 81  ? 3.528   3.380   -0.037  1.00 0.98  ? 81  LEU A HD23 2  
ATOM 4566  N N    . ASN A 1 82  ? 4.272   0.176   -5.578  1.00 0.26  ? 82  ASN A N    2  
ATOM 4567  C CA   . ASN A 1 82  ? 3.972   -0.852  -6.556  1.00 0.26  ? 82  ASN A CA   2  
ATOM 4568  C C    . ASN A 1 82  ? 4.466   -2.187  -6.030  1.00 0.23  ? 82  ASN A C    2  
ATOM 4569  O O    . ASN A 1 82  ? 3.866   -3.238  -6.265  1.00 0.25  ? 82  ASN A O    2  
ATOM 4570  C CB   . ASN A 1 82  ? 4.627   -0.538  -7.900  1.00 0.30  ? 82  ASN A CB   2  
ATOM 4571  C CG   . ASN A 1 82  ? 3.707   0.220   -8.839  1.00 0.79  ? 82  ASN A CG   2  
ATOM 4572  O OD1  . ASN A 1 82  ? 2.974   -0.380  -9.624  1.00 1.51  ? 82  ASN A OD1  2  
ATOM 4573  N ND2  . ASN A 1 82  ? 3.734   1.539   -8.765  1.00 1.42  ? 82  ASN A ND2  2  
ATOM 4574  H H    . ASN A 1 82  ? 4.926   0.874   -5.794  1.00 0.28  ? 82  ASN A H    2  
ATOM 4575  H HA   . ASN A 1 82  ? 2.900   -0.888  -6.671  1.00 0.30  ? 82  ASN A HA   2  
ATOM 4576  H HB2  . ASN A 1 82  ? 5.509   0.063   -7.727  1.00 0.58  ? 82  ASN A HB2  2  
ATOM 4577  H HB3  . ASN A 1 82  ? 4.920   -1.463  -8.374  1.00 0.65  ? 82  ASN A HB3  2  
ATOM 4578  H HD21 . ASN A 1 82  ? 4.341   1.958   -8.113  1.00 1.89  ? 82  ASN A HD21 2  
ATOM 4579  H HD22 . ASN A 1 82  ? 3.150   2.048   -9.365  1.00 1.76  ? 82  ASN A HD22 2  
ATOM 4580  N N    . LEU A 1 83  ? 5.575   -2.120  -5.310  1.00 0.23  ? 83  LEU A N    2  
ATOM 4581  C CA   . LEU A 1 83  ? 6.093   -3.255  -4.573  1.00 0.24  ? 83  LEU A CA   2  
ATOM 4582  C C    . LEU A 1 83  ? 5.125   -3.666  -3.480  1.00 0.23  ? 83  LEU A C    2  
ATOM 4583  O O    . LEU A 1 83  ? 4.699   -4.818  -3.409  1.00 0.25  ? 83  LEU A O    2  
ATOM 4584  C CB   . LEU A 1 83  ? 7.418   -2.886  -3.930  1.00 0.27  ? 83  LEU A CB   2  
ATOM 4585  C CG   . LEU A 1 83  ? 7.777   -3.734  -2.723  1.00 0.31  ? 83  LEU A CG   2  
ATOM 4586  C CD1  . LEU A 1 83  ? 8.163   -5.139  -3.158  1.00 0.35  ? 83  LEU A CD1  2  
ATOM 4587  C CD2  . LEU A 1 83  ? 8.876   -3.074  -1.916  1.00 0.36  ? 83  LEU A CD2  2  
ATOM 4588  H H    . LEU A 1 83  ? 6.067   -1.270  -5.280  1.00 0.24  ? 83  LEU A H    2  
ATOM 4589  H HA   . LEU A 1 83  ? 6.240   -4.076  -5.256  1.00 0.25  ? 83  LEU A HA   2  
ATOM 4590  H HB2  . LEU A 1 83  ? 8.192   -2.991  -4.670  1.00 0.30  ? 83  LEU A HB2  2  
ATOM 4591  H HB3  . LEU A 1 83  ? 7.371   -1.853  -3.618  1.00 0.29  ? 83  LEU A HB3  2  
ATOM 4592  H HG   . LEU A 1 83  ? 6.900   -3.808  -2.092  1.00 0.30  ? 83  LEU A HG   2  
ATOM 4593  H HD11 . LEU A 1 83  ? 8.416   -5.730  -2.292  1.00 1.01  ? 83  LEU A HD11 2  
ATOM 4594  H HD12 . LEU A 1 83  ? 9.013   -5.089  -3.823  1.00 1.02  ? 83  LEU A HD12 2  
ATOM 4595  H HD13 . LEU A 1 83  ? 7.326   -5.593  -3.675  1.00 1.12  ? 83  LEU A HD13 2  
ATOM 4596  H HD21 . LEU A 1 83  ? 9.778   -3.036  -2.504  1.00 1.09  ? 83  LEU A HD21 2  
ATOM 4597  H HD22 . LEU A 1 83  ? 9.053   -3.645  -1.016  1.00 1.01  ? 83  LEU A HD22 2  
ATOM 4598  H HD23 . LEU A 1 83  ? 8.573   -2.069  -1.654  1.00 1.14  ? 83  LEU A HD23 2  
ATOM 4599  N N    . ILE A 1 84  ? 4.807   -2.704  -2.619  1.00 0.24  ? 84  ILE A N    2  
ATOM 4600  C CA   . ILE A 1 84  ? 3.880   -2.914  -1.519  1.00 0.26  ? 84  ILE A CA   2  
ATOM 4601  C C    . ILE A 1 84  ? 2.580   -3.519  -2.032  1.00 0.27  ? 84  ILE A C    2  
ATOM 4602  O O    . ILE A 1 84  ? 1.967   -4.361  -1.374  1.00 0.29  ? 84  ILE A O    2  
ATOM 4603  C CB   . ILE A 1 84  ? 3.605   -1.586  -0.781  1.00 0.29  ? 84  ILE A CB   2  
ATOM 4604  C CG1  . ILE A 1 84  ? 4.886   -1.071  -0.118  1.00 0.55  ? 84  ILE A CG1  2  
ATOM 4605  C CG2  . ILE A 1 84  ? 2.490   -1.740  0.248   1.00 0.47  ? 84  ILE A CG2  2  
ATOM 4606  C CD1  . ILE A 1 84  ? 5.550   -2.074  0.796   1.00 0.62  ? 84  ILE A CD1  2  
ATOM 4607  H H    . ILE A 1 84  ? 5.220   -1.818  -2.727  1.00 0.25  ? 84  ILE A H    2  
ATOM 4608  H HA   . ILE A 1 84  ? 4.335   -3.604  -0.824  1.00 0.28  ? 84  ILE A HA   2  
ATOM 4609  H HB   . ILE A 1 84  ? 3.291   -0.863  -1.514  1.00 0.29  ? 84  ILE A HB   2  
ATOM 4610  H HG12 . ILE A 1 84  ? 5.597   -0.806  -0.886  1.00 1.22  ? 84  ILE A HG12 2  
ATOM 4611  H HG13 . ILE A 1 84  ? 4.651   -0.193  0.466   1.00 1.29  ? 84  ILE A HG13 2  
ATOM 4612  H HG21 . ILE A 1 84  ? 1.581   -2.046  -0.248  1.00 1.12  ? 84  ILE A HG21 2  
ATOM 4613  H HG22 . ILE A 1 84  ? 2.328   -0.797  0.748   1.00 1.09  ? 84  ILE A HG22 2  
ATOM 4614  H HG23 . ILE A 1 84  ? 2.772   -2.488  0.975   1.00 1.17  ? 84  ILE A HG23 2  
ATOM 4615  H HD11 . ILE A 1 84  ? 6.388   -1.608  1.293   1.00 1.22  ? 84  ILE A HD11 2  
ATOM 4616  H HD12 . ILE A 1 84  ? 5.901   -2.913  0.216   1.00 1.15  ? 84  ILE A HD12 2  
ATOM 4617  H HD13 . ILE A 1 84  ? 4.840   -2.416  1.534   1.00 1.31  ? 84  ILE A HD13 2  
ATOM 4618  N N    . GLY A 1 85  ? 2.197   -3.107  -3.233  1.00 0.26  ? 85  GLY A N    2  
ATOM 4619  C CA   . GLY A 1 85  ? 1.061   -3.684  -3.893  1.00 0.29  ? 85  GLY A CA   2  
ATOM 4620  C C    . GLY A 1 85  ? 1.261   -5.157  -4.148  1.00 0.29  ? 85  GLY A C    2  
ATOM 4621  O O    . GLY A 1 85  ? 0.467   -5.964  -3.699  1.00 0.33  ? 85  GLY A O    2  
ATOM 4622  H H    . GLY A 1 85  ? 2.698   -2.396  -3.677  1.00 0.25  ? 85  GLY A H    2  
ATOM 4623  H HA2  . GLY A 1 85  ? 0.187   -3.548  -3.274  1.00 0.33  ? 85  GLY A HA2  2  
ATOM 4624  H HA3  . GLY A 1 85  ? 0.908   -3.183  -4.836  1.00 0.31  ? 85  GLY A HA3  2  
ATOM 4625  N N    . GLY A 1 86  ? 2.372   -5.516  -4.791  1.00 0.28  ? 86  GLY A N    2  
ATOM 4626  C CA   . GLY A 1 86  ? 2.577   -6.898  -5.195  1.00 0.31  ? 86  GLY A CA   2  
ATOM 4627  C C    . GLY A 1 86  ? 2.740   -7.802  -3.997  1.00 0.29  ? 86  GLY A C    2  
ATOM 4628  O O    . GLY A 1 86  ? 2.393   -8.985  -4.030  1.00 0.35  ? 86  GLY A O    2  
ATOM 4629  H H    . GLY A 1 86  ? 3.085   -4.853  -4.936  1.00 0.28  ? 86  GLY A H    2  
ATOM 4630  H HA2  . GLY A 1 86  ? 1.726   -7.226  -5.773  1.00 0.34  ? 86  GLY A HA2  2  
ATOM 4631  H HA3  . GLY A 1 86  ? 3.465   -6.959  -5.806  1.00 0.33  ? 86  GLY A HA3  2  
ATOM 4632  N N    . LEU A 1 87  ? 3.264   -7.221  -2.936  1.00 0.25  ? 87  LEU A N    2  
ATOM 4633  C CA   . LEU A 1 87  ? 3.399   -7.898  -1.663  1.00 0.25  ? 87  LEU A CA   2  
ATOM 4634  C C    . LEU A 1 87  ? 2.029   -8.182  -1.075  1.00 0.26  ? 87  LEU A C    2  
ATOM 4635  O O    . LEU A 1 87  ? 1.653   -9.336  -0.860  1.00 0.29  ? 87  LEU A O    2  
ATOM 4636  C CB   . LEU A 1 87  ? 4.177   -7.011  -0.702  1.00 0.25  ? 87  LEU A CB   2  
ATOM 4637  C CG   . LEU A 1 87  ? 5.682   -6.929  -0.929  1.00 0.26  ? 87  LEU A CG   2  
ATOM 4638  C CD1  . LEU A 1 87  ? 6.259   -5.788  -0.115  1.00 0.26  ? 87  LEU A CD1  2  
ATOM 4639  C CD2  . LEU A 1 87  ? 6.355   -8.239  -0.547  1.00 0.35  ? 87  LEU A CD2  2  
ATOM 4640  H H    . LEU A 1 87  ? 3.564   -6.288  -3.013  1.00 0.26  ? 87  LEU A H    2  
ATOM 4641  H HA   . LEU A 1 87  ? 3.930   -8.824  -1.815  1.00 0.28  ? 87  LEU A HA   2  
ATOM 4642  H HB2  . LEU A 1 87  ? 3.772   -6.011  -0.788  1.00 0.25  ? 87  LEU A HB2  2  
ATOM 4643  H HB3  . LEU A 1 87  ? 4.004   -7.368  0.302   1.00 0.28  ? 87  LEU A HB3  2  
ATOM 4644  H HG   . LEU A 1 87  ? 5.880   -6.734  -1.972  1.00 0.25  ? 87  LEU A HG   2  
ATOM 4645  H HD11 . LEU A 1 87  ? 5.785   -4.865  -0.404  1.00 1.02  ? 87  LEU A HD11 2  
ATOM 4646  H HD12 . LEU A 1 87  ? 7.321   -5.720  -0.295  1.00 1.05  ? 87  LEU A HD12 2  
ATOM 4647  H HD13 . LEU A 1 87  ? 6.082   -5.970  0.935   1.00 1.06  ? 87  LEU A HD13 2  
ATOM 4648  H HD21 . LEU A 1 87  ? 6.157   -8.454  0.494   1.00 0.97  ? 87  LEU A HD21 2  
ATOM 4649  H HD22 . LEU A 1 87  ? 7.421   -8.151  -0.698  1.00 1.10  ? 87  LEU A HD22 2  
ATOM 4650  H HD23 . LEU A 1 87  ? 5.967   -9.037  -1.160  1.00 1.13  ? 87  LEU A HD23 2  
ATOM 4651  N N    . ALA A 1 88  ? 1.281   -7.107  -0.839  1.00 0.25  ? 88  ALA A N    2  
ATOM 4652  C CA   . ALA A 1 88  ? -0.044  -7.195  -0.247  1.00 0.27  ? 88  ALA A CA   2  
ATOM 4653  C C    . ALA A 1 88  ? -0.940  -8.094  -1.058  1.00 0.30  ? 88  ALA A C    2  
ATOM 4654  O O    . ALA A 1 88  ? -1.736  -8.854  -0.521  1.00 0.35  ? 88  ALA A O    2  
ATOM 4655  C CB   . ALA A 1 88  ? -0.684  -5.832  -0.189  1.00 0.27  ? 88  ALA A CB   2  
ATOM 4656  H H    . ALA A 1 88  ? 1.635   -6.220  -1.078  1.00 0.26  ? 88  ALA A H    2  
ATOM 4657  H HA   . ALA A 1 88  ? 0.052   -7.578  0.757   1.00 0.29  ? 88  ALA A HA   2  
ATOM 4658  H HB1  . ALA A 1 88  ? -0.991  -5.556  -1.193  1.00 1.06  ? 88  ALA A HB1  2  
ATOM 4659  H HB2  . ALA A 1 88  ? 0.024   -5.111  0.188   1.00 1.04  ? 88  ALA A HB2  2  
ATOM 4660  H HB3  . ALA A 1 88  ? -1.550  -5.867  0.453   1.00 1.06  ? 88  ALA A HB3  2  
ATOM 4661  N N    . MET A 1 89  ? -0.809  -7.968  -2.360  1.00 0.29  ? 89  MET A N    2  
ATOM 4662  C CA   . MET A 1 89  ? -1.597  -8.728  -3.298  1.00 0.33  ? 89  MET A CA   2  
ATOM 4663  C C    . MET A 1 89  ? -1.391  -10.212 -3.090  1.00 0.34  ? 89  MET A C    2  
ATOM 4664  O O    . MET A 1 89  ? -2.348  -10.978 -3.046  1.00 0.39  ? 89  MET A O    2  
ATOM 4665  C CB   . MET A 1 89  ? -1.217  -8.335  -4.717  1.00 0.35  ? 89  MET A CB   2  
ATOM 4666  C CG   . MET A 1 89  ? -1.736  -6.969  -5.114  1.00 0.42  ? 89  MET A CG   2  
ATOM 4667  S SD   . MET A 1 89  ? -1.292  -6.524  -6.806  1.00 1.03  ? 89  MET A SD   2  
ATOM 4668  C CE   . MET A 1 89  ? -1.858  -7.964  -7.711  1.00 1.89  ? 89  MET A CE   2  
ATOM 4669  H H    . MET A 1 89  ? -0.148  -7.323  -2.707  1.00 0.28  ? 89  MET A H    2  
ATOM 4670  H HA   . MET A 1 89  ? -2.633  -8.487  -3.127  1.00 0.37  ? 89  MET A HA   2  
ATOM 4671  H HB2  . MET A 1 89  ? -0.137  -8.318  -4.793  1.00 0.32  ? 89  MET A HB2  2  
ATOM 4672  H HB3  . MET A 1 89  ? -1.611  -9.067  -5.403  1.00 0.39  ? 89  MET A HB3  2  
ATOM 4673  H HG2  . MET A 1 89  ? -2.806  -6.958  -5.005  1.00 0.56  ? 89  MET A HG2  2  
ATOM 4674  H HG3  . MET A 1 89  ? -1.308  -6.238  -4.443  1.00 0.43  ? 89  MET A HG3  2  
ATOM 4675  H HE1  . MET A 1 89  ? -1.715  -7.803  -8.770  1.00 2.52  ? 89  MET A HE1  2  
ATOM 4676  H HE2  . MET A 1 89  ? -2.907  -8.127  -7.511  1.00 2.34  ? 89  MET A HE2  2  
ATOM 4677  H HE3  . MET A 1 89  ? -1.293  -8.830  -7.401  1.00 2.22  ? 89  MET A HE3  2  
ATOM 4678  N N    . ALA A 1 90  ? -0.138  -10.601 -2.920  1.00 0.34  ? 90  ALA A N    2  
ATOM 4679  C CA   . ALA A 1 90  ? 0.206   -11.995 -2.725  1.00 0.40  ? 90  ALA A CA   2  
ATOM 4680  C C    . ALA A 1 90  ? -0.268  -12.470 -1.359  1.00 0.42  ? 90  ALA A C    2  
ATOM 4681  O O    . ALA A 1 90  ? -0.689  -13.612 -1.197  1.00 0.49  ? 90  ALA A O    2  
ATOM 4682  C CB   . ALA A 1 90  ? 1.703   -12.178 -2.868  1.00 0.46  ? 90  ALA A CB   2  
ATOM 4683  H H    . ALA A 1 90  ? 0.578   -9.926  -2.911  1.00 0.32  ? 90  ALA A H    2  
ATOM 4684  H HA   . ALA A 1 90  ? -0.285  -12.574 -3.492  1.00 0.42  ? 90  ALA A HA   2  
ATOM 4685  H HB1  . ALA A 1 90  ? 1.949   -13.224 -2.774  1.00 1.20  ? 90  ALA A HB1  2  
ATOM 4686  H HB2  . ALA A 1 90  ? 2.210   -11.618 -2.096  1.00 1.13  ? 90  ALA A HB2  2  
ATOM 4687  H HB3  . ALA A 1 90  ? 2.017   -11.819 -3.836  1.00 1.03  ? 90  ALA A HB3  2  
ATOM 4688  N N    . CYS A 1 91  ? -0.217  -11.572 -0.387  1.00 0.41  ? 91  CYS A N    2  
ATOM 4689  C CA   . CYS A 1 91  ? -0.622  -11.885 0.975   1.00 0.47  ? 91  CYS A CA   2  
ATOM 4690  C C    . CYS A 1 91  ? -2.143  -12.019 1.084   1.00 0.45  ? 91  CYS A C    2  
ATOM 4691  O O    . CYS A 1 91  ? -2.646  -12.934 1.734   1.00 0.51  ? 91  CYS A O    2  
ATOM 4692  C CB   . CYS A 1 91  ? -0.095  -10.812 1.927   1.00 0.55  ? 91  CYS A CB   2  
ATOM 4693  S SG   . CYS A 1 91  ? 1.700   -10.609 1.873   1.00 1.76  ? 91  CYS A SG   2  
ATOM 4694  H H    . CYS A 1 91  ? 0.112   -10.669 -0.592  1.00 0.40  ? 91  CYS A H    2  
ATOM 4695  H HA   . CYS A 1 91  ? -0.179  -12.834 1.237   1.00 0.53  ? 91  CYS A HA   2  
ATOM 4696  H HB2  . CYS A 1 91  ? -0.538  -9.862  1.667   1.00 1.09  ? 91  CYS A HB2  2  
ATOM 4697  H HB3  . CYS A 1 91  ? -0.368  -11.069 2.940   1.00 0.94  ? 91  CYS A HB3  2  
ATOM 4698  H HG   . CYS A 1 91  ? 2.006   -10.023 0.720   1.00 2.29  ? 91  CYS A HG   2  
ATOM 4699  N N    . HIS A 1 92  ? -2.875  -11.116 0.437   1.00 0.41  ? 92  HIS A N    2  
ATOM 4700  C CA   . HIS A 1 92  ? -4.331  -11.198 0.409   1.00 0.46  ? 92  HIS A CA   2  
ATOM 4701  C C    . HIS A 1 92  ? -4.746  -12.402 -0.413  1.00 0.45  ? 92  HIS A C    2  
ATOM 4702  O O    . HIS A 1 92  ? -5.695  -13.096 -0.072  1.00 0.49  ? 92  HIS A O    2  
ATOM 4703  C CB   . HIS A 1 92  ? -4.961  -9.922  -0.173  1.00 0.54  ? 92  HIS A CB   2  
ATOM 4704  C CG   . HIS A 1 92  ? -6.467  -9.897  -0.103  1.00 1.21  ? 92  HIS A CG   2  
ATOM 4705  N ND1  . HIS A 1 92  ? -7.165  -9.599  1.050   1.00 2.13  ? 92  HIS A ND1  2  
ATOM 4706  C CD2  . HIS A 1 92  ? -7.409  -10.140 -1.052  1.00 1.96  ? 92  HIS A CD2  2  
ATOM 4707  C CE1  . HIS A 1 92  ? -8.464  -9.660  0.811   1.00 2.74  ? 92  HIS A CE1  2  
ATOM 4708  N NE2  . HIS A 1 92  ? -8.638  -9.984  -0.455  1.00 2.62  ? 92  HIS A NE2  2  
ATOM 4709  H H    . HIS A 1 92  ? -2.423  -10.376 -0.028  1.00 0.40  ? 92  HIS A H    2  
ATOM 4710  H HA   . HIS A 1 92  ? -4.676  -11.333 1.424   1.00 0.53  ? 92  HIS A HA   2  
ATOM 4711  H HB2  . HIS A 1 92  ? -4.590  -9.067  0.371   1.00 1.06  ? 92  HIS A HB2  2  
ATOM 4712  H HB3  . HIS A 1 92  ? -4.675  -9.832  -1.211  1.00 0.91  ? 92  HIS A HB3  2  
ATOM 4713  H HD1  . HIS A 1 92  ? -6.771  -9.373  1.914   1.00 2.63  ? 92  HIS A HD1  2  
ATOM 4714  H HD2  . HIS A 1 92  ? -7.225  -10.402 -2.084  1.00 2.49  ? 92  HIS A HD2  2  
ATOM 4715  H HE1  . HIS A 1 92  ? -9.249  -9.476  1.530   1.00 3.56  ? 92  HIS A HE1  2  
ATOM 4716  H HE2  . HIS A 1 92  ? -9.509  -10.000 -0.918  1.00 3.27  ? 92  HIS A HE2  2  
ATOM 4717  N N    . ASP A 1 93  ? -4.020  -12.640 -1.496  1.00 0.45  ? 93  ASP A N    2  
ATOM 4718  C CA   . ASP A 1 93  ? -4.249  -13.808 -2.328  1.00 0.52  ? 93  ASP A CA   2  
ATOM 4719  C C    . ASP A 1 93  ? -4.066  -15.073 -1.500  1.00 0.56  ? 93  ASP A C    2  
ATOM 4720  O O    . ASP A 1 93  ? -4.901  -15.966 -1.531  1.00 0.65  ? 93  ASP A O    2  
ATOM 4721  C CB   . ASP A 1 93  ? -3.290  -13.810 -3.522  1.00 0.54  ? 93  ASP A CB   2  
ATOM 4722  C CG   . ASP A 1 93  ? -3.491  -15.005 -4.434  1.00 0.93  ? 93  ASP A CG   2  
ATOM 4723  O OD1  . ASP A 1 93  ? -4.361  -14.939 -5.325  1.00 1.75  ? 93  ASP A OD1  2  
ATOM 4724  O OD2  . ASP A 1 93  ? -2.769  -16.015 -4.270  1.00 1.48  ? 93  ASP A OD2  2  
ATOM 4725  H H    . ASP A 1 93  ? -3.307  -12.008 -1.747  1.00 0.44  ? 93  ASP A H    2  
ATOM 4726  H HA   . ASP A 1 93  ? -5.268  -13.768 -2.687  1.00 0.56  ? 93  ASP A HA   2  
ATOM 4727  H HB2  . ASP A 1 93  ? -3.438  -12.902 -4.098  1.00 0.94  ? 93  ASP A HB2  2  
ATOM 4728  H HB3  . ASP A 1 93  ? -2.274  -13.831 -3.153  1.00 0.78  ? 93  ASP A HB3  2  
ATOM 4729  N N    . SER A 1 94  ? -2.988  -15.113 -0.725  1.00 0.54  ? 94  SER A N    2  
ATOM 4730  C CA   . SER A 1 94  ? -2.712  -16.231 0.166   1.00 0.60  ? 94  SER A CA   2  
ATOM 4731  C C    . SER A 1 94  ? -3.824  -16.391 1.186   1.00 0.63  ? 94  SER A C    2  
ATOM 4732  O O    . SER A 1 94  ? -4.258  -17.495 1.466   1.00 0.70  ? 94  SER A O    2  
ATOM 4733  C CB   . SER A 1 94  ? -1.393  -16.017 0.897   1.00 0.65  ? 94  SER A CB   2  
ATOM 4734  O OG   . SER A 1 94  ? -0.307  -15.942 -0.012  1.00 1.27  ? 94  SER A OG   2  
ATOM 4735  H H    . SER A 1 94  ? -2.361  -14.366 -0.752  1.00 0.52  ? 94  SER A H    2  
ATOM 4736  H HA   . SER A 1 94  ? -2.646  -17.130 -0.431  1.00 0.65  ? 94  SER A HA   2  
ATOM 4737  H HB2  . SER A 1 94  ? -1.447  -15.092 1.456   1.00 0.97  ? 94  SER A HB2  2  
ATOM 4738  H HB3  . SER A 1 94  ? -1.227  -16.837 1.577   1.00 1.04  ? 94  SER A HB3  2  
ATOM 4739  H HG   . SER A 1 94  ? -0.485  -15.254 -0.671  1.00 1.85  ? 94  SER A HG   2  
ATOM 4740  N N    . PHE A 1 95  ? -4.275  -15.273 1.731   1.00 0.60  ? 95  PHE A N    2  
ATOM 4741  C CA   . PHE A 1 95  ? -5.358  -15.262 2.698   1.00 0.66  ? 95  PHE A CA   2  
ATOM 4742  C C    . PHE A 1 95  ? -6.608  -15.888 2.088   1.00 0.72  ? 95  PHE A C    2  
ATOM 4743  O O    . PHE A 1 95  ? -7.339  -16.615 2.751   1.00 0.84  ? 95  PHE A O    2  
ATOM 4744  C CB   . PHE A 1 95  ? -5.630  -13.820 3.133   1.00 0.64  ? 95  PHE A CB   2  
ATOM 4745  C CG   . PHE A 1 95  ? -6.610  -13.689 4.261   1.00 0.78  ? 95  PHE A CG   2  
ATOM 4746  C CD1  . PHE A 1 95  ? -6.305  -14.178 5.520   1.00 1.30  ? 95  PHE A CD1  2  
ATOM 4747  C CD2  . PHE A 1 95  ? -7.829  -13.063 4.065   1.00 1.80  ? 95  PHE A CD2  2  
ATOM 4748  C CE1  . PHE A 1 95  ? -7.200  -14.045 6.563   1.00 1.76  ? 95  PHE A CE1  2  
ATOM 4749  C CE2  . PHE A 1 95  ? -8.729  -12.929 5.105   1.00 2.35  ? 95  PHE A CE2  2  
ATOM 4750  C CZ   . PHE A 1 95  ? -8.413  -13.421 6.354   1.00 2.08  ? 95  PHE A CZ   2  
ATOM 4751  H H    . PHE A 1 95  ? -3.860  -14.426 1.479   1.00 0.55  ? 95  PHE A H    2  
ATOM 4752  H HA   . PHE A 1 95  ? -5.053  -15.842 3.555   1.00 0.75  ? 95  PHE A HA   2  
ATOM 4753  H HB2  . PHE A 1 95  ? -4.702  -13.369 3.449   1.00 0.99  ? 95  PHE A HB2  2  
ATOM 4754  H HB3  . PHE A 1 95  ? -6.020  -13.270 2.288   1.00 0.98  ? 95  PHE A HB3  2  
ATOM 4755  H HD1  . PHE A 1 95  ? -5.357  -14.668 5.683   1.00 1.96  ? 95  PHE A HD1  2  
ATOM 4756  H HD2  . PHE A 1 95  ? -8.077  -12.678 3.087   1.00 2.46  ? 95  PHE A HD2  2  
ATOM 4757  H HE1  . PHE A 1 95  ? -6.952  -14.430 7.541   1.00 2.41  ? 95  PHE A HE1  2  
ATOM 4758  H HE2  . PHE A 1 95  ? -9.677  -12.441 4.940   1.00 3.27  ? 95  PHE A HE2  2  
ATOM 4759  H HZ   . PHE A 1 95  ? -9.114  -13.316 7.168   1.00 2.63  ? 95  PHE A HZ   2  
ATOM 4760  N N    . LEU A 1 96  ? -6.813  -15.621 0.807   1.00 0.69  ? 96  LEU A N    2  
ATOM 4761  C CA   . LEU A 1 96  ? -7.945  -16.163 0.068   1.00 0.81  ? 96  LEU A CA   2  
ATOM 4762  C C    . LEU A 1 96  ? -7.723  -17.635 -0.254  1.00 0.90  ? 96  LEU A C    2  
ATOM 4763  O O    . LEU A 1 96  ? -8.648  -18.447 -0.193  1.00 1.09  ? 96  LEU A O    2  
ATOM 4764  C CB   . LEU A 1 96  ? -8.153  -15.368 -1.226  1.00 0.83  ? 96  LEU A CB   2  
ATOM 4765  C CG   . LEU A 1 96  ? -9.098  -14.165 -1.129  1.00 0.87  ? 96  LEU A CG   2  
ATOM 4766  C CD1  . LEU A 1 96  ? -10.537 -14.625 -0.989  1.00 1.21  ? 96  LEU A CD1  2  
ATOM 4767  C CD2  . LEU A 1 96  ? -8.721  -13.271 0.039   1.00 1.08  ? 96  LEU A CD2  2  
ATOM 4768  H H    . LEU A 1 96  ? -6.175  -15.044 0.338   1.00 0.62  ? 96  LEU A H    2  
ATOM 4769  H HA   . LEU A 1 96  ? -8.821  -16.066 0.686   1.00 0.86  ? 96  LEU A HA   2  
ATOM 4770  H HB2  . LEU A 1 96  ? -7.189  -15.009 -1.553  1.00 0.76  ? 96  LEU A HB2  2  
ATOM 4771  H HB3  . LEU A 1 96  ? -8.537  -16.041 -1.976  1.00 0.93  ? 96  LEU A HB3  2  
ATOM 4772  H HG   . LEU A 1 96  ? -9.020  -13.582 -2.034  1.00 0.92  ? 96  LEU A HG   2  
ATOM 4773  H HD11 . LEU A 1 96  ? -10.652 -15.165 -0.064  1.00 1.70  ? 96  LEU A HD11 2  
ATOM 4774  H HD12 . LEU A 1 96  ? -10.789 -15.270 -1.816  1.00 1.64  ? 96  LEU A HD12 2  
ATOM 4775  H HD13 . LEU A 1 96  ? -11.191 -13.765 -0.989  1.00 1.64  ? 96  LEU A HD13 2  
ATOM 4776  H HD21 . LEU A 1 96  ? -7.720  -12.889 -0.113  1.00 1.68  ? 96  LEU A HD21 2  
ATOM 4777  H HD22 . LEU A 1 96  ? -8.751  -13.845 0.955   1.00 1.41  ? 96  LEU A HD22 2  
ATOM 4778  H HD23 . LEU A 1 96  ? -9.417  -12.448 0.104   1.00 1.51  ? 96  LEU A HD23 2  
ATOM 4779  N N    . LYS A 1 97  ? -6.486  -17.966 -0.592  1.00 0.83  ? 97  LYS A N    2  
ATOM 4780  C CA   . LYS A 1 97  ? -6.111  -19.333 -0.921  1.00 0.93  ? 97  LYS A CA   2  
ATOM 4781  C C    . LYS A 1 97  ? -6.106  -20.205 0.330   1.00 0.97  ? 97  LYS A C    2  
ATOM 4782  O O    . LYS A 1 97  ? -6.382  -21.403 0.271   1.00 1.12  ? 97  LYS A O    2  
ATOM 4783  C CB   . LYS A 1 97  ? -4.729  -19.351 -1.574  1.00 0.93  ? 97  LYS A CB   2  
ATOM 4784  C CG   . LYS A 1 97  ? -4.671  -18.559 -2.864  1.00 0.99  ? 97  LYS A CG   2  
ATOM 4785  C CD   . LYS A 1 97  ? -5.422  -19.235 -3.996  1.00 1.25  ? 97  LYS A CD   2  
ATOM 4786  C CE   . LYS A 1 97  ? -5.529  -18.325 -5.212  1.00 2.06  ? 97  LYS A CE   2  
ATOM 4787  N NZ   . LYS A 1 97  ? -4.196  -17.880 -5.701  1.00 2.65  ? 97  LYS A NZ   2  
ATOM 4788  H H    . LYS A 1 97  ? -5.800  -17.261 -0.632  1.00 0.75  ? 97  LYS A H    2  
ATOM 4789  H HA   . LYS A 1 97  ? -6.831  -19.713 -1.621  1.00 1.01  ? 97  LYS A HA   2  
ATOM 4790  H HB2  . LYS A 1 97  ? -4.011  -18.929 -0.884  1.00 0.89  ? 97  LYS A HB2  2  
ATOM 4791  H HB3  . LYS A 1 97  ? -4.454  -20.372 -1.787  1.00 1.04  ? 97  LYS A HB3  2  
ATOM 4792  H HG2  . LYS A 1 97  ? -5.120  -17.595 -2.687  1.00 1.50  ? 97  LYS A HG2  2  
ATOM 4793  H HG3  . LYS A 1 97  ? -3.638  -18.430 -3.152  1.00 1.64  ? 97  LYS A HG3  2  
ATOM 4794  H HD2  . LYS A 1 97  ? -4.895  -20.136 -4.277  1.00 1.86  ? 97  LYS A HD2  2  
ATOM 4795  H HD3  . LYS A 1 97  ? -6.415  -19.487 -3.658  1.00 1.74  ? 97  LYS A HD3  2  
ATOM 4796  H HE2  . LYS A 1 97  ? -6.030  -18.862 -6.004  1.00 2.59  ? 97  LYS A HE2  2  
ATOM 4797  H HE3  . LYS A 1 97  ? -6.112  -17.456 -4.944  1.00 2.52  ? 97  LYS A HE3  2  
ATOM 4798  H HZ1  . LYS A 1 97  ? -3.580  -18.702 -5.862  1.00 3.00  ? 97  LYS A HZ1  2  
ATOM 4799  H HZ2  . LYS A 1 97  ? -3.743  -17.249 -5.003  1.00 2.88  ? 97  LYS A HZ2  2  
ATOM 4800  H HZ3  . LYS A 1 97  ? -4.300  -17.359 -6.595  1.00 3.15  ? 97  LYS A HZ3  2  
ATOM 4801  N N    . ALA A 1 98  ? -5.808  -19.584 1.459   1.00 0.99  ? 98  ALA A N    2  
ATOM 4802  C CA   . ALA A 1 98  ? -5.681  -20.290 2.720   1.00 1.06  ? 98  ALA A CA   2  
ATOM 4803  C C    . ALA A 1 98  ? -7.012  -20.372 3.462   1.00 1.09  ? 98  ALA A C    2  
ATOM 4804  O O    . ALA A 1 98  ? -7.610  -21.445 3.571   1.00 1.23  ? 98  ALA A O    2  
ATOM 4805  C CB   . ALA A 1 98  ? -4.628  -19.612 3.587   1.00 1.00  ? 98  ALA A CB   2  
ATOM 4806  H H    . ALA A 1 98  ? -5.646  -18.616 1.439   1.00 1.04  ? 98  ALA A H    2  
ATOM 4807  H HA   . ALA A 1 98  ? -5.341  -21.288 2.504   1.00 1.17  ? 98  ALA A HA   2  
ATOM 4808  H HB1  . ALA A 1 98  ? -4.939  -18.601 3.807   1.00 1.37  ? 98  ALA A HB1  2  
ATOM 4809  H HB2  . ALA A 1 98  ? -3.687  -19.588 3.056   1.00 1.46  ? 98  ALA A HB2  2  
ATOM 4810  H HB3  . ALA A 1 98  ? -4.508  -20.162 4.509   1.00 1.42  ? 98  ALA A HB3  2  
ATOM 4811  N N    . VAL A 1 99  ? -7.485  -19.232 3.951   1.00 1.00  ? 99  VAL A N    2  
ATOM 4812  C CA   . VAL A 1 99  ? -8.691  -19.181 4.764   1.00 1.06  ? 99  VAL A CA   2  
ATOM 4813  C C    . VAL A 1 99  ? -9.083  -17.727 5.038   1.00 1.00  ? 99  VAL A C    2  
ATOM 4814  O O    . VAL A 1 99  ? -8.608  -17.096 5.979   1.00 1.01  ? 99  VAL A O    2  
ATOM 4815  C CB   . VAL A 1 99  ? -8.522  -19.969 6.093   1.00 1.16  ? 99  VAL A CB   2  
ATOM 4816  C CG1  . VAL A 1 99  ? -7.291  -19.513 6.867   1.00 1.13  ? 99  VAL A CG1  2  
ATOM 4817  C CG2  . VAL A 1 99  ? -9.774  -19.853 6.949   1.00 1.24  ? 99  VAL A CG2  2  
ATOM 4818  H H    . VAL A 1 99  ? -7.021  -18.390 3.737   1.00 0.92  ? 99  VAL A H    2  
ATOM 4819  H HA   . VAL A 1 99  ? -9.485  -19.647 4.197   1.00 1.12  ? 99  VAL A HA   2  
ATOM 4820  H HB   . VAL A 1 99  ? -8.386  -21.011 5.844   1.00 1.24  ? 99  VAL A HB   2  
ATOM 4821  H HG11 . VAL A 1 99  ? -6.407  -19.671 6.266   1.00 1.64  ? 99  VAL A HG11 2  
ATOM 4822  H HG12 . VAL A 1 99  ? -7.209  -20.081 7.782   1.00 1.48  ? 99  VAL A HG12 2  
ATOM 4823  H HG13 . VAL A 1 99  ? -7.383  -18.463 7.101   1.00 1.41  ? 99  VAL A HG13 2  
ATOM 4824  H HG21 . VAL A 1 99  ? -9.631  -20.394 7.874   1.00 1.52  ? 99  VAL A HG21 2  
ATOM 4825  H HG22 . VAL A 1 99  ? -10.613 -20.270 6.415   1.00 1.65  ? 99  VAL A HG22 2  
ATOM 4826  H HG23 . VAL A 1 99  ? -9.966  -18.812 7.165   1.00 1.63  ? 99  VAL A HG23 2  
ATOM 4827  N N    . PRO A 1 100 ? -9.934  -17.159 4.184   1.00 1.00  ? 100 PRO A N    2  
ATOM 4828  C CA   . PRO A 1 100 ? -10.341 -15.769 4.276   1.00 1.02  ? 100 PRO A CA   2  
ATOM 4829  C C    . PRO A 1 100 ? -11.700 -15.585 4.938   1.00 1.28  ? 100 PRO A C    2  
ATOM 4830  O O    . PRO A 1 100 ? -12.300 -14.514 4.854   1.00 1.60  ? 100 PRO A O    2  
ATOM 4831  C CB   . PRO A 1 100 ? -10.408 -15.394 2.802   1.00 1.04  ? 100 PRO A CB   2  
ATOM 4832  C CG   . PRO A 1 100 ? -10.929 -16.632 2.132   1.00 1.03  ? 100 PRO A CG   2  
ATOM 4833  C CD   . PRO A 1 100 ? -10.537 -17.804 3.009   1.00 1.06  ? 100 PRO A CD   2  
ATOM 4834  H HA   . PRO A 1 100 ? -9.606  -15.165 4.781   1.00 0.95  ? 100 PRO A HA   2  
ATOM 4835  H HB2  . PRO A 1 100 ? -11.074 -14.553 2.668   1.00 1.23  ? 100 PRO A HB2  2  
ATOM 4836  H HB3  . PRO A 1 100 ? -9.418  -15.140 2.447   1.00 1.05  ? 100 PRO A HB3  2  
ATOM 4837  H HG2  . PRO A 1 100 ? -12.004 -16.574 2.048   1.00 1.10  ? 100 PRO A HG2  2  
ATOM 4838  H HG3  . PRO A 1 100 ? -10.485 -16.735 1.155   1.00 1.03  ? 100 PRO A HG3  2  
ATOM 4839  H HD2  . PRO A 1 100 ? -11.409 -18.376 3.288   1.00 1.19  ? 100 PRO A HD2  2  
ATOM 4840  H HD3  . PRO A 1 100 ? -9.819  -18.432 2.503   1.00 1.04  ? 100 PRO A HD3  2  
ATOM 4841  N N    . SER A 1 101 ? -12.173 -16.624 5.603   1.00 1.57  ? 101 SER A N    2  
ATOM 4842  C CA   . SER A 1 101 ? -13.488 -16.594 6.215   1.00 1.88  ? 101 SER A CA   2  
ATOM 4843  C C    . SER A 1 101 ? -13.447 -15.864 7.557   1.00 1.62  ? 101 SER A C    2  
ATOM 4844  O O    . SER A 1 101 ? -14.468 -15.352 8.020   1.00 1.94  ? 101 SER A O    2  
ATOM 4845  C CB   . SER A 1 101 ? -14.010 -18.022 6.391   1.00 2.76  ? 101 SER A CB   2  
ATOM 4846  O OG   . SER A 1 101 ? -15.380 -18.039 6.748   1.00 3.39  ? 101 SER A OG   2  
ATOM 4847  H H    . SER A 1 101 ? -11.629 -17.434 5.675   1.00 1.80  ? 101 SER A H    2  
ATOM 4848  H HA   . SER A 1 101 ? -14.150 -16.060 5.550   1.00 2.06  ? 101 SER A HA   2  
ATOM 4849  H HB2  . SER A 1 101 ? -13.889 -18.562 5.464   1.00 3.14  ? 101 SER A HB2  2  
ATOM 4850  H HB3  . SER A 1 101 ? -13.443 -18.515 7.168   1.00 3.02  ? 101 SER A HB3  2  
ATOM 4851  H HG   . SER A 1 101 ? -15.822 -17.271 6.361   1.00 3.74  ? 101 SER A HG   2  
ATOM 4852  N N    . GLN A 1 102 ? -12.249 -15.791 8.150   1.00 1.61  ? 102 GLN A N    2  
ATOM 4853  C CA   . GLN A 1 102 ? -12.053 -15.191 9.476   1.00 2.12  ? 102 GLN A CA   2  
ATOM 4854  C C    . GLN A 1 102 ? -12.883 -15.901 10.543  1.00 2.74  ? 102 GLN A C    2  
ATOM 4855  O O    . GLN A 1 102 ? -12.416 -16.851 11.174  1.00 3.39  ? 102 GLN A O    2  
ATOM 4856  C CB   . GLN A 1 102 ? -12.374 -13.693 9.453   1.00 2.47  ? 102 GLN A CB   2  
ATOM 4857  C CG   . GLN A 1 102 ? -11.318 -12.862 8.745   1.00 3.02  ? 102 GLN A CG   2  
ATOM 4858  C CD   . GLN A 1 102 ? -10.063 -12.682 9.579   1.00 3.87  ? 102 GLN A CD   2  
ATOM 4859  O OE1  . GLN A 1 102 ? -9.933  -11.709 10.320  1.00 4.45  ? 102 GLN A OE1  2  
ATOM 4860  N NE2  . GLN A 1 102 ? -9.137  -13.622 9.480   1.00 4.44  ? 102 GLN A NE2  2  
ATOM 4861  H H    . GLN A 1 102 ? -11.463 -16.142 7.673   1.00 1.67  ? 102 GLN A H    2  
ATOM 4862  H HA   . GLN A 1 102 ? -11.010 -15.313 9.730   1.00 2.52  ? 102 GLN A HA   2  
ATOM 4863  H HB2  . GLN A 1 102 ? -13.317 -13.544 8.948   1.00 2.90  ? 102 GLN A HB2  2  
ATOM 4864  H HB3  . GLN A 1 102 ? -12.459 -13.338 10.470  1.00 2.74  ? 102 GLN A HB3  2  
ATOM 4865  H HG2  . GLN A 1 102 ? -11.052 -13.353 7.822   1.00 3.38  ? 102 GLN A HG2  2  
ATOM 4866  H HG3  . GLN A 1 102 ? -11.731 -11.888 8.528   1.00 3.09  ? 102 GLN A HG3  2  
ATOM 4867  H HE21 . GLN A 1 102 ? -9.307  -14.379 8.879   1.00 4.34  ? 102 GLN A HE21 2  
ATOM 4868  H HE22 . GLN A 1 102 ? -8.321  -13.527 10.014  1.00 5.19  ? 102 GLN A HE22 2  
ATOM 4869  N N    . LYS A 1 103 ? -14.116 -15.452 10.718  1.00 3.15  ? 103 LYS A N    2  
ATOM 4870  C CA   . LYS A 1 103 ? -15.016 -16.032 11.697  1.00 4.06  ? 103 LYS A CA   2  
ATOM 4871  C C    . LYS A 1 103 ? -16.419 -16.109 11.117  1.00 4.57  ? 103 LYS A C    2  
ATOM 4872  O O    . LYS A 1 103 ? -16.903 -15.149 10.513  1.00 5.24  ? 103 LYS A O    2  
ATOM 4873  C CB   . LYS A 1 103 ? -15.016 -15.201 12.982  1.00 4.73  ? 103 LYS A CB   2  
ATOM 4874  C CG   . LYS A 1 103 ? -15.896 -15.777 14.078  1.00 5.30  ? 103 LYS A CG   2  
ATOM 4875  C CD   . LYS A 1 103 ? -15.838 -14.940 15.341  1.00 6.25  ? 103 LYS A CD   2  
ATOM 4876  C CE   . LYS A 1 103 ? -16.694 -15.539 16.445  1.00 6.82  ? 103 LYS A CE   2  
ATOM 4877  N NZ   . LYS A 1 103 ? -16.259 -16.915 16.804  1.00 7.43  ? 103 LYS A NZ   2  
ATOM 4878  H H    . LYS A 1 103 ? -14.439 -14.717 10.155  1.00 3.17  ? 103 LYS A H    2  
ATOM 4879  H HA   . LYS A 1 103 ? -14.670 -17.031 11.918  1.00 4.39  ? 103 LYS A HA   2  
ATOM 4880  H HB2  . LYS A 1 103 ? -14.006 -15.139 13.357  1.00 4.96  ? 103 LYS A HB2  2  
ATOM 4881  H HB3  . LYS A 1 103 ? -15.369 -14.206 12.753  1.00 5.08  ? 103 LYS A HB3  2  
ATOM 4882  H HG2  . LYS A 1 103 ? -16.917 -15.808 13.726  1.00 5.38  ? 103 LYS A HG2  2  
ATOM 4883  H HG3  . LYS A 1 103 ? -15.562 -16.779 14.303  1.00 5.39  ? 103 LYS A HG3  2  
ATOM 4884  H HD2  . LYS A 1 103 ? -14.814 -14.887 15.680  1.00 6.63  ? 103 LYS A HD2  2  
ATOM 4885  H HD3  . LYS A 1 103 ? -16.197 -13.946 15.119  1.00 6.48  ? 103 LYS A HD3  2  
ATOM 4886  H HE2  . LYS A 1 103 ? -16.621 -14.911 17.319  1.00 6.94  ? 103 LYS A HE2  2  
ATOM 4887  H HE3  . LYS A 1 103 ? -17.720 -15.571 16.110  1.00 7.02  ? 103 LYS A HE3  2  
ATOM 4888  H HZ1  . LYS A 1 103 ? -15.267 -16.910 17.111  1.00 7.62  ? 103 LYS A HZ1  2  
ATOM 4889  H HZ2  . LYS A 1 103 ? -16.353 -17.548 15.986  1.00 7.72  ? 103 LYS A HZ2  2  
ATOM 4890  H HZ3  . LYS A 1 103 ? -16.846 -17.285 17.579  1.00 7.66  ? 103 LYS A HZ3  2  
ATOM 4891  N N    . ARG A 1 104 ? -17.061 -17.255 11.286  1.00 4.68  ? 104 ARG A N    2  
ATOM 4892  C CA   . ARG A 1 104 ? -18.394 -17.466 10.749  1.00 5.53  ? 104 ARG A CA   2  
ATOM 4893  C C    . ARG A 1 104 ? -19.440 -17.348 11.847  1.00 5.66  ? 104 ARG A C    2  
ATOM 4894  O O    . ARG A 1 104 ? -19.831 -18.337 12.467  1.00 5.96  ? 104 ARG A O    2  
ATOM 4895  C CB   . ARG A 1 104 ? -18.479 -18.832 10.070  1.00 6.11  ? 104 ARG A CB   2  
ATOM 4896  C CG   . ARG A 1 104 ? -17.507 -18.981 8.914   1.00 6.81  ? 104 ARG A CG   2  
ATOM 4897  C CD   . ARG A 1 104 ? -17.580 -20.360 8.283   1.00 7.63  ? 104 ARG A CD   2  
ATOM 4898  N NE   . ARG A 1 104 ? -16.626 -20.496 7.183   1.00 8.13  ? 104 ARG A NE   2  
ATOM 4899  C CZ   . ARG A 1 104 ? -16.415 -21.626 6.511   1.00 8.95  ? 104 ARG A CZ   2  
ATOM 4900  N NH1  . ARG A 1 104 ? -17.086 -22.727 6.828   1.00 9.34  ? 104 ARG A NH1  2  
ATOM 4901  N NH2  . ARG A 1 104 ? -15.529 -21.657 5.523   1.00 9.59  ? 104 ARG A NH2  2  
ATOM 4902  H H    . ARG A 1 104 ? -16.628 -17.977 11.790  1.00 4.48  ? 104 ARG A H    2  
ATOM 4903  H HA   . ARG A 1 104 ? -18.577 -16.698 10.013  1.00 6.02  ? 104 ARG A HA   2  
ATOM 4904  H HB2  . ARG A 1 104 ? -18.263 -19.600 10.798  1.00 6.43  ? 104 ARG A HB2  2  
ATOM 4905  H HB3  . ARG A 1 104 ? -19.480 -18.975 9.692   1.00 6.10  ? 104 ARG A HB3  2  
ATOM 4906  H HG2  . ARG A 1 104 ? -17.743 -18.244 8.161   1.00 6.95  ? 104 ARG A HG2  2  
ATOM 4907  H HG3  . ARG A 1 104 ? -16.504 -18.816 9.279   1.00 6.93  ? 104 ARG A HG3  2  
ATOM 4908  H HD2  . ARG A 1 104 ? -17.356 -21.101 9.035   1.00 7.90  ? 104 ARG A HD2  2  
ATOM 4909  H HD3  . ARG A 1 104 ? -18.578 -20.520 7.904   1.00 7.87  ? 104 ARG A HD3  2  
ATOM 4910  H HE   . ARG A 1 104 ? -16.113 -19.689 6.934   1.00 8.02  ? 104 ARG A HE   2  
ATOM 4911  H HH11 . ARG A 1 104 ? -17.756 -22.716 7.574   1.00 9.05  ? 104 ARG A HH11 2  
ATOM 4912  H HH12 . ARG A 1 104 ? -16.928 -23.576 6.319   1.00 10.06 ? 104 ARG A HH12 2  
ATOM 4913  H HH21 . ARG A 1 104 ? -15.014 -20.834 5.278   1.00 9.50  ? 104 ARG A HH21 2  
ATOM 4914  H HH22 . ARG A 1 104 ? -15.371 -22.509 5.012   1.00 10.30 ? 104 ARG A HH22 2  
ATOM 4915  N N    . THR A 1 105 ? -19.869 -16.125 12.099  1.00 5.79  ? 105 THR A N    2  
ATOM 4916  C CA   . THR A 1 105 ? -20.898 -15.862 13.084  1.00 6.20  ? 105 THR A CA   2  
ATOM 4917  C C    . THR A 1 105 ? -21.797 -14.731 12.597  1.00 6.46  ? 105 THR A C    2  
ATOM 4918  O O    . THR A 1 105 ? -22.896 -15.025 12.082  1.00 6.80  ? 105 THR A O    2  
ATOM 4919  C CB   . THR A 1 105 ? -20.289 -15.497 14.455  1.00 6.59  ? 105 THR A CB   2  
ATOM 4920  O OG1  . THR A 1 105 ? -19.407 -16.542 14.892  1.00 6.66  ? 105 THR A OG1  2  
ATOM 4921  C CG2  . THR A 1 105 ? -21.379 -15.289 15.496  1.00 7.00  ? 105 THR A CG2  2  
ATOM 4922  O OXT  . THR A 1 105 ? -21.383 -13.560 12.684  1.00 6.62  ? 105 THR A OXT  2  
ATOM 4923  H H    . THR A 1 105 ? -19.482 -15.370 11.603  1.00 5.84  ? 105 THR A H    2  
ATOM 4924  H HA   . THR A 1 105 ? -21.491 -16.758 13.200  1.00 6.42  ? 105 THR A HA   2  
ATOM 4925  H HB   . THR A 1 105 ? -19.729 -14.578 14.353  1.00 6.92  ? 105 THR A HB   2  
ATOM 4926  H HG1  . THR A 1 105 ? -19.344 -17.218 14.205  1.00 6.49  ? 105 THR A HG1  2  
ATOM 4927  H HG21 . THR A 1 105 ? -20.929 -15.013 16.438  1.00 7.20  ? 105 THR A HG21 2  
ATOM 4928  H HG22 . THR A 1 105 ? -21.938 -16.205 15.619  1.00 7.26  ? 105 THR A HG22 2  
ATOM 4929  H HG23 . THR A 1 105 ? -22.042 -14.503 15.171  1.00 7.15  ? 105 THR A HG23 2  
ATOM 4930  N N    . MET B 1 1   ? 18.420  -13.161 14.439  1.00 7.64  ? 1   MET B N    2  
ATOM 4931  C CA   . MET B 1 1   ? 17.181  -13.725 13.852  1.00 7.05  ? 1   MET B CA   2  
ATOM 4932  C C    . MET B 1 1   ? 17.502  -14.954 13.011  1.00 6.85  ? 1   MET B C    2  
ATOM 4933  O O    . MET B 1 1   ? 18.666  -15.208 12.693  1.00 7.13  ? 1   MET B O    2  
ATOM 4934  C CB   . MET B 1 1   ? 16.444  -12.664 13.017  1.00 7.11  ? 1   MET B CB   2  
ATOM 4935  C CG   . MET B 1 1   ? 17.309  -11.937 11.993  1.00 7.39  ? 1   MET B CG   2  
ATOM 4936  S SD   . MET B 1 1   ? 17.787  -12.969 10.593  1.00 7.66  ? 1   MET B SD   2  
ATOM 4937  C CE   . MET B 1 1   ? 18.841  -11.840 9.688   1.00 7.91  ? 1   MET B CE   2  
ATOM 4938  H H1   . MET B 1 1   ? 19.090  -12.909 13.686  1.00 7.96  ? 1   MET B H1   2  
ATOM 4939  H H2   . MET B 1 1   ? 18.868  -13.859 15.065  1.00 7.75  ? 1   MET B H2   2  
ATOM 4940  H H3   . MET B 1 1   ? 18.200  -12.308 14.992  1.00 7.88  ? 1   MET B H3   2  
ATOM 4941  H HA   . MET B 1 1   ? 16.541  -14.032 14.668  1.00 7.07  ? 1   MET B HA   2  
ATOM 4942  H HB2  . MET B 1 1   ? 15.636  -13.144 12.487  1.00 7.26  ? 1   MET B HB2  2  
ATOM 4943  H HB3  . MET B 1 1   ? 16.027  -11.925 13.688  1.00 7.17  ? 1   MET B HB3  2  
ATOM 4944  H HG2  . MET B 1 1   ? 16.759  -11.088 11.617  1.00 7.57  ? 1   MET B HG2  2  
ATOM 4945  H HG3  . MET B 1 1   ? 18.204  -11.589 12.485  1.00 7.61  ? 1   MET B HG3  2  
ATOM 4946  H HE1  . MET B 1 1   ? 19.685  -11.565 10.301  1.00 8.15  ? 1   MET B HE1  2  
ATOM 4947  H HE2  . MET B 1 1   ? 18.280  -10.954 9.428   1.00 8.15  ? 1   MET B HE2  2  
ATOM 4948  H HE3  . MET B 1 1   ? 19.193  -12.320 8.786   1.00 7.91  ? 1   MET B HE3  2  
ATOM 4949  N N    . ALA B 1 2   ? 16.473  -15.719 12.665  1.00 6.68  ? 2   ALA B N    2  
ATOM 4950  C CA   . ALA B 1 2   ? 16.643  -16.933 11.878  1.00 6.74  ? 2   ALA B CA   2  
ATOM 4951  C C    . ALA B 1 2   ? 15.345  -17.297 11.173  1.00 6.15  ? 2   ALA B C    2  
ATOM 4952  O O    . ALA B 1 2   ? 15.234  -17.183 9.953   1.00 6.28  ? 2   ALA B O    2  
ATOM 4953  C CB   . ALA B 1 2   ? 17.103  -18.083 12.763  1.00 7.32  ? 2   ALA B CB   2  
ATOM 4954  H H    . ALA B 1 2   ? 15.567  -15.455 12.941  1.00 6.72  ? 2   ALA B H    2  
ATOM 4955  H HA   . ALA B 1 2   ? 17.407  -16.748 11.138  1.00 7.13  ? 2   ALA B HA   2  
ATOM 4956  H HB1  . ALA B 1 2   ? 17.293  -18.952 12.153  1.00 7.70  ? 2   ALA B HB1  2  
ATOM 4957  H HB2  . ALA B 1 2   ? 16.334  -18.311 13.486  1.00 7.47  ? 2   ALA B HB2  2  
ATOM 4958  H HB3  . ALA B 1 2   ? 18.008  -17.801 13.279  1.00 7.50  ? 2   ALA B HB3  2  
ATOM 4959  N N    . LYS B 1 3   ? 14.359  -17.719 11.952  1.00 5.79  ? 3   LYS B N    2  
ATOM 4960  C CA   . LYS B 1 3   ? 13.060  -18.084 11.411  1.00 5.53  ? 3   LYS B CA   2  
ATOM 4961  C C    . LYS B 1 3   ? 12.179  -16.849 11.299  1.00 5.00  ? 3   LYS B C    2  
ATOM 4962  O O    . LYS B 1 3   ? 11.355  -16.582 12.176  1.00 5.14  ? 3   LYS B O    2  
ATOM 4963  C CB   . LYS B 1 3   ? 12.382  -19.124 12.303  1.00 6.01  ? 3   LYS B CB   2  
ATOM 4964  C CG   . LYS B 1 3   ? 13.187  -20.396 12.497  1.00 6.28  ? 3   LYS B CG   2  
ATOM 4965  C CD   . LYS B 1 3   ? 12.453  -21.370 13.399  1.00 6.97  ? 3   LYS B CD   2  
ATOM 4966  C CE   . LYS B 1 3   ? 13.249  -22.642 13.615  1.00 7.46  ? 3   LYS B CE   2  
ATOM 4967  N NZ   . LYS B 1 3   ? 12.527  -23.599 14.490  1.00 7.93  ? 3   LYS B NZ   2  
ATOM 4968  H H    . LYS B 1 3   ? 14.506  -17.777 12.921  1.00 5.96  ? 3   LYS B H    2  
ATOM 4969  H HA   . LYS B 1 3   ? 13.211  -18.502 10.427  1.00 5.72  ? 3   LYS B HA   2  
ATOM 4970  H HB2  . LYS B 1 3   ? 12.206  -18.686 13.274  1.00 6.29  ? 3   LYS B HB2  2  
ATOM 4971  H HB3  . LYS B 1 3   ? 11.432  -19.390 11.863  1.00 6.28  ? 3   LYS B HB3  2  
ATOM 4972  H HG2  . LYS B 1 3   ? 13.349  -20.861 11.535  1.00 6.42  ? 3   LYS B HG2  2  
ATOM 4973  H HG3  . LYS B 1 3   ? 14.137  -20.147 12.945  1.00 6.22  ? 3   LYS B HG3  2  
ATOM 4974  H HD2  . LYS B 1 3   ? 12.280  -20.900 14.355  1.00 7.10  ? 3   LYS B HD2  2  
ATOM 4975  H HD3  . LYS B 1 3   ? 11.506  -21.622 12.943  1.00 7.33  ? 3   LYS B HD3  2  
ATOM 4976  H HE2  . LYS B 1 3   ? 13.429  -23.106 12.659  1.00 7.70  ? 3   LYS B HE2  2  
ATOM 4977  H HE3  . LYS B 1 3   ? 14.193  -22.388 14.074  1.00 7.56  ? 3   LYS B HE3  2  
ATOM 4978  H HZ1  . LYS B 1 3   ? 11.604  -23.841 14.075  1.00 7.98  ? 3   LYS B HZ1  2  
ATOM 4979  H HZ2  . LYS B 1 3   ? 12.374  -23.182 15.429  1.00 8.25  ? 3   LYS B HZ2  2  
ATOM 4980  H HZ3  . LYS B 1 3   ? 13.083  -24.471 14.601  1.00 8.16  ? 3   LYS B HZ3  2  
ATOM 4981  N N    . ILE B 1 4   ? 12.368  -16.094 10.227  1.00 4.75  ? 4   ILE B N    2  
ATOM 4982  C CA   . ILE B 1 4   ? 11.631  -14.858 10.025  1.00 4.41  ? 4   ILE B CA   2  
ATOM 4983  C C    . ILE B 1 4   ? 10.142  -15.137 9.872   1.00 3.66  ? 4   ILE B C    2  
ATOM 4984  O O    . ILE B 1 4   ? 9.716   -15.796 8.922   1.00 3.91  ? 4   ILE B O    2  
ATOM 4985  C CB   . ILE B 1 4   ? 12.136  -14.088 8.787   1.00 5.15  ? 4   ILE B CB   2  
ATOM 4986  C CG1  . ILE B 1 4   ? 13.647  -13.839 8.882   1.00 5.78  ? 4   ILE B CG1  2  
ATOM 4987  C CG2  . ILE B 1 4   ? 11.389  -12.768 8.642   1.00 5.59  ? 4   ILE B CG2  2  
ATOM 4988  C CD1  . ILE B 1 4   ? 14.060  -12.995 10.070  1.00 6.54  ? 4   ILE B CD1  2  
ATOM 4989  H H    . ILE B 1 4   ? 13.020  -16.379 9.552   1.00 5.02  ? 4   ILE B H    2  
ATOM 4990  H HA   . ILE B 1 4   ? 11.782  -14.237 10.895  1.00 4.58  ? 4   ILE B HA   2  
ATOM 4991  H HB   . ILE B 1 4   ? 11.932  -14.685 7.911   1.00 5.38  ? 4   ILE B HB   2  
ATOM 4992  H HG12 . ILE B 1 4   ? 14.155  -14.787 8.959   1.00 5.98  ? 4   ILE B HG12 2  
ATOM 4993  H HG13 . ILE B 1 4   ? 13.976  -13.333 7.986   1.00 5.88  ? 4   ILE B HG13 2  
ATOM 4994  H HG21 . ILE B 1 4   ? 10.331  -12.962 8.548   1.00 5.93  ? 4   ILE B HG21 2  
ATOM 4995  H HG22 . ILE B 1 4   ? 11.740  -12.251 7.761   1.00 6.00  ? 4   ILE B HG22 2  
ATOM 4996  H HG23 . ILE B 1 4   ? 11.567  -12.156 9.514   1.00 5.54  ? 4   ILE B HG23 2  
ATOM 4997  H HD11 . ILE B 1 4   ? 13.769  -13.492 10.983  1.00 6.97  ? 4   ILE B HD11 2  
ATOM 4998  H HD12 . ILE B 1 4   ? 13.573  -12.033 10.014  1.00 6.74  ? 4   ILE B HD12 2  
ATOM 4999  H HD13 . ILE B 1 4   ? 15.130  -12.859 10.059  1.00 6.73  ? 4   ILE B HD13 2  
ATOM 5000  N N    . SER B 1 5   ? 9.363   -14.670 10.834  1.00 3.24  ? 5   SER B N    2  
ATOM 5001  C CA   . SER B 1 5   ? 7.916   -14.808 10.783  1.00 2.93  ? 5   SER B CA   2  
ATOM 5002  C C    . SER B 1 5   ? 7.240   -13.608 11.439  1.00 2.01  ? 5   SER B C    2  
ATOM 5003  O O    . SER B 1 5   ? 6.017   -13.558 11.565  1.00 2.25  ? 5   SER B O    2  
ATOM 5004  C CB   . SER B 1 5   ? 7.485   -16.107 11.466  1.00 3.70  ? 5   SER B CB   2  
ATOM 5005  O OG   . SER B 1 5   ? 8.114   -17.225 10.858  1.00 4.46  ? 5   SER B OG   2  
ATOM 5006  H H    . SER B 1 5   ? 9.775   -14.234 11.610  1.00 3.53  ? 5   SER B H    2  
ATOM 5007  H HA   . SER B 1 5   ? 7.625   -14.844 9.744   1.00 3.38  ? 5   SER B HA   2  
ATOM 5008  H HB2  . SER B 1 5   ? 7.763   -16.075 12.508  1.00 3.90  ? 5   SER B HB2  2  
ATOM 5009  H HB3  . SER B 1 5   ? 6.415   -16.220 11.381  1.00 4.02  ? 5   SER B HB3  2  
ATOM 5010  H HG   . SER B 1 5   ? 8.664   -16.917 10.124  1.00 4.65  ? 5   SER B HG   2  
ATOM 5011  N N    . SER B 1 6   ? 8.044   -12.643 11.854  1.00 1.51  ? 6   SER B N    2  
ATOM 5012  C CA   . SER B 1 6   ? 7.531   -11.426 12.450  1.00 1.03  ? 6   SER B CA   2  
ATOM 5013  C C    . SER B 1 6   ? 7.491   -10.328 11.393  1.00 0.82  ? 6   SER B C    2  
ATOM 5014  O O    . SER B 1 6   ? 8.483   -10.093 10.699  1.00 0.86  ? 6   SER B O    2  
ATOM 5015  C CB   . SER B 1 6   ? 8.407   -11.005 13.636  1.00 1.67  ? 6   SER B CB   2  
ATOM 5016  O OG   . SER B 1 6   ? 7.817   -9.942  14.366  1.00 2.25  ? 6   SER B OG   2  
ATOM 5017  H H    . SER B 1 6   ? 9.013   -12.748 11.751  1.00 2.00  ? 6   SER B H    2  
ATOM 5018  H HA   . SER B 1 6   ? 6.528   -11.618 12.796  1.00 1.21  ? 6   SER B HA   2  
ATOM 5019  H HB2  . SER B 1 6   ? 8.540   -11.848 14.297  1.00 2.14  ? 6   SER B HB2  2  
ATOM 5020  H HB3  . SER B 1 6   ? 9.370   -10.681 13.269  1.00 2.15  ? 6   SER B HB3  2  
ATOM 5021  H HG   . SER B 1 6   ? 8.370   -9.156  14.284  1.00 2.50  ? 6   SER B HG   2  
ATOM 5022  N N    . PRO B 1 7   ? 6.343   -9.654  11.246  1.00 0.70  ? 7   PRO B N    2  
ATOM 5023  C CA   . PRO B 1 7   ? 6.154   -8.624  10.223  1.00 0.54  ? 7   PRO B CA   2  
ATOM 5024  C C    . PRO B 1 7   ? 6.776   -7.297  10.631  1.00 0.45  ? 7   PRO B C    2  
ATOM 5025  O O    . PRO B 1 7   ? 6.934   -7.006  11.818  1.00 0.57  ? 7   PRO B O    2  
ATOM 5026  C CB   . PRO B 1 7   ? 4.638   -8.495  10.170  1.00 0.62  ? 7   PRO B CB   2  
ATOM 5027  C CG   . PRO B 1 7   ? 4.240   -8.705  11.581  1.00 0.75  ? 7   PRO B CG   2  
ATOM 5028  C CD   . PRO B 1 7   ? 5.130   -9.817  12.074  1.00 0.82  ? 7   PRO B CD   2  
ATOM 5029  H HA   . PRO B 1 7   ? 6.535   -8.930  9.262   1.00 0.57  ? 7   PRO B HA   2  
ATOM 5030  H HB2  . PRO B 1 7   ? 4.364   -7.511  9.815   1.00 0.60  ? 7   PRO B HB2  2  
ATOM 5031  H HB3  . PRO B 1 7   ? 4.225   -9.253  9.523   1.00 0.68  ? 7   PRO B HB3  2  
ATOM 5032  H HG2  . PRO B 1 7   ? 4.419   -7.799  12.145  1.00 0.75  ? 7   PRO B HG2  2  
ATOM 5033  H HG3  . PRO B 1 7   ? 3.203   -8.994  11.638  1.00 0.87  ? 7   PRO B HG3  2  
ATOM 5034  H HD2  . PRO B 1 7   ? 5.355   -9.686  13.122  1.00 0.93  ? 7   PRO B HD2  2  
ATOM 5035  H HD3  . PRO B 1 7   ? 4.669   -10.778 11.900  1.00 0.91  ? 7   PRO B HD3  2  
ATOM 5036  N N    . THR B 1 8   ? 7.138   -6.507  9.648   1.00 0.34  ? 8   THR B N    2  
ATOM 5037  C CA   . THR B 1 8   ? 7.662   -5.180  9.892   1.00 0.27  ? 8   THR B CA   2  
ATOM 5038  C C    . THR B 1 8   ? 6.556   -4.151  9.738   1.00 0.28  ? 8   THR B C    2  
ATOM 5039  O O    . THR B 1 8   ? 5.392   -4.517  9.561   1.00 0.34  ? 8   THR B O    2  
ATOM 5040  C CB   . THR B 1 8   ? 8.782   -4.870  8.903   1.00 0.29  ? 8   THR B CB   2  
ATOM 5041  O OG1  . THR B 1 8   ? 8.228   -4.729  7.593   1.00 0.37  ? 8   THR B OG1  2  
ATOM 5042  C CG2  . THR B 1 8   ? 9.806   -5.986  8.925   1.00 0.33  ? 8   THR B CG2  2  
ATOM 5043  H H    . THR B 1 8   ? 7.071   -6.832  8.719   1.00 0.43  ? 8   THR B H    2  
ATOM 5044  H HA   . THR B 1 8   ? 8.059   -5.141  10.894  1.00 0.31  ? 8   THR B HA   2  
ATOM 5045  H HB   . THR B 1 8   ? 9.267   -3.950  9.187   1.00 0.33  ? 8   THR B HB   2  
ATOM 5046  H HG1  . THR B 1 8   ? 8.707   -5.306  6.977   1.00 0.32  ? 8   THR B HG1  2  
ATOM 5047  H HG21 . THR B 1 8   ? 10.582  -5.747  9.635   1.00 1.05  ? 8   THR B HG21 2  
ATOM 5048  H HG22 . THR B 1 8   ? 10.230  -6.107  7.942   1.00 1.08  ? 8   THR B HG22 2  
ATOM 5049  H HG23 . THR B 1 8   ? 9.321   -6.905  9.221   1.00 1.05  ? 8   THR B HG23 2  
ATOM 5050  N N    . GLU B 1 9   ? 6.918   -2.876  9.786   1.00 0.28  ? 9   GLU B N    2  
ATOM 5051  C CA   . GLU B 1 9   ? 5.949   -1.798  9.638   1.00 0.33  ? 9   GLU B CA   2  
ATOM 5052  C C    . GLU B 1 9   ? 5.166   -1.958  8.338   1.00 0.36  ? 9   GLU B C    2  
ATOM 5053  O O    . GLU B 1 9   ? 3.944   -1.949  8.346   1.00 0.52  ? 9   GLU B O    2  
ATOM 5054  C CB   . GLU B 1 9   ? 6.651   -0.438  9.658   1.00 0.40  ? 9   GLU B CB   2  
ATOM 5055  C CG   . GLU B 1 9   ? 5.694   0.737   9.778   1.00 0.56  ? 9   GLU B CG   2  
ATOM 5056  C CD   . GLU B 1 9   ? 5.120   0.867   11.171  1.00 1.73  ? 9   GLU B CD   2  
ATOM 5057  O OE1  . GLU B 1 9   ? 5.884   1.179   12.109  1.00 2.48  ? 9   GLU B OE1  2  
ATOM 5058  O OE2  . GLU B 1 9   ? 3.907   0.658   11.338  1.00 2.47  ? 9   GLU B OE2  2  
ATOM 5059  H H    . GLU B 1 9   ? 7.867   -2.656  9.927   1.00 0.29  ? 9   GLU B H    2  
ATOM 5060  H HA   . GLU B 1 9   ? 5.256   -1.850  10.467  1.00 0.37  ? 9   GLU B HA   2  
ATOM 5061  H HB2  . GLU B 1 9   ? 7.330   -0.408  10.498  1.00 0.44  ? 9   GLU B HB2  2  
ATOM 5062  H HB3  . GLU B 1 9   ? 7.219   -0.324  8.746   1.00 0.37  ? 9   GLU B HB3  2  
ATOM 5063  H HG2  . GLU B 1 9   ? 6.212   1.654   9.528   1.00 0.94  ? 9   GLU B HG2  2  
ATOM 5064  H HG3  . GLU B 1 9   ? 4.878   0.587   9.083   1.00 0.74  ? 9   GLU B HG3  2  
ATOM 5065  N N    . THR B 1 10  ? 5.875   -2.155  7.233   1.00 0.26  ? 10  THR B N    2  
ATOM 5066  C CA   . THR B 1 10  ? 5.244   -2.283  5.926   1.00 0.27  ? 10  THR B CA   2  
ATOM 5067  C C    . THR B 1 10  ? 4.432   -3.561  5.840   1.00 0.27  ? 10  THR B C    2  
ATOM 5068  O O    . THR B 1 10  ? 3.320   -3.552  5.331   1.00 0.31  ? 10  THR B O    2  
ATOM 5069  C CB   . THR B 1 10  ? 6.274   -2.227  4.763   1.00 0.27  ? 10  THR B CB   2  
ATOM 5070  O OG1  . THR B 1 10  ? 5.838   -3.039  3.671   1.00 0.40  ? 10  THR B OG1  2  
ATOM 5071  C CG2  . THR B 1 10  ? 7.657   -2.675  5.209   1.00 0.26  ? 10  THR B CG2  2  
ATOM 5072  H H    . THR B 1 10  ? 6.839   -2.247  7.304   1.00 0.22  ? 10  THR B H    2  
ATOM 5073  H HA   . THR B 1 10  ? 4.565   -1.455  5.807   1.00 0.30  ? 10  THR B HA   2  
ATOM 5074  H HB   . THR B 1 10  ? 6.339   -1.203  4.419   1.00 0.33  ? 10  THR B HB   2  
ATOM 5075  H HG1  . THR B 1 10  ? 6.569   -3.580  3.364   1.00 1.00  ? 10  THR B HG1  2  
ATOM 5076  H HG21 . THR B 1 10  ? 7.578   -3.615  5.737   1.00 1.12  ? 10  THR B HG21 2  
ATOM 5077  H HG22 . THR B 1 10  ? 8.088   -1.928  5.859   1.00 0.94  ? 10  THR B HG22 2  
ATOM 5078  H HG23 . THR B 1 10  ? 8.290   -2.803  4.343   1.00 0.99  ? 10  THR B HG23 2  
ATOM 5079  N N    . GLU B 1 11  ? 4.961   -4.642  6.384   1.00 0.24  ? 11  GLU B N    2  
ATOM 5080  C CA   . GLU B 1 11  ? 4.304   -5.933  6.271   1.00 0.27  ? 11  GLU B CA   2  
ATOM 5081  C C    . GLU B 1 11  ? 3.008   -5.959  7.051   1.00 0.30  ? 11  GLU B C    2  
ATOM 5082  O O    . GLU B 1 11  ? 1.987   -6.432  6.558   1.00 0.32  ? 11  GLU B O    2  
ATOM 5083  C CB   . GLU B 1 11  ? 5.230   -7.033  6.746   1.00 0.29  ? 11  GLU B CB   2  
ATOM 5084  C CG   . GLU B 1 11  ? 6.579   -6.950  6.084   1.00 0.41  ? 11  GLU B CG   2  
ATOM 5085  C CD   . GLU B 1 11  ? 7.441   -8.164  6.341   1.00 1.11  ? 11  GLU B CD   2  
ATOM 5086  O OE1  . GLU B 1 11  ? 7.786   -8.406  7.514   1.00 1.71  ? 11  GLU B OE1  2  
ATOM 5087  O OE2  . GLU B 1 11  ? 7.775   -8.875  5.373   1.00 1.85  ? 11  GLU B OE2  2  
ATOM 5088  H H    . GLU B 1 11  ? 5.815   -4.572  6.866   1.00 0.23  ? 11  GLU B H    2  
ATOM 5089  H HA   . GLU B 1 11  ? 4.083   -6.091  5.232   1.00 0.29  ? 11  GLU B HA   2  
ATOM 5090  H HB2  . GLU B 1 11  ? 5.359   -6.947  7.814   1.00 0.40  ? 11  GLU B HB2  2  
ATOM 5091  H HB3  . GLU B 1 11  ? 4.792   -7.991  6.513   1.00 0.42  ? 11  GLU B HB3  2  
ATOM 5092  H HG2  . GLU B 1 11  ? 6.422   -6.841  5.026   1.00 0.40  ? 11  GLU B HG2  2  
ATOM 5093  H HG3  . GLU B 1 11  ? 7.092   -6.077  6.459   1.00 0.71  ? 11  GLU B HG3  2  
ATOM 5094  N N    . ARG B 1 12  ? 3.041   -5.429  8.260   1.00 0.35  ? 12  ARG B N    2  
ATOM 5095  C CA   . ARG B 1 12  ? 1.842   -5.364  9.076   1.00 0.42  ? 12  ARG B CA   2  
ATOM 5096  C C    . ARG B 1 12  ? 0.861   -4.386  8.456   1.00 0.43  ? 12  ARG B C    2  
ATOM 5097  O O    . ARG B 1 12  ? -0.349  -4.578  8.513   1.00 0.47  ? 12  ARG B O    2  
ATOM 5098  C CB   . ARG B 1 12  ? 2.169   -4.991  10.535  1.00 0.48  ? 12  ARG B CB   2  
ATOM 5099  C CG   . ARG B 1 12  ? 2.794   -3.613  10.750  1.00 0.49  ? 12  ARG B CG   2  
ATOM 5100  C CD   . ARG B 1 12  ? 1.776   -2.491  10.621  1.00 0.56  ? 12  ARG B CD   2  
ATOM 5101  N NE   . ARG B 1 12  ? 2.140   -1.332  11.432  1.00 1.08  ? 12  ARG B NE   2  
ATOM 5102  C CZ   . ARG B 1 12  ? 1.647   -1.077  12.644  1.00 1.34  ? 12  ARG B CZ   2  
ATOM 5103  N NH1  . ARG B 1 12  ? 0.768   -1.900  13.204  1.00 1.86  ? 12  ARG B NH1  2  
ATOM 5104  N NH2  . ARG B 1 12  ? 2.050   0.000   13.298  1.00 1.95  ? 12  ARG B NH2  2  
ATOM 5105  H H    . ARG B 1 12  ? 3.889   -5.071  8.604   1.00 0.34  ? 12  ARG B H    2  
ATOM 5106  H HA   . ARG B 1 12  ? 1.390   -6.344  9.063   1.00 0.44  ? 12  ARG B HA   2  
ATOM 5107  H HB2  . ARG B 1 12  ? 1.257   -5.031  11.107  1.00 0.55  ? 12  ARG B HB2  2  
ATOM 5108  H HB3  . ARG B 1 12  ? 2.853   -5.731  10.927  1.00 0.48  ? 12  ARG B HB3  2  
ATOM 5109  H HG2  . ARG B 1 12  ? 3.228   -3.576  11.736  1.00 0.52  ? 12  ARG B HG2  2  
ATOM 5110  H HG3  . ARG B 1 12  ? 3.570   -3.466  10.009  1.00 0.45  ? 12  ARG B HG3  2  
ATOM 5111  H HD2  . ARG B 1 12  ? 1.732   -2.190  9.570   1.00 0.91  ? 12  ARG B HD2  2  
ATOM 5112  H HD3  . ARG B 1 12  ? 0.811   -2.858  10.927  1.00 0.83  ? 12  ARG B HD3  2  
ATOM 5113  H HE   . ARG B 1 12  ? 2.801   -0.698  11.052  1.00 1.80  ? 12  ARG B HE   2  
ATOM 5114  H HH11 . ARG B 1 12  ? 0.467   -2.724  12.718  1.00 2.09  ? 12  ARG B HH11 2  
ATOM 5115  H HH12 . ARG B 1 12  ? 0.406   -1.704  14.117  1.00 2.42  ? 12  ARG B HH12 2  
ATOM 5116  H HH21 . ARG B 1 12  ? 2.723   0.617   12.874  1.00 2.48  ? 12  ARG B HH21 2  
ATOM 5117  H HH22 . ARG B 1 12  ? 1.697   0.201   14.213  1.00 2.20  ? 12  ARG B HH22 2  
ATOM 5118  N N    . CYS B 1 13  ? 1.409   -3.349  7.840   1.00 0.42  ? 13  CYS B N    2  
ATOM 5119  C CA   . CYS B 1 13  ? 0.615   -2.324  7.188   1.00 0.44  ? 13  CYS B CA   2  
ATOM 5120  C C    . CYS B 1 13  ? -0.056  -2.907  5.964   1.00 0.30  ? 13  CYS B C    2  
ATOM 5121  O O    . CYS B 1 13  ? -1.214  -2.612  5.665   1.00 0.29  ? 13  CYS B O    2  
ATOM 5122  C CB   . CYS B 1 13  ? 1.521   -1.150  6.824   1.00 0.57  ? 13  CYS B CB   2  
ATOM 5123  S SG   . CYS B 1 13  ? 1.851   -0.040  8.207   1.00 2.16  ? 13  CYS B SG   2  
ATOM 5124  H H    . CYS B 1 13  ? 2.389   -3.274  7.817   1.00 0.41  ? 13  CYS B H    2  
ATOM 5125  H HA   . CYS B 1 13  ? -0.142  -1.991  7.880   1.00 0.54  ? 13  CYS B HA   2  
ATOM 5126  H HB2  . CYS B 1 13  ? 2.472   -1.539  6.485   1.00 1.00  ? 13  CYS B HB2  2  
ATOM 5127  H HB3  . CYS B 1 13  ? 1.082   -0.578  6.041   1.00 0.84  ? 13  CYS B HB3  2  
ATOM 5128  H HG   . CYS B 1 13  ? 2.965   -0.454  8.797   1.00 2.85  ? 13  CYS B HG   2  
ATOM 5129  N N    . ILE B 1 14  ? 0.682   -3.762  5.287   1.00 0.26  ? 14  ILE B N    2  
ATOM 5130  C CA   . ILE B 1 14  ? 0.170   -4.530  4.179   1.00 0.24  ? 14  ILE B CA   2  
ATOM 5131  C C    . ILE B 1 14  ? -1.033  -5.369  4.607   1.00 0.21  ? 14  ILE B C    2  
ATOM 5132  O O    . ILE B 1 14  ? -2.056  -5.413  3.920   1.00 0.23  ? 14  ILE B O    2  
ATOM 5133  C CB   . ILE B 1 14  ? 1.282   -5.443  3.627   1.00 0.24  ? 14  ILE B CB   2  
ATOM 5134  C CG1  . ILE B 1 14  ? 2.204   -4.666  2.687   1.00 0.25  ? 14  ILE B CG1  2  
ATOM 5135  C CG2  . ILE B 1 14  ? 0.708   -6.667  2.934   1.00 0.27  ? 14  ILE B CG2  2  
ATOM 5136  C CD1  . ILE B 1 14  ? 3.421   -5.457  2.287   1.00 0.27  ? 14  ILE B CD1  2  
ATOM 5137  H H    . ILE B 1 14  ? 1.627   -3.870  5.535   1.00 0.27  ? 14  ILE B H    2  
ATOM 5138  H HA   . ILE B 1 14  ? -0.129  -3.840  3.412   1.00 0.27  ? 14  ILE B HA   2  
ATOM 5139  H HB   . ILE B 1 14  ? 1.867   -5.786  4.469   1.00 0.25  ? 14  ILE B HB   2  
ATOM 5140  H HG12 . ILE B 1 14  ? 1.666   -4.407  1.788   1.00 0.26  ? 14  ILE B HG12 2  
ATOM 5141  H HG13 . ILE B 1 14  ? 2.540   -3.765  3.179   1.00 0.27  ? 14  ILE B HG13 2  
ATOM 5142  H HG21 . ILE B 1 14  ? 0.199   -7.284  3.660   1.00 1.01  ? 14  ILE B HG21 2  
ATOM 5143  H HG22 . ILE B 1 14  ? 1.506   -7.231  2.476   1.00 1.03  ? 14  ILE B HG22 2  
ATOM 5144  H HG23 . ILE B 1 14  ? 0.007   -6.350  2.177   1.00 1.01  ? 14  ILE B HG23 2  
ATOM 5145  H HD11 . ILE B 1 14  ? 3.997   -5.696  3.172   1.00 1.06  ? 14  ILE B HD11 2  
ATOM 5146  H HD12 . ILE B 1 14  ? 4.025   -4.874  1.608   1.00 0.96  ? 14  ILE B HD12 2  
ATOM 5147  H HD13 . ILE B 1 14  ? 3.107   -6.371  1.803   1.00 1.12  ? 14  ILE B HD13 2  
ATOM 5148  N N    . GLU B 1 15  ? -0.914  -6.002  5.767   1.00 0.24  ? 15  GLU B N    2  
ATOM 5149  C CA   . GLU B 1 15  ? -1.953  -6.879  6.271   1.00 0.28  ? 15  GLU B CA   2  
ATOM 5150  C C    . GLU B 1 15  ? -3.112  -6.060  6.762   1.00 0.30  ? 15  GLU B C    2  
ATOM 5151  O O    . GLU B 1 15  ? -4.243  -6.528  6.828   1.00 0.34  ? 15  GLU B O    2  
ATOM 5152  C CB   . GLU B 1 15  ? -1.436  -7.716  7.420   1.00 0.32  ? 15  GLU B CB   2  
ATOM 5153  C CG   . GLU B 1 15  ? -0.194  -8.520  7.076   1.00 0.32  ? 15  GLU B CG   2  
ATOM 5154  C CD   . GLU B 1 15  ? 0.253   -9.410  8.214   1.00 0.38  ? 15  GLU B CD   2  
ATOM 5155  O OE1  . GLU B 1 15  ? 0.313   -8.935  9.366   1.00 1.25  ? 15  GLU B OE1  2  
ATOM 5156  O OE2  . GLU B 1 15  ? 0.547   -10.596 7.964   1.00 1.06  ? 15  GLU B OE2  2  
ATOM 5157  H H    . GLU B 1 15  ? -0.116  -5.856  6.311   1.00 0.26  ? 15  GLU B H    2  
ATOM 5158  H HA   . GLU B 1 15  ? -2.279  -7.522  5.470   1.00 0.29  ? 15  GLU B HA   2  
ATOM 5159  H HB2  . GLU B 1 15  ? -1.206  -7.054  8.247   1.00 0.32  ? 15  GLU B HB2  2  
ATOM 5160  H HB3  . GLU B 1 15  ? -2.217  -8.397  7.725   1.00 0.37  ? 15  GLU B HB3  2  
ATOM 5161  H HG2  . GLU B 1 15  ? -0.411  -9.141  6.219   1.00 0.33  ? 15  GLU B HG2  2  
ATOM 5162  H HG3  . GLU B 1 15  ? 0.611   -7.834  6.827   1.00 0.31  ? 15  GLU B HG3  2  
ATOM 5163  N N    . SER B 1 16  ? -2.813  -4.835  7.121   1.00 0.31  ? 16  SER B N    2  
ATOM 5164  C CA   . SER B 1 16  ? -3.822  -3.941  7.602   1.00 0.37  ? 16  SER B CA   2  
ATOM 5165  C C    . SER B 1 16  ? -4.670  -3.450  6.439   1.00 0.28  ? 16  SER B C    2  
ATOM 5166  O O    . SER B 1 16  ? -5.876  -3.288  6.574   1.00 0.28  ? 16  SER B O    2  
ATOM 5167  C CB   . SER B 1 16  ? -3.185  -2.789  8.358   1.00 0.54  ? 16  SER B CB   2  
ATOM 5168  O OG   . SER B 1 16  ? -2.386  -3.269  9.426   1.00 0.97  ? 16  SER B OG   2  
ATOM 5169  H H    . SER B 1 16  ? -1.884  -4.528  7.063   1.00 0.31  ? 16  SER B H    2  
ATOM 5170  H HA   . SER B 1 16  ? -4.446  -4.500  8.273   1.00 0.45  ? 16  SER B HA   2  
ATOM 5171  H HB2  . SER B 1 16  ? -2.563  -2.216  7.687   1.00 0.76  ? 16  SER B HB2  2  
ATOM 5172  H HB3  . SER B 1 16  ? -3.957  -2.160  8.762   1.00 0.80  ? 16  SER B HB3  2  
ATOM 5173  H HG   . SER B 1 16  ? -1.649  -3.786  9.068   1.00 1.17  ? 16  SER B HG   2  
ATOM 5174  N N    . LEU B 1 17  ? -4.037  -3.242  5.288   1.00 0.27  ? 17  LEU B N    2  
ATOM 5175  C CA   . LEU B 1 17  ? -4.773  -2.965  4.061   1.00 0.28  ? 17  LEU B CA   2  
ATOM 5176  C C    . LEU B 1 17  ? -5.623  -4.174  3.723   1.00 0.27  ? 17  LEU B C    2  
ATOM 5177  O O    . LEU B 1 17  ? -6.760  -4.042  3.294   1.00 0.32  ? 17  LEU B O    2  
ATOM 5178  C CB   . LEU B 1 17  ? -3.825  -2.664  2.906   1.00 0.29  ? 17  LEU B CB   2  
ATOM 5179  C CG   . LEU B 1 17  ? -2.781  -1.594  3.205   1.00 0.33  ? 17  LEU B CG   2  
ATOM 5180  C CD1  . LEU B 1 17  ? -1.776  -1.483  2.071   1.00 0.33  ? 17  LEU B CD1  2  
ATOM 5181  C CD2  . LEU B 1 17  ? -3.445  -0.247  3.463   1.00 0.46  ? 17  LEU B CD2  2  
ATOM 5182  H H    . LEU B 1 17  ? -3.053  -3.267  5.267   1.00 0.27  ? 17  LEU B H    2  
ATOM 5183  H HA   . LEU B 1 17  ? -5.413  -2.114  4.235   1.00 0.31  ? 17  LEU B HA   2  
ATOM 5184  H HB2  . LEU B 1 17  ? -3.314  -3.580  2.644   1.00 0.26  ? 17  LEU B HB2  2  
ATOM 5185  H HB3  . LEU B 1 17  ? -4.412  -2.337  2.058   1.00 0.35  ? 17  LEU B HB3  2  
ATOM 5186  H HG   . LEU B 1 17  ? -2.250  -1.881  4.092   1.00 0.33  ? 17  LEU B HG   2  
ATOM 5187  H HD11 . LEU B 1 17  ? -1.057  -0.711  2.303   1.00 1.09  ? 17  LEU B HD11 2  
ATOM 5188  H HD12 . LEU B 1 17  ? -2.292  -1.231  1.157   1.00 1.06  ? 17  LEU B HD12 2  
ATOM 5189  H HD13 . LEU B 1 17  ? -1.267  -2.426  1.949   1.00 1.06  ? 17  LEU B HD13 2  
ATOM 5190  H HD21 . LEU B 1 17  ? -4.144  -0.339  4.281   1.00 1.07  ? 17  LEU B HD21 2  
ATOM 5191  H HD22 . LEU B 1 17  ? -3.969  0.073   2.574   1.00 1.10  ? 17  LEU B HD22 2  
ATOM 5192  H HD23 . LEU B 1 17  ? -2.690  0.483   3.716   1.00 1.21  ? 17  LEU B HD23 2  
ATOM 5193  N N    . ILE B 1 18  ? -5.051  -5.355  3.938   1.00 0.27  ? 18  ILE B N    2  
ATOM 5194  C CA   . ILE B 1 18  ? -5.780  -6.607  3.801   1.00 0.30  ? 18  ILE B CA   2  
ATOM 5195  C C    . ILE B 1 18  ? -7.009  -6.610  4.705   1.00 0.28  ? 18  ILE B C    2  
ATOM 5196  O O    . ILE B 1 18  ? -8.096  -7.000  4.287   1.00 0.30  ? 18  ILE B O    2  
ATOM 5197  C CB   . ILE B 1 18  ? -4.876  -7.823  4.136   1.00 0.36  ? 18  ILE B CB   2  
ATOM 5198  C CG1  . ILE B 1 18  ? -3.814  -8.002  3.052   1.00 0.62  ? 18  ILE B CG1  2  
ATOM 5199  C CG2  . ILE B 1 18  ? -5.700  -9.097  4.302   1.00 0.47  ? 18  ILE B CG2  2  
ATOM 5200  C CD1  . ILE B 1 18  ? -2.881  -9.164  3.304   1.00 1.37  ? 18  ILE B CD1  2  
ATOM 5201  H H    . ILE B 1 18  ? -4.102  -5.382  4.190   1.00 0.29  ? 18  ILE B H    2  
ATOM 5202  H HA   . ILE B 1 18  ? -6.102  -6.695  2.773   1.00 0.33  ? 18  ILE B HA   2  
ATOM 5203  H HB   . ILE B 1 18  ? -4.379  -7.627  5.078   1.00 0.37  ? 18  ILE B HB   2  
ATOM 5204  H HG12 . ILE B 1 18  ? -4.302  -8.169  2.105   1.00 0.97  ? 18  ILE B HG12 2  
ATOM 5205  H HG13 . ILE B 1 18  ? -3.217  -7.104  2.990   1.00 1.37  ? 18  ILE B HG13 2  
ATOM 5206  H HG21 . ILE B 1 18  ? -6.265  -9.280  3.402   1.00 1.13  ? 18  ILE B HG21 2  
ATOM 5207  H HG22 . ILE B 1 18  ? -6.380  -8.979  5.135   1.00 1.10  ? 18  ILE B HG22 2  
ATOM 5208  H HG23 . ILE B 1 18  ? -5.038  -9.933  4.490   1.00 1.11  ? 18  ILE B HG23 2  
ATOM 5209  H HD11 . ILE B 1 18  ? -2.165  -9.229  2.500   1.00 1.87  ? 18  ILE B HD11 2  
ATOM 5210  H HD12 . ILE B 1 18  ? -3.451  -10.079 3.353   1.00 1.89  ? 18  ILE B HD12 2  
ATOM 5211  H HD13 . ILE B 1 18  ? -2.360  -9.015  4.237   1.00 1.99  ? 18  ILE B HD13 2  
ATOM 5212  N N    . ALA B 1 19  ? -6.825  -6.146  5.933   1.00 0.25  ? 19  ALA B N    2  
ATOM 5213  C CA   . ALA B 1 19  ? -7.896  -6.109  6.919   1.00 0.25  ? 19  ALA B CA   2  
ATOM 5214  C C    . ALA B 1 19  ? -8.979  -5.107  6.537   1.00 0.23  ? 19  ALA B C    2  
ATOM 5215  O O    . ALA B 1 19  ? -10.159 -5.454  6.494   1.00 0.27  ? 19  ALA B O    2  
ATOM 5216  C CB   . ALA B 1 19  ? -7.330  -5.778  8.291   1.00 0.28  ? 19  ALA B CB   2  
ATOM 5217  H H    . ALA B 1 19  ? -5.933  -5.827  6.189   1.00 0.25  ? 19  ALA B H    2  
ATOM 5218  H HA   . ALA B 1 19  ? -8.336  -7.094  6.967   1.00 0.29  ? 19  ALA B HA   2  
ATOM 5219  H HB1  . ALA B 1 19  ? -6.945  -4.768  8.287   1.00 1.03  ? 19  ALA B HB1  2  
ATOM 5220  H HB2  . ALA B 1 19  ? -6.530  -6.465  8.526   1.00 1.06  ? 19  ALA B HB2  2  
ATOM 5221  H HB3  . ALA B 1 19  ? -8.109  -5.864  9.033   1.00 0.97  ? 19  ALA B HB3  2  
ATOM 5222  N N    . VAL B 1 20  ? -8.580  -3.868  6.255   1.00 0.20  ? 20  VAL B N    2  
ATOM 5223  C CA   . VAL B 1 20  ? -9.535  -2.821  5.908   1.00 0.22  ? 20  VAL B CA   2  
ATOM 5224  C C    . VAL B 1 20  ? -10.242 -3.175  4.614   1.00 0.23  ? 20  VAL B C    2  
ATOM 5225  O O    . VAL B 1 20  ? -11.450 -2.964  4.468   1.00 0.27  ? 20  VAL B O    2  
ATOM 5226  C CB   . VAL B 1 20  ? -8.864  -1.430  5.781   1.00 0.27  ? 20  VAL B CB   2  
ATOM 5227  C CG1  . VAL B 1 20  ? -7.936  -1.204  6.940   1.00 0.87  ? 20  VAL B CG1  2  
ATOM 5228  C CG2  . VAL B 1 20  ? -8.104  -1.267  4.475   1.00 0.87  ? 20  VAL B CG2  2  
ATOM 5229  H H    . VAL B 1 20  ? -7.620  -3.652  6.283   1.00 0.21  ? 20  VAL B H    2  
ATOM 5230  H HA   . VAL B 1 20  ? -10.268 -2.773  6.700   1.00 0.24  ? 20  VAL B HA   2  
ATOM 5231  H HB   . VAL B 1 20  ? -9.635  -0.677  5.824   1.00 0.52  ? 20  VAL B HB   2  
ATOM 5232  H HG11 . VAL B 1 20  ? -7.220  -2.012  6.970   1.00 1.36  ? 20  VAL B HG11 2  
ATOM 5233  H HG12 . VAL B 1 20  ? -8.502  -1.183  7.858   1.00 1.57  ? 20  VAL B HG12 2  
ATOM 5234  H HG13 . VAL B 1 20  ? -7.417  -0.268  6.805   1.00 1.42  ? 20  VAL B HG13 2  
ATOM 5235  H HG21 . VAL B 1 20  ? -7.378  -2.060  4.381   1.00 1.45  ? 20  VAL B HG21 2  
ATOM 5236  H HG22 . VAL B 1 20  ? -7.597  -0.313  4.470   1.00 1.40  ? 20  VAL B HG22 2  
ATOM 5237  H HG23 . VAL B 1 20  ? -8.796  -1.312  3.648   1.00 1.53  ? 20  VAL B HG23 2  
ATOM 5238  N N    . PHE B 1 21  ? -9.481  -3.731  3.687   1.00 0.22  ? 21  PHE B N    2  
ATOM 5239  C CA   . PHE B 1 21  ? -10.049 -4.190  2.432   1.00 0.25  ? 21  PHE B CA   2  
ATOM 5240  C C    . PHE B 1 21  ? -11.075 -5.288  2.684   1.00 0.29  ? 21  PHE B C    2  
ATOM 5241  O O    . PHE B 1 21  ? -12.195 -5.209  2.211   1.00 0.35  ? 21  PHE B O    2  
ATOM 5242  C CB   . PHE B 1 21  ? -8.959  -4.704  1.489   1.00 0.26  ? 21  PHE B CB   2  
ATOM 5243  C CG   . PHE B 1 21  ? -9.498  -5.209  0.184   1.00 0.91  ? 21  PHE B CG   2  
ATOM 5244  C CD1  . PHE B 1 21  ? -9.884  -4.327  -0.806  1.00 1.85  ? 21  PHE B CD1  2  
ATOM 5245  C CD2  . PHE B 1 21  ? -9.633  -6.567  -0.043  1.00 1.59  ? 21  PHE B CD2  2  
ATOM 5246  C CE1  . PHE B 1 21  ? -10.394 -4.788  -2.001  1.00 2.48  ? 21  PHE B CE1  2  
ATOM 5247  C CE2  . PHE B 1 21  ? -10.145 -7.034  -1.236  1.00 2.17  ? 21  PHE B CE2  2  
ATOM 5248  C CZ   . PHE B 1 21  ? -10.525 -6.143  -2.216  1.00 2.40  ? 21  PHE B CZ   2  
ATOM 5249  H H    . PHE B 1 21  ? -8.498  -3.807  3.848   1.00 0.22  ? 21  PHE B H    2  
ATOM 5250  H HA   . PHE B 1 21  ? -10.546 -3.351  1.970   1.00 0.27  ? 21  PHE B HA   2  
ATOM 5251  H HB2  . PHE B 1 21  ? -8.265  -3.901  1.277   1.00 0.64  ? 21  PHE B HB2  2  
ATOM 5252  H HB3  . PHE B 1 21  ? -8.432  -5.515  1.969   1.00 0.62  ? 21  PHE B HB3  2  
ATOM 5253  H HD1  . PHE B 1 21  ? -9.778  -3.265  -0.640  1.00 2.42  ? 21  PHE B HD1  2  
ATOM 5254  H HD2  . PHE B 1 21  ? -9.335  -7.266  0.724   1.00 2.15  ? 21  PHE B HD2  2  
ATOM 5255  H HE1  . PHE B 1 21  ? -10.691 -4.087  -2.767  1.00 3.33  ? 21  PHE B HE1  2  
ATOM 5256  H HE2  . PHE B 1 21  ? -10.245 -8.095  -1.403  1.00 2.85  ? 21  PHE B HE2  2  
ATOM 5257  H HZ   . PHE B 1 21  ? -10.926 -6.506  -3.149  1.00 2.98  ? 21  PHE B HZ   2  
ATOM 5258  N N    . GLN B 1 22  ? -10.692 -6.286  3.467   1.00 0.30  ? 22  GLN B N    2  
ATOM 5259  C CA   . GLN B 1 22  ? -11.520 -7.465  3.680   1.00 0.37  ? 22  GLN B CA   2  
ATOM 5260  C C    . GLN B 1 22  ? -12.780 -7.115  4.456   1.00 0.36  ? 22  GLN B C    2  
ATOM 5261  O O    . GLN B 1 22  ? -13.852 -7.635  4.169   1.00 0.44  ? 22  GLN B O    2  
ATOM 5262  C CB   . GLN B 1 22  ? -10.707 -8.523  4.432   1.00 0.47  ? 22  GLN B CB   2  
ATOM 5263  C CG   . GLN B 1 22  ? -11.143 -9.962  4.196   1.00 1.11  ? 22  GLN B CG   2  
ATOM 5264  C CD   . GLN B 1 22  ? -12.413 -10.354 4.931   1.00 1.98  ? 22  GLN B CD   2  
ATOM 5265  O OE1  . GLN B 1 22  ? -13.513 -10.301 4.383   1.00 2.68  ? 22  GLN B OE1  2  
ATOM 5266  N NE2  . GLN B 1 22  ? -12.272 -10.737 6.189   1.00 2.65  ? 22  GLN B NE2  2  
ATOM 5267  H H    . GLN B 1 22  ? -9.826  -6.229  3.925   1.00 0.28  ? 22  GLN B H    2  
ATOM 5268  H HA   . GLN B 1 22  ? -11.805 -7.855  2.716   1.00 0.43  ? 22  GLN B HA   2  
ATOM 5269  H HB2  . GLN B 1 22  ? -9.672  -8.436  4.132   1.00 0.83  ? 22  GLN B HB2  2  
ATOM 5270  H HB3  . GLN B 1 22  ? -10.778 -8.320  5.490   1.00 0.94  ? 22  GLN B HB3  2  
ATOM 5271  H HG2  . GLN B 1 22  ? -11.312 -10.095 3.137   1.00 1.54  ? 22  GLN B HG2  2  
ATOM 5272  H HG3  . GLN B 1 22  ? -10.345 -10.615 4.512   1.00 1.67  ? 22  GLN B HG3  2  
ATOM 5273  H HE21 . GLN B 1 22  ? -11.366 -10.743 6.574   1.00 2.74  ? 22  GLN B HE21 2  
ATOM 5274  H HE22 . GLN B 1 22  ? -13.075 -10.996 6.687   1.00 3.38  ? 22  GLN B HE22 2  
ATOM 5275  N N    . LYS B 1 23  ? -12.664 -6.222  5.424   1.00 0.35  ? 23  LYS B N    2  
ATOM 5276  C CA   . LYS B 1 23  ? -13.804 -5.895  6.258   1.00 0.39  ? 23  LYS B CA   2  
ATOM 5277  C C    . LYS B 1 23  ? -14.882 -5.169  5.456   1.00 0.41  ? 23  LYS B C    2  
ATOM 5278  O O    . LYS B 1 23  ? -16.074 -5.393  5.667   1.00 0.49  ? 23  LYS B O    2  
ATOM 5279  C CB   . LYS B 1 23  ? -13.375 -5.065  7.467   1.00 0.41  ? 23  LYS B CB   2  
ATOM 5280  C CG   . LYS B 1 23  ? -12.844 -3.706  7.123   1.00 0.42  ? 23  LYS B CG   2  
ATOM 5281  C CD   . LYS B 1 23  ? -12.195 -3.083  8.329   1.00 0.63  ? 23  LYS B CD   2  
ATOM 5282  C CE   . LYS B 1 23  ? -12.115 -1.589  8.164   1.00 0.64  ? 23  LYS B CE   2  
ATOM 5283  N NZ   . LYS B 1 23  ? -11.465 -0.918  9.319   1.00 0.91  ? 23  LYS B NZ   2  
ATOM 5284  H H    . LYS B 1 23  ? -11.799 -5.780  5.586   1.00 0.35  ? 23  LYS B H    2  
ATOM 5285  H HA   . LYS B 1 23  ? -14.212 -6.827  6.607   1.00 0.42  ? 23  LYS B HA   2  
ATOM 5286  H HB2  . LYS B 1 23  ? -14.222 -4.923  8.116   1.00 0.45  ? 23  LYS B HB2  2  
ATOM 5287  H HB3  . LYS B 1 23  ? -12.607 -5.596  8.005   1.00 0.45  ? 23  LYS B HB3  2  
ATOM 5288  H HG2  . LYS B 1 23  ? -12.115 -3.799  6.332   1.00 0.53  ? 23  LYS B HG2  2  
ATOM 5289  H HG3  . LYS B 1 23  ? -13.661 -3.080  6.799   1.00 0.57  ? 23  LYS B HG3  2  
ATOM 5290  H HD2  . LYS B 1 23  ? -12.781 -3.318  9.203   1.00 0.97  ? 23  LYS B HD2  2  
ATOM 5291  H HD3  . LYS B 1 23  ? -11.199 -3.486  8.431   1.00 0.85  ? 23  LYS B HD3  2  
ATOM 5292  H HE2  . LYS B 1 23  ? -11.564 -1.370  7.268   1.00 0.72  ? 23  LYS B HE2  2  
ATOM 5293  H HE3  . LYS B 1 23  ? -13.122 -1.220  8.063   1.00 0.85  ? 23  LYS B HE3  2  
ATOM 5294  H HZ1  . LYS B 1 23  ? -11.282 0.087   9.091   1.00 1.42  ? 23  LYS B HZ1  2  
ATOM 5295  H HZ2  . LYS B 1 23  ? -10.563 -1.379  9.546   1.00 1.26  ? 23  LYS B HZ2  2  
ATOM 5296  H HZ3  . LYS B 1 23  ? -12.083 -0.962  10.153  1.00 1.47  ? 23  LYS B HZ3  2  
ATOM 5297  N N    . TYR B 1 24  ? -14.468 -4.298  4.541   1.00 0.36  ? 24  TYR B N    2  
ATOM 5298  C CA   . TYR B 1 24  ? -15.420 -3.559  3.729   1.00 0.39  ? 24  TYR B CA   2  
ATOM 5299  C C    . TYR B 1 24  ? -15.823 -4.319  2.474   1.00 0.34  ? 24  TYR B C    2  
ATOM 5300  O O    . TYR B 1 24  ? -16.959 -4.219  2.034   1.00 0.40  ? 24  TYR B O    2  
ATOM 5301  C CB   . TYR B 1 24  ? -14.888 -2.175  3.389   1.00 0.46  ? 24  TYR B CB   2  
ATOM 5302  C CG   . TYR B 1 24  ? -15.309 -1.145  4.413   1.00 0.86  ? 24  TYR B CG   2  
ATOM 5303  C CD1  . TYR B 1 24  ? -16.499 -0.446  4.261   1.00 1.66  ? 24  TYR B CD1  2  
ATOM 5304  C CD2  . TYR B 1 24  ? -14.544 -0.897  5.544   1.00 1.52  ? 24  TYR B CD2  2  
ATOM 5305  C CE1  . TYR B 1 24  ? -16.916 0.467   5.208   1.00 1.99  ? 24  TYR B CE1  2  
ATOM 5306  C CE2  . TYR B 1 24  ? -14.953 0.023   6.492   1.00 1.83  ? 24  TYR B CE2  2  
ATOM 5307  C CZ   . TYR B 1 24  ? -16.139 0.699   6.320   1.00 1.71  ? 24  TYR B CZ   2  
ATOM 5308  O OH   . TYR B 1 24  ? -16.558 1.597   7.272   1.00 2.15  ? 24  TYR B OH   2  
ATOM 5309  H H    . TYR B 1 24  ? -13.503 -4.154  4.408   1.00 0.33  ? 24  TYR B H    2  
ATOM 5310  H HA   . TYR B 1 24  ? -16.307 -3.433  4.332   1.00 0.50  ? 24  TYR B HA   2  
ATOM 5311  H HB2  . TYR B 1 24  ? -13.807 -2.206  3.357   1.00 0.51  ? 24  TYR B HB2  2  
ATOM 5312  H HB3  . TYR B 1 24  ? -15.269 -1.873  2.428   1.00 0.45  ? 24  TYR B HB3  2  
ATOM 5313  H HD1  . TYR B 1 24  ? -17.106 -0.629  3.386   1.00 2.37  ? 24  TYR B HD1  2  
ATOM 5314  H HD2  . TYR B 1 24  ? -13.613 -1.427  5.673   1.00 2.22  ? 24  TYR B HD2  2  
ATOM 5315  H HE1  . TYR B 1 24  ? -17.847 1.000   5.071   1.00 2.79  ? 24  TYR B HE1  2  
ATOM 5316  H HE2  . TYR B 1 24  ? -14.343 0.205   7.363   1.00 2.59  ? 24  TYR B HE2  2  
ATOM 5317  H HH   . TYR B 1 24  ? -17.510 1.507   7.399   1.00 2.39  ? 24  TYR B HH   2  
ATOM 5318  N N    . ALA B 1 25  ? -14.898 -5.076  1.906   1.00 0.29  ? 25  ALA B N    2  
ATOM 5319  C CA   . ALA B 1 25  ? -15.196 -5.919  0.753   1.00 0.34  ? 25  ALA B CA   2  
ATOM 5320  C C    . ALA B 1 25  ? -15.999 -7.136  1.190   1.00 0.47  ? 25  ALA B C    2  
ATOM 5321  O O    . ALA B 1 25  ? -16.592 -7.851  0.378   1.00 0.58  ? 25  ALA B O    2  
ATOM 5322  C CB   . ALA B 1 25  ? -13.910 -6.352  0.065   1.00 0.37  ? 25  ALA B CB   2  
ATOM 5323  H H    . ALA B 1 25  ? -13.982 -5.064  2.262   1.00 0.28  ? 25  ALA B H    2  
ATOM 5324  H HA   . ALA B 1 25  ? -15.779 -5.340  0.055   1.00 0.34  ? 25  ALA B HA   2  
ATOM 5325  H HB1  . ALA B 1 25  ? -13.318 -5.477  -0.169  1.00 1.05  ? 25  ALA B HB1  2  
ATOM 5326  H HB2  . ALA B 1 25  ? -14.146 -6.881  -0.848  1.00 0.98  ? 25  ALA B HB2  2  
ATOM 5327  H HB3  . ALA B 1 25  ? -13.348 -7.000  0.726   1.00 1.09  ? 25  ALA B HB3  2  
ATOM 5328  N N    . GLY B 1 26  ? -15.985 -7.376  2.490   1.00 0.50  ? 26  GLY B N    2  
ATOM 5329  C CA   . GLY B 1 26  ? -16.712 -8.490  3.052   1.00 0.64  ? 26  GLY B CA   2  
ATOM 5330  C C    . GLY B 1 26  ? -18.056 -8.077  3.621   1.00 0.76  ? 26  GLY B C    2  
ATOM 5331  O O    . GLY B 1 26  ? -18.633 -8.792  4.439   1.00 0.96  ? 26  GLY B O    2  
ATOM 5332  H H    . GLY B 1 26  ? -15.459 -6.787  3.079   1.00 0.45  ? 26  GLY B H    2  
ATOM 5333  H HA2  . GLY B 1 26  ? -16.868 -9.228  2.279   1.00 0.74  ? 26  GLY B HA2  2  
ATOM 5334  H HA3  . GLY B 1 26  ? -16.119 -8.929  3.839   1.00 0.64  ? 26  GLY B HA3  2  
ATOM 5335  N N    . LYS B 1 27  ? -18.555 -6.922  3.193   1.00 0.69  ? 27  LYS B N    2  
ATOM 5336  C CA   . LYS B 1 27  ? -19.856 -6.441  3.647   1.00 0.82  ? 27  LYS B CA   2  
ATOM 5337  C C    . LYS B 1 27  ? -20.963 -7.083  2.825   1.00 0.95  ? 27  LYS B C    2  
ATOM 5338  O O    . LYS B 1 27  ? -21.885 -7.689  3.371   1.00 1.11  ? 27  LYS B O    2  
ATOM 5339  C CB   . LYS B 1 27  ? -19.941 -4.916  3.538   1.00 0.77  ? 27  LYS B CB   2  
ATOM 5340  C CG   . LYS B 1 27  ? -19.026 -4.183  4.504   1.00 0.81  ? 27  LYS B CG   2  
ATOM 5341  C CD   . LYS B 1 27  ? -19.038 -2.679  4.266   1.00 0.86  ? 27  LYS B CD   2  
ATOM 5342  C CE   . LYS B 1 27  ? -20.419 -2.075  4.470   1.00 1.11  ? 27  LYS B CE   2  
ATOM 5343  N NZ   . LYS B 1 27  ? -20.927 -2.291  5.852   1.00 1.72  ? 27  LYS B NZ   2  
ATOM 5344  H H    . LYS B 1 27  ? -18.047 -6.387  2.541   1.00 0.61  ? 27  LYS B H    2  
ATOM 5345  H HA   . LYS B 1 27  ? -19.975 -6.729  4.680   1.00 0.93  ? 27  LYS B HA   2  
ATOM 5346  H HB2  . LYS B 1 27  ? -19.675 -4.623  2.533   1.00 0.68  ? 27  LYS B HB2  2  
ATOM 5347  H HB3  . LYS B 1 27  ? -20.957 -4.611  3.736   1.00 0.89  ? 27  LYS B HB3  2  
ATOM 5348  H HG2  . LYS B 1 27  ? -19.354 -4.376  5.512   1.00 0.95  ? 27  LYS B HG2  2  
ATOM 5349  H HG3  . LYS B 1 27  ? -18.017 -4.550  4.378   1.00 0.79  ? 27  LYS B HG3  2  
ATOM 5350  H HD2  . LYS B 1 27  ? -18.350 -2.212  4.953   1.00 1.08  ? 27  LYS B HD2  2  
ATOM 5351  H HD3  . LYS B 1 27  ? -18.719 -2.487  3.251   1.00 1.11  ? 27  LYS B HD3  2  
ATOM 5352  H HE2  . LYS B 1 27  ? -20.361 -1.013  4.282   1.00 1.65  ? 27  LYS B HE2  2  
ATOM 5353  H HE3  . LYS B 1 27  ? -21.104 -2.527  3.768   1.00 1.47  ? 27  LYS B HE3  2  
ATOM 5354  H HZ1  . LYS B 1 27  ? -20.283 -1.853  6.541   1.00 2.17  ? 27  LYS B HZ1  2  
ATOM 5355  H HZ2  . LYS B 1 27  ? -20.997 -3.308  6.057   1.00 2.11  ? 27  LYS B HZ2  2  
ATOM 5356  H HZ3  . LYS B 1 27  ? -21.869 -1.863  5.956   1.00 2.19  ? 27  LYS B HZ3  2  
ATOM 5357  N N    . ASP B 1 28  ? -20.855 -6.952  1.511   1.00 1.00  ? 28  ASP B N    2  
ATOM 5358  C CA   . ASP B 1 28  ? -21.796 -7.580  0.597   1.00 1.19  ? 28  ASP B CA   2  
ATOM 5359  C C    . ASP B 1 28  ? -21.476 -9.065  0.506   1.00 1.26  ? 28  ASP B C    2  
ATOM 5360  O O    . ASP B 1 28  ? -22.338 -9.894  0.216   1.00 1.58  ? 28  ASP B O    2  
ATOM 5361  C CB   . ASP B 1 28  ? -21.702 -6.943  -0.793  1.00 1.33  ? 28  ASP B CB   2  
ATOM 5362  C CG   . ASP B 1 28  ? -22.965 -7.131  -1.612  1.00 1.65  ? 28  ASP B CG   2  
ATOM 5363  O OD1  . ASP B 1 28  ? -23.128 -8.193  -2.241  1.00 2.15  ? 28  ASP B OD1  2  
ATOM 5364  O OD2  . ASP B 1 28  ? -23.807 -6.205  -1.636  1.00 2.09  ? 28  ASP B OD2  2  
ATOM 5365  H H    . ASP B 1 28  ? -20.111 -6.410  1.141   1.00 0.99  ? 28  ASP B H    2  
ATOM 5366  H HA   . ASP B 1 28  ? -22.794 -7.451  0.989   1.00 1.28  ? 28  ASP B HA   2  
ATOM 5367  H HB2  . ASP B 1 28  ? -21.513 -5.883  -0.692  1.00 1.33  ? 28  ASP B HB2  2  
ATOM 5368  H HB3  . ASP B 1 28  ? -20.881 -7.396  -1.330  1.00 1.44  ? 28  ASP B HB3  2  
ATOM 5369  N N    . GLY B 1 29  ? -20.220 -9.387  0.788   1.00 1.15  ? 29  GLY B N    2  
ATOM 5370  C CA   . GLY B 1 29  ? -19.795 -10.768 0.825   1.00 1.32  ? 29  GLY B CA   2  
ATOM 5371  C C    . GLY B 1 29  ? -18.934 -11.152 -0.358  1.00 1.51  ? 29  GLY B C    2  
ATOM 5372  O O    . GLY B 1 29  ? -19.017 -12.278 -0.850  1.00 1.64  ? 29  GLY B O    2  
ATOM 5373  H H    . GLY B 1 29  ? -19.576 -8.671  0.975   1.00 1.14  ? 29  GLY B H    2  
ATOM 5374  H HA2  . GLY B 1 29  ? -19.232 -10.934 1.731   1.00 1.61  ? 29  GLY B HA2  2  
ATOM 5375  H HA3  . GLY B 1 29  ? -20.672 -11.400 0.838   1.00 1.54  ? 29  GLY B HA3  2  
ATOM 5376  N N    . TYR B 1 30  ? -18.108 -10.227 -0.826  1.00 2.07  ? 30  TYR B N    2  
ATOM 5377  C CA   . TYR B 1 30  ? -17.228 -10.510 -1.951  1.00 2.80  ? 30  TYR B CA   2  
ATOM 5378  C C    . TYR B 1 30  ? -15.850 -10.949 -1.476  1.00 2.61  ? 30  TYR B C    2  
ATOM 5379  O O    . TYR B 1 30  ? -15.342 -11.986 -1.909  1.00 3.02  ? 30  TYR B O    2  
ATOM 5380  C CB   . TYR B 1 30  ? -17.087 -9.293  -2.863  1.00 3.68  ? 30  TYR B CB   2  
ATOM 5381  C CG   . TYR B 1 30  ? -18.346 -8.927  -3.612  1.00 4.52  ? 30  TYR B CG   2  
ATOM 5382  C CD1  . TYR B 1 30  ? -18.749 -9.653  -4.723  1.00 5.11  ? 30  TYR B CD1  2  
ATOM 5383  C CD2  . TYR B 1 30  ? -19.118 -7.842  -3.222  1.00 5.12  ? 30  TYR B CD2  2  
ATOM 5384  C CE1  . TYR B 1 30  ? -19.887 -9.311  -5.427  1.00 6.04  ? 30  TYR B CE1  2  
ATOM 5385  C CE2  . TYR B 1 30  ? -20.260 -7.494  -3.917  1.00 6.09  ? 30  TYR B CE2  2  
ATOM 5386  C CZ   . TYR B 1 30  ? -20.639 -8.230  -5.019  1.00 6.46  ? 30  TYR B CZ   2  
ATOM 5387  O OH   . TYR B 1 30  ? -21.770 -7.879  -5.721  1.00 7.51  ? 30  TYR B OH   2  
ATOM 5388  H H    . TYR B 1 30  ? -18.086 -9.338  -0.408  1.00 2.21  ? 30  TYR B H    2  
ATOM 5389  H HA   . TYR B 1 30  ? -17.670 -11.317 -2.515  1.00 3.26  ? 30  TYR B HA   2  
ATOM 5390  H HB2  . TYR B 1 30  ? -16.801 -8.440  -2.267  1.00 3.86  ? 30  TYR B HB2  2  
ATOM 5391  H HB3  . TYR B 1 30  ? -16.313 -9.489  -3.592  1.00 3.94  ? 30  TYR B HB3  2  
ATOM 5392  H HD1  . TYR B 1 30  ? -18.160 -10.501 -5.037  1.00 5.08  ? 30  TYR B HD1  2  
ATOM 5393  H HD2  . TYR B 1 30  ? -18.818 -7.266  -2.359  1.00 5.08  ? 30  TYR B HD2  2  
ATOM 5394  H HE1  . TYR B 1 30  ? -20.185 -9.889  -6.288  1.00 6.63  ? 30  TYR B HE1  2  
ATOM 5395  H HE2  . TYR B 1 30  ? -20.850 -6.647  -3.597  1.00 6.74  ? 30  TYR B HE2  2  
ATOM 5396  H HH   . TYR B 1 30  ? -22.323 -8.662  -5.853  1.00 7.75  ? 30  TYR B HH   2  
ATOM 5397  N N    . ASN B 1 31  ? -15.249 -10.134 -0.597  1.00 2.62  ? 31  ASN B N    2  
ATOM 5398  C CA   . ASN B 1 31  ? -13.916 -10.396 -0.021  1.00 2.78  ? 31  ASN B CA   2  
ATOM 5399  C C    . ASN B 1 31  ? -12.816 -10.164 -1.061  1.00 1.96  ? 31  ASN B C    2  
ATOM 5400  O O    . ASN B 1 31  ? -11.778 -9.568  -0.767  1.00 2.53  ? 31  ASN B O    2  
ATOM 5401  C CB   . ASN B 1 31  ? -13.835 -11.823 0.549   1.00 3.85  ? 31  ASN B CB   2  
ATOM 5402  C CG   . ASN B 1 31  ? -12.613 -12.063 1.426   1.00 4.61  ? 31  ASN B CG   2  
ATOM 5403  O OD1  . ASN B 1 31  ? -11.536 -11.510 1.207   1.00 4.92  ? 31  ASN B OD1  2  
ATOM 5404  N ND2  . ASN B 1 31  ? -12.781 -12.899 2.438   1.00 5.33  ? 31  ASN B ND2  2  
ATOM 5405  H H    . ASN B 1 31  ? -15.720 -9.311  -0.326  1.00 2.93  ? 31  ASN B H    2  
ATOM 5406  H HA   . ASN B 1 31  ? -13.772 -9.693  0.786   1.00 3.24  ? 31  ASN B HA   2  
ATOM 5407  H HB2  . ASN B 1 31  ? -14.716 -12.013 1.143   1.00 4.17  ? 31  ASN B HB2  2  
ATOM 5408  H HB3  . ASN B 1 31  ? -13.807 -12.525 -0.272  1.00 4.22  ? 31  ASN B HB3  2  
ATOM 5409  H HD21 . ASN B 1 31  ? -13.665 -13.306 2.560   1.00 5.37  ? 31  ASN B HD21 2  
ATOM 5410  H HD22 . ASN B 1 31  ? -12.019 -13.071 3.028   1.00 5.97  ? 31  ASN B HD22 2  
ATOM 5411  N N    . TYR B 1 32  ? -13.052 -10.637 -2.275  1.00 1.18  ? 32  TYR B N    2  
ATOM 5412  C CA   . TYR B 1 32  ? -12.128 -10.433 -3.378  1.00 1.18  ? 32  TYR B CA   2  
ATOM 5413  C C    . TYR B 1 32  ? -12.227 -8.998  -3.890  1.00 0.91  ? 32  TYR B C    2  
ATOM 5414  O O    . TYR B 1 32  ? -11.227 -8.403  -4.290  1.00 1.04  ? 32  TYR B O    2  
ATOM 5415  C CB   . TYR B 1 32  ? -12.439 -11.426 -4.506  1.00 1.78  ? 32  TYR B CB   2  
ATOM 5416  C CG   . TYR B 1 32  ? -11.494 -11.345 -5.687  1.00 2.38  ? 32  TYR B CG   2  
ATOM 5417  C CD1  . TYR B 1 32  ? -11.721 -10.450 -6.726  1.00 3.08  ? 32  TYR B CD1  2  
ATOM 5418  C CD2  . TYR B 1 32  ? -10.374 -12.162 -5.760  1.00 2.99  ? 32  TYR B CD2  2  
ATOM 5419  C CE1  . TYR B 1 32  ? -10.858 -10.371 -7.801  1.00 3.93  ? 32  TYR B CE1  2  
ATOM 5420  C CE2  . TYR B 1 32  ? -9.508  -12.090 -6.834  1.00 3.86  ? 32  TYR B CE2  2  
ATOM 5421  C CZ   . TYR B 1 32  ? -9.753  -11.192 -7.850  1.00 4.19  ? 32  TYR B CZ   2  
ATOM 5422  O OH   . TYR B 1 32  ? -8.890  -11.112 -8.917  1.00 5.19  ? 32  TYR B OH   2  
ATOM 5423  H H    . TYR B 1 32  ? -13.876 -11.147 -2.432  1.00 1.45  ? 32  TYR B H    2  
ATOM 5424  H HA   . TYR B 1 32  ? -11.128 -10.609 -3.014  1.00 1.85  ? 32  TYR B HA   2  
ATOM 5425  H HB2  . TYR B 1 32  ? -12.387 -12.430 -4.114  1.00 2.15  ? 32  TYR B HB2  2  
ATOM 5426  H HB3  . TYR B 1 32  ? -13.440 -11.241 -4.871  1.00 2.32  ? 32  TYR B HB3  2  
ATOM 5427  H HD1  . TYR B 1 32  ? -12.587 -9.807  -6.685  1.00 3.32  ? 32  TYR B HD1  2  
ATOM 5428  H HD2  . TYR B 1 32  ? -10.183 -12.867 -4.963  1.00 3.17  ? 32  TYR B HD2  2  
ATOM 5429  H HE1  . TYR B 1 32  ? -11.053 -9.669  -8.599  1.00 4.65  ? 32  TYR B HE1  2  
ATOM 5430  H HE2  . TYR B 1 32  ? -8.641  -12.735 -6.874  1.00 4.54  ? 32  TYR B HE2  2  
ATOM 5431  H HH   . TYR B 1 32  ? -8.648  -10.188 -9.061  1.00 5.57  ? 32  TYR B HH   2  
ATOM 5432  N N    . THR B 1 33  ? -13.432 -8.448  -3.854  1.00 0.66  ? 33  THR B N    2  
ATOM 5433  C CA   . THR B 1 33  ? -13.690 -7.127  -4.402  1.00 0.45  ? 33  THR B CA   2  
ATOM 5434  C C    . THR B 1 33  ? -14.493 -6.259  -3.453  1.00 0.37  ? 33  THR B C    2  
ATOM 5435  O O    . THR B 1 33  ? -15.430 -6.713  -2.802  1.00 0.44  ? 33  THR B O    2  
ATOM 5436  C CB   . THR B 1 33  ? -14.438 -7.222  -5.741  1.00 0.45  ? 33  THR B CB   2  
ATOM 5437  O OG1  . THR B 1 33  ? -15.027 -8.523  -5.887  1.00 0.66  ? 33  THR B OG1  2  
ATOM 5438  C CG2  . THR B 1 33  ? -13.512 -6.928  -6.907  1.00 0.43  ? 33  THR B CG2  2  
ATOM 5439  H H    . THR B 1 33  ? -14.170 -8.942  -3.446  1.00 0.73  ? 33  THR B H    2  
ATOM 5440  H HA   . THR B 1 33  ? -12.743 -6.638  -4.583  1.00 0.49  ? 33  THR B HA   2  
ATOM 5441  H HB   . THR B 1 33  ? -15.225 -6.485  -5.739  1.00 0.56  ? 33  THR B HB   2  
ATOM 5442  H HG1  . THR B 1 33  ? -15.974 -8.465  -5.719  1.00 1.28  ? 33  THR B HG1  2  
ATOM 5443  H HG21 . THR B 1 33  ? -13.108 -5.931  -6.796  1.00 1.10  ? 33  THR B HG21 2  
ATOM 5444  H HG22 . THR B 1 33  ? -14.070 -6.986  -7.832  1.00 0.99  ? 33  THR B HG22 2  
ATOM 5445  H HG23 . THR B 1 33  ? -12.707 -7.646  -6.921  1.00 1.14  ? 33  THR B HG23 2  
ATOM 5446  N N    . LEU B 1 34  ? -14.081 -5.011  -3.379  1.00 0.32  ? 34  LEU B N    2  
ATOM 5447  C CA   . LEU B 1 34  ? -14.787 -3.981  -2.658  1.00 0.30  ? 34  LEU B CA   2  
ATOM 5448  C C    . LEU B 1 34  ? -15.794 -3.350  -3.600  1.00 0.31  ? 34  LEU B C    2  
ATOM 5449  O O    . LEU B 1 34  ? -15.425 -2.608  -4.519  1.00 0.34  ? 34  LEU B O    2  
ATOM 5450  C CB   . LEU B 1 34  ? -13.757 -2.961  -2.152  1.00 0.29  ? 34  LEU B CB   2  
ATOM 5451  C CG   . LEU B 1 34  ? -13.801 -2.644  -0.660  1.00 0.29  ? 34  LEU B CG   2  
ATOM 5452  C CD1  . LEU B 1 34  ? -12.481 -2.048  -0.198  1.00 0.45  ? 34  LEU B CD1  2  
ATOM 5453  C CD2  . LEU B 1 34  ? -14.922 -1.682  -0.362  1.00 0.28  ? 34  LEU B CD2  2  
ATOM 5454  H H    . LEU B 1 34  ? -13.249 -4.766  -3.836  1.00 0.31  ? 34  LEU B H    2  
ATOM 5455  H HA   . LEU B 1 34  ? -15.316 -4.423  -1.831  1.00 0.32  ? 34  LEU B HA   2  
ATOM 5456  H HB2  . LEU B 1 34  ? -12.767 -3.355  -2.371  1.00 0.34  ? 34  LEU B HB2  2  
ATOM 5457  H HB3  . LEU B 1 34  ? -13.903 -2.032  -2.701  1.00 0.33  ? 34  LEU B HB3  2  
ATOM 5458  H HG   . LEU B 1 34  ? -13.975 -3.554  -0.107  1.00 0.32  ? 34  LEU B HG   2  
ATOM 5459  H HD11 . LEU B 1 34  ? -12.283 -1.139  -0.748  1.00 1.03  ? 34  LEU B HD11 2  
ATOM 5460  H HD12 . LEU B 1 34  ? -11.686 -2.756  -0.375  1.00 1.18  ? 34  LEU B HD12 2  
ATOM 5461  H HD13 . LEU B 1 34  ? -12.535 -1.826  0.858   1.00 1.09  ? 34  LEU B HD13 2  
ATOM 5462  H HD21 . LEU B 1 34  ? -14.861 -0.841  -1.036  1.00 1.05  ? 34  LEU B HD21 2  
ATOM 5463  H HD22 . LEU B 1 34  ? -14.835 -1.329  0.654   1.00 1.09  ? 34  LEU B HD22 2  
ATOM 5464  H HD23 . LEU B 1 34  ? -15.868 -2.182  -0.495  1.00 1.01  ? 34  LEU B HD23 2  
ATOM 5465  N N    . SER B 1 35  ? -17.057 -3.697  -3.397  1.00 0.31  ? 35  SER B N    2  
ATOM 5466  C CA   . SER B 1 35  ? -18.128 -3.285  -4.281  1.00 0.33  ? 35  SER B CA   2  
ATOM 5467  C C    . SER B 1 35  ? -18.279 -1.769  -4.288  1.00 0.32  ? 35  SER B C    2  
ATOM 5468  O O    . SER B 1 35  ? -17.723 -1.081  -3.431  1.00 0.30  ? 35  SER B O    2  
ATOM 5469  C CB   . SER B 1 35  ? -19.439 -3.959  -3.866  1.00 0.37  ? 35  SER B CB   2  
ATOM 5470  O OG   . SER B 1 35  ? -20.489 -3.681  -4.774  1.00 0.40  ? 35  SER B OG   2  
ATOM 5471  H H    . SER B 1 35  ? -17.280 -4.260  -2.613  1.00 0.33  ? 35  SER B H    2  
ATOM 5472  H HA   . SER B 1 35  ? -17.870 -3.610  -5.266  1.00 0.35  ? 35  SER B HA   2  
ATOM 5473  H HB2  . SER B 1 35  ? -19.291 -5.028  -3.829  1.00 0.38  ? 35  SER B HB2  2  
ATOM 5474  H HB3  . SER B 1 35  ? -19.722 -3.607  -2.887  1.00 0.38  ? 35  SER B HB3  2  
ATOM 5475  H HG   . SER B 1 35  ? -20.781 -4.505  -5.183  1.00 0.68  ? 35  SER B HG   2  
ATOM 5476  N N    . LYS B 1 36  ? -19.036 -1.257  -5.254  1.00 0.38  ? 36  LYS B N    2  
ATOM 5477  C CA   . LYS B 1 36  ? -19.205 0.180   -5.428  1.00 0.42  ? 36  LYS B CA   2  
ATOM 5478  C C    . LYS B 1 36  ? -19.584 0.846   -4.110  1.00 0.36  ? 36  LYS B C    2  
ATOM 5479  O O    . LYS B 1 36  ? -18.829 1.653   -3.579  1.00 0.35  ? 36  LYS B O    2  
ATOM 5480  C CB   . LYS B 1 36  ? -20.272 0.467   -6.489  1.00 0.53  ? 36  LYS B CB   2  
ATOM 5481  C CG   . LYS B 1 36  ? -20.390 1.937   -6.863  1.00 0.62  ? 36  LYS B CG   2  
ATOM 5482  C CD   . LYS B 1 36  ? -19.119 2.448   -7.524  1.00 0.66  ? 36  LYS B CD   2  
ATOM 5483  C CE   . LYS B 1 36  ? -19.232 3.917   -7.903  1.00 0.61  ? 36  LYS B CE   2  
ATOM 5484  N NZ   . LYS B 1 36  ? -20.290 4.158   -8.917  1.00 0.65  ? 36  LYS B NZ   2  
ATOM 5485  H H    . LYS B 1 36  ? -19.496 -1.869  -5.871  1.00 0.43  ? 36  LYS B H    2  
ATOM 5486  H HA   . LYS B 1 36  ? -18.265 0.584   -5.759  1.00 0.46  ? 36  LYS B HA   2  
ATOM 5487  H HB2  . LYS B 1 36  ? -20.030 -0.089  -7.383  1.00 0.58  ? 36  LYS B HB2  2  
ATOM 5488  H HB3  . LYS B 1 36  ? -21.230 0.133   -6.119  1.00 0.56  ? 36  LYS B HB3  2  
ATOM 5489  H HG2  . LYS B 1 36  ? -21.216 2.060   -7.548  1.00 1.07  ? 36  LYS B HG2  2  
ATOM 5490  H HG3  . LYS B 1 36  ? -20.575 2.511   -5.966  1.00 1.21  ? 36  LYS B HG3  2  
ATOM 5491  H HD2  . LYS B 1 36  ? -18.296 2.330   -6.836  1.00 1.25  ? 36  LYS B HD2  2  
ATOM 5492  H HD3  . LYS B 1 36  ? -18.930 1.867   -8.417  1.00 1.12  ? 36  LYS B HD3  2  
ATOM 5493  H HE2  . LYS B 1 36  ? -19.464 4.488   -7.016  1.00 0.66  ? 36  LYS B HE2  2  
ATOM 5494  H HE3  . LYS B 1 36  ? -18.282 4.247   -8.301  1.00 0.58  ? 36  LYS B HE3  2  
ATOM 5495  H HZ1  . LYS B 1 36  ? -20.277 5.161   -9.215  1.00 1.18  ? 36  LYS B HZ1  2  
ATOM 5496  H HZ2  . LYS B 1 36  ? -21.226 3.941   -8.521  1.00 1.14  ? 36  LYS B HZ2  2  
ATOM 5497  H HZ3  . LYS B 1 36  ? -20.132 3.559   -9.752  1.00 1.16  ? 36  LYS B HZ3  2  
ATOM 5498  N N    . THR B 1 37  ? -20.729 0.465   -3.569  1.00 0.37  ? 37  THR B N    2  
ATOM 5499  C CA   . THR B 1 37  ? -21.238 1.058   -2.340  1.00 0.38  ? 37  THR B CA   2  
ATOM 5500  C C    . THR B 1 37  ? -20.352 0.721   -1.141  1.00 0.36  ? 37  THR B C    2  
ATOM 5501  O O    . THR B 1 37  ? -20.251 1.504   -0.194  1.00 0.38  ? 37  THR B O    2  
ATOM 5502  C CB   . THR B 1 37  ? -22.669 0.577   -2.066  1.00 0.44  ? 37  THR B CB   2  
ATOM 5503  O OG1  . THR B 1 37  ? -23.465 0.742   -3.247  1.00 0.47  ? 37  THR B OG1  2  
ATOM 5504  C CG2  . THR B 1 37  ? -23.293 1.355   -0.916  1.00 0.49  ? 37  THR B CG2  2  
ATOM 5505  H H    . THR B 1 37  ? -21.254 -0.236  -4.009  1.00 0.39  ? 37  THR B H    2  
ATOM 5506  H HA   . THR B 1 37  ? -21.256 2.133   -2.469  1.00 0.39  ? 37  THR B HA   2  
ATOM 5507  H HB   . THR B 1 37  ? -22.635 -0.472  -1.805  1.00 0.44  ? 37  THR B HB   2  
ATOM 5508  H HG1  . THR B 1 37  ? -23.592 -0.120  -3.667  1.00 0.79  ? 37  THR B HG1  2  
ATOM 5509  H HG21 . THR B 1 37  ? -24.280 0.967   -0.711  1.00 1.15  ? 37  THR B HG21 2  
ATOM 5510  H HG22 . THR B 1 37  ? -23.365 2.399   -1.187  1.00 1.09  ? 37  THR B HG22 2  
ATOM 5511  H HG23 . THR B 1 37  ? -22.674 1.254   -0.037  1.00 1.12  ? 37  THR B HG23 2  
ATOM 5512  N N    . GLU B 1 38  ? -19.689 -0.428  -1.190  1.00 0.34  ? 38  GLU B N    2  
ATOM 5513  C CA   . GLU B 1 38  ? -18.796 -0.820  -0.110  1.00 0.33  ? 38  GLU B CA   2  
ATOM 5514  C C    . GLU B 1 38  ? -17.616 0.129   -0.083  1.00 0.33  ? 38  GLU B C    2  
ATOM 5515  O O    . GLU B 1 38  ? -17.135 0.522   0.977   1.00 0.48  ? 38  GLU B O    2  
ATOM 5516  C CB   . GLU B 1 38  ? -18.298 -2.254  -0.285  1.00 0.34  ? 38  GLU B CB   2  
ATOM 5517  C CG   . GLU B 1 38  ? -19.386 -3.309  -0.234  1.00 0.47  ? 38  GLU B CG   2  
ATOM 5518  C CD   . GLU B 1 38  ? -18.826 -4.713  -0.372  1.00 1.27  ? 38  GLU B CD   2  
ATOM 5519  O OE1  . GLU B 1 38  ? -18.237 -5.018  -1.423  1.00 1.96  ? 38  GLU B OE1  2  
ATOM 5520  O OE2  . GLU B 1 38  ? -18.968 -5.509  0.574   1.00 2.16  ? 38  GLU B OE2  2  
ATOM 5521  H H    . GLU B 1 38  ? -19.772 -1.000  -1.980  1.00 0.34  ? 38  GLU B H    2  
ATOM 5522  H HA   . GLU B 1 38  ? -19.334 -0.742  0.818   1.00 0.35  ? 38  GLU B HA   2  
ATOM 5523  H HB2  . GLU B 1 38  ? -17.803 -2.330  -1.238  1.00 0.41  ? 38  GLU B HB2  2  
ATOM 5524  H HB3  . GLU B 1 38  ? -17.586 -2.470  0.498   1.00 0.45  ? 38  GLU B HB3  2  
ATOM 5525  H HG2  . GLU B 1 38  ? -19.902 -3.233  0.713   1.00 1.15  ? 38  GLU B HG2  2  
ATOM 5526  H HG3  . GLU B 1 38  ? -20.083 -3.132  -1.039  1.00 1.30  ? 38  GLU B HG3  2  
ATOM 5527  N N    . PHE B 1 39  ? -17.181 0.514   -1.275  1.00 0.29  ? 39  PHE B N    2  
ATOM 5528  C CA   . PHE B 1 39  ? -16.055 1.407   -1.447  1.00 0.31  ? 39  PHE B CA   2  
ATOM 5529  C C    . PHE B 1 39  ? -16.468 2.822   -1.103  1.00 0.28  ? 39  PHE B C    2  
ATOM 5530  O O    . PHE B 1 39  ? -15.679 3.604   -0.575  1.00 0.27  ? 39  PHE B O    2  
ATOM 5531  C CB   . PHE B 1 39  ? -15.572 1.336   -2.891  1.00 0.53  ? 39  PHE B CB   2  
ATOM 5532  C CG   . PHE B 1 39  ? -14.288 2.060   -3.143  1.00 0.81  ? 39  PHE B CG   2  
ATOM 5533  C CD1  . PHE B 1 39  ? -13.117 1.648   -2.530  1.00 1.76  ? 39  PHE B CD1  2  
ATOM 5534  C CD2  . PHE B 1 39  ? -14.251 3.150   -3.992  1.00 1.78  ? 39  PHE B CD2  2  
ATOM 5535  C CE1  . PHE B 1 39  ? -11.931 2.312   -2.761  1.00 2.61  ? 39  PHE B CE1  2  
ATOM 5536  C CE2  . PHE B 1 39  ? -13.070 3.818   -4.228  1.00 2.66  ? 39  PHE B CE2  2  
ATOM 5537  C CZ   . PHE B 1 39  ? -11.907 3.399   -3.612  1.00 2.87  ? 39  PHE B CZ   2  
ATOM 5538  H H    . PHE B 1 39  ? -17.642 0.180   -2.079  1.00 0.34  ? 39  PHE B H    2  
ATOM 5539  H HA   . PHE B 1 39  ? -15.263 1.095   -0.783  1.00 0.35  ? 39  PHE B HA   2  
ATOM 5540  H HB2  . PHE B 1 39  ? -15.432 0.304   -3.162  1.00 1.23  ? 39  PHE B HB2  2  
ATOM 5541  H HB3  . PHE B 1 39  ? -16.327 1.766   -3.533  1.00 1.41  ? 39  PHE B HB3  2  
ATOM 5542  H HD1  . PHE B 1 39  ? -13.138 0.797   -1.864  1.00 2.30  ? 39  PHE B HD1  2  
ATOM 5543  H HD2  . PHE B 1 39  ? -15.161 3.477   -4.473  1.00 2.31  ? 39  PHE B HD2  2  
ATOM 5544  H HE1  . PHE B 1 39  ? -11.025 1.980   -2.278  1.00 3.44  ? 39  PHE B HE1  2  
ATOM 5545  H HE2  . PHE B 1 39  ? -13.055 4.666   -4.893  1.00 3.51  ? 39  PHE B HE2  2  
ATOM 5546  H HZ   . PHE B 1 39  ? -10.980 3.922   -3.798  1.00 3.69  ? 39  PHE B HZ   2  
ATOM 5547  N N    . LEU B 1 40  ? -17.714 3.135   -1.409  1.00 0.33  ? 40  LEU B N    2  
ATOM 5548  C CA   . LEU B 1 40  ? -18.283 4.420   -1.068  1.00 0.37  ? 40  LEU B CA   2  
ATOM 5549  C C    . LEU B 1 40  ? -18.282 4.591   0.443   1.00 0.40  ? 40  LEU B C    2  
ATOM 5550  O O    . LEU B 1 40  ? -17.812 5.597   0.971   1.00 0.43  ? 40  LEU B O    2  
ATOM 5551  C CB   . LEU B 1 40  ? -19.706 4.528   -1.607  1.00 0.43  ? 40  LEU B CB   2  
ATOM 5552  C CG   . LEU B 1 40  ? -19.866 4.281   -3.112  1.00 0.50  ? 40  LEU B CG   2  
ATOM 5553  C CD1  . LEU B 1 40  ? -21.155 4.897   -3.626  1.00 1.07  ? 40  LEU B CD1  2  
ATOM 5554  C CD2  . LEU B 1 40  ? -18.663 4.799   -3.884  1.00 0.46  ? 40  LEU B CD2  2  
ATOM 5555  H H    . LEU B 1 40  ? -18.266 2.483   -1.894  1.00 0.37  ? 40  LEU B H    2  
ATOM 5556  H HA   . LEU B 1 40  ? -17.675 5.187   -1.514  1.00 0.38  ? 40  LEU B HA   2  
ATOM 5557  H HB2  . LEU B 1 40  ? -20.309 3.798   -1.085  1.00 0.65  ? 40  LEU B HB2  2  
ATOM 5558  H HB3  . LEU B 1 40  ? -20.082 5.513   -1.382  1.00 0.47  ? 40  LEU B HB3  2  
ATOM 5559  H HG   . LEU B 1 40  ? -19.925 3.215   -3.282  1.00 0.80  ? 40  LEU B HG   2  
ATOM 5560  H HD11 . LEU B 1 40  ? -21.994 4.459   -3.108  1.00 1.87  ? 40  LEU B HD11 2  
ATOM 5561  H HD12 . LEU B 1 40  ? -21.246 4.707   -4.686  1.00 1.41  ? 40  LEU B HD12 2  
ATOM 5562  H HD13 . LEU B 1 40  ? -21.140 5.962   -3.451  1.00 1.46  ? 40  LEU B HD13 2  
ATOM 5563  H HD21 . LEU B 1 40  ? -17.798 4.206   -3.615  1.00 1.02  ? 40  LEU B HD21 2  
ATOM 5564  H HD22 . LEU B 1 40  ? -18.489 5.834   -3.633  1.00 0.96  ? 40  LEU B HD22 2  
ATOM 5565  H HD23 . LEU B 1 40  ? -18.848 4.706   -4.942  1.00 1.09  ? 40  LEU B HD23 2  
ATOM 5566  N N    . SER B 1 41  ? -18.788 3.577   1.128   1.00 0.42  ? 41  SER B N    2  
ATOM 5567  C CA   . SER B 1 41  ? -18.799 3.557   2.576   1.00 0.52  ? 41  SER B CA   2  
ATOM 5568  C C    . SER B 1 41  ? -17.366 3.576   3.098   1.00 0.45  ? 41  SER B C    2  
ATOM 5569  O O    . SER B 1 41  ? -17.042 4.338   4.007   1.00 0.47  ? 41  SER B O    2  
ATOM 5570  C CB   . SER B 1 41  ? -19.541 2.311   3.080   1.00 0.67  ? 41  SER B CB   2  
ATOM 5571  O OG   . SER B 1 41  ? -19.719 2.343   4.487   1.00 1.40  ? 41  SER B OG   2  
ATOM 5572  H H    . SER B 1 41  ? -19.166 2.817   0.639   1.00 0.42  ? 41  SER B H    2  
ATOM 5573  H HA   . SER B 1 41  ? -19.313 4.441   2.921   1.00 0.60  ? 41  SER B HA   2  
ATOM 5574  H HB2  . SER B 1 41  ? -20.512 2.260   2.612   1.00 1.27  ? 41  SER B HB2  2  
ATOM 5575  H HB3  . SER B 1 41  ? -18.973 1.429   2.822   1.00 1.19  ? 41  SER B HB3  2  
ATOM 5576  H HG   . SER B 1 41  ? -20.273 3.099   4.720   1.00 1.96  ? 41  SER B HG   2  
ATOM 5577  N N    . PHE B 1 42  ? -16.515 2.747   2.493   1.00 0.42  ? 42  PHE B N    2  
ATOM 5578  C CA   . PHE B 1 42  ? -15.101 2.672   2.847   1.00 0.46  ? 42  PHE B CA   2  
ATOM 5579  C C    . PHE B 1 42  ? -14.447 4.034   2.777   1.00 0.29  ? 42  PHE B C    2  
ATOM 5580  O O    . PHE B 1 42  ? -13.910 4.517   3.754   1.00 0.42  ? 42  PHE B O    2  
ATOM 5581  C CB   . PHE B 1 42  ? -14.350 1.726   1.909   1.00 0.80  ? 42  PHE B CB   2  
ATOM 5582  C CG   . PHE B 1 42  ? -12.909 1.552   2.297   1.00 1.89  ? 42  PHE B CG   2  
ATOM 5583  C CD1  . PHE B 1 42  ? -11.933 2.410   1.814   1.00 2.77  ? 42  PHE B CD1  2  
ATOM 5584  C CD2  . PHE B 1 42  ? -12.537 0.546   3.168   1.00 2.69  ? 42  PHE B CD2  2  
ATOM 5585  C CE1  . PHE B 1 42  ? -10.617 2.267   2.197   1.00 3.80  ? 42  PHE B CE1  2  
ATOM 5586  C CE2  . PHE B 1 42  ? -11.222 0.393   3.551   1.00 3.73  ? 42  PHE B CE2  2  
ATOM 5587  C CZ   . PHE B 1 42  ? -10.260 1.255   3.067   1.00 4.13  ? 42  PHE B CZ   2  
ATOM 5588  H H    . PHE B 1 42  ? -16.855 2.155   1.784   1.00 0.44  ? 42  PHE B H    2  
ATOM 5589  H HA   . PHE B 1 42  ? -15.016 2.304   3.858   1.00 0.66  ? 42  PHE B HA   2  
ATOM 5590  H HB2  . PHE B 1 42  ? -14.824 0.749   1.922   1.00 0.53  ? 42  PHE B HB2  2  
ATOM 5591  H HB3  . PHE B 1 42  ? -14.382 2.135   0.903   1.00 1.30  ? 42  PHE B HB3  2  
ATOM 5592  H HD1  . PHE B 1 42  ? -12.212 3.199   1.131   1.00 3.00  ? 42  PHE B HD1  2  
ATOM 5593  H HD2  . PHE B 1 42  ? -13.288 -0.131  3.548   1.00 2.86  ? 42  PHE B HD2  2  
ATOM 5594  H HE1  . PHE B 1 42  ? -9.865  2.941   1.814   1.00 4.59  ? 42  PHE B HE1  2  
ATOM 5595  H HE2  . PHE B 1 42  ? -10.946 -0.398  4.231   1.00 4.49  ? 42  PHE B HE2  2  
ATOM 5596  H HZ   . PHE B 1 42  ? -9.230  1.140   3.369   1.00 5.02  ? 42  PHE B HZ   2  
ATOM 5597  N N    . MET B 1 43  ? -14.480 4.647   1.616   1.00 0.26  ? 43  MET B N    2  
ATOM 5598  C CA   . MET B 1 43  ? -13.783 5.905   1.429   1.00 0.29  ? 43  MET B CA   2  
ATOM 5599  C C    . MET B 1 43  ? -14.334 7.007   2.319   1.00 0.29  ? 43  MET B C    2  
ATOM 5600  O O    . MET B 1 43  ? -13.584 7.854   2.778   1.00 0.37  ? 43  MET B O    2  
ATOM 5601  C CB   . MET B 1 43  ? -13.820 6.348   -0.018  1.00 0.38  ? 43  MET B CB   2  
ATOM 5602  C CG   . MET B 1 43  ? -12.908 5.537   -0.923  1.00 0.62  ? 43  MET B CG   2  
ATOM 5603  S SD   . MET B 1 43  ? -12.342 6.460   -2.368  1.00 1.22  ? 43  MET B SD   2  
ATOM 5604  C CE   . MET B 1 43  ? -11.282 7.688   -1.603  1.00 2.25  ? 43  MET B CE   2  
ATOM 5605  H H    . MET B 1 43  ? -14.971 4.238   0.862   1.00 0.29  ? 43  MET B H    2  
ATOM 5606  H HA   . MET B 1 43  ? -12.754 5.738   1.706   1.00 0.35  ? 43  MET B HA   2  
ATOM 5607  H HB2  . MET B 1 43  ? -14.833 6.245   -0.372  1.00 0.75  ? 43  MET B HB2  2  
ATOM 5608  H HB3  . MET B 1 43  ? -13.529 7.384   -0.070  1.00 0.69  ? 43  MET B HB3  2  
ATOM 5609  H HG2  . MET B 1 43  ? -12.046 5.226   -0.355  1.00 1.11  ? 43  MET B HG2  2  
ATOM 5610  H HG3  . MET B 1 43  ? -13.446 4.663   -1.261  1.00 1.23  ? 43  MET B HG3  2  
ATOM 5611  H HE1  . MET B 1 43  ? -11.863 8.295   -0.925  1.00 2.63  ? 43  MET B HE1  2  
ATOM 5612  H HE2  . MET B 1 43  ? -10.851 8.317   -2.369  1.00 2.66  ? 43  MET B HE2  2  
ATOM 5613  H HE3  . MET B 1 43  ? -10.492 7.193   -1.058  1.00 2.85  ? 43  MET B HE3  2  
ATOM 5614  N N    . ASN B 1 44  ? -15.631 7.008   2.575   1.00 0.29  ? 44  ASN B N    2  
ATOM 5615  C CA   . ASN B 1 44  ? -16.202 8.036   3.438   1.00 0.33  ? 44  ASN B CA   2  
ATOM 5616  C C    . ASN B 1 44  ? -15.880 7.779   4.906   1.00 0.32  ? 44  ASN B C    2  
ATOM 5617  O O    . ASN B 1 44  ? -16.049 8.664   5.740   1.00 0.39  ? 44  ASN B O    2  
ATOM 5618  C CB   . ASN B 1 44  ? -17.712 8.150   3.282   1.00 0.42  ? 44  ASN B CB   2  
ATOM 5619  C CG   . ASN B 1 44  ? -18.141 8.906   2.038   1.00 1.05  ? 44  ASN B CG   2  
ATOM 5620  O OD1  . ASN B 1 44  ? -18.195 10.135  2.035   1.00 1.53  ? 44  ASN B OD1  2  
ATOM 5621  N ND2  . ASN B 1 44  ? -18.479 8.185   0.987   1.00 1.83  ? 44  ASN B ND2  2  
ATOM 5622  H H    . ASN B 1 44  ? -16.212 6.319   2.178   1.00 0.30  ? 44  ASN B H    2  
ATOM 5623  H HA   . ASN B 1 44  ? -15.756 8.977   3.150   1.00 0.37  ? 44  ASN B HA   2  
ATOM 5624  H HB2  . ASN B 1 44  ? -18.132 7.161   3.246   1.00 1.03  ? 44  ASN B HB2  2  
ATOM 5625  H HB3  . ASN B 1 44  ? -18.101 8.666   4.141   1.00 0.89  ? 44  ASN B HB3  2  
ATOM 5626  H HD21 . ASN B 1 44  ? -18.434 7.204   1.061   1.00 1.98  ? 44  ASN B HD21 2  
ATOM 5627  H HD22 . ASN B 1 44  ? -18.774 8.655   0.178   1.00 2.46  ? 44  ASN B HD22 2  
ATOM 5628  N N    . THR B 1 45  ? -15.449 6.568   5.231   1.00 0.27  ? 45  THR B N    2  
ATOM 5629  C CA   . THR B 1 45  ? -15.093 6.246   6.614   1.00 0.29  ? 45  THR B CA   2  
ATOM 5630  C C    . THR B 1 45  ? -13.587 6.162   6.813   1.00 0.28  ? 45  THR B C    2  
ATOM 5631  O O    . THR B 1 45  ? -12.988 6.951   7.546   1.00 0.34  ? 45  THR B O    2  
ATOM 5632  C CB   . THR B 1 45  ? -15.702 4.905   7.053   1.00 0.30  ? 45  THR B CB   2  
ATOM 5633  O OG1  . THR B 1 45  ? -15.490 3.922   6.036   1.00 0.34  ? 45  THR B OG1  2  
ATOM 5634  C CG2  . THR B 1 45  ? -17.186 5.042   7.333   1.00 0.34  ? 45  THR B CG2  2  
ATOM 5635  H H    . THR B 1 45  ? -15.370 5.875   4.530   1.00 0.24  ? 45  THR B H    2  
ATOM 5636  H HA   . THR B 1 45  ? -15.489 7.021   7.251   1.00 0.33  ? 45  THR B HA   2  
ATOM 5637  H HB   . THR B 1 45  ? -15.202 4.582   7.957   1.00 0.30  ? 45  THR B HB   2  
ATOM 5638  H HG1  . THR B 1 45  ? -16.235 3.935   5.419   1.00 1.03  ? 45  THR B HG1  2  
ATOM 5639  H HG21 . THR B 1 45  ? -17.693 5.365   6.436   1.00 1.04  ? 45  THR B HG21 2  
ATOM 5640  H HG22 . THR B 1 45  ? -17.339 5.770   8.115   1.00 1.14  ? 45  THR B HG22 2  
ATOM 5641  H HG23 . THR B 1 45  ? -17.581 4.087   7.647   1.00 1.05  ? 45  THR B HG23 2  
ATOM 5642  N N    . GLU B 1 46  ? -12.991 5.210   6.127   1.00 0.23  ? 46  GLU B N    2  
ATOM 5643  C CA   . GLU B 1 46  ? -11.594 4.887   6.286   1.00 0.25  ? 46  GLU B CA   2  
ATOM 5644  C C    . GLU B 1 46  ? -10.713 5.879   5.539   1.00 0.25  ? 46  GLU B C    2  
ATOM 5645  O O    . GLU B 1 46  ? -9.511  5.926   5.748   1.00 0.34  ? 46  GLU B O    2  
ATOM 5646  C CB   . GLU B 1 46  ? -11.333 3.467   5.791   1.00 0.29  ? 46  GLU B CB   2  
ATOM 5647  C CG   . GLU B 1 46  ? -12.176 2.413   6.489   1.00 0.57  ? 46  GLU B CG   2  
ATOM 5648  C CD   . GLU B 1 46  ? -11.840 2.274   7.959   1.00 1.17  ? 46  GLU B CD   2  
ATOM 5649  O OE1  . GLU B 1 46  ? -10.959 1.458   8.292   1.00 1.68  ? 46  GLU B OE1  2  
ATOM 5650  O OE2  . GLU B 1 46  ? -12.460 2.967   8.789   1.00 1.70  ? 46  GLU B OE2  2  
ATOM 5651  H H    . GLU B 1 46  ? -13.525 4.691   5.481   1.00 0.20  ? 46  GLU B H    2  
ATOM 5652  H HA   . GLU B 1 46  ? -11.366 4.934   7.337   1.00 0.28  ? 46  GLU B HA   2  
ATOM 5653  H HB2  . GLU B 1 46  ? -11.537 3.421   4.737   1.00 0.43  ? 46  GLU B HB2  2  
ATOM 5654  H HB3  . GLU B 1 46  ? -10.301 3.229   5.952   1.00 0.54  ? 46  GLU B HB3  2  
ATOM 5655  H HG2  . GLU B 1 46  ? -13.217 2.685   6.399   1.00 0.66  ? 46  GLU B HG2  2  
ATOM 5656  H HG3  . GLU B 1 46  ? -12.011 1.461   6.006   1.00 0.71  ? 46  GLU B HG3  2  
ATOM 5657  N N    . LEU B 1 47  ? -11.304 6.667   4.660   1.00 0.25  ? 47  LEU B N    2  
ATOM 5658  C CA   . LEU B 1 47  ? -10.549 7.686   3.949   1.00 0.26  ? 47  LEU B CA   2  
ATOM 5659  C C    . LEU B 1 47  ? -11.281 9.009   3.978   1.00 0.28  ? 47  LEU B C    2  
ATOM 5660  O O    . LEU B 1 47  ? -11.130 9.833   3.079   1.00 0.30  ? 47  LEU B O    2  
ATOM 5661  C CB   . LEU B 1 47  ? -10.295 7.262   2.507   1.00 0.26  ? 47  LEU B CB   2  
ATOM 5662  C CG   . LEU B 1 47  ? -9.417  6.027   2.351   1.00 0.27  ? 47  LEU B CG   2  
ATOM 5663  C CD1  . LEU B 1 47  ? -9.307  5.639   0.891   1.00 0.32  ? 47  LEU B CD1  2  
ATOM 5664  C CD2  . LEU B 1 47  ? -8.043  6.286   2.950   1.00 0.28  ? 47  LEU B CD2  2  
ATOM 5665  H H    . LEU B 1 47  ? -12.262 6.559   4.476   1.00 0.29  ? 47  LEU B H    2  
ATOM 5666  H HA   . LEU B 1 47  ? -9.602  7.806   4.453   1.00 0.29  ? 47  LEU B HA   2  
ATOM 5667  H HB2  . LEU B 1 47  ? -11.247 7.069   2.035   1.00 0.27  ? 47  LEU B HB2  2  
ATOM 5668  H HB3  . LEU B 1 47  ? -9.816  8.082   1.996   1.00 0.27  ? 47  LEU B HB3  2  
ATOM 5669  H HG   . LEU B 1 47  ? -9.866  5.201   2.883   1.00 0.29  ? 47  LEU B HG   2  
ATOM 5670  H HD11 . LEU B 1 47  ? -8.630  4.803   0.791   1.00 1.00  ? 47  LEU B HD11 2  
ATOM 5671  H HD12 . LEU B 1 47  ? -8.933  6.480   0.323   1.00 0.94  ? 47  LEU B HD12 2  
ATOM 5672  H HD13 . LEU B 1 47  ? -10.282 5.361   0.522   1.00 0.95  ? 47  LEU B HD13 2  
ATOM 5673  H HD21 . LEU B 1 47  ? -7.423  5.411   2.829   1.00 0.92  ? 47  LEU B HD21 2  
ATOM 5674  H HD22 . LEU B 1 47  ? -8.149  6.510   4.003   1.00 1.01  ? 47  LEU B HD22 2  
ATOM 5675  H HD23 . LEU B 1 47  ? -7.584  7.128   2.451   1.00 1.12  ? 47  LEU B HD23 2  
ATOM 5676  N N    . ALA B 1 48  ? -12.091 9.193   5.008   1.00 0.32  ? 48  ALA B N    2  
ATOM 5677  C CA   . ALA B 1 48  ? -12.851 10.416  5.183   1.00 0.37  ? 48  ALA B CA   2  
ATOM 5678  C C    . ALA B 1 48  ? -11.942 11.638  5.215   1.00 0.39  ? 48  ALA B C    2  
ATOM 5679  O O    . ALA B 1 48  ? -12.363 12.740  4.866   1.00 0.44  ? 48  ALA B O    2  
ATOM 5680  C CB   . ALA B 1 48  ? -13.676 10.323  6.451   1.00 0.41  ? 48  ALA B CB   2  
ATOM 5681  H H    . ALA B 1 48  ? -12.187 8.478   5.672   1.00 0.34  ? 48  ALA B H    2  
ATOM 5682  H HA   . ALA B 1 48  ? -13.526 10.508  4.347   1.00 0.39  ? 48  ALA B HA   2  
ATOM 5683  H HB1  . ALA B 1 48  ? -14.278 11.209  6.556   1.00 1.06  ? 48  ALA B HB1  2  
ATOM 5684  H HB2  . ALA B 1 48  ? -13.019 10.225  7.303   1.00 1.14  ? 48  ALA B HB2  2  
ATOM 5685  H HB3  . ALA B 1 48  ? -14.320 9.454   6.390   1.00 1.02  ? 48  ALA B HB3  2  
ATOM 5686  N N    . ALA B 1 49  ? -10.698 11.428  5.623   1.00 0.38  ? 49  ALA B N    2  
ATOM 5687  C CA   . ALA B 1 49  ? -9.688  12.475  5.613   1.00 0.41  ? 49  ALA B CA   2  
ATOM 5688  C C    . ALA B 1 49  ? -9.522  13.052  4.215   1.00 0.41  ? 49  ALA B C    2  
ATOM 5689  O O    . ALA B 1 49  ? -9.450  14.266  4.032   1.00 0.47  ? 49  ALA B O    2  
ATOM 5690  C CB   . ALA B 1 49  ? -8.367  11.916  6.107   1.00 0.44  ? 49  ALA B CB   2  
ATOM 5691  H H    . ALA B 1 49  ? -10.450 10.535  5.949   1.00 0.37  ? 49  ALA B H    2  
ATOM 5692  H HA   . ALA B 1 49  ? -10.002 13.257  6.285   1.00 0.45  ? 49  ALA B HA   2  
ATOM 5693  H HB1  . ALA B 1 49  ? -7.610  12.683  6.059   1.00 1.15  ? 49  ALA B HB1  2  
ATOM 5694  H HB2  . ALA B 1 49  ? -8.078  11.079  5.481   1.00 1.10  ? 49  ALA B HB2  2  
ATOM 5695  H HB3  . ALA B 1 49  ? -8.478  11.580  7.126   1.00 1.07  ? 49  ALA B HB3  2  
ATOM 5696  N N    . PHE B 1 50  ? -9.465  12.167  3.238   1.00 0.36  ? 50  PHE B N    2  
ATOM 5697  C CA   . PHE B 1 50  ? -9.307  12.556  1.849   1.00 0.37  ? 50  PHE B CA   2  
ATOM 5698  C C    . PHE B 1 50  ? -10.665 12.858  1.224   1.00 0.38  ? 50  PHE B C    2  
ATOM 5699  O O    . PHE B 1 50  ? -10.871 13.910  0.617   1.00 0.44  ? 50  PHE B O    2  
ATOM 5700  C CB   . PHE B 1 50  ? -8.628  11.421  1.086   1.00 0.35  ? 50  PHE B CB   2  
ATOM 5701  C CG   . PHE B 1 50  ? -8.176  11.798  -0.297  1.00 0.70  ? 50  PHE B CG   2  
ATOM 5702  C CD1  . PHE B 1 50  ? -6.916  12.339  -0.503  1.00 1.63  ? 50  PHE B CD1  2  
ATOM 5703  C CD2  . PHE B 1 50  ? -9.008  11.613  -1.390  1.00 1.33  ? 50  PHE B CD2  2  
ATOM 5704  C CE1  . PHE B 1 50  ? -6.494  12.687  -1.771  1.00 2.10  ? 50  PHE B CE1  2  
ATOM 5705  C CE2  . PHE B 1 50  ? -8.591  11.960  -2.661  1.00 1.67  ? 50  PHE B CE2  2  
ATOM 5706  C CZ   . PHE B 1 50  ? -7.332  12.498  -2.852  1.00 1.80  ? 50  PHE B CZ   2  
ATOM 5707  H H    . PHE B 1 50  ? -9.535  11.213  3.460   1.00 0.32  ? 50  PHE B H    2  
ATOM 5708  H HA   . PHE B 1 50  ? -8.687  13.438  1.808   1.00 0.41  ? 50  PHE B HA   2  
ATOM 5709  H HB2  . PHE B 1 50  ? -7.763  11.092  1.643   1.00 0.61  ? 50  PHE B HB2  2  
ATOM 5710  H HB3  . PHE B 1 50  ? -9.326  10.599  0.999   1.00 0.56  ? 50  PHE B HB3  2  
ATOM 5711  H HD1  . PHE B 1 50  ? -6.259  12.488  0.342   1.00 2.27  ? 50  PHE B HD1  2  
ATOM 5712  H HD2  . PHE B 1 50  ? -9.991  11.193  -1.243  1.00 2.01  ? 50  PHE B HD2  2  
ATOM 5713  H HE1  . PHE B 1 50  ? -5.510  13.108  -1.917  1.00 2.96  ? 50  PHE B HE1  2  
ATOM 5714  H HE2  . PHE B 1 50  ? -9.248  11.811  -3.505  1.00 2.32  ? 50  PHE B HE2  2  
ATOM 5715  H HZ   . PHE B 1 50  ? -7.005  12.769  -3.844  1.00 2.24  ? 50  PHE B HZ   2  
ATOM 5716  N N    . THR B 1 51  ? -11.582 11.920  1.404   1.00 0.36  ? 51  THR B N    2  
ATOM 5717  C CA   . THR B 1 51  ? -12.901 11.959  0.791   1.00 0.40  ? 51  THR B CA   2  
ATOM 5718  C C    . THR B 1 51  ? -13.673 13.226  1.140   1.00 0.45  ? 51  THR B C    2  
ATOM 5719  O O    . THR B 1 51  ? -14.123 13.951  0.255   1.00 0.53  ? 51  THR B O    2  
ATOM 5720  C CB   . THR B 1 51  ? -13.707 10.735  1.246   1.00 0.39  ? 51  THR B CB   2  
ATOM 5721  O OG1  . THR B 1 51  ? -13.097 9.540   0.746   1.00 0.39  ? 51  THR B OG1  2  
ATOM 5722  C CG2  . THR B 1 51  ? -15.157 10.813  0.798   1.00 0.49  ? 51  THR B CG2  2  
ATOM 5723  H H    . THR B 1 51  ? -11.362 11.154  1.983   1.00 0.36  ? 51  THR B H    2  
ATOM 5724  H HA   . THR B 1 51  ? -12.776 11.903  -0.278  1.00 0.44  ? 51  THR B HA   2  
ATOM 5725  H HB   . THR B 1 51  ? -13.682 10.707  2.325   1.00 0.36  ? 51  THR B HB   2  
ATOM 5726  H HG1  . THR B 1 51  ? -13.002 8.906   1.468   1.00 0.41  ? 51  THR B HG1  2  
ATOM 5727  H HG21 . THR B 1 51  ? -15.653 9.880   1.017   1.00 1.13  ? 51  THR B HG21 2  
ATOM 5728  H HG22 . THR B 1 51  ? -15.200 11.006  -0.261  1.00 1.14  ? 51  THR B HG22 2  
ATOM 5729  H HG23 . THR B 1 51  ? -15.651 11.614  1.331   1.00 1.03  ? 51  THR B HG23 2  
ATOM 5730  N N    . LYS B 1 52  ? -13.807 13.497  2.428   1.00 0.47  ? 52  LYS B N    2  
ATOM 5731  C CA   . LYS B 1 52  ? -14.639 14.599  2.885   1.00 0.60  ? 52  LYS B CA   2  
ATOM 5732  C C    . LYS B 1 52  ? -13.939 15.926  2.684   1.00 0.69  ? 52  LYS B C    2  
ATOM 5733  O O    . LYS B 1 52  ? -14.543 16.991  2.812   1.00 0.84  ? 52  LYS B O    2  
ATOM 5734  C CB   . LYS B 1 52  ? -14.988 14.416  4.353   1.00 0.70  ? 52  LYS B CB   2  
ATOM 5735  C CG   . LYS B 1 52  ? -15.869 13.203  4.600   1.00 0.78  ? 52  LYS B CG   2  
ATOM 5736  C CD   . LYS B 1 52  ? -16.199 13.036  6.071   1.00 1.07  ? 52  LYS B CD   2  
ATOM 5737  C CE   . LYS B 1 52  ? -17.140 11.863  6.292   1.00 1.24  ? 52  LYS B CE   2  
ATOM 5738  N NZ   . LYS B 1 52  ? -18.510 12.143  5.785   1.00 1.82  ? 52  LYS B NZ   2  
ATOM 5739  H H    . LYS B 1 52  ? -13.322 12.954  3.087   1.00 0.45  ? 52  LYS B H    2  
ATOM 5740  H HA   . LYS B 1 52  ? -15.547 14.588  2.304   1.00 0.65  ? 52  LYS B HA   2  
ATOM 5741  H HB2  . LYS B 1 52  ? -14.069 14.300  4.914   1.00 0.71  ? 52  LYS B HB2  2  
ATOM 5742  H HB3  . LYS B 1 52  ? -15.508 15.295  4.702   1.00 0.79  ? 52  LYS B HB3  2  
ATOM 5743  H HG2  . LYS B 1 52  ? -16.788 13.321  4.048   1.00 1.34  ? 52  LYS B HG2  2  
ATOM 5744  H HG3  . LYS B 1 52  ? -15.350 12.321  4.253   1.00 1.23  ? 52  LYS B HG3  2  
ATOM 5745  H HD2  . LYS B 1 52  ? -15.286 12.863  6.619   1.00 1.64  ? 52  LYS B HD2  2  
ATOM 5746  H HD3  . LYS B 1 52  ? -16.670 13.938  6.429   1.00 1.63  ? 52  LYS B HD3  2  
ATOM 5747  H HE2  . LYS B 1 52  ? -16.745 11.002  5.770   1.00 1.50  ? 52  LYS B HE2  2  
ATOM 5748  H HE3  . LYS B 1 52  ? -17.190 11.650  7.349   1.00 1.67  ? 52  LYS B HE3  2  
ATOM 5749  H HZ1  . LYS B 1 52  ? -18.485 12.355  4.767   1.00 2.15  ? 52  LYS B HZ1  2  
ATOM 5750  H HZ2  . LYS B 1 52  ? -18.920 12.959  6.281   1.00 2.33  ? 52  LYS B HZ2  2  
ATOM 5751  H HZ3  . LYS B 1 52  ? -19.128 11.318  5.938   1.00 2.24  ? 52  LYS B HZ3  2  
ATOM 5752  N N    . ASN B 1 53  ? -12.664 15.856  2.360   1.00 0.68  ? 53  ASN B N    2  
ATOM 5753  C CA   . ASN B 1 53  ? -11.872 17.045  2.146   1.00 0.85  ? 53  ASN B CA   2  
ATOM 5754  C C    . ASN B 1 53  ? -12.212 17.651  0.789   1.00 1.00  ? 53  ASN B C    2  
ATOM 5755  O O    . ASN B 1 53  ? -12.046 18.851  0.568   1.00 1.22  ? 53  ASN B O    2  
ATOM 5756  C CB   . ASN B 1 53  ? -10.394 16.695  2.255   1.00 0.92  ? 53  ASN B CB   2  
ATOM 5757  C CG   . ASN B 1 53  ? -9.485  17.912  2.270   1.00 1.40  ? 53  ASN B CG   2  
ATOM 5758  O OD1  . ASN B 1 53  ? -8.348  17.850  1.803   1.00 1.93  ? 53  ASN B OD1  2  
ATOM 5759  N ND2  . ASN B 1 53  ? -9.964  19.021  2.814   1.00 2.05  ? 53  ASN B ND2  2  
ATOM 5760  H H    . ASN B 1 53  ? -12.246 14.975  2.256   1.00 0.63  ? 53  ASN B H    2  
ATOM 5761  H HA   . ASN B 1 53  ? -12.125 17.751  2.918   1.00 0.95  ? 53  ASN B HA   2  
ATOM 5762  H HB2  . ASN B 1 53  ? -10.243 16.141  3.172   1.00 1.05  ? 53  ASN B HB2  2  
ATOM 5763  H HB3  . ASN B 1 53  ? -10.121 16.074  1.418   1.00 1.23  ? 53  ASN B HB3  2  
ATOM 5764  H HD21 . ASN B 1 53  ? -10.875 19.007  3.179   1.00 2.35  ? 53  ASN B HD21 2  
ATOM 5765  H HD22 . ASN B 1 53  ? -9.385  19.814  2.835   1.00 2.52  ? 53  ASN B HD22 2  
ATOM 5766  N N    . GLN B 1 54  ? -12.705 16.811  -0.112  1.00 1.01  ? 54  GLN B N    2  
ATOM 5767  C CA   . GLN B 1 54  ? -13.249 17.282  -1.372  1.00 1.29  ? 54  GLN B CA   2  
ATOM 5768  C C    . GLN B 1 54  ? -14.769 17.248  -1.291  1.00 1.33  ? 54  GLN B C    2  
ATOM 5769  O O    . GLN B 1 54  ? -15.359 16.214  -0.979  1.00 2.05  ? 54  GLN B O    2  
ATOM 5770  C CB   . GLN B 1 54  ? -12.766 16.425  -2.543  1.00 1.74  ? 54  GLN B CB   2  
ATOM 5771  C CG   . GLN B 1 54  ? -13.074 17.039  -3.901  1.00 2.17  ? 54  GLN B CG   2  
ATOM 5772  C CD   . GLN B 1 54  ? -12.691 16.140  -5.057  1.00 2.39  ? 54  GLN B CD   2  
ATOM 5773  O OE1  . GLN B 1 54  ? -13.504 15.359  -5.548  1.00 2.90  ? 54  GLN B OE1  2  
ATOM 5774  N NE2  . GLN B 1 54  ? -11.448 16.243  -5.498  1.00 2.71  ? 54  GLN B NE2  2  
ATOM 5775  H H    . GLN B 1 54  ? -12.716 15.849  0.084   1.00 0.93  ? 54  GLN B H    2  
ATOM 5776  H HA   . GLN B 1 54  ? -12.927 18.304  -1.517  1.00 1.53  ? 54  GLN B HA   2  
ATOM 5777  H HB2  . GLN B 1 54  ? -11.695 16.293  -2.463  1.00 2.09  ? 54  GLN B HB2  2  
ATOM 5778  H HB3  . GLN B 1 54  ? -13.244 15.458  -2.490  1.00 2.20  ? 54  GLN B HB3  2  
ATOM 5779  H HG2  . GLN B 1 54  ? -14.133 17.238  -3.958  1.00 2.68  ? 54  GLN B HG2  2  
ATOM 5780  H HG3  . GLN B 1 54  ? -12.529 17.967  -3.991  1.00 2.59  ? 54  GLN B HG3  2  
ATOM 5781  H HE21 . GLN B 1 54  ? -10.851 16.889  -5.060  1.00 2.93  ? 54  GLN B HE21 2  
ATOM 5782  H HE22 . GLN B 1 54  ? -11.172 15.668  -6.242  1.00 3.06  ? 54  GLN B HE22 2  
ATOM 5783  N N    . LYS B 1 55  ? -15.404 18.373  -1.565  1.00 1.43  ? 55  LYS B N    2  
ATOM 5784  C CA   . LYS B 1 55  ? -16.844 18.501  -1.373  1.00 1.87  ? 55  LYS B CA   2  
ATOM 5785  C C    . LYS B 1 55  ? -17.612 17.991  -2.593  1.00 1.59  ? 55  LYS B C    2  
ATOM 5786  O O    . LYS B 1 55  ? -18.428 18.709  -3.177  1.00 2.27  ? 55  LYS B O    2  
ATOM 5787  C CB   . LYS B 1 55  ? -17.221 19.960  -1.071  1.00 2.84  ? 55  LYS B CB   2  
ATOM 5788  C CG   . LYS B 1 55  ? -16.701 20.484  0.268   1.00 3.60  ? 55  LYS B CG   2  
ATOM 5789  C CD   . LYS B 1 55  ? -15.197 20.728  0.243   1.00 4.28  ? 55  LYS B CD   2  
ATOM 5790  C CE   . LYS B 1 55  ? -14.661 21.129  1.610   1.00 5.02  ? 55  LYS B CE   2  
ATOM 5791  N NZ   . LYS B 1 55  ? -15.210 22.432  2.073   1.00 5.58  ? 55  LYS B NZ   2  
ATOM 5792  H H    . LYS B 1 55  ? -14.897 19.136  -1.917  1.00 1.82  ? 55  LYS B H    2  
ATOM 5793  H HA   . LYS B 1 55  ? -17.112 17.894  -0.523  1.00 2.27  ? 55  LYS B HA   2  
ATOM 5794  H HB2  . LYS B 1 55  ? -16.824 20.589  -1.853  1.00 3.16  ? 55  LYS B HB2  2  
ATOM 5795  H HB3  . LYS B 1 55  ? -18.298 20.045  -1.070  1.00 3.23  ? 55  LYS B HB3  2  
ATOM 5796  H HG2  . LYS B 1 55  ? -17.200 21.412  0.496   1.00 4.06  ? 55  LYS B HG2  2  
ATOM 5797  H HG3  . LYS B 1 55  ? -16.925 19.757  1.035   1.00 3.78  ? 55  LYS B HG3  2  
ATOM 5798  H HD2  . LYS B 1 55  ? -14.701 19.823  -0.072  1.00 4.58  ? 55  LYS B HD2  2  
ATOM 5799  H HD3  . LYS B 1 55  ? -14.985 21.519  -0.462  1.00 4.44  ? 55  LYS B HD3  2  
ATOM 5800  H HE2  . LYS B 1 55  ? -14.927 20.365  2.323   1.00 5.05  ? 55  LYS B HE2  2  
ATOM 5801  H HE3  . LYS B 1 55  ? -13.585 21.204  1.550   1.00 5.52  ? 55  LYS B HE3  2  
ATOM 5802  H HZ1  . LYS B 1 55  ? -14.804 22.681  2.998   1.00 5.86  ? 55  LYS B HZ1  2  
ATOM 5803  H HZ2  . LYS B 1 55  ? -16.243 22.375  2.166   1.00 5.76  ? 55  LYS B HZ2  2  
ATOM 5804  H HZ3  . LYS B 1 55  ? -14.977 23.183  1.391   1.00 5.87  ? 55  LYS B HZ3  2  
ATOM 5805  N N    . ASP B 1 56  ? -17.349 16.741  -2.963  1.00 1.36  ? 56  ASP B N    2  
ATOM 5806  C CA   . ASP B 1 56  ? -18.005 16.117  -4.107  1.00 1.50  ? 56  ASP B CA   2  
ATOM 5807  C C    . ASP B 1 56  ? -17.837 14.599  -4.062  1.00 1.27  ? 56  ASP B C    2  
ATOM 5808  O O    . ASP B 1 56  ? -16.740 14.085  -4.269  1.00 1.44  ? 56  ASP B O    2  
ATOM 5809  C CB   . ASP B 1 56  ? -17.431 16.672  -5.413  1.00 2.13  ? 56  ASP B CB   2  
ATOM 5810  C CG   . ASP B 1 56  ? -18.013 16.008  -6.646  1.00 2.84  ? 56  ASP B CG   2  
ATOM 5811  O OD1  . ASP B 1 56  ? -19.159 15.514  -6.588  1.00 3.44  ? 56  ASP B OD1  2  
ATOM 5812  O OD2  . ASP B 1 56  ? -17.329 15.998  -7.691  1.00 3.39  ? 56  ASP B OD2  2  
ATOM 5813  H H    . ASP B 1 56  ? -16.691 16.221  -2.449  1.00 1.71  ? 56  ASP B H    2  
ATOM 5814  H HA   . ASP B 1 56  ? -19.056 16.356  -4.056  1.00 1.84  ? 56  ASP B HA   2  
ATOM 5815  H HB2  . ASP B 1 56  ? -17.639 17.728  -5.468  1.00 2.43  ? 56  ASP B HB2  2  
ATOM 5816  H HB3  . ASP B 1 56  ? -16.361 16.520  -5.418  1.00 2.59  ? 56  ASP B HB3  2  
ATOM 5817  N N    . PRO B 1 57  ? -18.929 13.859  -3.799  1.00 1.06  ? 57  PRO B N    2  
ATOM 5818  C CA   . PRO B 1 57  ? -18.901 12.392  -3.694  1.00 1.02  ? 57  PRO B CA   2  
ATOM 5819  C C    . PRO B 1 57  ? -18.604 11.700  -5.022  1.00 0.76  ? 57  PRO B C    2  
ATOM 5820  O O    . PRO B 1 57  ? -18.400 10.485  -5.067  1.00 0.70  ? 57  PRO B O    2  
ATOM 5821  C CB   . PRO B 1 57  ? -20.310 12.038  -3.215  1.00 1.20  ? 57  PRO B CB   2  
ATOM 5822  C CG   . PRO B 1 57  ? -21.156 13.178  -3.657  1.00 1.20  ? 57  PRO B CG   2  
ATOM 5823  C CD   . PRO B 1 57  ? -20.279 14.394  -3.563  1.00 1.14  ? 57  PRO B CD   2  
ATOM 5824  H HA   . PRO B 1 57  ? -18.182 12.067  -2.962  1.00 1.22  ? 57  PRO B HA   2  
ATOM 5825  H HB2  . PRO B 1 57  ? -20.626 11.110  -3.671  1.00 1.21  ? 57  PRO B HB2  2  
ATOM 5826  H HB3  . PRO B 1 57  ? -20.314 11.937  -2.139  1.00 1.44  ? 57  PRO B HB3  2  
ATOM 5827  H HG2  . PRO B 1 57  ? -21.478 13.025  -4.677  1.00 1.14  ? 57  PRO B HG2  2  
ATOM 5828  H HG3  . PRO B 1 57  ? -22.009 13.279  -3.003  1.00 1.39  ? 57  PRO B HG3  2  
ATOM 5829  H HD2  . PRO B 1 57  ? -20.547 15.112  -4.322  1.00 1.16  ? 57  PRO B HD2  2  
ATOM 5830  H HD3  . PRO B 1 57  ? -20.349 14.834  -2.581  1.00 1.29  ? 57  PRO B HD3  2  
ATOM 5831  N N    . GLY B 1 58  ? -18.575 12.472  -6.101  1.00 0.67  ? 58  GLY B N    2  
ATOM 5832  C CA   . GLY B 1 58  ? -18.277 11.913  -7.404  1.00 0.56  ? 58  GLY B CA   2  
ATOM 5833  C C    . GLY B 1 58  ? -16.845 11.447  -7.514  1.00 0.49  ? 58  GLY B C    2  
ATOM 5834  O O    . GLY B 1 58  ? -16.493 10.715  -8.431  1.00 0.48  ? 58  GLY B O    2  
ATOM 5835  H H    . GLY B 1 58  ? -18.754 13.436  -6.009  1.00 0.74  ? 58  GLY B H    2  
ATOM 5836  H HA2  . GLY B 1 58  ? -18.932 11.072  -7.582  1.00 0.57  ? 58  GLY B HA2  2  
ATOM 5837  H HA3  . GLY B 1 58  ? -18.456 12.662  -8.158  1.00 0.60  ? 58  GLY B HA3  2  
ATOM 5838  N N    . VAL B 1 59  ? -16.017 11.859  -6.569  1.00 0.52  ? 59  VAL B N    2  
ATOM 5839  C CA   . VAL B 1 59  ? -14.610 11.496  -6.584  1.00 0.52  ? 59  VAL B CA   2  
ATOM 5840  C C    . VAL B 1 59  ? -14.411 10.012  -6.351  1.00 0.49  ? 59  VAL B C    2  
ATOM 5841  O O    . VAL B 1 59  ? -13.585 9.385   -7.010  1.00 0.49  ? 59  VAL B O    2  
ATOM 5842  C CB   . VAL B 1 59  ? -13.804 12.291  -5.539  1.00 0.61  ? 59  VAL B CB   2  
ATOM 5843  C CG1  . VAL B 1 59  ? -14.384 12.098  -4.146  1.00 0.65  ? 59  VAL B CG1  2  
ATOM 5844  C CG2  . VAL B 1 59  ? -12.343 11.879  -5.566  1.00 0.66  ? 59  VAL B CG2  2  
ATOM 5845  H H    . VAL B 1 59  ? -16.358 12.432  -5.848  1.00 0.58  ? 59  VAL B H    2  
ATOM 5846  H HA   . VAL B 1 59  ? -14.227 11.729  -7.564  1.00 0.53  ? 59  VAL B HA   2  
ATOM 5847  H HB   . VAL B 1 59  ? -13.870 13.336  -5.787  1.00 0.64  ? 59  VAL B HB   2  
ATOM 5848  H HG11 . VAL B 1 59  ? -15.371 12.530  -4.105  1.00 1.19  ? 59  VAL B HG11 2  
ATOM 5849  H HG12 . VAL B 1 59  ? -13.746 12.577  -3.418  1.00 1.14  ? 59  VAL B HG12 2  
ATOM 5850  H HG13 . VAL B 1 59  ? -14.446 11.041  -3.932  1.00 1.29  ? 59  VAL B HG13 2  
ATOM 5851  H HG21 . VAL B 1 59  ? -11.799 12.426  -4.811  1.00 1.21  ? 59  VAL B HG21 2  
ATOM 5852  H HG22 . VAL B 1 59  ? -11.927 12.093  -6.539  1.00 1.26  ? 59  VAL B HG22 2  
ATOM 5853  H HG23 . VAL B 1 59  ? -12.271 10.816  -5.367  1.00 1.19  ? 59  VAL B HG23 2  
ATOM 5854  N N    . LEU B 1 60  ? -15.171 9.441   -5.432  1.00 0.48  ? 60  LEU B N    2  
ATOM 5855  C CA   . LEU B 1 60  ? -15.048 8.021   -5.147  1.00 0.46  ? 60  LEU B CA   2  
ATOM 5856  C C    . LEU B 1 60  ? -15.476 7.238   -6.370  1.00 0.43  ? 60  LEU B C    2  
ATOM 5857  O O    . LEU B 1 60  ? -15.051 6.107   -6.598  1.00 0.41  ? 60  LEU B O    2  
ATOM 5858  C CB   . LEU B 1 60  ? -15.903 7.607   -3.956  1.00 0.48  ? 60  LEU B CB   2  
ATOM 5859  C CG   . LEU B 1 60  ? -15.939 8.598   -2.794  1.00 0.52  ? 60  LEU B CG   2  
ATOM 5860  C CD1  . LEU B 1 60  ? -16.763 8.042   -1.642  1.00 0.51  ? 60  LEU B CD1  2  
ATOM 5861  C CD2  . LEU B 1 60  ? -14.534 8.933   -2.334  1.00 0.52  ? 60  LEU B CD2  2  
ATOM 5862  H H    . LEU B 1 60  ? -15.815 9.987   -4.933  1.00 0.50  ? 60  LEU B H    2  
ATOM 5863  H HA   . LEU B 1 60  ? -14.009 7.817   -4.933  1.00 0.47  ? 60  LEU B HA   2  
ATOM 5864  H HB2  . LEU B 1 60  ? -16.915 7.446   -4.303  1.00 0.51  ? 60  LEU B HB2  2  
ATOM 5865  H HB3  . LEU B 1 60  ? -15.512 6.670   -3.589  1.00 0.49  ? 60  LEU B HB3  2  
ATOM 5866  H HG   . LEU B 1 60  ? -16.406 9.512   -3.127  1.00 0.57  ? 60  LEU B HG   2  
ATOM 5867  H HD11 . LEU B 1 60  ? -16.681 8.697   -0.784  1.00 1.00  ? 60  LEU B HD11 2  
ATOM 5868  H HD12 . LEU B 1 60  ? -16.399 7.060   -1.380  1.00 1.22  ? 60  LEU B HD12 2  
ATOM 5869  H HD13 . LEU B 1 60  ? -17.798 7.971   -1.941  1.00 1.18  ? 60  LEU B HD13 2  
ATOM 5870  H HD21 . LEU B 1 60  ? -14.056 8.040   -1.964  1.00 1.20  ? 60  LEU B HD21 2  
ATOM 5871  H HD22 . LEU B 1 60  ? -14.577 9.672   -1.550  1.00 1.11  ? 60  LEU B HD22 2  
ATOM 5872  H HD23 . LEU B 1 60  ? -13.969 9.323   -3.168  1.00 1.11  ? 60  LEU B HD23 2  
ATOM 5873  N N    . ASP B 1 61  ? -16.321 7.882   -7.160  1.00 0.46  ? 61  ASP B N    2  
ATOM 5874  C CA   . ASP B 1 61  ? -16.808 7.310   -8.402  1.00 0.46  ? 61  ASP B CA   2  
ATOM 5875  C C    . ASP B 1 61  ? -15.685 7.290   -9.420  1.00 0.47  ? 61  ASP B C    2  
ATOM 5876  O O    . ASP B 1 61  ? -15.525 6.338   -10.188 1.00 0.51  ? 61  ASP B O    2  
ATOM 5877  C CB   . ASP B 1 61  ? -17.984 8.131   -8.932  1.00 0.47  ? 61  ASP B CB   2  
ATOM 5878  C CG   . ASP B 1 61  ? -18.885 7.337   -9.860  1.00 0.48  ? 61  ASP B CG   2  
ATOM 5879  O OD1  . ASP B 1 61  ? -18.611 7.300   -11.077 1.00 1.19  ? 61  ASP B OD1  2  
ATOM 5880  O OD2  . ASP B 1 61  ? -19.880 6.753   -9.379  1.00 1.22  ? 61  ASP B OD2  2  
ATOM 5881  H H    . ASP B 1 61  ? -16.617 8.782   -6.897  1.00 0.49  ? 61  ASP B H    2  
ATOM 5882  H HA   . ASP B 1 61  ? -17.125 6.306   -8.209  1.00 0.48  ? 61  ASP B HA   2  
ATOM 5883  H HB2  . ASP B 1 61  ? -18.567 8.495   -8.099  1.00 0.48  ? 61  ASP B HB2  2  
ATOM 5884  H HB3  . ASP B 1 61  ? -17.595 8.976   -9.482  1.00 0.51  ? 61  ASP B HB3  2  
ATOM 5885  N N    . ARG B 1 62  ? -14.899 8.350   -9.395  1.00 0.47  ? 62  ARG B N    2  
ATOM 5886  C CA   . ARG B 1 62  ? -13.743 8.480   -10.262 1.00 0.51  ? 62  ARG B CA   2  
ATOM 5887  C C    . ARG B 1 62  ? -12.671 7.488   -9.847  1.00 0.50  ? 62  ARG B C    2  
ATOM 5888  O O    . ARG B 1 62  ? -12.048 6.856   -10.693 1.00 0.56  ? 62  ARG B O    2  
ATOM 5889  C CB   . ARG B 1 62  ? -13.212 9.909   -10.199 1.00 0.55  ? 62  ARG B CB   2  
ATOM 5890  C CG   . ARG B 1 62  ? -14.287 10.936  -10.489 1.00 0.55  ? 62  ARG B CG   2  
ATOM 5891  C CD   . ARG B 1 62  ? -13.815 12.351  -10.252 1.00 0.62  ? 62  ARG B CD   2  
ATOM 5892  N NE   . ARG B 1 62  ? -14.890 13.303  -10.509 1.00 1.45  ? 62  ARG B NE   2  
ATOM 5893  C CZ   . ARG B 1 62  ? -15.355 14.167  -9.611  1.00 1.97  ? 62  ARG B CZ   2  
ATOM 5894  N NH1  . ARG B 1 62  ? -14.741 14.327  -8.444  1.00 1.66  ? 62  ARG B NH1  2  
ATOM 5895  N NH2  . ARG B 1 62  ? -16.423 14.896  -9.893  1.00 3.02  ? 62  ARG B NH2  2  
ATOM 5896  H H    . ARG B 1 62  ? -15.106 9.077   -8.769  1.00 0.47  ? 62  ARG B H    2  
ATOM 5897  H HA   . ARG B 1 62  ? -14.056 8.261   -11.270 1.00 0.53  ? 62  ARG B HA   2  
ATOM 5898  H HB2  . ARG B 1 62  ? -12.815 10.095  -9.211  1.00 0.60  ? 62  ARG B HB2  2  
ATOM 5899  H HB3  . ARG B 1 62  ? -12.423 10.026  -10.927 1.00 0.59  ? 62  ARG B HB3  2  
ATOM 5900  H HG2  . ARG B 1 62  ? -14.591 10.844  -11.513 1.00 0.56  ? 62  ARG B HG2  2  
ATOM 5901  H HG3  . ARG B 1 62  ? -15.134 10.740  -9.847  1.00 0.56  ? 62  ARG B HG3  2  
ATOM 5902  H HD2  . ARG B 1 62  ? -13.498 12.439  -9.228  1.00 1.11  ? 62  ARG B HD2  2  
ATOM 5903  H HD3  . ARG B 1 62  ? -12.989 12.561  -10.911 1.00 0.98  ? 62  ARG B HD3  2  
ATOM 5904  H HE   . ARG B 1 62  ? -15.322 13.259  -11.393 1.00 1.91  ? 62  ARG B HE   2  
ATOM 5905  H HH11 . ARG B 1 62  ? -13.914 13.804  -8.230  1.00 1.23  ? 62  ARG B HH11 2  
ATOM 5906  H HH12 . ARG B 1 62  ? -15.105 14.977  -7.769  1.00 2.13  ? 62  ARG B HH12 2  
ATOM 5907  H HH21 . ARG B 1 62  ? -16.877 14.806  -10.782 1.00 3.45  ? 62  ARG B HH21 2  
ATOM 5908  H HH22 . ARG B 1 62  ? -16.796 15.533  -9.201  1.00 3.46  ? 62  ARG B HH22 2  
ATOM 5909  N N    . MET B 1 63  ? -12.475 7.344   -8.536  1.00 0.45  ? 63  MET B N    2  
ATOM 5910  C CA   . MET B 1 63  ? -11.538 6.356   -8.011  1.00 0.44  ? 63  MET B CA   2  
ATOM 5911  C C    . MET B 1 63  ? -11.923 4.985   -8.498  1.00 0.41  ? 63  MET B C    2  
ATOM 5912  O O    . MET B 1 63  ? -11.120 4.296   -9.112  1.00 0.42  ? 63  MET B O    2  
ATOM 5913  C CB   . MET B 1 63  ? -11.524 6.331   -6.487  1.00 0.43  ? 63  MET B CB   2  
ATOM 5914  C CG   . MET B 1 63  ? -11.255 7.677   -5.859  1.00 0.49  ? 63  MET B CG   2  
ATOM 5915  S SD   . MET B 1 63  ? -9.642  8.331   -6.344  1.00 0.63  ? 63  MET B SD   2  
ATOM 5916  C CE   . MET B 1 63  ? -9.517  9.773   -5.291  1.00 1.54  ? 63  MET B CE   2  
ATOM 5917  H H    . MET B 1 63  ? -12.968 7.923   -7.912  1.00 0.45  ? 63  MET B H    2  
ATOM 5918  H HA   . MET B 1 63  ? -10.552 6.599   -8.375  1.00 0.47  ? 63  MET B HA   2  
ATOM 5919  H HB2  . MET B 1 63  ? -12.476 5.966   -6.140  1.00 0.39  ? 63  MET B HB2  2  
ATOM 5920  H HB3  . MET B 1 63  ? -10.753 5.649   -6.163  1.00 0.45  ? 63  MET B HB3  2  
ATOM 5921  H HG2  . MET B 1 63  ? -12.029 8.361   -6.178  1.00 0.48  ? 63  MET B HG2  2  
ATOM 5922  H HG3  . MET B 1 63  ? -11.285 7.576   -4.785  1.00 0.54  ? 63  MET B HG3  2  
ATOM 5923  H HE1  . MET B 1 63  ? -8.562  10.251  -5.449  1.00 2.05  ? 63  MET B HE1  2  
ATOM 5924  H HE2  . MET B 1 63  ? -9.603  9.472   -4.258  1.00 2.05  ? 63  MET B HE2  2  
ATOM 5925  H HE3  . MET B 1 63  ? -10.309 10.465  -5.533  1.00 2.14  ? 63  MET B HE3  2  
ATOM 5926  N N    . MET B 1 64  ? -13.169 4.612   -8.223  1.00 0.41  ? 64  MET B N    2  
ATOM 5927  C CA   . MET B 1 64  ? -13.691 3.321   -8.625  1.00 0.42  ? 64  MET B CA   2  
ATOM 5928  C C    . MET B 1 64  ? -13.332 3.020   -10.066 1.00 0.44  ? 64  MET B C    2  
ATOM 5929  O O    . MET B 1 64  ? -12.665 2.042   -10.337 1.00 0.41  ? 64  MET B O    2  
ATOM 5930  C CB   . MET B 1 64  ? -15.210 3.271   -8.445  1.00 0.55  ? 64  MET B CB   2  
ATOM 5931  C CG   . MET B 1 64  ? -15.847 1.999   -8.984  1.00 0.65  ? 64  MET B CG   2  
ATOM 5932  S SD   . MET B 1 64  ? -15.168 0.501   -8.246  1.00 1.87  ? 64  MET B SD   2  
ATOM 5933  C CE   . MET B 1 64  ? -15.523 0.773   -6.513  1.00 2.41  ? 64  MET B CE   2  
ATOM 5934  H H    . MET B 1 64  ? -13.752 5.227   -7.725  1.00 0.42  ? 64  MET B H    2  
ATOM 5935  H HA   . MET B 1 64  ? -13.239 2.572   -7.992  1.00 0.41  ? 64  MET B HA   2  
ATOM 5936  H HB2  . MET B 1 64  ? -15.440 3.346   -7.393  1.00 0.60  ? 64  MET B HB2  2  
ATOM 5937  H HB3  . MET B 1 64  ? -15.647 4.113   -8.961  1.00 0.63  ? 64  MET B HB3  2  
ATOM 5938  H HG2  . MET B 1 64  ? -16.906 2.030   -8.783  1.00 1.29  ? 64  MET B HG2  2  
ATOM 5939  H HG3  . MET B 1 64  ? -15.688 1.959   -10.053 1.00 1.05  ? 64  MET B HG3  2  
ATOM 5940  H HE1  . MET B 1 64  ? -14.922 1.592   -6.147  1.00 2.83  ? 64  MET B HE1  2  
ATOM 5941  H HE2  . MET B 1 64  ? -15.293 -0.121  -5.953  1.00 2.83  ? 64  MET B HE2  2  
ATOM 5942  H HE3  . MET B 1 64  ? -16.566 1.013   -6.397  1.00 2.75  ? 64  MET B HE3  2  
ATOM 5943  N N    . LYS B 1 65  ? -13.712 3.894   -10.981 1.00 0.52  ? 65  LYS B N    2  
ATOM 5944  C CA   . LYS B 1 65  ? -13.523 3.593   -12.397 1.00 0.56  ? 65  LYS B CA   2  
ATOM 5945  C C    . LYS B 1 65  ? -12.074 3.782   -12.840 1.00 0.54  ? 65  LYS B C    2  
ATOM 5946  O O    . LYS B 1 65  ? -11.647 3.184   -13.826 1.00 0.60  ? 65  LYS B O    2  
ATOM 5947  C CB   . LYS B 1 65  ? -14.475 4.403   -13.275 1.00 0.67  ? 65  LYS B CB   2  
ATOM 5948  C CG   . LYS B 1 65  ? -15.937 4.005   -13.107 1.00 0.79  ? 65  LYS B CG   2  
ATOM 5949  C CD   . LYS B 1 65  ? -16.143 2.491   -13.214 1.00 0.86  ? 65  LYS B CD   2  
ATOM 5950  C CE   . LYS B 1 65  ? -15.631 1.928   -14.533 1.00 1.57  ? 65  LYS B CE   2  
ATOM 5951  N NZ   . LYS B 1 65  ? -15.819 0.453   -14.622 1.00 2.49  ? 65  LYS B NZ   2  
ATOM 5952  H H    . LYS B 1 65  ? -14.107 4.756   -10.700 1.00 0.56  ? 65  LYS B H    2  
ATOM 5953  H HA   . LYS B 1 65  ? -13.763 2.547   -12.522 1.00 0.59  ? 65  LYS B HA   2  
ATOM 5954  H HB2  . LYS B 1 65  ? -14.376 5.449   -13.025 1.00 0.75  ? 65  LYS B HB2  2  
ATOM 5955  H HB3  . LYS B 1 65  ? -14.202 4.261   -14.311 1.00 0.66  ? 65  LYS B HB3  2  
ATOM 5956  H HG2  . LYS B 1 65  ? -16.276 4.333   -12.135 1.00 0.86  ? 65  LYS B HG2  2  
ATOM 5957  H HG3  . LYS B 1 65  ? -16.520 4.493   -13.874 1.00 0.89  ? 65  LYS B HG3  2  
ATOM 5958  H HD2  . LYS B 1 65  ? -15.620 2.008   -12.403 1.00 1.29  ? 65  LYS B HD2  2  
ATOM 5959  H HD3  . LYS B 1 65  ? -17.200 2.279   -13.133 1.00 1.25  ? 65  LYS B HD3  2  
ATOM 5960  H HE2  . LYS B 1 65  ? -16.167 2.399   -15.343 1.00 1.92  ? 65  LYS B HE2  2  
ATOM 5961  H HE3  . LYS B 1 65  ? -14.578 2.153   -14.621 1.00 2.11  ? 65  LYS B HE3  2  
ATOM 5962  H HZ1  . LYS B 1 65  ? -16.820 0.209   -14.482 1.00 2.91  ? 65  LYS B HZ1  2  
ATOM 5963  H HZ2  . LYS B 1 65  ? -15.250 -0.035  -13.892 1.00 2.86  ? 65  LYS B HZ2  2  
ATOM 5964  H HZ3  . LYS B 1 65  ? -15.521 0.108   -15.557 1.00 3.01  ? 65  LYS B HZ3  2  
ATOM 5965  N N    . LYS B 1 66  ? -11.321 4.600   -12.121 1.00 0.50  ? 66  LYS B N    2  
ATOM 5966  C CA   . LYS B 1 66  ? -9.888  4.738   -12.372 1.00 0.52  ? 66  LYS B CA   2  
ATOM 5967  C C    . LYS B 1 66  ? -9.170  3.453   -11.994 1.00 0.48  ? 66  LYS B C    2  
ATOM 5968  O O    . LYS B 1 66  ? -8.341  2.933   -12.740 1.00 0.54  ? 66  LYS B O    2  
ATOM 5969  C CB   . LYS B 1 66  ? -9.303  5.890   -11.549 1.00 0.55  ? 66  LYS B CB   2  
ATOM 5970  C CG   . LYS B 1 66  ? -7.784  5.977   -11.610 1.00 0.91  ? 66  LYS B CG   2  
ATOM 5971  C CD   . LYS B 1 66  ? -7.244  7.104   -10.737 1.00 0.96  ? 66  LYS B CD   2  
ATOM 5972  C CE   . LYS B 1 66  ? -7.615  6.920   -9.269  1.00 0.73  ? 66  LYS B CE   2  
ATOM 5973  N NZ   . LYS B 1 66  ? -7.096  8.028   -8.425  1.00 1.47  ? 66  LYS B NZ   2  
ATOM 5974  H H    . LYS B 1 66  ? -11.736 5.134   -11.409 1.00 0.50  ? 66  LYS B H    2  
ATOM 5975  H HA   . LYS B 1 66  ? -9.743  4.935   -13.423 1.00 0.58  ? 66  LYS B HA   2  
ATOM 5976  H HB2  . LYS B 1 66  ? -9.711  6.822   -11.908 1.00 0.84  ? 66  LYS B HB2  2  
ATOM 5977  H HB3  . LYS B 1 66  ? -9.589  5.755   -10.515 1.00 0.87  ? 66  LYS B HB3  2  
ATOM 5978  H HG2  . LYS B 1 66  ? -7.367  5.039   -11.270 1.00 1.32  ? 66  LYS B HG2  2  
ATOM 5979  H HG3  . LYS B 1 66  ? -7.485  6.152   -12.634 1.00 1.31  ? 66  LYS B HG3  2  
ATOM 5980  H HD2  . LYS B 1 66  ? -6.168  7.125   -10.822 1.00 1.49  ? 66  LYS B HD2  2  
ATOM 5981  H HD3  . LYS B 1 66  ? -7.652  8.041   -11.086 1.00 1.60  ? 66  LYS B HD3  2  
ATOM 5982  H HE2  . LYS B 1 66  ? -8.689  6.893   -9.183  1.00 1.11  ? 66  LYS B HE2  2  
ATOM 5983  H HE3  . LYS B 1 66  ? -7.201  5.986   -8.916  1.00 0.98  ? 66  LYS B HE3  2  
ATOM 5984  H HZ1  . LYS B 1 66  ? -7.405  7.905   -7.438  1.00 2.03  ? 66  LYS B HZ1  2  
ATOM 5985  H HZ2  . LYS B 1 66  ? -7.447  8.940   -8.773  1.00 1.78  ? 66  LYS B HZ2  2  
ATOM 5986  H HZ3  . LYS B 1 66  ? -6.055  8.039   -8.448  1.00 2.01  ? 66  LYS B HZ3  2  
ATOM 5987  N N    . LEU B 1 67  ? -9.514  2.951   -10.825 1.00 0.41  ? 67  LEU B N    2  
ATOM 5988  C CA   . LEU B 1 67  ? -8.833  1.819   -10.238 1.00 0.39  ? 67  LEU B CA   2  
ATOM 5989  C C    . LEU B 1 67  ? -9.366  0.512   -10.784 1.00 0.40  ? 67  LEU B C    2  
ATOM 5990  O O    . LEU B 1 67  ? -8.591  -0.418  -10.983 1.00 0.46  ? 67  LEU B O    2  
ATOM 5991  C CB   . LEU B 1 67  ? -9.013  1.850   -8.734  1.00 0.34  ? 67  LEU B CB   2  
ATOM 5992  C CG   . LEU B 1 67  ? -8.652  3.183   -8.077  1.00 0.33  ? 67  LEU B CG   2  
ATOM 5993  C CD1  . LEU B 1 67  ? -9.161  3.230   -6.652  1.00 0.30  ? 67  LEU B CD1  2  
ATOM 5994  C CD2  . LEU B 1 67  ? -7.151  3.418   -8.125  1.00 0.37  ? 67  LEU B CD2  2  
ATOM 5995  H H    . LEU B 1 67  ? -10.262 3.363   -10.332 1.00 0.42  ? 67  LEU B H    2  
ATOM 5996  H HA   . LEU B 1 67  ? -7.787  1.898   -10.465 1.00 0.44  ? 67  LEU B HA   2  
ATOM 5997  H HB2  . LEU B 1 67  ? -10.047 1.627   -8.526  1.00 0.34  ? 67  LEU B HB2  2  
ATOM 5998  H HB3  . LEU B 1 67  ? -8.395  1.075   -8.297  1.00 0.35  ? 67  LEU B HB3  2  
ATOM 5999  H HG   . LEU B 1 67  ? -9.131  3.983   -8.625  1.00 0.36  ? 67  LEU B HG   2  
ATOM 6000  H HD11 . LEU B 1 67  ? -10.242 3.229   -6.658  1.00 1.06  ? 67  LEU B HD11 2  
ATOM 6001  H HD12 . LEU B 1 67  ? -8.807  4.131   -6.172  1.00 1.02  ? 67  LEU B HD12 2  
ATOM 6002  H HD13 . LEU B 1 67  ? -8.805  2.363   -6.115  1.00 1.06  ? 67  LEU B HD13 2  
ATOM 6003  H HD21 . LEU B 1 67  ? -6.835  3.510   -9.154  1.00 1.11  ? 67  LEU B HD21 2  
ATOM 6004  H HD22 . LEU B 1 67  ? -6.642  2.584   -7.664  1.00 1.06  ? 67  LEU B HD22 2  
ATOM 6005  H HD23 . LEU B 1 67  ? -6.910  4.326   -7.592  1.00 1.07  ? 67  LEU B HD23 2  
ATOM 6006  N N    . ASP B 1 68  ? -10.686 0.461   -11.013 1.00 0.39  ? 68  ASP B N    2  
ATOM 6007  C CA   . ASP B 1 68  ? -11.378 -0.736  -11.513 1.00 0.42  ? 68  ASP B CA   2  
ATOM 6008  C C    . ASP B 1 68  ? -10.842 -1.125  -12.874 1.00 0.52  ? 68  ASP B C    2  
ATOM 6009  O O    . ASP B 1 68  ? -11.437 -0.869  -13.923 1.00 0.57  ? 68  ASP B O    2  
ATOM 6010  C CB   . ASP B 1 68  ? -12.890 -0.491  -11.577 1.00 0.43  ? 68  ASP B CB   2  
ATOM 6011  C CG   . ASP B 1 68  ? -13.664 -1.602  -12.266 1.00 0.46  ? 68  ASP B CG   2  
ATOM 6012  O OD1  . ASP B 1 68  ? -13.403 -2.793  -11.996 1.00 1.13  ? 68  ASP B OD1  2  
ATOM 6013  O OD2  . ASP B 1 68  ? -14.540 -1.282  -13.098 1.00 1.23  ? 68  ASP B OD2  2  
ATOM 6014  H H    . ASP B 1 68  ? -11.224 1.265   -10.831 1.00 0.40  ? 68  ASP B H    2  
ATOM 6015  H HA   . ASP B 1 68  ? -11.182 -1.548  -10.819 1.00 0.41  ? 68  ASP B HA   2  
ATOM 6016  H HB2  . ASP B 1 68  ? -13.265 -0.388  -10.570 1.00 0.41  ? 68  ASP B HB2  2  
ATOM 6017  H HB3  . ASP B 1 68  ? -13.067 0.432   -12.111 1.00 0.47  ? 68  ASP B HB3  2  
ATOM 6018  N N    . THR B 1 69  ? -9.685  -1.716  -12.826 1.00 0.58  ? 69  THR B N    2  
ATOM 6019  C CA   . THR B 1 69  ? -8.995  -2.163  -14.001 1.00 0.74  ? 69  THR B CA   2  
ATOM 6020  C C    . THR B 1 69  ? -9.481  -3.551  -14.378 1.00 0.83  ? 69  THR B C    2  
ATOM 6021  O O    . THR B 1 69  ? -9.250  -4.041  -15.486 1.00 0.99  ? 69  THR B O    2  
ATOM 6022  C CB   . THR B 1 69  ? -7.485  -2.153  -13.739 1.00 0.79  ? 69  THR B CB   2  
ATOM 6023  O OG1  . THR B 1 69  ? -6.765  -2.138  -14.979 1.00 0.91  ? 69  THR B OG1  2  
ATOM 6024  C CG2  . THR B 1 69  ? -7.074  -3.363  -12.925 1.00 0.82  ? 69  THR B CG2  2  
ATOM 6025  H H    . THR B 1 69  ? -9.252  -1.821  -11.940 1.00 0.55  ? 69  THR B H    2  
ATOM 6026  H HA   . THR B 1 69  ? -9.214  -1.481  -14.801 1.00 0.80  ? 69  THR B HA   2  
ATOM 6027  H HB   . THR B 1 69  ? -7.256  -1.257  -13.165 1.00 0.76  ? 69  THR B HB   2  
ATOM 6028  H HG1  . THR B 1 69  ? -6.090  -1.452  -14.946 1.00 1.26  ? 69  THR B HG1  2  
ATOM 6029  H HG21 . THR B 1 69  ? -6.007  -3.353  -12.771 1.00 1.41  ? 69  THR B HG21 2  
ATOM 6030  H HG22 . THR B 1 69  ? -7.357  -4.263  -13.452 1.00 1.35  ? 69  THR B HG22 2  
ATOM 6031  H HG23 . THR B 1 69  ? -7.579  -3.337  -11.969 1.00 1.13  ? 69  THR B HG23 2  
ATOM 6032  N N    . ASN B 1 70  ? -10.182 -4.170  -13.440 1.00 0.80  ? 70  ASN B N    2  
ATOM 6033  C CA   . ASN B 1 70  ? -10.808 -5.453  -13.671 1.00 0.94  ? 70  ASN B CA   2  
ATOM 6034  C C    . ASN B 1 70  ? -12.071 -5.246  -14.489 1.00 0.86  ? 70  ASN B C    2  
ATOM 6035  O O    . ASN B 1 70  ? -12.615 -6.174  -15.087 1.00 0.98  ? 70  ASN B O    2  
ATOM 6036  C CB   . ASN B 1 70  ? -11.151 -6.091  -12.328 1.00 1.00  ? 70  ASN B CB   2  
ATOM 6037  C CG   . ASN B 1 70  ? -11.515 -7.559  -12.434 1.00 1.25  ? 70  ASN B CG   2  
ATOM 6038  O OD1  . ASN B 1 70  ? -12.672 -7.908  -12.668 1.00 1.46  ? 70  ASN B OD1  2  
ATOM 6039  N ND2  . ASN B 1 70  ? -10.538 -8.429  -12.236 1.00 1.66  ? 70  ASN B ND2  2  
ATOM 6040  H H    . ASN B 1 70  ? -10.274 -3.748  -12.559 1.00 0.72  ? 70  ASN B H    2  
ATOM 6041  H HA   . ASN B 1 70  ? -10.121 -6.086  -14.213 1.00 1.12  ? 70  ASN B HA   2  
ATOM 6042  H HB2  . ASN B 1 70  ? -10.300 -5.990  -11.677 1.00 1.07  ? 70  ASN B HB2  2  
ATOM 6043  H HB3  . ASN B 1 70  ? -11.988 -5.562  -11.895 1.00 0.89  ? 70  ASN B HB3  2  
ATOM 6044  H HD21 . ASN B 1 70  ? -9.641  -8.084  -12.031 1.00 1.93  ? 70  ASN B HD21 2  
ATOM 6045  H HD22 . ASN B 1 70  ? -10.748 -9.385  -12.303 1.00 1.85  ? 70  ASN B HD22 2  
ATOM 6046  N N    . SER B 1 71  ? -12.490 -3.981  -14.523 1.00 0.70  ? 71  SER B N    2  
ATOM 6047  C CA   . SER B 1 71  ? -13.656 -3.538  -15.266 1.00 0.66  ? 71  SER B CA   2  
ATOM 6048  C C    . SER B 1 71  ? -14.900 -4.278  -14.806 1.00 0.61  ? 71  SER B C    2  
ATOM 6049  O O    . SER B 1 71  ? -15.772 -4.619  -15.603 1.00 0.66  ? 71  SER B O    2  
ATOM 6050  C CB   . SER B 1 71  ? -13.433 -3.716  -16.768 1.00 0.82  ? 71  SER B CB   2  
ATOM 6051  O OG   . SER B 1 71  ? -12.252 -3.047  -17.187 1.00 1.48  ? 71  SER B OG   2  
ATOM 6052  H H    . SER B 1 71  ? -11.998 -3.315  -13.997 1.00 0.65  ? 71  SER B H    2  
ATOM 6053  H HA   . SER B 1 71  ? -13.787 -2.490  -15.052 1.00 0.61  ? 71  SER B HA   2  
ATOM 6054  H HB2  . SER B 1 71  ? -13.336 -4.768  -16.994 1.00 1.18  ? 71  SER B HB2  2  
ATOM 6055  H HB3  . SER B 1 71  ? -14.274 -3.307  -17.308 1.00 1.15  ? 71  SER B HB3  2  
ATOM 6056  H HG   . SER B 1 71  ? -11.494 -3.409  -16.709 1.00 2.03  ? 71  SER B HG   2  
ATOM 6057  N N    . ASP B 1 72  ? -14.975 -4.505  -13.507 1.00 0.58  ? 72  ASP B N    2  
ATOM 6058  C CA   . ASP B 1 72  ? -16.078 -5.246  -12.928 1.00 0.65  ? 72  ASP B CA   2  
ATOM 6059  C C    . ASP B 1 72  ? -17.007 -4.294  -12.192 1.00 0.56  ? 72  ASP B C    2  
ATOM 6060  O O    . ASP B 1 72  ? -18.165 -4.612  -11.933 1.00 0.66  ? 72  ASP B O    2  
ATOM 6061  C CB   . ASP B 1 72  ? -15.548 -6.317  -11.972 1.00 0.80  ? 72  ASP B CB   2  
ATOM 6062  C CG   . ASP B 1 72  ? -16.618 -7.299  -11.533 1.00 0.92  ? 72  ASP B CG   2  
ATOM 6063  O OD1  . ASP B 1 72  ? -16.850 -8.295  -12.255 1.00 1.56  ? 72  ASP B OD1  2  
ATOM 6064  O OD2  . ASP B 1 72  ? -17.217 -7.100  -10.459 1.00 1.53  ? 72  ASP B OD2  2  
ATOM 6065  H H    . ASP B 1 72  ? -14.272 -4.141  -12.916 1.00 0.56  ? 72  ASP B H    2  
ATOM 6066  H HA   . ASP B 1 72  ? -16.622 -5.721  -13.730 1.00 0.76  ? 72  ASP B HA   2  
ATOM 6067  H HB2  . ASP B 1 72  ? -14.761 -6.870  -12.464 1.00 1.15  ? 72  ASP B HB2  2  
ATOM 6068  H HB3  . ASP B 1 72  ? -15.145 -5.836  -11.092 1.00 1.00  ? 72  ASP B HB3  2  
ATOM 6069  N N    . GLY B 1 73  ? -16.500 -3.108  -11.886 1.00 0.45  ? 73  GLY B N    2  
ATOM 6070  C CA   . GLY B 1 73  ? -17.288 -2.135  -11.153 1.00 0.46  ? 73  GLY B CA   2  
ATOM 6071  C C    . GLY B 1 73  ? -17.026 -2.232  -9.672  1.00 0.41  ? 73  GLY B C    2  
ATOM 6072  O O    . GLY B 1 73  ? -17.750 -1.661  -8.854  1.00 0.44  ? 73  GLY B O    2  
ATOM 6073  H H    . GLY B 1 73  ? -15.568 -2.892  -12.149 1.00 0.42  ? 73  GLY B H    2  
ATOM 6074  H HA2  . GLY B 1 73  ? -17.031 -1.141  -11.493 1.00 0.48  ? 73  GLY B HA2  2  
ATOM 6075  H HA3  . GLY B 1 73  ? -18.335 -2.316  -11.339 1.00 0.55  ? 73  GLY B HA3  2  
ATOM 6076  N N    . GLN B 1 74  ? -15.988 -2.977  -9.340  1.00 0.38  ? 74  GLN B N    2  
ATOM 6077  C CA   . GLN B 1 74  ? -15.548 -3.152  -7.975  1.00 0.37  ? 74  GLN B CA   2  
ATOM 6078  C C    . GLN B 1 74  ? -14.045 -3.006  -7.944  1.00 0.36  ? 74  GLN B C    2  
ATOM 6079  O O    . GLN B 1 74  ? -13.394 -3.038  -8.987  1.00 0.39  ? 74  GLN B O    2  
ATOM 6080  C CB   . GLN B 1 74  ? -15.905 -4.542  -7.457  1.00 0.38  ? 74  GLN B CB   2  
ATOM 6081  C CG   . GLN B 1 74  ? -17.367 -4.905  -7.569  1.00 0.41  ? 74  GLN B CG   2  
ATOM 6082  C CD   . GLN B 1 74  ? -17.660 -6.275  -7.000  1.00 0.49  ? 74  GLN B CD   2  
ATOM 6083  O OE1  . GLN B 1 74  ? -17.948 -6.415  -5.817  1.00 1.02  ? 74  GLN B OE1  2  
ATOM 6084  N NE2  . GLN B 1 74  ? -17.585 -7.294  -7.837  1.00 1.25  ? 74  GLN B NE2  2  
ATOM 6085  H H    . GLN B 1 74  ? -15.474 -3.413  -10.050 1.00 0.39  ? 74  GLN B H    2  
ATOM 6086  H HA   . GLN B 1 74  ? -16.007 -2.394  -7.355  1.00 0.39  ? 74  GLN B HA   2  
ATOM 6087  H HB2  . GLN B 1 74  ? -15.340 -5.268  -8.017  1.00 0.39  ? 74  GLN B HB2  2  
ATOM 6088  H HB3  . GLN B 1 74  ? -15.618 -4.607  -6.418  1.00 0.38  ? 74  GLN B HB3  2  
ATOM 6089  H HG2  . GLN B 1 74  ? -17.947 -4.174  -7.034  1.00 0.42  ? 74  GLN B HG2  2  
ATOM 6090  H HG3  . GLN B 1 74  ? -17.644 -4.897  -8.610  1.00 0.44  ? 74  GLN B HG3  2  
ATOM 6091  H HE21 . GLN B 1 74  ? -17.345 -7.109  -8.780  1.00 1.91  ? 74  GLN B HE21 2  
ATOM 6092  H HE22 . GLN B 1 74  ? -17.772 -8.190  -7.493  1.00 1.32  ? 74  GLN B HE22 2  
ATOM 6093  N N    . LEU B 1 75  ? -13.489 -2.869  -6.766  1.00 0.33  ? 75  LEU B N    2  
ATOM 6094  C CA   . LEU B 1 75  ? -12.051 -2.795  -6.637  1.00 0.31  ? 75  LEU B CA   2  
ATOM 6095  C C    . LEU B 1 75  ? -11.525 -3.973  -5.874  1.00 0.32  ? 75  LEU B C    2  
ATOM 6096  O O    . LEU B 1 75  ? -11.846 -4.167  -4.706  1.00 0.32  ? 75  LEU B O    2  
ATOM 6097  C CB   . LEU B 1 75  ? -11.624 -1.511  -5.957  1.00 0.31  ? 75  LEU B CB   2  
ATOM 6098  C CG   . LEU B 1 75  ? -12.064 -0.248  -6.680  1.00 0.32  ? 75  LEU B CG   2  
ATOM 6099  C CD1  . LEU B 1 75  ? -11.554 0.979   -5.959  1.00 0.35  ? 75  LEU B CD1  2  
ATOM 6100  C CD2  . LEU B 1 75  ? -11.575 -0.272  -8.121  1.00 0.35  ? 75  LEU B CD2  2  
ATOM 6101  H H    . LEU B 1 75  ? -14.055 -2.815  -5.966  1.00 0.33  ? 75  LEU B H    2  
ATOM 6102  H HA   . LEU B 1 75  ? -11.629 -2.822  -7.630  1.00 0.33  ? 75  LEU B HA   2  
ATOM 6103  H HB2  . LEU B 1 75  ? -12.035 -1.505  -4.954  1.00 0.33  ? 75  LEU B HB2  2  
ATOM 6104  H HB3  . LEU B 1 75  ? -10.543 -1.508  -5.894  1.00 0.32  ? 75  LEU B HB3  2  
ATOM 6105  H HG   . LEU B 1 75  ? -13.144 -0.204  -6.694  1.00 0.36  ? 75  LEU B HG   2  
ATOM 6106  H HD11 . LEU B 1 75  ? -10.474 0.957   -5.928  1.00 1.08  ? 75  LEU B HD11 2  
ATOM 6107  H HD12 . LEU B 1 75  ? -11.943 0.992   -4.950  1.00 0.98  ? 75  LEU B HD12 2  
ATOM 6108  H HD13 . LEU B 1 75  ? -11.880 1.866   -6.480  1.00 1.09  ? 75  LEU B HD13 2  
ATOM 6109  H HD21 . LEU B 1 75  ? -10.494 -0.269  -8.141  1.00 1.10  ? 75  LEU B HD21 2  
ATOM 6110  H HD22 . LEU B 1 75  ? -11.946 0.598   -8.644  1.00 1.05  ? 75  LEU B HD22 2  
ATOM 6111  H HD23 . LEU B 1 75  ? -11.936 -1.166  -8.610  1.00 1.06  ? 75  LEU B HD23 2  
ATOM 6112  N N    . ASP B 1 76  ? -10.720 -4.758  -6.544  1.00 0.35  ? 76  ASP B N    2  
ATOM 6113  C CA   . ASP B 1 76  ? -10.117 -5.909  -5.921  1.00 0.36  ? 76  ASP B CA   2  
ATOM 6114  C C    . ASP B 1 76  ? -8.908  -5.478  -5.126  1.00 0.33  ? 76  ASP B C    2  
ATOM 6115  O O    . ASP B 1 76  ? -8.650  -4.285  -4.973  1.00 0.32  ? 76  ASP B O    2  
ATOM 6116  C CB   . ASP B 1 76  ? -9.789  -6.979  -6.970  1.00 0.44  ? 76  ASP B CB   2  
ATOM 6117  C CG   . ASP B 1 76  ? -8.373  -6.952  -7.533  1.00 0.91  ? 76  ASP B CG   2  
ATOM 6118  O OD1  . ASP B 1 76  ? -7.740  -5.883  -7.557  1.00 1.44  ? 76  ASP B OD1  2  
ATOM 6119  O OD2  . ASP B 1 76  ? -7.892  -8.025  -7.967  1.00 1.68  ? 76  ASP B OD2  2  
ATOM 6120  H H    . ASP B 1 76  ? -10.513 -4.550  -7.482  1.00 0.41  ? 76  ASP B H    2  
ATOM 6121  H HA   . ASP B 1 76  ? -10.831 -6.320  -5.223  1.00 0.37  ? 76  ASP B HA   2  
ATOM 6122  H HB2  . ASP B 1 76  ? -9.938  -7.943  -6.511  1.00 0.74  ? 76  ASP B HB2  2  
ATOM 6123  H HB3  . ASP B 1 76  ? -10.484 -6.861  -7.804  1.00 0.64  ? 76  ASP B HB3  2  
ATOM 6124  N N    . PHE B 1 77  ? -8.192  -6.436  -4.604  1.00 0.40  ? 77  PHE B N    2  
ATOM 6125  C CA   . PHE B 1 77  ? -7.077  -6.158  -3.737  1.00 0.49  ? 77  PHE B CA   2  
ATOM 6126  C C    . PHE B 1 77  ? -6.025  -5.282  -4.410  1.00 0.39  ? 77  PHE B C    2  
ATOM 6127  O O    . PHE B 1 77  ? -5.577  -4.297  -3.832  1.00 0.38  ? 77  PHE B O    2  
ATOM 6128  C CB   . PHE B 1 77  ? -6.507  -7.472  -3.230  1.00 0.72  ? 77  PHE B CB   2  
ATOM 6129  C CG   . PHE B 1 77  ? -6.215  -8.510  -4.278  1.00 1.75  ? 77  PHE B CG   2  
ATOM 6130  C CD1  . PHE B 1 77  ? -7.221  -9.333  -4.755  1.00 2.66  ? 77  PHE B CD1  2  
ATOM 6131  C CD2  . PHE B 1 77  ? -4.932  -8.681  -4.763  1.00 2.56  ? 77  PHE B CD2  2  
ATOM 6132  C CE1  . PHE B 1 77  ? -6.952  -10.303 -5.698  1.00 3.77  ? 77  PHE B CE1  2  
ATOM 6133  C CE2  . PHE B 1 77  ? -4.657  -9.647  -5.709  1.00 3.67  ? 77  PHE B CE2  2  
ATOM 6134  C CZ   . PHE B 1 77  ? -5.669  -10.460 -6.176  1.00 4.14  ? 77  PHE B CZ   2  
ATOM 6135  H H    . PHE B 1 77  ? -8.419  -7.364  -4.814  1.00 0.47  ? 77  PHE B H    2  
ATOM 6136  H HA   . PHE B 1 77  ? -7.467  -5.614  -2.889  1.00 0.56  ? 77  PHE B HA   2  
ATOM 6137  H HB2  . PHE B 1 77  ? -5.596  -7.278  -2.701  1.00 1.26  ? 77  PHE B HB2  2  
ATOM 6138  H HB3  . PHE B 1 77  ? -7.232  -7.890  -2.559  1.00 0.99  ? 77  PHE B HB3  2  
ATOM 6139  H HD1  . PHE B 1 77  ? -8.227  -9.208  -4.384  1.00 2.85  ? 77  PHE B HD1  2  
ATOM 6140  H HD2  . PHE B 1 77  ? -4.143  -8.048  -4.395  1.00 2.71  ? 77  PHE B HD2  2  
ATOM 6141  H HE1  . PHE B 1 77  ? -7.746  -10.938 -6.060  1.00 4.58  ? 77  PHE B HE1  2  
ATOM 6142  H HE2  . PHE B 1 77  ? -3.649  -9.768  -6.081  1.00 4.42  ? 77  PHE B HE2  2  
ATOM 6143  H HZ   . PHE B 1 77  ? -5.456  -11.219 -6.914  1.00 5.09  ? 77  PHE B HZ   2  
ATOM 6144  N N    . SER B 1 78  ? -5.665  -5.617  -5.633  1.00 0.38  ? 78  SER B N    2  
ATOM 6145  C CA   . SER B 1 78  ? -4.728  -4.812  -6.401  1.00 0.38  ? 78  SER B CA   2  
ATOM 6146  C C    . SER B 1 78  ? -5.328  -3.453  -6.748  1.00 0.38  ? 78  SER B C    2  
ATOM 6147  O O    . SER B 1 78  ? -4.633  -2.436  -6.754  1.00 0.44  ? 78  SER B O    2  
ATOM 6148  C CB   . SER B 1 78  ? -4.331  -5.556  -7.673  1.00 0.44  ? 78  SER B CB   2  
ATOM 6149  O OG   . SER B 1 78  ? -5.257  -6.586  -7.970  1.00 1.32  ? 78  SER B OG   2  
ATOM 6150  H H    . SER B 1 78  ? -6.042  -6.423  -6.037  1.00 0.44  ? 78  SER B H    2  
ATOM 6151  H HA   . SER B 1 78  ? -3.848  -4.659  -5.795  1.00 0.40  ? 78  SER B HA   2  
ATOM 6152  H HB2  . SER B 1 78  ? -4.307  -4.862  -8.499  1.00 1.06  ? 78  SER B HB2  2  
ATOM 6153  H HB3  . SER B 1 78  ? -3.352  -5.994  -7.542  1.00 0.94  ? 78  SER B HB3  2  
ATOM 6154  H HG   . SER B 1 78  ? -6.159  -6.212  -8.011  1.00 1.76  ? 78  SER B HG   2  
ATOM 6155  N N    . GLU B 1 79  ? -6.625  -3.438  -7.011  1.00 0.36  ? 79  GLU B N    2  
ATOM 6156  C CA   . GLU B 1 79  ? -7.320  -2.216  -7.389  1.00 0.42  ? 79  GLU B CA   2  
ATOM 6157  C C    . GLU B 1 79  ? -7.374  -1.252  -6.209  1.00 0.33  ? 79  GLU B C    2  
ATOM 6158  O O    . GLU B 1 79  ? -7.119  -0.053  -6.348  1.00 0.33  ? 79  GLU B O    2  
ATOM 6159  C CB   . GLU B 1 79  ? -8.732  -2.543  -7.872  1.00 0.51  ? 79  GLU B CB   2  
ATOM 6160  C CG   . GLU B 1 79  ? -8.843  -2.817  -9.366  1.00 0.64  ? 79  GLU B CG   2  
ATOM 6161  C CD   . GLU B 1 79  ? -8.019  -3.993  -9.846  1.00 1.81  ? 79  GLU B CD   2  
ATOM 6162  O OE1  . GLU B 1 79  ? -6.773  -3.896  -9.851  1.00 2.54  ? 79  GLU B OE1  2  
ATOM 6163  O OE2  . GLU B 1 79  ? -8.620  -5.007  -10.257 1.00 2.57  ? 79  GLU B OE2  2  
ATOM 6164  H H    . GLU B 1 79  ? -7.140  -4.283  -6.945  1.00 0.34  ? 79  GLU B H    2  
ATOM 6165  H HA   . GLU B 1 79  ? -6.768  -1.754  -8.193  1.00 0.51  ? 79  GLU B HA   2  
ATOM 6166  H HB2  . GLU B 1 79  ? -9.080  -3.419  -7.347  1.00 0.48  ? 79  GLU B HB2  2  
ATOM 6167  H HB3  . GLU B 1 79  ? -9.377  -1.715  -7.633  1.00 0.60  ? 79  GLU B HB3  2  
ATOM 6168  H HG2  . GLU B 1 79  ? -9.877  -3.011  -9.603  1.00 0.89  ? 79  GLU B HG2  2  
ATOM 6169  H HG3  . GLU B 1 79  ? -8.519  -1.934  -9.899  1.00 1.04  ? 79  GLU B HG3  2  
ATOM 6170  N N    . PHE B 1 80  ? -7.690  -1.799  -5.049  1.00 0.28  ? 80  PHE B N    2  
ATOM 6171  C CA   . PHE B 1 80  ? -7.715  -1.047  -3.804  1.00 0.25  ? 80  PHE B CA   2  
ATOM 6172  C C    . PHE B 1 80  ? -6.328  -0.518  -3.470  1.00 0.23  ? 80  PHE B C    2  
ATOM 6173  O O    . PHE B 1 80  ? -6.175  0.582   -2.948  1.00 0.26  ? 80  PHE B O    2  
ATOM 6174  C CB   . PHE B 1 80  ? -8.207  -1.953  -2.679  1.00 0.31  ? 80  PHE B CB   2  
ATOM 6175  C CG   . PHE B 1 80  ? -8.094  -1.347  -1.315  1.00 0.71  ? 80  PHE B CG   2  
ATOM 6176  C CD1  . PHE B 1 80  ? -8.899  -0.287  -0.946  1.00 1.26  ? 80  PHE B CD1  2  
ATOM 6177  C CD2  . PHE B 1 80  ? -7.178  -1.843  -0.403  1.00 1.60  ? 80  PHE B CD2  2  
ATOM 6178  C CE1  . PHE B 1 80  ? -8.791  0.269   0.309   1.00 1.56  ? 80  PHE B CE1  2  
ATOM 6179  C CE2  . PHE B 1 80  ? -7.067  -1.290  0.855   1.00 1.98  ? 80  PHE B CE2  2  
ATOM 6180  C CZ   . PHE B 1 80  ? -7.875  -0.232  1.211   1.00 1.64  ? 80  PHE B CZ   2  
ATOM 6181  H H    . PHE B 1 80  ? -7.923  -2.757  -5.028  1.00 0.28  ? 80  PHE B H    2  
ATOM 6182  H HA   . PHE B 1 80  ? -8.397  -0.215  -3.917  1.00 0.29  ? 80  PHE B HA   2  
ATOM 6183  H HB2  . PHE B 1 80  ? -9.244  -2.199  -2.849  1.00 0.38  ? 80  PHE B HB2  2  
ATOM 6184  H HB3  . PHE B 1 80  ? -7.620  -2.859  -2.685  1.00 0.47  ? 80  PHE B HB3  2  
ATOM 6185  H HD1  . PHE B 1 80  ? -9.617  0.106   -1.650  1.00 1.92  ? 80  PHE B HD1  2  
ATOM 6186  H HD2  . PHE B 1 80  ? -6.546  -2.673  -0.684  1.00 2.25  ? 80  PHE B HD2  2  
ATOM 6187  H HE1  . PHE B 1 80  ? -9.425  1.097   0.588   1.00 2.20  ? 80  PHE B HE1  2  
ATOM 6188  H HE2  . PHE B 1 80  ? -6.349  -1.684  1.559   1.00 2.80  ? 80  PHE B HE2  2  
ATOM 6189  H HZ   . PHE B 1 80  ? -7.790  0.205   2.194   1.00 2.01  ? 80  PHE B HZ   2  
ATOM 6190  N N    . LEU B 1 81  ? -5.319  -1.308  -3.776  1.00 0.25  ? 81  LEU B N    2  
ATOM 6191  C CA   . LEU B 1 81  ? -3.952  -0.933  -3.472  1.00 0.26  ? 81  LEU B CA   2  
ATOM 6192  C C    . LEU B 1 81  ? -3.422  0.082   -4.463  1.00 0.26  ? 81  LEU B C    2  
ATOM 6193  O O    . LEU B 1 81  ? -2.493  0.822   -4.158  1.00 0.27  ? 81  LEU B O    2  
ATOM 6194  C CB   . LEU B 1 81  ? -3.070  -2.161  -3.449  1.00 0.29  ? 81  LEU B CB   2  
ATOM 6195  C CG   . LEU B 1 81  ? -3.382  -3.130  -2.312  1.00 0.28  ? 81  LEU B CG   2  
ATOM 6196  C CD1  . LEU B 1 81  ? -2.542  -4.376  -2.452  1.00 0.33  ? 81  LEU B CD1  2  
ATOM 6197  C CD2  . LEU B 1 81  ? -3.171  -2.470  -0.946  1.00 0.29  ? 81  LEU B CD2  2  
ATOM 6198  H H    . LEU B 1 81  ? -5.498  -2.172  -4.206  1.00 0.27  ? 81  LEU B H    2  
ATOM 6199  H HA   . LEU B 1 81  ? -3.948  -0.487  -2.490  1.00 0.26  ? 81  LEU B HA   2  
ATOM 6200  H HB2  . LEU B 1 81  ? -3.196  -2.686  -4.391  1.00 0.31  ? 81  LEU B HB2  2  
ATOM 6201  H HB3  . LEU B 1 81  ? -2.041  -1.840  -3.364  1.00 0.31  ? 81  LEU B HB3  2  
ATOM 6202  H HG   . LEU B 1 81  ? -4.419  -3.427  -2.384  1.00 0.28  ? 81  LEU B HG   2  
ATOM 6203  H HD11 . LEU B 1 81  ? -2.807  -5.076  -1.674  1.00 1.05  ? 81  LEU B HD11 2  
ATOM 6204  H HD12 . LEU B 1 81  ? -1.499  -4.114  -2.368  1.00 1.03  ? 81  LEU B HD12 2  
ATOM 6205  H HD13 . LEU B 1 81  ? -2.724  -4.826  -3.417  1.00 1.12  ? 81  LEU B HD13 2  
ATOM 6206  H HD21 . LEU B 1 81  ? -3.856  -1.639  -0.831  1.00 0.94  ? 81  LEU B HD21 2  
ATOM 6207  H HD22 . LEU B 1 81  ? -2.157  -2.108  -0.870  1.00 0.98  ? 81  LEU B HD22 2  
ATOM 6208  H HD23 . LEU B 1 81  ? -3.352  -3.190  -0.159  1.00 0.98  ? 81  LEU B HD23 2  
ATOM 6209  N N    . ASN B 1 82  ? -4.009  0.118   -5.648  1.00 0.26  ? 82  ASN B N    2  
ATOM 6210  C CA   . ASN B 1 82  ? -3.695  1.166   -6.601  1.00 0.26  ? 82  ASN B CA   2  
ATOM 6211  C C    . ASN B 1 82  ? -4.199  2.490   -6.056  1.00 0.23  ? 82  ASN B C    2  
ATOM 6212  O O    . ASN B 1 82  ? -3.599  3.545   -6.259  1.00 0.24  ? 82  ASN B O    2  
ATOM 6213  C CB   . ASN B 1 82  ? -4.328  0.878   -7.963  1.00 0.30  ? 82  ASN B CB   2  
ATOM 6214  C CG   . ASN B 1 82  ? -3.391  0.140   -8.903  1.00 0.78  ? 82  ASN B CG   2  
ATOM 6215  O OD1  . ASN B 1 82  ? -2.634  0.758   -9.653  1.00 1.50  ? 82  ASN B OD1  2  
ATOM 6216  N ND2  . ASN B 1 82  ? -3.428  -1.182  -8.867  1.00 1.42  ? 82  ASN B ND2  2  
ATOM 6217  H H    . ASN B 1 82  ? -4.662  -0.573  -5.887  1.00 0.28  ? 82  ASN B H    2  
ATOM 6218  H HA   . ASN B 1 82  ? -2.620  1.206   -6.699  1.00 0.30  ? 82  ASN B HA   2  
ATOM 6219  H HB2  . ASN B 1 82  ? -5.210  0.272   -7.816  1.00 0.58  ? 82  ASN B HB2  2  
ATOM 6220  H HB3  . ASN B 1 82  ? -4.615  1.811   -8.422  1.00 0.65  ? 82  ASN B HB3  2  
ATOM 6221  H HD21 . ASN B 1 82  ? -4.050  -1.615  -8.238  1.00 1.90  ? 82  ASN B HD21 2  
ATOM 6222  H HD22 . ASN B 1 82  ? -2.842  -1.678  -9.474  1.00 1.75  ? 82  ASN B HD22 2  
ATOM 6223  N N    . LEU B 1 83  ? -5.319  2.409   -5.358  1.00 0.23  ? 83  LEU B N    2  
ATOM 6224  C CA   . LEU B 1 83  ? -5.848  3.528   -4.606  1.00 0.24  ? 83  LEU B CA   2  
ATOM 6225  C C    . LEU B 1 83  ? -4.896  3.919   -3.491  1.00 0.23  ? 83  LEU B C    2  
ATOM 6226  O O    . LEU B 1 83  ? -4.474  5.071   -3.393  1.00 0.25  ? 83  LEU B O    2  
ATOM 6227  C CB   . LEU B 1 83  ? -7.182  3.149   -3.991  1.00 0.27  ? 83  LEU B CB   2  
ATOM 6228  C CG   . LEU B 1 83  ? -7.558  3.975   -2.774  1.00 0.31  ? 83  LEU B CG   2  
ATOM 6229  C CD1  . LEU B 1 83  ? -7.938  5.388   -3.191  1.00 0.35  ? 83  LEU B CD1  2  
ATOM 6230  C CD2  . LEU B 1 83  ? -8.671  3.301   -1.997  1.00 0.36  ? 83  LEU B CD2  2  
ATOM 6231  H H    . LEU B 1 83  ? -5.811  1.560   -5.353  1.00 0.24  ? 83  LEU B H    2  
ATOM 6232  H HA   . LEU B 1 83  ? -5.984  4.363   -5.276  1.00 0.25  ? 83  LEU B HA   2  
ATOM 6233  H HB2  . LEU B 1 83  ? -7.944  3.269   -4.741  1.00 0.30  ? 83  LEU B HB2  2  
ATOM 6234  H HB3  . LEU B 1 83  ? -7.141  2.111   -3.699  1.00 0.28  ? 83  LEU B HB3  2  
ATOM 6235  H HG   . LEU B 1 83  ? -6.691  4.037   -2.128  1.00 0.30  ? 83  LEU B HG   2  
ATOM 6236  H HD11 . LEU B 1 83  ? -8.204  5.964   -2.317  1.00 1.01  ? 83  LEU B HD11 2  
ATOM 6237  H HD12 . LEU B 1 83  ? -8.777  5.352   -3.869  1.00 1.02  ? 83  LEU B HD12 2  
ATOM 6238  H HD13 . LEU B 1 83  ? -7.092  5.852   -3.684  1.00 1.12  ? 83  LEU B HD13 2  
ATOM 6239  H HD21 . LEU B 1 83  ? -9.563  3.275   -2.598  1.00 1.09  ? 83  LEU B HD21 2  
ATOM 6240  H HD22 . LEU B 1 83  ? -8.860  3.852   -1.088  1.00 1.01  ? 83  LEU B HD22 2  
ATOM 6241  H HD23 . LEU B 1 83  ? -8.372  2.290   -1.751  1.00 1.14  ? 83  LEU B HD23 2  
ATOM 6242  N N    . ILE B 1 84  ? -4.591  2.942   -2.643  1.00 0.24  ? 84  ILE B N    2  
ATOM 6243  C CA   . ILE B 1 84  ? -3.681  3.133   -1.526  1.00 0.26  ? 84  ILE B CA   2  
ATOM 6244  C C    . ILE B 1 84  ? -2.373  3.746   -2.009  1.00 0.27  ? 84  ILE B C    2  
ATOM 6245  O O    . ILE B 1 84  ? -1.768  4.573   -1.325  1.00 0.29  ? 84  ILE B O    2  
ATOM 6246  C CB   . ILE B 1 84  ? -3.418  1.791   -0.808  1.00 0.29  ? 84  ILE B CB   2  
ATOM 6247  C CG1  . ILE B 1 84  ? -4.710  1.263   -0.176  1.00 0.55  ? 84  ILE B CG1  2  
ATOM 6248  C CG2  . ILE B 1 84  ? -2.319  1.925   0.240   1.00 0.47  ? 84  ILE B CG2  2  
ATOM 6249  C CD1  . ILE B 1 84  ? -5.389  2.250   0.747   1.00 0.62  ? 84  ILE B CD1  2  
ATOM 6250  H H    . ILE B 1 84  ? -5.001  2.059   -2.775  1.00 0.25  ? 84  ILE B H    2  
ATOM 6251  H HA   . ILE B 1 84  ? -4.145  3.809   -0.826  1.00 0.28  ? 84  ILE B HA   2  
ATOM 6252  H HB   . ILE B 1 84  ? -3.091  1.081   -1.550  1.00 0.29  ? 84  ILE B HB   2  
ATOM 6253  H HG12 . ILE B 1 84  ? -5.408  1.010   -0.960  1.00 1.22  ? 84  ILE B HG12 2  
ATOM 6254  H HG13 . ILE B 1 84  ? -4.484  0.374   0.396   1.00 1.29  ? 84  ILE B HG13 2  
ATOM 6255  H HG21 . ILE B 1 84  ? -1.403  2.240   -0.237  1.00 1.12  ? 84  ILE B HG21 2  
ATOM 6256  H HG22 . ILE B 1 84  ? -2.165  0.974   0.724   1.00 1.09  ? 84  ILE B HG22 2  
ATOM 6257  H HG23 . ILE B 1 84  ? -2.612  2.660   0.976   1.00 1.17  ? 84  ILE B HG23 2  
ATOM 6258  H HD11 . ILE B 1 84  ? -6.233  1.773   1.223   1.00 1.22  ? 84  ILE B HD11 2  
ATOM 6259  H HD12 . ILE B 1 84  ? -5.733  3.098   0.176   1.00 1.15  ? 84  ILE B HD12 2  
ATOM 6260  H HD13 . ILE B 1 84  ? -4.690  2.581   1.500   1.00 1.30  ? 84  ILE B HD13 2  
ATOM 6261  N N    . GLY B 1 85  ? -1.971  3.356   -3.211  1.00 0.26  ? 85  GLY B N    2  
ATOM 6262  C CA   . GLY B 1 85  ? -0.824  3.944   -3.842  1.00 0.29  ? 85  GLY B CA   2  
ATOM 6263  C C    . GLY B 1 85  ? -1.021  5.421   -4.068  1.00 0.28  ? 85  GLY B C    2  
ATOM 6264  O O    . GLY B 1 85  ? -0.233  6.219   -3.591  1.00 0.32  ? 85  GLY B O    2  
ATOM 6265  H H    . GLY B 1 85  ? -2.467  2.658   -3.679  1.00 0.25  ? 85  GLY B H    2  
ATOM 6266  H HA2  . GLY B 1 85  ? 0.040   3.794   -3.212  1.00 0.33  ? 85  GLY B HA2  2  
ATOM 6267  H HA3  . GLY B 1 85  ? -0.656  3.462   -4.792  1.00 0.31  ? 85  GLY B HA3  2  
ATOM 6268  N N    . GLY B 1 86  ? -2.122  5.793   -4.717  1.00 0.27  ? 86  GLY B N    2  
ATOM 6269  C CA   . GLY B 1 86  ? -2.322  7.182   -5.097  1.00 0.30  ? 86  GLY B CA   2  
ATOM 6270  C C    . GLY B 1 86  ? -2.501  8.062   -3.888  1.00 0.29  ? 86  GLY B C    2  
ATOM 6271  O O    . GLY B 1 86  ? -2.153  9.245   -3.894  1.00 0.34  ? 86  GLY B O    2  
ATOM 6272  H H    . GLY B 1 86  ? -2.830  5.130   -4.892  1.00 0.27  ? 86  GLY B H    2  
ATOM 6273  H HA2  . GLY B 1 86  ? -1.462  7.519   -5.657  1.00 0.33  ? 86  GLY B HA2  2  
ATOM 6274  H HA3  . GLY B 1 86  ? -3.199  7.256   -5.720  1.00 0.32  ? 86  GLY B HA3  2  
ATOM 6275  N N    . LEU B 1 87  ? -3.042  7.464   -2.847  1.00 0.25  ? 87  LEU B N    2  
ATOM 6276  C CA   . LEU B 1 87  ? -3.198  8.117   -1.564  1.00 0.25  ? 87  LEU B CA   2  
ATOM 6277  C C    . LEU B 1 87  ? -1.838  8.388   -0.950  1.00 0.26  ? 87  LEU B C    2  
ATOM 6278  O O    . LEU B 1 87  ? -1.466  9.538   -0.710  1.00 0.29  ? 87  LEU B O    2  
ATOM 6279  C CB   . LEU B 1 87  ? -3.991  7.212   -0.634  1.00 0.25  ? 87  LEU B CB   2  
ATOM 6280  C CG   . LEU B 1 87  ? -5.493  7.133   -0.886  1.00 0.26  ? 87  LEU B CG   2  
ATOM 6281  C CD1  . LEU B 1 87  ? -6.082  5.978   -0.103  1.00 0.26  ? 87  LEU B CD1  2  
ATOM 6282  C CD2  . LEU B 1 87  ? -6.172  8.436   -0.490  1.00 0.35  ? 87  LEU B CD2  2  
ATOM 6283  H H    . LEU B 1 87  ? -3.341  6.533   -2.947  1.00 0.26  ? 87  LEU B H    2  
ATOM 6284  H HA   . LEU B 1 87  ? -3.728  9.045   -1.707  1.00 0.28  ? 87  LEU B HA   2  
ATOM 6285  H HB2  . LEU B 1 87  ? -3.586  6.213   -0.733  1.00 0.25  ? 87  LEU B HB2  2  
ATOM 6286  H HB3  . LEU B 1 87  ? -3.835  7.547   0.380   1.00 0.28  ? 87  LEU B HB3  2  
ATOM 6287  H HG   . LEU B 1 87  ? -5.675  6.959   -1.935  1.00 0.26  ? 87  LEU B HG   2  
ATOM 6288  H HD11 . LEU B 1 87  ? -5.602  5.061   -0.403  1.00 1.02  ? 87  LEU B HD11 2  
ATOM 6289  H HD12 . LEU B 1 87  ? -7.140  5.913   -0.303  1.00 1.05  ? 87  LEU B HD12 2  
ATOM 6290  H HD13 . LEU B 1 87  ? -5.923  6.140   0.953   1.00 1.06  ? 87  LEU B HD13 2  
ATOM 6291  H HD21 . LEU B 1 87  ? -5.990  8.631   0.557   1.00 0.97  ? 87  LEU B HD21 2  
ATOM 6292  H HD22 . LEU B 1 87  ? -7.236  8.351   -0.659  1.00 1.10  ? 87  LEU B HD22 2  
ATOM 6293  H HD23 . LEU B 1 87  ? -5.776  9.245   -1.082  1.00 1.13  ? 87  LEU B HD23 2  
ATOM 6294  N N    . ALA B 1 88  ? -1.094  7.311   -0.724  1.00 0.25  ? 88  ALA B N    2  
ATOM 6295  C CA   . ALA B 1 88  ? 0.222   7.387   -0.110  1.00 0.27  ? 88  ALA B CA   2  
ATOM 6296  C C    . ALA B 1 88  ? 1.130   8.300   -0.890  1.00 0.29  ? 88  ALA B C    2  
ATOM 6297  O O    . ALA B 1 88  ? 1.922   9.046   -0.328  1.00 0.35  ? 88  ALA B O    2  
ATOM 6298  C CB   . ALA B 1 88  ? 0.860   6.023   -0.069  1.00 0.26  ? 88  ALA B CB   2  
ATOM 6299  H H    . ALA B 1 88  ? -1.444  6.428   -0.987  1.00 0.25  ? 88  ALA B H    2  
ATOM 6300  H HA   . ALA B 1 88  ? 0.108   7.750   0.899   1.00 0.28  ? 88  ALA B HA   2  
ATOM 6301  H HB1  . ALA B 1 88  ? 1.182   5.767   -1.073  1.00 1.06  ? 88  ALA B HB1  2  
ATOM 6302  H HB2  . ALA B 1 88  ? 0.146   5.296   0.284   1.00 1.04  ? 88  ALA B HB2  2  
ATOM 6303  H HB3  . ALA B 1 88  ? 1.716   6.046   0.586   1.00 1.06  ? 88  ALA B HB3  2  
ATOM 6304  N N    . MET B 1 89  ? 1.015   8.201   -2.196  1.00 0.29  ? 89  MET B N    2  
ATOM 6305  C CA   . MET B 1 89  ? 1.818   8.978   -3.106  1.00 0.32  ? 89  MET B CA   2  
ATOM 6306  C C    . MET B 1 89  ? 1.608   10.458  -2.879  1.00 0.34  ? 89  MET B C    2  
ATOM 6307  O O    . MET B 1 89  ? 2.566   11.225  -2.816  1.00 0.39  ? 89  MET B O    2  
ATOM 6308  C CB   . MET B 1 89  ? 1.464   8.611   -4.539  1.00 0.34  ? 89  MET B CB   2  
ATOM 6309  C CG   . MET B 1 89  ? 1.991   7.253   -4.954  1.00 0.42  ? 89  MET B CG   2  
ATOM 6310  S SD   . MET B 1 89  ? 1.580   6.840   -6.664  1.00 1.03  ? 89  MET B SD   2  
ATOM 6311  C CE   . MET B 1 89  ? 2.153   8.301   -7.532  1.00 1.89  ? 89  MET B CE   2  
ATOM 6312  H H    . MET B 1 89  ? 0.359   7.565   -2.565  1.00 0.28  ? 89  MET B H    2  
ATOM 6313  H HA   . MET B 1 89  ? 2.850   8.732   -2.922  1.00 0.37  ? 89  MET B HA   2  
ATOM 6314  H HB2  . MET B 1 89  ? 0.385   8.593   -4.634  1.00 0.32  ? 89  MET B HB2  2  
ATOM 6315  H HB3  . MET B 1 89  ? 1.868   9.355   -5.204  1.00 0.38  ? 89  MET B HB3  2  
ATOM 6316  H HG2  . MET B 1 89  ? 3.058   7.241   -4.824  1.00 0.55  ? 89  MET B HG2  2  
ATOM 6317  H HG3  . MET B 1 89  ? 1.551   6.508   -4.305  1.00 0.42  ? 89  MET B HG3  2  
ATOM 6318  H HE1  . MET B 1 89  ? 2.026   8.161   -8.595  1.00 2.52  ? 89  MET B HE1  2  
ATOM 6319  H HE2  . MET B 1 89  ? 3.198   8.463   -7.312  1.00 2.34  ? 89  MET B HE2  2  
ATOM 6320  H HE3  . MET B 1 89  ? 1.581   9.158   -7.211  1.00 2.22  ? 89  MET B HE3  2  
ATOM 6321  N N    . ALA B 1 90  ? 0.354   10.844  -2.716  1.00 0.34  ? 90  ALA B N    2  
ATOM 6322  C CA   . ALA B 1 90  ? 0.008   12.235  -2.502  1.00 0.39  ? 90  ALA B CA   2  
ATOM 6323  C C    . ALA B 1 90  ? 0.460   12.684  -1.120  1.00 0.42  ? 90  ALA B C    2  
ATOM 6324  O O    . ALA B 1 90  ? 0.880   13.821  -0.930  1.00 0.49  ? 90  ALA B O    2  
ATOM 6325  C CB   . ALA B 1 90  ? -1.490  12.426  -2.668  1.00 0.46  ? 90  ALA B CB   2  
ATOM 6326  H H    . ALA B 1 90  ? -0.365  10.170  -2.730  1.00 0.32  ? 90  ALA B H    2  
ATOM 6327  H HA   . ALA B 1 90  ? 0.512   12.829  -3.251  1.00 0.42  ? 90  ALA B HA   2  
ATOM 6328  H HB1  . ALA B 1 90  ? -1.735  13.471  -2.562  1.00 1.20  ? 90  ALA B HB1  2  
ATOM 6329  H HB2  . ALA B 1 90  ? -2.007  11.854  -1.912  1.00 1.13  ? 90  ALA B HB2  2  
ATOM 6330  H HB3  . ALA B 1 90  ? -1.788  12.081  -3.647  1.00 1.03  ? 90  ALA B HB3  2  
ATOM 6331  N N    . CYS B 1 91  ? 0.392   11.766  -0.166  1.00 0.41  ? 91  CYS B N    2  
ATOM 6332  C CA   . CYS B 1 91  ? 0.777   12.052  1.208   1.00 0.47  ? 91  CYS B CA   2  
ATOM 6333  C C    . CYS B 1 91  ? 2.297   12.185  1.342   1.00 0.44  ? 91  CYS B C    2  
ATOM 6334  O O    . CYS B 1 91  ? 2.789   13.089  2.020   1.00 0.51  ? 91  CYS B O    2  
ATOM 6335  C CB   . CYS B 1 91  ? 0.239   10.958  2.133   1.00 0.55  ? 91  CYS B CB   2  
ATOM 6336  S SG   . CYS B 1 91  ? -1.555  10.748  2.050   1.00 1.76  ? 91  CYS B SG   2  
ATOM 6337  H H    . CYS B 1 91  ? 0.063   10.868  -0.393  1.00 0.40  ? 91  CYS B H    2  
ATOM 6338  H HA   . CYS B 1 91  ? 0.329   12.994  1.483   1.00 0.52  ? 91  CYS B HA   2  
ATOM 6339  H HB2  . CYS B 1 91  ? 0.688   10.014  1.860   1.00 1.09  ? 91  CYS B HB2  2  
ATOM 6340  H HB3  . CYS B 1 91  ? 0.498   11.196  3.153   1.00 0.94  ? 91  CYS B HB3  2  
ATOM 6341  H HG   . CYS B 1 91  ? -1.846  10.205  0.874   1.00 2.29  ? 91  CYS B HG   2  
ATOM 6342  N N    . HIS B 1 92  ? 3.041   11.292  0.692   1.00 0.41  ? 92  HIS B N    2  
ATOM 6343  C CA   . HIS B 1 92  ? 4.499   11.376  0.686   1.00 0.46  ? 92  HIS B CA   2  
ATOM 6344  C C    . HIS B 1 92  ? 4.925   12.593  -0.108  1.00 0.45  ? 92  HIS B C    2  
ATOM 6345  O O    . HIS B 1 92  ? 5.868   13.282  0.261   1.00 0.49  ? 92  HIS B O    2  
ATOM 6346  C CB   . HIS B 1 92  ? 5.136   10.110  0.090   1.00 0.54  ? 92  HIS B CB   2  
ATOM 6347  C CG   . HIS B 1 92  ? 6.641   10.085  0.181   1.00 1.21  ? 92  HIS B CG   2  
ATOM 6348  N ND1  . HIS B 1 92  ? 7.320   9.763   1.339   1.00 2.12  ? 92  HIS B ND1  2  
ATOM 6349  C CD2  . HIS B 1 92  ? 7.597   10.344  -0.748  1.00 1.96  ? 92  HIS B CD2  2  
ATOM 6350  C CE1  . HIS B 1 92  ? 8.622   9.827   1.121   1.00 2.74  ? 92  HIS B CE1  2  
ATOM 6351  N NE2  . HIS B 1 92  ? 8.817   10.174  -0.135  1.00 2.62  ? 92  HIS B NE2  2  
ATOM 6352  H H    . HIS B 1 92  ? 2.597   10.561  0.205   1.00 0.40  ? 92  HIS B H    2  
ATOM 6353  H HA   . HIS B 1 92  ? 4.828   11.492  1.709   1.00 0.53  ? 92  HIS B HA   2  
ATOM 6354  H HB2  . HIS B 1 92  ? 4.758   9.246   0.611   1.00 1.05  ? 92  HIS B HB2  2  
ATOM 6355  H HB3  . HIS B 1 92  ? 4.866   10.040  -0.953  1.00 0.91  ? 92  HIS B HB3  2  
ATOM 6356  H HD1  . HIS B 1 92  ? 6.911   9.523   2.192   1.00 2.62  ? 92  HIS B HD1  2  
ATOM 6357  H HD2  . HIS B 1 92  ? 7.430   10.628  -1.778  1.00 2.49  ? 92  HIS B HD2  2  
ATOM 6358  H HE1  . HIS B 1 92  ? 9.395   9.631   1.850   1.00 3.56  ? 92  HIS B HE1  2  
ATOM 6359  H HE2  . HIS B 1 92  ? 9.696   10.205  -0.582  1.00 3.27  ? 92  HIS B HE2  2  
ATOM 6360  N N    . ASP B 1 93  ? 4.214   12.851  -1.196  1.00 0.45  ? 93  ASP B N    2  
ATOM 6361  C CA   . ASP B 1 93  ? 4.456   14.036  -2.001  1.00 0.52  ? 93  ASP B CA   2  
ATOM 6362  C C    . ASP B 1 93  ? 4.262   15.282  -1.148  1.00 0.56  ? 93  ASP B C    2  
ATOM 6363  O O    . ASP B 1 93  ? 5.099   16.174  -1.148  1.00 0.65  ? 93  ASP B O    2  
ATOM 6364  C CB   . ASP B 1 93  ? 3.513   14.061  -3.206  1.00 0.54  ? 93  ASP B CB   2  
ATOM 6365  C CG   . ASP B 1 93  ? 3.732   15.269  -4.096  1.00 0.92  ? 93  ASP B CG   2  
ATOM 6366  O OD1  . ASP B 1 93  ? 4.640   15.229  -4.946  1.00 1.74  ? 93  ASP B OD1  2  
ATOM 6367  O OD2  . ASP B 1 93  ? 2.992   16.265  -3.953  1.00 1.48  ? 93  ASP B OD2  2  
ATOM 6368  H H    . ASP B 1 93  ? 3.505   12.225  -1.467  1.00 0.43  ? 93  ASP B H    2  
ATOM 6369  H HA   . ASP B 1 93  ? 5.479   14.001  -2.345  1.00 0.56  ? 93  ASP B HA   2  
ATOM 6370  H HB2  . ASP B 1 93  ? 3.668   13.165  -3.798  1.00 0.94  ? 93  ASP B HB2  2  
ATOM 6371  H HB3  . ASP B 1 93  ? 2.493   14.079  -2.852  1.00 0.77  ? 93  ASP B HB3  2  
ATOM 6372  N N    . SER B 1 94  ? 3.171   15.308  -0.390  1.00 0.54  ? 94  SER B N    2  
ATOM 6373  C CA   . SER B 1 94  ? 2.881   16.410  0.517   1.00 0.60  ? 94  SER B CA   2  
ATOM 6374  C C    . SER B 1 94  ? 3.976   16.550  1.557   1.00 0.63  ? 94  SER B C    2  
ATOM 6375  O O    . SER B 1 94  ? 4.402   17.647  1.870   1.00 0.70  ? 94  SER B O    2  
ATOM 6376  C CB   . SER B 1 94  ? 1.551   16.181  1.224   1.00 0.65  ? 94  SER B CB   2  
ATOM 6377  O OG   . SER B 1 94  ? 0.480   16.125  0.296   1.00 1.26  ? 94  SER B OG   2  
ATOM 6378  H H    . SER B 1 94  ? 2.543   14.562  -0.443  1.00 0.52  ? 94  SER B H    2  
ATOM 6379  H HA   . SER B 1 94  ? 2.825   17.319  -0.063  1.00 0.66  ? 94  SER B HA   2  
ATOM 6380  H HB2  . SER B 1 94  ? 1.596   15.245  1.764   1.00 0.96  ? 94  SER B HB2  2  
ATOM 6381  H HB3  . SER B 1 94  ? 1.374   16.989  1.918   1.00 1.04  ? 94  SER B HB3  2  
ATOM 6382  H HG   . SER B 1 94  ? 0.680   15.465  -0.386  1.00 1.85  ? 94  SER B HG   2  
ATOM 6383  N N    . PHE B 1 95  ? 4.420   15.423  2.085   1.00 0.60  ? 95  PHE B N    2  
ATOM 6384  C CA   . PHE B 1 95  ? 5.489   15.394  3.069   1.00 0.67  ? 95  PHE B CA   2  
ATOM 6385  C C    . PHE B 1 95  ? 6.747   16.032  2.489   1.00 0.73  ? 95  PHE B C    2  
ATOM 6386  O O    . PHE B 1 95  ? 7.470   16.747  3.174   1.00 0.84  ? 95  PHE B O    2  
ATOM 6387  C CB   . PHE B 1 95  ? 5.753   13.945  3.481   1.00 0.64  ? 95  PHE B CB   2  
ATOM 6388  C CG   . PHE B 1 95  ? 6.717   13.791  4.620   1.00 0.78  ? 95  PHE B CG   2  
ATOM 6389  C CD1  . PHE B 1 95  ? 6.394   14.258  5.883   1.00 1.29  ? 95  PHE B CD1  2  
ATOM 6390  C CD2  . PHE B 1 95  ? 7.939   13.166  4.433   1.00 1.80  ? 95  PHE B CD2  2  
ATOM 6391  C CE1  . PHE B 1 95  ? 7.272   14.107  6.937   1.00 1.76  ? 95  PHE B CE1  2  
ATOM 6392  C CE2  . PHE B 1 95  ? 8.821   13.013  5.482   1.00 2.35  ? 95  PHE B CE2  2  
ATOM 6393  C CZ   . PHE B 1 95  ? 8.488   13.485  6.735   1.00 2.07  ? 95  PHE B CZ   2  
ATOM 6394  H H    . PHE B 1 95  ? 4.013   14.579  1.807   1.00 0.56  ? 95  PHE B H    2  
ATOM 6395  H HA   . PHE B 1 95  ? 5.171   15.959  3.931   1.00 0.75  ? 95  PHE B HA   2  
ATOM 6396  H HB2  . PHE B 1 95  ? 4.819   13.490  3.776   1.00 0.99  ? 95  PHE B HB2  2  
ATOM 6397  H HB3  . PHE B 1 95  ? 6.153   13.409  2.632   1.00 0.98  ? 95  PHE B HB3  2  
ATOM 6398  H HD1  . PHE B 1 95  ? 5.443   14.745  6.041   1.00 1.96  ? 95  PHE B HD1  2  
ATOM 6399  H HD2  . PHE B 1 95  ? 8.200   12.796  3.452   1.00 2.46  ? 95  PHE B HD2  2  
ATOM 6400  H HE1  . PHE B 1 95  ? 7.011   14.475  7.917   1.00 2.40  ? 95  PHE B HE1  2  
ATOM 6401  H HE2  . PHE B 1 95  ? 9.771   12.528  5.325   1.00 3.27  ? 95  PHE B HE2  2  
ATOM 6402  H HZ   . PHE B 1 95  ? 9.176   13.366  7.558   1.00 2.63  ? 95  PHE B HZ   2  
ATOM 6403  N N    . LEU B 1 96  ? 6.971   15.788  1.207   1.00 0.69  ? 96  LEU B N    2  
ATOM 6404  C CA   . LEU B 1 96  ? 8.114   16.340  0.494   1.00 0.81  ? 96  LEU B CA   2  
ATOM 6405  C C    . LEU B 1 96  ? 7.902   17.816  0.193   1.00 0.91  ? 96  LEU B C    2  
ATOM 6406  O O    . LEU B 1 96  ? 8.832   18.619  0.266   1.00 1.09  ? 96  LEU B O    2  
ATOM 6407  C CB   . LEU B 1 96  ? 8.343   15.571  -0.808  1.00 0.83  ? 96  LEU B CB   2  
ATOM 6408  C CG   . LEU B 1 96  ? 9.289   14.367  -0.719  1.00 0.87  ? 96  LEU B CG   2  
ATOM 6409  C CD1  . LEU B 1 96  ? 10.724  14.826  -0.547  1.00 1.22  ? 96  LEU B CD1  2  
ATOM 6410  C CD2  . LEU B 1 96  ? 8.893   13.451  0.425   1.00 1.08  ? 96  LEU B CD2  2  
ATOM 6411  H H    . LEU B 1 96  ? 6.339   15.221  0.719   1.00 0.62  ? 96  LEU B H    2  
ATOM 6412  H HA   . LEU B 1 96  ? 8.980   16.232  1.124   1.00 0.87  ? 96  LEU B HA   2  
ATOM 6413  H HB2  . LEU B 1 96  ? 7.384   15.217  -1.158  1.00 0.76  ? 96  LEU B HB2  2  
ATOM 6414  H HB3  . LEU B 1 96  ? 8.737   16.257  -1.540  1.00 0.93  ? 96  LEU B HB3  2  
ATOM 6415  H HG   . LEU B 1 96  ? 9.225   13.802  -1.637  1.00 0.92  ? 96  LEU B HG   2  
ATOM 6416  H HD11 . LEU B 1 96  ? 10.824  15.350  0.391   1.00 1.70  ? 96  LEU B HD11 2  
ATOM 6417  H HD12 . LEU B 1 96  ? 10.989  15.487  -1.358  1.00 1.65  ? 96  LEU B HD12 2  
ATOM 6418  H HD13 . LEU B 1 96  ? 11.380  13.968  -0.552  1.00 1.64  ? 96  LEU B HD13 2  
ATOM 6419  H HD21 . LEU B 1 96  ? 7.895   13.073  0.251   1.00 1.68  ? 96  LEU B HD21 2  
ATOM 6420  H HD22 . LEU B 1 96  ? 8.912   14.005  1.353   1.00 1.41  ? 96  LEU B HD22 2  
ATOM 6421  H HD23 . LEU B 1 96  ? 9.587   12.626  0.482   1.00 1.51  ? 96  LEU B HD23 2  
ATOM 6422  N N    . LYS B 1 97  ? 6.670   18.160  -0.150  1.00 0.83  ? 97  LYS B N    2  
ATOM 6423  C CA   . LYS B 1 97  ? 6.303   19.534  -0.457  1.00 0.94  ? 97  LYS B CA   2  
ATOM 6424  C C    . LYS B 1 97  ? 6.280   20.383  0.809   1.00 0.98  ? 97  LYS B C    2  
ATOM 6425  O O    . LYS B 1 97  ? 6.549   21.584  0.775   1.00 1.14  ? 97  LYS B O    2  
ATOM 6426  C CB   . LYS B 1 97  ? 4.930   19.564  -1.129  1.00 0.94  ? 97  LYS B CB   2  
ATOM 6427  C CG   . LYS B 1 97  ? 4.890   18.795  -2.435  1.00 0.99  ? 97  LYS B CG   2  
ATOM 6428  C CD   . LYS B 1 97  ? 5.656   19.495  -3.542  1.00 1.25  ? 97  LYS B CD   2  
ATOM 6429  C CE   . LYS B 1 97  ? 5.779   18.607  -4.773  1.00 2.06  ? 97  LYS B CE   2  
ATOM 6430  N NZ   . LYS B 1 97  ? 4.453   18.170  -5.286  1.00 2.65  ? 97  LYS B NZ   2  
ATOM 6431  H H    . LYS B 1 97  ? 5.982   17.459  -0.210  1.00 0.75  ? 97  LYS B H    2  
ATOM 6432  H HA   . LYS B 1 97  ? 7.034   19.926  -1.143  1.00 1.02  ? 97  LYS B HA   2  
ATOM 6433  H HB2  . LYS B 1 97  ? 4.203   19.128  -0.459  1.00 0.90  ? 97  LYS B HB2  2  
ATOM 6434  H HB3  . LYS B 1 97  ? 4.657   20.587  -1.327  1.00 1.04  ? 97  LYS B HB3  2  
ATOM 6435  H HG2  . LYS B 1 97  ? 5.338   17.830  -2.271  1.00 1.50  ? 97  LYS B HG2  2  
ATOM 6436  H HG3  . LYS B 1 97  ? 3.863   18.672  -2.740  1.00 1.64  ? 97  LYS B HG3  2  
ATOM 6437  H HD2  . LYS B 1 97  ? 5.134   20.400  -3.813  1.00 1.87  ? 97  LYS B HD2  2  
ATOM 6438  H HD3  . LYS B 1 97  ? 6.645   19.739  -3.186  1.00 1.74  ? 97  LYS B HD3  2  
ATOM 6439  H HE2  . LYS B 1 97  ? 6.290   19.159  -5.548  1.00 2.59  ? 97  LYS B HE2  2  
ATOM 6440  H HE3  . LYS B 1 97  ? 6.360   17.734  -4.513  1.00 2.52  ? 97  LYS B HE3  2  
ATOM 6441  H HZ1  . LYS B 1 97  ? 3.836   18.992  -5.441  1.00 3.01  ? 97  LYS B HZ1  2  
ATOM 6442  H HZ2  . LYS B 1 97  ? 3.994   17.524  -4.607  1.00 2.88  ? 97  LYS B HZ2  2  
ATOM 6443  H HZ3  . LYS B 1 97  ? 4.572   17.669  -6.187  1.00 3.15  ? 97  LYS B HZ3  2  
ATOM 6444  N N    . ALA B 1 98  ? 5.962   19.741  1.922   1.00 0.99  ? 98  ALA B N    2  
ATOM 6445  C CA   . ALA B 1 98  ? 5.806   20.423  3.193   1.00 1.07  ? 98  ALA B CA   2  
ATOM 6446  C C    . ALA B 1 98  ? 7.119   20.495  3.966   1.00 1.10  ? 98  ALA B C    2  
ATOM 6447  O O    . ALA B 1 98  ? 7.688   21.574  4.142   1.00 1.24  ? 98  ALA B O    2  
ATOM 6448  C CB   . ALA B 1 98  ? 4.740   19.725  4.026   1.00 1.01  ? 98  ALA B CB   2  
ATOM 6449  H H    . ALA B 1 98  ? 5.807   18.771  1.881   1.00 1.05  ? 98  ALA B H    2  
ATOM 6450  H HA   . ALA B 1 98  ? 5.466   21.423  2.989   1.00 1.18  ? 98  ALA B HA   2  
ATOM 6451  H HB1  . ALA B 1 98  ? 5.051   18.710  4.230   1.00 1.37  ? 98  ALA B HB1  2  
ATOM 6452  H HB2  . ALA B 1 98  ? 3.809   19.709  3.477   1.00 1.47  ? 98  ALA B HB2  2  
ATOM 6453  H HB3  . ALA B 1 98  ? 4.604   20.255  4.957   1.00 1.42  ? 98  ALA B HB3  2  
ATOM 6454  N N    . VAL B 1 99  ? 7.596   19.343  4.424   1.00 1.01  ? 99  VAL B N    2  
ATOM 6455  C CA   . VAL B 1 99  ? 8.791   19.275  5.256   1.00 1.07  ? 99  VAL B CA   2  
ATOM 6456  C C    . VAL B 1 99  ? 9.176   17.814  5.509   1.00 1.01  ? 99  VAL B C    2  
ATOM 6457  O O    . VAL B 1 99  ? 8.685   17.167  6.430   1.00 1.02  ? 99  VAL B O    2  
ATOM 6458  C CB   . VAL B 1 99  ? 8.602   20.035  6.599   1.00 1.17  ? 99  VAL B CB   2  
ATOM 6459  C CG1  . VAL B 1 99  ? 7.359   19.563  7.347   1.00 1.14  ? 99  VAL B CG1  2  
ATOM 6460  C CG2  . VAL B 1 99  ? 9.843   19.905  7.471   1.00 1.25  ? 99  VAL B CG2  2  
ATOM 6461  H H    . VAL B 1 99  ? 7.141   18.505  4.179   1.00 0.92  ? 99  VAL B H    2  
ATOM 6462  H HA   . VAL B 1 99  ? 9.594   19.751  4.711   1.00 1.12  ? 99  VAL B HA   2  
ATOM 6463  H HB   . VAL B 1 99  ? 8.467   21.082  6.368   1.00 1.25  ? 99  VAL B HB   2  
ATOM 6464  H HG11 . VAL B 1 99  ? 6.484   19.731  6.735   1.00 1.65  ? 99  VAL B HG11 2  
ATOM 6465  H HG12 . VAL B 1 99  ? 7.263   20.113  8.271   1.00 1.48  ? 99  VAL B HG12 2  
ATOM 6466  H HG13 . VAL B 1 99  ? 7.448   18.508  7.563   1.00 1.42  ? 99  VAL B HG13 2  
ATOM 6467  H HG21 . VAL B 1 99  ? 9.685   20.430  8.402   1.00 1.52  ? 99  VAL B HG21 2  
ATOM 6468  H HG22 . VAL B 1 99  ? 10.691  20.332  6.956   1.00 1.65  ? 99  VAL B HG22 2  
ATOM 6469  H HG23 . VAL B 1 99  ? 10.031  18.861  7.672   1.00 1.64  ? 99  VAL B HG23 2  
ATOM 6470  N N    . PRO B 1 100 ? 10.041  17.261  4.659   1.00 1.01  ? 100 PRO B N    2  
ATOM 6471  C CA   . PRO B 1 100 ? 10.448  15.870  4.733   1.00 1.02  ? 100 PRO B CA   2  
ATOM 6472  C C    . PRO B 1 100 ? 11.793  15.674  5.417   1.00 1.28  ? 100 PRO B C    2  
ATOM 6473  O O    . PRO B 1 100 ? 12.393  14.603  5.329   1.00 1.60  ? 100 PRO B O    2  
ATOM 6474  C CB   . PRO B 1 100 ? 10.537  15.520  3.254   1.00 1.04  ? 100 PRO B CB   2  
ATOM 6475  C CG   . PRO B 1 100 ? 11.069  16.770  2.616   1.00 1.04  ? 100 PRO B CG   2  
ATOM 6476  C CD   . PRO B 1 100 ? 10.663  17.926  3.506   1.00 1.07  ? 100 PRO B CD   2  
ATOM 6477  H HA   . PRO B 1 100 ? 9.704   15.256  5.215   1.00 0.95  ? 100 PRO B HA   2  
ATOM 6478  H HB2  . PRO B 1 100 ? 11.205  14.682  3.117   1.00 1.23  ? 100 PRO B HB2  2  
ATOM 6479  H HB3  . PRO B 1 100 ? 9.553   15.274  2.879   1.00 1.05  ? 100 PRO B HB3  2  
ATOM 6480  H HG2  . PRO B 1 100 ? 12.144  16.715  2.547   1.00 1.11  ? 100 PRO B HG2  2  
ATOM 6481  H HG3  . PRO B 1 100 ? 10.640  16.890  1.632   1.00 1.04  ? 100 PRO B HG3  2  
ATOM 6482  H HD2  . PRO B 1 100 ? 11.530  18.493  3.810   1.00 1.20  ? 100 PRO B HD2  2  
ATOM 6483  H HD3  . PRO B 1 100 ? 9.952   18.563  3.001   1.00 1.05  ? 100 PRO B HD3  2  
ATOM 6484  N N    . SER B 1 101 ? 12.256  16.702  6.105   1.00 1.57  ? 101 SER B N    2  
ATOM 6485  C CA   . SER B 1 101 ? 13.560  16.656  6.735   1.00 1.88  ? 101 SER B CA   2  
ATOM 6486  C C    . SER B 1 101 ? 13.499  15.897  8.059   1.00 1.62  ? 101 SER B C    2  
ATOM 6487  O O    . SER B 1 101 ? 14.512  15.363  8.518   1.00 1.94  ? 101 SER B O    2  
ATOM 6488  C CB   . SER B 1 101 ? 14.085  18.078  6.950   1.00 2.76  ? 101 SER B CB   2  
ATOM 6489  O OG   . SER B 1 101 ? 15.450  18.078  7.329   1.00 3.39  ? 101 SER B OG   2  
ATOM 6490  H H    . SER B 1 101 ? 11.710  17.511  6.184   1.00 1.80  ? 101 SER B H    2  
ATOM 6491  H HA   . SER B 1 101 ? 14.231  16.134  6.070   1.00 2.07  ? 101 SER B HA   2  
ATOM 6492  H HB2  . SER B 1 101 ? 13.984  18.636  6.033   1.00 3.14  ? 101 SER B HB2  2  
ATOM 6493  H HB3  . SER B 1 101 ? 13.508  18.559  7.727   1.00 3.02  ? 101 SER B HB3  2  
ATOM 6494  H HG   . SER B 1 101 ? 15.894  17.323  6.921   1.00 3.73  ? 101 SER B HG   2  
ATOM 6495  N N    . GLN B 1 102 ? 12.294  15.818  8.637   1.00 1.61  ? 102 GLN B N    2  
ATOM 6496  C CA   . GLN B 1 102 ? 12.079  15.192  9.948   1.00 2.12  ? 102 GLN B CA   2  
ATOM 6497  C C    . GLN B 1 102 ? 12.895  15.880  11.041  1.00 2.74  ? 102 GLN B C    2  
ATOM 6498  O O    . GLN B 1 102 ? 12.419  16.815  11.688  1.00 3.39  ? 102 GLN B O    2  
ATOM 6499  C CB   . GLN B 1 102 ? 12.399  13.692  9.902   1.00 2.47  ? 102 GLN B CB   2  
ATOM 6500  C CG   . GLN B 1 102 ? 11.356  12.876  9.160   1.00 3.01  ? 102 GLN B CG   2  
ATOM 6501  C CD   . GLN B 1 102 ? 10.087  12.679  9.969   1.00 3.87  ? 102 GLN B CD   2  
ATOM 6502  O OE1  . GLN B 1 102 ? 9.940   11.685  10.679  1.00 4.45  ? 102 GLN B OE1  2  
ATOM 6503  N NE2  . GLN B 1 102 ? 9.168   13.624  9.878   1.00 4.44  ? 102 GLN B NE2  2  
ATOM 6504  H H    . GLN B 1 102 ? 11.515  16.182  8.158   1.00 1.67  ? 102 GLN B H    2  
ATOM 6505  H HA   . GLN B 1 102 ? 11.034  15.309  10.190  1.00 2.52  ? 102 GLN B HA   2  
ATOM 6506  H HB2  . GLN B 1 102 ? 13.351  13.553  9.410   1.00 2.90  ? 102 GLN B HB2  2  
ATOM 6507  H HB3  . GLN B 1 102 ? 12.467  13.318  10.911  1.00 2.74  ? 102 GLN B HB3  2  
ATOM 6508  H HG2  . GLN B 1 102 ? 11.105  13.387  8.243   1.00 3.38  ? 102 GLN B HG2  2  
ATOM 6509  H HG3  . GLN B 1 102 ? 11.772  11.907  8.928   1.00 3.09  ? 102 GLN B HG3  2  
ATOM 6510  H HE21 . GLN B 1 102 ? 9.351   14.397  9.299   1.00 4.33  ? 102 GLN B HE21 2  
ATOM 6511  H HE22 . GLN B 1 102 ? 8.343   13.519  10.398  1.00 5.18  ? 102 GLN B HE22 2  
ATOM 6512  N N    . LYS B 1 103 ? 14.125  15.431  11.224  1.00 3.15  ? 103 LYS B N    2  
ATOM 6513  C CA   . LYS B 1 103 ? 15.008  15.992  12.228  1.00 4.07  ? 103 LYS B CA   2  
ATOM 6514  C C    . LYS B 1 103 ? 16.423  16.081  11.676  1.00 4.57  ? 103 LYS B C    2  
ATOM 6515  O O    . LYS B 1 103 ? 16.921  15.131  11.071  1.00 5.24  ? 103 LYS B O    2  
ATOM 6516  C CB   . LYS B 1 103 ? 14.985  15.137  13.497  1.00 4.74  ? 103 LYS B CB   2  
ATOM 6517  C CG   . LYS B 1 103 ? 15.850  15.690  14.617  1.00 5.31  ? 103 LYS B CG   2  
ATOM 6518  C CD   . LYS B 1 103 ? 15.771  14.823  15.862  1.00 6.26  ? 103 LYS B CD   2  
ATOM 6519  C CE   . LYS B 1 103 ? 16.603  15.401  16.994  1.00 6.83  ? 103 LYS B CE   2  
ATOM 6520  N NZ   . LYS B 1 103 ? 16.155  16.768  17.372  1.00 7.43  ? 103 LYS B NZ   2  
ATOM 6521  H H    . LYS B 1 103 ? 14.455  14.706  10.654  1.00 3.17  ? 103 LYS B H    2  
ATOM 6522  H HA   . LYS B 1 103 ? 14.658  16.986  12.463  1.00 4.39  ? 103 LYS B HA   2  
ATOM 6523  H HB2  . LYS B 1 103 ? 13.968  15.072  13.855  1.00 4.97  ? 103 LYS B HB2  2  
ATOM 6524  H HB3  . LYS B 1 103 ? 15.337  14.145  13.256  1.00 5.08  ? 103 LYS B HB3  2  
ATOM 6525  H HG2  . LYS B 1 103 ? 16.875  15.727  14.281  1.00 5.38  ? 103 LYS B HG2  2  
ATOM 6526  H HG3  . LYS B 1 103 ? 15.513  16.685  14.859  1.00 5.40  ? 103 LYS B HG3  2  
ATOM 6527  H HD2  . LYS B 1 103 ? 14.742  14.760  16.179  1.00 6.63  ? 103 LYS B HD2  2  
ATOM 6528  H HD3  . LYS B 1 103 ? 16.138  13.836  15.625  1.00 6.49  ? 103 LYS B HD3  2  
ATOM 6529  H HE2  . LYS B 1 103 ? 16.516  14.754  17.853  1.00 6.94  ? 103 LYS B HE2  2  
ATOM 6530  H HE3  . LYS B 1 103 ? 17.635  15.444  16.680  1.00 7.02  ? 103 LYS B HE3  2  
ATOM 6531  H HZ1  . LYS B 1 103 ? 15.156  16.752  17.663  1.00 7.63  ? 103 LYS B HZ1  2  
ATOM 6532  H HZ2  . LYS B 1 103 ? 16.258  17.416  16.564  1.00 7.73  ? 103 LYS B HZ2  2  
ATOM 6533  H HZ3  . LYS B 1 103 ? 16.727  17.126  18.161  1.00 7.66  ? 103 LYS B HZ3  2  
ATOM 6534  N N    . ARG B 1 104 ? 17.061  17.221  11.873  1.00 4.69  ? 104 ARG B N    2  
ATOM 6535  C CA   . ARG B 1 104 ? 18.401  17.444  11.360  1.00 5.54  ? 104 ARG B CA   2  
ATOM 6536  C C    . ARG B 1 104 ? 19.428  17.305  12.473  1.00 5.67  ? 104 ARG B C    2  
ATOM 6537  O O    . ARG B 1 104 ? 19.799  18.282  13.123  1.00 5.97  ? 104 ARG B O    2  
ATOM 6538  C CB   . ARG B 1 104 ? 18.495  18.824  10.709  1.00 6.11  ? 104 ARG B CB   2  
ATOM 6539  C CG   . ARG B 1 104 ? 17.538  18.996  9.544   1.00 6.81  ? 104 ARG B CG   2  
ATOM 6540  C CD   . ARG B 1 104 ? 17.616  20.386  8.943   1.00 7.63  ? 104 ARG B CD   2  
ATOM 6541  N NE   . ARG B 1 104 ? 16.685  20.541  7.828   1.00 8.12  ? 104 ARG B NE   2  
ATOM 6542  C CZ   . ARG B 1 104 ? 16.489  21.683  7.171   1.00 8.95  ? 104 ARG B CZ   2  
ATOM 6543  N NH1  . ARG B 1 104 ? 17.148  22.779  7.525   1.00 9.34  ? 104 ARG B NH1  2  
ATOM 6544  N NH2  . ARG B 1 104 ? 15.625  21.735  6.165   1.00 9.59  ? 104 ARG B NH2  2  
ATOM 6545  H H    . ARG B 1 104 ? 16.621  17.933  12.387  1.00 4.49  ? 104 ARG B H    2  
ATOM 6546  H HA   . ARG B 1 104 ? 18.597  16.690  10.612  1.00 6.02  ? 104 ARG B HA   2  
ATOM 6547  H HB2  . ARG B 1 104 ? 18.271  19.577  11.449  1.00 6.43  ? 104 ARG B HB2  2  
ATOM 6548  H HB3  . ARG B 1 104 ? 19.502  18.973  10.347  1.00 6.10  ? 104 ARG B HB3  2  
ATOM 6549  H HG2  . ARG B 1 104 ? 17.783  18.272  8.782   1.00 6.95  ? 104 ARG B HG2  2  
ATOM 6550  H HG3  . ARG B 1 104 ? 16.531  18.822  9.895   1.00 6.93  ? 104 ARG B HG3  2  
ATOM 6551  H HD2  . ARG B 1 104 ? 17.375  21.111  9.706   1.00 7.90  ? 104 ARG B HD2  2  
ATOM 6552  H HD3  . ARG B 1 104 ? 18.622  20.559  8.588   1.00 7.87  ? 104 ARG B HD3  2  
ATOM 6553  H HE   . ARG B 1 104 ? 16.176  19.739  7.555   1.00 8.01  ? 104 ARG B HE   2  
ATOM 6554  H HH11 . ARG B 1 104 ? 17.796  22.752  8.291   1.00 9.05  ? 104 ARG B HH11 2  
ATOM 6555  H HH12 . ARG B 1 104 ? 16.999  23.639  7.030   1.00 10.05 ? 104 ARG B HH12 2  
ATOM 6556  H HH21 . ARG B 1 104 ? 15.112  20.916  5.895   1.00 9.49  ? 104 ARG B HH21 2  
ATOM 6557  H HH22 . ARG B 1 104 ? 15.481  22.597  5.670   1.00 10.29 ? 104 ARG B HH22 2  
ATOM 6558  N N    . THR B 1 105 ? 19.856  16.077  12.706  1.00 5.80  ? 105 THR B N    2  
ATOM 6559  C CA   . THR B 1 105 ? 20.869  15.790  13.704  1.00 6.20  ? 105 THR B CA   2  
ATOM 6560  C C    . THR B 1 105 ? 21.777  14.667  13.208  1.00 6.46  ? 105 THR B C    2  
ATOM 6561  O O    . THR B 1 105 ? 22.888  14.971  12.725  1.00 6.81  ? 105 THR B O    2  
ATOM 6562  C CB   . THR B 1 105 ? 20.238  15.396  15.057  1.00 6.59  ? 105 THR B CB   2  
ATOM 6563  O OG1  . THR B 1 105 ? 19.345  16.427  15.504  1.00 6.66  ? 105 THR B OG1  2  
ATOM 6564  C CG2  . THR B 1 105 ? 21.311  15.168  16.111  1.00 7.01  ? 105 THR B CG2  2  
ATOM 6565  O OXT  . THR B 1 105 ? 21.361  13.492  13.268  1.00 6.62  ? 105 THR B OXT  2  
ATOM 6566  H H    . THR B 1 105 ? 19.484  15.335  12.183  1.00 5.85  ? 105 THR B H    2  
ATOM 6567  H HA   . THR B 1 105 ? 21.460  16.684  13.848  1.00 6.42  ? 105 THR B HA   2  
ATOM 6568  H HB   . THR B 1 105 ? 19.682  14.479  14.928  1.00 6.93  ? 105 THR B HB   2  
ATOM 6569  H HG1  . THR B 1 105 ? 19.317  17.134  14.843  1.00 6.49  ? 105 THR B HG1  2  
ATOM 6570  H HG21 . THR B 1 105 ? 20.848  14.871  17.040  1.00 7.21  ? 105 THR B HG21 2  
ATOM 6571  H HG22 . THR B 1 105 ? 21.866  16.083  16.261  1.00 7.27  ? 105 THR B HG22 2  
ATOM 6572  H HG23 . THR B 1 105 ? 21.982  14.391  15.778  1.00 7.16  ? 105 THR B HG23 2  
ATOM 6573  N N    . MET A 1 1   ? -18.696 17.614  12.071  1.00 7.63  ? 1   MET A N    3  
ATOM 6574  C CA   . MET A 1 1   ? -19.091 16.526  12.992  1.00 7.05  ? 1   MET A CA   3  
ATOM 6575  C C    . MET A 1 1   ? -17.870 15.947  13.698  1.00 6.84  ? 1   MET A C    3  
ATOM 6576  O O    . MET A 1 1   ? -17.335 14.920  13.280  1.00 7.12  ? 1   MET A O    3  
ATOM 6577  C CB   . MET A 1 1   ? -19.834 15.421  12.233  1.00 7.11  ? 1   MET A CB   3  
ATOM 6578  C CG   . MET A 1 1   ? -21.241 15.808  11.792  1.00 7.39  ? 1   MET A CG   3  
ATOM 6579  S SD   . MET A 1 1   ? -21.265 17.146  10.580  1.00 7.66  ? 1   MET A SD   3  
ATOM 6580  C CE   . MET A 1 1   ? -20.517 16.341  9.164   1.00 7.91  ? 1   MET A CE   3  
ATOM 6581  H H1   . MET A 1 1   ? -18.235 18.380  12.602  1.00 7.95  ? 1   MET A H1   3  
ATOM 6582  H H2   . MET A 1 1   ? -19.532 18.001  11.587  1.00 7.75  ? 1   MET A H2   3  
ATOM 6583  H H3   . MET A 1 1   ? -18.031 17.257  11.360  1.00 7.88  ? 1   MET A H3   3  
ATOM 6584  H HA   . MET A 1 1   ? -19.751 16.944  13.736  1.00 7.07  ? 1   MET A HA   3  
ATOM 6585  H HB2  . MET A 1 1   ? -19.265 15.159  11.353  1.00 7.26  ? 1   MET A HB2  3  
ATOM 6586  H HB3  . MET A 1 1   ? -19.908 14.552  12.871  1.00 7.17  ? 1   MET A HB3  3  
ATOM 6587  H HG2  . MET A 1 1   ? -21.715 14.943  11.356  1.00 7.57  ? 1   MET A HG2  3  
ATOM 6588  H HG3  . MET A 1 1   ? -21.800 16.120  12.662  1.00 7.61  ? 1   MET A HG3  3  
ATOM 6589  H HE1  . MET A 1 1   ? -20.490 17.027  8.330   1.00 8.15  ? 1   MET A HE1  3  
ATOM 6590  H HE2  . MET A 1 1   ? -21.099 15.471  8.896   1.00 8.15  ? 1   MET A HE2  3  
ATOM 6591  H HE3  . MET A 1 1   ? -19.511 16.037  9.413   1.00 7.92  ? 1   MET A HE3  3  
ATOM 6592  N N    . ALA A 1 2   ? -17.439 16.624  14.765  1.00 6.67  ? 2   ALA A N    3  
ATOM 6593  C CA   . ALA A 1 2   ? -16.301 16.189  15.575  1.00 6.74  ? 2   ALA A CA   3  
ATOM 6594  C C    . ALA A 1 2   ? -15.034 16.052  14.735  1.00 6.14  ? 2   ALA A C    3  
ATOM 6595  O O    . ALA A 1 2   ? -14.656 14.951  14.330  1.00 6.28  ? 2   ALA A O    3  
ATOM 6596  C CB   . ALA A 1 2   ? -16.618 14.881  16.289  1.00 7.31  ? 2   ALA A CB   3  
ATOM 6597  H H    . ALA A 1 2   ? -17.905 17.452  15.015  1.00 6.72  ? 2   ALA A H    3  
ATOM 6598  H HA   . ALA A 1 2   ? -16.131 16.944  16.330  1.00 7.13  ? 2   ALA A HA   3  
ATOM 6599  H HB1  . ALA A 1 2   ? -17.517 14.999  16.877  1.00 7.69  ? 2   ALA A HB1  3  
ATOM 6600  H HB2  . ALA A 1 2   ? -15.797 14.614  16.938  1.00 7.46  ? 2   ALA A HB2  3  
ATOM 6601  H HB3  . ALA A 1 2   ? -16.766 14.100  15.558  1.00 7.49  ? 2   ALA A HB3  3  
ATOM 6602  N N    . LYS A 1 3   ? -14.387 17.177  14.468  1.00 5.79  ? 3   LYS A N    3  
ATOM 6603  C CA   . LYS A 1 3   ? -13.154 17.185  13.693  1.00 5.52  ? 3   LYS A CA   3  
ATOM 6604  C C    . LYS A 1 3   ? -12.004 16.605  14.510  1.00 5.00  ? 3   LYS A C    3  
ATOM 6605  O O    . LYS A 1 3   ? -11.783 16.996  15.659  1.00 5.14  ? 3   LYS A O    3  
ATOM 6606  C CB   . LYS A 1 3   ? -12.815 18.607  13.233  1.00 6.00  ? 3   LYS A CB   3  
ATOM 6607  C CG   . LYS A 1 3   ? -12.743 19.621  14.366  1.00 6.27  ? 3   LYS A CG   3  
ATOM 6608  C CD   . LYS A 1 3   ? -12.358 21.003  13.866  1.00 6.96  ? 3   LYS A CD   3  
ATOM 6609  C CE   . LYS A 1 3   ? -10.941 21.029  13.313  1.00 7.45  ? 3   LYS A CE   3  
ATOM 6610  N NZ   . LYS A 1 3   ? -10.539 22.393  12.883  1.00 7.92  ? 3   LYS A NZ   3  
ATOM 6611  H H    . LYS A 1 3   ? -14.746 18.026  14.801  1.00 5.95  ? 3   LYS A H    3  
ATOM 6612  H HA   . LYS A 1 3   ? -13.308 16.562  12.824  1.00 5.71  ? 3   LYS A HA   3  
ATOM 6613  H HB2  . LYS A 1 3   ? -11.858 18.591  12.735  1.00 6.29  ? 3   LYS A HB2  3  
ATOM 6614  H HB3  . LYS A 1 3   ? -13.568 18.936  12.533  1.00 6.28  ? 3   LYS A HB3  3  
ATOM 6615  H HG2  . LYS A 1 3   ? -13.710 19.681  14.841  1.00 6.42  ? 3   LYS A HG2  3  
ATOM 6616  H HG3  . LYS A 1 3   ? -12.008 19.290  15.085  1.00 6.21  ? 3   LYS A HG3  3  
ATOM 6617  H HD2  . LYS A 1 3   ? -13.042 21.294  13.084  1.00 7.10  ? 3   LYS A HD2  3  
ATOM 6618  H HD3  . LYS A 1 3   ? -12.428 21.704  14.686  1.00 7.33  ? 3   LYS A HD3  3  
ATOM 6619  H HE2  . LYS A 1 3   ? -10.263 20.688  14.080  1.00 7.69  ? 3   LYS A HE2  3  
ATOM 6620  H HE3  . LYS A 1 3   ? -10.887 20.363  12.465  1.00 7.56  ? 3   LYS A HE3  3  
ATOM 6621  H HZ1  . LYS A 1 3   ? -10.578 23.049  13.690  1.00 7.97  ? 3   LYS A HZ1  3  
ATOM 6622  H HZ2  . LYS A 1 3   ? -11.175 22.739  12.138  1.00 8.25  ? 3   LYS A HZ2  3  
ATOM 6623  H HZ3  . LYS A 1 3   ? -9.568  22.378  12.513  1.00 8.16  ? 3   LYS A HZ3  3  
ATOM 6624  N N    . ILE A 1 4   ? -11.293 15.652  13.925  1.00 4.74  ? 4   ILE A N    3  
ATOM 6625  C CA   . ILE A 1 4   ? -10.151 15.036  14.582  1.00 4.41  ? 4   ILE A CA   3  
ATOM 6626  C C    . ILE A 1 4   ? -9.010  14.856  13.591  1.00 3.66  ? 4   ILE A C    3  
ATOM 6627  O O    . ILE A 1 4   ? -9.208  14.964  12.379  1.00 3.90  ? 4   ILE A O    3  
ATOM 6628  C CB   . ILE A 1 4   ? -10.483 13.655  15.221  1.00 5.14  ? 4   ILE A CB   3  
ATOM 6629  C CG1  . ILE A 1 4   ? -10.838 12.598  14.159  1.00 5.77  ? 4   ILE A CG1  3  
ATOM 6630  C CG2  . ILE A 1 4   ? -11.608 13.787  16.241  1.00 5.58  ? 4   ILE A CG2  3  
ATOM 6631  C CD1  . ILE A 1 4   ? -12.224 12.739  13.558  1.00 6.53  ? 4   ILE A CD1  3  
ATOM 6632  H H    . ILE A 1 4   ? -11.538 15.357  13.019  1.00 5.01  ? 4   ILE A H    3  
ATOM 6633  H HA   . ILE A 1 4   ? -9.824  15.702  15.368  1.00 4.58  ? 4   ILE A HA   3  
ATOM 6634  H HB   . ILE A 1 4   ? -9.602  13.325  15.754  1.00 5.37  ? 4   ILE A HB   3  
ATOM 6635  H HG12 . ILE A 1 4   ? -10.126 12.663  13.350  1.00 5.98  ? 4   ILE A HG12 3  
ATOM 6636  H HG13 . ILE A 1 4   ? -10.771 11.617  14.607  1.00 5.87  ? 4   ILE A HG13 3  
ATOM 6637  H HG21 . ILE A 1 4   ? -12.491 14.174  15.754  1.00 5.92  ? 4   ILE A HG21 3  
ATOM 6638  H HG22 . ILE A 1 4   ? -11.305 14.463  17.026  1.00 5.99  ? 4   ILE A HG22 3  
ATOM 6639  H HG23 . ILE A 1 4   ? -11.824 12.818  16.662  1.00 5.54  ? 4   ILE A HG23 3  
ATOM 6640  H HD11 . ILE A 1 4   ? -12.370 11.978  12.807  1.00 6.97  ? 4   ILE A HD11 3  
ATOM 6641  H HD12 . ILE A 1 4   ? -12.323 13.715  13.107  1.00 6.74  ? 4   ILE A HD12 3  
ATOM 6642  H HD13 . ILE A 1 4   ? -12.965 12.625  14.335  1.00 6.72  ? 4   ILE A HD13 3  
ATOM 6643  N N    . SER A 1 5   ? -7.822  14.594  14.105  1.00 3.24  ? 5   SER A N    3  
ATOM 6644  C CA   . SER A 1 5   ? -6.668  14.336  13.263  1.00 2.93  ? 5   SER A CA   3  
ATOM 6645  C C    . SER A 1 5   ? -6.147  12.923  13.508  1.00 2.01  ? 5   SER A C    3  
ATOM 6646  O O    . SER A 1 5   ? -4.979  12.722  13.845  1.00 2.25  ? 5   SER A O    3  
ATOM 6647  C CB   . SER A 1 5   ? -5.578  15.381  13.524  1.00 3.70  ? 5   SER A CB   3  
ATOM 6648  O OG   . SER A 1 5   ? -5.355  15.558  14.914  1.00 4.46  ? 5   SER A OG   3  
ATOM 6649  H H    . SER A 1 5   ? -7.714  14.575  15.082  1.00 3.53  ? 5   SER A H    3  
ATOM 6650  H HA   . SER A 1 5   ? -6.987  14.412  12.235  1.00 3.38  ? 5   SER A HA   3  
ATOM 6651  H HB2  . SER A 1 5   ? -4.657  15.057  13.065  1.00 3.91  ? 5   SER A HB2  3  
ATOM 6652  H HB3  . SER A 1 5   ? -5.880  16.326  13.096  1.00 4.03  ? 5   SER A HB3  3  
ATOM 6653  H HG   . SER A 1 5   ? -5.448  14.709  15.365  1.00 4.64  ? 5   SER A HG   3  
ATOM 6654  N N    . SER A 1 6   ? -7.031  11.951  13.351  1.00 1.51  ? 6   SER A N    3  
ATOM 6655  C CA   . SER A 1 6   ? -6.687  10.558  13.571  1.00 1.03  ? 6   SER A CA   3  
ATOM 6656  C C    . SER A 1 6   ? -6.828  9.779   12.270  1.00 0.82  ? 6   SER A C    3  
ATOM 6657  O O    . SER A 1 6   ? -7.871  9.830   11.619  1.00 0.85  ? 6   SER A O    3  
ATOM 6658  C CB   . SER A 1 6   ? -7.592  9.956   14.653  1.00 1.67  ? 6   SER A CB   3  
ATOM 6659  O OG   . SER A 1 6   ? -7.205  8.629   14.980  1.00 2.25  ? 6   SER A OG   3  
ATOM 6660  H H    . SER A 1 6   ? -7.942  12.176  13.062  1.00 1.99  ? 6   SER A H    3  
ATOM 6661  H HA   . SER A 1 6   ? -5.660  10.514  13.900  1.00 1.21  ? 6   SER A HA   3  
ATOM 6662  H HB2  . SER A 1 6   ? -7.533  10.562  15.544  1.00 2.13  ? 6   SER A HB2  3  
ATOM 6663  H HB3  . SER A 1 6   ? -8.611  9.943   14.295  1.00 2.15  ? 6   SER A HB3  3  
ATOM 6664  H HG   . SER A 1 6   ? -7.660  8.008   14.394  1.00 2.50  ? 6   SER A HG   3  
ATOM 6665  N N    . PRO A 1 7   ? -5.778  9.061   11.866  1.00 0.69  ? 7   PRO A N    3  
ATOM 6666  C CA   . PRO A 1 7   ? -5.798  8.257   10.650  1.00 0.54  ? 7   PRO A CA   3  
ATOM 6667  C C    . PRO A 1 7   ? -6.483  6.920   10.875  1.00 0.44  ? 7   PRO A C    3  
ATOM 6668  O O    . PRO A 1 7   ? -6.561  6.428   12.003  1.00 0.56  ? 7   PRO A O    3  
ATOM 6669  C CB   . PRO A 1 7   ? -4.315  8.044   10.377  1.00 0.61  ? 7   PRO A CB   3  
ATOM 6670  C CG   . PRO A 1 7   ? -3.738  7.935   11.737  1.00 0.75  ? 7   PRO A CG   3  
ATOM 6671  C CD   . PRO A 1 7   ? -4.479  8.956   12.562  1.00 0.82  ? 7   PRO A CD   3  
ATOM 6672  H HA   . PRO A 1 7   ? -6.260  8.777   9.825   1.00 0.57  ? 7   PRO A HA   3  
ATOM 6673  H HB2  . PRO A 1 7   ? -4.174  7.137   9.806   1.00 0.60  ? 7   PRO A HB2  3  
ATOM 6674  H HB3  . PRO A 1 7   ? -3.914  8.889   9.840   1.00 0.68  ? 7   PRO A HB3  3  
ATOM 6675  H HG2  . PRO A 1 7   ? -3.910  6.939   12.125  1.00 0.75  ? 7   PRO A HG2  3  
ATOM 6676  H HG3  . PRO A 1 7   ? -2.683  8.159   11.715  1.00 0.87  ? 7   PRO A HG3  3  
ATOM 6677  H HD2  . PRO A 1 7   ? -4.609  8.603   13.575  1.00 0.93  ? 7   PRO A HD2  3  
ATOM 6678  H HD3  . PRO A 1 7   ? -3.959  9.902   12.551  1.00 0.90  ? 7   PRO A HD3  3  
ATOM 6679  N N    . THR A 1 8   ? -6.985  6.338   9.809   1.00 0.34  ? 8   THR A N    3  
ATOM 6680  C CA   . THR A 1 8   ? -7.557  5.015   9.884   1.00 0.27  ? 8   THR A CA   3  
ATOM 6681  C C    . THR A 1 8   ? -6.466  3.988   9.687   1.00 0.28  ? 8   THR A C    3  
ATOM 6682  O O    . THR A 1 8   ? -5.291  4.344   9.579   1.00 0.35  ? 8   THR A O    3  
ATOM 6683  C CB   . THR A 1 8   ? -8.621  4.811   8.814   1.00 0.28  ? 8   THR A CB   3  
ATOM 6684  O OG1  . THR A 1 8   ? -7.992  4.699   7.538   1.00 0.36  ? 8   THR A OG1  3  
ATOM 6685  C CG2  . THR A 1 8   ? -9.595  5.970   8.825   1.00 0.32  ? 8   THR A CG2  3  
ATOM 6686  H H    . THR A 1 8   ? -6.976  6.816   8.945   1.00 0.42  ? 8   THR A H    3  
ATOM 6687  H HA   . THR A 1 8   ? -8.005  4.884   10.854  1.00 0.31  ? 8   THR A HA   3  
ATOM 6688  H HB   . THR A 1 8   ? -9.160  3.904   9.025   1.00 0.32  ? 8   THR A HB   3  
ATOM 6689  H HG1  . THR A 1 8   ? -8.498  5.205   6.883   1.00 0.31  ? 8   THR A HG1  3  
ATOM 6690  H HG21 . THR A 1 8   ? -10.146 5.985   7.899   1.00 1.05  ? 8   THR A HG21 3  
ATOM 6691  H HG22 . THR A 1 8   ? -9.052  6.895   8.937   1.00 1.08  ? 8   THR A HG22 3  
ATOM 6692  H HG23 . THR A 1 8   ? -10.280 5.851   9.649   1.00 1.04  ? 8   THR A HG23 3  
ATOM 6693  N N    . GLU A 1 9   ? -6.849  2.727   9.608   1.00 0.28  ? 9   GLU A N    3  
ATOM 6694  C CA   . GLU A 1 9   ? -5.885  1.664   9.411   1.00 0.33  ? 9   GLU A CA   3  
ATOM 6695  C C    . GLU A 1 9   ? -5.086  1.894   8.131   1.00 0.36  ? 9   GLU A C    3  
ATOM 6696  O O    . GLU A 1 9   ? -3.865  1.891   8.154   1.00 0.52  ? 9   GLU A O    3  
ATOM 6697  C CB   . GLU A 1 9   ? -6.568  0.302   9.359   1.00 0.40  ? 9   GLU A CB   3  
ATOM 6698  C CG   . GLU A 1 9   ? -5.572  -0.838  9.323   1.00 0.56  ? 9   GLU A CG   3  
ATOM 6699  C CD   . GLU A 1 9   ? -4.768  -0.940  10.604  1.00 1.73  ? 9   GLU A CD   3  
ATOM 6700  O OE1  . GLU A 1 9   ? -5.263  -1.548  11.573  1.00 2.48  ? 9   GLU A OE1  3  
ATOM 6701  O OE2  . GLU A 1 9   ? -3.637  -0.414  10.650  1.00 2.47  ? 9   GLU A OE2  3  
ATOM 6702  H H    . GLU A 1 9   ? -7.805  2.511   9.682   1.00 0.29  ? 9   GLU A H    3  
ATOM 6703  H HA   . GLU A 1 9   ? -5.204  1.677   10.248  1.00 0.37  ? 9   GLU A HA   3  
ATOM 6704  H HB2  . GLU A 1 9   ? -7.193  0.186   10.233  1.00 0.44  ? 9   GLU A HB2  3  
ATOM 6705  H HB3  . GLU A 1 9   ? -7.183  0.248   8.472   1.00 0.38  ? 9   GLU A HB3  3  
ATOM 6706  H HG2  . GLU A 1 9   ? -6.096  -1.770  9.163   1.00 0.94  ? 9   GLU A HG2  3  
ATOM 6707  H HG3  . GLU A 1 9   ? -4.888  -0.663  8.501   1.00 0.73  ? 9   GLU A HG3  3  
ATOM 6708  N N    . THR A 1 10  ? -5.776  2.147   7.030   1.00 0.26  ? 10  THR A N    3  
ATOM 6709  C CA   . THR A 1 10  ? -5.119  2.329   5.747   1.00 0.27  ? 10  THR A CA   3  
ATOM 6710  C C    . THR A 1 10  ? -4.357  3.639   5.711   1.00 0.27  ? 10  THR A C    3  
ATOM 6711  O O    . THR A 1 10  ? -3.288  3.711   5.124   1.00 0.31  ? 10  THR A O    3  
ATOM 6712  C CB   . THR A 1 10  ? -6.119  2.260   4.563   1.00 0.27  ? 10  THR A CB   3  
ATOM 6713  O OG1  . THR A 1 10  ? -5.557  2.858   3.388   1.00 0.40  ? 10  THR A OG1  3  
ATOM 6714  C CG2  . THR A 1 10  ? -7.436  2.938   4.916   1.00 0.25  ? 10  THR A CG2  3  
ATOM 6715  H H    . THR A 1 10  ? -6.743  2.244   7.087   1.00 0.22  ? 10  THR A H    3  
ATOM 6716  H HA   . THR A 1 10  ? -4.406  1.531   5.626   1.00 0.31  ? 10  THR A HA   3  
ATOM 6717  H HB   . THR A 1 10  ? -6.318  1.217   4.347   1.00 0.34  ? 10  THR A HB   3  
ATOM 6718  H HG1  . THR A 1 10  ? -4.652  3.135   3.566   1.00 1.00  ? 10  THR A HG1  3  
ATOM 6719  H HG21 . THR A 1 10  ? -7.236  3.918   5.326   1.00 1.12  ? 10  THR A HG21 3  
ATOM 6720  H HG22 . THR A 1 10  ? -7.963  2.343   5.647   1.00 0.94  ? 10  THR A HG22 3  
ATOM 6721  H HG23 . THR A 1 10  ? -8.042  3.036   4.028   1.00 1.00  ? 10  THR A HG23 3  
ATOM 6722  N N    . GLU A 1 11  ? -4.882  4.658   6.371   1.00 0.25  ? 11  GLU A N    3  
ATOM 6723  C CA   . GLU A 1 11  ? -4.246  5.965   6.358   1.00 0.27  ? 11  GLU A CA   3  
ATOM 6724  C C    . GLU A 1 11  ? -2.945  5.941   7.135   1.00 0.30  ? 11  GLU A C    3  
ATOM 6725  O O    . GLU A 1 11  ? -1.915  6.402   6.651   1.00 0.32  ? 11  GLU A O    3  
ATOM 6726  C CB   . GLU A 1 11  ? -5.178  7.015   6.925   1.00 0.29  ? 11  GLU A CB   3  
ATOM 6727  C CG   . GLU A 1 11  ? -6.536  6.986   6.267   1.00 0.41  ? 11  GLU A CG   3  
ATOM 6728  C CD   . GLU A 1 11  ? -7.422  8.141   6.680   1.00 1.11  ? 11  GLU A CD   3  
ATOM 6729  O OE1  . GLU A 1 11  ? -7.514  8.417   7.895   1.00 1.85  ? 11  GLU A OE1  3  
ATOM 6730  O OE2  . GLU A 1 11  ? -8.037  8.767   5.794   1.00 1.71  ? 11  GLU A OE2  3  
ATOM 6731  H H    . GLU A 1 11  ? -5.717  4.531   6.871   1.00 0.23  ? 11  GLU A H    3  
ATOM 6732  H HA   . GLU A 1 11  ? -4.031  6.208   5.335   1.00 0.30  ? 11  GLU A HA   3  
ATOM 6733  H HB2  . GLU A 1 11  ? -5.301  6.839   7.982   1.00 0.41  ? 11  GLU A HB2  3  
ATOM 6734  H HB3  . GLU A 1 11  ? -4.746  7.991   6.772   1.00 0.42  ? 11  GLU A HB3  3  
ATOM 6735  H HG2  . GLU A 1 11  ? -6.392  7.012   5.201   1.00 0.40  ? 11  GLU A HG2  3  
ATOM 6736  H HG3  . GLU A 1 11  ? -7.027  6.063   6.535   1.00 0.71  ? 11  GLU A HG3  3  
ATOM 6737  N N    . ARG A 1 12  ? -2.991  5.374   8.332   1.00 0.35  ? 12  ARG A N    3  
ATOM 6738  C CA   . ARG A 1 12  ? -1.793  5.245   9.149   1.00 0.42  ? 12  ARG A CA   3  
ATOM 6739  C C    . ARG A 1 12  ? -0.802  4.342   8.439   1.00 0.43  ? 12  ARG A C    3  
ATOM 6740  O O    . ARG A 1 12  ? 0.404   4.562   8.480   1.00 0.47  ? 12  ARG A O    3  
ATOM 6741  C CB   . ARG A 1 12  ? -2.121  4.693   10.553  1.00 0.48  ? 12  ARG A CB   3  
ATOM 6742  C CG   . ARG A 1 12  ? -2.687  3.276   10.583  1.00 0.49  ? 12  ARG A CG   3  
ATOM 6743  C CD   . ARG A 1 12  ? -1.586  2.230   10.500  1.00 0.56  ? 12  ARG A CD   3  
ATOM 6744  N NE   . ARG A 1 12  ? -0.770  2.213   11.714  1.00 1.08  ? 12  ARG A NE   3  
ATOM 6745  C CZ   . ARG A 1 12  ? 0.479   1.757   11.783  1.00 1.35  ? 12  ARG A CZ   3  
ATOM 6746  N NH1  . ARG A 1 12  ? 1.078   1.267   10.707  1.00 1.86  ? 12  ARG A NH1  3  
ATOM 6747  N NH2  . ARG A 1 12  ? 1.129   1.791   12.940  1.00 1.95  ? 12  ARG A NH2  3  
ATOM 6748  H H    . ARG A 1 12  ? -3.850  5.036   8.666   1.00 0.35  ? 12  ARG A H    3  
ATOM 6749  H HA   . ARG A 1 12  ? -1.356  6.228   9.249   1.00 0.44  ? 12  ARG A HA   3  
ATOM 6750  H HB2  . ARG A 1 12  ? -1.212  4.688   11.132  1.00 0.56  ? 12  ARG A HB2  3  
ATOM 6751  H HB3  . ARG A 1 12  ? -2.834  5.352   11.023  1.00 0.48  ? 12  ARG A HB3  3  
ATOM 6752  H HG2  . ARG A 1 12  ? -3.234  3.137   11.503  1.00 0.53  ? 12  ARG A HG2  3  
ATOM 6753  H HG3  . ARG A 1 12  ? -3.356  3.149   9.743   1.00 0.45  ? 12  ARG A HG3  3  
ATOM 6754  H HD2  . ARG A 1 12  ? -2.036  1.259   10.353  1.00 0.91  ? 12  ARG A HD2  3  
ATOM 6755  H HD3  . ARG A 1 12  ? -0.956  2.466   9.646   1.00 0.84  ? 12  ARG A HD3  3  
ATOM 6756  H HE   . ARG A 1 12  ? -1.185  2.567   12.534  1.00 1.80  ? 12  ARG A HE   3  
ATOM 6757  H HH11 . ARG A 1 12  ? 0.597   1.234   9.833   1.00 2.09  ? 12  ARG A HH11 3  
ATOM 6758  H HH12 . ARG A 1 12  ? 2.035   0.935   10.764  1.00 2.43  ? 12  ARG A HH12 3  
ATOM 6759  H HH21 . ARG A 1 12  ? 0.682   2.159   13.759  1.00 2.48  ? 12  ARG A HH21 3  
ATOM 6760  H HH22 . ARG A 1 12  ? 2.069   1.448   13.002  1.00 2.20  ? 12  ARG A HH22 3  
ATOM 6761  N N    . CYS A 1 13  ? -1.340  3.340   7.762   1.00 0.42  ? 13  CYS A N    3  
ATOM 6762  C CA   . CYS A 1 13  ? -0.538  2.365   7.054   1.00 0.44  ? 13  CYS A CA   3  
ATOM 6763  C C    . CYS A 1 13  ? 0.139   3.023   5.867   1.00 0.30  ? 13  CYS A C    3  
ATOM 6764  O O    . CYS A 1 13  ? 1.293   2.740   5.553   1.00 0.29  ? 13  CYS A O    3  
ATOM 6765  C CB   . CYS A 1 13  ? -1.431  1.200   6.626   1.00 0.57  ? 13  CYS A CB   3  
ATOM 6766  S SG   . CYS A 1 13  ? -1.766  0.016   7.947   1.00 2.16  ? 13  CYS A SG   3  
ATOM 6767  H H    . CYS A 1 13  ? -2.321  3.261   7.730   1.00 0.41  ? 13  CYS A H    3  
ATOM 6768  H HA   . CYS A 1 13  ? 0.221   2.000   7.730   1.00 0.55  ? 13  CYS A HA   3  
ATOM 6769  H HB2  . CYS A 1 13  ? -2.381  1.596   6.298   1.00 1.00  ? 13  CYS A HB2  3  
ATOM 6770  H HB3  . CYS A 1 13  ? -0.978  0.672   5.823   1.00 0.84  ? 13  CYS A HB3  3  
ATOM 6771  H HG   . CYS A 1 13  ? -2.880  0.400   8.561   1.00 2.85  ? 13  CYS A HG   3  
ATOM 6772  N N    . ILE A 1 14  ? -0.585  3.935   5.251   1.00 0.26  ? 14  ILE A N    3  
ATOM 6773  C CA   . ILE A 1 14  ? -0.065  4.749   4.176   1.00 0.24  ? 14  ILE A CA   3  
ATOM 6774  C C    . ILE A 1 14  ? 1.115   5.599   4.652   1.00 0.21  ? 14  ILE A C    3  
ATOM 6775  O O    . ILE A 1 14  ? 2.145   5.691   3.980   1.00 0.23  ? 14  ILE A O    3  
ATOM 6776  C CB   . ILE A 1 14  ? -1.182  5.659   3.626   1.00 0.24  ? 14  ILE A CB   3  
ATOM 6777  C CG1  . ILE A 1 14  ? -2.094  4.885   2.673   1.00 0.25  ? 14  ILE A CG1  3  
ATOM 6778  C CG2  . ILE A 1 14  ? -0.607  6.884   2.944   1.00 0.27  ? 14  ILE A CG2  3  
ATOM 6779  C CD1  . ILE A 1 14  ? -3.361  5.633   2.343   1.00 0.27  ? 14  ILE A CD1  3  
ATOM 6780  H H    . ILE A 1 14  ? -1.520  4.061   5.525   1.00 0.27  ? 14  ILE A H    3  
ATOM 6781  H HA   . ILE A 1 14  ? 0.264   4.091   3.391   1.00 0.27  ? 14  ILE A HA   3  
ATOM 6782  H HB   . ILE A 1 14  ? -1.773  5.995   4.465   1.00 0.25  ? 14  ILE A HB   3  
ATOM 6783  H HG12 . ILE A 1 14  ? -1.569  4.697   1.749   1.00 0.26  ? 14  ILE A HG12 3  
ATOM 6784  H HG13 . ILE A 1 14  ? -2.372  3.945   3.126   1.00 0.27  ? 14  ILE A HG13 3  
ATOM 6785  H HG21 . ILE A 1 14  ? 0.108   6.570   2.201   1.00 1.02  ? 14  ILE A HG21 3  
ATOM 6786  H HG22 . ILE A 1 14  ? -0.117  7.507   3.678   1.00 1.02  ? 14  ILE A HG22 3  
ATOM 6787  H HG23 . ILE A 1 14  ? -1.402  7.439   2.471   1.00 1.01  ? 14  ILE A HG23 3  
ATOM 6788  H HD11 . ILE A 1 14  ? -3.106  6.586   1.902   1.00 1.06  ? 14  ILE A HD11 3  
ATOM 6789  H HD12 . ILE A 1 14  ? -3.929  5.791   3.250   1.00 0.96  ? 14  ILE A HD12 3  
ATOM 6790  H HD13 . ILE A 1 14  ? -3.949  5.058   1.644   1.00 1.12  ? 14  ILE A HD13 3  
ATOM 6791  N N    . GLU A 1 15  ? 0.970   6.186   5.832   1.00 0.24  ? 15  GLU A N    3  
ATOM 6792  C CA   . GLU A 1 15  ? 1.985   7.071   6.378   1.00 0.28  ? 15  GLU A CA   3  
ATOM 6793  C C    . GLU A 1 15  ? 3.150   6.265   6.868   1.00 0.30  ? 15  GLU A C    3  
ATOM 6794  O O    . GLU A 1 15  ? 4.271   6.753   6.978   1.00 0.34  ? 15  GLU A O    3  
ATOM 6795  C CB   . GLU A 1 15  ? 1.425   7.864   7.537   1.00 0.32  ? 15  GLU A CB   3  
ATOM 6796  C CG   . GLU A 1 15  ? 0.195   8.672   7.171   1.00 0.33  ? 15  GLU A CG   3  
ATOM 6797  C CD   . GLU A 1 15  ? -0.322  9.494   8.327   1.00 0.38  ? 15  GLU A CD   3  
ATOM 6798  O OE1  . GLU A 1 15  ? 0.133   10.645  8.485   1.00 1.26  ? 15  GLU A OE1  3  
ATOM 6799  O OE2  . GLU A 1 15  ? -1.187  9.004   9.081   1.00 1.06  ? 15  GLU A OE2  3  
ATOM 6800  H H    . GLU A 1 15  ? 0.168   6.005   6.362   1.00 0.26  ? 15  GLU A H    3  
ATOM 6801  H HA   . GLU A 1 15  ? 2.310   7.744   5.601   1.00 0.29  ? 15  GLU A HA   3  
ATOM 6802  H HB2  . GLU A 1 15  ? 1.167   7.173   8.331   1.00 0.33  ? 15  GLU A HB2  3  
ATOM 6803  H HB3  . GLU A 1 15  ? 2.189   8.539   7.894   1.00 0.37  ? 15  GLU A HB3  3  
ATOM 6804  H HG2  . GLU A 1 15  ? 0.450   9.341   6.363   1.00 0.33  ? 15  GLU A HG2  3  
ATOM 6805  H HG3  . GLU A 1 15  ? -0.583  7.993   6.845   1.00 0.31  ? 15  GLU A HG3  3  
ATOM 6806  N N    . SER A 1 16  ? 2.871   5.025   7.178   1.00 0.31  ? 16  SER A N    3  
ATOM 6807  C CA   . SER A 1 16  ? 3.888   4.137   7.640   1.00 0.38  ? 16  SER A CA   3  
ATOM 6808  C C    . SER A 1 16  ? 4.748   3.686   6.472   1.00 0.29  ? 16  SER A C    3  
ATOM 6809  O O    . SER A 1 16  ? 5.942   3.464   6.626   1.00 0.28  ? 16  SER A O    3  
ATOM 6810  C CB   . SER A 1 16  ? 3.259   2.965   8.372   1.00 0.54  ? 16  SER A CB   3  
ATOM 6811  O OG   . SER A 1 16  ? 2.507   3.425   9.480   1.00 0.97  ? 16  SER A OG   3  
ATOM 6812  H H    . SER A 1 16  ? 1.948   4.704   7.095   1.00 0.31  ? 16  SER A H    3  
ATOM 6813  H HA   . SER A 1 16  ? 4.502   4.690   8.325   1.00 0.45  ? 16  SER A HA   3  
ATOM 6814  H HB2  . SER A 1 16  ? 2.605   2.426   7.702   1.00 0.77  ? 16  SER A HB2  3  
ATOM 6815  H HB3  . SER A 1 16  ? 4.033   2.312   8.729   1.00 0.80  ? 16  SER A HB3  3  
ATOM 6816  H HG   . SER A 1 16  ? 1.740   3.925   9.163   1.00 1.17  ? 16  SER A HG   3  
ATOM 6817  N N    . LEU A 1 17  ? 4.140   3.586   5.295   1.00 0.27  ? 17  LEU A N    3  
ATOM 6818  C CA   . LEU A 1 17  ? 4.901   3.365   4.074   1.00 0.28  ? 17  LEU A CA   3  
ATOM 6819  C C    . LEU A 1 17  ? 5.762   4.584   3.816   1.00 0.27  ? 17  LEU A C    3  
ATOM 6820  O O    . LEU A 1 17  ? 6.909   4.470   3.402   1.00 0.32  ? 17  LEU A O    3  
ATOM 6821  C CB   . LEU A 1 17  ? 3.973   3.124   2.887   1.00 0.29  ? 17  LEU A CB   3  
ATOM 6822  C CG   . LEU A 1 17  ? 2.916   2.051   3.121   1.00 0.33  ? 17  LEU A CG   3  
ATOM 6823  C CD1  . LEU A 1 17  ? 1.923   1.998   1.974   1.00 0.33  ? 17  LEU A CD1  3  
ATOM 6824  C CD2  . LEU A 1 17  ? 3.568   0.691   3.327   1.00 0.46  ? 17  LEU A CD2  3  
ATOM 6825  H H    . LEU A 1 17  ? 3.163   3.659   5.247   1.00 0.28  ? 17  LEU A H    3  
ATOM 6826  H HA   . LEU A 1 17  ? 5.534   2.503   4.219   1.00 0.31  ? 17  LEU A HA   3  
ATOM 6827  H HB2  . LEU A 1 17  ? 3.476   4.056   2.655   1.00 0.27  ? 17  LEU A HB2  3  
ATOM 6828  H HB3  . LEU A 1 17  ? 4.574   2.829   2.037   1.00 0.36  ? 17  LEU A HB3  3  
ATOM 6829  H HG   . LEU A 1 17  ? 2.377   2.301   4.017   1.00 0.33  ? 17  LEU A HG   3  
ATOM 6830  H HD11 . LEU A 1 17  ? 2.437   1.714   1.068   1.00 1.09  ? 17  LEU A HD11 3  
ATOM 6831  H HD12 . LEU A 1 17  ? 1.473   2.971   1.842   1.00 1.06  ? 17  LEU A HD12 3  
ATOM 6832  H HD13 . LEU A 1 17  ? 1.154   1.271   2.196   1.00 1.06  ? 17  LEU A HD13 3  
ATOM 6833  H HD21 . LEU A 1 17  ? 2.801   -0.058  3.458   1.00 1.08  ? 17  LEU A HD21 3  
ATOM 6834  H HD22 . LEU A 1 17  ? 4.196   0.722   4.205   1.00 1.10  ? 17  LEU A HD22 3  
ATOM 6835  H HD23 . LEU A 1 17  ? 4.168   0.445   2.464   1.00 1.21  ? 17  LEU A HD23 3  
ATOM 6836  N N    . ILE A 1 18  ? 5.188   5.757   4.081   1.00 0.27  ? 18  ILE A N    3  
ATOM 6837  C CA   . ILE A 1 18  ? 5.933   7.005   4.049   1.00 0.30  ? 18  ILE A CA   3  
ATOM 6838  C C    . ILE A 1 18  ? 7.142   6.919   4.975   1.00 0.28  ? 18  ILE A C    3  
ATOM 6839  O O    . ILE A 1 18  ? 8.253   7.261   4.587   1.00 0.30  ? 18  ILE A O    3  
ATOM 6840  C CB   . ILE A 1 18  ? 5.046   8.212   4.457   1.00 0.36  ? 18  ILE A CB   3  
ATOM 6841  C CG1  . ILE A 1 18  ? 4.014   8.510   3.365   1.00 0.63  ? 18  ILE A CG1  3  
ATOM 6842  C CG2  . ILE A 1 18  ? 5.900   9.441   4.750   1.00 0.47  ? 18  ILE A CG2  3  
ATOM 6843  C CD1  . ILE A 1 18  ? 3.083   9.657   3.700   1.00 1.37  ? 18  ILE A CD1  3  
ATOM 6844  H H    . ILE A 1 18  ? 4.231   5.778   4.297   1.00 0.29  ? 18  ILE A H    3  
ATOM 6845  H HA   . ILE A 1 18  ? 6.278   7.163   3.037   1.00 0.33  ? 18  ILE A HA   3  
ATOM 6846  H HB   . ILE A 1 18  ? 4.519   7.951   5.367   1.00 0.36  ? 18  ILE A HB   3  
ATOM 6847  H HG12 . ILE A 1 18  ? 4.531   8.761   2.452   1.00 0.98  ? 18  ILE A HG12 3  
ATOM 6848  H HG13 . ILE A 1 18  ? 3.410   7.629   3.201   1.00 1.37  ? 18  ILE A HG13 3  
ATOM 6849  H HG21 . ILE A 1 18  ? 6.551   9.635   3.911   1.00 1.13  ? 18  ILE A HG21 3  
ATOM 6850  H HG22 . ILE A 1 18  ? 6.498   9.262   5.634   1.00 1.10  ? 18  ILE A HG22 3  
ATOM 6851  H HG23 . ILE A 1 18  ? 5.258   10.296  4.915   1.00 1.11  ? 18  ILE A HG23 3  
ATOM 6852  H HD11 . ILE A 1 18  ? 2.550   9.435   4.614   1.00 1.87  ? 18  ILE A HD11 3  
ATOM 6853  H HD12 . ILE A 1 18  ? 2.376   9.793   2.896   1.00 1.89  ? 18  ILE A HD12 3  
ATOM 6854  H HD13 . ILE A 1 18  ? 3.657   10.562  3.831   1.00 1.99  ? 18  ILE A HD13 3  
ATOM 6855  N N    . ALA A 1 19  ? 6.912   6.430   6.187   1.00 0.25  ? 19  ALA A N    3  
ATOM 6856  C CA   . ALA A 1 19  ? 7.965   6.299   7.184   1.00 0.25  ? 19  ALA A CA   3  
ATOM 6857  C C    . ALA A 1 19  ? 9.057   5.333   6.731   1.00 0.23  ? 19  ALA A C    3  
ATOM 6858  O O    . ALA A 1 19  ? 10.231  5.697   6.681   1.00 0.28  ? 19  ALA A O    3  
ATOM 6859  C CB   . ALA A 1 19  ? 7.372   5.841   8.510   1.00 0.28  ? 19  ALA A CB   3  
ATOM 6860  H H    . ALA A 1 19  ? 5.997   6.161   6.422   1.00 0.26  ? 19  ALA A H    3  
ATOM 6861  H HA   . ALA A 1 19  ? 8.403   7.275   7.334   1.00 0.29  ? 19  ALA A HA   3  
ATOM 6862  H HB1  . ALA A 1 19  ? 6.966   4.846   8.398   1.00 1.04  ? 19  ALA A HB1  3  
ATOM 6863  H HB2  . ALA A 1 19  ? 6.585   6.519   8.807   1.00 1.06  ? 19  ALA A HB2  3  
ATOM 6864  H HB3  . ALA A 1 19  ? 8.144   5.831   9.266   1.00 0.97  ? 19  ALA A HB3  3  
ATOM 6865  N N    . VAL A 1 20  ? 8.666   4.106   6.389   1.00 0.20  ? 20  VAL A N    3  
ATOM 6866  C CA   . VAL A 1 20  ? 9.629   3.075   6.010   1.00 0.22  ? 20  VAL A CA   3  
ATOM 6867  C C    . VAL A 1 20  ? 10.369  3.478   4.743   1.00 0.23  ? 20  VAL A C    3  
ATOM 6868  O O    . VAL A 1 20  ? 11.580  3.265   4.617   1.00 0.27  ? 20  VAL A O    3  
ATOM 6869  C CB   . VAL A 1 20  ? 8.951   1.695   5.822   1.00 0.27  ? 20  VAL A CB   3  
ATOM 6870  C CG1  . VAL A 1 20  ? 8.004   1.433   6.956   1.00 0.87  ? 20  VAL A CG1  3  
ATOM 6871  C CG2  . VAL A 1 20  ? 8.210   1.587   4.501   1.00 0.87  ? 20  VAL A CG2  3  
ATOM 6872  H H    . VAL A 1 20  ? 7.707   3.890   6.393   1.00 0.21  ? 20  VAL A H    3  
ATOM 6873  H HA   . VAL A 1 20  ? 10.346  2.990   6.813   1.00 0.24  ? 20  VAL A HA   3  
ATOM 6874  H HB   . VAL A 1 20  ? 9.713   0.935   5.850   1.00 0.52  ? 20  VAL A HB   3  
ATOM 6875  H HG11 . VAL A 1 20  ? 8.552   1.385   7.883   1.00 1.36  ? 20  VAL A HG11 3  
ATOM 6876  H HG12 . VAL A 1 20  ? 7.487   0.501   6.784   1.00 1.57  ? 20  VAL A HG12 3  
ATOM 6877  H HG13 . VAL A 1 20  ? 7.287   2.241   6.999   1.00 1.42  ? 20  VAL A HG13 3  
ATOM 6878  H HG21 . VAL A 1 20  ? 7.474   2.373   4.437   1.00 1.45  ? 20  VAL A HG21 3  
ATOM 6879  H HG22 . VAL A 1 20  ? 7.718   0.627   4.443   1.00 1.40  ? 20  VAL A HG22 3  
ATOM 6880  H HG23 . VAL A 1 20  ? 8.912   1.683   3.685   1.00 1.53  ? 20  VAL A HG23 3  
ATOM 6881  N N    . PHE A 1 21  ? 9.640   4.078   3.815   1.00 0.23  ? 21  PHE A N    3  
ATOM 6882  C CA   . PHE A 1 21  ? 10.253  4.584   2.595   1.00 0.25  ? 21  PHE A CA   3  
ATOM 6883  C C    . PHE A 1 21  ? 11.257  5.683   2.916   1.00 0.29  ? 21  PHE A C    3  
ATOM 6884  O O    . PHE A 1 21  ? 12.403  5.629   2.487   1.00 0.35  ? 21  PHE A O    3  
ATOM 6885  C CB   . PHE A 1 21  ? 9.193   5.123   1.630   1.00 0.26  ? 21  PHE A CB   3  
ATOM 6886  C CG   . PHE A 1 21  ? 9.763   5.682   0.352   1.00 0.91  ? 21  PHE A CG   3  
ATOM 6887  C CD1  . PHE A 1 21  ? 10.058  4.849   -0.712  1.00 1.85  ? 21  PHE A CD1  3  
ATOM 6888  C CD2  . PHE A 1 21  ? 10.005  7.041   0.220   1.00 1.59  ? 21  PHE A CD2  3  
ATOM 6889  C CE1  . PHE A 1 21  ? 10.585  5.358   -1.885  1.00 2.48  ? 21  PHE A CE1  3  
ATOM 6890  C CE2  . PHE A 1 21  ? 10.533  7.556   -0.950  1.00 2.17  ? 21  PHE A CE2  3  
ATOM 6891  C CZ   . PHE A 1 21  ? 10.823  6.713   -2.003  1.00 2.40  ? 21  PHE A CZ   3  
ATOM 6892  H H    . PHE A 1 21  ? 8.650   4.157   3.953   1.00 0.23  ? 21  PHE A H    3  
ATOM 6893  H HA   . PHE A 1 21  ? 10.773  3.764   2.122   1.00 0.27  ? 21  PHE A HA   3  
ATOM 6894  H HB2  . PHE A 1 21  ? 8.513   4.325   1.372   1.00 0.64  ? 21  PHE A HB2  3  
ATOM 6895  H HB3  . PHE A 1 21  ? 8.644   5.911   2.121   1.00 0.62  ? 21  PHE A HB3  3  
ATOM 6896  H HD1  . PHE A 1 21  ? 9.872   3.789   -0.623  1.00 2.42  ? 21  PHE A HD1  3  
ATOM 6897  H HD2  . PHE A 1 21  ? 9.781   7.702   1.043   1.00 2.15  ? 21  PHE A HD2  3  
ATOM 6898  H HE1  . PHE A 1 21  ? 10.811  4.696   -2.708  1.00 3.33  ? 21  PHE A HE1  3  
ATOM 6899  H HE2  . PHE A 1 21  ? 10.716  8.616   -1.040  1.00 2.85  ? 21  PHE A HE2  3  
ATOM 6900  H HZ   . PHE A 1 21  ? 11.235  7.112   -2.919  1.00 2.98  ? 21  PHE A HZ   3  
ATOM 6901  N N    . GLN A 1 22  ? 10.826  6.656   3.703   1.00 0.30  ? 22  GLN A N    3  
ATOM 6902  C CA   . GLN A 1 22  ? 11.610  7.855   3.957   1.00 0.37  ? 22  GLN A CA   3  
ATOM 6903  C C    . GLN A 1 22  ? 12.859  7.549   4.769   1.00 0.36  ? 22  GLN A C    3  
ATOM 6904  O O    . GLN A 1 22  ? 13.863  8.248   4.651   1.00 0.44  ? 22  GLN A O    3  
ATOM 6905  C CB   . GLN A 1 22  ? 10.746  8.881   4.692   1.00 0.47  ? 22  GLN A CB   3  
ATOM 6906  C CG   . GLN A 1 22  ? 11.147  10.323  4.446   1.00 1.12  ? 22  GLN A CG   3  
ATOM 6907  C CD   . GLN A 1 22  ? 10.918  10.758  3.011   1.00 1.98  ? 22  GLN A CD   3  
ATOM 6908  O OE1  . GLN A 1 22  ? 10.038  10.241  2.322   1.00 2.68  ? 22  GLN A OE1  3  
ATOM 6909  N NE2  . GLN A 1 22  ? 11.692  11.728  2.554   1.00 2.66  ? 22  GLN A NE2  3  
ATOM 6910  H H    . GLN A 1 22  ? 9.948   6.569   4.131   1.00 0.28  ? 22  GLN A H    3  
ATOM 6911  H HA   . GLN A 1 22  ? 11.912  8.266   3.007   1.00 0.42  ? 22  GLN A HA   3  
ATOM 6912  H HB2  . GLN A 1 22  ? 9.720   8.760   4.376   1.00 0.83  ? 22  GLN A HB2  3  
ATOM 6913  H HB3  . GLN A 1 22  ? 10.808  8.690   5.753   1.00 0.94  ? 22  GLN A HB3  3  
ATOM 6914  H HG2  . GLN A 1 22  ? 10.564  10.958  5.094   1.00 1.54  ? 22  GLN A HG2  3  
ATOM 6915  H HG3  . GLN A 1 22  ? 12.195  10.433  4.677   1.00 1.68  ? 22  GLN A HG3  3  
ATOM 6916  H HE21 . GLN A 1 22  ? 12.361  12.110  3.161   1.00 2.74  ? 22  GLN A HE21 3  
ATOM 6917  H HE22 . GLN A 1 22  ? 11.565  12.023  1.627   1.00 3.38  ? 22  GLN A HE22 3  
ATOM 6918  N N    . LYS A 1 23  ? 12.810  6.508   5.587   1.00 0.35  ? 23  LYS A N    3  
ATOM 6919  C CA   . LYS A 1 23  ? 13.956  6.169   6.408   1.00 0.39  ? 23  LYS A CA   3  
ATOM 6920  C C    . LYS A 1 23  ? 15.030  5.449   5.591   1.00 0.40  ? 23  LYS A C    3  
ATOM 6921  O O    . LYS A 1 23  ? 16.223  5.679   5.790   1.00 0.49  ? 23  LYS A O    3  
ATOM 6922  C CB   . LYS A 1 23  ? 13.534  5.334   7.621   1.00 0.41  ? 23  LYS A CB   3  
ATOM 6923  C CG   . LYS A 1 23  ? 12.924  4.004   7.275   1.00 0.42  ? 23  LYS A CG   3  
ATOM 6924  C CD   . LYS A 1 23  ? 12.230  3.411   8.479   1.00 0.63  ? 23  LYS A CD   3  
ATOM 6925  C CE   . LYS A 1 23  ? 12.219  1.907   8.390   1.00 0.63  ? 23  LYS A CE   3  
ATOM 6926  N NZ   . LYS A 1 23  ? 11.475  1.267   9.507   1.00 0.91  ? 23  LYS A NZ   3  
ATOM 6927  H H    . LYS A 1 23  ? 11.987  5.975   5.654   1.00 0.35  ? 23  LYS A H    3  
ATOM 6928  H HA   . LYS A 1 23  ? 14.369  7.100   6.760   1.00 0.42  ? 23  LYS A HA   3  
ATOM 6929  H HB2  . LYS A 1 23  ? 14.399  5.139   8.233   1.00 0.45  ? 23  LYS A HB2  3  
ATOM 6930  H HB3  . LYS A 1 23  ? 12.814  5.892   8.198   1.00 0.45  ? 23  LYS A HB3  3  
ATOM 6931  H HG2  . LYS A 1 23  ? 12.204  4.141   6.482   1.00 0.53  ? 23  LYS A HG2  3  
ATOM 6932  H HG3  . LYS A 1 23  ? 13.703  3.331   6.950   1.00 0.57  ? 23  LYS A HG3  3  
ATOM 6933  H HD2  . LYS A 1 23  ? 12.754  3.714   9.371   1.00 0.97  ? 23  LYS A HD2  3  
ATOM 6934  H HD3  . LYS A 1 23  ? 11.213  3.775   8.508   1.00 0.85  ? 23  LYS A HD3  3  
ATOM 6935  H HE2  . LYS A 1 23  ? 11.769  1.620   7.456   1.00 0.72  ? 23  LYS A HE2  3  
ATOM 6936  H HE3  . LYS A 1 23  ? 13.243  1.572   8.411   1.00 0.85  ? 23  LYS A HE3  3  
ATOM 6937  H HZ1  . LYS A 1 23  ? 12.003  1.375   10.398  1.00 1.42  ? 23  LYS A HZ1  3  
ATOM 6938  H HZ2  . LYS A 1 23  ? 11.348  0.247   9.314   1.00 1.25  ? 23  LYS A HZ2  3  
ATOM 6939  H HZ3  . LYS A 1 23  ? 10.541  1.706   9.615   1.00 1.47  ? 23  LYS A HZ3  3  
ATOM 6940  N N    . TYR A 1 24  ? 14.621  4.594   4.658   1.00 0.36  ? 24  TYR A N    3  
ATOM 6941  C CA   . TYR A 1 24  ? 15.587  3.870   3.841   1.00 0.39  ? 24  TYR A CA   3  
ATOM 6942  C C    . TYR A 1 24  ? 16.020  4.680   2.639   1.00 0.34  ? 24  TYR A C    3  
ATOM 6943  O O    . TYR A 1 24  ? 17.209  4.784   2.350   1.00 0.40  ? 24  TYR A O    3  
ATOM 6944  C CB   . TYR A 1 24  ? 15.044  2.518   3.405   1.00 0.46  ? 24  TYR A CB   3  
ATOM 6945  C CG   . TYR A 1 24  ? 15.217  1.476   4.481   1.00 0.86  ? 24  TYR A CG   3  
ATOM 6946  C CD1  . TYR A 1 24  ? 16.416  0.786   4.603   1.00 1.67  ? 24  TYR A CD1  3  
ATOM 6947  C CD2  . TYR A 1 24  ? 14.209  1.204   5.392   1.00 1.52  ? 24  TYR A CD2  3  
ATOM 6948  C CE1  . TYR A 1 24  ? 16.603  -0.146  5.603   1.00 1.99  ? 24  TYR A CE1  3  
ATOM 6949  C CE2  . TYR A 1 24  ? 14.388  0.268   6.391   1.00 1.83  ? 24  TYR A CE2  3  
ATOM 6950  C CZ   . TYR A 1 24  ? 15.587  -0.400  6.495   1.00 1.72  ? 24  TYR A CZ   3  
ATOM 6951  O OH   . TYR A 1 24  ? 15.771  -1.328  7.494   1.00 2.15  ? 24  TYR A OH   3  
ATOM 6952  H H    . TYR A 1 24  ? 13.654  4.452   4.516   1.00 0.33  ? 24  TYR A H    3  
ATOM 6953  H HA   . TYR A 1 24  ? 16.458  3.701   4.458   1.00 0.50  ? 24  TYR A HA   3  
ATOM 6954  H HB2  . TYR A 1 24  ? 13.991  2.613   3.173   1.00 0.51  ? 24  TYR A HB2  3  
ATOM 6955  H HB3  . TYR A 1 24  ? 15.577  2.188   2.527   1.00 0.45  ? 24  TYR A HB3  3  
ATOM 6956  H HD1  . TYR A 1 24  ? 17.211  0.986   3.900   1.00 2.37  ? 24  TYR A HD1  3  
ATOM 6957  H HD2  . TYR A 1 24  ? 13.269  1.729   5.309   1.00 2.22  ? 24  TYR A HD2  3  
ATOM 6958  H HE1  . TYR A 1 24  ? 17.543  -0.672  5.681   1.00 2.80  ? 24  TYR A HE1  3  
ATOM 6959  H HE2  . TYR A 1 24  ? 13.591  0.067   7.091   1.00 2.59  ? 24  TYR A HE2  3  
ATOM 6960  H HH   . TYR A 1 24  ? 15.247  -2.119  7.293   1.00 2.39  ? 24  TYR A HH   3  
ATOM 6961  N N    . ALA A 1 25  ? 15.061  5.270   1.951   1.00 0.29  ? 25  ALA A N    3  
ATOM 6962  C CA   . ALA A 1 25  ? 15.362  6.152   0.840   1.00 0.34  ? 25  ALA A CA   3  
ATOM 6963  C C    . ALA A 1 25  ? 16.108  7.374   1.355   1.00 0.47  ? 25  ALA A C    3  
ATOM 6964  O O    . ALA A 1 25  ? 16.826  8.051   0.618   1.00 0.58  ? 25  ALA A O    3  
ATOM 6965  C CB   . ALA A 1 25  ? 14.076  6.555   0.134   1.00 0.37  ? 25  ALA A CB   3  
ATOM 6966  H H    . ALA A 1 25  ? 14.121  5.113   2.199   1.00 0.28  ? 25  ALA A H    3  
ATOM 6967  H HA   . ALA A 1 25  ? 15.987  5.615   0.140   1.00 0.34  ? 25  ALA A HA   3  
ATOM 6968  H HB1  . ALA A 1 25  ? 13.505  7.211   0.778   1.00 1.04  ? 25  ALA A HB1  3  
ATOM 6969  H HB2  . ALA A 1 25  ? 13.495  5.668   -0.075  1.00 0.98  ? 25  ALA A HB2  3  
ATOM 6970  H HB3  . ALA A 1 25  ? 14.311  7.063   -0.790  1.00 1.09  ? 25  ALA A HB3  3  
ATOM 6971  N N    . GLY A 1 26  ? 15.941  7.629   2.648   1.00 0.49  ? 26  GLY A N    3  
ATOM 6972  C CA   . GLY A 1 26  ? 16.609  8.733   3.297   1.00 0.64  ? 26  GLY A CA   3  
ATOM 6973  C C    . GLY A 1 26  ? 18.102  8.522   3.427   1.00 0.75  ? 26  GLY A C    3  
ATOM 6974  O O    . GLY A 1 26  ? 18.850  9.483   3.600   1.00 0.96  ? 26  GLY A O    3  
ATOM 6975  H H    . GLY A 1 26  ? 15.339  7.053   3.172   1.00 0.45  ? 26  GLY A H    3  
ATOM 6976  H HA2  . GLY A 1 26  ? 16.439  9.627   2.721   1.00 0.73  ? 26  GLY A HA2  3  
ATOM 6977  H HA3  . GLY A 1 26  ? 16.186  8.867   4.282   1.00 0.64  ? 26  GLY A HA3  3  
ATOM 6978  N N    . LYS A 1 27  ? 18.544  7.270   3.323   1.00 0.69  ? 27  LYS A N    3  
ATOM 6979  C CA   . LYS A 1 27  ? 19.969  6.961   3.393   1.00 0.82  ? 27  LYS A CA   3  
ATOM 6980  C C    . LYS A 1 27  ? 20.710  7.604   2.228   1.00 0.95  ? 27  LYS A C    3  
ATOM 6981  O O    . LYS A 1 27  ? 21.890  7.926   2.333   1.00 1.11  ? 27  LYS A O    3  
ATOM 6982  C CB   . LYS A 1 27  ? 20.220  5.454   3.353   1.00 0.77  ? 27  LYS A CB   3  
ATOM 6983  C CG   . LYS A 1 27  ? 19.621  4.669   4.506   1.00 0.81  ? 27  LYS A CG   3  
ATOM 6984  C CD   . LYS A 1 27  ? 20.049  3.213   4.434   1.00 0.85  ? 27  LYS A CD   3  
ATOM 6985  C CE   . LYS A 1 27  ? 19.456  2.384   5.555   1.00 1.11  ? 27  LYS A CE   3  
ATOM 6986  N NZ   . LYS A 1 27  ? 20.038  1.014   5.596   1.00 1.72  ? 27  LYS A NZ   3  
ATOM 6987  H H    . LYS A 1 27  ? 17.900  6.540   3.193   1.00 0.60  ? 27  LYS A H    3  
ATOM 6988  H HA   . LYS A 1 27  ? 20.355  7.361   4.318   1.00 0.92  ? 27  LYS A HA   3  
ATOM 6989  H HB2  . LYS A 1 27  ? 19.809  5.065   2.437   1.00 0.68  ? 27  LYS A HB2  3  
ATOM 6990  H HB3  . LYS A 1 27  ? 21.287  5.285   3.352   1.00 0.89  ? 27  LYS A HB3  3  
ATOM 6991  H HG2  . LYS A 1 27  ? 19.964  5.093   5.439   1.00 0.95  ? 27  LYS A HG2  3  
ATOM 6992  H HG3  . LYS A 1 27  ? 18.544  4.725   4.451   1.00 0.78  ? 27  LYS A HG3  3  
ATOM 6993  H HD2  . LYS A 1 27  ? 19.722  2.802   3.492   1.00 1.08  ? 27  LYS A HD2  3  
ATOM 6994  H HD3  . LYS A 1 27  ? 21.127  3.162   4.492   1.00 1.11  ? 27  LYS A HD3  3  
ATOM 6995  H HE2  . LYS A 1 27  ? 19.650  2.879   6.495   1.00 1.65  ? 27  LYS A HE2  3  
ATOM 6996  H HE3  . LYS A 1 27  ? 18.388  2.309   5.400   1.00 1.47  ? 27  LYS A HE3  3  
ATOM 6997  H HZ1  . LYS A 1 27  ? 19.896  0.533   4.685   1.00 2.17  ? 27  LYS A HZ1  3  
ATOM 6998  H HZ2  . LYS A 1 27  ? 19.584  0.454   6.344   1.00 2.11  ? 27  LYS A HZ2  3  
ATOM 6999  H HZ3  . LYS A 1 27  ? 21.057  1.065   5.790   1.00 2.19  ? 27  LYS A HZ3  3  
ATOM 7000  N N    . ASP A 1 28  ? 20.006  7.785   1.119   1.00 1.00  ? 28  ASP A N    3  
ATOM 7001  C CA   . ASP A 1 28  ? 20.611  8.349   -0.078  1.00 1.19  ? 28  ASP A CA   3  
ATOM 7002  C C    . ASP A 1 28  ? 20.269  9.832   -0.204  1.00 1.26  ? 28  ASP A C    3  
ATOM 7003  O O    . ASP A 1 28  ? 20.566  10.475  -1.211  1.00 1.58  ? 28  ASP A O    3  
ATOM 7004  C CB   . ASP A 1 28  ? 20.149  7.580   -1.318  1.00 1.33  ? 28  ASP A CB   3  
ATOM 7005  C CG   . ASP A 1 28  ? 21.037  7.842   -2.514  1.00 1.65  ? 28  ASP A CG   3  
ATOM 7006  O OD1  . ASP A 1 28  ? 22.240  7.511   -2.443  1.00 2.16  ? 28  ASP A OD1  3  
ATOM 7007  O OD2  . ASP A 1 28  ? 20.549  8.393   -3.520  1.00 2.08  ? 28  ASP A OD2  3  
ATOM 7008  H H    . ASP A 1 28  ? 19.058  7.533   1.105   1.00 0.99  ? 28  ASP A H    3  
ATOM 7009  H HA   . ASP A 1 28  ? 21.683  8.249   0.018   1.00 1.28  ? 28  ASP A HA   3  
ATOM 7010  H HB2  . ASP A 1 28  ? 20.164  6.521   -1.106  1.00 1.33  ? 28  ASP A HB2  3  
ATOM 7011  H HB3  . ASP A 1 28  ? 19.141  7.880   -1.567  1.00 1.44  ? 28  ASP A HB3  3  
ATOM 7012  N N    . GLY A 1 29  ? 19.651  10.374  0.837   1.00 1.15  ? 29  GLY A N    3  
ATOM 7013  C CA   . GLY A 1 29  ? 19.324  11.785  0.853   1.00 1.32  ? 29  GLY A CA   3  
ATOM 7014  C C    . GLY A 1 29  ? 17.849  12.052  0.626   1.00 1.51  ? 29  GLY A C    3  
ATOM 7015  O O    . GLY A 1 29  ? 17.439  13.208  0.562   1.00 1.64  ? 29  GLY A O    3  
ATOM 7016  H H    . GLY A 1 29  ? 19.424  9.811   1.608   1.00 1.14  ? 29  GLY A H    3  
ATOM 7017  H HA2  . GLY A 1 29  ? 19.608  12.198  1.810   1.00 1.60  ? 29  GLY A HA2  3  
ATOM 7018  H HA3  . GLY A 1 29  ? 19.890  12.281  0.079   1.00 1.54  ? 29  GLY A HA3  3  
ATOM 7019  N N    . TYR A 1 30  ? 17.062  10.971  0.513   1.00 2.07  ? 30  TYR A N    3  
ATOM 7020  C CA   . TYR A 1 30  ? 15.605  11.035  0.284   1.00 2.80  ? 30  TYR A CA   3  
ATOM 7021  C C    . TYR A 1 30  ? 15.224  12.048  -0.799  1.00 2.61  ? 30  TYR A C    3  
ATOM 7022  O O    . TYR A 1 30  ? 16.050  12.428  -1.630  1.00 3.02  ? 30  TYR A O    3  
ATOM 7023  C CB   . TYR A 1 30  ? 14.816  11.306  1.592   1.00 3.68  ? 30  TYR A CB   3  
ATOM 7024  C CG   . TYR A 1 30  ? 15.239  12.530  2.386   1.00 4.52  ? 30  TYR A CG   3  
ATOM 7025  C CD1  . TYR A 1 30  ? 14.748  13.794  2.073   1.00 5.12  ? 30  TYR A CD1  3  
ATOM 7026  C CD2  . TYR A 1 30  ? 16.124  12.419  3.452   1.00 5.11  ? 30  TYR A CD2  3  
ATOM 7027  C CE1  . TYR A 1 30  ? 15.132  14.909  2.797   1.00 6.09  ? 30  TYR A CE1  3  
ATOM 7028  C CE2  . TYR A 1 30  ? 16.511  13.527  4.179   1.00 6.04  ? 30  TYR A CE2  3  
ATOM 7029  C CZ   . TYR A 1 30  ? 16.013  14.770  3.847   1.00 6.45  ? 30  TYR A CZ   3  
ATOM 7030  O OH   . TYR A 1 30  ? 16.405  15.875  4.568   1.00 7.51  ? 30  TYR A OH   3  
ATOM 7031  H H    . TYR A 1 30  ? 17.480  10.087  0.576   1.00 2.21  ? 30  TYR A H    3  
ATOM 7032  H HA   . TYR A 1 30  ? 15.315  10.058  -0.078  1.00 3.26  ? 30  TYR A HA   3  
ATOM 7033  H HB2  . TYR A 1 30  ? 13.774  11.433  1.343   1.00 3.86  ? 30  TYR A HB2  3  
ATOM 7034  H HB3  . TYR A 1 30  ? 14.907  10.448  2.238   1.00 3.95  ? 30  TYR A HB3  3  
ATOM 7035  H HD1  . TYR A 1 30  ? 14.057  13.900  1.249   1.00 5.07  ? 30  TYR A HD1  3  
ATOM 7036  H HD2  . TYR A 1 30  ? 16.515  11.447  3.709   1.00 5.09  ? 30  TYR A HD2  3  
ATOM 7037  H HE1  . TYR A 1 30  ? 14.741  15.882  2.537   1.00 6.74  ? 30  TYR A HE1  3  
ATOM 7038  H HE2  . TYR A 1 30  ? 17.200  13.419  5.003   1.00 6.63  ? 30  TYR A HE2  3  
ATOM 7039  H HH   . TYR A 1 30  ? 15.634  16.437  4.748   1.00 7.75  ? 30  TYR A HH   3  
ATOM 7040  N N    . ASN A 1 31  ? 13.943  12.419  -0.814  1.00 2.62  ? 31  ASN A N    3  
ATOM 7041  C CA   . ASN A 1 31  ? 13.414  13.447  -1.712  1.00 2.78  ? 31  ASN A CA   3  
ATOM 7042  C C    . ASN A 1 31  ? 13.182  12.899  -3.123  1.00 1.96  ? 31  ASN A C    3  
ATOM 7043  O O    . ASN A 1 31  ? 12.753  13.631  -4.014  1.00 2.53  ? 31  ASN A O    3  
ATOM 7044  C CB   . ASN A 1 31  ? 14.332  14.683  -1.749  1.00 3.85  ? 31  ASN A CB   3  
ATOM 7045  C CG   . ASN A 1 31  ? 13.685  15.885  -2.412  1.00 4.61  ? 31  ASN A CG   3  
ATOM 7046  O OD1  . ASN A 1 31  ? 12.468  16.058  -2.363  1.00 4.92  ? 31  ASN A OD1  3  
ATOM 7047  N ND2  . ASN A 1 31  ? 14.494  16.725  -3.036  1.00 5.33  ? 31  ASN A ND2  3  
ATOM 7048  H H    . ASN A 1 31  ? 13.323  11.978  -0.198  1.00 2.93  ? 31  ASN A H    3  
ATOM 7049  H HA   . ASN A 1 31  ? 12.458  13.749  -1.314  1.00 3.24  ? 31  ASN A HA   3  
ATOM 7050  H HB2  . ASN A 1 31  ? 14.596  14.956  -0.739  1.00 4.17  ? 31  ASN A HB2  3  
ATOM 7051  H HB3  . ASN A 1 31  ? 15.232  14.436  -2.295  1.00 4.22  ? 31  ASN A HB3  3  
ATOM 7052  H HD21 . ASN A 1 31  ? 15.456  16.530  -3.037  1.00 5.37  ? 31  ASN A HD21 3  
ATOM 7053  H HD22 . ASN A 1 31  ? 14.101  17.511  -3.469  1.00 5.97  ? 31  ASN A HD22 3  
ATOM 7054  N N    . TYR A 1 32  ? 13.433  11.606  -3.332  1.00 1.18  ? 32  TYR A N    3  
ATOM 7055  C CA   . TYR A 1 32  ? 13.169  11.010  -4.639  1.00 1.18  ? 32  TYR A CA   3  
ATOM 7056  C C    . TYR A 1 32  ? 13.014  9.482   -4.614  1.00 0.92  ? 32  TYR A C    3  
ATOM 7057  O O    . TYR A 1 32  ? 11.925  8.975   -4.881  1.00 1.05  ? 32  TYR A O    3  
ATOM 7058  C CB   . TYR A 1 32  ? 14.210  11.454  -5.696  1.00 1.78  ? 32  TYR A CB   3  
ATOM 7059  C CG   . TYR A 1 32  ? 15.684  11.190  -5.395  1.00 2.38  ? 32  TYR A CG   3  
ATOM 7060  C CD1  . TYR A 1 32  ? 16.146  10.859  -4.125  1.00 2.99  ? 32  TYR A CD1  3  
ATOM 7061  C CD2  . TYR A 1 32  ? 16.621  11.289  -6.417  1.00 3.08  ? 32  TYR A CD2  3  
ATOM 7062  C CE1  . TYR A 1 32  ? 17.490  10.635  -3.886  1.00 3.86  ? 32  TYR A CE1  3  
ATOM 7063  C CE2  . TYR A 1 32  ? 17.964  11.070  -6.184  1.00 3.93  ? 32  TYR A CE2  3  
ATOM 7064  C CZ   . TYR A 1 32  ? 18.393  10.742  -4.920  1.00 4.19  ? 32  TYR A CZ   3  
ATOM 7065  O OH   . TYR A 1 32  ? 19.733  10.532  -4.688  1.00 5.19  ? 32  TYR A OH   3  
ATOM 7066  H H    . TYR A 1 32  ? 13.792  11.055  -2.607  1.00 1.45  ? 32  TYR A H    3  
ATOM 7067  H HA   . TYR A 1 32  ? 12.214  11.409  -4.951  1.00 1.86  ? 32  TYR A HA   3  
ATOM 7068  H HB2  . TYR A 1 32  ? 13.987  10.949  -6.622  1.00 2.16  ? 32  TYR A HB2  3  
ATOM 7069  H HB3  . TYR A 1 32  ? 14.098  12.518  -5.854  1.00 2.32  ? 32  TYR A HB3  3  
ATOM 7070  H HD1  . TYR A 1 32  ? 15.437  10.776  -3.316  1.00 3.17  ? 32  TYR A HD1  3  
ATOM 7071  H HD2  . TYR A 1 32  ? 16.285  11.545  -7.411  1.00 3.32  ? 32  TYR A HD2  3  
ATOM 7072  H HE1  . TYR A 1 32  ? 17.826  10.378  -2.892  1.00 4.54  ? 32  TYR A HE1  3  
ATOM 7073  H HE2  . TYR A 1 32  ? 18.671  11.152  -6.995  1.00 4.65  ? 32  TYR A HE2  3  
ATOM 7074  H HH   . TYR A 1 32  ? 19.848  9.710   -4.173  1.00 5.57  ? 32  TYR A HH   3  
ATOM 7075  N N    . THR A 1 33  ? 14.066  8.745   -4.283  1.00 0.67  ? 33  THR A N    3  
ATOM 7076  C CA   . THR A 1 33  ? 14.071  7.309   -4.533  1.00 0.46  ? 33  THR A CA   3  
ATOM 7077  C C    . THR A 1 33  ? 14.782  6.492   -3.466  1.00 0.38  ? 33  THR A C    3  
ATOM 7078  O O    . THR A 1 33  ? 15.659  6.977   -2.747  1.00 0.44  ? 33  THR A O    3  
ATOM 7079  C CB   . THR A 1 33  ? 14.739  7.024   -5.883  1.00 0.45  ? 33  THR A CB   3  
ATOM 7080  O OG1  . THR A 1 33  ? 15.510  8.153   -6.314  1.00 0.66  ? 33  THR A OG1  3  
ATOM 7081  C CG2  . THR A 1 33  ? 13.725  6.649   -6.940  1.00 0.43  ? 33  THR A CG2  3  
ATOM 7082  H H    . THR A 1 33  ? 14.849  9.167   -3.878  1.00 0.73  ? 33  THR A H    3  
ATOM 7083  H HA   . THR A 1 33  ? 13.050  6.960   -4.594  1.00 0.50  ? 33  THR A HA   3  
ATOM 7084  H HB   . THR A 1 33  ? 15.402  6.196   -5.749  1.00 0.56  ? 33  THR A HB   3  
ATOM 7085  H HG1  . THR A 1 33  ? 16.423  8.037   -6.019  1.00 1.28  ? 33  THR A HG1  3  
ATOM 7086  H HG21 . THR A 1 33  ? 13.297  5.687   -6.691  1.00 1.10  ? 33  THR A HG21 3  
ATOM 7087  H HG22 . THR A 1 33  ? 14.216  6.585   -7.900  1.00 0.99  ? 33  THR A HG22 3  
ATOM 7088  H HG23 . THR A 1 33  ? 12.946  7.394   -6.974  1.00 1.14  ? 33  THR A HG23 3  
ATOM 7089  N N    . LEU A 1 34  ? 14.353  5.243   -3.381  1.00 0.32  ? 34  LEU A N    3  
ATOM 7090  C CA   . LEU A 1 34  ? 14.992  4.216   -2.583  1.00 0.30  ? 34  LEU A CA   3  
ATOM 7091  C C    . LEU A 1 34  ? 16.045  3.544   -3.438  1.00 0.31  ? 34  LEU A C    3  
ATOM 7092  O O    . LEU A 1 34  ? 15.726  2.773   -4.346  1.00 0.34  ? 34  LEU A O    3  
ATOM 7093  C CB   . LEU A 1 34  ? 13.916  3.224   -2.130  1.00 0.30  ? 34  LEU A CB   3  
ATOM 7094  C CG   . LEU A 1 34  ? 13.899  2.893   -0.641  1.00 0.29  ? 34  LEU A CG   3  
ATOM 7095  C CD1  . LEU A 1 34  ? 12.565  2.285   -0.241  1.00 0.45  ? 34  LEU A CD1  3  
ATOM 7096  C CD2  . LEU A 1 34  ? 15.020  1.939   -0.300  1.00 0.28  ? 34  LEU A CD2  3  
ATOM 7097  H H    . LEU A 1 34  ? 13.548  4.993   -3.889  1.00 0.32  ? 34  LEU A H    3  
ATOM 7098  H HA   . LEU A 1 34  ? 15.477  4.663   -1.730  1.00 0.32  ? 34  LEU A HA   3  
ATOM 7099  H HB2  . LEU A 1 34  ? 12.945  3.645   -2.387  1.00 0.34  ? 34  LEU A HB2  3  
ATOM 7100  H HB3  . LEU A 1 34  ? 14.058  2.298   -2.683  1.00 0.34  ? 34  LEU A HB3  3  
ATOM 7101  H HG   . LEU A 1 34  ? 14.041  3.801   -0.076  1.00 0.32  ? 34  LEU A HG   3  
ATOM 7102  H HD11 . LEU A 1 34  ? 12.403  1.373   -0.797  1.00 1.03  ? 34  LEU A HD11 3  
ATOM 7103  H HD12 . LEU A 1 34  ? 11.772  2.983   -0.458  1.00 1.18  ? 34  LEU A HD12 3  
ATOM 7104  H HD13 . LEU A 1 34  ? 12.573  2.065   0.817   1.00 1.08  ? 34  LEU A HD13 3  
ATOM 7105  H HD21 . LEU A 1 34  ? 14.991  1.710   0.755   1.00 1.05  ? 34  LEU A HD21 3  
ATOM 7106  H HD22 . LEU A 1 34  ? 15.964  2.396   -0.546  1.00 1.09  ? 34  LEU A HD22 3  
ATOM 7107  H HD23 . LEU A 1 34  ? 14.901  1.025   -0.867  1.00 1.01  ? 34  LEU A HD23 3  
ATOM 7108  N N    . SER A 1 35  ? 17.295  3.882   -3.161  1.00 0.32  ? 35  SER A N    3  
ATOM 7109  C CA   . SER A 1 35  ? 18.413  3.456   -3.978  1.00 0.33  ? 35  SER A CA   3  
ATOM 7110  C C    . SER A 1 35  ? 18.560  1.940   -3.972  1.00 0.32  ? 35  SER A C    3  
ATOM 7111  O O    . SER A 1 35  ? 17.995  1.265   -3.112  1.00 0.30  ? 35  SER A O    3  
ATOM 7112  C CB   . SER A 1 35  ? 19.695  4.134   -3.489  1.00 0.37  ? 35  SER A CB   3  
ATOM 7113  O OG   . SER A 1 35  ? 20.792  3.844   -4.337  1.00 0.40  ? 35  SER A OG   3  
ATOM 7114  H H    . SER A 1 35  ? 17.469  4.445   -2.379  1.00 0.33  ? 35  SER A H    3  
ATOM 7115  H HA   . SER A 1 35  ? 18.215  3.773   -4.983  1.00 0.35  ? 35  SER A HA   3  
ATOM 7116  H HB2  . SER A 1 35  ? 19.547  5.204   -3.470  1.00 0.39  ? 35  SER A HB2  3  
ATOM 7117  H HB3  . SER A 1 35  ? 19.923  3.786   -2.493  1.00 0.38  ? 35  SER A HB3  3  
ATOM 7118  H HG   . SER A 1 35  ? 21.540  3.558   -3.801  1.00 0.68  ? 35  SER A HG   3  
ATOM 7119  N N    . LYS A 1 36  ? 19.316  1.417   -4.935  1.00 0.38  ? 36  LYS A N    3  
ATOM 7120  C CA   . LYS A 1 36  ? 19.479  -0.023  -5.100  1.00 0.42  ? 36  LYS A CA   3  
ATOM 7121  C C    . LYS A 1 36  ? 19.850  -0.683  -3.778  1.00 0.36  ? 36  LYS A C    3  
ATOM 7122  O O    . LYS A 1 36  ? 19.097  -1.504  -3.261  1.00 0.35  ? 36  LYS A O    3  
ATOM 7123  C CB   . LYS A 1 36  ? 20.551  -0.319  -6.155  1.00 0.53  ? 36  LYS A CB   3  
ATOM 7124  C CG   . LYS A 1 36  ? 20.711  -1.798  -6.468  1.00 0.62  ? 36  LYS A CG   3  
ATOM 7125  C CD   . LYS A 1 36  ? 19.446  -2.379  -7.075  1.00 0.66  ? 36  LYS A CD   3  
ATOM 7126  C CE   . LYS A 1 36  ? 19.622  -3.842  -7.463  1.00 0.61  ? 36  LYS A CE   3  
ATOM 7127  N NZ   . LYS A 1 36  ? 20.555  -4.011  -8.611  1.00 0.65  ? 36  LYS A NZ   3  
ATOM 7128  H H    . LYS A 1 36  ? 19.783  2.023   -5.552  1.00 0.43  ? 36  LYS A H    3  
ATOM 7129  H HA   . LYS A 1 36  ? 18.536  -0.425  -5.436  1.00 0.46  ? 36  LYS A HA   3  
ATOM 7130  H HB2  . LYS A 1 36  ? 20.290  0.194   -7.069  1.00 0.58  ? 36  LYS A HB2  3  
ATOM 7131  H HB3  . LYS A 1 36  ? 21.499  0.057   -5.801  1.00 0.56  ? 36  LYS A HB3  3  
ATOM 7132  H HG2  . LYS A 1 36  ? 21.524  -1.923  -7.166  1.00 1.06  ? 36  LYS A HG2  3  
ATOM 7133  H HG3  . LYS A 1 36  ? 20.937  -2.326  -5.553  1.00 1.21  ? 36  LYS A HG3  3  
ATOM 7134  H HD2  . LYS A 1 36  ? 18.645  -2.305  -6.353  1.00 1.25  ? 36  LYS A HD2  3  
ATOM 7135  H HD3  . LYS A 1 36  ? 19.188  -1.808  -7.960  1.00 1.12  ? 36  LYS A HD3  3  
ATOM 7136  H HE2  . LYS A 1 36  ? 20.014  -4.381  -6.613  1.00 0.66  ? 36  LYS A HE2  3  
ATOM 7137  H HE3  . LYS A 1 36  ? 18.658  -4.248  -7.731  1.00 0.58  ? 36  LYS A HE3  3  
ATOM 7138  H HZ1  . LYS A 1 36  ? 20.282  -3.380  -9.392  1.00 1.18  ? 36  LYS A HZ1  3  
ATOM 7139  H HZ2  . LYS A 1 36  ? 20.521  -4.996  -8.955  1.00 1.14  ? 36  LYS A HZ2  3  
ATOM 7140  H HZ3  . LYS A 1 36  ? 21.528  -3.788  -8.322  1.00 1.16  ? 36  LYS A HZ3  3  
ATOM 7141  N N    . THR A 1 37  ? 20.987  -0.294  -3.219  1.00 0.37  ? 37  THR A N    3  
ATOM 7142  C CA   . THR A 1 37  ? 21.460  -0.861  -1.965  1.00 0.38  ? 37  THR A CA   3  
ATOM 7143  C C    . THR A 1 37  ? 20.499  -0.559  -0.814  1.00 0.36  ? 37  THR A C    3  
ATOM 7144  O O    . THR A 1 37  ? 20.352  -1.357  0.113   1.00 0.38  ? 37  THR A O    3  
ATOM 7145  C CB   . THR A 1 37  ? 22.854  -0.325  -1.614  1.00 0.44  ? 37  THR A CB   3  
ATOM 7146  O OG1  . THR A 1 37  ? 23.757  -0.579  -2.698  1.00 0.48  ? 37  THR A OG1  3  
ATOM 7147  C CG2  . THR A 1 37  ? 23.378  -0.980  -0.346  1.00 0.49  ? 37  THR A CG2  3  
ATOM 7148  H H    . THR A 1 37  ? 21.532  0.392   -3.667  1.00 0.39  ? 37  THR A H    3  
ATOM 7149  H HA   . THR A 1 37  ? 21.530  -1.933  -2.089  1.00 0.39  ? 37  THR A HA   3  
ATOM 7150  H HB   . THR A 1 37  ? 22.781  0.743   -1.454  1.00 0.44  ? 37  THR A HB   3  
ATOM 7151  H HG1  . THR A 1 37  ? 24.225  0.237   -2.920  1.00 0.80  ? 37  THR A HG1  3  
ATOM 7152  H HG21 . THR A 1 37  ? 24.360  -0.595  -0.117  1.00 1.15  ? 37  THR A HG21 3  
ATOM 7153  H HG22 . THR A 1 37  ? 23.431  -2.050  -0.491  1.00 1.09  ? 37  THR A HG22 3  
ATOM 7154  H HG23 . THR A 1 37  ? 22.705  -0.765  0.473   1.00 1.13  ? 37  THR A HG23 3  
ATOM 7155  N N    . GLU A 1 38  ? 19.820  0.575   -0.895  1.00 0.34  ? 38  GLU A N    3  
ATOM 7156  C CA   . GLU A 1 38  ? 18.895  0.978   0.149   1.00 0.34  ? 38  GLU A CA   3  
ATOM 7157  C C    . GLU A 1 38  ? 17.675  0.080   0.120   1.00 0.34  ? 38  GLU A C    3  
ATOM 7158  O O    . GLU A 1 38  ? 17.065  -0.200  1.148   1.00 0.48  ? 38  GLU A O    3  
ATOM 7159  C CB   . GLU A 1 38  ? 18.498  2.445   -0.013  1.00 0.35  ? 38  GLU A CB   3  
ATOM 7160  C CG   . GLU A 1 38  ? 19.510  3.428   0.558   1.00 0.47  ? 38  GLU A CG   3  
ATOM 7161  C CD   . GLU A 1 38  ? 20.936  3.161   0.118   1.00 1.27  ? 38  GLU A CD   3  
ATOM 7162  O OE1  . GLU A 1 38  ? 21.347  3.685   -0.932  1.00 1.96  ? 38  GLU A OE1  3  
ATOM 7163  O OE2  . GLU A 1 38  ? 21.660  2.440   0.838   1.00 2.16  ? 38  GLU A OE2  3  
ATOM 7164  H H    . GLU A 1 38  ? 19.919  1.138   -1.690  1.00 0.34  ? 38  GLU A H    3  
ATOM 7165  H HA   . GLU A 1 38  ? 19.389  0.857   1.095   1.00 0.35  ? 38  GLU A HA   3  
ATOM 7166  H HB2  . GLU A 1 38  ? 18.371  2.659   -1.063  1.00 0.41  ? 38  GLU A HB2  3  
ATOM 7167  H HB3  . GLU A 1 38  ? 17.558  2.604   0.494   1.00 0.45  ? 38  GLU A HB3  3  
ATOM 7168  H HG2  . GLU A 1 38  ? 19.239  4.424   0.245   1.00 1.16  ? 38  GLU A HG2  3  
ATOM 7169  H HG3  . GLU A 1 38  ? 19.469  3.370   1.634   1.00 1.30  ? 38  GLU A HG3  3  
ATOM 7170  N N    . PHE A 1 39  ? 17.354  -0.394  -1.073  1.00 0.29  ? 39  PHE A N    3  
ATOM 7171  C CA   . PHE A 1 39  ? 16.240  -1.295  -1.274  1.00 0.31  ? 39  PHE A CA   3  
ATOM 7172  C C    . PHE A 1 39  ? 16.648  -2.694  -0.868  1.00 0.28  ? 39  PHE A C    3  
ATOM 7173  O O    . PHE A 1 39  ? 15.847  -3.465  -0.343  1.00 0.27  ? 39  PHE A O    3  
ATOM 7174  C CB   . PHE A 1 39  ? 15.820  -1.268  -2.741  1.00 0.53  ? 39  PHE A CB   3  
ATOM 7175  C CG   . PHE A 1 39  ? 14.544  -1.997  -3.018  1.00 0.81  ? 39  PHE A CG   3  
ATOM 7176  C CD1  . PHE A 1 39  ? 13.389  -1.670  -2.330  1.00 1.78  ? 39  PHE A CD1  3  
ATOM 7177  C CD2  . PHE A 1 39  ? 14.497  -3.005  -3.965  1.00 1.76  ? 39  PHE A CD2  3  
ATOM 7178  C CE1  . PHE A 1 39  ? 12.209  -2.334  -2.581  1.00 2.66  ? 39  PHE A CE1  3  
ATOM 7179  C CE2  . PHE A 1 39  ? 13.319  -3.674  -4.222  1.00 2.62  ? 39  PHE A CE2  3  
ATOM 7180  C CZ   . PHE A 1 39  ? 12.172  -3.340  -3.530  1.00 2.88  ? 39  PHE A CZ   3  
ATOM 7181  H H    . PHE A 1 39  ? 17.889  -0.125  -1.852  1.00 0.34  ? 39  PHE A H    3  
ATOM 7182  H HA   . PHE A 1 39  ? 15.418  -0.969  -0.653  1.00 0.35  ? 39  PHE A HA   3  
ATOM 7183  H HB2  . PHE A 1 39  ? 15.697  -0.245  -3.051  1.00 1.23  ? 39  PHE A HB2  3  
ATOM 7184  H HB3  . PHE A 1 39  ? 16.599  -1.724  -3.336  1.00 1.41  ? 39  PHE A HB3  3  
ATOM 7185  H HD1  . PHE A 1 39  ? 13.417  -0.884  -1.590  1.00 2.31  ? 39  PHE A HD1  3  
ATOM 7186  H HD2  . PHE A 1 39  ? 15.395  -3.266  -4.507  1.00 2.31  ? 39  PHE A HD2  3  
ATOM 7187  H HE1  . PHE A 1 39  ? 11.315  -2.069  -2.038  1.00 3.51  ? 39  PHE A HE1  3  
ATOM 7188  H HE2  . PHE A 1 39  ? 13.292  -4.458  -4.963  1.00 3.45  ? 39  PHE A HE2  3  
ATOM 7189  H HZ   . PHE A 1 39  ? 11.250  -3.862  -3.728  1.00 3.70  ? 39  PHE A HZ   3  
ATOM 7190  N N    . LEU A 1 40  ? 17.910  -3.006  -1.114  1.00 0.33  ? 40  LEU A N    3  
ATOM 7191  C CA   . LEU A 1 40  ? 18.484  -4.264  -0.686  1.00 0.37  ? 40  LEU A CA   3  
ATOM 7192  C C    . LEU A 1 40  ? 18.420  -4.355  0.831   1.00 0.40  ? 40  LEU A C    3  
ATOM 7193  O O    . LEU A 1 40  ? 17.974  -5.354  1.394   1.00 0.43  ? 40  LEU A O    3  
ATOM 7194  C CB   . LEU A 1 40  ? 19.934  -4.373  -1.155  1.00 0.43  ? 40  LEU A CB   3  
ATOM 7195  C CG   . LEU A 1 40  ? 20.172  -4.117  -2.647  1.00 0.50  ? 40  LEU A CG   3  
ATOM 7196  C CD1  . LEU A 1 40  ? 21.526  -4.657  -3.077  1.00 1.07  ? 40  LEU A CD1  3  
ATOM 7197  C CD2  . LEU A 1 40  ? 19.055  -4.705  -3.491  1.00 0.46  ? 40  LEU A CD2  3  
ATOM 7198  H H    . LEU A 1 40  ? 18.470  -2.371  -1.613  1.00 0.37  ? 40  LEU A H    3  
ATOM 7199  H HA   . LEU A 1 40  ? 17.906  -5.065  -1.117  1.00 0.38  ? 40  LEU A HA   3  
ATOM 7200  H HB2  . LEU A 1 40  ? 20.512  -3.649  -0.597  1.00 0.65  ? 40  LEU A HB2  3  
ATOM 7201  H HB3  . LEU A 1 40  ? 20.293  -5.361  -0.918  1.00 0.47  ? 40  LEU A HB3  3  
ATOM 7202  H HG   . LEU A 1 40  ? 20.180  -3.049  -2.817  1.00 0.80  ? 40  LEU A HG   3  
ATOM 7203  H HD11 . LEU A 1 40  ? 22.305  -4.166  -2.513  1.00 1.87  ? 40  LEU A HD11 3  
ATOM 7204  H HD12 . LEU A 1 40  ? 21.670  -4.469  -4.130  1.00 1.41  ? 40  LEU A HD12 3  
ATOM 7205  H HD13 . LEU A 1 40  ? 21.563  -5.721  -2.893  1.00 1.46  ? 40  LEU A HD13 3  
ATOM 7206  H HD21 . LEU A 1 40  ? 19.294  -4.581  -4.537  1.00 1.02  ? 40  LEU A HD21 3  
ATOM 7207  H HD22 . LEU A 1 40  ? 18.136  -4.178  -3.268  1.00 0.97  ? 40  LEU A HD22 3  
ATOM 7208  H HD23 . LEU A 1 40  ? 18.940  -5.753  -3.264  1.00 1.09  ? 40  LEU A HD23 3  
ATOM 7209  N N    . SER A 1 41  ? 18.849  -3.282  1.475   1.00 0.42  ? 41  SER A N    3  
ATOM 7210  C CA   . SER A 1 41  ? 18.783  -3.167  2.918   1.00 0.52  ? 41  SER A CA   3  
ATOM 7211  C C    . SER A 1 41  ? 17.329  -3.231  3.368   1.00 0.45  ? 41  SER A C    3  
ATOM 7212  O O    . SER A 1 41  ? 16.991  -3.983  4.281   1.00 0.47  ? 41  SER A O    3  
ATOM 7213  C CB   . SER A 1 41  ? 19.429  -1.851  3.367   1.00 0.67  ? 41  SER A CB   3  
ATOM 7214  O OG   . SER A 1 41  ? 19.415  -1.712  4.779   1.00 1.40  ? 41  SER A OG   3  
ATOM 7215  H H    . SER A 1 41  ? 19.223  -2.540  0.957   1.00 0.42  ? 41  SER A H    3  
ATOM 7216  H HA   . SER A 1 41  ? 19.324  -3.996  3.347   1.00 0.60  ? 41  SER A HA   3  
ATOM 7217  H HB2  . SER A 1 41  ? 20.455  -1.826  3.030   1.00 1.27  ? 41  SER A HB2  3  
ATOM 7218  H HB3  . SER A 1 41  ? 18.890  -1.023  2.932   1.00 1.19  ? 41  SER A HB3  3  
ATOM 7219  H HG   . SER A 1 41  ? 19.859  -2.468  5.182   1.00 1.97  ? 41  SER A HG   3  
ATOM 7220  N N    . PHE A 1 42  ? 16.474  -2.456  2.701   1.00 0.42  ? 42  PHE A N    3  
ATOM 7221  C CA   . PHE A 1 42  ? 15.046  -2.433  2.998   1.00 0.46  ? 42  PHE A CA   3  
ATOM 7222  C C    . PHE A 1 42  ? 14.453  -3.824  2.948   1.00 0.29  ? 42  PHE A C    3  
ATOM 7223  O O    . PHE A 1 42  ? 13.968  -4.327  3.943   1.00 0.43  ? 42  PHE A O    3  
ATOM 7224  C CB   . PHE A 1 42  ? 14.295  -1.548  2.003   1.00 0.80  ? 42  PHE A CB   3  
ATOM 7225  C CG   . PHE A 1 42  ? 12.831  -1.434  2.323   1.00 1.89  ? 42  PHE A CG   3  
ATOM 7226  C CD1  . PHE A 1 42  ? 12.377  -0.455  3.188   1.00 2.77  ? 42  PHE A CD1  3  
ATOM 7227  C CD2  . PHE A 1 42  ? 11.913  -2.318  1.777   1.00 2.69  ? 42  PHE A CD2  3  
ATOM 7228  C CE1  . PHE A 1 42  ? 11.040  -0.360  3.506   1.00 3.80  ? 42  PHE A CE1  3  
ATOM 7229  C CE2  . PHE A 1 42  ? 10.574  -2.227  2.090   1.00 3.73  ? 42  PHE A CE2  3  
ATOM 7230  C CZ   . PHE A 1 42  ? 10.136  -1.247  2.957   1.00 4.13  ? 42  PHE A CZ   3  
ATOM 7231  H H    . PHE A 1 42  ? 16.818  -1.873  1.987   1.00 0.44  ? 42  PHE A H    3  
ATOM 7232  H HA   . PHE A 1 42  ? 14.907  -2.042  3.992   1.00 0.66  ? 42  PHE A HA   3  
ATOM 7233  H HB2  . PHE A 1 42  ? 14.722  -0.549  2.010   1.00 0.53  ? 42  PHE A HB2  3  
ATOM 7234  H HB3  . PHE A 1 42  ? 14.389  -1.982  1.013   1.00 1.30  ? 42  PHE A HB3  3  
ATOM 7235  H HD1  . PHE A 1 42  ? 13.083  0.240   3.618   1.00 3.00  ? 42  PHE A HD1  3  
ATOM 7236  H HD2  . PHE A 1 42  ? 12.256  -3.086  1.098   1.00 2.86  ? 42  PHE A HD2  3  
ATOM 7237  H HE1  . PHE A 1 42  ? 10.699  0.408   4.184   1.00 4.58  ? 42  PHE A HE1  3  
ATOM 7238  H HE2  . PHE A 1 42  ? 9.869   -2.921  1.659   1.00 4.49  ? 42  PHE A HE2  3  
ATOM 7239  H HZ   . PHE A 1 42  ? 9.089   -1.174  3.206   1.00 5.02  ? 42  PHE A HZ   3  
ATOM 7240  N N    . MET A 1 43  ? 14.492  -4.441  1.789   1.00 0.26  ? 43  MET A N    3  
ATOM 7241  C CA   . MET A 1 43  ? 13.822  -5.719  1.604   1.00 0.29  ? 43  MET A CA   3  
ATOM 7242  C C    . MET A 1 43  ? 14.364  -6.811  2.518   1.00 0.29  ? 43  MET A C    3  
ATOM 7243  O O    . MET A 1 43  ? 13.620  -7.693  2.925   1.00 0.37  ? 43  MET A O    3  
ATOM 7244  C CB   . MET A 1 43  ? 13.910  -6.180  0.167   1.00 0.39  ? 43  MET A CB   3  
ATOM 7245  C CG   . MET A 1 43  ? 13.040  -5.388  -0.792  1.00 0.62  ? 43  MET A CG   3  
ATOM 7246  S SD   . MET A 1 43  ? 12.573  -6.335  -2.259  1.00 1.22  ? 43  MET A SD   3  
ATOM 7247  C CE   . MET A 1 43  ? 11.509  -7.586  -1.540  1.00 2.26  ? 43  MET A CE   3  
ATOM 7248  H H    . MET A 1 43  ? 14.972  -4.022  1.031   1.00 0.29  ? 43  MET A H    3  
ATOM 7249  H HA   . MET A 1 43  ? 12.781  -5.567  1.846   1.00 0.35  ? 43  MET A HA   3  
ATOM 7250  H HB2  . MET A 1 43  ? 14.935  -6.085  -0.148  1.00 0.75  ? 43  MET A HB2  3  
ATOM 7251  H HB3  . MET A 1 43  ? 13.620  -7.215  0.120   1.00 0.69  ? 43  MET A HB3  3  
ATOM 7252  H HG2  . MET A 1 43  ? 12.144  -5.083  -0.277  1.00 1.11  ? 43  MET A HG2  3  
ATOM 7253  H HG3  . MET A 1 43  ? 13.585  -4.511  -1.108  1.00 1.23  ? 43  MET A HG3  3  
ATOM 7254  H HE1  . MET A 1 43  ? 11.127  -8.226  -2.322  1.00 2.63  ? 43  MET A HE1  3  
ATOM 7255  H HE2  . MET A 1 43  ? 10.686  -7.110  -1.030  1.00 2.66  ? 43  MET A HE2  3  
ATOM 7256  H HE3  . MET A 1 43  ? 12.074  -8.178  -0.836  1.00 2.85  ? 43  MET A HE3  3  
ATOM 7257  N N    . ASN A 1 44  ? 15.647  -6.772  2.843   1.00 0.29  ? 44  ASN A N    3  
ATOM 7258  C CA   . ASN A 1 44  ? 16.204  -7.787  3.733   1.00 0.33  ? 44  ASN A CA   3  
ATOM 7259  C C    . ASN A 1 44  ? 15.818  -7.533  5.179   1.00 0.32  ? 44  ASN A C    3  
ATOM 7260  O O    . ASN A 1 44  ? 15.923  -8.427  6.013   1.00 0.39  ? 44  ASN A O    3  
ATOM 7261  C CB   . ASN A 1 44  ? 17.722  -7.868  3.654   1.00 0.42  ? 44  ASN A CB   3  
ATOM 7262  C CG   . ASN A 1 44  ? 18.230  -8.660  2.465   1.00 1.05  ? 44  ASN A CG   3  
ATOM 7263  O OD1  . ASN A 1 44  ? 18.324  -9.886  2.520   1.00 1.54  ? 44  ASN A OD1  3  
ATOM 7264  N ND2  . ASN A 1 44  ? 18.595  -7.971  1.402   1.00 1.83  ? 44  ASN A ND2  3  
ATOM 7265  H H    . ASN A 1 44  ? 16.225  -6.064  2.480   1.00 0.30  ? 44  ASN A H    3  
ATOM 7266  H HA   . ASN A 1 44  ? 15.793  -8.738  3.430   1.00 0.37  ? 44  ASN A HA   3  
ATOM 7267  H HB2  . ASN A 1 44  ? 18.121  -6.874  3.601   1.00 1.03  ? 44  ASN A HB2  3  
ATOM 7268  H HB3  . ASN A 1 44  ? 18.078  -8.341  4.551   1.00 0.89  ? 44  ASN A HB3  3  
ATOM 7269  H HD21 . ASN A 1 44  ? 18.517  -6.988  1.435   1.00 1.98  ? 44  ASN A HD21 3  
ATOM 7270  H HD22 . ASN A 1 44  ? 18.934  -8.462  0.627   1.00 2.46  ? 44  ASN A HD22 3  
ATOM 7271  N N    . THR A 1 45  ? 15.407  -6.314  5.489   1.00 0.26  ? 45  THR A N    3  
ATOM 7272  C CA   . THR A 1 45  ? 15.025  -5.982  6.860   1.00 0.29  ? 45  THR A CA   3  
ATOM 7273  C C    . THR A 1 45  ? 13.515  -5.872  7.013   1.00 0.28  ? 45  THR A C    3  
ATOM 7274  O O    . THR A 1 45  ? 12.887  -6.646  7.734   1.00 0.34  ? 45  THR A O    3  
ATOM 7275  C CB   . THR A 1 45  ? 15.662  -4.659  7.318   1.00 0.29  ? 45  THR A CB   3  
ATOM 7276  O OG1  . THR A 1 45  ? 15.469  -3.655  6.319   1.00 0.34  ? 45  THR A OG1  3  
ATOM 7277  C CG2  . THR A 1 45  ? 17.146  -4.835  7.594   1.00 0.34  ? 45  THR A CG2  3  
ATOM 7278  H H    . THR A 1 45  ? 15.356  -5.623  4.782   1.00 0.24  ? 45  THR A H    3  
ATOM 7279  H HA   . THR A 1 45  ? 15.383  -6.770  7.505   1.00 0.33  ? 45  THR A HA   3  
ATOM 7280  H HB   . THR A 1 45  ? 15.173  -4.342  8.228   1.00 0.29  ? 45  THR A HB   3  
ATOM 7281  H HG1  . THR A 1 45  ? 16.142  -3.756  5.629   1.00 1.03  ? 45  THR A HG1  3  
ATOM 7282  H HG21 . THR A 1 45  ? 17.639  -5.184  6.699   1.00 1.04  ? 45  THR A HG21 3  
ATOM 7283  H HG22 . THR A 1 45  ? 17.283  -5.557  8.386   1.00 1.14  ? 45  THR A HG22 3  
ATOM 7284  H HG23 . THR A 1 45  ? 17.571  -3.888  7.892   1.00 1.05  ? 45  THR A HG23 3  
ATOM 7285  N N    . GLU A 1 46  ? 12.948  -4.918  6.300   1.00 0.23  ? 46  GLU A N    3  
ATOM 7286  C CA   . GLU A 1 46  ? 11.543  -4.595  6.406   1.00 0.25  ? 46  GLU A CA   3  
ATOM 7287  C C    . GLU A 1 46  ? 10.688  -5.590  5.633   1.00 0.25  ? 46  GLU A C    3  
ATOM 7288  O O    . GLU A 1 46  ? 9.473   -5.580  5.739   1.00 0.34  ? 46  GLU A O    3  
ATOM 7289  C CB   . GLU A 1 46  ? 11.289  -3.181  5.891   1.00 0.29  ? 46  GLU A CB   3  
ATOM 7290  C CG   . GLU A 1 46  ? 12.128  -2.116  6.581   1.00 0.58  ? 46  GLU A CG   3  
ATOM 7291  C CD   . GLU A 1 46  ? 11.865  -2.026  8.073   1.00 1.17  ? 46  GLU A CD   3  
ATOM 7292  O OE1  . GLU A 1 46  ? 12.513  -2.765  8.840   1.00 1.68  ? 46  GLU A OE1  3  
ATOM 7293  O OE2  . GLU A 1 46  ? 11.016  -1.206  8.488   1.00 1.70  ? 46  GLU A OE2  3  
ATOM 7294  H H    . GLU A 1 46  ? 13.504  -4.405  5.673   1.00 0.20  ? 46  GLU A H    3  
ATOM 7295  H HA   . GLU A 1 46  ? 11.275  -4.635  7.448   1.00 0.28  ? 46  GLU A HA   3  
ATOM 7296  H HB2  . GLU A 1 46  ? 11.501  -3.149  4.836   1.00 0.43  ? 46  GLU A HB2  3  
ATOM 7297  H HB3  . GLU A 1 46  ? 10.255  -2.941  6.043   1.00 0.54  ? 46  GLU A HB3  3  
ATOM 7298  H HG2  . GLU A 1 46  ? 13.171  -2.347  6.431   1.00 0.66  ? 46  GLU A HG2  3  
ATOM 7299  H HG3  . GLU A 1 46  ? 11.905  -1.158  6.134   1.00 0.71  ? 46  GLU A HG3  3  
ATOM 7300  N N    . LEU A 1 47  ? 11.317  -6.431  4.834   1.00 0.25  ? 47  LEU A N    3  
ATOM 7301  C CA   . LEU A 1 47  ? 10.592  -7.484  4.141   1.00 0.26  ? 47  LEU A CA   3  
ATOM 7302  C C    . LEU A 1 47  ? 11.328  -8.798  4.258   1.00 0.28  ? 47  LEU A C    3  
ATOM 7303  O O    . LEU A 1 47  ? 11.248  -9.653  3.376   1.00 0.30  ? 47  LEU A O    3  
ATOM 7304  C CB   . LEU A 1 47  ? 10.390  -7.128  2.675   1.00 0.26  ? 47  LEU A CB   3  
ATOM 7305  C CG   . LEU A 1 47  ? 9.525   -5.900  2.431   1.00 0.27  ? 47  LEU A CG   3  
ATOM 7306  C CD1  . LEU A 1 47  ? 9.505   -5.560  0.956   1.00 0.32  ? 47  LEU A CD1  3  
ATOM 7307  C CD2  . LEU A 1 47  ? 8.118   -6.144  2.956   1.00 0.27  ? 47  LEU A CD2  3  
ATOM 7308  H H    . LEU A 1 47  ? 12.281  -6.335  4.693   1.00 0.29  ? 47  LEU A H    3  
ATOM 7309  H HA   . LEU A 1 47  ? 9.628   -7.585  4.613   1.00 0.29  ? 47  LEU A HA   3  
ATOM 7310  H HB2  . LEU A 1 47  ? 11.358  -6.962  2.227   1.00 0.27  ? 47  LEU A HB2  3  
ATOM 7311  H HB3  . LEU A 1 47  ? 9.923   -7.970  2.187   1.00 0.27  ? 47  LEU A HB3  3  
ATOM 7312  H HG   . LEU A 1 47  ? 9.944   -5.059  2.964   1.00 0.29  ? 47  LEU A HG   3  
ATOM 7313  H HD11 . LEU A 1 47  ? 10.509  -5.346  0.627   1.00 1.00  ? 47  LEU A HD11 3  
ATOM 7314  H HD12 . LEU A 1 47  ? 8.880   -4.694  0.798   1.00 0.93  ? 47  LEU A HD12 3  
ATOM 7315  H HD13 . LEU A 1 47  ? 9.112   -6.397  0.399   1.00 0.95  ? 47  LEU A HD13 3  
ATOM 7316  H HD21 . LEU A 1 47  ? 8.160   -6.317  4.024   1.00 0.92  ? 47  LEU A HD21 3  
ATOM 7317  H HD22 . LEU A 1 47  ? 7.698   -7.013  2.471   1.00 1.01  ? 47  LEU A HD22 3  
ATOM 7318  H HD23 . LEU A 1 47  ? 7.500   -5.282  2.756   1.00 1.12  ? 47  LEU A HD23 3  
ATOM 7319  N N    . ALA A 1 48  ? 12.066  -8.947  5.345   1.00 0.32  ? 48  ALA A N    3  
ATOM 7320  C CA   . ALA A 1 48  ? 12.814  -10.161 5.605   1.00 0.36  ? 48  ALA A CA   3  
ATOM 7321  C C    . ALA A 1 48  ? 11.902  -11.388 5.630   1.00 0.39  ? 48  ALA A C    3  
ATOM 7322  O O    . ALA A 1 48  ? 12.354  -12.505 5.384   1.00 0.44  ? 48  ALA A O    3  
ATOM 7323  C CB   . ALA A 1 48  ? 13.582  -10.015 6.904   1.00 0.41  ? 48  ALA A CB   3  
ATOM 7324  H H    . ALA A 1 48  ? 12.123  -8.208  5.988   1.00 0.34  ? 48  ALA A H    3  
ATOM 7325  H HA   . ALA A 1 48  ? 13.528  -10.280 4.804   1.00 0.39  ? 48  ALA A HA   3  
ATOM 7326  H HB1  . ALA A 1 48  ? 12.893  -9.832  7.713   1.00 1.06  ? 48  ALA A HB1  3  
ATOM 7327  H HB2  . ALA A 1 48  ? 14.270  -9.181  6.815   1.00 1.14  ? 48  ALA A HB2  3  
ATOM 7328  H HB3  . ALA A 1 48  ? 14.138  -10.920 7.097   1.00 1.02  ? 48  ALA A HB3  3  
ATOM 7329  N N    . ALA A 1 49  ? 10.620  -11.177 5.904   1.00 0.38  ? 49  ALA A N    3  
ATOM 7330  C CA   . ALA A 1 49  ? 9.633   -12.246 5.817   1.00 0.41  ? 49  ALA A CA   3  
ATOM 7331  C C    . ALA A 1 49  ? 9.615   -12.831 4.412   1.00 0.41  ? 49  ALA A C    3  
ATOM 7332  O O    . ALA A 1 49  ? 9.673   -14.047 4.221   1.00 0.47  ? 49  ALA A O    3  
ATOM 7333  C CB   . ALA A 1 49  ? 8.252   -11.713 6.167   1.00 0.44  ? 49  ALA A CB   3  
ATOM 7334  H H    . ALA A 1 49  ? 10.328  -10.279 6.174   1.00 0.37  ? 49  ALA A H    3  
ATOM 7335  H HA   . ALA A 1 49  ? 9.896   -13.017 6.523   1.00 0.45  ? 49  ALA A HA   3  
ATOM 7336  H HB1  . ALA A 1 49  ? 7.995   -10.906 5.489   1.00 1.16  ? 49  ALA A HB1  3  
ATOM 7337  H HB2  . ALA A 1 49  ? 8.255   -11.343 7.181   1.00 1.10  ? 49  ALA A HB2  3  
ATOM 7338  H HB3  . ALA A 1 49  ? 7.525   -12.505 6.074   1.00 1.07  ? 49  ALA A HB3  3  
ATOM 7339  N N    . PHE A 1 50  ? 9.570   -11.941 3.438   1.00 0.36  ? 50  PHE A N    3  
ATOM 7340  C CA   . PHE A 1 50  ? 9.446   -12.316 2.042   1.00 0.37  ? 50  PHE A CA   3  
ATOM 7341  C C    . PHE A 1 50  ? 10.813  -12.620 1.432   1.00 0.38  ? 50  PHE A C    3  
ATOM 7342  O O    . PHE A 1 50  ? 10.954  -13.519 0.605   1.00 0.44  ? 50  PHE A O    3  
ATOM 7343  C CB   . PHE A 1 50  ? 8.787   -11.167 1.286   1.00 0.35  ? 50  PHE A CB   3  
ATOM 7344  C CG   . PHE A 1 50  ? 8.242   -11.552 -0.063  1.00 0.70  ? 50  PHE A CG   3  
ATOM 7345  C CD1  . PHE A 1 50  ? 6.940   -12.010 -0.189  1.00 1.63  ? 50  PHE A CD1  3  
ATOM 7346  C CD2  . PHE A 1 50  ? 9.027   -11.456 -1.200  1.00 1.32  ? 50  PHE A CD2  3  
ATOM 7347  C CE1  . PHE A 1 50  ? 6.431   -12.366 -1.424  1.00 2.09  ? 50  PHE A CE1  3  
ATOM 7348  C CE2  . PHE A 1 50  ? 8.523   -11.811 -2.437  1.00 1.66  ? 50  PHE A CE2  3  
ATOM 7349  C CZ   . PHE A 1 50  ? 7.225   -12.266 -2.550  1.00 1.80  ? 50  PHE A CZ   3  
ATOM 7350  H H    . PHE A 1 50  ? 9.623   -10.988 3.669   1.00 0.32  ? 50  PHE A H    3  
ATOM 7351  H HA   . PHE A 1 50  ? 8.820   -13.192 1.977   1.00 0.41  ? 50  PHE A HA   3  
ATOM 7352  H HB2  . PHE A 1 50  ? 7.969   -10.780 1.879   1.00 0.61  ? 50  PHE A HB2  3  
ATOM 7353  H HB3  . PHE A 1 50  ? 9.522   -10.385 1.142   1.00 0.56  ? 50  PHE A HB3  3  
ATOM 7354  H HD1  . PHE A 1 50  ? 6.319   -12.087 0.691   1.00 2.27  ? 50  PHE A HD1  3  
ATOM 7355  H HD2  . PHE A 1 50  ? 10.044  -11.101 -1.115  1.00 2.01  ? 50  PHE A HD2  3  
ATOM 7356  H HE1  . PHE A 1 50  ? 5.415   -12.722 -1.508  1.00 2.96  ? 50  PHE A HE1  3  
ATOM 7357  H HE2  . PHE A 1 50  ? 9.145   -11.732 -3.316  1.00 2.32  ? 50  PHE A HE2  3  
ATOM 7358  H HZ   . PHE A 1 50  ? 6.830   -12.543 -3.515  1.00 2.24  ? 50  PHE A HZ   3  
ATOM 7359  N N    . THR A 1 51  ? 11.806  -11.859 1.847   1.00 0.36  ? 51  THR A N    3  
ATOM 7360  C CA   . THR A 1 51  ? 13.133  -11.935 1.267   1.00 0.40  ? 51  THR A CA   3  
ATOM 7361  C C    . THR A 1 51  ? 13.975  -13.074 1.845   1.00 0.45  ? 51  THR A C    3  
ATOM 7362  O O    . THR A 1 51  ? 14.524  -13.885 1.103   1.00 0.54  ? 51  THR A O    3  
ATOM 7363  C CB   . THR A 1 51  ? 13.868  -10.605 1.488   1.00 0.39  ? 51  THR A CB   3  
ATOM 7364  O OG1  . THR A 1 51  ? 13.148  -9.536  0.863   1.00 0.39  ? 51  THR A OG1  3  
ATOM 7365  C CG2  . THR A 1 51  ? 15.287  -10.663 0.947   1.00 0.49  ? 51  THR A CG2  3  
ATOM 7366  H H    . THR A 1 51  ? 11.638  -11.200 2.555   1.00 0.36  ? 51  THR A H    3  
ATOM 7367  H HA   . THR A 1 51  ? 13.023  -12.083 0.203   1.00 0.44  ? 51  THR A HA   3  
ATOM 7368  H HB   . THR A 1 51  ? 13.911  -10.419 2.550   1.00 0.36  ? 51  THR A HB   3  
ATOM 7369  H HG1  . THR A 1 51  ? 12.926  -8.874  1.528   1.00 0.41  ? 51  THR A HG1  3  
ATOM 7370  H HG21 . THR A 1 51  ? 15.748  -9.691  1.041   1.00 1.13  ? 51  THR A HG21 3  
ATOM 7371  H HG22 . THR A 1 51  ? 15.264  -10.957 -0.091  1.00 1.14  ? 51  THR A HG22 3  
ATOM 7372  H HG23 . THR A 1 51  ? 15.854  -11.386 1.513   1.00 1.03  ? 51  THR A HG23 3  
ATOM 7373  N N    . LYS A 1 52  ? 14.058  -13.142 3.168   1.00 0.48  ? 52  LYS A N    3  
ATOM 7374  C CA   . LYS A 1 52  ? 15.043  -14.000 3.828   1.00 0.60  ? 52  LYS A CA   3  
ATOM 7375  C C    . LYS A 1 52  ? 14.743  -15.482 3.673   1.00 0.69  ? 52  LYS A C    3  
ATOM 7376  O O    . LYS A 1 52  ? 15.594  -16.321 3.968   1.00 0.84  ? 52  LYS A O    3  
ATOM 7377  C CB   . LYS A 1 52  ? 15.149  -13.653 5.300   1.00 0.70  ? 52  LYS A CB   3  
ATOM 7378  C CG   . LYS A 1 52  ? 15.859  -12.336 5.546   1.00 0.78  ? 52  LYS A CG   3  
ATOM 7379  C CD   . LYS A 1 52  ? 17.312  -12.407 5.117   1.00 1.07  ? 52  LYS A CD   3  
ATOM 7380  C CE   . LYS A 1 52  ? 18.076  -11.153 5.501   1.00 1.24  ? 52  LYS A CE   3  
ATOM 7381  N NZ   . LYS A 1 52  ? 19.487  -11.204 5.036   1.00 1.82  ? 52  LYS A NZ   3  
ATOM 7382  H H    . LYS A 1 52  ? 13.436  -12.619 3.719   1.00 0.45  ? 52  LYS A H    3  
ATOM 7383  H HA   . LYS A 1 52  ? 15.995  -13.797 3.369   1.00 0.65  ? 52  LYS A HA   3  
ATOM 7384  H HB2  . LYS A 1 52  ? 14.153  -13.593 5.716   1.00 0.71  ? 52  LYS A HB2  3  
ATOM 7385  H HB3  . LYS A 1 52  ? 15.696  -14.434 5.804   1.00 0.79  ? 52  LYS A HB3  3  
ATOM 7386  H HG2  . LYS A 1 52  ? 15.366  -11.568 4.969   1.00 1.34  ? 52  LYS A HG2  3  
ATOM 7387  H HG3  . LYS A 1 52  ? 15.810  -12.095 6.596   1.00 1.23  ? 52  LYS A HG3  3  
ATOM 7388  H HD2  . LYS A 1 52  ? 17.772  -13.256 5.592   1.00 1.64  ? 52  LYS A HD2  3  
ATOM 7389  H HD3  . LYS A 1 52  ? 17.354  -12.526 4.044   1.00 1.63  ? 52  LYS A HD3  3  
ATOM 7390  H HE2  . LYS A 1 52  ? 17.589  -10.299 5.056   1.00 1.50  ? 52  LYS A HE2  3  
ATOM 7391  H HE3  . LYS A 1 52  ? 18.063  -11.054 6.577   1.00 1.67  ? 52  LYS A HE3  3  
ATOM 7392  H HZ1  . LYS A 1 52  ? 19.985  -10.333 5.305   1.00 2.15  ? 52  LYS A HZ1  3  
ATOM 7393  H HZ2  . LYS A 1 52  ? 19.519  -11.301 4.000   1.00 2.33  ? 52  LYS A HZ2  3  
ATOM 7394  H HZ3  . LYS A 1 52  ? 19.979  -12.017 5.464   1.00 2.24  ? 52  LYS A HZ3  3  
ATOM 7395  N N    . ASN A 1 53  ? 13.552  -15.811 3.206   1.00 0.68  ? 53  ASN A N    3  
ATOM 7396  C CA   . ASN A 1 53  ? 13.198  -17.208 3.016   1.00 0.85  ? 53  ASN A CA   3  
ATOM 7397  C C    . ASN A 1 53  ? 13.726  -17.704 1.672   1.00 1.00  ? 53  ASN A C    3  
ATOM 7398  O O    . ASN A 1 53  ? 13.605  -18.882 1.336   1.00 1.22  ? 53  ASN A O    3  
ATOM 7399  C CB   . ASN A 1 53  ? 11.684  -17.428 3.134   1.00 0.92  ? 53  ASN A CB   3  
ATOM 7400  C CG   . ASN A 1 53  ? 10.896  -16.937 1.933   1.00 1.40  ? 53  ASN A CG   3  
ATOM 7401  O OD1  . ASN A 1 53  ? 10.798  -17.627 0.915   1.00 1.94  ? 53  ASN A OD1  3  
ATOM 7402  N ND2  . ASN A 1 53  ? 10.279  -15.777 2.062   1.00 2.05  ? 53  ASN A ND2  3  
ATOM 7403  H H    . ASN A 1 53  ? 12.910  -15.108 2.980   1.00 0.63  ? 53  ASN A H    3  
ATOM 7404  H HA   . ASN A 1 53  ? 13.690  -17.768 3.798   1.00 0.95  ? 53  ASN A HA   3  
ATOM 7405  H HB2  . ASN A 1 53  ? 11.489  -18.481 3.255   1.00 1.05  ? 53  ASN A HB2  3  
ATOM 7406  H HB3  . ASN A 1 53  ? 11.331  -16.900 4.009   1.00 1.23  ? 53  ASN A HB3  3  
ATOM 7407  H HD21 . ASN A 1 53  ? 10.354  -15.299 2.919   1.00 2.35  ? 53  ASN A HD21 3  
ATOM 7408  H HD22 . ASN A 1 53  ? 9.770   -15.437 1.294   1.00 2.52  ? 53  ASN A HD22 3  
ATOM 7409  N N    . GLN A 1 54  ? 14.315  -16.788 0.913   1.00 1.02  ? 54  GLN A N    3  
ATOM 7410  C CA   . GLN A 1 54  ? 14.994  -17.127 -0.324  1.00 1.29  ? 54  GLN A CA   3  
ATOM 7411  C C    . GLN A 1 54  ? 16.406  -16.549 -0.294  1.00 1.33  ? 54  GLN A C    3  
ATOM 7412  O O    . GLN A 1 54  ? 16.600  -15.342 -0.449  1.00 2.05  ? 54  GLN A O    3  
ATOM 7413  C CB   . GLN A 1 54  ? 14.222  -16.594 -1.536  1.00 1.74  ? 54  GLN A CB   3  
ATOM 7414  C CG   . GLN A 1 54  ? 14.815  -17.025 -2.870  1.00 2.17  ? 54  GLN A CG   3  
ATOM 7415  C CD   . GLN A 1 54  ? 13.976  -16.585 -4.052  1.00 2.40  ? 54  GLN A CD   3  
ATOM 7416  O OE1  . GLN A 1 54  ? 14.182  -15.511 -4.618  1.00 2.91  ? 54  GLN A OE1  3  
ATOM 7417  N NE2  . GLN A 1 54  ? 13.021  -17.415 -4.433  1.00 2.71  ? 54  GLN A NE2  3  
ATOM 7418  H H    . GLN A 1 54  ? 14.296  -15.846 1.198   1.00 0.93  ? 54  GLN A H    3  
ATOM 7419  H HA   . GLN A 1 54  ? 15.057  -18.204 -0.386  1.00 1.53  ? 54  GLN A HA   3  
ATOM 7420  H HB2  . GLN A 1 54  ? 13.205  -16.951 -1.485  1.00 2.09  ? 54  GLN A HB2  3  
ATOM 7421  H HB3  . GLN A 1 54  ? 14.219  -15.514 -1.500  1.00 2.20  ? 54  GLN A HB3  3  
ATOM 7422  H HG2  . GLN A 1 54  ? 15.800  -16.592 -2.967  1.00 2.68  ? 54  GLN A HG2  3  
ATOM 7423  H HG3  . GLN A 1 54  ? 14.894  -18.101 -2.883  1.00 2.60  ? 54  GLN A HG3  3  
ATOM 7424  H HE21 . GLN A 1 54  ? 12.913  -18.257 -3.939  1.00 2.94  ? 54  GLN A HE21 3  
ATOM 7425  H HE22 . GLN A 1 54  ? 12.455  -17.157 -5.191  1.00 3.07  ? 54  GLN A HE22 3  
ATOM 7426  N N    . LYS A 1 55  ? 17.386  -17.411 -0.073  1.00 1.44  ? 55  LYS A N    3  
ATOM 7427  C CA   . LYS A 1 55  ? 18.767  -16.975 0.083   1.00 1.87  ? 55  LYS A CA   3  
ATOM 7428  C C    . LYS A 1 55  ? 19.411  -16.679 -1.272  1.00 1.59  ? 55  LYS A C    3  
ATOM 7429  O O    . LYS A 1 55  ? 20.237  -17.448 -1.772  1.00 2.27  ? 55  LYS A O    3  
ATOM 7430  C CB   . LYS A 1 55  ? 19.571  -18.035 0.846   1.00 2.84  ? 55  LYS A CB   3  
ATOM 7431  C CG   . LYS A 1 55  ? 21.002  -17.621 1.163   1.00 3.60  ? 55  LYS A CG   3  
ATOM 7432  C CD   . LYS A 1 55  ? 21.052  -16.345 1.988   1.00 4.29  ? 55  LYS A CD   3  
ATOM 7433  C CE   . LYS A 1 55  ? 22.484  -15.927 2.282   1.00 5.02  ? 55  LYS A CE   3  
ATOM 7434  N NZ   . LYS A 1 55  ? 23.193  -16.914 3.140   1.00 5.58  ? 55  LYS A NZ   3  
ATOM 7435  H H    . LYS A 1 55  ? 17.176  -18.367 -0.018  1.00 1.82  ? 55  LYS A H    3  
ATOM 7436  H HA   . LYS A 1 55  ? 18.755  -16.066 0.662   1.00 2.28  ? 55  LYS A HA   3  
ATOM 7437  H HB2  . LYS A 1 55  ? 19.069  -18.248 1.777   1.00 3.16  ? 55  LYS A HB2  3  
ATOM 7438  H HB3  . LYS A 1 55  ? 19.605  -18.937 0.253   1.00 3.23  ? 55  LYS A HB3  3  
ATOM 7439  H HG2  . LYS A 1 55  ? 21.480  -18.413 1.718   1.00 4.06  ? 55  LYS A HG2  3  
ATOM 7440  H HG3  . LYS A 1 55  ? 21.531  -17.460 0.236   1.00 3.78  ? 55  LYS A HG3  3  
ATOM 7441  H HD2  . LYS A 1 55  ? 20.563  -15.553 1.439   1.00 4.59  ? 55  LYS A HD2  3  
ATOM 7442  H HD3  . LYS A 1 55  ? 20.535  -16.511 2.922   1.00 4.44  ? 55  LYS A HD3  3  
ATOM 7443  H HE2  . LYS A 1 55  ? 23.015  -15.834 1.347   1.00 5.06  ? 55  LYS A HE2  3  
ATOM 7444  H HE3  . LYS A 1 55  ? 22.471  -14.971 2.783   1.00 5.52  ? 55  LYS A HE3  3  
ATOM 7445  H HZ1  . LYS A 1 55  ? 24.174  -16.607 3.302   1.00 5.86  ? 55  LYS A HZ1  3  
ATOM 7446  H HZ2  . LYS A 1 55  ? 23.205  -17.847 2.683   1.00 5.76  ? 55  LYS A HZ2  3  
ATOM 7447  H HZ3  . LYS A 1 55  ? 22.715  -16.999 4.059   1.00 5.87  ? 55  LYS A HZ3  3  
ATOM 7448  N N    . ASP A 1 56  ? 19.019  -15.562 -1.862  1.00 1.36  ? 56  ASP A N    3  
ATOM 7449  C CA   . ASP A 1 56  ? 19.598  -15.101 -3.114  1.00 1.50  ? 56  ASP A CA   3  
ATOM 7450  C C    . ASP A 1 56  ? 19.373  -13.601 -3.253  1.00 1.27  ? 56  ASP A C    3  
ATOM 7451  O O    . ASP A 1 56  ? 18.240  -13.158 -3.400  1.00 1.44  ? 56  ASP A O    3  
ATOM 7452  C CB   . ASP A 1 56  ? 18.973  -15.836 -4.305  1.00 2.13  ? 56  ASP A CB   3  
ATOM 7453  C CG   . ASP A 1 56  ? 19.690  -15.550 -5.612  1.00 2.83  ? 56  ASP A CG   3  
ATOM 7454  O OD1  . ASP A 1 56  ? 19.503  -14.458 -6.181  1.00 3.44  ? 56  ASP A OD1  3  
ATOM 7455  O OD2  . ASP A 1 56  ? 20.443  -16.431 -6.087  1.00 3.39  ? 56  ASP A OD2  3  
ATOM 7456  H H    . ASP A 1 56  ? 18.306  -15.028 -1.443  1.00 1.71  ? 56  ASP A H    3  
ATOM 7457  H HA   . ASP A 1 56  ? 20.658  -15.301 -3.087  1.00 1.84  ? 56  ASP A HA   3  
ATOM 7458  H HB2  . ASP A 1 56  ? 19.012  -16.901 -4.123  1.00 2.43  ? 56  ASP A HB2  3  
ATOM 7459  H HB3  . ASP A 1 56  ? 17.941  -15.531 -4.407  1.00 2.59  ? 56  ASP A HB3  3  
ATOM 7460  N N    . PRO A 1 57  ? 20.444  -12.796 -3.196  1.00 1.06  ? 57  PRO A N    3  
ATOM 7461  C CA   . PRO A 1 57  ? 20.341  -11.331 -3.255  1.00 1.02  ? 57  PRO A CA   3  
ATOM 7462  C C    . PRO A 1 57  ? 19.812  -10.822 -4.595  1.00 0.75  ? 57  PRO A C    3  
ATOM 7463  O O    . PRO A 1 57  ? 19.491  -9.641  -4.742  1.00 0.70  ? 57  PRO A O    3  
ATOM 7464  C CB   . PRO A 1 57  ? 21.781  -10.858 -3.040  1.00 1.20  ? 57  PRO A CB   3  
ATOM 7465  C CG   . PRO A 1 57  ? 22.624  -12.016 -3.440  1.00 1.20  ? 57  PRO A CG   3  
ATOM 7466  C CD   . PRO A 1 57  ? 21.841  -13.240 -3.061  1.00 1.14  ? 57  PRO A CD   3  
ATOM 7467  H HA   . PRO A 1 57  ? 19.717  -10.953 -2.460  1.00 1.22  ? 57  PRO A HA   3  
ATOM 7468  H HB2  . PRO A 1 57  ? 21.975  -9.995  -3.660  1.00 1.21  ? 57  PRO A HB2  3  
ATOM 7469  H HB3  . PRO A 1 57  ? 21.929  -10.602 -2.002  1.00 1.44  ? 57  PRO A HB3  3  
ATOM 7470  H HG2  . PRO A 1 57  ? 22.796  -11.995 -4.506  1.00 1.15  ? 57  PRO A HG2  3  
ATOM 7471  H HG3  . PRO A 1 57  ? 23.561  -11.991 -2.905  1.00 1.39  ? 57  PRO A HG3  3  
ATOM 7472  H HD2  . PRO A 1 57  ? 22.058  -14.052 -3.739  1.00 1.16  ? 57  PRO A HD2  3  
ATOM 7473  H HD3  . PRO A 1 57  ? 22.055  -13.526 -2.043  1.00 1.29  ? 57  PRO A HD3  3  
ATOM 7474  N N    . GLY A 1 58  ? 19.708  -11.721 -5.564  1.00 0.67  ? 58  GLY A N    3  
ATOM 7475  C CA   . GLY A 1 58  ? 19.258  -11.343 -6.885  1.00 0.56  ? 58  GLY A CA   3  
ATOM 7476  C C    . GLY A 1 58  ? 17.759  -11.193 -6.965  1.00 0.49  ? 58  GLY A C    3  
ATOM 7477  O O    . GLY A 1 58  ? 17.232  -10.707 -7.960  1.00 0.48  ? 58  GLY A O    3  
ATOM 7478  H H    . GLY A 1 58  ? 19.930  -12.662 -5.377  1.00 0.74  ? 58  GLY A H    3  
ATOM 7479  H HA2  . GLY A 1 58  ? 19.720  -10.407 -7.158  1.00 0.57  ? 58  GLY A HA2  3  
ATOM 7480  H HA3  . GLY A 1 58  ? 19.565  -12.102 -7.586  1.00 0.61  ? 58  GLY A HA3  3  
ATOM 7481  N N    . VAL A 1 59  ? 17.059  -11.607 -5.923  1.00 0.52  ? 59  VAL A N    3  
ATOM 7482  C CA   . VAL A 1 59  ? 15.609  -11.505 -5.913  1.00 0.52  ? 59  VAL A CA   3  
ATOM 7483  C C    . VAL A 1 59  ? 15.163  -10.060 -5.813  1.00 0.49  ? 59  VAL A C    3  
ATOM 7484  O O    . VAL A 1 59  ? 14.230  -9.639  -6.497  1.00 0.49  ? 59  VAL A O    3  
ATOM 7485  C CB   . VAL A 1 59  ? 14.976  -12.324 -4.768  1.00 0.61  ? 59  VAL A CB   3  
ATOM 7486  C CG1  . VAL A 1 59  ? 15.542  -11.914 -3.418  1.00 0.65  ? 59  VAL A CG1  3  
ATOM 7487  C CG2  . VAL A 1 59  ? 13.466  -12.162 -4.775  1.00 0.66  ? 59  VAL A CG2  3  
ATOM 7488  H H    . VAL A 1 59  ? 17.525  -12.002 -5.153  1.00 0.58  ? 59  VAL A H    3  
ATOM 7489  H HA   . VAL A 1 59  ? 15.255  -11.896 -6.853  1.00 0.53  ? 59  VAL A HA   3  
ATOM 7490  H HB   . VAL A 1 59  ? 15.211  -13.362 -4.931  1.00 0.64  ? 59  VAL A HB   3  
ATOM 7491  H HG11 . VAL A 1 59  ? 15.005  -12.424 -2.631  1.00 1.19  ? 59  VAL A HG11 3  
ATOM 7492  H HG12 . VAL A 1 59  ? 15.435  -10.847 -3.294  1.00 1.14  ? 59  VAL A HG12 3  
ATOM 7493  H HG13 . VAL A 1 59  ? 16.588  -12.178 -3.371  1.00 1.29  ? 59  VAL A HG13 3  
ATOM 7494  H HG21 . VAL A 1 59  ? 13.068  -12.525 -5.711  1.00 1.21  ? 59  VAL A HG21 3  
ATOM 7495  H HG22 . VAL A 1 59  ? 13.221  -11.113 -4.660  1.00 1.26  ? 59  VAL A HG22 3  
ATOM 7496  H HG23 . VAL A 1 59  ? 13.039  -12.725 -3.957  1.00 1.19  ? 59  VAL A HG23 3  
ATOM 7497  N N    . LEU A 1 60  ? 15.847  -9.296  -4.983  1.00 0.48  ? 60  LEU A N    3  
ATOM 7498  C CA   . LEU A 1 60  ? 15.519  -7.893  -4.811  1.00 0.46  ? 60  LEU A CA   3  
ATOM 7499  C C    . LEU A 1 60  ? 15.878  -7.147  -6.081  1.00 0.43  ? 60  LEU A C    3  
ATOM 7500  O O    . LEU A 1 60  ? 15.384  -6.057  -6.350  1.00 0.41  ? 60  LEU A O    3  
ATOM 7501  C CB   . LEU A 1 60  ? 16.274  -7.297  -3.628  1.00 0.48  ? 60  LEU A CB   3  
ATOM 7502  C CG   . LEU A 1 60  ? 16.363  -8.199  -2.397  1.00 0.51  ? 60  LEU A CG   3  
ATOM 7503  C CD1  . LEU A 1 60  ? 17.074  -7.487  -1.262  1.00 0.51  ? 60  LEU A CD1  3  
ATOM 7504  C CD2  . LEU A 1 60  ? 14.979  -8.646  -1.967  1.00 0.52  ? 60  LEU A CD2  3  
ATOM 7505  H H    . LEU A 1 60  ? 16.584  -9.686  -4.474  1.00 0.50  ? 60  LEU A H    3  
ATOM 7506  H HA   . LEU A 1 60  ? 14.455  -7.821  -4.637  1.00 0.47  ? 60  LEU A HA   3  
ATOM 7507  H HB2  . LEU A 1 60  ? 17.277  -7.054  -3.950  1.00 0.51  ? 60  LEU A HB2  3  
ATOM 7508  H HB3  . LEU A 1 60  ? 15.772  -6.386  -3.342  1.00 0.48  ? 60  LEU A HB3  3  
ATOM 7509  H HG   . LEU A 1 60  ? 16.934  -9.081  -2.647  1.00 0.57  ? 60  LEU A HG   3  
ATOM 7510  H HD11 . LEU A 1 60  ? 16.610  -6.530  -1.092  1.00 1.00  ? 60  LEU A HD11 3  
ATOM 7511  H HD12 . LEU A 1 60  ? 18.112  -7.342  -1.520  1.00 1.22  ? 60  LEU A HD12 3  
ATOM 7512  H HD13 . LEU A 1 60  ? 17.008  -8.083  -0.359  1.00 1.18  ? 60  LEU A HD13 3  
ATOM 7513  H HD21 . LEU A 1 60  ? 15.056  -9.249  -1.076  1.00 1.20  ? 60  LEU A HD21 3  
ATOM 7514  H HD22 . LEU A 1 60  ? 14.529  -9.226  -2.758  1.00 1.11  ? 60  LEU A HD22 3  
ATOM 7515  H HD23 . LEU A 1 60  ? 14.368  -7.781  -1.767  1.00 1.11  ? 60  LEU A HD23 3  
ATOM 7516  N N    . ASP A 1 61  ? 16.744  -7.776  -6.855  1.00 0.46  ? 61  ASP A N    3  
ATOM 7517  C CA   . ASP A 1 61  ? 17.154  -7.259  -8.151  1.00 0.46  ? 61  ASP A CA   3  
ATOM 7518  C C    . ASP A 1 61  ? 16.005  -7.386  -9.129  1.00 0.47  ? 61  ASP A C    3  
ATOM 7519  O O    . ASP A 1 61  ? 15.719  -6.477  -9.909  1.00 0.51  ? 61  ASP A O    3  
ATOM 7520  C CB   . ASP A 1 61  ? 18.360  -8.040  -8.670  1.00 0.47  ? 61  ASP A CB   3  
ATOM 7521  C CG   . ASP A 1 61  ? 19.064  -7.348  -9.819  1.00 0.48  ? 61  ASP A CG   3  
ATOM 7522  O OD1  . ASP A 1 61  ? 19.907  -6.458  -9.557  1.00 1.19  ? 61  ASP A OD1  3  
ATOM 7523  O OD2  . ASP A 1 61  ? 18.799  -7.709  -10.985 1.00 1.22  ? 61  ASP A OD2  3  
ATOM 7524  H H    . ASP A 1 61  ? 17.115  -8.627  -6.542  1.00 0.49  ? 61  ASP A H    3  
ATOM 7525  H HA   . ASP A 1 61  ? 17.412  -6.226  -8.037  1.00 0.48  ? 61  ASP A HA   3  
ATOM 7526  H HB2  . ASP A 1 61  ? 19.059  -8.184  -7.867  1.00 0.48  ? 61  ASP A HB2  3  
ATOM 7527  H HB3  . ASP A 1 61  ? 18.024  -9.007  -9.013  1.00 0.51  ? 61  ASP A HB3  3  
ATOM 7528  N N    . ARG A 1 62  ? 15.341  -8.525  -9.053  1.00 0.47  ? 62  ARG A N    3  
ATOM 7529  C CA   . ARG A 1 62  ? 14.178  -8.804  -9.873  1.00 0.51  ? 62  ARG A CA   3  
ATOM 7530  C C    . ARG A 1 62  ? 13.048  -7.855  -9.499  1.00 0.50  ? 62  ARG A C    3  
ATOM 7531  O O    . ARG A 1 62  ? 12.325  -7.363  -10.365 1.00 0.56  ? 62  ARG A O    3  
ATOM 7532  C CB   . ARG A 1 62  ? 13.742  -10.251 -9.665  1.00 0.55  ? 62  ARG A CB   3  
ATOM 7533  C CG   . ARG A 1 62  ? 14.888  -11.242 -9.771  1.00 0.55  ? 62  ARG A CG   3  
ATOM 7534  C CD   . ARG A 1 62  ? 14.459  -12.626 -9.344  1.00 0.62  ? 62  ARG A CD   3  
ATOM 7535  N NE   . ARG A 1 62  ? 15.532  -13.606 -9.484  1.00 1.45  ? 62  ARG A NE   3  
ATOM 7536  C CZ   . ARG A 1 62  ? 15.327  -14.906 -9.685  1.00 1.97  ? 62  ARG A CZ   3  
ATOM 7537  N NH1  . ARG A 1 62  ? 14.092  -15.381 -9.777  1.00 1.66  ? 62  ARG A NH1  3  
ATOM 7538  N NH2  . ARG A 1 62  ? 16.358  -15.729 -9.792  1.00 3.02  ? 62  ARG A NH2  3  
ATOM 7539  H H    . ARG A 1 62  ? 15.649  -9.207  -8.420  1.00 0.47  ? 62  ARG A H    3  
ATOM 7540  H HA   . ARG A 1 62  ? 14.445  -8.653  -10.908 1.00 0.53  ? 62  ARG A HA   3  
ATOM 7541  H HB2  . ARG A 1 62  ? 13.299  -10.345 -8.684  1.00 0.60  ? 62  ARG A HB2  3  
ATOM 7542  H HB3  . ARG A 1 62  ? 13.004  -10.505 -10.412 1.00 0.60  ? 62  ARG A HB3  3  
ATOM 7543  H HG2  . ARG A 1 62  ? 15.232  -11.280 -10.787 1.00 0.56  ? 62  ARG A HG2  3  
ATOM 7544  H HG3  . ARG A 1 62  ? 15.693  -10.913 -9.129  1.00 0.56  ? 62  ARG A HG3  3  
ATOM 7545  H HD2  . ARG A 1 62  ? 14.162  -12.582 -8.311  1.00 1.11  ? 62  ARG A HD2  3  
ATOM 7546  H HD3  . ARG A 1 62  ? 13.622  -12.930 -9.948  1.00 0.98  ? 62  ARG A HD3  3  
ATOM 7547  H HE   . ARG A 1 62  ? 16.457  -13.274 -9.419  1.00 1.91  ? 62  ARG A HE   3  
ATOM 7548  H HH11 . ARG A 1 62  ? 13.306  -14.766 -9.697  1.00 1.23  ? 62  ARG A HH11 3  
ATOM 7549  H HH12 . ARG A 1 62  ? 13.939  -16.364 -9.923  1.00 2.13  ? 62  ARG A HH12 3  
ATOM 7550  H HH21 . ARG A 1 62  ? 17.295  -15.375 -9.718  1.00 3.45  ? 62  ARG A HH21 3  
ATOM 7551  H HH22 . ARG A 1 62  ? 16.209  -16.710 -9.950  1.00 3.45  ? 62  ARG A HH22 3  
ATOM 7552  N N    . MET A 1 63  ? 12.908  -7.606  -8.197  1.00 0.45  ? 63  MET A N    3  
ATOM 7553  C CA   . MET A 1 63  ? 11.930  -6.643  -7.699  1.00 0.44  ? 63  MET A CA   3  
ATOM 7554  C C    . MET A 1 63  ? 12.281  -5.264  -8.206  1.00 0.41  ? 63  MET A C    3  
ATOM 7555  O O    . MET A 1 63  ? 11.436  -4.558  -8.745  1.00 0.42  ? 63  MET A O    3  
ATOM 7556  C CB   . MET A 1 63  ? 11.911  -6.611  -6.174  1.00 0.43  ? 63  MET A CB   3  
ATOM 7557  C CG   . MET A 1 63  ? 11.775  -7.978  -5.540  1.00 0.49  ? 63  MET A CG   3  
ATOM 7558  S SD   . MET A 1 63  ? 10.225  -8.791  -5.978  1.00 0.64  ? 63  MET A SD   3  
ATOM 7559  C CE   . MET A 1 63  ? 10.399  -10.344 -5.106  1.00 1.54  ? 63  MET A CE   3  
ATOM 7560  H H    . MET A 1 63  ? 13.480  -8.086  -7.556  1.00 0.45  ? 63  MET A H    3  
ATOM 7561  H HA   . MET A 1 63  ? 10.954  -6.924  -8.066  1.00 0.47  ? 63  MET A HA   3  
ATOM 7562  H HB2  . MET A 1 63  ? 12.826  -6.158  -5.826  1.00 0.39  ? 63  MET A HB2  3  
ATOM 7563  H HB3  . MET A 1 63  ? 11.077  -6.006  -5.851  1.00 0.46  ? 63  MET A HB3  3  
ATOM 7564  H HG2  . MET A 1 63  ? 12.600  -8.592  -5.872  1.00 0.48  ? 63  MET A HG2  3  
ATOM 7565  H HG3  . MET A 1 63  ? 11.823  -7.868  -4.470  1.00 0.54  ? 63  MET A HG3  3  
ATOM 7566  H HE1  . MET A 1 63  ? 10.524  -10.153 -4.051  1.00 2.05  ? 63  MET A HE1  3  
ATOM 7567  H HE2  . MET A 1 63  ? 11.264  -10.872 -5.481  1.00 2.05  ? 63  MET A HE2  3  
ATOM 7568  H HE3  . MET A 1 63  ? 9.515   -10.944 -5.262  1.00 2.13  ? 63  MET A HE3  3  
ATOM 7569  N N    . MET A 1 64  ? 13.543  -4.899  -8.025  1.00 0.41  ? 64  MET A N    3  
ATOM 7570  C CA   . MET A 1 64  ? 14.055  -3.621  -8.484  1.00 0.42  ? 64  MET A CA   3  
ATOM 7571  C C    . MET A 1 64  ? 13.601  -3.330  -9.901  1.00 0.44  ? 64  MET A C    3  
ATOM 7572  O O    . MET A 1 64  ? 12.955  -2.334  -10.142 1.00 0.41  ? 64  MET A O    3  
ATOM 7573  C CB   . MET A 1 64  ? 15.581  -3.606  -8.447  1.00 0.55  ? 64  MET A CB   3  
ATOM 7574  C CG   . MET A 1 64  ? 16.184  -2.352  -9.056  1.00 0.65  ? 64  MET A CG   3  
ATOM 7575  S SD   . MET A 1 64  ? 17.741  -2.680  -9.901  1.00 1.87  ? 64  MET A SD   3  
ATOM 7576  C CE   . MET A 1 64  ? 18.157  -1.038  -10.475 1.00 2.41  ? 64  MET A CE   3  
ATOM 7577  H H    . MET A 1 64  ? 14.152  -5.510  -7.552  1.00 0.42  ? 64  MET A H    3  
ATOM 7578  H HA   . MET A 1 64  ? 13.676  -2.853  -7.828  1.00 0.42  ? 64  MET A HA   3  
ATOM 7579  H HB2  . MET A 1 64  ? 15.907  -3.678  -7.419  1.00 0.60  ? 64  MET A HB2  3  
ATOM 7580  H HB3  . MET A 1 64  ? 15.952  -4.460  -8.994  1.00 0.64  ? 64  MET A HB3  3  
ATOM 7581  H HG2  . MET A 1 64  ? 15.482  -1.940  -9.767  1.00 1.29  ? 64  MET A HG2  3  
ATOM 7582  H HG3  . MET A 1 64  ? 16.361  -1.634  -8.268  1.00 1.05  ? 64  MET A HG3  3  
ATOM 7583  H HE1  . MET A 1 64  ? 18.259  -0.376  -9.628  1.00 2.83  ? 64  MET A HE1  3  
ATOM 7584  H HE2  . MET A 1 64  ? 17.373  -0.676  -11.124 1.00 2.83  ? 64  MET A HE2  3  
ATOM 7585  H HE3  . MET A 1 64  ? 19.088  -1.073  -11.019 1.00 2.75  ? 64  MET A HE3  3  
ATOM 7586  N N    . LYS A 1 65  ? 13.901  -4.235  -10.819 1.00 0.52  ? 65  LYS A N    3  
ATOM 7587  C CA   . LYS A 1 65  ? 13.723  -3.967  -12.245 1.00 0.56  ? 65  LYS A CA   3  
ATOM 7588  C C    . LYS A 1 65  ? 12.270  -3.689  -12.630 1.00 0.54  ? 65  LYS A C    3  
ATOM 7589  O O    . LYS A 1 65  ? 12.003  -2.732  -13.356 1.00 0.60  ? 65  LYS A O    3  
ATOM 7590  C CB   . LYS A 1 65  ? 14.283  -5.116  -13.075 1.00 0.66  ? 65  LYS A CB   3  
ATOM 7591  C CG   . LYS A 1 65  ? 15.787  -5.272  -12.936 1.00 0.79  ? 65  LYS A CG   3  
ATOM 7592  C CD   . LYS A 1 65  ? 16.517  -3.988  -13.305 1.00 0.86  ? 65  LYS A CD   3  
ATOM 7593  C CE   . LYS A 1 65  ? 18.024  -4.176  -13.251 1.00 1.57  ? 65  LYS A CE   3  
ATOM 7594  N NZ   . LYS A 1 65  ? 18.756  -2.980  -13.745 1.00 2.49  ? 65  LYS A NZ   3  
ATOM 7595  H H    . LYS A 1 65  ? 14.252  -5.110  -10.528 1.00 0.56  ? 65  LYS A H    3  
ATOM 7596  H HA   . LYS A 1 65  ? 14.296  -3.080  -12.468 1.00 0.59  ? 65  LYS A HA   3  
ATOM 7597  H HB2  . LYS A 1 65  ? 13.813  -6.036  -12.761 1.00 0.75  ? 65  LYS A HB2  3  
ATOM 7598  H HB3  . LYS A 1 65  ? 14.054  -4.939  -14.115 1.00 0.66  ? 65  LYS A HB3  3  
ATOM 7599  H HG2  . LYS A 1 65  ? 16.021  -5.527  -11.913 1.00 0.86  ? 65  LYS A HG2  3  
ATOM 7600  H HG3  . LYS A 1 65  ? 16.119  -6.064  -13.590 1.00 0.89  ? 65  LYS A HG3  3  
ATOM 7601  H HD2  . LYS A 1 65  ? 16.233  -3.698  -14.304 1.00 1.29  ? 65  LYS A HD2  3  
ATOM 7602  H HD3  . LYS A 1 65  ? 16.231  -3.209  -12.604 1.00 1.25  ? 65  LYS A HD3  3  
ATOM 7603  H HE2  . LYS A 1 65  ? 18.313  -4.364  -12.227 1.00 1.92  ? 65  LYS A HE2  3  
ATOM 7604  H HE3  . LYS A 1 65  ? 18.288  -5.026  -13.860 1.00 2.11  ? 65  LYS A HE3  3  
ATOM 7605  H HZ1  . LYS A 1 65  ? 19.783  -3.140  -13.692 1.00 2.92  ? 65  LYS A HZ1  3  
ATOM 7606  H HZ2  . LYS A 1 65  ? 18.521  -2.148  -13.169 1.00 2.86  ? 65  LYS A HZ2  3  
ATOM 7607  H HZ3  . LYS A 1 65  ? 18.499  -2.784  -14.734 1.00 3.01  ? 65  LYS A HZ3  3  
ATOM 7608  N N    . LYS A 1 66  ? 11.339  -4.518  -12.162 1.00 0.50  ? 66  LYS A N    3  
ATOM 7609  C CA   . LYS A 1 66  ? 9.914   -4.307  -12.451 1.00 0.52  ? 66  LYS A CA   3  
ATOM 7610  C C    . LYS A 1 66  ? 9.446   -2.975  -11.914 1.00 0.48  ? 66  LYS A C    3  
ATOM 7611  O O    . LYS A 1 66  ? 8.783   -2.198  -12.600 1.00 0.55  ? 66  LYS A O    3  
ATOM 7612  C CB   . LYS A 1 66  ? 9.041   -5.386  -11.814 1.00 0.55  ? 66  LYS A CB   3  
ATOM 7613  C CG   . LYS A 1 66  ? 9.628   -5.999  -10.566 1.00 0.91  ? 66  LYS A CG   3  
ATOM 7614  C CD   . LYS A 1 66  ? 8.684   -7.009  -9.927  1.00 0.96  ? 66  LYS A CD   3  
ATOM 7615  C CE   . LYS A 1 66  ? 7.528   -6.325  -9.213  1.00 0.73  ? 66  LYS A CE   3  
ATOM 7616  N NZ   . LYS A 1 66  ? 6.500   -7.298  -8.760  1.00 1.47  ? 66  LYS A NZ   3  
ATOM 7617  H H    . LYS A 1 66  ? 11.614  -5.280  -11.610 1.00 0.50  ? 66  LYS A H    3  
ATOM 7618  H HA   . LYS A 1 66  ? 9.780   -4.326  -13.519 1.00 0.58  ? 66  LYS A HA   3  
ATOM 7619  H HB2  . LYS A 1 66  ? 8.106   -4.923  -11.531 1.00 0.84  ? 66  LYS A HB2  3  
ATOM 7620  H HB3  . LYS A 1 66  ? 8.854   -6.167  -12.531 1.00 0.87  ? 66  LYS A HB3  3  
ATOM 7621  H HG2  . LYS A 1 66  ? 10.551  -6.493  -10.824 1.00 1.33  ? 66  LYS A HG2  3  
ATOM 7622  H HG3  . LYS A 1 66  ? 9.826   -5.205  -9.862  1.00 1.31  ? 66  LYS A HG3  3  
ATOM 7623  H HD2  . LYS A 1 66  ? 8.286   -7.651  -10.698 1.00 1.50  ? 66  LYS A HD2  3  
ATOM 7624  H HD3  . LYS A 1 66  ? 9.237   -7.602  -9.213  1.00 1.60  ? 66  LYS A HD3  3  
ATOM 7625  H HE2  . LYS A 1 66  ? 7.918   -5.801  -8.349  1.00 1.11  ? 66  LYS A HE2  3  
ATOM 7626  H HE3  . LYS A 1 66  ? 7.072   -5.617  -9.887  1.00 0.98  ? 66  LYS A HE3  3  
ATOM 7627  H HZ1  . LYS A 1 66  ? 6.918   -7.985  -8.101  1.00 2.03  ? 66  LYS A HZ1  3  
ATOM 7628  H HZ2  . LYS A 1 66  ? 6.107   -7.812  -9.572  1.00 1.78  ? 66  LYS A HZ2  3  
ATOM 7629  H HZ3  . LYS A 1 66  ? 5.725   -6.800  -8.277  1.00 2.01  ? 66  LYS A HZ3  3  
ATOM 7630  N N    . LEU A 1 67  ? 9.791   -2.741  -10.671 1.00 0.41  ? 67  LEU A N    3  
ATOM 7631  C CA   . LEU A 1 67  ? 9.339   -1.581  -9.943  1.00 0.39  ? 67  LEU A CA   3  
ATOM 7632  C C    . LEU A 1 67  ? 10.044  -0.338  -10.433 1.00 0.40  ? 67  LEU A C    3  
ATOM 7633  O O    . LEU A 1 67  ? 9.459   0.738   -10.448 1.00 0.46  ? 67  LEU A O    3  
ATOM 7634  C CB   . LEU A 1 67  ? 9.654   -1.792  -8.491  1.00 0.34  ? 67  LEU A CB   3  
ATOM 7635  C CG   . LEU A 1 67  ? 9.081   -3.066  -7.879  1.00 0.33  ? 67  LEU A CG   3  
ATOM 7636  C CD1  . LEU A 1 67  ? 9.628   -3.270  -6.480  1.00 0.30  ? 67  LEU A CD1  3  
ATOM 7637  C CD2  . LEU A 1 67  ? 7.563   -3.024  -7.871  1.00 0.37  ? 67  LEU A CD2  3  
ATOM 7638  H H    . LEU A 1 67  ? 10.389  -3.376  -10.221 1.00 0.43  ? 67  LEU A H    3  
ATOM 7639  H HA   . LEU A 1 67  ? 8.278   -1.477  -10.072 1.00 0.44  ? 67  LEU A HA   3  
ATOM 7640  H HB2  . LEU A 1 67  ? 10.723  -1.830  -8.422  1.00 0.34  ? 67  LEU A HB2  3  
ATOM 7641  H HB3  . LEU A 1 67  ? 9.293   -0.942  -7.929  1.00 0.36  ? 67  LEU A HB3  3  
ATOM 7642  H HG   . LEU A 1 67  ? 9.388   -3.909  -8.478  1.00 0.36  ? 67  LEU A HG   3  
ATOM 7643  H HD11 . LEU A 1 67  ? 10.682  -3.501  -6.536  1.00 1.06  ? 67  LEU A HD11 3  
ATOM 7644  H HD12 . LEU A 1 67  ? 9.104   -4.085  -6.003  1.00 1.02  ? 67  LEU A HD12 3  
ATOM 7645  H HD13 . LEU A 1 67  ? 9.492   -2.362  -5.907  1.00 1.06  ? 67  LEU A HD13 3  
ATOM 7646  H HD21 . LEU A 1 67  ? 7.200   -2.945  -8.886  1.00 1.11  ? 67  LEU A HD21 3  
ATOM 7647  H HD22 . LEU A 1 67  ? 7.230   -2.170  -7.300  1.00 1.06  ? 67  LEU A HD22 3  
ATOM 7648  H HD23 . LEU A 1 67  ? 7.180   -3.928  -7.423  1.00 1.08  ? 67  LEU A HD23 3  
ATOM 7649  N N    . ASP A 1 68  ? 11.313  -0.506  -10.805 1.00 0.40  ? 68  ASP A N    3  
ATOM 7650  C CA   . ASP A 1 68  ? 12.114  0.555   -11.405 1.00 0.42  ? 68  ASP A CA   3  
ATOM 7651  C C    . ASP A 1 68  ? 11.559  0.837   -12.789 1.00 0.52  ? 68  ASP A C    3  
ATOM 7652  O O    . ASP A 1 68  ? 12.199  0.621   -13.820 1.00 0.56  ? 68  ASP A O    3  
ATOM 7653  C CB   . ASP A 1 68  ? 13.591  0.133   -11.486 1.00 0.43  ? 68  ASP A CB   3  
ATOM 7654  C CG   . ASP A 1 68  ? 14.482  1.164   -12.150 1.00 0.46  ? 68  ASP A CG   3  
ATOM 7655  O OD1  . ASP A 1 68  ? 14.473  2.334   -11.724 1.00 1.13  ? 68  ASP A OD1  3  
ATOM 7656  O OD2  . ASP A 1 68  ? 15.196  0.803   -13.112 1.00 1.23  ? 68  ASP A OD2  3  
ATOM 7657  H H    . ASP A 1 68  ? 11.732  -1.384  -10.664 1.00 0.40  ? 68  ASP A H    3  
ATOM 7658  H HA   . ASP A 1 68  ? 12.015  1.440   -10.782 1.00 0.41  ? 68  ASP A HA   3  
ATOM 7659  H HB2  . ASP A 1 68  ? 13.964  -0.050  -10.492 1.00 0.41  ? 68  ASP A HB2  3  
ATOM 7660  H HB3  . ASP A 1 68  ? 13.655  -0.782  -12.051 1.00 0.47  ? 68  ASP A HB3  3  
ATOM 7661  N N    . THR A 1 69  ? 10.332  1.278   -12.782 1.00 0.59  ? 69  THR A N    3  
ATOM 7662  C CA   . THR A 1 69  ? 9.548   1.435   -13.972 1.00 0.74  ? 69  THR A CA   3  
ATOM 7663  C C    . THR A 1 69  ? 9.879   2.746   -14.662 1.00 0.84  ? 69  THR A C    3  
ATOM 7664  O O    . THR A 1 69  ? 9.604   2.931   -15.848 1.00 0.99  ? 69  THR A O    3  
ATOM 7665  C CB   . THR A 1 69  ? 8.056   1.344   -13.604 1.00 0.79  ? 69  THR A CB   3  
ATOM 7666  O OG1  . THR A 1 69  ? 7.260   1.147   -14.780 1.00 0.90  ? 69  THR A OG1  3  
ATOM 7667  C CG2  . THR A 1 69  ? 7.599   2.602   -12.883 1.00 0.83  ? 69  THR A CG2  3  
ATOM 7668  H H    . THR A 1 69  ? 9.921   1.497   -11.905 1.00 0.55  ? 69  THR A H    3  
ATOM 7669  H HA   . THR A 1 69  ? 9.783   0.625   -14.636 1.00 0.80  ? 69  THR A HA   3  
ATOM 7670  H HB   . THR A 1 69  ? 7.931   0.496   -12.929 1.00 0.76  ? 69  THR A HB   3  
ATOM 7671  H HG1  . THR A 1 69  ? 7.430   0.267   -15.136 1.00 1.25  ? 69  THR A HG1  3  
ATOM 7672  H HG21 . THR A 1 69  ? 8.218   2.759   -12.011 1.00 1.41  ? 69  THR A HG21 3  
ATOM 7673  H HG22 . THR A 1 69  ? 6.569   2.492   -12.579 1.00 1.35  ? 69  THR A HG22 3  
ATOM 7674  H HG23 . THR A 1 69  ? 7.692   3.448   -13.546 1.00 1.12  ? 69  THR A HG23 3  
ATOM 7675  N N    . ASN A 1 70  ? 10.491  3.648   -13.913 1.00 0.80  ? 70  ASN A N    3  
ATOM 7676  C CA   . ASN A 1 70  ? 10.989  4.885   -14.483 1.00 0.94  ? 70  ASN A CA   3  
ATOM 7677  C C    . ASN A 1 70  ? 12.407  4.665   -14.989 1.00 0.86  ? 70  ASN A C    3  
ATOM 7678  O O    . ASN A 1 70  ? 12.956  5.471   -15.738 1.00 0.97  ? 70  ASN A O    3  
ATOM 7679  C CB   . ASN A 1 70  ? 10.961  5.995   -13.439 1.00 1.01  ? 70  ASN A CB   3  
ATOM 7680  C CG   . ASN A 1 70  ? 10.847  7.383   -14.048 1.00 1.25  ? 70  ASN A CG   3  
ATOM 7681  O OD1  . ASN A 1 70  ? 11.320  7.638   -15.156 1.00 1.46  ? 70  ASN A OD1  3  
ATOM 7682  N ND2  . ASN A 1 70  ? 10.211  8.292   -13.327 1.00 1.66  ? 70  ASN A ND2  3  
ATOM 7683  H H    . ASN A 1 70  ? 10.592  3.483   -12.943 1.00 0.72  ? 70  ASN A H    3  
ATOM 7684  H HA   . ASN A 1 70  ? 10.354  5.156   -15.313 1.00 1.12  ? 70  ASN A HA   3  
ATOM 7685  H HB2  . ASN A 1 70  ? 10.120  5.830   -12.789 1.00 1.07  ? 70  ASN A HB2  3  
ATOM 7686  H HB3  . ASN A 1 70  ? 11.870  5.953   -12.859 1.00 0.89  ? 70  ASN A HB3  3  
ATOM 7687  H HD21 . ASN A 1 70  ? 9.854   8.022   -12.451 1.00 1.94  ? 70  ASN A HD21 3  
ATOM 7688  H HD22 . ASN A 1 70  ? 10.118  9.194   -13.695 1.00 1.86  ? 70  ASN A HD22 3  
ATOM 7689  N N    . SER A 1 71  ? 12.976  3.537   -14.562 1.00 0.70  ? 71  SER A N    3  
ATOM 7690  C CA   . SER A 1 71  ? 14.270  3.067   -15.031 1.00 0.66  ? 71  SER A CA   3  
ATOM 7691  C C    . SER A 1 71  ? 15.393  4.005   -14.611 1.00 0.61  ? 71  SER A C    3  
ATOM 7692  O O    . SER A 1 71  ? 16.282  4.329   -15.400 1.00 0.65  ? 71  SER A O    3  
ATOM 7693  C CB   . SER A 1 71  ? 14.249  2.884   -16.548 1.00 0.82  ? 71  SER A CB   3  
ATOM 7694  O OG   . SER A 1 71  ? 13.187  2.022   -16.933 1.00 1.47  ? 71  SER A OG   3  
ATOM 7695  H H    . SER A 1 71  ? 12.506  3.005   -13.886 1.00 0.65  ? 71  SER A H    3  
ATOM 7696  H HA   . SER A 1 71  ? 14.443  2.107   -14.571 1.00 0.61  ? 71  SER A HA   3  
ATOM 7697  H HB2  . SER A 1 71  ? 14.109  3.842   -17.024 1.00 1.19  ? 71  SER A HB2  3  
ATOM 7698  H HB3  . SER A 1 71  ? 15.183  2.451   -16.872 1.00 1.15  ? 71  SER A HB3  3  
ATOM 7699  H HG   . SER A 1 71  ? 12.846  1.566   -16.150 1.00 2.02  ? 71  SER A HG   3  
ATOM 7700  N N    . ASP A 1 72  ? 15.360  4.423   -13.357 1.00 0.58  ? 72  ASP A N    3  
ATOM 7701  C CA   . ASP A 1 72  ? 16.392  5.291   -12.821 1.00 0.65  ? 72  ASP A CA   3  
ATOM 7702  C C    . ASP A 1 72  ? 17.380  4.464   -12.011 1.00 0.56  ? 72  ASP A C    3  
ATOM 7703  O O    . ASP A 1 72  ? 18.513  4.882   -11.774 1.00 0.66  ? 72  ASP A O    3  
ATOM 7704  C CB   . ASP A 1 72  ? 15.771  6.384   -11.948 1.00 0.80  ? 72  ASP A CB   3  
ATOM 7705  C CG   . ASP A 1 72  ? 16.793  7.395   -11.469 1.00 0.93  ? 72  ASP A CG   3  
ATOM 7706  O OD1  . ASP A 1 72  ? 17.103  8.339   -12.227 1.00 1.56  ? 72  ASP A OD1  3  
ATOM 7707  O OD2  . ASP A 1 72  ? 17.290  7.258   -10.336 1.00 1.53  ? 72  ASP A OD2  3  
ATOM 7708  H H    . ASP A 1 72  ? 14.631  4.120   -12.768 1.00 0.56  ? 72  ASP A H    3  
ATOM 7709  H HA   . ASP A 1 72  ? 16.911  5.747   -13.651 1.00 0.76  ? 72  ASP A HA   3  
ATOM 7710  H HB2  . ASP A 1 72  ? 15.016  6.906   -12.518 1.00 1.15  ? 72  ASP A HB2  3  
ATOM 7711  H HB3  . ASP A 1 72  ? 15.311  5.928   -11.083 1.00 1.00  ? 72  ASP A HB3  3  
ATOM 7712  N N    . GLY A 1 73  ? 16.953  3.271   -11.623 1.00 0.45  ? 73  GLY A N    3  
ATOM 7713  C CA   . GLY A 1 73  ? 17.816  2.381   -10.871 1.00 0.46  ? 73  GLY A CA   3  
ATOM 7714  C C    . GLY A 1 73  ? 17.477  2.386   -9.403  1.00 0.41  ? 73  GLY A C    3  
ATOM 7715  O O    . GLY A 1 73  ? 18.192  1.812   -8.578  1.00 0.44  ? 73  GLY A O    3  
ATOM 7716  H H    . GLY A 1 73  ? 16.021  2.993   -11.834 1.00 0.42  ? 73  GLY A H    3  
ATOM 7717  H HA2  . GLY A 1 73  ? 17.705  1.376   -11.249 1.00 0.48  ? 73  GLY A HA2  3  
ATOM 7718  H HA3  . GLY A 1 73  ? 18.837  2.697   -10.997 1.00 0.55  ? 73  GLY A HA3  3  
ATOM 7719  N N    . GLN A 1 74  ? 16.380  3.038   -9.087  1.00 0.38  ? 74  GLN A N    3  
ATOM 7720  C CA   . GLN A 1 74  ? 15.897  3.141   -7.730  1.00 0.37  ? 74  GLN A CA   3  
ATOM 7721  C C    . GLN A 1 74  ? 14.392  3.011   -7.754  1.00 0.36  ? 74  GLN A C    3  
ATOM 7722  O O    . GLN A 1 74  ? 13.794  2.952   -8.826  1.00 0.39  ? 74  GLN A O    3  
ATOM 7723  C CB   . GLN A 1 74  ? 16.267  4.487   -7.119  1.00 0.38  ? 74  GLN A CB   3  
ATOM 7724  C CG   . GLN A 1 74  ? 17.744  4.826   -7.191  1.00 0.42  ? 74  GLN A CG   3  
ATOM 7725  C CD   . GLN A 1 74  ? 18.121  6.040   -6.360  1.00 0.50  ? 74  GLN A CD   3  
ATOM 7726  O OE1  . GLN A 1 74  ? 17.505  6.325   -5.337  1.00 1.03  ? 74  GLN A OE1  3  
ATOM 7727  N NE2  . GLN A 1 74  ? 19.138  6.760   -6.795  1.00 1.25  ? 74  GLN A NE2  3  
ATOM 7728  H H    . GLN A 1 74  ? 15.853  3.452   -9.802  1.00 0.39  ? 74  GLN A H    3  
ATOM 7729  H HA   . GLN A 1 74  ? 16.325  2.339   -7.140  1.00 0.40  ? 74  GLN A HA   3  
ATOM 7730  H HB2  . GLN A 1 74  ? 15.716  5.260   -7.638  1.00 0.39  ? 74  GLN A HB2  3  
ATOM 7731  H HB3  . GLN A 1 74  ? 15.966  4.482   -6.083  1.00 0.38  ? 74  GLN A HB3  3  
ATOM 7732  H HG2  . GLN A 1 74  ? 18.309  3.980   -6.839  1.00 0.42  ? 74  GLN A HG2  3  
ATOM 7733  H HG3  . GLN A 1 74  ? 17.996  5.025   -8.220  1.00 0.44  ? 74  GLN A HG3  3  
ATOM 7734  H HE21 . GLN A 1 74  ? 19.588  6.477   -7.621  1.00 1.91  ? 74  GLN A HE21 3  
ATOM 7735  H HE22 . GLN A 1 74  ? 19.406  7.545   -6.272  1.00 1.32  ? 74  GLN A HE22 3  
ATOM 7736  N N    . LEU A 1 75  ? 13.779  2.980   -6.591  1.00 0.33  ? 75  LEU A N    3  
ATOM 7737  C CA   . LEU A 1 75  ? 12.333  2.920   -6.521  1.00 0.32  ? 75  LEU A CA   3  
ATOM 7738  C C    . LEU A 1 75  ? 11.781  4.148   -5.853  1.00 0.32  ? 75  LEU A C    3  
ATOM 7739  O O    . LEU A 1 75  ? 12.047  4.414   -4.679  1.00 0.32  ? 75  LEU A O    3  
ATOM 7740  C CB   . LEU A 1 75  ? 11.866  1.683   -5.776  1.00 0.31  ? 75  LEU A CB   3  
ATOM 7741  C CG   . LEU A 1 75  ? 12.401  0.380   -6.344  1.00 0.33  ? 75  LEU A CG   3  
ATOM 7742  C CD1  . LEU A 1 75  ? 11.759  -0.795  -5.646  1.00 0.35  ? 75  LEU A CD1  3  
ATOM 7743  C CD2  . LEU A 1 75  ? 12.153  0.325   -7.843  1.00 0.35  ? 75  LEU A CD2  3  
ATOM 7744  H H    . LEU A 1 75  ? 14.307  2.995   -5.765  1.00 0.33  ? 75  LEU A H    3  
ATOM 7745  H HA   . LEU A 1 75  ? 11.958  2.881   -7.534  1.00 0.33  ? 75  LEU A HA   3  
ATOM 7746  H HB2  . LEU A 1 75  ? 12.179  1.773   -4.742  1.00 0.33  ? 75  LEU A HB2  3  
ATOM 7747  H HB3  . LEU A 1 75  ? 10.779  1.646   -5.816  1.00 0.32  ? 75  LEU A HB3  3  
ATOM 7748  H HG   . LEU A 1 75  ? 13.466  0.329   -6.178  1.00 0.36  ? 75  LEU A HG   3  
ATOM 7749  H HD11 . LEU A 1 75  ? 10.688  -0.747  -5.773  1.00 1.08  ? 75  LEU A HD11 3  
ATOM 7750  H HD12 . LEU A 1 75  ? 11.999  -0.764  -4.593  1.00 0.98  ? 75  LEU A HD12 3  
ATOM 7751  H HD13 . LEU A 1 75  ? 12.132  -1.716  -6.073  1.00 1.09  ? 75  LEU A HD13 3  
ATOM 7752  H HD21 . LEU A 1 75  ? 12.634  1.170   -8.318  1.00 1.10  ? 75  LEU A HD21 3  
ATOM 7753  H HD22 . LEU A 1 75  ? 11.088  0.367   -8.036  1.00 1.05  ? 75  LEU A HD22 3  
ATOM 7754  H HD23 . LEU A 1 75  ? 12.556  -0.593  -8.244  1.00 1.06  ? 75  LEU A HD23 3  
ATOM 7755  N N    . ASP A 1 76  ? 11.032  4.904   -6.615  1.00 0.35  ? 76  ASP A N    3  
ATOM 7756  C CA   . ASP A 1 76  ? 10.361  6.070   -6.091  1.00 0.36  ? 76  ASP A CA   3  
ATOM 7757  C C    . ASP A 1 76  ? 9.119   5.608   -5.351  1.00 0.33  ? 76  ASP A C    3  
ATOM 7758  O O    . ASP A 1 76  ? 8.793   4.428   -5.400  1.00 0.32  ? 76  ASP A O    3  
ATOM 7759  C CB   . ASP A 1 76  ? 10.071  7.061   -7.230  1.00 0.44  ? 76  ASP A CB   3  
ATOM 7760  C CG   . ASP A 1 76  ? 8.651   7.017   -7.795  1.00 0.91  ? 76  ASP A CG   3  
ATOM 7761  O OD1  . ASP A 1 76  ? 7.695   7.431   -7.099  1.00 1.45  ? 76  ASP A OD1  3  
ATOM 7762  O OD2  . ASP A 1 76  ? 8.491   6.629   -8.965  1.00 1.68  ? 76  ASP A OD2  3  
ATOM 7763  H H    . ASP A 1 76  ? 10.924  4.661   -7.571  1.00 0.41  ? 76  ASP A H    3  
ATOM 7764  H HA   . ASP A 1 76  ? 11.025  6.538   -5.377  1.00 0.37  ? 76  ASP A HA   3  
ATOM 7765  H HB2  . ASP A 1 76  ? 10.269  8.063   -6.876  1.00 0.74  ? 76  ASP A HB2  3  
ATOM 7766  H HB3  . ASP A 1 76  ? 10.761  6.828   -8.046  1.00 0.64  ? 76  ASP A HB3  3  
ATOM 7767  N N    . PHE A 1 77  ? 8.446   6.505   -4.653  1.00 0.41  ? 77  PHE A N    3  
ATOM 7768  C CA   . PHE A 1 77  ? 7.356   6.108   -3.767  1.00 0.49  ? 77  PHE A CA   3  
ATOM 7769  C C    . PHE A 1 77  ? 6.311   5.267   -4.497  1.00 0.39  ? 77  PHE A C    3  
ATOM 7770  O O    . PHE A 1 77  ? 5.874   4.242   -3.989  1.00 0.39  ? 77  PHE A O    3  
ATOM 7771  C CB   . PHE A 1 77  ? 6.702   7.332   -3.148  1.00 0.72  ? 77  PHE A CB   3  
ATOM 7772  C CG   . PHE A 1 77  ? 5.974   7.025   -1.872  1.00 1.76  ? 77  PHE A CG   3  
ATOM 7773  C CD1  . PHE A 1 77  ? 6.640   6.449   -0.804  1.00 2.66  ? 77  PHE A CD1  3  
ATOM 7774  C CD2  . PHE A 1 77  ? 4.630   7.314   -1.740  1.00 2.56  ? 77  PHE A CD2  3  
ATOM 7775  C CE1  . PHE A 1 77  ? 5.977   6.166   0.373   1.00 3.77  ? 77  PHE A CE1  3  
ATOM 7776  C CE2  . PHE A 1 77  ? 3.964   7.034   -0.565  1.00 3.67  ? 77  PHE A CE2  3  
ATOM 7777  C CZ   . PHE A 1 77  ? 4.637   6.459   0.493   1.00 4.15  ? 77  PHE A CZ   3  
ATOM 7778  H H    . PHE A 1 77  ? 8.675   7.454   -4.741  1.00 0.47  ? 77  PHE A H    3  
ATOM 7779  H HA   . PHE A 1 77  ? 7.784   5.510   -2.977  1.00 0.57  ? 77  PHE A HA   3  
ATOM 7780  H HB2  . PHE A 1 77  ? 7.461   8.068   -2.940  1.00 1.26  ? 77  PHE A HB2  3  
ATOM 7781  H HB3  . PHE A 1 77  ? 5.986   7.740   -3.848  1.00 1.00  ? 77  PHE A HB3  3  
ATOM 7782  H HD1  . PHE A 1 77  ? 7.692   6.219   -0.897  1.00 2.85  ? 77  PHE A HD1  3  
ATOM 7783  H HD2  . PHE A 1 77  ? 4.100   7.763   -2.566  1.00 2.72  ? 77  PHE A HD2  3  
ATOM 7784  H HE1  . PHE A 1 77  ? 6.509   5.715   1.198   1.00 4.59  ? 77  PHE A HE1  3  
ATOM 7785  H HE2  . PHE A 1 77  ? 2.913   7.265   -0.473  1.00 4.42  ? 77  PHE A HE2  3  
ATOM 7786  H HZ   . PHE A 1 77  ? 4.115   6.239   1.413   1.00 5.09  ? 77  PHE A HZ   3  
ATOM 7787  N N    . SER A 1 78  ? 5.931   5.690   -5.692  1.00 0.39  ? 78  SER A N    3  
ATOM 7788  C CA   . SER A 1 78  ? 4.962   4.954   -6.495  1.00 0.38  ? 78  SER A CA   3  
ATOM 7789  C C    . SER A 1 78  ? 5.502   3.581   -6.896  1.00 0.38  ? 78  SER A C    3  
ATOM 7790  O O    . SER A 1 78  ? 4.740   2.626   -7.044  1.00 0.44  ? 78  SER A O    3  
ATOM 7791  C CB   . SER A 1 78  ? 4.589   5.758   -7.741  1.00 0.45  ? 78  SER A CB   3  
ATOM 7792  O OG   . SER A 1 78  ? 5.724   6.026   -8.547  1.00 1.31  ? 78  SER A OG   3  
ATOM 7793  H H    . SER A 1 78  ? 6.306   6.522   -6.041  1.00 0.45  ? 78  SER A H    3  
ATOM 7794  H HA   . SER A 1 78  ? 4.077   4.815   -5.893  1.00 0.40  ? 78  SER A HA   3  
ATOM 7795  H HB2  . SER A 1 78  ? 3.876   5.197   -8.326  1.00 1.07  ? 78  SER A HB2  3  
ATOM 7796  H HB3  . SER A 1 78  ? 4.146   6.696   -7.440  1.00 0.94  ? 78  SER A HB3  3  
ATOM 7797  H HG   . SER A 1 78  ? 6.386   6.516   -8.033  1.00 1.76  ? 78  SER A HG   3  
ATOM 7798  N N    . GLU A 1 79  ? 6.815   3.486   -7.049  1.00 0.36  ? 79  GLU A N    3  
ATOM 7799  C CA   . GLU A 1 79  ? 7.460   2.240   -7.451  1.00 0.42  ? 79  GLU A CA   3  
ATOM 7800  C C    . GLU A 1 79  ? 7.633   1.336   -6.235  1.00 0.33  ? 79  GLU A C    3  
ATOM 7801  O O    . GLU A 1 79  ? 7.508   0.115   -6.317  1.00 0.33  ? 79  GLU A O    3  
ATOM 7802  C CB   . GLU A 1 79  ? 8.807   2.547   -8.105  1.00 0.51  ? 79  GLU A CB   3  
ATOM 7803  C CG   . GLU A 1 79  ? 8.691   3.539   -9.252  1.00 0.64  ? 79  GLU A CG   3  
ATOM 7804  C CD   . GLU A 1 79  ? 10.018  3.864   -9.910  1.00 1.81  ? 79  GLU A CD   3  
ATOM 7805  O OE1  . GLU A 1 79  ? 10.912  4.399   -9.225  1.00 2.54  ? 79  GLU A OE1  3  
ATOM 7806  O OE2  . GLU A 1 79  ? 10.163  3.611   -11.124 1.00 2.57  ? 79  GLU A OE2  3  
ATOM 7807  H H    . GLU A 1 79  ? 7.376   4.275   -6.873  1.00 0.35  ? 79  GLU A H    3  
ATOM 7808  H HA   . GLU A 1 79  ? 6.820   1.748   -8.168  1.00 0.51  ? 79  GLU A HA   3  
ATOM 7809  H HB2  . GLU A 1 79  ? 9.473   2.961   -7.361  1.00 0.48  ? 79  GLU A HB2  3  
ATOM 7810  H HB3  . GLU A 1 79  ? 9.229   1.631   -8.489  1.00 0.60  ? 79  GLU A HB3  3  
ATOM 7811  H HG2  . GLU A 1 79  ? 8.032   3.125   -10.000 1.00 0.89  ? 79  GLU A HG2  3  
ATOM 7812  H HG3  . GLU A 1 79  ? 8.263   4.455   -8.870  1.00 1.04  ? 79  GLU A HG3  3  
ATOM 7813  N N    . PHE A 1 80  ? 7.903   1.966   -5.105  1.00 0.28  ? 80  PHE A N    3  
ATOM 7814  C CA   . PHE A 1 80  ? 7.959   1.291   -3.819  1.00 0.25  ? 80  PHE A CA   3  
ATOM 7815  C C    . PHE A 1 80  ? 6.581   0.761   -3.446  1.00 0.23  ? 80  PHE A C    3  
ATOM 7816  O O    . PHE A 1 80  ? 6.439   -0.348  -2.945  1.00 0.26  ? 80  PHE A O    3  
ATOM 7817  C CB   . PHE A 1 80  ? 8.446   2.278   -2.761  1.00 0.31  ? 80  PHE A CB   3  
ATOM 7818  C CG   . PHE A 1 80  ? 8.336   1.770   -1.360  1.00 0.71  ? 80  PHE A CG   3  
ATOM 7819  C CD1  . PHE A 1 80  ? 9.187   0.785   -0.901  1.00 1.26  ? 80  PHE A CD1  3  
ATOM 7820  C CD2  . PHE A 1 80  ? 7.376   2.283   -0.503  1.00 1.60  ? 80  PHE A CD2  3  
ATOM 7821  C CE1  . PHE A 1 80  ? 9.083   0.317   0.389   1.00 1.56  ? 80  PHE A CE1  3  
ATOM 7822  C CE2  . PHE A 1 80  ? 7.268   1.818   0.789   1.00 1.98  ? 80  PHE A CE2  3  
ATOM 7823  C CZ   . PHE A 1 80  ? 8.123   0.833   1.235   1.00 1.64  ? 80  PHE A CZ   3  
ATOM 7824  H H    . PHE A 1 80  ? 8.082   2.934   -5.138  1.00 0.28  ? 80  PHE A H    3  
ATOM 7825  H HA   . PHE A 1 80  ? 8.654   0.464   -3.889  1.00 0.29  ? 80  PHE A HA   3  
ATOM 7826  H HB2  . PHE A 1 80  ? 9.482   2.516   -2.947  1.00 0.38  ? 80  PHE A HB2  3  
ATOM 7827  H HB3  . PHE A 1 80  ? 7.856   3.179   -2.832  1.00 0.47  ? 80  PHE A HB3  3  
ATOM 7828  H HD1  . PHE A 1 80  ? 9.938   0.381   -1.563  1.00 1.92  ? 80  PHE A HD1  3  
ATOM 7829  H HD2  . PHE A 1 80  ? 6.707   3.054   -0.856  1.00 2.25  ? 80  PHE A HD2  3  
ATOM 7830  H HE1  . PHE A 1 80  ? 9.753   -0.454  0.739   1.00 2.20  ? 80  PHE A HE1  3  
ATOM 7831  H HE2  . PHE A 1 80  ? 6.516   2.223   1.450   1.00 2.80  ? 80  PHE A HE2  3  
ATOM 7832  H HZ   . PHE A 1 80  ? 8.040   0.465   2.247   1.00 2.01  ? 80  PHE A HZ   3  
ATOM 7833  N N    . LEU A 1 81  ? 5.567   1.567   -3.695  1.00 0.25  ? 81  LEU A N    3  
ATOM 7834  C CA   . LEU A 1 81  ? 4.198   1.164   -3.430  1.00 0.26  ? 81  LEU A CA   3  
ATOM 7835  C C    . LEU A 1 81  ? 3.735   0.147   -4.444  1.00 0.26  ? 81  LEU A C    3  
ATOM 7836  O O    . LEU A 1 81  ? 2.862   -0.670  -4.164  1.00 0.27  ? 81  LEU A O    3  
ATOM 7837  C CB   . LEU A 1 81  ? 3.279   2.365   -3.456  1.00 0.29  ? 81  LEU A CB   3  
ATOM 7838  C CG   . LEU A 1 81  ? 3.542   3.389   -2.358  1.00 0.28  ? 81  LEU A CG   3  
ATOM 7839  C CD1  . LEU A 1 81  ? 2.577   4.545   -2.490  1.00 0.34  ? 81  LEU A CD1  3  
ATOM 7840  C CD2  . LEU A 1 81  ? 3.447   2.740   -0.976  1.00 0.29  ? 81  LEU A CD2  3  
ATOM 7841  H H    . LEU A 1 81  ? 5.743   2.467   -4.050  1.00 0.27  ? 81  LEU A H    3  
ATOM 7842  H HA   . LEU A 1 81  ? 4.167   0.717   -2.452  1.00 0.26  ? 81  LEU A HA   3  
ATOM 7843  H HB2  . LEU A 1 81  ? 3.395   2.856   -4.417  1.00 0.31  ? 81  LEU A HB2  3  
ATOM 7844  H HB3  . LEU A 1 81  ? 2.264   2.009   -3.366  1.00 0.32  ? 81  LEU A HB3  3  
ATOM 7845  H HG   . LEU A 1 81  ? 4.541   3.783   -2.477  1.00 0.28  ? 81  LEU A HG   3  
ATOM 7846  H HD11 . LEU A 1 81  ? 2.855   5.323   -1.796  1.00 1.05  ? 81  LEU A HD11 3  
ATOM 7847  H HD12 . LEU A 1 81  ? 1.576   4.205   -2.270  1.00 1.03  ? 81  LEU A HD12 3  
ATOM 7848  H HD13 . LEU A 1 81  ? 2.614   4.931   -3.500  1.00 1.12  ? 81  LEU A HD13 3  
ATOM 7849  H HD21 . LEU A 1 81  ? 3.583   3.491   -0.208  1.00 0.94  ? 81  LEU A HD21 3  
ATOM 7850  H HD22 . LEU A 1 81  ? 4.217   1.985   -0.872  1.00 0.98  ? 81  LEU A HD22 3  
ATOM 7851  H HD23 . LEU A 1 81  ? 2.478   2.280   -0.858  1.00 0.98  ? 81  LEU A HD23 3  
ATOM 7852  N N    . ASN A 1 82  ? 4.313   0.214   -5.629  1.00 0.26  ? 82  ASN A N    3  
ATOM 7853  C CA   . ASN A 1 82  ? 4.064   -0.789  -6.643  1.00 0.26  ? 82  ASN A CA   3  
ATOM 7854  C C    . ASN A 1 82  ? 4.492   -2.139  -6.087  1.00 0.23  ? 82  ASN A C    3  
ATOM 7855  O O    . ASN A 1 82  ? 3.836   -3.160  -6.284  1.00 0.25  ? 82  ASN A O    3  
ATOM 7856  C CB   . ASN A 1 82  ? 4.861   -0.469  -7.914  1.00 0.30  ? 82  ASN A CB   3  
ATOM 7857  C CG   . ASN A 1 82  ? 4.276   -1.107  -9.165  1.00 0.79  ? 82  ASN A CG   3  
ATOM 7858  O OD1  . ASN A 1 82  ? 3.668   -2.177  -9.116  1.00 1.51  ? 82  ASN A OD1  3  
ATOM 7859  N ND2  . ASN A 1 82  ? 4.459   -0.449  -10.301 1.00 1.42  ? 82  ASN A ND2  3  
ATOM 7860  H H    . ASN A 1 82  ? 4.912   0.966   -5.828  1.00 0.28  ? 82  ASN A H    3  
ATOM 7861  H HA   . ASN A 1 82  ? 3.004   -0.793  -6.852  1.00 0.30  ? 82  ASN A HA   3  
ATOM 7862  H HB2  . ASN A 1 82  ? 4.901   0.602   -8.052  1.00 0.58  ? 82  ASN A HB2  3  
ATOM 7863  H HB3  . ASN A 1 82  ? 5.868   -0.839  -7.790  1.00 0.65  ? 82  ASN A HB3  3  
ATOM 7864  H HD21 . ASN A 1 82  ? 4.952   0.398   -10.273 1.00 1.89  ? 82  ASN A HD21 3  
ATOM 7865  H HD22 . ASN A 1 82  ? 4.092   -0.835  -11.125 1.00 1.76  ? 82  ASN A HD22 3  
ATOM 7866  N N    . LEU A 1 83  ? 5.607   -2.110  -5.372  1.00 0.23  ? 83  LEU A N    3  
ATOM 7867  C CA   . LEU A 1 83  ? 6.108   -3.263  -4.645  1.00 0.24  ? 83  LEU A CA   3  
ATOM 7868  C C    . LEU A 1 83  ? 5.121   -3.703  -3.579  1.00 0.23  ? 83  LEU A C    3  
ATOM 7869  O O    . LEU A 1 83  ? 4.749   -4.872  -3.515  1.00 0.25  ? 83  LEU A O    3  
ATOM 7870  C CB   . LEU A 1 83  ? 7.425   -2.908  -3.982  1.00 0.27  ? 83  LEU A CB   3  
ATOM 7871  C CG   . LEU A 1 83  ? 7.834   -3.833  -2.850  1.00 0.31  ? 83  LEU A CG   3  
ATOM 7872  C CD1  . LEU A 1 83  ? 8.309   -5.172  -3.394  1.00 0.35  ? 83  LEU A CD1  3  
ATOM 7873  C CD2  . LEU A 1 83  ? 8.892   -3.170  -1.993  1.00 0.36  ? 83  LEU A CD2  3  
ATOM 7874  H H    . LEU A 1 83  ? 6.121   -1.274  -5.335  1.00 0.24  ? 83  LEU A H    3  
ATOM 7875  H HA   . LEU A 1 83  ? 6.265   -4.068  -5.344  1.00 0.25  ? 83  LEU A HA   3  
ATOM 7876  H HB2  . LEU A 1 83  ? 8.195   -2.927  -4.734  1.00 0.30  ? 83  LEU A HB2  3  
ATOM 7877  H HB3  . LEU A 1 83  ? 7.350   -1.905  -3.589  1.00 0.29  ? 83  LEU A HB3  3  
ATOM 7878  H HG   . LEU A 1 83  ? 6.966   -4.013  -2.230  1.00 0.30  ? 83  LEU A HG   3  
ATOM 7879  H HD11 . LEU A 1 83  ? 9.162   -5.019  -4.037  1.00 1.01  ? 83  LEU A HD11 3  
ATOM 7880  H HD12 . LEU A 1 83  ? 7.509   -5.633  -3.959  1.00 1.02  ? 83  LEU A HD12 3  
ATOM 7881  H HD13 . LEU A 1 83  ? 8.587   -5.816  -2.573  1.00 1.12  ? 83  LEU A HD13 3  
ATOM 7882  H HD21 . LEU A 1 83  ? 9.143   -3.817  -1.166  1.00 1.09  ? 83  LEU A HD21 3  
ATOM 7883  H HD22 . LEU A 1 83  ? 8.510   -2.230  -1.616  1.00 1.01  ? 83  LEU A HD22 3  
ATOM 7884  H HD23 . LEU A 1 83  ? 9.769   -2.986  -2.591  1.00 1.14  ? 83  LEU A HD23 3  
ATOM 7885  N N    . ILE A 1 84  ? 4.720   -2.757  -2.734  1.00 0.24  ? 84  ILE A N    3  
ATOM 7886  C CA   . ILE A 1 84  ? 3.753   -3.021  -1.678  1.00 0.26  ? 84  ILE A CA   3  
ATOM 7887  C C    . ILE A 1 84  ? 2.496   -3.661  -2.259  1.00 0.27  ? 84  ILE A C    3  
ATOM 7888  O O    . ILE A 1 84  ? 1.878   -4.515  -1.628  1.00 0.29  ? 84  ILE A O    3  
ATOM 7889  C CB   . ILE A 1 84  ? 3.415   -1.726  -0.891  1.00 0.29  ? 84  ILE A CB   3  
ATOM 7890  C CG1  . ILE A 1 84  ? 4.351   -1.571  0.312   1.00 0.55  ? 84  ILE A CG1  3  
ATOM 7891  C CG2  . ILE A 1 84  ? 1.961   -1.708  -0.427  1.00 0.47  ? 84  ILE A CG2  3  
ATOM 7892  C CD1  . ILE A 1 84  ? 5.818   -1.506  -0.044  1.00 0.62  ? 84  ILE A CD1  3  
ATOM 7893  H H    . ILE A 1 84  ? 5.095   -1.853  -2.821  1.00 0.25  ? 84  ILE A H    3  
ATOM 7894  H HA   . ILE A 1 84  ? 4.204   -3.722  -0.991  1.00 0.28  ? 84  ILE A HA   3  
ATOM 7895  H HB   . ILE A 1 84  ? 3.568   -0.886  -1.557  1.00 0.29  ? 84  ILE A HB   3  
ATOM 7896  H HG12 . ILE A 1 84  ? 4.101   -0.660  0.833   1.00 1.22  ? 84  ILE A HG12 3  
ATOM 7897  H HG13 . ILE A 1 84  ? 4.208   -2.410  0.979   1.00 1.29  ? 84  ILE A HG13 3  
ATOM 7898  H HG21 . ILE A 1 84  ? 1.772   -2.569  0.201   1.00 1.12  ? 84  ILE A HG21 3  
ATOM 7899  H HG22 . ILE A 1 84  ? 1.309   -1.739  -1.286  1.00 1.09  ? 84  ILE A HG22 3  
ATOM 7900  H HG23 . ILE A 1 84  ? 1.775   -0.805  0.135   1.00 1.17  ? 84  ILE A HG23 3  
ATOM 7901  H HD11 . ILE A 1 84  ? 6.107   -2.415  -0.550  1.00 1.22  ? 84  ILE A HD11 3  
ATOM 7902  H HD12 . ILE A 1 84  ? 6.404   -1.393  0.856   1.00 1.15  ? 84  ILE A HD12 3  
ATOM 7903  H HD13 . ILE A 1 84  ? 5.994   -0.661  -0.695  1.00 1.31  ? 84  ILE A HD13 3  
ATOM 7904  N N    . GLY A 1 85  ? 2.150   -3.265  -3.477  1.00 0.26  ? 85  GLY A N    3  
ATOM 7905  C CA   . GLY A 1 85  ? 1.065   -3.894  -4.185  1.00 0.29  ? 85  GLY A CA   3  
ATOM 7906  C C    . GLY A 1 85  ? 1.318   -5.371  -4.396  1.00 0.29  ? 85  GLY A C    3  
ATOM 7907  O O    . GLY A 1 85  ? 0.513   -6.198  -3.988  1.00 0.33  ? 85  GLY A O    3  
ATOM 7908  H H    . GLY A 1 85  ? 2.638   -2.530  -3.898  1.00 0.25  ? 85  GLY A H    3  
ATOM 7909  H HA2  . GLY A 1 85  ? 0.156   -3.769  -3.618  1.00 0.33  ? 85  GLY A HA2  3  
ATOM 7910  H HA3  . GLY A 1 85  ? 0.949   -3.419  -5.147  1.00 0.31  ? 85  GLY A HA3  3  
ATOM 7911  N N    . GLY A 1 86  ? 2.473   -5.706  -4.964  1.00 0.28  ? 86  GLY A N    3  
ATOM 7912  C CA   . GLY A 1 86  ? 2.764   -7.091  -5.294  1.00 0.31  ? 86  GLY A CA   3  
ATOM 7913  C C    . GLY A 1 86  ? 2.958   -7.925  -4.049  1.00 0.29  ? 86  GLY A C    3  
ATOM 7914  O O    . GLY A 1 86  ? 2.666   -9.122  -4.028  1.00 0.35  ? 86  GLY A O    3  
ATOM 7915  H H    . GLY A 1 86  ? 3.153   -5.014  -5.116  1.00 0.28  ? 86  GLY A H    3  
ATOM 7916  H HA2  . GLY A 1 86  ? 1.943   -7.496  -5.869  1.00 0.34  ? 86  GLY A HA2  3  
ATOM 7917  H HA3  . GLY A 1 86  ? 3.664   -7.130  -5.888  1.00 0.33  ? 86  GLY A HA3  3  
ATOM 7918  N N    . LEU A 1 87  ? 3.443   -7.270  -3.013  1.00 0.25  ? 87  LEU A N    3  
ATOM 7919  C CA   . LEU A 1 87  ? 3.623   -7.884  -1.711  1.00 0.25  ? 87  LEU A CA   3  
ATOM 7920  C C    . LEU A 1 87  ? 2.276   -8.204  -1.099  1.00 0.26  ? 87  LEU A C    3  
ATOM 7921  O O    . LEU A 1 87  ? 1.971   -9.359  -0.789  1.00 0.29  ? 87  LEU A O    3  
ATOM 7922  C CB   . LEU A 1 87  ? 4.358   -6.919  -0.791  1.00 0.25  ? 87  LEU A CB   3  
ATOM 7923  C CG   . LEU A 1 87  ? 5.863   -6.802  -0.996  1.00 0.26  ? 87  LEU A CG   3  
ATOM 7924  C CD1  . LEU A 1 87  ? 6.384   -5.600  -0.234  1.00 0.26  ? 87  LEU A CD1  3  
ATOM 7925  C CD2  . LEU A 1 87  ? 6.571   -8.066  -0.529  1.00 0.35  ? 87  LEU A CD2  3  
ATOM 7926  H H    . LEU A 1 87  ? 3.679   -6.323  -3.129  1.00 0.26  ? 87  LEU A H    3  
ATOM 7927  H HA   . LEU A 1 87  ? 4.198   -8.788  -1.826  1.00 0.28  ? 87  LEU A HA   3  
ATOM 7928  H HB2  . LEU A 1 87  ? 3.927   -5.938  -0.940  1.00 0.25  ? 87  LEU A HB2  3  
ATOM 7929  H HB3  . LEU A 1 87  ? 4.178   -7.221  0.229   1.00 0.28  ? 87  LEU A HB3  3  
ATOM 7930  H HG   . LEU A 1 87  ? 6.076   -6.658  -2.045  1.00 0.25  ? 87  LEU A HG   3  
ATOM 7931  H HD11 . LEU A 1 87  ? 5.862   -4.713  -0.558  1.00 1.02  ? 87  LEU A HD11 3  
ATOM 7932  H HD12 . LEU A 1 87  ? 7.439   -5.485  -0.426  1.00 1.05  ? 87  LEU A HD12 3  
ATOM 7933  H HD13 . LEU A 1 87  ? 6.223   -5.747  0.823   1.00 1.06  ? 87  LEU A HD13 3  
ATOM 7934  H HD21 . LEU A 1 87  ? 6.371   -8.224  0.522   1.00 0.97  ? 87  LEU A HD21 3  
ATOM 7935  H HD22 . LEU A 1 87  ? 7.634   -7.961  -0.679  1.00 1.10  ? 87  LEU A HD22 3  
ATOM 7936  H HD23 . LEU A 1 87  ? 6.210   -8.913  -1.094  1.00 1.13  ? 87  LEU A HD23 3  
ATOM 7937  N N    . ALA A 1 88  ? 1.470   -7.162  -0.946  1.00 0.25  ? 88  ALA A N    3  
ATOM 7938  C CA   . ALA A 1 88  ? 0.156   -7.277  -0.344  1.00 0.27  ? 88  ALA A CA   3  
ATOM 7939  C C    . ALA A 1 88  ? -0.690  -8.267  -1.091  1.00 0.30  ? 88  ALA A C    3  
ATOM 7940  O O    . ALA A 1 88  ? -1.408  -9.052  -0.497  1.00 0.35  ? 88  ALA A O    3  
ATOM 7941  C CB   . ALA A 1 88  ? -0.554  -5.946  -0.347  1.00 0.27  ? 88  ALA A CB   3  
ATOM 7942  H H    . ALA A 1 88  ? 1.773   -6.277  -1.254  1.00 0.26  ? 88  ALA A H    3  
ATOM 7943  H HA   . ALA A 1 88  ? 0.278   -7.602  0.677   1.00 0.29  ? 88  ALA A HA   3  
ATOM 7944  H HB1  . ALA A 1 88  ? -1.372  -5.975  0.355   1.00 1.06  ? 88  ALA A HB1  3  
ATOM 7945  H HB2  . ALA A 1 88  ? -0.946  -5.765  -1.343  1.00 1.04  ? 88  ALA A HB2  3  
ATOM 7946  H HB3  . ALA A 1 88  ? 0.136   -5.162  -0.078  1.00 1.06  ? 88  ALA A HB3  3  
ATOM 7947  N N    . MET A 1 89  ? -0.606  -8.201  -2.401  1.00 0.29  ? 89  MET A N    3  
ATOM 7948  C CA   . MET A 1 89  ? -1.375  -9.071  -3.258  1.00 0.33  ? 89  MET A CA   3  
ATOM 7949  C C    . MET A 1 89  ? -1.014  -10.526 -3.019  1.00 0.34  ? 89  MET A C    3  
ATOM 7950  O O    . MET A 1 89  ? -1.884  -11.389 -2.994  1.00 0.39  ? 89  MET A O    3  
ATOM 7951  C CB   . MET A 1 89  ? -1.150  -8.698  -4.714  1.00 0.35  ? 89  MET A CB   3  
ATOM 7952  C CG   . MET A 1 89  ? -1.817  -7.395  -5.109  1.00 0.42  ? 89  MET A CG   3  
ATOM 7953  S SD   . MET A 1 89  ? -1.685  -7.064  -6.877  1.00 1.03  ? 89  MET A SD   3  
ATOM 7954  C CE   . MET A 1 89  ? -2.473  -8.520  -7.565  1.00 1.89  ? 89  MET A CE   3  
ATOM 7955  H H    . MET A 1 89  ? -0.008  -7.532  -2.810  1.00 0.28  ? 89  MET A H    3  
ATOM 7956  H HA   . MET A 1 89  ? -2.415  -8.925  -3.016  1.00 0.37  ? 89  MET A HA   3  
ATOM 7957  H HB2  . MET A 1 89  ? -0.084  -8.593  -4.883  1.00 0.32  ? 89  MET A HB2  3  
ATOM 7958  H HB3  . MET A 1 89  ? -1.534  -9.484  -5.342  1.00 0.39  ? 89  MET A HB3  3  
ATOM 7959  H HG2  . MET A 1 89  ? -2.859  -7.439  -4.826  1.00 0.56  ? 89  MET A HG2  3  
ATOM 7960  H HG3  . MET A 1 89  ? -1.333  -6.585  -4.570  1.00 0.43  ? 89  MET A HG3  3  
ATOM 7961  H HE1  . MET A 1 89  ? -3.473  -8.610  -7.168  1.00 2.52  ? 89  MET A HE1  3  
ATOM 7962  H HE2  . MET A 1 89  ? -1.901  -9.396  -7.304  1.00 2.34  ? 89  MET A HE2  3  
ATOM 7963  H HE3  . MET A 1 89  ? -2.520  -8.429  -8.639  1.00 2.22  ? 89  MET A HE3  3  
ATOM 7964  N N    . ALA A 1 90  ? 0.267   -10.786 -2.807  1.00 0.34  ? 90  ALA A N    3  
ATOM 7965  C CA   . ALA A 1 90  ? 0.738   -12.137 -2.564  1.00 0.40  ? 90  ALA A CA   3  
ATOM 7966  C C    . ALA A 1 90  ? 0.282   -12.618 -1.193  1.00 0.42  ? 90  ALA A C    3  
ATOM 7967  O O    . ALA A 1 90  ? -0.148  -13.759 -1.029  1.00 0.49  ? 90  ALA A O    3  
ATOM 7968  C CB   . ALA A 1 90  ? 2.250   -12.191 -2.677  1.00 0.46  ? 90  ALA A CB   3  
ATOM 7969  H H    . ALA A 1 90  ? 0.913   -10.044 -2.801  1.00 0.32  ? 90  ALA A H    3  
ATOM 7970  H HA   . ALA A 1 90  ? 0.316   -12.782 -3.323  1.00 0.42  ? 90  ALA A HA   3  
ATOM 7971  H HB1  . ALA A 1 90  ? 2.551   -11.803 -3.641  1.00 1.20  ? 90  ALA A HB1  3  
ATOM 7972  H HB2  . ALA A 1 90  ? 2.584   -13.212 -2.578  1.00 1.13  ? 90  ALA A HB2  3  
ATOM 7973  H HB3  . ALA A 1 90  ? 2.689   -11.590 -1.895  1.00 1.03  ? 90  ALA A HB3  3  
ATOM 7974  N N    . CYS A 1 91  ? 0.357   -11.726 -0.216  1.00 0.41  ? 91  CYS A N    3  
ATOM 7975  C CA   . CYS A 1 91  ? -0.041  -12.037 1.150   1.00 0.47  ? 91  CYS A CA   3  
ATOM 7976  C C    . CYS A 1 91  ? -1.558  -12.169 1.253   1.00 0.45  ? 91  CYS A C    3  
ATOM 7977  O O    . CYS A 1 91  ? -2.071  -12.980 2.017   1.00 0.51  ? 91  CYS A O    3  
ATOM 7978  C CB   . CYS A 1 91  ? 0.472   -10.947 2.094   1.00 0.55  ? 91  CYS A CB   3  
ATOM 7979  S SG   . CYS A 1 91  ? 2.260   -10.693 2.006   1.00 1.76  ? 91  CYS A SG   3  
ATOM 7980  H H    . CYS A 1 91  ? 0.695   -10.826 -0.419  1.00 0.40  ? 91  CYS A H    3  
ATOM 7981  H HA   . CYS A 1 91  ? 0.407   -12.981 1.419   1.00 0.53  ? 91  CYS A HA   3  
ATOM 7982  H HB2  . CYS A 1 91  ? -0.002  -10.009 1.843   1.00 1.09  ? 91  CYS A HB2  3  
ATOM 7983  H HB3  . CYS A 1 91  ? 0.226   -11.212 3.112   1.00 0.94  ? 91  CYS A HB3  3  
ATOM 7984  H HG   . CYS A 1 91  ? 2.531   -10.114 0.842   1.00 2.29  ? 91  CYS A HG   3  
ATOM 7985  N N    . HIS A 1 92  ? -2.267  -11.378 0.464   1.00 0.41  ? 92  HIS A N    3  
ATOM 7986  C CA   . HIS A 1 92  ? -3.719  -11.430 0.418   1.00 0.46  ? 92  HIS A CA   3  
ATOM 7987  C C    . HIS A 1 92  ? -4.155  -12.699 -0.283  1.00 0.45  ? 92  HIS A C    3  
ATOM 7988  O O    . HIS A 1 92  ? -5.066  -13.384 0.167   1.00 0.49  ? 92  HIS A O    3  
ATOM 7989  C CB   . HIS A 1 92  ? -4.273  -10.206 -0.315  1.00 0.54  ? 92  HIS A CB   3  
ATOM 7990  C CG   . HIS A 1 92  ? -5.766  -10.102 -0.297  1.00 1.21  ? 92  HIS A CG   3  
ATOM 7991  N ND1  . HIS A 1 92  ? -6.539  -10.150 -1.434  1.00 2.13  ? 92  HIS A ND1  3  
ATOM 7992  C CD2  . HIS A 1 92  ? -6.626  -9.926  0.732   1.00 1.96  ? 92  HIS A CD2  3  
ATOM 7993  C CE1  . HIS A 1 92  ? -7.808  -10.004 -1.108  1.00 2.74  ? 92  HIS A CE1  3  
ATOM 7994  N NE2  . HIS A 1 92  ? -7.889  -9.868  0.202   1.00 2.62  ? 92  HIS A NE2  3  
ATOM 7995  H H    . HIS A 1 92  ? -1.794  -10.730 -0.106  1.00 0.40  ? 92  HIS A H    3  
ATOM 7996  H HA   . HIS A 1 92  ? -4.090  -11.439 1.432   1.00 0.53  ? 92  HIS A HA   3  
ATOM 7997  H HB2  . HIS A 1 92  ? -3.876  -9.313  0.142   1.00 1.06  ? 92  HIS A HB2  3  
ATOM 7998  H HB3  . HIS A 1 92  ? -3.956  -10.244 -1.348  1.00 0.91  ? 92  HIS A HB3  3  
ATOM 7999  H HD1  . HIS A 1 92  ? -6.205  -10.273 -2.353  1.00 2.63  ? 92  HIS A HD1  3  
ATOM 8000  H HD2  . HIS A 1 92  ? -6.365  -9.846  1.775   1.00 2.49  ? 92  HIS A HD2  3  
ATOM 8001  H HE1  . HIS A 1 92  ? -8.639  -9.996  -1.795  1.00 3.56  ? 92  HIS A HE1  3  
ATOM 8002  H HE2  . HIS A 1 92  ? -8.725  -9.936  0.726   1.00 3.27  ? 92  HIS A HE2  3  
ATOM 8003  N N    . ASP A 1 93  ? -3.482  -13.004 -1.381  1.00 0.45  ? 93  ASP A N    3  
ATOM 8004  C CA   . ASP A 1 93  ? -3.706  -14.244 -2.107  1.00 0.52  ? 93  ASP A CA   3  
ATOM 8005  C C    . ASP A 1 93  ? -3.467  -15.430 -1.177  1.00 0.56  ? 93  ASP A C    3  
ATOM 8006  O O    . ASP A 1 93  ? -4.176  -16.430 -1.226  1.00 0.65  ? 93  ASP A O    3  
ATOM 8007  C CB   . ASP A 1 93  ? -2.770  -14.303 -3.318  1.00 0.54  ? 93  ASP A CB   3  
ATOM 8008  C CG   . ASP A 1 93  ? -3.010  -15.512 -4.202  1.00 0.93  ? 93  ASP A CG   3  
ATOM 8009  O OD1  . ASP A 1 93  ? -4.012  -15.519 -4.952  1.00 1.48  ? 93  ASP A OD1  3  
ATOM 8010  O OD2  . ASP A 1 93  ? -2.185  -16.450 -4.171  1.00 1.75  ? 93  ASP A OD2  3  
ATOM 8011  H H    . ASP A 1 93  ? -2.814  -12.367 -1.726  1.00 0.44  ? 93  ASP A H    3  
ATOM 8012  H HA   . ASP A 1 93  ? -4.732  -14.257 -2.443  1.00 0.56  ? 93  ASP A HA   3  
ATOM 8013  H HB2  . ASP A 1 93  ? -2.909  -13.409 -3.914  1.00 0.94  ? 93  ASP A HB2  3  
ATOM 8014  H HB3  . ASP A 1 93  ? -1.748  -14.336 -2.969  1.00 0.78  ? 93  ASP A HB3  3  
ATOM 8015  N N    . SER A 1 94  ? -2.482  -15.277 -0.300  1.00 0.54  ? 94  SER A N    3  
ATOM 8016  C CA   . SER A 1 94  ? -2.174  -16.281 0.708   1.00 0.60  ? 94  SER A CA   3  
ATOM 8017  C C    . SER A 1 94  ? -3.279  -16.353 1.753   1.00 0.63  ? 94  SER A C    3  
ATOM 8018  O O    . SER A 1 94  ? -3.689  -17.435 2.157   1.00 0.70  ? 94  SER A O    3  
ATOM 8019  C CB   . SER A 1 94  ? -0.855  -15.942 1.393   1.00 0.65  ? 94  SER A CB   3  
ATOM 8020  O OG   . SER A 1 94  ? 0.215   -15.919 0.460   1.00 1.27  ? 94  SER A OG   3  
ATOM 8021  H H    . SER A 1 94  ? -1.949  -14.458 -0.328  1.00 0.52  ? 94  SER A H    3  
ATOM 8022  H HA   . SER A 1 94  ? -2.084  -17.238 0.219   1.00 0.65  ? 94  SER A HA   3  
ATOM 8023  H HB2  . SER A 1 94  ? -0.940  -14.966 1.856   1.00 0.97  ? 94  SER A HB2  3  
ATOM 8024  H HB3  . SER A 1 94  ? -0.648  -16.681 2.150   1.00 1.04  ? 94  SER A HB3  3  
ATOM 8025  H HG   . SER A 1 94  ? 0.029   -15.259 -0.227  1.00 1.85  ? 94  SER A HG   3  
ATOM 8026  N N    . PHE A 1 95  ? -3.746  -15.186 2.180   1.00 0.60  ? 95  PHE A N    3  
ATOM 8027  C CA   . PHE A 1 95  ? -4.814  -15.078 3.164   1.00 0.66  ? 95  PHE A CA   3  
ATOM 8028  C C    . PHE A 1 95  ? -6.078  -15.748 2.640   1.00 0.72  ? 95  PHE A C    3  
ATOM 8029  O O    . PHE A 1 95  ? -6.805  -16.409 3.380   1.00 0.84  ? 95  PHE A O    3  
ATOM 8030  C CB   . PHE A 1 95  ? -5.079  -13.599 3.468   1.00 0.64  ? 95  PHE A CB   3  
ATOM 8031  C CG   . PHE A 1 95  ? -5.985  -13.355 4.642   1.00 0.78  ? 95  PHE A CG   3  
ATOM 8032  C CD1  . PHE A 1 95  ? -5.558  -13.634 5.931   1.00 1.30  ? 95  PHE A CD1  3  
ATOM 8033  C CD2  . PHE A 1 95  ? -7.254  -12.832 4.459   1.00 1.80  ? 95  PHE A CD2  3  
ATOM 8034  C CE1  . PHE A 1 95  ? -6.382  -13.399 7.015   1.00 1.76  ? 95  PHE A CE1  3  
ATOM 8035  C CE2  . PHE A 1 95  ? -8.083  -12.596 5.540   1.00 2.35  ? 95  PHE A CE2  3  
ATOM 8036  C CZ   . PHE A 1 95  ? -7.646  -12.879 6.819   1.00 2.08  ? 95  PHE A CZ   3  
ATOM 8037  H H    . PHE A 1 95  ? -3.345  -14.361 1.828   1.00 0.55  ? 95  PHE A H    3  
ATOM 8038  H HA   . PHE A 1 95  ? -4.496  -15.577 4.067   1.00 0.75  ? 95  PHE A HA   3  
ATOM 8039  H HB2  . PHE A 1 95  ? -4.138  -13.110 3.674   1.00 0.99  ? 95  PHE A HB2  3  
ATOM 8040  H HB3  . PHE A 1 95  ? -5.532  -13.141 2.600   1.00 0.98  ? 95  PHE A HB3  3  
ATOM 8041  H HD1  . PHE A 1 95  ? -4.570  -14.042 6.085   1.00 1.96  ? 95  PHE A HD1  3  
ATOM 8042  H HD2  . PHE A 1 95  ? -7.597  -12.610 3.460   1.00 2.46  ? 95  PHE A HD2  3  
ATOM 8043  H HE1  . PHE A 1 95  ? -6.037  -13.621 8.014   1.00 2.41  ? 95  PHE A HE1  3  
ATOM 8044  H HE2  . PHE A 1 95  ? -9.071  -12.191 5.385   1.00 3.27  ? 95  PHE A HE2  3  
ATOM 8045  H HZ   . PHE A 1 95  ? -8.292  -12.694 7.664   1.00 2.63  ? 95  PHE A HZ   3  
ATOM 8046  N N    . LEU A 1 96  ? -6.314  -15.584 1.345   1.00 0.69  ? 96  LEU A N    3  
ATOM 8047  C CA   . LEU A 1 96  ? -7.442  -16.209 0.671   1.00 0.81  ? 96  LEU A CA   3  
ATOM 8048  C C    . LEU A 1 96  ? -7.254  -17.721 0.595   1.00 0.90  ? 96  LEU A C    3  
ATOM 8049  O O    . LEU A 1 96  ? -8.216  -18.485 0.645   1.00 1.09  ? 96  LEU A O    3  
ATOM 8050  C CB   . LEU A 1 96  ? -7.604  -15.621 -0.735  1.00 0.83  ? 96  LEU A CB   3  
ATOM 8051  C CG   . LEU A 1 96  ? -8.488  -14.371 -0.845  1.00 0.87  ? 96  LEU A CG   3  
ATOM 8052  C CD1  . LEU A 1 96  ? -9.952  -14.734 -0.684  1.00 1.21  ? 96  LEU A CD1  3  
ATOM 8053  C CD2  . LEU A 1 96  ? -8.099  -13.323 0.187   1.00 1.08  ? 96  LEU A CD2  3  
ATOM 8054  H H    . LEU A 1 96  ? -5.708  -15.012 0.826   1.00 0.62  ? 96  LEU A H    3  
ATOM 8055  H HA   . LEU A 1 96  ? -8.328  -15.996 1.244   1.00 0.86  ? 96  LEU A HA   3  
ATOM 8056  H HB2  . LEU A 1 96  ? -6.622  -15.369 -1.106  1.00 0.76  ? 96  LEU A HB2  3  
ATOM 8057  H HB3  . LEU A 1 96  ? -8.020  -16.384 -1.373  1.00 0.93  ? 96  LEU A HB3  3  
ATOM 8058  H HG   . LEU A 1 96  ? -8.358  -13.936 -1.823  1.00 0.92  ? 96  LEU A HG   3  
ATOM 8059  H HD11 . LEU A 1 96  ? -10.555 -13.844 -0.774  1.00 1.70  ? 96  LEU A HD11 3  
ATOM 8060  H HD12 . LEU A 1 96  ? -10.108 -15.177 0.286   1.00 1.64  ? 96  LEU A HD12 3  
ATOM 8061  H HD13 . LEU A 1 96  ? -10.234 -15.439 -1.451  1.00 1.64  ? 96  LEU A HD13 3  
ATOM 8062  H HD21 . LEU A 1 96  ? -8.763  -12.475 0.108   1.00 1.68  ? 96  LEU A HD21 3  
ATOM 8063  H HD22 . LEU A 1 96  ? -7.082  -13.003 0.006   1.00 1.41  ? 96  LEU A HD22 3  
ATOM 8064  H HD23 . LEU A 1 96  ? -8.171  -13.748 1.177   1.00 1.51  ? 96  LEU A HD23 3  
ATOM 8065  N N    . LYS A 1 97  ? -6.003  -18.142 0.493   1.00 0.83  ? 97  LYS A N    3  
ATOM 8066  C CA   . LYS A 1 97  ? -5.664  -19.557 0.461   1.00 0.93  ? 97  LYS A CA   3  
ATOM 8067  C C    . LYS A 1 97  ? -5.415  -20.082 1.871   1.00 0.97  ? 97  LYS A C    3  
ATOM 8068  O O    . LYS A 1 97  ? -4.916  -21.191 2.054   1.00 1.12  ? 97  LYS A O    3  
ATOM 8069  C CB   . LYS A 1 97  ? -4.426  -19.782 -0.406  1.00 0.93  ? 97  LYS A CB   3  
ATOM 8070  C CG   . LYS A 1 97  ? -4.638  -19.430 -1.869  1.00 0.99  ? 97  LYS A CG   3  
ATOM 8071  C CD   . LYS A 1 97  ? -3.354  -19.564 -2.673  1.00 1.25  ? 97  LYS A CD   3  
ATOM 8072  C CE   . LYS A 1 97  ? -2.219  -18.770 -2.049  1.00 2.06  ? 97  LYS A CE   3  
ATOM 8073  N NZ   . LYS A 1 97  ? -1.071  -18.614 -2.980  1.00 2.65  ? 97  LYS A NZ   3  
ATOM 8074  H H    . LYS A 1 97  ? -5.281  -17.479 0.433   1.00 0.75  ? 97  LYS A H    3  
ATOM 8075  H HA   . LYS A 1 97  ? -6.496  -20.090 0.029   1.00 1.01  ? 97  LYS A HA   3  
ATOM 8076  H HB2  . LYS A 1 97  ? -3.619  -19.172 -0.025  1.00 0.89  ? 97  LYS A HB2  3  
ATOM 8077  H HB3  . LYS A 1 97  ? -4.138  -20.818 -0.344  1.00 1.04  ? 97  LYS A HB3  3  
ATOM 8078  H HG2  . LYS A 1 97  ? -5.380  -20.096 -2.285  1.00 1.50  ? 97  LYS A HG2  3  
ATOM 8079  H HG3  . LYS A 1 97  ? -4.990  -18.411 -1.935  1.00 1.64  ? 97  LYS A HG3  3  
ATOM 8080  H HD2  . LYS A 1 97  ? -3.072  -20.605 -2.711  1.00 1.86  ? 97  LYS A HD2  3  
ATOM 8081  H HD3  . LYS A 1 97  ? -3.529  -19.199 -3.674  1.00 1.74  ? 97  LYS A HD3  3  
ATOM 8082  H HE2  . LYS A 1 97  ? -2.589  -17.793 -1.779  1.00 2.59  ? 97  LYS A HE2  3  
ATOM 8083  H HE3  . LYS A 1 97  ? -1.884  -19.285 -1.160  1.00 2.52  ? 97  LYS A HE3  3  
ATOM 8084  H HZ1  . LYS A 1 97  ? -0.262  -18.186 -2.487  1.00 3.00  ? 97  LYS A HZ1  3  
ATOM 8085  H HZ2  . LYS A 1 97  ? -1.340  -17.994 -3.774  1.00 2.88  ? 97  LYS A HZ2  3  
ATOM 8086  H HZ3  . LYS A 1 97  ? -0.783  -19.539 -3.357  1.00 3.15  ? 97  LYS A HZ3  3  
ATOM 8087  N N    . ALA A 1 98  ? -5.755  -19.272 2.863   1.00 0.99  ? 98  ALA A N    3  
ATOM 8088  C CA   . ALA A 1 98  ? -5.567  -19.646 4.254   1.00 1.06  ? 98  ALA A CA   3  
ATOM 8089  C C    . ALA A 1 98  ? -6.893  -19.622 5.000   1.00 1.09  ? 98  ALA A C    3  
ATOM 8090  O O    . ALA A 1 98  ? -7.458  -20.668 5.323   1.00 1.23  ? 98  ALA A O    3  
ATOM 8091  C CB   . ALA A 1 98  ? -4.560  -18.719 4.924   1.00 1.00  ? 98  ALA A CB   3  
ATOM 8092  H H    . ALA A 1 98  ? -6.148  -18.398 2.652   1.00 1.04  ? 98  ALA A H    3  
ATOM 8093  H HA   . ALA A 1 98  ? -5.169  -20.649 4.277   1.00 1.17  ? 98  ALA A HA   3  
ATOM 8094  H HB1  . ALA A 1 98  ? -3.636  -18.728 4.367   1.00 1.37  ? 98  ALA A HB1  3  
ATOM 8095  H HB2  . ALA A 1 98  ? -4.376  -19.056 5.933   1.00 1.46  ? 98  ALA A HB2  3  
ATOM 8096  H HB3  . ALA A 1 98  ? -4.956  -17.713 4.945   1.00 1.42  ? 98  ALA A HB3  3  
ATOM 8097  N N    . VAL A 1 99  ? -7.396  -18.421 5.243   1.00 1.00  ? 99  VAL A N    3  
ATOM 8098  C CA   . VAL A 1 99  ? -8.653  -18.235 5.949   1.00 1.06  ? 99  VAL A CA   3  
ATOM 8099  C C    . VAL A 1 99  ? -9.098  -16.768 5.866   1.00 1.00  ? 99  VAL A C    3  
ATOM 8100  O O    . VAL A 1 99  ? -8.861  -15.957 6.763   1.00 1.01  ? 99  VAL A O    3  
ATOM 8101  C CB   . VAL A 1 99  ? -8.569  -18.713 7.421   1.00 1.16  ? 99  VAL A CB   3  
ATOM 8102  C CG1  . VAL A 1 99  ? -7.429  -18.033 8.163   1.00 1.13  ? 99  VAL A CG1  3  
ATOM 8103  C CG2  . VAL A 1 99  ? -9.897  -18.494 8.130   1.00 1.24  ? 99  VAL A CG2  3  
ATOM 8104  H H    . VAL A 1 99  ? -6.915  -17.626 4.919   1.00 0.92  ? 99  VAL A H    3  
ATOM 8105  H HA   . VAL A 1 99  ? -9.395  -18.839 5.444   1.00 1.12  ? 99  VAL A HA   3  
ATOM 8106  H HB   . VAL A 1 99  ? -8.367  -19.775 7.412   1.00 1.24  ? 99  VAL A HB   3  
ATOM 8107  H HG11 . VAL A 1 99  ? -6.492  -18.281 7.688   1.00 1.64  ? 99  VAL A HG11 3  
ATOM 8108  H HG12 . VAL A 1 99  ? -7.416  -18.367 9.189   1.00 1.48  ? 99  VAL A HG12 3  
ATOM 8109  H HG13 . VAL A 1 99  ? -7.573  -16.962 8.134   1.00 1.41  ? 99  VAL A HG13 3  
ATOM 8110  H HG21 . VAL A 1 99  ? -10.672 -19.042 7.615   1.00 1.52  ? 99  VAL A HG21 3  
ATOM 8111  H HG22 . VAL A 1 99  ? -10.136 -17.441 8.123   1.00 1.65  ? 99  VAL A HG22 3  
ATOM 8112  H HG23 . VAL A 1 99  ? -9.824  -18.842 9.150   1.00 1.63  ? 99  VAL A HG23 3  
ATOM 8113  N N    . PRO A 1 100 ? -9.746  -16.413 4.759   1.00 1.00  ? 100 PRO A N    3  
ATOM 8114  C CA   . PRO A 1 100 ? -10.175 -15.049 4.490   1.00 1.02  ? 100 PRO A CA   3  
ATOM 8115  C C    . PRO A 1 100 ? -11.562 -14.766 5.040   1.00 1.28  ? 100 PRO A C    3  
ATOM 8116  O O    . PRO A 1 100 ? -12.069 -13.648 4.943   1.00 1.60  ? 100 PRO A O    3  
ATOM 8117  C CB   . PRO A 1 100 ? -10.161 -15.007 2.967   1.00 1.04  ? 100 PRO A CB   3  
ATOM 8118  C CG   . PRO A 1 100 ? -10.540 -16.395 2.551   1.00 1.03  ? 100 PRO A CG   3  
ATOM 8119  C CD   . PRO A 1 100 ? -10.111 -17.321 3.666   1.00 1.06  ? 100 PRO A CD   3  
ATOM 8120  H HA   . PRO A 1 100 ? -9.480  -14.325 4.885   1.00 0.95  ? 100 PRO A HA   3  
ATOM 8121  H HB2  . PRO A 1 100 ? -10.873 -14.274 2.616   1.00 1.23  ? 100 PRO A HB2  3  
ATOM 8122  H HB3  . PRO A 1 100 ? -9.169  -14.751 2.624   1.00 1.05  ? 100 PRO A HB3  3  
ATOM 8123  H HG2  . PRO A 1 100 ? -11.608 -16.453 2.411   1.00 1.10  ? 100 PRO A HG2  3  
ATOM 8124  H HG3  . PRO A 1 100 ? -10.031 -16.655 1.636   1.00 1.03  ? 100 PRO A HG3  3  
ATOM 8125  H HD2  . PRO A 1 100 ? -10.929 -17.960 3.961   1.00 1.19  ? 100 PRO A HD2  3  
ATOM 8126  H HD3  . PRO A 1 100 ? -9.261  -17.914 3.365   1.00 1.04  ? 100 PRO A HD3  3  
ATOM 8127  N N    . SER A 1 101 ? -12.161 -15.785 5.631   1.00 1.57  ? 101 SER A N    3  
ATOM 8128  C CA   . SER A 1 101 ? -13.457 -15.649 6.264   1.00 1.88  ? 101 SER A CA   3  
ATOM 8129  C C    . SER A 1 101 ? -13.286 -15.166 7.699   1.00 1.62  ? 101 SER A C    3  
ATOM 8130  O O    . SER A 1 101 ? -13.753 -15.803 8.639   1.00 1.94  ? 101 SER A O    3  
ATOM 8131  C CB   . SER A 1 101 ? -14.196 -16.987 6.231   1.00 2.76  ? 101 SER A CB   3  
ATOM 8132  O OG   . SER A 1 101 ? -14.375 -17.439 4.896   1.00 3.39  ? 101 SER A OG   3  
ATOM 8133  H H    . SER A 1 101 ? -11.714 -16.655 5.645   1.00 1.80  ? 101 SER A H    3  
ATOM 8134  H HA   . SER A 1 101 ? -14.024 -14.915 5.710   1.00 2.06  ? 101 SER A HA   3  
ATOM 8135  H HB2  . SER A 1 101 ? -13.624 -17.725 6.774   1.00 3.14  ? 101 SER A HB2  3  
ATOM 8136  H HB3  . SER A 1 101 ? -15.165 -16.872 6.692   1.00 3.02  ? 101 SER A HB3  3  
ATOM 8137  H HG   . SER A 1 101 ? -13.756 -18.159 4.714   1.00 3.74  ? 101 SER A HG   3  
ATOM 8138  N N    . GLN A 1 102 ? -12.586 -14.050 7.862   1.00 1.61  ? 102 GLN A N    3  
ATOM 8139  C CA   . GLN A 1 102 ? -12.381 -13.473 9.182   1.00 2.12  ? 102 GLN A CA   3  
ATOM 8140  C C    . GLN A 1 102 ? -13.710 -13.027 9.788   1.00 2.74  ? 102 GLN A C    3  
ATOM 8141  O O    . GLN A 1 102 ? -14.516 -12.373 9.123   1.00 3.39  ? 102 GLN A O    3  
ATOM 8142  C CB   . GLN A 1 102 ? -11.402 -12.293 9.121   1.00 2.47  ? 102 GLN A CB   3  
ATOM 8143  C CG   . GLN A 1 102 ? -11.773 -11.227 8.104   1.00 3.02  ? 102 GLN A CG   3  
ATOM 8144  C CD   . GLN A 1 102 ? -10.919 -9.980  8.239   1.00 3.87  ? 102 GLN A CD   3  
ATOM 8145  O OE1  . GLN A 1 102 ? -11.277 -9.045  8.956   1.00 4.45  ? 102 GLN A OE1  3  
ATOM 8146  N NE2  . GLN A 1 102 ? -9.779  -9.964  7.567   1.00 4.44  ? 102 GLN A NE2  3  
ATOM 8147  H H    . GLN A 1 102 ? -12.198 -13.609 7.075   1.00 1.67  ? 102 GLN A H    3  
ATOM 8148  H HA   . GLN A 1 102 ? -11.960 -14.242 9.812   1.00 2.52  ? 102 GLN A HA   3  
ATOM 8149  H HB2  . GLN A 1 102 ? -11.359 -11.829 10.095  1.00 2.90  ? 102 GLN A HB2  3  
ATOM 8150  H HB3  . GLN A 1 102 ? -10.421 -12.670 8.873   1.00 2.74  ? 102 GLN A HB3  3  
ATOM 8151  H HG2  . GLN A 1 102 ? -11.638 -11.630 7.111   1.00 3.38  ? 102 GLN A HG2  3  
ATOM 8152  H HG3  . GLN A 1 102 ? -12.808 -10.955 8.246   1.00 3.09  ? 102 GLN A HG3  3  
ATOM 8153  H HE21 . GLN A 1 102 ? -9.550  -10.746 7.024   1.00 4.34  ? 102 GLN A HE21 3  
ATOM 8154  H HE22 . GLN A 1 102 ? -9.209  -9.171  7.643   1.00 5.19  ? 102 GLN A HE22 3  
ATOM 8155  N N    . LYS A 1 103 ? -13.933 -13.420 11.041  1.00 3.15  ? 103 LYS A N    3  
ATOM 8156  C CA   . LYS A 1 103 ? -15.141 -13.057 11.781  1.00 4.06  ? 103 LYS A CA   3  
ATOM 8157  C C    . LYS A 1 103 ? -16.393 -13.601 11.094  1.00 4.57  ? 103 LYS A C    3  
ATOM 8158  O O    . LYS A 1 103 ? -17.402 -12.906 10.969  1.00 5.24  ? 103 LYS A O    3  
ATOM 8159  C CB   . LYS A 1 103 ? -15.242 -11.535 11.945  1.00 4.73  ? 103 LYS A CB   3  
ATOM 8160  C CG   . LYS A 1 103 ? -14.087 -10.918 12.721  1.00 5.30  ? 103 LYS A CG   3  
ATOM 8161  C CD   . LYS A 1 103 ? -14.007 -11.464 14.138  1.00 6.25  ? 103 LYS A CD   3  
ATOM 8162  C CE   . LYS A 1 103 ? -12.917 -10.775 14.940  1.00 6.82  ? 103 LYS A CE   3  
ATOM 8163  N NZ   . LYS A 1 103 ? -12.841 -11.296 16.330  1.00 7.43  ? 103 LYS A NZ   3  
ATOM 8164  H H    . LYS A 1 103 ? -13.264 -13.988 11.482  1.00 3.17  ? 103 LYS A H    3  
ATOM 8165  H HA   . LYS A 1 103 ? -15.068 -13.507 12.760  1.00 4.39  ? 103 LYS A HA   3  
ATOM 8166  H HB2  . LYS A 1 103 ? -15.270 -11.082 10.966  1.00 4.96  ? 103 LYS A HB2  3  
ATOM 8167  H HB3  . LYS A 1 103 ? -16.160 -11.305 12.464  1.00 5.08  ? 103 LYS A HB3  3  
ATOM 8168  H HG2  . LYS A 1 103 ? -13.163 -11.140 12.211  1.00 5.38  ? 103 LYS A HG2  3  
ATOM 8169  H HG3  . LYS A 1 103 ? -14.227 -9.848  12.766  1.00 5.39  ? 103 LYS A HG3  3  
ATOM 8170  H HD2  . LYS A 1 103 ? -14.954 -11.307 14.629  1.00 6.63  ? 103 LYS A HD2  3  
ATOM 8171  H HD3  . LYS A 1 103 ? -13.793 -12.522 14.094  1.00 6.48  ? 103 LYS A HD3  3  
ATOM 8172  H HE2  . LYS A 1 103 ? -11.970 -10.941 14.451  1.00 6.94  ? 103 LYS A HE2  3  
ATOM 8173  H HE3  . LYS A 1 103 ? -13.125 -9.716  14.971  1.00 7.02  ? 103 LYS A HE3  3  
ATOM 8174  H HZ1  . LYS A 1 103 ? -12.674 -12.323 16.320  1.00 7.62  ? 103 LYS A HZ1  3  
ATOM 8175  H HZ2  . LYS A 1 103 ? -13.730 -11.106 16.835  1.00 7.72  ? 103 LYS A HZ2  3  
ATOM 8176  H HZ3  . LYS A 1 103 ? -12.061 -10.835 16.840  1.00 7.66  ? 103 LYS A HZ3  3  
ATOM 8177  N N    . ARG A 1 104 ? -16.325 -14.852 10.656  1.00 4.68  ? 104 ARG A N    3  
ATOM 8178  C CA   . ARG A 1 104 ? -17.450 -15.478 9.970   1.00 5.53  ? 104 ARG A CA   3  
ATOM 8179  C C    . ARG A 1 104 ? -18.458 -16.052 10.960  1.00 5.66  ? 104 ARG A C    3  
ATOM 8180  O O    . ARG A 1 104 ? -19.553 -16.455 10.575  1.00 5.96  ? 104 ARG A O    3  
ATOM 8181  C CB   . ARG A 1 104 ? -16.964 -16.563 8.993   1.00 6.11  ? 104 ARG A CB   3  
ATOM 8182  C CG   . ARG A 1 104 ? -15.997 -17.583 9.591   1.00 6.81  ? 104 ARG A CG   3  
ATOM 8183  C CD   . ARG A 1 104 ? -16.699 -18.614 10.458  1.00 7.63  ? 104 ARG A CD   3  
ATOM 8184  N NE   . ARG A 1 104 ? -17.622 -19.447 9.692   1.00 8.13  ? 104 ARG A NE   3  
ATOM 8185  C CZ   . ARG A 1 104 ? -18.584 -20.190 10.237  1.00 8.95  ? 104 ARG A CZ   3  
ATOM 8186  N NH1  . ARG A 1 104 ? -18.780 -20.174 11.552  1.00 9.34  ? 104 ARG A NH1  3  
ATOM 8187  N NH2  . ARG A 1 104 ? -19.359 -20.942 9.466   1.00 9.59  ? 104 ARG A NH2  3  
ATOM 8188  H H    . ARG A 1 104 ? -15.495 -15.362 10.789  1.00 4.48  ? 104 ARG A H    3  
ATOM 8189  H HA   . ARG A 1 104 ? -17.944 -14.704 9.400   1.00 6.02  ? 104 ARG A HA   3  
ATOM 8190  H HB2  . ARG A 1 104 ? -17.824 -17.099 8.622   1.00 6.43  ? 104 ARG A HB2  3  
ATOM 8191  H HB3  . ARG A 1 104 ? -16.471 -16.080 8.162   1.00 6.10  ? 104 ARG A HB3  3  
ATOM 8192  H HG2  . ARG A 1 104 ? -15.494 -18.096 8.785   1.00 6.95  ? 104 ARG A HG2  3  
ATOM 8193  H HG3  . ARG A 1 104 ? -15.268 -17.059 10.190  1.00 6.93  ? 104 ARG A HG3  3  
ATOM 8194  H HD2  . ARG A 1 104 ? -15.955 -19.249 10.915  1.00 7.90  ? 104 ARG A HD2  3  
ATOM 8195  H HD3  . ARG A 1 104 ? -17.252 -18.099 11.230  1.00 7.87  ? 104 ARG A HD3  3  
ATOM 8196  H HE   . ARG A 1 104 ? -17.507 -19.462 8.714   1.00 8.02  ? 104 ARG A HE   3  
ATOM 8197  H HH11 . ARG A 1 104 ? -18.204 -19.597 12.146  1.00 9.05  ? 104 ARG A HH11 3  
ATOM 8198  H HH12 . ARG A 1 104 ? -19.505 -20.736 11.960  1.00 10.06 ? 104 ARG A HH12 3  
ATOM 8199  H HH21 . ARG A 1 104 ? -19.226 -20.952 8.472   1.00 9.50  ? 104 ARG A HH21 3  
ATOM 8200  H HH22 . ARG A 1 104 ? -20.079 -21.511 9.876   1.00 10.30 ? 104 ARG A HH22 3  
ATOM 8201  N N    . THR A 1 105 ? -18.080 -16.095 12.229  1.00 5.79  ? 105 THR A N    3  
ATOM 8202  C CA   . THR A 1 105 ? -18.964 -16.602 13.263  1.00 6.20  ? 105 THR A CA   3  
ATOM 8203  C C    . THR A 1 105 ? -19.568 -15.444 14.053  1.00 6.46  ? 105 THR A C    3  
ATOM 8204  O O    . THR A 1 105 ? -18.880 -14.898 14.942  1.00 6.80  ? 105 THR A O    3  
ATOM 8205  C CB   . THR A 1 105 ? -18.219 -17.556 14.218  1.00 6.59  ? 105 THR A CB   3  
ATOM 8206  O OG1  . THR A 1 105 ? -17.464 -18.512 13.459  1.00 6.66  ? 105 THR A OG1  3  
ATOM 8207  C CG2  . THR A 1 105 ? -19.193 -18.291 15.126  1.00 7.00  ? 105 THR A CG2  3  
ATOM 8208  O OXT  . THR A 1 105 ? -20.724 -15.069 13.766  1.00 6.62  ? 105 THR A OXT  3  
ATOM 8209  H H    . THR A 1 105 ? -17.190 -15.773 12.478  1.00 5.84  ? 105 THR A H    3  
ATOM 8210  H HA   . THR A 1 105 ? -19.761 -17.153 12.783  1.00 6.42  ? 105 THR A HA   3  
ATOM 8211  H HB   . THR A 1 105 ? -17.544 -16.977 14.831  1.00 6.92  ? 105 THR A HB   3  
ATOM 8212  H HG1  . THR A 1 105 ? -16.582 -18.594 13.844  1.00 6.49  ? 105 THR A HG1  3  
ATOM 8213  H HG21 . THR A 1 105 ? -18.645 -18.940 15.793  1.00 7.20  ? 105 THR A HG21 3  
ATOM 8214  H HG22 . THR A 1 105 ? -19.869 -18.882 14.525  1.00 7.26  ? 105 THR A HG22 3  
ATOM 8215  H HG23 . THR A 1 105 ? -19.758 -17.576 15.705  1.00 7.15  ? 105 THR A HG23 3  
ATOM 8216  N N    . MET B 1 1   ? 18.641  -17.685 12.080  1.00 7.64  ? 1   MET B N    3  
ATOM 8217  C CA   . MET B 1 1   ? 19.025  -16.611 13.026  1.00 7.05  ? 1   MET B CA   3  
ATOM 8218  C C    . MET B 1 1   ? 17.794  -16.043 13.720  1.00 6.85  ? 1   MET B C    3  
ATOM 8219  O O    . MET B 1 1   ? 17.257  -15.016 13.300  1.00 7.13  ? 1   MET B O    3  
ATOM 8220  C CB   . MET B 1 1   ? 19.784  -15.491 12.300  1.00 7.11  ? 1   MET B CB   3  
ATOM 8221  C CG   . MET B 1 1   ? 21.197  -15.870 11.876  1.00 7.39  ? 1   MET B CG   3  
ATOM 8222  S SD   . MET B 1 1   ? 21.245  -17.182 10.635  1.00 7.66  ? 1   MET B SD   3  
ATOM 8223  C CE   . MET B 1 1   ? 20.514  -16.350 9.226   1.00 7.91  ? 1   MET B CE   3  
ATOM 8224  H H1   . MET B 1 1   ? 18.175  -18.462 12.590  1.00 7.96  ? 1   MET B H1   3  
ATOM 8225  H H2   . MET B 1 1   ? 19.481  -18.059 11.598  1.00 7.75  ? 1   MET B H2   3  
ATOM 8226  H H3   . MET B 1 1   ? 17.981  -17.315 11.366  1.00 7.88  ? 1   MET B H3   3  
ATOM 8227  H HA   . MET B 1 1   ? 19.672  -17.043 13.775  1.00 7.07  ? 1   MET B HA   3  
ATOM 8228  H HB2  . MET B 1 1   ? 19.230  -15.215 11.415  1.00 7.26  ? 1   MET B HB2  3  
ATOM 8229  H HB3  . MET B 1 1   ? 19.846  -14.635 12.954  1.00 7.17  ? 1   MET B HB3  3  
ATOM 8230  H HG2  . MET B 1 1   ? 21.679  -14.995 11.466  1.00 7.57  ? 1   MET B HG2  3  
ATOM 8231  H HG3  . MET B 1 1   ? 21.741  -16.202 12.748  1.00 7.61  ? 1   MET B HG3  3  
ATOM 8232  H HE1  . MET B 1 1   ? 20.504  -17.018 8.379   1.00 8.15  ? 1   MET B HE1  3  
ATOM 8233  H HE2  . MET B 1 1   ? 21.095  -15.472 8.985   1.00 8.15  ? 1   MET B HE2  3  
ATOM 8234  H HE3  . MET B 1 1   ? 19.503  -16.057 9.465   1.00 7.91  ? 1   MET B HE3  3  
ATOM 8235  N N    . ALA B 1 2   ? 17.346  -16.736 14.770  1.00 6.68  ? 2   ALA B N    3  
ATOM 8236  C CA   . ALA B 1 2   ? 16.196  -16.312 15.568  1.00 6.74  ? 2   ALA B CA   3  
ATOM 8237  C C    . ALA B 1 2   ? 14.941  -16.156 14.711  1.00 6.15  ? 2   ALA B C    3  
ATOM 8238  O O    . ALA B 1 2   ? 14.565  -15.045 14.329  1.00 6.28  ? 2   ALA B O    3  
ATOM 8239  C CB   . ALA B 1 2   ? 16.505  -15.019 16.312  1.00 7.32  ? 2   ALA B CB   3  
ATOM 8240  H H    . ALA B 1 2   ? 17.803  -17.572 15.013  1.00 6.72  ? 2   ALA B H    3  
ATOM 8241  H HA   . ALA B 1 2   ? 16.012  -17.080 16.306  1.00 7.13  ? 2   ALA B HA   3  
ATOM 8242  H HB1  . ALA B 1 2   ? 17.396  -15.149 16.909  1.00 7.70  ? 2   ALA B HB1  3  
ATOM 8243  H HB2  . ALA B 1 2   ? 15.675  -14.765 16.953  1.00 7.47  ? 2   ALA B HB2  3  
ATOM 8244  H HB3  . ALA B 1 2   ? 16.663  -14.223 15.597  1.00 7.50  ? 2   ALA B HB3  3  
ATOM 8245  N N    . LYS B 1 3   ? 14.302  -17.277 14.408  1.00 5.79  ? 3   LYS B N    3  
ATOM 8246  C CA   . LYS B 1 3   ? 13.083  -17.272 13.608  1.00 5.53  ? 3   LYS B CA   3  
ATOM 8247  C C    . LYS B 1 3   ? 11.915  -16.708 14.410  1.00 5.00  ? 3   LYS B C    3  
ATOM 8248  O O    . LYS B 1 3   ? 11.661  -17.134 15.538  1.00 5.14  ? 3   LYS B O    3  
ATOM 8249  C CB   . LYS B 1 3   ? 12.753  -18.688 13.119  1.00 6.01  ? 3   LYS B CB   3  
ATOM 8250  C CG   . LYS B 1 3   ? 12.661  -19.721 14.234  1.00 6.28  ? 3   LYS B CG   3  
ATOM 8251  C CD   . LYS B 1 3   ? 12.282  -21.095 13.703  1.00 6.97  ? 3   LYS B CD   3  
ATOM 8252  C CE   . LYS B 1 3   ? 10.875  -21.109 13.128  1.00 7.46  ? 3   LYS B CE   3  
ATOM 8253  N NZ   . LYS B 1 3   ? 10.479  -22.462 12.655  1.00 7.93  ? 3   LYS B NZ   3  
ATOM 8254  H H    . LYS B 1 3   ? 14.656  -18.131 14.734  1.00 5.96  ? 3   LYS B H    3  
ATOM 8255  H HA   . LYS B 1 3   ? 13.254  -16.637 12.752  1.00 5.72  ? 3   LYS B HA   3  
ATOM 8256  H HB2  . LYS B 1 3   ? 11.806  -18.664 12.602  1.00 6.29  ? 3   LYS B HB2  3  
ATOM 8257  H HB3  . LYS B 1 3   ? 13.521  -19.005 12.429  1.00 6.28  ? 3   LYS B HB3  3  
ATOM 8258  H HG2  . LYS B 1 3   ? 13.619  -19.790 14.725  1.00 6.42  ? 3   LYS B HG2  3  
ATOM 8259  H HG3  . LYS B 1 3   ? 11.913  -19.401 14.945  1.00 6.22  ? 3   LYS B HG3  3  
ATOM 8260  H HD2  . LYS B 1 3   ? 12.977  -21.374 12.928  1.00 7.10  ? 3   LYS B HD2  3  
ATOM 8261  H HD3  . LYS B 1 3   ? 12.337  -21.810 14.511  1.00 7.33  ? 3   LYS B HD3  3  
ATOM 8262  H HE2  . LYS B 1 3   ? 10.182  -20.789 13.893  1.00 7.70  ? 3   LYS B HE2  3  
ATOM 8263  H HE3  . LYS B 1 3   ? 10.833  -20.421 12.297  1.00 7.56  ? 3   LYS B HE3  3  
ATOM 8264  H HZ1  . LYS B 1 3   ? 10.500  -23.139 13.443  1.00 7.98  ? 3   LYS B HZ1  3  
ATOM 8265  H HZ2  . LYS B 1 3   ? 11.134  -22.788 11.917  1.00 8.25  ? 3   LYS B HZ2  3  
ATOM 8266  H HZ3  . LYS B 1 3   ? 9.517   -22.435 12.257  1.00 8.16  ? 3   LYS B HZ3  3  
ATOM 8267  N N    . ILE B 1 4   ? 11.220  -15.740 13.835  1.00 4.75  ? 4   ILE B N    3  
ATOM 8268  C CA   . ILE B 1 4   ? 10.067  -15.135 14.488  1.00 4.41  ? 4   ILE B CA   3  
ATOM 8269  C C    . ILE B 1 4   ? 8.943   -14.931 13.482  1.00 3.66  ? 4   ILE B C    3  
ATOM 8270  O O    . ILE B 1 4   ? 9.162   -15.007 12.274  1.00 3.91  ? 4   ILE B O    3  
ATOM 8271  C CB   . ILE B 1 4   ? 10.389  -13.770 15.160  1.00 5.15  ? 4   ILE B CB   3  
ATOM 8272  C CG1  . ILE B 1 4   ? 10.764  -12.693 14.125  1.00 5.78  ? 4   ILE B CG1  3  
ATOM 8273  C CG2  . ILE B 1 4   ? 11.495  -13.924 16.197  1.00 5.59  ? 4   ILE B CG2  3  
ATOM 8274  C CD1  . ILE B 1 4   ? 12.160  -12.825 13.546  1.00 6.54  ? 4   ILE B CD1  3  
ATOM 8275  H H    . ILE B 1 4   ? 11.480  -15.427 12.942  1.00 5.02  ? 4   ILE B H    3  
ATOM 8276  H HA   . ILE B 1 4   ? 9.725   -15.817 15.254  1.00 4.58  ? 4   ILE B HA   3  
ATOM 8277  H HB   . ILE B 1 4   ? 9.500   -13.448 15.683  1.00 5.38  ? 4   ILE B HB   3  
ATOM 8278  H HG12 . ILE B 1 4   ? 10.066  -12.740 13.302  1.00 5.98  ? 4   ILE B HG12 3  
ATOM 8279  H HG13 . ILE B 1 4   ? 10.690  -11.721 14.591  1.00 5.88  ? 4   ILE B HG13 3  
ATOM 8280  H HG21 . ILE B 1 4   ? 12.387  -14.299 15.717  1.00 5.93  ? 4   ILE B HG21 3  
ATOM 8281  H HG22 . ILE B 1 4   ? 11.179  -14.618 16.962  1.00 6.00  ? 4   ILE B HG22 3  
ATOM 8282  H HG23 . ILE B 1 4   ? 11.705  -12.965 16.646  1.00 5.54  ? 4   ILE B HG23 3  
ATOM 8283  H HD11 . ILE B 1 4   ? 12.320  -12.049 12.811  1.00 6.97  ? 4   ILE B HD11 3  
ATOM 8284  H HD12 . ILE B 1 4   ? 12.266  -13.791 13.078  1.00 6.74  ? 4   ILE B HD12 3  
ATOM 8285  H HD13 . ILE B 1 4   ? 12.887  -12.726 14.337  1.00 6.73  ? 4   ILE B HD13 3  
ATOM 8286  N N    . SER B 1 5   ? 7.748   -14.679 13.980  1.00 3.24  ? 5   SER B N    3  
ATOM 8287  C CA   . SER B 1 5   ? 6.606   -14.409 13.125  1.00 2.93  ? 5   SER B CA   3  
ATOM 8288  C C    . SER B 1 5   ? 6.081   -13.003 13.387  1.00 2.01  ? 5   SER B C    3  
ATOM 8289  O O    . SER B 1 5   ? 4.911   -12.806 13.714  1.00 2.25  ? 5   SER B O    3  
ATOM 8290  C CB   . SER B 1 5   ? 5.516   -15.459 13.360  1.00 3.70  ? 5   SER B CB   3  
ATOM 8291  O OG   . SER B 1 5   ? 5.296   -15.666 14.749  1.00 4.46  ? 5   SER B OG   3  
ATOM 8292  H H    . SER B 1 5   ? 7.625   -14.669 14.954  1.00 3.53  ? 5   SER B H    3  
ATOM 8293  H HA   . SER B 1 5   ? 6.939   -14.471 12.099  1.00 3.38  ? 5   SER B HA   3  
ATOM 8294  H HB2  . SER B 1 5   ? 4.594   -15.124 12.908  1.00 3.90  ? 5   SER B HB2  3  
ATOM 8295  H HB3  . SER B 1 5   ? 5.818   -16.394 12.912  1.00 4.02  ? 5   SER B HB3  3  
ATOM 8296  H HG   . SER B 1 5   ? 5.322   -14.816 15.205  1.00 4.65  ? 5   SER B HG   3  
ATOM 8297  N N    . SER B 1 6   ? 6.969   -12.029 13.262  1.00 1.51  ? 6   SER B N    3  
ATOM 8298  C CA   . SER B 1 6   ? 6.622   -10.641 13.501  1.00 1.03  ? 6   SER B CA   3  
ATOM 8299  C C    . SER B 1 6   ? 6.792   -9.837  12.220  1.00 0.82  ? 6   SER B C    3  
ATOM 8300  O O    . SER B 1 6   ? 7.854   -9.869  11.596  1.00 0.86  ? 6   SER B O    3  
ATOM 8301  C CB   . SER B 1 6   ? 7.504   -10.061 14.613  1.00 1.67  ? 6   SER B CB   3  
ATOM 8302  O OG   . SER B 1 6   ? 7.109   -8.740  14.952  1.00 2.25  ? 6   SER B OG   3  
ATOM 8303  H H    . SER B 1 6   ? 7.883   -12.249 12.988  1.00 2.00  ? 6   SER B H    3  
ATOM 8304  H HA   . SER B 1 6   ? 5.588   -10.601 13.811  1.00 1.21  ? 6   SER B HA   3  
ATOM 8305  H HB2  . SER B 1 6   ? 7.426   -10.682 15.492  1.00 2.14  ? 6   SER B HB2  3  
ATOM 8306  H HB3  . SER B 1 6   ? 8.532   -10.041 14.279  1.00 2.15  ? 6   SER B HB3  3  
ATOM 8307  H HG   . SER B 1 6   ? 7.597   -8.109  14.405  1.00 2.50  ? 6   SER B HG   3  
ATOM 8308  N N    . PRO B 1 7   ? 5.747   -9.112  11.807  1.00 0.70  ? 7   PRO B N    3  
ATOM 8309  C CA   . PRO B 1 7   ? 5.786   -8.287  10.603  1.00 0.54  ? 7   PRO B CA   3  
ATOM 8310  C C    . PRO B 1 7   ? 6.471   -6.957  10.865  1.00 0.45  ? 7   PRO B C    3  
ATOM 8311  O O    . PRO B 1 7   ? 6.539   -6.495  12.007  1.00 0.57  ? 7   PRO B O    3  
ATOM 8312  C CB   . PRO B 1 7   ? 4.307   -8.067  10.313  1.00 0.62  ? 7   PRO B CB   3  
ATOM 8313  C CG   . PRO B 1 7   ? 3.710   -7.981  11.666  1.00 0.75  ? 7   PRO B CG   3  
ATOM 8314  C CD   . PRO B 1 7   ? 4.437   -9.018  12.482  1.00 0.82  ? 7   PRO B CD   3  
ATOM 8315  H HA   . PRO B 1 7   ? 6.258   -8.795  9.774   1.00 0.57  ? 7   PRO B HA   3  
ATOM 8316  H HB2  . PRO B 1 7   ? 4.175   -7.150  9.755   1.00 0.60  ? 7   PRO B HB2  3  
ATOM 8317  H HB3  . PRO B 1 7   ? 3.912   -8.902  9.755   1.00 0.68  ? 7   PRO B HB3  3  
ATOM 8318  H HG2  . PRO B 1 7   ? 3.880   -6.993  12.075  1.00 0.75  ? 7   PRO B HG2  3  
ATOM 8319  H HG3  . PRO B 1 7   ? 2.655   -8.201  11.624  1.00 0.87  ? 7   PRO B HG3  3  
ATOM 8320  H HD2  . PRO B 1 7   ? 4.550   -8.686  13.504  1.00 0.93  ? 7   PRO B HD2  3  
ATOM 8321  H HD3  . PRO B 1 7   ? 3.915   -9.963  12.445  1.00 0.91  ? 7   PRO B HD3  3  
ATOM 8322  N N    . THR B 1 8   ? 6.989   -6.351  9.821   1.00 0.34  ? 8   THR B N    3  
ATOM 8323  C CA   . THR B 1 8   ? 7.564   -5.029  9.933   1.00 0.27  ? 8   THR B CA   3  
ATOM 8324  C C    . THR B 1 8   ? 6.479   -3.994  9.741   1.00 0.28  ? 8   THR B C    3  
ATOM 8325  O O    . THR B 1 8   ? 5.304   -4.344  9.616   1.00 0.34  ? 8   THR B O    3  
ATOM 8326  C CB   . THR B 1 8   ? 8.645   -4.808  8.881   1.00 0.29  ? 8   THR B CB   3  
ATOM 8327  O OG1  . THR B 1 8   ? 8.035   -4.678  7.598   1.00 0.37  ? 8   THR B OG1  3  
ATOM 8328  C CG2  . THR B 1 8   ? 9.623   -5.965  8.888   1.00 0.33  ? 8   THR B CG2  3  
ATOM 8329  H H    . THR B 1 8   ? 6.993   -6.809  8.946   1.00 0.43  ? 8   THR B H    3  
ATOM 8330  H HA   . THR B 1 8   ? 7.999   -4.920  10.911  1.00 0.31  ? 8   THR B HA   3  
ATOM 8331  H HB   . THR B 1 8   ? 9.178   -3.903  9.111   1.00 0.33  ? 8   THR B HB   3  
ATOM 8332  H HG1  . THR B 1 8   ? 8.551   -5.177  6.943   1.00 0.32  ? 8   THR B HG1  3  
ATOM 8333  H HG21 . THR B 1 8   ? 10.191  -5.960  7.972   1.00 1.05  ? 8   THR B HG21 3  
ATOM 8334  H HG22 . THR B 1 8   ? 9.081   -6.893  8.973   1.00 1.08  ? 8   THR B HG22 3  
ATOM 8335  H HG23 . THR B 1 8   ? 10.293  -5.858  9.728   1.00 1.05  ? 8   THR B HG23 3  
ATOM 8336  N N    . GLU B 1 9   ? 6.866   -2.732  9.689   1.00 0.28  ? 9   GLU B N    3  
ATOM 8337  C CA   . GLU B 1 9   ? 5.905   -1.663  9.495   1.00 0.33  ? 9   GLU B CA   3  
ATOM 8338  C C    . GLU B 1 9   ? 5.123   -1.871  8.200   1.00 0.36  ? 9   GLU B C    3  
ATOM 8339  O O    . GLU B 1 9   ? 3.902   -1.865  8.205   1.00 0.52  ? 9   GLU B O    3  
ATOM 8340  C CB   . GLU B 1 9   ? 6.587   -0.301  9.475   1.00 0.40  ? 9   GLU B CB   3  
ATOM 8341  C CG   . GLU B 1 9   ? 5.589   0.838   9.450   1.00 0.56  ? 9   GLU B CG   3  
ATOM 8342  C CD   . GLU B 1 9   ? 4.777   0.915   10.727  1.00 1.73  ? 9   GLU B CD   3  
ATOM 8343  O OE1  . GLU B 1 9   ? 5.283   1.478   11.720  1.00 2.48  ? 9   GLU B OE1  3  
ATOM 8344  O OE2  . GLU B 1 9   ? 3.638   0.404   10.749  1.00 2.47  ? 9   GLU B OE2  3  
ATOM 8345  H H    . GLU B 1 9   ? 7.821   -2.519  9.782   1.00 0.29  ? 9   GLU B H    3  
ATOM 8346  H HA   . GLU B 1 9   ? 5.212   -1.690  10.322  1.00 0.37  ? 9   GLU B HA   3  
ATOM 8347  H HB2  . GLU B 1 9   ? 7.203   -0.201  10.358  1.00 0.44  ? 9   GLU B HB2  3  
ATOM 8348  H HB3  . GLU B 1 9   ? 7.213   -0.229  8.595   1.00 0.37  ? 9   GLU B HB3  3  
ATOM 8349  H HG2  . GLU B 1 9   ? 6.114   1.775   9.311   1.00 0.94  ? 9   GLU B HG2  3  
ATOM 8350  H HG3  . GLU B 1 9   ? 4.912   0.677   8.621   1.00 0.74  ? 9   GLU B HG3  3  
ATOM 8351  N N    . THR B 1 10  ? 5.829   -2.106  7.105   1.00 0.26  ? 10  THR B N    3  
ATOM 8352  C CA   . THR B 1 10  ? 5.192   -2.263  5.807   1.00 0.27  ? 10  THR B CA   3  
ATOM 8353  C C    . THR B 1 10  ? 4.430   -3.572  5.736   1.00 0.27  ? 10  THR B C    3  
ATOM 8354  O O    . THR B 1 10  ? 3.368   -3.629  5.132   1.00 0.31  ? 10  THR B O    3  
ATOM 8355  C CB   . THR B 1 10  ? 6.211   -2.170  4.643   1.00 0.27  ? 10  THR B CB   3  
ATOM 8356  O OG1  . THR B 1 10  ? 5.668   -2.744  3.447   1.00 0.40  ? 10  THR B OG1  3  
ATOM 8357  C CG2  . THR B 1 10  ? 7.523   -2.857  5.004   1.00 0.26  ? 10  THR B CG2  3  
ATOM 8358  H H    . THR B 1 10  ? 6.794   -2.211  7.175   1.00 0.22  ? 10  THR B H    3  
ATOM 8359  H HA   . THR B 1 10  ? 4.482   -1.463  5.689   1.00 0.30  ? 10  THR B HA   3  
ATOM 8360  H HB   . THR B 1 10  ? 6.415   -1.124  4.451   1.00 0.33  ? 10  THR B HB   3  
ATOM 8361  H HG1  . THR B 1 10  ? 4.766   -3.041  3.612   1.00 1.00  ? 10  THR B HG1  3  
ATOM 8362  H HG21 . THR B 1 10  ? 7.316   -3.846  5.389   1.00 1.12  ? 10  THR B HG21 3  
ATOM 8363  H HG22 . THR B 1 10  ? 8.039   -2.277  5.756   1.00 0.94  ? 10  THR B HG22 3  
ATOM 8364  H HG23 . THR B 1 10  ? 8.144   -2.936  4.125   1.00 0.99  ? 10  THR B HG23 3  
ATOM 8365  N N    . GLU B 1 11  ? 4.943   -4.604  6.383   1.00 0.24  ? 11  GLU B N    3  
ATOM 8366  C CA   . GLU B 1 11  ? 4.306   -5.910  6.334   1.00 0.27  ? 11  GLU B CA   3  
ATOM 8367  C C    . GLU B 1 11  ? 2.990   -5.898  7.091   1.00 0.30  ? 11  GLU B C    3  
ATOM 8368  O O    . GLU B 1 11  ? 1.965   -6.340  6.578   1.00 0.32  ? 11  GLU B O    3  
ATOM 8369  C CB   . GLU B 1 11  ? 5.229   -6.973  6.898   1.00 0.29  ? 11  GLU B CB   3  
ATOM 8370  C CG   . GLU B 1 11  ? 6.598   -6.933  6.264   1.00 0.41  ? 11  GLU B CG   3  
ATOM 8371  C CD   . GLU B 1 11  ? 7.483   -8.088  6.686   1.00 1.11  ? 11  GLU B CD   3  
ATOM 8372  O OE1  . GLU B 1 11  ? 7.549   -8.371  7.904   1.00 1.85  ? 11  GLU B OE1  3  
ATOM 8373  O OE2  . GLU B 1 11  ? 8.135   -8.694  5.813   1.00 1.71  ? 11  GLU B OE2  3  
ATOM 8374  H H    . GLU B 1 11  ? 5.771   -4.489  6.898   1.00 0.23  ? 11  GLU B H    3  
ATOM 8375  H HA   . GLU B 1 11  ? 4.107   -6.134  5.303   1.00 0.29  ? 11  GLU B HA   3  
ATOM 8376  H HB2  . GLU B 1 11  ? 5.333   -6.818  7.959   1.00 0.40  ? 11  GLU B HB2  3  
ATOM 8377  H HB3  . GLU B 1 11  ? 4.798   -7.947  6.719   1.00 0.42  ? 11  GLU B HB3  3  
ATOM 8378  H HG2  . GLU B 1 11  ? 6.475   -6.949  5.197   1.00 0.40  ? 11  GLU B HG2  3  
ATOM 8379  H HG3  . GLU B 1 11  ? 7.080   -6.010  6.552   1.00 0.71  ? 11  GLU B HG3  3  
ATOM 8380  N N    . ARG B 1 12  ? 3.020   -5.356  8.298   1.00 0.35  ? 12  ARG B N    3  
ATOM 8381  C CA   . ARG B 1 12  ? 1.808   -5.238  9.099   1.00 0.42  ? 12  ARG B CA   3  
ATOM 8382  C C    . ARG B 1 12  ? 0.830   -4.323  8.391   1.00 0.43  ? 12  ARG B C    3  
ATOM 8383  O O    . ARG B 1 12  ? -0.377  -4.538  8.411   1.00 0.47  ? 12  ARG B O    3  
ATOM 8384  C CB   . ARG B 1 12  ? 2.112   -4.712  10.517  1.00 0.48  ? 12  ARG B CB   3  
ATOM 8385  C CG   . ARG B 1 12  ? 2.679   -3.298  10.583  1.00 0.49  ? 12  ARG B CG   3  
ATOM 8386  C CD   . ARG B 1 12  ? 1.581   -2.249  10.503  1.00 0.56  ? 12  ARG B CD   3  
ATOM 8387  N NE   . ARG B 1 12  ? 0.743   -2.255  11.703  1.00 1.08  ? 12  ARG B NE   3  
ATOM 8388  C CZ   . ARG B 1 12  ? -0.504  -1.791  11.761  1.00 1.34  ? 12  ARG B CZ   3  
ATOM 8389  N NH1  . ARG B 1 12  ? -1.086  -1.281  10.685  1.00 1.86  ? 12  ARG B NH1  3  
ATOM 8390  N NH2  . ARG B 1 12  ? -1.172  -1.845  12.906  1.00 1.95  ? 12  ARG B NH2  3  
ATOM 8391  H H    . ARG B 1 12  ? 3.873   -5.028  8.654   1.00 0.34  ? 12  ARG B H    3  
ATOM 8392  H HA   . ARG B 1 12  ? 1.367   -6.222  9.174   1.00 0.44  ? 12  ARG B HA   3  
ATOM 8393  H HB2  . ARG B 1 12  ? 1.194   -4.718  11.082  1.00 0.55  ? 12  ARG B HB2  3  
ATOM 8394  H HB3  . ARG B 1 12  ? 2.816   -5.380  10.988  1.00 0.48  ? 12  ARG B HB3  3  
ATOM 8395  H HG2  . ARG B 1 12  ? 3.211   -3.177  11.515  1.00 0.52  ? 12  ARG B HG2  3  
ATOM 8396  H HG3  . ARG B 1 12  ? 3.362   -3.156  9.758   1.00 0.45  ? 12  ARG B HG3  3  
ATOM 8397  H HD2  . ARG B 1 12  ? 2.035   -1.276  10.382  1.00 0.91  ? 12  ARG B HD2  3  
ATOM 8398  H HD3  . ARG B 1 12  ? 0.965   -2.466  9.633   1.00 0.83  ? 12  ARG B HD3  3  
ATOM 8399  H HE   . ARG B 1 12  ? 1.144   -2.628  12.522  1.00 1.80  ? 12  ARG B HE   3  
ATOM 8400  H HH11 . ARG B 1 12  ? -0.591  -1.237  9.818   1.00 2.09  ? 12  ARG B HH11 3  
ATOM 8401  H HH12 . ARG B 1 12  ? -2.040  -0.943  10.732  1.00 2.42  ? 12  ARG B HH12 3  
ATOM 8402  H HH21 . ARG B 1 12  ? -0.741  -2.236  13.724  1.00 2.48  ? 12  ARG B HH21 3  
ATOM 8403  H HH22 . ARG B 1 12  ? -2.110  -1.493  12.960  1.00 2.20  ? 12  ARG B HH22 3  
ATOM 8404  N N    . CYS B 1 13  ? 1.381   -3.310  7.738   1.00 0.42  ? 13  CYS B N    3  
ATOM 8405  C CA   . CYS B 1 13  ? 0.591   -2.319  7.039   1.00 0.44  ? 13  CYS B CA   3  
ATOM 8406  C C    . CYS B 1 13  ? -0.068  -2.954  5.830   1.00 0.30  ? 13  CYS B C    3  
ATOM 8407  O O    . CYS B 1 13  ? -1.218  -2.665  5.503   1.00 0.29  ? 13  CYS B O    3  
ATOM 8408  C CB   . CYS B 1 13  ? 1.492   -1.148  6.648   1.00 0.57  ? 13  CYS B CB   3  
ATOM 8409  S SG   . CYS B 1 13  ? 1.806   0.011   7.996   1.00 2.16  ? 13  CYS B SG   3  
ATOM 8410  H H    . CYS B 1 13  ? 2.362   -3.237  7.717   1.00 0.41  ? 13  CYS B H    3  
ATOM 8411  H HA   . CYS B 1 13  ? -0.178  -1.967  7.709   1.00 0.54  ? 13  CYS B HA   3  
ATOM 8412  H HB2  . CYS B 1 13  ? 2.447   -1.537  6.327   1.00 1.00  ? 13  CYS B HB2  3  
ATOM 8413  H HB3  . CYS B 1 13  ? 1.053   -0.604  5.847   1.00 0.84  ? 13  CYS B HB3  3  
ATOM 8414  H HG   . CYS B 1 13  ? 2.908   -0.387  8.622   1.00 2.85  ? 13  CYS B HG   3  
ATOM 8415  N N    . ILE B 1 14  ? 0.665   -3.852  5.207   1.00 0.26  ? 14  ILE B N    3  
ATOM 8416  C CA   . ILE B 1 14  ? 0.163   -4.646  4.108   1.00 0.24  ? 14  ILE B CA   3  
ATOM 8417  C C    . ILE B 1 14  ? -1.023  -5.505  4.549   1.00 0.21  ? 14  ILE B C    3  
ATOM 8418  O O    . ILE B 1 14  ? -2.042  -5.584  3.859   1.00 0.23  ? 14  ILE B O    3  
ATOM 8419  C CB   . ILE B 1 14  ? 1.289   -5.546  3.559   1.00 0.24  ? 14  ILE B CB   3  
ATOM 8420  C CG1  . ILE B 1 14  ? 2.218   -4.757  2.637   1.00 0.25  ? 14  ILE B CG1  3  
ATOM 8421  C CG2  . ILE B 1 14  ? 0.724   -6.758  2.842   1.00 0.27  ? 14  ILE B CG2  3  
ATOM 8422  C CD1  . ILE B 1 14  ? 3.490   -5.501  2.313   1.00 0.27  ? 14  ILE B CD1  3  
ATOM 8423  H H    . ILE B 1 14  ? 1.596   -3.984  5.493   1.00 0.27  ? 14  ILE B H    3  
ATOM 8424  H HA   . ILE B 1 14  ? -0.152  -3.972  3.331   1.00 0.27  ? 14  ILE B HA   3  
ATOM 8425  H HB   . ILE B 1 14  ? 1.863   -5.902  4.402   1.00 0.25  ? 14  ILE B HB   3  
ATOM 8426  H HG12 . ILE B 1 14  ? 1.710   -4.550  1.707   1.00 0.26  ? 14  ILE B HG12 3  
ATOM 8427  H HG13 . ILE B 1 14  ? 2.489   -3.826  3.113   1.00 0.27  ? 14  ILE B HG13 3  
ATOM 8428  H HG21 . ILE B 1 14  ? 0.024   -6.427  2.089   1.00 1.01  ? 14  ILE B HG21 3  
ATOM 8429  H HG22 . ILE B 1 14  ? 0.218   -7.394  3.553   1.00 1.03  ? 14  ILE B HG22 3  
ATOM 8430  H HG23 . ILE B 1 14  ? 1.527   -7.305  2.374   1.00 1.01  ? 14  ILE B HG23 3  
ATOM 8431  H HD11 . ILE B 1 14  ? 3.242   -6.443  1.847   1.00 1.06  ? 14  ILE B HD11 3  
ATOM 8432  H HD12 . ILE B 1 14  ? 4.041   -5.680  3.228   1.00 0.96  ? 14  ILE B HD12 3  
ATOM 8433  H HD13 . ILE B 1 14  ? 4.091   -4.910  1.639   1.00 1.12  ? 14  ILE B HD13 3  
ATOM 8434  N N    . GLU B 1 15  ? -0.899  -6.114  5.721   1.00 0.24  ? 15  GLU B N    3  
ATOM 8435  C CA   . GLU B 1 15  ? -1.923  -7.008  6.233   1.00 0.28  ? 15  GLU B CA   3  
ATOM 8436  C C    . GLU B 1 15  ? -3.096  -6.209  6.721   1.00 0.30  ? 15  GLU B C    3  
ATOM 8437  O O    . GLU B 1 15  ? -4.215  -6.704  6.818   1.00 0.34  ? 15  GLU B O    3  
ATOM 8438  C CB   . GLU B 1 15  ? -1.387  -7.824  7.387   1.00 0.32  ? 15  GLU B CB   3  
ATOM 8439  C CG   . GLU B 1 15  ? -0.152  -8.628  7.036   1.00 0.32  ? 15  GLU B CG   3  
ATOM 8440  C CD   . GLU B 1 15  ? 0.339   -9.454  8.201   1.00 0.38  ? 15  GLU B CD   3  
ATOM 8441  O OE1  . GLU B 1 15  ? 1.143   -8.946  9.006   1.00 1.06  ? 15  GLU B OE1  3  
ATOM 8442  O OE2  . GLU B 1 15  ? -0.099  -10.617 8.331   1.00 1.25  ? 15  GLU B OE2  3  
ATOM 8443  H H    . GLU B 1 15  ? -0.105  -5.945  6.268   1.00 0.26  ? 15  GLU B H    3  
ATOM 8444  H HA   . GLU B 1 15  ? -2.236  -7.664  5.438   1.00 0.29  ? 15  GLU B HA   3  
ATOM 8445  H HB2  . GLU B 1 15  ? -1.145  -7.149  8.200   1.00 0.32  ? 15  GLU B HB2  3  
ATOM 8446  H HB3  . GLU B 1 15  ? -2.160  -8.503  7.715   1.00 0.37  ? 15  GLU B HB3  3  
ATOM 8447  H HG2  . GLU B 1 15  ? -0.390  -9.291  6.216   1.00 0.33  ? 15  GLU B HG2  3  
ATOM 8448  H HG3  . GLU B 1 15  ? 0.633   -7.946  6.730   1.00 0.31  ? 15  GLU B HG3  3  
ATOM 8449  N N    . SER B 1 16  ? -2.822  -4.975  7.055   1.00 0.31  ? 16  SER B N    3  
ATOM 8450  C CA   . SER B 1 16  ? -3.847  -4.094  7.518   1.00 0.37  ? 16  SER B CA   3  
ATOM 8451  C C    . SER B 1 16  ? -4.686  -3.621  6.343   1.00 0.28  ? 16  SER B C    3  
ATOM 8452  O O    . SER B 1 16  ? -5.882  -3.403  6.480   1.00 0.28  ? 16  SER B O    3  
ATOM 8453  C CB   . SER B 1 16  ? -3.229  -2.939  8.282   1.00 0.54  ? 16  SER B CB   3  
ATOM 8454  O OG   . SER B 1 16  ? -2.491  -3.416  9.391   1.00 0.97  ? 16  SER B OG   3  
ATOM 8455  H H    . SER B 1 16  ? -1.899  -4.651  6.989   1.00 0.31  ? 16  SER B H    3  
ATOM 8456  H HA   . SER B 1 16  ? -4.472  -4.660  8.182   1.00 0.45  ? 16  SER B HA   3  
ATOM 8457  H HB2  . SER B 1 16  ? -2.567  -2.386  7.631   1.00 0.76  ? 16  SER B HB2  3  
ATOM 8458  H HB3  . SER B 1 16  ? -4.008  -2.293  8.639   1.00 0.80  ? 16  SER B HB3  3  
ATOM 8459  H HG   . SER B 1 16  ? -1.724  -3.917  9.076   1.00 1.17  ? 16  SER B HG   3  
ATOM 8460  N N    . LEU B 1 17  ? -4.059  -3.501  5.178   1.00 0.27  ? 17  LEU B N    3  
ATOM 8461  C CA   . LEU B 1 17  ? -4.799  -3.256  3.949   1.00 0.28  ? 17  LEU B CA   3  
ATOM 8462  C C    . LEU B 1 17  ? -5.657  -4.470  3.654   1.00 0.27  ? 17  LEU B C    3  
ATOM 8463  O O    . LEU B 1 17  ? -6.798  -4.347  3.224   1.00 0.32  ? 17  LEU B O    3  
ATOM 8464  C CB   . LEU B 1 17  ? -3.852  -2.994  2.783   1.00 0.29  ? 17  LEU B CB   3  
ATOM 8465  C CG   . LEU B 1 17  ? -2.798  -1.928  3.056   1.00 0.33  ? 17  LEU B CG   3  
ATOM 8466  C CD1  . LEU B 1 17  ? -1.786  -1.855  1.925   1.00 0.33  ? 17  LEU B CD1  3  
ATOM 8467  C CD2  . LEU B 1 17  ? -3.450  -0.570  3.276   1.00 0.46  ? 17  LEU B CD2  3  
ATOM 8468  H H    . LEU B 1 17  ? -3.081  -3.575  5.146   1.00 0.27  ? 17  LEU B H    3  
ATOM 8469  H HA   . LEU B 1 17  ? -5.434  -2.397  4.101   1.00 0.31  ? 17  LEU B HA   3  
ATOM 8470  H HB2  . LEU B 1 17  ? -3.354  -3.921  2.542   1.00 0.26  ? 17  LEU B HB2  3  
ATOM 8471  H HB3  . LEU B 1 17  ? -4.439  -2.682  1.930   1.00 0.35  ? 17  LEU B HB3  3  
ATOM 8472  H HG   . LEU B 1 17  ? -2.273  -2.196  3.954   1.00 0.33  ? 17  LEU B HG   3  
ATOM 8473  H HD11 . LEU B 1 17  ? -2.283  -1.553  1.016   1.00 1.09  ? 17  LEU B HD11 3  
ATOM 8474  H HD12 . LEU B 1 17  ? -1.334  -2.825  1.782   1.00 1.06  ? 17  LEU B HD12 3  
ATOM 8475  H HD13 . LEU B 1 17  ? -1.020  -1.134  2.171   1.00 1.06  ? 17  LEU B HD13 3  
ATOM 8476  H HD21 . LEU B 1 17  ? -2.686  0.177   3.434   1.00 1.07  ? 17  LEU B HD21 3  
ATOM 8477  H HD22 . LEU B 1 17  ? -4.092  -0.617  4.144   1.00 1.10  ? 17  LEU B HD22 3  
ATOM 8478  H HD23 . LEU B 1 17  ? -4.037  -0.308  2.408   1.00 1.21  ? 17  LEU B HD23 3  
ATOM 8479  N N    . ILE B 1 18  ? -5.088  -5.647  3.906   1.00 0.27  ? 18  ILE B N    3  
ATOM 8480  C CA   . ILE B 1 18  ? -5.833  -6.895  3.838   1.00 0.30  ? 18  ILE B CA   3  
ATOM 8481  C C    . ILE B 1 18  ? -7.056  -6.826  4.747   1.00 0.28  ? 18  ILE B C    3  
ATOM 8482  O O    . ILE B 1 18  ? -8.160  -7.170  4.339   1.00 0.30  ? 18  ILE B O    3  
ATOM 8483  C CB   . ILE B 1 18  ? -4.953  -8.109  4.239   1.00 0.36  ? 18  ILE B CB   3  
ATOM 8484  C CG1  . ILE B 1 18  ? -3.905  -8.387  3.157   1.00 0.62  ? 18  ILE B CG1  3  
ATOM 8485  C CG2  . ILE B 1 18  ? -5.813  -9.343  4.492   1.00 0.47  ? 18  ILE B CG2  3  
ATOM 8486  C CD1  . ILE B 1 18  ? -2.979  -9.540  3.487   1.00 1.37  ? 18  ILE B CD1  3  
ATOM 8487  H H    . ILE B 1 18  ? -4.135  -5.673  4.135   1.00 0.29  ? 18  ILE B H    3  
ATOM 8488  H HA   . ILE B 1 18  ? -6.162  -7.033  2.818   1.00 0.33  ? 18  ILE B HA   3  
ATOM 8489  H HB   . ILE B 1 18  ? -4.440  -7.866  5.162   1.00 0.37  ? 18  ILE B HB   3  
ATOM 8490  H HG12 . ILE B 1 18  ? -4.408  -8.622  2.231   1.00 0.97  ? 18  ILE B HG12 3  
ATOM 8491  H HG13 . ILE B 1 18  ? -3.298  -7.504  3.017   1.00 1.37  ? 18  ILE B HG13 3  
ATOM 8492  H HG21 . ILE B 1 18  ? -6.451  -9.520  3.638   1.00 1.13  ? 18  ILE B HG21 3  
ATOM 8493  H HG22 . ILE B 1 18  ? -6.426  -9.181  5.370   1.00 1.10  ? 18  ILE B HG22 3  
ATOM 8494  H HG23 . ILE B 1 18  ? -5.174  -10.203 4.650   1.00 1.11  ? 18  ILE B HG23 3  
ATOM 8495  H HD11 . ILE B 1 18  ? -2.463  -9.337  4.412   1.00 1.87  ? 18  ILE B HD11 3  
ATOM 8496  H HD12 . ILE B 1 18  ? -2.257  -9.662  2.692   1.00 1.89  ? 18  ILE B HD12 3  
ATOM 8497  H HD13 . ILE B 1 18  ? -3.557  -10.447 3.589   1.00 1.99  ? 18  ILE B HD13 3  
ATOM 8498  N N    . ALA B 1 19  ? -6.847  -6.353  5.968   1.00 0.25  ? 19  ALA B N    3  
ATOM 8499  C CA   . ALA B 1 19  ? -7.916  -6.238  6.952   1.00 0.25  ? 19  ALA B CA   3  
ATOM 8500  C C    . ALA B 1 19  ? -9.001  -5.267  6.496   1.00 0.23  ? 19  ALA B C    3  
ATOM 8501  O O    . ALA B 1 19  ? -10.174 -5.633  6.420   1.00 0.27  ? 19  ALA B O    3  
ATOM 8502  C CB   . ALA B 1 19  ? -7.348  -5.802  8.293   1.00 0.28  ? 19  ALA B CB   3  
ATOM 8503  H H    . ALA B 1 19  ? -5.939  -6.080  6.220   1.00 0.25  ? 19  ALA B H    3  
ATOM 8504  H HA   . ALA B 1 19  ? -8.356  -7.216  7.077   1.00 0.29  ? 19  ALA B HA   3  
ATOM 8505  H HB1  . ALA B 1 19  ? -6.937  -4.806  8.205   1.00 1.03  ? 19  ALA B HB1  3  
ATOM 8506  H HB2  . ALA B 1 19  ? -6.569  -6.486  8.592   1.00 1.06  ? 19  ALA B HB2  3  
ATOM 8507  H HB3  . ALA B 1 19  ? -8.133  -5.803  9.035   1.00 0.97  ? 19  ALA B HB3  3  
ATOM 8508  N N    . VAL B 1 20  ? -8.606  -4.034  6.184   1.00 0.20  ? 20  VAL B N    3  
ATOM 8509  C CA   . VAL B 1 20  ? -9.560  -2.997  5.810   1.00 0.22  ? 20  VAL B CA   3  
ATOM 8510  C C    . VAL B 1 20  ? -10.281 -3.374  4.524   1.00 0.23  ? 20  VAL B C    3  
ATOM 8511  O O    . VAL B 1 20  ? -11.490 -3.159  4.383   1.00 0.27  ? 20  VAL B O    3  
ATOM 8512  C CB   . VAL B 1 20  ? -8.879  -1.614  5.657   1.00 0.27  ? 20  VAL B CB   3  
ATOM 8513  C CG1  . VAL B 1 20  ? -7.950  -1.375  6.811   1.00 0.87  ? 20  VAL B CG1  3  
ATOM 8514  C CG2  . VAL B 1 20  ? -8.116  -1.483  4.350   1.00 0.87  ? 20  VAL B CG2  3  
ATOM 8515  H H    . VAL B 1 20  ? -7.647  -3.816  6.208   1.00 0.21  ? 20  VAL B H    3  
ATOM 8516  H HA   . VAL B 1 20  ? -10.290 -2.925  6.602   1.00 0.24  ? 20  VAL B HA   3  
ATOM 8517  H HB   . VAL B 1 20  ? -9.641  -0.854  5.685   1.00 0.52  ? 20  VAL B HB   3  
ATOM 8518  H HG11 . VAL B 1 20  ? -8.513  -1.343  7.730   1.00 1.36  ? 20  VAL B HG11 3  
ATOM 8519  H HG12 . VAL B 1 20  ? -7.429  -0.441  6.664   1.00 1.57  ? 20  VAL B HG12 3  
ATOM 8520  H HG13 . VAL B 1 20  ? -7.237  -2.185  6.850   1.00 1.42  ? 20  VAL B HG13 3  
ATOM 8521  H HG21 . VAL B 1 20  ? -7.379  -2.269  4.285   1.00 1.45  ? 20  VAL B HG21 3  
ATOM 8522  H HG22 . VAL B 1 20  ? -7.621  -0.524  4.317   1.00 1.40  ? 20  VAL B HG22 3  
ATOM 8523  H HG23 . VAL B 1 20  ? -8.803  -1.563  3.521   1.00 1.53  ? 20  VAL B HG23 3  
ATOM 8524  N N    . PHE B 1 21  ? -9.536  -3.957  3.598   1.00 0.22  ? 21  PHE B N    3  
ATOM 8525  C CA   . PHE B 1 21  ? -10.127 -4.441  2.358   1.00 0.25  ? 21  PHE B CA   3  
ATOM 8526  C C    . PHE B 1 21  ? -11.138 -5.545  2.643   1.00 0.29  ? 21  PHE B C    3  
ATOM 8527  O O    . PHE B 1 21  ? -12.278 -5.482  2.198   1.00 0.35  ? 21  PHE B O    3  
ATOM 8528  C CB   . PHE B 1 21  ? -9.053  -4.964  1.402   1.00 0.26  ? 21  PHE B CB   3  
ATOM 8529  C CG   . PHE B 1 21  ? -9.602  -5.498  0.106   1.00 0.91  ? 21  PHE B CG   3  
ATOM 8530  C CD1  . PHE B 1 21  ? -9.878  -4.645  -0.949  1.00 1.85  ? 21  PHE B CD1  3  
ATOM 8531  C CD2  . PHE B 1 21  ? -9.843  -6.855  -0.056  1.00 1.59  ? 21  PHE B CD2  3  
ATOM 8532  C CE1  . PHE B 1 21  ? -10.384 -5.132  -2.139  1.00 2.48  ? 21  PHE B CE1  3  
ATOM 8533  C CE2  . PHE B 1 21  ? -10.350 -7.346  -1.244  1.00 2.17  ? 21  PHE B CE2  3  
ATOM 8534  C CZ   . PHE B 1 21  ? -10.620 -6.483  -2.286  1.00 2.40  ? 21  PHE B CZ   3  
ATOM 8535  H H    . PHE B 1 21  ? -8.549  -4.037  3.750   1.00 0.22  ? 21  PHE B H    3  
ATOM 8536  H HA   . PHE B 1 21  ? -10.640 -3.614  1.891   1.00 0.27  ? 21  PHE B HA   3  
ATOM 8537  H HB2  . PHE B 1 21  ? -8.368  -4.161  1.168   1.00 0.64  ? 21  PHE B HB2  3  
ATOM 8538  H HB3  . PHE B 1 21  ? -8.512  -5.761  1.888   1.00 0.62  ? 21  PHE B HB3  3  
ATOM 8539  H HD1  . PHE B 1 21  ? -9.692  -3.588  -0.836  1.00 2.42  ? 21  PHE B HD1  3  
ATOM 8540  H HD2  . PHE B 1 21  ? -9.631  -7.530  0.760   1.00 2.15  ? 21  PHE B HD2  3  
ATOM 8541  H HE1  . PHE B 1 21  ? -10.596 -4.454  -2.953  1.00 3.33  ? 21  PHE B HE1  3  
ATOM 8542  H HE2  . PHE B 1 21  ? -10.531 -8.405  -1.356  1.00 2.85  ? 21  PHE B HE2  3  
ATOM 8543  H HZ   . PHE B 1 21  ? -11.017 -6.866  -3.216  1.00 2.98  ? 21  PHE B HZ   3  
ATOM 8544  N N    . GLN B 1 22  ? -10.720 -6.534  3.418   1.00 0.30  ? 22  GLN B N    3  
ATOM 8545  C CA   . GLN B 1 22  ? -11.509 -7.737  3.638   1.00 0.37  ? 22  GLN B CA   3  
ATOM 8546  C C    . GLN B 1 22  ? -12.771 -7.445  4.441   1.00 0.36  ? 22  GLN B C    3  
ATOM 8547  O O    . GLN B 1 22  ? -13.769 -8.153  4.310   1.00 0.44  ? 22  GLN B O    3  
ATOM 8548  C CB   . GLN B 1 22  ? -10.658 -8.777  4.366   1.00 0.47  ? 22  GLN B CB   3  
ATOM 8549  C CG   . GLN B 1 22  ? -11.054 -10.213 4.085   1.00 1.11  ? 22  GLN B CG   3  
ATOM 8550  C CD   . GLN B 1 22  ? -10.798 -10.621 2.646   1.00 1.98  ? 22  GLN B CD   3  
ATOM 8551  O OE1  . GLN B 1 22  ? -9.903  -10.093 1.984   1.00 2.68  ? 22  GLN B OE1  3  
ATOM 8552  N NE2  . GLN B 1 22  ? -11.563 -11.581 2.157   1.00 2.65  ? 22  GLN B NE2  3  
ATOM 8553  H H    . GLN B 1 22  ? -9.848  -6.456  3.861   1.00 0.28  ? 22  GLN B H    3  
ATOM 8554  H HA   . GLN B 1 22  ? -11.799 -8.129  2.678   1.00 0.43  ? 22  GLN B HA   3  
ATOM 8555  H HB2  . GLN B 1 22  ? -9.626  -8.649  4.069   1.00 0.83  ? 22  GLN B HB2  3  
ATOM 8556  H HB3  . GLN B 1 22  ? -10.738 -8.606  5.430   1.00 0.94  ? 22  GLN B HB3  3  
ATOM 8557  H HG2  . GLN B 1 22  ? -10.485 -10.861 4.732   1.00 1.54  ? 22  GLN B HG2  3  
ATOM 8558  H HG3  . GLN B 1 22  ? -12.107 -10.328 4.294   1.00 1.67  ? 22  GLN B HG3  3  
ATOM 8559  H HE21 . GLN B 1 22  ? -12.246 -11.976 2.744   1.00 2.74  ? 22  GLN B HE21 3  
ATOM 8560  H HE22 . GLN B 1 22  ? -11.421 -11.858 1.227   1.00 3.38  ? 22  GLN B HE22 3  
ATOM 8561  N N    . LYS B 1 23  ? -12.736 -6.414  5.271   1.00 0.35  ? 23  LYS B N    3  
ATOM 8562  C CA   . LYS B 1 23  ? -13.896 -6.087  6.081   1.00 0.39  ? 23  LYS B CA   3  
ATOM 8563  C C    . LYS B 1 23  ? -14.956 -5.353  5.261   1.00 0.41  ? 23  LYS B C    3  
ATOM 8564  O O    . LYS B 1 23  ? -16.152 -5.584  5.442   1.00 0.49  ? 23  LYS B O    3  
ATOM 8565  C CB   . LYS B 1 23  ? -13.492 -5.275  7.314   1.00 0.41  ? 23  LYS B CB   3  
ATOM 8566  C CG   . LYS B 1 23  ? -12.875 -3.941  7.002   1.00 0.42  ? 23  LYS B CG   3  
ATOM 8567  C CD   . LYS B 1 23  ? -12.200 -3.373  8.225   1.00 0.63  ? 23  LYS B CD   3  
ATOM 8568  C CE   . LYS B 1 23  ? -12.189 -1.868  8.168   1.00 0.64  ? 23  LYS B CE   3  
ATOM 8569  N NZ   . LYS B 1 23  ? -11.467 -1.252  9.311   1.00 0.91  ? 23  LYS B NZ   3  
ATOM 8570  H H    . LYS B 1 23  ? -11.915 -5.878  5.356   1.00 0.35  ? 23  LYS B H    3  
ATOM 8571  H HA   . LYS B 1 23  ? -14.314 -7.023  6.409   1.00 0.42  ? 23  LYS B HA   3  
ATOM 8572  H HB2  . LYS B 1 23  ? -14.367 -5.090  7.916   1.00 0.45  ? 23  LYS B HB2  3  
ATOM 8573  H HB3  . LYS B 1 23  ? -12.782 -5.844  7.893   1.00 0.45  ? 23  LYS B HB3  3  
ATOM 8574  H HG2  . LYS B 1 23  ? -12.143 -4.064  6.218   1.00 0.53  ? 23  LYS B HG2  3  
ATOM 8575  H HG3  . LYS B 1 23  ? -13.648 -3.261  6.679   1.00 0.57  ? 23  LYS B HG3  3  
ATOM 8576  H HD2  . LYS B 1 23  ? -12.735 -3.694  9.104   1.00 0.97  ? 23  LYS B HD2  3  
ATOM 8577  H HD3  . LYS B 1 23  ? -11.185 -3.738  8.261   1.00 0.85  ? 23  LYS B HD3  3  
ATOM 8578  H HE2  . LYS B 1 23  ? -11.720 -1.562  7.247   1.00 0.72  ? 23  LYS B HE2  3  
ATOM 8579  H HE3  . LYS B 1 23  ? -13.213 -1.534  8.176   1.00 0.85  ? 23  LYS B HE3  3  
ATOM 8580  H HZ1  . LYS B 1 23  ? -12.009 -1.382  10.189  1.00 1.42  ? 23  LYS B HZ1  3  
ATOM 8581  H HZ2  . LYS B 1 23  ? -11.336 -0.228  9.142   1.00 1.26  ? 23  LYS B HZ2  3  
ATOM 8582  H HZ3  . LYS B 1 23  ? -10.534 -1.694  9.424   1.00 1.47  ? 23  LYS B HZ3  3  
ATOM 8583  N N    . TYR B 1 24  ? -14.531 -4.484  4.350   1.00 0.36  ? 24  TYR B N    3  
ATOM 8584  C CA   . TYR B 1 24  ? -15.483 -3.744  3.527   1.00 0.39  ? 24  TYR B CA   3  
ATOM 8585  C C    . TYR B 1 24  ? -15.895 -4.533  2.304   1.00 0.34  ? 24  TYR B C    3  
ATOM 8586  O O    . TYR B 1 24  ? -17.078 -4.635  1.995   1.00 0.40  ? 24  TYR B O    3  
ATOM 8587  C CB   . TYR B 1 24  ? -14.928 -2.386  3.125   1.00 0.46  ? 24  TYR B CB   3  
ATOM 8588  C CG   . TYR B 1 24  ? -15.118 -1.363  4.217   1.00 0.86  ? 24  TYR B CG   3  
ATOM 8589  C CD1  . TYR B 1 24  ? -16.316 -0.675  4.328   1.00 1.66  ? 24  TYR B CD1  3  
ATOM 8590  C CD2  . TYR B 1 24  ? -14.126 -1.108  5.150   1.00 1.52  ? 24  TYR B CD2  3  
ATOM 8591  C CE1  . TYR B 1 24  ? -16.522 0.238   5.339   1.00 1.99  ? 24  TYR B CE1  3  
ATOM 8592  C CE2  . TYR B 1 24  ? -14.323 -0.190  6.162   1.00 1.83  ? 24  TYR B CE2  3  
ATOM 8593  C CZ   . TYR B 1 24  ? -15.523 0.477   6.253   1.00 1.71  ? 24  TYR B CZ   3  
ATOM 8594  O OH   . TYR B 1 24  ? -15.732 1.384   7.265   1.00 2.15  ? 24  TYR B OH   3  
ATOM 8595  H H    . TYR B 1 24  ? -13.561 -4.338  4.226   1.00 0.33  ? 24  TYR B H    3  
ATOM 8596  H HA   . TYR B 1 24  ? -16.364 -3.583  4.131   1.00 0.50  ? 24  TYR B HA   3  
ATOM 8597  H HB2  . TYR B 1 24  ? -13.871 -2.479  2.910   1.00 0.51  ? 24  TYR B HB2  3  
ATOM 8598  H HB3  . TYR B 1 24  ? -15.444 -2.038  2.245   1.00 0.45  ? 24  TYR B HB3  3  
ATOM 8599  H HD1  . TYR B 1 24  ? -17.098 -0.863  3.607   1.00 2.37  ? 24  TYR B HD1  3  
ATOM 8600  H HD2  . TYR B 1 24  ? -13.185 -1.633  5.077   1.00 2.22  ? 24  TYR B HD2  3  
ATOM 8601  H HE1  . TYR B 1 24  ? -17.463 0.764   5.407   1.00 2.79  ? 24  TYR B HE1  3  
ATOM 8602  H HE2  . TYR B 1 24  ? -13.540 0.000   6.881   1.00 2.59  ? 24  TYR B HE2  3  
ATOM 8603  H HH   . TYR B 1 24  ? -15.185 2.171   7.105   1.00 2.39  ? 24  TYR B HH   3  
ATOM 8604  N N    . ALA B 1 25  ? -14.923 -5.109  1.621   1.00 0.29  ? 25  ALA B N    3  
ATOM 8605  C CA   . ALA B 1 25  ? -15.206 -5.970  0.489   1.00 0.34  ? 25  ALA B CA   3  
ATOM 8606  C C    . ALA B 1 25  ? -15.962 -7.201  0.971   1.00 0.47  ? 25  ALA B C    3  
ATOM 8607  O O    . ALA B 1 25  ? -16.668 -7.864  0.211   1.00 0.58  ? 25  ALA B O    3  
ATOM 8608  C CB   . ALA B 1 25  ? -13.911 -6.362  -0.203  1.00 0.37  ? 25  ALA B CB   3  
ATOM 8609  H H    . ALA B 1 25  ? -13.988 -4.955  1.887   1.00 0.28  ? 25  ALA B H    3  
ATOM 8610  H HA   . ALA B 1 25  ? -15.820 -5.419  -0.210  1.00 0.34  ? 25  ALA B HA   3  
ATOM 8611  H HB1  . ALA B 1 25  ? -13.351 -7.032  0.435   1.00 1.05  ? 25  ALA B HB1  3  
ATOM 8612  H HB2  . ALA B 1 25  ? -13.325 -5.471  -0.387  1.00 0.98  ? 25  ALA B HB2  3  
ATOM 8613  H HB3  . ALA B 1 25  ? -14.132 -6.850  -1.143  1.00 1.09  ? 25  ALA B HB3  3  
ATOM 8614  N N    . GLY B 1 26  ? -15.817 -7.479  2.262   1.00 0.50  ? 26  GLY B N    3  
ATOM 8615  C CA   . GLY B 1 26  ? -16.498 -8.595  2.878   1.00 0.64  ? 26  GLY B CA   3  
ATOM 8616  C C    . GLY B 1 26  ? -17.993 -8.381  2.993   1.00 0.76  ? 26  GLY B C    3  
ATOM 8617  O O    . GLY B 1 26  ? -18.746 -9.342  3.152   1.00 0.96  ? 26  GLY B O    3  
ATOM 8618  H H    . GLY B 1 26  ? -15.224 -6.912  2.807   1.00 0.45  ? 26  GLY B H    3  
ATOM 8619  H HA2  . GLY B 1 26  ? -16.324 -9.475  2.285   1.00 0.74  ? 26  GLY B HA2  3  
ATOM 8620  H HA3  . GLY B 1 26  ? -16.089 -8.751  3.865   1.00 0.64  ? 26  GLY B HA3  3  
ATOM 8621  N N    . LYS B 1 27  ? -18.433 -7.128  2.897   1.00 0.69  ? 27  LYS B N    3  
ATOM 8622  C CA   . LYS B 1 27  ? -19.858 -6.821  2.950   1.00 0.82  ? 27  LYS B CA   3  
ATOM 8623  C C    . LYS B 1 27  ? -20.580 -7.445  1.765   1.00 0.95  ? 27  LYS B C    3  
ATOM 8624  O O    . LYS B 1 27  ? -21.762 -7.778  1.850   1.00 1.11  ? 27  LYS B O    3  
ATOM 8625  C CB   . LYS B 1 27  ? -20.109 -5.313  2.929   1.00 0.77  ? 27  LYS B CB   3  
ATOM 8626  C CG   . LYS B 1 27  ? -19.526 -4.548  4.106   1.00 0.81  ? 27  LYS B CG   3  
ATOM 8627  C CD   . LYS B 1 27  ? -19.952 -3.089  4.055   1.00 0.86  ? 27  LYS B CD   3  
ATOM 8628  C CE   . LYS B 1 27  ? -19.376 -2.284  5.205   1.00 1.11  ? 27  LYS B CE   3  
ATOM 8629  N NZ   . LYS B 1 27  ? -19.958 -0.916  5.266   1.00 1.72  ? 27  LYS B NZ   3  
ATOM 8630  H H    . LYS B 1 27  ? -17.787 -6.397  2.785   1.00 0.61  ? 27  LYS B H    3  
ATOM 8631  H HA   . LYS B 1 27  ? -20.259 -7.235  3.863   1.00 0.93  ? 27  LYS B HA   3  
ATOM 8632  H HB2  . LYS B 1 27  ? -19.680 -4.909  2.027   1.00 0.68  ? 27  LYS B HB2  3  
ATOM 8633  H HB3  . LYS B 1 27  ? -21.174 -5.142  2.913   1.00 0.89  ? 27  LYS B HB3  3  
ATOM 8634  H HG2  . LYS B 1 27  ? -19.880 -4.989  5.025   1.00 0.95  ? 27  LYS B HG2  3  
ATOM 8635  H HG3  . LYS B 1 27  ? -18.448 -4.603  4.065   1.00 0.79  ? 27  LYS B HG3  3  
ATOM 8636  H HD2  . LYS B 1 27  ? -19.609 -2.659  3.128   1.00 1.08  ? 27  LYS B HD2  3  
ATOM 8637  H HD3  . LYS B 1 27  ? -21.030 -3.039  4.098   1.00 1.11  ? 27  LYS B HD3  3  
ATOM 8638  H HE2  . LYS B 1 27  ? -19.585 -2.799  6.131   1.00 1.65  ? 27  LYS B HE2  3  
ATOM 8639  H HE3  . LYS B 1 27  ? -18.307 -2.206  5.069   1.00 1.47  ? 27  LYS B HE3  3  
ATOM 8640  H HZ1  . LYS B 1 27  ? -19.802 -0.416  4.367   1.00 2.17  ? 27  LYS B HZ1  3  
ATOM 8641  H HZ2  . LYS B 1 27  ? -19.516 -0.372  6.032   1.00 2.11  ? 27  LYS B HZ2  3  
ATOM 8642  H HZ3  . LYS B 1 27  ? -20.981 -0.971  5.444   1.00 2.19  ? 27  LYS B HZ3  3  
ATOM 8643  N N    . ASP B 1 28  ? -19.860 -7.602  0.661   1.00 1.00  ? 28  ASP B N    3  
ATOM 8644  C CA   . ASP B 1 28  ? -20.445 -8.142  -0.556  1.00 1.19  ? 28  ASP B CA   3  
ATOM 8645  C C    . ASP B 1 28  ? -20.102 -9.623  -0.705  1.00 1.26  ? 28  ASP B C    3  
ATOM 8646  O O    . ASP B 1 28  ? -20.382 -10.244 -1.728  1.00 1.58  ? 28  ASP B O    3  
ATOM 8647  C CB   . ASP B 1 28  ? -19.963 -7.350  -1.773  1.00 1.33  ? 28  ASP B CB   3  
ATOM 8648  C CG   . ASP B 1 28  ? -20.831 -7.591  -2.990  1.00 1.65  ? 28  ASP B CG   3  
ATOM 8649  O OD1  . ASP B 1 28  ? -22.031 -7.247  -2.941  1.00 2.15  ? 28  ASP B OD1  3  
ATOM 8650  O OD2  . ASP B 1 28  ? -20.331 -8.140  -3.991  1.00 2.09  ? 28  ASP B OD2  3  
ATOM 8651  H H    . ASP B 1 28  ? -18.912 -7.349  0.666   1.00 0.99  ? 28  ASP B H    3  
ATOM 8652  H HA   . ASP B 1 28  ? -21.518 -8.042  -0.476  1.00 1.28  ? 28  ASP B HA   3  
ATOM 8653  H HB2  . ASP B 1 28  ? -19.983 -6.296  -1.542  1.00 1.33  ? 28  ASP B HB2  3  
ATOM 8654  H HB3  . ASP B 1 28  ? -18.951 -7.644  -2.010  1.00 1.44  ? 28  ASP B HB3  3  
ATOM 8655  N N    . GLY B 1 29  ? -19.499 -10.186 0.336   1.00 1.15  ? 29  GLY B N    3  
ATOM 8656  C CA   . GLY B 1 29  ? -19.172 -11.599 0.328   1.00 1.32  ? 29  GLY B CA   3  
ATOM 8657  C C    . GLY B 1 29  ? -17.695 -11.862 0.120   1.00 1.51  ? 29  GLY B C    3  
ATOM 8658  O O    . GLY B 1 29  ? -17.284 -13.021 0.036   1.00 1.64  ? 29  GLY B O    3  
ATOM 8659  H H    . GLY B 1 29  ? -19.286 -9.639  1.121   1.00 1.14  ? 29  GLY B H    3  
ATOM 8660  H HA2  . GLY B 1 29  ? -19.473 -12.030 1.271   1.00 1.61  ? 29  GLY B HA2  3  
ATOM 8661  H HA3  . GLY B 1 29  ? -19.725 -12.079 -0.465  1.00 1.54  ? 29  GLY B HA3  3  
ATOM 8662  N N    . TYR B 1 30  ? -16.903 -10.781 0.044   1.00 2.07  ? 30  TYR B N    3  
ATOM 8663  C CA   . TYR B 1 30  ? -15.442 -10.841 -0.162  1.00 2.80  ? 30  TYR B CA   3  
ATOM 8664  C C    . TYR B 1 30  ? -15.044 -11.833 -1.258  1.00 2.61  ? 30  TYR B C    3  
ATOM 8665  O O    . TYR B 1 30  ? -15.857 -12.191 -2.109  1.00 3.02  ? 30  TYR B O    3  
ATOM 8666  C CB   . TYR B 1 30  ? -14.677 -11.138 1.153   1.00 3.68  ? 30  TYR B CB   3  
ATOM 8667  C CG   . TYR B 1 30  ? -15.115 -12.377 1.915   1.00 4.52  ? 30  TYR B CG   3  
ATOM 8668  C CD1  . TYR B 1 30  ? -14.620 -13.634 1.586   1.00 5.12  ? 30  TYR B CD1  3  
ATOM 8669  C CD2  . TYR B 1 30  ? -16.018 -12.285 2.969   1.00 5.11  ? 30  TYR B CD2  3  
ATOM 8670  C CE1  . TYR B 1 30  ? -15.015 -14.762 2.281   1.00 6.09  ? 30  TYR B CE1  3  
ATOM 8671  C CE2  . TYR B 1 30  ? -16.417 -13.408 3.668   1.00 6.04  ? 30  TYR B CE2  3  
ATOM 8672  C CZ   . TYR B 1 30  ? -15.913 -14.644 3.319   1.00 6.46  ? 30  TYR B CZ   3  
ATOM 8673  O OH   . TYR B 1 30  ? -16.312 -15.766 4.012   1.00 7.51  ? 30  TYR B OH   3  
ATOM 8674  H H    . TYR B 1 30  ? -17.322 -9.898  0.115   1.00 2.21  ? 30  TYR B H    3  
ATOM 8675  H HA   . TYR B 1 30  ? -15.146 -9.858  -0.499  1.00 3.26  ? 30  TYR B HA   3  
ATOM 8676  H HB2  . TYR B 1 30  ? -13.631 -11.263 0.920   1.00 3.86  ? 30  TYR B HB2  3  
ATOM 8677  H HB3  . TYR B 1 30  ? -14.781 -10.292 1.813   1.00 3.94  ? 30  TYR B HB3  3  
ATOM 8678  H HD1  . TYR B 1 30  ? -13.915 -13.724 0.773   1.00 5.08  ? 30  TYR B HD1  3  
ATOM 8679  H HD2  . TYR B 1 30  ? -16.413 -11.318 3.239   1.00 5.08  ? 30  TYR B HD2  3  
ATOM 8680  H HE1  . TYR B 1 30  ? -14.621 -15.729 2.008   1.00 6.74  ? 30  TYR B HE1  3  
ATOM 8681  H HE2  . TYR B 1 30  ? -17.119 -13.316 4.482   1.00 6.63  ? 30  TYR B HE2  3  
ATOM 8682  H HH   . TYR B 1 30  ? -15.538 -16.321 4.197   1.00 7.75  ? 30  TYR B HH   3  
ATOM 8683  N N    . ASN B 1 31  ? -13.765 -12.207 -1.260  1.00 2.62  ? 31  ASN B N    3  
ATOM 8684  C CA   . ASN B 1 31  ? -13.223 -13.219 -2.171  1.00 2.78  ? 31  ASN B CA   3  
ATOM 8685  C C    . ASN B 1 31  ? -12.973 -12.645 -3.568  1.00 1.96  ? 31  ASN B C    3  
ATOM 8686  O O    . ASN B 1 31  ? -12.551 -13.365 -4.476  1.00 2.53  ? 31  ASN B O    3  
ATOM 8687  C CB   . ASN B 1 31  ? -14.142 -14.451 -2.246  1.00 3.85  ? 31  ASN B CB   3  
ATOM 8688  C CG   . ASN B 1 31  ? -13.488 -15.641 -2.924  1.00 4.61  ? 31  ASN B CG   3  
ATOM 8689  O OD1  . ASN B 1 31  ? -12.271 -15.823 -2.854  1.00 4.92  ? 31  ASN B OD1  3  
ATOM 8690  N ND2  . ASN B 1 31  ? -14.292 -16.467 -3.574  1.00 5.33  ? 31  ASN B ND2  3  
ATOM 8691  H H    . ASN B 1 31  ? -13.152 -11.783 -0.624  1.00 2.93  ? 31  ASN B H    3  
ATOM 8692  H HA   . ASN B 1 31  ? -12.272 -13.530 -1.766  1.00 3.24  ? 31  ASN B HA   3  
ATOM 8693  H HB2  . ASN B 1 31  ? -14.421 -14.743 -1.245  1.00 4.17  ? 31  ASN B HB2  3  
ATOM 8694  H HB3  . ASN B 1 31  ? -15.033 -14.191 -2.799  1.00 4.22  ? 31  ASN B HB3  3  
ATOM 8695  H HD21 . ASN B 1 31  ? -15.254 -16.266 -3.584  1.00 5.37  ? 31  ASN B HD21 3  
ATOM 8696  H HD22 . ASN B 1 31  ? -13.896 -17.245 -4.017  1.00 5.97  ? 31  ASN B HD22 3  
ATOM 8697  N N    . TYR B 1 32  ? -13.211 -11.347 -3.753  1.00 1.18  ? 32  TYR B N    3  
ATOM 8698  C CA   . TYR B 1 32  ? -12.926 -10.725 -5.043  1.00 1.18  ? 32  TYR B CA   3  
ATOM 8699  C C    . TYR B 1 32  ? -12.768 -9.199  -4.979  1.00 0.91  ? 32  TYR B C    3  
ATOM 8700  O O    . TYR B 1 32  ? -11.670 -8.691  -5.201  1.00 1.04  ? 32  TYR B O    3  
ATOM 8701  C CB   . TYR B 1 32  ? -13.951 -11.143 -6.125  1.00 1.78  ? 32  TYR B CB   3  
ATOM 8702  C CG   . TYR B 1 32  ? -15.430 -10.882 -5.847  1.00 2.38  ? 32  TYR B CG   3  
ATOM 8703  C CD1  . TYR B 1 32  ? -15.915 -10.580 -4.579  1.00 2.99  ? 32  TYR B CD1  3  
ATOM 8704  C CD2  . TYR B 1 32  ? -16.347 -10.956 -6.887  1.00 3.08  ? 32  TYR B CD2  3  
ATOM 8705  C CE1  . TYR B 1 32  ? -17.263 -10.358 -4.360  1.00 3.86  ? 32  TYR B CE1  3  
ATOM 8706  C CE2  . TYR B 1 32  ? -17.694 -10.739 -6.677  1.00 3.93  ? 32  TYR B CE2  3  
ATOM 8707  C CZ   . TYR B 1 32  ? -18.147 -10.441 -5.414  1.00 4.19  ? 32  TYR B CZ   3  
ATOM 8708  O OH   . TYR B 1 32  ? -19.490 -10.232 -5.206  1.00 5.19  ? 32  TYR B OH   3  
ATOM 8709  H H    . TYR B 1 32  ? -13.576 -10.810 -3.022  1.00 1.45  ? 32  TYR B H    3  
ATOM 8710  H HA   . TYR B 1 32  ? -11.967 -11.119 -5.347  1.00 1.85  ? 32  TYR B HA   3  
ATOM 8711  H HB2  . TYR B 1 32  ? -13.710 -10.622 -7.037  1.00 2.15  ? 32  TYR B HB2  3  
ATOM 8712  H HB3  . TYR B 1 32  ? -13.839 -12.204 -6.301  1.00 2.32  ? 32  TYR B HB3  3  
ATOM 8713  H HD1  . TYR B 1 32  ? -15.222 -10.516 -3.754  1.00 3.17  ? 32  TYR B HD1  3  
ATOM 8714  H HD2  . TYR B 1 32  ? -15.991 -11.189 -7.880  1.00 3.32  ? 32  TYR B HD2  3  
ATOM 8715  H HE1  . TYR B 1 32  ? -17.617 -10.123 -3.367  1.00 4.54  ? 32  TYR B HE1  3  
ATOM 8716  H HE2  . TYR B 1 32  ? -18.385 -10.803 -7.502  1.00 4.65  ? 32  TYR B HE2  3  
ATOM 8717  H HH   . TYR B 1 32  ? -19.617 -9.433  -4.660  1.00 5.57  ? 32  TYR B HH   3  
ATOM 8718  N N    . THR B 1 33  ? -13.825 -8.468  -4.659  1.00 0.66  ? 33  THR B N    3  
ATOM 8719  C CA   . THR B 1 33  ? -13.824 -7.027  -4.882  1.00 0.45  ? 33  THR B CA   3  
ATOM 8720  C C    . THR B 1 33  ? -14.553 -6.229  -3.811  1.00 0.37  ? 33  THR B C    3  
ATOM 8721  O O    . THR B 1 33  ? -15.440 -6.725  -3.115  1.00 0.44  ? 33  THR B O    3  
ATOM 8722  C CB   . THR B 1 33  ? -14.469 -6.719  -6.236  1.00 0.45  ? 33  THR B CB   3  
ATOM 8723  O OG1  . THR B 1 33  ? -15.234 -7.840  -6.695  1.00 0.66  ? 33  THR B OG1  3  
ATOM 8724  C CG2  . THR B 1 33  ? -13.437 -6.327  -7.271  1.00 0.43  ? 33  THR B CG2  3  
ATOM 8725  H H    . THR B 1 33  ? -14.619 -8.895  -4.278  1.00 0.73  ? 33  THR B H    3  
ATOM 8726  H HA   . THR B 1 33  ? -12.802 -6.679  -4.919  1.00 0.49  ? 33  THR B HA   3  
ATOM 8727  H HB   . THR B 1 33  ? -15.133 -5.892  -6.098  1.00 0.56  ? 33  THR B HB   3  
ATOM 8728  H HG1  . THR B 1 33  ? -16.152 -7.727  -6.417  1.00 1.28  ? 33  THR B HG1  3  
ATOM 8729  H HG21 . THR B 1 33  ? -13.010 -5.371  -6.999  1.00 1.10  ? 33  THR B HG21 3  
ATOM 8730  H HG22 . THR B 1 33  ? -13.913 -6.244  -8.237  1.00 0.99  ? 33  THR B HG22 3  
ATOM 8731  H HG23 . THR B 1 33  ? -12.658 -7.072  -7.307  1.00 1.14  ? 33  THR B HG23 3  
ATOM 8732  N N    . LEU B 1 34  ? -14.124 -4.981  -3.697  1.00 0.32  ? 34  LEU B N    3  
ATOM 8733  C CA   . LEU B 1 34  ? -14.778 -3.970  -2.892  1.00 0.30  ? 34  LEU B CA   3  
ATOM 8734  C C    . LEU B 1 34  ? -15.815 -3.280  -3.752  1.00 0.31  ? 34  LEU B C    3  
ATOM 8735  O O    . LEU B 1 34  ? -15.481 -2.492  -4.637  1.00 0.34  ? 34  LEU B O    3  
ATOM 8736  C CB   . LEU B 1 34  ? -13.708 -2.986  -2.401  1.00 0.29  ? 34  LEU B CB   3  
ATOM 8737  C CG   . LEU B 1 34  ? -13.716 -2.684  -0.905  1.00 0.29  ? 34  LEU B CG   3  
ATOM 8738  C CD1  . LEU B 1 34  ? -12.387 -2.085  -0.473  1.00 0.45  ? 34  LEU B CD1  3  
ATOM 8739  C CD2  . LEU B 1 34  ? -14.842 -1.736  -0.566  1.00 0.28  ? 34  LEU B CD2  3  
ATOM 8740  H H    . LEU B 1 34  ? -13.312 -4.722  -4.188  1.00 0.31  ? 34  LEU B H    3  
ATOM 8741  H HA   . LEU B 1 34  ? -15.277 -4.431  -2.054  1.00 0.32  ? 34  LEU B HA   3  
ATOM 8742  H HB2  . LEU B 1 34  ? -12.735 -3.403  -2.650  1.00 0.34  ? 34  LEU B HB2  3  
ATOM 8743  H HB3  . LEU B 1 34  ? -13.841 -2.050  -2.937  1.00 0.33  ? 34  LEU B HB3  3  
ATOM 8744  H HG   . LEU B 1 34  ? -13.867 -3.603  -0.361  1.00 0.32  ? 34  LEU B HG   3  
ATOM 8745  H HD11 . LEU B 1 34  ? -12.216 -1.162  -1.007  1.00 1.03  ? 34  LEU B HD11 3  
ATOM 8746  H HD12 . LEU B 1 34  ? -11.592 -2.780  -0.691  1.00 1.18  ? 34  LEU B HD12 3  
ATOM 8747  H HD13 . LEU B 1 34  ? -12.410 -1.888  0.589   1.00 1.09  ? 34  LEU B HD13 3  
ATOM 8748  H HD21 . LEU B 1 34  ? -14.831 -1.527  0.494   1.00 1.05  ? 34  LEU B HD21 3  
ATOM 8749  H HD22 . LEU B 1 34  ? -15.781 -2.189  -0.836  1.00 1.09  ? 34  LEU B HD22 3  
ATOM 8750  H HD23 . LEU B 1 34  ? -14.714 -0.813  -1.114  1.00 1.01  ? 34  LEU B HD23 3  
ATOM 8751  N N    . SER B 1 35  ? -17.070 -3.624  -3.502  1.00 0.31  ? 35  SER B N    3  
ATOM 8752  C CA   . SER B 1 35  ? -18.175 -3.179  -4.330  1.00 0.33  ? 35  SER B CA   3  
ATOM 8753  C C    . SER B 1 35  ? -18.319 -1.665  -4.295  1.00 0.32  ? 35  SER B C    3  
ATOM 8754  O O    . SER B 1 35  ? -17.770 -1.006  -3.414  1.00 0.30  ? 35  SER B O    3  
ATOM 8755  C CB   . SER B 1 35  ? -19.465 -3.866  -3.879  1.00 0.37  ? 35  SER B CB   3  
ATOM 8756  O OG   . SER B 1 35  ? -20.544 -3.570  -4.749  1.00 0.40  ? 35  SER B OG   3  
ATOM 8757  H H    . SER B 1 35  ? -17.259 -4.200  -2.733  1.00 0.33  ? 35  SER B H    3  
ATOM 8758  H HA   . SER B 1 35  ? -17.958 -3.477  -5.336  1.00 0.35  ? 35  SER B HA   3  
ATOM 8759  H HB2  . SER B 1 35  ? -19.313 -4.936  -3.870  1.00 0.38  ? 35  SER B HB2  3  
ATOM 8760  H HB3  . SER B 1 35  ? -19.715 -3.532  -2.884  1.00 0.38  ? 35  SER B HB3  3  
ATOM 8761  H HG   . SER B 1 35  ? -21.305 -3.292  -4.225  1.00 0.68  ? 35  SER B HG   3  
ATOM 8762  N N    . LYS B 1 36  ? -19.058 -1.122  -5.261  1.00 0.38  ? 36  LYS B N    3  
ATOM 8763  C CA   . LYS B 1 36  ? -19.219 0.320   -5.401  1.00 0.42  ? 36  LYS B CA   3  
ATOM 8764  C C    . LYS B 1 36  ? -19.613 0.955   -4.074  1.00 0.36  ? 36  LYS B C    3  
ATOM 8765  O O    . LYS B 1 36  ? -18.870 1.767   -3.530  1.00 0.35  ? 36  LYS B O    3  
ATOM 8766  C CB   . LYS B 1 36  ? -20.271 0.637   -6.468  1.00 0.53  ? 36  LYS B CB   3  
ATOM 8767  C CG   . LYS B 1 36  ? -20.425 2.122   -6.758  1.00 0.62  ? 36  LYS B CG   3  
ATOM 8768  C CD   . LYS B 1 36  ? -19.148 2.712   -7.333  1.00 0.66  ? 36  LYS B CD   3  
ATOM 8769  C CE   . LYS B 1 36  ? -19.316 4.181   -7.697  1.00 0.61  ? 36  LYS B CE   3  
ATOM 8770  N NZ   . LYS B 1 36  ? -20.233 4.376   -8.851  1.00 0.65  ? 36  LYS B NZ   3  
ATOM 8771  H H    . LYS B 1 36  ? -19.512 -1.716  -5.901  1.00 0.43  ? 36  LYS B H    3  
ATOM 8772  H HA   . LYS B 1 36  ? -18.269 0.728   -5.714  1.00 0.46  ? 36  LYS B HA   3  
ATOM 8773  H HB2  . LYS B 1 36  ? -19.993 0.142   -7.387  1.00 0.58  ? 36  LYS B HB2  3  
ATOM 8774  H HB3  . LYS B 1 36  ? -21.225 0.256   -6.139  1.00 0.56  ? 36  LYS B HB3  3  
ATOM 8775  H HG2  . LYS B 1 36  ? -21.225 2.260   -7.468  1.00 1.07  ? 36  LYS B HG2  3  
ATOM 8776  H HG3  . LYS B 1 36  ? -20.664 2.634   -5.837  1.00 1.21  ? 36  LYS B HG3  3  
ATOM 8777  H HD2  . LYS B 1 36  ? -18.360 2.622   -6.600  1.00 1.25  ? 36  LYS B HD2  3  
ATOM 8778  H HD3  . LYS B 1 36  ? -18.876 2.157   -8.225  1.00 1.12  ? 36  LYS B HD3  3  
ATOM 8779  H HE2  . LYS B 1 36  ? -19.715 4.705   -6.843  1.00 0.66  ? 36  LYS B HE2  3  
ATOM 8780  H HE3  . LYS B 1 36  ? -18.346 4.588   -7.945  1.00 0.58  ? 36  LYS B HE3  3  
ATOM 8781  H HZ1  . LYS B 1 36  ? -19.957 3.756   -9.638  1.00 1.18  ? 36  LYS B HZ1  3  
ATOM 8782  H HZ2  . LYS B 1 36  ? -20.188 5.368   -9.180  1.00 1.14  ? 36  LYS B HZ2  3  
ATOM 8783  H HZ3  . LYS B 1 36  ? -21.214 4.159   -8.576  1.00 1.16  ? 36  LYS B HZ3  3  
ATOM 8784  N N    . THR B 1 37  ? -20.758 0.554   -3.541  1.00 0.37  ? 37  THR B N    3  
ATOM 8785  C CA   . THR B 1 37  ? -21.250 1.100   -2.284  1.00 0.38  ? 37  THR B CA   3  
ATOM 8786  C C    . THR B 1 37  ? -20.310 0.775   -1.122  1.00 0.36  ? 37  THR B C    3  
ATOM 8787  O O    . THR B 1 37  ? -20.180 1.555   -0.177  1.00 0.38  ? 37  THR B O    3  
ATOM 8788  C CB   . THR B 1 37  ? -22.651 0.560   -1.965  1.00 0.44  ? 37  THR B CB   3  
ATOM 8789  O OG1  . THR B 1 37  ? -23.543 0.835   -3.056  1.00 0.47  ? 37  THR B OG1  3  
ATOM 8790  C CG2  . THR B 1 37  ? -23.192 1.187   -0.691  1.00 0.49  ? 37  THR B CG2  3  
ATOM 8791  H H    . THR B 1 37  ? -21.290 -0.128  -4.004  1.00 0.39  ? 37  THR B H    3  
ATOM 8792  H HA   . THR B 1 37  ? -21.317 2.174   -2.390  1.00 0.39  ? 37  THR B HA   3  
ATOM 8793  H HB   . THR B 1 37  ? -22.580 -0.510  -1.824  1.00 0.44  ? 37  THR B HB   3  
ATOM 8794  H HG1  . THR B 1 37  ? -23.992 0.016   -3.314  1.00 0.79  ? 37  THR B HG1  3  
ATOM 8795  H HG21 . THR B 1 37  ? -24.177 0.796   -0.485  1.00 1.15  ? 37  THR B HG21 3  
ATOM 8796  H HG22 . THR B 1 37  ? -23.246 2.259   -0.815  1.00 1.09  ? 37  THR B HG22 3  
ATOM 8797  H HG23 . THR B 1 37  ? -22.531 0.955   0.132   1.00 1.12  ? 37  THR B HG23 3  
ATOM 8798  N N    . GLU B 1 38  ? -19.629 -0.358  -1.214  1.00 0.34  ? 38  GLU B N    3  
ATOM 8799  C CA   . GLU B 1 38  ? -18.720 -0.782  -0.164  1.00 0.33  ? 38  GLU B CA   3  
ATOM 8800  C C    . GLU B 1 38  ? -17.501 0.119   -0.156  1.00 0.33  ? 38  GLU B C    3  
ATOM 8801  O O    . GLU B 1 38  ? -16.907 0.380   0.888   1.00 0.48  ? 38  GLU B O    3  
ATOM 8802  C CB   . GLU B 1 38  ? -18.319 -2.245  -0.349  1.00 0.34  ? 38  GLU B CB   3  
ATOM 8803  C CG   . GLU B 1 38  ? -19.343 -3.236  0.182   1.00 0.47  ? 38  GLU B CG   3  
ATOM 8804  C CD   . GLU B 1 38  ? -20.757 -2.954  -0.280  1.00 1.27  ? 38  GLU B CD   3  
ATOM 8805  O OE1  . GLU B 1 38  ? -21.156 -3.462  -1.343  1.00 1.96  ? 38  GLU B OE1  3  
ATOM 8806  O OE2  . GLU B 1 38  ? -21.479 -2.224  0.428   1.00 2.16  ? 38  GLU B OE2  3  
ATOM 8807  H H    . GLU B 1 38  ? -19.717 -0.907  -2.022  1.00 0.34  ? 38  GLU B H    3  
ATOM 8808  H HA   . GLU B 1 38  ? -19.229 -0.680  0.776   1.00 0.35  ? 38  GLU B HA   3  
ATOM 8809  H HB2  . GLU B 1 38  ? -18.174 -2.437  -1.400  1.00 0.41  ? 38  GLU B HB2  3  
ATOM 8810  H HB3  . GLU B 1 38  ? -17.389 -2.415  0.173   1.00 0.45  ? 38  GLU B HB3  3  
ATOM 8811  H HG2  . GLU B 1 38  ? -19.069 -4.227  -0.145  1.00 1.15  ? 38  GLU B HG2  3  
ATOM 8812  H HG3  . GLU B 1 38  ? -19.323 -3.199  1.261   1.00 1.30  ? 38  GLU B HG3  3  
ATOM 8813  N N    . PHE B 1 39  ? -17.159 0.613   -1.335  1.00 0.29  ? 39  PHE B N    3  
ATOM 8814  C CA   . PHE B 1 39  ? -16.042 1.516   -1.501  1.00 0.31  ? 39  PHE B CA   3  
ATOM 8815  C C    . PHE B 1 39  ? -16.456 2.909   -1.077  1.00 0.28  ? 39  PHE B C    3  
ATOM 8816  O O    . PHE B 1 39  ? -15.662 3.669   -0.525  1.00 0.27  ? 39  PHE B O    3  
ATOM 8817  C CB   . PHE B 1 39  ? -15.598 1.517   -2.961  1.00 0.53  ? 39  PHE B CB   3  
ATOM 8818  C CG   . PHE B 1 39  ? -14.317 2.250   -3.202  1.00 0.81  ? 39  PHE B CG   3  
ATOM 8819  C CD1  . PHE B 1 39  ? -13.174 1.908   -2.502  1.00 1.78  ? 39  PHE B CD1  3  
ATOM 8820  C CD2  . PHE B 1 39  ? -14.253 3.274   -4.130  1.00 1.76  ? 39  PHE B CD2  3  
ATOM 8821  C CE1  . PHE B 1 39  ? -11.990 2.576   -2.721  1.00 2.66  ? 39  PHE B CE1  3  
ATOM 8822  C CE2  . PHE B 1 39  ? -13.071 3.946   -4.354  1.00 2.61  ? 39  PHE B CE2  3  
ATOM 8823  C CZ   . PHE B 1 39  ? -11.936 3.597   -3.648  1.00 2.87  ? 39  PHE B CZ   3  
ATOM 8824  H H    . PHE B 1 39  ? -17.683 0.359   -2.128  1.00 0.34  ? 39  PHE B H    3  
ATOM 8825  H HA   . PHE B 1 39  ? -15.231 1.179   -0.873  1.00 0.35  ? 39  PHE B HA   3  
ATOM 8826  H HB2  . PHE B 1 39  ? -15.470 0.501   -3.289  1.00 1.23  ? 39  PHE B HB2  3  
ATOM 8827  H HB3  . PHE B 1 39  ? -16.367 1.986   -3.560  1.00 1.41  ? 39  PHE B HB3  3  
ATOM 8828  H HD1  . PHE B 1 39  ? -13.215 1.109   -1.776  1.00 2.31  ? 39  PHE B HD1  3  
ATOM 8829  H HD2  . PHE B 1 39  ? -15.141 3.547   -4.681  1.00 2.30  ? 39  PHE B HD2  3  
ATOM 8830  H HE1  . PHE B 1 39  ? -11.106 2.299   -2.167  1.00 3.51  ? 39  PHE B HE1  3  
ATOM 8831  H HE2  . PHE B 1 39  ? -13.033 4.743   -5.080  1.00 3.44  ? 39  PHE B HE2  3  
ATOM 8832  H HZ   . PHE B 1 39  ? -11.010 4.124   -3.822  1.00 3.69  ? 39  PHE B HZ   3  
ATOM 8833  N N    . LEU B 1 40  ? -17.712 3.227   -1.338  1.00 0.33  ? 40  LEU B N    3  
ATOM 8834  C CA   . LEU B 1 40  ? -18.294 4.477   -0.895  1.00 0.37  ? 40  LEU B CA   3  
ATOM 8835  C C    . LEU B 1 40  ? -18.255 4.539   0.624   1.00 0.40  ? 40  LEU B C    3  
ATOM 8836  O O    . LEU B 1 40  ? -17.817 5.525   1.215   1.00 0.43  ? 40  LEU B O    3  
ATOM 8837  C CB   . LEU B 1 40  ? -19.736 4.594   -1.387  1.00 0.43  ? 40  LEU B CB   3  
ATOM 8838  C CG   . LEU B 1 40  ? -19.948 4.369   -2.888  1.00 0.50  ? 40  LEU B CG   3  
ATOM 8839  C CD1  . LEU B 1 40  ? -21.293 4.920   -3.331  1.00 1.07  ? 40  LEU B CD1  3  
ATOM 8840  C CD2  . LEU B 1 40  ? -18.815 4.970   -3.701  1.00 0.46  ? 40  LEU B CD2  3  
ATOM 8841  H H    . LEU B 1 40  ? -18.265 2.603   -1.859  1.00 0.37  ? 40  LEU B H    3  
ATOM 8842  H HA   . LEU B 1 40  ? -17.709 5.286   -1.301  1.00 0.38  ? 40  LEU B HA   3  
ATOM 8843  H HB2  . LEU B 1 40  ? -20.322 3.860   -0.852  1.00 0.65  ? 40  LEU B HB2  3  
ATOM 8844  H HB3  . LEU B 1 40  ? -20.100 5.578   -1.134  1.00 0.47  ? 40  LEU B HB3  3  
ATOM 8845  H HG   . LEU B 1 40  ? -19.954 3.304   -3.077  1.00 0.80  ? 40  LEU B HG   3  
ATOM 8846  H HD11 . LEU B 1 40  ? -22.082 4.420   -2.790  1.00 1.87  ? 40  LEU B HD11 3  
ATOM 8847  H HD12 . LEU B 1 40  ? -21.418 4.750   -4.390  1.00 1.41  ? 40  LEU B HD12 3  
ATOM 8848  H HD13 . LEU B 1 40  ? -21.332 5.980   -3.129  1.00 1.46  ? 40  LEU B HD13 3  
ATOM 8849  H HD21 . LEU B 1 40  ? -19.037 4.868   -4.752  1.00 1.02  ? 40  LEU B HD21 3  
ATOM 8850  H HD22 . LEU B 1 40  ? -17.901 4.435   -3.474  1.00 0.96  ? 40  LEU B HD22 3  
ATOM 8851  H HD23 . LEU B 1 40  ? -18.699 6.012   -3.450  1.00 1.09  ? 40  LEU B HD23 3  
ATOM 8852  N N    . SER B 1 41  ? -18.695 3.454   1.240   1.00 0.42  ? 41  SER B N    3  
ATOM 8853  C CA   . SER B 1 41  ? -18.652 3.311   2.682   1.00 0.52  ? 41  SER B CA   3  
ATOM 8854  C C    . SER B 1 41  ? -17.209 3.369   3.158   1.00 0.45  ? 41  SER B C    3  
ATOM 8855  O O    . SER B 1 41  ? -16.887 4.107   4.088   1.00 0.47  ? 41  SER B O    3  
ATOM 8856  C CB   . SER B 1 41  ? -19.303 1.986   3.095   1.00 0.67  ? 41  SER B CB   3  
ATOM 8857  O OG   . SER B 1 41  ? -19.305 1.819   4.504   1.00 1.40  ? 41  SER B OG   3  
ATOM 8858  H H    . SER B 1 41  ? -19.061 2.722   0.704   1.00 0.42  ? 41  SER B H    3  
ATOM 8859  H HA   . SER B 1 41  ? -19.201 4.130   3.117   1.00 0.60  ? 41  SER B HA   3  
ATOM 8860  H HB2  . SER B 1 41  ? -20.324 1.965   2.745   1.00 1.27  ? 41  SER B HB2  3  
ATOM 8861  H HB3  . SER B 1 41  ? -18.757 1.167   2.650   1.00 1.19  ? 41  SER B HB3  3  
ATOM 8862  H HG   . SER B 1 41  ? -19.788 2.550   4.912   1.00 1.96  ? 41  SER B HG   3  
ATOM 8863  N N    . PHE B 1 42  ? -16.342 2.604   2.493   1.00 0.42  ? 42  PHE B N    3  
ATOM 8864  C CA   . PHE B 1 42  ? -14.919 2.575   2.814   1.00 0.46  ? 42  PHE B CA   3  
ATOM 8865  C C    . PHE B 1 42  ? -14.325 3.965   2.799   1.00 0.29  ? 42  PHE B C    3  
ATOM 8866  O O    . PHE B 1 42  ? -13.856 4.450   3.811   1.00 0.42  ? 42  PHE B O    3  
ATOM 8867  C CB   . PHE B 1 42  ? -14.152 1.707   1.816   1.00 0.80  ? 42  PHE B CB   3  
ATOM 8868  C CG   . PHE B 1 42  ? -12.694 1.585   2.157   1.00 1.89  ? 42  PHE B CG   3  
ATOM 8869  C CD1  . PHE B 1 42  ? -12.257 0.590   3.010   1.00 2.77  ? 42  PHE B CD1  3  
ATOM 8870  C CD2  . PHE B 1 42  ? -11.767 2.479   1.643   1.00 2.69  ? 42  PHE B CD2  3  
ATOM 8871  C CE1  . PHE B 1 42  ? -10.925 0.486   3.349   1.00 3.80  ? 42  PHE B CE1  3  
ATOM 8872  C CE2  . PHE B 1 42  ? -10.433 2.379   1.975   1.00 3.73  ? 42  PHE B CE2  3  
ATOM 8873  C CZ   . PHE B 1 42  ? -10.011 1.382   2.832   1.00 4.13  ? 42  PHE B CZ   3  
ATOM 8874  H H    . PHE B 1 42  ? -16.674 2.032   1.764   1.00 0.44  ? 42  PHE B H    3  
ATOM 8875  H HA   . PHE B 1 42  ? -14.798 2.164   3.803   1.00 0.66  ? 42  PHE B HA   3  
ATOM 8876  H HB2  . PHE B 1 42  ? -14.580 0.710   1.796   1.00 0.53  ? 42  PHE B HB2  3  
ATOM 8877  H HB3  . PHE B 1 42  ? -14.229 2.161   0.831   1.00 1.30  ? 42  PHE B HB3  3  
ATOM 8878  H HD1  . PHE B 1 42  ? -12.971 -0.112  3.416   1.00 3.00  ? 42  PHE B HD1  3  
ATOM 8879  H HD2  . PHE B 1 42  ? -12.098 3.258   0.973   1.00 2.86  ? 42  PHE B HD2  3  
ATOM 8880  H HE1  . PHE B 1 42  ? -10.596 -0.294  4.017   1.00 4.59  ? 42  PHE B HE1  3  
ATOM 8881  H HE2  . PHE B 1 42  ? -9.721  3.081   1.570   1.00 4.49  ? 42  PHE B HE2  3  
ATOM 8882  H HZ   . PHE B 1 42  ? -8.968  1.302   3.096   1.00 5.02  ? 42  PHE B HZ   3  
ATOM 8883  N N    . MET B 1 43  ? -14.344 4.603   1.651   1.00 0.26  ? 43  MET B N    3  
ATOM 8884  C CA   . MET B 1 43  ? -13.671 5.884   1.501   1.00 0.29  ? 43  MET B CA   3  
ATOM 8885  C C    . MET B 1 43  ? -14.230 6.958   2.426   1.00 0.29  ? 43  MET B C    3  
ATOM 8886  O O    . MET B 1 43  ? -13.492 7.831   2.864   1.00 0.37  ? 43  MET B O    3  
ATOM 8887  C CB   . MET B 1 43  ? -13.735 6.372   0.072   1.00 0.38  ? 43  MET B CB   3  
ATOM 8888  C CG   . MET B 1 43  ? -12.850 5.596   -0.887  1.00 0.62  ? 43  MET B CG   3  
ATOM 8889  S SD   . MET B 1 43  ? -12.356 6.568   -2.325  1.00 1.22  ? 43  MET B SD   3  
ATOM 8890  C CE   . MET B 1 43  ? -11.302 7.805   -1.567  1.00 2.25  ? 43  MET B CE   3  
ATOM 8891  H H    . MET B 1 43  ? -14.810 4.197   0.878   1.00 0.29  ? 43  MET B H    3  
ATOM 8892  H HA   . MET B 1 43  ? -12.635 5.727   1.759   1.00 0.35  ? 43  MET B HA   3  
ATOM 8893  H HB2  . MET B 1 43  ? -14.754 6.284   -0.263  1.00 0.75  ? 43  MET B HB2  3  
ATOM 8894  H HB3  . MET B 1 43  ? -13.442 7.408   0.051   1.00 0.69  ? 43  MET B HB3  3  
ATOM 8895  H HG2  . MET B 1 43  ? -11.962 5.282   -0.362  1.00 1.11  ? 43  MET B HG2  3  
ATOM 8896  H HG3  . MET B 1 43  ? -13.390 4.725   -1.228  1.00 1.23  ? 43  MET B HG3  3  
ATOM 8897  H HE1  . MET B 1 43  ? -10.905 8.458   -2.330  1.00 2.63  ? 43  MET B HE1  3  
ATOM 8898  H HE2  . MET B 1 43  ? -10.489 7.319   -1.052  1.00 2.66  ? 43  MET B HE2  3  
ATOM 8899  H HE3  . MET B 1 43  ? -11.879 8.386   -0.862  1.00 2.85  ? 43  MET B HE3  3  
ATOM 8900  N N    . ASN B 1 44  ? -15.519 6.915   2.727   1.00 0.29  ? 44  ASN B N    3  
ATOM 8901  C CA   . ASN B 1 44  ? -16.090 7.913   3.627   1.00 0.33  ? 44  ASN B CA   3  
ATOM 8902  C C    . ASN B 1 44  ? -15.731 7.630   5.076   1.00 0.32  ? 44  ASN B C    3  
ATOM 8903  O O    . ASN B 1 44  ? -15.864 8.504   5.926   1.00 0.39  ? 44  ASN B O    3  
ATOM 8904  C CB   . ASN B 1 44  ? -17.605 7.998   3.524   1.00 0.42  ? 44  ASN B CB   3  
ATOM 8905  C CG   . ASN B 1 44  ? -18.098 8.810   2.341   1.00 1.05  ? 44  ASN B CG   3  
ATOM 8906  O OD1  . ASN B 1 44  ? -18.202 10.035  2.417   1.00 1.53  ? 44  ASN B OD1  3  
ATOM 8907  N ND2  . ASN B 1 44  ? -18.437 8.140   1.258   1.00 1.83  ? 44  ASN B ND2  3  
ATOM 8908  H H    . ASN B 1 44  ? -16.092 6.215   2.340   1.00 0.30  ? 44  ASN B H    3  
ATOM 8909  H HA   . ASN B 1 44  ? -15.673 8.870   3.350   1.00 0.37  ? 44  ASN B HA   3  
ATOM 8910  H HB2  . ASN B 1 44  ? -18.004 7.006   3.449   1.00 1.03  ? 44  ASN B HB2  3  
ATOM 8911  H HB3  . ASN B 1 44  ? -17.977 8.456   4.423   1.00 0.89  ? 44  ASN B HB3  3  
ATOM 8912  H HD21 . ASN B 1 44  ? -18.354 7.160   1.273   1.00 1.98  ? 44  ASN B HD21 3  
ATOM 8913  H HD22 . ASN B 1 44  ? -18.768 8.644   0.482   1.00 2.46  ? 44  ASN B HD22 3  
ATOM 8914  N N    . THR B 1 45  ? -15.320 6.407   5.369   1.00 0.27  ? 45  THR B N    3  
ATOM 8915  C CA   . THR B 1 45  ? -14.961 6.051   6.741   1.00 0.29  ? 45  THR B CA   3  
ATOM 8916  C C    . THR B 1 45  ? -13.455 5.938   6.915   1.00 0.28  ? 45  THR B C    3  
ATOM 8917  O O    . THR B 1 45  ? -12.835 6.707   7.652   1.00 0.34  ? 45  THR B O    3  
ATOM 8918  C CB   . THR B 1 45  ? -15.604 4.720   7.163   1.00 0.30  ? 45  THR B CB   3  
ATOM 8919  O OG1  . THR B 1 45  ? -15.395 3.736   6.146   1.00 0.34  ? 45  THR B OG1  3  
ATOM 8920  C CG2  . THR B 1 45  ? -17.091 4.886   7.420   1.00 0.34  ? 45  THR B CG2  3  
ATOM 8921  H H    . THR B 1 45  ? -15.253 5.730   4.651   1.00 0.24  ? 45  THR B H    3  
ATOM 8922  H HA   . THR B 1 45  ? -15.331 6.826   7.394   1.00 0.33  ? 45  THR B HA   3  
ATOM 8923  H HB   . THR B 1 45  ? -15.129 4.382   8.073   1.00 0.30  ? 45  THR B HB   3  
ATOM 8924  H HG1  . THR B 1 45  ? -16.064 3.846   5.453   1.00 1.03  ? 45  THR B HG1  3  
ATOM 8925  H HG21 . THR B 1 45  ? -17.571 5.252   6.524   1.00 1.04  ? 45  THR B HG21 3  
ATOM 8926  H HG22 . THR B 1 45  ? -17.242 5.592   8.223   1.00 1.14  ? 45  THR B HG22 3  
ATOM 8927  H HG23 . THR B 1 45  ? -17.518 3.933   7.693   1.00 1.05  ? 45  THR B HG23 3  
ATOM 8928  N N    . GLU B 1 46  ? -12.877 4.994   6.196   1.00 0.23  ? 46  GLU B N    3  
ATOM 8929  C CA   . GLU B 1 46  ? -11.476 4.665   6.316   1.00 0.25  ? 46  GLU B CA   3  
ATOM 8930  C C    . GLU B 1 46  ? -10.609 5.676   5.576   1.00 0.25  ? 46  GLU B C    3  
ATOM 8931  O O    . GLU B 1 46  ? -9.396  5.667   5.703   1.00 0.34  ? 46  GLU B O    3  
ATOM 8932  C CB   . GLU B 1 46  ? -11.216 3.261   5.776   1.00 0.29  ? 46  GLU B CB   3  
ATOM 8933  C CG   . GLU B 1 46  ? -12.068 2.185   6.431   1.00 0.57  ? 46  GLU B CG   3  
ATOM 8934  C CD   . GLU B 1 46  ? -11.829 2.060   7.923   1.00 1.17  ? 46  GLU B CD   3  
ATOM 8935  O OE1  . GLU B 1 46  ? -12.484 2.782   8.699   1.00 1.68  ? 46  GLU B OE1  3  
ATOM 8936  O OE2  . GLU B 1 46  ? -10.991 1.226   8.328   1.00 1.70  ? 46  GLU B OE2  3  
ATOM 8937  H H    . GLU B 1 46  ? -13.427 4.488   5.554   1.00 0.20  ? 46  GLU B H    3  
ATOM 8938  H HA   . GLU B 1 46  ? -11.225 4.684   7.364   1.00 0.28  ? 46  GLU B HA   3  
ATOM 8939  H HB2  . GLU B 1 46  ? -11.410 3.251   4.717   1.00 0.43  ? 46  GLU B HB2  3  
ATOM 8940  H HB3  . GLU B 1 46  ? -10.185 3.014   5.940   1.00 0.54  ? 46  GLU B HB3  3  
ATOM 8941  H HG2  . GLU B 1 46  ? -13.109 2.422   6.271   1.00 0.66  ? 46  GLU B HG2  3  
ATOM 8942  H HG3  . GLU B 1 46  ? -11.843 1.236   5.965   1.00 0.71  ? 46  GLU B HG3  3  
ATOM 8943  N N    . LEU B 1 47  ? -11.224 6.533   4.784   1.00 0.25  ? 47  LEU B N    3  
ATOM 8944  C CA   . LEU B 1 47  ? -10.486 7.596   4.123   1.00 0.26  ? 47  LEU B CA   3  
ATOM 8945  C C    . LEU B 1 47  ? -11.220 8.910   4.254   1.00 0.28  ? 47  LEU B C    3  
ATOM 8946  O O    . LEU B 1 47  ? -11.120 9.781   3.389   1.00 0.30  ? 47  LEU B O    3  
ATOM 8947  C CB   . LEU B 1 47  ? -10.258 7.267   2.653   1.00 0.26  ? 47  LEU B CB   3  
ATOM 8948  C CG   . LEU B 1 47  ? -9.387  6.044   2.403   1.00 0.27  ? 47  LEU B CG   3  
ATOM 8949  C CD1  . LEU B 1 47  ? -9.341  5.731   0.924   1.00 0.32  ? 47  LEU B CD1  3  
ATOM 8950  C CD2  . LEU B 1 47  ? -7.990  6.279   2.957   1.00 0.28  ? 47  LEU B CD2  3  
ATOM 8951  H H    . LEU B 1 47  ? -12.186 6.442   4.627   1.00 0.29  ? 47  LEU B H    3  
ATOM 8952  H HA   . LEU B 1 47  ? -9.528  7.686   4.614   1.00 0.29  ? 47  LEU B HA   3  
ATOM 8953  H HB2  . LEU B 1 47  ? -11.218 7.109   2.185   1.00 0.27  ? 47  LEU B HB2  3  
ATOM 8954  H HB3  . LEU B 1 47  ? -9.784  8.118   2.189   1.00 0.27  ? 47  LEU B HB3  3  
ATOM 8955  H HG   . LEU B 1 47  ? -9.815  5.193   2.911   1.00 0.29  ? 47  LEU B HG   3  
ATOM 8956  H HD11 . LEU B 1 47  ? -10.339 5.523   0.571   1.00 1.00  ? 47  LEU B HD11 3  
ATOM 8957  H HD12 . LEU B 1 47  ? -8.713  4.868   0.759   1.00 0.94  ? 47  LEU B HD12 3  
ATOM 8958  H HD13 . LEU B 1 47  ? -8.938  6.578   0.388   1.00 0.95  ? 47  LEU B HD13 3  
ATOM 8959  H HD21 . LEU B 1 47  ? -8.051  6.430   4.026   1.00 0.92  ? 47  LEU B HD21 3  
ATOM 8960  H HD22 . LEU B 1 47  ? -7.562  7.157   2.495   1.00 1.01  ? 47  LEU B HD22 3  
ATOM 8961  H HD23 . LEU B 1 47  ? -7.369  5.421   2.749   1.00 1.12  ? 47  LEU B HD23 3  
ATOM 8962  N N    . ALA B 1 48  ? -11.978 9.039   5.331   1.00 0.32  ? 48  ALA B N    3  
ATOM 8963  C CA   . ALA B 1 48  ? -12.729 10.249  5.601   1.00 0.37  ? 48  ALA B CA   3  
ATOM 8964  C C    . ALA B 1 48  ? -11.818 11.475  5.660   1.00 0.39  ? 48  ALA B C    3  
ATOM 8965  O O    . ALA B 1 48  ? -12.264 12.593  5.417   1.00 0.44  ? 48  ALA B O    3  
ATOM 8966  C CB   . ALA B 1 48  ? -13.518 10.083  6.884   1.00 0.41  ? 48  ALA B CB   3  
ATOM 8967  H H    . ALA B 1 48  ? -12.050 8.288   5.957   1.00 0.34  ? 48  ALA B H    3  
ATOM 8968  H HA   . ALA B 1 48  ? -13.430 10.384  4.791   1.00 0.39  ? 48  ALA B HA   3  
ATOM 8969  H HB1  . ALA B 1 48  ? -12.843 9.883   7.702   1.00 1.06  ? 48  ALA B HB1  3  
ATOM 8970  H HB2  . ALA B 1 48  ? -14.207 9.251   6.769   1.00 1.14  ? 48  ALA B HB2  3  
ATOM 8971  H HB3  . ALA B 1 48  ? -14.076 10.985  7.085   1.00 1.02  ? 48  ALA B HB3  3  
ATOM 8972  N N    . ALA B 1 49  ? -10.542 11.259  5.957   1.00 0.38  ? 49  ALA B N    3  
ATOM 8973  C CA   . ALA B 1 49  ? -9.550  12.327  5.905   1.00 0.41  ? 49  ALA B CA   3  
ATOM 8974  C C    . ALA B 1 49  ? -9.503  12.938  4.512   1.00 0.41  ? 49  ALA B C    3  
ATOM 8975  O O    . ALA B 1 49  ? -9.552  14.159  4.343   1.00 0.47  ? 49  ALA B O    3  
ATOM 8976  C CB   . ALA B 1 49  ? -8.177  11.785  6.273   1.00 0.44  ? 49  ALA B CB   3  
ATOM 8977  H H    . ALA B 1 49  ? -10.258 10.357  6.227   1.00 0.37  ? 49  ALA B H    3  
ATOM 8978  H HA   . ALA B 1 49  ? -9.824  13.085  6.619   1.00 0.45  ? 49  ALA B HA   3  
ATOM 8979  H HB1  . ALA B 1 49  ? -7.909  10.990  5.585   1.00 1.15  ? 49  ALA B HB1  3  
ATOM 8980  H HB2  . ALA B 1 49  ? -8.199  11.397  7.280   1.00 1.10  ? 49  ALA B HB2  3  
ATOM 8981  H HB3  . ALA B 1 49  ? -7.447  12.577  6.206   1.00 1.07  ? 49  ALA B HB3  3  
ATOM 8982  N N    . PHE B 1 50  ? -9.443  12.067  3.521   1.00 0.36  ? 50  PHE B N    3  
ATOM 8983  C CA   . PHE B 1 50  ? -9.297  12.467  2.135   1.00 0.37  ? 50  PHE B CA   3  
ATOM 8984  C C    . PHE B 1 50  ? -10.654 12.781  1.509   1.00 0.38  ? 50  PHE B C    3  
ATOM 8985  O O    . PHE B 1 50  ? -10.785 13.693  0.693   1.00 0.44  ? 50  PHE B O    3  
ATOM 8986  C CB   . PHE B 1 50  ? -8.624  11.331  1.369   1.00 0.35  ? 50  PHE B CB   3  
ATOM 8987  C CG   . PHE B 1 50  ? -8.057  11.739  0.037   1.00 0.70  ? 50  PHE B CG   3  
ATOM 8988  C CD1  . PHE B 1 50  ? -6.752  12.197  -0.060  1.00 1.63  ? 50  PHE B CD1  3  
ATOM 8989  C CD2  . PHE B 1 50  ? -8.825  11.667  -1.115  1.00 1.33  ? 50  PHE B CD2  3  
ATOM 8990  C CE1  . PHE B 1 50  ? -6.223  12.574  -1.279  1.00 2.10  ? 50  PHE B CE1  3  
ATOM 8991  C CE2  . PHE B 1 50  ? -8.301  12.043  -2.337  1.00 1.67  ? 50  PHE B CE2  3  
ATOM 8992  C CZ   . PHE B 1 50  ? -6.999  12.497  -2.419  1.00 1.80  ? 50  PHE B CZ   3  
ATOM 8993  H H    . PHE B 1 50  ? -9.502  11.109  3.733   1.00 0.32  ? 50  PHE B H    3  
ATOM 8994  H HA   . PHE B 1 50  ? -8.670  13.345  2.096   1.00 0.41  ? 50  PHE B HA   3  
ATOM 8995  H HB2  . PHE B 1 50  ? -7.819  10.933  1.968   1.00 0.61  ? 50  PHE B HB2  3  
ATOM 8996  H HB3  . PHE B 1 50  ? -9.357  10.551  1.198   1.00 0.56  ? 50  PHE B HB3  3  
ATOM 8997  H HD1  . PHE B 1 50  ? -6.146  12.257  0.831   1.00 2.27  ? 50  PHE B HD1  3  
ATOM 8998  H HD2  . PHE B 1 50  ? -9.843  11.313  -1.052  1.00 2.01  ? 50  PHE B HD2  3  
ATOM 8999  H HE1  . PHE B 1 50  ? -5.205  12.928  -1.341  1.00 2.96  ? 50  PHE B HE1  3  
ATOM 9000  H HE2  . PHE B 1 50  ? -8.909  11.983  -3.226  1.00 2.32  ? 50  PHE B HE2  3  
ATOM 9001  H HZ   . PHE B 1 50  ? -6.588  12.792  -3.374  1.00 2.24  ? 50  PHE B HZ   3  
ATOM 9002  N N    . THR B 1 51  ? -11.656 12.014  1.893   1.00 0.36  ? 51  THR B N    3  
ATOM 9003  C CA   . THR B 1 51  ? -12.972 12.103  1.292   1.00 0.40  ? 51  THR B CA   3  
ATOM 9004  C C    . THR B 1 51  ? -13.820 13.235  1.876   1.00 0.45  ? 51  THR B C    3  
ATOM 9005  O O    . THR B 1 51  ? -14.347 14.066  1.139   1.00 0.53  ? 51  THR B O    3  
ATOM 9006  C CB   . THR B 1 51  ? -13.713 10.772  1.476   1.00 0.39  ? 51  THR B CB   3  
ATOM 9007  O OG1  . THR B 1 51  ? -12.981 9.714   0.844   1.00 0.39  ? 51  THR B OG1  3  
ATOM 9008  C CG2  . THR B 1 51  ? -15.122 10.841  0.911   1.00 0.49  ? 51  THR B CG2  3  
ATOM 9009  H H    . THR B 1 51  ? -11.500 11.342  2.592   1.00 0.36  ? 51  THR B H    3  
ATOM 9010  H HA   . THR B 1 51  ? -12.845 12.272  0.234   1.00 0.44  ? 51  THR B HA   3  
ATOM 9011  H HB   . THR B 1 51  ? -13.774 10.566  2.534   1.00 0.36  ? 51  THR B HB   3  
ATOM 9012  H HG1  . THR B 1 51  ? -12.776 9.038   1.501   1.00 0.41  ? 51  THR B HG1  3  
ATOM 9013  H HG21 . THR B 1 51  ? -15.585 9.868   0.980   1.00 1.13  ? 51  THR B HG21 3  
ATOM 9014  H HG22 . THR B 1 51  ? -15.081 11.151  -0.121  1.00 1.14  ? 51  THR B HG22 3  
ATOM 9015  H HG23 . THR B 1 51  ? -15.698 11.555  1.479   1.00 1.03  ? 51  THR B HG23 3  
ATOM 9016  N N    . LYS B 1 52  ? -13.929 13.279  3.198   1.00 0.47  ? 52  LYS B N    3  
ATOM 9017  C CA   . LYS B 1 52  ? -14.921 14.128  3.857   1.00 0.60  ? 52  LYS B CA   3  
ATOM 9018  C C    . LYS B 1 52  ? -14.613 15.611  3.737   1.00 0.69  ? 52  LYS B C    3  
ATOM 9019  O O    . LYS B 1 52  ? -15.464 16.450  4.036   1.00 0.84  ? 52  LYS B O    3  
ATOM 9020  C CB   . LYS B 1 52  ? -15.052 13.749  5.321   1.00 0.70  ? 52  LYS B CB   3  
ATOM 9021  C CG   . LYS B 1 52  ? -15.768 12.429  5.530   1.00 0.78  ? 52  LYS B CG   3  
ATOM 9022  C CD   . LYS B 1 52  ? -17.215 12.511  5.080   1.00 1.07  ? 52  LYS B CD   3  
ATOM 9023  C CE   . LYS B 1 52  ? -17.987 11.249  5.423   1.00 1.24  ? 52  LYS B CE   3  
ATOM 9024  N NZ   . LYS B 1 52  ? -19.390 11.313  4.932   1.00 1.82  ? 52  LYS B NZ   3  
ATOM 9025  H H    . LYS B 1 52  ? -13.319 12.741  3.750   1.00 0.45  ? 52  LYS B H    3  
ATOM 9026  H HA   . LYS B 1 52  ? -15.867 13.936  3.380   1.00 0.65  ? 52  LYS B HA   3  
ATOM 9027  H HB2  . LYS B 1 52  ? -14.062 13.680  5.752   1.00 0.71  ? 52  LYS B HB2  3  
ATOM 9028  H HB3  . LYS B 1 52  ? -15.604 14.522  5.830   1.00 0.79  ? 52  LYS B HB3  3  
ATOM 9029  H HG2  . LYS B 1 52  ? -15.267 11.672  4.946   1.00 1.34  ? 52  LYS B HG2  3  
ATOM 9030  H HG3  . LYS B 1 52  ? -15.735 12.169  6.577   1.00 1.23  ? 52  LYS B HG3  3  
ATOM 9031  H HD2  . LYS B 1 52  ? -17.686 13.350  5.567   1.00 1.64  ? 52  LYS B HD2  3  
ATOM 9032  H HD3  . LYS B 1 52  ? -17.239 12.654  4.009   1.00 1.63  ? 52  LYS B HD3  3  
ATOM 9033  H HE2  . LYS B 1 52  ? -17.492 10.405  4.968   1.00 1.50  ? 52  LYS B HE2  3  
ATOM 9034  H HE3  . LYS B 1 52  ? -17.995 11.127  6.496   1.00 1.67  ? 52  LYS B HE3  3  
ATOM 9035  H HZ1  . LYS B 1 52  ? -19.896 10.438  5.172   1.00 2.15  ? 52  LYS B HZ1  3  
ATOM 9036  H HZ2  . LYS B 1 52  ? -19.406 11.433  3.899   1.00 2.33  ? 52  LYS B HZ2  3  
ATOM 9037  H HZ3  . LYS B 1 52  ? -19.887 12.116  5.367   1.00 2.24  ? 52  LYS B HZ3  3  
ATOM 9038  N N    . ASN B 1 53  ? -13.412 15.946  3.295   1.00 0.68  ? 53  ASN B N    3  
ATOM 9039  C CA   . ASN B 1 53  ? -13.054 17.347  3.134   1.00 0.85  ? 53  ASN B CA   3  
ATOM 9040  C C    . ASN B 1 53  ? -13.557 17.862  1.788   1.00 1.00  ? 53  ASN B C    3  
ATOM 9041  O O    . ASN B 1 53  ? -13.425 19.045  1.467   1.00 1.22  ? 53  ASN B O    3  
ATOM 9042  C CB   . ASN B 1 53  ? -11.543 17.566  3.280   1.00 0.92  ? 53  ASN B CB   3  
ATOM 9043  C CG   . ASN B 1 53  ? -10.738 17.091  2.083   1.00 1.40  ? 53  ASN B CG   3  
ATOM 9044  O OD1  . ASN B 1 53  ? -10.623 17.790  1.075   1.00 1.93  ? 53  ASN B OD1  3  
ATOM 9045  N ND2  . ASN B 1 53  ? -10.127 15.927  2.205   1.00 2.05  ? 53  ASN B ND2  3  
ATOM 9046  H H    . ASN B 1 53  ? -12.768 15.247  3.067   1.00 0.63  ? 53  ASN B H    3  
ATOM 9047  H HA   . ASN B 1 53  ? -13.562 17.895  3.914   1.00 0.95  ? 53  ASN B HA   3  
ATOM 9048  H HB2  . ASN B 1 53  ? -11.351 18.618  3.423   1.00 1.05  ? 53  ASN B HB2  3  
ATOM 9049  H HB3  . ASN B 1 53  ? -11.205 17.022  4.154   1.00 1.23  ? 53  ASN B HB3  3  
ATOM 9050  H HD21 . ASN B 1 53  ? -10.219 15.436  3.053   1.00 2.35  ? 53  ASN B HD21 3  
ATOM 9051  H HD22 . ASN B 1 53  ? -9.609  15.595  1.441   1.00 2.52  ? 53  ASN B HD22 3  
ATOM 9052  N N    . GLN B 1 54  ? -14.144 16.963  1.009   1.00 1.01  ? 54  GLN B N    3  
ATOM 9053  C CA   . GLN B 1 54  ? -14.802 17.326  -0.233  1.00 1.29  ? 54  GLN B CA   3  
ATOM 9054  C C    . GLN B 1 54  ? -16.213 16.749  -0.239  1.00 1.33  ? 54  GLN B C    3  
ATOM 9055  O O    . GLN B 1 54  ? -16.405 15.546  -0.425  1.00 2.05  ? 54  GLN B O    3  
ATOM 9056  C CB   . GLN B 1 54  ? -14.008 16.817  -1.439  1.00 1.74  ? 54  GLN B CB   3  
ATOM 9057  C CG   . GLN B 1 54  ? -14.577 17.268  -2.776  1.00 2.17  ? 54  GLN B CG   3  
ATOM 9058  C CD   . GLN B 1 54  ? -13.713 16.847  -3.945  1.00 2.39  ? 54  GLN B CD   3  
ATOM 9059  O OE1  . GLN B 1 54  ? -13.900 15.778  -4.525  1.00 2.90  ? 54  GLN B OE1  3  
ATOM 9060  N NE2  . GLN B 1 54  ? -12.753 17.686  -4.297  1.00 2.71  ? 54  GLN B NE2  3  
ATOM 9061  H H    . GLN B 1 54  ? -14.140 16.018  1.283   1.00 0.93  ? 54  GLN B H    3  
ATOM 9062  H HA   . GLN B 1 54  ? -14.865 18.403  -0.274  1.00 1.53  ? 54  GLN B HA   3  
ATOM 9063  H HB2  . GLN B 1 54  ? -12.993 17.177  -1.364  1.00 2.09  ? 54  GLN B HB2  3  
ATOM 9064  H HB3  . GLN B 1 54  ? -14.001 15.737  -1.421  1.00 2.20  ? 54  GLN B HB3  3  
ATOM 9065  H HG2  . GLN B 1 54  ? -15.559 16.836  -2.899  1.00 2.68  ? 54  GLN B HG2  3  
ATOM 9066  H HG3  . GLN B 1 54  ? -14.657 18.345  -2.773  1.00 2.59  ? 54  GLN B HG3  3  
ATOM 9067  H HE21 . GLN B 1 54  ? -12.656 18.518  -3.788  1.00 2.93  ? 54  GLN B HE21 3  
ATOM 9068  H HE22 . GLN B 1 54  ? -12.173 17.440  -5.047  1.00 3.06  ? 54  GLN B HE22 3  
ATOM 9069  N N    . LYS B 1 55  ? -17.195 17.608  -0.014  1.00 1.43  ? 55  LYS B N    3  
ATOM 9070  C CA   . LYS B 1 55  ? -18.579 17.174  0.109   1.00 1.87  ? 55  LYS B CA   3  
ATOM 9071  C C    . LYS B 1 55  ? -19.196 16.909  -1.263  1.00 1.59  ? 55  LYS B C    3  
ATOM 9072  O O    . LYS B 1 55  ? -19.998 17.699  -1.769  1.00 2.27  ? 55  LYS B O    3  
ATOM 9073  C CB   . LYS B 1 55  ? -19.396 18.221  0.879   1.00 2.84  ? 55  LYS B CB   3  
ATOM 9074  C CG   . LYS B 1 55  ? -20.832 17.801  1.160   1.00 3.60  ? 55  LYS B CG   3  
ATOM 9075  C CD   . LYS B 1 55  ? -20.894 16.511  1.959   1.00 4.28  ? 55  LYS B CD   3  
ATOM 9076  C CE   . LYS B 1 55  ? -22.328 16.083  2.221   1.00 5.02  ? 55  LYS B CE   3  
ATOM 9077  N NZ   . LYS B 1 55  ? -23.052 17.048  3.090   1.00 5.58  ? 55  LYS B NZ   3  
ATOM 9078  H H    . LYS B 1 55  ? -16.984 18.562  0.072   1.00 1.82  ? 55  LYS B H    3  
ATOM 9079  H HA   . LYS B 1 55  ? -18.582 16.253  0.669   1.00 2.27  ? 55  LYS B HA   3  
ATOM 9080  H HB2  . LYS B 1 55  ? -18.911 18.414  1.823   1.00 3.16  ? 55  LYS B HB2  3  
ATOM 9081  H HB3  . LYS B 1 55  ? -19.418 19.134  0.303   1.00 3.23  ? 55  LYS B HB3  3  
ATOM 9082  H HG2  . LYS B 1 55  ? -21.322 18.583  1.721   1.00 4.06  ? 55  LYS B HG2  3  
ATOM 9083  H HG3  . LYS B 1 55  ? -21.344 17.657  0.220   1.00 3.78  ? 55  LYS B HG3  3  
ATOM 9084  H HD2  . LYS B 1 55  ? -20.395 15.730  1.404   1.00 4.58  ? 55  LYS B HD2  3  
ATOM 9085  H HD3  . LYS B 1 55  ? -20.392 16.659  2.905   1.00 4.44  ? 55  LYS B HD3  3  
ATOM 9086  H HE2  . LYS B 1 55  ? -22.844 16.011  1.276   1.00 5.05  ? 55  LYS B HE2  3  
ATOM 9087  H HE3  . LYS B 1 55  ? -22.319 15.115  2.700   1.00 5.52  ? 55  LYS B HE3  3  
ATOM 9088  H HZ1  . LYS B 1 55  ? -24.029 16.728  3.240   1.00 5.86  ? 55  LYS B HZ1  3  
ATOM 9089  H HZ2  . LYS B 1 55  ? -23.073 17.987  2.647   1.00 5.76  ? 55  LYS B HZ2  3  
ATOM 9090  H HZ3  . LYS B 1 55  ? -22.579 17.122  4.015   1.00 5.87  ? 55  LYS B HZ3  3  
ATOM 9091  N N    . ASP B 1 56  ? -18.802 15.797  -1.863  1.00 1.36  ? 56  ASP B N    3  
ATOM 9092  C CA   . ASP B 1 56  ? -19.358 15.361  -3.135  1.00 1.50  ? 56  ASP B CA   3  
ATOM 9093  C C    . ASP B 1 56  ? -19.132 13.864  -3.302  1.00 1.27  ? 56  ASP B C    3  
ATOM 9094  O O    . ASP B 1 56  ? -17.998 13.423  -3.449  1.00 1.44  ? 56  ASP B O    3  
ATOM 9095  C CB   . ASP B 1 56  ? -18.710 16.117  -4.300  1.00 2.13  ? 56  ASP B CB   3  
ATOM 9096  C CG   . ASP B 1 56  ? -19.404 15.849  -5.620  1.00 2.84  ? 56  ASP B CG   3  
ATOM 9097  O OD1  . ASP B 1 56  ? -19.197 14.768  -6.204  1.00 3.44  ? 56  ASP B OD1  3  
ATOM 9098  O OD2  . ASP B 1 56  ? -20.169 16.722  -6.081  1.00 3.39  ? 56  ASP B OD2  3  
ATOM 9099  H H    . ASP B 1 56  ? -18.101 15.250  -1.439  1.00 1.71  ? 56  ASP B H    3  
ATOM 9100  H HA   . ASP B 1 56  ? -20.418 15.562  -3.125  1.00 1.84  ? 56  ASP B HA   3  
ATOM 9101  H HB2  . ASP B 1 56  ? -18.752 17.177  -4.101  1.00 2.43  ? 56  ASP B HB2  3  
ATOM 9102  H HB3  . ASP B 1 56  ? -17.677 15.812  -4.389  1.00 2.59  ? 56  ASP B HB3  3  
ATOM 9103  N N    . PRO B 1 57  ? -20.206 13.057  -3.276  1.00 1.06  ? 57  PRO B N    3  
ATOM 9104  C CA   . PRO B 1 57  ? -20.101 11.592  -3.362  1.00 1.02  ? 57  PRO B CA   3  
ATOM 9105  C C    . PRO B 1 57  ? -19.546 11.109  -4.702  1.00 0.76  ? 57  PRO B C    3  
ATOM 9106  O O    . PRO B 1 57  ? -19.214 9.933   -4.863  1.00 0.70  ? 57  PRO B O    3  
ATOM 9107  C CB   . PRO B 1 57  ? -21.547 11.116  -3.182  1.00 1.20  ? 57  PRO B CB   3  
ATOM 9108  C CG   . PRO B 1 57  ? -22.383 12.285  -3.573  1.00 1.20  ? 57  PRO B CG   3  
ATOM 9109  C CD   . PRO B 1 57  ? -21.604 13.499  -3.155  1.00 1.14  ? 57  PRO B CD   3  
ATOM 9110  H HA   . PRO B 1 57  ? -19.492 11.199  -2.562  1.00 1.22  ? 57  PRO B HA   3  
ATOM 9111  H HB2  . PRO B 1 57  ? -21.730 10.266  -3.822  1.00 1.21  ? 57  PRO B HB2  3  
ATOM 9112  H HB3  . PRO B 1 57  ? -21.712 10.841  -2.151  1.00 1.44  ? 57  PRO B HB3  3  
ATOM 9113  H HG2  . PRO B 1 57  ? -22.535 12.284  -4.642  1.00 1.14  ? 57  PRO B HG2  3  
ATOM 9114  H HG3  . PRO B 1 57  ? -23.330 12.249  -3.056  1.00 1.39  ? 57  PRO B HG3  3  
ATOM 9115  H HD2  . PRO B 1 57  ? -21.809 14.325  -3.818  1.00 1.16  ? 57  PRO B HD2  3  
ATOM 9116  H HD3  . PRO B 1 57  ? -21.835 13.762  -2.134  1.00 1.29  ? 57  PRO B HD3  3  
ATOM 9117  N N    . GLY B 1 58  ? -19.426 12.027  -5.654  1.00 0.67  ? 58  GLY B N    3  
ATOM 9118  C CA   . GLY B 1 58  ? -18.955 11.678  -6.975  1.00 0.56  ? 58  GLY B CA   3  
ATOM 9119  C C    . GLY B 1 58  ? -17.455 11.524  -7.033  1.00 0.49  ? 58  GLY B C    3  
ATOM 9120  O O    . GLY B 1 58  ? -16.915 11.057  -8.028  1.00 0.48  ? 58  GLY B O    3  
ATOM 9121  H H    . GLY B 1 58  ? -19.648 12.963  -5.449  1.00 0.74  ? 58  GLY B H    3  
ATOM 9122  H HA2  . GLY B 1 58  ? -19.414 10.748  -7.277  1.00 0.57  ? 58  GLY B HA2  3  
ATOM 9123  H HA3  . GLY B 1 58  ? -19.247 12.454  -7.665  1.00 0.60  ? 58  GLY B HA3  3  
ATOM 9124  N N    . VAL B 1 59  ? -16.773 11.916  -5.970  1.00 0.52  ? 59  VAL B N    3  
ATOM 9125  C CA   . VAL B 1 59  ? -15.325 11.811  -5.937  1.00 0.52  ? 59  VAL B CA   3  
ATOM 9126  C C    . VAL B 1 59  ? -14.882 10.363  -5.855  1.00 0.49  ? 59  VAL B C    3  
ATOM 9127  O O    . VAL B 1 59  ? -13.940 9.953   -6.531  1.00 0.49  ? 59  VAL B O    3  
ATOM 9128  C CB   . VAL B 1 59  ? -14.709 12.607  -4.767  1.00 0.61  ? 59  VAL B CB   3  
ATOM 9129  C CG1  . VAL B 1 59  ? -15.300 12.173  -3.434  1.00 0.65  ? 59  VAL B CG1  3  
ATOM 9130  C CG2  . VAL B 1 59  ? -13.200 12.446  -4.751  1.00 0.66  ? 59  VAL B CG2  3  
ATOM 9131  H H    . VAL B 1 59  ? -17.252 12.292  -5.197  1.00 0.58  ? 59  VAL B H    3  
ATOM 9132  H HA   . VAL B 1 59  ? -14.953 12.218  -6.863  1.00 0.53  ? 59  VAL B HA   3  
ATOM 9133  H HB   . VAL B 1 59  ? -14.942 13.648  -4.914  1.00 0.64  ? 59  VAL B HB   3  
ATOM 9134  H HG11 . VAL B 1 59  ? -14.777 12.669  -2.628  1.00 1.19  ? 59  VAL B HG11 3  
ATOM 9135  H HG12 . VAL B 1 59  ? -15.196 11.103  -3.328  1.00 1.14  ? 59  VAL B HG12 3  
ATOM 9136  H HG13 . VAL B 1 59  ? -16.346 12.437  -3.401  1.00 1.29  ? 59  VAL B HG13 3  
ATOM 9137  H HG21 . VAL B 1 59  ? -12.786 12.828  -5.672  1.00 1.21  ? 59  VAL B HG21 3  
ATOM 9138  H HG22 . VAL B 1 59  ? -12.957 11.394  -4.655  1.00 1.26  ? 59  VAL B HG22 3  
ATOM 9139  H HG23 . VAL B 1 59  ? -12.786 12.989  -3.914  1.00 1.19  ? 59  VAL B HG23 3  
ATOM 9140  N N    . LEU B 1 60  ? -15.581 9.585   -5.051  1.00 0.48  ? 60  LEU B N    3  
ATOM 9141  C CA   . LEU B 1 60  ? -15.258 8.179   -4.901  1.00 0.46  ? 60  LEU B CA   3  
ATOM 9142  C C    . LEU B 1 60  ? -15.597 7.458   -6.190  1.00 0.43  ? 60  LEU B C    3  
ATOM 9143  O O    . LEU B 1 60  ? -15.105 6.369   -6.470  1.00 0.41  ? 60  LEU B O    3  
ATOM 9144  C CB   . LEU B 1 60  ? -16.033 7.562   -3.742  1.00 0.48  ? 60  LEU B CB   3  
ATOM 9145  C CG   . LEU B 1 60  ? -16.139 8.440   -2.495  1.00 0.52  ? 60  LEU B CG   3  
ATOM 9146  C CD1  . LEU B 1 60  ? -16.870 7.707   -1.385  1.00 0.51  ? 60  LEU B CD1  3  
ATOM 9147  C CD2  . LEU B 1 60  ? -14.762 8.879   -2.035  1.00 0.52  ? 60  LEU B CD2  3  
ATOM 9148  H H    . LEU B 1 60  ? -16.326 9.968   -4.545  1.00 0.50  ? 60  LEU B H    3  
ATOM 9149  H HA   . LEU B 1 60  ? -14.197 8.100   -4.711  1.00 0.47  ? 60  LEU B HA   3  
ATOM 9150  H HB2  . LEU B 1 60  ? -17.032 7.325   -4.084  1.00 0.51  ? 60  LEU B HB2  3  
ATOM 9151  H HB3  . LEU B 1 60  ? -15.536 6.643   -3.466  1.00 0.49  ? 60  LEU B HB3  3  
ATOM 9152  H HG   . LEU B 1 60  ? -16.706 9.326   -2.737  1.00 0.57  ? 60  LEU B HG   3  
ATOM 9153  H HD11 . LEU B 1 60  ? -16.407 6.748   -1.224  1.00 1.00  ? 60  LEU B HD11 3  
ATOM 9154  H HD12 . LEU B 1 60  ? -17.902 7.566   -1.664  1.00 1.22  ? 60  LEU B HD12 3  
ATOM 9155  H HD13 . LEU B 1 60  ? -16.818 8.287   -0.471  1.00 1.18  ? 60  LEU B HD13 3  
ATOM 9156  H HD21 . LEU B 1 60  ? -14.853 9.464   -1.134  1.00 1.20  ? 60  LEU B HD21 3  
ATOM 9157  H HD22 . LEU B 1 60  ? -14.298 9.473   -2.807  1.00 1.11  ? 60  LEU B HD22 3  
ATOM 9158  H HD23 . LEU B 1 60  ? -14.155 8.008   -1.841  1.00 1.11  ? 60  LEU B HD23 3  
ATOM 9159  N N    . ASP B 1 61  ? -16.448 8.104   -6.969  1.00 0.46  ? 61  ASP B N    3  
ATOM 9160  C CA   . ASP B 1 61  ? -16.839 7.610   -8.280  1.00 0.46  ? 61  ASP B CA   3  
ATOM 9161  C C    . ASP B 1 61  ? -15.675 7.755   -9.238  1.00 0.47  ? 61  ASP B C    3  
ATOM 9162  O O    . ASP B 1 61  ? -15.381 6.863   -10.035 1.00 0.51  ? 61  ASP B O    3  
ATOM 9163  C CB   . ASP B 1 61  ? -18.036 8.403   -8.802  1.00 0.47  ? 61  ASP B CB   3  
ATOM 9164  C CG   . ASP B 1 61  ? -18.721 7.736   -9.977  1.00 0.48  ? 61  ASP B CG   3  
ATOM 9165  O OD1  . ASP B 1 61  ? -19.546 6.823   -9.751  1.00 1.19  ? 61  ASP B OD1  3  
ATOM 9166  O OD2  . ASP B 1 61  ? -18.459 8.143   -11.130 1.00 1.22  ? 61  ASP B OD2  3  
ATOM 9167  H H    . ASP B 1 61  ? -16.824 8.947   -6.645  1.00 0.49  ? 61  ASP B H    3  
ATOM 9168  H HA   . ASP B 1 61  ? -17.099 6.576   -8.189  1.00 0.48  ? 61  ASP B HA   3  
ATOM 9169  H HB2  . ASP B 1 61  ? -18.749 8.531   -8.008  1.00 0.48  ? 61  ASP B HB2  3  
ATOM 9170  H HB3  . ASP B 1 61  ? -17.693 9.377   -9.120  1.00 0.51  ? 61  ASP B HB3  3  
ATOM 9171  N N    . ARG B 1 62  ? -15.009 8.889   -9.126  1.00 0.47  ? 62  ARG B N    3  
ATOM 9172  C CA   . ARG B 1 62  ? -13.832 9.182   -9.921  1.00 0.51  ? 62  ARG B CA   3  
ATOM 9173  C C    . ARG B 1 62  ? -12.710 8.224   -9.547  1.00 0.50  ? 62  ARG B C    3  
ATOM 9174  O O    . ARG B 1 62  ? -11.983 7.736   -10.411 1.00 0.56  ? 62  ARG B O    3  
ATOM 9175  C CB   . ARG B 1 62  ? -13.398 10.623  -9.678  1.00 0.55  ? 62  ARG B CB   3  
ATOM 9176  C CG   . ARG B 1 62  ? -14.541 11.617  -9.784  1.00 0.55  ? 62  ARG B CG   3  
ATOM 9177  C CD   . ARG B 1 62  ? -14.119 12.994  -9.327  1.00 0.62  ? 62  ARG B CD   3  
ATOM 9178  N NE   . ARG B 1 62  ? -15.190 13.975  -9.469  1.00 1.45  ? 62  ARG B NE   3  
ATOM 9179  C CZ   . ARG B 1 62  ? -14.990 15.279  -9.639  1.00 1.97  ? 62  ARG B CZ   3  
ATOM 9180  N NH1  . ARG B 1 62  ? -13.755 15.762  -9.706  1.00 1.66  ? 62  ARG B NH1  3  
ATOM 9181  N NH2  . ARG B 1 62  ? -16.024 16.102  -9.742  1.00 3.02  ? 62  ARG B NH2  3  
ATOM 9182  H H    . ARG B 1 62  ? -15.325 9.558   -8.483  1.00 0.47  ? 62  ARG B H    3  
ATOM 9183  H HA   . ARG B 1 62  ? -14.082 9.050   -10.962 1.00 0.53  ? 62  ARG B HA   3  
ATOM 9184  H HB2  . ARG B 1 62  ? -12.972 10.699  -8.688  1.00 0.60  ? 62  ARG B HB2  3  
ATOM 9185  H HB3  . ARG B 1 62  ? -12.647 10.890  -10.406 1.00 0.59  ? 62  ARG B HB3  3  
ATOM 9186  H HG2  . ARG B 1 62  ? -14.868 11.674  -10.804 1.00 0.56  ? 62  ARG B HG2  3  
ATOM 9187  H HG3  . ARG B 1 62  ? -15.355 11.278  -9.162  1.00 0.56  ? 62  ARG B HG3  3  
ATOM 9188  H HD2  . ARG B 1 62  ? -13.840 12.933  -8.290  1.00 1.11  ? 62  ARG B HD2  3  
ATOM 9189  H HD3  . ARG B 1 62  ? -13.272 13.310  -9.911  1.00 0.98  ? 62  ARG B HD3  3  
ATOM 9190  H HE   . ARG B 1 62  ? -16.116 13.638  -9.433  1.00 1.91  ? 62  ARG B HE   3  
ATOM 9191  H HH11 . ARG B 1 62  ? -12.968 15.146  -9.631  1.00 1.23  ? 62  ARG B HH11 3  
ATOM 9192  H HH12 . ARG B 1 62  ? -13.601 16.745  -9.829  1.00 2.13  ? 62  ARG B HH12 3  
ATOM 9193  H HH21 . ARG B 1 62  ? -16.962 15.744  -9.692  1.00 3.45  ? 62  ARG B HH21 3  
ATOM 9194  H HH22 . ARG B 1 62  ? -15.877 17.085  -9.876  1.00 3.46  ? 62  ARG B HH22 3  
ATOM 9195  N N    . MET B 1 63  ? -12.589 7.953   -8.247  1.00 0.45  ? 63  MET B N    3  
ATOM 9196  C CA   . MET B 1 63  ? -11.620 6.981   -7.752  1.00 0.44  ? 63  MET B CA   3  
ATOM 9197  C C    . MET B 1 63  ? -11.963 5.611   -8.288  1.00 0.41  ? 63  MET B C    3  
ATOM 9198  O O    . MET B 1 63  ? -11.109 4.910   -8.821  1.00 0.42  ? 63  MET B O    3  
ATOM 9199  C CB   . MET B 1 63  ? -11.625 6.920   -6.229  1.00 0.43  ? 63  MET B CB   3  
ATOM 9200  C CG   . MET B 1 63  ? -11.499 8.274   -5.566  1.00 0.49  ? 63  MET B CG   3  
ATOM 9201  S SD   . MET B 1 63  ? -9.942  9.098   -5.963  1.00 0.63  ? 63  MET B SD   3  
ATOM 9202  C CE   . MET B 1 63  ? -10.134 10.630  -5.061  1.00 1.54  ? 63  MET B CE   3  
ATOM 9203  H H    . MET B 1 63  ? -13.170 8.420   -7.607  1.00 0.45  ? 63  MET B H    3  
ATOM 9204  H HA   . MET B 1 63  ? -10.637 7.267   -8.098  1.00 0.47  ? 63  MET B HA   3  
ATOM 9205  H HB2  . MET B 1 63  ? -12.545 6.461   -5.903  1.00 0.39  ? 63  MET B HB2  3  
ATOM 9206  H HB3  . MET B 1 63  ? -10.796 6.308   -5.904  1.00 0.45  ? 63  MET B HB3  3  
ATOM 9207  H HG2  . MET B 1 63  ? -12.318 8.894   -5.899  1.00 0.48  ? 63  MET B HG2  3  
ATOM 9208  H HG3  . MET B 1 63  ? -11.565 8.142   -4.501  1.00 0.54  ? 63  MET B HG3  3  
ATOM 9209  H HE1  . MET B 1 63  ? -10.277 10.416  -4.012  1.00 2.05  ? 63  MET B HE1  3  
ATOM 9210  H HE2  . MET B 1 63  ? -10.990 11.167  -5.440  1.00 2.05  ? 63  MET B HE2  3  
ATOM 9211  H HE3  . MET B 1 63  ? -9.246  11.234  -5.187  1.00 2.14  ? 63  MET B HE3  3  
ATOM 9212  N N    . MET B 1 64  ? -13.230 5.245   -8.138  1.00 0.41  ? 64  MET B N    3  
ATOM 9213  C CA   . MET B 1 64  ? -13.734 3.976   -8.630  1.00 0.42  ? 64  MET B CA   3  
ATOM 9214  C C    . MET B 1 64  ? -13.256 3.712   -10.044 1.00 0.44  ? 64  MET B C    3  
ATOM 9215  O O    . MET B 1 64  ? -12.608 2.720   -10.292 1.00 0.41  ? 64  MET B O    3  
ATOM 9216  C CB   . MET B 1 64  ? -15.260 3.963   -8.617  1.00 0.55  ? 64  MET B CB   3  
ATOM 9217  C CG   . MET B 1 64  ? -15.854 2.719   -9.260  1.00 0.65  ? 64  MET B CG   3  
ATOM 9218  S SD   . MET B 1 64  ? -17.398 3.061   -10.126 1.00 1.87  ? 64  MET B SD   3  
ATOM 9219  C CE   . MET B 1 64  ? -17.801 1.428   -10.730 1.00 2.41  ? 64  MET B CE   3  
ATOM 9220  H H    . MET B 1 64  ? -13.847 5.848   -7.665  1.00 0.42  ? 64  MET B H    3  
ATOM 9221  H HA   . MET B 1 64  ? -13.368 3.196   -7.982  1.00 0.41  ? 64  MET B HA   3  
ATOM 9222  H HB2  . MET B 1 64  ? -15.603 4.014   -7.595  1.00 0.60  ? 64  MET B HB2  3  
ATOM 9223  H HB3  . MET B 1 64  ? -15.622 4.827   -9.155  1.00 0.63  ? 64  MET B HB3  3  
ATOM 9224  H HG2  . MET B 1 64  ? -15.143 2.319   -9.966  1.00 1.29  ? 64  MET B HG2  3  
ATOM 9225  H HG3  . MET B 1 64  ? -16.044 1.988   -8.488  1.00 1.05  ? 64  MET B HG3  3  
ATOM 9226  H HE1  . MET B 1 64  ? -17.922 0.754   -9.895  1.00 2.83  ? 64  MET B HE1  3  
ATOM 9227  H HE2  . MET B 1 64  ? -17.003 1.074   -11.365 1.00 2.83  ? 64  MET B HE2  3  
ATOM 9228  H HE3  . MET B 1 64  ? -18.718 1.469   -11.296 1.00 2.75  ? 64  MET B HE3  3  
ATOM 9229  N N    . LYS B 1 65  ? -13.539 4.634   -10.950 1.00 0.52  ? 65  LYS B N    3  
ATOM 9230  C CA   . LYS B 1 65  ? -13.336 4.390   -12.379 1.00 0.56  ? 65  LYS B CA   3  
ATOM 9231  C C    . LYS B 1 65  ? -11.875 4.121   -12.747 1.00 0.54  ? 65  LYS B C    3  
ATOM 9232  O O    . LYS B 1 65  ? -11.593 3.186   -13.496 1.00 0.60  ? 65  LYS B O    3  
ATOM 9233  C CB   . LYS B 1 65  ? -13.884 5.553   -13.197 1.00 0.67  ? 65  LYS B CB   3  
ATOM 9234  C CG   . LYS B 1 65  ? -15.390 5.704   -13.079 1.00 0.79  ? 65  LYS B CG   3  
ATOM 9235  C CD   . LYS B 1 65  ? -16.112 4.427   -13.484 1.00 0.86  ? 65  LYS B CD   3  
ATOM 9236  C CE   . LYS B 1 65  ? -17.619 4.613   -13.454 1.00 1.57  ? 65  LYS B CE   3  
ATOM 9237  N NZ   . LYS B 1 65  ? -18.341 3.426   -13.984 1.00 2.49  ? 65  LYS B NZ   3  
ATOM 9238  H H    . LYS B 1 65  ? -13.892 5.506   -10.650 1.00 0.56  ? 65  LYS B H    3  
ATOM 9239  H HA   . LYS B 1 65  ? -13.905 3.507   -12.627 1.00 0.59  ? 65  LYS B HA   3  
ATOM 9240  H HB2  . LYS B 1 65  ? -13.421 6.469   -12.857 1.00 0.75  ? 65  LYS B HB2  3  
ATOM 9241  H HB3  . LYS B 1 65  ? -13.638 5.396   -14.236 1.00 0.66  ? 65  LYS B HB3  3  
ATOM 9242  H HG2  . LYS B 1 65  ? -15.641 5.938   -12.054 1.00 0.86  ? 65  LYS B HG2  3  
ATOM 9243  H HG3  . LYS B 1 65  ? -15.714 6.508   -13.722 1.00 0.89  ? 65  LYS B HG3  3  
ATOM 9244  H HD2  . LYS B 1 65  ? -15.811 4.155   -14.483 1.00 1.29  ? 65  LYS B HD2  3  
ATOM 9245  H HD3  . LYS B 1 65  ? -15.839 3.635   -12.793 1.00 1.25  ? 65  LYS B HD3  3  
ATOM 9246  H HE2  . LYS B 1 65  ? -17.926 4.783   -12.432 1.00 1.92  ? 65  LYS B HE2  3  
ATOM 9247  H HE3  . LYS B 1 65  ? -17.873 5.476   -14.052 1.00 2.11  ? 65  LYS B HE3  3  
ATOM 9248  H HZ1  . LYS B 1 65  ? -19.369 3.588   -13.946 1.00 2.91  ? 65  LYS B HZ1  3  
ATOM 9249  H HZ2  . LYS B 1 65  ? -18.115 2.582   -13.421 1.00 2.86  ? 65  LYS B HZ2  3  
ATOM 9250  H HZ3  . LYS B 1 65  ? -18.068 3.251   -14.971 1.00 3.01  ? 65  LYS B HZ3  3  
ATOM 9251  N N    . LYS B 1 66  ? -10.955 4.938   -12.241 1.00 0.50  ? 66  LYS B N    3  
ATOM 9252  C CA   . LYS B 1 66  ? -9.526  4.731   -12.510 1.00 0.52  ? 66  LYS B CA   3  
ATOM 9253  C C    . LYS B 1 66  ? -9.066  3.387   -11.992 1.00 0.48  ? 66  LYS B C    3  
ATOM 9254  O O    . LYS B 1 66  ? -8.390  2.623   -12.685 1.00 0.54  ? 66  LYS B O    3  
ATOM 9255  C CB   . LYS B 1 66  ? -8.663  5.795   -11.838 1.00 0.55  ? 66  LYS B CB   3  
ATOM 9256  C CG   . LYS B 1 66  ? -9.270  6.387   -10.589 1.00 0.91  ? 66  LYS B CG   3  
ATOM 9257  C CD   . LYS B 1 66  ? -8.335  7.380   -9.915  1.00 0.96  ? 66  LYS B CD   3  
ATOM 9258  C CE   . LYS B 1 66  ? -7.191  6.681   -9.200  1.00 0.73  ? 66  LYS B CE   3  
ATOM 9259  N NZ   . LYS B 1 66  ? -6.165  7.642   -8.716  1.00 1.47  ? 66  LYS B NZ   3  
ATOM 9260  H H    . LYS B 1 66  ? -11.240 5.690   -11.676 1.00 0.50  ? 66  LYS B H    3  
ATOM 9261  H HA   . LYS B 1 66  ? -9.374  4.771   -13.576 1.00 0.58  ? 66  LYS B HA   3  
ATOM 9262  H HB2  . LYS B 1 66  ? -7.735  5.325   -11.549 1.00 0.84  ? 66  LYS B HB2  3  
ATOM 9263  H HB3  . LYS B 1 66  ? -8.464  6.588   -12.539 1.00 0.87  ? 66  LYS B HB3  3  
ATOM 9264  H HG2  . LYS B 1 66  ? -10.188 6.888   -10.851 1.00 1.32  ? 66  LYS B HG2  3  
ATOM 9265  H HG3  . LYS B 1 66  ? -9.482  5.580   -9.902  1.00 1.31  ? 66  LYS B HG3  3  
ATOM 9266  H HD2  . LYS B 1 66  ? -7.924  8.039   -10.666 1.00 1.49  ? 66  LYS B HD2  3  
ATOM 9267  H HD3  . LYS B 1 66  ? -8.896  7.959   -9.197  1.00 1.60  ? 66  LYS B HD3  3  
ATOM 9268  H HE2  . LYS B 1 66  ? -7.595  6.144   -8.350  1.00 1.11  ? 66  LYS B HE2  3  
ATOM 9269  H HE3  . LYS B 1 66  ? -6.729  5.982   -9.879  1.00 0.98  ? 66  LYS B HE3  3  
ATOM 9270  H HZ1  . LYS B 1 66  ? -6.588  8.310   -8.043  1.00 2.03  ? 66  LYS B HZ1  3  
ATOM 9271  H HZ2  . LYS B 1 66  ? -5.767  8.176   -9.514  1.00 1.78  ? 66  LYS B HZ2  3  
ATOM 9272  H HZ3  . LYS B 1 66  ? -5.393  7.131   -8.240  1.00 2.01  ? 66  LYS B HZ3  3  
ATOM 9273  N N    . LEU B 1 67  ? -9.432  3.129   -10.760 1.00 0.41  ? 67  LEU B N    3  
ATOM 9274  C CA   . LEU B 1 67  ? -8.996  1.956   -10.046 1.00 0.39  ? 67  LEU B CA   3  
ATOM 9275  C C    . LEU B 1 67  ? -9.693  0.724   -10.573 1.00 0.40  ? 67  LEU B C    3  
ATOM 9276  O O    . LEU B 1 67  ? -9.108  -0.350  -10.604 1.00 0.46  ? 67  LEU B O    3  
ATOM 9277  C CB   . LEU B 1 67  ? -9.334  2.139   -8.596  1.00 0.34  ? 67  LEU B CB   3  
ATOM 9278  C CG   . LEU B 1 67  ? -8.772  3.402   -7.951  1.00 0.33  ? 67  LEU B CG   3  
ATOM 9279  C CD1  . LEU B 1 67  ? -9.342  3.579   -6.558  1.00 0.30  ? 67  LEU B CD1  3  
ATOM 9280  C CD2  . LEU B 1 67  ? -7.255  3.358   -7.917  1.00 0.37  ? 67  LEU B CD2  3  
ATOM 9281  H H    . LEU B 1 67  ? -10.036 3.757   -10.306 1.00 0.42  ? 67  LEU B H    3  
ATOM 9282  H HA   . LEU B 1 67  ? -7.932  1.851   -10.159 1.00 0.44  ? 67  LEU B HA   3  
ATOM 9283  H HB2  . LEU B 1 67  ? -10.406 2.178   -8.545  1.00 0.34  ? 67  LEU B HB2  3  
ATOM 9284  H HB3  . LEU B 1 67  ? -8.984  1.280   -8.043  1.00 0.35  ? 67  LEU B HB3  3  
ATOM 9285  H HG   . LEU B 1 67  ? -9.068  4.258   -8.539  1.00 0.36  ? 67  LEU B HG   3  
ATOM 9286  H HD11 . LEU B 1 67  ? -10.396 3.813   -6.627  1.00 1.06  ? 67  LEU B HD11 3  
ATOM 9287  H HD12 . LEU B 1 67  ? -8.827  4.384   -6.054  1.00 1.02  ? 67  LEU B HD12 3  
ATOM 9288  H HD13 . LEU B 1 67  ? -9.217  2.661   -6.001  1.00 1.06  ? 67  LEU B HD13 3  
ATOM 9289  H HD21 . LEU B 1 67  ? -6.875  3.299   -8.927  1.00 1.11  ? 67  LEU B HD21 3  
ATOM 9290  H HD22 . LEU B 1 67  ? -6.934  2.493   -7.358  1.00 1.06  ? 67  LEU B HD22 3  
ATOM 9291  H HD23 . LEU B 1 67  ? -6.879  4.253   -7.443  1.00 1.07  ? 67  LEU B HD23 3  
ATOM 9292  N N    . ASP B 1 68  ? -10.957 0.899   -10.961 1.00 0.39  ? 68  ASP B N    3  
ATOM 9293  C CA   . ASP B 1 68  ? -11.749 -0.151  -11.593 1.00 0.42  ? 68  ASP B CA   3  
ATOM 9294  C C    . ASP B 1 68  ? -11.171 -0.407  -12.974 1.00 0.52  ? 68  ASP B C    3  
ATOM 9295  O O    . ASP B 1 68  ? -11.796 -0.174  -14.012 1.00 0.57  ? 68  ASP B O    3  
ATOM 9296  C CB   . ASP B 1 68  ? -13.225 0.272   -11.689 1.00 0.43  ? 68  ASP B CB   3  
ATOM 9297  C CG   . ASP B 1 68  ? -14.110 -0.755  -12.373 1.00 0.46  ? 68  ASP B CG   3  
ATOM 9298  O OD1  . ASP B 1 68  ? -14.083 -1.935  -11.975 1.00 1.13  ? 68  ASP B OD1  3  
ATOM 9299  O OD2  . ASP B 1 68  ? -14.839 -0.380  -13.319 1.00 1.23  ? 68  ASP B OD2  3  
ATOM 9300  H H    . ASP B 1 68  ? -11.378 1.773   -10.809 1.00 0.40  ? 68  ASP B H    3  
ATOM 9301  H HA   . ASP B 1 68  ? -11.659 -1.048  -10.985 1.00 0.41  ? 68  ASP B HA   3  
ATOM 9302  H HB2  . ASP B 1 68  ? -13.611 0.444   -10.697 1.00 0.41  ? 68  ASP B HB2  3  
ATOM 9303  H HB3  . ASP B 1 68  ? -13.284 1.193   -12.246 1.00 0.47  ? 68  ASP B HB3  3  
ATOM 9304  N N    . THR B 1 69  ? -9.944  -0.846  -12.956 1.00 0.58  ? 69  THR B N    3  
ATOM 9305  C CA   . THR B 1 69  ? -9.140  -0.977  -14.135 1.00 0.74  ? 69  THR B CA   3  
ATOM 9306  C C    . THR B 1 69  ? -9.467  -2.275  -14.856 1.00 0.83  ? 69  THR B C    3  
ATOM 9307  O O    . THR B 1 69  ? -9.192  -2.430  -16.047 1.00 0.99  ? 69  THR B O    3  
ATOM 9308  C CB   . THR B 1 69  ? -7.654  -0.895  -13.734 1.00 0.79  ? 69  THR B CB   3  
ATOM 9309  O OG1  . THR B 1 69  ? -6.826  -0.651  -14.880 1.00 0.91  ? 69  THR B OG1  3  
ATOM 9310  C CG2  . THR B 1 69  ? -7.209  -2.174  -13.039 1.00 0.82  ? 69  THR B CG2  3  
ATOM 9311  H H    . THR B 1 69  ? -9.549  -1.082  -12.076 1.00 0.55  ? 69  THR B H    3  
ATOM 9312  H HA   . THR B 1 69  ? -9.364  -0.152  -14.786 1.00 0.80  ? 69  THR B HA   3  
ATOM 9313  H HB   . THR B 1 69  ? -7.549  -0.069  -13.029 1.00 0.76  ? 69  THR B HB   3  
ATOM 9314  H HG1  . THR B 1 69  ? -7.058  0.207   -15.263 1.00 1.26  ? 69  THR B HG1  3  
ATOM 9315  H HG21 . THR B 1 69  ? -7.842  -2.350  -12.180 1.00 1.41  ? 69  THR B HG21 3  
ATOM 9316  H HG22 . THR B 1 69  ? -6.184  -2.073  -12.716 1.00 1.35  ? 69  THR B HG22 3  
ATOM 9317  H HG23 . THR B 1 69  ? -7.295  -3.003  -13.723 1.00 1.13  ? 69  THR B HG23 3  
ATOM 9318  N N    . ASN B 1 70  ? -10.087 -3.194  -14.130 1.00 0.80  ? 70  ASN B N    3  
ATOM 9319  C CA   . ASN B 1 70  ? -10.578 -4.420  -14.728 1.00 0.94  ? 70  ASN B CA   3  
ATOM 9320  C C    . ASN B 1 70  ? -11.987 -4.191  -15.256 1.00 0.86  ? 70  ASN B C    3  
ATOM 9321  O O    . ASN B 1 70  ? -12.525 -4.983  -16.030 1.00 0.98  ? 70  ASN B O    3  
ATOM 9322  C CB   . ASN B 1 70  ? -10.570 -5.548  -13.702 1.00 1.00  ? 70  ASN B CB   3  
ATOM 9323  C CG   . ASN B 1 70  ? -10.430 -6.923  -14.333 1.00 1.25  ? 70  ASN B CG   3  
ATOM 9324  O OD1  . ASN B 1 70  ? -10.859 -7.156  -15.464 1.00 1.46  ? 70  ASN B OD1  3  
ATOM 9325  N ND2  . ASN B 1 70  ? -9.821  -7.847  -13.607 1.00 1.66  ? 70  ASN B ND2  3  
ATOM 9326  H H    . ASN B 1 70  ? -10.203 -3.046  -13.158 1.00 0.72  ? 70  ASN B H    3  
ATOM 9327  H HA   . ASN B 1 70  ? -9.928  -4.677  -15.549 1.00 1.12  ? 70  ASN B HA   3  
ATOM 9328  H HB2  . ASN B 1 70  ? -9.747  -5.389  -13.029 1.00 1.07  ? 70  ASN B HB2  3  
ATOM 9329  H HB3  . ASN B 1 70  ? -11.493 -5.520  -13.144 1.00 0.89  ? 70  ASN B HB3  3  
ATOM 9330  H HD21 . ASN B 1 70  ? -9.496  -7.595  -12.714 1.00 1.93  ? 70  ASN B HD21 3  
ATOM 9331  H HD22 . ASN B 1 70  ? -9.717  -8.744  -13.987 1.00 1.85  ? 70  ASN B HD22 3  
ATOM 9332  N N    . SER B 1 71  ? -12.563 -3.071  -14.816 1.00 0.70  ? 71  SER B N    3  
ATOM 9333  C CA   . SER B 1 71  ? -13.847 -2.589  -15.300 1.00 0.66  ? 71  SER B CA   3  
ATOM 9334  C C    . SER B 1 71  ? -14.980 -3.532  -14.921 1.00 0.61  ? 71  SER B C    3  
ATOM 9335  O O    . SER B 1 71  ? -15.854 -3.839  -15.733 1.00 0.66  ? 71  SER B O    3  
ATOM 9336  C CB   . SER B 1 71  ? -13.792 -2.373  -16.814 1.00 0.82  ? 71  SER B CB   3  
ATOM 9337  O OG   . SER B 1 71  ? -12.718 -1.506  -17.150 1.00 1.48  ? 71  SER B OG   3  
ATOM 9338  H H    . SER B 1 71  ? -12.106 -2.555  -14.119 1.00 0.65  ? 71  SER B H    3  
ATOM 9339  H HA   . SER B 1 71  ? -14.026 -1.637  -14.825 1.00 0.61  ? 71  SER B HA   3  
ATOM 9340  H HB2  . SER B 1 71  ? -13.644 -3.322  -17.307 1.00 1.18  ? 71  SER B HB2  3  
ATOM 9341  H HB3  . SER B 1 71  ? -14.718 -1.929  -17.149 1.00 1.15  ? 71  SER B HB3  3  
ATOM 9342  H HG   . SER B 1 71  ? -12.396 -1.081  -16.343 1.00 2.03  ? 71  SER B HG   3  
ATOM 9343  N N    . ASP B 1 72  ? -14.967 -3.974  -13.673 1.00 0.58  ? 72  ASP B N    3  
ATOM 9344  C CA   . ASP B 1 72  ? -16.009 -4.851  -13.169 1.00 0.65  ? 72  ASP B CA   3  
ATOM 9345  C C    . ASP B 1 72  ? -17.011 -4.041  -12.362 1.00 0.56  ? 72  ASP B C    3  
ATOM 9346  O O    . ASP B 1 72  ? -18.148 -4.463  -12.146 1.00 0.66  ? 72  ASP B O    3  
ATOM 9347  C CB   . ASP B 1 72  ? -15.404 -5.962  -12.303 1.00 0.80  ? 72  ASP B CB   3  
ATOM 9348  C CG   . ASP B 1 72  ? -16.433 -6.983  -11.860 1.00 0.92  ? 72  ASP B CG   3  
ATOM 9349  O OD1  . ASP B 1 72  ? -16.790 -7.865  -12.672 1.00 1.56  ? 72  ASP B OD1  3  
ATOM 9350  O OD2  . ASP B 1 72  ? -16.883 -6.926  -10.696 1.00 1.53  ? 72  ASP B OD2  3  
ATOM 9351  H H    . ASP B 1 72  ? -14.250 -3.682  -13.066 1.00 0.56  ? 72  ASP B H    3  
ATOM 9352  H HA   . ASP B 1 72  ? -16.514 -5.292  -14.014 1.00 0.76  ? 72  ASP B HA   3  
ATOM 9353  H HB2  . ASP B 1 72  ? -14.639 -6.474  -12.869 1.00 1.15  ? 72  ASP B HB2  3  
ATOM 9354  H HB3  . ASP B 1 72  ? -14.959 -5.521  -11.423 1.00 1.00  ? 72  ASP B HB3  3  
ATOM 9355  N N    . GLY B 1 73  ? -16.590 -2.854  -11.944 1.00 0.45  ? 73  GLY B N    3  
ATOM 9356  C CA   . GLY B 1 73  ? -17.465 -1.981  -11.189 1.00 0.46  ? 73  GLY B CA   3  
ATOM 9357  C C    . GLY B 1 73  ? -17.155 -2.020  -9.716  1.00 0.41  ? 73  GLY B C    3  
ATOM 9358  O O    . GLY B 1 73  ? -17.893 -1.475  -8.892  1.00 0.44  ? 73  GLY B O    3  
ATOM 9359  H H    . GLY B 1 73  ? -15.654 -2.571  -12.137 1.00 0.42  ? 73  GLY B H    3  
ATOM 9360  H HA2  . GLY B 1 73  ? -17.342 -0.967  -11.542 1.00 0.48  ? 73  GLY B HA2  3  
ATOM 9361  H HA3  . GLY B 1 73  ? -18.484 -2.289  -11.343 1.00 0.55  ? 73  GLY B HA3  3  
ATOM 9362  N N    . GLN B 1 74  ? -16.056 -2.668  -9.394  1.00 0.38  ? 74  GLN B N    3  
ATOM 9363  C CA   . GLN B 1 74  ? -15.595 -2.796  -8.030  1.00 0.37  ? 74  GLN B CA   3  
ATOM 9364  C C    . GLN B 1 74  ? -14.090 -2.666  -8.027  1.00 0.36  ? 74  GLN B C    3  
ATOM 9365  O O    . GLN B 1 74  ? -13.477 -2.579  -9.087  1.00 0.39  ? 74  GLN B O    3  
ATOM 9366  C CB   . GLN B 1 74  ? -15.972 -4.154  -7.451  1.00 0.38  ? 74  GLN B CB   3  
ATOM 9367  C CG   . GLN B 1 74  ? -17.447 -4.491  -7.551  1.00 0.41  ? 74  GLN B CG   3  
ATOM 9368  C CD   . GLN B 1 74  ? -17.836 -5.719  -6.751  1.00 0.49  ? 74  GLN B CD   3  
ATOM 9369  O OE1  . GLN B 1 74  ? -17.242 -6.020  -5.721  1.00 1.02  ? 74  GLN B OE1  3  
ATOM 9370  N NE2  . GLN B 1 74  ? -18.838 -6.439  -7.220  1.00 1.25  ? 74  GLN B NE2  3  
ATOM 9371  H H    . GLN B 1 74  ? -15.512 -3.060  -10.109 1.00 0.39  ? 74  GLN B H    3  
ATOM 9372  H HA   . GLN B 1 74  ? -16.034 -2.007  -7.433  1.00 0.39  ? 74  GLN B HA   3  
ATOM 9373  H HB2  . GLN B 1 74  ? -15.413 -4.916  -7.976  1.00 0.39  ? 74  GLN B HB2  3  
ATOM 9374  H HB3  . GLN B 1 74  ? -15.688 -4.169  -6.411  1.00 0.38  ? 74  GLN B HB3  3  
ATOM 9375  H HG2  . GLN B 1 74  ? -18.018 -3.654  -7.194  1.00 0.42  ? 74  GLN B HG2  3  
ATOM 9376  H HG3  . GLN B 1 74  ? -17.682 -4.669  -8.588  1.00 0.44  ? 74  GLN B HG3  3  
ATOM 9377  H HE21 . GLN B 1 74  ? -19.271 -6.146  -8.054  1.00 1.91  ? 74  GLN B HE21 3  
ATOM 9378  H HE22 . GLN B 1 74  ? -19.114 -7.231  -6.715  1.00 1.32  ? 74  GLN B HE22 3  
ATOM 9379  N N    . LEU B 1 75  ? -13.495 -2.661  -6.853  1.00 0.33  ? 75  LEU B N    3  
ATOM 9380  C CA   . LEU B 1 75  ? -12.049 -2.604  -6.760  1.00 0.31  ? 75  LEU B CA   3  
ATOM 9381  C C    . LEU B 1 75  ? -11.510 -3.844  -6.106  1.00 0.32  ? 75  LEU B C    3  
ATOM 9382  O O    . LEU B 1 75  ? -11.794 -4.128  -4.939  1.00 0.32  ? 75  LEU B O    3  
ATOM 9383  C CB   . LEU B 1 75  ? -11.593 -1.382  -5.985  1.00 0.31  ? 75  LEU B CB   3  
ATOM 9384  C CG   . LEU B 1 75  ? -12.120 -0.067  -6.535  1.00 0.32  ? 75  LEU B CG   3  
ATOM 9385  C CD1  . LEU B 1 75  ? -11.488 1.094   -5.804  1.00 0.35  ? 75  LEU B CD1  3  
ATOM 9386  C CD2  . LEU B 1 75  ? -11.847 0.015   -8.026  1.00 0.35  ? 75  LEU B CD2  3  
ATOM 9387  H H    . LEU B 1 75  ? -14.035 -2.695  -6.036  1.00 0.33  ? 75  LEU B H    3  
ATOM 9388  H HA   . LEU B 1 75  ? -11.657 -2.547  -7.767  1.00 0.33  ? 75  LEU B HA   3  
ATOM 9389  H HB2  . LEU B 1 75  ? -11.923 -1.493  -4.957  1.00 0.33  ? 75  LEU B HB2  3  
ATOM 9390  H HB3  . LEU B 1 75  ? -10.506 -1.345  -6.008  1.00 0.32  ? 75  LEU B HB3  3  
ATOM 9391  H HG   . LEU B 1 75  ? -13.189 -0.019  -6.385  1.00 0.36  ? 75  LEU B HG   3  
ATOM 9392  H HD11 . LEU B 1 75  ? -10.415 1.047   -5.914  1.00 1.08  ? 75  LEU B HD11 3  
ATOM 9393  H HD12 . LEU B 1 75  ? -11.746 1.043   -4.756  1.00 0.98  ? 75  LEU B HD12 3  
ATOM 9394  H HD13 . LEU B 1 75  ? -11.852 2.022   -6.220  1.00 1.09  ? 75  LEU B HD13 3  
ATOM 9395  H HD21 . LEU B 1 75  ? -12.319 -0.821  -8.525  1.00 1.10  ? 75  LEU B HD21 3  
ATOM 9396  H HD22 . LEU B 1 75  ? -10.779 -0.024  -8.203  1.00 1.05  ? 75  LEU B HD22 3  
ATOM 9397  H HD23 . LEU B 1 75  ? -12.244 0.939   -8.419  1.00 1.06  ? 75  LEU B HD23 3  
ATOM 9398  N N    . ASP B 1 76  ? -10.751 -4.588  -6.869  1.00 0.35  ? 76  ASP B N    3  
ATOM 9399  C CA   . ASP B 1 76  ? -10.091 -5.764  -6.355  1.00 0.36  ? 76  ASP B CA   3  
ATOM 9400  C C    . ASP B 1 76  ? -8.862  -5.315  -5.584  1.00 0.33  ? 76  ASP B C    3  
ATOM 9401  O O    . ASP B 1 76  ? -8.538  -4.134  -5.601  1.00 0.32  ? 76  ASP B O    3  
ATOM 9402  C CB   . ASP B 1 76  ? -9.782  -6.735  -7.505  1.00 0.44  ? 76  ASP B CB   3  
ATOM 9403  C CG   . ASP B 1 76  ? -8.353  -6.686  -8.044  1.00 0.91  ? 76  ASP B CG   3  
ATOM 9404  O OD1  . ASP B 1 76  ? -7.407  -7.093  -7.328  1.00 1.44  ? 76  ASP B OD1  3  
ATOM 9405  O OD2  . ASP B 1 76  ? -8.175  -6.294  -9.212  1.00 1.68  ? 76  ASP B OD2  3  
ATOM 9406  H H    . ASP B 1 76  ? -10.627 -4.330  -7.821  1.00 0.41  ? 76  ASP B H    3  
ATOM 9407  H HA   . ASP B 1 76  ? -10.767 -6.243  -5.661  1.00 0.37  ? 76  ASP B HA   3  
ATOM 9408  H HB2  . ASP B 1 76  ? -9.988  -7.741  -7.171  1.00 0.74  ? 76  ASP B HB2  3  
ATOM 9409  H HB3  . ASP B 1 76  ? -10.457 -6.487  -8.329  1.00 0.64  ? 76  ASP B HB3  3  
ATOM 9410  N N    . PHE B 1 77  ? -8.200  -6.225  -4.891  1.00 0.40  ? 77  PHE B N    3  
ATOM 9411  C CA   . PHE B 1 77  ? -7.126  -5.848  -3.981  1.00 0.49  ? 77  PHE B CA   3  
ATOM 9412  C C    . PHE B 1 77  ? -6.068  -4.993  -4.677  1.00 0.39  ? 77  PHE B C    3  
ATOM 9413  O O    . PHE B 1 77  ? -5.639  -3.977  -4.142  1.00 0.38  ? 77  PHE B O    3  
ATOM 9414  C CB   . PHE B 1 77  ? -6.482  -7.085  -3.374  1.00 0.72  ? 77  PHE B CB   3  
ATOM 9415  C CG   . PHE B 1 77  ? -5.776  -6.802  -2.082  1.00 1.75  ? 77  PHE B CG   3  
ATOM 9416  C CD1  . PHE B 1 77  ? -6.459  -6.246  -1.014  1.00 2.66  ? 77  PHE B CD1  3  
ATOM 9417  C CD2  . PHE B 1 77  ? -4.433  -7.094  -1.932  1.00 2.56  ? 77  PHE B CD2  3  
ATOM 9418  C CE1  . PHE B 1 77  ? -5.815  -5.985  0.179   1.00 3.77  ? 77  PHE B CE1  3  
ATOM 9419  C CE2  . PHE B 1 77  ? -3.786  -6.836  -0.742  1.00 3.67  ? 77  PHE B CE2  3  
ATOM 9420  C CZ   . PHE B 1 77  ? -4.476  -6.281  0.315   1.00 4.14  ? 77  PHE B CZ   3  
ATOM 9421  H H    . PHE B 1 77  ? -8.430  -7.173  -5.001  1.00 0.47  ? 77  PHE B H    3  
ATOM 9422  H HA   . PHE B 1 77  ? -7.566  -5.263  -3.186  1.00 0.56  ? 77  PHE B HA   3  
ATOM 9423  H HB2  . PHE B 1 77  ? -7.246  -7.823  -3.190  1.00 1.26  ? 77  PHE B HB2  3  
ATOM 9424  H HB3  . PHE B 1 77  ? -5.756  -7.483  -4.068  1.00 0.99  ? 77  PHE B HB3  3  
ATOM 9425  H HD1  . PHE B 1 77  ? -7.508  -6.015  -1.120  1.00 2.85  ? 77  PHE B HD1  3  
ATOM 9426  H HD2  . PHE B 1 77  ? -3.891  -7.527  -2.758  1.00 2.71  ? 77  PHE B HD2  3  
ATOM 9427  H HE1  . PHE B 1 77  ? -6.359  -5.551  1.004   1.00 4.58  ? 77  PHE B HE1  3  
ATOM 9428  H HE2  . PHE B 1 77  ? -2.737  -7.070  -0.639  1.00 4.42  ? 77  PHE B HE2  3  
ATOM 9429  H HZ   . PHE B 1 77  ? -3.968  -6.079  1.247   1.00 5.09  ? 77  PHE B HZ   3  
ATOM 9430  N N    . SER B 1 78  ? -5.669  -5.395  -5.874  1.00 0.38  ? 78  SER B N    3  
ATOM 9431  C CA   . SER B 1 78  ? -4.685  -4.648  -6.647  1.00 0.38  ? 78  SER B CA   3  
ATOM 9432  C C    . SER B 1 78  ? -5.216  -3.267  -7.036  1.00 0.38  ? 78  SER B C    3  
ATOM 9433  O O    . SER B 1 78  ? -4.451  -2.312  -7.168  1.00 0.44  ? 78  SER B O    3  
ATOM 9434  C CB   . SER B 1 78  ? -4.294  -5.432  -7.901  1.00 0.44  ? 78  SER B CB   3  
ATOM 9435  O OG   . SER B 1 78  ? -5.416  -5.693  -8.728  1.00 1.32  ? 78  SER B OG   3  
ATOM 9436  H H    . SER B 1 78  ? -6.042  -6.219  -6.244  1.00 0.44  ? 78  SER B H    3  
ATOM 9437  H HA   . SER B 1 78  ? -3.810  -4.520  -6.029  1.00 0.40  ? 78  SER B HA   3  
ATOM 9438  H HB2  . SER B 1 78  ? -3.573  -4.861  -8.467  1.00 1.06  ? 78  SER B HB2  3  
ATOM 9439  H HB3  . SER B 1 78  ? -3.854  -6.374  -7.606  1.00 0.94  ? 78  SER B HB3  3  
ATOM 9440  H HG   . SER B 1 78  ? -6.095  -6.175  -8.226  1.00 1.76  ? 78  SER B HG   3  
ATOM 9441  N N    . GLU B 1 79  ? -6.528  -3.167  -7.202  1.00 0.36  ? 79  GLU B N    3  
ATOM 9442  C CA   . GLU B 1 79  ? -7.163  -1.914  -7.593  1.00 0.42  ? 79  GLU B CA   3  
ATOM 9443  C C    . GLU B 1 79  ? -7.356  -1.031  -6.365  1.00 0.33  ? 79  GLU B C    3  
ATOM 9444  O O    . GLU B 1 79  ? -7.232  0.191   -6.424  1.00 0.33  ? 79  GLU B O    3  
ATOM 9445  C CB   . GLU B 1 79  ? -8.500  -2.205  -8.276  1.00 0.51  ? 79  GLU B CB   3  
ATOM 9446  C CG   . GLU B 1 79  ? -8.366  -3.175  -9.439  1.00 0.64  ? 79  GLU B CG   3  
ATOM 9447  C CD   . GLU B 1 79  ? -9.682  -3.479  -10.131 1.00 1.81  ? 79  GLU B CD   3  
ATOM 9448  O OE1  . GLU B 1 79  ? -10.593 -4.022  -9.475  1.00 2.54  ? 79  GLU B OE1  3  
ATOM 9449  O OE2  . GLU B 1 79  ? -9.799  -3.197  -11.343 1.00 2.57  ? 79  GLU B OE2  3  
ATOM 9450  H H    . GLU B 1 79  ? -7.092  -3.959  -7.047  1.00 0.34  ? 79  GLU B H    3  
ATOM 9451  H HA   . GLU B 1 79  ? -6.510  -1.410  -8.290  1.00 0.51  ? 79  GLU B HA   3  
ATOM 9452  H HB2  . GLU B 1 79  ? -9.179  -2.631  -7.551  1.00 0.48  ? 79  GLU B HB2  3  
ATOM 9453  H HB3  . GLU B 1 79  ? -8.915  -1.281  -8.648  1.00 0.60  ? 79  GLU B HB3  3  
ATOM 9454  H HG2  . GLU B 1 79  ? -7.691  -2.749  -10.165 1.00 0.89  ? 79  GLU B HG2  3  
ATOM 9455  H HG3  . GLU B 1 79  ? -7.951  -4.101  -9.067  1.00 1.04  ? 79  GLU B HG3  3  
ATOM 9456  N N    . PHE B 1 80  ? -7.643  -1.682  -5.251  1.00 0.28  ? 80  PHE B N    3  
ATOM 9457  C CA   . PHE B 1 80  ? -7.721  -1.030  -3.954  1.00 0.25  ? 80  PHE B CA   3  
ATOM 9458  C C    . PHE B 1 80  ? -6.350  -0.510  -3.549  1.00 0.23  ? 80  PHE B C    3  
ATOM 9459  O O    . PHE B 1 80  ? -6.215  0.588   -3.022  1.00 0.26  ? 80  PHE B O    3  
ATOM 9460  C CB   . PHE B 1 80  ? -8.226  -2.037  -2.923  1.00 0.31  ? 80  PHE B CB   3  
ATOM 9461  C CG   . PHE B 1 80  ? -8.140  -1.555  -1.511  1.00 0.71  ? 80  PHE B CG   3  
ATOM 9462  C CD1  . PHE B 1 80  ? -8.999  -0.579  -1.047  1.00 1.26  ? 80  PHE B CD1  3  
ATOM 9463  C CD2  . PHE B 1 80  ? -7.194  -2.084  -0.647  1.00 1.60  ? 80  PHE B CD2  3  
ATOM 9464  C CE1  . PHE B 1 80  ? -8.917  -0.136  0.252   1.00 1.56  ? 80  PHE B CE1  3  
ATOM 9465  C CE2  . PHE B 1 80  ? -7.110  -1.645  0.656   1.00 1.98  ? 80  PHE B CE2  3  
ATOM 9466  C CZ   . PHE B 1 80  ? -7.972  -0.668  1.105   1.00 1.64  ? 80  PHE B CZ   3  
ATOM 9467  H H    . PHE B 1 80  ? -7.818  -2.649  -5.304  1.00 0.28  ? 80  PHE B H    3  
ATOM 9468  H HA   . PHE B 1 80  ? -8.414  -0.202  -4.021  1.00 0.29  ? 80  PHE B HA   3  
ATOM 9469  H HB2  . PHE B 1 80  ? -9.260  -2.271  -3.131  1.00 0.38  ? 80  PHE B HB2  3  
ATOM 9470  H HB3  . PHE B 1 80  ? -7.636  -2.937  -3.000  1.00 0.47  ? 80  PHE B HB3  3  
ATOM 9471  H HD1  . PHE B 1 80  ? -9.738  -0.163  -1.714  1.00 1.92  ? 80  PHE B HD1  3  
ATOM 9472  H HD2  . PHE B 1 80  ? -6.520  -2.849  -1.001  1.00 2.25  ? 80  PHE B HD2  3  
ATOM 9473  H HE1  . PHE B 1 80  ? -9.593  0.628   0.605   1.00 2.20  ? 80  PHE B HE1  3  
ATOM 9474  H HE2  . PHE B 1 80  ? -6.369  -2.062  1.322   1.00 2.80  ? 80  PHE B HE2  3  
ATOM 9475  H HZ   . PHE B 1 80  ? -7.907  -0.319  2.125   1.00 2.01  ? 80  PHE B HZ   3  
ATOM 9476  N N    . LEU B 1 81  ? -5.332  -1.313  -3.795  1.00 0.25  ? 81  LEU B N    3  
ATOM 9477  C CA   . LEU B 1 81  ? -3.968  -0.917  -3.501  1.00 0.26  ? 81  LEU B CA   3  
ATOM 9478  C C    . LEU B 1 81  ? -3.486  0.119   -4.487  1.00 0.26  ? 81  LEU B C    3  
ATOM 9479  O O    . LEU B 1 81  ? -2.620  0.931   -4.174  1.00 0.27  ? 81  LEU B O    3  
ATOM 9480  C CB   . LEU B 1 81  ? -3.051  -2.118  -3.536  1.00 0.29  ? 81  LEU B CB   3  
ATOM 9481  C CG   . LEU B 1 81  ? -3.332  -3.162  -2.461  1.00 0.28  ? 81  LEU B CG   3  
ATOM 9482  C CD1  . LEU B 1 81  ? -2.364  -4.315  -2.599  1.00 0.33  ? 81  LEU B CD1  3  
ATOM 9483  C CD2  . LEU B 1 81  ? -3.260  -2.539  -1.067  1.00 0.29  ? 81  LEU B CD2  3  
ATOM 9484  H H    . LEU B 1 81  ? -5.504  -2.206  -4.172  1.00 0.27  ? 81  LEU B H    3  
ATOM 9485  H HA   . LEU B 1 81  ? -3.952  -0.489  -2.515  1.00 0.26  ? 81  LEU B HA   3  
ATOM 9486  H HB2  . LEU B 1 81  ? -3.150  -2.592  -4.507  1.00 0.31  ? 81  LEU B HB2  3  
ATOM 9487  H HB3  . LEU B 1 81  ? -2.036  -1.766  -3.422  1.00 0.31  ? 81  LEU B HB3  3  
ATOM 9488  H HG   . LEU B 1 81  ? -4.329  -3.556  -2.605  1.00 0.28  ? 81  LEU B HG   3  
ATOM 9489  H HD11 . LEU B 1 81  ? -2.653  -5.105  -1.923  1.00 1.05  ? 81  LEU B HD11 3  
ATOM 9490  H HD12 . LEU B 1 81  ? -1.367  -3.979  -2.356  1.00 1.03  ? 81  LEU B HD12 3  
ATOM 9491  H HD13 . LEU B 1 81  ? -2.386  -4.684  -3.614  1.00 1.12  ? 81  LEU B HD13 3  
ATOM 9492  H HD21 . LEU B 1 81  ? -3.407  -3.303  -0.315  1.00 0.94  ? 81  LEU B HD21 3  
ATOM 9493  H HD22 . LEU B 1 81  ? -4.031  -1.786  -0.963  1.00 0.98  ? 81  LEU B HD22 3  
ATOM 9494  H HD23 . LEU B 1 81  ? -2.292  -2.080  -0.926  1.00 0.98  ? 81  LEU B HD23 3  
ATOM 9495  N N    . ASN B 1 82  ? -4.044  0.076   -5.681  1.00 0.26  ? 82  ASN B N    3  
ATOM 9496  C CA   . ASN B 1 82  ? -3.777  1.098   -6.672  1.00 0.26  ? 82  ASN B CA   3  
ATOM 9497  C C    . ASN B 1 82  ? -4.211  2.440   -6.101  1.00 0.23  ? 82  ASN B C    3  
ATOM 9498  O O    . ASN B 1 82  ? -3.551  3.466   -6.270  1.00 0.24  ? 82  ASN B O    3  
ATOM 9499  C CB   . ASN B 1 82  ? -4.554  0.801   -7.961  1.00 0.30  ? 82  ASN B CB   3  
ATOM 9500  C CG   . ASN B 1 82  ? -3.952  1.464   -9.189  1.00 0.78  ? 82  ASN B CG   3  
ATOM 9501  O OD1  . ASN B 1 82  ? -3.350  2.534   -9.108  1.00 1.50  ? 82  ASN B OD1  3  
ATOM 9502  N ND2  . ASN B 1 82  ? -4.112  0.828   -10.339 1.00 1.42  ? 82  ASN B ND2  3  
ATOM 9503  H H    . ASN B 1 82  ? -4.637  -0.673  -5.907  1.00 0.28  ? 82  ASN B H    3  
ATOM 9504  H HA   . ASN B 1 82  ? -2.715  1.106   -6.866  1.00 0.30  ? 82  ASN B HA   3  
ATOM 9505  H HB2  . ASN B 1 82  ? -4.589  -0.266  -8.120  1.00 0.58  ? 82  ASN B HB2  3  
ATOM 9506  H HB3  . ASN B 1 82  ? -5.563  1.167   -7.845  1.00 0.65  ? 82  ASN B HB3  3  
ATOM 9507  H HD21 . ASN B 1 82  ? -4.601  -0.023  -10.336 1.00 1.90  ? 82  ASN B HD21 3  
ATOM 9508  H HD22 . ASN B 1 82  ? -3.732  1.230   -11.147 1.00 1.75  ? 82  ASN B HD22 3  
ATOM 9509  N N    . LEU B 1 83  ? -5.339  2.398   -5.403  1.00 0.23  ? 83  LEU B N    3  
ATOM 9510  C CA   . LEU B 1 83  ? -5.852  3.535   -4.663  1.00 0.24  ? 83  LEU B CA   3  
ATOM 9511  C C    . LEU B 1 83  ? -4.885  3.954   -3.570  1.00 0.23  ? 83  LEU B C    3  
ATOM 9512  O O    . LEU B 1 83  ? -4.514  5.123   -3.476  1.00 0.25  ? 83  LEU B O    3  
ATOM 9513  C CB   . LEU B 1 83  ? -7.182  3.169   -4.030  1.00 0.27  ? 83  LEU B CB   3  
ATOM 9514  C CG   . LEU B 1 83  ? -7.609  4.071   -2.887  1.00 0.31  ? 83  LEU B CG   3  
ATOM 9515  C CD1  . LEU B 1 83  ? -8.075  5.421   -3.414  1.00 0.35  ? 83  LEU B CD1  3  
ATOM 9516  C CD2  . LEU B 1 83  ? -8.683  3.393   -2.061  1.00 0.36  ? 83  LEU B CD2  3  
ATOM 9517  H H    . LEU B 1 83  ? -5.851  1.560   -5.391  1.00 0.24  ? 83  LEU B H    3  
ATOM 9518  H HA   . LEU B 1 83  ? -5.997  4.355   -5.348  1.00 0.25  ? 83  LEU B HA   3  
ATOM 9519  H HB2  . LEU B 1 83  ? -7.939  3.203   -4.795  1.00 0.30  ? 83  LEU B HB2  3  
ATOM 9520  H HB3  . LEU B 1 83  ? -7.116  2.157   -3.657  1.00 0.28  ? 83  LEU B HB3  3  
ATOM 9521  H HG   . LEU B 1 83  ? -6.753  4.238   -2.249  1.00 0.30  ? 83  LEU B HG   3  
ATOM 9522  H HD11 . LEU B 1 83  ? -8.917  5.279   -4.075  1.00 1.01  ? 83  LEU B HD11 3  
ATOM 9523  H HD12 . LEU B 1 83  ? -7.265  5.890   -3.957  1.00 1.02  ? 83  LEU B HD12 3  
ATOM 9524  H HD13 . LEU B 1 83  ? -8.366  6.051   -2.587  1.00 1.12  ? 83  LEU B HD13 3  
ATOM 9525  H HD21 . LEU B 1 83  ? -8.951  4.025   -1.227  1.00 1.09  ? 83  LEU B HD21 3  
ATOM 9526  H HD22 . LEU B 1 83  ? -8.309  2.447   -1.694  1.00 1.01  ? 83  LEU B HD22 3  
ATOM 9527  H HD23 . LEU B 1 83  ? -9.550  3.221   -2.677  1.00 1.14  ? 83  LEU B HD23 3  
ATOM 9528  N N    . ILE B 1 84  ? -4.500  2.991   -2.738  1.00 0.24  ? 84  ILE B N    3  
ATOM 9529  C CA   . ILE B 1 84  ? -3.549  3.234   -1.661  1.00 0.26  ? 84  ILE B CA   3  
ATOM 9530  C C    . ILE B 1 84  ? -2.283  3.883   -2.208  1.00 0.27  ? 84  ILE B C    3  
ATOM 9531  O O    . ILE B 1 84  ? -1.674  4.723   -1.550  1.00 0.29  ? 84  ILE B O    3  
ATOM 9532  C CB   . ILE B 1 84  ? -3.228  1.924   -0.893  1.00 0.29  ? 84  ILE B CB   3  
ATOM 9533  C CG1  . ILE B 1 84  ? -4.184  1.749   0.292   1.00 0.55  ? 84  ILE B CG1  3  
ATOM 9534  C CG2  . ILE B 1 84  ? -1.782  1.895   -0.403  1.00 0.47  ? 84  ILE B CG2  3  
ATOM 9535  C CD1  . ILE B 1 84  ? -5.645  1.694   -0.091  1.00 0.62  ? 84  ILE B CD1  3  
ATOM 9536  H H    . ILE B 1 84  ? -4.874  2.088   -2.848  1.00 0.25  ? 84  ILE B H    3  
ATOM 9537  H HA   . ILE B 1 84  ? -4.012  3.922   -0.968  1.00 0.28  ? 84  ILE B HA   3  
ATOM 9538  H HB   . ILE B 1 84  ? -3.369  1.098   -1.577  1.00 0.29  ? 84  ILE B HB   3  
ATOM 9539  H HG12 . ILE B 1 84  ? -3.944  0.829   0.801   1.00 1.22  ? 84  ILE B HG12 3  
ATOM 9540  H HG13 . ILE B 1 84  ? -4.052  2.575   0.975   1.00 1.29  ? 84  ILE B HG13 3  
ATOM 9541  H HG21 . ILE B 1 84  ? -1.604  2.743   0.245   1.00 1.12  ? 84  ILE B HG21 3  
ATOM 9542  H HG22 . ILE B 1 84  ? -1.115  1.944   -1.251  1.00 1.09  ? 84  ILE B HG22 3  
ATOM 9543  H HG23 . ILE B 1 84  ? -1.605  0.981   0.143   1.00 1.17  ? 84  ILE B HG23 3  
ATOM 9544  H HD11 . ILE B 1 84  ? -5.924  2.611   -0.587  1.00 1.22  ? 84  ILE B HD11 3  
ATOM 9545  H HD12 . ILE B 1 84  ? -6.246  1.569   0.798   1.00 1.15  ? 84  ILE B HD12 3  
ATOM 9546  H HD13 . ILE B 1 84  ? -5.812  0.859   -0.756  1.00 1.30  ? 84  ILE B HD13 3  
ATOM 9547  N N    . GLY B 1 85  ? -1.917  3.509   -3.427  1.00 0.26  ? 85  GLY B N    3  
ATOM 9548  C CA   . GLY B 1 85  ? -0.821  4.151   -4.105  1.00 0.29  ? 85  GLY B CA   3  
ATOM 9549  C C    . GLY B 1 85  ? -1.068  5.632   -4.290  1.00 0.28  ? 85  GLY B C    3  
ATOM 9550  O O    . GLY B 1 85  ? -0.269  6.449   -3.856  1.00 0.32  ? 85  GLY B O    3  
ATOM 9551  H H    . GLY B 1 85  ? -2.400  2.782   -3.870  1.00 0.25  ? 85  GLY B H    3  
ATOM 9552  H HA2  . GLY B 1 85  ? 0.078   4.014   -3.526  1.00 0.33  ? 85  GLY B HA2  3  
ATOM 9553  H HA3  . GLY B 1 85  ? -0.690  3.693   -5.074  1.00 0.31  ? 85  GLY B HA3  3  
ATOM 9554  N N    . GLY B 1 86  ? -2.213  5.980   -4.872  1.00 0.27  ? 86  GLY B N    3  
ATOM 9555  C CA   . GLY B 1 86  ? -2.496  7.372   -5.183  1.00 0.30  ? 86  GLY B CA   3  
ATOM 9556  C C    . GLY B 1 86  ? -2.703  8.184   -3.927  1.00 0.29  ? 86  GLY B C    3  
ATOM 9557  O O    . GLY B 1 86  ? -2.387  9.373   -3.873  1.00 0.34  ? 86  GLY B O    3  
ATOM 9558  H H    . GLY B 1 86  ? -2.892  5.291   -5.051  1.00 0.27  ? 86  GLY B H    3  
ATOM 9559  H HA2  . GLY B 1 86  ? -1.667  7.784   -5.737  1.00 0.33  ? 86  GLY B HA2  3  
ATOM 9560  H HA3  . GLY B 1 86  ? -3.388  7.424   -5.787  1.00 0.32  ? 86  GLY B HA3  3  
ATOM 9561  N N    . LEU B 1 87  ? -3.215  7.512   -2.914  1.00 0.25  ? 87  LEU B N    3  
ATOM 9562  C CA   . LEU B 1 87  ? -3.415  8.100   -1.604  1.00 0.25  ? 87  LEU B CA   3  
ATOM 9563  C C    . LEU B 1 87  ? -2.078  8.405   -0.964  1.00 0.26  ? 87  LEU B C    3  
ATOM 9564  O O    . LEU B 1 87  ? -1.777  9.553   -0.626  1.00 0.29  ? 87  LEU B O    3  
ATOM 9565  C CB   . LEU B 1 87  ? -4.167  7.119   -0.715  1.00 0.25  ? 87  LEU B CB   3  
ATOM 9566  C CG   . LEU B 1 87  ? -5.669  7.005   -0.948  1.00 0.26  ? 87  LEU B CG   3  
ATOM 9567  C CD1  . LEU B 1 87  ? -6.203  5.790   -0.217  1.00 0.26  ? 87  LEU B CD1  3  
ATOM 9568  C CD2  . LEU B 1 87  ? -6.382  8.261   -0.469  1.00 0.35  ? 87  LEU B CD2  3  
ATOM 9569  H H    . LEU B 1 87  ? -3.453  6.568   -3.054  1.00 0.26  ? 87  LEU B H    3  
ATOM 9570  H HA   . LEU B 1 87  ? -3.988  9.008   -1.710  1.00 0.28  ? 87  LEU B HA   3  
ATOM 9571  H HB2  . LEU B 1 87  ? -3.734  6.141   -0.875  1.00 0.25  ? 87  LEU B HB2  3  
ATOM 9572  H HB3  . LEU B 1 87  ? -4.005  7.403   0.313   1.00 0.28  ? 87  LEU B HB3  3  
ATOM 9573  H HG   . LEU B 1 87  ? -5.864  6.881   -2.002  1.00 0.26  ? 87  LEU B HG   3  
ATOM 9574  H HD11 . LEU B 1 87  ? -5.677  4.908   -0.549  1.00 1.02  ? 87  LEU B HD11 3  
ATOM 9575  H HD12 . LEU B 1 87  ? -7.256  5.679   -0.427  1.00 1.05  ? 87  LEU B HD12 3  
ATOM 9576  H HD13 . LEU B 1 87  ? -6.058  5.916   0.846   1.00 1.06  ? 87  LEU B HD13 3  
ATOM 9577  H HD21 . LEU B 1 87  ? -6.199  8.400   0.589   1.00 0.97  ? 87  LEU B HD21 3  
ATOM 9578  H HD22 . LEU B 1 87  ? -7.445  8.158   -0.638  1.00 1.10  ? 87  LEU B HD22 3  
ATOM 9579  H HD23 . LEU B 1 87  ? -6.013  9.118   -1.013  1.00 1.13  ? 87  LEU B HD23 3  
ATOM 9580  N N    . ALA B 1 88  ? -1.276  7.358   -0.818  1.00 0.25  ? 88  ALA B N    3  
ATOM 9581  C CA   . ALA B 1 88  ? 0.026   7.462   -0.194  1.00 0.27  ? 88  ALA B CA   3  
ATOM 9582  C C    . ALA B 1 88  ? 0.883   8.465   -0.908  1.00 0.29  ? 88  ALA B C    3  
ATOM 9583  O O    . ALA B 1 88  ? 1.587   9.242   -0.287  1.00 0.35  ? 88  ALA B O    3  
ATOM 9584  C CB   . ALA B 1 88  ? 0.737   6.129   -0.209  1.00 0.26  ? 88  ALA B CB   3  
ATOM 9585  H H    . ALA B 1 88  ? -1.576  6.478   -1.147  1.00 0.25  ? 88  ALA B H    3  
ATOM 9586  H HA   . ALA B 1 88  ? -0.113  7.768   0.830   1.00 0.28  ? 88  ALA B HA   3  
ATOM 9587  H HB1  . ALA B 1 88  ? 1.545   6.146   0.507   1.00 1.06  ? 88  ALA B HB1  3  
ATOM 9588  H HB2  . ALA B 1 88  ? 1.145   5.966   -1.203  1.00 1.04  ? 88  ALA B HB2  3  
ATOM 9589  H HB3  . ALA B 1 88  ? 0.043   5.340   0.035   1.00 1.06  ? 88  ALA B HB3  3  
ATOM 9590  N N    . MET B 1 89  ? 0.823   8.424   -2.220  1.00 0.29  ? 89  MET B N    3  
ATOM 9591  C CA   . MET B 1 89  ? 1.608   9.310   -3.044  1.00 0.32  ? 89  MET B CA   3  
ATOM 9592  C C    . MET B 1 89  ? 1.245   10.761  -2.783  1.00 0.34  ? 89  MET B C    3  
ATOM 9593  O O    . MET B 1 89  ? 2.115   11.622  -2.725  1.00 0.39  ? 89  MET B O    3  
ATOM 9594  C CB   . MET B 1 89  ? 1.406   8.966   -4.510  1.00 0.34  ? 89  MET B CB   3  
ATOM 9595  C CG   . MET B 1 89  ? 2.080   7.669   -4.913  1.00 0.42  ? 89  MET B CG   3  
ATOM 9596  S SD   . MET B 1 89  ? 1.979   7.362   -6.685  1.00 1.03  ? 89  MET B SD   3  
ATOM 9597  C CE   . MET B 1 89  ? 2.774   8.830   -7.336  1.00 1.89  ? 89  MET B CE   3  
ATOM 9598  H H    . MET B 1 89  ? 0.232   7.762   -2.650  1.00 0.28  ? 89  MET B H    3  
ATOM 9599  H HA   . MET B 1 89  ? 2.643   9.157   -2.788  1.00 0.37  ? 89  MET B HA   3  
ATOM 9600  H HB2  . MET B 1 89  ? 0.344   8.864   -4.698  1.00 0.32  ? 89  MET B HB2  3  
ATOM 9601  H HB3  . MET B 1 89  ? 1.802   9.763   -5.118  1.00 0.38  ? 89  MET B HB3  3  
ATOM 9602  H HG2  . MET B 1 89  ? 3.117   7.710   -4.614  1.00 0.55  ? 89  MET B HG2  3  
ATOM 9603  H HG3  . MET B 1 89  ? 1.589   6.852   -4.395  1.00 0.42  ? 89  MET B HG3  3  
ATOM 9604  H HE1  . MET B 1 89  ? 3.769   8.913   -6.924  1.00 2.52  ? 89  MET B HE1  3  
ATOM 9605  H HE2  . MET B 1 89  ? 2.199   9.703   -7.067  1.00 2.34  ? 89  MET B HE2  3  
ATOM 9606  H HE3  . MET B 1 89  ? 2.835   8.757   -8.411  1.00 2.22  ? 89  MET B HE3  3  
ATOM 9607  N N    . ALA B 1 90  ? -0.039  11.018  -2.587  1.00 0.34  ? 90  ALA B N    3  
ATOM 9608  C CA   . ALA B 1 90  ? -0.512  12.366  -2.327  1.00 0.39  ? 90  ALA B CA   3  
ATOM 9609  C C    . ALA B 1 90  ? -0.081  12.819  -0.939  1.00 0.42  ? 90  ALA B C    3  
ATOM 9610  O O    . ALA B 1 90  ? 0.342   13.957  -0.743  1.00 0.49  ? 90  ALA B O    3  
ATOM 9611  C CB   . ALA B 1 90  ? -2.024  12.423  -2.464  1.00 0.46  ? 90  ALA B CB   3  
ATOM 9612  H H    . ALA B 1 90  ? -0.688  10.279  -2.607  1.00 0.32  ? 90  ALA B H    3  
ATOM 9613  H HA   . ALA B 1 90  ? -0.078  13.025  -3.065  1.00 0.42  ? 90  ALA B HA   3  
ATOM 9614  H HB1  . ALA B 1 90  ? -2.308  12.055  -3.439  1.00 1.20  ? 90  ALA B HB1  3  
ATOM 9615  H HB2  . ALA B 1 90  ? -2.358  13.443  -2.349  1.00 1.13  ? 90  ALA B HB2  3  
ATOM 9616  H HB3  . ALA B 1 90  ? -2.474  11.805  -1.700  1.00 1.03  ? 90  ALA B HB3  3  
ATOM 9617  N N    . CYS B 1 91  ? -0.170  11.906  0.018   1.00 0.41  ? 91  CYS B N    3  
ATOM 9618  C CA   . CYS B 1 91  ? 0.206   12.190  1.396   1.00 0.47  ? 91  CYS B CA   3  
ATOM 9619  C C    . CYS B 1 91  ? 1.721   12.319  1.528   1.00 0.44  ? 91  CYS B C    3  
ATOM 9620  O O    . CYS B 1 91  ? 2.223   13.112  2.317   1.00 0.51  ? 91  CYS B O    3  
ATOM 9621  C CB   . CYS B 1 91  ? -0.323  11.083  2.311   1.00 0.55  ? 91  CYS B CB   3  
ATOM 9622  S SG   . CYS B 1 91  ? -2.110  10.836  2.194   1.00 1.76  ? 91  CYS B SG   3  
ATOM 9623  H H    . CYS B 1 91  ? -0.506  11.012  -0.209  1.00 0.40  ? 91  CYS B H    3  
ATOM 9624  H HA   . CYS B 1 91  ? -0.246  13.129  1.676   1.00 0.52  ? 91  CYS B HA   3  
ATOM 9625  H HB2  . CYS B 1 91  ? 0.153   10.148  2.047   1.00 1.09  ? 91  CYS B HB2  3  
ATOM 9626  H HB3  . CYS B 1 91  ? -0.090  11.328  3.336   1.00 0.94  ? 91  CYS B HB3  3  
ATOM 9627  H HG   . CYS B 1 91  ? -2.366  10.275  1.019   1.00 2.29  ? 91  CYS B HG   3  
ATOM 9628  N N    . HIS B 1 92  ? 2.442   11.542  0.736   1.00 0.41  ? 92  HIS B N    3  
ATOM 9629  C CA   . HIS B 1 92  ? 3.894   11.591  0.716   1.00 0.46  ? 92  HIS B CA   3  
ATOM 9630  C C    . HIS B 1 92  ? 4.344   12.874  0.049   1.00 0.45  ? 92  HIS B C    3  
ATOM 9631  O O    . HIS B 1 92  ? 5.245   13.549  0.529   1.00 0.49  ? 92  HIS B O    3  
ATOM 9632  C CB   . HIS B 1 92  ? 4.458   10.383  -0.033  1.00 0.54  ? 92  HIS B CB   3  
ATOM 9633  C CG   . HIS B 1 92  ? 5.950   10.277  0.011   1.00 1.21  ? 92  HIS B CG   3  
ATOM 9634  N ND1  . HIS B 1 92  ? 6.745   10.343  -1.111  1.00 2.12  ? 92  HIS B ND1  3  
ATOM 9635  C CD2  . HIS B 1 92  ? 6.790   10.081  1.051   1.00 1.96  ? 92  HIS B CD2  3  
ATOM 9636  C CE1  . HIS B 1 92  ? 8.007   10.193  -0.763  1.00 2.74  ? 92  HIS B CE1  3  
ATOM 9637  N NE2  . HIS B 1 92  ? 8.063   10.033  0.546   1.00 2.62  ? 92  HIS B NE2  3  
ATOM 9638  H H    . HIS B 1 92  ? 1.979   10.909  0.143   1.00 0.40  ? 92  HIS B H    3  
ATOM 9639  H HA   . HIS B 1 92  ? 4.247   11.580  1.736   1.00 0.53  ? 92  HIS B HA   3  
ATOM 9640  H HB2  . HIS B 1 92  ? 4.051   9.481   0.399   1.00 1.05  ? 92  HIS B HB2  3  
ATOM 9641  H HB3  . HIS B 1 92  ? 4.160   10.443  -1.069  1.00 0.91  ? 92  HIS B HB3  3  
ATOM 9642  H HD1  . HIS B 1 92  ? 6.430   10.489  -2.032  1.00 2.62  ? 92  HIS B HD1  3  
ATOM 9643  H HD2  . HIS B 1 92  ? 6.510   9.984   2.087   1.00 2.49  ? 92  HIS B HD2  3  
ATOM 9644  H HE1  . HIS B 1 92  ? 8.852   10.198  -1.434  1.00 3.56  ? 92  HIS B HE1  3  
ATOM 9645  H HE2  . HIS B 1 92  ? 8.890   10.085  1.088   1.00 3.27  ? 92  HIS B HE2  3  
ATOM 9646  N N    . ASP B 1 93  ? 3.691   13.203  -1.056  1.00 0.45  ? 93  ASP B N    3  
ATOM 9647  C CA   . ASP B 1 93  ? 3.930   14.457  -1.753  1.00 0.52  ? 93  ASP B CA   3  
ATOM 9648  C C    . ASP B 1 93  ? 3.673   15.624  -0.804  1.00 0.56  ? 93  ASP B C    3  
ATOM 9649  O O    . ASP B 1 93  ? 4.381   16.624  -0.819  1.00 0.65  ? 93  ASP B O    3  
ATOM 9650  C CB   . ASP B 1 93  ? 3.019   14.544  -2.982  1.00 0.54  ? 93  ASP B CB   3  
ATOM 9651  C CG   . ASP B 1 93  ? 3.282   15.773  -3.833  1.00 0.92  ? 93  ASP B CG   3  
ATOM 9652  O OD1  . ASP B 1 93  ? 4.285   15.784  -4.581  1.00 1.48  ? 93  ASP B OD1  3  
ATOM 9653  O OD2  . ASP B 1 93  ? 2.472   16.721  -3.777  1.00 1.74  ? 93  ASP B OD2  3  
ATOM 9654  H H    . ASP B 1 93  ? 3.030   12.574  -1.427  1.00 0.43  ? 93  ASP B H    3  
ATOM 9655  H HA   . ASP B 1 93  ? 4.960   14.477  -2.068  1.00 0.56  ? 93  ASP B HA   3  
ATOM 9656  H HB2  . ASP B 1 93  ? 3.171   13.662  -3.594  1.00 0.94  ? 93  ASP B HB2  3  
ATOM 9657  H HB3  . ASP B 1 93  ? 1.990   14.570  -2.654  1.00 0.77  ? 93  ASP B HB3  3  
ATOM 9658  N N    . SER B 1 94  ? 2.672   15.456  0.054   1.00 0.54  ? 94  SER B N    3  
ATOM 9659  C CA   . SER B 1 94  ? 2.349   16.441  1.075   1.00 0.60  ? 94  SER B CA   3  
ATOM 9660  C C    . SER B 1 94  ? 3.437   16.490  2.138   1.00 0.63  ? 94  SER B C    3  
ATOM 9661  O O    . SER B 1 94  ? 3.843   17.562  2.571   1.00 0.70  ? 94  SER B O    3  
ATOM 9662  C CB   . SER B 1 94  ? 1.017   16.096  1.730   1.00 0.65  ? 94  SER B CB   3  
ATOM 9663  O OG   . SER B 1 94  ? -0.038  16.107  0.780   1.00 1.26  ? 94  SER B OG   3  
ATOM 9664  H H    . SER B 1 94  ? 2.138   14.638  -0.001  1.00 0.52  ? 94  SER B H    3  
ATOM 9665  H HA   . SER B 1 94  ? 2.272   17.407  0.600   1.00 0.66  ? 94  SER B HA   3  
ATOM 9666  H HB2  . SER B 1 94  ? 1.086   15.109  2.170   1.00 0.96  ? 94  SER B HB2  3  
ATOM 9667  H HB3  . SER B 1 94  ? 0.802   16.817  2.503   1.00 1.04  ? 94  SER B HB3  3  
ATOM 9668  H HG   . SER B 1 94  ? 0.150   15.455  0.084   1.00 1.85  ? 94  SER B HG   3  
ATOM 9669  N N    . PHE B 1 95  ? 3.895   15.315  2.548   1.00 0.60  ? 95  PHE B N    3  
ATOM 9670  C CA   . PHE B 1 95  ? 4.947   15.187  3.549   1.00 0.67  ? 95  PHE B CA   3  
ATOM 9671  C C    . PHE B 1 95  ? 6.219   15.866  3.056   1.00 0.73  ? 95  PHE B C    3  
ATOM 9672  O O    . PHE B 1 95  ? 6.935   16.510  3.823   1.00 0.84  ? 95  PHE B O    3  
ATOM 9673  C CB   . PHE B 1 95  ? 5.204   13.704  3.827   1.00 0.64  ? 95  PHE B CB   3  
ATOM 9674  C CG   . PHE B 1 95  ? 6.089   13.437  5.010   1.00 0.78  ? 95  PHE B CG   3  
ATOM 9675  C CD1  . PHE B 1 95  ? 5.640   13.691  6.295   1.00 1.29  ? 95  PHE B CD1  3  
ATOM 9676  C CD2  . PHE B 1 95  ? 7.361   12.917  4.839   1.00 1.80  ? 95  PHE B CD2  3  
ATOM 9677  C CE1  . PHE B 1 95  ? 6.444   13.432  7.388   1.00 1.76  ? 95  PHE B CE1  3  
ATOM 9678  C CE2  . PHE B 1 95  ? 8.172   12.658  5.928   1.00 2.35  ? 95  PHE B CE2  3  
ATOM 9679  C CZ   . PHE B 1 95  ? 7.712   12.917  7.204   1.00 2.07  ? 95  PHE B CZ   3  
ATOM 9680  H H    . PHE B 1 95  ? 3.501   14.497  2.171   1.00 0.56  ? 95  PHE B H    3  
ATOM 9681  H HA   . PHE B 1 95  ? 4.614   15.670  4.456   1.00 0.75  ? 95  PHE B HA   3  
ATOM 9682  H HB2  . PHE B 1 95  ? 4.259   13.212  4.004   1.00 0.99  ? 95  PHE B HB2  3  
ATOM 9683  H HB3  . PHE B 1 95  ? 5.672   13.262  2.956   1.00 0.98  ? 95  PHE B HB3  3  
ATOM 9684  H HD1  . PHE B 1 95  ? 4.649   14.095  6.440   1.00 1.96  ? 95  PHE B HD1  3  
ATOM 9685  H HD2  . PHE B 1 95  ? 7.722   12.715  3.841   1.00 2.46  ? 95  PHE B HD2  3  
ATOM 9686  H HE1  . PHE B 1 95  ? 6.082   13.635  8.384   1.00 2.40  ? 95  PHE B HE1  3  
ATOM 9687  H HE2  . PHE B 1 95  ? 9.163   12.255  5.782   1.00 3.27  ? 95  PHE B HE2  3  
ATOM 9688  H HZ   . PHE B 1 95  ? 8.343   12.714  8.058   1.00 2.63  ? 95  PHE B HZ   3  
ATOM 9689  N N    . LEU B 1 96  ? 6.475   15.729  1.764   1.00 0.69  ? 96  LEU B N    3  
ATOM 9690  C CA   . LEU B 1 96  ? 7.616   16.364  1.119   1.00 0.81  ? 96  LEU B CA   3  
ATOM 9691  C C    . LEU B 1 96  ? 7.435   17.876  1.068   1.00 0.91  ? 96  LEU B C    3  
ATOM 9692  O O    . LEU B 1 96  ? 8.400   18.635  1.146   1.00 1.09  ? 96  LEU B O    3  
ATOM 9693  C CB   . LEU B 1 96  ? 7.800   15.803  -0.295  1.00 0.83  ? 96  LEU B CB   3  
ATOM 9694  C CG   . LEU B 1 96  ? 8.686   14.556  -0.413  1.00 0.87  ? 96  LEU B CG   3  
ATOM 9695  C CD1  . LEU B 1 96  ? 10.146  14.919  -0.222  1.00 1.22  ? 96  LEU B CD1  3  
ATOM 9696  C CD2  . LEU B 1 96  ? 8.279   13.491  0.594   1.00 1.08  ? 96  LEU B CD2  3  
ATOM 9697  H H    . LEU B 1 96  ? 5.874   15.171  1.221   1.00 0.62  ? 96  LEU B H    3  
ATOM 9698  H HA   . LEU B 1 96  ? 8.491   16.138  1.703   1.00 0.87  ? 96  LEU B HA   3  
ATOM 9699  H HB2  . LEU B 1 96  ? 6.826   15.558  -0.687  1.00 0.76  ? 96  LEU B HB2  3  
ATOM 9700  H HB3  . LEU B 1 96  ? 8.228   16.579  -0.910  1.00 0.93  ? 96  LEU B HB3  3  
ATOM 9701  H HG   . LEU B 1 96  ? 8.572   14.140  -1.401  1.00 0.92  ? 96  LEU B HG   3  
ATOM 9702  H HD11 . LEU B 1 96  ? 10.751  14.031  -0.316  1.00 1.70  ? 96  LEU B HD11 3  
ATOM 9703  H HD12 . LEU B 1 96  ? 10.285  15.346  0.758   1.00 1.65  ? 96  LEU B HD12 3  
ATOM 9704  H HD13 . LEU B 1 96  ? 10.440  15.636  -0.974  1.00 1.64  ? 96  LEU B HD13 3  
ATOM 9705  H HD21 . LEU B 1 96  ? 8.943   12.643  0.510   1.00 1.68  ? 96  LEU B HD21 3  
ATOM 9706  H HD22 . LEU B 1 96  ? 7.265   13.175  0.392   1.00 1.41  ? 96  LEU B HD22 3  
ATOM 9707  H HD23 . LEU B 1 96  ? 8.337   13.898  1.593   1.00 1.51  ? 96  LEU B HD23 3  
ATOM 9708  N N    . LYS B 1 97  ? 6.185   18.302  0.952   1.00 0.83  ? 97  LYS B N    3  
ATOM 9709  C CA   . LYS B 1 97  ? 5.845   19.719  0.943   1.00 0.94  ? 97  LYS B CA   3  
ATOM 9710  C C    . LYS B 1 97  ? 5.572   20.213  2.359   1.00 0.98  ? 97  LYS B C    3  
ATOM 9711  O O    . LYS B 1 97  ? 5.070   21.317  2.559   1.00 1.14  ? 97  LYS B O    3  
ATOM 9712  C CB   . LYS B 1 97  ? 4.621   19.961  0.062   1.00 0.94  ? 97  LYS B CB   3  
ATOM 9713  C CG   . LYS B 1 97  ? 4.857   19.638  -1.405  1.00 0.99  ? 97  LYS B CG   3  
ATOM 9714  C CD   . LYS B 1 97  ? 3.587   19.785  -2.227  1.00 1.25  ? 97  LYS B CD   3  
ATOM 9715  C CE   . LYS B 1 97  ? 2.445   18.980  -1.631  1.00 2.06  ? 97  LYS B CE   3  
ATOM 9716  N NZ   . LYS B 1 97  ? 1.312   18.836  -2.579  1.00 2.65  ? 97  LYS B NZ   3  
ATOM 9717  H H    . LYS B 1 97  ? 5.465   17.641  0.863   1.00 0.75  ? 97  LYS B H    3  
ATOM 9718  H HA   . LYS B 1 97  ? 6.683   20.260  0.539   1.00 1.02  ? 97  LYS B HA   3  
ATOM 9719  H HB2  . LYS B 1 97  ? 3.809   19.342  0.418   1.00 0.90  ? 97  LYS B HB2  3  
ATOM 9720  H HB3  . LYS B 1 97  ? 4.333   20.996  0.140   1.00 1.04  ? 97  LYS B HB3  3  
ATOM 9721  H HG2  . LYS B 1 97  ? 5.605   20.312  -1.795  1.00 1.50  ? 97  LYS B HG2  3  
ATOM 9722  H HG3  . LYS B 1 97  ? 5.211   18.621  -1.485  1.00 1.64  ? 97  LYS B HG3  3  
ATOM 9723  H HD2  . LYS B 1 97  ? 3.304   20.826  -2.255  1.00 1.87  ? 97  LYS B HD2  3  
ATOM 9724  H HD3  . LYS B 1 97  ? 3.777   19.435  -3.232  1.00 1.74  ? 97  LYS B HD3  3  
ATOM 9725  H HE2  . LYS B 1 97  ? 2.813   18.000  -1.371  1.00 2.59  ? 97  LYS B HE2  3  
ATOM 9726  H HE3  . LYS B 1 97  ? 2.098   19.481  -0.740  1.00 2.52  ? 97  LYS B HE3  3  
ATOM 9727  H HZ1  . LYS B 1 97  ? 0.500   18.392  -2.105  1.00 3.01  ? 97  LYS B HZ1  3  
ATOM 9728  H HZ2  . LYS B 1 97  ? 1.598   18.233  -3.381  1.00 2.88  ? 97  LYS B HZ2  3  
ATOM 9729  H HZ3  . LYS B 1 97  ? 1.025   19.766  -2.942  1.00 3.15  ? 97  LYS B HZ3  3  
ATOM 9730  N N    . ALA B 1 98  ? 5.894   19.383  3.339   1.00 0.99  ? 98  ALA B N    3  
ATOM 9731  C CA   . ALA B 1 98  ? 5.680   19.730  4.731   1.00 1.07  ? 98  ALA B CA   3  
ATOM 9732  C C    . ALA B 1 98  ? 6.992   19.692  5.499   1.00 1.10  ? 98  ALA B C    3  
ATOM 9733  O O    . ALA B 1 98  ? 7.551   20.733  5.843   1.00 1.24  ? 98  ALA B O    3  
ATOM 9734  C CB   . ALA B 1 98  ? 4.661   18.794  5.366   1.00 1.01  ? 98  ALA B CB   3  
ATOM 9735  H H    . ALA B 1 98  ? 6.288   18.513  3.117   1.00 1.05  ? 98  ALA B H    3  
ATOM 9736  H HA   . ALA B 1 98  ? 5.283   20.733  4.765   1.00 1.18  ? 98  ALA B HA   3  
ATOM 9737  H HB1  . ALA B 1 98  ? 3.745   18.819  4.794   1.00 1.37  ? 98  ALA B HB1  3  
ATOM 9738  H HB2  . ALA B 1 98  ? 4.462   19.111  6.379   1.00 1.47  ? 98  ALA B HB2  3  
ATOM 9739  H HB3  . ALA B 1 98  ? 5.052   17.787  5.373   1.00 1.42  ? 98  ALA B HB3  3  
ATOM 9740  N N    . VAL B 1 99  ? 7.491   18.486  5.732   1.00 1.01  ? 99  VAL B N    3  
ATOM 9741  C CA   . VAL B 1 99  ? 8.737   18.289  6.456   1.00 1.07  ? 99  VAL B CA   3  
ATOM 9742  C C    . VAL B 1 99  ? 9.181   16.824  6.354   1.00 1.01  ? 99  VAL B C    3  
ATOM 9743  O O    . VAL B 1 99  ? 8.925   15.996  7.231   1.00 1.02  ? 99  VAL B O    3  
ATOM 9744  C CB   . VAL B 1 99  ? 8.626   18.742  7.933   1.00 1.17  ? 99  VAL B CB   3  
ATOM 9745  C CG1  . VAL B 1 99  ? 7.472   18.050  8.642   1.00 1.14  ? 99  VAL B CG1  3  
ATOM 9746  C CG2  . VAL B 1 99  ? 9.941   18.507  8.662   1.00 1.25  ? 99  VAL B CG2  3  
ATOM 9747  H H    . VAL B 1 99  ? 7.014   17.697  5.389   1.00 0.92  ? 99  VAL B H    3  
ATOM 9748  H HA   . VAL B 1 99  ? 9.488   18.902  5.976   1.00 1.12  ? 99  VAL B HA   3  
ATOM 9749  H HB   . VAL B 1 99  ? 8.427   19.803  7.941   1.00 1.25  ? 99  VAL B HB   3  
ATOM 9750  H HG11 . VAL B 1 99  ? 6.544   18.314  8.159   1.00 1.65  ? 99  VAL B HG11 3  
ATOM 9751  H HG12 . VAL B 1 99  ? 7.445   18.362  9.676   1.00 1.48  ? 99  VAL B HG12 3  
ATOM 9752  H HG13 . VAL B 1 99  ? 7.613   16.981  8.591   1.00 1.42  ? 99  VAL B HG13 3  
ATOM 9753  H HG21 . VAL B 1 99  ? 10.727  19.064  8.170   1.00 1.52  ? 99  VAL B HG21 3  
ATOM 9754  H HG22 . VAL B 1 99  ? 10.180  17.454  8.639   1.00 1.65  ? 99  VAL B HG22 3  
ATOM 9755  H HG23 . VAL B 1 99  ? 9.851   18.837  9.686   1.00 1.64  ? 99  VAL B HG23 3  
ATOM 9756  N N    . PRO B 1 100 ? 9.850   16.489  5.252   1.00 1.01  ? 100 PRO B N    3  
ATOM 9757  C CA   . PRO B 1 100 ? 10.282  15.131  4.963   1.00 1.02  ? 100 PRO B CA   3  
ATOM 9758  C C    . PRO B 1 100 ? 11.660  14.835  5.531   1.00 1.28  ? 100 PRO B C    3  
ATOM 9759  O O    . PRO B 1 100 ? 12.170  13.720  5.415   1.00 1.60  ? 100 PRO B O    3  
ATOM 9760  C CB   . PRO B 1 100 ? 10.294  15.118  3.441   1.00 1.04  ? 100 PRO B CB   3  
ATOM 9761  C CG   . PRO B 1 100 ? 10.682  16.512  3.056   1.00 1.04  ? 100 PRO B CG   3  
ATOM 9762  C CD   . PRO B 1 100 ? 10.238  17.419  4.181   1.00 1.07  ? 100 PRO B CD   3  
ATOM 9763  H HA   . PRO B 1 100 ? 9.579   14.401  5.333   1.00 0.95  ? 100 PRO B HA   3  
ATOM 9764  H HB2  . PRO B 1 100 ? 11.012  14.389  3.089   1.00 1.23  ? 100 PRO B HB2  3  
ATOM 9765  H HB3  . PRO B 1 100 ? 9.307   14.869  3.075   1.00 1.05  ? 100 PRO B HB3  3  
ATOM 9766  H HG2  . PRO B 1 100 ? 11.754  16.572  2.933   1.00 1.11  ? 100 PRO B HG2  3  
ATOM 9767  H HG3  . PRO B 1 100 ? 10.187  16.790  2.137   1.00 1.04  ? 100 PRO B HG3  3  
ATOM 9768  H HD2  . PRO B 1 100 ? 11.051  18.049  4.502   1.00 1.20  ? 100 PRO B HD2  3  
ATOM 9769  H HD3  . PRO B 1 100 ? 9.395   18.020  3.876   1.00 1.05  ? 100 PRO B HD3  3  
ATOM 9770  N N    . SER B 1 101 ? 12.249  15.839  6.155   1.00 1.57  ? 101 SER B N    3  
ATOM 9771  C CA   . SER B 1 101 ? 13.534  15.686  6.805   1.00 1.88  ? 101 SER B CA   3  
ATOM 9772  C C    . SER B 1 101 ? 13.341  15.177  8.229   1.00 1.62  ? 101 SER B C    3  
ATOM 9773  O O    . SER B 1 101 ? 13.796  15.791  9.190   1.00 1.94  ? 101 SER B O    3  
ATOM 9774  C CB   . SER B 1 101 ? 14.274  17.026  6.803   1.00 2.76  ? 101 SER B CB   3  
ATOM 9775  O OG   . SER B 1 101 ? 14.458  17.496  5.476   1.00 3.39  ? 101 SER B OG   3  
ATOM 9776  H H    . SER B 1 101 ? 11.804  16.710  6.181   1.00 1.80  ? 101 SER B H    3  
ATOM 9777  H HA   . SER B 1 101 ? 14.108  14.962  6.245   1.00 2.07  ? 101 SER B HA   3  
ATOM 9778  H HB2  . SER B 1 101 ? 13.698  17.754  7.354   1.00 3.14  ? 101 SER B HB2  3  
ATOM 9779  H HB3  . SER B 1 101 ? 15.242  16.903  7.267   1.00 3.02  ? 101 SER B HB3  3  
ATOM 9780  H HG   . SER B 1 101 ? 13.871  18.244  5.318   1.00 3.73  ? 101 SER B HG   3  
ATOM 9781  N N    . GLN B 1 102 ? 12.634  14.061  8.357   1.00 1.61  ? 102 GLN B N    3  
ATOM 9782  C CA   . GLN B 1 102 ? 12.407  13.459  9.662   1.00 2.12  ? 102 GLN B CA   3  
ATOM 9783  C C    . GLN B 1 102 ? 13.723  13.003  10.283  1.00 2.74  ? 102 GLN B C    3  
ATOM 9784  O O    . GLN B 1 102 ? 14.537  12.347  9.627   1.00 3.39  ? 102 GLN B O    3  
ATOM 9785  C CB   . GLN B 1 102 ? 11.428  12.285  9.563   1.00 2.47  ? 102 GLN B CB   3  
ATOM 9786  C CG   . GLN B 1 102 ? 11.814  11.236  8.532   1.00 3.01  ? 102 GLN B CG   3  
ATOM 9787  C CD   . GLN B 1 102 ? 10.959  9.988   8.633   1.00 3.87  ? 102 GLN B CD   3  
ATOM 9788  O OE1  . GLN B 1 102 ? 11.305  9.040   9.337   1.00 4.45  ? 102 GLN B OE1  3  
ATOM 9789  N NE2  . GLN B 1 102 ? 9.829   9.986   7.943   1.00 4.44  ? 102 GLN B NE2  3  
ATOM 9790  H H    . GLN B 1 102 ? 12.256  13.637  7.555   1.00 1.67  ? 102 GLN B H    3  
ATOM 9791  H HA   . GLN B 1 102 ? 11.976  14.218  10.297  1.00 2.52  ? 102 GLN B HA   3  
ATOM 9792  H HB2  . GLN B 1 102 ? 11.369  11.803  10.527  1.00 2.90  ? 102 GLN B HB2  3  
ATOM 9793  H HB3  . GLN B 1 102 ? 10.452  12.668  9.305   1.00 2.74  ? 102 GLN B HB3  3  
ATOM 9794  H HG2  . GLN B 1 102 ? 11.696  11.657  7.545   1.00 3.38  ? 102 GLN B HG2  3  
ATOM 9795  H HG3  . GLN B 1 102 ? 12.847  10.960  8.685   1.00 3.09  ? 102 GLN B HG3  3  
ATOM 9796  H HE21 . GLN B 1 102 ? 9.609   10.777  7.410   1.00 4.33  ? 102 GLN B HE21 3  
ATOM 9797  H HE22 . GLN B 1 102 ? 9.251   9.196   8.001   1.00 5.18  ? 102 GLN B HE22 3  
ATOM 9798  N N    . LYS B 1 103 ? 13.926  13.379  11.545  1.00 3.15  ? 103 LYS B N    3  
ATOM 9799  C CA   . LYS B 1 103 ? 15.124  13.004  12.297  1.00 4.07  ? 103 LYS B CA   3  
ATOM 9800  C C    . LYS B 1 103 ? 16.390  13.554  11.640  1.00 4.57  ? 103 LYS B C    3  
ATOM 9801  O O    . LYS B 1 103 ? 17.397  12.855  11.519  1.00 5.24  ? 103 LYS B O    3  
ATOM 9802  C CB   . LYS B 1 103 ? 15.221  11.479  12.436  1.00 4.74  ? 103 LYS B CB   3  
ATOM 9803  C CG   . LYS B 1 103 ? 14.055  10.846  13.181  1.00 5.31  ? 103 LYS B CG   3  
ATOM 9804  C CD   . LYS B 1 103 ? 13.952  11.362  14.607  1.00 6.26  ? 103 LYS B CD   3  
ATOM 9805  C CE   . LYS B 1 103 ? 12.844  10.660  15.374  1.00 6.83  ? 103 LYS B CE   3  
ATOM 9806  N NZ   . LYS B 1 103 ? 12.744  11.153  16.771  1.00 7.43  ? 103 LYS B NZ   3  
ATOM 9807  H H    . LYS B 1 103 ? 13.248  13.933  11.987  1.00 3.17  ? 103 LYS B H    3  
ATOM 9808  H HA   . LYS B 1 103 ? 15.037  13.436  13.283  1.00 4.39  ? 103 LYS B HA   3  
ATOM 9809  H HB2  . LYS B 1 103 ? 15.265  11.044  11.450  1.00 4.97  ? 103 LYS B HB2  3  
ATOM 9810  H HB3  . LYS B 1 103 ? 16.130  11.237  12.966  1.00 5.08  ? 103 LYS B HB3  3  
ATOM 9811  H HG2  . LYS B 1 103 ? 13.138  11.079  12.659  1.00 5.38  ? 103 LYS B HG2  3  
ATOM 9812  H HG3  . LYS B 1 103 ? 14.195  9.775   13.204  1.00 5.40  ? 103 LYS B HG3  3  
ATOM 9813  H HD2  . LYS B 1 103 ? 14.890  11.190  15.111  1.00 6.63  ? 103 LYS B HD2  3  
ATOM 9814  H HD3  . LYS B 1 103 ? 13.743  12.421  14.582  1.00 6.49  ? 103 LYS B HD3  3  
ATOM 9815  H HE2  . LYS B 1 103 ? 11.905  10.836  14.871  1.00 6.94  ? 103 LYS B HE2  3  
ATOM 9816  H HE3  . LYS B 1 103 ? 13.051  9.599   15.389  1.00 7.02  ? 103 LYS B HE3  3  
ATOM 9817  H HZ1  . LYS B 1 103 ? 12.572  12.180  16.778  1.00 7.63  ? 103 LYS B HZ1  3  
ATOM 9818  H HZ2  . LYS B 1 103 ? 13.626  10.959  17.284  1.00 7.73  ? 103 LYS B HZ2  3  
ATOM 9819  H HZ3  . LYS B 1 103 ? 11.961  10.680  17.263  1.00 7.66  ? 103 LYS B HZ3  3  
ATOM 9820  N N    . ARG B 1 104 ? 16.335  14.815  11.224  1.00 4.69  ? 104 ARG B N    3  
ATOM 9821  C CA   . ARG B 1 104 ? 17.472  15.450  10.569  1.00 5.54  ? 104 ARG B CA   3  
ATOM 9822  C C    . ARG B 1 104 ? 18.462  16.005  11.589  1.00 5.67  ? 104 ARG B C    3  
ATOM 9823  O O    . ARG B 1 104 ? 19.568  16.413  11.238  1.00 5.97  ? 104 ARG B O    3  
ATOM 9824  C CB   . ARG B 1 104 ? 17.000  16.553  9.604   1.00 6.11  ? 104 ARG B CB   3  
ATOM 9825  C CG   . ARG B 1 104 ? 16.020  17.562  10.204  1.00 6.81  ? 104 ARG B CG   3  
ATOM 9826  C CD   . ARG B 1 104 ? 16.704  18.577  11.105  1.00 7.63  ? 104 ARG B CD   3  
ATOM 9827  N NE   . ARG B 1 104 ? 17.642  19.422  10.370  1.00 8.12  ? 104 ARG B NE   3  
ATOM 9828  C CZ   . ARG B 1 104 ? 18.596  20.150  10.946  1.00 8.95  ? 104 ARG B CZ   3  
ATOM 9829  N NH1  . ARG B 1 104 ? 18.772  20.103  12.262  1.00 9.34  ? 104 ARG B NH1  3  
ATOM 9830  N NH2  . ARG B 1 104 ? 19.379  20.920  10.204  1.00 9.59  ? 104 ARG B NH2  3  
ATOM 9831  H H    . ARG B 1 104 ? 15.509  15.327  11.362  1.00 4.49  ? 104 ARG B H    3  
ATOM 9832  H HA   . ARG B 1 104 ? 17.976  14.687  9.994   1.00 6.02  ? 104 ARG B HA   3  
ATOM 9833  H HB2  . ARG B 1 104 ? 17.865  17.098  9.256   1.00 6.43  ? 104 ARG B HB2  3  
ATOM 9834  H HB3  . ARG B 1 104 ? 16.522  16.084  8.756   1.00 6.10  ? 104 ARG B HB3  3  
ATOM 9835  H HG2  . ARG B 1 104 ? 15.534  18.090  9.399   1.00 6.95  ? 104 ARG B HG2  3  
ATOM 9836  H HG3  . ARG B 1 104 ? 15.279  17.027  10.779  1.00 6.93  ? 104 ARG B HG3  3  
ATOM 9837  H HD2  . ARG B 1 104 ? 15.950  19.203  11.558  1.00 7.90  ? 104 ARG B HD2  3  
ATOM 9838  H HD3  . ARG B 1 104 ? 17.241  18.045  11.879  1.00 7.87  ? 104 ARG B HD3  3  
ATOM 9839  H HE   . ARG B 1 104 ? 17.543  19.459  9.390   1.00 8.01  ? 104 ARG B HE   3  
ATOM 9840  H HH11 . ARG B 1 104 ? 18.186  19.513  12.834  1.00 9.05  ? 104 ARG B HH11 3  
ATOM 9841  H HH12 . ARG B 1 104 ? 19.486  20.660  12.695  1.00 10.05 ? 104 ARG B HH12 3  
ATOM 9842  H HH21 . ARG B 1 104 ? 19.257  20.956  9.206   1.00 9.49  ? 104 ARG B HH21 3  
ATOM 9843  H HH22 . ARG B 1 104 ? 20.094  21.479  10.633  1.00 10.29 ? 104 ARG B HH22 3  
ATOM 9844  N N    . THR B 1 105 ? 18.060  16.026  12.851  1.00 5.80  ? 105 THR B N    3  
ATOM 9845  C CA   . THR B 1 105 ? 18.921  16.514  13.911  1.00 6.20  ? 105 THR B CA   3  
ATOM 9846  C C    . THR B 1 105 ? 19.502  15.341  14.696  1.00 6.46  ? 105 THR B C    3  
ATOM 9847  O O    . THR B 1 105 ? 18.782  14.780  15.550  1.00 6.81  ? 105 THR B O    3  
ATOM 9848  C CB   . THR B 1 105 ? 18.160  17.451  14.868  1.00 6.59  ? 105 THR B CB   3  
ATOM 9849  O OG1  . THR B 1 105 ? 17.418  18.422  14.115  1.00 6.66  ? 105 THR B OG1  3  
ATOM 9850  C CG2  . THR B 1 105 ? 19.121  18.168  15.806  1.00 7.01  ? 105 THR B CG2  3  
ATOM 9851  O OXT  . THR B 1 105 ? 20.673  14.978  14.449  1.00 6.62  ? 105 THR B OXT  3  
ATOM 9852  H H    . THR B 1 105 ? 17.163  15.700  13.076  1.00 5.85  ? 105 THR B H    3  
ATOM 9853  H HA   . THR B 1 105 ? 19.730  17.069  13.457  1.00 6.42  ? 105 THR B HA   3  
ATOM 9854  H HB   . THR B 1 105 ? 17.475  16.861  15.459  1.00 6.93  ? 105 THR B HB   3  
ATOM 9855  H HG1  . THR B 1 105 ? 16.536  18.517  14.503  1.00 6.49  ? 105 THR B HG1  3  
ATOM 9856  H HG21 . THR B 1 105 ? 18.561  18.803  16.477  1.00 7.21  ? 105 THR B HG21 3  
ATOM 9857  H HG22 . THR B 1 105 ? 19.804  18.770  15.227  1.00 7.27  ? 105 THR B HG22 3  
ATOM 9858  H HG23 . THR B 1 105 ? 19.677  17.440  16.377  1.00 7.16  ? 105 THR B HG23 3  
ATOM 9859  N N    . MET A 1 1   ? -16.483 15.970  17.252  1.00 7.63  ? 1   MET A N    4  
ATOM 9860  C CA   . MET A 1 1   ? -16.964 17.051  16.360  1.00 7.05  ? 1   MET A CA   4  
ATOM 9861  C C    . MET A 1 1   ? -16.159 17.089  15.064  1.00 6.84  ? 1   MET A C    4  
ATOM 9862  O O    . MET A 1 1   ? -15.874 18.165  14.534  1.00 7.12  ? 1   MET A O    4  
ATOM 9863  C CB   . MET A 1 1   ? -16.892 18.407  17.074  1.00 7.11  ? 1   MET A CB   4  
ATOM 9864  C CG   . MET A 1 1   ? -15.517 18.748  17.623  1.00 7.39  ? 1   MET A CG   4  
ATOM 9865  S SD   . MET A 1 1   ? -15.505 20.301  18.537  1.00 7.66  ? 1   MET A SD   4  
ATOM 9866  C CE   . MET A 1 1   ? -13.828 20.304  19.161  1.00 7.91  ? 1   MET A CE   4  
ATOM 9867  H H1   . MET A 1 1   ? -15.466 16.083  17.441  1.00 7.95  ? 1   MET A H1   4  
ATOM 9868  H H2   . MET A 1 1   ? -16.641 15.043  16.809  1.00 7.75  ? 1   MET A H2   4  
ATOM 9869  H H3   . MET A 1 1   ? -16.996 15.998  18.157  1.00 7.88  ? 1   MET A H3   4  
ATOM 9870  H HA   . MET A 1 1   ? -17.995 16.842  16.115  1.00 7.07  ? 1   MET A HA   4  
ATOM 9871  H HB2  . MET A 1 1   ? -17.175 19.181  16.375  1.00 7.26  ? 1   MET A HB2  4  
ATOM 9872  H HB3  . MET A 1 1   ? -17.593 18.406  17.894  1.00 7.17  ? 1   MET A HB3  4  
ATOM 9873  H HG2  . MET A 1 1   ? -15.201 17.956  18.285  1.00 7.57  ? 1   MET A HG2  4  
ATOM 9874  H HG3  . MET A 1 1   ? -14.823 18.825  16.798  1.00 7.61  ? 1   MET A HG3  4  
ATOM 9875  H HE1  . MET A 1 1   ? -13.667 21.192  19.752  1.00 8.15  ? 1   MET A HE1  4  
ATOM 9876  H HE2  . MET A 1 1   ? -13.136 20.291  18.334  1.00 8.15  ? 1   MET A HE2  4  
ATOM 9877  H HE3  . MET A 1 1   ? -13.673 19.429  19.776  1.00 7.92  ? 1   MET A HE3  4  
ATOM 9878  N N    . ALA A 1 2   ? -15.802 15.903  14.563  1.00 6.67  ? 2   ALA A N    4  
ATOM 9879  C CA   . ALA A 1 2   ? -15.043 15.766  13.319  1.00 6.74  ? 2   ALA A CA   4  
ATOM 9880  C C    . ALA A 1 2   ? -13.661 16.403  13.433  1.00 6.14  ? 2   ALA A C    4  
ATOM 9881  O O    . ALA A 1 2   ? -13.221 16.755  14.531  1.00 6.28  ? 2   ALA A O    4  
ATOM 9882  C CB   . ALA A 1 2   ? -15.815 16.365  12.151  1.00 7.31  ? 2   ALA A CB   4  
ATOM 9883  H H    . ALA A 1 2   ? -16.063 15.088  15.043  1.00 6.72  ? 2   ALA A H    4  
ATOM 9884  H HA   . ALA A 1 2   ? -14.919 14.710  13.128  1.00 7.13  ? 2   ALA A HA   4  
ATOM 9885  H HB1  . ALA A 1 2   ? -15.930 17.428  12.303  1.00 7.69  ? 2   ALA A HB1  4  
ATOM 9886  H HB2  . ALA A 1 2   ? -16.789 15.904  12.089  1.00 7.46  ? 2   ALA A HB2  4  
ATOM 9887  H HB3  . ALA A 1 2   ? -15.275 16.189  11.234  1.00 7.49  ? 2   ALA A HB3  4  
ATOM 9888  N N    . LYS A 1 3   ? -12.977 16.520  12.295  1.00 5.79  ? 3   LYS A N    4  
ATOM 9889  C CA   . LYS A 1 3   ? -11.651 17.135  12.234  1.00 5.52  ? 3   LYS A CA   4  
ATOM 9890  C C    . LYS A 1 3   ? -10.657 16.374  13.105  1.00 5.00  ? 3   LYS A C    4  
ATOM 9891  O O    . LYS A 1 3   ? -9.801  16.965  13.766  1.00 5.14  ? 3   LYS A O    4  
ATOM 9892  C CB   . LYS A 1 3   ? -11.721 18.606  12.653  1.00 6.00  ? 3   LYS A CB   4  
ATOM 9893  C CG   . LYS A 1 3   ? -12.608 19.444  11.752  1.00 6.27  ? 3   LYS A CG   4  
ATOM 9894  C CD   . LYS A 1 3   ? -12.727 20.872  12.251  1.00 6.96  ? 3   LYS A CD   4  
ATOM 9895  C CE   . LYS A 1 3   ? -13.614 21.697  11.339  1.00 7.45  ? 3   LYS A CE   4  
ATOM 9896  N NZ   . LYS A 1 3   ? -13.773 23.093  11.822  1.00 7.92  ? 3   LYS A NZ   4  
ATOM 9897  H H    . LYS A 1 3   ? -13.377 16.181  11.465  1.00 5.95  ? 3   LYS A H    4  
ATOM 9898  H HA   . LYS A 1 3   ? -11.316 17.081  11.208  1.00 5.71  ? 3   LYS A HA   4  
ATOM 9899  H HB2  . LYS A 1 3   ? -12.106 18.665  13.661  1.00 6.29  ? 3   LYS A HB2  4  
ATOM 9900  H HB3  . LYS A 1 3   ? -10.725 19.023  12.631  1.00 6.28  ? 3   LYS A HB3  4  
ATOM 9901  H HG2  . LYS A 1 3   ? -12.186 19.457  10.759  1.00 6.42  ? 3   LYS A HG2  4  
ATOM 9902  H HG3  . LYS A 1 3   ? -13.593 19.000  11.719  1.00 6.21  ? 3   LYS A HG3  4  
ATOM 9903  H HD2  . LYS A 1 3   ? -13.154 20.863  13.243  1.00 7.10  ? 3   LYS A HD2  4  
ATOM 9904  H HD3  . LYS A 1 3   ? -11.744 21.317  12.284  1.00 7.33  ? 3   LYS A HD3  4  
ATOM 9905  H HE2  . LYS A 1 3   ? -13.174 21.716  10.352  1.00 7.69  ? 3   LYS A HE2  4  
ATOM 9906  H HE3  . LYS A 1 3   ? -14.586 21.229  11.287  1.00 7.56  ? 3   LYS A HE3  4  
ATOM 9907  H HZ1  . LYS A 1 3   ? -14.407 23.619  11.185  1.00 7.97  ? 3   LYS A HZ1  4  
ATOM 9908  H HZ2  . LYS A 1 3   ? -12.851 23.572  11.846  1.00 8.25  ? 3   LYS A HZ2  4  
ATOM 9909  H HZ3  . LYS A 1 3   ? -14.181 23.098  12.779  1.00 8.16  ? 3   LYS A HZ3  4  
ATOM 9910  N N    . ILE A 1 4   ? -10.783 15.057  13.101  1.00 4.74  ? 4   ILE A N    4  
ATOM 9911  C CA   . ILE A 1 4   ? -9.897  14.203  13.870  1.00 4.41  ? 4   ILE A CA   4  
ATOM 9912  C C    . ILE A 1 4   ? -8.680  13.837  13.034  1.00 3.66  ? 4   ILE A C    4  
ATOM 9913  O O    . ILE A 1 4   ? -8.780  13.063  12.081  1.00 3.90  ? 4   ILE A O    4  
ATOM 9914  C CB   . ILE A 1 4   ? -10.608 12.910  14.330  1.00 5.14  ? 4   ILE A CB   4  
ATOM 9915  C CG1  . ILE A 1 4   ? -11.879 13.246  15.118  1.00 5.77  ? 4   ILE A CG1  4  
ATOM 9916  C CG2  . ILE A 1 4   ? -9.670  12.054  15.170  1.00 5.58  ? 4   ILE A CG2  4  
ATOM 9917  C CD1  . ILE A 1 4   ? -11.627 14.060  16.370  1.00 6.53  ? 4   ILE A CD1  4  
ATOM 9918  H H    . ILE A 1 4   ? -11.486 14.646  12.555  1.00 5.01  ? 4   ILE A H    4  
ATOM 9919  H HA   . ILE A 1 4   ? -9.575  14.749  14.744  1.00 4.58  ? 4   ILE A HA   4  
ATOM 9920  H HB   . ILE A 1 4   ? -10.878 12.345  13.451  1.00 5.37  ? 4   ILE A HB   4  
ATOM 9921  H HG12 . ILE A 1 4   ? -12.546 13.812  14.486  1.00 5.98  ? 4   ILE A HG12 4  
ATOM 9922  H HG13 . ILE A 1 4   ? -12.364 12.326  15.412  1.00 5.87  ? 4   ILE A HG13 4  
ATOM 9923  H HG21 . ILE A 1 4   ? -8.793  11.804  14.592  1.00 5.92  ? 4   ILE A HG21 4  
ATOM 9924  H HG22 . ILE A 1 4   ? -10.178 11.148  15.465  1.00 5.99  ? 4   ILE A HG22 4  
ATOM 9925  H HG23 . ILE A 1 4   ? -9.375  12.604  16.052  1.00 5.54  ? 4   ILE A HG23 4  
ATOM 9926  H HD11 . ILE A 1 4   ? -11.183 15.007  16.101  1.00 6.97  ? 4   ILE A HD11 4  
ATOM 9927  H HD12 . ILE A 1 4   ? -10.956 13.520  17.022  1.00 6.74  ? 4   ILE A HD12 4  
ATOM 9928  H HD13 . ILE A 1 4   ? -12.562 14.234  16.880  1.00 6.72  ? 4   ILE A HD13 4  
ATOM 9929  N N    . SER A 1 5   ? -7.537  14.398  13.389  1.00 3.24  ? 5   SER A N    4  
ATOM 9930  C CA   . SER A 1 5   ? -6.304  14.156  12.658  1.00 2.93  ? 5   SER A CA   4  
ATOM 9931  C C    . SER A 1 5   ? -5.662  12.840  13.099  1.00 2.01  ? 5   SER A C    4  
ATOM 9932  O O    . SER A 1 5   ? -4.506  12.800  13.520  1.00 2.25  ? 5   SER A O    4  
ATOM 9933  C CB   . SER A 1 5   ? -5.340  15.323  12.871  1.00 3.70  ? 5   SER A CB   4  
ATOM 9934  O OG   . SER A 1 5   ? -5.965  16.553  12.539  1.00 4.46  ? 5   SER A OG   4  
ATOM 9935  H H    . SER A 1 5   ? -7.519  14.992  14.170  1.00 3.53  ? 5   SER A H    4  
ATOM 9936  H HA   . SER A 1 5   ? -6.548  14.089  11.609  1.00 3.38  ? 5   SER A HA   4  
ATOM 9937  H HB2  . SER A 1 5   ? -5.036  15.353  13.906  1.00 3.91  ? 5   SER A HB2  4  
ATOM 9938  H HB3  . SER A 1 5   ? -4.472  15.191  12.243  1.00 4.03  ? 5   SER A HB3  4  
ATOM 9939  H HG   . SER A 1 5   ? -6.580  16.414  11.809  1.00 4.64  ? 5   SER A HG   4  
ATOM 9940  N N    . SER A 1 6   ? -6.434  11.771  13.009  1.00 1.51  ? 6   SER A N    4  
ATOM 9941  C CA   . SER A 1 6   ? -5.958  10.440  13.337  1.00 1.03  ? 6   SER A CA   4  
ATOM 9942  C C    . SER A 1 6   ? -6.258  9.501   12.177  1.00 0.82  ? 6   SER A C    4  
ATOM 9943  O O    . SER A 1 6   ? -7.399  9.421   11.721  1.00 0.85  ? 6   SER A O    4  
ATOM 9944  C CB   . SER A 1 6   ? -6.627  9.940   14.618  1.00 1.67  ? 6   SER A CB   4  
ATOM 9945  O OG   . SER A 1 6   ? -6.410  10.843  15.691  1.00 2.25  ? 6   SER A OG   4  
ATOM 9946  H H    . SER A 1 6   ? -7.361  11.880  12.702  1.00 1.99  ? 6   SER A H    4  
ATOM 9947  H HA   . SER A 1 6   ? -4.889  10.492  13.486  1.00 1.21  ? 6   SER A HA   4  
ATOM 9948  H HB2  . SER A 1 6   ? -7.691  9.845   14.452  1.00 2.13  ? 6   SER A HB2  4  
ATOM 9949  H HB3  . SER A 1 6   ? -6.217  8.978   14.883  1.00 2.15  ? 6   SER A HB3  4  
ATOM 9950  H HG   . SER A 1 6   ? -5.535  11.240  15.602  1.00 2.50  ? 6   SER A HG   4  
ATOM 9951  N N    . PRO A 1 7   ? -5.241  8.789   11.679  1.00 0.69  ? 7   PRO A N    4  
ATOM 9952  C CA   . PRO A 1 7   ? -5.370  7.952   10.484  1.00 0.54  ? 7   PRO A CA   4  
ATOM 9953  C C    . PRO A 1 7   ? -6.089  6.639   10.767  1.00 0.44  ? 7   PRO A C    4  
ATOM 9954  O O    . PRO A 1 7   ? -6.071  6.126   11.889  1.00 0.56  ? 7   PRO A O    4  
ATOM 9955  C CB   . PRO A 1 7   ? -3.915  7.678   10.124  1.00 0.61  ? 7   PRO A CB   4  
ATOM 9956  C CG   . PRO A 1 7   ? -3.263  7.594   11.448  1.00 0.75  ? 7   PRO A CG   4  
ATOM 9957  C CD   . PRO A 1 7   ? -3.879  8.711   12.245  1.00 0.82  ? 7   PRO A CD   4  
ATOM 9958  H HA   . PRO A 1 7   ? -5.858  8.473   9.675   1.00 0.57  ? 7   PRO A HA   4  
ATOM 9959  H HB2  . PRO A 1 7   ? -3.839  6.750   9.576   1.00 0.60  ? 7   PRO A HB2  4  
ATOM 9960  H HB3  . PRO A 1 7   ? -3.521  8.494   9.536   1.00 0.68  ? 7   PRO A HB3  4  
ATOM 9961  H HG2  . PRO A 1 7   ? -3.490  6.636   11.899  1.00 0.75  ? 7   PRO A HG2  4  
ATOM 9962  H HG3  . PRO A 1 7   ? -2.199  7.735   11.351  1.00 0.87  ? 7   PRO A HG3  4  
ATOM 9963  H HD2  . PRO A 1 7   ? -3.908  8.459   13.295  1.00 0.93  ? 7   PRO A HD2  4  
ATOM 9964  H HD3  . PRO A 1 7   ? -3.341  9.634   12.089  1.00 0.90  ? 7   PRO A HD3  4  
ATOM 9965  N N    . THR A 1 8   ? -6.720  6.105   9.744   1.00 0.34  ? 8   THR A N    4  
ATOM 9966  C CA   . THR A 1 8   ? -7.382  4.825   9.844   1.00 0.27  ? 8   THR A CA   4  
ATOM 9967  C C    . THR A 1 8   ? -6.439  3.712   9.433   1.00 0.28  ? 8   THR A C    4  
ATOM 9968  O O    . THR A 1 8   ? -5.274  3.967   9.143   1.00 0.35  ? 8   THR A O    4  
ATOM 9969  C CB   . THR A 1 8   ? -8.610  4.791   8.944   1.00 0.28  ? 8   THR A CB   4  
ATOM 9970  O OG1  . THR A 1 8   ? -8.189  4.740   7.579   1.00 0.36  ? 8   THR A OG1  4  
ATOM 9971  C CG2  . THR A 1 8   ? -9.467  6.021   9.190   1.00 0.32  ? 8   THR A CG2  4  
ATOM 9972  H H    . THR A 1 8   ? -6.760  6.599   8.893   1.00 0.42  ? 8   THR A H    4  
ATOM 9973  H HA   . THR A 1 8   ? -7.694  4.673   10.861  1.00 0.31  ? 8   THR A HA   4  
ATOM 9974  H HB   . THR A 1 8   ? -9.186  3.913   9.175   1.00 0.32  ? 8   THR A HB   4  
ATOM 9975  H HG1  . THR A 1 8   ? -8.637  5.440   7.078   1.00 0.31  ? 8   THR A HG1  4  
ATOM 9976  H HG21 . THR A 1 8   ? -8.850  6.904   9.114   1.00 1.05  ? 8   THR A HG21 4  
ATOM 9977  H HG22 . THR A 1 8   ? -9.898  5.966   10.177  1.00 1.08  ? 8   THR A HG22 4  
ATOM 9978  H HG23 . THR A 1 8   ? -10.251 6.070   8.455   1.00 1.04  ? 8   THR A HG23 4  
ATOM 9979  N N    . GLU A 1 9   ? -6.962  2.495   9.380   1.00 0.28  ? 9   GLU A N    4  
ATOM 9980  C CA   . GLU A 1 9   ? -6.188  1.308   9.023   1.00 0.33  ? 9   GLU A CA   4  
ATOM 9981  C C    . GLU A 1 9   ? -5.350  1.543   7.769   1.00 0.36  ? 9   GLU A C    4  
ATOM 9982  O O    . GLU A 1 9   ? -4.145  1.304   7.755   1.00 0.52  ? 9   GLU A O    4  
ATOM 9983  C CB   . GLU A 1 9   ? -7.144  0.145   8.774   1.00 0.40  ? 9   GLU A CB   4  
ATOM 9984  C CG   . GLU A 1 9   ? -6.472  -1.206  8.733   1.00 0.56  ? 9   GLU A CG   4  
ATOM 9985  C CD   . GLU A 1 9   ? -6.112  -1.705  10.116  1.00 1.73  ? 9   GLU A CD   4  
ATOM 9986  O OE1  . GLU A 1 9   ? -7.031  -2.082  10.869  1.00 2.48  ? 9   GLU A OE1  4  
ATOM 9987  O OE2  . GLU A 1 9   ? -4.918  -1.710  10.464  1.00 2.47  ? 9   GLU A OE2  4  
ATOM 9988  H H    . GLU A 1 9   ? -7.917  2.389   9.592   1.00 0.29  ? 9   GLU A H    4  
ATOM 9989  H HA   . GLU A 1 9   ? -5.531  1.065   9.847   1.00 0.37  ? 9   GLU A HA   4  
ATOM 9990  H HB2  . GLU A 1 9   ? -7.881  0.128   9.560   1.00 0.44  ? 9   GLU A HB2  4  
ATOM 9991  H HB3  . GLU A 1 9   ? -7.640  0.303   7.829   1.00 0.38  ? 9   GLU A HB3  4  
ATOM 9992  H HG2  . GLU A 1 9   ? -7.139  -1.918  8.269   1.00 0.94  ? 9   GLU A HG2  4  
ATOM 9993  H HG3  . GLU A 1 9   ? -5.568  -1.123  8.145   1.00 0.73  ? 9   GLU A HG3  4  
ATOM 9994  N N    . THR A 1 10  ? -5.993  2.033   6.726   1.00 0.26  ? 10  THR A N    4  
ATOM 9995  C CA   . THR A 1 10  ? -5.319  2.258   5.460   1.00 0.27  ? 10  THR A CA   4  
ATOM 9996  C C    . THR A 1 10  ? -4.446  3.495   5.518   1.00 0.27  ? 10  THR A C    4  
ATOM 9997  O O    . THR A 1 10  ? -3.349  3.500   4.975   1.00 0.31  ? 10  THR A O    4  
ATOM 9998  C CB   . THR A 1 10  ? -6.321  2.367   4.287   1.00 0.27  ? 10  THR A CB   4  
ATOM 9999  O OG1  . THR A 1 10  ? -5.737  3.073   3.183   1.00 0.40  ? 10  THR A OG1  4  
ATOM 10000 C CG2  . THR A 1 10  ? -7.599  3.058   4.733   1.00 0.25  ? 10  THR A CG2  4  
ATOM 10001 H H    . THR A 1 10  ? -6.939  2.266   6.814   1.00 0.22  ? 10  THR A H    4  
ATOM 10002 H HA   . THR A 1 10  ? -4.678  1.413   5.276   1.00 0.31  ? 10  THR A HA   4  
ATOM 10003 H HB   . THR A 1 10  ? -6.568  1.368   3.956   1.00 0.34  ? 10  THR A HB   4  
ATOM 10004 H HG1  . THR A 1 10  ? -4.778  3.006   3.230   1.00 1.00  ? 10  THR A HG1  4  
ATOM 10005 H HG21 . THR A 1 10  ? -8.178  3.342   3.869   1.00 1.12  ? 10  THR A HG21 4  
ATOM 10006 H HG22 . THR A 1 10  ? -7.352  3.938   5.311   1.00 0.94  ? 10  THR A HG22 4  
ATOM 10007 H HG23 . THR A 1 10  ? -8.177  2.379   5.345   1.00 1.00  ? 10  THR A HG23 4  
ATOM 10008 N N    . GLU A 1 11  ? -4.905  4.525   6.201   1.00 0.25  ? 11  GLU A N    4  
ATOM 10009 C CA   . GLU A 1 11  ? -4.161  5.769   6.248   1.00 0.27  ? 11  GLU A CA   4  
ATOM 10010 C C    . GLU A 1 11  ? -2.871  5.595   7.032   1.00 0.30  ? 11  GLU A C    4  
ATOM 10011 O O    . GLU A 1 11  ? -1.821  6.099   6.639   1.00 0.32  ? 11  GLU A O    4  
ATOM 10012 C CB   . GLU A 1 11  ? -5.007  6.868   6.855   1.00 0.29  ? 11  GLU A CB   4  
ATOM 10013 C CG   . GLU A 1 11  ? -6.383  6.936   6.243   1.00 0.41  ? 11  GLU A CG   4  
ATOM 10014 C CD   . GLU A 1 11  ? -7.188  8.111   6.744   1.00 1.11  ? 11  GLU A CD   4  
ATOM 10015 O OE1  . GLU A 1 11  ? -7.243  8.310   7.974   1.00 1.85  ? 11  GLU A OE1  4  
ATOM 10016 O OE2  . GLU A 1 11  ? -7.787  8.822   5.915   1.00 1.71  ? 11  GLU A OE2  4  
ATOM 10017 H H    . GLU A 1 11  ? -5.761  4.452   6.680   1.00 0.23  ? 11  GLU A H    4  
ATOM 10018 H HA   . GLU A 1 11  ? -3.918  6.037   5.236   1.00 0.30  ? 11  GLU A HA   4  
ATOM 10019 H HB2  . GLU A 1 11  ? -5.106  6.687   7.911   1.00 0.41  ? 11  GLU A HB2  4  
ATOM 10020 H HB3  . GLU A 1 11  ? -4.518  7.817   6.697   1.00 0.42  ? 11  GLU A HB3  4  
ATOM 10021 H HG2  . GLU A 1 11  ? -6.275  7.012   5.174   1.00 0.40  ? 11  GLU A HG2  4  
ATOM 10022 H HG3  . GLU A 1 11  ? -6.913  6.027   6.485   1.00 0.71  ? 11  GLU A HG3  4  
ATOM 10023 N N    . ARG A 1 12  ? -2.945  4.850   8.128   1.00 0.35  ? 12  ARG A N    4  
ATOM 10024 C CA   . ARG A 1 12  ? -1.761  4.572   8.928   1.00 0.42  ? 12  ARG A CA   4  
ATOM 10025 C C    . ARG A 1 12  ? -0.848  3.609   8.184   1.00 0.43  ? 12  ARG A C    4  
ATOM 10026 O O    . ARG A 1 12  ? 0.367   3.635   8.356   1.00 0.47  ? 12  ARG A O    4  
ATOM 10027 C CB   . ARG A 1 12  ? -2.127  4.049   10.332  1.00 0.48  ? 12  ARG A CB   4  
ATOM 10028 C CG   . ARG A 1 12  ? -2.970  2.778   10.378  1.00 0.49  ? 12  ARG A CG   4  
ATOM 10029 C CD   . ARG A 1 12  ? -2.170  1.535   10.043  1.00 0.56  ? 12  ARG A CD   4  
ATOM 10030 N NE   . ARG A 1 12  ? -2.768  0.332   10.610  1.00 1.08  ? 12  ARG A NE   4  
ATOM 10031 C CZ   . ARG A 1 12  ? -2.399  -0.208  11.770  1.00 1.35  ? 12  ARG A CZ   4  
ATOM 10032 N NH1  . ARG A 1 12  ? -1.459  0.367   12.509  1.00 1.86  ? 12  ARG A NH1  4  
ATOM 10033 N NH2  . ARG A 1 12  ? -2.984  -1.315  12.195  1.00 1.95  ? 12  ARG A NH2  4  
ATOM 10034 H H    . ARG A 1 12  ? -3.816  4.481   8.399   1.00 0.35  ? 12  ARG A H    4  
ATOM 10035 H HA   . ARG A 1 12  ? -1.232  5.507   9.040   1.00 0.44  ? 12  ARG A HA   4  
ATOM 10036 H HB2  . ARG A 1 12  ? -1.213  3.852   10.868  1.00 0.56  ? 12  ARG A HB2  4  
ATOM 10037 H HB3  . ARG A 1 12  ? -2.668  4.826   10.851  1.00 0.48  ? 12  ARG A HB3  4  
ATOM 10038 H HG2  . ARG A 1 12  ? -3.385  2.666   11.368  1.00 0.53  ? 12  ARG A HG2  4  
ATOM 10039 H HG3  . ARG A 1 12  ? -3.777  2.873   9.662   1.00 0.45  ? 12  ARG A HG3  4  
ATOM 10040 H HD2  . ARG A 1 12  ? -2.140  1.435   8.965   1.00 0.91  ? 12  ARG A HD2  4  
ATOM 10041 H HD3  . ARG A 1 12  ? -1.167  1.651   10.422  1.00 0.84  ? 12  ARG A HD3  4  
ATOM 10042 H HE   . ARG A 1 12  ? -3.485  -0.106  10.091  1.00 1.80  ? 12  ARG A HE   4  
ATOM 10043 H HH11 . ARG A 1 12  ? -1.017  1.210   12.201  1.00 2.09  ? 12  ARG A HH11 4  
ATOM 10044 H HH12 . ARG A 1 12  ? -1.192  -0.042  13.388  1.00 2.43  ? 12  ARG A HH12 4  
ATOM 10045 H HH21 . ARG A 1 12  ? -3.710  -1.745  11.636  1.00 2.48  ? 12  ARG A HH21 4  
ATOM 10046 H HH22 . ARG A 1 12  ? -2.714  -1.732  13.065  1.00 2.20  ? 12  ARG A HH22 4  
ATOM 10047 N N    . CYS A 1 13  ? -1.444  2.776   7.334   1.00 0.42  ? 13  CYS A N    4  
ATOM 10048 C CA   . CYS A 1 13  ? -0.674  1.897   6.466   1.00 0.44  ? 13  CYS A CA   4  
ATOM 10049 C C    . CYS A 1 13  ? 0.120   2.750   5.509   1.00 0.30  ? 13  CYS A C    4  
ATOM 10050 O O    . CYS A 1 13  ? 1.290   2.507   5.226   1.00 0.29  ? 13  CYS A O    4  
ATOM 10051 C CB   . CYS A 1 13  ? -1.602  0.977   5.663   1.00 0.57  ? 13  CYS A CB   4  
ATOM 10052 S SG   . CYS A 1 13  ? -1.317  1.031   3.877   1.00 2.16  ? 13  CYS A SG   4  
ATOM 10053 H H    . CYS A 1 13  ? -2.427  2.766   7.278   1.00 0.41  ? 13  CYS A H    4  
ATOM 10054 H HA   . CYS A 1 13  ? -0.001  1.308   7.069   1.00 0.55  ? 13  CYS A HA   4  
ATOM 10055 H HB2  . CYS A 1 13  ? -1.455  -0.038  5.976   1.00 1.00  ? 13  CYS A HB2  4  
ATOM 10056 H HB3  . CYS A 1 13  ? -2.633  1.258   5.846   1.00 0.84  ? 13  CYS A HB3  4  
ATOM 10057 H HG   . CYS A 1 13  ? -0.016  1.212   3.679   1.00 2.85  ? 13  CYS A HG   4  
ATOM 10058 N N    . ILE A 1 14  ? -0.543  3.771   5.037   1.00 0.26  ? 14  ILE A N    4  
ATOM 10059 C CA   . ILE A 1 14  ? 0.003   4.649   4.051   1.00 0.24  ? 14  ILE A CA   4  
ATOM 10060 C C    . ILE A 1 14  ? 1.146   5.481   4.616   1.00 0.21  ? 14  ILE A C    4  
ATOM 10061 O O    . ILE A 1 14  ? 2.180   5.645   3.970   1.00 0.23  ? 14  ILE A O    4  
ATOM 10062 C CB   . ILE A 1 14  ? -1.119  5.538   3.504   1.00 0.24  ? 14  ILE A CB   4  
ATOM 10063 C CG1  . ILE A 1 14  ? -2.030  4.705   2.600   1.00 0.25  ? 14  ILE A CG1  4  
ATOM 10064 C CG2  . ILE A 1 14  ? -0.555  6.735   2.772   1.00 0.27  ? 14  ILE A CG2  4  
ATOM 10065 C CD1  . ILE A 1 14  ? -3.328  5.392   2.270   1.00 0.27  ? 14  ILE A CD1  4  
ATOM 10066 H H    . ILE A 1 14  ? -1.455  3.932   5.360   1.00 0.27  ? 14  ILE A H    4  
ATOM 10067 H HA   . ILE A 1 14  ? 0.376   4.040   3.246   1.00 0.27  ? 14  ILE A HA   4  
ATOM 10068 H HB   . ILE A 1 14  ? -1.699  5.898   4.342   1.00 0.25  ? 14  ILE A HB   4  
ATOM 10069 H HG12 . ILE A 1 14  ? -1.522  4.498   1.671   1.00 0.26  ? 14  ILE A HG12 4  
ATOM 10070 H HG13 . ILE A 1 14  ? -2.266  3.769   3.095   1.00 0.27  ? 14  ILE A HG13 4  
ATOM 10071 H HG21 . ILE A 1 14  ? 0.192   6.397   2.072   1.00 1.02  ? 14  ILE A HG21 4  
ATOM 10072 H HG22 . ILE A 1 14  ? -0.106  7.414   3.482   1.00 1.02  ? 14  ILE A HG22 4  
ATOM 10073 H HG23 . ILE A 1 14  ? -1.348  7.237   2.240   1.00 1.01  ? 14  ILE A HG23 4  
ATOM 10074 H HD11 . ILE A 1 14  ? -3.902  4.772   1.597   1.00 1.06  ? 14  ILE A HD11 4  
ATOM 10075 H HD12 . ILE A 1 14  ? -3.117  6.342   1.801   1.00 0.96  ? 14  ILE A HD12 4  
ATOM 10076 H HD13 . ILE A 1 14  ? -3.889  5.552   3.180   1.00 1.12  ? 14  ILE A HD13 4  
ATOM 10077 N N    . GLU A 1 15  ? 0.990   5.957   5.841   1.00 0.24  ? 15  GLU A N    4  
ATOM 10078 C CA   . GLU A 1 15  ? 2.007   6.787   6.452   1.00 0.28  ? 15  GLU A CA   4  
ATOM 10079 C C    . GLU A 1 15  ? 3.155   5.924   6.909   1.00 0.30  ? 15  GLU A C    4  
ATOM 10080 O O    . GLU A 1 15  ? 4.287   6.385   7.020   1.00 0.34  ? 15  GLU A O    4  
ATOM 10081 C CB   . GLU A 1 15  ? 1.457   7.545   7.647   1.00 0.32  ? 15  GLU A CB   4  
ATOM 10082 C CG   . GLU A 1 15  ? 0.214   8.362   7.346   1.00 0.33  ? 15  GLU A CG   4  
ATOM 10083 C CD   . GLU A 1 15  ? -0.294  9.101   8.565   1.00 0.38  ? 15  GLU A CD   4  
ATOM 10084 O OE1  . GLU A 1 15  ? -0.428  8.470   9.636   1.00 1.26  ? 15  GLU A OE1  4  
ATOM 10085 O OE2  . GLU A 1 15  ? -0.556  10.319  8.463   1.00 1.06  ? 15  GLU A OE2  4  
ATOM 10086 H H    . GLU A 1 15  ? 0.189   5.725   6.352   1.00 0.26  ? 15  GLU A H    4  
ATOM 10087 H HA   . GLU A 1 15  ? 2.362   7.489   5.713   1.00 0.29  ? 15  GLU A HA   4  
ATOM 10088 H HB2  . GLU A 1 15  ? 1.219   6.832   8.426   1.00 0.33  ? 15  GLU A HB2  4  
ATOM 10089 H HB3  . GLU A 1 15  ? 2.226   8.213   8.004   1.00 0.37  ? 15  GLU A HB3  4  
ATOM 10090 H HG2  . GLU A 1 15  ? 0.452   9.084   6.577   1.00 0.33  ? 15  GLU A HG2  4  
ATOM 10091 H HG3  . GLU A 1 15  ? -0.563  7.699   6.990   1.00 0.31  ? 15  GLU A HG3  4  
ATOM 10092 N N    . SER A 1 16  ? 2.856   4.664   7.183   1.00 0.31  ? 16  SER A N    4  
ATOM 10093 C CA   . SER A 1 16  ? 3.879   3.740   7.603   1.00 0.38  ? 16  SER A CA   4  
ATOM 10094 C C    . SER A 1 16  ? 4.807   3.450   6.436   1.00 0.29  ? 16  SER A C    4  
ATOM 10095 O O    . SER A 1 16  ? 6.002   3.234   6.613   1.00 0.28  ? 16  SER A O    4  
ATOM 10096 C CB   . SER A 1 16  ? 3.259   2.458   8.175   1.00 0.54  ? 16  SER A CB   4  
ATOM 10097 O OG   . SER A 1 16  ? 2.695   1.639   7.172   1.00 0.97  ? 16  SER A OG   4  
ATOM 10098 H H    . SER A 1 16  ? 1.925   4.360   7.116   1.00 0.31  ? 16  SER A H    4  
ATOM 10099 H HA   . SER A 1 16  ? 4.449   4.231   8.369   1.00 0.45  ? 16  SER A HA   4  
ATOM 10100 H HB2  . SER A 1 16  ? 4.015   1.895   8.689   1.00 0.77  ? 16  SER A HB2  4  
ATOM 10101 H HB3  . SER A 1 16  ? 2.480   2.727   8.875   1.00 0.80  ? 16  SER A HB3  4  
ATOM 10102 H HG   . SER A 1 16  ? 2.285   2.189   6.493   1.00 1.17  ? 16  SER A HG   4  
ATOM 10103 N N    . LEU A 1 17  ? 4.250   3.494   5.232   1.00 0.27  ? 17  LEU A N    4  
ATOM 10104 C CA   . LEU A 1 17  ? 5.044   3.364   4.026   1.00 0.28  ? 17  LEU A CA   4  
ATOM 10105 C C    . LEU A 1 17  ? 5.914   4.589   3.860   1.00 0.27  ? 17  LEU A C    4  
ATOM 10106 O O    . LEU A 1 17  ? 7.054   4.486   3.445   1.00 0.32  ? 17  LEU A O    4  
ATOM 10107 C CB   . LEU A 1 17  ? 4.145   3.187   2.812   1.00 0.29  ? 17  LEU A CB   4  
ATOM 10108 C CG   . LEU A 1 17  ? 3.213   1.987   2.911   1.00 0.33  ? 17  LEU A CG   4  
ATOM 10109 C CD1  . LEU A 1 17  ? 2.271   1.918   1.722   1.00 0.33  ? 17  LEU A CD1  4  
ATOM 10110 C CD2  . LEU A 1 17  ? 4.025   0.705   3.045   1.00 0.46  ? 17  LEU A CD2  4  
ATOM 10111 H H    . LEU A 1 17  ? 3.282   3.619   5.156   1.00 0.28  ? 17  LEU A H    4  
ATOM 10112 H HA   . LEU A 1 17  ? 5.675   2.495   4.131   1.00 0.31  ? 17  LEU A HA   4  
ATOM 10113 H HB2  . LEU A 1 17  ? 3.554   4.084   2.696   1.00 0.27  ? 17  LEU A HB2  4  
ATOM 10114 H HB3  . LEU A 1 17  ? 4.768   3.064   1.937   1.00 0.36  ? 17  LEU A HB3  4  
ATOM 10115 H HG   . LEU A 1 17  ? 2.612   2.093   3.798   1.00 0.33  ? 17  LEU A HG   4  
ATOM 10116 H HD11 . LEU A 1 17  ? 2.837   1.724   0.823   1.00 1.09  ? 17  LEU A HD11 4  
ATOM 10117 H HD12 . LEU A 1 17  ? 1.750   2.860   1.623   1.00 1.06  ? 17  LEU A HD12 4  
ATOM 10118 H HD13 . LEU A 1 17  ? 1.554   1.124   1.878   1.00 1.06  ? 17  LEU A HD13 4  
ATOM 10119 H HD21 . LEU A 1 17  ? 4.526   0.696   4.003   1.00 1.08  ? 17  LEU A HD21 4  
ATOM 10120 H HD22 . LEU A 1 17  ? 4.759   0.660   2.254   1.00 1.10  ? 17  LEU A HD22 4  
ATOM 10121 H HD23 . LEU A 1 17  ? 3.366   -0.150  2.974   1.00 1.21  ? 17  LEU A HD23 4  
ATOM 10122 N N    . ILE A 1 18  ? 5.369   5.745   4.206   1.00 0.27  ? 18  ILE A N    4  
ATOM 10123 C CA   . ILE A 1 18  ? 6.139   6.977   4.231   1.00 0.30  ? 18  ILE A CA   4  
ATOM 10124 C C    . ILE A 1 18  ? 7.275   6.853   5.244   1.00 0.28  ? 18  ILE A C    4  
ATOM 10125 O O    . ILE A 1 18  ? 8.396   7.285   4.988   1.00 0.30  ? 18  ILE A O    4  
ATOM 10126 C CB   . ILE A 1 18  ? 5.238   8.209   4.552   1.00 0.36  ? 18  ILE A CB   4  
ATOM 10127 C CG1  . ILE A 1 18  ? 4.614   8.781   3.269   1.00 0.63  ? 18  ILE A CG1  4  
ATOM 10128 C CG2  . ILE A 1 18  ? 6.022   9.298   5.267   1.00 0.47  ? 18  ILE A CG2  4  
ATOM 10129 C CD1  . ILE A 1 18  ? 3.727   7.818   2.515   1.00 1.37  ? 18  ILE A CD1  4  
ATOM 10130 H H    . ILE A 1 18  ? 4.425   5.771   4.451   1.00 0.29  ? 18  ILE A H    4  
ATOM 10131 H HA   . ILE A 1 18  ? 6.566   7.116   3.250   1.00 0.33  ? 18  ILE A HA   4  
ATOM 10132 H HB   . ILE A 1 18  ? 4.443   7.883   5.213   1.00 0.36  ? 18  ILE A HB   4  
ATOM 10133 H HG12 . ILE A 1 18  ? 4.016   9.641   3.526   1.00 0.98  ? 18  ILE A HG12 4  
ATOM 10134 H HG13 . ILE A 1 18  ? 5.408   9.091   2.604   1.00 1.37  ? 18  ILE A HG13 4  
ATOM 10135 H HG21 . ILE A 1 18  ? 6.868   9.587   4.658   1.00 1.13  ? 18  ILE A HG21 4  
ATOM 10136 H HG22 . ILE A 1 18  ? 6.372   8.923   6.220   1.00 1.10  ? 18  ILE A HG22 4  
ATOM 10137 H HG23 . ILE A 1 18  ? 5.382   10.158  5.424   1.00 1.11  ? 18  ILE A HG23 4  
ATOM 10138 H HD11 . ILE A 1 18  ? 3.329   8.306   1.637   1.00 1.87  ? 18  ILE A HD11 4  
ATOM 10139 H HD12 . ILE A 1 18  ? 2.913   7.504   3.152   1.00 1.89  ? 18  ILE A HD12 4  
ATOM 10140 H HD13 . ILE A 1 18  ? 4.304   6.954   2.217   1.00 1.99  ? 18  ILE A HD13 4  
ATOM 10141 N N    . ALA A 1 19  ? 6.981   6.227   6.376   1.00 0.25  ? 19  ALA A N    4  
ATOM 10142 C CA   . ALA A 1 19  ? 7.970   6.012   7.422   1.00 0.25  ? 19  ALA A CA   4  
ATOM 10143 C C    . ALA A 1 19  ? 9.118   5.133   6.931   1.00 0.23  ? 19  ALA A C    4  
ATOM 10144 O O    . ALA A 1 19  ? 10.278  5.554   6.948   1.00 0.28  ? 19  ALA A O    4  
ATOM 10145 C CB   . ALA A 1 19  ? 7.314   5.396   8.650   1.00 0.28  ? 19  ALA A CB   4  
ATOM 10146 H H    . ALA A 1 19  ? 6.062   5.908   6.518   1.00 0.26  ? 19  ALA A H    4  
ATOM 10147 H HA   . ALA A 1 19  ? 8.366   6.977   7.703   1.00 0.29  ? 19  ALA A HA   4  
ATOM 10148 H HB1  . ALA A 1 19  ? 6.471   6.000   8.949   1.00 1.04  ? 19  ALA A HB1  4  
ATOM 10149 H HB2  . ALA A 1 19  ? 8.030   5.353   9.456   1.00 1.06  ? 19  ALA A HB2  4  
ATOM 10150 H HB3  . ALA A 1 19  ? 6.977   4.397   8.414   1.00 0.97  ? 19  ALA A HB3  4  
ATOM 10151 N N    . VAL A 1 20  ? 8.797   3.917   6.486   1.00 0.20  ? 20  VAL A N    4  
ATOM 10152 C CA   . VAL A 1 20  ? 9.823   2.987   6.017   1.00 0.22  ? 20  VAL A CA   4  
ATOM 10153 C C    . VAL A 1 20  ? 10.501  3.497   4.752   1.00 0.23  ? 20  VAL A C    4  
ATOM 10154 O O    . VAL A 1 20  ? 11.726  3.429   4.631   1.00 0.27  ? 20  VAL A O    4  
ATOM 10155 C CB   . VAL A 1 20  ? 9.282   1.556   5.774   1.00 0.27  ? 20  VAL A CB   4  
ATOM 10156 C CG1  . VAL A 1 20  ? 7.977   1.578   5.002   1.00 0.87  ? 20  VAL A CG1  4  
ATOM 10157 C CG2  . VAL A 1 20  ? 10.312  0.717   5.039   1.00 0.87  ? 20  VAL A CG2  4  
ATOM 10158 H H    . VAL A 1 20  ? 7.852   3.641   6.477   1.00 0.21  ? 20  VAL A H    4  
ATOM 10159 H HA   . VAL A 1 20  ? 10.567  2.927   6.792   1.00 0.24  ? 20  VAL A HA   4  
ATOM 10160 H HB   . VAL A 1 20  ? 9.104   1.094   6.727   1.00 0.52  ? 20  VAL A HB   4  
ATOM 10161 H HG11 . VAL A 1 20  ? 7.226   2.094   5.582   1.00 1.36  ? 20  VAL A HG11 4  
ATOM 10162 H HG12 . VAL A 1 20  ? 7.652   0.565   4.813   1.00 1.57  ? 20  VAL A HG12 4  
ATOM 10163 H HG13 . VAL A 1 20  ? 8.124   2.091   4.065   1.00 1.42  ? 20  VAL A HG13 4  
ATOM 10164 H HG21 . VAL A 1 20  ? 10.497  1.151   4.067   1.00 1.45  ? 20  VAL A HG21 4  
ATOM 10165 H HG22 . VAL A 1 20  ? 9.938   -0.287  4.921   1.00 1.40  ? 20  VAL A HG22 4  
ATOM 10166 H HG23 . VAL A 1 20  ? 11.232  0.693   5.604   1.00 1.53  ? 20  VAL A HG23 4  
ATOM 10167 N N    . PHE A 1 21  ? 9.717   4.017   3.821   1.00 0.23  ? 21  PHE A N    4  
ATOM 10168 C CA   . PHE A 1 21  ? 10.276  4.527   2.576   1.00 0.25  ? 21  PHE A CA   4  
ATOM 10169 C C    . PHE A 1 21  ? 11.320  5.597   2.860   1.00 0.29  ? 21  PHE A C    4  
ATOM 10170 O O    . PHE A 1 21  ? 12.434  5.531   2.362   1.00 0.35  ? 21  PHE A O    4  
ATOM 10171 C CB   . PHE A 1 21  ? 9.182   5.108   1.679   1.00 0.26  ? 21  PHE A CB   4  
ATOM 10172 C CG   . PHE A 1 21  ? 9.701   5.701   0.403   1.00 0.91  ? 21  PHE A CG   4  
ATOM 10173 C CD1  . PHE A 1 21  ? 10.095  4.887   -0.640  1.00 1.85  ? 21  PHE A CD1  4  
ATOM 10174 C CD2  . PHE A 1 21  ? 9.799   7.074   0.250   1.00 1.59  ? 21  PHE A CD2  4  
ATOM 10175 C CE1  . PHE A 1 21  ? 10.578  5.426   -1.812  1.00 2.48  ? 21  PHE A CE1  4  
ATOM 10176 C CE2  . PHE A 1 21  ? 10.283  7.618   -0.921  1.00 2.17  ? 21  PHE A CE2  4  
ATOM 10177 C CZ   . PHE A 1 21  ? 10.673  6.793   -1.953  1.00 2.40  ? 21  PHE A CZ   4  
ATOM 10178 H H    . PHE A 1 21  ? 8.732   4.057   3.972   1.00 0.23  ? 21  PHE A H    4  
ATOM 10179 H HA   . PHE A 1 21  ? 10.751  3.703   2.064   1.00 0.27  ? 21  PHE A HA   4  
ATOM 10180 H HB2  . PHE A 1 21  ? 8.480   4.327   1.425   1.00 0.64  ? 21  PHE A HB2  4  
ATOM 10181 H HB3  . PHE A 1 21  ? 8.667   5.885   2.221   1.00 0.62  ? 21  PHE A HB3  4  
ATOM 10182 H HD1  . PHE A 1 21  ? 10.020  3.815   -0.532  1.00 2.42  ? 21  PHE A HD1  4  
ATOM 10183 H HD2  . PHE A 1 21  ? 9.495   7.721   1.059   1.00 2.15  ? 21  PHE A HD2  4  
ATOM 10184 H HE1  . PHE A 1 21  ? 10.883  4.777   -2.621  1.00 3.33  ? 21  PHE A HE1  4  
ATOM 10185 H HE2  . PHE A 1 21  ? 10.356  8.688   -1.029  1.00 2.85  ? 21  PHE A HE2  4  
ATOM 10186 H HZ   . PHE A 1 21  ? 11.051  7.218   -2.870  1.00 2.98  ? 21  PHE A HZ   4  
ATOM 10187 N N    . GLN A 1 22  ? 10.963  6.550   3.702   1.00 0.30  ? 22  GLN A N    4  
ATOM 10188 C CA   . GLN A 1 22  ? 11.792  7.720   3.932   1.00 0.37  ? 22  GLN A CA   4  
ATOM 10189 C C    . GLN A 1 22  ? 13.010  7.420   4.797   1.00 0.36  ? 22  GLN A C    4  
ATOM 10190 O O    . GLN A 1 22  ? 13.999  8.148   4.738   1.00 0.44  ? 22  GLN A O    4  
ATOM 10191 C CB   . GLN A 1 22  ? 10.939  8.833   4.535   1.00 0.47  ? 22  GLN A CB   4  
ATOM 10192 C CG   . GLN A 1 22  ? 10.195  9.632   3.482   1.00 1.12  ? 22  GLN A CG   4  
ATOM 10193 C CD   . GLN A 1 22  ? 9.196   10.606  4.065   1.00 1.98  ? 22  GLN A CD   4  
ATOM 10194 O OE1  . GLN A 1 22  ? 9.357   11.095  5.178   1.00 2.68  ? 22  GLN A OE1  4  
ATOM 10195 N NE2  . GLN A 1 22  ? 8.154   10.906  3.305   1.00 2.66  ? 22  GLN A NE2  4  
ATOM 10196 H H    . GLN A 1 22  ? 10.116  6.463   4.194   1.00 0.28  ? 22  GLN A H    4  
ATOM 10197 H HA   . GLN A 1 22  ? 12.150  8.052   2.970   1.00 0.42  ? 22  GLN A HA   4  
ATOM 10198 H HB2  . GLN A 1 22  ? 10.205  8.389   5.200   1.00 0.83  ? 22  GLN A HB2  4  
ATOM 10199 H HB3  . GLN A 1 22  ? 11.570  9.504   5.095   1.00 0.94  ? 22  GLN A HB3  4  
ATOM 10200 H HG2  . GLN A 1 22  ? 10.915  10.187  2.899   1.00 1.54  ? 22  GLN A HG2  4  
ATOM 10201 H HG3  . GLN A 1 22  ? 9.670   8.944   2.837   1.00 1.68  ? 22  GLN A HG3  4  
ATOM 10202 H HE21 . GLN A 1 22  ? 8.094   10.488  2.424   1.00 2.74  ? 22  GLN A HE21 4  
ATOM 10203 H HE22 . GLN A 1 22  ? 7.491   11.533  3.657   1.00 3.38  ? 22  GLN A HE22 4  
ATOM 10204 N N    . LYS A 1 23  ? 12.973  6.352   5.579   1.00 0.35  ? 23  LYS A N    4  
ATOM 10205 C CA   . LYS A 1 23  ? 14.129  6.016   6.395   1.00 0.39  ? 23  LYS A CA   4  
ATOM 10206 C C    . LYS A 1 23  ? 15.188  5.288   5.566   1.00 0.40  ? 23  LYS A C    4  
ATOM 10207 O O    . LYS A 1 23  ? 16.385  5.471   5.781   1.00 0.49  ? 23  LYS A O    4  
ATOM 10208 C CB   . LYS A 1 23  ? 13.728  5.191   7.625   1.00 0.41  ? 23  LYS A CB   4  
ATOM 10209 C CG   . LYS A 1 23  ? 13.078  3.874   7.313   1.00 0.42  ? 23  LYS A CG   4  
ATOM 10210 C CD   . LYS A 1 23  ? 12.393  3.319   8.540   1.00 0.63  ? 23  LYS A CD   4  
ATOM 10211 C CE   . LYS A 1 23  ? 12.285  1.818   8.452   1.00 0.63  ? 23  LYS A CE   4  
ATOM 10212 N NZ   . LYS A 1 23  ? 11.552  1.218   9.597   1.00 0.91  ? 23  LYS A NZ   4  
ATOM 10213 H H    . LYS A 1 23  ? 12.162  5.793   5.618   1.00 0.35  ? 23  LYS A H    4  
ATOM 10214 H HA   . LYS A 1 23  ? 14.551  6.951   6.730   1.00 0.42  ? 23  LYS A HA   4  
ATOM 10215 H HB2  . LYS A 1 23  ? 14.609  4.981   8.208   1.00 0.45  ? 23  LYS A HB2  4  
ATOM 10216 H HB3  . LYS A 1 23  ? 13.043  5.766   8.224   1.00 0.45  ? 23  LYS A HB3  4  
ATOM 10217 H HG2  . LYS A 1 23  ? 12.347  4.018   6.531   1.00 0.53  ? 23  LYS A HG2  4  
ATOM 10218 H HG3  . LYS A 1 23  ? 13.834  3.176   6.983   1.00 0.57  ? 23  LYS A HG3  4  
ATOM 10219 H HD2  . LYS A 1 23  ? 12.965  3.585   9.414   1.00 0.97  ? 23  LYS A HD2  4  
ATOM 10220 H HD3  . LYS A 1 23  ? 11.403  3.745   8.605   1.00 0.85  ? 23  LYS A HD3  4  
ATOM 10221 H HE2  . LYS A 1 23  ? 11.778  1.564   7.538   1.00 0.72  ? 23  LYS A HE2  4  
ATOM 10222 H HE3  . LYS A 1 23  ? 13.285  1.420   8.426   1.00 0.85  ? 23  LYS A HE3  4  
ATOM 10223 H HZ1  . LYS A 1 23  ? 11.370  0.205   9.415   1.00 1.42  ? 23  LYS A HZ1  4  
ATOM 10224 H HZ2  . LYS A 1 23  ? 10.642  1.700   9.737   1.00 1.25  ? 23  LYS A HZ2  4  
ATOM 10225 H HZ3  . LYS A 1 23  ? 12.112  1.305   10.467  1.00 1.47  ? 23  LYS A HZ3  4  
ATOM 10226 N N    . TYR A 1 24  ? 14.745  4.471   4.615   1.00 0.36  ? 24  TYR A N    4  
ATOM 10227 C CA   . TYR A 1 24  ? 15.666  3.737   3.752   1.00 0.39  ? 24  TYR A CA   4  
ATOM 10228 C C    . TYR A 1 24  ? 16.076  4.552   2.535   1.00 0.34  ? 24  TYR A C    4  
ATOM 10229 O O    . TYR A 1 24  ? 17.244  4.579   2.166   1.00 0.40  ? 24  TYR A O    4  
ATOM 10230 C CB   . TYR A 1 24  ? 15.058  2.404   3.329   1.00 0.46  ? 24  TYR A CB   4  
ATOM 10231 C CG   . TYR A 1 24  ? 15.081  1.382   4.438   1.00 0.86  ? 24  TYR A CG   4  
ATOM 10232 C CD1  . TYR A 1 24  ? 16.245  0.691   4.744   1.00 1.67  ? 24  TYR A CD1  4  
ATOM 10233 C CD2  . TYR A 1 24  ? 13.952  1.128   5.196   1.00 1.52  ? 24  TYR A CD2  4  
ATOM 10234 C CE1  . TYR A 1 24  ? 16.282  -0.222  5.779   1.00 1.99  ? 24  TYR A CE1  4  
ATOM 10235 C CE2  . TYR A 1 24  ? 13.980  0.214   6.228   1.00 1.83  ? 24  TYR A CE2  4  
ATOM 10236 C CZ   . TYR A 1 24  ? 15.145  -0.456  6.517   1.00 1.72  ? 24  TYR A CZ   4  
ATOM 10237 O OH   . TYR A 1 24  ? 15.176  -1.356  7.560   1.00 2.15  ? 24  TYR A OH   4  
ATOM 10238 H H    . TYR A 1 24  ? 13.776  4.360   4.486   1.00 0.33  ? 24  TYR A H    4  
ATOM 10239 H HA   . TYR A 1 24  ? 16.555  3.535   4.333   1.00 0.50  ? 24  TYR A HA   4  
ATOM 10240 H HB2  . TYR A 1 24  ? 14.030  2.561   3.034   1.00 0.51  ? 24  TYR A HB2  4  
ATOM 10241 H HB3  . TYR A 1 24  ? 15.615  2.010   2.493   1.00 0.45  ? 24  TYR A HB3  4  
ATOM 10242 H HD1  . TYR A 1 24  ? 17.134  0.877   4.160   1.00 2.37  ? 24  TYR A HD1  4  
ATOM 10243 H HD2  . TYR A 1 24  ? 13.037  1.655   4.968   1.00 2.22  ? 24  TYR A HD2  4  
ATOM 10244 H HE1  . TYR A 1 24  ? 17.197  -0.750  6.001   1.00 2.80  ? 24  TYR A HE1  4  
ATOM 10245 H HE2  . TYR A 1 24  ? 13.088  0.029   6.808   1.00 2.59  ? 24  TYR A HE2  4  
ATOM 10246 H HH   . TYR A 1 24  ? 15.935  -1.166  8.123   1.00 2.39  ? 24  TYR A HH   4  
ATOM 10247 N N    . ALA A 1 25  ? 15.116  5.216   1.915   1.00 0.29  ? 25  ALA A N    4  
ATOM 10248 C CA   . ALA A 1 25  ? 15.397  6.058   0.762   1.00 0.34  ? 25  ALA A CA   4  
ATOM 10249 C C    . ALA A 1 25  ? 16.227  7.259   1.183   1.00 0.47  ? 25  ALA A C    4  
ATOM 10250 O O    . ALA A 1 25  ? 17.043  7.773   0.419   1.00 0.58  ? 25  ALA A O    4  
ATOM 10251 C CB   . ALA A 1 25  ? 14.102  6.507   0.106   1.00 0.37  ? 25  ALA A CB   4  
ATOM 10252 H H    . ALA A 1 25  ? 14.188  5.140   2.236   1.00 0.28  ? 25  ALA A H    4  
ATOM 10253 H HA   . ALA A 1 25  ? 15.958  5.472   0.049   1.00 0.34  ? 25  ALA A HA   4  
ATOM 10254 H HB1  . ALA A 1 25  ? 13.531  7.101   0.807   1.00 1.04  ? 25  ALA A HB1  4  
ATOM 10255 H HB2  . ALA A 1 25  ? 13.526  5.638   -0.180  1.00 0.98  ? 25  ALA A HB2  4  
ATOM 10256 H HB3  . ALA A 1 25  ? 14.326  7.098   -0.771  1.00 1.09  ? 25  ALA A HB3  4  
ATOM 10257 N N    . GLY A 1 26  ? 16.028  7.677   2.426   1.00 0.49  ? 26  GLY A N    4  
ATOM 10258 C CA   . GLY A 1 26  ? 16.753  8.810   2.959   1.00 0.64  ? 26  GLY A CA   4  
ATOM 10259 C C    . GLY A 1 26  ? 18.218  8.498   3.209   1.00 0.75  ? 26  GLY A C    4  
ATOM 10260 O O    . GLY A 1 26  ? 19.009  9.396   3.496   1.00 0.96  ? 26  GLY A O    4  
ATOM 10261 H H    . GLY A 1 26  ? 15.374  7.208   2.988   1.00 0.45  ? 26  GLY A H    4  
ATOM 10262 H HA2  . GLY A 1 26  ? 16.683  9.627   2.258   1.00 0.73  ? 26  GLY A HA2  4  
ATOM 10263 H HA3  . GLY A 1 26  ? 16.295  9.107   3.890   1.00 0.64  ? 26  GLY A HA3  4  
ATOM 10264 N N    . LYS A 1 27  ? 18.578  7.221   3.100   1.00 0.69  ? 27  LYS A N    4  
ATOM 10265 C CA   . LYS A 1 27  ? 19.956  6.789   3.300   1.00 0.82  ? 27  LYS A CA   4  
ATOM 10266 C C    . LYS A 1 27  ? 20.873  7.353   2.222   1.00 0.95  ? 27  LYS A C    4  
ATOM 10267 O O    . LYS A 1 27  ? 22.012  7.733   2.500   1.00 1.11  ? 27  LYS A O    4  
ATOM 10268 C CB   . LYS A 1 27  ? 20.057  5.266   3.271   1.00 0.77  ? 27  LYS A CB   4  
ATOM 10269 C CG   . LYS A 1 27  ? 19.443  4.555   4.462   1.00 0.81  ? 27  LYS A CG   4  
ATOM 10270 C CD   . LYS A 1 27  ? 19.585  3.048   4.306   1.00 0.85  ? 27  LYS A CD   4  
ATOM 10271 C CE   . LYS A 1 27  ? 19.191  2.301   5.567   1.00 1.11  ? 27  LYS A CE   4  
ATOM 10272 N NZ   . LYS A 1 27  ? 19.510  0.849   5.472   1.00 1.72  ? 27  LYS A NZ   4  
ATOM 10273 H H    . LYS A 1 27  ? 17.897  6.552   2.870   1.00 0.60  ? 27  LYS A H    4  
ATOM 10274 H HA   . LYS A 1 27  ? 20.284  7.147   4.264   1.00 0.92  ? 27  LYS A HA   4  
ATOM 10275 H HB2  . LYS A 1 27  ? 19.563  4.908   2.380   1.00 0.68  ? 27  LYS A HB2  4  
ATOM 10276 H HB3  . LYS A 1 27  ? 21.100  4.994   3.219   1.00 0.89  ? 27  LYS A HB3  4  
ATOM 10277 H HG2  . LYS A 1 27  ? 19.950  4.869   5.363   1.00 0.95  ? 27  LYS A HG2  4  
ATOM 10278 H HG3  . LYS A 1 27  ? 18.395  4.807   4.525   1.00 0.78  ? 27  LYS A HG3  4  
ATOM 10279 H HD2  . LYS A 1 27  ? 18.946  2.722   3.500   1.00 1.08  ? 27  LYS A HD2  4  
ATOM 10280 H HD3  . LYS A 1 27  ? 20.613  2.818   4.068   1.00 1.11  ? 27  LYS A HD3  4  
ATOM 10281 H HE2  . LYS A 1 27  ? 19.727  2.725   6.404   1.00 1.65  ? 27  LYS A HE2  4  
ATOM 10282 H HE3  . LYS A 1 27  ? 18.129  2.419   5.723   1.00 1.47  ? 27  LYS A HE3  4  
ATOM 10283 H HZ1  . LYS A 1 27  ? 19.200  0.357   6.336   1.00 2.17  ? 27  LYS A HZ1  4  
ATOM 10284 H HZ2  . LYS A 1 27  ? 20.536  0.716   5.364   1.00 2.11  ? 27  LYS A HZ2  4  
ATOM 10285 H HZ3  . LYS A 1 27  ? 19.030  0.424   4.651   1.00 2.19  ? 27  LYS A HZ3  4  
ATOM 10286 N N    . ASP A 1 28  ? 20.374  7.415   0.992   1.00 1.00  ? 28  ASP A N    4  
ATOM 10287 C CA   . ASP A 1 28  ? 21.211  7.794   -0.141  1.00 1.19  ? 28  ASP A CA   4  
ATOM 10288 C C    . ASP A 1 28  ? 21.506  9.292   -0.126  1.00 1.26  ? 28  ASP A C    4  
ATOM 10289 O O    . ASP A 1 28  ? 22.552  9.730   -0.603  1.00 1.58  ? 28  ASP A O    4  
ATOM 10290 C CB   . ASP A 1 28  ? 20.537  7.388   -1.458  1.00 1.33  ? 28  ASP A CB   4  
ATOM 10291 C CG   . ASP A 1 28  ? 21.404  7.661   -2.674  1.00 1.65  ? 28  ASP A CG   4  
ATOM 10292 O OD1  . ASP A 1 28  ? 22.455  6.997   -2.821  1.00 2.08  ? 28  ASP A OD1  4  
ATOM 10293 O OD2  . ASP A 1 28  ? 21.037  8.526   -3.496  1.00 2.16  ? 28  ASP A OD2  4  
ATOM 10294 H H    . ASP A 1 28  ? 19.428  7.202   0.843   1.00 0.99  ? 28  ASP A H    4  
ATOM 10295 H HA   . ASP A 1 28  ? 22.145  7.260   -0.050  1.00 1.28  ? 28  ASP A HA   4  
ATOM 10296 H HB2  . ASP A 1 28  ? 20.318  6.330   -1.426  1.00 1.33  ? 28  ASP A HB2  4  
ATOM 10297 H HB3  . ASP A 1 28  ? 19.614  7.939   -1.565  1.00 1.44  ? 28  ASP A HB3  4  
ATOM 10298 N N    . GLY A 1 29  ? 20.595  10.065  0.464   1.00 1.15  ? 29  GLY A N    4  
ATOM 10299 C CA   . GLY A 1 29  ? 20.809  11.497  0.660   1.00 1.32  ? 29  GLY A CA   4  
ATOM 10300 C C    . GLY A 1 29  ? 20.729  12.320  -0.619  1.00 1.51  ? 29  GLY A C    4  
ATOM 10301 O O    . GLY A 1 29  ? 20.195  13.433  -0.615  1.00 1.64  ? 29  GLY A O    4  
ATOM 10302 H H    . GLY A 1 29  ? 19.757  9.659   0.771   1.00 1.14  ? 29  GLY A H    4  
ATOM 10303 H HA2  . GLY A 1 29  ? 20.067  11.864  1.351   1.00 1.60  ? 29  GLY A HA2  4  
ATOM 10304 H HA3  . GLY A 1 29  ? 21.786  11.638  1.098   1.00 1.54  ? 29  GLY A HA3  4  
ATOM 10305 N N    . TYR A 1 30  ? 21.251  11.773  -1.709  1.00 2.07  ? 30  TYR A N    4  
ATOM 10306 C CA   . TYR A 1 30  ? 21.265  12.451  -2.998  1.00 2.80  ? 30  TYR A CA   4  
ATOM 10307 C C    . TYR A 1 30  ? 19.842  12.706  -3.474  1.00 2.61  ? 30  TYR A C    4  
ATOM 10308 O O    . TYR A 1 30  ? 19.545  13.741  -4.070  1.00 3.02  ? 30  TYR A O    4  
ATOM 10309 C CB   . TYR A 1 30  ? 22.024  11.592  -4.012  1.00 3.68  ? 30  TYR A CB   4  
ATOM 10310 C CG   . TYR A 1 30  ? 22.271  12.257  -5.347  1.00 4.52  ? 30  TYR A CG   4  
ATOM 10311 C CD1  . TYR A 1 30  ? 23.350  13.113  -5.525  1.00 5.11  ? 30  TYR A CD1  4  
ATOM 10312 C CD2  . TYR A 1 30  ? 21.439  12.015  -6.433  1.00 5.12  ? 30  TYR A CD2  4  
ATOM 10313 C CE1  . TYR A 1 30  ? 23.594  13.708  -6.746  1.00 6.04  ? 30  TYR A CE1  4  
ATOM 10314 C CE2  . TYR A 1 30  ? 21.674  12.610  -7.657  1.00 6.09  ? 30  TYR A CE2  4  
ATOM 10315 C CZ   . TYR A 1 30  ? 22.753  13.454  -7.809  1.00 6.45  ? 30  TYR A CZ   4  
ATOM 10316 O OH   . TYR A 1 30  ? 22.999  14.038  -9.030  1.00 7.51  ? 30  TYR A OH   4  
ATOM 10317 H H    . TYR A 1 30  ? 21.652  10.879  -1.642  1.00 2.21  ? 30  TYR A H    4  
ATOM 10318 H HA   . TYR A 1 30  ? 21.775  13.395  -2.878  1.00 3.26  ? 30  TYR A HA   4  
ATOM 10319 H HB2  . TYR A 1 30  ? 22.985  11.327  -3.597  1.00 3.86  ? 30  TYR A HB2  4  
ATOM 10320 H HB3  . TYR A 1 30  ? 21.460  10.687  -4.192  1.00 3.95  ? 30  TYR A HB3  4  
ATOM 10321 H HD1  . TYR A 1 30  ? 24.006  13.311  -4.690  1.00 5.09  ? 30  TYR A HD1  4  
ATOM 10322 H HD2  . TYR A 1 30  ? 20.594  11.353  -6.311  1.00 5.07  ? 30  TYR A HD2  4  
ATOM 10323 H HE1  . TYR A 1 30  ? 24.438  14.370  -6.865  1.00 6.63  ? 30  TYR A HE1  4  
ATOM 10324 H HE2  . TYR A 1 30  ? 21.016  12.412  -8.490  1.00 6.74  ? 30  TYR A HE2  4  
ATOM 10325 H HH   . TYR A 1 30  ? 22.180  14.416  -9.375  1.00 7.75  ? 30  TYR A HH   4  
ATOM 10326 N N    . ASN A 1 31  ? 18.969  11.755  -3.193  1.00 2.62  ? 31  ASN A N    4  
ATOM 10327 C CA   . ASN A 1 31  ? 17.563  11.869  -3.538  1.00 2.78  ? 31  ASN A CA   4  
ATOM 10328 C C    . ASN A 1 31  ? 16.746  11.130  -2.485  1.00 1.96  ? 31  ASN A C    4  
ATOM 10329 O O    . ASN A 1 31  ? 17.298  10.361  -1.699  1.00 2.53  ? 31  ASN A O    4  
ATOM 10330 C CB   . ASN A 1 31  ? 17.309  11.268  -4.926  1.00 3.85  ? 31  ASN A CB   4  
ATOM 10331 C CG   . ASN A 1 31  ? 16.076  11.840  -5.607  1.00 4.61  ? 31  ASN A CG   4  
ATOM 10332 O OD1  . ASN A 1 31  ? 15.136  12.297  -4.956  1.00 4.92  ? 31  ASN A OD1  4  
ATOM 10333 N ND2  . ASN A 1 31  ? 16.067  11.811  -6.930  1.00 5.33  ? 31  ASN A ND2  4  
ATOM 10334 H H    . ASN A 1 31  ? 19.278  10.945  -2.732  1.00 2.93  ? 31  ASN A H    4  
ATOM 10335 H HA   . ASN A 1 31  ? 17.293  12.914  -3.537  1.00 3.24  ? 31  ASN A HA   4  
ATOM 10336 H HB2  . ASN A 1 31  ? 18.164  11.463  -5.555  1.00 4.17  ? 31  ASN A HB2  4  
ATOM 10337 H HB3  . ASN A 1 31  ? 17.180  10.200  -4.828  1.00 4.22  ? 31  ASN A HB3  4  
ATOM 10338 H HD21 . ASN A 1 31  ? 16.842  11.424  -7.391  1.00 5.37  ? 31  ASN A HD21 4  
ATOM 10339 H HD22 . ASN A 1 31  ? 15.285  12.174  -7.397  1.00 5.97  ? 31  ASN A HD22 4  
ATOM 10340 N N    . TYR A 1 32  ? 15.444  11.367  -2.469  1.00 1.18  ? 32  TYR A N    4  
ATOM 10341 C CA   . TYR A 1 32  ? 14.553  10.698  -1.529  1.00 1.18  ? 32  TYR A CA   4  
ATOM 10342 C C    . TYR A 1 32  ? 13.986  9.428   -2.159  1.00 0.92  ? 32  TYR A C    4  
ATOM 10343 O O    . TYR A 1 32  ? 12.889  8.980   -1.829  1.00 1.05  ? 32  TYR A O    4  
ATOM 10344 C CB   . TYR A 1 32  ? 13.426  11.642  -1.092  1.00 1.78  ? 32  TYR A CB   4  
ATOM 10345 C CG   . TYR A 1 32  ? 12.631  12.242  -2.236  1.00 2.38  ? 32  TYR A CG   4  
ATOM 10346 C CD1  . TYR A 1 32  ? 11.552  11.565  -2.788  1.00 2.99  ? 32  TYR A CD1  4  
ATOM 10347 C CD2  . TYR A 1 32  ? 12.961  13.485  -2.759  1.00 3.08  ? 32  TYR A CD2  4  
ATOM 10348 C CE1  . TYR A 1 32  ? 10.828  12.107  -3.828  1.00 3.86  ? 32  TYR A CE1  4  
ATOM 10349 C CE2  . TYR A 1 32  ? 12.240  14.036  -3.801  1.00 3.93  ? 32  TYR A CE2  4  
ATOM 10350 C CZ   . TYR A 1 32  ? 11.175  13.342  -4.331  1.00 4.19  ? 32  TYR A CZ   4  
ATOM 10351 O OH   . TYR A 1 32  ? 10.449  13.882  -5.371  1.00 5.19  ? 32  TYR A OH   4  
ATOM 10352 H H    . TYR A 1 32  ? 15.066  11.999  -3.121  1.00 1.45  ? 32  TYR A H    4  
ATOM 10353 H HA   . TYR A 1 32  ? 15.136  10.423  -0.663  1.00 1.86  ? 32  TYR A HA   4  
ATOM 10354 H HB2  . TYR A 1 32  ? 12.740  11.098  -0.466  1.00 2.16  ? 32  TYR A HB2  4  
ATOM 10355 H HB3  . TYR A 1 32  ? 13.852  12.456  -0.523  1.00 2.32  ? 32  TYR A HB3  4  
ATOM 10356 H HD1  . TYR A 1 32  ? 11.281  10.598  -2.392  1.00 3.17  ? 32  TYR A HD1  4  
ATOM 10357 H HD2  . TYR A 1 32  ? 13.797  14.024  -2.340  1.00 3.32  ? 32  TYR A HD2  4  
ATOM 10358 H HE1  . TYR A 1 32  ? 9.994   11.562  -4.243  1.00 4.54  ? 32  TYR A HE1  4  
ATOM 10359 H HE2  . TYR A 1 32  ? 12.511  15.004  -4.193  1.00 4.65  ? 32  TYR A HE2  4  
ATOM 10360 H HH   . TYR A 1 32  ? 11.054  14.264  -6.020  1.00 5.57  ? 32  TYR A HH   4  
ATOM 10361 N N    . THR A 1 33  ? 14.771  8.867   -3.061  1.00 0.67  ? 33  THR A N    4  
ATOM 10362 C CA   . THR A 1 33  ? 14.430  7.659   -3.791  1.00 0.46  ? 33  THR A CA   4  
ATOM 10363 C C    . THR A 1 33  ? 15.283  6.514   -3.256  1.00 0.38  ? 33  THR A C    4  
ATOM 10364 O O    . THR A 1 33  ? 16.444  6.704   -2.895  1.00 0.44  ? 33  THR A O    4  
ATOM 10365 C CB   . THR A 1 33  ? 14.682  7.900   -5.297  1.00 0.45  ? 33  THR A CB   4  
ATOM 10366 O OG1  . THR A 1 33  ? 14.261  9.225   -5.645  1.00 0.66  ? 33  THR A OG1  4  
ATOM 10367 C CG2  . THR A 1 33  ? 13.943  6.911   -6.171  1.00 0.43  ? 33  THR A CG2  4  
ATOM 10368 H H    . THR A 1 33  ? 15.635  9.285   -3.244  1.00 0.73  ? 33  THR A H    4  
ATOM 10369 H HA   . THR A 1 33  ? 13.387  7.408   -3.639  1.00 0.50  ? 33  THR A HA   4  
ATOM 10370 H HB   . THR A 1 33  ? 15.733  7.804   -5.491  1.00 0.56  ? 33  THR A HB   4  
ATOM 10371 H HG1  . THR A 1 33  ? 13.310  9.223   -5.842  1.00 1.28  ? 33  THR A HG1  4  
ATOM 10372 H HG21 . THR A 1 33  ? 14.197  5.904   -5.871  1.00 1.10  ? 33  THR A HG21 4  
ATOM 10373 H HG22 . THR A 1 33  ? 14.231  7.058   -7.202  1.00 0.99  ? 33  THR A HG22 4  
ATOM 10374 H HG23 . THR A 1 33  ? 12.875  7.061   -6.069  1.00 1.14  ? 33  THR A HG23 4  
ATOM 10375 N N    . LEU A 1 34  ? 14.699  5.333   -3.197  1.00 0.32  ? 34  LEU A N    4  
ATOM 10376 C CA   . LEU A 1 34  ? 15.297  4.208   -2.502  1.00 0.30  ? 34  LEU A CA   4  
ATOM 10377 C C    . LEU A 1 34  ? 16.278  3.499   -3.408  1.00 0.31  ? 34  LEU A C    4  
ATOM 10378 O O    . LEU A 1 34  ? 15.900  2.738   -4.291  1.00 0.34  ? 34  LEU A O    4  
ATOM 10379 C CB   . LEU A 1 34  ? 14.162  3.276   -2.066  1.00 0.30  ? 34  LEU A CB   4  
ATOM 10380 C CG   . LEU A 1 34  ? 14.093  2.960   -0.575  1.00 0.29  ? 34  LEU A CG   4  
ATOM 10381 C CD1  . LEU A 1 34  ? 12.685  2.557   -0.177  1.00 0.45  ? 34  LEU A CD1  4  
ATOM 10382 C CD2  . LEU A 1 34  ? 15.057  1.851   -0.223  1.00 0.28  ? 34  LEU A CD2  4  
ATOM 10383 H H    . LEU A 1 34  ? 13.820  5.213   -3.626  1.00 0.32  ? 34  LEU A H    4  
ATOM 10384 H HA   . LEU A 1 34  ? 15.831  4.564   -1.635  1.00 0.32  ? 34  LEU A HA   4  
ATOM 10385 H HB2  . LEU A 1 34  ? 13.221  3.749   -2.347  1.00 0.34  ? 34  LEU A HB2  4  
ATOM 10386 H HB3  . LEU A 1 34  ? 14.265  2.343   -2.611  1.00 0.34  ? 34  LEU A HB3  4  
ATOM 10387 H HG   . LEU A 1 34  ? 14.366  3.842   -0.016  1.00 0.32  ? 34  LEU A HG   4  
ATOM 10388 H HD11 . LEU A 1 34  ? 12.658  2.346   0.883   1.00 1.03  ? 34  LEU A HD11 4  
ATOM 10389 H HD12 . LEU A 1 34  ? 12.394  1.675   -0.727  1.00 1.18  ? 34  LEU A HD12 4  
ATOM 10390 H HD13 . LEU A 1 34  ? 12.004  3.363   -0.401  1.00 1.08  ? 34  LEU A HD13 4  
ATOM 10391 H HD21 . LEU A 1 34  ? 14.868  1.516   0.787   1.00 1.05  ? 34  LEU A HD21 4  
ATOM 10392 H HD22 . LEU A 1 34  ? 16.066  2.221   -0.298  1.00 1.09  ? 34  LEU A HD22 4  
ATOM 10393 H HD23 . LEU A 1 34  ? 14.922  1.026   -0.906  1.00 1.01  ? 34  LEU A HD23 4  
ATOM 10394 N N    . SER A 1 35  ? 17.549  3.761   -3.162  1.00 0.32  ? 35  SER A N    4  
ATOM 10395 C CA   . SER A 1 35  ? 18.605  3.284   -4.023  1.00 0.33  ? 35  SER A CA   4  
ATOM 10396 C C    . SER A 1 35  ? 18.805  1.785   -3.861  1.00 0.32  ? 35  SER A C    4  
ATOM 10397 O O    . SER A 1 35  ? 18.259  1.178   -2.942  1.00 0.30  ? 35  SER A O    4  
ATOM 10398 C CB   . SER A 1 35  ? 19.895  4.060   -3.745  1.00 0.37  ? 35  SER A CB   4  
ATOM 10399 O OG   . SER A 1 35  ? 20.878  3.801   -4.733  1.00 0.40  ? 35  SER A OG   4  
ATOM 10400 H H    . SER A 1 35  ? 17.780  4.298   -2.377  1.00 0.33  ? 35  SER A H    4  
ATOM 10401 H HA   . SER A 1 35  ? 18.300  3.471   -5.032  1.00 0.35  ? 35  SER A HA   4  
ATOM 10402 H HB2  . SER A 1 35  ? 19.680  5.118   -3.743  1.00 0.39  ? 35  SER A HB2  4  
ATOM 10403 H HB3  . SER A 1 35  ? 20.279  3.772   -2.781  1.00 0.38  ? 35  SER A HB3  4  
ATOM 10404 H HG   . SER A 1 35  ? 21.756  3.842   -4.331  1.00 0.68  ? 35  SER A HG   4  
ATOM 10405 N N    . LYS A 1 36  ? 19.593  1.208   -4.761  1.00 0.38  ? 36  LYS A N    4  
ATOM 10406 C CA   . LYS A 1 36  ? 19.744  -0.238  -4.860  1.00 0.42  ? 36  LYS A CA   4  
ATOM 10407 C C    . LYS A 1 36  ? 20.034  -0.870  -3.503  1.00 0.36  ? 36  LYS A C    4  
ATOM 10408 O O    . LYS A 1 36  ? 19.231  -1.646  -2.995  1.00 0.35  ? 36  LYS A O    4  
ATOM 10409 C CB   . LYS A 1 36  ? 20.862  -0.582  -5.847  1.00 0.53  ? 36  LYS A CB   4  
ATOM 10410 C CG   . LYS A 1 36  ? 20.941  -2.060  -6.188  1.00 0.62  ? 36  LYS A CG   4  
ATOM 10411 C CD   . LYS A 1 36  ? 19.689  -2.528  -6.909  1.00 0.66  ? 36  LYS A CD   4  
ATOM 10412 C CE   . LYS A 1 36  ? 19.771  -4.001  -7.278  1.00 0.61  ? 36  LYS A CE   4  
ATOM 10413 N NZ   . LYS A 1 36  ? 20.826  -4.267  -8.291  1.00 0.65  ? 36  LYS A NZ   4  
ATOM 10414 H H    . LYS A 1 36  ? 20.095  1.779   -5.382  1.00 0.43  ? 36  LYS A H    4  
ATOM 10415 H HA   . LYS A 1 36  ? 18.816  -0.640  -5.235  1.00 0.46  ? 36  LYS A HA   4  
ATOM 10416 H HB2  . LYS A 1 36  ? 20.701  -0.032  -6.763  1.00 0.58  ? 36  LYS A HB2  4  
ATOM 10417 H HB3  . LYS A 1 36  ? 21.808  -0.282  -5.421  1.00 0.56  ? 36  LYS A HB3  4  
ATOM 10418 H HG2  . LYS A 1 36  ? 21.796  -2.229  -6.823  1.00 1.06  ? 36  LYS A HG2  4  
ATOM 10419 H HG3  . LYS A 1 36  ? 21.051  -2.623  -5.272  1.00 1.21  ? 36  LYS A HG3  4  
ATOM 10420 H HD2  . LYS A 1 36  ? 18.837  -2.378  -6.264  1.00 1.25  ? 36  LYS A HD2  4  
ATOM 10421 H HD3  . LYS A 1 36  ? 19.566  -1.944  -7.811  1.00 1.12  ? 36  LYS A HD3  4  
ATOM 10422 H HE2  . LYS A 1 36  ? 19.990  -4.570  -6.387  1.00 0.66  ? 36  LYS A HE2  4  
ATOM 10423 H HE3  . LYS A 1 36  ? 18.815  -4.311  -7.675  1.00 0.58  ? 36  LYS A HE3  4  
ATOM 10424 H HZ1  . LYS A 1 36  ? 20.669  -3.682  -9.137  1.00 1.18  ? 36  LYS A HZ1  4  
ATOM 10425 H HZ2  . LYS A 1 36  ? 20.800  -5.272  -8.574  1.00 1.14  ? 36  LYS A HZ2  4  
ATOM 10426 H HZ3  . LYS A 1 36  ? 21.766  -4.054  -7.900  1.00 1.16  ? 36  LYS A HZ3  4  
ATOM 10427 N N    . THR A 1 37  ? 21.153  -0.501  -2.905  1.00 0.37  ? 37  THR A N    4  
ATOM 10428 C CA   . THR A 1 37  ? 21.579  -1.086  -1.642  1.00 0.38  ? 37  THR A CA   4  
ATOM 10429 C C    . THR A 1 37  ? 20.607  -0.754  -0.510  1.00 0.36  ? 37  THR A C    4  
ATOM 10430 O O    . THR A 1 37  ? 20.426  -1.535  0.428   1.00 0.38  ? 37  THR A O    4  
ATOM 10431 C CB   . THR A 1 37  ? 22.976  -0.579  -1.269  1.00 0.44  ? 37  THR A CB   4  
ATOM 10432 O OG1  . THR A 1 37  ? 23.888  -0.838  -2.348  1.00 0.48  ? 37  THR A OG1  4  
ATOM 10433 C CG2  . THR A 1 37  ? 23.468  -1.262  -0.005  1.00 0.49  ? 37  THR A CG2  4  
ATOM 10434 H H    . THR A 1 37  ? 21.712  0.191   -3.320  1.00 0.39  ? 37  THR A H    4  
ATOM 10435 H HA   . THR A 1 37  ? 21.627  -2.158  -1.763  1.00 0.39  ? 37  THR A HA   4  
ATOM 10436 H HB   . THR A 1 37  ? 22.917  0.489   -1.095  1.00 0.44  ? 37  THR A HB   4  
ATOM 10437 H HG1  . THR A 1 37  ? 24.486  -1.551  -2.093  1.00 0.80  ? 37  THR A HG1  4  
ATOM 10438 H HG21 . THR A 1 37  ? 22.817  -1.006  0.819   1.00 1.15  ? 37  THR A HG21 4  
ATOM 10439 H HG22 . THR A 1 37  ? 24.475  -0.940  0.214   1.00 1.09  ? 37  THR A HG22 4  
ATOM 10440 H HG23 . THR A 1 37  ? 23.453  -2.334  -0.150  1.00 1.13  ? 37  THR A HG23 4  
ATOM 10441 N N    . GLU A 1 38  ? 19.956  0.388   -0.624  1.00 0.34  ? 38  GLU A N    4  
ATOM 10442 C CA   . GLU A 1 38  ? 19.053  0.857   0.415   1.00 0.34  ? 38  GLU A CA   4  
ATOM 10443 C C    . GLU A 1 38  ? 17.767  0.055   0.349   1.00 0.34  ? 38  GLU A C    4  
ATOM 10444 O O    . GLU A 1 38  ? 17.069  -0.124  1.346   1.00 0.48  ? 38  GLU A O    4  
ATOM 10445 C CB   . GLU A 1 38  ? 18.767  2.345   0.236   1.00 0.35  ? 38  GLU A CB   4  
ATOM 10446 C CG   . GLU A 1 38  ? 19.952  3.135   -0.309  1.00 0.47  ? 38  GLU A CG   4  
ATOM 10447 C CD   . GLU A 1 38  ? 21.148  3.189   0.628   1.00 1.27  ? 38  GLU A CD   4  
ATOM 10448 O OE1  . GLU A 1 38  ? 21.573  2.131   1.137   1.00 2.16  ? 38  GLU A OE1  4  
ATOM 10449 O OE2  . GLU A 1 38  ? 21.694  4.292   0.825   1.00 1.96  ? 38  GLU A OE2  4  
ATOM 10450 H H    . GLU A 1 38  ? 20.069  0.922   -1.436  1.00 0.34  ? 38  GLU A H    4  
ATOM 10451 H HA   . GLU A 1 38  ? 19.520  0.698   1.369   1.00 0.35  ? 38  GLU A HA   4  
ATOM 10452 H HB2  . GLU A 1 38  ? 17.939  2.455   -0.443  1.00 0.41  ? 38  GLU A HB2  4  
ATOM 10453 H HB3  . GLU A 1 38  ? 18.493  2.764   1.193   1.00 0.45  ? 38  GLU A HB3  4  
ATOM 10454 H HG2  . GLU A 1 38  ? 20.271  2.675   -1.231  1.00 1.16  ? 38  GLU A HG2  4  
ATOM 10455 H HG3  . GLU A 1 38  ? 19.628  4.145   -0.511  1.00 1.30  ? 38  GLU A HG3  4  
ATOM 10456 N N    . PHE A 1 39  ? 17.476  -0.435  -0.845  1.00 0.29  ? 39  PHE A N    4  
ATOM 10457 C CA   . PHE A 1 39  ? 16.321  -1.273  -1.079  1.00 0.31  ? 39  PHE A CA   4  
ATOM 10458 C C    . PHE A 1 39  ? 16.658  -2.696  -0.693  1.00 0.28  ? 39  PHE A C    4  
ATOM 10459 O O    . PHE A 1 39  ? 15.805  -3.452  -0.230  1.00 0.27  ? 39  PHE A O    4  
ATOM 10460 C CB   . PHE A 1 39  ? 15.927  -1.195  -2.554  1.00 0.53  ? 39  PHE A CB   4  
ATOM 10461 C CG   . PHE A 1 39  ? 14.674  -1.940  -2.897  1.00 0.81  ? 39  PHE A CG   4  
ATOM 10462 C CD1  . PHE A 1 39  ? 13.447  -1.500  -2.437  1.00 1.78  ? 39  PHE A CD1  4  
ATOM 10463 C CD2  . PHE A 1 39  ? 14.725  -3.073  -3.690  1.00 1.76  ? 39  PHE A CD2  4  
ATOM 10464 C CE1  . PHE A 1 39  ? 12.290  -2.179  -2.759  1.00 2.66  ? 39  PHE A CE1  4  
ATOM 10465 C CE2  . PHE A 1 39  ? 13.574  -3.756  -4.016  1.00 2.62  ? 39  PHE A CE2  4  
ATOM 10466 C CZ   . PHE A 1 39  ? 12.353  -3.309  -3.550  1.00 2.88  ? 39  PHE A CZ   4  
ATOM 10467 H H    . PHE A 1 39  ? 18.066  -0.224  -1.603  1.00 0.34  ? 39  PHE A H    4  
ATOM 10468 H HA   . PHE A 1 39  ? 15.507  -0.917  -0.462  1.00 0.35  ? 39  PHE A HA   4  
ATOM 10469 H HB2  . PHE A 1 39  ? 15.783  -0.162  -2.823  1.00 1.23  ? 39  PHE A HB2  4  
ATOM 10470 H HB3  . PHE A 1 39  ? 16.732  -1.603  -3.150  1.00 1.41  ? 39  PHE A HB3  4  
ATOM 10471 H HD1  . PHE A 1 39  ? 13.398  -0.616  -1.817  1.00 2.31  ? 39  PHE A HD1  4  
ATOM 10472 H HD2  . PHE A 1 39  ? 15.680  -3.423  -4.056  1.00 2.31  ? 39  PHE A HD2  4  
ATOM 10473 H HE1  . PHE A 1 39  ? 11.339  -1.825  -2.393  1.00 3.51  ? 39  PHE A HE1  4  
ATOM 10474 H HE2  . PHE A 1 39  ? 13.627  -4.639  -4.633  1.00 3.45  ? 39  PHE A HE2  4  
ATOM 10475 H HZ   . PHE A 1 39  ? 11.449  -3.842  -3.803  1.00 3.70  ? 39  PHE A HZ   4  
ATOM 10476 N N    . LEU A 1 40  ? 17.921  -3.045  -0.881  1.00 0.33  ? 40  LEU A N    4  
ATOM 10477 C CA   . LEU A 1 40  ? 18.425  -4.337  -0.473  1.00 0.37  ? 40  LEU A CA   4  
ATOM 10478 C C    . LEU A 1 40  ? 18.298  -4.481  1.034   1.00 0.40  ? 40  LEU A C    4  
ATOM 10479 O O    . LEU A 1 40  ? 17.769  -5.472  1.527   1.00 0.43  ? 40  LEU A O    4  
ATOM 10480 C CB   . LEU A 1 40  ? 19.884  -4.500  -0.893  1.00 0.43  ? 40  LEU A CB   4  
ATOM 10481 C CG   . LEU A 1 40  ? 20.175  -4.275  -2.380  1.00 0.50  ? 40  LEU A CG   4  
ATOM 10482 C CD1  . LEU A 1 40  ? 21.523  -4.865  -2.760  1.00 1.07  ? 40  LEU A CD1  4  
ATOM 10483 C CD2  . LEU A 1 40  ? 19.065  -4.841  -3.248  1.00 0.46  ? 40  LEU A CD2  4  
ATOM 10484 H H    . LEU A 1 40  ? 18.531  -2.414  -1.321  1.00 0.37  ? 40  LEU A H    4  
ATOM 10485 H HA   . LEU A 1 40  ? 17.828  -5.097  -0.953  1.00 0.38  ? 40  LEU A HA   4  
ATOM 10486 H HB2  . LEU A 1 40  ? 20.472  -3.790  -0.326  1.00 0.65  ? 40  LEU A HB2  4  
ATOM 10487 H HB3  . LEU A 1 40  ? 20.201  -5.497  -0.633  1.00 0.47  ? 40  LEU A HB3  4  
ATOM 10488 H HG   . LEU A 1 40  ? 20.223  -3.209  -2.566  1.00 0.80  ? 40  LEU A HG   4  
ATOM 10489 H HD11 . LEU A 1 40  ? 22.298  -4.402  -2.168  1.00 1.87  ? 40  LEU A HD11 4  
ATOM 10490 H HD12 . LEU A 1 40  ? 21.713  -4.685  -3.808  1.00 1.41  ? 40  LEU A HD12 4  
ATOM 10491 H HD13 . LEU A 1 40  ? 21.515  -5.929  -2.574  1.00 1.46  ? 40  LEU A HD13 4  
ATOM 10492 H HD21 . LEU A 1 40  ? 19.339  -4.749  -4.287  1.00 1.02  ? 40  LEU A HD21 4  
ATOM 10493 H HD22 . LEU A 1 40  ? 18.158  -4.279  -3.064  1.00 0.97  ? 40  LEU A HD22 4  
ATOM 10494 H HD23 . LEU A 1 40  ? 18.905  -5.879  -3.002  1.00 1.09  ? 40  LEU A HD23 4  
ATOM 10495 N N    . SER A 1 41  ? 18.777  -3.475  1.760   1.00 0.42  ? 41  SER A N    4  
ATOM 10496 C CA   . SER A 1 41  ? 18.633  -3.460  3.206   1.00 0.52  ? 41  SER A CA   4  
ATOM 10497 C C    . SER A 1 41  ? 17.156  -3.453  3.585   1.00 0.45  ? 41  SER A C    4  
ATOM 10498 O O    . SER A 1 41  ? 16.725  -4.294  4.359   1.00 0.47  ? 41  SER A O    4  
ATOM 10499 C CB   . SER A 1 41  ? 19.371  -2.266  3.824   1.00 0.67  ? 41  SER A CB   4  
ATOM 10500 O OG   . SER A 1 41  ? 19.032  -1.048  3.184   1.00 1.40  ? 41  SER A OG   4  
ATOM 10501 H H    . SER A 1 41  ? 19.241  -2.733  1.312   1.00 0.42  ? 41  SER A H    4  
ATOM 10502 H HA   . SER A 1 41  ? 19.074  -4.373  3.583   1.00 0.60  ? 41  SER A HA   4  
ATOM 10503 H HB2  . SER A 1 41  ? 19.110  -2.189  4.868   1.00 1.27  ? 41  SER A HB2  4  
ATOM 10504 H HB3  . SER A 1 41  ? 20.435  -2.420  3.733   1.00 1.19  ? 41  SER A HB3  4  
ATOM 10505 H HG   . SER A 1 41  ? 19.754  -0.785  2.598   1.00 1.97  ? 41  SER A HG   4  
ATOM 10506 N N    . PHE A 1 42  ? 16.389  -2.528  2.993   1.00 0.42  ? 42  PHE A N    4  
ATOM 10507 C CA   . PHE A 1 42  ? 14.931  -2.466  3.174   1.00 0.46  ? 42  PHE A CA   4  
ATOM 10508 C C    . PHE A 1 42  ? 14.300  -3.844  3.070   1.00 0.29  ? 42  PHE A C    4  
ATOM 10509 O O    . PHE A 1 42  ? 13.643  -4.303  3.991   1.00 0.43  ? 42  PHE A O    4  
ATOM 10510 C CB   . PHE A 1 42  ? 14.318  -1.571  2.101   1.00 0.80  ? 42  PHE A CB   4  
ATOM 10511 C CG   . PHE A 1 42  ? 12.836  -1.755  1.944   1.00 1.89  ? 42  PHE A CG   4  
ATOM 10512 C CD1  . PHE A 1 42  ? 11.978  -1.613  3.020   1.00 2.69  ? 42  PHE A CD1  4  
ATOM 10513 C CD2  . PHE A 1 42  ? 12.307  -2.101  0.715   1.00 2.77  ? 42  PHE A CD2  4  
ATOM 10514 C CE1  . PHE A 1 42  ? 10.620  -1.814  2.869   1.00 3.73  ? 42  PHE A CE1  4  
ATOM 10515 C CE2  . PHE A 1 42  ? 10.955  -2.303  0.560   1.00 3.80  ? 42  PHE A CE2  4  
ATOM 10516 C CZ   . PHE A 1 42  ? 10.109  -2.159  1.638   1.00 4.13  ? 42  PHE A CZ   4  
ATOM 10517 H H    . PHE A 1 42  ? 16.821  -1.857  2.418   1.00 0.44  ? 42  PHE A H    4  
ATOM 10518 H HA   . PHE A 1 42  ? 14.707  -2.045  4.147   1.00 0.66  ? 42  PHE A HA   4  
ATOM 10519 H HB2  . PHE A 1 42  ? 14.505  -0.531  2.343   1.00 0.53  ? 42  PHE A HB2  4  
ATOM 10520 H HB3  . PHE A 1 42  ? 14.780  -1.820  1.155   1.00 1.30  ? 42  PHE A HB3  4  
ATOM 10521 H HD1  . PHE A 1 42  ? 12.379  -1.342  3.986   1.00 2.86  ? 42  PHE A HD1  4  
ATOM 10522 H HD2  . PHE A 1 42  ? 12.968  -2.216  -0.132  1.00 3.00  ? 42  PHE A HD2  4  
ATOM 10523 H HE1  . PHE A 1 42  ? 9.960   -1.703  3.713   1.00 4.49  ? 42  PHE A HE1  4  
ATOM 10524 H HE2  . PHE A 1 42  ? 10.558  -2.572  -0.407  1.00 4.58  ? 42  PHE A HE2  4  
ATOM 10525 H HZ   . PHE A 1 42  ? 9.048   -2.317  1.518   1.00 5.02  ? 42  PHE A HZ   4  
ATOM 10526 N N    . MET A 1 43  ? 14.487  -4.497  1.945   1.00 0.26  ? 43  MET A N    4  
ATOM 10527 C CA   . MET A 1 43  ? 13.846  -5.780  1.726   1.00 0.29  ? 43  MET A CA   4  
ATOM 10528 C C    . MET A 1 43  ? 14.420  -6.876  2.613   1.00 0.29  ? 43  MET A C    4  
ATOM 10529 O O    . MET A 1 43  ? 13.709  -7.794  2.989   1.00 0.37  ? 43  MET A O    4  
ATOM 10530 C CB   . MET A 1 43  ? 13.931  -6.203  0.274   1.00 0.39  ? 43  MET A CB   4  
ATOM 10531 C CG   . MET A 1 43  ? 13.068  -5.369  -0.657  1.00 0.62  ? 43  MET A CG   4  
ATOM 10532 S SD   . MET A 1 43  ? 12.536  -6.275  -2.127  1.00 1.22  ? 43  MET A SD   4  
ATOM 10533 C CE   . MET A 1 43  ? 11.432  -7.489  -1.407  1.00 2.26  ? 43  MET A CE   4  
ATOM 10534 H H    . MET A 1 43  ? 15.051  -4.096  1.236   1.00 0.29  ? 43  MET A H    4  
ATOM 10535 H HA   . MET A 1 43  ? 12.804  -5.658  1.982   1.00 0.35  ? 43  MET A HA   4  
ATOM 10536 H HB2  . MET A 1 43  ? 14.957  -6.116  -0.042  1.00 0.75  ? 43  MET A HB2  4  
ATOM 10537 H HB3  . MET A 1 43  ? 13.622  -7.234  0.199   1.00 0.69  ? 43  MET A HB3  4  
ATOM 10538 H HG2  . MET A 1 43  ? 12.193  -5.043  -0.118  1.00 1.11  ? 43  MET A HG2  4  
ATOM 10539 H HG3  . MET A 1 43  ? 13.635  -4.504  -0.971  1.00 1.23  ? 43  MET A HG3  4  
ATOM 10540 H HE1  . MET A 1 43  ? 10.637  -6.985  -0.880  1.00 2.63  ? 43  MET A HE1  4  
ATOM 10541 H HE2  . MET A 1 43  ? 11.981  -8.114  -0.718  1.00 2.66  ? 43  MET A HE2  4  
ATOM 10542 H HE3  . MET A 1 43  ? 11.012  -8.102  -2.191  1.00 2.85  ? 43  MET A HE3  4  
ATOM 10543 N N    . ASN A 1 44  ? 15.691  -6.800  2.951   1.00 0.29  ? 44  ASN A N    4  
ATOM 10544 C CA   . ASN A 1 44  ? 16.287  -7.825  3.801   1.00 0.33  ? 44  ASN A CA   4  
ATOM 10545 C C    . ASN A 1 44  ? 15.913  -7.622  5.265   1.00 0.32  ? 44  ASN A C    4  
ATOM 10546 O O    . ASN A 1 44  ? 16.066  -8.531  6.079   1.00 0.39  ? 44  ASN A O    4  
ATOM 10547 C CB   . ASN A 1 44  ? 17.803  -7.844  3.679   1.00 0.42  ? 44  ASN A CB   4  
ATOM 10548 C CG   . ASN A 1 44  ? 18.304  -8.523  2.419   1.00 1.05  ? 44  ASN A CG   4  
ATOM 10549 O OD1  . ASN A 1 44  ? 17.702  -9.473  1.929   1.00 1.54  ? 44  ASN A OD1  4  
ATOM 10550 N ND2  . ASN A 1 44  ? 19.418  -8.045  1.888   1.00 1.83  ? 44  ASN A ND2  4  
ATOM 10551 H H    . ASN A 1 44  ? 16.244  -6.054  2.623   1.00 0.30  ? 44  ASN A H    4  
ATOM 10552 H HA   . ASN A 1 44  ? 15.901  -8.780  3.476   1.00 0.37  ? 44  ASN A HA   4  
ATOM 10553 H HB2  . ASN A 1 44  ? 18.164  -6.834  3.690   1.00 1.03  ? 44  ASN A HB2  4  
ATOM 10554 H HB3  . ASN A 1 44  ? 18.200  -8.371  4.527   1.00 0.89  ? 44  ASN A HB3  4  
ATOM 10555 H HD21 . ASN A 1 44  ? 19.855  -7.285  2.329   1.00 1.98  ? 44  ASN A HD21 4  
ATOM 10556 H HD22 . ASN A 1 44  ? 19.762  -8.471  1.076   1.00 2.46  ? 44  ASN A HD22 4  
ATOM 10557 N N    . THR A 1 45  ? 15.452  -6.430  5.605   1.00 0.26  ? 45  THR A N    4  
ATOM 10558 C CA   . THR A 1 45  ? 15.068  -6.130  6.980   1.00 0.29  ? 45  THR A CA   4  
ATOM 10559 C C    . THR A 1 45  ? 13.559  -6.088  7.133   1.00 0.28  ? 45  THR A C    4  
ATOM 10560 O O    . THR A 1 45  ? 12.965  -6.868  7.879   1.00 0.34  ? 45  THR A O    4  
ATOM 10561 C CB   . THR A 1 45  ? 15.642  -4.780  7.447   1.00 0.29  ? 45  THR A CB   4  
ATOM 10562 O OG1  . THR A 1 45  ? 15.314  -3.755  6.504   1.00 0.34  ? 45  THR A OG1  4  
ATOM 10563 C CG2  . THR A 1 45  ? 17.148  -4.860  7.620   1.00 0.34  ? 45  THR A CG2  4  
ATOM 10564 H H    . THR A 1 45  ? 15.371  -5.727  4.916   1.00 0.24  ? 45  THR A H    4  
ATOM 10565 H HA   . THR A 1 45  ? 15.465  -6.906  7.616   1.00 0.33  ? 45  THR A HA   4  
ATOM 10566 H HB   . THR A 1 45  ? 15.195  -4.528  8.397   1.00 0.29  ? 45  THR A HB   4  
ATOM 10567 H HG1  . THR A 1 45  ? 15.177  -2.916  6.971   1.00 1.03  ? 45  THR A HG1  4  
ATOM 10568 H HG21 . THR A 1 45  ? 17.528  -3.897  7.928   1.00 1.04  ? 45  THR A HG21 4  
ATOM 10569 H HG22 . THR A 1 45  ? 17.604  -5.144  6.683   1.00 1.14  ? 45  THR A HG22 4  
ATOM 10570 H HG23 . THR A 1 45  ? 17.385  -5.596  8.373   1.00 1.05  ? 45  THR A HG23 4  
ATOM 10571 N N    . GLU A 1 46  ? 12.955  -5.168  6.409   1.00 0.23  ? 46  GLU A N    4  
ATOM 10572 C CA   . GLU A 1 46  ? 11.545  -4.893  6.513   1.00 0.25  ? 46  GLU A CA   4  
ATOM 10573 C C    . GLU A 1 46  ? 10.730  -5.934  5.756   1.00 0.25  ? 46  GLU A C    4  
ATOM 10574 O O    . GLU A 1 46  ? 9.574   -6.164  6.068   1.00 0.34  ? 46  GLU A O    4  
ATOM 10575 C CB   . GLU A 1 46  ? 11.251  -3.492  5.977   1.00 0.29  ? 46  GLU A CB   4  
ATOM 10576 C CG   . GLU A 1 46  ? 11.962  -2.380  6.733   1.00 0.58  ? 46  GLU A CG   4  
ATOM 10577 C CD   . GLU A 1 46  ? 11.468  -2.198  8.158   1.00 1.17  ? 46  GLU A CD   4  
ATOM 10578 O OE1  . GLU A 1 46  ? 11.801  -3.032  9.026   1.00 1.68  ? 46  GLU A OE1  4  
ATOM 10579 O OE2  . GLU A 1 46  ? 10.758  -1.204  8.428   1.00 1.70  ? 46  GLU A OE2  4  
ATOM 10580 H H    . GLU A 1 46  ? 13.491  -4.646  5.768   1.00 0.20  ? 46  GLU A H    4  
ATOM 10581 H HA   . GLU A 1 46  ? 11.281  -4.926  7.555   1.00 0.28  ? 46  GLU A HA   4  
ATOM 10582 H HB2  . GLU A 1 46  ? 11.557  -3.446  4.945   1.00 0.43  ? 46  GLU A HB2  4  
ATOM 10583 H HB3  . GLU A 1 46  ? 10.194  -3.312  6.030   1.00 0.54  ? 46  GLU A HB3  4  
ATOM 10584 H HG2  . GLU A 1 46  ? 13.017  -2.606  6.765   1.00 0.66  ? 46  GLU A HG2  4  
ATOM 10585 H HG3  . GLU A 1 46  ? 11.814  -1.453  6.197   1.00 0.71  ? 46  GLU A HG3  4  
ATOM 10586 N N    . LEU A 1 47  ? 11.324  -6.569  4.761   1.00 0.25  ? 47  LEU A N    4  
ATOM 10587 C CA   . LEU A 1 47  ? 10.594  -7.576  4.000   1.00 0.26  ? 47  LEU A CA   4  
ATOM 10588 C C    . LEU A 1 47  ? 11.330  -8.893  3.971   1.00 0.28  ? 47  LEU A C    4  
ATOM 10589 O O    . LEU A 1 47  ? 11.213  -9.656  3.015   1.00 0.30  ? 47  LEU A O    4  
ATOM 10590 C CB   . LEU A 1 47  ? 10.341  -7.105  2.576   1.00 0.26  ? 47  LEU A CB   4  
ATOM 10591 C CG   . LEU A 1 47  ? 9.484   -5.855  2.455   1.00 0.27  ? 47  LEU A CG   4  
ATOM 10592 C CD1  . LEU A 1 47  ? 9.413   -5.418  1.008   1.00 0.32  ? 47  LEU A CD1  4  
ATOM 10593 C CD2  . LEU A 1 47  ? 8.093   -6.114  3.013   1.00 0.27  ? 47  LEU A CD2  4  
ATOM 10594 H H    . LEU A 1 47  ? 12.258  -6.357  4.529   1.00 0.29  ? 47  LEU A H    4  
ATOM 10595 H HA   . LEU A 1 47  ? 9.644   -7.728  4.488   1.00 0.29  ? 47  LEU A HA   4  
ATOM 10596 H HB2  . LEU A 1 47  ? 11.294  -6.919  2.105   1.00 0.27  ? 47  LEU A HB2  4  
ATOM 10597 H HB3  . LEU A 1 47  ? 9.846   -7.904  2.047   1.00 0.27  ? 47  LEU A HB3  4  
ATOM 10598 H HG   . LEU A 1 47  ? 9.935   -5.056  3.027   1.00 0.29  ? 47  LEU A HG   4  
ATOM 10599 H HD11 . LEU A 1 47  ? 8.982   -6.210  0.414   1.00 1.00  ? 47  LEU A HD11 4  
ATOM 10600 H HD12 . LEU A 1 47  ? 10.406  -5.199  0.650   1.00 0.93  ? 47  LEU A HD12 4  
ATOM 10601 H HD13 . LEU A 1 47  ? 8.798   -4.533  0.930   1.00 0.95  ? 47  LEU A HD13 4  
ATOM 10602 H HD21 . LEU A 1 47  ? 7.635   -6.931  2.474   1.00 0.92  ? 47  LEU A HD21 4  
ATOM 10603 H HD22 . LEU A 1 47  ? 7.488   -5.227  2.904   1.00 1.01  ? 47  LEU A HD22 4  
ATOM 10604 H HD23 . LEU A 1 47  ? 8.169   -6.373  4.060   1.00 1.12  ? 47  LEU A HD23 4  
ATOM 10605 N N    . ALA A 1 48  ? 12.103  -9.153  5.011   1.00 0.32  ? 48  ALA A N    4  
ATOM 10606 C CA   . ALA A 1 48  ? 12.839  -10.396 5.117   1.00 0.36  ? 48  ALA A CA   4  
ATOM 10607 C C    . ALA A 1 48  ? 11.897  -11.597 5.083   1.00 0.39  ? 48  ALA A C    4  
ATOM 10608 O O    . ALA A 1 48  ? 12.293  -12.698 4.694   1.00 0.44  ? 48  ALA A O    4  
ATOM 10609 C CB   . ALA A 1 48  ? 13.671  -10.383 6.379   1.00 0.41  ? 48  ALA A CB   4  
ATOM 10610 H H    . ALA A 1 48  ? 12.191  -8.483  5.721   1.00 0.34  ? 48  ALA A H    4  
ATOM 10611 H HA   . ALA A 1 48  ? 13.509  -10.455 4.272   1.00 0.39  ? 48  ALA A HA   4  
ATOM 10612 H HB1  . ALA A 1 48  ? 14.316  -11.246 6.399   1.00 1.06  ? 48  ALA A HB1  4  
ATOM 10613 H HB2  . ALA A 1 48  ? 13.018  -10.398 7.238   1.00 1.14  ? 48  ALA A HB2  4  
ATOM 10614 H HB3  . ALA A 1 48  ? 14.271  -9.480  6.396   1.00 1.02  ? 48  ALA A HB3  4  
ATOM 10615 N N    . ALA A 1 49  ? 10.648  -11.368 5.479   1.00 0.38  ? 49  ALA A N    4  
ATOM 10616 C CA   . ALA A 1 49  ? 9.598   -12.374 5.370   1.00 0.41  ? 49  ALA A CA   4  
ATOM 10617 C C    . ALA A 1 49  ? 9.446   -12.829 3.926   1.00 0.41  ? 49  ALA A C    4  
ATOM 10618 O O    . ALA A 1 49  ? 9.326   -14.020 3.640   1.00 0.47  ? 49  ALA A O    4  
ATOM 10619 C CB   . ALA A 1 49  ? 8.282   -11.805 5.872   1.00 0.44  ? 49  ALA A CB   4  
ATOM 10620 H H    . ALA A 1 49  ? 10.425  -10.491 5.863   1.00 0.37  ? 49  ALA A H    4  
ATOM 10621 H HA   . ALA A 1 49  ? 9.865   -13.216 5.986   1.00 0.45  ? 49  ALA A HA   4  
ATOM 10622 H HB1  . ALA A 1 49  ? 7.509   -12.555 5.786   1.00 1.16  ? 49  ALA A HB1  4  
ATOM 10623 H HB2  . ALA A 1 49  ? 8.014   -10.941 5.274   1.00 1.10  ? 49  ALA A HB2  4  
ATOM 10624 H HB3  . ALA A 1 49  ? 8.386   -11.510 6.904   1.00 1.07  ? 49  ALA A HB3  4  
ATOM 10625 N N    . PHE A 1 50  ? 9.465   -11.864 3.026   1.00 0.36  ? 50  PHE A N    4  
ATOM 10626 C CA   . PHE A 1 50  ? 9.308   -12.115 1.605   1.00 0.37  ? 50  PHE A CA   4  
ATOM 10627 C C    . PHE A 1 50  ? 10.645  -12.497 0.981   1.00 0.38  ? 50  PHE A C    4  
ATOM 10628 O O    . PHE A 1 50  ? 10.763  -13.509 0.294   1.00 0.44  ? 50  PHE A O    4  
ATOM 10629 C CB   . PHE A 1 50  ? 8.769   -10.852 0.936   1.00 0.35  ? 50  PHE A CB   4  
ATOM 10630 C CG   . PHE A 1 50  ? 8.447   -11.012 -0.524  1.00 0.70  ? 50  PHE A CG   4  
ATOM 10631 C CD1  . PHE A 1 50  ? 7.251   -11.589 -0.923  1.00 1.32  ? 50  PHE A CD1  4  
ATOM 10632 C CD2  . PHE A 1 50  ? 9.332   -10.574 -1.498  1.00 1.63  ? 50  PHE A CD2  4  
ATOM 10633 C CE1  . PHE A 1 50  ? 6.946   -11.727 -2.262  1.00 1.66  ? 50  PHE A CE1  4  
ATOM 10634 C CE2  . PHE A 1 50  ? 9.032   -10.713 -2.839  1.00 2.09  ? 50  PHE A CE2  4  
ATOM 10635 C CZ   . PHE A 1 50  ? 7.838   -11.289 -3.221  1.00 1.80  ? 50  PHE A CZ   4  
ATOM 10636 H H    . PHE A 1 50  ? 9.595   -10.939 3.330   1.00 0.32  ? 50  PHE A H    4  
ATOM 10637 H HA   . PHE A 1 50  ? 8.604   -12.922 1.472   1.00 0.41  ? 50  PHE A HA   4  
ATOM 10638 H HB2  . PHE A 1 50  ? 7.870   -10.543 1.445   1.00 0.61  ? 50  PHE A HB2  4  
ATOM 10639 H HB3  . PHE A 1 50  ? 9.515   -10.073 1.030   1.00 0.56  ? 50  PHE A HB3  4  
ATOM 10640 H HD1  . PHE A 1 50  ? 6.554   -11.932 -0.172  1.00 2.01  ? 50  PHE A HD1  4  
ATOM 10641 H HD2  . PHE A 1 50  ? 10.266  -10.122 -1.200  1.00 2.27  ? 50  PHE A HD2  4  
ATOM 10642 H HE1  . PHE A 1 50  ? 6.011   -12.180 -2.559  1.00 2.32  ? 50  PHE A HE1  4  
ATOM 10643 H HE2  . PHE A 1 50  ? 9.730   -10.369 -3.588  1.00 2.96  ? 50  PHE A HE2  4  
ATOM 10644 H HZ   . PHE A 1 50  ? 7.601   -11.396 -4.268  1.00 2.24  ? 50  PHE A HZ   4  
ATOM 10645 N N    . THR A 1 51  ? 11.641  -11.670 1.254   1.00 0.36  ? 51  THR A N    4  
ATOM 10646 C CA   . THR A 1 51  ? 12.970  -11.806 0.687   1.00 0.40  ? 51  THR A CA   4  
ATOM 10647 C C    . THR A 1 51  ? 13.570  -13.188 0.923   1.00 0.45  ? 51  THR A C    4  
ATOM 10648 O O    . THR A 1 51  ? 14.007  -13.857 -0.013  1.00 0.54  ? 51  THR A O    4  
ATOM 10649 C CB   . THR A 1 51  ? 13.890  -10.747 1.301   1.00 0.39  ? 51  THR A CB   4  
ATOM 10650 O OG1  . THR A 1 51  ? 13.450  -9.444  0.911   1.00 0.39  ? 51  THR A OG1  4  
ATOM 10651 C CG2  . THR A 1 51  ? 15.337  -10.962 0.895   1.00 0.49  ? 51  THR A CG2  4  
ATOM 10652 H H    . THR A 1 51  ? 11.473  -10.922 1.872   1.00 0.36  ? 51  THR A H    4  
ATOM 10653 H HA   . THR A 1 51  ? 12.906  -11.625 -0.374  1.00 0.44  ? 51  THR A HA   4  
ATOM 10654 H HB   . THR A 1 51  ? 13.818  -10.827 2.377   1.00 0.36  ? 51  THR A HB   4  
ATOM 10655 H HG1  . THR A 1 51  ? 13.443  -8.863  1.683   1.00 0.41  ? 51  THR A HG1  4  
ATOM 10656 H HG21 . THR A 1 51  ? 15.698  -11.880 1.336   1.00 1.13  ? 51  THR A HG21 4  
ATOM 10657 H HG22 . THR A 1 51  ? 15.936  -10.135 1.244   1.00 1.14  ? 51  THR A HG22 4  
ATOM 10658 H HG23 . THR A 1 51  ? 15.404  -11.030 -0.180  1.00 1.03  ? 51  THR A HG23 4  
ATOM 10659 N N    . LYS A 1 52  ? 13.576  -13.617 2.173   1.00 0.48  ? 52  LYS A N    4  
ATOM 10660 C CA   . LYS A 1 52  ? 14.231  -14.864 2.539   1.00 0.60  ? 52  LYS A CA   4  
ATOM 10661 C C    . LYS A 1 52  ? 13.373  -16.060 2.163   1.00 0.69  ? 52  LYS A C    4  
ATOM 10662 O O    . LYS A 1 52  ? 13.795  -17.213 2.290   1.00 0.84  ? 52  LYS A O    4  
ATOM 10663 C CB   . LYS A 1 52  ? 14.536  -14.872 4.032   1.00 0.70  ? 52  LYS A CB   4  
ATOM 10664 C CG   . LYS A 1 52  ? 15.491  -13.767 4.439   1.00 0.78  ? 52  LYS A CG   4  
ATOM 10665 C CD   . LYS A 1 52  ? 15.696  -13.720 5.939   1.00 1.07  ? 52  LYS A CD   4  
ATOM 10666 C CE   . LYS A 1 52  ? 16.724  -12.666 6.313   1.00 1.24  ? 52  LYS A CE   4  
ATOM 10667 N NZ   . LYS A 1 52  ? 18.072  -13.002 5.789   1.00 1.82  ? 52  LYS A NZ   4  
ATOM 10668 H H    . LYS A 1 52  ? 13.122  -13.088 2.867   1.00 0.45  ? 52  LYS A H    4  
ATOM 10669 H HA   . LYS A 1 52  ? 15.158  -14.915 1.993   1.00 0.65  ? 52  LYS A HA   4  
ATOM 10670 H HB2  . LYS A 1 52  ? 13.611  -14.749 4.579   1.00 0.71  ? 52  LYS A HB2  4  
ATOM 10671 H HB3  . LYS A 1 52  ? 14.979  -15.821 4.294   1.00 0.79  ? 52  LYS A HB3  4  
ATOM 10672 H HG2  . LYS A 1 52  ? 16.444  -13.936 3.963   1.00 1.34  ? 52  LYS A HG2  4  
ATOM 10673 H HG3  . LYS A 1 52  ? 15.086  -12.819 4.110   1.00 1.23  ? 52  LYS A HG3  4  
ATOM 10674 H HD2  . LYS A 1 52  ? 14.756  -13.482 6.415   1.00 1.64  ? 52  LYS A HD2  4  
ATOM 10675 H HD3  . LYS A 1 52  ? 16.041  -14.686 6.277   1.00 1.63  ? 52  LYS A HD3  4  
ATOM 10676 H HE2  . LYS A 1 52  ? 16.414  -11.718 5.894   1.00 1.50  ? 52  LYS A HE2  4  
ATOM 10677 H HE3  . LYS A 1 52  ? 16.769  -12.588 7.389   1.00 1.67  ? 52  LYS A HE3  4  
ATOM 10678 H HZ1  . LYS A 1 52  ? 18.388  -13.917 6.172   1.00 2.15  ? 52  LYS A HZ1  4  
ATOM 10679 H HZ2  . LYS A 1 52  ? 18.756  -12.271 6.067   1.00 2.33  ? 52  LYS A HZ2  4  
ATOM 10680 H HZ3  . LYS A 1 52  ? 18.051  -13.063 4.752   1.00 2.24  ? 52  LYS A HZ3  4  
ATOM 10681 N N    . ASN A 1 53  ? 12.174  -15.778 1.688   1.00 0.68  ? 53  ASN A N    4  
ATOM 10682 C CA   . ASN A 1 53  ? 11.256  -16.820 1.279   1.00 0.85  ? 53  ASN A CA   4  
ATOM 10683 C C    . ASN A 1 53  ? 11.306  -16.992 -0.237  1.00 1.00  ? 53  ASN A C    4  
ATOM 10684 O O    . ASN A 1 53  ? 10.784  -17.960 -0.790  1.00 1.22  ? 53  ASN A O    4  
ATOM 10685 C CB   . ASN A 1 53  ? 9.839   -16.475 1.735   1.00 0.92  ? 53  ASN A CB   4  
ATOM 10686 C CG   . ASN A 1 53  ? 8.894   -17.659 1.656   1.00 1.40  ? 53  ASN A CG   4  
ATOM 10687 O OD1  . ASN A 1 53  ? 9.300   -18.808 1.832   1.00 1.94  ? 53  ASN A OD1  4  
ATOM 10688 N ND2  . ASN A 1 53  ? 7.625   -17.387 1.401   1.00 2.05  ? 53  ASN A ND2  4  
ATOM 10689 H H    . ASN A 1 53  ? 11.902  -14.840 1.605   1.00 0.63  ? 53  ASN A H    4  
ATOM 10690 H HA   . ASN A 1 53  ? 11.565  -17.736 1.749   1.00 0.95  ? 53  ASN A HA   4  
ATOM 10691 H HB2  . ASN A 1 53  ? 9.876   -16.130 2.758   1.00 1.05  ? 53  ASN A HB2  4  
ATOM 10692 H HB3  . ASN A 1 53  ? 9.454   -15.687 1.109   1.00 1.23  ? 53  ASN A HB3  4  
ATOM 10693 H HD21 . ASN A 1 53  ? 7.367   -16.449 1.279   1.00 2.35  ? 53  ASN A HD21 4  
ATOM 10694 H HD22 . ASN A 1 53  ? 6.994   -18.134 1.339   1.00 2.52  ? 53  ASN A HD22 4  
ATOM 10695 N N    . GLN A 1 54  ? 11.962  -16.050 -0.903  1.00 1.02  ? 54  GLN A N    4  
ATOM 10696 C CA   . GLN A 1 54  ? 12.077  -16.073 -2.354  1.00 1.29  ? 54  GLN A CA   4  
ATOM 10697 C C    . GLN A 1 54  ? 13.460  -16.539 -2.793  1.00 1.33  ? 54  GLN A C    4  
ATOM 10698 O O    . GLN A 1 54  ? 14.081  -15.927 -3.664  1.00 2.05  ? 54  GLN A O    4  
ATOM 10699 C CB   . GLN A 1 54  ? 11.778  -14.690 -2.941  1.00 1.74  ? 54  GLN A CB   4  
ATOM 10700 C CG   . GLN A 1 54  ? 10.301  -14.318 -2.925  1.00 2.17  ? 54  GLN A CG   4  
ATOM 10701 C CD   . GLN A 1 54  ? 9.462   -15.189 -3.847  1.00 2.40  ? 54  GLN A CD   4  
ATOM 10702 O OE1  . GLN A 1 54  ? 9.763   -16.362 -4.068  1.00 2.91  ? 54  GLN A OE1  4  
ATOM 10703 N NE2  . GLN A 1 54  ? 8.407   -14.616 -4.401  1.00 2.71  ? 54  GLN A NE2  4  
ATOM 10704 H H    . GLN A 1 54  ? 12.385  -15.320 -0.403  1.00 0.93  ? 54  GLN A H    4  
ATOM 10705 H HA   . GLN A 1 54  ? 11.345  -16.772 -2.726  1.00 1.53  ? 54  GLN A HA   4  
ATOM 10706 H HB2  . GLN A 1 54  ? 12.318  -13.947 -2.373  1.00 2.09  ? 54  GLN A HB2  4  
ATOM 10707 H HB3  . GLN A 1 54  ? 12.121  -14.667 -3.964  1.00 2.20  ? 54  GLN A HB3  4  
ATOM 10708 H HG2  . GLN A 1 54  ? 9.927   -14.423 -1.918  1.00 2.68  ? 54  GLN A HG2  4  
ATOM 10709 H HG3  . GLN A 1 54  ? 10.200  -13.289 -3.238  1.00 2.60  ? 54  GLN A HG3  4  
ATOM 10710 H HE21 . GLN A 1 54  ? 8.227   -13.675 -4.192  1.00 2.94  ? 54  GLN A HE21 4  
ATOM 10711 H HE22 . GLN A 1 54  ? 7.850   -15.152 -5.004  1.00 3.07  ? 54  GLN A HE22 4  
ATOM 10712 N N    . LYS A 1 55  ? 13.929  -17.625 -2.177  1.00 1.44  ? 55  LYS A N    4  
ATOM 10713 C CA   . LYS A 1 55  ? 15.185  -18.278 -2.555  1.00 1.87  ? 55  LYS A CA   4  
ATOM 10714 C C    . LYS A 1 55  ? 16.412  -17.455 -2.156  1.00 1.59  ? 55  LYS A C    4  
ATOM 10715 O O    . LYS A 1 55  ? 17.033  -17.710 -1.123  1.00 2.27  ? 55  LYS A O    4  
ATOM 10716 C CB   . LYS A 1 55  ? 15.215  -18.572 -4.060  1.00 2.84  ? 55  LYS A CB   4  
ATOM 10717 C CG   . LYS A 1 55  ? 14.121  -19.522 -4.523  1.00 3.60  ? 55  LYS A CG   4  
ATOM 10718 C CD   . LYS A 1 55  ? 13.947  -19.483 -6.035  1.00 4.29  ? 55  LYS A CD   4  
ATOM 10719 C CE   . LYS A 1 55  ? 15.224  -19.865 -6.767  1.00 5.02  ? 55  LYS A CE   4  
ATOM 10720 N NZ   . LYS A 1 55  ? 15.062  -19.770 -8.244  1.00 5.58  ? 55  LYS A NZ   4  
ATOM 10721 H H    . LYS A 1 55  ? 13.414  -17.999 -1.432  1.00 1.82  ? 55  LYS A H    4  
ATOM 10722 H HA   . LYS A 1 55  ? 15.226  -19.218 -2.026  1.00 2.28  ? 55  LYS A HA   4  
ATOM 10723 H HB2  . LYS A 1 55  ? 15.105  -17.643 -4.598  1.00 3.16  ? 55  LYS A HB2  4  
ATOM 10724 H HB3  . LYS A 1 55  ? 16.171  -19.010 -4.310  1.00 3.23  ? 55  LYS A HB3  4  
ATOM 10725 H HG2  . LYS A 1 55  ? 14.383  -20.527 -4.228  1.00 4.06  ? 55  LYS A HG2  4  
ATOM 10726 H HG3  . LYS A 1 55  ? 13.190  -19.239 -4.054  1.00 3.78  ? 55  LYS A HG3  4  
ATOM 10727 H HD2  . LYS A 1 55  ? 13.166  -20.173 -6.314  1.00 4.59  ? 55  LYS A HD2  4  
ATOM 10728 H HD3  . LYS A 1 55  ? 13.664  -18.482 -6.325  1.00 4.44  ? 55  LYS A HD3  4  
ATOM 10729 H HE2  . LYS A 1 55  ? 16.015  -19.199 -6.457  1.00 5.06  ? 55  LYS A HE2  4  
ATOM 10730 H HE3  . LYS A 1 55  ? 15.484  -20.878 -6.505  1.00 5.52  ? 55  LYS A HE3  4  
ATOM 10731 H HZ1  . LYS A 1 55  ? 15.951  -20.026 -8.719  1.00 5.86  ? 55  LYS A HZ1  4  
ATOM 10732 H HZ2  . LYS A 1 55  ? 14.809  -18.797 -8.515  1.00 5.76  ? 55  LYS A HZ2  4  
ATOM 10733 H HZ3  . LYS A 1 55  ? 14.312  -20.412 -8.567  1.00 5.87  ? 55  LYS A HZ3  4  
ATOM 10734 N N    . ASP A 1 56  ? 16.744  -16.463 -2.967  1.00 1.36  ? 56  ASP A N    4  
ATOM 10735 C CA   . ASP A 1 56  ? 17.983  -15.716 -2.802  1.00 1.50  ? 56  ASP A CA   4  
ATOM 10736 C C    . ASP A 1 56  ? 17.743  -14.231 -3.056  1.00 1.27  ? 56  ASP A C    4  
ATOM 10737 O O    . ASP A 1 56  ? 16.800  -13.865 -3.755  1.00 1.44  ? 56  ASP A O    4  
ATOM 10738 C CB   . ASP A 1 56  ? 19.050  -16.261 -3.765  1.00 2.13  ? 56  ASP A CB   4  
ATOM 10739 C CG   . ASP A 1 56  ? 18.776  -15.923 -5.217  1.00 2.83  ? 56  ASP A CG   4  
ATOM 10740 O OD1  . ASP A 1 56  ? 18.036  -16.680 -5.885  1.00 3.39  ? 56  ASP A OD1  4  
ATOM 10741 O OD2  . ASP A 1 56  ? 19.316  -14.908 -5.703  1.00 3.44  ? 56  ASP A OD2  4  
ATOM 10742 H H    . ASP A 1 56  ? 16.125  -16.206 -3.687  1.00 1.71  ? 56  ASP A H    4  
ATOM 10743 H HA   . ASP A 1 56  ? 18.323  -15.849 -1.786  1.00 1.84  ? 56  ASP A HA   4  
ATOM 10744 H HB2  . ASP A 1 56  ? 20.009  -15.846 -3.501  1.00 2.43  ? 56  ASP A HB2  4  
ATOM 10745 H HB3  . ASP A 1 56  ? 19.094  -17.337 -3.669  1.00 2.59  ? 56  ASP A HB3  4  
ATOM 10746 N N    . PRO A 1 57  ? 18.603  -13.355 -2.488  1.00 1.06  ? 57  PRO A N    4  
ATOM 10747 C CA   . PRO A 1 57  ? 18.441  -11.888 -2.551  1.00 1.02  ? 57  PRO A CA   4  
ATOM 10748 C C    . PRO A 1 57  ? 18.489  -11.324 -3.967  1.00 0.75  ? 57  PRO A C    4  
ATOM 10749 O O    . PRO A 1 57  ? 18.283  -10.125 -4.166  1.00 0.70  ? 57  PRO A O    4  
ATOM 10750 C CB   . PRO A 1 57  ? 19.629  -11.362 -1.738  1.00 1.20  ? 57  PRO A CB   4  
ATOM 10751 C CG   . PRO A 1 57  ? 20.623  -12.464 -1.786  1.00 1.20  ? 57  PRO A CG   4  
ATOM 10752 C CD   . PRO A 1 57  ? 19.812  -13.721 -1.726  1.00 1.14  ? 57  PRO A CD   4  
ATOM 10753 H HA   . PRO A 1 57  ? 17.521  -11.577 -2.081  1.00 1.22  ? 57  PRO A HA   4  
ATOM 10754 H HB2  . PRO A 1 57  ? 20.013  -10.460 -2.195  1.00 1.21  ? 57  PRO A HB2  4  
ATOM 10755 H HB3  . PRO A 1 57  ? 19.317  -11.156 -0.725  1.00 1.44  ? 57  PRO A HB3  4  
ATOM 10756 H HG2  . PRO A 1 57  ? 21.179  -12.419 -2.714  1.00 1.15  ? 57  PRO A HG2  4  
ATOM 10757 H HG3  . PRO A 1 57  ? 21.289  -12.405 -0.939  1.00 1.39  ? 57  PRO A HG3  4  
ATOM 10758 H HD2  . PRO A 1 57  ? 20.340  -14.535 -2.197  1.00 1.16  ? 57  PRO A HD2  4  
ATOM 10759 H HD3  . PRO A 1 57  ? 19.564  -13.966 -0.705  1.00 1.29  ? 57  PRO A HD3  4  
ATOM 10760 N N    . GLY A 1 58  ? 18.754  -12.180 -4.948  1.00 0.67  ? 58  GLY A N    4  
ATOM 10761 C CA   . GLY A 1 58  ? 18.708  -11.760 -6.332  1.00 0.56  ? 58  GLY A CA   4  
ATOM 10762 C C    . GLY A 1 58  ? 17.306  -11.383 -6.748  1.00 0.49  ? 58  GLY A C    4  
ATOM 10763 O O    . GLY A 1 58  ? 17.099  -10.732 -7.767  1.00 0.48  ? 58  GLY A O    4  
ATOM 10764 H H    . GLY A 1 58  ? 18.980  -13.112 -4.729  1.00 0.74  ? 58  GLY A H    4  
ATOM 10765 H HA2  . GLY A 1 58  ? 19.359  -10.909 -6.466  1.00 0.57  ? 58  GLY A HA2  4  
ATOM 10766 H HA3  . GLY A 1 58  ? 19.048  -12.569 -6.954  1.00 0.61  ? 58  GLY A HA3  4  
ATOM 10767 N N    . VAL A 1 59  ? 16.344  -11.795 -5.943  1.00 0.52  ? 59  VAL A N    4  
ATOM 10768 C CA   . VAL A 1 59  ? 14.958  -11.436 -6.162  1.00 0.52  ? 59  VAL A CA   4  
ATOM 10769 C C    . VAL A 1 59  ? 14.753  -9.945  -5.988  1.00 0.49  ? 59  VAL A C    4  
ATOM 10770 O O    . VAL A 1 59  ? 14.017  -9.329  -6.747  1.00 0.49  ? 59  VAL A O    4  
ATOM 10771 C CB   . VAL A 1 59  ? 14.015  -12.194 -5.206  1.00 0.61  ? 59  VAL A CB   4  
ATOM 10772 C CG1  . VAL A 1 59  ? 14.437  -11.994 -3.758  1.00 0.65  ? 59  VAL A CG1  4  
ATOM 10773 C CG2  . VAL A 1 59  ? 12.578  -11.742 -5.403  1.00 0.66  ? 59  VAL A CG2  4  
ATOM 10774 H H    . VAL A 1 59  ? 16.576  -12.363 -5.179  1.00 0.58  ? 59  VAL A H    4  
ATOM 10775 H HA   . VAL A 1 59  ? 14.705  -11.697 -7.177  1.00 0.53  ? 59  VAL A HA   4  
ATOM 10776 H HB   . VAL A 1 59  ? 14.082  -13.241 -5.434  1.00 0.64  ? 59  VAL A HB   4  
ATOM 10777 H HG11 . VAL A 1 59  ? 13.684  -12.403 -3.102  1.00 1.19  ? 59  VAL A HG11 4  
ATOM 10778 H HG12 . VAL A 1 59  ? 14.557  -10.939 -3.564  1.00 1.14  ? 59  VAL A HG12 4  
ATOM 10779 H HG13 . VAL A 1 59  ? 15.377  -12.497 -3.587  1.00 1.29  ? 59  VAL A HG13 4  
ATOM 10780 H HG21 . VAL A 1 59  ? 12.272  -11.944 -6.418  1.00 1.21  ? 59  VAL A HG21 4  
ATOM 10781 H HG22 . VAL A 1 59  ? 12.511  -10.678 -5.211  1.00 1.26  ? 59  VAL A HG22 4  
ATOM 10782 H HG23 . VAL A 1 59  ? 11.933  -12.274 -4.718  1.00 1.19  ? 59  VAL A HG23 4  
ATOM 10783 N N    . LEU A 1 60  ? 15.434  -9.368  -5.006  1.00 0.48  ? 60  LEU A N    4  
ATOM 10784 C CA   . LEU A 1 60  ? 15.315  -7.939  -4.736  1.00 0.46  ? 60  LEU A CA   4  
ATOM 10785 C C    . LEU A 1 60  ? 15.779  -7.164  -5.951  1.00 0.43  ? 60  LEU A C    4  
ATOM 10786 O O    . LEU A 1 60  ? 15.350  -6.042  -6.204  1.00 0.41  ? 60  LEU A O    4  
ATOM 10787 C CB   . LEU A 1 60  ? 16.160  -7.531  -3.529  1.00 0.48  ? 60  LEU A CB   4  
ATOM 10788 C CG   . LEU A 1 60  ? 16.134  -8.504  -2.349  1.00 0.51  ? 60  LEU A CG   4  
ATOM 10789 C CD1  . LEU A 1 60  ? 16.940  -7.956  -1.177  1.00 0.51  ? 60  LEU A CD1  4  
ATOM 10790 C CD2  . LEU A 1 60  ? 14.705  -8.790  -1.937  1.00 0.52  ? 60  LEU A CD2  4  
ATOM 10791 H H    . LEU A 1 60  ? 16.025  -9.917  -4.450  1.00 0.50  ? 60  LEU A H    4  
ATOM 10792 H HA   . LEU A 1 60  ? 14.275  -7.722  -4.543  1.00 0.47  ? 60  LEU A HA   4  
ATOM 10793 H HB2  . LEU A 1 60  ? 17.184  -7.414  -3.855  1.00 0.51  ? 60  LEU A HB2  4  
ATOM 10794 H HB3  . LEU A 1 60  ? 15.798  -6.574  -3.185  1.00 0.48  ? 60  LEU A HB3  4  
ATOM 10795 H HG   . LEU A 1 60  ? 16.584  -9.436  -2.654  1.00 0.57  ? 60  LEU A HG   4  
ATOM 10796 H HD11 . LEU A 1 60  ? 16.813  -8.600  -0.316  1.00 1.00  ? 60  LEU A HD11 4  
ATOM 10797 H HD12 . LEU A 1 60  ? 16.596  -6.962  -0.937  1.00 1.22  ? 60  LEU A HD12 4  
ATOM 10798 H HD13 . LEU A 1 60  ? 17.985  -7.919  -1.445  1.00 1.18  ? 60  LEU A HD13 4  
ATOM 10799 H HD21 . LEU A 1 60  ? 14.172  -9.225  -2.769  1.00 1.20  ? 60  LEU A HD21 4  
ATOM 10800 H HD22 . LEU A 1 60  ? 14.224  -7.868  -1.648  1.00 1.11  ? 60  LEU A HD22 4  
ATOM 10801 H HD23 . LEU A 1 60  ? 14.698  -9.476  -1.107  1.00 1.11  ? 60  LEU A HD23 4  
ATOM 10802 N N    . ASP A 1 61  ? 16.648  -7.807  -6.705  1.00 0.46  ? 61  ASP A N    4  
ATOM 10803 C CA   . ASP A 1 61  ? 17.198  -7.243  -7.928  1.00 0.46  ? 61  ASP A CA   4  
ATOM 10804 C C    . ASP A 1 61  ? 16.125  -7.208  -8.999  1.00 0.47  ? 61  ASP A C    4  
ATOM 10805 O O    . ASP A 1 61  ? 16.016  -6.259  -9.776  1.00 0.51  ? 61  ASP A O    4  
ATOM 10806 C CB   . ASP A 1 61  ? 18.377  -8.093  -8.400  1.00 0.47  ? 61  ASP A CB   4  
ATOM 10807 C CG   . ASP A 1 61  ? 19.262  -7.379  -9.404  1.00 0.48  ? 61  ASP A CG   4  
ATOM 10808 O OD1  . ASP A 1 61  ? 18.971  -7.445  -10.614 1.00 1.19  ? 61  ASP A OD1  4  
ATOM 10809 O OD2  . ASP A 1 61  ? 20.269  -6.765  -8.988  1.00 1.22  ? 61  ASP A OD2  4  
ATOM 10810 H H    . ASP A 1 61  ? 16.921  -8.708  -6.428  1.00 0.49  ? 61  ASP A H    4  
ATOM 10811 H HA   . ASP A 1 61  ? 17.526  -6.244  -7.726  1.00 0.48  ? 61  ASP A HA   4  
ATOM 10812 H HB2  . ASP A 1 61  ? 18.970  -8.375  -7.548  1.00 0.48  ? 61  ASP A HB2  4  
ATOM 10813 H HB3  . ASP A 1 61  ? 17.990  -8.988  -8.866  1.00 0.51  ? 61  ASP A HB3  4  
ATOM 10814 N N    . ARG A 1 62  ? 15.319  -8.251  -8.998  1.00 0.47  ? 62  ARG A N    4  
ATOM 10815 C CA   . ARG A 1 62  ? 14.232  -8.394  -9.945  1.00 0.51  ? 62  ARG A CA   4  
ATOM 10816 C C    . ARG A 1 62  ? 13.088  -7.468  -9.559  1.00 0.50  ? 62  ARG A C    4  
ATOM 10817 O O    . ARG A 1 62  ? 12.405  -6.913  -10.418 1.00 0.56  ? 62  ARG A O    4  
ATOM 10818 C CB   . ARG A 1 62  ? 13.771  -9.848  -9.965  1.00 0.55  ? 62  ARG A CB   4  
ATOM 10819 C CG   . ARG A 1 62  ? 14.929  -10.829 -10.031 1.00 0.55  ? 62  ARG A CG   4  
ATOM 10820 C CD   . ARG A 1 62  ? 14.457  -12.262 -9.936  1.00 0.62  ? 62  ARG A CD   4  
ATOM 10821 N NE   . ARG A 1 62  ? 15.561  -13.209 -10.081 1.00 1.45  ? 62  ARG A NE   4  
ATOM 10822 C CZ   . ARG A 1 62  ? 15.442  -14.523 -9.905  1.00 1.97  ? 62  ARG A CZ   4  
ATOM 10823 N NH1  . ARG A 1 62  ? 14.275  -15.050 -9.566  1.00 1.66  ? 62  ARG A NH1  4  
ATOM 10824 N NH2  . ARG A 1 62  ? 16.494  -15.311 -10.066 1.00 3.02  ? 62  ARG A NH2  4  
ATOM 10825 H H    . ARG A 1 62  ? 15.458  -8.951  -8.328  1.00 0.47  ? 62  ARG A H    4  
ATOM 10826 H HA   . ARG A 1 62  ? 14.598  -8.119  -10.921 1.00 0.53  ? 62  ARG A HA   4  
ATOM 10827 H HB2  . ARG A 1 62  ? 13.202  -10.049 -9.068  1.00 0.60  ? 62  ARG A HB2  4  
ATOM 10828 H HB3  . ARG A 1 62  ? 13.140  -10.006 -10.827 1.00 0.60  ? 62  ARG A HB3  4  
ATOM 10829 H HG2  . ARG A 1 62  ? 15.453  -10.694 -10.959 1.00 0.56  ? 62  ARG A HG2  4  
ATOM 10830 H HG3  . ARG A 1 62  ? 15.600  -10.628 -9.209  1.00 0.56  ? 62  ARG A HG3  4  
ATOM 10831 H HD2  . ARG A 1 62  ? 14.000  -12.406 -8.972  1.00 1.11  ? 62  ARG A HD2  4  
ATOM 10832 H HD3  . ARG A 1 62  ? 13.733  -12.444 -10.713 1.00 0.98  ? 62  ARG A HD3  4  
ATOM 10833 H HE   . ARG A 1 62  ? 16.438  -12.842 -10.328 1.00 1.91  ? 62  ARG A HE   4  
ATOM 10834 H HH11 . ARG A 1 62  ? 13.471  -14.460 -9.436  1.00 1.23  ? 62  ARG A HH11 4  
ATOM 10835 H HH12 . ARG A 1 62  ? 14.189  -16.041 -9.431  1.00 2.13  ? 62  ARG A HH12 4  
ATOM 10836 H HH21 . ARG A 1 62  ? 17.383  -14.919 -10.321 1.00 3.45  ? 62  ARG A HH21 4  
ATOM 10837 H HH22 . ARG A 1 62  ? 16.407  -16.302 -9.930  1.00 3.45  ? 62  ARG A HH22 4  
ATOM 10838 N N    . MET A 1 63  ? 12.893  -7.300  -8.251  1.00 0.45  ? 63  MET A N    4  
ATOM 10839 C CA   . MET A 1 63  ? 11.913  -6.349  -7.743  1.00 0.44  ? 63  MET A CA   4  
ATOM 10840 C C    . MET A 1 63  ? 12.338  -4.962  -8.160  1.00 0.41  ? 63  MET A C    4  
ATOM 10841 O O    . MET A 1 63  ? 11.563  -4.207  -8.738  1.00 0.42  ? 63  MET A O    4  
ATOM 10842 C CB   . MET A 1 63  ? 11.825  -6.365  -6.214  1.00 0.43  ? 63  MET A CB   4  
ATOM 10843 C CG   . MET A 1 63  ? 11.820  -7.743  -5.568  1.00 0.49  ? 63  MET A CG   4  
ATOM 10844 S SD   . MET A 1 63  ? 10.252  -8.627  -5.745  1.00 0.64  ? 63  MET A SD   4  
ATOM 10845 C CE   . MET A 1 63  ? 10.384  -9.297  -7.402  1.00 1.54  ? 63  MET A CE   4  
ATOM 10846 H H    . MET A 1 63  ? 13.427  -7.829  -7.618  1.00 0.45  ? 63  MET A H    4  
ATOM 10847 H HA   . MET A 1 63  ? 10.951  -6.578  -8.168  1.00 0.47  ? 63  MET A HA   4  
ATOM 10848 H HB2  . MET A 1 63  ? 12.662  -5.811  -5.821  1.00 0.39  ? 63  MET A HB2  4  
ATOM 10849 H HB3  . MET A 1 63  ? 10.915  -5.859  -5.924  1.00 0.46  ? 63  MET A HB3  4  
ATOM 10850 H HG2  . MET A 1 63  ? 12.600  -8.334  -6.020  1.00 0.48  ? 63  MET A HG2  4  
ATOM 10851 H HG3  . MET A 1 63  ? 12.037  -7.627  -4.519  1.00 0.54  ? 63  MET A HG3  4  
ATOM 10852 H HE1  . MET A 1 63  ? 10.471  -8.489  -8.112  1.00 2.05  ? 63  MET A HE1  4  
ATOM 10853 H HE2  . MET A 1 63  ? 9.502   -9.878  -7.627  1.00 2.05  ? 63  MET A HE2  4  
ATOM 10854 H HE3  . MET A 1 63  ? 11.258  -9.927  -7.467  1.00 2.13  ? 63  MET A HE3  4  
ATOM 10855 N N    . MET A 1 64  ? 13.600  -4.662  -7.870  1.00 0.41  ? 64  MET A N    4  
ATOM 10856 C CA   . MET A 1 64  ? 14.182  -3.362  -8.142  1.00 0.42  ? 64  MET A CA   4  
ATOM 10857 C C    . MET A 1 64  ? 13.881  -2.915  -9.560  1.00 0.44  ? 64  MET A C    4  
ATOM 10858 O O    . MET A 1 64  ? 13.294  -1.868  -9.762  1.00 0.41  ? 64  MET A O    4  
ATOM 10859 C CB   . MET A 1 64  ? 15.694  -3.401  -7.934  1.00 0.55  ? 64  MET A CB   4  
ATOM 10860 C CG   . MET A 1 64  ? 16.318  -2.024  -7.837  1.00 0.65  ? 64  MET A CG   4  
ATOM 10861 S SD   . MET A 1 64  ? 15.831  -1.169  -6.332  1.00 1.87  ? 64  MET A SD   4  
ATOM 10862 C CE   . MET A 1 64  ? 16.616  0.416   -6.575  1.00 2.41  ? 64  MET A CE   4  
ATOM 10863 H H    . MET A 1 64  ? 14.162  -5.345  -7.440  1.00 0.42  ? 64  MET A H    4  
ATOM 10864 H HA   . MET A 1 64  ? 13.752  -2.653  -7.453  1.00 0.42  ? 64  MET A HA   4  
ATOM 10865 H HB2  . MET A 1 64  ? 15.908  -3.937  -7.019  1.00 0.60  ? 64  MET A HB2  4  
ATOM 10866 H HB3  . MET A 1 64  ? 16.149  -3.924  -8.762  1.00 0.64  ? 64  MET A HB3  4  
ATOM 10867 H HG2  . MET A 1 64  ? 17.393  -2.126  -7.850  1.00 1.29  ? 64  MET A HG2  4  
ATOM 10868 H HG3  . MET A 1 64  ? 16.002  -1.438  -8.688  1.00 1.05  ? 64  MET A HG3  4  
ATOM 10869 H HE1  . MET A 1 64  ? 16.206  0.889   -7.455  1.00 2.83  ? 64  MET A HE1  4  
ATOM 10870 H HE2  . MET A 1 64  ? 17.679  0.277   -6.705  1.00 2.83  ? 64  MET A HE2  4  
ATOM 10871 H HE3  . MET A 1 64  ? 16.438  1.042   -5.713  1.00 2.75  ? 64  MET A HE3  4  
ATOM 10872 N N    . LYS A 1 65  ? 14.247  -3.728  -10.539 1.00 0.52  ? 65  LYS A N    4  
ATOM 10873 C CA   . LYS A 1 65  ? 14.078  -3.334  -11.935 1.00 0.56  ? 65  LYS A CA   4  
ATOM 10874 C C    . LYS A 1 65  ? 12.624  -3.386  -12.392 1.00 0.54  ? 65  LYS A C    4  
ATOM 10875 O O    . LYS A 1 65  ? 12.254  -2.731  -13.369 1.00 0.60  ? 65  LYS A O    4  
ATOM 10876 C CB   . LYS A 1 65  ? 14.976  -4.157  -12.859 1.00 0.66  ? 65  LYS A CB   4  
ATOM 10877 C CG   . LYS A 1 65  ? 16.378  -3.580  -12.975 1.00 0.79  ? 65  LYS A CG   4  
ATOM 10878 C CD   . LYS A 1 65  ? 16.347  -2.182  -13.583 1.00 0.86  ? 65  LYS A CD   4  
ATOM 10879 C CE   . LYS A 1 65  ? 17.700  -1.497  -13.517 1.00 1.57  ? 65  LYS A CE   4  
ATOM 10880 N NZ   . LYS A 1 65  ? 17.619  -0.084  -13.975 1.00 2.49  ? 65  LYS A NZ   4  
ATOM 10881 H H    . LYS A 1 65  ? 14.638  -4.608  -10.317 1.00 0.56  ? 65  LYS A H    4  
ATOM 10882 H HA   . LYS A 1 65  ? 14.393  -2.306  -11.996 1.00 0.59  ? 65  LYS A HA   4  
ATOM 10883 H HB2  . LYS A 1 65  ? 15.049  -5.163  -12.473 1.00 0.75  ? 65  LYS A HB2  4  
ATOM 10884 H HB3  . LYS A 1 65  ? 14.536  -4.185  -13.844 1.00 0.66  ? 65  LYS A HB3  4  
ATOM 10885 H HG2  . LYS A 1 65  ? 16.817  -3.525  -11.989 1.00 0.86  ? 65  LYS A HG2  4  
ATOM 10886 H HG3  . LYS A 1 65  ? 16.974  -4.225  -13.602 1.00 0.89  ? 65  LYS A HG3  4  
ATOM 10887 H HD2  . LYS A 1 65  ? 16.048  -2.261  -14.617 1.00 1.29  ? 65  LYS A HD2  4  
ATOM 10888 H HD3  . LYS A 1 65  ? 15.628  -1.581  -13.048 1.00 1.25  ? 65  LYS A HD3  4  
ATOM 10889 H HE2  . LYS A 1 65  ? 18.050  -1.515  -12.496 1.00 1.92  ? 65  LYS A HE2  4  
ATOM 10890 H HE3  . LYS A 1 65  ? 18.395  -2.032  -14.147 1.00 2.11  ? 65  LYS A HE3  4  
ATOM 10891 H HZ1  . LYS A 1 65  ? 18.537  0.389   -13.856 1.00 2.92  ? 65  LYS A HZ1  4  
ATOM 10892 H HZ2  . LYS A 1 65  ? 16.899  0.435   -13.422 1.00 2.86  ? 65  LYS A HZ2  4  
ATOM 10893 H HZ3  . LYS A 1 65  ? 17.352  -0.048  -14.979 1.00 3.01  ? 65  LYS A HZ3  4  
ATOM 10894 N N    . LYS A 1 66  ? 11.804  -4.160  -11.701 1.00 0.50  ? 66  LYS A N    4  
ATOM 10895 C CA   . LYS A 1 66  ? 10.369  -4.169  -11.963 1.00 0.52  ? 66  LYS A CA   4  
ATOM 10896 C C    . LYS A 1 66  ? 9.758   -2.835  -11.547 1.00 0.48  ? 66  LYS A C    4  
ATOM 10897 O O    . LYS A 1 66  ? 8.879   -2.290  -12.217 1.00 0.55  ? 66  LYS A O    4  
ATOM 10898 C CB   . LYS A 1 66  ? 9.691   -5.299  -11.181 1.00 0.55  ? 66  LYS A CB   4  
ATOM 10899 C CG   . LYS A 1 66  ? 8.179   -5.333  -11.345 1.00 0.91  ? 66  LYS A CG   4  
ATOM 10900 C CD   . LYS A 1 66  ? 7.464   -5.429  -10.002 1.00 0.96  ? 66  LYS A CD   4  
ATOM 10901 C CE   . LYS A 1 66  ? 7.828   -6.694  -9.236  1.00 0.73  ? 66  LYS A CE   4  
ATOM 10902 N NZ   . LYS A 1 66  ? 7.389   -7.926  -9.945  1.00 1.47  ? 66  LYS A NZ   4  
ATOM 10903 H H    . LYS A 1 66  ? 12.169  -4.739  -10.999 1.00 0.50  ? 66  LYS A H    4  
ATOM 10904 H HA   . LYS A 1 66  ? 10.215  -4.319  -13.020 1.00 0.58  ? 66  LYS A HA   4  
ATOM 10905 H HB2  . LYS A 1 66  ? 10.091  -6.244  -11.515 1.00 0.84  ? 66  LYS A HB2  4  
ATOM 10906 H HB3  . LYS A 1 66  ? 9.913   -5.174  -10.130 1.00 0.87  ? 66  LYS A HB3  4  
ATOM 10907 H HG2  . LYS A 1 66  ? 7.863   -4.426  -11.842 1.00 1.33  ? 66  LYS A HG2  4  
ATOM 10908 H HG3  . LYS A 1 66  ? 7.912   -6.187  -11.949 1.00 1.31  ? 66  LYS A HG3  4  
ATOM 10909 H HD2  . LYS A 1 66  ? 7.736   -4.574  -9.403  1.00 1.50  ? 66  LYS A HD2  4  
ATOM 10910 H HD3  . LYS A 1 66  ? 6.399   -5.420  -10.175 1.00 1.60  ? 66  LYS A HD3  4  
ATOM 10911 H HE2  . LYS A 1 66  ? 8.900   -6.727  -9.109  1.00 1.11  ? 66  LYS A HE2  4  
ATOM 10912 H HE3  . LYS A 1 66  ? 7.355   -6.658  -8.263  1.00 0.98  ? 66  LYS A HE3  4  
ATOM 10913 H HZ1  . LYS A 1 66  ? 7.902   -8.030  -10.842 1.00 2.03  ? 66  LYS A HZ1  4  
ATOM 10914 H HZ2  . LYS A 1 66  ? 6.370   -7.880  -10.147 1.00 1.78  ? 66  LYS A HZ2  4  
ATOM 10915 H HZ3  . LYS A 1 66  ? 7.573   -8.764  -9.358  1.00 2.01  ? 66  LYS A HZ3  4  
ATOM 10916 N N    . LEU A 1 67  ? 10.248  -2.321  -10.434 1.00 0.41  ? 67  LEU A N    4  
ATOM 10917 C CA   . LEU A 1 67  ? 9.695   -1.129  -9.817  1.00 0.39  ? 67  LEU A CA   4  
ATOM 10918 C C    . LEU A 1 67  ? 10.391  0.128   -10.304 1.00 0.40  ? 67  LEU A C    4  
ATOM 10919 O O    . LEU A 1 67  ? 9.765   1.179   -10.394 1.00 0.46  ? 67  LEU A O    4  
ATOM 10920 C CB   . LEU A 1 67  ? 9.852   -1.240  -8.317  1.00 0.34  ? 67  LEU A CB   4  
ATOM 10921 C CG   . LEU A 1 67  ? 9.361   -2.562  -7.727  1.00 0.33  ? 67  LEU A CG   4  
ATOM 10922 C CD1  . LEU A 1 67  ? 9.848   -2.727  -6.303  1.00 0.30  ? 67  LEU A CD1  4  
ATOM 10923 C CD2  . LEU A 1 67  ? 7.845   -2.649  -7.792  1.00 0.37  ? 67  LEU A CD2  4  
ATOM 10924 H H    . LEU A 1 67  ? 11.010  -2.765  -10.003 1.00 0.43  ? 67  LEU A H    4  
ATOM 10925 H HA   . LEU A 1 67  ? 8.649   -1.074  -10.059 1.00 0.44  ? 67  LEU A HA   4  
ATOM 10926 H HB2  . LEU A 1 67  ? 10.901  -1.123  -8.092  1.00 0.34  ? 67  LEU A HB2  4  
ATOM 10927 H HB3  . LEU A 1 67  ? 9.304   -0.432  -7.852  1.00 0.36  ? 67  LEU A HB3  4  
ATOM 10928 H HG   . LEU A 1 67  ? 9.766   -3.377  -8.310  1.00 0.36  ? 67  LEU A HG   4  
ATOM 10929 H HD11 . LEU A 1 67  ? 9.524   -1.880  -5.714  1.00 1.06  ? 67  LEU A HD11 4  
ATOM 10930 H HD12 . LEU A 1 67  ? 10.927  -2.778  -6.297  1.00 1.02  ? 67  LEU A HD12 4  
ATOM 10931 H HD13 . LEU A 1 67  ? 9.442   -3.636  -5.886  1.00 1.06  ? 67  LEU A HD13 4  
ATOM 10932 H HD21 . LEU A 1 67  ? 7.527   -2.600  -8.823  1.00 1.11  ? 67  LEU A HD21 4  
ATOM 10933 H HD22 . LEU A 1 67  ? 7.412   -1.826  -7.242  1.00 1.06  ? 67  LEU A HD22 4  
ATOM 10934 H HD23 . LEU A 1 67  ? 7.516   -3.583  -7.357  1.00 1.08  ? 67  LEU A HD23 4  
ATOM 10935 N N    . ASP A 1 68  ? 11.695  0.007   -10.578 1.00 0.40  ? 68  ASP A N    4  
ATOM 10936 C CA   . ASP A 1 68  ? 12.520  1.108   -11.093 1.00 0.42  ? 68  ASP A CA   4  
ATOM 10937 C C    . ASP A 1 68  ? 12.027  1.510   -12.471 1.00 0.52  ? 68  ASP A C    4  
ATOM 10938 O O    . ASP A 1 68  ? 12.630  1.221   -13.507 1.00 0.56  ? 68  ASP A O    4  
ATOM 10939 C CB   . ASP A 1 68  ? 13.999  0.683   -11.126 1.00 0.43  ? 68  ASP A CB   4  
ATOM 10940 C CG   . ASP A 1 68  ? 14.913  1.655   -11.858 1.00 0.46  ? 68  ASP A CG   4  
ATOM 10941 O OD1  . ASP A 1 68  ? 15.004  2.831   -11.452 1.00 1.23  ? 68  ASP A OD1  4  
ATOM 10942 O OD2  . ASP A 1 68  ? 15.569  1.231   -12.841 1.00 1.13  ? 68  ASP A OD2  4  
ATOM 10943 H H    . ASP A 1 68  ? 12.127  -0.860  -10.409 1.00 0.40  ? 68  ASP A H    4  
ATOM 10944 H HA   . ASP A 1 68  ? 12.406  1.957   -10.418 1.00 0.41  ? 68  ASP A HA   4  
ATOM 10945 H HB2  . ASP A 1 68  ? 14.354  0.589   -10.110 1.00 0.41  ? 68  ASP A HB2  4  
ATOM 10946 H HB3  . ASP A 1 68  ? 14.071  -0.281  -11.611 1.00 0.47  ? 68  ASP A HB3  4  
ATOM 10947 N N    . THR A 1 69  ? 10.888  2.145   -12.452 1.00 0.59  ? 69  THR A N    4  
ATOM 10948 C CA   . THR A 1 69  ? 10.226  2.609   -13.638 1.00 0.74  ? 69  THR A CA   4  
ATOM 10949 C C    . THR A 1 69  ? 10.811  3.956   -14.037 1.00 0.84  ? 69  THR A C    4  
ATOM 10950 O O    . THR A 1 69  ? 10.713  4.386   -15.187 1.00 0.99  ? 69  THR A O    4  
ATOM 10951 C CB   . THR A 1 69  ? 8.712   2.704   -13.371 1.00 0.79  ? 69  THR A CB   4  
ATOM 10952 O OG1  . THR A 1 69  ? 7.977   2.640   -14.600 1.00 0.90  ? 69  THR A OG1  4  
ATOM 10953 C CG2  . THR A 1 69  ? 8.369   3.990   -12.639 1.00 0.83  ? 69  THR A CG2  4  
ATOM 10954 H H    . THR A 1 69  ? 10.462  2.305   -11.570 1.00 0.55  ? 69  THR A H    4  
ATOM 10955 H HA   . THR A 1 69  ? 10.395  1.900   -14.422 1.00 0.80  ? 69  THR A HA   4  
ATOM 10956 H HB   . THR A 1 69  ? 8.432   1.865   -12.740 1.00 0.76  ? 69  THR A HB   4  
ATOM 10957 H HG1  . THR A 1 69  ? 8.266   3.353   -15.184 1.00 1.25  ? 69  THR A HG1  4  
ATOM 10958 H HG21 . THR A 1 69  ? 8.956   4.052   -11.734 1.00 1.41  ? 69  THR A HG21 4  
ATOM 10959 H HG22 . THR A 1 69  ? 7.318   3.998   -12.392 1.00 1.35  ? 69  THR A HG22 4  
ATOM 10960 H HG23 . THR A 1 69  ? 8.598   4.833   -13.273 1.00 1.12  ? 69  THR A HG23 4  
ATOM 10961 N N    . ASN A 1 70  ? 11.451  4.595   -13.065 1.00 0.80  ? 70  ASN A N    4  
ATOM 10962 C CA   . ASN A 1 70  ? 12.156  5.847   -13.284 1.00 0.94  ? 70  ASN A CA   4  
ATOM 10963 C C    . ASN A 1 70  ? 13.457  5.565   -14.018 1.00 0.86  ? 70  ASN A C    4  
ATOM 10964 O O    . ASN A 1 70  ? 14.089  6.455   -14.589 1.00 0.97  ? 70  ASN A O    4  
ATOM 10965 C CB   . ASN A 1 70  ? 12.457  6.487   -11.929 1.00 1.01  ? 70  ASN A CB   4  
ATOM 10966 C CG   . ASN A 1 70  ? 12.686  7.986   -11.994 1.00 1.25  ? 70  ASN A CG   4  
ATOM 10967 O OD1  . ASN A 1 70  ? 13.128  8.527   -13.007 1.00 1.46  ? 70  ASN A OD1  4  
ATOM 10968 N ND2  . ASN A 1 70  ? 12.394  8.669   -10.899 1.00 1.66  ? 70  ASN A ND2  4  
ATOM 10969 H H    . ASN A 1 70  ? 11.437  4.209   -12.150 1.00 0.72  ? 70  ASN A H    4  
ATOM 10970 H HA   . ASN A 1 70  ? 11.535  6.503   -13.871 1.00 1.12  ? 70  ASN A HA   4  
ATOM 10971 H HB2  . ASN A 1 70  ? 11.628  6.296   -11.270 1.00 1.07  ? 70  ASN A HB2  4  
ATOM 10972 H HB3  . ASN A 1 70  ? 13.343  6.025   -11.517 1.00 0.89  ? 70  ASN A HB3  4  
ATOM 10973 H HD21 . ASN A 1 70  ? 12.049  8.174   -10.122 1.00 1.94  ? 70  ASN A HD21 4  
ATOM 10974 H HD22 . ASN A 1 70  ? 12.532  9.640   -10.904 1.00 1.86  ? 70  ASN A HD22 4  
ATOM 10975 N N    . SER A 1 71  ? 13.817  4.283   -14.005 1.00 0.70  ? 71  SER A N    4  
ATOM 10976 C CA   . SER A 1 71  ? 15.009  3.776   -14.666 1.00 0.66  ? 71  SER A CA   4  
ATOM 10977 C C    . SER A 1 71  ? 16.251  4.495   -14.168 1.00 0.61  ? 71  SER A C    4  
ATOM 10978 O O    . SER A 1 71  ? 17.208  4.713   -14.913 1.00 0.65  ? 71  SER A O    4  
ATOM 10979 C CB   . SER A 1 71  ? 14.870  3.903   -16.183 1.00 0.82  ? 71  SER A CB   4  
ATOM 10980 O OG   . SER A 1 71  ? 13.671  3.285   -16.631 1.00 1.47  ? 71  SER A OG   4  
ATOM 10981 H H    . SER A 1 71  ? 13.257  3.649   -13.509 1.00 0.65  ? 71  SER A H    4  
ATOM 10982 H HA   . SER A 1 71  ? 15.096  2.734   -14.404 1.00 0.61  ? 71  SER A HA   4  
ATOM 10983 H HB2  . SER A 1 71  ? 14.846  4.948   -16.455 1.00 1.19  ? 71  SER A HB2  4  
ATOM 10984 H HB3  . SER A 1 71  ? 15.710  3.424   -16.662 1.00 1.15  ? 71  SER A HB3  4  
ATOM 10985 H HG   . SER A 1 71  ? 12.915  3.769   -16.282 1.00 2.02  ? 71  SER A HG   4  
ATOM 10986 N N    . ASP A 1 72  ? 16.232  4.833   -12.893 1.00 0.58  ? 72  ASP A N    4  
ATOM 10987 C CA   . ASP A 1 72  ? 17.302  5.601   -12.289 1.00 0.65  ? 72  ASP A CA   4  
ATOM 10988 C C    . ASP A 1 72  ? 18.165  4.693   -11.432 1.00 0.56  ? 72  ASP A C    4  
ATOM 10989 O O    . ASP A 1 72  ? 19.306  5.017   -11.105 1.00 0.66  ? 72  ASP A O    4  
ATOM 10990 C CB   . ASP A 1 72  ? 16.721  6.730   -11.435 1.00 0.80  ? 72  ASP A CB   4  
ATOM 10991 C CG   . ASP A 1 72  ? 17.773  7.717   -10.974 1.00 0.93  ? 72  ASP A CG   4  
ATOM 10992 O OD1  . ASP A 1 72  ? 18.101  8.636   -11.750 1.00 1.56  ? 72  ASP A OD1  4  
ATOM 10993 O OD2  . ASP A 1 72  ? 18.260  7.590   -9.833  1.00 1.53  ? 72  ASP A OD2  4  
ATOM 10994 H H    . ASP A 1 72  ? 15.478  4.532   -12.332 1.00 0.56  ? 72  ASP A H    4  
ATOM 10995 H HA   . ASP A 1 72  ? 17.905  6.022   -13.078 1.00 0.76  ? 72  ASP A HA   4  
ATOM 10996 H HB2  . ASP A 1 72  ? 15.983  7.266   -12.014 1.00 1.15  ? 72  ASP A HB2  4  
ATOM 10997 H HB3  . ASP A 1 72  ? 16.246  6.305   -10.563 1.00 1.00  ? 72  ASP A HB3  4  
ATOM 10998 N N    . GLY A 1 73  ? 17.617  3.537   -11.092 1.00 0.45  ? 73  GLY A N    4  
ATOM 10999 C CA   . GLY A 1 73  ? 18.322  2.613   -10.234 1.00 0.46  ? 73  GLY A CA   4  
ATOM 11000 C C    . GLY A 1 73  ? 17.946  2.833   -8.793  1.00 0.41  ? 73  GLY A C    4  
ATOM 11001 O O    . GLY A 1 73  ? 18.666  2.433   -7.876  1.00 0.44  ? 73  GLY A O    4  
ATOM 11002 H H    . GLY A 1 73  ? 16.703  3.314   -11.413 1.00 0.42  ? 73  GLY A H    4  
ATOM 11003 H HA2  . GLY A 1 73  ? 18.068  1.601   -10.516 1.00 0.48  ? 73  GLY A HA2  4  
ATOM 11004 H HA3  . GLY A 1 73  ? 19.385  2.760   -10.348 1.00 0.55  ? 73  GLY A HA3  4  
ATOM 11005 N N    . GLN A 1 74  ? 16.817  3.495   -8.606  1.00 0.38  ? 74  GLN A N    4  
ATOM 11006 C CA   . GLN A 1 74  ? 16.274  3.761   -7.292  1.00 0.37  ? 74  GLN A CA   4  
ATOM 11007 C C    . GLN A 1 74  ? 14.764  3.623   -7.363  1.00 0.36  ? 74  GLN A C    4  
ATOM 11008 O O    . GLN A 1 74  ? 14.188  3.678   -8.446  1.00 0.39  ? 74  GLN A O    4  
ATOM 11009 C CB   . GLN A 1 74  ? 16.625  5.169   -6.809  1.00 0.38  ? 74  GLN A CB   4  
ATOM 11010 C CG   . GLN A 1 74  ? 18.105  5.505   -6.830  1.00 0.42  ? 74  GLN A CG   4  
ATOM 11011 C CD   . GLN A 1 74  ? 18.423  6.801   -6.110  1.00 0.50  ? 74  GLN A CD   4  
ATOM 11012 O OE1  . GLN A 1 74  ? 17.620  7.729   -6.088  1.00 1.03  ? 74  GLN A OE1  4  
ATOM 11013 N NE2  . GLN A 1 74  ? 19.597  6.864   -5.502  1.00 1.25  ? 74  GLN A NE2  4  
ATOM 11014 H H    . GLN A 1 74  ? 16.309  3.798   -9.389  1.00 0.39  ? 74  GLN A H    4  
ATOM 11015 H HA   . GLN A 1 74  ? 16.670  3.028   -6.603  1.00 0.40  ? 74  GLN A HA   4  
ATOM 11016 H HB2  . GLN A 1 74  ? 16.113  5.878   -7.436  1.00 0.39  ? 74  GLN A HB2  4  
ATOM 11017 H HB3  . GLN A 1 74  ? 16.269  5.284   -5.795  1.00 0.38  ? 74  GLN A HB3  4  
ATOM 11018 H HG2  . GLN A 1 74  ? 18.648  4.708   -6.358  1.00 0.42  ? 74  GLN A HG2  4  
ATOM 11019 H HG3  . GLN A 1 74  ? 18.420  5.597   -7.857  1.00 0.44  ? 74  GLN A HG3  4  
ATOM 11020 H HE21 . GLN A 1 74  ? 20.189  6.084   -5.553  1.00 1.91  ? 74  GLN A HE21 4  
ATOM 11021 H HE22 . GLN A 1 74  ? 19.822  7.685   -5.008  1.00 1.32  ? 74  GLN A HE22 4  
ATOM 11022 N N    . LEU A 1 75  ? 14.136  3.454   -6.220  1.00 0.33  ? 75  LEU A N    4  
ATOM 11023 C CA   . LEU A 1 75  ? 12.694  3.304   -6.166  1.00 0.32  ? 75  LEU A CA   4  
ATOM 11024 C C    . LEU A 1 75  ? 12.062  4.444   -5.425  1.00 0.32  ? 75  LEU A C    4  
ATOM 11025 O O    . LEU A 1 75  ? 12.239  4.602   -4.219  1.00 0.32  ? 75  LEU A O    4  
ATOM 11026 C CB   . LEU A 1 75  ? 12.301  1.990   -5.516  1.00 0.31  ? 75  LEU A CB   4  
ATOM 11027 C CG   . LEU A 1 75  ? 12.850  0.760   -6.221  1.00 0.33  ? 75  LEU A CG   4  
ATOM 11028 C CD1  . LEU A 1 75  ? 12.279  -0.498  -5.613  1.00 0.35  ? 75  LEU A CD1  4  
ATOM 11029 C CD2  . LEU A 1 75  ? 12.543  0.832   -7.703  1.00 0.35  ? 75  LEU A CD2  4  
ATOM 11030 H H    . LEU A 1 75  ? 14.656  3.428   -5.391  1.00 0.33  ? 75  LEU A H    4  
ATOM 11031 H HA   . LEU A 1 75  ? 12.328  3.319   -7.176  1.00 0.33  ? 75  LEU A HA   4  
ATOM 11032 H HB2  . LEU A 1 75  ? 12.660  1.996   -4.494  1.00 0.33  ? 75  LEU A HB2  4  
ATOM 11033 H HB3  . LEU A 1 75  ? 11.219  1.923   -5.507  1.00 0.32  ? 75  LEU A HB3  4  
ATOM 11034 H HG   . LEU A 1 75  ? 13.923  0.732   -6.102  1.00 0.36  ? 75  LEU A HG   4  
ATOM 11035 H HD11 . LEU A 1 75  ? 12.679  -1.361  -6.124  1.00 1.08  ? 75  LEU A HD11 4  
ATOM 11036 H HD12 . LEU A 1 75  ? 11.202  -0.490  -5.712  1.00 0.98  ? 75  LEU A HD12 4  
ATOM 11037 H HD13 . LEU A 1 75  ? 12.543  -0.545  -4.567  1.00 1.09  ? 75  LEU A HD13 4  
ATOM 11038 H HD21 . LEU A 1 75  ? 13.024  1.702   -8.128  1.00 1.10  ? 75  LEU A HD21 4  
ATOM 11039 H HD22 . LEU A 1 75  ? 11.473  0.910   -7.849  1.00 1.05  ? 75  LEU A HD22 4  
ATOM 11040 H HD23 . LEU A 1 75  ? 12.909  -0.058  -8.194  1.00 1.06  ? 75  LEU A HD23 4  
ATOM 11041 N N    . ASP A 1 76  ? 11.340  5.244   -6.163  1.00 0.35  ? 76  ASP A N    4  
ATOM 11042 C CA   . ASP A 1 76  ? 10.702  6.411   -5.613  1.00 0.36  ? 76  ASP A CA   4  
ATOM 11043 C C    . ASP A 1 76  ? 9.340   6.034   -5.063  1.00 0.33  ? 76  ASP A C    4  
ATOM 11044 O O    . ASP A 1 76  ? 8.985   4.857   -5.018  1.00 0.32  ? 76  ASP A O    4  
ATOM 11045 C CB   . ASP A 1 76  ? 10.600  7.481   -6.693  1.00 0.44  ? 76  ASP A CB   4  
ATOM 11046 C CG   . ASP A 1 76  ? 10.695  8.893   -6.140  1.00 0.91  ? 76  ASP A CG   4  
ATOM 11047 O OD1  . ASP A 1 76  ? 9.751   9.335   -5.448  1.00 1.45  ? 76  ASP A OD1  4  
ATOM 11048 O OD2  . ASP A 1 76  ? 11.707  9.574   -6.409  1.00 1.68  ? 76  ASP A OD2  4  
ATOM 11049 H H    . ASP A 1 76  ? 11.240  5.047   -7.130  1.00 0.41  ? 76  ASP A H    4  
ATOM 11050 H HA   . ASP A 1 76  ? 11.306  6.784   -4.802  1.00 0.37  ? 76  ASP A HA   4  
ATOM 11051 H HB2  . ASP A 1 76  ? 11.404  7.328   -7.414  1.00 0.74  ? 76  ASP A HB2  4  
ATOM 11052 H HB3  . ASP A 1 76  ? 9.657   7.375   -7.191  1.00 0.64  ? 76  ASP A HB3  4  
ATOM 11053 N N    . PHE A 1 77  ? 8.592   7.033   -4.657  1.00 0.41  ? 77  PHE A N    4  
ATOM 11054 C CA   . PHE A 1 77  ? 7.356   6.842   -3.914  1.00 0.49  ? 77  PHE A CA   4  
ATOM 11055 C C    . PHE A 1 77  ? 6.406   5.823   -4.553  1.00 0.39  ? 77  PHE A C    4  
ATOM 11056 O O    . PHE A 1 77  ? 6.055   4.829   -3.927  1.00 0.39  ? 77  PHE A O    4  
ATOM 11057 C CB   . PHE A 1 77  ? 6.681   8.199   -3.693  1.00 0.72  ? 77  PHE A CB   4  
ATOM 11058 C CG   . PHE A 1 77  ? 6.170   8.920   -4.924  1.00 1.76  ? 77  PHE A CG   4  
ATOM 11059 C CD1  . PHE A 1 77  ? 6.892   8.949   -6.109  1.00 2.66  ? 77  PHE A CD1  4  
ATOM 11060 C CD2  . PHE A 1 77  ? 4.961   9.596   -4.876  1.00 2.56  ? 77  PHE A CD2  4  
ATOM 11061 C CE1  . PHE A 1 77  ? 6.419   9.628   -7.213  1.00 3.77  ? 77  PHE A CE1  4  
ATOM 11062 C CE2  . PHE A 1 77  ? 4.483   10.276  -5.980  1.00 3.67  ? 77  PHE A CE2  4  
ATOM 11063 C CZ   . PHE A 1 77  ? 5.212   10.291  -7.149  1.00 4.15  ? 77  PHE A CZ   4  
ATOM 11064 H H    . PHE A 1 77  ? 8.893   7.954   -4.857  1.00 0.47  ? 77  PHE A H    4  
ATOM 11065 H HA   . PHE A 1 77  ? 7.638   6.455   -2.945  1.00 0.57  ? 77  PHE A HA   4  
ATOM 11066 H HB2  . PHE A 1 77  ? 5.843   8.066   -3.028  1.00 1.26  ? 77  PHE A HB2  4  
ATOM 11067 H HB3  . PHE A 1 77  ? 7.406   8.843   -3.220  1.00 1.00  ? 77  PHE A HB3  4  
ATOM 11068 H HD1  . PHE A 1 77  ? 7.835   8.427   -6.165  1.00 2.85  ? 77  PHE A HD1  4  
ATOM 11069 H HD2  . PHE A 1 77  ? 4.387   9.588   -3.961  1.00 2.72  ? 77  PHE A HD2  4  
ATOM 11070 H HE1  . PHE A 1 77  ? 6.994   9.641   -8.125  1.00 4.59  ? 77  PHE A HE1  4  
ATOM 11071 H HE2  . PHE A 1 77  ? 3.538   10.795  -5.927  1.00 4.42  ? 77  PHE A HE2  4  
ATOM 11072 H HZ   . PHE A 1 77  ? 4.841   10.821  -8.012  1.00 5.09  ? 77  PHE A HZ   4  
ATOM 11073 N N    . SER A 1 78  ? 6.018   6.047   -5.796  1.00 0.39  ? 78  SER A N    4  
ATOM 11074 C CA   . SER A 1 78  ? 5.083   5.164   -6.475  1.00 0.38  ? 78  SER A CA   4  
ATOM 11075 C C    . SER A 1 78  ? 5.732   3.822   -6.797  1.00 0.38  ? 78  SER A C    4  
ATOM 11076 O O    . SER A 1 78  ? 5.056   2.803   -6.880  1.00 0.44  ? 78  SER A O    4  
ATOM 11077 C CB   . SER A 1 78  ? 4.578   5.827   -7.756  1.00 0.45  ? 78  SER A CB   4  
ATOM 11078 O OG   . SER A 1 78  ? 3.528   5.080   -8.349  1.00 1.31  ? 78  SER A OG   4  
ATOM 11079 H H    . SER A 1 78  ? 6.357   6.830   -6.264  1.00 0.45  ? 78  SER A H    4  
ATOM 11080 H HA   . SER A 1 78  ? 4.246   4.996   -5.814  1.00 0.40  ? 78  SER A HA   4  
ATOM 11081 H HB2  . SER A 1 78  ? 4.206   6.814   -7.522  1.00 1.07  ? 78  SER A HB2  4  
ATOM 11082 H HB3  . SER A 1 78  ? 5.391   5.906   -8.462  1.00 0.94  ? 78  SER A HB3  4  
ATOM 11083 H HG   . SER A 1 78  ? 2.680   5.423   -8.040  1.00 1.76  ? 78  SER A HG   4  
ATOM 11084 N N    . GLU A 1 79  ? 7.046   3.821   -6.949  1.00 0.36  ? 79  GLU A N    4  
ATOM 11085 C CA   . GLU A 1 79  ? 7.765   2.612   -7.324  1.00 0.42  ? 79  GLU A CA   4  
ATOM 11086 C C    . GLU A 1 79  ? 7.850   1.672   -6.127  1.00 0.33  ? 79  GLU A C    4  
ATOM 11087 O O    . GLU A 1 79  ? 7.639   0.464   -6.241  1.00 0.33  ? 79  GLU A O    4  
ATOM 11088 C CB   . GLU A 1 79  ? 9.152   2.988   -7.841  1.00 0.51  ? 79  GLU A CB   4  
ATOM 11089 C CG   . GLU A 1 79  ? 9.087   3.993   -8.980  1.00 0.64  ? 79  GLU A CG   4  
ATOM 11090 C CD   . GLU A 1 79  ? 10.447  4.453   -9.458  1.00 1.81  ? 79  GLU A CD   4  
ATOM 11091 O OE1  . GLU A 1 79  ? 11.016  5.364   -8.832  1.00 2.54  ? 79  GLU A OE1  4  
ATOM 11092 O OE2  . GLU A 1 79  ? 10.932  3.929   -10.475 1.00 2.57  ? 79  GLU A OE2  4  
ATOM 11093 H H    . GLU A 1 79  ? 7.552   4.645   -6.783  1.00 0.35  ? 79  GLU A H    4  
ATOM 11094 H HA   . GLU A 1 79  ? 7.211   2.125   -8.113  1.00 0.51  ? 79  GLU A HA   4  
ATOM 11095 H HB2  . GLU A 1 79  ? 9.725   3.419   -7.034  1.00 0.48  ? 79  GLU A HB2  4  
ATOM 11096 H HB3  . GLU A 1 79  ? 9.649   2.099   -8.197  1.00 0.60  ? 79  GLU A HB3  4  
ATOM 11097 H HG2  . GLU A 1 79  ? 8.570   3.538   -9.812  1.00 0.89  ? 79  GLU A HG2  4  
ATOM 11098 H HG3  . GLU A 1 79  ? 8.530   4.857   -8.646  1.00 1.04  ? 79  GLU A HG3  4  
ATOM 11099 N N    . PHE A 1 80  ? 8.122   2.260   -4.974  1.00 0.28  ? 80  PHE A N    4  
ATOM 11100 C CA   . PHE A 1 80  ? 8.103   1.553   -3.702  1.00 0.25  ? 80  PHE A CA   4  
ATOM 11101 C C    . PHE A 1 80  ? 6.705   1.018   -3.422  1.00 0.23  ? 80  PHE A C    4  
ATOM 11102 O O    . PHE A 1 80  ? 6.535   -0.085  -2.910  1.00 0.26  ? 80  PHE A O    4  
ATOM 11103 C CB   . PHE A 1 80  ? 8.533   2.524   -2.602  1.00 0.31  ? 80  PHE A CB   4  
ATOM 11104 C CG   . PHE A 1 80  ? 8.435   1.990   -1.203  1.00 0.71  ? 80  PHE A CG   4  
ATOM 11105 C CD1  . PHE A 1 80  ? 9.445   1.208   -0.676  1.00 1.60  ? 80  PHE A CD1  4  
ATOM 11106 C CD2  . PHE A 1 80  ? 7.338   2.290   -0.408  1.00 1.26  ? 80  PHE A CD2  4  
ATOM 11107 C CE1  . PHE A 1 80  ? 9.363   0.732   0.617   1.00 1.98  ? 80  PHE A CE1  4  
ATOM 11108 C CE2  . PHE A 1 80  ? 7.254   1.816   0.885   1.00 1.56  ? 80  PHE A CE2  4  
ATOM 11109 C CZ   . PHE A 1 80  ? 8.268   1.036   1.398   1.00 1.64  ? 80  PHE A CZ   4  
ATOM 11110 H H    . PHE A 1 80  ? 8.351   3.217   -4.976  1.00 0.28  ? 80  PHE A H    4  
ATOM 11111 H HA   . PHE A 1 80  ? 8.798   0.728   -3.752  1.00 0.29  ? 80  PHE A HA   4  
ATOM 11112 H HB2  . PHE A 1 80  ? 9.560   2.808   -2.770  1.00 0.38  ? 80  PHE A HB2  4  
ATOM 11113 H HB3  . PHE A 1 80  ? 7.912   3.406   -2.660  1.00 0.47  ? 80  PHE A HB3  4  
ATOM 11114 H HD1  . PHE A 1 80  ? 10.303  0.968   -1.285  1.00 2.25  ? 80  PHE A HD1  4  
ATOM 11115 H HD2  . PHE A 1 80  ? 6.542   2.900   -0.811  1.00 1.92  ? 80  PHE A HD2  4  
ATOM 11116 H HE1  . PHE A 1 80  ? 10.158  0.120   1.017   1.00 2.80  ? 80  PHE A HE1  4  
ATOM 11117 H HE2  . PHE A 1 80  ? 6.397   2.057   1.495   1.00 2.20  ? 80  PHE A HE2  4  
ATOM 11118 H HZ   . PHE A 1 80  ? 8.206   0.664   2.410   1.00 2.01  ? 80  PHE A HZ   4  
ATOM 11119 N N    . LEU A 1 81  ? 5.707   1.804   -3.777  1.00 0.25  ? 81  LEU A N    4  
ATOM 11120 C CA   . LEU A 1 81  ? 4.323   1.427   -3.545  1.00 0.26  ? 81  LEU A CA   4  
ATOM 11121 C C    . LEU A 1 81  ? 3.852   0.386   -4.538  1.00 0.26  ? 81  LEU A C    4  
ATOM 11122 O O    . LEU A 1 81  ? 2.986   -0.430  -4.225  1.00 0.27  ? 81  LEU A O    4  
ATOM 11123 C CB   . LEU A 1 81  ? 3.433   2.645   -3.622  1.00 0.29  ? 81  LEU A CB   4  
ATOM 11124 C CG   . LEU A 1 81  ? 3.711   3.699   -2.556  1.00 0.28  ? 81  LEU A CG   4  
ATOM 11125 C CD1  . LEU A 1 81  ? 2.820   4.900   -2.775  1.00 0.34  ? 81  LEU A CD1  4  
ATOM 11126 C CD2  . LEU A 1 81  ? 3.534   3.113   -1.153  1.00 0.29  ? 81  LEU A CD2  4  
ATOM 11127 H H    . LEU A 1 81  ? 5.906   2.672   -4.193  1.00 0.27  ? 81  LEU A H    4  
ATOM 11128 H HA   . LEU A 1 81  ? 4.258   1.011   -2.555  1.00 0.26  ? 81  LEU A HA   4  
ATOM 11129 H HB2  . LEU A 1 81  ? 3.566   3.101   -4.598  1.00 0.31  ? 81  LEU A HB2  4  
ATOM 11130 H HB3  . LEU A 1 81  ? 2.410   2.315   -3.528  1.00 0.32  ? 81  LEU A HB3  4  
ATOM 11131 H HG   . LEU A 1 81  ? 4.734   4.034   -2.654  1.00 0.28  ? 81  LEU A HG   4  
ATOM 11132 H HD11 . LEU A 1 81  ? 1.787   4.588   -2.756  1.00 1.05  ? 81  LEU A HD11 4  
ATOM 11133 H HD12 . LEU A 1 81  ? 3.043   5.342   -3.736  1.00 1.03  ? 81  LEU A HD12 4  
ATOM 11134 H HD13 . LEU A 1 81  ? 2.995   5.625   -1.995  1.00 1.12  ? 81  LEU A HD13 4  
ATOM 11135 H HD21 . LEU A 1 81  ? 4.216   2.280   -1.016  1.00 0.94  ? 81  LEU A HD21 4  
ATOM 11136 H HD22 . LEU A 1 81  ? 2.519   2.764   -1.030  1.00 0.98  ? 81  LEU A HD22 4  
ATOM 11137 H HD23 . LEU A 1 81  ? 3.744   3.870   -0.411  1.00 0.98  ? 81  LEU A HD23 4  
ATOM 11138 N N    . ASN A 1 82  ? 4.415   0.417   -5.734  1.00 0.26  ? 82  ASN A N    4  
ATOM 11139 C CA   . ASN A 1 82  ? 4.122   -0.602  -6.725  1.00 0.26  ? 82  ASN A CA   4  
ATOM 11140 C C    . ASN A 1 82  ? 4.545   -1.950  -6.175  1.00 0.23  ? 82  ASN A C    4  
ATOM 11141 O O    . ASN A 1 82  ? 3.909   -2.979  -6.411  1.00 0.25  ? 82  ASN A O    4  
ATOM 11142 C CB   . ASN A 1 82  ? 4.852   -0.319  -8.039  1.00 0.30  ? 82  ASN A CB   4  
ATOM 11143 C CG   . ASN A 1 82  ? 3.958   0.336   -9.078  1.00 0.79  ? 82  ASN A CG   4  
ATOM 11144 O OD1  . ASN A 1 82  ? 3.328   -0.347  -9.885  1.00 1.51  ? 82  ASN A OD1  4  
ATOM 11145 N ND2  . ASN A 1 82  ? 3.888   1.657   -9.065  1.00 1.42  ? 82  ASN A ND2  4  
ATOM 11146 H H    . ASN A 1 82  ? 5.039   1.142   -5.956  1.00 0.28  ? 82  ASN A H    4  
ATOM 11147 H HA   . ASN A 1 82  ? 3.053   -0.600  -6.888  1.00 0.30  ? 82  ASN A HA   4  
ATOM 11148 H HB2  . ASN A 1 82  ? 5.696   0.335   -7.844  1.00 0.58  ? 82  ASN A HB2  4  
ATOM 11149 H HB3  . ASN A 1 82  ? 5.219   -1.251  -8.443  1.00 0.65  ? 82  ASN A HB3  4  
ATOM 11150 H HD21 . ASN A 1 82  ? 4.414   2.144   -8.389  1.00 1.89  ? 82  ASN A HD21 4  
ATOM 11151 H HD22 . ASN A 1 82  ? 3.313   2.098   -9.728  1.00 1.76  ? 82  ASN A HD22 4  
ATOM 11152 N N    . LEU A 1 83  ? 5.631   -1.913  -5.425  1.00 0.23  ? 83  LEU A N    4  
ATOM 11153 C CA   . LEU A 1 83  ? 6.108   -3.064  -4.695  1.00 0.24  ? 83  LEU A CA   4  
ATOM 11154 C C    . LEU A 1 83  ? 5.105   -3.493  -3.642  1.00 0.23  ? 83  LEU A C    4  
ATOM 11155 O O    . LEU A 1 83  ? 4.743   -4.661  -3.565  1.00 0.25  ? 83  LEU A O    4  
ATOM 11156 C CB   . LEU A 1 83  ? 7.419   -2.728  -4.021  1.00 0.27  ? 83  LEU A CB   4  
ATOM 11157 C CG   . LEU A 1 83  ? 7.797   -3.664  -2.889  1.00 0.31  ? 83  LEU A CG   4  
ATOM 11158 C CD1  . LEU A 1 83  ? 8.207   -5.025  -3.435  1.00 0.35  ? 83  LEU A CD1  4  
ATOM 11159 C CD2  . LEU A 1 83  ? 8.893   -3.051  -2.047  1.00 0.36  ? 83  LEU A CD2  4  
ATOM 11160 H H    . LEU A 1 83  ? 6.137   -1.073  -5.367  1.00 0.24  ? 83  LEU A H    4  
ATOM 11161 H HA   . LEU A 1 83  ? 6.263   -3.871  -5.391  1.00 0.25  ? 83  LEU A HA   4  
ATOM 11162 H HB2  . LEU A 1 83  ? 8.193   -2.756  -4.768  1.00 0.30  ? 83  LEU A HB2  4  
ATOM 11163 H HB3  . LEU A 1 83  ? 7.353   -1.725  -3.626  1.00 0.29  ? 83  LEU A HB3  4  
ATOM 11164 H HG   . LEU A 1 83  ? 6.929   -3.803  -2.258  1.00 0.30  ? 83  LEU A HG   4  
ATOM 11165 H HD11 . LEU A 1 83  ? 9.057   -4.908  -4.091  1.00 1.01  ? 83  LEU A HD11 4  
ATOM 11166 H HD12 . LEU A 1 83  ? 7.381   -5.452  -3.988  1.00 1.02  ? 83  LEU A HD12 4  
ATOM 11167 H HD13 . LEU A 1 83  ? 8.469   -5.679  -2.616  1.00 1.12  ? 83  LEU A HD13 4  
ATOM 11168 H HD21 . LEU A 1 83  ? 9.042   -3.653  -1.162  1.00 1.09  ? 83  LEU A HD21 4  
ATOM 11169 H HD22 . LEU A 1 83  ? 8.606   -2.048  -1.760  1.00 1.01  ? 83  LEU A HD22 4  
ATOM 11170 H HD23 . LEU A 1 83  ? 9.806   -3.015  -2.618  1.00 1.14  ? 83  LEU A HD23 4  
ATOM 11171 N N    . ILE A 1 84  ? 4.676   -2.538  -2.821  1.00 0.24  ? 84  ILE A N    4  
ATOM 11172 C CA   . ILE A 1 84  ? 3.680   -2.802  -1.794  1.00 0.26  ? 84  ILE A CA   4  
ATOM 11173 C C    . ILE A 1 84  ? 2.436   -3.429  -2.414  1.00 0.27  ? 84  ILE A C    4  
ATOM 11174 O O    . ILE A 1 84  ? 1.791   -4.278  -1.806  1.00 0.29  ? 84  ILE A O    4  
ATOM 11175 C CB   . ILE A 1 84  ? 3.329   -1.510  -1.009  1.00 0.29  ? 84  ILE A CB   4  
ATOM 11176 C CG1  . ILE A 1 84  ? 4.244   -1.366  0.213   1.00 0.55  ? 84  ILE A CG1  4  
ATOM 11177 C CG2  . ILE A 1 84  ? 1.868   -1.493  -0.570  1.00 0.47  ? 84  ILE A CG2  4  
ATOM 11178 C CD1  . ILE A 1 84  ? 5.717   -1.283  -0.117  1.00 0.62  ? 84  ILE A CD1  4  
ATOM 11179 H H    . ILE A 1 84  ? 5.045   -1.630  -2.907  1.00 0.25  ? 84  ILE A H    4  
ATOM 11180 H HA   . ILE A 1 84  ? 4.109   -3.510  -1.100  1.00 0.28  ? 84  ILE A HA   4  
ATOM 11181 H HB   . ILE A 1 84  ? 3.496   -0.667  -1.668  1.00 0.29  ? 84  ILE A HB   4  
ATOM 11182 H HG12 . ILE A 1 84  ? 3.976   -0.467  0.744   1.00 1.22  ? 84  ILE A HG12 4  
ATOM 11183 H HG13 . ILE A 1 84  ? 4.096   -2.216  0.862   1.00 1.29  ? 84  ILE A HG13 4  
ATOM 11184 H HG21 . ILE A 1 84  ? 1.667   -0.587  -0.019  1.00 1.12  ? 84  ILE A HG21 4  
ATOM 11185 H HG22 . ILE A 1 84  ? 1.671   -2.350  0.060   1.00 1.09  ? 84  ILE A HG22 4  
ATOM 11186 H HG23 . ILE A 1 84  ? 1.230   -1.535  -1.442  1.00 1.17  ? 84  ILE A HG23 4  
ATOM 11187 H HD11 . ILE A 1 84  ? 5.899   -0.420  -0.741  1.00 1.22  ? 84  ILE A HD11 4  
ATOM 11188 H HD12 . ILE A 1 84  ? 6.020   -2.176  -0.643  1.00 1.15  ? 84  ILE A HD12 4  
ATOM 11189 H HD13 . ILE A 1 84  ? 6.286   -1.193  0.797   1.00 1.31  ? 84  ILE A HD13 4  
ATOM 11190 N N    . GLY A 1 85  ? 2.137   -3.033  -3.644  1.00 0.26  ? 85  GLY A N    4  
ATOM 11191 C CA   . GLY A 1 85  ? 1.069   -3.655  -4.386  1.00 0.29  ? 85  GLY A CA   4  
ATOM 11192 C C    . GLY A 1 85  ? 1.314   -5.136  -4.593  1.00 0.29  ? 85  GLY A C    4  
ATOM 11193 O O    . GLY A 1 85  ? 0.443   -5.951  -4.312  1.00 0.33  ? 85  GLY A O    4  
ATOM 11194 H H    . GLY A 1 85  ? 2.648   -2.303  -4.048  1.00 0.25  ? 85  GLY A H    4  
ATOM 11195 H HA2  . GLY A 1 85  ? 0.143   -3.523  -3.846  1.00 0.33  ? 85  GLY A HA2  4  
ATOM 11196 H HA3  . GLY A 1 85  ? 0.985   -3.176  -5.350  1.00 0.31  ? 85  GLY A HA3  4  
ATOM 11197 N N    . GLY A 1 86  ? 2.519   -5.494  -5.038  1.00 0.28  ? 86  GLY A N    4  
ATOM 11198 C CA   . GLY A 1 86  ? 2.818   -6.890  -5.314  1.00 0.31  ? 86  GLY A CA   4  
ATOM 11199 C C    . GLY A 1 86  ? 2.922   -7.693  -4.037  1.00 0.29  ? 86  GLY A C    4  
ATOM 11200 O O    . GLY A 1 86  ? 2.478   -8.841  -3.964  1.00 0.35  ? 86  GLY A O    4  
ATOM 11201 H H    . GLY A 1 86  ? 3.226   -4.811  -5.141  1.00 0.28  ? 86  GLY A H    4  
ATOM 11202 H HA2  . GLY A 1 86  ? 2.032   -7.305  -5.928  1.00 0.34  ? 86  GLY A HA2  4  
ATOM 11203 H HA3  . GLY A 1 86  ? 3.755   -6.953  -5.846  1.00 0.33  ? 86  GLY A HA3  4  
ATOM 11204 N N    . LEU A 1 87  ? 3.500   -7.063  -3.032  1.00 0.25  ? 87  LEU A N    4  
ATOM 11205 C CA   . LEU A 1 87  ? 3.625   -7.640  -1.706  1.00 0.25  ? 87  LEU A CA   4  
ATOM 11206 C C    . LEU A 1 87  ? 2.255   -7.949  -1.130  1.00 0.26  ? 87  LEU A C    4  
ATOM 11207 O O    . LEU A 1 87  ? 1.950   -9.092  -0.785  1.00 0.29  ? 87  LEU A O    4  
ATOM 11208 C CB   . LEU A 1 87  ? 4.328   -6.652  -0.788  1.00 0.25  ? 87  LEU A CB   4  
ATOM 11209 C CG   . LEU A 1 87  ? 5.832   -6.495  -0.982  1.00 0.26  ? 87  LEU A CG   4  
ATOM 11210 C CD1  . LEU A 1 87  ? 6.318   -5.278  -0.217  1.00 0.26  ? 87  LEU A CD1  4  
ATOM 11211 C CD2  . LEU A 1 87  ? 6.565   -7.740  -0.506  1.00 0.35  ? 87  LEU A CD2  4  
ATOM 11212 H H    . LEU A 1 87  ? 3.854   -6.160  -3.189  1.00 0.26  ? 87  LEU A H    4  
ATOM 11213 H HA   . LEU A 1 87  ? 4.205   -8.547  -1.775  1.00 0.28  ? 87  LEU A HA   4  
ATOM 11214 H HB2  . LEU A 1 87  ? 3.872   -5.682  -0.944  1.00 0.25  ? 87  LEU A HB2  4  
ATOM 11215 H HB3  . LEU A 1 87  ? 4.150   -6.955  0.232   1.00 0.28  ? 87  LEU A HB3  4  
ATOM 11216 H HG   . LEU A 1 87  ? 6.048   -6.349  -2.029  1.00 0.25  ? 87  LEU A HG   4  
ATOM 11217 H HD11 . LEU A 1 87  ? 5.766   -4.408  -0.535  1.00 1.02  ? 87  LEU A HD11 4  
ATOM 11218 H HD12 . LEU A 1 87  ? 7.368   -5.127  -0.412  1.00 1.05  ? 87  LEU A HD12 4  
ATOM 11219 H HD13 . LEU A 1 87  ? 6.168   -5.432  0.842   1.00 1.06  ? 87  LEU A HD13 4  
ATOM 11220 H HD21 . LEU A 1 87  ? 7.626   -7.615  -0.665  1.00 0.97  ? 87  LEU A HD21 4  
ATOM 11221 H HD22 . LEU A 1 87  ? 6.217   -8.599  -1.060  1.00 1.10  ? 87  LEU A HD22 4  
ATOM 11222 H HD23 . LEU A 1 87  ? 6.377   -7.890  0.548   1.00 1.13  ? 87  LEU A HD23 4  
ATOM 11223 N N    . ALA A 1 88  ? 1.432   -6.912  -1.043  1.00 0.25  ? 88  ALA A N    4  
ATOM 11224 C CA   . ALA A 1 88  ? 0.108   -7.025  -0.462  1.00 0.27  ? 88  ALA A CA   4  
ATOM 11225 C C    . ALA A 1 88  ? -0.722  -8.033  -1.197  1.00 0.30  ? 88  ALA A C    4  
ATOM 11226 O O    . ALA A 1 88  ? -1.525  -8.735  -0.603  1.00 0.35  ? 88  ALA A O    4  
ATOM 11227 C CB   . ALA A 1 88  ? -0.615  -5.704  -0.497  1.00 0.27  ? 88  ALA A CB   4  
ATOM 11228 H H    . ALA A 1 88  ? 1.729   -6.035  -1.382  1.00 0.26  ? 88  ALA A H    4  
ATOM 11229 H HA   . ALA A 1 88  ? 0.218   -7.332  0.564   1.00 0.29  ? 88  ALA A HA   4  
ATOM 11230 H HB1  . ALA A 1 88  ? -1.472  -5.747  0.159   1.00 1.06  ? 88  ALA A HB1  4  
ATOM 11231 H HB2  . ALA A 1 88  ? -0.953  -5.526  -1.512  1.00 1.04  ? 88  ALA A HB2  4  
ATOM 11232 H HB3  . ALA A 1 88  ? 0.048   -4.911  -0.188  1.00 1.06  ? 88  ALA A HB3  4  
ATOM 11233 N N    . MET A 1 89  ? -0.544  -8.076  -2.497  1.00 0.29  ? 89  MET A N    4  
ATOM 11234 C CA   . MET A 1 89  ? -1.278  -8.999  -3.321  1.00 0.33  ? 89  MET A CA   4  
ATOM 11235 C C    . MET A 1 89  ? -0.916  -10.430 -2.983  1.00 0.34  ? 89  MET A C    4  
ATOM 11236 O O    . MET A 1 89  ? -1.789  -11.291 -2.886  1.00 0.39  ? 89  MET A O    4  
ATOM 11237 C CB   . MET A 1 89  ? -1.023  -8.704  -4.790  1.00 0.35  ? 89  MET A CB   4  
ATOM 11238 C CG   . MET A 1 89  ? -1.818  -7.515  -5.272  1.00 0.42  ? 89  MET A CG   4  
ATOM 11239 S SD   . MET A 1 89  ? -1.854  -7.378  -7.072  1.00 1.03  ? 89  MET A SD   4  
ATOM 11240 C CE   . MET A 1 89  ? -0.107  -7.255  -7.452  1.00 1.89  ? 89  MET A CE   4  
ATOM 11241 H H    . MET A 1 89  ? 0.097   -7.457  -2.917  1.00 0.28  ? 89  MET A H    4  
ATOM 11242 H HA   . MET A 1 89  ? -2.324  -8.847  -3.111  1.00 0.37  ? 89  MET A HA   4  
ATOM 11243 H HB2  . MET A 1 89  ? 0.030   -8.490  -4.926  1.00 0.32  ? 89  MET A HB2  4  
ATOM 11244 H HB3  . MET A 1 89  ? -1.295  -9.565  -5.380  1.00 0.39  ? 89  MET A HB3  4  
ATOM 11245 H HG2  . MET A 1 89  ? -2.826  -7.622  -4.902  1.00 0.56  ? 89  MET A HG2  4  
ATOM 11246 H HG3  . MET A 1 89  ? -1.380  -6.613  -4.862  1.00 0.43  ? 89  MET A HG3  4  
ATOM 11247 H HE1  . MET A 1 89  ? 0.022   -7.147  -8.519  1.00 2.52  ? 89  MET A HE1  4  
ATOM 11248 H HE2  . MET A 1 89  ? 0.396   -8.148  -7.117  1.00 2.34  ? 89  MET A HE2  4  
ATOM 11249 H HE3  . MET A 1 89  ? 0.311   -6.396  -6.950  1.00 2.22  ? 89  MET A HE3  4  
ATOM 11250 N N    . ALA A 1 90  ? 0.370   -10.658 -2.756  1.00 0.34  ? 90  ALA A N    4  
ATOM 11251 C CA   . ALA A 1 90  ? 0.870   -11.981 -2.420  1.00 0.40  ? 90  ALA A CA   4  
ATOM 11252 C C    . ALA A 1 90  ? 0.346   -12.421 -1.060  1.00 0.42  ? 90  ALA A C    4  
ATOM 11253 O O    . ALA A 1 90  ? 0.150   -13.604 -0.803  1.00 0.49  ? 90  ALA A O    4  
ATOM 11254 C CB   . ALA A 1 90  ? 2.390   -11.987 -2.436  1.00 0.46  ? 90  ALA A CB   4  
ATOM 11255 H H    . ALA A 1 90  ? 1.003   -9.907  -2.810  1.00 0.32  ? 90  ALA A H    4  
ATOM 11256 H HA   . ALA A 1 90  ? 0.520   -12.673 -3.173  1.00 0.42  ? 90  ALA A HA   4  
ATOM 11257 H HB1  . ALA A 1 90  ? 2.758   -11.314 -1.676  1.00 1.20  ? 90  ALA A HB1  4  
ATOM 11258 H HB2  . ALA A 1 90  ? 2.738   -11.661 -3.405  1.00 1.13  ? 90  ALA A HB2  4  
ATOM 11259 H HB3  . ALA A 1 90  ? 2.748   -12.985 -2.240  1.00 1.03  ? 90  ALA A HB3  4  
ATOM 11260 N N    . CYS A 1 91  ? 0.105   -11.449 -0.200  1.00 0.41  ? 91  CYS A N    4  
ATOM 11261 C CA   . CYS A 1 91  ? -0.410  -11.713 1.129   1.00 0.47  ? 91  CYS A CA   4  
ATOM 11262 C C    . CYS A 1 91  ? -1.922  -11.884 1.075   1.00 0.45  ? 91  CYS A C    4  
ATOM 11263 O O    . CYS A 1 91  ? -2.480  -12.777 1.704   1.00 0.51  ? 91  CYS A O    4  
ATOM 11264 C CB   . CYS A 1 91  ? -0.030  -10.568 2.070   1.00 0.55  ? 91  CYS A CB   4  
ATOM 11265 S SG   . CYS A 1 91  ? 1.744   -10.223 2.117   1.00 1.76  ? 91  CYS A SG   4  
ATOM 11266 H H    . CYS A 1 91  ? 0.272   -10.528 -0.471  1.00 0.40  ? 91  CYS A H    4  
ATOM 11267 H HA   . CYS A 1 91  ? 0.031   -12.633 1.483   1.00 0.53  ? 91  CYS A HA   4  
ATOM 11268 H HB2  . CYS A 1 91  ? -0.528  -9.664  1.747   1.00 1.09  ? 91  CYS A HB2  4  
ATOM 11269 H HB3  . CYS A 1 91  ? -0.346  -10.810 3.074   1.00 0.94  ? 91  CYS A HB3  4  
ATOM 11270 H HG   . CYS A 1 91  ? 2.102   -9.770  0.920   1.00 2.29  ? 91  CYS A HG   4  
ATOM 11271 N N    . HIS A 1 92  ? -2.569  -11.028 0.298   1.00 0.41  ? 92  HIS A N    4  
ATOM 11272 C CA   . HIS A 1 92  ? -4.004  -11.096 0.092   1.00 0.46  ? 92  HIS A CA   4  
ATOM 11273 C C    . HIS A 1 92  ? -4.395  -12.465 -0.423  1.00 0.45  ? 92  HIS A C    4  
ATOM 11274 O O    . HIS A 1 92  ? -5.318  -13.085 0.101   1.00 0.49  ? 92  HIS A O    4  
ATOM 11275 C CB   . HIS A 1 92  ? -4.466  -10.023 -0.902  1.00 0.54  ? 92  HIS A CB   4  
ATOM 11276 C CG   . HIS A 1 92  ? -5.927  -10.106 -1.235  1.00 1.21  ? 92  HIS A CG   4  
ATOM 11277 N ND1  . HIS A 1 92  ? -6.421  -10.839 -2.297  1.00 2.13  ? 92  HIS A ND1  4  
ATOM 11278 C CD2  . HIS A 1 92  ? -7.007  -9.553  -0.634  1.00 1.96  ? 92  HIS A CD2  4  
ATOM 11279 C CE1  . HIS A 1 92  ? -7.735  -10.734 -2.331  1.00 2.74  ? 92  HIS A CE1  4  
ATOM 11280 N NE2  . HIS A 1 92  ? -8.115  -9.961  -1.333  1.00 2.62  ? 92  HIS A NE2  4  
ATOM 11281 H H    . HIS A 1 92  ? -2.059  -10.319 -0.151  1.00 0.40  ? 92  HIS A H    4  
ATOM 11282 H HA   . HIS A 1 92  ? -4.486  -10.927 1.043   1.00 0.53  ? 92  HIS A HA   4  
ATOM 11283 H HB2  . HIS A 1 92  ? -4.276  -9.047  -0.481  1.00 1.06  ? 92  HIS A HB2  4  
ATOM 11284 H HB3  . HIS A 1 92  ? -3.908  -10.128 -1.820  1.00 0.91  ? 92  HIS A HB3  4  
ATOM 11285 H HD1  . HIS A 1 92  ? -5.886  -11.371 -2.934  1.00 2.63  ? 92  HIS A HD1  4  
ATOM 11286 H HD2  . HIS A 1 92  ? -6.996  -8.909  0.234   1.00 2.49  ? 92  HIS A HD2  4  
ATOM 11287 H HE1  . HIS A 1 92  ? -8.388  -11.201 -3.051  1.00 3.56  ? 92  HIS A HE1  4  
ATOM 11288 H HE2  . HIS A 1 92  ? -9.042  -9.706  -1.138  1.00 3.27  ? 92  HIS A HE2  4  
ATOM 11289 N N    . ASP A 1 93  ? -3.696  -12.933 -1.448  1.00 0.45  ? 93  ASP A N    4  
ATOM 11290 C CA   . ASP A 1 93  ? -4.007  -14.219 -2.023  1.00 0.52  ? 93  ASP A CA   4  
ATOM 11291 C C    . ASP A 1 93  ? -3.747  -15.320 -1.019  1.00 0.56  ? 93  ASP A C    4  
ATOM 11292 O O    . ASP A 1 93  ? -4.543  -16.238 -0.878  1.00 0.65  ? 93  ASP A O    4  
ATOM 11293 C CB   . ASP A 1 93  ? -3.241  -14.460 -3.325  1.00 0.54  ? 93  ASP A CB   4  
ATOM 11294 C CG   . ASP A 1 93  ? -1.742  -14.681 -3.201  1.00 0.93  ? 93  ASP A CG   4  
ATOM 11295 O OD1  . ASP A 1 93  ? -1.326  -15.745 -2.690  1.00 1.48  ? 93  ASP A OD1  4  
ATOM 11296 O OD2  . ASP A 1 93  ? -0.977  -13.828 -3.691  1.00 1.75  ? 93  ASP A OD2  4  
ATOM 11297 H H    . ASP A 1 93  ? -2.957  -12.404 -1.825  1.00 0.44  ? 93  ASP A H    4  
ATOM 11298 H HA   . ASP A 1 93  ? -5.066  -14.215 -2.244  1.00 0.56  ? 93  ASP A HA   4  
ATOM 11299 H HB2  . ASP A 1 93  ? -3.639  -15.332 -3.765  1.00 0.94  ? 93  ASP A HB2  4  
ATOM 11300 H HB3  . ASP A 1 93  ? -3.406  -13.610 -3.984  1.00 0.78  ? 93  ASP A HB3  4  
ATOM 11301 N N    . SER A 1 94  ? -2.637  -15.201 -0.317  1.00 0.54  ? 94  SER A N    4  
ATOM 11302 C CA   . SER A 1 94  ? -2.324  -16.088 0.805   1.00 0.60  ? 94  SER A CA   4  
ATOM 11303 C C    . SER A 1 94  ? -3.519  -16.228 1.737   1.00 0.63  ? 94  SER A C    4  
ATOM 11304 O O    . SER A 1 94  ? -3.946  -17.334 2.037   1.00 0.70  ? 94  SER A O    4  
ATOM 11305 C CB   . SER A 1 94  ? -1.140  -15.555 1.606   1.00 0.65  ? 94  SER A CB   4  
ATOM 11306 O OG   . SER A 1 94  ? 0.052   -15.575 0.839   1.00 1.27  ? 94  SER A OG   4  
ATOM 11307 H H    . SER A 1 94  ? -1.991  -14.524 -0.596  1.00 0.52  ? 94  SER A H    4  
ATOM 11308 H HA   . SER A 1 94  ? -2.074  -17.058 0.405   1.00 0.65  ? 94  SER A HA   4  
ATOM 11309 H HB2  . SER A 1 94  ? -1.349  -14.536 1.905   1.00 0.97  ? 94  SER A HB2  4  
ATOM 11310 H HB3  . SER A 1 94  ? -1.003  -16.164 2.487   1.00 1.04  ? 94  SER A HB3  4  
ATOM 11311 H HG   . SER A 1 94  ? 0.016   -14.869 0.175   1.00 1.85  ? 94  SER A HG   4  
ATOM 11312 N N    . PHE A 1 95  ? -4.069  -15.099 2.166   1.00 0.60  ? 95  PHE A N    4  
ATOM 11313 C CA   . PHE A 1 95  ? -5.200  -15.098 3.080   1.00 0.66  ? 95  PHE A CA   4  
ATOM 11314 C C    . PHE A 1 95  ? -6.410  -15.778 2.447   1.00 0.72  ? 95  PHE A C    4  
ATOM 11315 O O    . PHE A 1 95  ? -7.148  -16.494 3.104   1.00 0.84  ? 95  PHE A O    4  
ATOM 11316 C CB   . PHE A 1 95  ? -5.555  -13.666 3.484   1.00 0.64  ? 95  PHE A CB   4  
ATOM 11317 C CG   . PHE A 1 95  ? -4.658  -13.079 4.539   1.00 0.78  ? 95  PHE A CG   4  
ATOM 11318 C CD1  . PHE A 1 95  ? -4.731  -13.517 5.850   1.00 1.80  ? 95  PHE A CD1  4  
ATOM 11319 C CD2  . PHE A 1 95  ? -3.747  -12.086 4.220   1.00 1.30  ? 95  PHE A CD2  4  
ATOM 11320 C CE1  . PHE A 1 95  ? -3.912  -12.976 6.822   1.00 2.35  ? 95  PHE A CE1  4  
ATOM 11321 C CE2  . PHE A 1 95  ? -2.927  -11.540 5.188   1.00 1.76  ? 95  PHE A CE2  4  
ATOM 11322 C CZ   . PHE A 1 95  ? -3.008  -11.986 6.490   1.00 2.08  ? 95  PHE A CZ   4  
ATOM 11323 H H    . PHE A 1 95  ? -3.711  -14.242 1.848   1.00 0.55  ? 95  PHE A H    4  
ATOM 11324 H HA   . PHE A 1 95  ? -4.914  -15.651 3.963   1.00 0.75  ? 95  PHE A HA   4  
ATOM 11325 H HB2  . PHE A 1 95  ? -5.485  -13.034 2.612   1.00 0.99  ? 95  PHE A HB2  4  
ATOM 11326 H HB3  . PHE A 1 95  ? -6.567  -13.644 3.855   1.00 0.98  ? 95  PHE A HB3  4  
ATOM 11327 H HD1  . PHE A 1 95  ? -5.436  -14.292 6.112   1.00 2.46  ? 95  PHE A HD1  4  
ATOM 11328 H HD2  . PHE A 1 95  ? -3.682  -11.737 3.201   1.00 1.96  ? 95  PHE A HD2  4  
ATOM 11329 H HE1  . PHE A 1 95  ? -3.977  -13.326 7.840   1.00 3.27  ? 95  PHE A HE1  4  
ATOM 11330 H HE2  . PHE A 1 95  ? -2.222  -10.767 4.924   1.00 2.41  ? 95  PHE A HE2  4  
ATOM 11331 H HZ   . PHE A 1 95  ? -2.368  -11.562 7.247   1.00 2.63  ? 95  PHE A HZ   4  
ATOM 11332 N N    . LEU A 1 96  ? -6.586  -15.579 1.159   1.00 0.69  ? 96  LEU A N    4  
ATOM 11333 C CA   . LEU A 1 96  ? -7.736  -16.124 0.453   1.00 0.81  ? 96  LEU A CA   4  
ATOM 11334 C C    . LEU A 1 96  ? -7.517  -17.591 0.108   1.00 0.90  ? 96  LEU A C    4  
ATOM 11335 O O    . LEU A 1 96  ? -8.458  -18.323 -0.199  1.00 1.09  ? 96  LEU A O    4  
ATOM 11336 C CB   . LEU A 1 96  ? -8.011  -15.300 -0.803  1.00 0.83  ? 96  LEU A CB   4  
ATOM 11337 C CG   . LEU A 1 96  ? -8.923  -14.084 -0.600  1.00 0.87  ? 96  LEU A CG   4  
ATOM 11338 C CD1  . LEU A 1 96  ? -10.328 -14.531 -0.236  1.00 1.21  ? 96  LEU A CD1  4  
ATOM 11339 C CD2  . LEU A 1 96  ? -8.372  -13.164 0.479   1.00 1.08  ? 96  LEU A CD2  4  
ATOM 11340 H H    . LEU A 1 96  ? -5.917  -15.063 0.660   1.00 0.62  ? 96  LEU A H    4  
ATOM 11341 H HA   . LEU A 1 96  ? -8.588  -16.052 1.113   1.00 0.86  ? 96  LEU A HA   4  
ATOM 11342 H HB2  . LEU A 1 96  ? -7.065  -14.948 -1.184  1.00 0.76  ? 96  LEU A HB2  4  
ATOM 11343 H HB3  . LEU A 1 96  ? -8.461  -15.943 -1.541  1.00 0.93  ? 96  LEU A HB3  4  
ATOM 11344 H HG   . LEU A 1 96  ? -8.978  -13.525 -1.522  1.00 0.92  ? 96  LEU A HG   4  
ATOM 11345 H HD11 . LEU A 1 96  ? -10.302 -15.071 0.699   1.00 1.70  ? 96  LEU A HD11 4  
ATOM 11346 H HD12 . LEU A 1 96  ? -10.712 -15.174 -1.013  1.00 1.64  ? 96  LEU A HD12 4  
ATOM 11347 H HD13 . LEU A 1 96  ? -10.966 -13.666 -0.133  1.00 1.64  ? 96  LEU A HD13 4  
ATOM 11348 H HD21 . LEU A 1 96  ? -7.400  -12.798 0.176   1.00 1.68  ? 96  LEU A HD21 4  
ATOM 11349 H HD22 . LEU A 1 96  ? -8.275  -13.715 1.407   1.00 1.41  ? 96  LEU A HD22 4  
ATOM 11350 H HD23 . LEU A 1 96  ? -9.043  -12.331 0.622   1.00 1.51  ? 96  LEU A HD23 4  
ATOM 11351 N N    . LYS A 1 97  ? -6.270  -18.012 0.178   1.00 0.83  ? 97  LYS A N    4  
ATOM 11352 C CA   . LYS A 1 97  ? -5.900  -19.395 -0.055  1.00 0.93  ? 97  LYS A CA   4  
ATOM 11353 C C    . LYS A 1 97  ? -5.540  -20.065 1.267   1.00 0.97  ? 97  LYS A C    4  
ATOM 11354 O O    . LYS A 1 97  ? -4.994  -21.168 1.298   1.00 1.12  ? 97  LYS A O    4  
ATOM 11355 C CB   . LYS A 1 97  ? -4.729  -19.450 -1.037  1.00 0.93  ? 97  LYS A CB   4  
ATOM 11356 C CG   . LYS A 1 97  ? -5.107  -19.005 -2.446  1.00 0.99  ? 97  LYS A CG   4  
ATOM 11357 C CD   . LYS A 1 97  ? -3.983  -18.246 -3.130  1.00 1.25  ? 97  LYS A CD   4  
ATOM 11358 C CE   . LYS A 1 97  ? -2.690  -19.037 -3.164  1.00 2.06  ? 97  LYS A CE   4  
ATOM 11359 N NZ   . LYS A 1 97  ? -1.589  -18.254 -3.784  1.00 2.65  ? 97  LYS A NZ   4  
ATOM 11360 H H    . LYS A 1 97  ? -5.561  -17.362 0.384   1.00 0.75  ? 97  LYS A H    4  
ATOM 11361 H HA   . LYS A 1 97  ? -6.748  -19.903 -0.488  1.00 1.01  ? 97  LYS A HA   4  
ATOM 11362 H HB2  . LYS A 1 97  ? -3.941  -18.808 -0.676  1.00 0.89  ? 97  LYS A HB2  4  
ATOM 11363 H HB3  . LYS A 1 97  ? -4.362  -20.464 -1.088  1.00 1.04  ? 97  LYS A HB3  4  
ATOM 11364 H HG2  . LYS A 1 97  ? -5.346  -19.877 -3.036  1.00 1.50  ? 97  LYS A HG2  4  
ATOM 11365 H HG3  . LYS A 1 97  ? -5.974  -18.363 -2.386  1.00 1.64  ? 97  LYS A HG3  4  
ATOM 11366 H HD2  . LYS A 1 97  ? -4.279  -18.023 -4.144  1.00 1.86  ? 97  LYS A HD2  4  
ATOM 11367 H HD3  . LYS A 1 97  ? -3.813  -17.321 -2.595  1.00 1.74  ? 97  LYS A HD3  4  
ATOM 11368 H HE2  . LYS A 1 97  ? -2.415  -19.295 -2.153  1.00 2.59  ? 97  LYS A HE2  4  
ATOM 11369 H HE3  . LYS A 1 97  ? -2.849  -19.939 -3.735  1.00 2.52  ? 97  LYS A HE3  4  
ATOM 11370 H HZ1  . LYS A 1 97  ? -0.700  -18.790 -3.743  1.00 3.00  ? 97  LYS A HZ1  4  
ATOM 11371 H HZ2  . LYS A 1 97  ? -1.460  -17.347 -3.277  1.00 2.88  ? 97  LYS A HZ2  4  
ATOM 11372 H HZ3  . LYS A 1 97  ? -1.814  -18.048 -4.779  1.00 3.15  ? 97  LYS A HZ3  4  
ATOM 11373 N N    . ALA A 1 98  ? -5.864  -19.384 2.360   1.00 0.99  ? 98  ALA A N    4  
ATOM 11374 C CA   . ALA A 1 98  ? -5.588  -19.888 3.697   1.00 1.06  ? 98  ALA A CA   4  
ATOM 11375 C C    . ALA A 1 98  ? -6.742  -19.563 4.645   1.00 1.09  ? 98  ALA A C    4  
ATOM 11376 O O    . ALA A 1 98  ? -7.572  -20.420 4.955   1.00 1.23  ? 98  ALA A O    4  
ATOM 11377 C CB   . ALA A 1 98  ? -4.278  -19.311 4.223   1.00 1.00  ? 98  ALA A CB   4  
ATOM 11378 H H    . ALA A 1 98  ? -6.301  -18.512 2.263   1.00 1.04  ? 98  ALA A H    4  
ATOM 11379 H HA   . ALA A 1 98  ? -5.481  -20.958 3.630   1.00 1.17  ? 98  ALA A HA   4  
ATOM 11380 H HB1  . ALA A 1 98  ? -4.349  -18.231 4.257   1.00 1.37  ? 98  ALA A HB1  4  
ATOM 11381 H HB2  . ALA A 1 98  ? -3.470  -19.593 3.563   1.00 1.46  ? 98  ALA A HB2  4  
ATOM 11382 H HB3  . ALA A 1 98  ? -4.086  -19.692 5.214   1.00 1.42  ? 98  ALA A HB3  4  
ATOM 11383 N N    . VAL A 1 99  ? -6.804  -18.309 5.070   1.00 1.00  ? 99  VAL A N    4  
ATOM 11384 C CA   . VAL A 1 99  ? -7.860  -17.831 5.951   1.00 1.06  ? 99  VAL A CA   4  
ATOM 11385 C C    . VAL A 1 99  ? -7.874  -16.307 5.956   1.00 1.00  ? 99  VAL A C    4  
ATOM 11386 O O    . VAL A 1 99  ? -6.954  -15.663 6.464   1.00 1.01  ? 99  VAL A O    4  
ATOM 11387 C CB   . VAL A 1 99  ? -7.725  -18.360 7.403   1.00 1.16  ? 99  VAL A CB   4  
ATOM 11388 C CG1  . VAL A 1 99  ? -6.337  -18.100 7.974   1.00 1.13  ? 99  VAL A CG1  4  
ATOM 11389 C CG2  . VAL A 1 99  ? -8.798  -17.739 8.292   1.00 1.24  ? 99  VAL A CG2  4  
ATOM 11390 H H    . VAL A 1 99  ? -6.131  -17.668 4.756   1.00 0.92  ? 99  VAL A H    4  
ATOM 11391 H HA   . VAL A 1 99  ? -8.801  -18.182 5.551   1.00 1.12  ? 99  VAL A HA   4  
ATOM 11392 H HB   . VAL A 1 99  ? -7.882  -19.428 7.385   1.00 1.24  ? 99  VAL A HB   4  
ATOM 11393 H HG11 . VAL A 1 99  ? -6.283  -18.487 8.981   1.00 1.64  ? 99  VAL A HG11 4  
ATOM 11394 H HG12 . VAL A 1 99  ? -6.147  -17.037 7.984   1.00 1.48  ? 99  VAL A HG12 4  
ATOM 11395 H HG13 . VAL A 1 99  ? -5.598  -18.592 7.358   1.00 1.41  ? 99  VAL A HG13 4  
ATOM 11396 H HG21 . VAL A 1 99  ? -8.732  -16.659 8.237   1.00 1.52  ? 99  VAL A HG21 4  
ATOM 11397 H HG22 . VAL A 1 99  ? -8.649  -18.057 9.313   1.00 1.65  ? 99  VAL A HG22 4  
ATOM 11398 H HG23 . VAL A 1 99  ? -9.774  -18.055 7.954   1.00 1.63  ? 99  VAL A HG23 4  
ATOM 11399 N N    . PRO A 1 100 ? -8.891  -15.706 5.336   1.00 1.00  ? 100 PRO A N    4  
ATOM 11400 C CA   . PRO A 1 100 ? -9.038  -14.257 5.312   1.00 1.02  ? 100 PRO A CA   4  
ATOM 11401 C C    . PRO A 1 100 ? -9.293  -13.699 6.699   1.00 1.28  ? 100 PRO A C    4  
ATOM 11402 O O    . PRO A 1 100 ? -10.095 -14.239 7.462   1.00 1.60  ? 100 PRO A O    4  
ATOM 11403 C CB   . PRO A 1 100 ? -10.243 -14.019 4.391   1.00 1.04  ? 100 PRO A CB   4  
ATOM 11404 C CG   . PRO A 1 100 ? -10.432 -15.302 3.656   1.00 1.03  ? 100 PRO A CG   4  
ATOM 11405 C CD   . PRO A 1 100 ? -9.967  -16.377 4.593   1.00 1.06  ? 100 PRO A CD   4  
ATOM 11406 H HA   . PRO A 1 100 ? -8.169  -13.777 4.901   1.00 0.95  ? 100 PRO A HA   4  
ATOM 11407 H HB2  . PRO A 1 100 ? -11.111 -13.768 4.985   1.00 1.23  ? 100 PRO A HB2  4  
ATOM 11408 H HB3  . PRO A 1 100 ? -10.021 -13.208 3.711   1.00 1.05  ? 100 PRO A HB3  4  
ATOM 11409 H HG2  . PRO A 1 100 ? -11.474 -15.439 3.413   1.00 1.10  ? 100 PRO A HG2  4  
ATOM 11410 H HG3  . PRO A 1 100 ? -9.830  -15.303 2.758   1.00 1.03  ? 100 PRO A HG3  4  
ATOM 11411 H HD2  . PRO A 1 100 ? -10.766 -16.679 5.253   1.00 1.19  ? 100 PRO A HD2  4  
ATOM 11412 H HD3  . PRO A 1 100 ? -9.586  -17.223 4.040   1.00 1.04  ? 100 PRO A HD3  4  
ATOM 11413 N N    . SER A 1 101 ? -8.605  -12.614 7.018   1.00 1.57  ? 101 SER A N    4  
ATOM 11414 C CA   . SER A 1 101 ? -8.818  -11.901 8.265   1.00 1.88  ? 101 SER A CA   4  
ATOM 11415 C C    . SER A 1 101 ? -10.086 -11.059 8.159   1.00 1.62  ? 101 SER A C    4  
ATOM 11416 O O    . SER A 1 101 ? -10.216 -10.002 8.781   1.00 1.94  ? 101 SER A O    4  
ATOM 11417 C CB   . SER A 1 101 ? -7.607  -11.018 8.560   1.00 2.76  ? 101 SER A CB   4  
ATOM 11418 O OG   . SER A 1 101 ? -6.406  -11.766 8.463   1.00 3.39  ? 101 SER A OG   4  
ATOM 11419 H H    . SER A 1 101 ? -7.933  -12.278 6.393   1.00 1.80  ? 101 SER A H    4  
ATOM 11420 H HA   . SER A 1 101 ? -8.936  -12.626 9.055   1.00 2.06  ? 101 SER A HA   4  
ATOM 11421 H HB2  . SER A 1 101 ? -7.571  -10.207 7.847   1.00 3.14  ? 101 SER A HB2  4  
ATOM 11422 H HB3  . SER A 1 101 ? -7.688  -10.617 9.559   1.00 3.02  ? 101 SER A HB3  4  
ATOM 11423 H HG   . SER A 1 101 ? -5.657  -11.205 8.705   1.00 3.74  ? 101 SER A HG   4  
ATOM 11424 N N    . GLN A 1 102 ? -11.011 -11.550 7.347   1.00 1.61  ? 102 GLN A N    4  
ATOM 11425 C CA   . GLN A 1 102 ? -12.283 -10.893 7.108   1.00 2.12  ? 102 GLN A CA   4  
ATOM 11426 C C    . GLN A 1 102 ? -13.181 -11.032 8.328   1.00 2.74  ? 102 GLN A C    4  
ATOM 11427 O O    . GLN A 1 102 ? -13.833 -12.058 8.522   1.00 3.39  ? 102 GLN A O    4  
ATOM 11428 C CB   . GLN A 1 102 ? -12.951 -11.508 5