data_2LUX
# 
_entry.id   2LUX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LUX         
RCSB  RCSB102864   
BMRB  18545        
WWPDB D_1000102864 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 2L0P  PDB  'human apo-S100A1'      
unspecified 2LP3  PDB  'human holo-S100A1'     
unspecified 2LLS  PDB  'human apo-S100A1-C85M' 
unspecified 2LP2  PDB  'human holo-S100A1-Hcy' 
unspecified 2LHL  PDB  'human apo-S100A1-E32Q' 
unspecified 2JPT  PDB  'bovine apo-S100A1-bMe' 
unspecified 18545 BMRB .                       
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LUX 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-06-22 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ruszczynska-Bartnik, K.' 1 
'Budzinska, M.'           2 
'Zdanowski, K.'           3 
'Ejchart, A.'             4 
# 
_citation.id                        primary 
_citation.title                     'Solution structure of human holo-S100A1 C85M mutant' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ruszczynska-Bartnik, K.' 1 
primary 'Ejchart, A.'             2 
primary 'Budzinska, M.'           3 
primary 'Zdanowski, K.'           4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein S100-A1' 10453.641 2 ? C85M ? ? 
2 non-polymer syn 'CALCIUM ION'     40.078    4 ? ?    ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'S-100 protein alpha chain, S-100 protein subunit alpha, S100 calcium-binding protein A1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA
LTVAMNNFFWENS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA
LTVAMNNFFWENS
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  SER n 
1 3  GLU n 
1 4  LEU n 
1 5  GLU n 
1 6  THR n 
1 7  ALA n 
1 8  MET n 
1 9  GLU n 
1 10 THR n 
1 11 LEU n 
1 12 ILE n 
1 13 ASN n 
1 14 VAL n 
1 15 PHE n 
1 16 HIS n 
1 17 ALA n 
1 18 HIS n 
1 19 SER n 
1 20 GLY n 
1 21 LYS n 
1 22 GLU n 
1 23 GLY n 
1 24 ASP n 
1 25 LYS n 
1 26 TYR n 
1 27 LYS n 
1 28 LEU n 
1 29 SER n 
1 30 LYS n 
1 31 LYS n 
1 32 GLU n 
1 33 LEU n 
1 34 LYS n 
1 35 GLU n 
1 36 LEU n 
1 37 LEU n 
1 38 GLN n 
1 39 THR n 
1 40 GLU n 
1 41 LEU n 
1 42 SER n 
1 43 GLY n 
1 44 PHE n 
1 45 LEU n 
1 46 ASP n 
1 47 ALA n 
1 48 GLN n 
1 49 LYS n 
1 50 ASP n 
1 51 VAL n 
1 52 ASP n 
1 53 ALA n 
1 54 VAL n 
1 55 ASP n 
1 56 LYS n 
1 57 VAL n 
1 58 MET n 
1 59 LYS n 
1 60 GLU n 
1 61 LEU n 
1 62 ASP n 
1 63 GLU n 
1 64 ASN n 
1 65 GLY n 
1 66 ASP n 
1 67 GLY n 
1 68 GLU n 
1 69 VAL n 
1 70 ASP n 
1 71 PHE n 
1 72 GLN n 
1 73 GLU n 
1 74 TYR n 
1 75 VAL n 
1 76 VAL n 
1 77 LEU n 
1 78 VAL n 
1 79 ALA n 
1 80 ALA n 
1 81 LEU n 
1 82 THR n 
1 83 VAL n 
1 84 ALA n 
1 85 MET n 
1 86 ASN n 
1 87 ASN n 
1 88 PHE n 
1 89 PHE n 
1 90 TRP n 
1 91 GLU n 
1 92 ASN n 
1 93 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'S100A1, S100A' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET30a+ 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    S10A1_HUMAN 
_struct_ref.pdbx_db_accession          P23297 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GSELETAMETLINVFHAHSGKEGDKYKLSKKELKELLQTELSGFLDAQKDVDAVDKVMKELDENGDGEVDFQEYVVLVAA
LTVACNNFFWENS
;
_struct_ref.pdbx_align_begin           2 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2LUX A 1 ? 93 ? P23297 2 ? 94 ? 1 93 
2 1 2LUX B 1 ? 93 ? P23297 2 ? 94 ? 1 93 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2LUX MET A 85 ? UNP P23297 CYS 86 'ENGINEERED MUTATION' 85 1 
2 2LUX MET B 85 ? UNP P23297 CYS 86 'ENGINEERED MUTATION' 85 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1  1 '2D 1H-15N HSQC'                            
1 2  2 '2D 1H-13C HSQC aliphatic'                  
1 3  2 '2D 1H-13C HSQC aromatic'                   
1 4  1 '3D 1H-15N NOESY'                           
1 5  2 '3D 1H-13C NOESY aliphatic'                 
1 6  2 '3D 1H-13C NOESY aromatic'                  
1 7  1 '3D CBCA(CO)NH'                             
1 8  1 '3D HNCO'                                   
1 9  1 '3D HBHA(CO)NH'                             
1 10 1 '3D HN(CO)CA'                               
1 11 3 '2D 1H-15N HSQC edited for relaxation data' 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      0.05 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         310 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.solvent_system 
;1 mM [U-98% 13C; U-98% 15N] S100A1C85M, 50 mM [U-99% 2H] TRIS, 50 mM sodium chloride, 10 mM CALCIUM ION, 10 % [U-99% 2H] D2O, 90 % H2O, 90% H2O/10% D2O
;
1 '90% H2O/10% D2O' 
;1 mM [U-98% 13C; U-98% 15N] S100A1C85M, 50 mM [U-99% 2H] TRIS, 50 mM sodium chloride, 10 mM CALCIUM ION, 100 % [U-99% 2H] D2O, 100% D2O
;
2 '100% D2O'        
;1 mM [U-99% 15N] S100A1C85M, 50 mM [U-2H] TRIS, 50 mM sodium chloride, 10 mM CALCIUM ION, 10 % [U-99% 2H] D2O, 90 % H2O, 90% H2O/10% D2O
;
3 '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
400 Varian INOVA               1 'Varian INOVA'             
500 Varian UNITYPLUS           2 'Varian UnityPlus'         
700 Varian 'Varian NMR System' 3 'Varian Varian NMR System' 
# 
_pdbx_nmr_refine.entry_id           2LUX 
_pdbx_nmr_refine.method             'DGSA-distance geometry simulated annealing' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            210 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LUX 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LUX 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Goddard                                             'peak picking'              SPARKY     ?    1 
Goddard                                             'data analysis'             SPARKY     ?    2 
'Keller and Wuthrich'                               'chemical shift assignment' CARA       1.8  3 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ?    4 
'Peter Guntert'                                     'chemical shift assignment' CYANA      3.0  5 
'Peter Guntert'                                     'data analysis'             CYANA      3.0  6 
'Peter Guntert'                                     'structure solution'        CYANA      3.0  7 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH 2.26 8 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH 2.26 9 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.entry_id                   2LUX 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LUX 
_struct.title                     'Calcium saturated form of human C85M S100A1 mutant' 
_struct.pdbx_descriptor           'Protein S100-A1' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LUX 
_struct_keywords.pdbx_keywords   'METAL BINDING PROTEIN' 
_struct_keywords.text            'METAL BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 2  ? GLU A 22 ? SER A 2  GLU A 22 1 ? 21 
HELX_P HELX_P2  2  SER A 29 ? LEU A 41 ? SER A 29 LEU A 41 1 ? 13 
HELX_P HELX_P3  3  SER A 42 ? VAL A 51 ? SER A 42 VAL A 51 5 ? 10 
HELX_P HELX_P4  4  ASP A 52 ? ASP A 62 ? ASP A 52 ASP A 62 1 ? 11 
HELX_P HELX_P5  5  ASP A 70 ? ASN A 92 ? ASP A 70 ASN A 92 1 ? 23 
HELX_P HELX_P6  6  SER B 2  ? GLU B 22 ? SER B 2  GLU B 22 1 ? 21 
HELX_P HELX_P7  7  SER B 29 ? LEU B 41 ? SER B 29 LEU B 41 1 ? 13 
HELX_P HELX_P8  8  SER B 42 ? VAL B 51 ? SER B 42 VAL B 51 5 ? 10 
HELX_P HELX_P9  9  ASP B 52 ? ASP B 62 ? ASP B 52 ASP B 62 1 ? 11 
HELX_P HELX_P10 10 ASP B 70 ? ASN B 92 ? ASP B 70 ASN B 92 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 62 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 62 A CA 202 1_555 ? ? ? ? ? ? ? 3.440 ? 
metalc2  metalc ? ? B ASP 62 OD2 ? ? ? 1_555 F CA . CA ? ? B ASP 62 B CA 102 1_555 ? ? ? ? ? ? ? 3.442 ? 
metalc3  metalc ? ? B ASP 66 OD2 ? ? ? 1_555 F CA . CA ? ? B ASP 66 B CA 102 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc4  metalc ? ? A ASP 66 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 202 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc5  metalc ? ? A GLU 73 OE1 ? ? ? 1_555 D CA . CA ? ? A GLU 73 A CA 202 1_555 ? ? ? ? ? ? ? 2.960 ? 
metalc6  metalc ? ? B GLU 73 OE1 ? ? ? 1_555 F CA . CA ? ? B GLU 73 B CA 102 1_555 ? ? ? ? ? ? ? 2.959 ? 
metalc7  metalc ? ? B GLU 32 OE2 ? ? ? 1_555 E CA . CA ? ? B GLU 32 B CA 101 1_555 ? ? ? ? ? ? ? 3.373 ? 
metalc8  metalc ? ? A GLU 32 OE2 ? ? ? 1_555 C CA . CA ? ? A GLU 32 A CA 201 1_555 ? ? ? ? ? ? ? 3.374 ? 
metalc9  metalc ? ? B GLU 22 O   ? ? ? 1_555 E CA . CA ? ? B GLU 22 B CA 101 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc10 metalc ? ? A GLU 22 O   ? ? ? 1_555 C CA . CA ? ? A GLU 22 A CA 201 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc11 metalc ? ? A ASN 64 OD1 ? ? ? 1_555 D CA . CA ? ? A ASN 64 A CA 202 1_555 ? ? ? ? ? ? ? 2.503 ? 
metalc12 metalc ? ? B ASN 64 OD1 ? ? ? 1_555 F CA . CA ? ? B ASN 64 B CA 102 1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc13 metalc ? ? A LYS 27 O   ? ? ? 1_555 C CA . CA ? ? A LYS 27 A CA 201 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc14 metalc ? ? B LYS 27 O   ? ? ? 1_555 E CA . CA ? ? B LYS 27 B CA 101 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc15 metalc ? ? A SER 19 O   ? ? ? 1_555 C CA . CA ? ? A SER 19 A CA 201 1_555 ? ? ? ? ? ? ? 2.512 ? 
metalc16 metalc ? ? B SER 19 O   ? ? ? 1_555 E CA . CA ? ? B SER 19 B CA 101 1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc17 metalc ? ? A GLU 68 O   ? ? ? 1_555 D CA . CA ? ? A GLU 68 A CA 202 1_555 ? ? ? ? ? ? ? 2.517 ? 
metalc18 metalc ? ? B GLU 68 O   ? ? ? 1_555 F CA . CA ? ? B GLU 68 B CA 102 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc19 metalc ? ? A ASP 24 O   ? ? ? 1_555 C CA . CA ? ? A ASP 24 A CA 201 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc20 metalc ? ? B ASP 24 O   ? ? ? 1_555 E CA . CA ? ? B ASP 24 B CA 101 1_555 ? ? ? ? ? ? ? 2.566 ? 
metalc21 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 F CA . CA ? ? B GLU 73 B CA 102 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc22 metalc ? ? A GLU 73 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 73 A CA 202 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc23 metalc ? ? A SER 19 OG  ? ? ? 1_555 C CA . CA ? ? A SER 19 A CA 201 1_555 ? ? ? ? ? ? ? 3.051 ? 
metalc24 metalc ? ? B SER 19 OG  ? ? ? 1_555 E CA . CA ? ? B SER 19 B CA 101 1_555 ? ? ? ? ? ? ? 3.052 ? 
metalc25 metalc ? ? A ASP 62 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 62 A CA 202 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc26 metalc ? ? B ASP 62 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 62 B CA 102 1_555 ? ? ? ? ? ? ? 2.183 ? 
metalc27 metalc ? ? B GLU 32 OE1 ? ? ? 1_555 E CA . CA ? ? B GLU 32 B CA 101 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc28 metalc ? ? A GLU 32 OE1 ? ? ? 1_555 C CA . CA ? ? A GLU 32 A CA 201 1_555 ? ? ? ? ? ? ? 2.361 ? 
metalc29 metalc ? ? A ASP 66 OD1 ? ? ? 1_555 D CA . CA ? ? A ASP 66 A CA 202 1_555 ? ? ? ? ? ? ? 2.946 ? 
metalc30 metalc ? ? B ASP 66 OD1 ? ? ? 1_555 F CA . CA ? ? B ASP 66 B CA 102 1_555 ? ? ? ? ? ? ? 2.946 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 201' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA A 202' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA B 101' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CA B 102' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 SER A 19 ? SER A 19 . ? 1_555 ? 
2  AC1 6 GLU A 22 ? GLU A 22 . ? 1_555 ? 
3  AC1 6 GLY A 23 ? GLY A 23 . ? 1_555 ? 
4  AC1 6 ASP A 24 ? ASP A 24 . ? 1_555 ? 
5  AC1 6 LYS A 27 ? LYS A 27 . ? 1_555 ? 
6  AC1 6 GLU A 32 ? GLU A 32 . ? 1_555 ? 
7  AC2 5 ASP A 62 ? ASP A 62 . ? 1_555 ? 
8  AC2 5 ASN A 64 ? ASN A 64 . ? 1_555 ? 
9  AC2 5 ASP A 66 ? ASP A 66 . ? 1_555 ? 
10 AC2 5 GLU A 68 ? GLU A 68 . ? 1_555 ? 
11 AC2 5 GLU A 73 ? GLU A 73 . ? 1_555 ? 
12 AC3 6 SER B 19 ? SER B 19 . ? 1_555 ? 
13 AC3 6 GLU B 22 ? GLU B 22 . ? 1_555 ? 
14 AC3 6 GLY B 23 ? GLY B 23 . ? 1_555 ? 
15 AC3 6 ASP B 24 ? ASP B 24 . ? 1_555 ? 
16 AC3 6 LYS B 27 ? LYS B 27 . ? 1_555 ? 
17 AC3 6 GLU B 32 ? GLU B 32 . ? 1_555 ? 
18 AC4 5 ASP B 62 ? ASP B 62 . ? 1_555 ? 
19 AC4 5 ASN B 64 ? ASN B 64 . ? 1_555 ? 
20 AC4 5 ASP B 66 ? ASP B 66 . ? 1_555 ? 
21 AC4 5 GLU B 68 ? GLU B 68 . ? 1_555 ? 
22 AC4 5 GLU B 73 ? GLU B 73 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2LUX 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . GLY A 1 1  ? 157.157 -8.038  -9.722  1.00 0.00 ? 1   GLY A N    1  
ATOM   2     C  CA   . GLY A 1 1  ? 156.442 -7.171  -8.792  1.00 0.00 ? 1   GLY A CA   1  
ATOM   3     C  C    . GLY A 1 1  ? 156.291 -7.841  -7.430  1.00 0.00 ? 1   GLY A C    1  
ATOM   4     O  O    . GLY A 1 1  ? 156.198 -9.064  -7.336  1.00 0.00 ? 1   GLY A O    1  
ATOM   5     H  H1   . GLY A 1 1  ? 157.521 -7.670  -10.553 1.00 0.00 ? 1   GLY A H1   1  
ATOM   6     H  HA2  . GLY A 1 1  ? 156.991 -6.247  -8.675  1.00 0.00 ? 1   GLY A HA2  1  
ATOM   7     H  HA3  . GLY A 1 1  ? 155.462 -6.956  -9.188  1.00 0.00 ? 1   GLY A HA3  1  
ATOM   8     N  N    . SER A 1 2  ? 156.268 -7.030  -6.377  1.00 0.00 ? 2   SER A N    1  
ATOM   9     C  CA   . SER A 1 2  ? 156.127 -7.556  -5.024  1.00 0.00 ? 2   SER A CA   1  
ATOM   10    C  C    . SER A 1 2  ? 154.728 -8.116  -4.806  1.00 0.00 ? 2   SER A C    1  
ATOM   11    O  O    . SER A 1 2  ? 153.796 -7.819  -5.562  1.00 0.00 ? 2   SER A O    1  
ATOM   12    C  CB   . SER A 1 2  ? 156.395 -6.457  -3.997  1.00 0.00 ? 2   SER A CB   1  
ATOM   13    O  OG   . SER A 1 2  ? 155.306 -5.546  -3.988  1.00 0.00 ? 2   SER A OG   1  
ATOM   14    H  H    . SER A 1 2  ? 156.345 -6.063  -6.512  1.00 0.00 ? 2   SER A H    1  
ATOM   15    H  HA   . SER A 1 2  ? 156.846 -8.348  -4.881  1.00 0.00 ? 2   SER A HA   1  
ATOM   16    H  HB2  . SER A 1 2  ? 156.492 -6.896  -3.019  1.00 0.00 ? 2   SER A HB2  1  
ATOM   17    H  HB3  . SER A 1 2  ? 157.311 -5.940  -4.252  1.00 0.00 ? 2   SER A HB3  1  
ATOM   18    H  HG   . SER A 1 2  ? 154.499 -6.046  -4.132  1.00 0.00 ? 2   SER A HG   1  
ATOM   19    N  N    . GLU A 1 3  ? 154.580 -8.923  -3.762  1.00 0.00 ? 3   GLU A N    1  
ATOM   20    C  CA   . GLU A 1 3  ? 153.285 -9.506  -3.465  1.00 0.00 ? 3   GLU A CA   1  
ATOM   21    C  C    . GLU A 1 3  ? 152.280 -8.395  -3.214  1.00 0.00 ? 3   GLU A C    1  
ATOM   22    O  O    . GLU A 1 3  ? 151.112 -8.506  -3.590  1.00 0.00 ? 3   GLU A O    1  
ATOM   23    C  CB   . GLU A 1 3  ? 153.383 -10.395 -2.224  1.00 0.00 ? 3   GLU A CB   1  
ATOM   24    C  CG   . GLU A 1 3  ? 154.314 -11.575 -2.508  1.00 0.00 ? 3   GLU A CG   1  
ATOM   25    C  CD   . GLU A 1 3  ? 154.365 -12.502 -1.298  1.00 0.00 ? 3   GLU A CD   1  
ATOM   26    O  OE1  . GLU A 1 3  ? 153.838 -12.124 -0.264  1.00 0.00 ? 3   GLU A OE1  1  
ATOM   27    O  OE2  . GLU A 1 3  ? 154.930 -13.575 -1.422  1.00 0.00 ? 3   GLU A OE2  1  
ATOM   28    H  H    . GLU A 1 3  ? 155.348 -9.125  -3.189  1.00 0.00 ? 3   GLU A H    1  
ATOM   29    H  HA   . GLU A 1 3  ? 152.959 -10.102 -4.304  1.00 0.00 ? 3   GLU A HA   1  
ATOM   30    H  HB2  . GLU A 1 3  ? 153.774 -9.819  -1.398  1.00 0.00 ? 3   GLU A HB2  1  
ATOM   31    H  HB3  . GLU A 1 3  ? 152.402 -10.767 -1.969  1.00 0.00 ? 3   GLU A HB3  1  
ATOM   32    H  HG2  . GLU A 1 3  ? 153.945 -12.122 -3.362  1.00 0.00 ? 3   GLU A HG2  1  
ATOM   33    H  HG3  . GLU A 1 3  ? 155.306 -11.207 -2.718  1.00 0.00 ? 3   GLU A HG3  1  
ATOM   34    N  N    . LEU A 1 4  ? 152.740 -7.311  -2.593  1.00 0.00 ? 4   LEU A N    1  
ATOM   35    C  CA   . LEU A 1 4  ? 151.858 -6.188  -2.330  1.00 0.00 ? 4   LEU A CA   1  
ATOM   36    C  C    . LEU A 1 4  ? 151.338 -5.628  -3.648  1.00 0.00 ? 4   LEU A C    1  
ATOM   37    O  O    . LEU A 1 4  ? 150.154 -5.306  -3.774  1.00 0.00 ? 4   LEU A O    1  
ATOM   38    C  CB   . LEU A 1 4  ? 152.618 -5.102  -1.557  1.00 0.00 ? 4   LEU A CB   1  
ATOM   39    C  CG   . LEU A 1 4  ? 151.645 -4.019  -1.058  1.00 0.00 ? 4   LEU A CG   1  
ATOM   40    C  CD1  . LEU A 1 4  ? 152.212 -3.372  0.208   1.00 0.00 ? 4   LEU A CD1  1  
ATOM   41    C  CD2  . LEU A 1 4  ? 151.455 -2.929  -2.125  1.00 0.00 ? 4   LEU A CD2  1  
ATOM   42    H  H    . LEU A 1 4  ? 153.682 -7.265  -2.326  1.00 0.00 ? 4   LEU A H    1  
ATOM   43    H  HA   . LEU A 1 4  ? 151.023 -6.527  -1.735  1.00 0.00 ? 4   LEU A HA   1  
ATOM   44    H  HB2  . LEU A 1 4  ? 153.114 -5.554  -0.710  1.00 0.00 ? 4   LEU A HB2  1  
ATOM   45    H  HB3  . LEU A 1 4  ? 153.356 -4.655  -2.204  1.00 0.00 ? 4   LEU A HB3  1  
ATOM   46    H  HG   . LEU A 1 4  ? 150.690 -4.470  -0.830  1.00 0.00 ? 4   LEU A HG   1  
ATOM   47    H  HD11 . LEU A 1 4  ? 151.710 -2.433  0.388   1.00 0.00 ? 4   LEU A HD11 1  
ATOM   48    H  HD12 . LEU A 1 4  ? 153.270 -3.196  0.078   1.00 0.00 ? 4   LEU A HD12 1  
ATOM   49    H  HD13 . LEU A 1 4  ? 152.057 -4.031  1.049   1.00 0.00 ? 4   LEU A HD13 1  
ATOM   50    H  HD21 . LEU A 1 4  ? 151.021 -2.054  -1.666  1.00 0.00 ? 4   LEU A HD21 1  
ATOM   51    H  HD22 . LEU A 1 4  ? 150.794 -3.288  -2.897  1.00 0.00 ? 4   LEU A HD22 1  
ATOM   52    H  HD23 . LEU A 1 4  ? 152.409 -2.669  -2.557  1.00 0.00 ? 4   LEU A HD23 1  
ATOM   53    N  N    . GLU A 1 5  ? 152.222 -5.539  -4.646  1.00 0.00 ? 5   GLU A N    1  
ATOM   54    C  CA   . GLU A 1 5  ? 151.805 -5.041  -5.948  1.00 0.00 ? 5   GLU A CA   1  
ATOM   55    C  C    . GLU A 1 5  ? 150.818 -6.005  -6.582  1.00 0.00 ? 5   GLU A C    1  
ATOM   56    O  O    . GLU A 1 5  ? 149.843 -5.588  -7.205  1.00 0.00 ? 5   GLU A O    1  
ATOM   57    C  CB   . GLU A 1 5  ? 153.008 -4.884  -6.881  1.00 0.00 ? 5   GLU A CB   1  
ATOM   58    C  CG   . GLU A 1 5  ? 153.937 -3.784  -6.368  1.00 0.00 ? 5   GLU A CG   1  
ATOM   59    C  CD   . GLU A 1 5  ? 155.094 -3.601  -7.344  1.00 0.00 ? 5   GLU A CD   1  
ATOM   60    O  OE1  . GLU A 1 5  ? 155.230 -4.429  -8.231  1.00 0.00 ? 5   GLU A OE1  1  
ATOM   61    O  OE2  . GLU A 1 5  ? 155.828 -2.641  -7.193  1.00 0.00 ? 5   GLU A OE2  1  
ATOM   62    H  H    . GLU A 1 5  ? 153.149 -5.827  -4.505  1.00 0.00 ? 5   GLU A H    1  
ATOM   63    H  HA   . GLU A 1 5  ? 151.333 -4.077  -5.822  1.00 0.00 ? 5   GLU A HA   1  
ATOM   64    H  HB2  . GLU A 1 5  ? 153.550 -5.817  -6.926  1.00 0.00 ? 5   GLU A HB2  1  
ATOM   65    H  HB3  . GLU A 1 5  ? 152.661 -4.625  -7.870  1.00 0.00 ? 5   GLU A HB3  1  
ATOM   66    H  HG2  . GLU A 1 5  ? 153.385 -2.858  -6.286  1.00 0.00 ? 5   GLU A HG2  1  
ATOM   67    H  HG3  . GLU A 1 5  ? 154.323 -4.059  -5.401  1.00 0.00 ? 5   GLU A HG3  1  
ATOM   68    N  N    . THR A 1 6  ? 151.072 -7.303  -6.412  1.00 0.00 ? 6   THR A N    1  
ATOM   69    C  CA   . THR A 1 6  ? 150.179 -8.306  -6.977  1.00 0.00 ? 6   THR A CA   1  
ATOM   70    C  C    . THR A 1 6  ? 148.788 -8.169  -6.377  1.00 0.00 ? 6   THR A C    1  
ATOM   71    O  O    . THR A 1 6  ? 147.782 -8.233  -7.084  1.00 0.00 ? 6   THR A O    1  
ATOM   72    C  CB   . THR A 1 6  ? 150.724 -9.708  -6.699  1.00 0.00 ? 6   THR A CB   1  
ATOM   73    O  OG1  . THR A 1 6  ? 152.057 -9.801  -7.183  1.00 0.00 ? 6   THR A OG1  1  
ATOM   74    C  CG2  . THR A 1 6  ? 149.850 -10.747 -7.402  1.00 0.00 ? 6   THR A CG2  1  
ATOM   75    H  H    . THR A 1 6  ? 151.867 -7.584  -5.901  1.00 0.00 ? 6   THR A H    1  
ATOM   76    H  HA   . THR A 1 6  ? 150.118 -8.161  -8.045  1.00 0.00 ? 6   THR A HA   1  
ATOM   77    H  HB   . THR A 1 6  ? 150.714 -9.895  -5.636  1.00 0.00 ? 6   THR A HB   1  
ATOM   78    H  HG1  . THR A 1 6  ? 152.212 -9.057  -7.771  1.00 0.00 ? 6   THR A HG1  1  
ATOM   79    H  HG21 . THR A 1 6  ? 149.644 -10.421 -8.410  1.00 0.00 ? 6   THR A HG21 1  
ATOM   80    H  HG22 . THR A 1 6  ? 148.921 -10.859 -6.863  1.00 0.00 ? 6   THR A HG22 1  
ATOM   81    H  HG23 . THR A 1 6  ? 150.367 -11.695 -7.428  1.00 0.00 ? 6   THR A HG23 1  
ATOM   82    N  N    . ALA A 1 7  ? 148.745 -7.963  -5.065  1.00 0.00 ? 7   ALA A N    1  
ATOM   83    C  CA   . ALA A 1 7  ? 147.480 -7.797  -4.367  1.00 0.00 ? 7   ALA A CA   1  
ATOM   84    C  C    . ALA A 1 7  ? 146.803 -6.500  -4.792  1.00 0.00 ? 7   ALA A C    1  
ATOM   85    O  O    . ALA A 1 7  ? 145.579 -6.423  -4.886  1.00 0.00 ? 7   ALA A O    1  
ATOM   86    C  CB   . ALA A 1 7  ? 147.724 -7.787  -2.852  1.00 0.00 ? 7   ALA A CB   1  
ATOM   87    H  H    . ALA A 1 7  ? 149.584 -7.911  -4.560  1.00 0.00 ? 7   ALA A H    1  
ATOM   88    H  HA   . ALA A 1 7  ? 146.834 -8.626  -4.610  1.00 0.00 ? 7   ALA A HA   1  
ATOM   89    H  HB1  . ALA A 1 7  ? 147.617 -8.789  -2.466  1.00 0.00 ? 7   ALA A HB1  1  
ATOM   90    H  HB2  . ALA A 1 7  ? 147.009 -7.137  -2.370  1.00 0.00 ? 7   ALA A HB2  1  
ATOM   91    H  HB3  . ALA A 1 7  ? 148.724 -7.432  -2.652  1.00 0.00 ? 7   ALA A HB3  1  
ATOM   92    N  N    . MET A 1 8  ? 147.615 -5.476  -5.023  1.00 0.00 ? 8   MET A N    1  
ATOM   93    C  CA   . MET A 1 8  ? 147.097 -4.170  -5.409  1.00 0.00 ? 8   MET A CA   1  
ATOM   94    C  C    . MET A 1 8  ? 146.298 -4.236  -6.713  1.00 0.00 ? 8   MET A C    1  
ATOM   95    O  O    . MET A 1 8  ? 145.210 -3.654  -6.826  1.00 0.00 ? 8   MET A O    1  
ATOM   96    C  CB   . MET A 1 8  ? 148.289 -3.233  -5.608  1.00 0.00 ? 8   MET A CB   1  
ATOM   97    C  CG   . MET A 1 8  ? 147.812 -1.796  -5.792  1.00 0.00 ? 8   MET A CG   1  
ATOM   98    S  SD   . MET A 1 8  ? 149.220 -0.765  -6.275  1.00 0.00 ? 8   MET A SD   1  
ATOM   99    C  CE   . MET A 1 8  ? 150.224 -1.030  -4.794  1.00 0.00 ? 8   MET A CE   1  
ATOM   100   H  H    . MET A 1 8  ? 148.584 -5.595  -4.910  1.00 0.00 ? 8   MET A H    1  
ATOM   101   H  HA   . MET A 1 8  ? 146.472 -3.780  -4.622  1.00 0.00 ? 8   MET A HA   1  
ATOM   102   H  HB2  . MET A 1 8  ? 148.933 -3.287  -4.744  1.00 0.00 ? 8   MET A HB2  1  
ATOM   103   H  HB3  . MET A 1 8  ? 148.840 -3.538  -6.486  1.00 0.00 ? 8   MET A HB3  1  
ATOM   104   H  HG2  . MET A 1 8  ? 147.054 -1.760  -6.561  1.00 0.00 ? 8   MET A HG2  1  
ATOM   105   H  HG3  . MET A 1 8  ? 147.403 -1.433  -4.861  1.00 0.00 ? 8   MET A HG3  1  
ATOM   106   H  HE1  . MET A 1 8  ? 150.835 -0.155  -4.611  1.00 0.00 ? 8   MET A HE1  1  
ATOM   107   H  HE2  . MET A 1 8  ? 150.864 -1.886  -4.940  1.00 0.00 ? 8   MET A HE2  1  
ATOM   108   H  HE3  . MET A 1 8  ? 149.577 -1.207  -3.946  1.00 0.00 ? 8   MET A HE3  1  
ATOM   109   N  N    . GLU A 1 9  ? 146.831 -4.970  -7.686  1.00 0.00 ? 9   GLU A N    1  
ATOM   110   C  CA   . GLU A 1 9  ? 146.174 -5.099  -8.981  1.00 0.00 ? 9   GLU A CA   1  
ATOM   111   C  C    . GLU A 1 9  ? 144.781 -5.657  -8.809  1.00 0.00 ? 9   GLU A C    1  
ATOM   112   O  O    . GLU A 1 9  ? 143.864 -5.322  -9.560  1.00 0.00 ? 9   GLU A O    1  
ATOM   113   C  CB   . GLU A 1 9  ? 146.986 -6.021  -9.893  1.00 0.00 ? 9   GLU A CB   1  
ATOM   114   C  CG   . GLU A 1 9  ? 148.347 -5.386  -10.183 1.00 0.00 ? 9   GLU A CG   1  
ATOM   115   C  CD   . GLU A 1 9  ? 149.138 -6.267  -11.144 1.00 0.00 ? 9   GLU A CD   1  
ATOM   116   O  OE1  . GLU A 1 9  ? 148.696 -7.374  -11.403 1.00 0.00 ? 9   GLU A OE1  1  
ATOM   117   O  OE2  . GLU A 1 9  ? 150.175 -5.821  -11.608 1.00 0.00 ? 9   GLU A OE2  1  
ATOM   118   H  H    . GLU A 1 9  ? 147.686 -5.425  -7.533  1.00 0.00 ? 9   GLU A H    1  
ATOM   119   H  HA   . GLU A 1 9  ? 146.108 -4.124  -9.441  1.00 0.00 ? 9   GLU A HA   1  
ATOM   120   H  HB2  . GLU A 1 9  ? 147.129 -6.974  -9.406  1.00 0.00 ? 9   GLU A HB2  1  
ATOM   121   H  HB3  . GLU A 1 9  ? 146.454 -6.168  -10.822 1.00 0.00 ? 9   GLU A HB3  1  
ATOM   122   H  HG2  . GLU A 1 9  ? 148.201 -4.414  -10.629 1.00 0.00 ? 9   GLU A HG2  1  
ATOM   123   H  HG3  . GLU A 1 9  ? 148.898 -5.279  -9.262  1.00 0.00 ? 9   GLU A HG3  1  
ATOM   124   N  N    . THR A 1 10 ? 144.623 -6.500  -7.811  1.00 0.00 ? 10  THR A N    1  
ATOM   125   C  CA   . THR A 1 10 ? 143.334 -7.090  -7.542  1.00 0.00 ? 10  THR A CA   1  
ATOM   126   C  C    . THR A 1 10 ? 142.285 -6.008  -7.304  1.00 0.00 ? 10  THR A C    1  
ATOM   127   O  O    . THR A 1 10 ? 141.128 -6.182  -7.685  1.00 0.00 ? 10  THR A O    1  
ATOM   128   C  CB   . THR A 1 10 ? 143.412 -8.003  -6.316  1.00 0.00 ? 10  THR A CB   1  
ATOM   129   O  OG1  . THR A 1 10 ? 144.451 -8.954  -6.499  1.00 0.00 ? 10  THR A OG1  1  
ATOM   130   C  CG2  . THR A 1 10 ? 142.079 -8.733  -6.139  1.00 0.00 ? 10  THR A CG2  1  
ATOM   131   H  H    . THR A 1 10 ? 145.388 -6.724  -7.241  1.00 0.00 ? 10  THR A H    1  
ATOM   132   H  HA   . THR A 1 10 ? 143.038 -7.682  -8.395  1.00 0.00 ? 10  THR A HA   1  
ATOM   133   H  HB   . THR A 1 10 ? 143.610 -7.412  -5.436  1.00 0.00 ? 10  THR A HB   1  
ATOM   134   H  HG1  . THR A 1 10 ? 144.059 -9.830  -6.472  1.00 0.00 ? 10  THR A HG1  1  
ATOM   135   H  HG21 . THR A 1 10 ? 142.227 -9.608  -5.523  1.00 0.00 ? 10  THR A HG21 1  
ATOM   136   H  HG22 . THR A 1 10 ? 141.701 -9.031  -7.105  1.00 0.00 ? 10  THR A HG22 1  
ATOM   137   H  HG23 . THR A 1 10 ? 141.368 -8.074  -5.662  1.00 0.00 ? 10  THR A HG23 1  
ATOM   138   N  N    . LEU A 1 11 ? 142.668 -4.901  -6.653  1.00 0.00 ? 11  LEU A N    1  
ATOM   139   C  CA   . LEU A 1 11 ? 141.680 -3.854  -6.379  1.00 0.00 ? 11  LEU A CA   1  
ATOM   140   C  C    . LEU A 1 11 ? 141.110 -3.277  -7.668  1.00 0.00 ? 11  LEU A C    1  
ATOM   141   O  O    . LEU A 1 11 ? 139.905 -3.026  -7.779  1.00 0.00 ? 11  LEU A O    1  
ATOM   142   C  CB   . LEU A 1 11 ? 142.326 -2.715  -5.586  1.00 0.00 ? 11  LEU A CB   1  
ATOM   143   C  CG   . LEU A 1 11 ? 142.938 -3.252  -4.293  1.00 0.00 ? 11  LEU A CG   1  
ATOM   144   C  CD1  . LEU A 1 11 ? 143.453 -2.083  -3.450  1.00 0.00 ? 11  LEU A CD1  1  
ATOM   145   C  CD2  . LEU A 1 11 ? 141.883 -4.025  -3.499  1.00 0.00 ? 11  LEU A CD2  1  
ATOM   146   H  H    . LEU A 1 11 ? 143.611 -4.788  -6.354  1.00 0.00 ? 11  LEU A H    1  
ATOM   147   H  HA   . LEU A 1 11 ? 140.875 -4.273  -5.798  1.00 0.00 ? 11  LEU A HA   1  
ATOM   148   H  HB2  . LEU A 1 11 ? 143.099 -2.256  -6.184  1.00 0.00 ? 11  LEU A HB2  1  
ATOM   149   H  HB3  . LEU A 1 11 ? 141.576 -1.977  -5.345  1.00 0.00 ? 11  LEU A HB3  1  
ATOM   150   H  HG   . LEU A 1 11 ? 143.760 -3.904  -4.537  1.00 0.00 ? 11  LEU A HG   1  
ATOM   151   H  HD11 . LEU A 1 11 ? 144.046 -2.463  -2.631  1.00 0.00 ? 11  LEU A HD11 1  
ATOM   152   H  HD12 . LEU A 1 11 ? 142.615 -1.525  -3.058  1.00 0.00 ? 11  LEU A HD12 1  
ATOM   153   H  HD13 . LEU A 1 11 ? 144.060 -1.436  -4.064  1.00 0.00 ? 11  LEU A HD13 1  
ATOM   154   H  HD21 . LEU A 1 11 ? 142.151 -4.032  -2.453  1.00 0.00 ? 11  LEU A HD21 1  
ATOM   155   H  HD22 . LEU A 1 11 ? 141.832 -5.041  -3.864  1.00 0.00 ? 11  LEU A HD22 1  
ATOM   156   H  HD23 . LEU A 1 11 ? 140.921 -3.551  -3.622  1.00 0.00 ? 11  LEU A HD23 1  
ATOM   157   N  N    . ILE A 1 12 ? 141.982 -3.054  -8.639  1.00 0.00 ? 12  ILE A N    1  
ATOM   158   C  CA   . ILE A 1 12 ? 141.558 -2.491  -9.908  1.00 0.00 ? 12  ILE A CA   1  
ATOM   159   C  C    . ILE A 1 12 ? 140.641 -3.436  -10.678 1.00 0.00 ? 12  ILE A C    1  
ATOM   160   O  O    . ILE A 1 12 ? 139.614 -3.016  -11.212 1.00 0.00 ? 12  ILE A O    1  
ATOM   161   C  CB   . ILE A 1 12 ? 142.790 -2.145  -10.741 1.00 0.00 ? 12  ILE A CB   1  
ATOM   162   C  CG1  . ILE A 1 12 ? 143.648 -1.153  -9.949  1.00 0.00 ? 12  ILE A CG1  1  
ATOM   163   C  CG2  . ILE A 1 12 ? 142.355 -1.509  -12.063 1.00 0.00 ? 12  ILE A CG2  1  
ATOM   164   C  CD1  . ILE A 1 12 ? 144.950 -0.869  -10.703 1.00 0.00 ? 12  ILE A CD1  1  
ATOM   165   H  H    . ILE A 1 12 ? 142.930 -3.263  -8.495  1.00 0.00 ? 12  ILE A H    1  
ATOM   166   H  HA   . ILE A 1 12 ? 141.017 -1.578  -9.711  1.00 0.00 ? 12  ILE A HA   1  
ATOM   167   H  HB   . ILE A 1 12 ? 143.358 -3.041  -10.938 1.00 0.00 ? 12  ILE A HB   1  
ATOM   168   H  HG12 . ILE A 1 12 ? 143.101 -0.231  -9.818  1.00 0.00 ? 12  ILE A HG12 1  
ATOM   169   H  HG13 . ILE A 1 12 ? 143.880 -1.574  -8.978  1.00 0.00 ? 12  ILE A HG13 1  
ATOM   170   H  HG21 . ILE A 1 12 ? 143.226 -1.149  -12.592 1.00 0.00 ? 12  ILE A HG21 1  
ATOM   171   H  HG22 . ILE A 1 12 ? 141.688 -0.684  -11.863 1.00 0.00 ? 12  ILE A HG22 1  
ATOM   172   H  HG23 . ILE A 1 12 ? 141.846 -2.246  -12.666 1.00 0.00 ? 12  ILE A HG23 1  
ATOM   173   H  HD11 . ILE A 1 12 ? 145.725 -0.617  -9.995  1.00 0.00 ? 12  ILE A HD11 1  
ATOM   174   H  HD12 . ILE A 1 12 ? 144.800 -0.042  -11.381 1.00 0.00 ? 12  ILE A HD12 1  
ATOM   175   H  HD13 . ILE A 1 12 ? 145.242 -1.745  -11.261 1.00 0.00 ? 12  ILE A HD13 1  
ATOM   176   N  N    . ASN A 1 13 ? 141.022 -4.709  -10.750 1.00 0.00 ? 13  ASN A N    1  
ATOM   177   C  CA   . ASN A 1 13 ? 140.221 -5.684  -11.481 1.00 0.00 ? 13  ASN A CA   1  
ATOM   178   C  C    . ASN A 1 13 ? 138.813 -5.814  -10.910 1.00 0.00 ? 13  ASN A C    1  
ATOM   179   O  O    . ASN A 1 13 ? 137.832 -5.869  -11.660 1.00 0.00 ? 13  ASN A O    1  
ATOM   180   C  CB   . ASN A 1 13 ? 140.909 -7.050  -11.440 1.00 0.00 ? 13  ASN A CB   1  
ATOM   181   C  CG   . ASN A 1 13 ? 140.245 -7.998  -12.432 1.00 0.00 ? 13  ASN A CG   1  
ATOM   182   O  OD1  . ASN A 1 13 ? 139.288 -7.621  -13.108 1.00 0.00 ? 13  ASN A OD1  1  
ATOM   183   N  ND2  . ASN A 1 13 ? 140.698 -9.215  -12.561 1.00 0.00 ? 13  ASN A ND2  1  
ATOM   184   H  H    . ASN A 1 13 ? 141.856 -4.991  -10.318 1.00 0.00 ? 13  ASN A H    1  
ATOM   185   H  HA   . ASN A 1 13 ? 140.149 -5.370  -12.511 1.00 0.00 ? 13  ASN A HA   1  
ATOM   186   H  HB2  . ASN A 1 13 ? 141.952 -6.933  -11.698 1.00 0.00 ? 13  ASN A HB2  1  
ATOM   187   H  HB3  . ASN A 1 13 ? 140.829 -7.461  -10.445 1.00 0.00 ? 13  ASN A HB3  1  
ATOM   188   H  HD21 . ASN A 1 13 ? 141.460 -9.514  -12.022 1.00 0.00 ? 13  ASN A HD21 1  
ATOM   189   H  HD22 . ASN A 1 13 ? 140.277 -9.831  -13.197 1.00 0.00 ? 13  ASN A HD22 1  
ATOM   190   N  N    . VAL A 1 14 ? 138.705 -5.858  -9.583  1.00 0.00 ? 14  VAL A N    1  
ATOM   191   C  CA   . VAL A 1 14 ? 137.393 -5.985  -8.964  1.00 0.00 ? 14  VAL A CA   1  
ATOM   192   C  C    . VAL A 1 14 ? 136.616 -4.684  -9.087  1.00 0.00 ? 14  VAL A C    1  
ATOM   193   O  O    . VAL A 1 14 ? 135.416 -4.693  -9.363  1.00 0.00 ? 14  VAL A O    1  
ATOM   194   C  CB   . VAL A 1 14 ? 137.532 -6.387  -7.491  1.00 0.00 ? 14  VAL A CB   1  
ATOM   195   C  CG1  . VAL A 1 14 ? 138.359 -7.671  -7.388  1.00 0.00 ? 14  VAL A CG1  1  
ATOM   196   C  CG2  . VAL A 1 14 ? 138.232 -5.275  -6.709  1.00 0.00 ? 14  VAL A CG2  1  
ATOM   197   H  H    . VAL A 1 14 ? 139.508 -5.808  -9.024  1.00 0.00 ? 14  VAL A H    1  
ATOM   198   H  HA   . VAL A 1 14 ? 136.847 -6.760  -9.480  1.00 0.00 ? 14  VAL A HA   1  
ATOM   199   H  HB   . VAL A 1 14 ? 136.551 -6.560  -7.073  1.00 0.00 ? 14  VAL A HB   1  
ATOM   200   H  HG11 . VAL A 1 14 ? 139.211 -7.606  -8.049  1.00 0.00 ? 14  VAL A HG11 1  
ATOM   201   H  HG12 . VAL A 1 14 ? 137.749 -8.517  -7.671  1.00 0.00 ? 14  VAL A HG12 1  
ATOM   202   H  HG13 . VAL A 1 14 ? 138.701 -7.799  -6.372  1.00 0.00 ? 14  VAL A HG13 1  
ATOM   203   H  HG21 . VAL A 1 14 ? 139.197 -5.082  -7.147  1.00 0.00 ? 14  VAL A HG21 1  
ATOM   204   H  HG22 . VAL A 1 14 ? 138.359 -5.582  -5.682  1.00 0.00 ? 14  VAL A HG22 1  
ATOM   205   H  HG23 . VAL A 1 14 ? 137.633 -4.377  -6.744  1.00 0.00 ? 14  VAL A HG23 1  
ATOM   206   N  N    . PHE A 1 15 ? 137.301 -3.560  -8.905  1.00 0.00 ? 15  PHE A N    1  
ATOM   207   C  CA   . PHE A 1 15 ? 136.633 -2.275  -9.025  1.00 0.00 ? 15  PHE A CA   1  
ATOM   208   C  C    . PHE A 1 15 ? 136.090 -2.102  -10.436 1.00 0.00 ? 15  PHE A C    1  
ATOM   209   O  O    . PHE A 1 15 ? 134.940 -1.708  -10.631 1.00 0.00 ? 15  PHE A O    1  
ATOM   210   C  CB   . PHE A 1 15 ? 137.616 -1.146  -8.711  1.00 0.00 ? 15  PHE A CB   1  
ATOM   211   C  CG   . PHE A 1 15 ? 136.886 0.176   -8.713  1.00 0.00 ? 15  PHE A CG   1  
ATOM   212   C  CD1  . PHE A 1 15 ? 136.235 0.619   -7.555  1.00 0.00 ? 15  PHE A CD1  1  
ATOM   213   C  CD2  . PHE A 1 15 ? 136.863 0.960   -9.873  1.00 0.00 ? 15  PHE A CD2  1  
ATOM   214   C  CE1  . PHE A 1 15 ? 135.560 1.846   -7.558  1.00 0.00 ? 15  PHE A CE1  1  
ATOM   215   C  CE2  . PHE A 1 15 ? 136.187 2.187   -9.875  1.00 0.00 ? 15  PHE A CE2  1  
ATOM   216   C  CZ   . PHE A 1 15 ? 135.536 2.630   -8.718  1.00 0.00 ? 15  PHE A CZ   1  
ATOM   217   H  H    . PHE A 1 15 ? 138.263 -3.595  -8.701  1.00 0.00 ? 15  PHE A H    1  
ATOM   218   H  HA   . PHE A 1 15 ? 135.814 -2.235  -8.323  1.00 0.00 ? 15  PHE A HA   1  
ATOM   219   H  HB2  . PHE A 1 15 ? 138.057 -1.312  -7.739  1.00 0.00 ? 15  PHE A HB2  1  
ATOM   220   H  HB3  . PHE A 1 15 ? 138.394 -1.127  -9.460  1.00 0.00 ? 15  PHE A HB3  1  
ATOM   221   H  HD1  . PHE A 1 15 ? 136.253 0.014   -6.662  1.00 0.00 ? 15  PHE A HD1  1  
ATOM   222   H  HD2  . PHE A 1 15 ? 137.365 0.619   -10.766 1.00 0.00 ? 15  PHE A HD2  1  
ATOM   223   H  HE1  . PHE A 1 15 ? 135.058 2.187   -6.665  1.00 0.00 ? 15  PHE A HE1  1  
ATOM   224   H  HE2  . PHE A 1 15 ? 136.169 2.791   -10.770 1.00 0.00 ? 15  PHE A HE2  1  
ATOM   225   H  HZ   . PHE A 1 15 ? 135.016 3.575   -8.719  1.00 0.00 ? 15  PHE A HZ   1  
ATOM   226   N  N    . HIS A 1 16 ? 136.936 -2.401  -11.417 1.00 0.00 ? 16  HIS A N    1  
ATOM   227   C  CA   . HIS A 1 16 ? 136.551 -2.278  -12.815 1.00 0.00 ? 16  HIS A CA   1  
ATOM   228   C  C    . HIS A 1 16 ? 135.410 -3.223  -13.188 1.00 0.00 ? 16  HIS A C    1  
ATOM   229   O  O    . HIS A 1 16 ? 134.457 -2.818  -13.857 1.00 0.00 ? 16  HIS A O    1  
ATOM   230   C  CB   . HIS A 1 16 ? 137.757 -2.568  -13.709 1.00 0.00 ? 16  HIS A CB   1  
ATOM   231   C  CG   . HIS A 1 16 ? 137.380 -2.354  -15.148 1.00 0.00 ? 16  HIS A CG   1  
ATOM   232   N  ND1  . HIS A 1 16 ? 136.951 -3.392  -15.962 1.00 0.00 ? 16  HIS A ND1  1  
ATOM   233   C  CD2  . HIS A 1 16 ? 137.358 -1.229  -15.934 1.00 0.00 ? 16  HIS A CD2  1  
ATOM   234   C  CE1  . HIS A 1 16 ? 136.693 -2.874  -17.177 1.00 0.00 ? 16  HIS A CE1  1  
ATOM   235   N  NE2  . HIS A 1 16 ? 136.924 -1.559  -17.214 1.00 0.00 ? 16  HIS A NE2  1  
ATOM   236   H  H    . HIS A 1 16 ? 137.840 -2.708  -11.194 1.00 0.00 ? 16  HIS A H    1  
ATOM   237   H  HA   . HIS A 1 16 ? 136.230 -1.263  -12.997 1.00 0.00 ? 16  HIS A HA   1  
ATOM   238   H  HB2  . HIS A 1 16 ? 138.567 -1.902  -13.446 1.00 0.00 ? 16  HIS A HB2  1  
ATOM   239   H  HB3  . HIS A 1 16 ? 138.073 -3.591  -13.568 1.00 0.00 ? 16  HIS A HB3  1  
ATOM   240   H  HD1  . HIS A 1 16 ? 136.855 -4.331  -15.700 1.00 0.00 ? 16  HIS A HD1  1  
ATOM   241   H  HD2  . HIS A 1 16 ? 137.635 -0.237  -15.607 1.00 0.00 ? 16  HIS A HD2  1  
ATOM   242   H  HE1  . HIS A 1 16 ? 136.341 -3.451  -18.019 1.00 0.00 ? 16  HIS A HE1  1  
ATOM   243   H  HE2  . HIS A 1 16 ? 136.813 -0.957  -17.979 1.00 0.00 ? 16  HIS A HE2  1  
ATOM   244   N  N    . ALA A 1 17 ? 135.518 -4.491  -12.784 1.00 0.00 ? 17  ALA A N    1  
ATOM   245   C  CA   . ALA A 1 17 ? 134.484 -5.461  -13.136 1.00 0.00 ? 17  ALA A CA   1  
ATOM   246   C  C    . ALA A 1 17 ? 133.149 -5.141  -12.476 1.00 0.00 ? 17  ALA A C    1  
ATOM   247   O  O    . ALA A 1 17 ? 132.127 -5.046  -13.154 1.00 0.00 ? 17  ALA A O    1  
ATOM   248   C  CB   . ALA A 1 17 ? 134.930 -6.863  -12.721 1.00 0.00 ? 17  ALA A CB   1  
ATOM   249   H  H    . ALA A 1 17 ? 136.308 -4.780  -12.271 1.00 0.00 ? 17  ALA A H    1  
ATOM   250   H  HA   . ALA A 1 17 ? 134.347 -5.449  -14.207 1.00 0.00 ? 17  ALA A HA   1  
ATOM   251   H  HB1  . ALA A 1 17 ? 134.088 -7.538  -12.767 1.00 0.00 ? 17  ALA A HB1  1  
ATOM   252   H  HB2  . ALA A 1 17 ? 135.314 -6.835  -11.712 1.00 0.00 ? 17  ALA A HB2  1  
ATOM   253   H  HB3  . ALA A 1 17 ? 135.704 -7.207  -13.391 1.00 0.00 ? 17  ALA A HB3  1  
ATOM   254   N  N    . HIS A 1 18 ? 133.152 -4.966  -11.160 1.00 0.00 ? 18  HIS A N    1  
ATOM   255   C  CA   . HIS A 1 18 ? 131.914 -4.649  -10.465 1.00 0.00 ? 18  HIS A CA   1  
ATOM   256   C  C    . HIS A 1 18 ? 131.337 -3.316  -10.924 1.00 0.00 ? 18  HIS A C    1  
ATOM   257   O  O    . HIS A 1 18 ? 130.139 -3.211  -11.189 1.00 0.00 ? 18  HIS A O    1  
ATOM   258   C  CB   . HIS A 1 18 ? 132.132 -4.652  -8.956  1.00 0.00 ? 18  HIS A CB   1  
ATOM   259   C  CG   . HIS A 1 18 ? 132.386 -6.067  -8.506  1.00 0.00 ? 18  HIS A CG   1  
ATOM   260   N  ND1  . HIS A 1 18 ? 131.370 -7.010  -8.450  1.00 0.00 ? 18  HIS A ND1  1  
ATOM   261   C  CD2  . HIS A 1 18 ? 133.524 -6.721  -8.103  1.00 0.00 ? 18  HIS A CD2  1  
ATOM   262   C  CE1  . HIS A 1 18 ? 131.913 -8.168  -8.031  1.00 0.00 ? 18  HIS A CE1  1  
ATOM   263   N  NE2  . HIS A 1 18 ? 133.223 -8.047  -7.805  1.00 0.00 ? 18  HIS A NE2  1  
ATOM   264   H  H    . HIS A 1 18 ? 133.991 -5.044  -10.656 1.00 0.00 ? 18  HIS A H    1  
ATOM   265   H  HA   . HIS A 1 18 ? 131.194 -5.420  -10.699 1.00 0.00 ? 18  HIS A HA   1  
ATOM   266   H  HB2  . HIS A 1 18 ? 132.984 -4.033  -8.711  1.00 0.00 ? 18  HIS A HB2  1  
ATOM   267   H  HB3  . HIS A 1 18 ? 131.251 -4.268  -8.464  1.00 0.00 ? 18  HIS A HB3  1  
ATOM   268   H  HD1  . HIS A 1 18 ? 130.428 -6.861  -8.676  1.00 0.00 ? 18  HIS A HD1  1  
ATOM   269   H  HD2  . HIS A 1 18 ? 134.501 -6.275  -8.023  1.00 0.00 ? 18  HIS A HD2  1  
ATOM   270   H  HE1  . HIS A 1 18 ? 131.357 -9.082  -7.892  1.00 0.00 ? 18  HIS A HE1  1  
ATOM   271   H  HE2  . HIS A 1 18 ? 133.840 -8.742  -7.495  1.00 0.00 ? 18  HIS A HE2  1  
ATOM   272   N  N    . SER A 1 19 ? 132.189 -2.299  -11.025 1.00 0.00 ? 19  SER A N    1  
ATOM   273   C  CA   . SER A 1 19 ? 131.721 -0.991  -11.464 1.00 0.00 ? 19  SER A CA   1  
ATOM   274   C  C    . SER A 1 19 ? 131.135 -1.090  -12.864 1.00 0.00 ? 19  SER A C    1  
ATOM   275   O  O    . SER A 1 19 ? 130.110 -0.472  -13.170 1.00 0.00 ? 19  SER A O    1  
ATOM   276   C  CB   . SER A 1 19 ? 132.883 0.004   -11.473 1.00 0.00 ? 19  SER A CB   1  
ATOM   277   O  OG   . SER A 1 19 ? 132.379 1.313   -11.707 1.00 0.00 ? 19  SER A OG   1  
ATOM   278   H  H    . SER A 1 19 ? 133.136 -2.430  -10.808 1.00 0.00 ? 19  SER A H    1  
ATOM   279   H  HA   . SER A 1 19 ? 130.961 -0.639  -10.785 1.00 0.00 ? 19  SER A HA   1  
ATOM   280   H  HB2  . SER A 1 19 ? 133.388 -0.018  -10.523 1.00 0.00 ? 19  SER A HB2  1  
ATOM   281   H  HB3  . SER A 1 19 ? 133.581 -0.268  -12.254 1.00 0.00 ? 19  SER A HB3  1  
ATOM   282   H  HG   . SER A 1 19 ? 132.435 1.489   -12.649 1.00 0.00 ? 19  SER A HG   1  
ATOM   283   N  N    . GLY A 1 20 ? 131.808 -1.876  -13.705 1.00 0.00 ? 20  GLY A N    1  
ATOM   284   C  CA   . GLY A 1 20 ? 131.378 -2.081  -15.080 1.00 0.00 ? 20  GLY A CA   1  
ATOM   285   C  C    . GLY A 1 20 ? 130.031 -2.788  -15.172 1.00 0.00 ? 20  GLY A C    1  
ATOM   286   O  O    . GLY A 1 20 ? 129.231 -2.507  -16.064 1.00 0.00 ? 20  GLY A O    1  
ATOM   287   H  H    . GLY A 1 20 ? 132.619 -2.331  -13.386 1.00 0.00 ? 20  GLY A H    1  
ATOM   288   H  HA2  . GLY A 1 20 ? 131.302 -1.125  -15.565 1.00 0.00 ? 20  GLY A HA2  1  
ATOM   289   H  HA3  . GLY A 1 20 ? 132.120 -2.677  -15.593 1.00 0.00 ? 20  GLY A HA3  1  
ATOM   290   N  N    . LYS A 1 21 ? 129.804 -3.735  -14.269 1.00 0.00 ? 21  LYS A N    1  
ATOM   291   C  CA   . LYS A 1 21 ? 128.569 -4.511  -14.288 1.00 0.00 ? 21  LYS A CA   1  
ATOM   292   C  C    . LYS A 1 21 ? 127.328 -3.633  -14.159 1.00 0.00 ? 21  LYS A C    1  
ATOM   293   O  O    . LYS A 1 21 ? 126.333 -3.862  -14.847 1.00 0.00 ? 21  LYS A O    1  
ATOM   294   C  CB   . LYS A 1 21 ? 128.590 -5.531  -13.150 1.00 0.00 ? 21  LYS A CB   1  
ATOM   295   C  CG   . LYS A 1 21 ? 127.351 -6.424  -13.248 1.00 0.00 ? 21  LYS A CG   1  
ATOM   296   C  CD   . LYS A 1 21 ? 127.329 -7.405  -12.076 1.00 0.00 ? 21  LYS A CD   1  
ATOM   297   C  CE   . LYS A 1 21 ? 126.152 -8.365  -12.247 1.00 0.00 ? 21  LYS A CE   1  
ATOM   298   N  NZ   . LYS A 1 21 ? 126.109 -9.310  -11.095 1.00 0.00 ? 21  LYS A NZ   1  
ATOM   299   H  H    . LYS A 1 21 ? 130.491 -3.939  -13.599 1.00 0.00 ? 21  LYS A H    1  
ATOM   300   H  HA   . LYS A 1 21 ? 128.515 -5.047  -15.222 1.00 0.00 ? 21  LYS A HA   1  
ATOM   301   H  HB2  . LYS A 1 21 ? 129.484 -6.136  -13.226 1.00 0.00 ? 21  LYS A HB2  1  
ATOM   302   H  HB3  . LYS A 1 21 ? 128.585 -5.014  -12.202 1.00 0.00 ? 21  LYS A HB3  1  
ATOM   303   H  HG2  . LYS A 1 21 ? 126.461 -5.814  -13.219 1.00 0.00 ? 21  LYS A HG2  1  
ATOM   304   H  HG3  . LYS A 1 21 ? 127.379 -6.977  -14.175 1.00 0.00 ? 21  LYS A HG3  1  
ATOM   305   H  HD2  . LYS A 1 21 ? 128.253 -7.965  -12.056 1.00 0.00 ? 21  LYS A HD2  1  
ATOM   306   H  HD3  . LYS A 1 21 ? 127.216 -6.861  -11.151 1.00 0.00 ? 21  LYS A HD3  1  
ATOM   307   H  HE2  . LYS A 1 21 ? 125.233 -7.799  -12.285 1.00 0.00 ? 21  LYS A HE2  1  
ATOM   308   H  HE3  . LYS A 1 21 ? 126.271 -8.920  -13.165 1.00 0.00 ? 21  LYS A HE3  1  
ATOM   309   H  HZ1  . LYS A 1 21 ? 125.651 -10.196 -11.391 1.00 0.00 ? 21  LYS A HZ1  1  
ATOM   310   H  HZ2  . LYS A 1 21 ? 125.567 -8.881  -10.316 1.00 0.00 ? 21  LYS A HZ2  1  
ATOM   311   H  HZ3  . LYS A 1 21 ? 127.076 -9.512  -10.775 1.00 0.00 ? 21  LYS A HZ3  1  
ATOM   312   N  N    . GLU A 1 22 ? 127.374 -2.637  -13.280 1.00 0.00 ? 22  GLU A N    1  
ATOM   313   C  CA   . GLU A 1 22 ? 126.220 -1.757  -13.094 1.00 0.00 ? 22  GLU A CA   1  
ATOM   314   C  C    . GLU A 1 22 ? 126.615 -0.287  -13.191 1.00 0.00 ? 22  GLU A C    1  
ATOM   315   O  O    . GLU A 1 22 ? 127.692 0.109   -12.742 1.00 0.00 ? 22  GLU A O    1  
ATOM   316   C  CB   . GLU A 1 22 ? 125.589 -2.019  -11.725 1.00 0.00 ? 22  GLU A CB   1  
ATOM   317   C  CG   . GLU A 1 22 ? 125.125 -3.474  -11.645 1.00 0.00 ? 22  GLU A CG   1  
ATOM   318   C  CD   . GLU A 1 22 ? 124.427 -3.726  -10.314 1.00 0.00 ? 22  GLU A CD   1  
ATOM   319   O  OE1  . GLU A 1 22 ? 124.478 -2.851  -9.466  1.00 0.00 ? 22  GLU A OE1  1  
ATOM   320   O  OE2  . GLU A 1 22 ? 123.850 -4.790  -10.162 1.00 0.00 ? 22  GLU A OE2  1  
ATOM   321   H  H    . GLU A 1 22 ? 128.185 -2.494  -12.749 1.00 0.00 ? 22  GLU A H    1  
ATOM   322   H  HA   . GLU A 1 22 ? 125.484 -1.972  -13.856 1.00 0.00 ? 22  GLU A HA   1  
ATOM   323   H  HB2  . GLU A 1 22 ? 126.320 -1.829  -10.951 1.00 0.00 ? 22  GLU A HB2  1  
ATOM   324   H  HB3  . GLU A 1 22 ? 124.742 -1.365  -11.588 1.00 0.00 ? 22  GLU A HB3  1  
ATOM   325   H  HG2  . GLU A 1 22 ? 124.439 -3.675  -12.455 1.00 0.00 ? 22  GLU A HG2  1  
ATOM   326   H  HG3  . GLU A 1 22 ? 125.981 -4.128  -11.730 1.00 0.00 ? 22  GLU A HG3  1  
ATOM   327   N  N    . GLY A 1 23 ? 125.717 0.528   -13.740 1.00 0.00 ? 23  GLY A N    1  
ATOM   328   C  CA   . GLY A 1 23 ? 125.966 1.961   -13.843 1.00 0.00 ? 23  GLY A CA   1  
ATOM   329   C  C    . GLY A 1 23 ? 126.997 2.266   -14.915 1.00 0.00 ? 23  GLY A C    1  
ATOM   330   O  O    . GLY A 1 23 ? 127.323 1.412   -15.740 1.00 0.00 ? 23  GLY A O    1  
ATOM   331   H  H    . GLY A 1 23 ? 124.863 0.163   -14.053 1.00 0.00 ? 23  GLY A H    1  
ATOM   332   H  HA2  . GLY A 1 23 ? 125.041 2.463   -14.088 1.00 0.00 ? 23  GLY A HA2  1  
ATOM   333   H  HA3  . GLY A 1 23 ? 126.327 2.330   -12.895 1.00 0.00 ? 23  GLY A HA3  1  
ATOM   334   N  N    . ASP A 1 24 ? 127.532 3.480   -14.875 1.00 0.00 ? 24  ASP A N    1  
ATOM   335   C  CA   . ASP A 1 24 ? 128.554 3.873   -15.828 1.00 0.00 ? 24  ASP A CA   1  
ATOM   336   C  C    . ASP A 1 24 ? 129.853 3.150   -15.498 1.00 0.00 ? 24  ASP A C    1  
ATOM   337   O  O    . ASP A 1 24 ? 130.224 3.022   -14.324 1.00 0.00 ? 24  ASP A O    1  
ATOM   338   C  CB   . ASP A 1 24 ? 128.774 5.386   -15.776 1.00 0.00 ? 24  ASP A CB   1  
ATOM   339   C  CG   . ASP A 1 24 ? 127.524 6.111   -16.262 1.00 0.00 ? 24  ASP A CG   1  
ATOM   340   O  OD1  . ASP A 1 24 ? 126.666 5.456   -16.832 1.00 0.00 ? 24  ASP A OD1  1  
ATOM   341   O  OD2  . ASP A 1 24 ? 127.441 7.311   -16.057 1.00 0.00 ? 24  ASP A OD2  1  
ATOM   342   H  H    . ASP A 1 24 ? 127.250 4.111   -14.180 1.00 0.00 ? 24  ASP A H    1  
ATOM   343   H  HA   . ASP A 1 24 ? 128.236 3.596   -16.822 1.00 0.00 ? 24  ASP A HA   1  
ATOM   344   H  HB2  . ASP A 1 24 ? 128.988 5.682   -14.759 1.00 0.00 ? 24  ASP A HB2  1  
ATOM   345   H  HB3  . ASP A 1 24 ? 129.608 5.648   -16.409 1.00 0.00 ? 24  ASP A HB3  1  
ATOM   346   N  N    . LYS A 1 25 ? 130.531 2.663   -16.532 1.00 0.00 ? 25  LYS A N    1  
ATOM   347   C  CA   . LYS A 1 25 ? 131.783 1.948   -16.338 1.00 0.00 ? 25  LYS A CA   1  
ATOM   348   C  C    . LYS A 1 25 ? 132.831 2.850   -15.689 1.00 0.00 ? 25  LYS A C    1  
ATOM   349   O  O    . LYS A 1 25 ? 133.621 2.410   -14.854 1.00 0.00 ? 25  LYS A O    1  
ATOM   350   C  CB   . LYS A 1 25 ? 132.314 1.465   -17.691 1.00 0.00 ? 25  LYS A CB   1  
ATOM   351   C  CG   . LYS A 1 25 ? 131.309 0.503   -18.331 1.00 0.00 ? 25  LYS A CG   1  
ATOM   352   C  CD   . LYS A 1 25 ? 131.939 -0.154  -19.562 1.00 0.00 ? 25  LYS A CD   1  
ATOM   353   C  CE   . LYS A 1 25 ? 132.234 0.909   -20.625 1.00 0.00 ? 25  LYS A CE   1  
ATOM   354   N  NZ   . LYS A 1 25 ? 131.082 1.847   -20.728 1.00 0.00 ? 25  LYS A NZ   1  
ATOM   355   H  H    . LYS A 1 25 ? 130.180 2.783   -17.438 1.00 0.00 ? 25  LYS A H    1  
ATOM   356   H  HA   . LYS A 1 25 ? 131.611 1.096   -15.703 1.00 0.00 ? 25  LYS A HA   1  
ATOM   357   H  HB2  . LYS A 1 25 ? 132.462 2.316   -18.340 1.00 0.00 ? 25  LYS A HB2  1  
ATOM   358   H  HB3  . LYS A 1 25 ? 133.254 0.955   -17.546 1.00 0.00 ? 25  LYS A HB3  1  
ATOM   359   H  HG2  . LYS A 1 25 ? 131.034 -0.258  -17.619 1.00 0.00 ? 25  LYS A HG2  1  
ATOM   360   H  HG3  . LYS A 1 25 ? 130.427 1.050   -18.629 1.00 0.00 ? 25  LYS A HG3  1  
ATOM   361   H  HD2  . LYS A 1 25 ? 132.860 -0.641  -19.276 1.00 0.00 ? 25  LYS A HD2  1  
ATOM   362   H  HD3  . LYS A 1 25 ? 131.257 -0.884  -19.968 1.00 0.00 ? 25  LYS A HD3  1  
ATOM   363   H  HE2  . LYS A 1 25 ? 133.122 1.459   -20.348 1.00 0.00 ? 25  LYS A HE2  1  
ATOM   364   H  HE3  . LYS A 1 25 ? 132.393 0.429   -21.578 1.00 0.00 ? 25  LYS A HE3  1  
ATOM   365   H  HZ1  . LYS A 1 25 ? 130.948 2.124   -21.721 1.00 0.00 ? 25  LYS A HZ1  1  
ATOM   366   H  HZ2  . LYS A 1 25 ? 131.271 2.694   -20.154 1.00 0.00 ? 25  LYS A HZ2  1  
ATOM   367   H  HZ3  . LYS A 1 25 ? 130.220 1.379   -20.382 1.00 0.00 ? 25  LYS A HZ3  1  
ATOM   368   N  N    . TYR A 1 26 ? 132.842 4.111   -16.110 1.00 0.00 ? 26  TYR A N    1  
ATOM   369   C  CA   . TYR A 1 26 ? 133.808 5.082   -15.603 1.00 0.00 ? 26  TYR A CA   1  
ATOM   370   C  C    . TYR A 1 26 ? 133.612 5.409   -14.124 1.00 0.00 ? 26  TYR A C    1  
ATOM   371   O  O    . TYR A 1 26 ? 134.583 5.683   -13.417 1.00 0.00 ? 26  TYR A O    1  
ATOM   372   C  CB   . TYR A 1 26 ? 133.709 6.374   -16.416 1.00 0.00 ? 26  TYR A CB   1  
ATOM   373   C  CG   . TYR A 1 26 ? 134.039 6.087   -17.860 1.00 0.00 ? 26  TYR A CG   1  
ATOM   374   C  CD1  . TYR A 1 26 ? 135.376 6.018   -18.272 1.00 0.00 ? 26  TYR A CD1  1  
ATOM   375   C  CD2  . TYR A 1 26 ? 133.010 5.893   -18.789 1.00 0.00 ? 26  TYR A CD2  1  
ATOM   376   C  CE1  . TYR A 1 26 ? 135.682 5.753   -19.612 1.00 0.00 ? 26  TYR A CE1  1  
ATOM   377   C  CE2  . TYR A 1 26 ? 133.316 5.628   -20.128 1.00 0.00 ? 26  TYR A CE2  1  
ATOM   378   C  CZ   . TYR A 1 26 ? 134.652 5.559   -20.540 1.00 0.00 ? 26  TYR A CZ   1  
ATOM   379   O  OH   . TYR A 1 26 ? 134.954 5.298   -21.861 1.00 0.00 ? 26  TYR A OH   1  
ATOM   380   H  H    . TYR A 1 26 ? 132.199 4.393   -16.793 1.00 0.00 ? 26  TYR A H    1  
ATOM   381   H  HA   . TYR A 1 26 ? 134.800 4.678   -15.735 1.00 0.00 ? 26  TYR A HA   1  
ATOM   382   H  HB2  . TYR A 1 26 ? 132.704 6.766   -16.346 1.00 0.00 ? 26  TYR A HB2  1  
ATOM   383   H  HB3  . TYR A 1 26 ? 134.406 7.100   -16.025 1.00 0.00 ? 26  TYR A HB3  1  
ATOM   384   H  HD1  . TYR A 1 26 ? 136.170 6.168   -17.555 1.00 0.00 ? 26  TYR A HD1  1  
ATOM   385   H  HD2  . TYR A 1 26 ? 131.979 5.947   -18.470 1.00 0.00 ? 26  TYR A HD2  1  
ATOM   386   H  HE1  . TYR A 1 26 ? 136.713 5.699   -19.930 1.00 0.00 ? 26  TYR A HE1  1  
ATOM   387   H  HE2  . TYR A 1 26 ? 132.521 5.478   -20.845 1.00 0.00 ? 26  TYR A HE2  1  
ATOM   388   H  HH   . TYR A 1 26 ? 134.357 4.613   -22.173 1.00 0.00 ? 26  TYR A HH   1  
ATOM   389   N  N    . LYS A 1 27 ? 132.362 5.428   -13.659 1.00 0.00 ? 27  LYS A N    1  
ATOM   390   C  CA   . LYS A 1 27 ? 132.092 5.784   -12.262 1.00 0.00 ? 27  LYS A CA   1  
ATOM   391   C  C    . LYS A 1 27 ? 131.298 4.720   -11.509 1.00 0.00 ? 27  LYS A C    1  
ATOM   392   O  O    . LYS A 1 27 ? 130.435 4.035   -12.069 1.00 0.00 ? 27  LYS A O    1  
ATOM   393   C  CB   . LYS A 1 27 ? 131.326 7.107   -12.213 1.00 0.00 ? 27  LYS A CB   1  
ATOM   394   C  CG   . LYS A 1 27 ? 132.192 8.218   -12.808 1.00 0.00 ? 27  LYS A CG   1  
ATOM   395   C  CD   . LYS A 1 27 ? 131.477 9.562   -12.653 1.00 0.00 ? 27  LYS A CD   1  
ATOM   396   C  CE   . LYS A 1 27 ? 132.288 10.653  -13.357 1.00 0.00 ? 27  LYS A CE   1  
ATOM   397   N  NZ   . LYS A 1 27 ? 131.559 11.950  -13.264 1.00 0.00 ? 27  LYS A NZ   1  
ATOM   398   H  H    . LYS A 1 27 ? 131.616 5.236   -14.264 1.00 0.00 ? 27  LYS A H    1  
ATOM   399   H  HA   . LYS A 1 27 ? 133.033 5.926   -11.751 1.00 0.00 ? 27  LYS A HA   1  
ATOM   400   H  HB2  . LYS A 1 27 ? 130.413 7.015   -12.784 1.00 0.00 ? 27  LYS A HB2  1  
ATOM   401   H  HB3  . LYS A 1 27 ? 131.088 7.348   -11.188 1.00 0.00 ? 27  LYS A HB3  1  
ATOM   402   H  HG2  . LYS A 1 27 ? 133.139 8.252   -12.290 1.00 0.00 ? 27  LYS A HG2  1  
ATOM   403   H  HG3  . LYS A 1 27 ? 132.361 8.022   -13.856 1.00 0.00 ? 27  LYS A HG3  1  
ATOM   404   H  HD2  . LYS A 1 27 ? 130.494 9.501   -13.096 1.00 0.00 ? 27  LYS A HD2  1  
ATOM   405   H  HD3  . LYS A 1 27 ? 131.387 9.804   -11.605 1.00 0.00 ? 27  LYS A HD3  1  
ATOM   406   H  HE2  . LYS A 1 27 ? 133.252 10.748  -12.881 1.00 0.00 ? 27  LYS A HE2  1  
ATOM   407   H  HE3  . LYS A 1 27 ? 132.422 10.389  -14.395 1.00 0.00 ? 27  LYS A HE3  1  
ATOM   408   H  HZ1  . LYS A 1 27 ? 130.899 12.035  -14.063 1.00 0.00 ? 27  LYS A HZ1  1  
ATOM   409   H  HZ2  . LYS A 1 27 ? 132.243 12.734  -13.294 1.00 0.00 ? 27  LYS A HZ2  1  
ATOM   410   H  HZ3  . LYS A 1 27 ? 131.026 11.986  -12.373 1.00 0.00 ? 27  LYS A HZ3  1  
ATOM   411   N  N    . LEU A 1 28 ? 131.587 4.629   -10.215 1.00 0.00 ? 28  LEU A N    1  
ATOM   412   C  CA   . LEU A 1 28 ? 130.894 3.702   -9.331  1.00 0.00 ? 28  LEU A CA   1  
ATOM   413   C  C    . LEU A 1 28 ? 129.941 4.495   -8.436  1.00 0.00 ? 28  LEU A C    1  
ATOM   414   O  O    . LEU A 1 28 ? 130.370 5.413   -7.737  1.00 0.00 ? 28  LEU A O    1  
ATOM   415   C  CB   . LEU A 1 28 ? 131.926 2.974   -8.458  1.00 0.00 ? 28  LEU A CB   1  
ATOM   416   C  CG   . LEU A 1 28 ? 131.248 1.912   -7.585  1.00 0.00 ? 28  LEU A CG   1  
ATOM   417   C  CD1  . LEU A 1 28 ? 130.993 0.645   -8.402  1.00 0.00 ? 28  LEU A CD1  1  
ATOM   418   C  CD2  . LEU A 1 28 ? 132.157 1.576   -6.405  1.00 0.00 ? 28  LEU A CD2  1  
ATOM   419   H  H    . LEU A 1 28 ? 132.266 5.226   -9.836  1.00 0.00 ? 28  LEU A H    1  
ATOM   420   H  HA   . LEU A 1 28 ? 130.338 2.987   -9.915  1.00 0.00 ? 28  LEU A HA   1  
ATOM   421   H  HB2  . LEU A 1 28 ? 132.658 2.497   -9.095  1.00 0.00 ? 28  LEU A HB2  1  
ATOM   422   H  HB3  . LEU A 1 28 ? 132.423 3.692   -7.822  1.00 0.00 ? 28  LEU A HB3  1  
ATOM   423   H  HG   . LEU A 1 28 ? 130.307 2.296   -7.218  1.00 0.00 ? 28  LEU A HG   1  
ATOM   424   H  HD11 . LEU A 1 28 ? 130.590 -0.121  -7.757  1.00 0.00 ? 28  LEU A HD11 1  
ATOM   425   H  HD12 . LEU A 1 28 ? 131.922 0.302   -8.828  1.00 0.00 ? 28  LEU A HD12 1  
ATOM   426   H  HD13 . LEU A 1 28 ? 130.294 0.855   -9.191  1.00 0.00 ? 28  LEU A HD13 1  
ATOM   427   H  HD21 . LEU A 1 28 ? 131.639 0.908   -5.734  1.00 0.00 ? 28  LEU A HD21 1  
ATOM   428   H  HD22 . LEU A 1 28 ? 132.419 2.483   -5.880  1.00 0.00 ? 28  LEU A HD22 1  
ATOM   429   H  HD23 . LEU A 1 28 ? 133.054 1.097   -6.766  1.00 0.00 ? 28  LEU A HD23 1  
ATOM   430   N  N    . SER A 1 29 ? 128.661 4.140   -8.436  1.00 0.00 ? 29  SER A N    1  
ATOM   431   C  CA   . SER A 1 29 ? 127.703 4.846   -7.588  1.00 0.00 ? 29  SER A CA   1  
ATOM   432   C  C    . SER A 1 29 ? 127.737 4.262   -6.183  1.00 0.00 ? 29  SER A C    1  
ATOM   433   O  O    . SER A 1 29 ? 128.190 3.132   -5.987  1.00 0.00 ? 29  SER A O    1  
ATOM   434   C  CB   . SER A 1 29 ? 126.290 4.743   -8.162  1.00 0.00 ? 29  SER A CB   1  
ATOM   435   O  OG   . SER A 1 29 ? 125.788 3.437   -7.942  1.00 0.00 ? 29  SER A OG   1  
ATOM   436   H  H    . SER A 1 29 ? 128.360 3.396   -8.997  1.00 0.00 ? 29  SER A H    1  
ATOM   437   H  HA   . SER A 1 29 ? 127.985 5.888   -7.539  1.00 0.00 ? 29  SER A HA   1  
ATOM   438   H  HB2  . SER A 1 29 ? 125.649 5.456   -7.674  1.00 0.00 ? 29  SER A HB2  1  
ATOM   439   H  HB3  . SER A 1 29 ? 126.319 4.955   -9.224  1.00 0.00 ? 29  SER A HB3  1  
ATOM   440   H  HG   . SER A 1 29 ? 126.368 2.996   -7.317  1.00 0.00 ? 29  SER A HG   1  
ATOM   441   N  N    . LYS A 1 30 ? 127.261 5.018   -5.199  1.00 0.00 ? 30  LYS A N    1  
ATOM   442   C  CA   . LYS A 1 30 ? 127.267 4.512   -3.837  1.00 0.00 ? 30  LYS A CA   1  
ATOM   443   C  C    . LYS A 1 30 ? 126.474 3.219   -3.756  1.00 0.00 ? 30  LYS A C    1  
ATOM   444   O  O    . LYS A 1 30 ? 126.857 2.298   -3.042  1.00 0.00 ? 30  LYS A O    1  
ATOM   445   C  CB   . LYS A 1 30 ? 126.647 5.509   -2.862  1.00 0.00 ? 30  LYS A CB   1  
ATOM   446   C  CG   . LYS A 1 30 ? 126.902 5.015   -1.432  1.00 0.00 ? 30  LYS A CG   1  
ATOM   447   C  CD   . LYS A 1 30 ? 125.956 5.713   -0.461  1.00 0.00 ? 30  LYS A CD   1  
ATOM   448   C  CE   . LYS A 1 30 ? 126.331 7.190   -0.323  1.00 0.00 ? 30  LYS A CE   1  
ATOM   449   N  NZ   . LYS A 1 30 ? 125.641 7.977   -1.384  1.00 0.00 ? 30  LYS A NZ   1  
ATOM   450   H  H    . LYS A 1 30 ? 126.908 5.912   -5.391  1.00 0.00 ? 30  LYS A H    1  
ATOM   451   H  HA   . LYS A 1 30 ? 128.287 4.318   -3.538  1.00 0.00 ? 30  LYS A HA   1  
ATOM   452   H  HB2  . LYS A 1 30 ? 127.101 6.481   -2.999  1.00 0.00 ? 30  LYS A HB2  1  
ATOM   453   H  HB3  . LYS A 1 30 ? 125.584 5.575   -3.034  1.00 0.00 ? 30  LYS A HB3  1  
ATOM   454   H  HG2  . LYS A 1 30 ? 126.739 3.949   -1.382  1.00 0.00 ? 30  LYS A HG2  1  
ATOM   455   H  HG3  . LYS A 1 30 ? 127.923 5.230   -1.156  1.00 0.00 ? 30  LYS A HG3  1  
ATOM   456   H  HD2  . LYS A 1 30 ? 124.946 5.628   -0.831  1.00 0.00 ? 30  LYS A HD2  1  
ATOM   457   H  HD3  . LYS A 1 30 ? 126.024 5.232   0.503   1.00 0.00 ? 30  LYS A HD3  1  
ATOM   458   H  HE2  . LYS A 1 30 ? 126.024 7.549   0.648   1.00 0.00 ? 30  LYS A HE2  1  
ATOM   459   H  HE3  . LYS A 1 30 ? 127.399 7.306   -0.427  1.00 0.00 ? 30  LYS A HE3  1  
ATOM   460   H  HZ1  . LYS A 1 30 ? 125.167 8.797   -0.954  1.00 0.00 ? 30  LYS A HZ1  1  
ATOM   461   H  HZ2  . LYS A 1 30 ? 124.936 7.376   -1.858  1.00 0.00 ? 30  LYS A HZ2  1  
ATOM   462   H  HZ3  . LYS A 1 30 ? 126.338 8.310   -2.080  1.00 0.00 ? 30  LYS A HZ3  1  
ATOM   463   N  N    . LYS A 1 31 ? 125.360 3.154   -4.476  1.00 0.00 ? 31  LYS A N    1  
ATOM   464   C  CA   . LYS A 1 31 ? 124.543 1.954   -4.441  1.00 0.00 ? 31  LYS A CA   1  
ATOM   465   C  C    . LYS A 1 31 ? 125.369 0.755   -4.876  1.00 0.00 ? 31  LYS A C    1  
ATOM   466   O  O    . LYS A 1 31 ? 125.303 -0.312  -4.266  1.00 0.00 ? 31  LYS A O    1  
ATOM   467   C  CB   . LYS A 1 31 ? 123.338 2.113   -5.369  1.00 0.00 ? 31  LYS A CB   1  
ATOM   468   C  CG   . LYS A 1 31 ? 122.417 0.900   -5.226  1.00 0.00 ? 31  LYS A CG   1  
ATOM   469   C  CD   . LYS A 1 31 ? 121.247 1.031   -6.204  1.00 0.00 ? 31  LYS A CD   1  
ATOM   470   C  CE   . LYS A 1 31 ? 120.245 -0.098  -5.958  1.00 0.00 ? 31  LYS A CE   1  
ATOM   471   N  NZ   . LYS A 1 31 ? 119.197 -0.069  -7.017  1.00 0.00 ? 31  LYS A NZ   1  
ATOM   472   H  H    . LYS A 1 31 ? 125.087 3.917   -5.026  1.00 0.00 ? 31  LYS A H    1  
ATOM   473   H  HA   . LYS A 1 31 ? 124.193 1.794   -3.432  1.00 0.00 ? 31  LYS A HA   1  
ATOM   474   H  HB2  . LYS A 1 31 ? 122.797 3.010   -5.105  1.00 0.00 ? 31  LYS A HB2  1  
ATOM   475   H  HB3  . LYS A 1 31 ? 123.678 2.186   -6.391  1.00 0.00 ? 31  LYS A HB3  1  
ATOM   476   H  HG2  . LYS A 1 31 ? 122.972 -0.001  -5.446  1.00 0.00 ? 31  LYS A HG2  1  
ATOM   477   H  HG3  . LYS A 1 31 ? 122.037 0.853   -4.218  1.00 0.00 ? 31  LYS A HG3  1  
ATOM   478   H  HD2  . LYS A 1 31 ? 120.761 1.984   -6.056  1.00 0.00 ? 31  LYS A HD2  1  
ATOM   479   H  HD3  . LYS A 1 31 ? 121.616 0.969   -7.216  1.00 0.00 ? 31  LYS A HD3  1  
ATOM   480   H  HE2  . LYS A 1 31 ? 120.759 -1.047  -5.987  1.00 0.00 ? 31  LYS A HE2  1  
ATOM   481   H  HE3  . LYS A 1 31 ? 119.785 0.033   -4.991  1.00 0.00 ? 31  LYS A HE3  1  
ATOM   482   H  HZ1  . LYS A 1 31 ? 118.354 -0.579  -6.684  1.00 0.00 ? 31  LYS A HZ1  1  
ATOM   483   H  HZ2  . LYS A 1 31 ? 119.561 -0.527  -7.878  1.00 0.00 ? 31  LYS A HZ2  1  
ATOM   484   H  HZ3  . LYS A 1 31 ? 118.943 0.916   -7.227  1.00 0.00 ? 31  LYS A HZ3  1  
ATOM   485   N  N    . GLU A 1 32 ? 126.167 0.945   -5.921  1.00 0.00 ? 32  GLU A N    1  
ATOM   486   C  CA   . GLU A 1 32 ? 127.019 -0.128  -6.404  1.00 0.00 ? 32  GLU A CA   1  
ATOM   487   C  C    . GLU A 1 32 ? 128.085 -0.457  -5.359  1.00 0.00 ? 32  GLU A C    1  
ATOM   488   O  O    . GLU A 1 32 ? 128.420 -1.624  -5.137  1.00 0.00 ? 32  GLU A O    1  
ATOM   489   C  CB   . GLU A 1 32 ? 127.670 0.304   -7.727  1.00 0.00 ? 32  GLU A CB   1  
ATOM   490   C  CG   . GLU A 1 32 ? 126.566 0.489   -8.773  1.00 0.00 ? 32  GLU A CG   1  
ATOM   491   C  CD   . GLU A 1 32 ? 127.133 0.895   -10.137 1.00 0.00 ? 32  GLU A CD   1  
ATOM   492   O  OE1  . GLU A 1 32 ? 128.328 1.140   -10.241 1.00 0.00 ? 32  GLU A OE1  1  
ATOM   493   O  OE2  . GLU A 1 32 ? 126.348 0.981   -11.060 1.00 0.00 ? 32  GLU A OE2  1  
ATOM   494   H  H    . GLU A 1 32 ? 126.194 1.820   -6.359  1.00 0.00 ? 32  GLU A H    1  
ATOM   495   H  HA   . GLU A 1 32 ? 126.416 -1.006  -6.580  1.00 0.00 ? 32  GLU A HA   1  
ATOM   496   H  HB2  . GLU A 1 32 ? 128.199 1.236   -7.585  1.00 0.00 ? 32  GLU A HB2  1  
ATOM   497   H  HB3  . GLU A 1 32 ? 128.357 -0.457  -8.060  1.00 0.00 ? 32  GLU A HB3  1  
ATOM   498   H  HG2  . GLU A 1 32 ? 126.030 -0.442  -8.882  1.00 0.00 ? 32  GLU A HG2  1  
ATOM   499   H  HG3  . GLU A 1 32 ? 125.880 1.247   -8.434  1.00 0.00 ? 32  GLU A HG3  1  
ATOM   500   N  N    . LEU A 1 33 ? 128.608 0.587   -4.706  1.00 0.00 ? 33  LEU A N    1  
ATOM   501   C  CA   . LEU A 1 33 ? 129.630 0.394   -3.679  1.00 0.00 ? 33  LEU A CA   1  
ATOM   502   C  C    . LEU A 1 33 ? 129.089 -0.377  -2.478  1.00 0.00 ? 33  LEU A C    1  
ATOM   503   O  O    . LEU A 1 33 ? 129.756 -1.275  -1.959  1.00 0.00 ? 33  LEU A O    1  
ATOM   504   C  CB   . LEU A 1 33 ? 130.151 1.759   -3.213  1.00 0.00 ? 33  LEU A CB   1  
ATOM   505   C  CG   . LEU A 1 33 ? 131.275 1.578   -2.179  1.00 0.00 ? 33  LEU A CG   1  
ATOM   506   C  CD1  . LEU A 1 33 ? 132.537 1.050   -2.865  1.00 0.00 ? 33  LEU A CD1  1  
ATOM   507   C  CD2  . LEU A 1 33 ? 131.590 2.925   -1.518  1.00 0.00 ? 33  LEU A CD2  1  
ATOM   508   H  H    . LEU A 1 33 ? 128.299 1.495   -4.918  1.00 0.00 ? 33  LEU A H    1  
ATOM   509   H  HA   . LEU A 1 33 ? 130.449 -0.160  -4.106  1.00 0.00 ? 33  LEU A HA   1  
ATOM   510   H  HB2  . LEU A 1 33 ? 130.530 2.306   -4.064  1.00 0.00 ? 33  LEU A HB2  1  
ATOM   511   H  HB3  . LEU A 1 33 ? 129.338 2.311   -2.767  1.00 0.00 ? 33  LEU A HB3  1  
ATOM   512   H  HG   . LEU A 1 33 ? 130.964 0.875   -1.422  1.00 0.00 ? 33  LEU A HG   1  
ATOM   513   H  HD11 . LEU A 1 33 ? 132.671 1.552   -3.811  1.00 0.00 ? 33  LEU A HD11 1  
ATOM   514   H  HD12 . LEU A 1 33 ? 132.441 -0.013  -3.031  1.00 0.00 ? 33  LEU A HD12 1  
ATOM   515   H  HD13 . LEU A 1 33 ? 133.394 1.239   -2.235  1.00 0.00 ? 33  LEU A HD13 1  
ATOM   516   H  HD21 . LEU A 1 33 ? 130.688 3.514   -1.440  1.00 0.00 ? 33  LEU A HD21 1  
ATOM   517   H  HD22 . LEU A 1 33 ? 132.316 3.460   -2.112  1.00 0.00 ? 33  LEU A HD22 1  
ATOM   518   H  HD23 . LEU A 1 33 ? 131.988 2.751   -0.532  1.00 0.00 ? 33  LEU A HD23 1  
ATOM   519   N  N    . LYS A 1 34 ? 127.885 -0.023  -2.027  1.00 0.00 ? 34  LYS A N    1  
ATOM   520   C  CA   . LYS A 1 34 ? 127.302 -0.688  -0.890  1.00 0.00 ? 34  LYS A CA   1  
ATOM   521   C  C    . LYS A 1 34 ? 127.128 -2.172  -1.160  1.00 0.00 ? 34  LYS A C    1  
ATOM   522   O  O    . LYS A 1 34 ? 127.474 -3.013  -0.329  1.00 0.00 ? 34  LYS A O    1  
ATOM   523   C  CB   . LYS A 1 34 ? 125.950 -0.053  -0.635  1.00 0.00 ? 34  LYS A CB   1  
ATOM   524   C  CG   . LYS A 1 34 ? 125.340 -0.630  0.624   1.00 0.00 ? 34  LYS A CG   1  
ATOM   525   C  CD   . LYS A 1 34 ? 124.027 0.088   0.885   1.00 0.00 ? 34  LYS A CD   1  
ATOM   526   C  CE   . LYS A 1 34 ? 123.007 -0.279  -0.196  1.00 0.00 ? 34  LYS A CE   1  
ATOM   527   N  NZ   . LYS A 1 34 ? 121.630 -0.118  0.349   1.00 0.00 ? 34  LYS A NZ   1  
ATOM   528   H  H    . LYS A 1 34 ? 127.384 0.707   -2.453  1.00 0.00 ? 34  LYS A H    1  
ATOM   529   H  HA   . LYS A 1 34 ? 127.929 -0.547  -0.025  1.00 0.00 ? 34  LYS A HA   1  
ATOM   530   H  HB2  . LYS A 1 34 ? 126.072 1.014   -0.519  1.00 0.00 ? 34  LYS A HB2  1  
ATOM   531   H  HB3  . LYS A 1 34 ? 125.297 -0.251  -1.472  1.00 0.00 ? 34  LYS A HB3  1  
ATOM   532   H  HG2  . LYS A 1 34 ? 125.164 -1.687  0.492   1.00 0.00 ? 34  LYS A HG2  1  
ATOM   533   H  HG3  . LYS A 1 34 ? 126.008 -0.471  1.457   1.00 0.00 ? 34  LYS A HG3  1  
ATOM   534   H  HD2  . LYS A 1 34 ? 123.662 -0.207  1.838   1.00 0.00 ? 34  LYS A HD2  1  
ATOM   535   H  HD3  . LYS A 1 34 ? 124.190 1.155   0.874   1.00 0.00 ? 34  LYS A HD3  1  
ATOM   536   H  HE2  . LYS A 1 34 ? 123.136 0.371   -1.048  1.00 0.00 ? 34  LYS A HE2  1  
ATOM   537   H  HE3  . LYS A 1 34 ? 123.155 -1.305  -0.501  1.00 0.00 ? 34  LYS A HE3  1  
ATOM   538   H  HZ1  . LYS A 1 34 ? 120.937 -0.228  -0.418  1.00 0.00 ? 34  LYS A HZ1  1  
ATOM   539   H  HZ2  . LYS A 1 34 ? 121.534 0.829   0.772   1.00 0.00 ? 34  LYS A HZ2  1  
ATOM   540   H  HZ3  . LYS A 1 34 ? 121.457 -0.841  1.075   1.00 0.00 ? 34  LYS A HZ3  1  
ATOM   541   N  N    . GLU A 1 35 ? 126.600 -2.486  -2.335  1.00 0.00 ? 35  GLU A N    1  
ATOM   542   C  CA   . GLU A 1 35 ? 126.400 -3.873  -2.710  1.00 0.00 ? 35  GLU A CA   1  
ATOM   543   C  C    . GLU A 1 35 ? 127.734 -4.592  -2.845  1.00 0.00 ? 35  GLU A C    1  
ATOM   544   O  O    . GLU A 1 35 ? 127.866 -5.752  -2.456  1.00 0.00 ? 35  GLU A O    1  
ATOM   545   C  CB   . GLU A 1 35 ? 125.640 -3.951  -4.034  1.00 0.00 ? 35  GLU A CB   1  
ATOM   546   C  CG   . GLU A 1 35 ? 125.314 -5.412  -4.350  1.00 0.00 ? 35  GLU A CG   1  
ATOM   547   C  CD   . GLU A 1 35 ? 124.645 -5.514  -5.718  1.00 0.00 ? 35  GLU A CD   1  
ATOM   548   O  OE1  . GLU A 1 35 ? 124.490 -4.486  -6.356  1.00 0.00 ? 35  GLU A OE1  1  
ATOM   549   O  OE2  . GLU A 1 35 ? 124.300 -6.618  -6.105  1.00 0.00 ? 35  GLU A OE2  1  
ATOM   550   H  H    . GLU A 1 35 ? 126.349 -1.773  -2.957  1.00 0.00 ? 35  GLU A H    1  
ATOM   551   H  HA   . GLU A 1 35 ? 125.815 -4.361  -1.945  1.00 0.00 ? 35  GLU A HA   1  
ATOM   552   H  HB2  . GLU A 1 35 ? 124.723 -3.386  -3.958  1.00 0.00 ? 35  GLU A HB2  1  
ATOM   553   H  HB3  . GLU A 1 35 ? 126.251 -3.542  -4.825  1.00 0.00 ? 35  GLU A HB3  1  
ATOM   554   H  HG2  . GLU A 1 35 ? 126.226 -5.990  -4.353  1.00 0.00 ? 35  GLU A HG2  1  
ATOM   555   H  HG3  . GLU A 1 35 ? 124.645 -5.801  -3.597  1.00 0.00 ? 35  GLU A HG3  1  
ATOM   556   N  N    . LEU A 1 36 ? 128.722 -3.901  -3.416  1.00 0.00 ? 36  LEU A N    1  
ATOM   557   C  CA   . LEU A 1 36 ? 130.033 -4.510  -3.606  1.00 0.00 ? 36  LEU A CA   1  
ATOM   558   C  C    . LEU A 1 36 ? 130.681 -4.909  -2.287  1.00 0.00 ? 36  LEU A C    1  
ATOM   559   O  O    . LEU A 1 36 ? 131.115 -6.053  -2.122  1.00 0.00 ? 36  LEU A O    1  
ATOM   560   C  CB   . LEU A 1 36 ? 130.940 -3.505  -4.329  1.00 0.00 ? 36  LEU A CB   1  
ATOM   561   C  CG   . LEU A 1 36 ? 132.335 -4.098  -4.551  1.00 0.00 ? 36  LEU A CG   1  
ATOM   562   C  CD1  . LEU A 1 36 ? 132.259 -5.235  -5.562  1.00 0.00 ? 36  LEU A CD1  1  
ATOM   563   C  CD2  . LEU A 1 36 ? 133.262 -3.008  -5.094  1.00 0.00 ? 36  LEU A CD2  1  
ATOM   564   H  H    . LEU A 1 36 ? 128.562 -2.980  -3.724  1.00 0.00 ? 36  LEU A H    1  
ATOM   565   H  HA   . LEU A 1 36 ? 129.928 -5.386  -4.226  1.00 0.00 ? 36  LEU A HA   1  
ATOM   566   H  HB2  . LEU A 1 36 ? 130.502 -3.254  -5.283  1.00 0.00 ? 36  LEU A HB2  1  
ATOM   567   H  HB3  . LEU A 1 36 ? 131.025 -2.610  -3.731  1.00 0.00 ? 36  LEU A HB3  1  
ATOM   568   H  HG   . LEU A 1 36 ? 132.731 -4.471  -3.619  1.00 0.00 ? 36  LEU A HG   1  
ATOM   569   H  HD11 . LEU A 1 36 ? 133.238 -5.401  -5.980  1.00 0.00 ? 36  LEU A HD11 1  
ATOM   570   H  HD12 . LEU A 1 36 ? 131.570 -4.972  -6.347  1.00 0.00 ? 36  LEU A HD12 1  
ATOM   571   H  HD13 . LEU A 1 36 ? 131.920 -6.133  -5.069  1.00 0.00 ? 36  LEU A HD13 1  
ATOM   572   H  HD21 . LEU A 1 36 ? 133.167 -2.120  -4.486  1.00 0.00 ? 36  LEU A HD21 1  
ATOM   573   H  HD22 . LEU A 1 36 ? 132.988 -2.776  -6.113  1.00 0.00 ? 36  LEU A HD22 1  
ATOM   574   H  HD23 . LEU A 1 36 ? 134.283 -3.356  -5.066  1.00 0.00 ? 36  LEU A HD23 1  
ATOM   575   N  N    . LEU A 1 37 ? 130.751 -3.973  -1.347  1.00 0.00 ? 37  LEU A N    1  
ATOM   576   C  CA   . LEU A 1 37 ? 131.363 -4.274  -0.063  1.00 0.00 ? 37  LEU A CA   1  
ATOM   577   C  C    . LEU A 1 37 ? 130.515 -5.207  0.780   1.00 0.00 ? 37  LEU A C    1  
ATOM   578   O  O    . LEU A 1 37 ? 131.043 -6.052  1.492   1.00 0.00 ? 37  LEU A O    1  
ATOM   579   C  CB   . LEU A 1 37 ? 131.657 -2.992  0.720   1.00 0.00 ? 37  LEU A CB   1  
ATOM   580   C  CG   . LEU A 1 37 ? 132.589 -2.074  -0.081  1.00 0.00 ? 37  LEU A CG   1  
ATOM   581   C  CD1  . LEU A 1 37 ? 133.017 -0.910  0.807   1.00 0.00 ? 37  LEU A CD1  1  
ATOM   582   C  CD2  . LEU A 1 37 ? 133.840 -2.837  -0.532  1.00 0.00 ? 37  LEU A CD2  1  
ATOM   583   H  H    . LEU A 1 37 ? 130.393 -3.074  -1.523  1.00 0.00 ? 37  LEU A H    1  
ATOM   584   H  HA   . LEU A 1 37 ? 132.297 -4.775  -0.251  1.00 0.00 ? 37  LEU A HA   1  
ATOM   585   H  HB2  . LEU A 1 37 ? 130.729 -2.475  0.917   1.00 0.00 ? 37  LEU A HB2  1  
ATOM   586   H  HB3  . LEU A 1 37 ? 132.128 -3.248  1.657   1.00 0.00 ? 37  LEU A HB3  1  
ATOM   587   H  HG   . LEU A 1 37 ? 132.064 -1.693  -0.945  1.00 0.00 ? 37  LEU A HG   1  
ATOM   588   H  HD11 . LEU A 1 37 ? 133.709 -0.283  0.268   1.00 0.00 ? 37  LEU A HD11 1  
ATOM   589   H  HD12 . LEU A 1 37 ? 133.498 -1.300  1.692   1.00 0.00 ? 37  LEU A HD12 1  
ATOM   590   H  HD13 . LEU A 1 37 ? 132.150 -0.335  1.091   1.00 0.00 ? 37  LEU A HD13 1  
ATOM   591   H  HD21 . LEU A 1 37 ? 134.136 -3.534  0.240   1.00 0.00 ? 37  LEU A HD21 1  
ATOM   592   H  HD22 . LEU A 1 37 ? 134.643 -2.138  -0.710  1.00 0.00 ? 37  LEU A HD22 1  
ATOM   593   H  HD23 . LEU A 1 37 ? 133.627 -3.377  -1.443  1.00 0.00 ? 37  LEU A HD23 1  
ATOM   594   N  N    . GLN A 1 38 ? 129.201 -5.048  0.737   1.00 0.00 ? 38  GLN A N    1  
ATOM   595   C  CA   . GLN A 1 38 ? 128.364 -5.903  1.556   1.00 0.00 ? 38  GLN A CA   1  
ATOM   596   C  C    . GLN A 1 38 ? 128.526 -7.368  1.165   1.00 0.00 ? 38  GLN A C    1  
ATOM   597   O  O    . GLN A 1 38 ? 128.680 -8.230  2.025   1.00 0.00 ? 38  GLN A O    1  
ATOM   598   C  CB   . GLN A 1 38 ? 126.898 -5.491  1.404   1.00 0.00 ? 38  GLN A CB   1  
ATOM   599   C  CG   . GLN A 1 38 ? 126.040 -6.271  2.402   1.00 0.00 ? 38  GLN A CG   1  
ATOM   600   C  CD   . GLN A 1 38 ? 124.582 -5.842  2.284   1.00 0.00 ? 38  GLN A CD   1  
ATOM   601   O  OE1  . GLN A 1 38 ? 124.271 -4.886  1.573   1.00 0.00 ? 38  GLN A OE1  1  
ATOM   602   N  NE2  . GLN A 1 38 ? 123.664 -6.494  2.943   1.00 0.00 ? 38  GLN A NE2  1  
ATOM   603   H  H    . GLN A 1 38 ? 128.803 -4.348  0.178   1.00 0.00 ? 38  GLN A H    1  
ATOM   604   H  HA   . GLN A 1 38 ? 128.650 -5.785  2.590   1.00 0.00 ? 38  GLN A HA   1  
ATOM   605   H  HB2  . GLN A 1 38 ? 126.800 -4.432  1.596   1.00 0.00 ? 38  GLN A HB2  1  
ATOM   606   H  HB3  . GLN A 1 38 ? 126.565 -5.708  0.400   1.00 0.00 ? 38  GLN A HB3  1  
ATOM   607   H  HG2  . GLN A 1 38 ? 126.120 -7.327  2.193   1.00 0.00 ? 38  GLN A HG2  1  
ATOM   608   H  HG3  . GLN A 1 38 ? 126.390 -6.077  3.405   1.00 0.00 ? 38  GLN A HG3  1  
ATOM   609   H  HE21 . GLN A 1 38 ? 123.913 -7.254  3.509   1.00 0.00 ? 38  GLN A HE21 1  
ATOM   610   H  HE22 . GLN A 1 38 ? 122.724 -6.224  2.873   1.00 0.00 ? 38  GLN A HE22 1  
ATOM   611   N  N    . THR A 1 39 ? 128.493 -7.643  -0.136  1.00 0.00 ? 39  THR A N    1  
ATOM   612   C  CA   . THR A 1 39 ? 128.638 -9.015  -0.614  1.00 0.00 ? 39  THR A CA   1  
ATOM   613   C  C    . THR A 1 39 ? 130.080 -9.532  -0.557  1.00 0.00 ? 39  THR A C    1  
ATOM   614   O  O    . THR A 1 39 ? 130.329 -10.651 -0.110  1.00 0.00 ? 39  THR A O    1  
ATOM   615   C  CB   . THR A 1 39 ? 128.131 -9.108  -2.054  1.00 0.00 ? 39  THR A CB   1  
ATOM   616   O  OG1  . THR A 1 39 ? 126.797 -8.621  -2.117  1.00 0.00 ? 39  THR A OG1  1  
ATOM   617   C  CG2  . THR A 1 39 ? 128.166 -10.565 -2.518  1.00 0.00 ? 39  THR A CG2  1  
ATOM   618   H  H    . THR A 1 39 ? 128.368 -6.916  -0.781  1.00 0.00 ? 39  THR A H    1  
ATOM   619   H  HA   . THR A 1 39 ? 128.023 -9.655  -0.002  1.00 0.00 ? 39  THR A HA   1  
ATOM   620   H  HB   . THR A 1 39 ? 128.762 -8.514  -2.698  1.00 0.00 ? 39  THR A HB   1  
ATOM   621   H  HG1  . THR A 1 39 ? 126.551 -8.319  -1.239  1.00 0.00 ? 39  THR A HG1  1  
ATOM   622   H  HG21 . THR A 1 39 ? 129.180 -10.837 -2.771  1.00 0.00 ? 39  THR A HG21 1  
ATOM   623   H  HG22 . THR A 1 39 ? 127.535 -10.681 -3.386  1.00 0.00 ? 39  THR A HG22 1  
ATOM   624   H  HG23 . THR A 1 39 ? 127.809 -11.203 -1.724  1.00 0.00 ? 39  THR A HG23 1  
ATOM   625   N  N    . GLU A 1 40 ? 131.017 -8.731  -1.069  1.00 0.00 ? 40  GLU A N    1  
ATOM   626   C  CA   . GLU A 1 40 ? 132.421 -9.146  -1.130  1.00 0.00 ? 40  GLU A CA   1  
ATOM   627   C  C    . GLU A 1 40 ? 133.154 -9.066  0.210   1.00 0.00 ? 40  GLU A C    1  
ATOM   628   O  O    . GLU A 1 40 ? 134.073 -9.846  0.462   1.00 0.00 ? 40  GLU A O    1  
ATOM   629   C  CB   . GLU A 1 40 ? 133.165 -8.289  -2.157  1.00 0.00 ? 40  GLU A CB   1  
ATOM   630   C  CG   . GLU A 1 40 ? 132.586 -8.528  -3.558  1.00 0.00 ? 40  GLU A CG   1  
ATOM   631   C  CD   . GLU A 1 40 ? 132.743 -9.989  -3.973  1.00 0.00 ? 40  GLU A CD   1  
ATOM   632   O  OE1  . GLU A 1 40 ? 133.550 -10.676 -3.372  1.00 0.00 ? 40  GLU A OE1  1  
ATOM   633   O  OE2  . GLU A 1 40 ? 132.056 -10.397 -4.895  1.00 0.00 ? 40  GLU A OE2  1  
ATOM   634   H  H    . GLU A 1 40 ? 130.754 -7.864  -1.453  1.00 0.00 ? 40  GLU A H    1  
ATOM   635   H  HA   . GLU A 1 40 ? 132.451 -10.169 -1.463  1.00 0.00 ? 40  GLU A HA   1  
ATOM   636   H  HB2  . GLU A 1 40 ? 133.059 -7.246  -1.898  1.00 0.00 ? 40  GLU A HB2  1  
ATOM   637   H  HB3  . GLU A 1 40 ? 134.211 -8.555  -2.154  1.00 0.00 ? 40  GLU A HB3  1  
ATOM   638   H  HG2  . GLU A 1 40 ? 131.538 -8.270  -3.559  1.00 0.00 ? 40  GLU A HG2  1  
ATOM   639   H  HG3  . GLU A 1 40 ? 133.107 -7.902  -4.267  1.00 0.00 ? 40  GLU A HG3  1  
ATOM   640   N  N    . LEU A 1 41 ? 132.795 -8.097  1.043   1.00 0.00 ? 41  LEU A N    1  
ATOM   641   C  CA   . LEU A 1 41 ? 133.487 -7.908  2.319   1.00 0.00 ? 41  LEU A CA   1  
ATOM   642   C  C    . LEU A 1 41 ? 132.715 -8.588  3.458   1.00 0.00 ? 41  LEU A C    1  
ATOM   643   O  O    . LEU A 1 41 ? 131.477 -8.604  3.477   1.00 0.00 ? 41  LEU A O    1  
ATOM   644   C  CB   . LEU A 1 41 ? 133.677 -6.400  2.594   1.00 0.00 ? 41  LEU A CB   1  
ATOM   645   C  CG   . LEU A 1 41 ? 134.805 -6.165  3.629   1.00 0.00 ? 41  LEU A CG   1  
ATOM   646   C  CD1  . LEU A 1 41 ? 135.443 -4.796  3.372   1.00 0.00 ? 41  LEU A CD1  1  
ATOM   647   C  CD2  . LEU A 1 41 ? 134.273 -6.204  5.069   1.00 0.00 ? 41  LEU A CD2  1  
ATOM   648   H  H    . LEU A 1 41 ? 132.085 -7.474  0.782   1.00 0.00 ? 41  LEU A H    1  
ATOM   649   H  HA   . LEU A 1 41 ? 134.461 -8.368  2.244   1.00 0.00 ? 41  LEU A HA   1  
ATOM   650   H  HB2  . LEU A 1 41 ? 133.929 -5.896  1.670   1.00 0.00 ? 41  LEU A HB2  1  
ATOM   651   H  HB3  . LEU A 1 41 ? 132.755 -5.992  2.972   1.00 0.00 ? 41  LEU A HB3  1  
ATOM   652   H  HG   . LEU A 1 41 ? 135.565 -6.925  3.510   1.00 0.00 ? 41  LEU A HG   1  
ATOM   653   H  HD11 . LEU A 1 41 ? 135.889 -4.426  4.284   1.00 0.00 ? 41  LEU A HD11 1  
ATOM   654   H  HD12 . LEU A 1 41 ? 134.686 -4.104  3.035   1.00 0.00 ? 41  LEU A HD12 1  
ATOM   655   H  HD13 . LEU A 1 41 ? 136.205 -4.893  2.612   1.00 0.00 ? 41  LEU A HD13 1  
ATOM   656   H  HD21 . LEU A 1 41 ? 134.288 -7.222  5.426   1.00 0.00 ? 41  LEU A HD21 1  
ATOM   657   H  HD22 . LEU A 1 41 ? 133.266 -5.817  5.105   1.00 0.00 ? 41  LEU A HD22 1  
ATOM   658   H  HD23 . LEU A 1 41 ? 134.906 -5.599  5.702   1.00 0.00 ? 41  LEU A HD23 1  
ATOM   659   N  N    . SER A 1 42 ? 133.454 -9.155  4.403   1.00 0.00 ? 42  SER A N    1  
ATOM   660   C  CA   . SER A 1 42 ? 132.846 -9.851  5.532   1.00 0.00 ? 42  SER A CA   1  
ATOM   661   C  C    . SER A 1 42 ? 131.770 -8.975  6.156   1.00 0.00 ? 42  SER A C    1  
ATOM   662   O  O    . SER A 1 42 ? 130.831 -9.469  6.781   1.00 0.00 ? 42  SER A O    1  
ATOM   663   C  CB   . SER A 1 42 ? 133.909 -10.186 6.578   1.00 0.00 ? 42  SER A CB   1  
ATOM   664   O  OG   . SER A 1 42 ? 133.327 -10.979 7.603   1.00 0.00 ? 42  SER A OG   1  
ATOM   665   H  H    . SER A 1 42 ? 134.430 -9.117  4.333   1.00 0.00 ? 42  SER A H    1  
ATOM   666   H  HA   . SER A 1 42 ? 132.396 -10.768 5.182   1.00 0.00 ? 42  SER A HA   1  
ATOM   667   H  HB2  . SER A 1 42 ? 134.711 -10.738 6.116   1.00 0.00 ? 42  SER A HB2  1  
ATOM   668   H  HB3  . SER A 1 42 ? 134.302 -9.268  6.998   1.00 0.00 ? 42  SER A HB3  1  
ATOM   669   H  HG   . SER A 1 42 ? 133.646 -10.656 8.448   1.00 0.00 ? 42  SER A HG   1  
ATOM   670   N  N    . GLY A 1 43 ? 131.914 -7.674  5.965   1.00 0.00 ? 43  GLY A N    1  
ATOM   671   C  CA   . GLY A 1 43 ? 130.955 -6.715  6.487   1.00 0.00 ? 43  GLY A CA   1  
ATOM   672   C  C    . GLY A 1 43 ? 129.532 -7.195  6.230   1.00 0.00 ? 43  GLY A C    1  
ATOM   673   O  O    . GLY A 1 43 ? 128.578 -6.646  6.780   1.00 0.00 ? 43  GLY A O    1  
ATOM   674   H  H    . GLY A 1 43 ? 132.671 -7.354  5.448   1.00 0.00 ? 43  GLY A H    1  
ATOM   675   H  HA2  . GLY A 1 43 ? 131.109 -6.601  7.551   1.00 0.00 ? 43  GLY A HA2  1  
ATOM   676   H  HA3  . GLY A 1 43 ? 131.101 -5.763  6.000   1.00 0.00 ? 43  GLY A HA3  1  
ATOM   677   N  N    . PHE A 1 44 ? 129.389 -8.228  5.398   1.00 0.00 ? 44  PHE A N    1  
ATOM   678   C  CA   . PHE A 1 44 ? 128.061 -8.756  5.106   1.00 0.00 ? 44  PHE A CA   1  
ATOM   679   C  C    . PHE A 1 44 ? 127.315 -8.983  6.418   1.00 0.00 ? 44  PHE A C    1  
ATOM   680   O  O    . PHE A 1 44 ? 126.131 -8.669  6.531   1.00 0.00 ? 44  PHE A O    1  
ATOM   681   C  CB   . PHE A 1 44 ? 128.181 -10.092 4.367   1.00 0.00 ? 44  PHE A CB   1  
ATOM   682   C  CG   . PHE A 1 44 ? 126.808 -10.579 3.968   1.00 0.00 ? 44  PHE A CG   1  
ATOM   683   C  CD1  . PHE A 1 44 ? 126.241 -10.170 2.755   1.00 0.00 ? 44  PHE A CD1  1  
ATOM   684   C  CD2  . PHE A 1 44 ? 126.105 -11.448 4.811   1.00 0.00 ? 44  PHE A CD2  1  
ATOM   685   C  CE1  . PHE A 1 44 ? 124.969 -10.628 2.388   1.00 0.00 ? 44  PHE A CE1  1  
ATOM   686   C  CE2  . PHE A 1 44 ? 124.834 -11.905 4.444   1.00 0.00 ? 44  PHE A CE2  1  
ATOM   687   C  CZ   . PHE A 1 44 ? 124.265 -11.494 3.232   1.00 0.00 ? 44  PHE A CZ   1  
ATOM   688   H  H    . PHE A 1 44 ? 130.184 -8.636  4.978   1.00 0.00 ? 44  PHE A H    1  
ATOM   689   H  HA   . PHE A 1 44 ? 127.517 -8.053  4.495   1.00 0.00 ? 44  PHE A HA   1  
ATOM   690   H  HB2  . PHE A 1 44 ? 128.789 -9.964  3.485   1.00 0.00 ? 44  PHE A HB2  1  
ATOM   691   H  HB3  . PHE A 1 44 ? 128.642 -10.820 5.017   1.00 0.00 ? 44  PHE A HB3  1  
ATOM   692   H  HD1  . PHE A 1 44 ? 126.782 -9.504  2.103   1.00 0.00 ? 44  PHE A HD1  1  
ATOM   693   H  HD2  . PHE A 1 44 ? 126.542 -11.764 5.747   1.00 0.00 ? 44  PHE A HD2  1  
ATOM   694   H  HE1  . PHE A 1 44 ? 124.531 -10.311 1.453   1.00 0.00 ? 44  PHE A HE1  1  
ATOM   695   H  HE2  . PHE A 1 44 ? 124.292 -12.574 5.095   1.00 0.00 ? 44  PHE A HE2  1  
ATOM   696   H  HZ   . PHE A 1 44 ? 123.285 -11.847 2.949   1.00 0.00 ? 44  PHE A HZ   1  
ATOM   697   N  N    . LEU A 1 45 ? 128.027 -9.497  7.414   1.00 0.00 ? 45  LEU A N    1  
ATOM   698   C  CA   . LEU A 1 45 ? 127.435 -9.725  8.727   1.00 0.00 ? 45  LEU A CA   1  
ATOM   699   C  C    . LEU A 1 45 ? 126.892 -8.407  9.274   1.00 0.00 ? 45  LEU A C    1  
ATOM   700   O  O    . LEU A 1 45 ? 125.861 -8.371  9.945   1.00 0.00 ? 45  LEU A O    1  
ATOM   701   C  CB   . LEU A 1 45 ? 128.486 -10.295 9.684   1.00 0.00 ? 45  LEU A CB   1  
ATOM   702   C  CG   . LEU A 1 45 ? 127.833 -10.640 11.028  1.00 0.00 ? 45  LEU A CG   1  
ATOM   703   C  CD1  . LEU A 1 45 ? 126.940 -11.876 10.874  1.00 0.00 ? 45  LEU A CD1  1  
ATOM   704   C  CD2  . LEU A 1 45 ? 128.924 -10.930 12.060  1.00 0.00 ? 45  LEU A CD2  1  
ATOM   705   H  H    . LEU A 1 45 ? 128.974 -9.704  7.272   1.00 0.00 ? 45  LEU A H    1  
ATOM   706   H  HA   . LEU A 1 45 ? 126.623 -10.431 8.630   1.00 0.00 ? 45  LEU A HA   1  
ATOM   707   H  HB2  . LEU A 1 45 ? 128.921 -11.184 9.252   1.00 0.00 ? 45  LEU A HB2  1  
ATOM   708   H  HB3  . LEU A 1 45 ? 129.259 -9.559  9.844   1.00 0.00 ? 45  LEU A HB3  1  
ATOM   709   H  HG   . LEU A 1 45 ? 127.234 -9.805  11.361  1.00 0.00 ? 45  LEU A HG   1  
ATOM   710   H  HD11 . LEU A 1 45 ? 126.814 -12.350 11.836  1.00 0.00 ? 45  LEU A HD11 1  
ATOM   711   H  HD12 . LEU A 1 45 ? 127.398 -12.573 10.188  1.00 0.00 ? 45  LEU A HD12 1  
ATOM   712   H  HD13 . LEU A 1 45 ? 125.975 -11.578 10.492  1.00 0.00 ? 45  LEU A HD13 1  
ATOM   713   H  HD21 . LEU A 1 45 ? 129.613 -11.658 11.660  1.00 0.00 ? 45  LEU A HD21 1  
ATOM   714   H  HD22 . LEU A 1 45 ? 128.473 -11.319 12.961  1.00 0.00 ? 45  LEU A HD22 1  
ATOM   715   H  HD23 . LEU A 1 45 ? 129.455 -10.019 12.288  1.00 0.00 ? 45  LEU A HD23 1  
ATOM   716   N  N    . ASP A 1 46 ? 127.608 -7.328  8.972   1.00 0.00 ? 46  ASP A N    1  
ATOM   717   C  CA   . ASP A 1 46 ? 127.225 -5.992  9.420   1.00 0.00 ? 46  ASP A CA   1  
ATOM   718   C  C    . ASP A 1 46 ? 126.135 -5.422  8.518   1.00 0.00 ? 46  ASP A C    1  
ATOM   719   O  O    . ASP A 1 46 ? 125.793 -4.242  8.605   1.00 0.00 ? 46  ASP A O    1  
ATOM   720   C  CB   . ASP A 1 46 ? 128.441 -5.064  9.407   1.00 0.00 ? 46  ASP A CB   1  
ATOM   721   C  CG   . ASP A 1 46 ? 129.456 -5.521  10.449  1.00 0.00 ? 46  ASP A CG   1  
ATOM   722   O  OD1  . ASP A 1 46 ? 129.097 -6.342  11.277  1.00 0.00 ? 46  ASP A OD1  1  
ATOM   723   O  OD2  . ASP A 1 46 ? 130.578 -5.043  10.404  1.00 0.00 ? 46  ASP A OD2  1  
ATOM   724   H  H    . ASP A 1 46 ? 128.420 -7.432  8.432   1.00 0.00 ? 46  ASP A H    1  
ATOM   725   H  HA   . ASP A 1 46 ? 126.847 -6.056  10.429  1.00 0.00 ? 46  ASP A HA   1  
ATOM   726   H  HB2  . ASP A 1 46 ? 128.898 -5.085  8.428   1.00 0.00 ? 46  ASP A HB2  1  
ATOM   727   H  HB3  . ASP A 1 46 ? 128.126 -4.057  9.634   1.00 0.00 ? 46  ASP A HB3  1  
ATOM   728   N  N    . ALA A 1 47 ? 125.601 -6.270  7.646   1.00 0.00 ? 47  ALA A N    1  
ATOM   729   C  CA   . ALA A 1 47 ? 124.557 -5.854  6.716   1.00 0.00 ? 47  ALA A CA   1  
ATOM   730   C  C    . ALA A 1 47 ? 123.350 -5.306  7.476   1.00 0.00 ? 47  ALA A C    1  
ATOM   731   O  O    . ALA A 1 47 ? 122.579 -4.512  6.940   1.00 0.00 ? 47  ALA A O    1  
ATOM   732   C  CB   . ALA A 1 47 ? 124.123 -7.040  5.856   1.00 0.00 ? 47  ALA A CB   1  
ATOM   733   H  H    . ALA A 1 47 ? 125.923 -7.196  7.621   1.00 0.00 ? 47  ALA A H    1  
ATOM   734   H  HA   . ALA A 1 47 ? 124.950 -5.083  6.071   1.00 0.00 ? 47  ALA A HA   1  
ATOM   735   H  HB1  . ALA A 1 47 ? 124.900 -7.272  5.142   1.00 0.00 ? 47  ALA A HB1  1  
ATOM   736   H  HB2  . ALA A 1 47 ? 123.214 -6.791  5.330   1.00 0.00 ? 47  ALA A HB2  1  
ATOM   737   H  HB3  . ALA A 1 47 ? 123.949 -7.899  6.488   1.00 0.00 ? 47  ALA A HB3  1  
ATOM   738   N  N    . GLN A 1 48 ? 123.194 -5.741  8.723   1.00 0.00 ? 48  GLN A N    1  
ATOM   739   C  CA   . GLN A 1 48 ? 122.078 -5.294  9.555   1.00 0.00 ? 48  GLN A CA   1  
ATOM   740   C  C    . GLN A 1 48 ? 122.014 -3.764  9.606   1.00 0.00 ? 48  GLN A C    1  
ATOM   741   O  O    . GLN A 1 48 ? 122.521 -3.082  8.717   1.00 0.00 ? 48  GLN A O    1  
ATOM   742   C  CB   . GLN A 1 48 ? 122.239 -5.850  10.973  1.00 0.00 ? 48  GLN A CB   1  
ATOM   743   C  CG   . GLN A 1 48 ? 122.164 -7.376  10.936  1.00 0.00 ? 48  GLN A CG   1  
ATOM   744   C  CD   . GLN A 1 48 ? 122.373 -7.943  12.336  1.00 0.00 ? 48  GLN A CD   1  
ATOM   745   O  OE1  . GLN A 1 48 ? 122.860 -7.242  13.224  1.00 0.00 ? 48  GLN A OE1  1  
ATOM   746   N  NE2  . GLN A 1 48 ? 122.032 -9.177  12.589  1.00 0.00 ? 48  GLN A NE2  1  
ATOM   747   H  H    . GLN A 1 48 ? 123.841 -6.378  9.092   1.00 0.00 ? 48  GLN A H    1  
ATOM   748   H  HA   . GLN A 1 48 ? 121.157 -5.670  9.137   1.00 0.00 ? 48  GLN A HA   1  
ATOM   749   H  HB2  . GLN A 1 48 ? 123.197 -5.545  11.372  1.00 0.00 ? 48  GLN A HB2  1  
ATOM   750   H  HB3  . GLN A 1 48 ? 121.450 -5.469  11.602  1.00 0.00 ? 48  GLN A HB3  1  
ATOM   751   H  HG2  . GLN A 1 48 ? 121.193 -7.678  10.569  1.00 0.00 ? 48  GLN A HG2  1  
ATOM   752   H  HG3  . GLN A 1 48 ? 122.930 -7.757  10.278  1.00 0.00 ? 48  GLN A HG3  1  
ATOM   753   H  HE21 . GLN A 1 48 ? 121.644 -9.733  11.882  1.00 0.00 ? 48  GLN A HE21 1  
ATOM   754   H  HE22 . GLN A 1 48 ? 122.164 -9.548  13.487  1.00 0.00 ? 48  GLN A HE22 1  
ATOM   755   N  N    . LYS A 1 49 ? 121.381 -3.231  10.650  1.00 0.00 ? 49  LYS A N    1  
ATOM   756   C  CA   . LYS A 1 49 ? 121.246 -1.783  10.794  1.00 0.00 ? 49  LYS A CA   1  
ATOM   757   C  C    . LYS A 1 49 ? 122.616 -1.116  10.789  1.00 0.00 ? 49  LYS A C    1  
ATOM   758   O  O    . LYS A 1 49 ? 122.753 0.039   10.386  1.00 0.00 ? 49  LYS A O    1  
ATOM   759   C  CB   . LYS A 1 49 ? 120.509 -1.448  12.095  1.00 0.00 ? 49  LYS A CB   1  
ATOM   760   C  CG   . LYS A 1 49 ? 121.393 -1.791  13.297  1.00 0.00 ? 49  LYS A CG   1  
ATOM   761   C  CD   . LYS A 1 49 ? 120.602 -1.575  14.589  1.00 0.00 ? 49  LYS A CD   1  
ATOM   762   C  CE   . LYS A 1 49 ? 121.555 -1.603  15.785  1.00 0.00 ? 49  LYS A CE   1  
ATOM   763   N  NZ   . LYS A 1 49 ? 122.549 -0.499  15.655  1.00 0.00 ? 49  LYS A NZ   1  
ATOM   764   H  H    . LYS A 1 49 ? 120.989 -3.819  11.329  1.00 0.00 ? 49  LYS A H    1  
ATOM   765   H  HA   . LYS A 1 49 ? 120.671 -1.403  9.963   1.00 0.00 ? 49  LYS A HA   1  
ATOM   766   H  HB2  . LYS A 1 49 ? 120.272 -0.394  12.112  1.00 0.00 ? 49  LYS A HB2  1  
ATOM   767   H  HB3  . LYS A 1 49 ? 119.595 -2.022  12.149  1.00 0.00 ? 49  LYS A HB3  1  
ATOM   768   H  HG2  . LYS A 1 49 ? 121.706 -2.822  13.232  1.00 0.00 ? 49  LYS A HG2  1  
ATOM   769   H  HG3  . LYS A 1 49 ? 122.262 -1.151  13.301  1.00 0.00 ? 49  LYS A HG3  1  
ATOM   770   H  HD2  . LYS A 1 49 ? 120.100 -0.619  14.549  1.00 0.00 ? 49  LYS A HD2  1  
ATOM   771   H  HD3  . LYS A 1 49 ? 119.870 -2.361  14.698  1.00 0.00 ? 49  LYS A HD3  1  
ATOM   772   H  HE2  . LYS A 1 49 ? 120.993 -1.474  16.697  1.00 0.00 ? 49  LYS A HE2  1  
ATOM   773   H  HE3  . LYS A 1 49 ? 122.072 -2.551  15.812  1.00 0.00 ? 49  LYS A HE3  1  
ATOM   774   H  HZ1  . LYS A 1 49 ? 123.404 -0.856  15.183  1.00 0.00 ? 49  LYS A HZ1  1  
ATOM   775   H  HZ2  . LYS A 1 49 ? 122.795 -0.142  16.601  1.00 0.00 ? 49  LYS A HZ2  1  
ATOM   776   H  HZ3  . LYS A 1 49 ? 122.140 0.271   15.089  1.00 0.00 ? 49  LYS A HZ3  1  
ATOM   777   N  N    . ASP A 1 50 ? 123.626 -1.854  11.223  1.00 0.00 ? 50  ASP A N    1  
ATOM   778   C  CA   . ASP A 1 50 ? 124.985 -1.332  11.247  1.00 0.00 ? 50  ASP A CA   1  
ATOM   779   C  C    . ASP A 1 50 ? 125.369 -0.830  9.858   1.00 0.00 ? 50  ASP A C    1  
ATOM   780   O  O    . ASP A 1 50 ? 126.105 0.149   9.715   1.00 0.00 ? 50  ASP A O    1  
ATOM   781   C  CB   . ASP A 1 50 ? 125.960 -2.427  11.686  1.00 0.00 ? 50  ASP A CB   1  
ATOM   782   C  CG   . ASP A 1 50 ? 125.716 -2.790  13.147  1.00 0.00 ? 50  ASP A CG   1  
ATOM   783   O  OD1  . ASP A 1 50 ? 124.994 -2.060  13.805  1.00 0.00 ? 50  ASP A OD1  1  
ATOM   784   O  OD2  . ASP A 1 50 ? 126.254 -3.793  13.586  1.00 0.00 ? 50  ASP A OD2  1  
ATOM   785   H  H    . ASP A 1 50 ? 123.459 -2.774  11.521  1.00 0.00 ? 50  ASP A H    1  
ATOM   786   H  HA   . ASP A 1 50 ? 125.037 -0.511  11.948  1.00 0.00 ? 50  ASP A HA   1  
ATOM   787   H  HB2  . ASP A 1 50 ? 125.816 -3.302  11.070  1.00 0.00 ? 50  ASP A HB2  1  
ATOM   788   H  HB3  . ASP A 1 50 ? 126.973 -2.072  11.572  1.00 0.00 ? 50  ASP A HB3  1  
ATOM   789   N  N    . VAL A 1 51 ? 124.864 -1.518  8.839   1.00 0.00 ? 51  VAL A N    1  
ATOM   790   C  CA   . VAL A 1 51 ? 125.154 -1.158  7.455   1.00 0.00 ? 51  VAL A CA   1  
ATOM   791   C  C    . VAL A 1 51 ? 124.843 0.312   7.198   1.00 0.00 ? 51  VAL A C    1  
ATOM   792   O  O    . VAL A 1 51 ? 125.467 0.943   6.351   1.00 0.00 ? 51  VAL A O    1  
ATOM   793   C  CB   . VAL A 1 51 ? 124.322 -2.026  6.510   1.00 0.00 ? 51  VAL A CB   1  
ATOM   794   C  CG1  . VAL A 1 51 ? 122.871 -1.535  6.499   1.00 0.00 ? 51  VAL A CG1  1  
ATOM   795   C  CG2  . VAL A 1 51 ? 124.902 -1.939  5.096   1.00 0.00 ? 51  VAL A CG2  1  
ATOM   796   H  H    . VAL A 1 51 ? 124.286 -2.289  9.021   1.00 0.00 ? 51  VAL A H    1  
ATOM   797   H  HA   . VAL A 1 51 ? 126.200 -1.335  7.258   1.00 0.00 ? 51  VAL A HA   1  
ATOM   798   H  HB   . VAL A 1 51 ? 124.349 -3.048  6.850   1.00 0.00 ? 51  VAL A HB   1  
ATOM   799   H  HG11 . VAL A 1 51 ? 122.762 -0.747  5.768   1.00 0.00 ? 51  VAL A HG11 1  
ATOM   800   H  HG12 . VAL A 1 51 ? 122.610 -1.155  7.476   1.00 0.00 ? 51  VAL A HG12 1  
ATOM   801   H  HG13 . VAL A 1 51 ? 122.215 -2.354  6.245   1.00 0.00 ? 51  VAL A HG13 1  
ATOM   802   H  HG21 . VAL A 1 51 ? 125.887 -2.383  5.083   1.00 0.00 ? 51  VAL A HG21 1  
ATOM   803   H  HG22 . VAL A 1 51 ? 124.969 -0.904  4.798   1.00 0.00 ? 51  VAL A HG22 1  
ATOM   804   H  HG23 . VAL A 1 51 ? 124.259 -2.471  4.410   1.00 0.00 ? 51  VAL A HG23 1  
ATOM   805   N  N    . ASP A 1 52 ? 123.872 0.848   7.926   1.00 0.00 ? 52  ASP A N    1  
ATOM   806   C  CA   . ASP A 1 52 ? 123.488 2.246   7.758   1.00 0.00 ? 52  ASP A CA   1  
ATOM   807   C  C    . ASP A 1 52 ? 124.702 3.161   7.910   1.00 0.00 ? 52  ASP A C    1  
ATOM   808   O  O    . ASP A 1 52 ? 124.813 4.181   7.223   1.00 0.00 ? 52  ASP A O    1  
ATOM   809   C  CB   . ASP A 1 52 ? 122.428 2.624   8.796   1.00 0.00 ? 52  ASP A CB   1  
ATOM   810   C  CG   . ASP A 1 52 ? 121.126 1.886   8.505   1.00 0.00 ? 52  ASP A CG   1  
ATOM   811   O  OD1  . ASP A 1 52 ? 121.019 1.315   7.432   1.00 0.00 ? 52  ASP A OD1  1  
ATOM   812   O  OD2  . ASP A 1 52 ? 120.256 1.901   9.359   1.00 0.00 ? 52  ASP A OD2  1  
ATOM   813   H  H    . ASP A 1 52 ? 123.403 0.296   8.585   1.00 0.00 ? 52  ASP A H    1  
ATOM   814   H  HA   . ASP A 1 52 ? 123.070 2.379   6.771   1.00 0.00 ? 52  ASP A HA   1  
ATOM   815   H  HB2  . ASP A 1 52 ? 122.781 2.357   9.782   1.00 0.00 ? 52  ASP A HB2  1  
ATOM   816   H  HB3  . ASP A 1 52 ? 122.252 3.688   8.756   1.00 0.00 ? 52  ASP A HB3  1  
ATOM   817   N  N    . ALA A 1 53 ? 125.615 2.788   8.802   1.00 0.00 ? 53  ALA A N    1  
ATOM   818   C  CA   . ALA A 1 53 ? 126.814 3.589   9.029   1.00 0.00 ? 53  ALA A CA   1  
ATOM   819   C  C    . ALA A 1 53 ? 127.572 3.772   7.724   1.00 0.00 ? 53  ALA A C    1  
ATOM   820   O  O    . ALA A 1 53 ? 128.284 4.768   7.532   1.00 0.00 ? 53  ALA A O    1  
ATOM   821   C  CB   . ALA A 1 53 ? 127.726 2.906   10.050  1.00 0.00 ? 53  ALA A CB   1  
ATOM   822   H  H    . ALA A 1 53 ? 125.481 1.962   9.315   1.00 0.00 ? 53  ALA A H    1  
ATOM   823   H  HA   . ALA A 1 53 ? 126.526 4.558   9.408   1.00 0.00 ? 53  ALA A HA   1  
ATOM   824   H  HB1  . ALA A 1 53 ? 128.736 3.276   9.933   1.00 0.00 ? 53  ALA A HB1  1  
ATOM   825   H  HB2  . ALA A 1 53 ? 127.713 1.838   9.887   1.00 0.00 ? 53  ALA A HB2  1  
ATOM   826   H  HB3  . ALA A 1 53 ? 127.375 3.123   11.048  1.00 0.00 ? 53  ALA A HB3  1  
ATOM   827   N  N    . VAL A 1 54 ? 127.422 2.809   6.824   1.00 0.00 ? 54  VAL A N    1  
ATOM   828   C  CA   . VAL A 1 54 ? 128.105 2.897   5.552   1.00 0.00 ? 54  VAL A CA   1  
ATOM   829   C  C    . VAL A 1 54 ? 127.794 4.244   4.914   1.00 0.00 ? 54  VAL A C    1  
ATOM   830   O  O    . VAL A 1 54 ? 128.659 4.865   4.310   1.00 0.00 ? 54  VAL A O    1  
ATOM   831   C  CB   . VAL A 1 54 ? 127.658 1.764   4.621   1.00 0.00 ? 54  VAL A CB   1  
ATOM   832   C  CG1  . VAL A 1 54 ? 126.271 2.072   4.044   1.00 0.00 ? 54  VAL A CG1  1  
ATOM   833   C  CG2  . VAL A 1 54 ? 128.662 1.628   3.474   1.00 0.00 ? 54  VAL A CG2  1  
ATOM   834   H  H    . VAL A 1 54 ? 126.849 2.039   7.020   1.00 0.00 ? 54  VAL A H    1  
ATOM   835   H  HA   . VAL A 1 54 ? 129.166 2.815   5.718   1.00 0.00 ? 54  VAL A HA   1  
ATOM   836   H  HB   . VAL A 1 54 ? 127.617 0.839   5.176   1.00 0.00 ? 54  VAL A HB   1  
ATOM   837   H  HG11 . VAL A 1 54 ? 125.789 1.151   3.754   1.00 0.00 ? 54  VAL A HG11 1  
ATOM   838   H  HG12 . VAL A 1 54 ? 126.375 2.710   3.178   1.00 0.00 ? 54  VAL A HG12 1  
ATOM   839   H  HG13 . VAL A 1 54 ? 125.672 2.573   4.788   1.00 0.00 ? 54  VAL A HG13 1  
ATOM   840   H  HG21 . VAL A 1 54 ? 128.648 2.526   2.874   1.00 0.00 ? 54  VAL A HG21 1  
ATOM   841   H  HG22 . VAL A 1 54 ? 128.394 0.781   2.860   1.00 0.00 ? 54  VAL A HG22 1  
ATOM   842   H  HG23 . VAL A 1 54 ? 129.652 1.480   3.878   1.00 0.00 ? 54  VAL A HG23 1  
ATOM   843   N  N    . ASP A 1 55 ? 126.562 4.713   5.067   1.00 0.00 ? 55  ASP A N    1  
ATOM   844   C  CA   . ASP A 1 55 ? 126.213 6.010   4.512   1.00 0.00 ? 55  ASP A CA   1  
ATOM   845   C  C    . ASP A 1 55 ? 127.022 7.111   5.197   1.00 0.00 ? 55  ASP A C    1  
ATOM   846   O  O    . ASP A 1 55 ? 127.488 8.052   4.555   1.00 0.00 ? 55  ASP A O    1  
ATOM   847   C  CB   . ASP A 1 55 ? 124.718 6.277   4.702   1.00 0.00 ? 55  ASP A CB   1  
ATOM   848   C  CG   . ASP A 1 55 ? 123.901 5.294   3.870   1.00 0.00 ? 55  ASP A CG   1  
ATOM   849   O  OD1  . ASP A 1 55 ? 124.484 4.639   3.022   1.00 0.00 ? 55  ASP A OD1  1  
ATOM   850   O  OD2  . ASP A 1 55 ? 122.704 5.211   4.094   1.00 0.00 ? 55  ASP A OD2  1  
ATOM   851   H  H    . ASP A 1 55 ? 125.895 4.200   5.579   1.00 0.00 ? 55  ASP A H    1  
ATOM   852   H  HA   . ASP A 1 55 ? 126.438 6.013   3.456   1.00 0.00 ? 55  ASP A HA   1  
ATOM   853   H  HB2  . ASP A 1 55 ? 124.465 6.161   5.745   1.00 0.00 ? 55  ASP A HB2  1  
ATOM   854   H  HB3  . ASP A 1 55 ? 124.492 7.285   4.389   1.00 0.00 ? 55  ASP A HB3  1  
ATOM   855   N  N    . LYS A 1 56 ? 127.157 6.982   6.519   1.00 0.00 ? 56  LYS A N    1  
ATOM   856   C  CA   . LYS A 1 56 ? 127.885 7.966   7.321   1.00 0.00 ? 56  LYS A CA   1  
ATOM   857   C  C    . LYS A 1 56 ? 129.367 8.073   6.959   1.00 0.00 ? 56  LYS A C    1  
ATOM   858   O  O    . LYS A 1 56 ? 129.923 9.173   6.952   1.00 0.00 ? 56  LYS A O    1  
ATOM   859   C  CB   . LYS A 1 56 ? 127.759 7.608   8.803   1.00 0.00 ? 56  LYS A CB   1  
ATOM   860   C  CG   . LYS A 1 56 ? 126.296 7.720   9.236   1.00 0.00 ? 56  LYS A CG   1  
ATOM   861   C  CD   . LYS A 1 56 ? 126.189 7.476   10.742  1.00 0.00 ? 56  LYS A CD   1  
ATOM   862   C  CE   . LYS A 1 56 ? 124.717 7.466   11.154  1.00 0.00 ? 56  LYS A CE   1  
ATOM   863   N  NZ   . LYS A 1 56 ? 124.604 7.066   12.585  1.00 0.00 ? 56  LYS A NZ   1  
ATOM   864   H  H    . LYS A 1 56 ? 126.746 6.215   6.966   1.00 0.00 ? 56  LYS A H    1  
ATOM   865   H  HA   . LYS A 1 56 ? 127.427 8.931   7.172   1.00 0.00 ? 56  LYS A HA   1  
ATOM   866   H  HB2  . LYS A 1 56 ? 128.105 6.596   8.959   1.00 0.00 ? 56  LYS A HB2  1  
ATOM   867   H  HB3  . LYS A 1 56 ? 128.359 8.288   9.389   1.00 0.00 ? 56  LYS A HB3  1  
ATOM   868   H  HG2  . LYS A 1 56 ? 125.927 8.708   9.003   1.00 0.00 ? 56  LYS A HG2  1  
ATOM   869   H  HG3  . LYS A 1 56 ? 125.708 6.982   8.711   1.00 0.00 ? 56  LYS A HG3  1  
ATOM   870   H  HD2  . LYS A 1 56 ? 126.638 6.523   10.984  1.00 0.00 ? 56  LYS A HD2  1  
ATOM   871   H  HD3  . LYS A 1 56 ? 126.705 8.263   11.271  1.00 0.00 ? 56  LYS A HD3  1  
ATOM   872   H  HE2  . LYS A 1 56 ? 124.300 8.455   11.023  1.00 0.00 ? 56  LYS A HE2  1  
ATOM   873   H  HE3  . LYS A 1 56 ? 124.175 6.763   10.540  1.00 0.00 ? 56  LYS A HE3  1  
ATOM   874   H  HZ1  . LYS A 1 56 ? 124.661 6.032   12.662  1.00 0.00 ? 56  LYS A HZ1  1  
ATOM   875   H  HZ2  . LYS A 1 56 ? 123.693 7.394   12.966  1.00 0.00 ? 56  LYS A HZ2  1  
ATOM   876   H  HZ3  . LYS A 1 56 ? 125.381 7.494   13.128  1.00 0.00 ? 56  LYS A HZ3  1  
ATOM   877   N  N    . VAL A 1 57 ? 130.019 6.941   6.696   1.00 0.00 ? 57  VAL A N    1  
ATOM   878   C  CA   . VAL A 1 57 ? 131.453 6.981   6.385   1.00 0.00 ? 57  VAL A CA   1  
ATOM   879   C  C    . VAL A 1 57 ? 131.724 7.580   5.003   1.00 0.00 ? 57  VAL A C    1  
ATOM   880   O  O    . VAL A 1 57 ? 132.758 8.214   4.792   1.00 0.00 ? 57  VAL A O    1  
ATOM   881   C  CB   . VAL A 1 57 ? 132.078 5.585   6.494   1.00 0.00 ? 57  VAL A CB   1  
ATOM   882   C  CG1  . VAL A 1 57 ? 131.721 4.975   7.850   1.00 0.00 ? 57  VAL A CG1  1  
ATOM   883   C  CG2  . VAL A 1 57 ? 131.556 4.686   5.380   1.00 0.00 ? 57  VAL A CG2  1  
ATOM   884   H  H    . VAL A 1 57 ? 129.544 6.077   6.743   1.00 0.00 ? 57  VAL A H    1  
ATOM   885   H  HA   . VAL A 1 57 ? 131.930 7.616   7.116   1.00 0.00 ? 57  VAL A HA   1  
ATOM   886   H  HB   . VAL A 1 57 ? 133.151 5.669   6.418   1.00 0.00 ? 57  VAL A HB   1  
ATOM   887   H  HG11 . VAL A 1 57 ? 132.220 4.022   7.958   1.00 0.00 ? 57  VAL A HG11 1  
ATOM   888   H  HG12 . VAL A 1 57 ? 130.652 4.831   7.911   1.00 0.00 ? 57  VAL A HG12 1  
ATOM   889   H  HG13 . VAL A 1 57 ? 132.041 5.640   8.639   1.00 0.00 ? 57  VAL A HG13 1  
ATOM   890   H  HG21 . VAL A 1 57 ? 130.495 4.585   5.483   1.00 0.00 ? 57  VAL A HG21 1  
ATOM   891   H  HG22 . VAL A 1 57 ? 132.018 3.713   5.457   1.00 0.00 ? 57  VAL A HG22 1  
ATOM   892   H  HG23 . VAL A 1 57 ? 131.788 5.120   4.420   1.00 0.00 ? 57  VAL A HG23 1  
ATOM   893   N  N    . MET A 1 58 ? 130.802 7.380   4.066   1.00 0.00 ? 58  MET A N    1  
ATOM   894   C  CA   . MET A 1 58 ? 130.978 7.916   2.715   1.00 0.00 ? 58  MET A CA   1  
ATOM   895   C  C    . MET A 1 58 ? 131.142 9.431   2.727   1.00 0.00 ? 58  MET A C    1  
ATOM   896   O  O    . MET A 1 58 ? 131.909 9.983   1.936   1.00 0.00 ? 58  MET A O    1  
ATOM   897   C  CB   . MET A 1 58 ? 129.758 7.559   1.861   1.00 0.00 ? 58  MET A CB   1  
ATOM   898   C  CG   . MET A 1 58 ? 129.738 6.057   1.574   1.00 0.00 ? 58  MET A CG   1  
ATOM   899   S  SD   . MET A 1 58 ? 131.145 5.612   0.536   1.00 0.00 ? 58  MET A SD   1  
ATOM   900   C  CE   . MET A 1 58 ? 130.619 6.521   -0.939  1.00 0.00 ? 58  MET A CE   1  
ATOM   901   H  H    . MET A 1 58 ? 129.995 6.868   4.282   1.00 0.00 ? 58  MET A H    1  
ATOM   902   H  HA   . MET A 1 58 ? 131.854 7.470   2.272   1.00 0.00 ? 58  MET A HA   1  
ATOM   903   H  HB2  . MET A 1 58 ? 128.858 7.836   2.392   1.00 0.00 ? 58  MET A HB2  1  
ATOM   904   H  HB3  . MET A 1 58 ? 129.804 8.103   0.931   1.00 0.00 ? 58  MET A HB3  1  
ATOM   905   H  HG2  . MET A 1 58 ? 129.805 5.517   2.498   1.00 0.00 ? 58  MET A HG2  1  
ATOM   906   H  HG3  . MET A 1 58 ? 128.820 5.796   1.069   1.00 0.00 ? 58  MET A HG3  1  
ATOM   907   H  HE1  . MET A 1 58 ? 131.198 7.430   -1.028  1.00 0.00 ? 58  MET A HE1  1  
ATOM   908   H  HE2  . MET A 1 58 ? 129.574 6.769   -0.860  1.00 0.00 ? 58  MET A HE2  1  
ATOM   909   H  HE3  . MET A 1 58 ? 130.770 5.902   -1.810  1.00 0.00 ? 58  MET A HE3  1  
ATOM   910   N  N    . LYS A 1 59 ? 130.414 10.107  3.608   1.00 0.00 ? 59  LYS A N    1  
ATOM   911   C  CA   . LYS A 1 59 ? 130.497 11.560  3.671   1.00 0.00 ? 59  LYS A CA   1  
ATOM   912   C  C    . LYS A 1 59 ? 131.910 12.035  3.994   1.00 0.00 ? 59  LYS A C    1  
ATOM   913   O  O    . LYS A 1 59 ? 132.408 12.977  3.376   1.00 0.00 ? 59  LYS A O    1  
ATOM   914   C  CB   . LYS A 1 59 ? 129.529 12.086  4.733   1.00 0.00 ? 59  LYS A CB   1  
ATOM   915   C  CG   . LYS A 1 59 ? 129.518 13.615  4.700   1.00 0.00 ? 59  LYS A CG   1  
ATOM   916   C  CD   . LYS A 1 59 ? 128.599 14.142  5.805   1.00 0.00 ? 59  LYS A CD   1  
ATOM   917   C  CE   . LYS A 1 59 ? 128.466 15.660  5.677   1.00 0.00 ? 59  LYS A CE   1  
ATOM   918   N  NZ   . LYS A 1 59 ? 129.785 16.299  5.948   1.00 0.00 ? 59  LYS A NZ   1  
ATOM   919   H  H    . LYS A 1 59 ? 129.808 9.626   4.210   1.00 0.00 ? 59  LYS A H    1  
ATOM   920   H  HA   . LYS A 1 59 ? 130.205 11.963  2.713   1.00 0.00 ? 59  LYS A HA   1  
ATOM   921   H  HB2  . LYS A 1 59 ? 128.535 11.713  4.530   1.00 0.00 ? 59  LYS A HB2  1  
ATOM   922   H  HB3  . LYS A 1 59 ? 129.848 11.751  5.707   1.00 0.00 ? 59  LYS A HB3  1  
ATOM   923   H  HG2  . LYS A 1 59 ? 130.520 13.986  4.858   1.00 0.00 ? 59  LYS A HG2  1  
ATOM   924   H  HG3  . LYS A 1 59 ? 129.155 13.953  3.741   1.00 0.00 ? 59  LYS A HG3  1  
ATOM   925   H  HD2  . LYS A 1 59 ? 127.625 13.685  5.711   1.00 0.00 ? 59  LYS A HD2  1  
ATOM   926   H  HD3  . LYS A 1 59 ? 129.020 13.900  6.770   1.00 0.00 ? 59  LYS A HD3  1  
ATOM   927   H  HE2  . LYS A 1 59 ? 128.143 15.910  4.677   1.00 0.00 ? 59  LYS A HE2  1  
ATOM   928   H  HE3  . LYS A 1 59 ? 127.739 16.020  6.390   1.00 0.00 ? 59  LYS A HE3  1  
ATOM   929   H  HZ1  . LYS A 1 59 ? 129.638 17.206  6.434   1.00 0.00 ? 59  LYS A HZ1  1  
ATOM   930   H  HZ2  . LYS A 1 59 ? 130.281 16.464  5.048   1.00 0.00 ? 59  LYS A HZ2  1  
ATOM   931   H  HZ3  . LYS A 1 59 ? 130.357 15.674  6.550   1.00 0.00 ? 59  LYS A HZ3  1  
ATOM   932   N  N    . GLU A 1 60 ? 132.558 11.394  4.966   1.00 0.00 ? 60  GLU A N    1  
ATOM   933   C  CA   . GLU A 1 60 ? 133.910 11.795  5.340   1.00 0.00 ? 60  GLU A CA   1  
ATOM   934   C  C    . GLU A 1 60 ? 134.917 11.502  4.232   1.00 0.00 ? 60  GLU A C    1  
ATOM   935   O  O    . GLU A 1 60 ? 135.812 12.305  3.968   1.00 0.00 ? 60  GLU A O    1  
ATOM   936   C  CB   . GLU A 1 60 ? 134.333 11.061  6.615   1.00 0.00 ? 60  GLU A CB   1  
ATOM   937   C  CG   . GLU A 1 60 ? 133.444 11.502  7.778   1.00 0.00 ? 60  GLU A CG   1  
ATOM   938   C  CD   . GLU A 1 60 ? 133.899 10.825  9.067   1.00 0.00 ? 60  GLU A CD   1  
ATOM   939   O  OE1  . GLU A 1 60 ? 134.739 9.943   8.984   1.00 0.00 ? 60  GLU A OE1  1  
ATOM   940   O  OE2  . GLU A 1 60 ? 133.401 11.196  10.117  1.00 0.00 ? 60  GLU A OE2  1  
ATOM   941   H  H    . GLU A 1 60 ? 132.121 10.653  5.436   1.00 0.00 ? 60  GLU A H    1  
ATOM   942   H  HA   . GLU A 1 60 ? 133.914 12.856  5.540   1.00 0.00 ? 60  GLU A HA   1  
ATOM   943   H  HB2  . GLU A 1 60 ? 134.231 9.996   6.466   1.00 0.00 ? 60  GLU A HB2  1  
ATOM   944   H  HB3  . GLU A 1 60 ? 135.362 11.296  6.841   1.00 0.00 ? 60  GLU A HB3  1  
ATOM   945   H  HG2  . GLU A 1 60 ? 133.511 12.574  7.894   1.00 0.00 ? 60  GLU A HG2  1  
ATOM   946   H  HG3  . GLU A 1 60 ? 132.421 11.226  7.572   1.00 0.00 ? 60  GLU A HG3  1  
ATOM   947   N  N    . LEU A 1 61 ? 134.769 10.348  3.587   1.00 0.00 ? 61  LEU A N    1  
ATOM   948   C  CA   . LEU A 1 61 ? 135.679 9.965   2.512   1.00 0.00 ? 61  LEU A CA   1  
ATOM   949   C  C    . LEU A 1 61 ? 135.525 10.865  1.295   1.00 0.00 ? 61  LEU A C    1  
ATOM   950   O  O    . LEU A 1 61 ? 136.505 11.171  0.616   1.00 0.00 ? 61  LEU A O    1  
ATOM   951   C  CB   . LEU A 1 61 ? 135.443 8.507   2.113   1.00 0.00 ? 61  LEU A CB   1  
ATOM   952   C  CG   . LEU A 1 61 ? 135.671 7.594   3.324   1.00 0.00 ? 61  LEU A CG   1  
ATOM   953   C  CD1  . LEU A 1 61 ? 135.500 6.138   2.899   1.00 0.00 ? 61  LEU A CD1  1  
ATOM   954   C  CD2  . LEU A 1 61 ? 137.089 7.796   3.870   1.00 0.00 ? 61  LEU A CD2  1  
ATOM   955   H  H    . LEU A 1 61 ? 134.039 9.743   3.840   1.00 0.00 ? 61  LEU A H    1  
ATOM   956   H  HA   . LEU A 1 61 ? 136.691 10.062  2.873   1.00 0.00 ? 61  LEU A HA   1  
ATOM   957   H  HB2  . LEU A 1 61 ? 134.428 8.391   1.761   1.00 0.00 ? 61  LEU A HB2  1  
ATOM   958   H  HB3  . LEU A 1 61 ? 136.130 8.234   1.326   1.00 0.00 ? 61  LEU A HB3  1  
ATOM   959   H  HG   . LEU A 1 61 ? 134.953 7.831   4.089   1.00 0.00 ? 61  LEU A HG   1  
ATOM   960   H  HD11 . LEU A 1 61 ? 134.448 5.899   2.845   1.00 0.00 ? 61  LEU A HD11 1  
ATOM   961   H  HD12 . LEU A 1 61 ? 135.978 5.495   3.621   1.00 0.00 ? 61  LEU A HD12 1  
ATOM   962   H  HD13 . LEU A 1 61 ? 135.952 5.992   1.932   1.00 0.00 ? 61  LEU A HD13 1  
ATOM   963   H  HD21 . LEU A 1 61 ? 137.759 8.032   3.057   1.00 0.00 ? 61  LEU A HD21 1  
ATOM   964   H  HD22 . LEU A 1 61 ? 137.421 6.891   4.360   1.00 0.00 ? 61  LEU A HD22 1  
ATOM   965   H  HD23 . LEU A 1 61 ? 137.089 8.608   4.582   1.00 0.00 ? 61  LEU A HD23 1  
ATOM   966   N  N    . ASP A 1 62 ? 134.295 11.275  1.008   1.00 0.00 ? 62  ASP A N    1  
ATOM   967   C  CA   . ASP A 1 62 ? 134.059 12.124  -0.151  1.00 0.00 ? 62  ASP A CA   1  
ATOM   968   C  C    . ASP A 1 62 ? 134.262 13.593  0.183   1.00 0.00 ? 62  ASP A C    1  
ATOM   969   O  O    . ASP A 1 62 ? 133.402 14.220  0.804   1.00 0.00 ? 62  ASP A O    1  
ATOM   970   C  CB   . ASP A 1 62 ? 132.628 11.927  -0.644  1.00 0.00 ? 62  ASP A CB   1  
ATOM   971   C  CG   . ASP A 1 62 ? 132.403 12.728  -1.918  1.00 0.00 ? 62  ASP A CG   1  
ATOM   972   O  OD1  . ASP A 1 62 ? 133.378 13.025  -2.590  1.00 0.00 ? 62  ASP A OD1  1  
ATOM   973   O  OD2  . ASP A 1 62 ? 131.262 13.055  -2.188  1.00 0.00 ? 62  ASP A OD2  1  
ATOM   974   H  H    . ASP A 1 62 ? 133.541 10.996  1.570   1.00 0.00 ? 62  ASP A H    1  
ATOM   975   H  HA   . ASP A 1 62 ? 134.740 11.843  -0.940  1.00 0.00 ? 62  ASP A HA   1  
ATOM   976   H  HB2  . ASP A 1 62 ? 132.458 10.879  -0.844  1.00 0.00 ? 62  ASP A HB2  1  
ATOM   977   H  HB3  . ASP A 1 62 ? 131.938 12.264  0.116   1.00 0.00 ? 62  ASP A HB3  1  
ATOM   978   N  N    . GLU A 1 63 ? 135.372 14.156  -0.272  1.00 0.00 ? 63  GLU A N    1  
ATOM   979   C  CA   . GLU A 1 63 ? 135.627 15.569  -0.049  1.00 0.00 ? 63  GLU A CA   1  
ATOM   980   C  C    . GLU A 1 63 ? 134.619 16.394  -0.835  1.00 0.00 ? 63  GLU A C    1  
ATOM   981   O  O    . GLU A 1 63 ? 134.154 17.442  -0.385  1.00 0.00 ? 63  GLU A O    1  
ATOM   982   C  CB   . GLU A 1 63 ? 137.042 15.923  -0.501  1.00 0.00 ? 63  GLU A CB   1  
ATOM   983   C  CG   . GLU A 1 63 ? 137.350 17.375  -0.130  1.00 0.00 ? 63  GLU A CG   1  
ATOM   984   C  CD   . GLU A 1 63 ? 138.723 17.770  -0.664  1.00 0.00 ? 63  GLU A CD   1  
ATOM   985   O  OE1  . GLU A 1 63 ? 139.350 16.939  -1.302  1.00 0.00 ? 63  GLU A OE1  1  
ATOM   986   O  OE2  . GLU A 1 63 ? 139.126 18.897  -0.430  1.00 0.00 ? 63  GLU A OE2  1  
ATOM   987   H  H    . GLU A 1 63 ? 136.009 13.624  -0.792  1.00 0.00 ? 63  GLU A H    1  
ATOM   988   H  HA   . GLU A 1 63 ? 135.525 15.789  1.003   1.00 0.00 ? 63  GLU A HA   1  
ATOM   989   H  HB2  . GLU A 1 63 ? 137.743 15.266  -0.013  1.00 0.00 ? 63  GLU A HB2  1  
ATOM   990   H  HB3  . GLU A 1 63 ? 137.119 15.802  -1.570  1.00 0.00 ? 63  GLU A HB3  1  
ATOM   991   H  HG2  . GLU A 1 63 ? 136.599 18.021  -0.559  1.00 0.00 ? 63  GLU A HG2  1  
ATOM   992   H  HG3  . GLU A 1 63 ? 137.342 17.479  0.945   1.00 0.00 ? 63  GLU A HG3  1  
ATOM   993   N  N    . ASN A 1 64 ? 134.304 15.898  -2.029  1.00 0.00 ? 64  ASN A N    1  
ATOM   994   C  CA   . ASN A 1 64 ? 133.365 16.566  -2.919  1.00 0.00 ? 64  ASN A CA   1  
ATOM   995   C  C    . ASN A 1 64 ? 132.005 16.730  -2.260  1.00 0.00 ? 64  ASN A C    1  
ATOM   996   O  O    . ASN A 1 64 ? 131.309 17.723  -2.473  1.00 0.00 ? 64  ASN A O    1  
ATOM   997   C  CB   . ASN A 1 64 ? 133.170 15.715  -4.177  1.00 0.00 ? 64  ASN A CB   1  
ATOM   998   C  CG   . ASN A 1 64 ? 134.506 15.432  -4.851  1.00 0.00 ? 64  ASN A CG   1  
ATOM   999   O  OD1  . ASN A 1 64 ? 134.789 14.280  -5.196  1.00 0.00 ? 64  ASN A OD1  1  
ATOM   1000  N  ND2  . ASN A 1 64 ? 135.345 16.409  -5.061  1.00 0.00 ? 64  ASN A ND2  1  
ATOM   1001  H  H    . ASN A 1 64 ? 134.724 15.063  -2.322  1.00 0.00 ? 64  ASN A H    1  
ATOM   1002  H  HA   . ASN A 1 64 ? 133.753 17.532  -3.201  1.00 0.00 ? 64  ASN A HA   1  
ATOM   1003  H  HB2  . ASN A 1 64 ? 132.704 14.780  -3.905  1.00 0.00 ? 64  ASN A HB2  1  
ATOM   1004  H  HB3  . ASN A 1 64 ? 132.529 16.244  -4.868  1.00 0.00 ? 64  ASN A HB3  1  
ATOM   1005  H  HD21 . ASN A 1 64 ? 135.114 17.321  -4.786  1.00 0.00 ? 64  ASN A HD21 1  
ATOM   1006  H  HD22 . ASN A 1 64 ? 136.206 16.231  -5.495  1.00 0.00 ? 64  ASN A HD22 1  
ATOM   1007  N  N    . GLY A 1 65 ? 131.617 15.717  -1.497  1.00 0.00 ? 65  GLY A N    1  
ATOM   1008  C  CA   . GLY A 1 65 ? 130.312 15.720  -0.849  1.00 0.00 ? 65  GLY A CA   1  
ATOM   1009  C  C    . GLY A 1 65 ? 129.271 15.313  -1.885  1.00 0.00 ? 65  GLY A C    1  
ATOM   1010  O  O    . GLY A 1 65 ? 128.064 15.370  -1.649  1.00 0.00 ? 65  GLY A O    1  
ATOM   1011  H  H    . GLY A 1 65 ? 132.208 14.939  -1.394  1.00 0.00 ? 65  GLY A H    1  
ATOM   1012  H  HA2  . GLY A 1 65 ? 130.312 15.013  -0.029  1.00 0.00 ? 65  GLY A HA2  1  
ATOM   1013  H  HA3  . GLY A 1 65 ? 130.087 16.708  -0.483  1.00 0.00 ? 65  GLY A HA3  1  
ATOM   1014  N  N    . ASP A 1 66 ? 129.784 14.920  -3.050  1.00 0.00 ? 66  ASP A N    1  
ATOM   1015  C  CA   . ASP A 1 66 ? 128.961 14.510  -4.184  1.00 0.00 ? 66  ASP A CA   1  
ATOM   1016  C  C    . ASP A 1 66 ? 128.123 13.262  -3.893  1.00 0.00 ? 66  ASP A C    1  
ATOM   1017  O  O    . ASP A 1 66 ? 127.015 13.119  -4.411  1.00 0.00 ? 66  ASP A O    1  
ATOM   1018  C  CB   . ASP A 1 66 ? 129.870 14.285  -5.405  1.00 0.00 ? 66  ASP A CB   1  
ATOM   1019  C  CG   . ASP A 1 66 ? 130.859 13.139  -5.158  1.00 0.00 ? 66  ASP A CG   1  
ATOM   1020  O  OD1  . ASP A 1 66 ? 130.641 12.375  -4.242  1.00 0.00 ? 66  ASP A OD1  1  
ATOM   1021  O  OD2  . ASP A 1 66 ? 131.829 13.047  -5.896  1.00 0.00 ? 66  ASP A OD2  1  
ATOM   1022  H  H    . ASP A 1 66 ? 130.758 14.919  -3.155  1.00 0.00 ? 66  ASP A H    1  
ATOM   1023  H  HA   . ASP A 1 66 ? 128.286 15.319  -4.417  1.00 0.00 ? 66  ASP A HA   1  
ATOM   1024  H  HB2  . ASP A 1 66 ? 129.259 14.047  -6.262  1.00 0.00 ? 66  ASP A HB2  1  
ATOM   1025  H  HB3  . ASP A 1 66 ? 130.422 15.192  -5.605  1.00 0.00 ? 66  ASP A HB3  1  
ATOM   1026  N  N    . GLY A 1 67 ? 128.659 12.357  -3.091  1.00 0.00 ? 67  GLY A N    1  
ATOM   1027  C  CA   . GLY A 1 67 ? 127.958 11.117  -2.771  1.00 0.00 ? 67  GLY A CA   1  
ATOM   1028  C  C    . GLY A 1 67 ? 128.432 10.014  -3.708  1.00 0.00 ? 67  GLY A C    1  
ATOM   1029  O  O    . GLY A 1 67 ? 128.058 8.850   -3.570  1.00 0.00 ? 67  GLY A O    1  
ATOM   1030  H  H    . GLY A 1 67 ? 129.554 12.512  -2.720  1.00 0.00 ? 67  GLY A H    1  
ATOM   1031  H  HA2  . GLY A 1 67 ? 128.169 10.839  -1.747  1.00 0.00 ? 67  GLY A HA2  1  
ATOM   1032  H  HA3  . GLY A 1 67 ? 126.897 11.258  -2.896  1.00 0.00 ? 67  GLY A HA3  1  
ATOM   1033  N  N    . GLU A 1 68 ? 129.288 10.407  -4.644  1.00 0.00 ? 68  GLU A N    1  
ATOM   1034  C  CA   . GLU A 1 68 ? 129.870 9.483   -5.609  1.00 0.00 ? 68  GLU A CA   1  
ATOM   1035  C  C    . GLU A 1 68 ? 131.351 9.340   -5.305  1.00 0.00 ? 68  GLU A C    1  
ATOM   1036  O  O    . GLU A 1 68 ? 131.957 10.246  -4.718  1.00 0.00 ? 68  GLU A O    1  
ATOM   1037  C  CB   . GLU A 1 68 ? 129.683 10.009  -7.035  1.00 0.00 ? 68  GLU A CB   1  
ATOM   1038  C  CG   . GLU A 1 68 ? 128.190 10.143  -7.342  1.00 0.00 ? 68  GLU A CG   1  
ATOM   1039  C  CD   . GLU A 1 68 ? 127.994 10.597  -8.785  1.00 0.00 ? 68  GLU A CD   1  
ATOM   1040  O  OE1  . GLU A 1 68 ? 128.980 10.947  -9.414  1.00 0.00 ? 68  GLU A OE1  1  
ATOM   1041  O  OE2  . GLU A 1 68 ? 126.863 10.588  -9.239  1.00 0.00 ? 68  GLU A OE2  1  
ATOM   1042  H  H    . GLU A 1 68 ? 129.551 11.348  -4.678  1.00 0.00 ? 68  GLU A H    1  
ATOM   1043  H  HA   . GLU A 1 68 ? 129.391 8.519   -5.517  1.00 0.00 ? 68  GLU A HA   1  
ATOM   1044  H  HB2  . GLU A 1 68 ? 130.157 10.975  -7.126  1.00 0.00 ? 68  GLU A HB2  1  
ATOM   1045  H  HB3  . GLU A 1 68 ? 130.131 9.320   -7.734  1.00 0.00 ? 68  GLU A HB3  1  
ATOM   1046  H  HG2  . GLU A 1 68 ? 127.710 9.186   -7.200  1.00 0.00 ? 68  GLU A HG2  1  
ATOM   1047  H  HG3  . GLU A 1 68 ? 127.750 10.869  -6.676  1.00 0.00 ? 68  GLU A HG3  1  
ATOM   1048  N  N    . VAL A 1 69 ? 131.944 8.208   -5.681  1.00 0.00 ? 69  VAL A N    1  
ATOM   1049  C  CA   . VAL A 1 69 ? 133.360 7.996   -5.398  1.00 0.00 ? 69  VAL A CA   1  
ATOM   1050  C  C    . VAL A 1 69 ? 134.169 7.682   -6.642  1.00 0.00 ? 69  VAL A C    1  
ATOM   1051  O  O    . VAL A 1 69 ? 133.689 7.077   -7.601  1.00 0.00 ? 69  VAL A O    1  
ATOM   1052  C  CB   . VAL A 1 69 ? 133.517 6.852   -4.393  1.00 0.00 ? 69  VAL A CB   1  
ATOM   1053  C  CG1  . VAL A 1 69 ? 132.776 7.196   -3.102  1.00 0.00 ? 69  VAL A CG1  1  
ATOM   1054  C  CG2  . VAL A 1 69 ? 132.937 5.566   -4.987  1.00 0.00 ? 69  VAL A CG2  1  
ATOM   1055  H  H    . VAL A 1 69 ? 131.426 7.511   -6.135  1.00 0.00 ? 69  VAL A H    1  
ATOM   1056  H  HA   . VAL A 1 69 ? 133.765 8.888   -4.956  1.00 0.00 ? 69  VAL A HA   1  
ATOM   1057  H  HB   . VAL A 1 69 ? 134.562 6.704   -4.177  1.00 0.00 ? 69  VAL A HB   1  
ATOM   1058  H  HG11 . VAL A 1 69 ? 133.171 8.114   -2.695  1.00 0.00 ? 69  VAL A HG11 1  
ATOM   1059  H  HG12 . VAL A 1 69 ? 132.913 6.398   -2.385  1.00 0.00 ? 69  VAL A HG12 1  
ATOM   1060  H  HG13 . VAL A 1 69 ? 131.725 7.318   -3.314  1.00 0.00 ? 69  VAL A HG13 1  
ATOM   1061  H  HG21 . VAL A 1 69 ? 132.645 4.900   -4.188  1.00 0.00 ? 69  VAL A HG21 1  
ATOM   1062  H  HG22 . VAL A 1 69 ? 133.684 5.085   -5.601  1.00 0.00 ? 69  VAL A HG22 1  
ATOM   1063  H  HG23 . VAL A 1 69 ? 132.073 5.806   -5.590  1.00 0.00 ? 69  VAL A HG23 1  
ATOM   1064  N  N    . ASP A 1 70 ? 135.426 8.097   -6.575  1.00 0.00 ? 70  ASP A N    1  
ATOM   1065  C  CA   . ASP A 1 70 ? 136.391 7.883   -7.636  1.00 0.00 ? 70  ASP A CA   1  
ATOM   1066  C  C    . ASP A 1 70 ? 137.366 6.810   -7.186  1.00 0.00 ? 70  ASP A C    1  
ATOM   1067  O  O    . ASP A 1 70 ? 137.400 6.463   -6.005  1.00 0.00 ? 70  ASP A O    1  
ATOM   1068  C  CB   . ASP A 1 70 ? 137.144 9.179   -7.941  1.00 0.00 ? 70  ASP A CB   1  
ATOM   1069  C  CG   . ASP A 1 70 ? 136.186 10.216  -8.517  1.00 0.00 ? 70  ASP A CG   1  
ATOM   1070  O  OD1  . ASP A 1 70 ? 135.085 9.838   -8.883  1.00 0.00 ? 70  ASP A OD1  1  
ATOM   1071  O  OD2  . ASP A 1 70 ? 136.567 11.374  -8.584  1.00 0.00 ? 70  ASP A OD2  1  
ATOM   1072  H  H    . ASP A 1 70 ? 135.722 8.556   -5.761  1.00 0.00 ? 70  ASP A H    1  
ATOM   1073  H  HA   . ASP A 1 70 ? 135.878 7.549   -8.527  1.00 0.00 ? 70  ASP A HA   1  
ATOM   1074  H  HB2  . ASP A 1 70 ? 137.581 9.562   -7.029  1.00 0.00 ? 70  ASP A HB2  1  
ATOM   1075  H  HB3  . ASP A 1 70 ? 137.927 8.979   -8.657  1.00 0.00 ? 70  ASP A HB3  1  
ATOM   1076  N  N    . PHE A 1 71 ? 138.152 6.276   -8.102  1.00 0.00 ? 71  PHE A N    1  
ATOM   1077  C  CA   . PHE A 1 71 ? 139.095 5.242   -7.718  1.00 0.00 ? 71  PHE A CA   1  
ATOM   1078  C  C    . PHE A 1 71 ? 139.920 5.713   -6.526  1.00 0.00 ? 71  PHE A C    1  
ATOM   1079  O  O    . PHE A 1 71 ? 140.163 4.946   -5.593  1.00 0.00 ? 71  PHE A O    1  
ATOM   1080  C  CB   . PHE A 1 71 ? 140.022 4.911   -8.889  1.00 0.00 ? 71  PHE A CB   1  
ATOM   1081  C  CG   . PHE A 1 71 ? 140.933 3.769   -8.502  1.00 0.00 ? 71  PHE A CG   1  
ATOM   1082  C  CD1  . PHE A 1 71 ? 140.485 2.447   -8.602  1.00 0.00 ? 71  PHE A CD1  1  
ATOM   1083  C  CD2  . PHE A 1 71 ? 142.229 4.037   -8.046  1.00 0.00 ? 71  PHE A CD2  1  
ATOM   1084  C  CE1  . PHE A 1 71 ? 141.334 1.392   -8.244  1.00 0.00 ? 71  PHE A CE1  1  
ATOM   1085  C  CE2  . PHE A 1 71 ? 143.078 2.984   -7.689  1.00 0.00 ? 71  PHE A CE2  1  
ATOM   1086  C  CZ   . PHE A 1 71 ? 142.631 1.661   -7.788  1.00 0.00 ? 71  PHE A CZ   1  
ATOM   1087  H  H    . PHE A 1 71 ? 138.096 6.571   -9.034  1.00 0.00 ? 71  PHE A H    1  
ATOM   1088  H  HA   . PHE A 1 71 ? 138.549 4.353   -7.439  1.00 0.00 ? 71  PHE A HA   1  
ATOM   1089  H  HB2  . PHE A 1 71 ? 139.432 4.626   -9.746  1.00 0.00 ? 71  PHE A HB2  1  
ATOM   1090  H  HB3  . PHE A 1 71 ? 140.618 5.777   -9.133  1.00 0.00 ? 71  PHE A HB3  1  
ATOM   1091  H  HD1  . PHE A 1 71 ? 139.485 2.240   -8.953  1.00 0.00 ? 71  PHE A HD1  1  
ATOM   1092  H  HD2  . PHE A 1 71 ? 142.574 5.058   -7.971  1.00 0.00 ? 71  PHE A HD2  1  
ATOM   1093  H  HE1  . PHE A 1 71 ? 140.990 0.371   -8.320  1.00 0.00 ? 71  PHE A HE1  1  
ATOM   1094  H  HE2  . PHE A 1 71 ? 144.077 3.192   -7.339  1.00 0.00 ? 71  PHE A HE2  1  
ATOM   1095  H  HZ   . PHE A 1 71 ? 143.286 0.848   -7.512  1.00 0.00 ? 71  PHE A HZ   1  
ATOM   1096  N  N    . GLN A 1 72 ? 140.340 6.976   -6.543  1.00 0.00 ? 72  GLN A N    1  
ATOM   1097  C  CA   . GLN A 1 72 ? 141.120 7.501   -5.431  1.00 0.00 ? 72  GLN A CA   1  
ATOM   1098  C  C    . GLN A 1 72 ? 140.349 7.417   -4.115  1.00 0.00 ? 72  GLN A C    1  
ATOM   1099  O  O    . GLN A 1 72 ? 140.910 7.041   -3.092  1.00 0.00 ? 72  GLN A O    1  
ATOM   1100  C  CB   . GLN A 1 72 ? 141.506 8.957   -5.698  1.00 0.00 ? 72  GLN A CB   1  
ATOM   1101  C  CG   . GLN A 1 72 ? 142.430 9.451   -4.581  1.00 0.00 ? 72  GLN A CG   1  
ATOM   1102  C  CD   . GLN A 1 72 ? 142.764 10.924  -4.792  1.00 0.00 ? 72  GLN A CD   1  
ATOM   1103  O  OE1  . GLN A 1 72 ? 141.871 11.771  -4.778  1.00 0.00 ? 72  GLN A OE1  1  
ATOM   1104  N  NE2  . GLN A 1 72 ? 144.003 11.282  -4.988  1.00 0.00 ? 72  GLN A NE2  1  
ATOM   1105  H  H    . GLN A 1 72 ? 140.116 7.556   -7.301  1.00 0.00 ? 72  GLN A H    1  
ATOM   1106  H  HA   . GLN A 1 72 ? 142.025 6.919   -5.338  1.00 0.00 ? 72  GLN A HA   1  
ATOM   1107  H  HB2  . GLN A 1 72 ? 142.018 9.025   -6.647  1.00 0.00 ? 72  GLN A HB2  1  
ATOM   1108  H  HB3  . GLN A 1 72 ? 140.616 9.567   -5.723  1.00 0.00 ? 72  GLN A HB3  1  
ATOM   1109  H  HG2  . GLN A 1 72 ? 141.933 9.333   -3.629  1.00 0.00 ? 72  GLN A HG2  1  
ATOM   1110  H  HG3  . GLN A 1 72 ? 143.339 8.871   -4.581  1.00 0.00 ? 72  GLN A HG3  1  
ATOM   1111  H  HE21 . GLN A 1 72 ? 144.713 10.606  -4.999  1.00 0.00 ? 72  GLN A HE21 1  
ATOM   1112  H  HE22 . GLN A 1 72 ? 144.225 12.227  -5.124  1.00 0.00 ? 72  GLN A HE22 1  
ATOM   1113  N  N    . GLU A 1 73 ? 139.061 7.757   -4.132  1.00 0.00 ? 73  GLU A N    1  
ATOM   1114  C  CA   . GLU A 1 73 ? 138.278 7.678   -2.903  1.00 0.00 ? 73  GLU A CA   1  
ATOM   1115  C  C    . GLU A 1 73 ? 138.082 6.215   -2.485  1.00 0.00 ? 73  GLU A C    1  
ATOM   1116  O  O    . GLU A 1 73 ? 138.098 5.876   -1.298  1.00 0.00 ? 73  GLU A O    1  
ATOM   1117  C  CB   . GLU A 1 73 ? 136.912 8.354   -3.084  1.00 0.00 ? 73  GLU A CB   1  
ATOM   1118  C  CG   . GLU A 1 73 ? 137.087 9.856   -3.344  1.00 0.00 ? 73  GLU A CG   1  
ATOM   1119  C  CD   . GLU A 1 73 ? 135.716 10.536  -3.395  1.00 0.00 ? 73  GLU A CD   1  
ATOM   1120  O  OE1  . GLU A 1 73 ? 134.732 9.846   -3.211  1.00 0.00 ? 73  GLU A OE1  1  
ATOM   1121  O  OE2  . GLU A 1 73 ? 135.667 11.733  -3.639  1.00 0.00 ? 73  GLU A OE2  1  
ATOM   1122  H  H    . GLU A 1 73 ? 138.640 8.050   -4.966  1.00 0.00 ? 73  GLU A H    1  
ATOM   1123  H  HA   . GLU A 1 73 ? 138.814 8.194   -2.120  1.00 0.00 ? 73  GLU A HA   1  
ATOM   1124  H  HB2  . GLU A 1 73 ? 136.411 7.907   -3.926  1.00 0.00 ? 73  GLU A HB2  1  
ATOM   1125  H  HB3  . GLU A 1 73 ? 136.318 8.210   -2.194  1.00 0.00 ? 73  GLU A HB3  1  
ATOM   1126  H  HG2  . GLU A 1 73 ? 137.675 10.291  -2.550  1.00 0.00 ? 73  GLU A HG2  1  
ATOM   1127  H  HG3  . GLU A 1 73 ? 137.593 10.000  -4.286  1.00 0.00 ? 73  GLU A HG3  1  
ATOM   1128  N  N    . TYR A 1 74 ? 137.880 5.356   -3.486  1.00 0.00 ? 74  TYR A N    1  
ATOM   1129  C  CA   . TYR A 1 74 ? 137.660 3.929   -3.246  1.00 0.00 ? 74  TYR A CA   1  
ATOM   1130  C  C    . TYR A 1 74 ? 138.849 3.242   -2.577  1.00 0.00 ? 74  TYR A C    1  
ATOM   1131  O  O    . TYR A 1 74 ? 138.673 2.440   -1.651  1.00 0.00 ? 74  TYR A O    1  
ATOM   1132  C  CB   . TYR A 1 74 ? 137.384 3.236   -4.583  1.00 0.00 ? 74  TYR A CB   1  
ATOM   1133  C  CG   . TYR A 1 74 ? 137.118 1.765   -4.359  1.00 0.00 ? 74  TYR A CG   1  
ATOM   1134  C  CD1  . TYR A 1 74 ? 135.823 1.311   -4.075  1.00 0.00 ? 74  TYR A CD1  1  
ATOM   1135  C  CD2  . TYR A 1 74 ? 138.177 0.853   -4.442  1.00 0.00 ? 74  TYR A CD2  1  
ATOM   1136  C  CE1  . TYR A 1 74 ? 135.591 -0.058  -3.873  1.00 0.00 ? 74  TYR A CE1  1  
ATOM   1137  C  CE2  . TYR A 1 74 ? 137.945 -0.512  -4.240  1.00 0.00 ? 74  TYR A CE2  1  
ATOM   1138  C  CZ   . TYR A 1 74 ? 136.653 -0.967  -3.956  1.00 0.00 ? 74  TYR A CZ   1  
ATOM   1139  O  OH   . TYR A 1 74 ? 136.424 -2.314  -3.759  1.00 0.00 ? 74  TYR A OH   1  
ATOM   1140  H  H    . TYR A 1 74 ? 137.866 5.690   -4.407  1.00 0.00 ? 74  TYR A H    1  
ATOM   1141  H  HA   . TYR A 1 74 ? 136.792 3.811   -2.617  1.00 0.00 ? 74  TYR A HA   1  
ATOM   1142  H  HB2  . TYR A 1 74 ? 136.521 3.690   -5.048  1.00 0.00 ? 74  TYR A HB2  1  
ATOM   1143  H  HB3  . TYR A 1 74 ? 138.241 3.352   -5.230  1.00 0.00 ? 74  TYR A HB3  1  
ATOM   1144  H  HD1  . TYR A 1 74 ? 135.006 2.014   -4.011  1.00 0.00 ? 74  TYR A HD1  1  
ATOM   1145  H  HD2  . TYR A 1 74 ? 139.174 1.204   -4.661  1.00 0.00 ? 74  TYR A HD2  1  
ATOM   1146  H  HE1  . TYR A 1 74 ? 134.594 -0.412  -3.655  1.00 0.00 ? 74  TYR A HE1  1  
ATOM   1147  H  HE2  . TYR A 1 74 ? 138.765 -1.212  -4.303  1.00 0.00 ? 74  TYR A HE2  1  
ATOM   1148  H  HH   . TYR A 1 74 ? 136.592 -2.768  -4.588  1.00 0.00 ? 74  TYR A HH   1  
ATOM   1149  N  N    . VAL A 1 75 ? 140.056 3.526   -3.060  1.00 0.00 ? 75  VAL A N    1  
ATOM   1150  C  CA   . VAL A 1 75 ? 141.234 2.877   -2.497  1.00 0.00 ? 75  VAL A CA   1  
ATOM   1151  C  C    . VAL A 1 75 ? 141.383 3.199   -1.017  1.00 0.00 ? 75  VAL A C    1  
ATOM   1152  O  O    . VAL A 1 75 ? 141.731 2.327   -0.221  1.00 0.00 ? 75  VAL A O    1  
ATOM   1153  C  CB   . VAL A 1 75 ? 142.504 3.279   -3.258  1.00 0.00 ? 75  VAL A CB   1  
ATOM   1154  C  CG1  . VAL A 1 75 ? 142.975 4.663   -2.807  1.00 0.00 ? 75  VAL A CG1  1  
ATOM   1155  C  CG2  . VAL A 1 75 ? 143.603 2.241   -2.990  1.00 0.00 ? 75  VAL A CG2  1  
ATOM   1156  H  H    . VAL A 1 75 ? 140.147 4.151   -3.811  1.00 0.00 ? 75  VAL A H    1  
ATOM   1157  H  HA   . VAL A 1 75 ? 141.107 1.809   -2.597  1.00 0.00 ? 75  VAL A HA   1  
ATOM   1158  H  HB   . VAL A 1 75 ? 142.288 3.306   -4.316  1.00 0.00 ? 75  VAL A HB   1  
ATOM   1159  H  HG11 . VAL A 1 75 ? 143.625 4.563   -1.951  1.00 0.00 ? 75  VAL A HG11 1  
ATOM   1160  H  HG12 . VAL A 1 75 ? 142.125 5.263   -2.543  1.00 0.00 ? 75  VAL A HG12 1  
ATOM   1161  H  HG13 . VAL A 1 75 ? 143.514 5.139   -3.613  1.00 0.00 ? 75  VAL A HG13 1  
ATOM   1162  H  HG21 . VAL A 1 75 ? 143.576 1.484   -3.761  1.00 0.00 ? 75  VAL A HG21 1  
ATOM   1163  H  HG22 . VAL A 1 75 ? 143.441 1.777   -2.028  1.00 0.00 ? 75  VAL A HG22 1  
ATOM   1164  H  HG23 . VAL A 1 75 ? 144.567 2.724   -2.996  1.00 0.00 ? 75  VAL A HG23 1  
ATOM   1165  N  N    . VAL A 1 76 ? 141.096 4.439   -0.639  1.00 0.00 ? 76  VAL A N    1  
ATOM   1166  C  CA   . VAL A 1 76 ? 141.186 4.807   0.761   1.00 0.00 ? 76  VAL A CA   1  
ATOM   1167  C  C    . VAL A 1 76 ? 139.993 4.248   1.519   1.00 0.00 ? 76  VAL A C    1  
ATOM   1168  O  O    . VAL A 1 76 ? 140.104 3.882   2.689   1.00 0.00 ? 76  VAL A O    1  
ATOM   1169  C  CB   . VAL A 1 76 ? 141.264 6.332   0.924   1.00 0.00 ? 76  VAL A CB   1  
ATOM   1170  C  CG1  . VAL A 1 76 ? 142.490 6.857   0.175   1.00 0.00 ? 76  VAL A CG1  1  
ATOM   1171  C  CG2  . VAL A 1 76 ? 140.011 6.990   0.345   1.00 0.00 ? 76  VAL A CG2  1  
ATOM   1172  H  H    . VAL A 1 76 ? 140.804 5.099   -1.301  1.00 0.00 ? 76  VAL A H    1  
ATOM   1173  H  HA   . VAL A 1 76 ? 142.086 4.373   1.172   1.00 0.00 ? 76  VAL A HA   1  
ATOM   1174  H  HB   . VAL A 1 76 ? 141.352 6.577   1.973   1.00 0.00 ? 76  VAL A HB   1  
ATOM   1175  H  HG11 . VAL A 1 76 ? 143.317 6.177   0.317   1.00 0.00 ? 76  VAL A HG11 1  
ATOM   1176  H  HG12 . VAL A 1 76 ? 142.756 7.831   0.557   1.00 0.00 ? 76  VAL A HG12 1  
ATOM   1177  H  HG13 . VAL A 1 76 ? 142.263 6.933   -0.878  1.00 0.00 ? 76  VAL A HG13 1  
ATOM   1178  H  HG21 . VAL A 1 76 ? 140.036 6.909   -0.731  1.00 0.00 ? 76  VAL A HG21 1  
ATOM   1179  H  HG22 . VAL A 1 76 ? 139.991 8.033   0.626   1.00 0.00 ? 76  VAL A HG22 1  
ATOM   1180  H  HG23 . VAL A 1 76 ? 139.128 6.499   0.726   1.00 0.00 ? 76  VAL A HG23 1  
ATOM   1181  N  N    . LEU A 1 77 ? 138.844 4.183   0.844   1.00 0.00 ? 77  LEU A N    1  
ATOM   1182  C  CA   . LEU A 1 77 ? 137.645 3.663   1.483   1.00 0.00 ? 77  LEU A CA   1  
ATOM   1183  C  C    . LEU A 1 77 ? 137.843 2.217   1.921   1.00 0.00 ? 77  LEU A C    1  
ATOM   1184  O  O    . LEU A 1 77 ? 137.448 1.839   3.023   1.00 0.00 ? 77  LEU A O    1  
ATOM   1185  C  CB   . LEU A 1 77 ? 136.468 3.749   0.505   1.00 0.00 ? 77  LEU A CB   1  
ATOM   1186  C  CG   . LEU A 1 77 ? 135.151 3.416   1.231   1.00 0.00 ? 77  LEU A CG   1  
ATOM   1187  C  CD1  . LEU A 1 77 ? 134.003 4.184   0.577   1.00 0.00 ? 77  LEU A CD1  1  
ATOM   1188  C  CD2  . LEU A 1 77 ? 134.851 1.913   1.136   1.00 0.00 ? 77  LEU A CD2  1  
ATOM   1189  H  H    . LEU A 1 77 ? 138.805 4.493   -0.090  1.00 0.00 ? 77  LEU A H    1  
ATOM   1190  H  HA   . LEU A 1 77 ? 137.423 4.265   2.350   1.00 0.00 ? 77  LEU A HA   1  
ATOM   1191  H  HB2  . LEU A 1 77 ? 136.416 4.749   0.100   1.00 0.00 ? 77  LEU A HB2  1  
ATOM   1192  H  HB3  . LEU A 1 77 ? 136.625 3.049   -0.300  1.00 0.00 ? 77  LEU A HB3  1  
ATOM   1193  H  HG   . LEU A 1 77 ? 135.227 3.702   2.270   1.00 0.00 ? 77  LEU A HG   1  
ATOM   1194  H  HD11 . LEU A 1 77 ? 133.077 3.932   1.072   1.00 0.00 ? 77  LEU A HD11 1  
ATOM   1195  H  HD12 . LEU A 1 77 ? 133.940 3.918   -0.467  1.00 0.00 ? 77  LEU A HD12 1  
ATOM   1196  H  HD13 . LEU A 1 77 ? 134.182 5.245   0.669   1.00 0.00 ? 77  LEU A HD13 1  
ATOM   1197  H  HD21 . LEU A 1 77 ? 135.032 1.564   0.131   1.00 0.00 ? 77  LEU A HD21 1  
ATOM   1198  H  HD22 . LEU A 1 77 ? 133.815 1.739   1.391   1.00 0.00 ? 77  LEU A HD22 1  
ATOM   1199  H  HD23 . LEU A 1 77 ? 135.481 1.371   1.825   1.00 0.00 ? 77  LEU A HD23 1  
ATOM   1200  N  N    . VAL A 1 78 ? 138.470 1.409   1.065   1.00 0.00 ? 78  VAL A N    1  
ATOM   1201  C  CA   . VAL A 1 78 ? 138.714 0.014   1.417   1.00 0.00 ? 78  VAL A CA   1  
ATOM   1202  C  C    . VAL A 1 78 ? 139.826 -0.097  2.456   1.00 0.00 ? 78  VAL A C    1  
ATOM   1203  O  O    . VAL A 1 78 ? 139.829 -1.000  3.299   1.00 0.00 ? 78  VAL A O    1  
ATOM   1204  C  CB   . VAL A 1 78 ? 139.064 -0.807  0.170   1.00 0.00 ? 78  VAL A CB   1  
ATOM   1205  C  CG1  . VAL A 1 78 ? 137.954 -0.647  -0.870  1.00 0.00 ? 78  VAL A CG1  1  
ATOM   1206  C  CG2  . VAL A 1 78 ? 140.389 -0.323  -0.430  1.00 0.00 ? 78  VAL A CG2  1  
ATOM   1207  H  H    . VAL A 1 78 ? 138.776 1.758   0.196   1.00 0.00 ? 78  VAL A H    1  
ATOM   1208  H  HA   . VAL A 1 78 ? 137.808 -0.390  1.847   1.00 0.00 ? 78  VAL A HA   1  
ATOM   1209  H  HB   . VAL A 1 78 ? 139.148 -1.850  0.443   1.00 0.00 ? 78  VAL A HB   1  
ATOM   1210  H  HG11 . VAL A 1 78 ? 138.250 -1.131  -1.788  1.00 0.00 ? 78  VAL A HG11 1  
ATOM   1211  H  HG12 . VAL A 1 78 ? 137.782 0.402   -1.054  1.00 0.00 ? 78  VAL A HG12 1  
ATOM   1212  H  HG13 . VAL A 1 78 ? 137.047 -1.102  -0.500  1.00 0.00 ? 78  VAL A HG13 1  
ATOM   1213  H  HG21 . VAL A 1 78 ? 141.158 -0.336  0.326   1.00 0.00 ? 78  VAL A HG21 1  
ATOM   1214  H  HG22 . VAL A 1 78 ? 140.266 0.680   -0.803  1.00 0.00 ? 78  VAL A HG22 1  
ATOM   1215  H  HG23 . VAL A 1 78 ? 140.674 -0.977  -1.244  1.00 0.00 ? 78  VAL A HG23 1  
ATOM   1216  N  N    . ALA A 1 79 ? 140.781 0.827   2.380   1.00 0.00 ? 79  ALA A N    1  
ATOM   1217  C  CA   . ALA A 1 79 ? 141.906 0.818   3.304   1.00 0.00 ? 79  ALA A CA   1  
ATOM   1218  C  C    . ALA A 1 79 ? 141.435 0.995   4.742   1.00 0.00 ? 79  ALA A C    1  
ATOM   1219  O  O    . ALA A 1 79 ? 141.966 0.363   5.655   1.00 0.00 ? 79  ALA A O    1  
ATOM   1220  C  CB   . ALA A 1 79 ? 142.887 1.936   2.934   1.00 0.00 ? 79  ALA A CB   1  
ATOM   1221  H  H    . ALA A 1 79 ? 140.733 1.516   1.685   1.00 0.00 ? 79  ALA A H    1  
ATOM   1222  H  HA   . ALA A 1 79 ? 142.416 -0.129  3.219   1.00 0.00 ? 79  ALA A HA   1  
ATOM   1223  H  HB1  . ALA A 1 79 ? 142.684 2.814   3.530   1.00 0.00 ? 79  ALA A HB1  1  
ATOM   1224  H  HB2  . ALA A 1 79 ? 142.774 2.181   1.888   1.00 0.00 ? 79  ALA A HB2  1  
ATOM   1225  H  HB3  . ALA A 1 79 ? 143.898 1.603   3.115   1.00 0.00 ? 79  ALA A HB3  1  
ATOM   1226  N  N    . ALA A 1 80 ? 140.431 1.842   4.946   1.00 0.00 ? 80  ALA A N    1  
ATOM   1227  C  CA   . ALA A 1 80 ? 139.917 2.054   6.291   1.00 0.00 ? 80  ALA A CA   1  
ATOM   1228  C  C    . ALA A 1 80 ? 139.295 0.768   6.817   1.00 0.00 ? 80  ALA A C    1  
ATOM   1229  O  O    . ALA A 1 80 ? 139.496 0.392   7.971   1.00 0.00 ? 80  ALA A O    1  
ATOM   1230  C  CB   . ALA A 1 80 ? 138.870 3.170   6.285   1.00 0.00 ? 80  ALA A CB   1  
ATOM   1231  H  H    . ALA A 1 80 ? 140.031 2.319   4.189   1.00 0.00 ? 80  ALA A H    1  
ATOM   1232  H  HA   . ALA A 1 80 ? 140.732 2.341   6.939   1.00 0.00 ? 80  ALA A HA   1  
ATOM   1233  H  HB1  . ALA A 1 80 ? 138.051 2.891   5.639   1.00 0.00 ? 80  ALA A HB1  1  
ATOM   1234  H  HB2  . ALA A 1 80 ? 139.320 4.083   5.924   1.00 0.00 ? 80  ALA A HB2  1  
ATOM   1235  H  HB3  . ALA A 1 80 ? 138.501 3.323   7.288   1.00 0.00 ? 80  ALA A HB3  1  
ATOM   1236  N  N    . LEU A 1 81 ? 138.549 0.088   5.949   1.00 0.00 ? 81  LEU A N    1  
ATOM   1237  C  CA   . LEU A 1 81 ? 137.915 -1.169  6.322   1.00 0.00 ? 81  LEU A CA   1  
ATOM   1238  C  C    . LEU A 1 81 ? 138.969 -2.225  6.632   1.00 0.00 ? 81  LEU A C    1  
ATOM   1239  O  O    . LEU A 1 81 ? 138.795 -3.047  7.533   1.00 0.00 ? 81  LEU A O    1  
ATOM   1240  C  CB   . LEU A 1 81 ? 137.011 -1.657  5.186   1.00 0.00 ? 81  LEU A CB   1  
ATOM   1241  C  CG   . LEU A 1 81 ? 135.963 -0.588  4.860   1.00 0.00 ? 81  LEU A CG   1  
ATOM   1242  C  CD1  . LEU A 1 81 ? 134.992 -1.128  3.809   1.00 0.00 ? 81  LEU A CD1  1  
ATOM   1243  C  CD2  . LEU A 1 81 ? 135.181 -0.224  6.127   1.00 0.00 ? 81  LEU A CD2  1  
ATOM   1244  H  H    . LEU A 1 81 ? 138.436 0.432   5.038   1.00 0.00 ? 81  LEU A H    1  
ATOM   1245  H  HA   . LEU A 1 81 ? 137.315 -1.010  7.204   1.00 0.00 ? 81  LEU A HA   1  
ATOM   1246  H  HB2  . LEU A 1 81 ? 137.612 -1.850  4.307   1.00 0.00 ? 81  LEU A HB2  1  
ATOM   1247  H  HB3  . LEU A 1 81 ? 136.514 -2.565  5.487   1.00 0.00 ? 81  LEU A HB3  1  
ATOM   1248  H  HG   . LEU A 1 81 ? 136.456 0.293   4.474   1.00 0.00 ? 81  LEU A HG   1  
ATOM   1249  H  HD11 . LEU A 1 81 ? 134.621 -2.092  4.122   1.00 0.00 ? 81  LEU A HD11 1  
ATOM   1250  H  HD12 . LEU A 1 81 ? 135.506 -1.230  2.863   1.00 0.00 ? 81  LEU A HD12 1  
ATOM   1251  H  HD13 . LEU A 1 81 ? 134.165 -0.443  3.697   1.00 0.00 ? 81  LEU A HD13 1  
ATOM   1252  H  HD21 . LEU A 1 81 ? 135.071 -1.103  6.745   1.00 0.00 ? 81  LEU A HD21 1  
ATOM   1253  H  HD22 . LEU A 1 81 ? 134.205 0.150   5.855   1.00 0.00 ? 81  LEU A HD22 1  
ATOM   1254  H  HD23 . LEU A 1 81 ? 135.717 0.536   6.675   1.00 0.00 ? 81  LEU A HD23 1  
ATOM   1255  N  N    . THR A 1 82 ? 140.070 -2.185  5.882   1.00 0.00 ? 82  THR A N    1  
ATOM   1256  C  CA   . THR A 1 82 ? 141.151 -3.147  6.073   1.00 0.00 ? 82  THR A CA   1  
ATOM   1257  C  C    . THR A 1 82 ? 141.593 -3.181  7.526   1.00 0.00 ? 82  THR A C    1  
ATOM   1258  O  O    . THR A 1 82 ? 141.898 -4.243  8.067   1.00 0.00 ? 82  THR A O    1  
ATOM   1259  C  CB   . THR A 1 82 ? 142.344 -2.765  5.198   1.00 0.00 ? 82  THR A CB   1  
ATOM   1260  O  OG1  . THR A 1 82 ? 141.935 -2.690  3.840   1.00 0.00 ? 82  THR A OG1  1  
ATOM   1261  C  CG2  . THR A 1 82 ? 143.459 -3.801  5.358   1.00 0.00 ? 82  THR A CG2  1  
ATOM   1262  H  H    . THR A 1 82 ? 140.150 -1.499  5.178   1.00 0.00 ? 82  THR A H    1  
ATOM   1263  H  HA   . THR A 1 82 ? 140.806 -4.127  5.786   1.00 0.00 ? 82  THR A HA   1  
ATOM   1264  H  HB   . THR A 1 82 ? 142.713 -1.803  5.511   1.00 0.00 ? 82  THR A HB   1  
ATOM   1265  H  HG1  . THR A 1 82 ? 142.722 -2.728  3.291   1.00 0.00 ? 82  THR A HG1  1  
ATOM   1266  H  HG21 . THR A 1 82 ? 143.028 -4.775  5.530   1.00 0.00 ? 82  THR A HG21 1  
ATOM   1267  H  HG22 . THR A 1 82 ? 144.083 -3.532  6.198   1.00 0.00 ? 82  THR A HG22 1  
ATOM   1268  H  HG23 . THR A 1 82 ? 144.060 -3.825  4.461   1.00 0.00 ? 82  THR A HG23 1  
ATOM   1269  N  N    . VAL A 1 83 ? 141.622 -2.020  8.151   1.00 0.00 ? 83  VAL A N    1  
ATOM   1270  C  CA   . VAL A 1 83 ? 142.024 -1.936  9.541   1.00 0.00 ? 83  VAL A CA   1  
ATOM   1271  C  C    . VAL A 1 83 ? 141.089 -2.768  10.412  1.00 0.00 ? 83  VAL A C    1  
ATOM   1272  O  O    . VAL A 1 83 ? 141.519 -3.364  11.399  1.00 0.00 ? 83  VAL A O    1  
ATOM   1273  C  CB   . VAL A 1 83 ? 142.016 -0.482  10.013  1.00 0.00 ? 83  VAL A CB   1  
ATOM   1274  C  CG1  . VAL A 1 83 ? 142.310 -0.436  11.514  1.00 0.00 ? 83  VAL A CG1  1  
ATOM   1275  C  CG2  . VAL A 1 83 ? 143.090 0.303   9.258   1.00 0.00 ? 83  VAL A CG2  1  
ATOM   1276  H  H    . VAL A 1 83 ? 141.366 -1.205  7.671   1.00 0.00 ? 83  VAL A H    1  
ATOM   1277  H  HA   . VAL A 1 83 ? 143.026 -2.327  9.636   1.00 0.00 ? 83  VAL A HA   1  
ATOM   1278  H  HB   . VAL A 1 83 ? 141.045 -0.048  9.822   1.00 0.00 ? 83  VAL A HB   1  
ATOM   1279  H  HG11 . VAL A 1 83 ? 141.482 -0.865  12.058  1.00 0.00 ? 83  VAL A HG11 1  
ATOM   1280  H  HG12 . VAL A 1 83 ? 142.450 0.591   11.821  1.00 0.00 ? 83  VAL A HG12 1  
ATOM   1281  H  HG13 . VAL A 1 83 ? 143.211 -0.999  11.724  1.00 0.00 ? 83  VAL A HG13 1  
ATOM   1282  H  HG21 . VAL A 1 83 ? 144.043 0.171   9.746   1.00 0.00 ? 83  VAL A HG21 1  
ATOM   1283  H  HG22 . VAL A 1 83 ? 142.831 1.352   9.253   1.00 0.00 ? 83  VAL A HG22 1  
ATOM   1284  H  HG23 . VAL A 1 83 ? 143.153 -0.057  8.242   1.00 0.00 ? 83  VAL A HG23 1  
ATOM   1285  N  N    . ALA A 1 84 ? 139.804 -2.802  10.056  1.00 0.00 ? 84  ALA A N    1  
ATOM   1286  C  CA   . ALA A 1 84 ? 138.841 -3.564  10.842  1.00 0.00 ? 84  ALA A CA   1  
ATOM   1287  C  C    . ALA A 1 84 ? 139.195 -5.048  10.846  1.00 0.00 ? 84  ALA A C    1  
ATOM   1288  O  O    . ALA A 1 84 ? 139.073 -5.723  11.876  1.00 0.00 ? 84  ALA A O    1  
ATOM   1289  C  CB   . ALA A 1 84 ? 137.435 -3.376  10.269  1.00 0.00 ? 84  ALA A CB   1  
ATOM   1290  H  H    . ALA A 1 84 ? 139.499 -2.313  9.251   1.00 0.00 ? 84  ALA A H    1  
ATOM   1291  H  HA   . ALA A 1 84 ? 138.853 -3.199  11.857  1.00 0.00 ? 84  ALA A HA   1  
ATOM   1292  H  HB1  . ALA A 1 84 ? 137.389 -3.805  9.279   1.00 0.00 ? 84  ALA A HB1  1  
ATOM   1293  H  HB2  . ALA A 1 84 ? 137.208 -2.321  10.215  1.00 0.00 ? 84  ALA A HB2  1  
ATOM   1294  H  HB3  . ALA A 1 84 ? 136.718 -3.867  10.909  1.00 0.00 ? 84  ALA A HB3  1  
ATOM   1295  N  N    . MET A 1 85 ? 139.652 -5.560  9.705   1.00 0.00 ? 85  MET A N    1  
ATOM   1296  C  CA   . MET A 1 85 ? 140.022 -6.963  9.645   1.00 0.00 ? 85  MET A CA   1  
ATOM   1297  C  C    . MET A 1 85 ? 141.124 -7.222  10.654  1.00 0.00 ? 85  MET A C    1  
ATOM   1298  O  O    . MET A 1 85 ? 141.137 -8.250  11.330  1.00 0.00 ? 85  MET A O    1  
ATOM   1299  C  CB   . MET A 1 85 ? 140.523 -7.342  8.255   1.00 0.00 ? 85  MET A CB   1  
ATOM   1300  C  CG   . MET A 1 85 ? 140.678 -8.861  8.192   1.00 0.00 ? 85  MET A CG   1  
ATOM   1301  S  SD   . MET A 1 85 ? 141.580 -9.320  6.692   1.00 0.00 ? 85  MET A SD   1  
ATOM   1302  C  CE   . MET A 1 85 ? 143.148 -9.728  7.499   1.00 0.00 ? 85  MET A CE   1  
ATOM   1303  H  H    . MET A 1 85 ? 139.748 -4.991  8.913   1.00 0.00 ? 85  MET A H    1  
ATOM   1304  H  HA   . MET A 1 85 ? 139.167 -7.572  9.890   1.00 0.00 ? 85  MET A HA   1  
ATOM   1305  H  HB2  . MET A 1 85 ? 139.809 -7.017  7.511   1.00 0.00 ? 85  MET A HB2  1  
ATOM   1306  H  HB3  . MET A 1 85 ? 141.477 -6.875  8.072   1.00 0.00 ? 85  MET A HB3  1  
ATOM   1307  H  HG2  . MET A 1 85 ? 141.215 -9.207  9.062   1.00 0.00 ? 85  MET A HG2  1  
ATOM   1308  H  HG3  . MET A 1 85 ? 139.700 -9.318  8.174   1.00 0.00 ? 85  MET A HG3  1  
ATOM   1309  H  HE1  . MET A 1 85 ? 143.952 -9.647  6.782   1.00 0.00 ? 85  MET A HE1  1  
ATOM   1310  H  HE2  . MET A 1 85 ? 143.109 -10.735 7.881   1.00 0.00 ? 85  MET A HE2  1  
ATOM   1311  H  HE3  . MET A 1 85 ? 143.319 -9.042  8.319   1.00 0.00 ? 85  MET A HE3  1  
ATOM   1312  N  N    . ASN A 1 86 ? 142.040 -6.264  10.766  1.00 0.00 ? 86  ASN A N    1  
ATOM   1313  C  CA   . ASN A 1 86 ? 143.126 -6.391  11.718  1.00 0.00 ? 86  ASN A CA   1  
ATOM   1314  C  C    . ASN A 1 86 ? 142.551 -6.552  13.116  1.00 0.00 ? 86  ASN A C    1  
ATOM   1315  O  O    . ASN A 1 86 ? 143.011 -7.381  13.900  1.00 0.00 ? 86  ASN A O    1  
ATOM   1316  C  CB   . ASN A 1 86 ? 144.016 -5.148  11.653  1.00 0.00 ? 86  ASN A CB   1  
ATOM   1317  C  CG   . ASN A 1 86 ? 145.305 -5.378  12.431  1.00 0.00 ? 86  ASN A CG   1  
ATOM   1318  O  OD1  . ASN A 1 86 ? 146.042 -6.324  12.153  1.00 0.00 ? 86  ASN A OD1  1  
ATOM   1319  N  ND2  . ASN A 1 86 ? 145.626 -4.553  13.388  1.00 0.00 ? 86  ASN A ND2  1  
ATOM   1320  H  H    . ASN A 1 86 ? 141.970 -5.458  10.213  1.00 0.00 ? 86  ASN A H    1  
ATOM   1321  H  HA   . ASN A 1 86 ? 143.715 -7.263  11.473  1.00 0.00 ? 86  ASN A HA   1  
ATOM   1322  H  HB2  . ASN A 1 86 ? 144.254 -4.934  10.622  1.00 0.00 ? 86  ASN A HB2  1  
ATOM   1323  H  HB3  . ASN A 1 86 ? 143.488 -4.309  12.080  1.00 0.00 ? 86  ASN A HB3  1  
ATOM   1324  H  HD21 . ASN A 1 86 ? 145.040 -3.797  13.600  1.00 0.00 ? 86  ASN A HD21 1  
ATOM   1325  H  HD22 . ASN A 1 86 ? 146.453 -4.687  13.894  1.00 0.00 ? 86  ASN A HD22 1  
ATOM   1326  N  N    . ASN A 1 87 ? 141.514 -5.768  13.409  1.00 0.00 ? 87  ASN A N    1  
ATOM   1327  C  CA   . ASN A 1 87 ? 140.858 -5.862  14.704  1.00 0.00 ? 87  ASN A CA   1  
ATOM   1328  C  C    . ASN A 1 87 ? 140.293 -7.262  14.886  1.00 0.00 ? 87  ASN A C    1  
ATOM   1329  O  O    . ASN A 1 87 ? 140.402 -7.860  15.956  1.00 0.00 ? 87  ASN A O    1  
ATOM   1330  C  CB   . ASN A 1 87 ? 139.728 -4.833  14.798  1.00 0.00 ? 87  ASN A CB   1  
ATOM   1331  C  CG   . ASN A 1 87 ? 139.241 -4.722  16.239  1.00 0.00 ? 87  ASN A CG   1  
ATOM   1332  O  OD1  . ASN A 1 87 ? 139.787 -5.371  17.131  1.00 0.00 ? 87  ASN A OD1  1  
ATOM   1333  N  ND2  . ASN A 1 87 ? 138.238 -3.936  16.520  1.00 0.00 ? 87  ASN A ND2  1  
ATOM   1334  H  H    . ASN A 1 87 ? 141.174 -5.144  12.735  1.00 0.00 ? 87  ASN A H    1  
ATOM   1335  H  HA   . ASN A 1 87 ? 141.580 -5.666  15.483  1.00 0.00 ? 87  ASN A HA   1  
ATOM   1336  H  HB2  . ASN A 1 87 ? 140.091 -3.872  14.466  1.00 0.00 ? 87  ASN A HB2  1  
ATOM   1337  H  HB3  . ASN A 1 87 ? 138.908 -5.145  14.167  1.00 0.00 ? 87  ASN A HB3  1  
ATOM   1338  H  HD21 . ASN A 1 87 ? 137.804 -3.422  15.807  1.00 0.00 ? 87  ASN A HD21 1  
ATOM   1339  H  HD22 . ASN A 1 87 ? 137.920 -3.860  17.443  1.00 0.00 ? 87  ASN A HD22 1  
ATOM   1340  N  N    . PHE A 1 88 ? 139.705 -7.781  13.809  1.00 0.00 ? 88  PHE A N    1  
ATOM   1341  C  CA   . PHE A 1 88 ? 139.138 -9.125  13.828  1.00 0.00 ? 88  PHE A CA   1  
ATOM   1342  C  C    . PHE A 1 88 ? 140.220 -10.154 14.131  1.00 0.00 ? 88  PHE A C    1  
ATOM   1343  O  O    . PHE A 1 88 ? 140.003 -11.106 14.882  1.00 0.00 ? 88  PHE A O    1  
ATOM   1344  C  CB   . PHE A 1 88 ? 138.486 -9.443  12.480  1.00 0.00 ? 88  PHE A CB   1  
ATOM   1345  C  CG   . PHE A 1 88 ? 137.793 -10.782 12.563  1.00 0.00 ? 88  PHE A CG   1  
ATOM   1346  C  CD1  . PHE A 1 88 ? 136.490 -10.867 13.067  1.00 0.00 ? 88  PHE A CD1  1  
ATOM   1347  C  CD2  . PHE A 1 88 ? 138.455 -11.940 12.136  1.00 0.00 ? 88  PHE A CD2  1  
ATOM   1348  C  CE1  . PHE A 1 88 ? 135.849 -12.108 13.143  1.00 0.00 ? 88  PHE A CE1  1  
ATOM   1349  C  CE2  . PHE A 1 88 ? 137.813 -13.181 12.213  1.00 0.00 ? 88  PHE A CE2  1  
ATOM   1350  C  CZ   . PHE A 1 88 ? 136.510 -13.265 12.717  1.00 0.00 ? 88  PHE A CZ   1  
ATOM   1351  H  H    . PHE A 1 88 ? 139.663 -7.250  12.979  1.00 0.00 ? 88  PHE A H    1  
ATOM   1352  H  HA   . PHE A 1 88 ? 138.384 -9.174  14.599  1.00 0.00 ? 88  PHE A HA   1  
ATOM   1353  H  HB2  . PHE A 1 88 ? 137.763 -8.677  12.241  1.00 0.00 ? 88  PHE A HB2  1  
ATOM   1354  H  HB3  . PHE A 1 88 ? 139.243 -9.478  11.712  1.00 0.00 ? 88  PHE A HB3  1  
ATOM   1355  H  HD1  . PHE A 1 88 ? 135.980 -9.974  13.397  1.00 0.00 ? 88  PHE A HD1  1  
ATOM   1356  H  HD2  . PHE A 1 88 ? 139.461 -11.875 11.746  1.00 0.00 ? 88  PHE A HD2  1  
ATOM   1357  H  HE1  . PHE A 1 88 ? 134.843 -12.173 13.533  1.00 0.00 ? 88  PHE A HE1  1  
ATOM   1358  H  HE2  . PHE A 1 88 ? 138.323 -14.075 11.883  1.00 0.00 ? 88  PHE A HE2  1  
ATOM   1359  H  HZ   . PHE A 1 88 ? 136.014 -14.224 12.777  1.00 0.00 ? 88  PHE A HZ   1  
ATOM   1360  N  N    . PHE A 1 89 ? 141.385 -9.950  13.529  1.00 0.00 ? 89  PHE A N    1  
ATOM   1361  C  CA   . PHE A 1 89 ? 142.507 -10.861 13.710  1.00 0.00 ? 89  PHE A CA   1  
ATOM   1362  C  C    . PHE A 1 89 ? 142.783 -11.059 15.193  1.00 0.00 ? 89  PHE A C    1  
ATOM   1363  O  O    . PHE A 1 89 ? 143.087 -12.167 15.637  1.00 0.00 ? 89  PHE A O    1  
ATOM   1364  C  CB   . PHE A 1 89 ? 143.749 -10.283 13.028  1.00 0.00 ? 89  PHE A CB   1  
ATOM   1365  C  CG   . PHE A 1 89 ? 144.867 -11.295 13.060  1.00 0.00 ? 89  PHE A CG   1  
ATOM   1366  C  CD1  . PHE A 1 89 ? 144.965 -12.251 12.043  1.00 0.00 ? 89  PHE A CD1  1  
ATOM   1367  C  CD2  . PHE A 1 89 ? 145.805 -11.277 14.099  1.00 0.00 ? 89  PHE A CD2  1  
ATOM   1368  C  CE1  . PHE A 1 89 ? 146.000 -13.189 12.062  1.00 0.00 ? 89  PHE A CE1  1  
ATOM   1369  C  CE2  . PHE A 1 89 ? 146.842 -12.218 14.119  1.00 0.00 ? 89  PHE A CE2  1  
ATOM   1370  C  CZ   . PHE A 1 89 ? 146.940 -13.175 13.100  1.00 0.00 ? 89  PHE A CZ   1  
ATOM   1371  H  H    . PHE A 1 89 ? 141.490 -9.175  12.940  1.00 0.00 ? 89  PHE A H    1  
ATOM   1372  H  HA   . PHE A 1 89 ? 142.269 -11.813 13.260  1.00 0.00 ? 89  PHE A HA   1  
ATOM   1373  H  HB2  . PHE A 1 89 ? 143.515 -10.039 12.003  1.00 0.00 ? 89  PHE A HB2  1  
ATOM   1374  H  HB3  . PHE A 1 89 ? 144.061 -9.390  13.548  1.00 0.00 ? 89  PHE A HB3  1  
ATOM   1375  H  HD1  . PHE A 1 89 ? 144.241 -12.262 11.243  1.00 0.00 ? 89  PHE A HD1  1  
ATOM   1376  H  HD2  . PHE A 1 89 ? 145.730 -10.539 14.884  1.00 0.00 ? 89  PHE A HD2  1  
ATOM   1377  H  HE1  . PHE A 1 89 ? 146.074 -13.925 11.275  1.00 0.00 ? 89  PHE A HE1  1  
ATOM   1378  H  HE2  . PHE A 1 89 ? 147.567 -12.207 14.920  1.00 0.00 ? 89  PHE A HE2  1  
ATOM   1379  H  HZ   . PHE A 1 89 ? 147.740 -13.900 13.115  1.00 0.00 ? 89  PHE A HZ   1  
ATOM   1380  N  N    . TRP A 1 90 ? 142.665 -9.980  15.954  1.00 0.00 ? 90  TRP A N    1  
ATOM   1381  C  CA   . TRP A 1 90 ? 142.895 -10.043 17.389  1.00 0.00 ? 90  TRP A CA   1  
ATOM   1382  C  C    . TRP A 1 90 ? 142.022 -11.124 18.023  1.00 0.00 ? 90  TRP A C    1  
ATOM   1383  O  O    . TRP A 1 90 ? 142.441 -11.792 18.968  1.00 0.00 ? 90  TRP A O    1  
ATOM   1384  C  CB   . TRP A 1 90 ? 142.577 -8.689  18.026  1.00 0.00 ? 90  TRP A CB   1  
ATOM   1385  C  CG   . TRP A 1 90 ? 142.968 -8.710  19.469  1.00 0.00 ? 90  TRP A CG   1  
ATOM   1386  C  CD1  . TRP A 1 90 ? 142.106 -8.816  20.505  1.00 0.00 ? 90  TRP A CD1  1  
ATOM   1387  C  CD2  . TRP A 1 90 ? 144.301 -8.622  20.051  1.00 0.00 ? 90  TRP A CD2  1  
ATOM   1388  N  NE1  . TRP A 1 90 ? 142.824 -8.800  21.688  1.00 0.00 ? 90  TRP A NE1  1  
ATOM   1389  C  CE2  . TRP A 1 90 ? 144.181 -8.682  21.461  1.00 0.00 ? 90  TRP A CE2  1  
ATOM   1390  C  CE3  . TRP A 1 90 ? 145.590 -8.498  19.502  1.00 0.00 ? 90  TRP A CE3  1  
ATOM   1391  C  CZ2  . TRP A 1 90 ? 145.298 -8.620  22.293  1.00 0.00 ? 90  TRP A CZ2  1  
ATOM   1392  C  CZ3  . TRP A 1 90 ? 146.717 -8.436  20.337  1.00 0.00 ? 90  TRP A CZ3  1  
ATOM   1393  C  CH2  . TRP A 1 90 ? 146.572 -8.497  21.730  1.00 0.00 ? 90  TRP A CH2  1  
ATOM   1394  H  H    . TRP A 1 90 ? 142.413 -9.128  15.543  1.00 0.00 ? 90  TRP A H    1  
ATOM   1395  H  HA   . TRP A 1 90 ? 143.932 -10.279 17.569  1.00 0.00 ? 90  TRP A HA   1  
ATOM   1396  H  HB2  . TRP A 1 90 ? 143.127 -7.914  17.514  1.00 0.00 ? 90  TRP A HB2  1  
ATOM   1397  H  HB3  . TRP A 1 90 ? 141.518 -8.493  17.944  1.00 0.00 ? 90  TRP A HB3  1  
ATOM   1398  H  HD1  . TRP A 1 90 ? 141.032 -8.899  20.424  1.00 0.00 ? 90  TRP A HD1  1  
ATOM   1399  H  HE1  . TRP A 1 90 ? 142.436 -8.863  22.585  1.00 0.00 ? 90  TRP A HE1  1  
ATOM   1400  H  HE3  . TRP A 1 90 ? 145.713 -8.450  18.429  1.00 0.00 ? 90  TRP A HE3  1  
ATOM   1401  H  HZ2  . TRP A 1 90 ? 145.181 -8.668  23.366  1.00 0.00 ? 90  TRP A HZ2  1  
ATOM   1402  H  HZ3  . TRP A 1 90 ? 147.702 -8.341  19.904  1.00 0.00 ? 90  TRP A HZ3  1  
ATOM   1403  H  HH2  . TRP A 1 90 ? 147.443 -8.449  22.367  1.00 0.00 ? 90  TRP A HH2  1  
ATOM   1404  N  N    . GLU A 1 91 ? 140.807 -11.293 17.504  1.00 0.00 ? 91  GLU A N    1  
ATOM   1405  C  CA   . GLU A 1 91 ? 139.899 -12.301 18.043  1.00 0.00 ? 91  GLU A CA   1  
ATOM   1406  C  C    . GLU A 1 91 ? 140.493 -13.696 17.884  1.00 0.00 ? 91  GLU A C    1  
ATOM   1407  O  O    . GLU A 1 91 ? 140.274 -14.575 18.719  1.00 0.00 ? 91  GLU A O    1  
ATOM   1408  C  CB   . GLU A 1 91 ? 138.546 -12.233 17.334  1.00 0.00 ? 91  GLU A CB   1  
ATOM   1409  C  CG   . GLU A 1 91 ? 137.885 -10.884 17.624  1.00 0.00 ? 91  GLU A CG   1  
ATOM   1410  C  CD   . GLU A 1 91 ? 136.505 -10.828 16.978  1.00 0.00 ? 91  GLU A CD   1  
ATOM   1411  O  OE1  . GLU A 1 91 ? 136.193 -11.728 16.216  1.00 0.00 ? 91  GLU A OE1  1  
ATOM   1412  O  OE2  . GLU A 1 91 ? 135.781 -9.887  17.254  1.00 0.00 ? 91  GLU A OE2  1  
ATOM   1413  H  H    . GLU A 1 91 ? 140.518 -10.737 16.745  1.00 0.00 ? 91  GLU A H    1  
ATOM   1414  H  HA   . GLU A 1 91 ? 139.749 -12.105 19.096  1.00 0.00 ? 91  GLU A HA   1  
ATOM   1415  H  HB2  . GLU A 1 91 ? 138.690 -12.345 16.269  1.00 0.00 ? 91  GLU A HB2  1  
ATOM   1416  H  HB3  . GLU A 1 91 ? 137.910 -13.026 17.695  1.00 0.00 ? 91  GLU A HB3  1  
ATOM   1417  H  HG2  . GLU A 1 91 ? 137.786 -10.756 18.692  1.00 0.00 ? 91  GLU A HG2  1  
ATOM   1418  H  HG3  . GLU A 1 91 ? 138.499 -10.091 17.224  1.00 0.00 ? 91  GLU A HG3  1  
ATOM   1419  N  N    . ASN A 1 92 ? 141.247 -13.893 16.806  1.00 0.00 ? 92  ASN A N    1  
ATOM   1420  C  CA   . ASN A 1 92 ? 141.872 -15.185 16.543  1.00 0.00 ? 92  ASN A CA   1  
ATOM   1421  C  C    . ASN A 1 92 ? 143.345 -15.147 16.914  1.00 0.00 ? 92  ASN A C    1  
ATOM   1422  O  O    . ASN A 1 92 ? 144.078 -14.259 16.479  1.00 0.00 ? 92  ASN A O    1  
ATOM   1423  C  CB   . ASN A 1 92 ? 141.749 -15.553 15.070  1.00 0.00 ? 92  ASN A CB   1  
ATOM   1424  C  CG   . ASN A 1 92 ? 142.058 -17.032 14.888  1.00 0.00 ? 92  ASN A CG   1  
ATOM   1425  O  OD1  . ASN A 1 92 ? 141.313 -17.886 15.369  1.00 0.00 ? 92  ASN A OD1  1  
ATOM   1426  N  ND2  . ASN A 1 92 ? 143.124 -17.389 14.230  1.00 0.00 ? 92  ASN A ND2  1  
ATOM   1427  H  H    . ASN A 1 92 ? 141.387 -13.155 16.176  1.00 0.00 ? 92  ASN A H    1  
ATOM   1428  H  HA   . ASN A 1 92 ? 141.383 -15.947 17.132  1.00 0.00 ? 92  ASN A HA   1  
ATOM   1429  H  HB2  . ASN A 1 92 ? 140.748 -15.345 14.727  1.00 0.00 ? 92  ASN A HB2  1  
ATOM   1430  H  HB3  . ASN A 1 92 ? 142.457 -14.971 14.501  1.00 0.00 ? 92  ASN A HB3  1  
ATOM   1431  H  HD21 . ASN A 1 92 ? 143.720 -16.709 13.854  1.00 0.00 ? 92  ASN A HD21 1  
ATOM   1432  H  HD22 . ASN A 1 92 ? 143.330 -18.339 14.119  1.00 0.00 ? 92  ASN A HD22 1  
ATOM   1433  N  N    . SER A 1 93 ? 143.768 -16.116 17.712  1.00 0.00 ? 93  SER A N    1  
ATOM   1434  C  CA   . SER A 1 93 ? 145.158 -16.203 18.139  1.00 0.00 ? 93  SER A CA   1  
ATOM   1435  C  C    . SER A 1 93 ? 145.379 -15.408 19.422  1.00 0.00 ? 93  SER A C    1  
ATOM   1436  O  O    . SER A 1 93 ? 146.522 -15.093 19.711  1.00 0.00 ? 93  SER A O    1  
ATOM   1437  C  CB   . SER A 1 93 ? 146.090 -15.682 17.042  1.00 0.00 ? 93  SER A CB   1  
ATOM   1438  O  OG   . SER A 1 93 ? 145.504 -15.930 15.771  1.00 0.00 ? 93  SER A OG   1  
ATOM   1439  O  OXT  . SER A 1 93 ? 144.402 -15.125 20.095  1.00 0.00 ? 93  SER A OXT  1  
ATOM   1440  H  H    . SER A 1 93 ? 143.131 -16.795 18.020  1.00 0.00 ? 93  SER A H    1  
ATOM   1441  H  HA   . SER A 1 93 ? 145.390 -17.237 18.324  1.00 0.00 ? 93  SER A HA   1  
ATOM   1442  H  HB2  . SER A 1 93 ? 146.239 -14.623 17.163  1.00 0.00 ? 93  SER A HB2  1  
ATOM   1443  H  HB3  . SER A 1 93 ? 147.045 -16.188 17.113  1.00 0.00 ? 93  SER A HB3  1  
ATOM   1444  H  HG   . SER A 1 93 ? 145.510 -16.879 15.621  1.00 0.00 ? 93  SER A HG   1  
ATOM   1445  N  N    . GLY B 1 1  ? 136.237 -15.929 1.236   1.00 0.00 ? 1   GLY B N    1  
ATOM   1446  C  CA   . GLY B 1 1  ? 136.554 -14.506 1.196   1.00 0.00 ? 1   GLY B CA   1  
ATOM   1447  C  C    . GLY B 1 1  ? 136.739 -14.029 -0.239  1.00 0.00 ? 1   GLY B C    1  
ATOM   1448  O  O    . GLY B 1 1  ? 137.176 -14.788 -1.105  1.00 0.00 ? 1   GLY B O    1  
ATOM   1449  H  H1   . GLY B 1 1  ? 135.877 -16.328 2.056   1.00 0.00 ? 1   GLY B H1   1  
ATOM   1450  H  HA2  . GLY B 1 1  ? 135.749 -13.950 1.656   1.00 0.00 ? 1   GLY B HA2  1  
ATOM   1451  H  HA3  . GLY B 1 1  ? 137.466 -14.330 1.746   1.00 0.00 ? 1   GLY B HA3  1  
ATOM   1452  N  N    . SER B 1 2  ? 136.403 -12.767 -0.487  1.00 0.00 ? 2   SER B N    1  
ATOM   1453  C  CA   . SER B 1 2  ? 136.536 -12.200 -1.824  1.00 0.00 ? 2   SER B CA   1  
ATOM   1454  C  C    . SER B 1 2  ? 138.004 -12.034 -2.195  1.00 0.00 ? 2   SER B C    1  
ATOM   1455  O  O    . SER B 1 2  ? 138.887 -12.051 -1.331  1.00 0.00 ? 2   SER B O    1  
ATOM   1456  C  CB   . SER B 1 2  ? 135.842 -10.842 -1.896  1.00 0.00 ? 2   SER B CB   1  
ATOM   1457  O  OG   . SER B 1 2  ? 136.607 -9.884  -1.179  1.00 0.00 ? 2   SER B OG   1  
ATOM   1458  H  H    . SER B 1 2  ? 136.060 -12.208 0.241   1.00 0.00 ? 2   SER B H    1  
ATOM   1459  H  HA   . SER B 1 2  ? 136.070 -12.867 -2.534  1.00 0.00 ? 2   SER B HA   1  
ATOM   1460  H  HB2  . SER B 1 2  ? 135.767 -10.531 -2.924  1.00 0.00 ? 2   SER B HB2  1  
ATOM   1461  H  HB3  . SER B 1 2  ? 134.849 -10.920 -1.471  1.00 0.00 ? 2   SER B HB3  1  
ATOM   1462  H  HG   . SER B 1 2  ? 137.535 -10.089 -1.309  1.00 0.00 ? 2   SER B HG   1  
ATOM   1463  N  N    . GLU B 1 3  ? 138.262 -11.863 -3.486  1.00 0.00 ? 3   GLU B N    1  
ATOM   1464  C  CA   . GLU B 1 3  ? 139.628 -11.690 -3.943  1.00 0.00 ? 3   GLU B CA   1  
ATOM   1465  C  C    . GLU B 1 3  ? 140.228 -10.460 -3.284  1.00 0.00 ? 3   GLU B C    1  
ATOM   1466  O  O    . GLU B 1 3  ? 141.411 -10.441 -2.943  1.00 0.00 ? 3   GLU B O    1  
ATOM   1467  C  CB   . GLU B 1 3  ? 139.656 -11.519 -5.464  1.00 0.00 ? 3   GLU B CB   1  
ATOM   1468  C  CG   . GLU B 1 3  ? 139.151 -12.796 -6.136  1.00 0.00 ? 3   GLU B CG   1  
ATOM   1469  C  CD   . GLU B 1 3  ? 139.237 -12.657 -7.651  1.00 0.00 ? 3   GLU B CD   1  
ATOM   1470  O  OE1  . GLU B 1 3  ? 139.508 -11.560 -8.112  1.00 0.00 ? 3   GLU B OE1  1  
ATOM   1471  O  OE2  . GLU B 1 3  ? 139.031 -13.649 -8.330  1.00 0.00 ? 3   GLU B OE2  1  
ATOM   1472  H  H    . GLU B 1 3  ? 137.527 -11.851 -4.134  1.00 0.00 ? 3   GLU B H    1  
ATOM   1473  H  HA   . GLU B 1 3  ? 140.209 -12.560 -3.673  1.00 0.00 ? 3   GLU B HA   1  
ATOM   1474  H  HB2  . GLU B 1 3  ? 139.021 -10.689 -5.742  1.00 0.00 ? 3   GLU B HB2  1  
ATOM   1475  H  HB3  . GLU B 1 3  ? 140.667 -11.321 -5.785  1.00 0.00 ? 3   GLU B HB3  1  
ATOM   1476  H  HG2  . GLU B 1 3  ? 139.757 -13.629 -5.817  1.00 0.00 ? 3   GLU B HG2  1  
ATOM   1477  H  HG3  . GLU B 1 3  ? 138.125 -12.970 -5.850  1.00 0.00 ? 3   GLU B HG3  1  
ATOM   1478  N  N    . LEU B 1 4  ? 139.400 -9.435  -3.085  1.00 0.00 ? 4   LEU B N    1  
ATOM   1479  C  CA   . LEU B 1 4  ? 139.878 -8.224  -2.440  1.00 0.00 ? 4   LEU B CA   1  
ATOM   1480  C  C    . LEU B 1 4  ? 140.356 -8.550  -1.031  1.00 0.00 ? 4   LEU B C    1  
ATOM   1481  O  O    . LEU B 1 4  ? 141.400 -8.063  -0.590  1.00 0.00 ? 4   LEU B O    1  
ATOM   1482  C  CB   . LEU B 1 4  ? 138.749 -7.185  -2.388  1.00 0.00 ? 4   LEU B CB   1  
ATOM   1483  C  CG   . LEU B 1 4  ? 139.298 -5.820  -1.934  1.00 0.00 ? 4   LEU B CG   1  
ATOM   1484  C  CD1  . LEU B 1 4  ? 138.424 -4.706  -2.516  1.00 0.00 ? 4   LEU B CD1  1  
ATOM   1485  C  CD2  . LEU B 1 4  ? 139.279 -5.712  -0.402  1.00 0.00 ? 4   LEU B CD2  1  
ATOM   1486  H  H    . LEU B 1 4  ? 138.463 -9.505  -3.360  1.00 0.00 ? 4   LEU B H    1  
ATOM   1487  H  HA   . LEU B 1 4  ? 140.702 -7.822  -3.010  1.00 0.00 ? 4   LEU B HA   1  
ATOM   1488  H  HB2  . LEU B 1 4  ? 138.315 -7.088  -3.372  1.00 0.00 ? 4   LEU B HB2  1  
ATOM   1489  H  HB3  . LEU B 1 4  ? 137.991 -7.519  -1.697  1.00 0.00 ? 4   LEU B HB3  1  
ATOM   1490  H  HG   . LEU B 1 4  ? 140.310 -5.703  -2.292  1.00 0.00 ? 4   LEU B HG   1  
ATOM   1491  H  HD11 . LEU B 1 4  ? 138.604 -3.789  -1.975  1.00 0.00 ? 4   LEU B HD11 1  
ATOM   1492  H  HD12 . LEU B 1 4  ? 137.383 -4.980  -2.426  1.00 0.00 ? 4   LEU B HD12 1  
ATOM   1493  H  HD13 . LEU B 1 4  ? 138.670 -4.563  -3.558  1.00 0.00 ? 4   LEU B HD13 1  
ATOM   1494  H  HD21 . LEU B 1 4  ? 139.380 -4.675  -0.118  1.00 0.00 ? 4   LEU B HD21 1  
ATOM   1495  H  HD22 . LEU B 1 4  ? 140.099 -6.275  0.012   1.00 0.00 ? 4   LEU B HD22 1  
ATOM   1496  H  HD23 . LEU B 1 4  ? 138.346 -6.097  -0.018  1.00 0.00 ? 4   LEU B HD23 1  
ATOM   1497  N  N    . GLU B 1 5  ? 139.606 -9.405  -0.331  1.00 0.00 ? 5   GLU B N    1  
ATOM   1498  C  CA   . GLU B 1 5  ? 140.004 -9.796  1.013   1.00 0.00 ? 5   GLU B CA   1  
ATOM   1499  C  C    . GLU B 1 5  ? 141.296 -10.592 0.963   1.00 0.00 ? 5   GLU B C    1  
ATOM   1500  O  O    . GLU B 1 5  ? 142.170 -10.427 1.812   1.00 0.00 ? 5   GLU B O    1  
ATOM   1501  C  CB   . GLU B 1 5  ? 138.922 -10.655 1.673   1.00 0.00 ? 5   GLU B CB   1  
ATOM   1502  C  CG   . GLU B 1 5  ? 137.659 -9.827  1.909   1.00 0.00 ? 5   GLU B CG   1  
ATOM   1503  C  CD   . GLU B 1 5  ? 136.618 -10.684 2.623   1.00 0.00 ? 5   GLU B CD   1  
ATOM   1504  O  OE1  . GLU B 1 5  ? 136.834 -11.881 2.722   1.00 0.00 ? 5   GLU B OE1  1  
ATOM   1505  O  OE2  . GLU B 1 5  ? 135.622 -10.134 3.059   1.00 0.00 ? 5   GLU B OE2  1  
ATOM   1506  H  H    . GLU B 1 5  ? 138.796 -9.785  -0.732  1.00 0.00 ? 5   GLU B H    1  
ATOM   1507  H  HA   . GLU B 1 5  ? 140.154 -8.906  1.608   1.00 0.00 ? 5   GLU B HA   1  
ATOM   1508  H  HB2  . GLU B 1 5  ? 138.687 -11.490 1.030   1.00 0.00 ? 5   GLU B HB2  1  
ATOM   1509  H  HB3  . GLU B 1 5  ? 139.287 -11.025 2.619   1.00 0.00 ? 5   GLU B HB3  1  
ATOM   1510  H  HG2  . GLU B 1 5  ? 137.900 -8.969  2.520   1.00 0.00 ? 5   GLU B HG2  1  
ATOM   1511  H  HG3  . GLU B 1 5  ? 137.263 -9.495  0.964   1.00 0.00 ? 5   GLU B HG3  1  
ATOM   1512  N  N    . THR B 1 6  ? 141.416 -11.453 -0.047  1.00 0.00 ? 6   THR B N    1  
ATOM   1513  C  CA   . THR B 1 6  ? 142.623 -12.258 -0.185  1.00 0.00 ? 6   THR B CA   1  
ATOM   1514  C  C    . THR B 1 6  ? 143.835 -11.359 -0.382  1.00 0.00 ? 6   THR B C    1  
ATOM   1515  O  O    . THR B 1 6  ? 144.889 -11.573 0.217   1.00 0.00 ? 6   THR B O    1  
ATOM   1516  C  CB   . THR B 1 6  ? 142.486 -13.206 -1.378  1.00 0.00 ? 6   THR B CB   1  
ATOM   1517  O  OG1  . THR B 1 6  ? 141.304 -13.981 -1.231  1.00 0.00 ? 6   THR B OG1  1  
ATOM   1518  C  CG2  . THR B 1 6  ? 143.701 -14.133 -1.439  1.00 0.00 ? 6   THR B CG2  1  
ATOM   1519  H  H    . THR B 1 6  ? 140.687 -11.545 -0.703  1.00 0.00 ? 6   THR B H    1  
ATOM   1520  H  HA   . THR B 1 6  ? 142.760 -12.842 0.712   1.00 0.00 ? 6   THR B HA   1  
ATOM   1521  H  HB   . THR B 1 6  ? 142.430 -12.632 -2.290  1.00 0.00 ? 6   THR B HB   1  
ATOM   1522  H  HG1  . THR B 1 6  ? 141.006 -13.899 -0.322  1.00 0.00 ? 6   THR B HG1  1  
ATOM   1523  H  HG21 . THR B 1 6  ? 143.916 -14.510 -0.450  1.00 0.00 ? 6   THR B HG21 1  
ATOM   1524  H  HG22 . THR B 1 6  ? 144.554 -13.583 -1.807  1.00 0.00 ? 6   THR B HG22 1  
ATOM   1525  H  HG23 . THR B 1 6  ? 143.491 -14.958 -2.102  1.00 0.00 ? 6   THR B HG23 1  
ATOM   1526  N  N    . ALA B 1 7  ? 143.665 -10.340 -1.218  1.00 0.00 ? 7   ALA B N    1  
ATOM   1527  C  CA   . ALA B 1 7  ? 144.737 -9.394  -1.483  1.00 0.00 ? 7   ALA B CA   1  
ATOM   1528  C  C    . ALA B 1 7  ? 145.048 -8.576  -0.235  1.00 0.00 ? 7   ALA B C    1  
ATOM   1529  O  O    . ALA B 1 7  ? 146.197 -8.225  0.024   1.00 0.00 ? 7   ALA B O    1  
ATOM   1530  C  CB   . ALA B 1 7  ? 144.330 -8.463  -2.631  1.00 0.00 ? 7   ALA B CB   1  
ATOM   1531  H  H    . ALA B 1 7  ? 142.797 -10.217 -1.656  1.00 0.00 ? 7   ALA B H    1  
ATOM   1532  H  HA   . ALA B 1 7  ? 145.623 -9.939  -1.774  1.00 0.00 ? 7   ALA B HA   1  
ATOM   1533  H  HB1  . ALA B 1 7  ? 144.683 -8.871  -3.567  1.00 0.00 ? 7   ALA B HB1  1  
ATOM   1534  H  HB2  . ALA B 1 7  ? 144.762 -7.484  -2.481  1.00 0.00 ? 7   ALA B HB2  1  
ATOM   1535  H  HB3  . ALA B 1 7  ? 143.254 -8.378  -2.660  1.00 0.00 ? 7   ALA B HB3  1  
ATOM   1536  N  N    . MET B 1 8  ? 144.003 -8.257  0.518   1.00 0.00 ? 8   MET B N    1  
ATOM   1537  C  CA   . MET B 1 8  ? 144.154 -7.454  1.725   1.00 0.00 ? 8   MET B CA   1  
ATOM   1538  C  C    . MET B 1 8  ? 145.081 -8.124  2.743   1.00 0.00 ? 8   MET B C    1  
ATOM   1539  O  O    . MET B 1 8  ? 145.955 -7.475  3.334   1.00 0.00 ? 8   MET B O    1  
ATOM   1540  C  CB   . MET B 1 8  ? 142.771 -7.285  2.354   1.00 0.00 ? 8   MET B CB   1  
ATOM   1541  C  CG   . MET B 1 8  ? 142.822 -6.269  3.490   1.00 0.00 ? 8   MET B CG   1  
ATOM   1542  S  SD   . MET B 1 8  ? 141.237 -6.286  4.366   1.00 0.00 ? 8   MET B SD   1  
ATOM   1543  C  CE   . MET B 1 8  ? 140.193 -5.791  2.974   1.00 0.00 ? 8   MET B CE   1  
ATOM   1544  H  H    . MET B 1 8  ? 143.106 -8.549  0.245   1.00 0.00 ? 8   MET B H    1  
ATOM   1545  H  HA   . MET B 1 8  ? 144.544 -6.482  1.467   1.00 0.00 ? 8   MET B HA   1  
ATOM   1546  H  HB2  . MET B 1 8  ? 142.076 -6.944  1.600   1.00 0.00 ? 8   MET B HB2  1  
ATOM   1547  H  HB3  . MET B 1 8  ? 142.436 -8.236  2.741   1.00 0.00 ? 8   MET B HB3  1  
ATOM   1548  H  HG2  . MET B 1 8  ? 143.618 -6.529  4.172   1.00 0.00 ? 8   MET B HG2  1  
ATOM   1549  H  HG3  . MET B 1 8  ? 142.999 -5.285  3.083   1.00 0.00 ? 8   MET B HG3  1  
ATOM   1550  H  HE1  . MET B 1 8  ? 139.336 -5.245  3.344   1.00 0.00 ? 8   MET B HE1  1  
ATOM   1551  H  HE2  . MET B 1 8  ? 139.854 -6.670  2.448   1.00 0.00 ? 8   MET B HE2  1  
ATOM   1552  H  HE3  . MET B 1 8  ? 140.763 -5.167  2.301   1.00 0.00 ? 8   MET B HE3  1  
ATOM   1553  N  N    . GLU B 1 9  ? 144.901 -9.430  2.921   1.00 0.00 ? 9   GLU B N    1  
ATOM   1554  C  CA   . GLU B 1 9  ? 145.711 -10.179 3.875   1.00 0.00 ? 9   GLU B CA   1  
ATOM   1555  C  C    . GLU B 1 9  ? 147.177 -10.043 3.539   1.00 0.00 ? 9   GLU B C    1  
ATOM   1556  O  O    . GLU B 1 9  ? 148.034 -10.037 4.423   1.00 0.00 ? 9   GLU B O    1  
ATOM   1557  C  CB   . GLU B 1 9  ? 145.314 -11.656 3.854   1.00 0.00 ? 9   GLU B CB   1  
ATOM   1558  C  CG   . GLU B 1 9  ? 143.870 -11.807 4.333   1.00 0.00 ? 9   GLU B CG   1  
ATOM   1559  C  CD   . GLU B 1 9  ? 143.487 -13.282 4.377   1.00 0.00 ? 9   GLU B CD   1  
ATOM   1560  O  OE1  . GLU B 1 9  ? 144.261 -14.091 3.891   1.00 0.00 ? 9   GLU B OE1  1  
ATOM   1561  O  OE2  . GLU B 1 9  ? 142.424 -13.584 4.897   1.00 0.00 ? 9   GLU B OE2  1  
ATOM   1562  H  H    . GLU B 1 9  ? 144.206 -9.895  2.410   1.00 0.00 ? 9   GLU B H    1  
ATOM   1563  H  HA   . GLU B 1 9  ? 145.539 -9.786  4.866   1.00 0.00 ? 9   GLU B HA   1  
ATOM   1564  H  HB2  . GLU B 1 9  ? 145.403 -12.039 2.848   1.00 0.00 ? 9   GLU B HB2  1  
ATOM   1565  H  HB3  . GLU B 1 9  ? 145.969 -12.214 4.509   1.00 0.00 ? 9   GLU B HB3  1  
ATOM   1566  H  HG2  . GLU B 1 9  ? 143.773 -11.383 5.321   1.00 0.00 ? 9   GLU B HG2  1  
ATOM   1567  H  HG3  . GLU B 1 9  ? 143.211 -11.287 3.654   1.00 0.00 ? 9   GLU B HG3  1  
ATOM   1568  N  N    . THR B 1 10 ? 147.460 -9.924  2.259   1.00 0.00 ? 10  THR B N    1  
ATOM   1569  C  CA   . THR B 1 10 ? 148.827 -9.777  1.818   1.00 0.00 ? 10  THR B CA   1  
ATOM   1570  C  C    . THR B 1 10 ? 149.477 -8.563  2.474   1.00 0.00 ? 10  THR B C    1  
ATOM   1571  O  O    . THR B 1 10 ? 150.670 -8.593  2.775   1.00 0.00 ? 10  THR B O    1  
ATOM   1572  C  CB   . THR B 1 10 ? 148.881 -9.625  0.297   1.00 0.00 ? 10  THR B CB   1  
ATOM   1573  O  OG1  . THR B 1 10 ? 148.195 -10.710 -0.312  1.00 0.00 ? 10  THR B OG1  1  
ATOM   1574  C  CG2  . THR B 1 10 ? 150.340 -9.623  -0.163  1.00 0.00 ? 10  THR B CG2  1  
ATOM   1575  H  H    . THR B 1 10 ? 146.735 -9.928  1.599   1.00 0.00 ? 10  THR B H    1  
ATOM   1576  H  HA   . THR B 1 10 ? 149.379 -10.662 2.097   1.00 0.00 ? 10  THR B HA   1  
ATOM   1577  H  HB   . THR B 1 10 ? 148.419 -8.696  0.008   1.00 0.00 ? 10  THR B HB   1  
ATOM   1578  H  HG1  . THR B 1 10 ? 148.821 -11.186 -0.862  1.00 0.00 ? 10  THR B HG1  1  
ATOM   1579  H  HG21 . THR B 1 10 ? 150.387 -9.867  -1.214  1.00 0.00 ? 10  THR B HG21 1  
ATOM   1580  H  HG22 . THR B 1 10 ? 150.897 -10.355 0.403   1.00 0.00 ? 10  THR B HG22 1  
ATOM   1581  H  HG23 . THR B 1 10 ? 150.766 -8.643  -0.002  1.00 0.00 ? 10  THR B HG23 1  
ATOM   1582  N  N    . LEU B 1 11 ? 148.714 -7.479  2.676   1.00 0.00 ? 11  LEU B N    1  
ATOM   1583  C  CA   . LEU B 1 11 ? 149.313 -6.284  3.273   1.00 0.00 ? 11  LEU B CA   1  
ATOM   1584  C  C    . LEU B 1 11 ? 149.832 -6.564  4.679   1.00 0.00 ? 11  LEU B C    1  
ATOM   1585  O  O    . LEU B 1 11 ? 150.913 -6.110  5.063   1.00 0.00 ? 11  LEU B O    1  
ATOM   1586  C  CB   . LEU B 1 11 ? 148.275 -5.160  3.359   1.00 0.00 ? 11  LEU B CB   1  
ATOM   1587  C  CG   . LEU B 1 11 ? 147.703 -4.862  1.975   1.00 0.00 ? 11  LEU B CG   1  
ATOM   1588  C  CD1  . LEU B 1 11 ? 146.776 -3.648  2.058   1.00 0.00 ? 11  LEU B CD1  1  
ATOM   1589  C  CD2  . LEU B 1 11 ? 148.842 -4.566  0.995   1.00 0.00 ? 11  LEU B CD2  1  
ATOM   1590  H  H    . LEU B 1 11 ? 147.753 -7.481  2.420   1.00 0.00 ? 11  LEU B H    1  
ATOM   1591  H  HA   . LEU B 1 11 ? 150.134 -5.955  2.657   1.00 0.00 ? 11  LEU B HA   1  
ATOM   1592  H  HB2  . LEU B 1 11 ? 147.474 -5.464  4.018   1.00 0.00 ? 11  LEU B HB2  1  
ATOM   1593  H  HB3  . LEU B 1 11 ? 148.743 -4.270  3.752   1.00 0.00 ? 11  LEU B HB3  1  
ATOM   1594  H  HG   . LEU B 1 11 ? 147.143 -5.716  1.632   1.00 0.00 ? 11  LEU B HG   1  
ATOM   1595  H  HD11 . LEU B 1 11 ? 146.231 -3.548  1.131   1.00 0.00 ? 11  LEU B HD11 1  
ATOM   1596  H  HD12 . LEU B 1 11 ? 147.363 -2.757  2.229   1.00 0.00 ? 11  LEU B HD12 1  
ATOM   1597  H  HD13 . LEU B 1 11 ? 146.080 -3.783  2.871   1.00 0.00 ? 11  LEU B HD13 1  
ATOM   1598  H  HD21 . LEU B 1 11 ? 148.470 -3.960  0.182   1.00 0.00 ? 11  LEU B HD21 1  
ATOM   1599  H  HD22 . LEU B 1 11 ? 149.231 -5.494  0.604   1.00 0.00 ? 11  LEU B HD22 1  
ATOM   1600  H  HD23 . LEU B 1 11 ? 149.630 -4.035  1.509   1.00 0.00 ? 11  LEU B HD23 1  
ATOM   1601  N  N    . ILE B 1 12 ? 149.049 -7.305  5.446   1.00 0.00 ? 12  ILE B N    1  
ATOM   1602  C  CA   . ILE B 1 12 ? 149.430 -7.625  6.810   1.00 0.00 ? 12  ILE B CA   1  
ATOM   1603  C  C    . ILE B 1 12 ? 150.667 -8.518  6.867   1.00 0.00 ? 12  ILE B C    1  
ATOM   1604  O  O    . ILE B 1 12 ? 151.577 -8.277  7.659   1.00 0.00 ? 12  ILE B O    1  
ATOM   1605  C  CB   . ILE B 1 12 ? 148.254 -8.296  7.517   1.00 0.00 ? 12  ILE B CB   1  
ATOM   1606  C  CG1  . ILE B 1 12 ? 147.058 -7.339  7.482   1.00 0.00 ? 12  ILE B CG1  1  
ATOM   1607  C  CG2  . ILE B 1 12 ? 148.631 -8.598  8.969   1.00 0.00 ? 12  ILE B CG2  1  
ATOM   1608  C  CD1  . ILE B 1 12 ? 145.825 -8.021  8.081   1.00 0.00 ? 12  ILE B CD1  1  
ATOM   1609  H  H    . ILE B 1 12 ? 148.195 -7.632  5.094   1.00 0.00 ? 12  ILE B H    1  
ATOM   1610  H  HA   . ILE B 1 12 ? 149.652 -6.704  7.327   1.00 0.00 ? 12  ILE B HA   1  
ATOM   1611  H  HB   . ILE B 1 12 ? 148.001 -9.214  7.008   1.00 0.00 ? 12  ILE B HB   1  
ATOM   1612  H  HG12 . ILE B 1 12 ? 147.291 -6.453  8.055   1.00 0.00 ? 12  ILE B HG12 1  
ATOM   1613  H  HG13 . ILE B 1 12 ? 146.851 -7.060  6.455   1.00 0.00 ? 12  ILE B HG13 1  
ATOM   1614  H  HG21 . ILE B 1 12 ? 147.759 -8.952  9.499   1.00 0.00 ? 12  ILE B HG21 1  
ATOM   1615  H  HG22 . ILE B 1 12 ? 148.998 -7.698  9.440   1.00 0.00 ? 12  ILE B HG22 1  
ATOM   1616  H  HG23 . ILE B 1 12 ? 149.400 -9.356  8.991   1.00 0.00 ? 12  ILE B HG23 1  
ATOM   1617  H  HD11 . ILE B 1 12 ? 144.935 -7.607  7.630   1.00 0.00 ? 12  ILE B HD11 1  
ATOM   1618  H  HD12 . ILE B 1 12 ? 145.801 -7.849  9.148   1.00 0.00 ? 12  ILE B HD12 1  
ATOM   1619  H  HD13 . ILE B 1 12 ? 145.868 -9.082  7.888   1.00 0.00 ? 12  ILE B HD13 1  
ATOM   1620  N  N    . ASN B 1 13 ? 150.686 -9.560  6.038   1.00 0.00 ? 13  ASN B N    1  
ATOM   1621  C  CA   . ASN B 1 13 ? 151.817 -10.483 6.032   1.00 0.00 ? 13  ASN B CA   1  
ATOM   1622  C  C    . ASN B 1 13 ? 153.127 -9.782  5.683   1.00 0.00 ? 13  ASN B C    1  
ATOM   1623  O  O    . ASN B 1 13 ? 154.159 -10.025 6.318   1.00 0.00 ? 13  ASN B O    1  
ATOM   1624  C  CB   . ASN B 1 13 ? 151.561 -11.604 5.024   1.00 0.00 ? 13  ASN B CB   1  
ATOM   1625  C  CG   . ASN B 1 13 ? 152.583 -12.719 5.214   1.00 0.00 ? 13  ASN B CG   1  
ATOM   1626  O  OD1  . ASN B 1 13 ? 153.457 -12.622 6.075   1.00 0.00 ? 13  ASN B OD1  1  
ATOM   1627  N  ND2  . ASN B 1 13 ? 152.524 -13.780 4.456   1.00 0.00 ? 13  ASN B ND2  1  
ATOM   1628  H  H    . ASN B 1 13 ? 149.930 -9.716  5.436   1.00 0.00 ? 13  ASN B H    1  
ATOM   1629  H  HA   . ASN B 1 13 ? 151.911 -10.920 7.014   1.00 0.00 ? 13  ASN B HA   1  
ATOM   1630  H  HB2  . ASN B 1 13 ? 150.566 -11.998 5.173   1.00 0.00 ? 13  ASN B HB2  1  
ATOM   1631  H  HB3  . ASN B 1 13 ? 151.643 -11.210 4.021   1.00 0.00 ? 13  ASN B HB3  1  
ATOM   1632  H  HD21 . ASN B 1 13 ? 151.827 -13.855 3.772   1.00 0.00 ? 13  ASN B HD21 1  
ATOM   1633  H  HD22 . ASN B 1 13 ? 153.177 -14.502 4.572   1.00 0.00 ? 13  ASN B HD22 1  
ATOM   1634  N  N    . VAL B 1 14 ? 153.091 -8.907  4.679   1.00 0.00 ? 14  VAL B N    1  
ATOM   1635  C  CA   . VAL B 1 14 ? 154.302 -8.203  4.285   1.00 0.00 ? 14  VAL B CA   1  
ATOM   1636  C  C    . VAL B 1 14 ? 154.671 -7.153  5.322   1.00 0.00 ? 14  VAL B C    1  
ATOM   1637  O  O    . VAL B 1 14 ? 155.844 -6.990  5.660   1.00 0.00 ? 14  VAL B O    1  
ATOM   1638  C  CB   . VAL B 1 14 ? 154.120 -7.552  2.908   1.00 0.00 ? 14  VAL B CB   1  
ATOM   1639  C  CG1  . VAL B 1 14 ? 153.701 -8.617  1.893   1.00 0.00 ? 14  VAL B CG1  1  
ATOM   1640  C  CG2  . VAL B 1 14 ? 153.040 -6.471  2.980   1.00 0.00 ? 14  VAL B CG2  1  
ATOM   1641  H  H    . VAL B 1 14 ? 152.250 -8.741  4.204   1.00 0.00 ? 14  VAL B H    1  
ATOM   1642  H  HA   . VAL B 1 14 ? 155.107 -8.919  4.221   1.00 0.00 ? 14  VAL B HA   1  
ATOM   1643  H  HB   . VAL B 1 14 ? 155.054 -7.108  2.595   1.00 0.00 ? 14  VAL B HB   1  
ATOM   1644  H  HG11 . VAL B 1 14 ? 152.949 -9.257  2.330   1.00 0.00 ? 14  VAL B HG11 1  
ATOM   1645  H  HG12 . VAL B 1 14 ? 154.562 -9.211  1.616   1.00 0.00 ? 14  VAL B HG12 1  
ATOM   1646  H  HG13 . VAL B 1 14 ? 153.299 -8.138  1.012   1.00 0.00 ? 14  VAL B HG13 1  
ATOM   1647  H  HG21 . VAL B 1 14 ? 152.117 -6.910  3.321   1.00 0.00 ? 14  VAL B HG21 1  
ATOM   1648  H  HG22 . VAL B 1 14 ? 152.894 -6.045  1.998   1.00 0.00 ? 14  VAL B HG22 1  
ATOM   1649  H  HG23 . VAL B 1 14 ? 153.348 -5.697  3.666   1.00 0.00 ? 14  VAL B HG23 1  
ATOM   1650  N  N    . PHE B 1 15 ? 153.670 -6.456  5.848   1.00 0.00 ? 15  PHE B N    1  
ATOM   1651  C  CA   . PHE B 1 15 ? 153.940 -5.449  6.859   1.00 0.00 ? 15  PHE B CA   1  
ATOM   1652  C  C    . PHE B 1 15 ? 154.566 -6.098  8.085   1.00 0.00 ? 15  PHE B C    1  
ATOM   1653  O  O    . PHE B 1 15 ? 155.564 -5.616  8.622   1.00 0.00 ? 15  PHE B O    1  
ATOM   1654  C  CB   . PHE B 1 15 ? 152.640 -4.748  7.257   1.00 0.00 ? 15  PHE B CB   1  
ATOM   1655  C  CG   . PHE B 1 15 ? 152.943 -3.619  8.211   1.00 0.00 ? 15  PHE B CG   1  
ATOM   1656  C  CD1  . PHE B 1 15 ? 153.299 -2.358  7.716   1.00 0.00 ? 15  PHE B CD1  1  
ATOM   1657  C  CD2  . PHE B 1 15 ? 152.867 -3.831  9.593   1.00 0.00 ? 15  PHE B CD2  1  
ATOM   1658  C  CE1  . PHE B 1 15 ? 153.579 -1.311  8.603   1.00 0.00 ? 15  PHE B CE1  1  
ATOM   1659  C  CE2  . PHE B 1 15 ? 153.147 -2.785  10.479  1.00 0.00 ? 15  PHE B CE2  1  
ATOM   1660  C  CZ   . PHE B 1 15 ? 153.503 -1.524  9.984   1.00 0.00 ? 15  PHE B CZ   1  
ATOM   1661  H  H    . PHE B 1 15 ? 152.743 -6.628  5.562   1.00 0.00 ? 15  PHE B H    1  
ATOM   1662  H  HA   . PHE B 1 15 ? 154.625 -4.718  6.457   1.00 0.00 ? 15  PHE B HA   1  
ATOM   1663  H  HB2  . PHE B 1 15 ? 152.160 -4.352  6.373   1.00 0.00 ? 15  PHE B HB2  1  
ATOM   1664  H  HB3  . PHE B 1 15 ? 151.981 -5.456  7.737   1.00 0.00 ? 15  PHE B HB3  1  
ATOM   1665  H  HD1  . PHE B 1 15 ? 153.359 -2.194  6.651   1.00 0.00 ? 15  PHE B HD1  1  
ATOM   1666  H  HD2  . PHE B 1 15 ? 152.592 -4.804  9.975   1.00 0.00 ? 15  PHE B HD2  1  
ATOM   1667  H  HE1  . PHE B 1 15 ? 153.854 -0.339  8.222   1.00 0.00 ? 15  PHE B HE1  1  
ATOM   1668  H  HE2  . PHE B 1 15 ? 153.090 -2.950  11.545  1.00 0.00 ? 15  PHE B HE2  1  
ATOM   1669  H  HZ   . PHE B 1 15 ? 153.720 -0.717  10.668  1.00 0.00 ? 15  PHE B HZ   1  
ATOM   1670  N  N    . HIS B 1 16 ? 153.962 -7.199  8.523   1.00 0.00 ? 16  HIS B N    1  
ATOM   1671  C  CA   . HIS B 1 16 ? 154.451 -7.921  9.688   1.00 0.00 ? 16  HIS B CA   1  
ATOM   1672  C  C    . HIS B 1 16 ? 155.853 -8.487  9.474   1.00 0.00 ? 16  HIS B C    1  
ATOM   1673  O  O    . HIS B 1 16 ? 156.715 -8.367  10.348  1.00 0.00 ? 16  HIS B O    1  
ATOM   1674  C  CB   . HIS B 1 16 ? 153.492 -9.064  10.024  1.00 0.00 ? 16  HIS B CB   1  
ATOM   1675  C  CG   . HIS B 1 16 ? 153.952 -9.753  11.278  1.00 0.00 ? 16  HIS B CG   1  
ATOM   1676  N  ND1  . HIS B 1 16 ? 154.756 -10.882 11.250  1.00 0.00 ? 16  HIS B ND1  1  
ATOM   1677  C  CD2  . HIS B 1 16 ? 153.732 -9.484  12.606  1.00 0.00 ? 16  HIS B CD2  1  
ATOM   1678  C  CE1  . HIS B 1 16 ? 154.987 -11.248 12.524  1.00 0.00 ? 16  HIS B CE1  1  
ATOM   1679  N  NE2  . HIS B 1 16 ? 154.386 -10.429 13.391  1.00 0.00 ? 16  HIS B NE2  1  
ATOM   1680  H  H    . HIS B 1 16 ? 153.169 -7.530  8.051   1.00 0.00 ? 16  HIS B H    1  
ATOM   1681  H  HA   . HIS B 1 16 ? 154.477 -7.243  10.527  1.00 0.00 ? 16  HIS B HA   1  
ATOM   1682  H  HB2  . HIS B 1 16 ? 152.498 -8.669  10.174  1.00 0.00 ? 16  HIS B HB2  1  
ATOM   1683  H  HB3  . HIS B 1 16 ? 153.478 -9.773  9.209   1.00 0.00 ? 16  HIS B HB3  1  
ATOM   1684  H  HD1  . HIS B 1 16 ? 155.093 -11.333 10.448  1.00 0.00 ? 16  HIS B HD1  1  
ATOM   1685  H  HD2  . HIS B 1 16 ? 153.140 -8.663  12.985  1.00 0.00 ? 16  HIS B HD2  1  
ATOM   1686  H  HE1  . HIS B 1 16 ? 155.586 -12.099 12.811  1.00 0.00 ? 16  HIS B HE1  1  
ATOM   1687  H  HE2  . HIS B 1 16 ? 154.402 -10.482 14.370  1.00 0.00 ? 16  HIS B HE2  1  
ATOM   1688  N  N    . ALA B 1 17 ? 156.078 -9.131  8.326   1.00 0.00 ? 17  ALA B N    1  
ATOM   1689  C  CA   . ALA B 1 17 ? 157.384 -9.731  8.068   1.00 0.00 ? 17  ALA B CA   1  
ATOM   1690  C  C    . ALA B 1 17 ? 158.482 -8.684  7.940   1.00 0.00 ? 17  ALA B C    1  
ATOM   1691  O  O    . ALA B 1 17 ? 159.502 -8.764  8.625   1.00 0.00 ? 17  ALA B O    1  
ATOM   1692  C  CB   . ALA B 1 17 ? 157.325 -10.561 6.785   1.00 0.00 ? 17  ALA B CB   1  
ATOM   1693  H  H    . ALA B 1 17 ? 155.354 -9.225  7.663   1.00 0.00 ? 17  ALA B H    1  
ATOM   1694  H  HA   . ALA B 1 17 ? 157.632 -10.388 8.887   1.00 0.00 ? 17  ALA B HA   1  
ATOM   1695  H  HB1  . ALA B 1 17 ? 158.327 -10.812 6.471   1.00 0.00 ? 17  ALA B HB1  1  
ATOM   1696  H  HB2  . ALA B 1 17 ? 156.837 -9.990  6.008   1.00 0.00 ? 17  ALA B HB2  1  
ATOM   1697  H  HB3  . ALA B 1 17 ? 156.768 -11.468 6.967   1.00 0.00 ? 17  ALA B HB3  1  
ATOM   1698  N  N    . HIS B 1 18 ? 158.277 -7.696  7.076   1.00 0.00 ? 18  HIS B N    1  
ATOM   1699  C  CA   . HIS B 1 18 ? 159.280 -6.655  6.909   1.00 0.00 ? 18  HIS B CA   1  
ATOM   1700  C  C    . HIS B 1 18 ? 159.488 -5.865  8.194   1.00 0.00 ? 18  HIS B C    1  
ATOM   1701  O  O    . HIS B 1 18 ? 160.624 -5.614  8.597   1.00 0.00 ? 18  HIS B O    1  
ATOM   1702  C  CB   . HIS B 1 18 ? 158.901 -5.727  5.759   1.00 0.00 ? 18  HIS B CB   1  
ATOM   1703  C  CG   . HIS B 1 18 ? 159.025 -6.486  4.464   1.00 0.00 ? 18  HIS B CG   1  
ATOM   1704  N  ND1  . HIS B 1 18 ? 160.260 -6.805  3.917   1.00 0.00 ? 18  HIS B ND1  1  
ATOM   1705  C  CD2  . HIS B 1 18 ? 158.091 -7.009  3.604   1.00 0.00 ? 18  HIS B CD2  1  
ATOM   1706  C  CE1  . HIS B 1 18 ? 160.037 -7.491  2.782   1.00 0.00 ? 18  HIS B CE1  1  
ATOM   1707  N  NE2  . HIS B 1 18 ? 158.732 -7.643  2.543   1.00 0.00 ? 18  HIS B NE2  1  
ATOM   1708  H  H    . HIS B 1 18 ? 157.447 -7.665  6.553   1.00 0.00 ? 18  HIS B H    1  
ATOM   1709  H  HA   . HIS B 1 18 ? 160.216 -7.132  6.658   1.00 0.00 ? 18  HIS B HA   1  
ATOM   1710  H  HB2  . HIS B 1 18 ? 157.883 -5.388  5.887   1.00 0.00 ? 18  HIS B HB2  1  
ATOM   1711  H  HB3  . HIS B 1 18 ? 159.569 -4.880  5.748   1.00 0.00 ? 18  HIS B HB3  1  
ATOM   1712  H  HD1  . HIS B 1 18 ? 161.135 -6.573  4.291   1.00 0.00 ? 18  HIS B HD1  1  
ATOM   1713  H  HD2  . HIS B 1 18 ? 157.023 -6.934  3.725   1.00 0.00 ? 18  HIS B HD2  1  
ATOM   1714  H  HE1  . HIS B 1 18 ? 160.818 -7.871  2.140   1.00 0.00 ? 18  HIS B HE1  1  
ATOM   1715  H  HE2  . HIS B 1 18 ? 158.316 -8.102  1.784   1.00 0.00 ? 18  HIS B HE2  1  
ATOM   1716  N  N    . SER B 1 19 ? 158.393 -5.475  8.842   1.00 0.00 ? 19  SER B N    1  
ATOM   1717  C  CA   . SER B 1 19 ? 158.501 -4.721  10.083  1.00 0.00 ? 19  SER B CA   1  
ATOM   1718  C  C    . SER B 1 19 ? 159.246 -5.539  11.126  1.00 0.00 ? 19  SER B C    1  
ATOM   1719  O  O    . SER B 1 19 ? 160.073 -5.012  11.877  1.00 0.00 ? 19  SER B O    1  
ATOM   1720  C  CB   . SER B 1 19 ? 157.107 -4.379  10.611  1.00 0.00 ? 19  SER B CB   1  
ATOM   1721  O  OG   . SER B 1 19 ? 157.227 -3.477  11.703  1.00 0.00 ? 19  SER B OG   1  
ATOM   1722  H  H    . SER B 1 19 ? 157.508 -5.702  8.485   1.00 0.00 ? 19  SER B H    1  
ATOM   1723  H  HA   . SER B 1 19 ? 159.042 -3.807  9.896   1.00 0.00 ? 19  SER B HA   1  
ATOM   1724  H  HB2  . SER B 1 19 ? 156.525 -3.918  9.832   1.00 0.00 ? 19  SER B HB2  1  
ATOM   1725  H  HB3  . SER B 1 19 ? 156.614 -5.286  10.933  1.00 0.00 ? 19  SER B HB3  1  
ATOM   1726  H  HG   . SER B 1 19 ? 157.229 -3.992  12.513  1.00 0.00 ? 19  SER B HG   1  
ATOM   1727  N  N    . GLY B 1 20 ? 158.933 -6.835  11.157  1.00 0.00 ? 20  GLY B N    1  
ATOM   1728  C  CA   . GLY B 1 20 ? 159.559 -7.756  12.094  1.00 0.00 ? 20  GLY B CA   1  
ATOM   1729  C  C    . GLY B 1 20 ? 161.055 -7.910  11.851  1.00 0.00 ? 20  GLY B C    1  
ATOM   1730  O  O    . GLY B 1 20 ? 161.833 -8.068  12.792  1.00 0.00 ? 20  GLY B O    1  
ATOM   1731  H  H    . GLY B 1 20 ? 158.262 -7.179  10.528  1.00 0.00 ? 20  GLY B H    1  
ATOM   1732  H  HA2  . GLY B 1 20 ? 159.406 -7.391  13.093  1.00 0.00 ? 20  GLY B HA2  1  
ATOM   1733  H  HA3  . GLY B 1 20 ? 159.089 -8.724  11.999  1.00 0.00 ? 20  GLY B HA3  1  
ATOM   1734  N  N    . LYS B 1 21 ? 161.447 -7.906  10.581  1.00 0.00 ? 21  LYS B N    1  
ATOM   1735  C  CA   . LYS B 1 21 ? 162.848 -8.093  10.228  1.00 0.00 ? 21  LYS B CA   1  
ATOM   1736  C  C    . LYS B 1 21 ? 163.754 -7.035  10.851  1.00 0.00 ? 21  LYS B C    1  
ATOM   1737  O  O    . LYS B 1 21 ? 164.843 -7.355  11.327  1.00 0.00 ? 21  LYS B O    1  
ATOM   1738  C  CB   . LYS B 1 21 ? 163.000 -8.057  8.707   1.00 0.00 ? 21  LYS B CB   1  
ATOM   1739  C  CG   . LYS B 1 21 ? 164.449 -8.377  8.333   1.00 0.00 ? 21  LYS B CG   1  
ATOM   1740  C  CD   . LYS B 1 21 ? 164.624 -8.279  6.818   1.00 0.00 ? 21  LYS B CD   1  
ATOM   1741  C  CE   . LYS B 1 21 ? 166.043 -8.712  6.449   1.00 0.00 ? 21  LYS B CE   1  
ATOM   1742  N  NZ   . LYS B 1 21 ? 166.231 -8.595  4.975   1.00 0.00 ? 21  LYS B NZ   1  
ATOM   1743  H  H    . LYS B 1 21 ? 160.778 -7.807  9.871   1.00 0.00 ? 21  LYS B H    1  
ATOM   1744  H  HA   . LYS B 1 21 ? 163.164 -9.065  10.576  1.00 0.00 ? 21  LYS B HA   1  
ATOM   1745  H  HB2  . LYS B 1 21 ? 162.338 -8.790  8.262   1.00 0.00 ? 21  LYS B HB2  1  
ATOM   1746  H  HB3  . LYS B 1 21 ? 162.745 -7.073  8.342   1.00 0.00 ? 21  LYS B HB3  1  
ATOM   1747  H  HG2  . LYS B 1 21 ? 165.111 -7.673  8.816   1.00 0.00 ? 21  LYS B HG2  1  
ATOM   1748  H  HG3  . LYS B 1 21 ? 164.691 -9.378  8.657   1.00 0.00 ? 21  LYS B HG3  1  
ATOM   1749  H  HD2  . LYS B 1 21 ? 163.909 -8.926  6.329   1.00 0.00 ? 21  LYS B HD2  1  
ATOM   1750  H  HD3  . LYS B 1 21 ? 164.465 -7.260  6.501   1.00 0.00 ? 21  LYS B HD3  1  
ATOM   1751  H  HE2  . LYS B 1 21 ? 166.754 -8.074  6.956   1.00 0.00 ? 21  LYS B HE2  1  
ATOM   1752  H  HE3  . LYS B 1 21 ? 166.197 -9.736  6.753   1.00 0.00 ? 21  LYS B HE3  1  
ATOM   1753  H  HZ1  . LYS B 1 21 ? 166.958 -9.269  4.663   1.00 0.00 ? 21  LYS B HZ1  1  
ATOM   1754  H  HZ2  . LYS B 1 21 ? 166.531 -7.627  4.739   1.00 0.00 ? 21  LYS B HZ2  1  
ATOM   1755  H  HZ3  . LYS B 1 21 ? 165.336 -8.809  4.493   1.00 0.00 ? 21  LYS B HZ3  1  
ATOM   1756  N  N    . GLU B 1 22 ? 163.317 -5.779  10.847  1.00 0.00 ? 22  GLU B N    1  
ATOM   1757  C  CA   . GLU B 1 22 ? 164.132 -4.708  11.421  1.00 0.00 ? 22  GLU B CA   1  
ATOM   1758  C  C    . GLU B 1 22 ? 163.336 -3.869  12.415  1.00 0.00 ? 22  GLU B C    1  
ATOM   1759  O  O    . GLU B 1 22 ? 162.146 -3.616  12.217  1.00 0.00 ? 22  GLU B O    1  
ATOM   1760  C  CB   . GLU B 1 22 ? 164.651 -3.803  10.301  1.00 0.00 ? 22  GLU B CB   1  
ATOM   1761  C  CG   . GLU B 1 22 ? 165.510 -4.624  9.338   1.00 0.00 ? 22  GLU B CG   1  
ATOM   1762  C  CD   . GLU B 1 22 ? 166.096 -3.717  8.262   1.00 0.00 ? 22  GLU B CD   1  
ATOM   1763  O  OE1  . GLU B 1 22 ? 165.693 -2.567  8.200   1.00 0.00 ? 22  GLU B OE1  1  
ATOM   1764  O  OE2  . GLU B 1 22 ? 166.939 -4.186  7.514   1.00 0.00 ? 22  GLU B OE2  1  
ATOM   1765  H  H    . GLU B 1 22 ? 162.445 -5.569  10.453  1.00 0.00 ? 22  GLU B H    1  
ATOM   1766  H  HA   . GLU B 1 22 ? 164.980 -5.142  11.931  1.00 0.00 ? 22  GLU B HA   1  
ATOM   1767  H  HB2  . GLU B 1 22 ? 163.816 -3.378  9.766   1.00 0.00 ? 22  GLU B HB2  1  
ATOM   1768  H  HB3  . GLU B 1 22 ? 165.249 -3.011  10.727  1.00 0.00 ? 22  GLU B HB3  1  
ATOM   1769  H  HG2  . GLU B 1 22 ? 166.313 -5.096  9.886   1.00 0.00 ? 22  GLU B HG2  1  
ATOM   1770  H  HG3  . GLU B 1 22 ? 164.901 -5.384  8.872   1.00 0.00 ? 22  GLU B HG3  1  
ATOM   1771  N  N    . GLY B 1 23 ? 164.011 -3.403  13.462  1.00 0.00 ? 23  GLY B N    1  
ATOM   1772  C  CA   . GLY B 1 23 ? 163.365 -2.550  14.453  1.00 0.00 ? 23  GLY B CA   1  
ATOM   1773  C  C    . GLY B 1 23 ? 162.419 -3.348  15.332  1.00 0.00 ? 23  GLY B C    1  
ATOM   1774  O  O    . GLY B 1 23 ? 162.456 -4.578  15.348  1.00 0.00 ? 23  GLY B O    1  
ATOM   1775  H  H    . GLY B 1 23 ? 164.964 -3.611  13.553  1.00 0.00 ? 23  GLY B H    1  
ATOM   1776  H  HA2  . GLY B 1 23 ? 164.123 -2.092  15.072  1.00 0.00 ? 23  GLY B HA2  1  
ATOM   1777  H  HA3  . GLY B 1 23 ? 162.806 -1.777  13.948  1.00 0.00 ? 23  GLY B HA3  1  
ATOM   1778  N  N    . ASP B 1 24 ? 161.550 -2.637  16.042  1.00 0.00 ? 24  ASP B N    1  
ATOM   1779  C  CA   . ASP B 1 24 ? 160.575 -3.293  16.893  1.00 0.00 ? 24  ASP B CA   1  
ATOM   1780  C  C    . ASP B 1 24 ? 159.516 -3.959  16.023  1.00 0.00 ? 24  ASP B C    1  
ATOM   1781  O  O    . ASP B 1 24 ? 159.068 -3.383  15.023  1.00 0.00 ? 24  ASP B O    1  
ATOM   1782  C  CB   . ASP B 1 24 ? 159.915 -2.274  17.825  1.00 0.00 ? 24  ASP B CB   1  
ATOM   1783  C  CG   . ASP B 1 24 ? 160.944 -1.725  18.808  1.00 0.00 ? 24  ASP B CG   1  
ATOM   1784  O  OD1  . ASP B 1 24 ? 162.015 -2.302  18.898  1.00 0.00 ? 24  ASP B OD1  1  
ATOM   1785  O  OD2  . ASP B 1 24 ? 160.646 -0.734  19.454  1.00 0.00 ? 24  ASP B OD2  1  
ATOM   1786  H  H    . ASP B 1 24 ? 161.553 -1.659  15.973  1.00 0.00 ? 24  ASP B H    1  
ATOM   1787  H  HA   . ASP B 1 24 ? 161.071 -4.046  17.486  1.00 0.00 ? 24  ASP B HA   1  
ATOM   1788  H  HB2  . ASP B 1 24 ? 159.508 -1.463  17.239  1.00 0.00 ? 24  ASP B HB2  1  
ATOM   1789  H  HB3  . ASP B 1 24 ? 159.118 -2.755  18.373  1.00 0.00 ? 24  ASP B HB3  1  
ATOM   1790  N  N    . LYS B 1 25 ? 159.134 -5.175  16.394  1.00 0.00 ? 25  LYS B N    1  
ATOM   1791  C  CA   . LYS B 1 25 ? 158.133 -5.911  15.636  1.00 0.00 ? 25  LYS B CA   1  
ATOM   1792  C  C    . LYS B 1 25 ? 156.800 -5.167  15.628  1.00 0.00 ? 25  LYS B C    1  
ATOM   1793  O  O    . LYS B 1 25 ? 156.085 -5.154  14.626  1.00 0.00 ? 25  LYS B O    1  
ATOM   1794  C  CB   . LYS B 1 25 ? 157.926 -7.292  16.264  1.00 0.00 ? 25  LYS B CB   1  
ATOM   1795  C  CG   . LYS B 1 25 ? 159.235 -8.085  16.223  1.00 0.00 ? 25  LYS B CG   1  
ATOM   1796  C  CD   . LYS B 1 25 ? 158.970 -9.536  16.634  1.00 0.00 ? 25  LYS B CD   1  
ATOM   1797  C  CE   . LYS B 1 25 ? 158.500 -9.586  18.090  1.00 0.00 ? 25  LYS B CE   1  
ATOM   1798  N  NZ   . LYS B 1 25 ? 159.330 -8.665  18.917  1.00 0.00 ? 25  LYS B NZ   1  
ATOM   1799  H  H    . LYS B 1 25 ? 159.536 -5.586  17.188  1.00 0.00 ? 25  LYS B H    1  
ATOM   1800  H  HA   . LYS B 1 25 ? 158.475 -6.033  14.623  1.00 0.00 ? 25  LYS B HA   1  
ATOM   1801  H  HB2  . LYS B 1 25 ? 157.610 -7.174  17.290  1.00 0.00 ? 25  LYS B HB2  1  
ATOM   1802  H  HB3  . LYS B 1 25 ? 157.167 -7.827  15.714  1.00 0.00 ? 25  LYS B HB3  1  
ATOM   1803  H  HG2  . LYS B 1 25 ? 159.639 -8.063  15.223  1.00 0.00 ? 25  LYS B HG2  1  
ATOM   1804  H  HG3  . LYS B 1 25 ? 159.946 -7.643  16.905  1.00 0.00 ? 25  LYS B HG3  1  
ATOM   1805  H  HD2  . LYS B 1 25 ? 158.207 -9.956  15.994  1.00 0.00 ? 25  LYS B HD2  1  
ATOM   1806  H  HD3  . LYS B 1 25 ? 159.879 -10.110 16.533  1.00 0.00 ? 25  LYS B HD3  1  
ATOM   1807  H  HE2  . LYS B 1 25 ? 157.464 -9.283  18.145  1.00 0.00 ? 25  LYS B HE2  1  
ATOM   1808  H  HE3  . LYS B 1 25 ? 158.599 -10.594 18.465  1.00 0.00 ? 25  LYS B HE3  1  
ATOM   1809  H  HZ1  . LYS B 1 25 ? 159.489 -9.087  19.853  1.00 0.00 ? 25  LYS B HZ1  1  
ATOM   1810  H  HZ2  . LYS B 1 25 ? 158.834 -7.755  19.025  1.00 0.00 ? 25  LYS B HZ2  1  
ATOM   1811  H  HZ3  . LYS B 1 25 ? 160.245 -8.509  18.450  1.00 0.00 ? 25  LYS B HZ3  1  
ATOM   1812  N  N    . TYR B 1 26 ? 156.468 -4.572  16.769  1.00 0.00 ? 26  TYR B N    1  
ATOM   1813  C  CA   . TYR B 1 26 ? 155.208 -3.850  16.920  1.00 0.00 ? 26  TYR B CA   1  
ATOM   1814  C  C    . TYR B 1 26 ? 155.129 -2.592  16.057  1.00 0.00 ? 26  TYR B C    1  
ATOM   1815  O  O    . TYR B 1 26 ? 154.047 -2.223  15.601  1.00 0.00 ? 26  TYR B O    1  
ATOM   1816  C  CB   . TYR B 1 26 ? 155.015 -3.461  18.386  1.00 0.00 ? 26  TYR B CB   1  
ATOM   1817  C  CG   . TYR B 1 26 ? 154.950 -4.707  19.235  1.00 0.00 ? 26  TYR B CG   1  
ATOM   1818  C  CD1  . TYR B 1 26 ? 153.749 -5.419  19.342  1.00 0.00 ? 26  TYR B CD1  1  
ATOM   1819  C  CD2  . TYR B 1 26 ? 156.090 -5.151  19.916  1.00 0.00 ? 26  TYR B CD2  1  
ATOM   1820  C  CE1  . TYR B 1 26 ? 153.689 -6.575  20.130  1.00 0.00 ? 26  TYR B CE1  1  
ATOM   1821  C  CE2  . TYR B 1 26 ? 156.030 -6.306  20.704  1.00 0.00 ? 26  TYR B CE2  1  
ATOM   1822  C  CZ   . TYR B 1 26 ? 154.829 -7.019  20.811  1.00 0.00 ? 26  TYR B CZ   1  
ATOM   1823  O  OH   . TYR B 1 26 ? 154.770 -8.157  21.588  1.00 0.00 ? 26  TYR B OH   1  
ATOM   1824  H  H    . TYR B 1 26 ? 157.074 -4.638  17.536  1.00 0.00 ? 26  TYR B H    1  
ATOM   1825  H  HA   . TYR B 1 26 ? 154.400 -4.508  16.639  1.00 0.00 ? 26  TYR B HA   1  
ATOM   1826  H  HB2  . TYR B 1 26 ? 155.845 -2.848  18.708  1.00 0.00 ? 26  TYR B HB2  1  
ATOM   1827  H  HB3  . TYR B 1 26 ? 154.095 -2.905  18.493  1.00 0.00 ? 26  TYR B HB3  1  
ATOM   1828  H  HD1  . TYR B 1 26 ? 152.870 -5.077  18.818  1.00 0.00 ? 26  TYR B HD1  1  
ATOM   1829  H  HD2  . TYR B 1 26 ? 157.017 -4.601  19.833  1.00 0.00 ? 26  TYR B HD2  1  
ATOM   1830  H  HE1  . TYR B 1 26 ? 152.763 -7.124  20.213  1.00 0.00 ? 26  TYR B HE1  1  
ATOM   1831  H  HE2  . TYR B 1 26 ? 156.910 -6.648  21.229  1.00 0.00 ? 26  TYR B HE2  1  
ATOM   1832  H  HH   . TYR B 1 26 ? 155.573 -8.661  21.438  1.00 0.00 ? 26  TYR B HH   1  
ATOM   1833  N  N    . LYS B 1 27 ? 156.256 -1.905  15.868  1.00 0.00 ? 27  LYS B N    1  
ATOM   1834  C  CA   . LYS B 1 27 ? 156.248 -0.661  15.093  1.00 0.00 ? 27  LYS B CA   1  
ATOM   1835  C  C    . LYS B 1 27 ? 157.229 -0.669  13.924  1.00 0.00 ? 27  LYS B C    1  
ATOM   1836  O  O    . LYS B 1 27 ? 158.314 -1.258  13.988  1.00 0.00 ? 27  LYS B O    1  
ATOM   1837  C  CB   . LYS B 1 27 ? 156.582 0.514   16.015  1.00 0.00 ? 27  LYS B CB   1  
ATOM   1838  C  CG   . LYS B 1 27 ? 155.501 0.639   17.091  1.00 0.00 ? 27  LYS B CG   1  
ATOM   1839  C  CD   . LYS B 1 27 ? 155.766 1.882   17.942  1.00 0.00 ? 27  LYS B CD   1  
ATOM   1840  C  CE   . LYS B 1 27 ? 154.756 1.937   19.090  1.00 0.00 ? 27  LYS B CE   1  
ATOM   1841  N  NZ   . LYS B 1 27 ? 155.056 3.110   19.959  1.00 0.00 ? 27  LYS B NZ   1  
ATOM   1842  H  H    . LYS B 1 27 ? 157.090 -2.218  16.277  1.00 0.00 ? 27  LYS B H    1  
ATOM   1843  H  HA   . LYS B 1 27 ? 155.256 -0.501  14.698  1.00 0.00 ? 27  LYS B HA   1  
ATOM   1844  H  HB2  . LYS B 1 27 ? 157.541 0.343   16.484  1.00 0.00 ? 27  LYS B HB2  1  
ATOM   1845  H  HB3  . LYS B 1 27 ? 156.620 1.426   15.438  1.00 0.00 ? 27  LYS B HB3  1  
ATOM   1846  H  HG2  . LYS B 1 27 ? 154.533 0.723   16.619  1.00 0.00 ? 27  LYS B HG2  1  
ATOM   1847  H  HG3  . LYS B 1 27 ? 155.519 -0.238  17.722  1.00 0.00 ? 27  LYS B HG3  1  
ATOM   1848  H  HD2  . LYS B 1 27 ? 156.768 1.836   18.343  1.00 0.00 ? 27  LYS B HD2  1  
ATOM   1849  H  HD3  . LYS B 1 27 ? 155.662 2.765   17.331  1.00 0.00 ? 27  LYS B HD3  1  
ATOM   1850  H  HE2  . LYS B 1 27 ? 153.759 2.032   18.688  1.00 0.00 ? 27  LYS B HE2  1  
ATOM   1851  H  HE3  . LYS B 1 27 ? 154.824 1.031   19.674  1.00 0.00 ? 27  LYS B HE3  1  
ATOM   1852  H  HZ1  . LYS B 1 27 ? 155.748 2.837   20.685  1.00 0.00 ? 27  LYS B HZ1  1  
ATOM   1853  H  HZ2  . LYS B 1 27 ? 154.180 3.434   20.418  1.00 0.00 ? 27  LYS B HZ2  1  
ATOM   1854  H  HZ3  . LYS B 1 27 ? 155.449 3.879   19.380  1.00 0.00 ? 27  LYS B HZ3  1  
ATOM   1855  N  N    . LEU B 1 28 ? 156.835 0.036   12.867  1.00 0.00 ? 28  LEU B N    1  
ATOM   1856  C  CA   . LEU B 1 28 ? 157.663 0.179   11.680  1.00 0.00 ? 28  LEU B CA   1  
ATOM   1857  C  C    . LEU B 1 28 ? 158.233 1.598   11.643  1.00 0.00 ? 28  LEU B C    1  
ATOM   1858  O  O    . LEU B 1 28 ? 157.476 2.568   11.680  1.00 0.00 ? 28  LEU B O    1  
ATOM   1859  C  CB   . LEU B 1 28 ? 156.799 -0.054  10.433  1.00 0.00 ? 28  LEU B CB   1  
ATOM   1860  C  CG   . LEU B 1 28 ? 157.655 -0.017  9.162   1.00 0.00 ? 28  LEU B CG   1  
ATOM   1861  C  CD1  . LEU B 1 28 ? 158.362 -1.358  8.964   1.00 0.00 ? 28  LEU B CD1  1  
ATOM   1862  C  CD2  . LEU B 1 28 ? 156.756 0.260   7.957   1.00 0.00 ? 28  LEU B CD2  1  
ATOM   1863  H  H    . LEU B 1 28 ? 155.972 0.500   12.901  1.00 0.00 ? 28  LEU B H    1  
ATOM   1864  H  HA   . LEU B 1 28 ? 158.467 -0.538  11.707  1.00 0.00 ? 28  LEU B HA   1  
ATOM   1865  H  HB2  . LEU B 1 28 ? 156.318 -1.018  10.508  1.00 0.00 ? 28  LEU B HB2  1  
ATOM   1866  H  HB3  . LEU B 1 28 ? 156.044 0.716   10.374  1.00 0.00 ? 28  LEU B HB3  1  
ATOM   1867  H  HG   . LEU B 1 28 ? 158.393 0.768   9.248   1.00 0.00 ? 28  LEU B HG   1  
ATOM   1868  H  HD11 . LEU B 1 28 ? 158.896 -1.346  8.026   1.00 0.00 ? 28  LEU B HD11 1  
ATOM   1869  H  HD12 . LEU B 1 28 ? 157.629 -2.149  8.948   1.00 0.00 ? 28  LEU B HD12 1  
ATOM   1870  H  HD13 . LEU B 1 28 ? 159.054 -1.525  9.769   1.00 0.00 ? 28  LEU B HD13 1  
ATOM   1871  H  HD21 . LEU B 1 28 ? 157.367 0.391   7.078   1.00 0.00 ? 28  LEU B HD21 1  
ATOM   1872  H  HD22 . LEU B 1 28 ? 156.181 1.157   8.135   1.00 0.00 ? 28  LEU B HD22 1  
ATOM   1873  H  HD23 . LEU B 1 28 ? 156.087 -0.573  7.808   1.00 0.00 ? 28  LEU B HD23 1  
ATOM   1874  N  N    . SER B 1 29 ? 159.552 1.728   11.557  1.00 0.00 ? 29  SER B N    1  
ATOM   1875  C  CA   . SER B 1 29 ? 160.157 3.056   11.500  1.00 0.00 ? 29  SER B CA   1  
ATOM   1876  C  C    . SER B 1 29 ? 160.135 3.567   10.067  1.00 0.00 ? 29  SER B C    1  
ATOM   1877  O  O    . SER B 1 29 ? 160.017 2.779   9.126   1.00 0.00 ? 29  SER B O    1  
ATOM   1878  C  CB   . SER B 1 29 ? 161.593 3.022   12.021  1.00 0.00 ? 29  SER B CB   1  
ATOM   1879  O  OG   . SER B 1 29 ? 162.430 2.409   11.055  1.00 0.00 ? 29  SER B OG   1  
ATOM   1880  H  H    . SER B 1 29 ? 160.121 0.930   11.519  1.00 0.00 ? 29  SER B H    1  
ATOM   1881  H  HA   . SER B 1 29 ? 159.578 3.728   12.117  1.00 0.00 ? 29  SER B HA   1  
ATOM   1882  H  HB2  . SER B 1 29 ? 161.937 4.026   12.202  1.00 0.00 ? 29  SER B HB2  1  
ATOM   1883  H  HB3  . SER B 1 29 ? 161.625 2.461   12.947  1.00 0.00 ? 29  SER B HB3  1  
ATOM   1884  H  HG   . SER B 1 29 ? 161.936 2.343   10.234  1.00 0.00 ? 29  SER B HG   1  
ATOM   1885  N  N    . LYS B 1 30 ? 160.253 4.878   9.888   1.00 0.00 ? 30  LYS B N    1  
ATOM   1886  C  CA   . LYS B 1 30 ? 160.241 5.422   8.539   1.00 0.00 ? 30  LYS B CA   1  
ATOM   1887  C  C    . LYS B 1 30 ? 161.364 4.813   7.719   1.00 0.00 ? 30  LYS B C    1  
ATOM   1888  O  O    . LYS B 1 30 ? 161.191 4.532   6.538   1.00 0.00 ? 30  LYS B O    1  
ATOM   1889  C  CB   . LYS B 1 30 ? 160.424 6.938   8.541   1.00 0.00 ? 30  LYS B CB   1  
ATOM   1890  C  CG   . LYS B 1 30 ? 160.165 7.461   7.122   1.00 0.00 ? 30  LYS B CG   1  
ATOM   1891  C  CD   . LYS B 1 30 ? 160.747 8.861   6.968   1.00 0.00 ? 30  LYS B CD   1  
ATOM   1892  C  CE   . LYS B 1 30 ? 159.942 9.867   7.796   1.00 0.00 ? 30  LYS B CE   1  
ATOM   1893  N  NZ   . LYS B 1 30 ? 160.487 9.916   9.182   1.00 0.00 ? 30  LYS B NZ   1  
ATOM   1894  H  H    . LYS B 1 30 ? 160.347 5.475   10.659  1.00 0.00 ? 30  LYS B H    1  
ATOM   1895  H  HA   . LYS B 1 30 ? 159.296 5.185   8.073   1.00 0.00 ? 30  LYS B HA   1  
ATOM   1896  H  HB2  . LYS B 1 30 ? 159.724 7.388   9.231   1.00 0.00 ? 30  LYS B HB2  1  
ATOM   1897  H  HB3  . LYS B 1 30 ? 161.434 7.182   8.835   1.00 0.00 ? 30  LYS B HB3  1  
ATOM   1898  H  HG2  . LYS B 1 30 ? 160.629 6.804   6.402   1.00 0.00 ? 30  LYS B HG2  1  
ATOM   1899  H  HG3  . LYS B 1 30 ? 159.102 7.492   6.941   1.00 0.00 ? 30  LYS B HG3  1  
ATOM   1900  H  HD2  . LYS B 1 30 ? 161.774 8.856   7.303   1.00 0.00 ? 30  LYS B HD2  1  
ATOM   1901  H  HD3  . LYS B 1 30 ? 160.714 9.143   5.926   1.00 0.00 ? 30  LYS B HD3  1  
ATOM   1902  H  HE2  . LYS B 1 30 ? 160.016 10.844  7.345   1.00 0.00 ? 30  LYS B HE2  1  
ATOM   1903  H  HE3  . LYS B 1 30 ? 158.907 9.565   7.827   1.00 0.00 ? 30  LYS B HE3  1  
ATOM   1904  H  HZ1  . LYS B 1 30 ? 160.647 10.906  9.456   1.00 0.00 ? 30  LYS B HZ1  1  
ATOM   1905  H  HZ2  . LYS B 1 30 ? 161.387 9.395   9.219   1.00 0.00 ? 30  LYS B HZ2  1  
ATOM   1906  H  HZ3  . LYS B 1 30 ? 159.807 9.483   9.839   1.00 0.00 ? 30  LYS B HZ3  1  
ATOM   1907  N  N    . LYS B 1 31 ? 162.522 4.620   8.340   1.00 0.00 ? 31  LYS B N    1  
ATOM   1908  C  CA   . LYS B 1 31 ? 163.647 4.052   7.617   1.00 0.00 ? 31  LYS B CA   1  
ATOM   1909  C  C    . LYS B 1 31 ? 163.264 2.692   7.057   1.00 0.00 ? 31  LYS B C    1  
ATOM   1910  O  O    . LYS B 1 31 ? 163.571 2.373   5.909   1.00 0.00 ? 31  LYS B O    1  
ATOM   1911  C  CB   . LYS B 1 31 ? 164.849 3.905   8.550   1.00 0.00 ? 31  LYS B CB   1  
ATOM   1912  C  CG   . LYS B 1 31 ? 166.064 3.428   7.752   1.00 0.00 ? 31  LYS B CG   1  
ATOM   1913  C  CD   . LYS B 1 31 ? 167.247 3.220   8.700   1.00 0.00 ? 31  LYS B CD   1  
ATOM   1914  C  CE   . LYS B 1 31 ? 168.501 2.893   7.888   1.00 0.00 ? 31  LYS B CE   1  
ATOM   1915  N  NZ   . LYS B 1 31 ? 169.609 2.524   8.815   1.00 0.00 ? 31  LYS B NZ   1  
ATOM   1916  H  H    . LYS B 1 31 ? 162.620 4.867   9.283   1.00 0.00 ? 31  LYS B H    1  
ATOM   1917  H  HA   . LYS B 1 31 ? 163.912 4.708   6.802   1.00 0.00 ? 31  LYS B HA   1  
ATOM   1918  H  HB2  . LYS B 1 31 ? 165.069 4.860   9.006   1.00 0.00 ? 31  LYS B HB2  1  
ATOM   1919  H  HB3  . LYS B 1 31 ? 164.621 3.183   9.320   1.00 0.00 ? 31  LYS B HB3  1  
ATOM   1920  H  HG2  . LYS B 1 31 ? 165.828 2.497   7.258   1.00 0.00 ? 31  LYS B HG2  1  
ATOM   1921  H  HG3  . LYS B 1 31 ? 166.324 4.171   7.013   1.00 0.00 ? 31  LYS B HG3  1  
ATOM   1922  H  HD2  . LYS B 1 31 ? 167.412 4.121   9.272   1.00 0.00 ? 31  LYS B HD2  1  
ATOM   1923  H  HD3  . LYS B 1 31 ? 167.031 2.402   9.370   1.00 0.00 ? 31  LYS B HD3  1  
ATOM   1924  H  HE2  . LYS B 1 31 ? 168.296 2.065   7.225   1.00 0.00 ? 31  LYS B HE2  1  
ATOM   1925  H  HE3  . LYS B 1 31 ? 168.791 3.756   7.308   1.00 0.00 ? 31  LYS B HE3  1  
ATOM   1926  H  HZ1  . LYS B 1 31 ? 170.520 2.637   8.328   1.00 0.00 ? 31  LYS B HZ1  1  
ATOM   1927  H  HZ2  . LYS B 1 31 ? 169.495 1.533   9.113   1.00 0.00 ? 31  LYS B HZ2  1  
ATOM   1928  H  HZ3  . LYS B 1 31 ? 169.584 3.143   9.649   1.00 0.00 ? 31  LYS B HZ3  1  
ATOM   1929  N  N    . GLU B 1 32 ? 162.571 1.902   7.868   1.00 0.00 ? 32  GLU B N    1  
ATOM   1930  C  CA   . GLU B 1 32 ? 162.132 0.589   7.424   1.00 0.00 ? 32  GLU B CA   1  
ATOM   1931  C  C    . GLU B 1 32 ? 161.098 0.737   6.308   1.00 0.00 ? 32  GLU B C    1  
ATOM   1932  O  O    . GLU B 1 32 ? 161.100 -0.024  5.336   1.00 0.00 ? 32  GLU B O    1  
ATOM   1933  C  CB   . GLU B 1 32 ? 161.539 -0.173  8.618   1.00 0.00 ? 32  GLU B CB   1  
ATOM   1934  C  CG   . GLU B 1 32 ? 162.652 -0.409  9.645   1.00 0.00 ? 32  GLU B CG   1  
ATOM   1935  C  CD   . GLU B 1 32 ? 162.149 -1.192  10.862  1.00 0.00 ? 32  GLU B CD   1  
ATOM   1936  O  OE1  . GLU B 1 32 ? 160.956 -1.441  10.963  1.00 0.00 ? 32  GLU B OE1  1  
ATOM   1937  O  OE2  . GLU B 1 32 ? 162.975 -1.509  11.695  1.00 0.00 ? 32  GLU B OE2  1  
ATOM   1938  H  H    . GLU B 1 32 ? 162.338 2.212   8.768   1.00 0.00 ? 32  GLU B H    1  
ATOM   1939  H  HA   . GLU B 1 32 ? 162.982 0.043   7.046   1.00 0.00 ? 32  GLU B HA   1  
ATOM   1940  H  HB2  . GLU B 1 32 ? 160.746 0.411   9.065   1.00 0.00 ? 32  GLU B HB2  1  
ATOM   1941  H  HB3  . GLU B 1 32 ? 161.149 -1.122  8.285   1.00 0.00 ? 32  GLU B HB3  1  
ATOM   1942  H  HG2  . GLU B 1 32 ? 163.446 -0.969  9.174   1.00 0.00 ? 32  GLU B HG2  1  
ATOM   1943  H  HG3  . GLU B 1 32 ? 163.041 0.540   9.970   1.00 0.00 ? 32  GLU B HG3  1  
ATOM   1944  N  N    . LEU B 1 33 ? 160.221 1.736   6.449   1.00 0.00 ? 33  LEU B N    1  
ATOM   1945  C  CA   . LEU B 1 33 ? 159.192 1.978   5.441   1.00 0.00 ? 33  LEU B CA   1  
ATOM   1946  C  C    . LEU B 1 33 ? 159.795 2.394   4.102   1.00 0.00 ? 33  LEU B C    1  
ATOM   1947  O  O    . LEU B 1 33 ? 159.366 1.918   3.048   1.00 0.00 ? 33  LEU B O    1  
ATOM   1948  C  CB   . LEU B 1 33 ? 158.243 3.078   5.933   1.00 0.00 ? 33  LEU B CB   1  
ATOM   1949  C  CG   . LEU B 1 33 ? 157.111 3.303   4.916   1.00 0.00 ? 33  LEU B CG   1  
ATOM   1950  C  CD1  . LEU B 1 33 ? 156.147 2.115   4.934   1.00 0.00 ? 33  LEU B CD1  1  
ATOM   1951  C  CD2  . LEU B 1 33 ? 156.342 4.579   5.275   1.00 0.00 ? 33  LEU B CD2  1  
ATOM   1952  H  H    . LEU B 1 33 ? 160.271 2.317   7.240   1.00 0.00 ? 33  LEU B H    1  
ATOM   1953  H  HA   . LEU B 1 33 ? 158.625 1.072   5.300   1.00 0.00 ? 33  LEU B HA   1  
ATOM   1954  H  HB2  . LEU B 1 33 ? 157.819 2.785   6.883   1.00 0.00 ? 33  LEU B HB2  1  
ATOM   1955  H  HB3  . LEU B 1 33 ? 158.800 3.993   6.058   1.00 0.00 ? 33  LEU B HB3  1  
ATOM   1956  H  HG   . LEU B 1 33 ? 157.528 3.407   3.925   1.00 0.00 ? 33  LEU B HG   1  
ATOM   1957  H  HD11 . LEU B 1 33 ? 155.981 1.800   5.953   1.00 0.00 ? 33  LEU B HD11 1  
ATOM   1958  H  HD12 . LEU B 1 33 ? 156.570 1.298   4.368   1.00 0.00 ? 33  LEU B HD12 1  
ATOM   1959  H  HD13 . LEU B 1 33 ? 155.207 2.408   4.492   1.00 0.00 ? 33  LEU B HD13 1  
ATOM   1960  H  HD21 . LEU B 1 33 ? 157.016 5.303   5.707   1.00 0.00 ? 33  LEU B HD21 1  
ATOM   1961  H  HD22 . LEU B 1 33 ? 155.563 4.345   5.986   1.00 0.00 ? 33  LEU B HD22 1  
ATOM   1962  H  HD23 . LEU B 1 33 ? 155.901 4.990   4.381   1.00 0.00 ? 33  LEU B HD23 1  
ATOM   1963  N  N    . LYS B 1 34 ? 160.782 3.289   4.137   1.00 0.00 ? 34  LYS B N    1  
ATOM   1964  C  CA   . LYS B 1 34 ? 161.401 3.748   2.920   1.00 0.00 ? 34  LYS B CA   1  
ATOM   1965  C  C    . LYS B 1 34 ? 162.033 2.593   2.165   1.00 0.00 ? 34  LYS B C    1  
ATOM   1966  O  O    . LYS B 1 34 ? 161.857 2.455   0.954   1.00 0.00 ? 34  LYS B O    1  
ATOM   1967  C  CB   . LYS B 1 34 ? 162.468 4.753   3.303   1.00 0.00 ? 34  LYS B CB   1  
ATOM   1968  C  CG   . LYS B 1 34 ? 163.073 5.362   2.057   1.00 0.00 ? 34  LYS B CG   1  
ATOM   1969  C  CD   . LYS B 1 34 ? 164.078 6.415   2.486   1.00 0.00 ? 34  LYS B CD   1  
ATOM   1970  C  CE   . LYS B 1 34 ? 165.278 5.749   3.165   1.00 0.00 ? 34  LYS B CE   1  
ATOM   1971  N  NZ   . LYS B 1 34 ? 166.475 6.625   3.023   1.00 0.00 ? 34  LYS B NZ   1  
ATOM   1972  H  H    . LYS B 1 34 ? 161.092 3.662   4.992   1.00 0.00 ? 34  LYS B H    1  
ATOM   1973  H  HA   . LYS B 1 34 ? 160.666 4.232   2.297   1.00 0.00 ? 34  LYS B HA   1  
ATOM   1974  H  HB2  . LYS B 1 34 ? 162.027 5.533   3.906   1.00 0.00 ? 34  LYS B HB2  1  
ATOM   1975  H  HB3  . LYS B 1 34 ? 163.242 4.257   3.870   1.00 0.00 ? 34  LYS B HB3  1  
ATOM   1976  H  HG2  . LYS B 1 34 ? 163.566 4.593   1.479   1.00 0.00 ? 34  LYS B HG2  1  
ATOM   1977  H  HG3  . LYS B 1 34 ? 162.298 5.823   1.464   1.00 0.00 ? 34  LYS B HG3  1  
ATOM   1978  H  HD2  . LYS B 1 34 ? 164.403 6.945   1.624   1.00 0.00 ? 34  LYS B HD2  1  
ATOM   1979  H  HD3  . LYS B 1 34 ? 163.611 7.100   3.177   1.00 0.00 ? 34  LYS B HD3  1  
ATOM   1980  H  HE2  . LYS B 1 34 ? 165.061 5.602   4.212   1.00 0.00 ? 34  LYS B HE2  1  
ATOM   1981  H  HE3  . LYS B 1 34 ? 165.473 4.795   2.699   1.00 0.00 ? 34  LYS B HE3  1  
ATOM   1982  H  HZ1  . LYS B 1 34 ? 167.251 6.247   3.601   1.00 0.00 ? 34  LYS B HZ1  1  
ATOM   1983  H  HZ2  . LYS B 1 34 ? 166.240 7.587   3.342   1.00 0.00 ? 34  LYS B HZ2  1  
ATOM   1984  H  HZ3  . LYS B 1 34 ? 166.770 6.652   2.026   1.00 0.00 ? 34  LYS B HZ3  1  
ATOM   1985  N  N    . GLU B 1 35 ? 162.760 1.757   2.893   1.00 0.00 ? 35  GLU B N    1  
ATOM   1986  C  CA   . GLU B 1 35 ? 163.400 0.608   2.280   1.00 0.00 ? 35  GLU B CA   1  
ATOM   1987  C  C    . GLU B 1 35 ? 162.361 -0.372  1.756   1.00 0.00 ? 35  GLU B C    1  
ATOM   1988  O  O    . GLU B 1 35 ? 162.531 -0.958  0.687   1.00 0.00 ? 35  GLU B O    1  
ATOM   1989  C  CB   . GLU B 1 35 ? 164.296 -0.096  3.301   1.00 0.00 ? 35  GLU B CB   1  
ATOM   1990  C  CG   . GLU B 1 35 ? 165.071 -1.220  2.612   1.00 0.00 ? 35  GLU B CG   1  
ATOM   1991  C  CD   . GLU B 1 35 ? 165.890 -1.994  3.639   1.00 0.00 ? 35  GLU B CD   1  
ATOM   1992  O  OE1  . GLU B 1 35 ? 165.808 -1.656  4.809   1.00 0.00 ? 35  GLU B OE1  1  
ATOM   1993  O  OE2  . GLU B 1 35 ? 166.586 -2.913  3.242   1.00 0.00 ? 35  GLU B OE2  1  
ATOM   1994  H  H    . GLU B 1 35 ? 162.859 1.916   3.854   1.00 0.00 ? 35  GLU B H    1  
ATOM   1995  H  HA   . GLU B 1 35 ? 164.012 0.945   1.457   1.00 0.00 ? 35  GLU B HA   1  
ATOM   1996  H  HB2  . GLU B 1 35 ? 164.990 0.617   3.723   1.00 0.00 ? 35  GLU B HB2  1  
ATOM   1997  H  HB3  . GLU B 1 35 ? 163.686 -0.512  4.089   1.00 0.00 ? 35  GLU B HB3  1  
ATOM   1998  H  HG2  . GLU B 1 35 ? 164.375 -1.891  2.129   1.00 0.00 ? 35  GLU B HG2  1  
ATOM   1999  H  HG3  . GLU B 1 35 ? 165.734 -0.797  1.872   1.00 0.00 ? 35  GLU B HG3  1  
ATOM   2000  N  N    . LEU B 1 36 ? 161.286 -0.559  2.522   1.00 0.00 ? 36  LEU B N    1  
ATOM   2001  C  CA   . LEU B 1 36 ? 160.243 -1.491  2.113   1.00 0.00 ? 36  LEU B CA   1  
ATOM   2002  C  C    . LEU B 1 36 ? 159.595 -1.090  0.793   1.00 0.00 ? 36  LEU B C    1  
ATOM   2003  O  O    . LEU B 1 36 ? 159.500 -1.901  -0.131  1.00 0.00 ? 36  LEU B O    1  
ATOM   2004  C  CB   . LEU B 1 36 ? 159.169 -1.536  3.208   1.00 0.00 ? 36  LEU B CB   1  
ATOM   2005  C  CG   . LEU B 1 36 ? 158.044 -2.504  2.823   1.00 0.00 ? 36  LEU B CG   1  
ATOM   2006  C  CD1  . LEU B 1 36 ? 158.565 -3.935  2.837   1.00 0.00 ? 36  LEU B CD1  1  
ATOM   2007  C  CD2  . LEU B 1 36 ? 156.906 -2.377  3.839   1.00 0.00 ? 36  LEU B CD2  1  
ATOM   2008  H  H    . LEU B 1 36 ? 161.202 -0.076  3.375   1.00 0.00 ? 36  LEU B H    1  
ATOM   2009  H  HA   . LEU B 1 36 ? 160.670 -2.474  2.010   1.00 0.00 ? 36  LEU B HA   1  
ATOM   2010  H  HB2  . LEU B 1 36 ? 159.619 -1.862  4.134   1.00 0.00 ? 36  LEU B HB2  1  
ATOM   2011  H  HB3  . LEU B 1 36 ? 158.756 -0.547  3.342   1.00 0.00 ? 36  LEU B HB3  1  
ATOM   2012  H  HG   . LEU B 1 36 ? 157.672 -2.265  1.839   1.00 0.00 ? 36  LEU B HG   1  
ATOM   2013  H  HD11 . LEU B 1 36 ? 157.732 -4.613  2.925   1.00 0.00 ? 36  LEU B HD11 1  
ATOM   2014  H  HD12 . LEU B 1 36 ? 159.231 -4.067  3.672   1.00 0.00 ? 36  LEU B HD12 1  
ATOM   2015  H  HD13 . LEU B 1 36 ? 159.096 -4.133  1.919   1.00 0.00 ? 36  LEU B HD13 1  
ATOM   2016  H  HD21 . LEU B 1 36 ? 156.665 -1.334  3.981   1.00 0.00 ? 36  LEU B HD21 1  
ATOM   2017  H  HD22 . LEU B 1 36 ? 157.214 -2.807  4.781   1.00 0.00 ? 36  LEU B HD22 1  
ATOM   2018  H  HD23 . LEU B 1 36 ? 156.035 -2.900  3.471   1.00 0.00 ? 36  LEU B HD23 1  
ATOM   2019  N  N    . LEU B 1 37 ? 159.147 0.158   0.703   1.00 0.00 ? 37  LEU B N    1  
ATOM   2020  C  CA   . LEU B 1 37 ? 158.506 0.615   -0.521  1.00 0.00 ? 37  LEU B CA   1  
ATOM   2021  C  C    . LEU B 1 37 ? 159.491 0.772   -1.666  1.00 0.00 ? 37  LEU B C    1  
ATOM   2022  O  O    . LEU B 1 37 ? 159.155 0.501   -2.811  1.00 0.00 ? 37  LEU B O    1  
ATOM   2023  C  CB   . LEU B 1 37 ? 157.763 1.933   -0.294  1.00 0.00 ? 37  LEU B CB   1  
ATOM   2024  C  CG   . LEU B 1 37 ? 156.699 1.767   0.800   1.00 0.00 ? 37  LEU B CG   1  
ATOM   2025  C  CD1  . LEU B 1 37 ? 155.850 3.033   0.856   1.00 0.00 ? 37  LEU B CD1  1  
ATOM   2026  C  CD2  . LEU B 1 37 ? 155.787 0.575   0.489   1.00 0.00 ? 37  LEU B CD2  1  
ATOM   2027  H  H    . LEU B 1 37 ? 159.242 0.770   1.466   1.00 0.00 ? 37  LEU B H    1  
ATOM   2028  H  HA   . LEU B 1 37 ? 157.789 -0.131  -0.817  1.00 0.00 ? 37  LEU B HA   1  
ATOM   2029  H  HB2  . LEU B 1 37 ? 158.469 2.693   0.007   1.00 0.00 ? 37  LEU B HB2  1  
ATOM   2030  H  HB3  . LEU B 1 37 ? 157.283 2.234   -1.214  1.00 0.00 ? 37  LEU B HB3  1  
ATOM   2031  H  HG   . LEU B 1 37 ? 157.184 1.616   1.754   1.00 0.00 ? 37  LEU B HG   1  
ATOM   2032  H  HD11 . LEU B 1 37 ? 155.070 2.910   1.592   1.00 0.00 ? 37  LEU B HD11 1  
ATOM   2033  H  HD12 . LEU B 1 37 ? 155.405 3.205   -0.114  1.00 0.00 ? 37  LEU B HD12 1  
ATOM   2034  H  HD13 . LEU B 1 37 ? 156.471 3.874   1.123   1.00 0.00 ? 37  LEU B HD13 1  
ATOM   2035  H  HD21 . LEU B 1 37 ? 155.623 0.512   -0.576  1.00 0.00 ? 37  LEU B HD21 1  
ATOM   2036  H  HD22 . LEU B 1 37 ? 154.840 0.706   0.991   1.00 0.00 ? 37  LEU B HD22 1  
ATOM   2037  H  HD23 . LEU B 1 37 ? 156.252 -0.337  0.837   1.00 0.00 ? 37  LEU B HD23 1  
ATOM   2038  N  N    . GLN B 1 38 ? 160.695 1.240   -1.378  1.00 0.00 ? 38  GLN B N    1  
ATOM   2039  C  CA   . GLN B 1 38 ? 161.648 1.432   -2.455  1.00 0.00 ? 38  GLN B CA   1  
ATOM   2040  C  C    . GLN B 1 38 ? 161.968 0.112   -3.146  1.00 0.00 ? 38  GLN B C    1  
ATOM   2041  O  O    . GLN B 1 38 ? 161.977 0.034   -4.372  1.00 0.00 ? 38  GLN B O    1  
ATOM   2042  C  CB   . GLN B 1 38 ? 162.935 2.049   -1.902  1.00 0.00 ? 38  GLN B CB   1  
ATOM   2043  C  CG   . GLN B 1 38 ? 163.864 2.417   -3.060  1.00 0.00 ? 38  GLN B CG   1  
ATOM   2044  C  CD   . GLN B 1 38 ? 165.135 3.065   -2.522  1.00 0.00 ? 38  GLN B CD   1  
ATOM   2045  O  OE1  . GLN B 1 38 ? 165.231 3.350   -1.329  1.00 0.00 ? 38  GLN B OE1  1  
ATOM   2046  N  NE2  . GLN B 1 38 ? 166.123 3.317   -3.337  1.00 0.00 ? 38  GLN B NE2  1  
ATOM   2047  H  H    . GLN B 1 38 ? 160.931 1.472   -0.456  1.00 0.00 ? 38  GLN B H    1  
ATOM   2048  H  HA   . GLN B 1 38 ? 161.223 2.111   -3.179  1.00 0.00 ? 38  GLN B HA   1  
ATOM   2049  H  HB2  . GLN B 1 38 ? 162.694 2.937   -1.336  1.00 0.00 ? 38  GLN B HB2  1  
ATOM   2050  H  HB3  . GLN B 1 38 ? 163.428 1.335   -1.260  1.00 0.00 ? 38  GLN B HB3  1  
ATOM   2051  H  HG2  . GLN B 1 38 ? 164.122 1.523   -3.609  1.00 0.00 ? 38  GLN B HG2  1  
ATOM   2052  H  HG3  . GLN B 1 38 ? 163.360 3.108   -3.717  1.00 0.00 ? 38  GLN B HG3  1  
ATOM   2053  H  HE21 . GLN B 1 38 ? 166.045 3.089   -4.287  1.00 0.00 ? 38  GLN B HE21 1  
ATOM   2054  H  HE22 . GLN B 1 38 ? 166.943 3.734   -3.000  1.00 0.00 ? 38  GLN B HE22 1  
ATOM   2055  N  N    . THR B 1 39 ? 162.229 -0.926  -2.355  1.00 0.00 ? 39  THR B N    1  
ATOM   2056  C  CA   . THR B 1 39 ? 162.548 -2.234  -2.919  1.00 0.00 ? 39  THR B CA   1  
ATOM   2057  C  C    . THR B 1 39 ? 161.327 -2.978  -3.467  1.00 0.00 ? 39  THR B C    1  
ATOM   2058  O  O    . THR B 1 39 ? 161.369 -3.532  -4.566  1.00 0.00 ? 39  THR B O    1  
ATOM   2059  C  CB   . THR B 1 39 ? 163.222 -3.097  -1.851  1.00 0.00 ? 39  THR B CB   1  
ATOM   2060  O  OG1  . THR B 1 39 ? 164.351 -2.409  -1.332  1.00 0.00 ? 39  THR B OG1  1  
ATOM   2061  C  CG2  . THR B 1 39 ? 163.669 -4.422  -2.469  1.00 0.00 ? 39  THR B CG2  1  
ATOM   2062  H  H    . THR B 1 39 ? 162.208 -0.810  -1.383  1.00 0.00 ? 39  THR B H    1  
ATOM   2063  H  HA   . THR B 1 39 ? 163.251 -2.094  -3.726  1.00 0.00 ? 39  THR B HA   1  
ATOM   2064  H  HB   . THR B 1 39 ? 162.521 -3.295  -1.054  1.00 0.00 ? 39  THR B HB   1  
ATOM   2065  H  HG1  . THR B 1 39 ? 164.396 -1.550  -1.757  1.00 0.00 ? 39  THR B HG1  1  
ATOM   2066  H  HG21 . THR B 1 39 ? 162.816 -5.075  -2.577  1.00 0.00 ? 39  THR B HG21 1  
ATOM   2067  H  HG22 . THR B 1 39 ? 164.400 -4.890  -1.827  1.00 0.00 ? 39  THR B HG22 1  
ATOM   2068  H  HG23 . THR B 1 39 ? 164.106 -4.237  -3.439  1.00 0.00 ? 39  THR B HG23 1  
ATOM   2069  N  N    . GLU B 1 40 ? 160.261 -3.036  -2.666  1.00 0.00 ? 40  GLU B N    1  
ATOM   2070  C  CA   . GLU B 1 40 ? 159.057 -3.775  -3.056  1.00 0.00 ? 40  GLU B CA   1  
ATOM   2071  C  C    . GLU B 1 40 ? 158.184 -3.053  -4.084  1.00 0.00 ? 40  GLU B C    1  
ATOM   2072  O  O    . GLU B 1 40 ? 157.513 -3.699  -4.888  1.00 0.00 ? 40  GLU B O    1  
ATOM   2073  C  CB   . GLU B 1 40 ? 158.215 -4.076  -1.811  1.00 0.00 ? 40  GLU B CB   1  
ATOM   2074  C  CG   . GLU B 1 40 ? 158.995 -4.995  -0.861  1.00 0.00 ? 40  GLU B CG   1  
ATOM   2075  C  CD   . GLU B 1 40 ? 159.322 -6.326  -1.532  1.00 0.00 ? 40  GLU B CD   1  
ATOM   2076  O  OE1  . GLU B 1 40 ? 158.688 -6.643  -2.524  1.00 0.00 ? 40  GLU B OE1  1  
ATOM   2077  O  OE2  . GLU B 1 40 ? 160.198 -7.015  -1.036  1.00 0.00 ? 40  GLU B OE2  1  
ATOM   2078  H  H    . GLU B 1 40 ? 160.298 -2.609  -1.781  1.00 0.00 ? 40  GLU B H    1  
ATOM   2079  H  HA   . GLU B 1 40 ? 159.367 -4.712  -3.483  1.00 0.00 ? 40  GLU B HA   1  
ATOM   2080  H  HB2  . GLU B 1 40 ? 157.979 -3.152  -1.306  1.00 0.00 ? 40  GLU B HB2  1  
ATOM   2081  H  HB3  . GLU B 1 40 ? 157.301 -4.566  -2.109  1.00 0.00 ? 40  GLU B HB3  1  
ATOM   2082  H  HG2  . GLU B 1 40 ? 159.915 -4.508  -0.571  1.00 0.00 ? 40  GLU B HG2  1  
ATOM   2083  H  HG3  . GLU B 1 40 ? 158.398 -5.179  0.020   1.00 0.00 ? 40  GLU B HG3  1  
ATOM   2084  N  N    . LEU B 1 41 ? 158.146 -1.728  -4.024  1.00 0.00 ? 41  LEU B N    1  
ATOM   2085  C  CA   . LEU B 1 41 ? 157.287 -0.962  -4.929  1.00 0.00 ? 41  LEU B CA   1  
ATOM   2086  C  C    . LEU B 1 41 ? 158.091 -0.455  -6.135  1.00 0.00 ? 41  LEU B C    1  
ATOM   2087  O  O    . LEU B 1 41 ? 159.268 -0.090  -6.018  1.00 0.00 ? 41  LEU B O    1  
ATOM   2088  C  CB   . LEU B 1 41 ? 156.634 0.210   -4.164  1.00 0.00 ? 41  LEU B CB   1  
ATOM   2089  C  CG   . LEU B 1 41 ? 155.375 0.723   -4.907  1.00 0.00 ? 41  LEU B CG   1  
ATOM   2090  C  CD1  . LEU B 1 41 ? 154.397 1.316   -3.887  1.00 0.00 ? 41  LEU B CD1  1  
ATOM   2091  C  CD2  . LEU B 1 41 ? 155.729 1.801   -5.944  1.00 0.00 ? 41  LEU B CD2  1  
ATOM   2092  H  H    . LEU B 1 41 ? 158.666 -1.260  -3.338  1.00 0.00 ? 41  LEU B H    1  
ATOM   2093  H  HA   . LEU B 1 41 ? 156.507 -1.615  -5.288  1.00 0.00 ? 41  LEU B HA   1  
ATOM   2094  H  HB2  . LEU B 1 41 ? 156.351 -0.123  -3.173  1.00 0.00 ? 41  LEU B HB2  1  
ATOM   2095  H  HB3  . LEU B 1 41 ? 157.346 1.012   -4.071  1.00 0.00 ? 41  LEU B HB3  1  
ATOM   2096  H  HG   . LEU B 1 41 ? 154.891 -0.105  -5.406  1.00 0.00 ? 41  LEU B HG   1  
ATOM   2097  H  HD11 . LEU B 1 41 ? 153.761 2.041   -4.373  1.00 0.00 ? 41  LEU B HD11 1  
ATOM   2098  H  HD12 . LEU B 1 41 ? 154.951 1.796   -3.094  1.00 0.00 ? 41  LEU B HD12 1  
ATOM   2099  H  HD13 . LEU B 1 41 ? 153.788 0.525   -3.474  1.00 0.00 ? 41  LEU B HD13 1  
ATOM   2100  H  HD21 . LEU B 1 41 ? 155.972 1.326   -6.881  1.00 0.00 ? 41  LEU B HD21 1  
ATOM   2101  H  HD22 . LEU B 1 41 ? 156.565 2.388   -5.600  1.00 0.00 ? 41  LEU B HD22 1  
ATOM   2102  H  HD23 . LEU B 1 41 ? 154.877 2.450   -6.089  1.00 0.00 ? 41  LEU B HD23 1  
ATOM   2103  N  N    . SER B 1 42 ? 157.447 -0.444  -7.296  1.00 0.00 ? 42  SER B N    1  
ATOM   2104  C  CA   . SER B 1 42 ? 158.100 -0.003  -8.525  1.00 0.00 ? 42  SER B CA   1  
ATOM   2105  C  C    . SER B 1 42 ? 158.793 1.331   -8.288  1.00 0.00 ? 42  SER B C    1  
ATOM   2106  O  O    . SER B 1 42 ? 159.758 1.675   -8.970  1.00 0.00 ? 42  SER B O    1  
ATOM   2107  C  CB   . SER B 1 42 ? 157.070 0.141   -9.645  1.00 0.00 ? 42  SER B CB   1  
ATOM   2108  O  OG   . SER B 1 42 ? 157.741 0.436   -10.863 1.00 0.00 ? 42  SER B OG   1  
ATOM   2109  H  H    . SER B 1 42 ? 156.518 -0.749  -7.331  1.00 0.00 ? 42  SER B H    1  
ATOM   2110  H  HA   . SER B 1 42 ? 158.837 -0.737  -8.816  1.00 0.00 ? 42  SER B HA   1  
ATOM   2111  H  HB2  . SER B 1 42 ? 156.524 -0.781  -9.756  1.00 0.00 ? 42  SER B HB2  1  
ATOM   2112  H  HB3  . SER B 1 42 ? 156.381 0.938   -9.399  1.00 0.00 ? 42  SER B HB3  1  
ATOM   2113  H  HG   . SER B 1 42 ? 157.247 1.124   -11.316 1.00 0.00 ? 42  SER B HG   1  
ATOM   2114  N  N    . GLY B 1 43 ? 158.297 2.065   -7.306  1.00 0.00 ? 43  GLY B N    1  
ATOM   2115  C  CA   . GLY B 1 43 ? 158.864 3.354   -6.953  1.00 0.00 ? 43  GLY B CA   1  
ATOM   2116  C  C    . GLY B 1 43 ? 160.385 3.271   -6.916  1.00 0.00 ? 43  GLY B C    1  
ATOM   2117  O  O    . GLY B 1 43 ? 161.067 4.294   -6.855  1.00 0.00 ? 43  GLY B O    1  
ATOM   2118  H  H    . GLY B 1 43 ? 157.543 1.724   -6.799  1.00 0.00 ? 43  GLY B H    1  
ATOM   2119  H  HA2  . GLY B 1 43 ? 158.564 4.088   -7.687  1.00 0.00 ? 43  GLY B HA2  1  
ATOM   2120  H  HA3  . GLY B 1 43 ? 158.503 3.650   -5.980  1.00 0.00 ? 43  GLY B HA3  1  
ATOM   2121  N  N    . PHE B 1 44 ? 160.920 2.050   -6.961  1.00 0.00 ? 44  PHE B N    1  
ATOM   2122  C  CA   . PHE B 1 44 ? 162.368 1.881   -6.939  1.00 0.00 ? 44  PHE B CA   1  
ATOM   2123  C  C    . PHE B 1 44 ? 162.994 2.806   -7.979  1.00 0.00 ? 44  PHE B C    1  
ATOM   2124  O  O    . PHE B 1 44 ? 164.013 3.447   -7.721  1.00 0.00 ? 44  PHE B O    1  
ATOM   2125  C  CB   . PHE B 1 44 ? 162.732 0.434   -7.282  1.00 0.00 ? 44  PHE B CB   1  
ATOM   2126  C  CG   . PHE B 1 44 ? 164.224 0.237   -7.148  1.00 0.00 ? 44  PHE B CG   1  
ATOM   2127  C  CD1  . PHE B 1 44 ? 164.781 -0.111  -5.912  1.00 0.00 ? 44  PHE B CD1  1  
ATOM   2128  C  CD2  . PHE B 1 44 ? 165.050 0.396   -8.267  1.00 0.00 ? 44  PHE B CD2  1  
ATOM   2129  C  CE1  . PHE B 1 44 ? 166.163 -0.297  -5.794  1.00 0.00 ? 44  PHE B CE1  1  
ATOM   2130  C  CE2  . PHE B 1 44 ? 166.433 0.211   -8.150  1.00 0.00 ? 44  PHE B CE2  1  
ATOM   2131  C  CZ   . PHE B 1 44 ? 166.989 -0.136  -6.912  1.00 0.00 ? 44  PHE B CZ   1  
ATOM   2132  H  H    . PHE B 1 44 ? 160.333 1.257   -7.006  1.00 0.00 ? 44  PHE B H    1  
ATOM   2133  H  HA   . PHE B 1 44 ? 162.749 2.127   -5.959  1.00 0.00 ? 44  PHE B HA   1  
ATOM   2134  H  HB2  . PHE B 1 44 ? 162.218 -0.237  -6.611  1.00 0.00 ? 44  PHE B HB2  1  
ATOM   2135  H  HB3  . PHE B 1 44 ? 162.433 0.221   -8.297  1.00 0.00 ? 44  PHE B HB3  1  
ATOM   2136  H  HD1  . PHE B 1 44 ? 164.145 -0.238  -5.050  1.00 0.00 ? 44  PHE B HD1  1  
ATOM   2137  H  HD2  . PHE B 1 44 ? 164.621 0.665   -9.221  1.00 0.00 ? 44  PHE B HD2  1  
ATOM   2138  H  HE1  . PHE B 1 44 ? 166.593 -0.564  -4.840  1.00 0.00 ? 44  PHE B HE1  1  
ATOM   2139  H  HE2  . PHE B 1 44 ? 167.069 0.335   -9.013  1.00 0.00 ? 44  PHE B HE2  1  
ATOM   2140  H  HZ   . PHE B 1 44 ? 168.055 -0.278  -6.821  1.00 0.00 ? 44  PHE B HZ   1  
ATOM   2141  N  N    . LEU B 1 45 ? 162.356 2.896   -9.140  1.00 0.00 ? 45  LEU B N    1  
ATOM   2142  C  CA   . LEU B 1 45 ? 162.835 3.776   -10.199 1.00 0.00 ? 45  LEU B CA   1  
ATOM   2143  C  C    . LEU B 1 45 ? 162.900 5.209   -9.676  1.00 0.00 ? 45  LEU B C    1  
ATOM   2144  O  O    . LEU B 1 45 ? 163.792 5.979   -10.033 1.00 0.00 ? 45  LEU B O    1  
ATOM   2145  C  CB   . LEU B 1 45 ? 161.897 3.703   -11.407 1.00 0.00 ? 45  LEU B CB   1  
ATOM   2146  C  CG   . LEU B 1 45 ? 162.465 4.541   -12.559 1.00 0.00 ? 45  LEU B CG   1  
ATOM   2147  C  CD1  . LEU B 1 45 ? 163.692 3.845   -13.156 1.00 0.00 ? 45  LEU B CD1  1  
ATOM   2148  C  CD2  . LEU B 1 45 ? 161.397 4.698   -13.643 1.00 0.00 ? 45  LEU B CD2  1  
ATOM   2149  H  H    . LEU B 1 45 ? 161.534 2.380   -9.279  1.00 0.00 ? 45  LEU B H    1  
ATOM   2150  H  HA   . LEU B 1 45 ? 163.824 3.463   -10.499 1.00 0.00 ? 45  LEU B HA   1  
ATOM   2151  H  HB2  . LEU B 1 45 ? 161.793 2.675   -11.721 1.00 0.00 ? 45  LEU B HB2  1  
ATOM   2152  H  HB3  . LEU B 1 45 ? 160.928 4.091   -11.129 1.00 0.00 ? 45  LEU B HB3  1  
ATOM   2153  H  HG   . LEU B 1 45 ? 162.750 5.515   -12.190 1.00 0.00 ? 45  LEU B HG   1  
ATOM   2154  H  HD11 . LEU B 1 45 ? 163.842 4.188   -14.169 1.00 0.00 ? 45  LEU B HD11 1  
ATOM   2155  H  HD12 . LEU B 1 45 ? 163.540 2.776   -13.157 1.00 0.00 ? 45  LEU B HD12 1  
ATOM   2156  H  HD13 . LEU B 1 45 ? 164.565 4.083   -12.565 1.00 0.00 ? 45  LEU B HD13 1  
ATOM   2157  H  HD21 . LEU B 1 45 ? 161.001 3.728   -13.903 1.00 0.00 ? 45  LEU B HD21 1  
ATOM   2158  H  HD22 . LEU B 1 45 ? 161.835 5.155   -14.518 1.00 0.00 ? 45  LEU B HD22 1  
ATOM   2159  H  HD23 . LEU B 1 45 ? 160.598 5.325   -13.274 1.00 0.00 ? 45  LEU B HD23 1  
ATOM   2160  N  N    . ASP B 1 46 ? 161.937 5.549   -8.824  1.00 0.00 ? 46  ASP B N    1  
ATOM   2161  C  CA   . ASP B 1 46 ? 161.857 6.882   -8.233  1.00 0.00 ? 46  ASP B CA   1  
ATOM   2162  C  C    . ASP B 1 46 ? 162.828 7.004   -7.063  1.00 0.00 ? 46  ASP B C    1  
ATOM   2163  O  O    . ASP B 1 46 ? 162.795 7.979   -6.312  1.00 0.00 ? 46  ASP B O    1  
ATOM   2164  C  CB   . ASP B 1 46 ? 160.432 7.159   -7.752  1.00 0.00 ? 46  ASP B CB   1  
ATOM   2165  C  CG   . ASP B 1 46 ? 159.484 7.231   -8.944  1.00 0.00 ? 46  ASP B CG   1  
ATOM   2166  O  OD1  . ASP B 1 46 ? 159.972 7.313   -10.059 1.00 0.00 ? 46  ASP B OD1  1  
ATOM   2167  O  OD2  . ASP B 1 46 ? 158.284 7.203   -8.725  1.00 0.00 ? 46  ASP B OD2  1  
ATOM   2168  H  H    . ASP B 1 46 ? 161.260 4.883   -8.584  1.00 0.00 ? 46  ASP B H    1  
ATOM   2169  H  HA   . ASP B 1 46 ? 162.120 7.613   -8.984  1.00 0.00 ? 46  ASP B HA   1  
ATOM   2170  H  HB2  . ASP B 1 46 ? 160.116 6.366   -7.089  1.00 0.00 ? 46  ASP B HB2  1  
ATOM   2171  H  HB3  . ASP B 1 46 ? 160.410 8.099   -7.222  1.00 0.00 ? 46  ASP B HB3  1  
ATOM   2172  N  N    . ALA B 1 47 ? 163.682 5.999   -6.911  1.00 0.00 ? 47  ALA B N    1  
ATOM   2173  C  CA   . ALA B 1 47 ? 164.657 5.982   -5.825  1.00 0.00 ? 47  ALA B CA   1  
ATOM   2174  C  C    . ALA B 1 47 ? 165.556 7.216   -5.892  1.00 0.00 ? 47  ALA B C    1  
ATOM   2175  O  O    . ALA B 1 47 ? 166.116 7.641   -4.882  1.00 0.00 ? 47  ALA B O    1  
ATOM   2176  C  CB   . ALA B 1 47 ? 165.515 4.720   -5.917  1.00 0.00 ? 47  ALA B CB   1  
ATOM   2177  H  H    . ALA B 1 47 ? 163.653 5.247   -7.538  1.00 0.00 ? 47  ALA B H    1  
ATOM   2178  H  HA   . ALA B 1 47 ? 164.132 5.977   -4.883  1.00 0.00 ? 47  ALA B HA   1  
ATOM   2179  H  HB1  . ALA B 1 47 ? 164.927 3.862   -5.627  1.00 0.00 ? 47  ALA B HB1  1  
ATOM   2180  H  HB2  . ALA B 1 47 ? 166.365 4.813   -5.258  1.00 0.00 ? 47  ALA B HB2  1  
ATOM   2181  H  HB3  . ALA B 1 47 ? 165.861 4.593   -6.933  1.00 0.00 ? 47  ALA B HB3  1  
ATOM   2182  N  N    . GLN B 1 48 ? 165.690 7.781   -7.088  1.00 0.00 ? 48  GLN B N    1  
ATOM   2183  C  CA   . GLN B 1 48 ? 166.522 8.967   -7.286  1.00 0.00 ? 48  GLN B CA   1  
ATOM   2184  C  C    . GLN B 1 48 ? 166.127 10.080  -6.310  1.00 0.00 ? 48  GLN B C    1  
ATOM   2185  O  O    . GLN B 1 48 ? 165.546 9.818   -5.257  1.00 0.00 ? 48  GLN B O    1  
ATOM   2186  C  CB   . GLN B 1 48 ? 166.370 9.468   -8.725  1.00 0.00 ? 48  GLN B CB   1  
ATOM   2187  C  CG   . GLN B 1 48 ? 166.896 8.407   -9.693  1.00 0.00 ? 48  GLN B CG   1  
ATOM   2188  C  CD   . GLN B 1 48 ? 166.703 8.875   -11.132 1.00 0.00 ? 48  GLN B CD   1  
ATOM   2189  O  OE1  . GLN B 1 48 ? 165.934 9.802   -11.387 1.00 0.00 ? 48  GLN B OE1  1  
ATOM   2190  N  NE2  . GLN B 1 48 ? 167.360 8.286   -12.093 1.00 0.00 ? 48  GLN B NE2  1  
ATOM   2191  H  H    . GLN B 1 48 ? 165.219 7.394   -7.855  1.00 0.00 ? 48  GLN B H    1  
ATOM   2192  H  HA   . GLN B 1 48 ? 167.555 8.702   -7.116  1.00 0.00 ? 48  GLN B HA   1  
ATOM   2193  H  HB2  . GLN B 1 48 ? 165.327 9.660   -8.931  1.00 0.00 ? 48  GLN B HB2  1  
ATOM   2194  H  HB3  . GLN B 1 48 ? 166.936 10.378  -8.852  1.00 0.00 ? 48  GLN B HB3  1  
ATOM   2195  H  HG2  . GLN B 1 48 ? 167.947 8.241   -9.507  1.00 0.00 ? 48  GLN B HG2  1  
ATOM   2196  H  HG3  . GLN B 1 48 ? 166.356 7.485   -9.543  1.00 0.00 ? 48  GLN B HG3  1  
ATOM   2197  H  HE21 . GLN B 1 48 ? 167.973 7.549   -11.888 1.00 0.00 ? 48  GLN B HE21 1  
ATOM   2198  H  HE22 . GLN B 1 48 ? 167.242 8.581   -13.020 1.00 0.00 ? 48  GLN B HE22 1  
ATOM   2199  N  N    . LYS B 1 49 ? 166.453 11.322  -6.663  1.00 0.00 ? 49  LYS B N    1  
ATOM   2200  C  CA   . LYS B 1 49 ? 166.140 12.461  -5.801  1.00 0.00 ? 49  LYS B CA   1  
ATOM   2201  C  C    . LYS B 1 49 ? 164.643 12.517  -5.515  1.00 0.00 ? 49  LYS B C    1  
ATOM   2202  O  O    . LYS B 1 49 ? 164.220 13.011  -4.470  1.00 0.00 ? 49  LYS B O    1  
ATOM   2203  C  CB   . LYS B 1 49 ? 166.592 13.766  -6.465  1.00 0.00 ? 49  LYS B CB   1  
ATOM   2204  C  CG   . LYS B 1 49 ? 165.715 14.059  -7.685  1.00 0.00 ? 49  LYS B CG   1  
ATOM   2205  C  CD   . LYS B 1 49 ? 166.256 15.291  -8.415  1.00 0.00 ? 49  LYS B CD   1  
ATOM   2206  C  CE   . LYS B 1 49 ? 165.223 15.779  -9.432  1.00 0.00 ? 49  LYS B CE   1  
ATOM   2207  N  NZ   . LYS B 1 49 ? 163.972 16.167  -8.721  1.00 0.00 ? 49  LYS B NZ   1  
ATOM   2208  H  H    . LYS B 1 49 ? 166.921 11.476  -7.509  1.00 0.00 ? 49  LYS B H    1  
ATOM   2209  H  HA   . LYS B 1 49 ? 166.668 12.345  -4.867  1.00 0.00 ? 49  LYS B HA   1  
ATOM   2210  H  HB2  . LYS B 1 49 ? 166.505 14.577  -5.756  1.00 0.00 ? 49  LYS B HB2  1  
ATOM   2211  H  HB3  . LYS B 1 49 ? 167.621 13.671  -6.778  1.00 0.00 ? 49  LYS B HB3  1  
ATOM   2212  H  HG2  . LYS B 1 49 ? 165.731 13.209  -8.352  1.00 0.00 ? 49  LYS B HG2  1  
ATOM   2213  H  HG3  . LYS B 1 49 ? 164.703 14.250  -7.365  1.00 0.00 ? 49  LYS B HG3  1  
ATOM   2214  H  HD2  . LYS B 1 49 ? 166.454 16.075  -7.697  1.00 0.00 ? 49  LYS B HD2  1  
ATOM   2215  H  HD3  . LYS B 1 49 ? 167.171 15.034  -8.928  1.00 0.00 ? 49  LYS B HD3  1  
ATOM   2216  H  HE2  . LYS B 1 49 ? 165.616 16.634  -9.961  1.00 0.00 ? 49  LYS B HE2  1  
ATOM   2217  H  HE3  . LYS B 1 49 ? 165.008 14.988  -10.135 1.00 0.00 ? 49  LYS B HE3  1  
ATOM   2218  H  HZ1  . LYS B 1 49 ? 163.318 15.359  -8.703  1.00 0.00 ? 49  LYS B HZ1  1  
ATOM   2219  H  HZ2  . LYS B 1 49 ? 163.524 16.964  -9.217  1.00 0.00 ? 49  LYS B HZ2  1  
ATOM   2220  H  HZ3  . LYS B 1 49 ? 164.198 16.447  -7.746  1.00 0.00 ? 49  LYS B HZ3  1  
ATOM   2221  N  N    . ASP B 1 50 ? 163.851 11.994  -6.440  1.00 0.00 ? 50  ASP B N    1  
ATOM   2222  C  CA   . ASP B 1 50 ? 162.405 11.973  -6.269  1.00 0.00 ? 50  ASP B CA   1  
ATOM   2223  C  C    . ASP B 1 50 ? 162.052 11.293  -4.949  1.00 0.00 ? 50  ASP B C    1  
ATOM   2224  O  O    . ASP B 1 50 ? 161.083 11.661  -4.282  1.00 0.00 ? 50  ASP B O    1  
ATOM   2225  C  CB   . ASP B 1 50 ? 161.751 11.216  -7.427  1.00 0.00 ? 50  ASP B CB   1  
ATOM   2226  C  CG   . ASP B 1 50 ? 161.924 11.999  -8.725  1.00 0.00 ? 50  ASP B CG   1  
ATOM   2227  O  OD1  . ASP B 1 50 ? 162.321 13.150  -8.651  1.00 0.00 ? 50  ASP B OD1  1  
ATOM   2228  O  OD2  . ASP B 1 50 ? 161.658 11.434  -9.773  1.00 0.00 ? 50  ASP B OD2  1  
ATOM   2229  H  H    . ASP B 1 50 ? 164.247 11.603  -7.247  1.00 0.00 ? 50  ASP B H    1  
ATOM   2230  H  HA   . ASP B 1 50 ? 162.034 12.986  -6.256  1.00 0.00 ? 50  ASP B HA   1  
ATOM   2231  H  HB2  . ASP B 1 50 ? 162.217 10.246  -7.529  1.00 0.00 ? 50  ASP B HB2  1  
ATOM   2232  H  HB3  . ASP B 1 50 ? 160.699 11.089  -7.224  1.00 0.00 ? 50  ASP B HB3  1  
ATOM   2233  N  N    . VAL B 1 51 ? 162.849 10.293  -4.585  1.00 0.00 ? 51  VAL B N    1  
ATOM   2234  C  CA   . VAL B 1 51 ? 162.627 9.547   -3.352  1.00 0.00 ? 51  VAL B CA   1  
ATOM   2235  C  C    . VAL B 1 51 ? 162.520 10.488  -2.158  1.00 0.00 ? 51  VAL B C    1  
ATOM   2236  O  O    . VAL B 1 51 ? 161.837 10.184  -1.184  1.00 0.00 ? 51  VAL B O    1  
ATOM   2237  C  CB   . VAL B 1 51 ? 163.780 8.568   -3.125  1.00 0.00 ? 51  VAL B CB   1  
ATOM   2238  C  CG1  . VAL B 1 51 ? 165.014 9.327   -2.628  1.00 0.00 ? 51  VAL B CG1  1  
ATOM   2239  C  CG2  . VAL B 1 51 ? 163.365 7.526   -2.083  1.00 0.00 ? 51  VAL B CG2  1  
ATOM   2240  H  H    . VAL B 1 51 ? 163.604 10.049  -5.162  1.00 0.00 ? 51  VAL B H    1  
ATOM   2241  H  HA   . VAL B 1 51 ? 161.708 8.987   -3.442  1.00 0.00 ? 51  VAL B HA   1  
ATOM   2242  H  HB   . VAL B 1 51 ? 164.016 8.075   -4.054  1.00 0.00 ? 51  VAL B HB   1  
ATOM   2243  H  HG11 . VAL B 1 51 ? 164.968 9.425   -1.553  1.00 0.00 ? 51  VAL B HG11 1  
ATOM   2244  H  HG12 . VAL B 1 51 ? 165.038 10.309  -3.077  1.00 0.00 ? 51  VAL B HG12 1  
ATOM   2245  H  HG13 . VAL B 1 51 ? 165.905 8.784   -2.902  1.00 0.00 ? 51  VAL B HG13 1  
ATOM   2246  H  HG21 . VAL B 1 51 ? 162.562 6.921   -2.478  1.00 0.00 ? 51  VAL B HG21 1  
ATOM   2247  H  HG22 . VAL B 1 51 ? 163.030 8.027   -1.186  1.00 0.00 ? 51  VAL B HG22 1  
ATOM   2248  H  HG23 . VAL B 1 51 ? 164.209 6.894   -1.849  1.00 0.00 ? 51  VAL B HG23 1  
ATOM   2249  N  N    . ASP B 1 52 ? 163.199 11.624  -2.235  1.00 0.00 ? 52  ASP B N    1  
ATOM   2250  C  CA   . ASP B 1 52 ? 163.172 12.596  -1.147  1.00 0.00 ? 52  ASP B CA   1  
ATOM   2251  C  C    . ASP B 1 52 ? 161.734 12.973  -0.797  1.00 0.00 ? 52  ASP B C    1  
ATOM   2252  O  O    . ASP B 1 52 ? 161.406 13.196  0.372   1.00 0.00 ? 52  ASP B O    1  
ATOM   2253  C  CB   . ASP B 1 52 ? 163.948 13.852  -1.549  1.00 0.00 ? 52  ASP B CB   1  
ATOM   2254  C  CG   . ASP B 1 52 ? 165.434 13.531  -1.669  1.00 0.00 ? 52  ASP B CG   1  
ATOM   2255  O  OD1  . ASP B 1 52 ? 165.826 12.460  -1.234  1.00 0.00 ? 52  ASP B OD1  1  
ATOM   2256  O  OD2  . ASP B 1 52 ? 166.158 14.360  -2.193  1.00 0.00 ? 52  ASP B OD2  1  
ATOM   2257  H  H    . ASP B 1 52 ? 163.733 11.814  -3.036  1.00 0.00 ? 52  ASP B H    1  
ATOM   2258  H  HA   . ASP B 1 52 ? 163.642 12.161  -0.278  1.00 0.00 ? 52  ASP B HA   1  
ATOM   2259  H  HB2  . ASP B 1 52 ? 163.580 14.210  -2.499  1.00 0.00 ? 52  ASP B HB2  1  
ATOM   2260  H  HB3  . ASP B 1 52 ? 163.807 14.615  -0.798  1.00 0.00 ? 52  ASP B HB3  1  
ATOM   2261  N  N    . ALA B 1 53 ? 160.875 13.033  -1.811  1.00 0.00 ? 53  ALA B N    1  
ATOM   2262  C  CA   . ALA B 1 53 ? 159.476 13.386  -1.590  1.00 0.00 ? 53  ALA B CA   1  
ATOM   2263  C  C    . ALA B 1 53 ? 158.852 12.430  -0.584  1.00 0.00 ? 53  ALA B C    1  
ATOM   2264  O  O    . ALA B 1 53 ? 157.907 12.785  0.133   1.00 0.00 ? 53  ALA B O    1  
ATOM   2265  C  CB   . ALA B 1 53 ? 158.695 13.317  -2.904  1.00 0.00 ? 53  ALA B CB   1  
ATOM   2266  H  H    . ALA B 1 53 ? 161.187 12.837  -2.721  1.00 0.00 ? 53  ALA B H    1  
ATOM   2267  H  HA   . ALA B 1 53 ? 159.423 14.391  -1.202  1.00 0.00 ? 53  ALA B HA   1  
ATOM   2268  H  HB1  . ALA B 1 53 ? 157.641 13.200  -2.688  1.00 0.00 ? 53  ALA B HB1  1  
ATOM   2269  H  HB2  . ALA B 1 53 ? 159.039 12.473  -3.483  1.00 0.00 ? 53  ALA B HB2  1  
ATOM   2270  H  HB3  . ALA B 1 53 ? 158.849 14.226  -3.463  1.00 0.00 ? 53  ALA B HB3  1  
ATOM   2271  N  N    . VAL B 1 54 ? 159.380 11.214  -0.531  1.00 0.00 ? 54  VAL B N    1  
ATOM   2272  C  CA   . VAL B 1 54 ? 158.851 10.238  0.394   1.00 0.00 ? 54  VAL B CA   1  
ATOM   2273  C  C    . VAL B 1 54 ? 158.823 10.842  1.791   1.00 0.00 ? 54  VAL B C    1  
ATOM   2274  O  O    . VAL B 1 54 ? 157.889 10.621  2.551   1.00 0.00 ? 54  VAL B O    1  
ATOM   2275  C  CB   . VAL B 1 54 ? 159.714 8.971   0.394   1.00 0.00 ? 54  VAL B CB   1  
ATOM   2276  C  CG1  . VAL B 1 54 ? 161.005 9.212   1.183   1.00 0.00 ? 54  VAL B CG1  1  
ATOM   2277  C  CG2  . VAL B 1 54 ? 158.933 7.826   1.041   1.00 0.00 ? 54  VAL B CG2  1  
ATOM   2278  H  H    . VAL B 1 54 ? 160.127 10.977  -1.119  1.00 0.00 ? 54  VAL B H    1  
ATOM   2279  H  HA   . VAL B 1 54 ? 157.849 9.978   0.095   1.00 0.00 ? 54  VAL B HA   1  
ATOM   2280  H  HB   . VAL B 1 54 ? 159.962 8.706   -0.624  1.00 0.00 ? 54  VAL B HB   1  
ATOM   2281  H  HG11 . VAL B 1 54 ? 161.766 8.524   0.847   1.00 0.00 ? 54  VAL B HG11 1  
ATOM   2282  H  HG12 . VAL B 1 54 ? 160.818 9.055   2.236   1.00 0.00 ? 54  VAL B HG12 1  
ATOM   2283  H  HG13 . VAL B 1 54 ? 161.342 10.225  1.027   1.00 0.00 ? 54  VAL B HG13 1  
ATOM   2284  H  HG21 . VAL B 1 54 ? 158.749 8.058   2.081   1.00 0.00 ? 54  VAL B HG21 1  
ATOM   2285  H  HG22 . VAL B 1 54 ? 159.506 6.914   0.973   1.00 0.00 ? 54  VAL B HG22 1  
ATOM   2286  H  HG23 . VAL B 1 54 ? 157.990 7.699   0.530   1.00 0.00 ? 54  VAL B HG23 1  
ATOM   2287  N  N    . ASP B 1 55 ? 159.837 11.630  2.128   1.00 0.00 ? 55  ASP B N    1  
ATOM   2288  C  CA   . ASP B 1 55 ? 159.851 12.265  3.434   1.00 0.00 ? 55  ASP B CA   1  
ATOM   2289  C  C    . ASP B 1 55 ? 158.681 13.243  3.556   1.00 0.00 ? 55  ASP B C    1  
ATOM   2290  O  O    . ASP B 1 55 ? 158.034 13.336  4.599   1.00 0.00 ? 55  ASP B O    1  
ATOM   2291  C  CB   . ASP B 1 55 ? 161.169 13.015  3.640   1.00 0.00 ? 55  ASP B CB   1  
ATOM   2292  C  CG   . ASP B 1 55 ? 162.328 12.026  3.705   1.00 0.00 ? 55  ASP B CG   1  
ATOM   2293  O  OD1  . ASP B 1 55 ? 162.064 10.843  3.838   1.00 0.00 ? 55  ASP B OD1  1  
ATOM   2294  O  OD2  . ASP B 1 55 ? 163.462 12.467  3.621   1.00 0.00 ? 55  ASP B OD2  1  
ATOM   2295  H  H    . ASP B 1 55 ? 160.562 11.808  1.485   1.00 0.00 ? 55  ASP B H    1  
ATOM   2296  H  HA   . ASP B 1 55 ? 159.756 11.507  4.196   1.00 0.00 ? 55  ASP B HA   1  
ATOM   2297  H  HB2  . ASP B 1 55 ? 161.325 13.697  2.817   1.00 0.00 ? 55  ASP B HB2  1  
ATOM   2298  H  HB3  . ASP B 1 55 ? 161.123 13.573  4.563   1.00 0.00 ? 55  ASP B HB3  1  
ATOM   2299  N  N    . LYS B 1 56 ? 158.439 13.984  2.472   1.00 0.00 ? 56  LYS B N    1  
ATOM   2300  C  CA   . LYS B 1 56 ? 157.368 14.980  2.440   1.00 0.00 ? 56  LYS B CA   1  
ATOM   2301  C  C    . LYS B 1 56 ? 155.971 14.382  2.611   1.00 0.00 ? 56  LYS B C    1  
ATOM   2302  O  O    . LYS B 1 56 ? 155.122 14.974  3.275   1.00 0.00 ? 56  LYS B O    1  
ATOM   2303  C  CB   . LYS B 1 56 ? 157.423 15.745  1.116   1.00 0.00 ? 56  LYS B CB   1  
ATOM   2304  C  CG   . LYS B 1 56 ? 158.730 16.537  1.036   1.00 0.00 ? 56  LYS B CG   1  
ATOM   2305  C  CD   . LYS B 1 56 ? 158.731 17.391  -0.234  1.00 0.00 ? 56  LYS B CD   1  
ATOM   2306  C  CE   . LYS B 1 56 ? 160.085 18.089  -0.378  1.00 0.00 ? 56  LYS B CE   1  
ATOM   2307  N  NZ   . LYS B 1 56 ? 160.147 18.786  -1.693  1.00 0.00 ? 56  LYS B NZ   1  
ATOM   2308  H  H    . LYS B 1 56 ? 159.004 13.868  1.681   1.00 0.00 ? 56  LYS B H    1  
ATOM   2309  H  HA   . LYS B 1 56 ? 157.536 15.685  3.239   1.00 0.00 ? 56  LYS B HA   1  
ATOM   2310  H  HB2  . LYS B 1 56 ? 157.375 15.044  0.295   1.00 0.00 ? 56  LYS B HB2  1  
ATOM   2311  H  HB3  . LYS B 1 56 ? 156.588 16.426  1.059   1.00 0.00 ? 56  LYS B HB3  1  
ATOM   2312  H  HG2  . LYS B 1 56 ? 158.817 17.177  1.902   1.00 0.00 ? 56  LYS B HG2  1  
ATOM   2313  H  HG3  . LYS B 1 56 ? 159.565 15.853  1.008   1.00 0.00 ? 56  LYS B HG3  1  
ATOM   2314  H  HD2  . LYS B 1 56 ? 158.558 16.759  -1.093  1.00 0.00 ? 56  LYS B HD2  1  
ATOM   2315  H  HD3  . LYS B 1 56 ? 157.951 18.133  -0.169  1.00 0.00 ? 56  LYS B HD3  1  
ATOM   2316  H  HE2  . LYS B 1 56 ? 160.205 18.810  0.417   1.00 0.00 ? 56  LYS B HE2  1  
ATOM   2317  H  HE3  . LYS B 1 56 ? 160.876 17.356  -0.322  1.00 0.00 ? 56  LYS B HE3  1  
ATOM   2318  H  HZ1  . LYS B 1 56 ? 160.389 18.101  -2.438  1.00 0.00 ? 56  LYS B HZ1  1  
ATOM   2319  H  HZ2  . LYS B 1 56 ? 160.872 19.531  -1.657  1.00 0.00 ? 56  LYS B HZ2  1  
ATOM   2320  H  HZ3  . LYS B 1 56 ? 159.222 19.211  -1.904  1.00 0.00 ? 56  LYS B HZ3  1  
ATOM   2321  N  N    . VAL B 1 57 ? 155.715 13.232  1.986   1.00 0.00 ? 57  VAL B N    1  
ATOM   2322  C  CA   . VAL B 1 57 ? 154.378 12.633  2.080   1.00 0.00 ? 57  VAL B CA   1  
ATOM   2323  C  C    . VAL B 1 57 ? 154.103 12.059  3.471   1.00 0.00 ? 57  VAL B C    1  
ATOM   2324  O  O    . VAL B 1 57 ? 152.959 12.055  3.927   1.00 0.00 ? 57  VAL B O    1  
ATOM   2325  C  CB   . VAL B 1 57 ? 154.183 11.555  1.008   1.00 0.00 ? 57  VAL B CB   1  
ATOM   2326  C  CG1  . VAL B 1 57 ? 154.546 12.128  -0.362  1.00 0.00 ? 57  VAL B CG1  1  
ATOM   2327  C  CG2  . VAL B 1 57 ? 155.070 10.351  1.304   1.00 0.00 ? 57  VAL B CG2  1  
ATOM   2328  H  H    . VAL B 1 57 ? 156.416 12.804  1.436   1.00 0.00 ? 57  VAL B H    1  
ATOM   2329  H  HA   . VAL B 1 57 ? 153.656 13.415  1.898   1.00 0.00 ? 57  VAL B HA   1  
ATOM   2330  H  HB   . VAL B 1 57 ? 153.149 11.246  0.998   1.00 0.00 ? 57  VAL B HB   1  
ATOM   2331  H  HG11 . VAL B 1 57 ? 154.341 11.393  -1.127  1.00 0.00 ? 57  VAL B HG11 1  
ATOM   2332  H  HG12 . VAL B 1 57 ? 155.595 12.382  -0.380  1.00 0.00 ? 57  VAL B HG12 1  
ATOM   2333  H  HG13 . VAL B 1 57 ? 153.958 13.015  -0.549  1.00 0.00 ? 57  VAL B HG13 1  
ATOM   2334  H  HG21 . VAL B 1 57 ? 156.094 10.661  1.285   1.00 0.00 ? 57  VAL B HG21 1  
ATOM   2335  H  HG22 . VAL B 1 57 ? 154.909 9.591   0.553   1.00 0.00 ? 57  VAL B HG22 1  
ATOM   2336  H  HG23 . VAL B 1 57 ? 154.830 9.951   2.278   1.00 0.00 ? 57  VAL B HG23 1  
ATOM   2337  N  N    . MET B 1 58 ? 155.143 11.575  4.143   1.00 0.00 ? 58  MET B N    1  
ATOM   2338  C  CA   . MET B 1 58 ? 154.972 11.006  5.480   1.00 0.00 ? 58  MET B CA   1  
ATOM   2339  C  C    . MET B 1 58 ? 154.369 12.014  6.451   1.00 0.00 ? 58  MET B C    1  
ATOM   2340  O  O    . MET B 1 58 ? 153.570 11.651  7.315   1.00 0.00 ? 58  MET B O    1  
ATOM   2341  C  CB   . MET B 1 58 ? 156.333 10.553  6.021   1.00 0.00 ? 58  MET B CB   1  
ATOM   2342  C  CG   . MET B 1 58 ? 156.825 9.330   5.246   1.00 0.00 ? 58  MET B CG   1  
ATOM   2343  S  SD   . MET B 1 58 ? 155.738 7.924   5.567   1.00 0.00 ? 58  MET B SD   1  
ATOM   2344  C  CE   . MET B 1 58 ? 156.139 7.738   7.321   1.00 0.00 ? 58  MET B CE   1  
ATOM   2345  H  H    . MET B 1 58 ? 156.035 11.600  3.737   1.00 0.00 ? 58  MET B H    1  
ATOM   2346  H  HA   . MET B 1 58 ? 154.323 10.146  5.416   1.00 0.00 ? 58  MET B HA   1  
ATOM   2347  H  HB2  . MET B 1 58 ? 157.045 11.358  5.912   1.00 0.00 ? 58  MET B HB2  1  
ATOM   2348  H  HB3  . MET B 1 58 ? 156.235 10.304  7.066   1.00 0.00 ? 58  MET B HB3  1  
ATOM   2349  H  HG2  . MET B 1 58 ? 156.814 9.544   4.197   1.00 0.00 ? 58  MET B HG2  1  
ATOM   2350  H  HG3  . MET B 1 58 ? 157.830 9.085   5.555   1.00 0.00 ? 58  MET B HG3  1  
ATOM   2351  H  HE1  . MET B 1 58 ? 155.334 8.140   7.920   1.00 0.00 ? 58  MET B HE1  1  
ATOM   2352  H  HE2  . MET B 1 58 ? 157.050 8.268   7.545   1.00 0.00 ? 58  MET B HE2  1  
ATOM   2353  H  HE3  . MET B 1 58 ? 156.278 6.690   7.545   1.00 0.00 ? 58  MET B HE3  1  
ATOM   2354  N  N    . LYS B 1 59 ? 154.762 13.276  6.322   1.00 0.00 ? 59  LYS B N    1  
ATOM   2355  C  CA   . LYS B 1 59 ? 154.250 14.300  7.223   1.00 0.00 ? 59  LYS B CA   1  
ATOM   2356  C  C    . LYS B 1 59 ? 152.731 14.428  7.133   1.00 0.00 ? 59  LYS B C    1  
ATOM   2357  O  O    . LYS B 1 59 ? 152.053 14.528  8.156   1.00 0.00 ? 59  LYS B O    1  
ATOM   2358  C  CB   . LYS B 1 59 ? 154.892 15.648  6.889   1.00 0.00 ? 59  LYS B CB   1  
ATOM   2359  C  CG   . LYS B 1 59 ? 154.457 16.691  7.921   1.00 0.00 ? 59  LYS B CG   1  
ATOM   2360  C  CD   . LYS B 1 59 ? 155.048 18.053  7.552   1.00 0.00 ? 59  LYS B CD   1  
ATOM   2361  C  CE   . LYS B 1 59 ? 154.742 19.060  8.662   1.00 0.00 ? 59  LYS B CE   1  
ATOM   2362  N  NZ   . LYS B 1 59 ? 153.272 19.294  8.730   1.00 0.00 ? 59  LYS B NZ   1  
ATOM   2363  H  H    . LYS B 1 59 ? 155.410 13.517  5.627   1.00 0.00 ? 59  LYS B H    1  
ATOM   2364  H  HA   . LYS B 1 59 ? 154.516 14.036  8.234   1.00 0.00 ? 59  LYS B HA   1  
ATOM   2365  H  HB2  . LYS B 1 59 ? 155.968 15.549  6.909   1.00 0.00 ? 59  LYS B HB2  1  
ATOM   2366  H  HB3  . LYS B 1 59 ? 154.576 15.964  5.906   1.00 0.00 ? 59  LYS B HB3  1  
ATOM   2367  H  HG2  . LYS B 1 59 ? 153.378 16.757  7.933   1.00 0.00 ? 59  LYS B HG2  1  
ATOM   2368  H  HG3  . LYS B 1 59 ? 154.811 16.401  8.898   1.00 0.00 ? 59  LYS B HG3  1  
ATOM   2369  H  HD2  . LYS B 1 59 ? 156.117 17.961  7.433   1.00 0.00 ? 59  LYS B HD2  1  
ATOM   2370  H  HD3  . LYS B 1 59 ? 154.610 18.396  6.626   1.00 0.00 ? 59  LYS B HD3  1  
ATOM   2371  H  HE2  . LYS B 1 59 ? 155.088 18.669  9.607   1.00 0.00 ? 59  LYS B HE2  1  
ATOM   2372  H  HE3  . LYS B 1 59 ? 155.246 19.992  8.452   1.00 0.00 ? 59  LYS B HE3  1  
ATOM   2373  H  HZ1  . LYS B 1 59 ? 153.090 20.287  8.982   1.00 0.00 ? 59  LYS B HZ1  1  
ATOM   2374  H  HZ2  . LYS B 1 59 ? 152.855 18.670  9.451   1.00 0.00 ? 59  LYS B HZ2  1  
ATOM   2375  H  HZ3  . LYS B 1 59 ? 152.845 19.090  7.805   1.00 0.00 ? 59  LYS B HZ3  1  
ATOM   2376  N  N    . GLU B 1 60 ? 152.195 14.432  5.914   1.00 0.00 ? 60  GLU B N    1  
ATOM   2377  C  CA   . GLU B 1 60 ? 150.750 14.560  5.744   1.00 0.00 ? 60  GLU B CA   1  
ATOM   2378  C  C    . GLU B 1 60 ? 150.007 13.332  6.261   1.00 0.00 ? 60  GLU B C    1  
ATOM   2379  O  O    . GLU B 1 60 ? 148.952 13.452  6.883   1.00 0.00 ? 60  GLU B O    1  
ATOM   2380  C  CB   . GLU B 1 60 ? 150.420 14.766  4.265   1.00 0.00 ? 60  GLU B CB   1  
ATOM   2381  C  CG   . GLU B 1 60 ? 151.001 16.099  3.791   1.00 0.00 ? 60  GLU B CG   1  
ATOM   2382  C  CD   . GLU B 1 60 ? 150.622 16.344  2.334   1.00 0.00 ? 60  GLU B CD   1  
ATOM   2383  O  OE1  . GLU B 1 60 ? 150.092 15.432  1.719   1.00 0.00 ? 60  GLU B OE1  1  
ATOM   2384  O  OE2  . GLU B 1 60 ? 150.866 17.440  1.855   1.00 0.00 ? 60  GLU B OE2  1  
ATOM   2385  H  H    . GLU B 1 60 ? 152.774 14.356  5.127   1.00 0.00 ? 60  GLU B H    1  
ATOM   2386  H  HA   . GLU B 1 60 ? 150.413 15.426  6.293   1.00 0.00 ? 60  GLU B HA   1  
ATOM   2387  H  HB2  . GLU B 1 60 ? 150.847 13.960  3.686   1.00 0.00 ? 60  GLU B HB2  1  
ATOM   2388  H  HB3  . GLU B 1 60 ? 149.349 14.776  4.133   1.00 0.00 ? 60  GLU B HB3  1  
ATOM   2389  H  HG2  . GLU B 1 60 ? 150.610 16.898  4.403   1.00 0.00 ? 60  GLU B HG2  1  
ATOM   2390  H  HG3  . GLU B 1 60 ? 152.077 16.073  3.880   1.00 0.00 ? 60  GLU B HG3  1  
ATOM   2391  N  N    . LEU B 1 61 ? 150.561 12.151  5.997   1.00 0.00 ? 61  LEU B N    1  
ATOM   2392  C  CA   . LEU B 1 61 ? 149.932 10.911  6.442   1.00 0.00 ? 61  LEU B CA   1  
ATOM   2393  C  C    . LEU B 1 61 ? 149.952 10.778  7.956   1.00 0.00 ? 61  LEU B C    1  
ATOM   2394  O  O    . LEU B 1 61 ? 149.010 10.255  8.552   1.00 0.00 ? 61  LEU B O    1  
ATOM   2395  C  CB   . LEU B 1 61 ? 150.630 9.706   5.806   1.00 0.00 ? 61  LEU B CB   1  
ATOM   2396  C  CG   . LEU B 1 61 ? 150.545 9.804   4.279   1.00 0.00 ? 61  LEU B CG   1  
ATOM   2397  C  CD1  . LEU B 1 61 ? 151.183 8.565   3.656   1.00 0.00 ? 61  LEU B CD1  1  
ATOM   2398  C  CD2  . LEU B 1 61 ? 149.077 9.888   3.842   1.00 0.00 ? 61  LEU B CD2  1  
ATOM   2399  H  H    . LEU B 1 61 ? 151.402 12.113  5.495   1.00 0.00 ? 61  LEU B H    1  
ATOM   2400  H  HA   . LEU B 1 61 ? 148.902 10.918  6.122   1.00 0.00 ? 61  LEU B HA   1  
ATOM   2401  H  HB2  . LEU B 1 61 ? 151.667 9.692   6.109   1.00 0.00 ? 61  LEU B HB2  1  
ATOM   2402  H  HB3  . LEU B 1 61 ? 150.147 8.798   6.133   1.00 0.00 ? 61  LEU B HB3  1  
ATOM   2403  H  HG   . LEU B 1 61 ? 151.069 10.682  3.947   1.00 0.00 ? 61  LEU B HG   1  
ATOM   2404  H  HD11 . LEU B 1 61 ? 152.257 8.673   3.658   1.00 0.00 ? 61  LEU B HD11 1  
ATOM   2405  H  HD12 . LEU B 1 61 ? 150.835 8.454   2.640   1.00 0.00 ? 61  LEU B HD12 1  
ATOM   2406  H  HD13 . LEU B 1 61 ? 150.907 7.694   4.228   1.00 0.00 ? 61  LEU B HD13 1  
ATOM   2407  H  HD21 . LEU B 1 61 ? 148.464 9.318   4.526   1.00 0.00 ? 61  LEU B HD21 1  
ATOM   2408  H  HD22 . LEU B 1 61 ? 148.972 9.486   2.844   1.00 0.00 ? 61  LEU B HD22 1  
ATOM   2409  H  HD23 . LEU B 1 61 ? 148.758 10.919  3.847   1.00 0.00 ? 61  LEU B HD23 1  
ATOM   2410  N  N    . ASP B 1 62 ? 151.032 11.234  8.582   1.00 0.00 ? 62  ASP B N    1  
ATOM   2411  C  CA   . ASP B 1 62 ? 151.137 11.129  10.030  1.00 0.00 ? 62  ASP B CA   1  
ATOM   2412  C  C    . ASP B 1 62 ? 150.477 12.308  10.725  1.00 0.00 ? 62  ASP B C    1  
ATOM   2413  O  O    . ASP B 1 62 ? 151.037 13.403  10.773  1.00 0.00 ? 62  ASP B O    1  
ATOM   2414  C  CB   . ASP B 1 62 ? 152.610 11.088  10.431  1.00 0.00 ? 62  ASP B CB   1  
ATOM   2415  C  CG   . ASP B 1 62 ? 152.734 10.871  11.932  1.00 0.00 ? 62  ASP B CG   1  
ATOM   2416  O  OD1  . ASP B 1 62 ? 151.799 10.349  12.516  1.00 0.00 ? 62  ASP B OD1  1  
ATOM   2417  O  OD2  . ASP B 1 62 ? 153.752 11.257  12.478  1.00 0.00 ? 62  ASP B OD2  1  
ATOM   2418  H  H    . ASP B 1 62 ? 151.765 11.633  8.066   1.00 0.00 ? 62  ASP B H    1  
ATOM   2419  H  HA   . ASP B 1 62 ? 150.665 10.216  10.354  1.00 0.00 ? 62  ASP B HA   1  
ATOM   2420  H  HB2  . ASP B 1 62 ? 153.101 10.280  9.909   1.00 0.00 ? 62  ASP B HB2  1  
ATOM   2421  H  HB3  . ASP B 1 62 ? 153.080 12.024  10.165  1.00 0.00 ? 62  ASP B HB3  1  
ATOM   2422  N  N    . GLU B 1 63 ? 149.308 12.072  11.307  1.00 0.00 ? 63  GLU B N    1  
ATOM   2423  C  CA   . GLU B 1 63 ? 148.627 13.124  12.042  1.00 0.00 ? 63  GLU B CA   1  
ATOM   2424  C  C    . GLU B 1 63 ? 149.430 13.474  13.286  1.00 0.00 ? 63  GLU B C    1  
ATOM   2425  O  O    . GLU B 1 63 ? 149.512 14.633  13.693  1.00 0.00 ? 63  GLU B O    1  
ATOM   2426  C  CB   . GLU B 1 63 ? 147.232 12.656  12.449  1.00 0.00 ? 63  GLU B CB   1  
ATOM   2427  C  CG   . GLU B 1 63 ? 146.470 13.816  13.093  1.00 0.00 ? 63  GLU B CG   1  
ATOM   2428  C  CD   . GLU B 1 63 ? 145.112 13.334  13.594  1.00 0.00 ? 63  GLU B CD   1  
ATOM   2429  O  OE1  . GLU B 1 63 ? 144.833 12.156  13.449  1.00 0.00 ? 63  GLU B OE1  1  
ATOM   2430  O  OE2  . GLU B 1 63 ? 144.372 14.152  14.115  1.00 0.00 ? 63  GLU B OE2  1  
ATOM   2431  H  H    . GLU B 1 63 ? 148.920 11.173  11.271  1.00 0.00 ? 63  GLU B H    1  
ATOM   2432  H  HA   . GLU B 1 63 ? 148.539 13.999  11.416  1.00 0.00 ? 63  GLU B HA   1  
ATOM   2433  H  HB2  . GLU B 1 63 ? 146.702 12.316  11.574  1.00 0.00 ? 63  GLU B HB2  1  
ATOM   2434  H  HB3  . GLU B 1 63 ? 147.316 11.845  13.157  1.00 0.00 ? 63  GLU B HB3  1  
ATOM   2435  H  HG2  . GLU B 1 63 ? 147.042 14.202  13.924  1.00 0.00 ? 63  GLU B HG2  1  
ATOM   2436  H  HG3  . GLU B 1 63 ? 146.325 14.599  12.364  1.00 0.00 ? 63  GLU B HG3  1  
ATOM   2437  N  N    . ASN B 1 64 ? 150.011 12.438  13.884  1.00 0.00 ? 64  ASN B N    1  
ATOM   2438  C  CA   . ASN B 1 64 ? 150.807 12.589  15.094  1.00 0.00 ? 64  ASN B CA   1  
ATOM   2439  C  C    . ASN B 1 64 ? 151.974 13.537  14.866  1.00 0.00 ? 64  ASN B C    1  
ATOM   2440  O  O    . ASN B 1 64 ? 152.367 14.290  15.757  1.00 0.00 ? 64  ASN B O    1  
ATOM   2441  C  CB   . ASN B 1 64 ? 151.385 11.229  15.491  1.00 0.00 ? 64  ASN B CB   1  
ATOM   2442  C  CG   . ASN B 1 64 ? 150.278 10.197  15.653  1.00 0.00 ? 64  ASN B CG   1  
ATOM   2443  O  OD1  . ASN B 1 64 ? 150.387 9.089   15.120  1.00 0.00 ? 64  ASN B OD1  1  
ATOM   2444  N  ND2  . ASN B 1 64 ? 149.218 10.489  16.357  1.00 0.00 ? 64  ASN B ND2  1  
ATOM   2445  H  H    . ASN B 1 64 ? 149.892 11.542  13.504  1.00 0.00 ? 64  ASN B H    1  
ATOM   2446  H  HA   . ASN B 1 64 ? 150.187 12.959  15.895  1.00 0.00 ? 64  ASN B HA   1  
ATOM   2447  H  HB2  . ASN B 1 64 ? 152.071 10.897  14.727  1.00 0.00 ? 64  ASN B HB2  1  
ATOM   2448  H  HB3  . ASN B 1 64 ? 151.917 11.329  16.426  1.00 0.00 ? 64  ASN B HB3  1  
ATOM   2449  H  HD21 . ASN B 1 64 ? 149.137 11.370  16.779  1.00 0.00 ? 64  ASN B HD21 1  
ATOM   2450  H  HD22 . ASN B 1 64 ? 148.503 9.828   16.463  1.00 0.00 ? 64  ASN B HD22 1  
ATOM   2451  N  N    . GLY B 1 65 ? 152.553 13.452  13.676  1.00 0.00 ? 65  GLY B N    1  
ATOM   2452  C  CA   . GLY B 1 65 ? 153.716 14.262  13.344  1.00 0.00 ? 65  GLY B CA   1  
ATOM   2453  C  C    . GLY B 1 65 ? 154.943 13.604  13.968  1.00 0.00 ? 65  GLY B C    1  
ATOM   2454  O  O    . GLY B 1 65 ? 156.044 14.154  13.968  1.00 0.00 ? 65  GLY B O    1  
ATOM   2455  H  H    . GLY B 1 65 ? 152.210 12.806  13.020  1.00 0.00 ? 65  GLY B H    1  
ATOM   2456  H  HA2  . GLY B 1 65 ? 153.830 14.313  12.270  1.00 0.00 ? 65  GLY B HA2  1  
ATOM   2457  H  HA3  . GLY B 1 65 ? 153.598 15.255  13.749  1.00 0.00 ? 65  GLY B HA3  1  
ATOM   2458  N  N    . ASP B 1 66 ? 154.704 12.414  14.517  1.00 0.00 ? 66  ASP B N    1  
ATOM   2459  C  CA   . ASP B 1 66 ? 155.736 11.625  15.184  1.00 0.00 ? 66  ASP B CA   1  
ATOM   2460  C  C    . ASP B 1 66 ? 156.863 11.199  14.243  1.00 0.00 ? 66  ASP B C    1  
ATOM   2461  O  O    . ASP B 1 66 ? 158.016 11.084  14.660  1.00 0.00 ? 66  ASP B O    1  
ATOM   2462  C  CB   . ASP B 1 66 ? 155.077 10.399  15.841  1.00 0.00 ? 66  ASP B CB   1  
ATOM   2463  C  CG   . ASP B 1 66 ? 154.447 9.477   14.791  1.00 0.00 ? 66  ASP B CG   1  
ATOM   2464  O  OD1  . ASP B 1 66 ? 154.775 9.614   13.631  1.00 0.00 ? 66  ASP B OD1  1  
ATOM   2465  O  OD2  . ASP B 1 66 ? 153.639 8.641   15.167  1.00 0.00 ? 66  ASP B OD2  1  
ATOM   2466  H  H    . ASP B 1 66 ? 153.792 12.058  14.483  1.00 0.00 ? 66  ASP B H    1  
ATOM   2467  H  HA   . ASP B 1 66 ? 156.165 12.231  15.968  1.00 0.00 ? 66  ASP B HA   1  
ATOM   2468  H  HB2  . ASP B 1 66 ? 155.825 9.848   16.392  1.00 0.00 ? 66  ASP B HB2  1  
ATOM   2469  H  HB3  . ASP B 1 66 ? 154.310 10.733  16.525  1.00 0.00 ? 66  ASP B HB3  1  
ATOM   2470  N  N    . GLY B 1 67 ? 156.529 10.940  12.988  1.00 0.00 ? 67  GLY B N    1  
ATOM   2471  C  CA   . GLY B 1 67 ? 157.522 10.499  12.014  1.00 0.00 ? 67  GLY B CA   1  
ATOM   2472  C  C    . GLY B 1 67 ? 157.503 8.979   11.931  1.00 0.00 ? 67  GLY B C    1  
ATOM   2473  O  O    . GLY B 1 67 ? 158.185 8.372   11.106  1.00 0.00 ? 67  GLY B O    1  
ATOM   2474  H  H    . GLY B 1 67 ? 155.592 11.030  12.713  1.00 0.00 ? 67  GLY B H    1  
ATOM   2475  H  HA2  . GLY B 1 67 ? 157.287 10.918  11.046  1.00 0.00 ? 67  GLY B HA2  1  
ATOM   2476  H  HA3  . GLY B 1 67 ? 158.502 10.826  12.321  1.00 0.00 ? 67  GLY B HA3  1  
ATOM   2477  N  N    . GLU B 1 68 ? 156.682 8.382   12.789  1.00 0.00 ? 68  GLU B N    1  
ATOM   2478  C  CA   . GLU B 1 68 ? 156.512 6.936   12.831  1.00 0.00 ? 68  GLU B CA   1  
ATOM   2479  C  C    . GLU B 1 68 ? 155.113 6.601   12.342  1.00 0.00 ? 68  GLU B C    1  
ATOM   2480  O  O    . GLU B 1 68 ? 154.206 7.439   12.431  1.00 0.00 ? 68  GLU B O    1  
ATOM   2481  C  CB   . GLU B 1 68 ? 156.698 6.417   14.260  1.00 0.00 ? 68  GLU B CB   1  
ATOM   2482  C  CG   . GLU B 1 68 ? 158.110 6.746   14.748  1.00 0.00 ? 68  GLU B CG   1  
ATOM   2483  C  CD   . GLU B 1 68 ? 158.326 6.168   16.142  1.00 0.00 ? 68  GLU B CD   1  
ATOM   2484  O  OE1  . GLU B 1 68 ? 157.361 5.708   16.727  1.00 0.00 ? 68  GLU B OE1  1  
ATOM   2485  O  OE2  . GLU B 1 68 ? 159.455 6.196   16.605  1.00 0.00 ? 68  GLU B OE2  1  
ATOM   2486  H  H    . GLU B 1 68 ? 156.161 8.936   13.402  1.00 0.00 ? 68  GLU B H    1  
ATOM   2487  H  HA   . GLU B 1 68 ? 157.240 6.469   12.183  1.00 0.00 ? 68  GLU B HA   1  
ATOM   2488  H  HB2  . GLU B 1 68 ? 155.974 6.888   14.910  1.00 0.00 ? 68  GLU B HB2  1  
ATOM   2489  H  HB3  . GLU B 1 68 ? 156.554 5.347   14.276  1.00 0.00 ? 68  GLU B HB3  1  
ATOM   2490  H  HG2  . GLU B 1 68 ? 158.831 6.318   14.067  1.00 0.00 ? 68  GLU B HG2  1  
ATOM   2491  H  HG3  . GLU B 1 68 ? 158.239 7.817   14.780  1.00 0.00 ? 68  GLU B HG3  1  
ATOM   2492  N  N    . VAL B 1 69 ? 154.927 5.395   11.810  1.00 0.00 ? 69  VAL B N    1  
ATOM   2493  C  CA   . VAL B 1 69 ? 153.613 5.021   11.297  1.00 0.00 ? 69  VAL B CA   1  
ATOM   2494  C  C    . VAL B 1 69 ? 153.078 3.745   11.924  1.00 0.00 ? 69  VAL B C    1  
ATOM   2495  O  O    . VAL B 1 69 ? 153.822 2.836   12.293  1.00 0.00 ? 69  VAL B O    1  
ATOM   2496  C  CB   . VAL B 1 69 ? 153.686 4.842   9.777   1.00 0.00 ? 69  VAL B CB   1  
ATOM   2497  C  CG1  . VAL B 1 69 ? 154.140 6.147   9.128   1.00 0.00 ? 69  VAL B CG1  1  
ATOM   2498  C  CG2  . VAL B 1 69 ? 154.683 3.731   9.440   1.00 0.00 ? 69  VAL B CG2  1  
ATOM   2499  H  H    . VAL B 1 69 ? 155.675 4.767   11.747  1.00 0.00 ? 69  VAL B H    1  
ATOM   2500  H  HA   . VAL B 1 69 ? 152.916 5.810   11.508  1.00 0.00 ? 69  VAL B HA   1  
ATOM   2501  H  HB   . VAL B 1 69 ? 152.714 4.575   9.400   1.00 0.00 ? 69  VAL B HB   1  
ATOM   2502  H  HG11 . VAL B 1 69 ? 153.450 6.937   9.386   1.00 0.00 ? 69  VAL B HG11 1  
ATOM   2503  H  HG12 . VAL B 1 69 ? 154.163 6.027   8.054   1.00 0.00 ? 69  VAL B HG12 1  
ATOM   2504  H  HG13 . VAL B 1 69 ? 155.127 6.402   9.486   1.00 0.00 ? 69  VAL B HG13 1  
ATOM   2505  H  HG21 . VAL B 1 69 ? 155.064 3.880   8.440   1.00 0.00 ? 69  VAL B HG21 1  
ATOM   2506  H  HG22 . VAL B 1 69 ? 154.185 2.773   9.494   1.00 0.00 ? 69  VAL B HG22 1  
ATOM   2507  H  HG23 . VAL B 1 69 ? 155.500 3.753   10.145  1.00 0.00 ? 69  VAL B HG23 1  
ATOM   2508  N  N    . ASP B 1 70 ? 151.756 3.708   12.002  1.00 0.00 ? 70  ASP B N    1  
ATOM   2509  C  CA   . ASP B 1 70 ? 151.025 2.577   12.541  1.00 0.00 ? 70  ASP B CA   1  
ATOM   2510  C  C    . ASP B 1 70 ? 150.363 1.844   11.387  1.00 0.00 ? 70  ASP B C    1  
ATOM   2511  O  O    . ASP B 1 70 ? 150.299 2.370   10.276  1.00 0.00 ? 70  ASP B O    1  
ATOM   2512  C  CB   . ASP B 1 70 ? 149.963 3.054   13.534  1.00 0.00 ? 70  ASP B CB   1  
ATOM   2513  C  CG   . ASP B 1 70 ? 150.633 3.676   14.755  1.00 0.00 ? 70  ASP B CG   1  
ATOM   2514  O  OD1  . ASP B 1 70 ? 151.831 3.495   14.904  1.00 0.00 ? 70  ASP B OD1  1  
ATOM   2515  O  OD2  . ASP B 1 70 ? 149.940 4.321   15.523  1.00 0.00 ? 70  ASP B OD2  1  
ATOM   2516  H  H    . ASP B 1 70 ? 151.248 4.474   11.665  1.00 0.00 ? 70  ASP B H    1  
ATOM   2517  H  HA   . ASP B 1 70 ? 151.711 1.911   13.042  1.00 0.00 ? 70  ASP B HA   1  
ATOM   2518  H  HB2  . ASP B 1 70 ? 149.332 3.791   13.058  1.00 0.00 ? 70  ASP B HB2  1  
ATOM   2519  H  HB3  . ASP B 1 70 ? 149.361 2.214   13.847  1.00 0.00 ? 70  ASP B HB3  1  
ATOM   2520  N  N    . PHE B 1 71 ? 149.878 0.640   11.628  1.00 0.00 ? 71  PHE B N    1  
ATOM   2521  C  CA   . PHE B 1 71 ? 149.242 -0.101  10.554  1.00 0.00 ? 71  PHE B CA   1  
ATOM   2522  C  C    . PHE B 1 71 ? 148.187 0.769   9.882   1.00 0.00 ? 71  PHE B C    1  
ATOM   2523  O  O    . PHE B 1 71 ? 148.076 0.779   8.656   1.00 0.00 ? 71  PHE B O    1  
ATOM   2524  C  CB   . PHE B 1 71 ? 148.590 -1.373  11.100  1.00 0.00 ? 71  PHE B CB   1  
ATOM   2525  C  CG   . PHE B 1 71 ? 148.020 -2.176  9.955   1.00 0.00 ? 71  PHE B CG   1  
ATOM   2526  C  CD1  . PHE B 1 71 ? 148.844 -3.023  9.207   1.00 0.00 ? 71  PHE B CD1  1  
ATOM   2527  C  CD2  . PHE B 1 71 ? 146.658 -2.073  9.647   1.00 0.00 ? 71  PHE B CD2  1  
ATOM   2528  C  CE1  . PHE B 1 71 ? 148.306 -3.767  8.148   1.00 0.00 ? 71  PHE B CE1  1  
ATOM   2529  C  CE2  . PHE B 1 71 ? 146.121 -2.815  8.589   1.00 0.00 ? 71  PHE B CE2  1  
ATOM   2530  C  CZ   . PHE B 1 71 ? 146.945 -3.662  7.840   1.00 0.00 ? 71  PHE B CZ   1  
ATOM   2531  H  H    . PHE B 1 71 ? 149.949 0.247   12.523  1.00 0.00 ? 71  PHE B H    1  
ATOM   2532  H  HA   . PHE B 1 71 ? 149.989 -0.375  9.824   1.00 0.00 ? 71  PHE B HA   1  
ATOM   2533  H  HB2  . PHE B 1 71 ? 149.330 -1.963  11.621  1.00 0.00 ? 71  PHE B HB2  1  
ATOM   2534  H  HB3  . PHE B 1 71 ? 147.794 -1.106  11.781  1.00 0.00 ? 71  PHE B HB3  1  
ATOM   2535  H  HD1  . PHE B 1 71 ? 149.894 -3.104  9.445   1.00 0.00 ? 71  PHE B HD1  1  
ATOM   2536  H  HD2  . PHE B 1 71 ? 146.021 -1.419  10.225  1.00 0.00 ? 71  PHE B HD2  1  
ATOM   2537  H  HE1  . PHE B 1 71 ? 148.940 -4.419  7.567   1.00 0.00 ? 71  PHE B HE1  1  
ATOM   2538  H  HE2  . PHE B 1 71 ? 145.070 -2.736  8.353   1.00 0.00 ? 71  PHE B HE2  1  
ATOM   2539  H  HZ   . PHE B 1 71 ? 146.530 -4.235  7.024   1.00 0.00 ? 71  PHE B HZ   1  
ATOM   2540  N  N    . GLN B 1 72 ? 147.420 1.509   10.679  1.00 0.00 ? 72  GLN B N    1  
ATOM   2541  C  CA   . GLN B 1 72 ? 146.397 2.376   10.107  1.00 0.00 ? 72  GLN B CA   1  
ATOM   2542  C  C    . GLN B 1 72 ? 147.005 3.410   9.161   1.00 0.00 ? 72  GLN B C    1  
ATOM   2543  O  O    . GLN B 1 72 ? 146.466 3.658   8.088   1.00 0.00 ? 72  GLN B O    1  
ATOM   2544  C  CB   . GLN B 1 72 ? 145.635 3.095   11.220  1.00 0.00 ? 72  GLN B CB   1  
ATOM   2545  C  CG   . GLN B 1 72 ? 144.486 3.902   10.608  1.00 0.00 ? 72  GLN B CG   1  
ATOM   2546  C  CD   . GLN B 1 72 ? 143.760 4.686   11.696  1.00 0.00 ? 72  GLN B CD   1  
ATOM   2547  O  OE1  . GLN B 1 72 ? 144.355 5.545   12.345  1.00 0.00 ? 72  GLN B OE1  1  
ATOM   2548  N  NE2  . GLN B 1 72 ? 142.501 4.440   11.936  1.00 0.00 ? 72  GLN B NE2  1  
ATOM   2549  H  H    . GLN B 1 72 ? 147.547 1.477   11.649  1.00 0.00 ? 72  GLN B H    1  
ATOM   2550  H  HA   . GLN B 1 72 ? 145.700 1.768   9.552   1.00 0.00 ? 72  GLN B HA   1  
ATOM   2551  H  HB2  . GLN B 1 72 ? 145.237 2.367   11.912  1.00 0.00 ? 72  GLN B HB2  1  
ATOM   2552  H  HB3  . GLN B 1 72 ? 146.302 3.763   11.742  1.00 0.00 ? 72  GLN B HB3  1  
ATOM   2553  H  HG2  . GLN B 1 72 ? 144.884 4.593   9.879   1.00 0.00 ? 72  GLN B HG2  1  
ATOM   2554  H  HG3  . GLN B 1 72 ? 143.793 3.235   10.122  1.00 0.00 ? 72  GLN B HG3  1  
ATOM   2555  H  HE21 . GLN B 1 72 ? 142.028 3.756   11.417  1.00 0.00 ? 72  GLN B HE21 1  
ATOM   2556  H  HE22 . GLN B 1 72 ? 142.027 4.940   12.632  1.00 0.00 ? 72  GLN B HE22 1  
ATOM   2557  N  N    . GLU B 1 73 ? 148.129 4.013   9.545   1.00 0.00 ? 73  GLU B N    1  
ATOM   2558  C  CA   . GLU B 1 73 ? 148.755 4.998   8.668   1.00 0.00 ? 73  GLU B CA   1  
ATOM   2559  C  C    . GLU B 1 73 ? 149.324 4.316   7.417   1.00 0.00 ? 73  GLU B C    1  
ATOM   2560  O  O    . GLU B 1 73 ? 149.272 4.857   6.308   1.00 0.00 ? 73  GLU B O    1  
ATOM   2561  C  CB   . GLU B 1 73 ? 149.873 5.748   9.404   1.00 0.00 ? 73  GLU B CB   1  
ATOM   2562  C  CG   . GLU B 1 73 ? 149.295 6.566   10.566  1.00 0.00 ? 73  GLU B CG   1  
ATOM   2563  C  CD   . GLU B 1 73 ? 150.402 7.407   11.209  1.00 0.00 ? 73  GLU B CD   1  
ATOM   2564  O  OE1  . GLU B 1 73 ? 151.518 7.339   10.731  1.00 0.00 ? 73  GLU B OE1  1  
ATOM   2565  O  OE2  . GLU B 1 73 ? 150.124 8.090   12.184  1.00 0.00 ? 73  GLU B OE2  1  
ATOM   2566  H  H    . GLU B 1 73 ? 148.537 3.790   10.407  1.00 0.00 ? 73  GLU B H    1  
ATOM   2567  H  HA   . GLU B 1 73 ? 148.006 5.713   8.363   1.00 0.00 ? 73  GLU B HA   1  
ATOM   2568  H  HB2  . GLU B 1 73 ? 150.576 5.031   9.794   1.00 0.00 ? 73  GLU B HB2  1  
ATOM   2569  H  HB3  . GLU B 1 73 ? 150.377 6.408   8.715   1.00 0.00 ? 73  GLU B HB3  1  
ATOM   2570  H  HG2  . GLU B 1 73 ? 148.518 7.218   10.194  1.00 0.00 ? 73  GLU B HG2  1  
ATOM   2571  H  HG3  . GLU B 1 73 ? 148.880 5.897   11.304  1.00 0.00 ? 73  GLU B HG3  1  
ATOM   2572  N  N    . TYR B 1 74 ? 149.882 3.121   7.618   1.00 0.00 ? 74  TYR B N    1  
ATOM   2573  C  CA   . TYR B 1 74 ? 150.482 2.355   6.525   1.00 0.00 ? 74  TYR B CA   1  
ATOM   2574  C  C    . TYR B 1 74 ? 149.480 1.970   5.439   1.00 0.00 ? 74  TYR B C    1  
ATOM   2575  O  O    . TYR B 1 74 ? 149.776 2.076   4.243   1.00 0.00 ? 74  TYR B O    1  
ATOM   2576  C  CB   . TYR B 1 74 ? 151.100 1.077   7.096   1.00 0.00 ? 74  TYR B CB   1  
ATOM   2577  C  CG   . TYR B 1 74 ? 151.759 0.281   5.992   1.00 0.00 ? 74  TYR B CG   1  
ATOM   2578  C  CD1  . TYR B 1 74 ? 153.089 0.534   5.629   1.00 0.00 ? 74  TYR B CD1  1  
ATOM   2579  C  CD2  . TYR B 1 74 ? 151.032 -0.717  5.331   1.00 0.00 ? 74  TYR B CD2  1  
ATOM   2580  C  CE1  . TYR B 1 74 ? 153.689 -0.215  4.605   1.00 0.00 ? 74  TYR B CE1  1  
ATOM   2581  C  CE2  . TYR B 1 74 ? 151.631 -1.461  4.310   1.00 0.00 ? 74  TYR B CE2  1  
ATOM   2582  C  CZ   . TYR B 1 74 ? 152.959 -1.211  3.947   1.00 0.00 ? 74  TYR B CZ   1  
ATOM   2583  O  OH   . TYR B 1 74 ? 153.549 -1.947  2.939   1.00 0.00 ? 74  TYR B OH   1  
ATOM   2584  H  H    . TYR B 1 74 ? 149.901 2.750   8.525   1.00 0.00 ? 74  TYR B H    1  
ATOM   2585  H  HA   . TYR B 1 74 ? 151.268 2.942   6.079   1.00 0.00 ? 74  TYR B HA   1  
ATOM   2586  H  HB2  . TYR B 1 74 ? 151.838 1.337   7.839   1.00 0.00 ? 74  TYR B HB2  1  
ATOM   2587  H  HB3  . TYR B 1 74 ? 150.326 0.478   7.554   1.00 0.00 ? 74  TYR B HB3  1  
ATOM   2588  H  HD1  . TYR B 1 74 ? 153.651 1.303   6.138   1.00 0.00 ? 74  TYR B HD1  1  
ATOM   2589  H  HD2  . TYR B 1 74 ? 150.008 -0.911  5.611   1.00 0.00 ? 74  TYR B HD2  1  
ATOM   2590  H  HE1  . TYR B 1 74 ? 154.715 -0.024  4.325   1.00 0.00 ? 74  TYR B HE1  1  
ATOM   2591  H  HE2  . TYR B 1 74 ? 151.067 -2.229  3.802   1.00 0.00 ? 74  TYR B HE2  1  
ATOM   2592  H  HH   . TYR B 1 74 ? 153.617 -2.857  3.238   1.00 0.00 ? 74  TYR B HH   1  
ATOM   2593  N  N    . VAL B 1 75 ? 148.306 1.495   5.848   1.00 0.00 ? 75  VAL B N    1  
ATOM   2594  C  CA   . VAL B 1 75 ? 147.315 1.068   4.868   1.00 0.00 ? 75  VAL B CA   1  
ATOM   2595  C  C    . VAL B 1 75 ? 146.911 2.222   3.960   1.00 0.00 ? 75  VAL B C    1  
ATOM   2596  O  O    . VAL B 1 75 ? 146.744 2.040   2.755   1.00 0.00 ? 75  VAL B O    1  
ATOM   2597  C  CB   . VAL B 1 75 ? 146.080 0.474   5.554   1.00 0.00 ? 75  VAL B CB   1  
ATOM   2598  C  CG1  . VAL B 1 75 ? 145.173 1.591   6.074   1.00 0.00 ? 75  VAL B CG1  1  
ATOM   2599  C  CG2  . VAL B 1 75 ? 145.314 -0.397  4.549   1.00 0.00 ? 75  VAL B CG2  1  
ATOM   2600  H  H    . VAL B 1 75 ? 148.122 1.407   6.808   1.00 0.00 ? 75  VAL B H    1  
ATOM   2601  H  HA   . VAL B 1 75 ? 147.760 0.300   4.254   1.00 0.00 ? 75  VAL B HA   1  
ATOM   2602  H  HB   . VAL B 1 75 ? 146.399 -0.138  6.385   1.00 0.00 ? 75  VAL B HB   1  
ATOM   2603  H  HG11 . VAL B 1 75 ? 144.489 1.892   5.296   1.00 0.00 ? 75  VAL B HG11 1  
ATOM   2604  H  HG12 . VAL B 1 75 ? 145.772 2.431   6.369   1.00 0.00 ? 75  VAL B HG12 1  
ATOM   2605  H  HG13 . VAL B 1 75 ? 144.612 1.233   6.925   1.00 0.00 ? 75  VAL B HG13 1  
ATOM   2606  H  HG21 . VAL B 1 75 ? 145.652 -1.421  4.633   1.00 0.00 ? 75  VAL B HG21 1  
ATOM   2607  H  HG22 . VAL B 1 75 ? 145.493 -0.041  3.545   1.00 0.00 ? 75  VAL B HG22 1  
ATOM   2608  H  HG23 . VAL B 1 75 ? 144.257 -0.350  4.760   1.00 0.00 ? 75  VAL B HG23 1  
ATOM   2609  N  N    . VAL B 1 76 ? 146.774 3.415   4.528   1.00 0.00 ? 76  VAL B N    1  
ATOM   2610  C  CA   . VAL B 1 76 ? 146.421 4.567   3.718   1.00 0.00 ? 76  VAL B CA   1  
ATOM   2611  C  C    . VAL B 1 76 ? 147.632 5.027   2.924   1.00 0.00 ? 76  VAL B C    1  
ATOM   2612  O  O    . VAL B 1 76 ? 147.500 5.511   1.799   1.00 0.00 ? 76  VAL B O    1  
ATOM   2613  C  CB   . VAL B 1 76 ? 145.880 5.707   4.592   1.00 0.00 ? 76  VAL B CB   1  
ATOM   2614  C  CG1  . VAL B 1 76 ? 144.649 5.217   5.354   1.00 0.00 ? 76  VAL B CG1  1  
ATOM   2615  C  CG2  . VAL B 1 76 ? 146.942 6.149   5.600   1.00 0.00 ? 76  VAL B CG2  1  
ATOM   2616  H  H    . VAL B 1 76 ? 146.934 3.523   5.489   1.00 0.00 ? 76  VAL B H    1  
ATOM   2617  H  HA   . VAL B 1 76 ? 145.649 4.271   3.023   1.00 0.00 ? 76  VAL B HA   1  
ATOM   2618  H  HB   . VAL B 1 76 ? 145.606 6.541   3.962   1.00 0.00 ? 76  VAL B HB   1  
ATOM   2619  H  HG11 . VAL B 1 76 ? 144.047 4.596   4.707   1.00 0.00 ? 76  VAL B HG11 1  
ATOM   2620  H  HG12 . VAL B 1 76 ? 144.066 6.066   5.681   1.00 0.00 ? 76  VAL B HG12 1  
ATOM   2621  H  HG13 . VAL B 1 76 ? 144.962 4.643   6.214   1.00 0.00 ? 76  VAL B HG13 1  
ATOM   2622  H  HG21 . VAL B 1 76 ? 147.066 5.378   6.344   1.00 0.00 ? 76  VAL B HG21 1  
ATOM   2623  H  HG22 . VAL B 1 76 ? 146.623 7.063   6.080   1.00 0.00 ? 76  VAL B HG22 1  
ATOM   2624  H  HG23 . VAL B 1 76 ? 147.881 6.320   5.093   1.00 0.00 ? 76  VAL B HG23 1  
ATOM   2625  N  N    . LEU B 1 77 ? 148.818 4.875   3.514   1.00 0.00 ? 77  LEU B N    1  
ATOM   2626  C  CA   . LEU B 1 77 ? 150.035 5.287   2.834   1.00 0.00 ? 77  LEU B CA   1  
ATOM   2627  C  C    . LEU B 1 77 ? 150.223 4.516   1.534   1.00 0.00 ? 77  LEU B C    1  
ATOM   2628  O  O    . LEU B 1 77 ? 150.584 5.096   0.509   1.00 0.00 ? 77  LEU B O    1  
ATOM   2629  C  CB   . LEU B 1 77 ? 151.239 5.049   3.752   1.00 0.00 ? 77  LEU B CB   1  
ATOM   2630  C  CG   . LEU B 1 77 ? 152.504 5.683   3.145   1.00 0.00 ? 77  LEU B CG   1  
ATOM   2631  C  CD1  . LEU B 1 77 ? 153.442 6.123   4.268   1.00 0.00 ? 77  LEU B CD1  1  
ATOM   2632  C  CD2  . LEU B 1 77 ? 153.242 4.667   2.259   1.00 0.00 ? 77  LEU B CD2  1  
ATOM   2633  H  H    . LEU B 1 77 ? 148.870 4.487   4.418   1.00 0.00 ? 77  LEU B H    1  
ATOM   2634  H  HA   . LEU B 1 77 ? 149.970 6.341   2.611   1.00 0.00 ? 77  LEU B HA   1  
ATOM   2635  H  HB2  . LEU B 1 77 ? 151.040 5.490   4.719   1.00 0.00 ? 77  LEU B HB2  1  
ATOM   2636  H  HB3  . LEU B 1 77 ? 151.388 3.989   3.873   1.00 0.00 ? 77  LEU B HB3  1  
ATOM   2637  H  HG   . LEU B 1 77 ? 152.230 6.543   2.551   1.00 0.00 ? 77  LEU B HG   1  
ATOM   2638  H  HD11 . LEU B 1 77 ? 154.338 6.546   3.840   1.00 0.00 ? 77  LEU B HD11 1  
ATOM   2639  H  HD12 . LEU B 1 77 ? 153.698 5.269   4.877   1.00 0.00 ? 77  LEU B HD12 1  
ATOM   2640  H  HD13 . LEU B 1 77 ? 152.950 6.866   4.878   1.00 0.00 ? 77  LEU B HD13 1  
ATOM   2641  H  HD21 . LEU B 1 77 ? 153.287 3.711   2.758   1.00 0.00 ? 77  LEU B HD21 1  
ATOM   2642  H  HD22 . LEU B 1 77 ? 154.246 5.019   2.074   1.00 0.00 ? 77  LEU B HD22 1  
ATOM   2643  H  HD23 . LEU B 1 77 ? 152.724 4.560   1.319   1.00 0.00 ? 77  LEU B HD23 1  
ATOM   2644  N  N    . VAL B 1 78 ? 149.963 3.209   1.567   1.00 0.00 ? 78  VAL B N    1  
ATOM   2645  C  CA   . VAL B 1 78 ? 150.102 2.401   0.358   1.00 0.00 ? 78  VAL B CA   1  
ATOM   2646  C  C    . VAL B 1 78 ? 148.959 2.682   -0.615  1.00 0.00 ? 78  VAL B C    1  
ATOM   2647  O  O    . VAL B 1 78 ? 149.126 2.609   -1.838  1.00 0.00 ? 78  VAL B O    1  
ATOM   2648  C  CB   . VAL B 1 78 ? 150.153 0.909   0.706   1.00 0.00 ? 78  VAL B CB   1  
ATOM   2649  C  CG1  . VAL B 1 78 ? 151.278 0.661   1.711   1.00 0.00 ? 78  VAL B CG1  1  
ATOM   2650  C  CG2  . VAL B 1 78 ? 148.822 0.460   1.320   1.00 0.00 ? 78  VAL B CG2  1  
ATOM   2651  H  H    . VAL B 1 78 ? 149.668 2.789   2.408   1.00 0.00 ? 78  VAL B H    1  
ATOM   2652  H  HA   . VAL B 1 78 ? 151.030 2.671   -0.124  1.00 0.00 ? 78  VAL B HA   1  
ATOM   2653  H  HB   . VAL B 1 78 ? 150.348 0.340   -0.192  1.00 0.00 ? 78  VAL B HB   1  
ATOM   2654  H  HG11 . VAL B 1 78 ? 151.244 -0.366  2.043   1.00 0.00 ? 78  VAL B HG11 1  
ATOM   2655  H  HG12 . VAL B 1 78 ? 151.154 1.318   2.560   1.00 0.00 ? 78  VAL B HG12 1  
ATOM   2656  H  HG13 . VAL B 1 78 ? 152.230 0.855   1.241   1.00 0.00 ? 78  VAL B HG13 1  
ATOM   2657  H  HG21 . VAL B 1 78 ? 148.009 0.724   0.660   1.00 0.00 ? 78  VAL B HG21 1  
ATOM   2658  H  HG22 . VAL B 1 78 ? 148.687 0.946   2.272   1.00 0.00 ? 78  VAL B HG22 1  
ATOM   2659  H  HG23 . VAL B 1 78 ? 148.835 -0.613  1.461   1.00 0.00 ? 78  VAL B HG23 1  
ATOM   2660  N  N    . ALA B 1 79 ? 147.790 2.992   -0.060  1.00 0.00 ? 79  ALA B N    1  
ATOM   2661  C  CA   . ALA B 1 79 ? 146.620 3.263   -0.882  1.00 0.00 ? 79  ALA B CA   1  
ATOM   2662  C  C    . ALA B 1 79 ? 146.852 4.471   -1.782  1.00 0.00 ? 79  ALA B C    1  
ATOM   2663  O  O    . ALA B 1 79 ? 146.430 4.478   -2.938  1.00 0.00 ? 79  ALA B O    1  
ATOM   2664  C  CB   . ALA B 1 79 ? 145.403 3.506   0.018   1.00 0.00 ? 79  ALA B CB   1  
ATOM   2665  H  H    . ALA B 1 79 ? 147.713 3.027   0.916   1.00 0.00 ? 79  ALA B H    1  
ATOM   2666  H  HA   . ALA B 1 79 ? 146.424 2.401   -1.502  1.00 0.00 ? 79  ALA B HA   1  
ATOM   2667  H  HB1  . ALA B 1 79 ? 145.271 4.567   0.174   1.00 0.00 ? 79  ALA B HB1  1  
ATOM   2668  H  HB2  . ALA B 1 79 ? 145.558 3.020   0.969   1.00 0.00 ? 79  ALA B HB2  1  
ATOM   2669  H  HB3  . ALA B 1 79 ? 144.520 3.098   -0.453  1.00 0.00 ? 79  ALA B HB3  1  
ATOM   2670  N  N    . ALA B 1 80 ? 147.531 5.488   -1.260  1.00 0.00 ? 80  ALA B N    1  
ATOM   2671  C  CA   . ALA B 1 80 ? 147.803 6.670   -2.064  1.00 0.00 ? 80  ALA B CA   1  
ATOM   2672  C  C    . ALA B 1 80 ? 148.713 6.308   -3.229  1.00 0.00 ? 80  ALA B C    1  
ATOM   2673  O  O    . ALA B 1 80 ? 148.501 6.748   -4.359  1.00 0.00 ? 80  ALA B O    1  
ATOM   2674  C  CB   . ALA B 1 80 ? 148.470 7.747   -1.205  1.00 0.00 ? 80  ALA B CB   1  
ATOM   2675  H  H    . ALA B 1 80 ? 147.857 5.437   -0.338  1.00 0.00 ? 80  ALA B H    1  
ATOM   2676  H  HA   . ALA B 1 80 ? 146.872 7.056   -2.449  1.00 0.00 ? 80  ALA B HA   1  
ATOM   2677  H  HB1  . ALA B 1 80 ? 149.403 7.370   -0.814  1.00 0.00 ? 80  ALA B HB1  1  
ATOM   2678  H  HB2  . ALA B 1 80 ? 147.817 8.010   -0.386  1.00 0.00 ? 80  ALA B HB2  1  
ATOM   2679  H  HB3  . ALA B 1 80 ? 148.660 8.622   -1.809  1.00 0.00 ? 80  ALA B HB3  1  
ATOM   2680  N  N    . LEU B 1 81 ? 149.718 5.484   -2.946  1.00 0.00 ? 81  LEU B N    1  
ATOM   2681  C  CA   . LEU B 1 81 ? 150.648 5.044   -3.978  1.00 0.00 ? 81  LEU B CA   1  
ATOM   2682  C  C    . LEU B 1 81 ? 149.923 4.207   -5.025  1.00 0.00 ? 81  LEU B C    1  
ATOM   2683  O  O    . LEU B 1 81 ? 150.227 4.280   -6.216  1.00 0.00 ? 81  LEU B O    1  
ATOM   2684  C  CB   . LEU B 1 81 ? 151.779 4.224   -3.350  1.00 0.00 ? 81  LEU B CB   1  
ATOM   2685  C  CG   . LEU B 1 81 ? 152.497 5.060   -2.284  1.00 0.00 ? 81  LEU B CG   1  
ATOM   2686  C  CD1  . LEU B 1 81 ? 153.696 4.277   -1.747  1.00 0.00 ? 81  LEU B CD1  1  
ATOM   2687  C  CD2  . LEU B 1 81 ? 152.987 6.375   -2.899  1.00 0.00 ? 81  LEU B CD2  1  
ATOM   2688  H  H    . LEU B 1 81 ? 149.828 5.156   -2.028  1.00 0.00 ? 81  LEU B H    1  
ATOM   2689  H  HA   . LEU B 1 81 ? 151.070 5.912   -4.462  1.00 0.00 ? 81  LEU B HA   1  
ATOM   2690  H  HB2  . LEU B 1 81 ? 151.366 3.336   -2.893  1.00 0.00 ? 81  LEU B HB2  1  
ATOM   2691  H  HB3  . LEU B 1 81 ? 152.484 3.939   -4.116  1.00 0.00 ? 81  LEU B HB3  1  
ATOM   2692  H  HG   . LEU B 1 81 ? 151.815 5.272   -1.474  1.00 0.00 ? 81  LEU B HG   1  
ATOM   2693  H  HD11 . LEU B 1 81 ? 154.297 3.926   -2.573  1.00 0.00 ? 81  LEU B HD11 1  
ATOM   2694  H  HD12 . LEU B 1 81 ? 153.347 3.433   -1.170  1.00 0.00 ? 81  LEU B HD12 1  
ATOM   2695  H  HD13 . LEU B 1 81 ? 154.291 4.922   -1.117  1.00 0.00 ? 81  LEU B HD13 1  
ATOM   2696  H  HD21 . LEU B 1 81 ? 153.281 6.206   -3.925  1.00 0.00 ? 81  LEU B HD21 1  
ATOM   2697  H  HD22 . LEU B 1 81 ? 153.834 6.741   -2.338  1.00 0.00 ? 81  LEU B HD22 1  
ATOM   2698  H  HD23 . LEU B 1 81 ? 152.192 7.105   -2.867  1.00 0.00 ? 81  LEU B HD23 1  
ATOM   2699  N  N    . THR B 1 82 ? 148.951 3.419   -4.566  1.00 0.00 ? 82  THR B N    1  
ATOM   2700  C  CA   . THR B 1 82 ? 148.186 2.560   -5.466  1.00 0.00 ? 82  THR B CA   1  
ATOM   2701  C  C    . THR B 1 82 ? 147.612 3.362   -6.619  1.00 0.00 ? 82  THR B C    1  
ATOM   2702  O  O    . THR B 1 82 ? 147.573 2.893   -7.757  1.00 0.00 ? 82  THR B O    1  
ATOM   2703  C  CB   . THR B 1 82 ? 147.041 1.898   -4.700  1.00 0.00 ? 82  THR B CB   1  
ATOM   2704  O  OG1  . THR B 1 82 ? 147.562 1.175   -3.595  1.00 0.00 ? 82  THR B OG1  1  
ATOM   2705  C  CG2  . THR B 1 82 ? 146.269 0.957   -5.628  1.00 0.00 ? 82  THR B CG2  1  
ATOM   2706  H  H    . THR B 1 82 ? 148.753 3.405   -3.602  1.00 0.00 ? 82  THR B H    1  
ATOM   2707  H  HA   . THR B 1 82 ? 148.834 1.791   -5.858  1.00 0.00 ? 82  THR B HA   1  
ATOM   2708  H  HB   . THR B 1 82 ? 146.373 2.662   -4.341  1.00 0.00 ? 82  THR B HB   1  
ATOM   2709  H  HG1  . THR B 1 82 ? 146.889 0.557   -3.300  1.00 0.00 ? 82  THR B HG1  1  
ATOM   2710  H  HG21 . THR B 1 82 ? 146.945 0.524   -6.348  1.00 0.00 ? 82  THR B HG21 1  
ATOM   2711  H  HG22 . THR B 1 82 ? 145.503 1.516   -6.147  1.00 0.00 ? 82  THR B HG22 1  
ATOM   2712  H  HG23 . THR B 1 82 ? 145.809 0.174   -5.044  1.00 0.00 ? 82  THR B HG23 1  
ATOM   2713  N  N    . VAL B 1 83 ? 147.172 4.570   -6.323  1.00 0.00 ? 83  VAL B N    1  
ATOM   2714  C  CA   . VAL B 1 83 ? 146.608 5.426   -7.349  1.00 0.00 ? 83  VAL B CA   1  
ATOM   2715  C  C    . VAL B 1 83 ? 147.641 5.697   -8.437  1.00 0.00 ? 83  VAL B C    1  
ATOM   2716  O  O    . VAL B 1 83 ? 147.294 5.808   -9.612  1.00 0.00 ? 83  VAL B O    1  
ATOM   2717  C  CB   . VAL B 1 83 ? 146.136 6.746   -6.741  1.00 0.00 ? 83  VAL B CB   1  
ATOM   2718  C  CG1  . VAL B 1 83 ? 145.676 7.683   -7.862  1.00 0.00 ? 83  VAL B CG1  1  
ATOM   2719  C  CG2  . VAL B 1 83 ? 144.970 6.479   -5.787  1.00 0.00 ? 83  VAL B CG2  1  
ATOM   2720  H  H    . VAL B 1 83 ? 147.230 4.894   -5.400  1.00 0.00 ? 83  VAL B H    1  
ATOM   2721  H  HA   . VAL B 1 83 ? 145.760 4.925   -7.791  1.00 0.00 ? 83  VAL B HA   1  
ATOM   2722  H  HB   . VAL B 1 83 ? 146.952 7.205   -6.200  1.00 0.00 ? 83  VAL B HB   1  
ATOM   2723  H  HG11 . VAL B 1 83 ? 146.529 7.989   -8.448  1.00 0.00 ? 83  VAL B HG11 1  
ATOM   2724  H  HG12 . VAL B 1 83 ? 145.204 8.553   -7.430  1.00 0.00 ? 83  VAL B HG12 1  
ATOM   2725  H  HG13 . VAL B 1 83 ? 144.969 7.166   -8.496  1.00 0.00 ? 83  VAL B HG13 1  
ATOM   2726  H  HG21 . VAL B 1 83 ? 144.049 6.430   -6.348  1.00 0.00 ? 83  VAL B HG21 1  
ATOM   2727  H  HG22 . VAL B 1 83 ? 144.909 7.279   -5.064  1.00 0.00 ? 83  VAL B HG22 1  
ATOM   2728  H  HG23 . VAL B 1 83 ? 145.131 5.542   -5.274  1.00 0.00 ? 83  VAL B HG23 1  
ATOM   2729  N  N    . ALA B 1 84 ? 148.911 5.816   -8.046  1.00 0.00 ? 84  ALA B N    1  
ATOM   2730  C  CA   . ALA B 1 84 ? 149.959 6.088   -9.023  1.00 0.00 ? 84  ALA B CA   1  
ATOM   2731  C  C    . ALA B 1 84 ? 150.059 4.958   -10.044 1.00 0.00 ? 84  ALA B C    1  
ATOM   2732  O  O    . ALA B 1 84 ? 150.256 5.204   -11.241 1.00 0.00 ? 84  ALA B O    1  
ATOM   2733  C  CB   . ALA B 1 84 ? 151.302 6.255   -8.312  1.00 0.00 ? 84  ALA B CB   1  
ATOM   2734  H  H    . ALA B 1 84 ? 149.148 5.714   -7.092  1.00 0.00 ? 84  ALA B H    1  
ATOM   2735  H  HA   . ALA B 1 84 ? 149.724 7.006   -9.541  1.00 0.00 ? 84  ALA B HA   1  
ATOM   2736  H  HB1  . ALA B 1 84 ? 151.585 5.320   -7.853  1.00 0.00 ? 84  ALA B HB1  1  
ATOM   2737  H  HB2  . ALA B 1 84 ? 151.215 7.017   -7.552  1.00 0.00 ? 84  ALA B HB2  1  
ATOM   2738  H  HB3  . ALA B 1 84 ? 152.055 6.547   -9.029  1.00 0.00 ? 84  ALA B HB3  1  
ATOM   2739  N  N    . MET B 1 85 ? 149.906 3.718   -9.584  1.00 0.00 ? 85  MET B N    1  
ATOM   2740  C  CA   . MET B 1 85 ? 149.974 2.598   -10.506 1.00 0.00 ? 85  MET B CA   1  
ATOM   2741  C  C    . MET B 1 85 ? 148.890 2.759   -11.553 1.00 0.00 ? 85  MET B C    1  
ATOM   2742  O  O    . MET B 1 85 ? 149.101 2.488   -12.735 1.00 0.00 ? 85  MET B O    1  
ATOM   2743  C  CB   . MET B 1 85 ? 149.769 1.273   -9.777  1.00 0.00 ? 85  MET B CB   1  
ATOM   2744  C  CG   . MET B 1 85 ? 150.074 0.133   -10.749 1.00 0.00 ? 85  MET B CG   1  
ATOM   2745  S  SD   . MET B 1 85 ? 149.524 -1.437  -10.039 1.00 0.00 ? 85  MET B SD   1  
ATOM   2746  C  CE   . MET B 1 85 ? 148.062 -1.647  -11.087 1.00 0.00 ? 85  MET B CE   1  
ATOM   2747  H  H    . MET B 1 85 ? 149.737 3.564   -8.631  1.00 0.00 ? 85  MET B H    1  
ATOM   2748  H  HA   . MET B 1 85 ? 150.935 2.588   -10.991 1.00 0.00 ? 85  MET B HA   1  
ATOM   2749  H  HB2  . MET B 1 85 ? 150.436 1.218   -8.929  1.00 0.00 ? 85  MET B HB2  1  
ATOM   2750  H  HB3  . MET B 1 85 ? 148.746 1.196   -9.442  1.00 0.00 ? 85  MET B HB3  1  
ATOM   2751  H  HG2  . MET B 1 85 ? 149.567 0.309   -11.685 1.00 0.00 ? 85  MET B HG2  1  
ATOM   2752  H  HG3  . MET B 1 85 ? 151.139 0.091   -10.925 1.00 0.00 ? 85  MET B HG3  1  
ATOM   2753  H  HE1  . MET B 1 85 ? 147.357 -2.299  -10.593 1.00 0.00 ? 85  MET B HE1  1  
ATOM   2754  H  HE2  . MET B 1 85 ? 148.353 -2.083  -12.030 1.00 0.00 ? 85  MET B HE2  1  
ATOM   2755  H  HE3  . MET B 1 85 ? 147.606 -0.684  -11.265 1.00 0.00 ? 85  MET B HE3  1  
ATOM   2756  N  N    . ASN B 1 86 ? 147.725 3.229   -11.111 1.00 0.00 ? 86  ASN B N    1  
ATOM   2757  C  CA   . ASN B 1 86 ? 146.624 3.448   -12.029 1.00 0.00 ? 86  ASN B CA   1  
ATOM   2758  C  C    . ASN B 1 86 ? 147.057 4.426   -13.107 1.00 0.00 ? 86  ASN B C    1  
ATOM   2759  O  O    . ASN B 1 86 ? 146.775 4.233   -14.289 1.00 0.00 ? 86  ASN B O    1  
ATOM   2760  C  CB   . ASN B 1 86 ? 145.422 4.005   -11.263 1.00 0.00 ? 86  ASN B CB   1  
ATOM   2761  C  CG   . ASN B 1 86 ? 144.177 3.981   -12.139 1.00 0.00 ? 86  ASN B CG   1  
ATOM   2762  O  OD1  . ASN B 1 86 ? 143.786 2.926   -12.640 1.00 0.00 ? 86  ASN B OD1  1  
ATOM   2763  N  ND2  . ASN B 1 86 ? 143.520 5.090   -12.345 1.00 0.00 ? 86  ASN B ND2  1  
ATOM   2764  H  H    . ASN B 1 86 ? 147.617 3.443   -10.161 1.00 0.00 ? 86  ASN B H    1  
ATOM   2765  H  HA   . ASN B 1 86 ? 146.349 2.510   -12.486 1.00 0.00 ? 86  ASN B HA   1  
ATOM   2766  H  HB2  . ASN B 1 86 ? 145.250 3.405   -10.382 1.00 0.00 ? 86  ASN B HB2  1  
ATOM   2767  H  HB3  . ASN B 1 86 ? 145.627 5.023   -10.968 1.00 0.00 ? 86  ASN B HB3  1  
ATOM   2768  H  HD21 . ASN B 1 86 ? 143.831 5.924   -11.937 1.00 0.00 ? 86  ASN B HD21 1  
ATOM   2769  H  HD22 . ASN B 1 86 ? 142.717 5.087   -12.904 1.00 0.00 ? 86  ASN B HD22 1  
ATOM   2770  N  N    . ASN B 1 87 ? 147.779 5.467   -12.692 1.00 0.00 ? 87  ASN B N    1  
ATOM   2771  C  CA   . ASN B 1 87 ? 148.280 6.448   -13.642 1.00 0.00 ? 87  ASN B CA   1  
ATOM   2772  C  C    . ASN B 1 87 ? 149.207 5.762   -14.633 1.00 0.00 ? 87  ASN B C    1  
ATOM   2773  O  O    . ASN B 1 87 ? 149.158 6.020   -15.836 1.00 0.00 ? 87  ASN B O    1  
ATOM   2774  C  CB   . ASN B 1 87 ? 149.039 7.553   -12.905 1.00 0.00 ? 87  ASN B CB   1  
ATOM   2775  C  CG   . ASN B 1 87 ? 149.304 8.722   -13.847 1.00 0.00 ? 87  ASN B CG   1  
ATOM   2776  O  OD1  . ASN B 1 87 ? 148.875 8.700   -15.001 1.00 0.00 ? 87  ASN B OD1  1  
ATOM   2777  N  ND2  . ASN B 1 87 ? 149.993 9.747   -13.425 1.00 0.00 ? 87  ASN B ND2  1  
ATOM   2778  H  H    . ASN B 1 87 ? 147.993 5.556   -11.739 1.00 0.00 ? 87  ASN B H    1  
ATOM   2779  H  HA   . ASN B 1 87 ? 147.449 6.884   -14.174 1.00 0.00 ? 87  ASN B HA   1  
ATOM   2780  H  HB2  . ASN B 1 87 ? 148.450 7.895   -12.066 1.00 0.00 ? 87  ASN B HB2  1  
ATOM   2781  H  HB3  . ASN B 1 87 ? 149.980 7.163   -12.546 1.00 0.00 ? 87  ASN B HB3  1  
ATOM   2782  H  HD21 . ASN B 1 87 ? 150.336 9.760   -12.506 1.00 0.00 ? 87  ASN B HD21 1  
ATOM   2783  H  HD22 . ASN B 1 87 ? 150.168 10.501  -14.025 1.00 0.00 ? 87  ASN B HD22 1  
ATOM   2784  N  N    . PHE B 1 88 ? 150.040 4.866   -14.107 1.00 0.00 ? 88  PHE B N    1  
ATOM   2785  C  CA   . PHE B 1 88 ? 150.972 4.114   -14.941 1.00 0.00 ? 88  PHE B CA   1  
ATOM   2786  C  C    . PHE B 1 88 ? 150.212 3.283   -15.967 1.00 0.00 ? 88  PHE B C    1  
ATOM   2787  O  O    . PHE B 1 88 ? 150.611 3.182   -17.128 1.00 0.00 ? 88  PHE B O    1  
ATOM   2788  C  CB   . PHE B 1 88 ? 151.837 3.199   -14.072 1.00 0.00 ? 88  PHE B CB   1  
ATOM   2789  C  CG   . PHE B 1 88 ? 152.878 2.527   -14.936 1.00 0.00 ? 88  PHE B CG   1  
ATOM   2790  C  CD1  . PHE B 1 88 ? 154.082 3.183   -15.217 1.00 0.00 ? 88  PHE B CD1  1  
ATOM   2791  C  CD2  . PHE B 1 88 ? 152.639 1.249   -15.455 1.00 0.00 ? 88  PHE B CD2  1  
ATOM   2792  C  CE1  . PHE B 1 88 ? 155.047 2.562   -16.018 1.00 0.00 ? 88  PHE B CE1  1  
ATOM   2793  C  CE2  . PHE B 1 88 ? 153.605 0.628   -16.257 1.00 0.00 ? 88  PHE B CE2  1  
ATOM   2794  C  CZ   . PHE B 1 88 ? 154.809 1.284   -16.538 1.00 0.00 ? 88  PHE B CZ   1  
ATOM   2795  H  H    . PHE B 1 88 ? 150.019 4.701   -13.134 1.00 0.00 ? 88  PHE B H    1  
ATOM   2796  H  HA   . PHE B 1 88 ? 151.613 4.809   -15.460 1.00 0.00 ? 88  PHE B HA   1  
ATOM   2797  H  HB2  . PHE B 1 88 ? 152.324 3.783   -13.307 1.00 0.00 ? 88  PHE B HB2  1  
ATOM   2798  H  HB3  . PHE B 1 88 ? 151.215 2.446   -13.612 1.00 0.00 ? 88  PHE B HB3  1  
ATOM   2799  H  HD1  . PHE B 1 88 ? 154.266 4.170   -14.816 1.00 0.00 ? 88  PHE B HD1  1  
ATOM   2800  H  HD2  . PHE B 1 88 ? 151.711 0.743   -15.238 1.00 0.00 ? 88  PHE B HD2  1  
ATOM   2801  H  HE1  . PHE B 1 88 ? 155.976 3.068   -16.235 1.00 0.00 ? 88  PHE B HE1  1  
ATOM   2802  H  HE2  . PHE B 1 88 ? 153.421 -0.357  -16.658 1.00 0.00 ? 88  PHE B HE2  1  
ATOM   2803  H  HZ   . PHE B 1 88 ? 155.554 0.805   -17.156 1.00 0.00 ? 88  PHE B HZ   1  
ATOM   2804  N  N    . PHE B 1 89 ? 149.114 2.686   -15.519 1.00 0.00 ? 89  PHE B N    1  
ATOM   2805  C  CA   . PHE B 1 89 ? 148.297 1.843   -16.382 1.00 0.00 ? 89  PHE B CA   1  
ATOM   2806  C  C    . PHE B 1 89 ? 147.925 2.602   -17.648 1.00 0.00 ? 89  PHE B C    1  
ATOM   2807  O  O    . PHE B 1 89 ? 147.910 2.038   -18.741 1.00 0.00 ? 89  PHE B O    1  
ATOM   2808  C  CB   . PHE B 1 89 ? 147.027 1.431   -15.637 1.00 0.00 ? 89  PHE B CB   1  
ATOM   2809  C  CG   . PHE B 1 89 ? 146.259 0.422   -16.454 1.00 0.00 ? 89  PHE B CG   1  
ATOM   2810  C  CD1  . PHE B 1 89 ? 146.563 -0.938  -16.338 1.00 0.00 ? 89  PHE B CD1  1  
ATOM   2811  C  CD2  . PHE B 1 89 ? 145.244 0.842   -17.323 1.00 0.00 ? 89  PHE B CD2  1  
ATOM   2812  C  CE1  . PHE B 1 89 ? 145.854 -1.881  -17.088 1.00 0.00 ? 89  PHE B CE1  1  
ATOM   2813  C  CE2  . PHE B 1 89 ? 144.535 -0.102  -18.076 1.00 0.00 ? 89  PHE B CE2  1  
ATOM   2814  C  CZ   . PHE B 1 89 ? 144.840 -1.464  -17.958 1.00 0.00 ? 89  PHE B CZ   1  
ATOM   2815  H  H    . PHE B 1 89 ? 148.854 2.804   -14.581 1.00 0.00 ? 89  PHE B H    1  
ATOM   2816  H  HA   . PHE B 1 89 ? 148.855 0.959   -16.647 1.00 0.00 ? 89  PHE B HA   1  
ATOM   2817  H  HB2  . PHE B 1 89 ? 147.295 0.992   -14.686 1.00 0.00 ? 89  PHE B HB2  1  
ATOM   2818  H  HB3  . PHE B 1 89 ? 146.410 2.300   -15.471 1.00 0.00 ? 89  PHE B HB3  1  
ATOM   2819  H  HD1  . PHE B 1 89 ? 147.346 -1.260  -15.667 1.00 0.00 ? 89  PHE B HD1  1  
ATOM   2820  H  HD2  . PHE B 1 89 ? 145.010 1.893   -17.413 1.00 0.00 ? 89  PHE B HD2  1  
ATOM   2821  H  HE1  . PHE B 1 89 ? 146.091 -2.931  -16.995 1.00 0.00 ? 89  PHE B HE1  1  
ATOM   2822  H  HE2  . PHE B 1 89 ? 143.753 0.221   -18.747 1.00 0.00 ? 89  PHE B HE2  1  
ATOM   2823  H  HZ   . PHE B 1 89 ? 144.292 -2.192  -18.538 1.00 0.00 ? 89  PHE B HZ   1  
ATOM   2824  N  N    . TRP B 1 90 ? 147.634 3.885   -17.490 1.00 0.00 ? 90  TRP B N    1  
ATOM   2825  C  CA   . TRP B 1 90 ? 147.270 4.719   -18.625 1.00 0.00 ? 90  TRP B CA   1  
ATOM   2826  C  C    . TRP B 1 90 ? 148.344 4.644   -19.708 1.00 0.00 ? 90  TRP B C    1  
ATOM   2827  O  O    . TRP B 1 90 ? 148.035 4.679   -20.900 1.00 0.00 ? 90  TRP B O    1  
ATOM   2828  C  CB   . TRP B 1 90 ? 147.101 6.170   -18.171 1.00 0.00 ? 90  TRP B CB   1  
ATOM   2829  C  CG   . TRP B 1 90 ? 146.571 6.990   -19.303 1.00 0.00 ? 90  TRP B CG   1  
ATOM   2830  C  CD1  . TRP B 1 90 ? 147.303 7.852   -20.045 1.00 0.00 ? 90  TRP B CD1  1  
ATOM   2831  C  CD2  . TRP B 1 90 ? 145.214 7.043   -19.831 1.00 0.00 ? 90  TRP B CD2  1  
ATOM   2832  N  NE1  . TRP B 1 90 ? 146.482 8.431   -20.996 1.00 0.00 ? 90  TRP B NE1  1  
ATOM   2833  C  CE2  . TRP B 1 90 ? 145.185 7.965   -20.905 1.00 0.00 ? 90  TRP B CE2  1  
ATOM   2834  C  CE3  . TRP B 1 90 ? 144.018 6.388   -19.488 1.00 0.00 ? 90  TRP B CE3  1  
ATOM   2835  C  CZ2  . TRP B 1 90 ? 144.011 8.227   -21.612 1.00 0.00 ? 90  TRP B CZ2  1  
ATOM   2836  C  CZ3  . TRP B 1 90 ? 142.835 6.650   -20.198 1.00 0.00 ? 90  TRP B CZ3  1  
ATOM   2837  C  CH2  . TRP B 1 90 ? 142.832 7.567   -21.257 1.00 0.00 ? 90  TRP B CH2  1  
ATOM   2838  H  H    . TRP B 1 90 ? 147.668 4.280   -16.593 1.00 0.00 ? 90  TRP B H    1  
ATOM   2839  H  HA   . TRP B 1 90 ? 146.334 4.369   -19.033 1.00 0.00 ? 90  TRP B HA   1  
ATOM   2840  H  HB2  . TRP B 1 90 ? 146.409 6.209   -17.343 1.00 0.00 ? 90  TRP B HB2  1  
ATOM   2841  H  HB3  . TRP B 1 90 ? 148.058 6.564   -17.859 1.00 0.00 ? 90  TRP B HB3  1  
ATOM   2842  H  HD1  . TRP B 1 90 ? 148.355 8.056   -19.916 1.00 0.00 ? 90  TRP B HD1  1  
ATOM   2843  H  HE1  . TRP B 1 90 ? 146.766 9.093   -21.661 1.00 0.00 ? 90  TRP B HE1  1  
ATOM   2844  H  HE3  . TRP B 1 90 ? 144.009 5.679   -18.672 1.00 0.00 ? 90  TRP B HE3  1  
ATOM   2845  H  HZ2  . TRP B 1 90 ? 144.015 8.935   -22.428 1.00 0.00 ? 90  TRP B HZ2  1  
ATOM   2846  H  HZ3  . TRP B 1 90 ? 141.922 6.142   -19.925 1.00 0.00 ? 90  TRP B HZ3  1  
ATOM   2847  H  HH2  . TRP B 1 90 ? 141.919 7.764   -21.800 1.00 0.00 ? 90  TRP B HH2  1  
ATOM   2848  N  N    . GLU B 1 91 ? 149.606 4.542   -19.294 1.00 0.00 ? 91  GLU B N    1  
ATOM   2849  C  CA   . GLU B 1 91 ? 150.702 4.465   -20.256 1.00 0.00 ? 91  GLU B CA   1  
ATOM   2850  C  C    . GLU B 1 91 ? 150.567 3.219   -21.123 1.00 0.00 ? 91  GLU B C    1  
ATOM   2851  O  O    . GLU B 1 91 ? 150.937 3.224   -22.297 1.00 0.00 ? 91  GLU B O    1  
ATOM   2852  C  CB   . GLU B 1 91 ? 152.047 4.442   -19.527 1.00 0.00 ? 91  GLU B CB   1  
ATOM   2853  C  CG   . GLU B 1 91 ? 152.245 5.762   -18.779 1.00 0.00 ? 91  GLU B CG   1  
ATOM   2854  C  CD   . GLU B 1 91 ? 153.611 5.780   -18.103 1.00 0.00 ? 91  GLU B CD   1  
ATOM   2855  O  OE1  . GLU B 1 91 ? 154.259 4.746   -18.093 1.00 0.00 ? 91  GLU B OE1  1  
ATOM   2856  O  OE2  . GLU B 1 91 ? 153.991 6.828   -17.606 1.00 0.00 ? 91  GLU B OE2  1  
ATOM   2857  H  H    . GLU B 1 91 ? 149.804 4.514   -18.331 1.00 0.00 ? 91  GLU B H    1  
ATOM   2858  H  HA   . GLU B 1 91 ? 150.668 5.338   -20.892 1.00 0.00 ? 91  GLU B HA   1  
ATOM   2859  H  HB2  . GLU B 1 91 ? 152.064 3.622   -18.825 1.00 0.00 ? 91  GLU B HB2  1  
ATOM   2860  H  HB3  . GLU B 1 91 ? 152.843 4.317   -20.245 1.00 0.00 ? 91  GLU B HB3  1  
ATOM   2861  H  HG2  . GLU B 1 91 ? 152.180 6.583   -19.479 1.00 0.00 ? 91  GLU B HG2  1  
ATOM   2862  H  HG3  . GLU B 1 91 ? 151.475 5.868   -18.030 1.00 0.00 ? 91  GLU B HG3  1  
ATOM   2863  N  N    . ASN B 1 92 ? 150.031 2.151   -20.538 1.00 0.00 ? 92  ASN B N    1  
ATOM   2864  C  CA   . ASN B 1 92 ? 149.848 0.899   -21.265 1.00 0.00 ? 92  ASN B CA   1  
ATOM   2865  C  C    . ASN B 1 92 ? 148.396 0.736   -21.683 1.00 0.00 ? 92  ASN B C    1  
ATOM   2866  O  O    . ASN B 1 92 ? 147.488 0.852   -20.859 1.00 0.00 ? 92  ASN B O    1  
ATOM   2867  C  CB   . ASN B 1 92 ? 150.241 -0.289  -20.395 1.00 0.00 ? 92  ASN B CB   1  
ATOM   2868  C  CG   . ASN B 1 92 ? 150.402 -1.525  -21.269 1.00 0.00 ? 92  ASN B CG   1  
ATOM   2869  O  OD1  . ASN B 1 92 ? 151.306 -1.582  -22.103 1.00 0.00 ? 92  ASN B OD1  1  
ATOM   2870  N  ND2  . ASN B 1 92 ? 149.572 -2.519  -21.136 1.00 0.00 ? 92  ASN B ND2  1  
ATOM   2871  H  H    . ASN B 1 92 ? 149.754 2.207   -19.599 1.00 0.00 ? 92  ASN B H    1  
ATOM   2872  H  HA   . ASN B 1 92 ? 150.470 0.902   -22.147 1.00 0.00 ? 92  ASN B HA   1  
ATOM   2873  H  HB2  . ASN B 1 92 ? 151.169 -0.077  -19.889 1.00 0.00 ? 92  ASN B HB2  1  
ATOM   2874  H  HB3  . ASN B 1 92 ? 149.462 -0.468  -19.670 1.00 0.00 ? 92  ASN B HB3  1  
ATOM   2875  H  HD21 . ASN B 1 92 ? 148.850 -2.471  -20.476 1.00 0.00 ? 92  ASN B HD21 1  
ATOM   2876  H  HD22 . ASN B 1 92 ? 149.668 -3.312  -21.701 1.00 0.00 ? 92  ASN B HD22 1  
ATOM   2877  N  N    . SER B 1 93 ? 148.189 0.466   -22.964 1.00 0.00 ? 93  SER B N    1  
ATOM   2878  C  CA   . SER B 1 93 ? 146.847 0.279   -23.498 1.00 0.00 ? 93  SER B CA   1  
ATOM   2879  C  C    . SER B 1 93 ? 146.256 1.610   -23.953 1.00 0.00 ? 93  SER B C    1  
ATOM   2880  O  O    . SER B 1 93 ? 145.046 1.682   -24.092 1.00 0.00 ? 93  SER B O    1  
ATOM   2881  C  CB   . SER B 1 93 ? 145.934 -0.357  -22.446 1.00 0.00 ? 93  SER B CB   1  
ATOM   2882  O  OG   . SER B 1 93 ? 146.709 -1.192  -21.595 1.00 0.00 ? 93  SER B OG   1  
ATOM   2883  O  OXT  . SER B 1 93 ? 147.024 2.537   -24.156 1.00 0.00 ? 93  SER B OXT  1  
ATOM   2884  H  H    . SER B 1 93 ? 148.958 0.385   -23.567 1.00 0.00 ? 93  SER B H    1  
ATOM   2885  H  HA   . SER B 1 93 ? 146.909 -0.385  -24.342 1.00 0.00 ? 93  SER B HA   1  
ATOM   2886  H  HB2  . SER B 1 93 ? 145.467 0.414   -21.854 1.00 0.00 ? 93  SER B HB2  1  
ATOM   2887  H  HB3  . SER B 1 93 ? 145.168 -0.941  -22.940 1.00 0.00 ? 93  SER B HB3  1  
ATOM   2888  H  HG   . SER B 1 93 ? 146.999 -1.949  -22.109 1.00 0.00 ? 93  SER B HG   1  
HETATM 2889  CA CA   . CA  C 2 .  ? 129.409 1.757   -12.247 1.00 0.00 ? 201 CA  A CA   1  
HETATM 2890  CA CA   . CA  D 2 .  ? 133.559 12.184  -4.596  1.00 0.00 ? 202 CA  A CA   1  
HETATM 2891  CA CA   . CA  E 2 .  ? 159.977 -2.652  12.737  1.00 0.00 ? 101 CA  B CA   1  
HETATM 2892  CA CA   . CA  F 2 .  ? 152.102 8.392   13.434  1.00 0.00 ? 102 CA  B CA   1  
ATOM   2893  N  N    . GLY A 1 1  ? 157.628 -8.358  -9.855  1.00 0.00 ? 1   GLY A N    2  
ATOM   2894  C  CA   . GLY A 1 1  ? 156.238 -8.512  -9.443  1.00 0.00 ? 1   GLY A CA   2  
ATOM   2895  C  C    . GLY A 1 1  ? 156.138 -8.723  -7.936  1.00 0.00 ? 1   GLY A C    2  
ATOM   2896  O  O    . GLY A 1 1  ? 155.873 -9.832  -7.472  1.00 0.00 ? 1   GLY A O    2  
ATOM   2897  H  H1   . GLY A 1 1  ? 158.288 -9.043  -9.622  1.00 0.00 ? 1   GLY A H1   2  
ATOM   2898  H  HA2  . GLY A 1 1  ? 155.686 -7.624  -9.715  1.00 0.00 ? 1   GLY A HA2  2  
ATOM   2899  H  HA3  . GLY A 1 1  ? 155.810 -9.365  -9.946  1.00 0.00 ? 1   GLY A HA3  2  
ATOM   2900  N  N    . SER A 1 2  ? 156.353 -7.654  -7.177  1.00 0.00 ? 2   SER A N    2  
ATOM   2901  C  CA   . SER A 1 2  ? 156.286 -7.736  -5.723  1.00 0.00 ? 2   SER A CA   2  
ATOM   2902  C  C    . SER A 1 2  ? 154.881 -8.118  -5.271  1.00 0.00 ? 2   SER A C    2  
ATOM   2903  O  O    . SER A 1 2  ? 153.894 -7.855  -5.969  1.00 0.00 ? 2   SER A O    2  
ATOM   2904  C  CB   . SER A 1 2  ? 156.671 -6.392  -5.107  1.00 0.00 ? 2   SER A CB   2  
ATOM   2905  O  OG   . SER A 1 2  ? 157.975 -6.031  -5.543  1.00 0.00 ? 2   SER A OG   2  
ATOM   2906  H  H    . SER A 1 2  ? 156.562 -6.795  -7.602  1.00 0.00 ? 2   SER A H    2  
ATOM   2907  H  HA   . SER A 1 2  ? 156.981 -8.488  -5.381  1.00 0.00 ? 2   SER A HA   2  
ATOM   2908  H  HB2  . SER A 1 2  ? 155.971 -5.636  -5.422  1.00 0.00 ? 2   SER A HB2  2  
ATOM   2909  H  HB3  . SER A 1 2  ? 156.649 -6.472  -4.028  1.00 0.00 ? 2   SER A HB3  2  
ATOM   2910  H  HG   . SER A 1 2  ? 158.195 -6.577  -6.301  1.00 0.00 ? 2   SER A HG   2  
ATOM   2911  N  N    . GLU A 1 3  ? 154.788 -8.736  -4.098  1.00 0.00 ? 3   GLU A N    2  
ATOM   2912  C  CA   . GLU A 1 3  ? 153.492 -9.139  -3.579  1.00 0.00 ? 3   GLU A CA   2  
ATOM   2913  C  C    . GLU A 1 3  ? 152.610 -7.915  -3.381  1.00 0.00 ? 3   GLU A C    2  
ATOM   2914  O  O    . GLU A 1 3  ? 151.402 -7.968  -3.608  1.00 0.00 ? 3   GLU A O    2  
ATOM   2915  C  CB   . GLU A 1 3  ? 153.660 -9.868  -2.245  1.00 0.00 ? 3   GLU A CB   2  
ATOM   2916  C  CG   . GLU A 1 3  ? 154.432 -11.170 -2.467  1.00 0.00 ? 3   GLU A CG   2  
ATOM   2917  C  CD   . GLU A 1 3  ? 154.546 -11.937 -1.154  1.00 0.00 ? 3   GLU A CD   2  
ATOM   2918  O  OE1  . GLU A 1 3  ? 154.193 -11.376 -0.130  1.00 0.00 ? 3   GLU A OE1  2  
ATOM   2919  O  OE2  . GLU A 1 3  ? 154.987 -13.075 -1.191  1.00 0.00 ? 3   GLU A OE2  2  
ATOM   2920  H  H    . GLU A 1 3  ? 155.598 -8.920  -3.579  1.00 0.00 ? 3   GLU A H    2  
ATOM   2921  H  HA   . GLU A 1 3  ? 153.019 -9.804  -4.286  1.00 0.00 ? 3   GLU A HA   2  
ATOM   2922  H  HB2  . GLU A 1 3  ? 154.206 -9.238  -1.558  1.00 0.00 ? 3   GLU A HB2  2  
ATOM   2923  H  HB3  . GLU A 1 3  ? 152.688 -10.094 -1.833  1.00 0.00 ? 3   GLU A HB3  2  
ATOM   2924  H  HG2  . GLU A 1 3  ? 153.910 -11.777 -3.193  1.00 0.00 ? 3   GLU A HG2  2  
ATOM   2925  H  HG3  . GLU A 1 3  ? 155.420 -10.941 -2.834  1.00 0.00 ? 3   GLU A HG3  2  
ATOM   2926  N  N    . LEU A 1 4  ? 153.221 -6.804  -2.973  1.00 0.00 ? 4   LEU A N    2  
ATOM   2927  C  CA   . LEU A 1 4  ? 152.461 -5.580  -2.778  1.00 0.00 ? 4   LEU A CA   2  
ATOM   2928  C  C    . LEU A 1 4  ? 151.802 -5.184  -4.091  1.00 0.00 ? 4   LEU A C    2  
ATOM   2929  O  O    . LEU A 1 4  ? 150.630 -4.796  -4.130  1.00 0.00 ? 4   LEU A O    2  
ATOM   2930  C  CB   . LEU A 1 4  ? 153.409 -4.456  -2.338  1.00 0.00 ? 4   LEU A CB   2  
ATOM   2931  C  CG   . LEU A 1 4  ? 152.619 -3.182  -2.019  1.00 0.00 ? 4   LEU A CG   2  
ATOM   2932  C  CD1  . LEU A 1 4  ? 152.015 -3.279  -0.615  1.00 0.00 ? 4   LEU A CD1  2  
ATOM   2933  C  CD2  . LEU A 1 4  ? 153.552 -1.965  -2.100  1.00 0.00 ? 4   LEU A CD2  2  
ATOM   2934  H  H    . LEU A 1 4  ? 154.189 -6.808  -2.818  1.00 0.00 ? 4   LEU A H    2  
ATOM   2935  H  HA   . LEU A 1 4  ? 151.708 -5.734  -2.021  1.00 0.00 ? 4   LEU A HA   2  
ATOM   2936  H  HB2  . LEU A 1 4  ? 153.954 -4.771  -1.461  1.00 0.00 ? 4   LEU A HB2  2  
ATOM   2937  H  HB3  . LEU A 1 4  ? 154.106 -4.251  -3.137  1.00 0.00 ? 4   LEU A HB3  2  
ATOM   2938  H  HG   . LEU A 1 4  ? 151.820 -3.067  -2.733  1.00 0.00 ? 4   LEU A HG   2  
ATOM   2939  H  HD11 . LEU A 1 4  ? 151.618 -2.317  -0.328  1.00 0.00 ? 4   LEU A HD11 2  
ATOM   2940  H  HD12 . LEU A 1 4  ? 152.780 -3.576  0.087   1.00 0.00 ? 4   LEU A HD12 2  
ATOM   2941  H  HD13 . LEU A 1 4  ? 151.221 -4.011  -0.614  1.00 0.00 ? 4   LEU A HD13 2  
ATOM   2942  H  HD21 . LEU A 1 4  ? 154.067 -1.966  -3.053  1.00 0.00 ? 4   LEU A HD21 2  
ATOM   2943  H  HD22 . LEU A 1 4  ? 154.276 -2.012  -1.301  1.00 0.00 ? 4   LEU A HD22 2  
ATOM   2944  H  HD23 . LEU A 1 4  ? 152.972 -1.059  -2.007  1.00 0.00 ? 4   LEU A HD23 2  
ATOM   2945  N  N    . GLU A 1 5  ? 152.569 -5.302  -5.175  1.00 0.00 ? 5   GLU A N    2  
ATOM   2946  C  CA   . GLU A 1 5  ? 152.053 -4.968  -6.489  1.00 0.00 ? 5   GLU A CA   2  
ATOM   2947  C  C    . GLU A 1 5  ? 150.942 -5.923  -6.884  1.00 0.00 ? 5   GLU A C    2  
ATOM   2948  O  O    . GLU A 1 5  ? 149.927 -5.510  -7.441  1.00 0.00 ? 5   GLU A O    2  
ATOM   2949  C  CB   . GLU A 1 5  ? 153.177 -5.036  -7.525  1.00 0.00 ? 5   GLU A CB   2  
ATOM   2950  C  CG   . GLU A 1 5  ? 152.657 -4.551  -8.878  1.00 0.00 ? 5   GLU A CG   2  
ATOM   2951  C  CD   . GLU A 1 5  ? 153.740 -4.709  -9.941  1.00 0.00 ? 5   GLU A CD   2  
ATOM   2952  O  OE1  . GLU A 1 5  ? 154.806 -5.197  -9.603  1.00 0.00 ? 5   GLU A OE1  2  
ATOM   2953  O  OE2  . GLU A 1 5  ? 153.486 -4.344  -11.076 1.00 0.00 ? 5   GLU A OE2  2  
ATOM   2954  H  H    . GLU A 1 5  ? 153.489 -5.627  -5.084  1.00 0.00 ? 5   GLU A H    2  
ATOM   2955  H  HA   . GLU A 1 5  ? 151.661 -3.962  -6.467  1.00 0.00 ? 5   GLU A HA   2  
ATOM   2956  H  HB2  . GLU A 1 5  ? 153.997 -4.408  -7.206  1.00 0.00 ? 5   GLU A HB2  2  
ATOM   2957  H  HB3  . GLU A 1 5  ? 153.519 -6.055  -7.617  1.00 0.00 ? 5   GLU A HB3  2  
ATOM   2958  H  HG2  . GLU A 1 5  ? 151.790 -5.132  -9.158  1.00 0.00 ? 5   GLU A HG2  2  
ATOM   2959  H  HG3  . GLU A 1 5  ? 152.381 -3.509  -8.803  1.00 0.00 ? 5   GLU A HG3  2  
ATOM   2960  N  N    . THR A 1 6  ? 151.135 -7.206  -6.589  1.00 0.00 ? 6   THR A N    2  
ATOM   2961  C  CA   . THR A 1 6  ? 150.121 -8.194  -6.926  1.00 0.00 ? 6   THR A CA   2  
ATOM   2962  C  C    . THR A 1 6  ? 148.815 -7.897  -6.201  1.00 0.00 ? 6   THR A C    2  
ATOM   2963  O  O    . THR A 1 6  ? 147.734 -7.989  -6.782  1.00 0.00 ? 6   THR A O    2  
ATOM   2964  C  CB   . THR A 1 6  ? 150.608 -9.595  -6.548  1.00 0.00 ? 6   THR A CB   2  
ATOM   2965  O  OG1  . THR A 1 6  ? 151.865 -9.839  -7.163  1.00 0.00 ? 6   THR A OG1  2  
ATOM   2966  C  CG2  . THR A 1 6  ? 149.593 -10.634 -7.025  1.00 0.00 ? 6   THR A CG2  2  
ATOM   2967  H  H    . THR A 1 6  ? 151.966 -7.486  -6.140  1.00 0.00 ? 6   THR A H    2  
ATOM   2968  H  HA   . THR A 1 6  ? 149.945 -8.164  -7.991  1.00 0.00 ? 6   THR A HA   2  
ATOM   2969  H  HB   . THR A 1 6  ? 150.711 -9.663  -5.476  1.00 0.00 ? 6   THR A HB   2  
ATOM   2970  H  HG1  . THR A 1 6  ? 152.238 -10.634 -6.772  1.00 0.00 ? 6   THR A HG1  2  
ATOM   2971  H  HG21 . THR A 1 6  ? 148.695 -10.560 -6.430  1.00 0.00 ? 6   THR A HG21 2  
ATOM   2972  H  HG22 . THR A 1 6  ? 150.014 -11.623 -6.920  1.00 0.00 ? 6   THR A HG22 2  
ATOM   2973  H  HG23 . THR A 1 6  ? 149.353 -10.453 -8.062  1.00 0.00 ? 6   THR A HG23 2  
ATOM   2974  N  N    . ALA A 1 7  ? 148.928 -7.540  -4.925  1.00 0.00 ? 7   ALA A N    2  
ATOM   2975  C  CA   . ALA A 1 7  ? 147.751 -7.230  -4.124  1.00 0.00 ? 7   ALA A CA   2  
ATOM   2976  C  C    . ALA A 1 7  ? 147.065 -5.955  -4.600  1.00 0.00 ? 7   ALA A C    2  
ATOM   2977  O  O    . ALA A 1 7  ? 145.839 -5.868  -4.614  1.00 0.00 ? 7   ALA A O    2  
ATOM   2978  C  CB   . ALA A 1 7  ? 148.150 -7.073  -2.656  1.00 0.00 ? 7   ALA A CB   2  
ATOM   2979  H  H    . ALA A 1 7  ? 149.817 -7.484  -4.517  1.00 0.00 ? 7   ALA A H    2  
ATOM   2980  H  HA   . ALA A 1 7  ? 147.053 -8.049  -4.204  1.00 0.00 ? 7   ALA A HA   2  
ATOM   2981  H  HB1  . ALA A 1 7  ? 148.460 -6.055  -2.474  1.00 0.00 ? 7   ALA A HB1  2  
ATOM   2982  H  HB2  . ALA A 1 7  ? 148.967 -7.742  -2.434  1.00 0.00 ? 7   ALA A HB2  2  
ATOM   2983  H  HB3  . ALA A 1 7  ? 147.306 -7.311  -2.026  1.00 0.00 ? 7   ALA A HB3  2  
ATOM   2984  N  N    . MET A 1 8  ? 147.863 -4.953  -4.960  1.00 0.00 ? 8   MET A N    2  
ATOM   2985  C  CA   . MET A 1 8  ? 147.305 -3.678  -5.400  1.00 0.00 ? 8   MET A CA   2  
ATOM   2986  C  C    . MET A 1 8  ? 146.431 -3.829  -6.645  1.00 0.00 ? 8   MET A C    2  
ATOM   2987  O  O    . MET A 1 8  ? 145.322 -3.282  -6.716  1.00 0.00 ? 8   MET A O    2  
ATOM   2988  C  CB   . MET A 1 8  ? 148.456 -2.727  -5.726  1.00 0.00 ? 8   MET A CB   2  
ATOM   2989  C  CG   . MET A 1 8  ? 147.914 -1.324  -5.988  1.00 0.00 ? 8   MET A CG   2  
ATOM   2990  S  SD   . MET A 1 8  ? 149.251 -0.278  -6.616  1.00 0.00 ? 8   MET A SD   2  
ATOM   2991  C  CE   . MET A 1 8  ? 150.324 -0.381  -5.163  1.00 0.00 ? 8   MET A CE   2  
ATOM   2992  H  H    . MET A 1 8  ? 148.841 -5.065  -4.907  1.00 0.00 ? 8   MET A H    2  
ATOM   2993  H  HA   . MET A 1 8  ? 146.718 -3.252  -4.602  1.00 0.00 ? 8   MET A HA   2  
ATOM   2994  H  HB2  . MET A 1 8  ? 149.143 -2.697  -4.892  1.00 0.00 ? 8   MET A HB2  2  
ATOM   2995  H  HB3  . MET A 1 8  ? 148.974 -3.080  -6.605  1.00 0.00 ? 8   MET A HB3  2  
ATOM   2996  H  HG2  . MET A 1 8  ? 147.119 -1.374  -6.718  1.00 0.00 ? 8   MET A HG2  2  
ATOM   2997  H  HG3  . MET A 1 8  ? 147.534 -0.909  -5.066  1.00 0.00 ? 8   MET A HG3  2  
ATOM   2998  H  HE1  . MET A 1 8  ? 150.946 0.503   -5.112  1.00 0.00 ? 8   MET A HE1  2  
ATOM   2999  H  HE2  . MET A 1 8  ? 150.953 -1.254  -5.241  1.00 0.00 ? 8   MET A HE2  2  
ATOM   3000  H  HE3  . MET A 1 8  ? 149.717 -0.455  -4.272  1.00 0.00 ? 8   MET A HE3  2  
ATOM   3001  N  N    . GLU A 1 9  ? 146.923 -4.595  -7.615  1.00 0.00 ? 9   GLU A N    2  
ATOM   3002  C  CA   . GLU A 1 9  ? 146.188 -4.800  -8.856  1.00 0.00 ? 9   GLU A CA   2  
ATOM   3003  C  C    . GLU A 1 9  ? 144.830 -5.392  -8.569  1.00 0.00 ? 9   GLU A C    2  
ATOM   3004  O  O    . GLU A 1 9  ? 143.857 -5.119  -9.272  1.00 0.00 ? 9   GLU A O    2  
ATOM   3005  C  CB   . GLU A 1 9  ? 146.972 -5.721  -9.791  1.00 0.00 ? 9   GLU A CB   2  
ATOM   3006  C  CG   . GLU A 1 9  ? 148.272 -5.031  -10.211 1.00 0.00 ? 9   GLU A CG   2  
ATOM   3007  C  CD   . GLU A 1 9  ? 149.038 -5.911  -11.193 1.00 0.00 ? 9   GLU A CD   2  
ATOM   3008  O  OE1  . GLU A 1 9  ? 148.638 -7.049  -11.374 1.00 0.00 ? 9   GLU A OE1  2  
ATOM   3009  O  OE2  . GLU A 1 9  ? 150.014 -5.434  -11.748 1.00 0.00 ? 9   GLU A OE2  2  
ATOM   3010  H  H    . GLU A 1 9  ? 147.798 -5.019  -7.497  1.00 0.00 ? 9   GLU A H    2  
ATOM   3011  H  HA   . GLU A 1 9  ? 146.054 -3.845  -9.342  1.00 0.00 ? 9   GLU A HA   2  
ATOM   3012  H  HB2  . GLU A 1 9  ? 147.202 -6.644  -9.278  1.00 0.00 ? 9   GLU A HB2  2  
ATOM   3013  H  HB3  . GLU A 1 9  ? 146.380 -5.934  -10.669 1.00 0.00 ? 9   GLU A HB3  2  
ATOM   3014  H  HG2  . GLU A 1 9  ? 148.039 -4.088  -10.682 1.00 0.00 ? 9   GLU A HG2  2  
ATOM   3015  H  HG3  . GLU A 1 9  ? 148.881 -4.853  -9.340  1.00 0.00 ? 9   GLU A HG3  2  
ATOM   3016  N  N    . THR A 1 10 ? 144.760 -6.193  -7.525  1.00 0.00 ? 10  THR A N    2  
ATOM   3017  C  CA   . THR A 1 10 ? 143.506 -6.799  -7.155  1.00 0.00 ? 10  THR A CA   2  
ATOM   3018  C  C    . THR A 1 10 ? 142.451 -5.723  -6.914  1.00 0.00 ? 10  THR A C    2  
ATOM   3019  O  O    . THR A 1 10 ? 141.282 -5.923  -7.243  1.00 0.00 ? 10  THR A O    2  
ATOM   3020  C  CB   . THR A 1 10 ? 143.673 -7.651  -5.893  1.00 0.00 ? 10  THR A CB   2  
ATOM   3021  O  OG1  . THR A 1 10 ? 144.721 -8.588  -6.094  1.00 0.00 ? 10  THR A OG1  2  
ATOM   3022  C  CG2  . THR A 1 10 ? 142.369 -8.400  -5.595  1.00 0.00 ? 10  THR A CG2  2  
ATOM   3023  H  H    . THR A 1 10 ? 145.564 -6.369  -6.991  1.00 0.00 ? 10  THR A H    2  
ATOM   3024  H  HA   . THR A 1 10 ? 143.176 -7.435  -7.962  1.00 0.00 ? 10  THR A HA   2  
ATOM   3025  H  HB   . THR A 1 10 ? 143.914 -7.013  -5.057  1.00 0.00 ? 10  THR A HB   2  
ATOM   3026  H  HG1  . THR A 1 10 ? 145.054 -8.473  -6.987  1.00 0.00 ? 10  THR A HG1  2  
ATOM   3027  H  HG21 . THR A 1 10 ? 141.834 -8.582  -6.517  1.00 0.00 ? 10  THR A HG21 2  
ATOM   3028  H  HG22 . THR A 1 10 ? 141.756 -7.806  -4.935  1.00 0.00 ? 10  THR A HG22 2  
ATOM   3029  H  HG23 . THR A 1 10 ? 142.597 -9.344  -5.122  1.00 0.00 ? 10  THR A HG23 2  
ATOM   3030  N  N    . LEU A 1 11 ? 142.846 -4.580  -6.329  1.00 0.00 ? 11  LEU A N    2  
ATOM   3031  C  CA   . LEU A 1 11 ? 141.859 -3.533  -6.072  1.00 0.00 ? 11  LEU A CA   2  
ATOM   3032  C  C    . LEU A 1 11 ? 141.271 -3.014  -7.378  1.00 0.00 ? 11  LEU A C    2  
ATOM   3033  O  O    . LEU A 1 11 ? 140.063 -2.772  -7.490  1.00 0.00 ? 11  LEU A O    2  
ATOM   3034  C  CB   . LEU A 1 11 ? 142.507 -2.361  -5.329  1.00 0.00 ? 11  LEU A CB   2  
ATOM   3035  C  CG   . LEU A 1 11 ? 143.141 -2.848  -4.027  1.00 0.00 ? 11  LEU A CG   2  
ATOM   3036  C  CD1  . LEU A 1 11 ? 143.658 -1.648  -3.232  1.00 0.00 ? 11  LEU A CD1  2  
ATOM   3037  C  CD2  . LEU A 1 11 ? 142.101 -3.601  -3.191  1.00 0.00 ? 11  LEU A CD2  2  
ATOM   3038  H  H    . LEU A 1 11 ? 143.799 -4.441  -6.083  1.00 0.00 ? 11  LEU A H    2  
ATOM   3039  H  HA   . LEU A 1 11 ? 141.064 -3.938  -5.464  1.00 0.00 ? 11  LEU A HA   2  
ATOM   3040  H  HB2  . LEU A 1 11 ? 143.268 -1.918  -5.954  1.00 0.00 ? 11  LEU A HB2  2  
ATOM   3041  H  HB3  . LEU A 1 11 ? 141.754 -1.621  -5.104  1.00 0.00 ? 11  LEU A HB3  2  
ATOM   3042  H  HG   . LEU A 1 11 ? 143.964 -3.503  -4.259  1.00 0.00 ? 11  LEU A HG   2  
ATOM   3043  H  HD11 . LEU A 1 11 ? 142.925 -0.855  -3.258  1.00 0.00 ? 11  LEU A HD11 2  
ATOM   3044  H  HD12 . LEU A 1 11 ? 144.582 -1.298  -3.669  1.00 0.00 ? 11  LEU A HD12 2  
ATOM   3045  H  HD13 . LEU A 1 11 ? 143.834 -1.943  -2.208  1.00 0.00 ? 11  LEU A HD13 2  
ATOM   3046  H  HD21 . LEU A 1 11 ? 141.134 -3.137  -3.316  1.00 0.00 ? 11  LEU A HD21 2  
ATOM   3047  H  HD22 . LEU A 1 11 ? 142.383 -3.569  -2.149  1.00 0.00 ? 11  LEU A HD22 2  
ATOM   3048  H  HD23 . LEU A 1 11 ? 142.052 -4.629  -3.519  1.00 0.00 ? 11  LEU A HD23 2  
ATOM   3049  N  N    . ILE A 1 12 ? 142.139 -2.838  -8.364  1.00 0.00 ? 12  ILE A N    2  
ATOM   3050  C  CA   . ILE A 1 12 ? 141.714 -2.337  -9.657  1.00 0.00 ? 12  ILE A CA   2  
ATOM   3051  C  C    . ILE A 1 12 ? 140.783 -3.312  -10.370 1.00 0.00 ? 12  ILE A C    2  
ATOM   3052  O  O    . ILE A 1 12 ? 139.772 -2.907  -10.943 1.00 0.00 ? 12  ILE A O    2  
ATOM   3053  C  CB   . ILE A 1 12 ? 142.942 -2.053  -10.520 1.00 0.00 ? 12  ILE A CB   2  
ATOM   3054  C  CG1  . ILE A 1 12 ? 143.824 -1.028  -9.798  1.00 0.00 ? 12  ILE A CG1  2  
ATOM   3055  C  CG2  . ILE A 1 12 ? 142.497 -1.488  -11.871 1.00 0.00 ? 12  ILE A CG2  2  
ATOM   3056  C  CD1  . ILE A 1 12 ? 145.122 -0.810  -10.582 1.00 0.00 ? 12  ILE A CD1  2  
ATOM   3057  H  H    . ILE A 1 12 ? 143.086 -3.043  -8.213  1.00 0.00 ? 12  ILE A H    2  
ATOM   3058  H  HA   . ILE A 1 12 ? 141.185 -1.409  -9.506  1.00 0.00 ? 12  ILE A HA   2  
ATOM   3059  H  HB   . ILE A 1 12 ? 143.497 -2.967  -10.674 1.00 0.00 ? 12  ILE A HB   2  
ATOM   3060  H  HG12 . ILE A 1 12 ? 143.293 -0.091  -9.718  1.00 0.00 ? 12  ILE A HG12 2  
ATOM   3061  H  HG13 . ILE A 1 12 ? 144.061 -1.393  -8.805  1.00 0.00 ? 12  ILE A HG13 2  
ATOM   3062  H  HG21 . ILE A 1 12 ? 141.870 -0.624  -11.711 1.00 0.00 ? 12  ILE A HG21 2  
ATOM   3063  H  HG22 . ILE A 1 12 ? 141.940 -2.241  -12.410 1.00 0.00 ? 12  ILE A HG22 2  
ATOM   3064  H  HG23 . ILE A 1 12 ? 143.365 -1.203  -12.446 1.00 0.00 ? 12  ILE A HG23 2  
ATOM   3065  H  HD11 . ILE A 1 12 ? 144.897 -0.701  -11.632 1.00 0.00 ? 12  ILE A HD11 2  
ATOM   3066  H  HD12 . ILE A 1 12 ? 145.775 -1.658  -10.441 1.00 0.00 ? 12  ILE A HD12 2  
ATOM   3067  H  HD13 . ILE A 1 12 ? 145.613 0.085   -10.225 1.00 0.00 ? 12  ILE A HD13 2  
ATOM   3068  N  N    . ASN A 1 13 ? 141.134 -4.597  -10.352 1.00 0.00 ? 13  ASN A N    2  
ATOM   3069  C  CA   . ASN A 1 13 ? 140.314 -5.596  -11.028 1.00 0.00 ? 13  ASN A CA   2  
ATOM   3070  C  C    . ASN A 1 13 ? 138.901 -5.653  -10.455 1.00 0.00 ? 13  ASN A C    2  
ATOM   3071  O  O    . ASN A 1 13 ? 137.923 -5.753  -11.205 1.00 0.00 ? 13  ASN A O    2  
ATOM   3072  C  CB   . ASN A 1 13 ? 140.967 -6.973  -10.900 1.00 0.00 ? 13  ASN A CB   2  
ATOM   3073  C  CG   . ASN A 1 13 ? 142.305 -6.985  -11.632 1.00 0.00 ? 13  ASN A CG   2  
ATOM   3074  O  OD1  . ASN A 1 13 ? 142.564 -6.120  -12.470 1.00 0.00 ? 13  ASN A OD1  2  
ATOM   3075  N  ND2  . ASN A 1 13 ? 143.177 -7.919  -11.364 1.00 0.00 ? 13  ASN A ND2  2  
ATOM   3076  H  H    . ASN A 1 13 ? 141.956 -4.871  -9.895  1.00 0.00 ? 13  ASN A H    2  
ATOM   3077  H  HA   . ASN A 1 13 ? 140.252 -5.343  -12.076 1.00 0.00 ? 13  ASN A HA   2  
ATOM   3078  H  HB2  . ASN A 1 13 ? 141.128 -7.198  -9.856  1.00 0.00 ? 13  ASN A HB2  2  
ATOM   3079  H  HB3  . ASN A 1 13 ? 140.318 -7.720  -11.332 1.00 0.00 ? 13  ASN A HB3  2  
ATOM   3080  H  HD21 . ASN A 1 13 ? 142.969 -8.607  -10.697 1.00 0.00 ? 13  ASN A HD21 2  
ATOM   3081  H  HD22 . ASN A 1 13 ? 144.039 -7.934  -11.831 1.00 0.00 ? 13  ASN A HD22 2  
ATOM   3082  N  N    . VAL A 1 14 ? 138.785 -5.574  -9.130  1.00 0.00 ? 14  VAL A N    2  
ATOM   3083  C  CA   . VAL A 1 14 ? 137.465 -5.614  -8.517  1.00 0.00 ? 14  VAL A CA   2  
ATOM   3084  C  C    . VAL A 1 14 ? 136.733 -4.305  -8.756  1.00 0.00 ? 14  VAL A C    2  
ATOM   3085  O  O    . VAL A 1 14 ? 135.535 -4.299  -9.039  1.00 0.00 ? 14  VAL A O    2  
ATOM   3086  C  CB   . VAL A 1 14 ? 137.570 -5.916  -7.016  1.00 0.00 ? 14  VAL A CB   2  
ATOM   3087  C  CG1  . VAL A 1 14 ? 138.294 -7.249  -6.818  1.00 0.00 ? 14  VAL A CG1  2  
ATOM   3088  C  CG2  . VAL A 1 14 ? 138.359 -4.813  -6.308  1.00 0.00 ? 14  VAL A CG2  2  
ATOM   3089  H  H    . VAL A 1 14 ? 139.584 -5.484  -8.570  1.00 0.00 ? 14  VAL A H    2  
ATOM   3090  H  HA   . VAL A 1 14 ? 136.901 -6.408  -8.984  1.00 0.00 ? 14  VAL A HA   2  
ATOM   3091  H  HB   . VAL A 1 14 ? 136.578 -5.982  -6.592  1.00 0.00 ? 14  VAL A HB   2  
ATOM   3092  H  HG11 . VAL A 1 14 ? 138.693 -7.297  -5.815  1.00 0.00 ? 14  VAL A HG11 2  
ATOM   3093  H  HG12 . VAL A 1 14 ? 139.102 -7.328  -7.531  1.00 0.00 ? 14  VAL A HG12 2  
ATOM   3094  H  HG13 . VAL A 1 14 ? 137.599 -8.061  -6.969  1.00 0.00 ? 14  VAL A HG13 2  
ATOM   3095  H  HG21 . VAL A 1 14 ? 137.878 -3.861  -6.473  1.00 0.00 ? 14  VAL A HG21 2  
ATOM   3096  H  HG22 . VAL A 1 14 ? 139.361 -4.786  -6.701  1.00 0.00 ? 14  VAL A HG22 2  
ATOM   3097  H  HG23 . VAL A 1 14 ? 138.393 -5.020  -5.246  1.00 0.00 ? 14  VAL A HG23 2  
ATOM   3098  N  N    . PHE A 1 15 ? 137.458 -3.192  -8.679  1.00 0.00 ? 15  PHE A N    2  
ATOM   3099  C  CA   . PHE A 1 15 ? 136.839 -1.898  -8.924  1.00 0.00 ? 15  PHE A CA   2  
ATOM   3100  C  C    . PHE A 1 15 ? 136.291 -1.843  -10.345 1.00 0.00 ? 15  PHE A C    2  
ATOM   3101  O  O    . PHE A 1 15 ? 135.147 -1.442  -10.573 1.00 0.00 ? 15  PHE A O    2  
ATOM   3102  C  CB   . PHE A 1 15 ? 137.881 -0.791  -8.736  1.00 0.00 ? 15  PHE A CB   2  
ATOM   3103  C  CG   . PHE A 1 15 ? 137.232 0.565   -8.888  1.00 0.00 ? 15  PHE A CG   2  
ATOM   3104  C  CD1  . PHE A 1 15 ? 136.618 1.181   -7.791  1.00 0.00 ? 15  PHE A CD1  2  
ATOM   3105  C  CD2  . PHE A 1 15 ? 137.254 1.210   -10.130 1.00 0.00 ? 15  PHE A CD2  2  
ATOM   3106  C  CE1  . PHE A 1 15 ? 136.028 2.442   -7.938  1.00 0.00 ? 15  PHE A CE1  2  
ATOM   3107  C  CE2  . PHE A 1 15 ? 136.662 2.470   -10.276 1.00 0.00 ? 15  PHE A CE2  2  
ATOM   3108  C  CZ   . PHE A 1 15 ? 136.049 3.086   -9.180  1.00 0.00 ? 15  PHE A CZ   2  
ATOM   3109  H  H    . PHE A 1 15 ? 138.420 -3.245  -8.471  1.00 0.00 ? 15  PHE A H    2  
ATOM   3110  H  HA   . PHE A 1 15 ? 136.033 -1.748  -8.223  1.00 0.00 ? 15  PHE A HA   2  
ATOM   3111  H  HB2  . PHE A 1 15 ? 138.314 -0.873  -7.750  1.00 0.00 ? 15  PHE A HB2  2  
ATOM   3112  H  HB3  . PHE A 1 15 ? 138.658 -0.901  -9.478  1.00 0.00 ? 15  PHE A HB3  2  
ATOM   3113  H  HD1  . PHE A 1 15 ? 136.598 0.684   -6.833  1.00 0.00 ? 15  PHE A HD1  2  
ATOM   3114  H  HD2  . PHE A 1 15 ? 137.727 0.735   -10.977 1.00 0.00 ? 15  PHE A HD2  2  
ATOM   3115  H  HE1  . PHE A 1 15 ? 135.557 2.918   -7.091  1.00 0.00 ? 15  PHE A HE1  2  
ATOM   3116  H  HE2  . PHE A 1 15 ? 136.679 2.967   -11.235 1.00 0.00 ? 15  PHE A HE2  2  
ATOM   3117  H  HZ   . PHE A 1 15 ? 135.594 4.058   -9.293  1.00 0.00 ? 15  PHE A HZ   2  
ATOM   3118  N  N    . HIS A 1 16 ? 137.127 -2.255  -11.294 1.00 0.00 ? 16  HIS A N    2  
ATOM   3119  C  CA   . HIS A 1 16 ? 136.742 -2.257  -12.699 1.00 0.00 ? 16  HIS A CA   2  
ATOM   3120  C  C    . HIS A 1 16 ? 135.573 -3.196  -12.974 1.00 0.00 ? 16  HIS A C    2  
ATOM   3121  O  O    . HIS A 1 16 ? 134.631 -2.830  -13.678 1.00 0.00 ? 16  HIS A O    2  
ATOM   3122  C  CB   . HIS A 1 16 ? 137.937 -2.673  -13.558 1.00 0.00 ? 16  HIS A CB   2  
ATOM   3123  C  CG   . HIS A 1 16 ? 137.560 -2.598  -15.011 1.00 0.00 ? 16  HIS A CG   2  
ATOM   3124  N  ND1  . HIS A 1 16 ? 137.104 -3.702  -15.714 1.00 0.00 ? 16  HIS A ND1  2  
ATOM   3125  C  CD2  . HIS A 1 16 ? 137.565 -1.558  -15.908 1.00 0.00 ? 16  HIS A CD2  2  
ATOM   3126  C  CE1  . HIS A 1 16 ? 136.854 -3.306  -16.976 1.00 0.00 ? 16  HIS A CE1  2  
ATOM   3127  N  NE2  . HIS A 1 16 ? 137.118 -2.007  -17.148 1.00 0.00 ? 16  HIS A NE2  2  
ATOM   3128  H  H    . HIS A 1 16 ? 138.023 -2.562  -11.044 1.00 0.00 ? 16  HIS A H    2  
ATOM   3129  H  HA   . HIS A 1 16 ? 136.454 -1.256  -12.979 1.00 0.00 ? 16  HIS A HA   2  
ATOM   3130  H  HB2  . HIS A 1 16 ? 138.767 -2.009  -13.366 1.00 0.00 ? 16  HIS A HB2  2  
ATOM   3131  H  HB3  . HIS A 1 16 ? 138.222 -3.685  -13.312 1.00 0.00 ? 16  HIS A HB3  2  
ATOM   3132  H  HD1  . HIS A 1 16 ? 136.984 -4.607  -15.358 1.00 0.00 ? 16  HIS A HD1  2  
ATOM   3133  H  HD2  . HIS A 1 16 ? 137.868 -0.546  -15.686 1.00 0.00 ? 16  HIS A HD2  2  
ATOM   3134  H  HE1  . HIS A 1 16 ? 136.487 -3.957  -17.755 1.00 0.00 ? 16  HIS A HE1  2  
ATOM   3135  H  HE2  . HIS A 1 16 ? 137.020 -1.484  -17.971 1.00 0.00 ? 16  HIS A HE2  2  
ATOM   3136  N  N    . ALA A 1 17 ? 135.641 -4.418  -12.444 1.00 0.00 ? 17  ALA A N    2  
ATOM   3137  C  CA   . ALA A 1 17 ? 134.575 -5.383  -12.691 1.00 0.00 ? 17  ALA A CA   2  
ATOM   3138  C  C    . ALA A 1 17 ? 133.256 -4.950  -12.064 1.00 0.00 ? 17  ALA A C    2  
ATOM   3139  O  O    . ALA A 1 17 ? 132.217 -4.965  -12.725 1.00 0.00 ? 17  ALA A O    2  
ATOM   3140  C  CB   . ALA A 1 17 ? 134.973 -6.750  -12.136 1.00 0.00 ? 17  ALA A CB   2  
ATOM   3141  H  H    . ALA A 1 17 ? 136.425 -4.680  -11.905 1.00 0.00 ? 17  ALA A H    2  
ATOM   3142  H  HA   . ALA A 1 17 ? 134.430 -5.477  -13.756 1.00 0.00 ? 17  ALA A HA   2  
ATOM   3143  H  HB1  . ALA A 1 17 ? 134.099 -7.383  -12.077 1.00 0.00 ? 17  ALA A HB1  2  
ATOM   3144  H  HB2  . ALA A 1 17 ? 135.395 -6.629  -11.149 1.00 0.00 ? 17  ALA A HB2  2  
ATOM   3145  H  HB3  . ALA A 1 17 ? 135.704 -7.205  -12.787 1.00 0.00 ? 17  ALA A HB3  2  
ATOM   3146  N  N    . HIS A 1 18 ? 133.288 -4.568  -10.792 1.00 0.00 ? 18  HIS A N    2  
ATOM   3147  C  CA   . HIS A 1 18 ? 132.065 -4.146  -10.127 1.00 0.00 ? 18  HIS A CA   2  
ATOM   3148  C  C    . HIS A 1 18 ? 131.478 -2.895  -10.771 1.00 0.00 ? 18  HIS A C    2  
ATOM   3149  O  O    . HIS A 1 18 ? 130.284 -2.843  -11.071 1.00 0.00 ? 18  HIS A O    2  
ATOM   3150  C  CB   . HIS A 1 18 ? 132.329 -3.883  -8.647  1.00 0.00 ? 18  HIS A CB   2  
ATOM   3151  C  CG   . HIS A 1 18 ? 132.762 -5.158  -7.977  1.00 0.00 ? 18  HIS A CG   2  
ATOM   3152  N  ND1  . HIS A 1 18 ? 131.991 -6.310  -8.012  1.00 0.00 ? 18  HIS A ND1  2  
ATOM   3153  C  CD2  . HIS A 1 18 ? 133.876 -5.476  -7.241  1.00 0.00 ? 18  HIS A CD2  2  
ATOM   3154  C  CE1  . HIS A 1 18 ? 132.646 -7.258  -7.316  1.00 0.00 ? 18  HIS A CE1  2  
ATOM   3155  N  NE2  . HIS A 1 18 ? 133.801 -6.802  -6.825  1.00 0.00 ? 18  HIS A NE2  2  
ATOM   3156  H  H    . HIS A 1 18 ? 134.136 -4.573  -10.301 1.00 0.00 ? 18  HIS A H    2  
ATOM   3157  H  HA   . HIS A 1 18 ? 131.341 -4.942  -10.207 1.00 0.00 ? 18  HIS A HA   2  
ATOM   3158  H  HB2  . HIS A 1 18 ? 133.109 -3.143  -8.550  1.00 0.00 ? 18  HIS A HB2  2  
ATOM   3159  H  HB3  . HIS A 1 18 ? 131.425 -3.520  -8.180  1.00 0.00 ? 18  HIS A HB3  2  
ATOM   3160  H  HD1  . HIS A 1 18 ? 131.126 -6.415  -8.460  1.00 0.00 ? 18  HIS A HD1  2  
ATOM   3161  H  HD2  . HIS A 1 18 ? 134.678 -4.795  -7.004  1.00 0.00 ? 18  HIS A HD2  2  
ATOM   3162  H  HE1  . HIS A 1 18 ? 132.281 -8.265  -7.172  1.00 0.00 ? 18  HIS A HE1  2  
ATOM   3163  H  HE2  . HIS A 1 18 ? 134.456 -7.296  -6.288  1.00 0.00 ? 18  HIS A HE2  2  
ATOM   3164  N  N    . SER A 1 19 ? 132.318 -1.882  -10.978 1.00 0.00 ? 19  SER A N    2  
ATOM   3165  C  CA   . SER A 1 19 ? 131.849 -0.639  -11.582 1.00 0.00 ? 19  SER A CA   2  
ATOM   3166  C  C    . SER A 1 19 ? 131.330 -0.875  -12.994 1.00 0.00 ? 19  SER A C    2  
ATOM   3167  O  O    . SER A 1 19 ? 130.330 -0.286  -13.411 1.00 0.00 ? 19  SER A O    2  
ATOM   3168  C  CB   . SER A 1 19 ? 132.993 0.374   -11.630 1.00 0.00 ? 19  SER A CB   2  
ATOM   3169  O  OG   . SER A 1 19 ? 133.545 0.522   -10.328 1.00 0.00 ? 19  SER A OG   2  
ATOM   3170  H  H    . SER A 1 19 ? 133.263 -1.970  -10.717 1.00 0.00 ? 19  SER A H    2  
ATOM   3171  H  HA   . SER A 1 19 ? 131.053 -0.235  -10.978 1.00 0.00 ? 19  SER A HA   2  
ATOM   3172  H  HB2  . SER A 1 19 ? 133.759 0.025   -12.302 1.00 0.00 ? 19  SER A HB2  2  
ATOM   3173  H  HB3  . SER A 1 19 ? 132.614 1.325   -11.982 1.00 0.00 ? 19  SER A HB3  2  
ATOM   3174  H  HG   . SER A 1 19 ? 133.531 1.455   -10.105 1.00 0.00 ? 19  SER A HG   2  
ATOM   3175  N  N    . GLY A 1 20 ? 132.037 -1.729  -13.728 1.00 0.00 ? 20  GLY A N    2  
ATOM   3176  C  CA   . GLY A 1 20 ? 131.675 -2.042  -15.105 1.00 0.00 ? 20  GLY A CA   2  
ATOM   3177  C  C    . GLY A 1 20 ? 130.315 -2.719  -15.232 1.00 0.00 ? 20  GLY A C    2  
ATOM   3178  O  O    . GLY A 1 20 ? 129.604 -2.520  -16.216 1.00 0.00 ? 20  GLY A O    2  
ATOM   3179  H  H    . GLY A 1 20 ? 132.831 -2.151  -13.337 1.00 0.00 ? 20  GLY A H    2  
ATOM   3180  H  HA2  . GLY A 1 20 ? 131.652 -1.123  -15.661 1.00 0.00 ? 20  GLY A HA2  2  
ATOM   3181  H  HA3  . GLY A 1 20 ? 132.430 -2.686  -15.530 1.00 0.00 ? 20  GLY A HA3  2  
ATOM   3182  N  N    . LYS A 1 21 ? 129.980 -3.557  -14.261 1.00 0.00 ? 21  LYS A N    2  
ATOM   3183  C  CA   . LYS A 1 21 ? 128.727 -4.300  -14.312 1.00 0.00 ? 21  LYS A CA   2  
ATOM   3184  C  C    . LYS A 1 21 ? 127.501 -3.392  -14.401 1.00 0.00 ? 21  LYS A C    2  
ATOM   3185  O  O    . LYS A 1 21 ? 126.560 -3.694  -15.135 1.00 0.00 ? 21  LYS A O    2  
ATOM   3186  C  CB   . LYS A 1 21 ? 128.612 -5.190  -13.075 1.00 0.00 ? 21  LYS A CB   2  
ATOM   3187  C  CG   . LYS A 1 21 ? 127.360 -6.061  -13.189 1.00 0.00 ? 21  LYS A CG   2  
ATOM   3188  C  CD   . LYS A 1 21 ? 127.201 -6.906  -11.926 1.00 0.00 ? 21  LYS A CD   2  
ATOM   3189  C  CE   . LYS A 1 21 ? 126.019 -7.858  -12.103 1.00 0.00 ? 21  LYS A CE   2  
ATOM   3190  N  NZ   . LYS A 1 21 ? 126.160 -9.007  -11.165 1.00 0.00 ? 21  LYS A NZ   2  
ATOM   3191  H  H    . LYS A 1 21 ? 130.600 -3.707  -13.516 1.00 0.00 ? 21  LYS A H    2  
ATOM   3192  H  HA   . LYS A 1 21 ? 128.743 -4.938  -15.183 1.00 0.00 ? 21  LYS A HA   2  
ATOM   3193  H  HB2  . LYS A 1 21 ? 129.490 -5.820  -13.003 1.00 0.00 ? 21  LYS A HB2  2  
ATOM   3194  H  HB3  . LYS A 1 21 ? 128.540 -4.572  -12.191 1.00 0.00 ? 21  LYS A HB3  2  
ATOM   3195  H  HG2  . LYS A 1 21 ? 126.490 -5.432  -13.311 1.00 0.00 ? 21  LYS A HG2  2  
ATOM   3196  H  HG3  . LYS A 1 21 ? 127.453 -6.713  -14.045 1.00 0.00 ? 21  LYS A HG3  2  
ATOM   3197  H  HD2  . LYS A 1 21 ? 128.104 -7.475  -11.757 1.00 0.00 ? 21  LYS A HD2  2  
ATOM   3198  H  HD3  . LYS A 1 21 ? 127.018 -6.259  -11.081 1.00 0.00 ? 21  LYS A HD3  2  
ATOM   3199  H  HE2  . LYS A 1 21 ? 125.100 -7.329  -11.894 1.00 0.00 ? 21  LYS A HE2  2  
ATOM   3200  H  HE3  . LYS A 1 21 ? 126.000 -8.222  -13.120 1.00 0.00 ? 21  LYS A HE3  2  
ATOM   3201  H  HZ1  . LYS A 1 21 ? 125.531 -8.867  -10.349 1.00 0.00 ? 21  LYS A HZ1  2  
ATOM   3202  H  HZ2  . LYS A 1 21 ? 127.146 -9.068  -10.838 1.00 0.00 ? 21  LYS A HZ2  2  
ATOM   3203  H  HZ3  . LYS A 1 21 ? 125.900 -9.887  -11.653 1.00 0.00 ? 21  LYS A HZ3  2  
ATOM   3204  N  N    . GLU A 1 22 ? 127.495 -2.291  -13.653 1.00 0.00 ? 22  GLU A N    2  
ATOM   3205  C  CA   . GLU A 1 22 ? 126.346 -1.381  -13.675 1.00 0.00 ? 22  GLU A CA   2  
ATOM   3206  C  C    . GLU A 1 22 ? 126.765 0.059   -13.957 1.00 0.00 ? 22  GLU A C    2  
ATOM   3207  O  O    . GLU A 1 22 ? 127.876 0.471   -13.630 1.00 0.00 ? 22  GLU A O    2  
ATOM   3208  C  CB   . GLU A 1 22 ? 125.617 -1.439  -12.332 1.00 0.00 ? 22  GLU A CB   2  
ATOM   3209  C  CG   . GLU A 1 22 ? 125.118 -2.863  -12.082 1.00 0.00 ? 22  GLU A CG   2  
ATOM   3210  C  CD   . GLU A 1 22 ? 124.323 -2.916  -10.782 1.00 0.00 ? 22  GLU A CD   2  
ATOM   3211  O  OE1  . GLU A 1 22 ? 124.336 -1.931  -10.063 1.00 0.00 ? 22  GLU A OE1  2  
ATOM   3212  O  OE2  . GLU A 1 22 ? 123.714 -3.941  -10.524 1.00 0.00 ? 22  GLU A OE2  2  
ATOM   3213  H  H    . GLU A 1 22 ? 128.261 -2.093  -13.073 1.00 0.00 ? 22  GLU A H    2  
ATOM   3214  H  HA   . GLU A 1 22 ? 125.660 -1.699  -14.447 1.00 0.00 ? 22  GLU A HA   2  
ATOM   3215  H  HB2  . GLU A 1 22 ? 126.296 -1.151  -11.544 1.00 0.00 ? 22  GLU A HB2  2  
ATOM   3216  H  HB3  . GLU A 1 22 ? 124.777 -0.763  -12.350 1.00 0.00 ? 22  GLU A HB3  2  
ATOM   3217  H  HG2  . GLU A 1 22 ? 124.485 -3.171  -12.902 1.00 0.00 ? 22  GLU A HG2  2  
ATOM   3218  H  HG3  . GLU A 1 22 ? 125.963 -3.532  -12.012 1.00 0.00 ? 22  GLU A HG3  2  
ATOM   3219  N  N    . GLY A 1 23 ? 125.851 0.827   -14.546 1.00 0.00 ? 23  GLY A N    2  
ATOM   3220  C  CA   . GLY A 1 23 ? 126.113 2.233   -14.834 1.00 0.00 ? 23  GLY A CA   2  
ATOM   3221  C  C    . GLY A 1 23 ? 127.292 2.403   -15.779 1.00 0.00 ? 23  GLY A C    2  
ATOM   3222  O  O    . GLY A 1 23 ? 127.691 1.465   -16.469 1.00 0.00 ? 23  GLY A O    2  
ATOM   3223  H  H    . GLY A 1 23 ? 124.976 0.446   -14.767 1.00 0.00 ? 23  GLY A H    2  
ATOM   3224  H  HA2  . GLY A 1 23 ? 125.233 2.669   -15.285 1.00 0.00 ? 23  GLY A HA2  2  
ATOM   3225  H  HA3  . GLY A 1 23 ? 126.329 2.748   -13.910 1.00 0.00 ? 23  GLY A HA3  2  
ATOM   3226  N  N    . ASP A 1 24 ? 127.858 3.605   -15.784 1.00 0.00 ? 24  ASP A N    2  
ATOM   3227  C  CA   . ASP A 1 24 ? 129.010 3.889   -16.623 1.00 0.00 ? 24  ASP A CA   2  
ATOM   3228  C  C    . ASP A 1 24 ? 130.241 3.190   -16.061 1.00 0.00 ? 24  ASP A C    2  
ATOM   3229  O  O    . ASP A 1 24 ? 130.451 3.164   -14.842 1.00 0.00 ? 24  ASP A O    2  
ATOM   3230  C  CB   . ASP A 1 24 ? 129.259 5.397   -16.687 1.00 0.00 ? 24  ASP A CB   2  
ATOM   3231  C  CG   . ASP A 1 24 ? 128.104 6.086   -17.405 1.00 0.00 ? 24  ASP A CG   2  
ATOM   3232  O  OD1  . ASP A 1 24 ? 127.316 5.388   -18.022 1.00 0.00 ? 24  ASP A OD1  2  
ATOM   3233  O  OD2  . ASP A 1 24 ? 128.024 7.301   -17.328 1.00 0.00 ? 24  ASP A OD2  2  
ATOM   3234  H  H    . ASP A 1 24 ? 127.505 4.306   -15.197 1.00 0.00 ? 24  ASP A H    2  
ATOM   3235  H  HA   . ASP A 1 24 ? 128.820 3.522   -17.620 1.00 0.00 ? 24  ASP A HA   2  
ATOM   3236  H  HB2  . ASP A 1 24 ? 129.341 5.789   -15.682 1.00 0.00 ? 24  ASP A HB2  2  
ATOM   3237  H  HB3  . ASP A 1 24 ? 130.177 5.587   -17.222 1.00 0.00 ? 24  ASP A HB3  2  
ATOM   3238  N  N    . LYS A 1 25 ? 131.043 2.615   -16.946 1.00 0.00 ? 25  LYS A N    2  
ATOM   3239  C  CA   . LYS A 1 25 ? 132.248 1.916   -16.523 1.00 0.00 ? 25  LYS A CA   2  
ATOM   3240  C  C    . LYS A 1 25 ? 133.197 2.874   -15.804 1.00 0.00 ? 25  LYS A C    2  
ATOM   3241  O  O    . LYS A 1 25 ? 133.872 2.504   -14.842 1.00 0.00 ? 25  LYS A O    2  
ATOM   3242  C  CB   . LYS A 1 25 ? 132.963 1.343   -17.751 1.00 0.00 ? 25  LYS A CB   2  
ATOM   3243  C  CG   . LYS A 1 25 ? 132.067 0.318   -18.450 1.00 0.00 ? 25  LYS A CG   2  
ATOM   3244  C  CD   . LYS A 1 25 ? 132.838 -0.340  -19.594 1.00 0.00 ? 25  LYS A CD   2  
ATOM   3245  C  CE   . LYS A 1 25 ? 131.902 -1.264  -20.374 1.00 0.00 ? 25  LYS A CE   2  
ATOM   3246  N  NZ   . LYS A 1 25 ? 130.846 -0.451  -21.042 1.00 0.00 ? 25  LYS A NZ   2  
ATOM   3247  H  H    . LYS A 1 25 ? 130.822 2.659   -17.900 1.00 0.00 ? 25  LYS A H    2  
ATOM   3248  H  HA   . LYS A 1 25 ? 131.982 1.111   -15.860 1.00 0.00 ? 25  LYS A HA   2  
ATOM   3249  H  HB2  . LYS A 1 25 ? 133.194 2.146   -18.437 1.00 0.00 ? 25  LYS A HB2  2  
ATOM   3250  H  HB3  . LYS A 1 25 ? 133.880 0.864   -17.441 1.00 0.00 ? 25  LYS A HB3  2  
ATOM   3251  H  HG2  . LYS A 1 25 ? 131.760 -0.435  -17.747 1.00 0.00 ? 25  LYS A HG2  2  
ATOM   3252  H  HG3  . LYS A 1 25 ? 131.195 0.815   -18.848 1.00 0.00 ? 25  LYS A HG3  2  
ATOM   3253  H  HD2  . LYS A 1 25 ? 133.225 0.423   -20.251 1.00 0.00 ? 25  LYS A HD2  2  
ATOM   3254  H  HD3  . LYS A 1 25 ? 133.656 -0.917  -19.191 1.00 0.00 ? 25  LYS A HD3  2  
ATOM   3255  H  HE2  . LYS A 1 25 ? 132.467 -1.803  -21.120 1.00 0.00 ? 25  LYS A HE2  2  
ATOM   3256  H  HE3  . LYS A 1 25 ? 131.441 -1.965  -19.695 1.00 0.00 ? 25  LYS A HE3  2  
ATOM   3257  H  HZ1  . LYS A 1 25 ? 130.507 0.281   -20.387 1.00 0.00 ? 25  LYS A HZ1  2  
ATOM   3258  H  HZ2  . LYS A 1 25 ? 130.054 -1.070  -21.313 1.00 0.00 ? 25  LYS A HZ2  2  
ATOM   3259  H  HZ3  . LYS A 1 25 ? 131.240 0.000   -21.890 1.00 0.00 ? 25  LYS A HZ3  2  
ATOM   3260  N  N    . TYR A 1 26 ? 133.259 4.101   -16.314 1.00 0.00 ? 26  TYR A N    2  
ATOM   3261  C  CA   . TYR A 1 26 ? 134.144 5.130   -15.768 1.00 0.00 ? 26  TYR A CA   2  
ATOM   3262  C  C    . TYR A 1 26 ? 133.766 5.590   -14.358 1.00 0.00 ? 26  TYR A C    2  
ATOM   3263  O  O    . TYR A 1 26 ? 134.641 5.980   -13.585 1.00 0.00 ? 26  TYR A O    2  
ATOM   3264  C  CB   . TYR A 1 26 ? 134.145 6.340   -16.703 1.00 0.00 ? 26  TYR A CB   2  
ATOM   3265  C  CG   . TYR A 1 26 ? 134.676 5.928   -18.055 1.00 0.00 ? 26  TYR A CG   2  
ATOM   3266  C  CD1  . TYR A 1 26 ? 136.058 5.864   -18.275 1.00 0.00 ? 26  TYR A CD1  2  
ATOM   3267  C  CD2  . TYR A 1 26 ? 133.788 5.612   -19.090 1.00 0.00 ? 26  TYR A CD2  2  
ATOM   3268  C  CE1  . TYR A 1 26 ? 136.551 5.484   -19.528 1.00 0.00 ? 26  TYR A CE1  2  
ATOM   3269  C  CE2  . TYR A 1 26 ? 134.281 5.232   -20.343 1.00 0.00 ? 26  TYR A CE2  2  
ATOM   3270  C  CZ   . TYR A 1 26 ? 135.662 5.167   -20.563 1.00 0.00 ? 26  TYR A CZ   2  
ATOM   3271  O  OH   . TYR A 1 26 ? 136.148 4.792   -21.799 1.00 0.00 ? 26  TYR A OH   2  
ATOM   3272  H  H    . TYR A 1 26 ? 132.710 4.317   -17.096 1.00 0.00 ? 26  TYR A H    2  
ATOM   3273  H  HA   . TYR A 1 26 ? 135.146 4.733   -15.738 1.00 0.00 ? 26  TYR A HA   2  
ATOM   3274  H  HB2  . TYR A 1 26 ? 133.138 6.713   -16.810 1.00 0.00 ? 26  TYR A HB2  2  
ATOM   3275  H  HB3  . TYR A 1 26 ? 134.775 7.113   -16.289 1.00 0.00 ? 26  TYR A HB3  2  
ATOM   3276  H  HD1  . TYR A 1 26 ? 136.744 6.108   -17.476 1.00 0.00 ? 26  TYR A HD1  2  
ATOM   3277  H  HD2  . TYR A 1 26 ? 132.723 5.662   -18.920 1.00 0.00 ? 26  TYR A HD2  2  
ATOM   3278  H  HE1  . TYR A 1 26 ? 137.616 5.434   -19.697 1.00 0.00 ? 26  TYR A HE1  2  
ATOM   3279  H  HE2  . TYR A 1 26 ? 133.595 4.988   -21.141 1.00 0.00 ? 26  TYR A HE2  2  
ATOM   3280  H  HH   . TYR A 1 26 ? 135.409 4.756   -22.410 1.00 0.00 ? 26  TYR A HH   2  
ATOM   3281  N  N    . LYS A 1 27 ? 132.472 5.599   -14.030 1.00 0.00 ? 27  LYS A N    2  
ATOM   3282  C  CA   . LYS A 1 27 ? 132.042 6.084   -12.711 1.00 0.00 ? 27  LYS A CA   2  
ATOM   3283  C  C    . LYS A 1 27 ? 131.413 4.998   -11.846 1.00 0.00 ? 27  LYS A C    2  
ATOM   3284  O  O    . LYS A 1 27 ? 130.721 4.100   -12.334 1.00 0.00 ? 27  LYS A O    2  
ATOM   3285  C  CB   . LYS A 1 27 ? 131.036 7.224   -12.890 1.00 0.00 ? 27  LYS A CB   2  
ATOM   3286  C  CG   . LYS A 1 27 ? 131.720 8.399   -13.593 1.00 0.00 ? 27  LYS A CG   2  
ATOM   3287  C  CD   . LYS A 1 27 ? 130.757 9.585   -13.668 1.00 0.00 ? 27  LYS A CD   2  
ATOM   3288  C  CE   . LYS A 1 27 ? 131.400 10.712  -14.478 1.00 0.00 ? 27  LYS A CE   2  
ATOM   3289  N  NZ   . LYS A 1 27 ? 130.529 11.921  -14.426 1.00 0.00 ? 27  LYS A NZ   2  
ATOM   3290  H  H    . LYS A 1 27 ? 131.802 5.316   -14.687 1.00 0.00 ? 27  LYS A H    2  
ATOM   3291  H  HA   . LYS A 1 27 ? 132.900 6.479   -12.187 1.00 0.00 ? 27  LYS A HA   2  
ATOM   3292  H  HB2  . LYS A 1 27 ? 130.203 6.880   -13.487 1.00 0.00 ? 27  LYS A HB2  2  
ATOM   3293  H  HB3  . LYS A 1 27 ? 130.678 7.546   -11.922 1.00 0.00 ? 27  LYS A HB3  2  
ATOM   3294  H  HG2  . LYS A 1 27 ? 132.602 8.684   -13.038 1.00 0.00 ? 27  LYS A HG2  2  
ATOM   3295  H  HG3  . LYS A 1 27 ? 132.004 8.105   -14.593 1.00 0.00 ? 27  LYS A HG3  2  
ATOM   3296  H  HD2  . LYS A 1 27 ? 129.839 9.273   -14.146 1.00 0.00 ? 27  LYS A HD2  2  
ATOM   3297  H  HD3  . LYS A 1 27 ? 130.542 9.937   -12.670 1.00 0.00 ? 27  LYS A HD3  2  
ATOM   3298  H  HE2  . LYS A 1 27 ? 132.367 10.948  -14.062 1.00 0.00 ? 27  LYS A HE2  2  
ATOM   3299  H  HE3  . LYS A 1 27 ? 131.516 10.396  -15.505 1.00 0.00 ? 27  LYS A HE3  2  
ATOM   3300  H  HZ1  . LYS A 1 27 ? 130.867 12.559  -13.678 1.00 0.00 ? 27  LYS A HZ1  2  
ATOM   3301  H  HZ2  . LYS A 1 27 ? 129.550 11.634  -14.222 1.00 0.00 ? 27  LYS A HZ2  2  
ATOM   3302  H  HZ3  . LYS A 1 27 ? 130.564 12.413  -15.340 1.00 0.00 ? 27  LYS A HZ3  2  
ATOM   3303  N  N    . LEU A 1 28 ? 131.649 5.124   -10.539 1.00 0.00 ? 28  LEU A N    2  
ATOM   3304  C  CA   . LEU A 1 28 ? 131.101 4.195   -9.559  1.00 0.00 ? 28  LEU A CA   2  
ATOM   3305  C  C    . LEU A 1 28 ? 129.948 4.868   -8.813  1.00 0.00 ? 28  LEU A C    2  
ATOM   3306  O  O    . LEU A 1 28 ? 130.083 5.995   -8.338  1.00 0.00 ? 28  LEU A O    2  
ATOM   3307  C  CB   . LEU A 1 28 ? 132.191 3.780   -8.554  1.00 0.00 ? 28  LEU A CB   2  
ATOM   3308  C  CG   . LEU A 1 28 ? 131.654 2.693   -7.610  1.00 0.00 ? 28  LEU A CG   2  
ATOM   3309  C  CD1  . LEU A 1 28 ? 131.730 1.318   -8.292  1.00 0.00 ? 28  LEU A CD1  2  
ATOM   3310  C  CD2  . LEU A 1 28 ? 132.480 2.670   -6.320  1.00 0.00 ? 28  LEU A CD2  2  
ATOM   3311  H  H    . LEU A 1 28 ? 132.191 5.877   -10.226 1.00 0.00 ? 28  LEU A H    2  
ATOM   3312  H  HA   . LEU A 1 28 ? 130.729 3.321   -10.068 1.00 0.00 ? 28  LEU A HA   2  
ATOM   3313  H  HB2  . LEU A 1 28 ? 133.046 3.395   -9.092  1.00 0.00 ? 28  LEU A HB2  2  
ATOM   3314  H  HB3  . LEU A 1 28 ? 132.492 4.640   -7.974  1.00 0.00 ? 28  LEU A HB3  2  
ATOM   3315  H  HG   . LEU A 1 28 ? 130.623 2.908   -7.369  1.00 0.00 ? 28  LEU A HG   2  
ATOM   3316  H  HD11 . LEU A 1 28 ? 132.659 0.833   -8.028  1.00 0.00 ? 28  LEU A HD11 2  
ATOM   3317  H  HD12 . LEU A 1 28 ? 131.684 1.436   -9.362  1.00 0.00 ? 28  LEU A HD12 2  
ATOM   3318  H  HD13 . LEU A 1 28 ? 130.903 0.710   -7.962  1.00 0.00 ? 28  LEU A HD13 2  
ATOM   3319  H  HD21 . LEU A 1 28 ? 132.570 3.672   -5.928  1.00 0.00 ? 28  LEU A HD21 2  
ATOM   3320  H  HD22 . LEU A 1 28 ? 133.461 2.273   -6.528  1.00 0.00 ? 28  LEU A HD22 2  
ATOM   3321  H  HD23 . LEU A 1 28 ? 131.988 2.043   -5.592  1.00 0.00 ? 28  LEU A HD23 2  
ATOM   3322  N  N    . SER A 1 29 ? 128.822 4.171   -8.705  1.00 0.00 ? 29  SER A N    2  
ATOM   3323  C  CA   . SER A 1 29 ? 127.656 4.710   -8.005  1.00 0.00 ? 29  SER A CA   2  
ATOM   3324  C  C    . SER A 1 29 ? 127.546 4.068   -6.628  1.00 0.00 ? 29  SER A C    2  
ATOM   3325  O  O    . SER A 1 29 ? 127.956 2.923   -6.436  1.00 0.00 ? 29  SER A O    2  
ATOM   3326  C  CB   . SER A 1 29 ? 126.382 4.442   -8.807  1.00 0.00 ? 29  SER A CB   2  
ATOM   3327  O  OG   . SER A 1 29 ? 125.286 5.093   -8.177  1.00 0.00 ? 29  SER A OG   2  
ATOM   3328  H  H    . SER A 1 29 ? 128.773 3.275   -9.100  1.00 0.00 ? 29  SER A H    2  
ATOM   3329  H  HA   . SER A 1 29 ? 127.777 5.778   -7.885  1.00 0.00 ? 29  SER A HA   2  
ATOM   3330  H  HB2  . SER A 1 29 ? 126.495 4.827   -9.807  1.00 0.00 ? 29  SER A HB2  2  
ATOM   3331  H  HB3  . SER A 1 29 ? 126.204 3.378   -8.852  1.00 0.00 ? 29  SER A HB3  2  
ATOM   3332  H  HG   . SER A 1 29 ? 124.939 4.503   -7.504  1.00 0.00 ? 29  SER A HG   2  
ATOM   3333  N  N    . LYS A 1 30 ? 127.021 4.796   -5.653  1.00 0.00 ? 30  LYS A N    2  
ATOM   3334  C  CA   . LYS A 1 30 ? 126.929 4.223   -4.322  1.00 0.00 ? 30  LYS A CA   2  
ATOM   3335  C  C    . LYS A 1 30 ? 126.169 2.912   -4.374  1.00 0.00 ? 30  LYS A C    2  
ATOM   3336  O  O    . LYS A 1 30 ? 126.494 1.977   -3.645  1.00 0.00 ? 30  LYS A O    2  
ATOM   3337  C  CB   . LYS A 1 30 ? 126.194 5.129   -3.344  1.00 0.00 ? 30  LYS A CB   2  
ATOM   3338  C  CG   . LYS A 1 30 ? 126.297 4.498   -1.947  1.00 0.00 ? 30  LYS A CG   2  
ATOM   3339  C  CD   . LYS A 1 30 ? 125.434 5.278   -0.972  1.00 0.00 ? 30  LYS A CD   2  
ATOM   3340  C  CE   . LYS A 1 30 ? 125.675 4.787   0.460   1.00 0.00 ? 30  LYS A CE   2  
ATOM   3341  N  NZ   . LYS A 1 30 ? 124.406 4.886   1.233   1.00 0.00 ? 30  LYS A NZ   2  
ATOM   3342  H  H    . LYS A 1 30 ? 126.718 5.713   -5.822  1.00 0.00 ? 30  LYS A H    2  
ATOM   3343  H  HA   . LYS A 1 30 ? 127.924 4.045   -3.952  1.00 0.00 ? 30  LYS A HA   2  
ATOM   3344  H  HB2  . LYS A 1 30 ? 126.652 6.109   -3.341  1.00 0.00 ? 30  LYS A HB2  2  
ATOM   3345  H  HB3  . LYS A 1 30 ? 125.157 5.209   -3.629  1.00 0.00 ? 30  LYS A HB3  2  
ATOM   3346  H  HG2  . LYS A 1 30 ? 125.956 3.476   -1.978  1.00 0.00 ? 30  LYS A HG2  2  
ATOM   3347  H  HG3  . LYS A 1 30 ? 127.323 4.526   -1.615  1.00 0.00 ? 30  LYS A HG3  2  
ATOM   3348  H  HD2  . LYS A 1 30 ? 125.668 6.325   -1.044  1.00 0.00 ? 30  LYS A HD2  2  
ATOM   3349  H  HD3  . LYS A 1 30 ? 124.403 5.113   -1.231  1.00 0.00 ? 30  LYS A HD3  2  
ATOM   3350  H  HE2  . LYS A 1 30 ? 126.007 3.759   0.444   1.00 0.00 ? 30  LYS A HE2  2  
ATOM   3351  H  HE3  . LYS A 1 30 ? 126.428 5.400   0.928   1.00 0.00 ? 30  LYS A HE3  2  
ATOM   3352  H  HZ1  . LYS A 1 30 ? 123.605 4.636   0.619   1.00 0.00 ? 30  LYS A HZ1  2  
ATOM   3353  H  HZ2  . LYS A 1 30 ? 124.286 5.861   1.580   1.00 0.00 ? 30  LYS A HZ2  2  
ATOM   3354  H  HZ3  . LYS A 1 30 ? 124.439 4.233   2.041   1.00 0.00 ? 30  LYS A HZ3  2  
ATOM   3355  N  N    . LYS A 1 31 ? 125.149 2.836   -5.219  1.00 0.00 ? 31  LYS A N    2  
ATOM   3356  C  CA   . LYS A 1 31 ? 124.385 1.608   -5.293  1.00 0.00 ? 31  LYS A CA   2  
ATOM   3357  C  C    . LYS A 1 31 ? 125.349 0.478   -5.588  1.00 0.00 ? 31  LYS A C    2  
ATOM   3358  O  O    . LYS A 1 31 ? 125.267 -0.594  -4.989  1.00 0.00 ? 31  LYS A O    2  
ATOM   3359  C  CB   . LYS A 1 31 ? 123.325 1.702   -6.398  1.00 0.00 ? 31  LYS A CB   2  
ATOM   3360  C  CG   . LYS A 1 31 ? 122.455 0.436   -6.418  1.00 0.00 ? 31  LYS A CG   2  
ATOM   3361  C  CD   . LYS A 1 31 ? 121.439 0.464   -5.268  1.00 0.00 ? 31  LYS A CD   2  
ATOM   3362  C  CE   . LYS A 1 31 ? 120.500 -0.737  -5.393  1.00 0.00 ? 31  LYS A CE   2  
ATOM   3363  N  NZ   . LYS A 1 31 ? 121.204 -1.969  -4.938  1.00 0.00 ? 31  LYS A NZ   2  
ATOM   3364  H  H    . LYS A 1 31 ? 124.910 3.604   -5.779  1.00 0.00 ? 31  LYS A H    2  
ATOM   3365  H  HA   . LYS A 1 31 ? 123.908 1.434   -4.344  1.00 0.00 ? 31  LYS A HA   2  
ATOM   3366  H  HB2  . LYS A 1 31 ? 122.698 2.563   -6.217  1.00 0.00 ? 31  LYS A HB2  2  
ATOM   3367  H  HB3  . LYS A 1 31 ? 123.814 1.812   -7.353  1.00 0.00 ? 31  LYS A HB3  2  
ATOM   3368  H  HG2  . LYS A 1 31 ? 121.927 0.382   -7.359  1.00 0.00 ? 31  LYS A HG2  2  
ATOM   3369  H  HG3  . LYS A 1 31 ? 123.086 -0.433  -6.314  1.00 0.00 ? 31  LYS A HG3  2  
ATOM   3370  H  HD2  . LYS A 1 31 ? 121.955 0.412   -4.323  1.00 0.00 ? 31  LYS A HD2  2  
ATOM   3371  H  HD3  . LYS A 1 31 ? 120.863 1.375   -5.317  1.00 0.00 ? 31  LYS A HD3  2  
ATOM   3372  H  HE2  . LYS A 1 31 ? 119.625 -0.575  -4.779  1.00 0.00 ? 31  LYS A HE2  2  
ATOM   3373  H  HE3  . LYS A 1 31 ? 120.199 -0.853  -6.423  1.00 0.00 ? 31  LYS A HE3  2  
ATOM   3374  H  HZ1  . LYS A 1 31 ? 122.220 -1.884  -5.144  1.00 0.00 ? 31  LYS A HZ1  2  
ATOM   3375  H  HZ2  . LYS A 1 31 ? 120.816 -2.794  -5.439  1.00 0.00 ? 31  LYS A HZ2  2  
ATOM   3376  H  HZ3  . LYS A 1 31 ? 121.069 -2.088  -3.915  1.00 0.00 ? 31  LYS A HZ3  2  
ATOM   3377  N  N    . GLU A 1 32 ? 126.301 0.745   -6.473  1.00 0.00 ? 32  GLU A N    2  
ATOM   3378  C  CA   . GLU A 1 32 ? 127.311 -0.246  -6.778  1.00 0.00 ? 32  GLU A CA   2  
ATOM   3379  C  C    . GLU A 1 32 ? 128.166 -0.469  -5.535  1.00 0.00 ? 32  GLU A C    2  
ATOM   3380  O  O    . GLU A 1 32 ? 128.614 -1.582  -5.264  1.00 0.00 ? 32  GLU A O    2  
ATOM   3381  C  CB   . GLU A 1 32 ? 128.221 0.242   -7.910  1.00 0.00 ? 32  GLU A CB   2  
ATOM   3382  C  CG   . GLU A 1 32 ? 127.422 0.430   -9.199  1.00 0.00 ? 32  GLU A CG   2  
ATOM   3383  C  CD   . GLU A 1 32 ? 128.362 0.891   -10.314 1.00 0.00 ? 32  GLU A CD   2  
ATOM   3384  O  OE1  . GLU A 1 32 ? 129.510 1.165   -10.014 1.00 0.00 ? 32  GLU A OE1  2  
ATOM   3385  O  OE2  . GLU A 1 32 ? 127.919 0.983   -11.445 1.00 0.00 ? 32  GLU A OE2  2  
ATOM   3386  H  H    . GLU A 1 32 ? 126.345 1.630   -6.890  1.00 0.00 ? 32  GLU A H    2  
ATOM   3387  H  HA   . GLU A 1 32 ? 126.838 -1.173  -7.066  1.00 0.00 ? 32  GLU A HA   2  
ATOM   3388  H  HB2  . GLU A 1 32 ? 128.678 1.176   -7.631  1.00 0.00 ? 32  GLU A HB2  2  
ATOM   3389  H  HB3  . GLU A 1 32 ? 128.993 -0.493  -8.079  1.00 0.00 ? 32  GLU A HB3  2  
ATOM   3390  H  HG2  . GLU A 1 32 ? 126.966 -0.507  -9.475  1.00 0.00 ? 32  GLU A HG2  2  
ATOM   3391  H  HG3  . GLU A 1 32 ? 126.656 1.172   -9.045  1.00 0.00 ? 32  GLU A HG3  2  
ATOM   3392  N  N    . LEU A 1 33 ? 128.419 0.626   -4.800  1.00 0.00 ? 33  LEU A N    2  
ATOM   3393  C  CA   . LEU A 1 33 ? 129.263 0.548   -3.607  1.00 0.00 ? 33  LEU A CA   2  
ATOM   3394  C  C    . LEU A 1 33 ? 128.665 -0.340  -2.520  1.00 0.00 ? 33  LEU A C    2  
ATOM   3395  O  O    . LEU A 1 33 ? 129.371 -1.171  -1.955  1.00 0.00 ? 33  LEU A O    2  
ATOM   3396  C  CB   . LEU A 1 33 ? 129.481 1.952   -3.034  1.00 0.00 ? 33  LEU A CB   2  
ATOM   3397  C  CG   . LEU A 1 33 ? 130.480 1.904   -1.868  1.00 0.00 ? 33  LEU A CG   2  
ATOM   3398  C  CD1  . LEU A 1 33 ? 131.894 1.654   -2.399  1.00 0.00 ? 33  LEU A CD1  2  
ATOM   3399  C  CD2  . LEU A 1 33 ? 130.451 3.243   -1.128  1.00 0.00 ? 33  LEU A CD2  2  
ATOM   3400  H  H    . LEU A 1 33 ? 128.058 1.496   -5.085  1.00 0.00 ? 33  LEU A H    2  
ATOM   3401  H  HA   . LEU A 1 33 ? 130.221 0.145   -3.892  1.00 0.00 ? 33  LEU A HA   2  
ATOM   3402  H  HB2  . LEU A 1 33 ? 129.858 2.604   -3.808  1.00 0.00 ? 33  LEU A HB2  2  
ATOM   3403  H  HB3  . LEU A 1 33 ? 128.539 2.332   -2.671  1.00 0.00 ? 33  LEU A HB3  2  
ATOM   3404  H  HG   . LEU A 1 33 ? 130.208 1.113   -1.186  1.00 0.00 ? 33  LEU A HG   2  
ATOM   3405  H  HD11 . LEU A 1 33 ? 132.027 0.599   -2.590  1.00 0.00 ? 33  LEU A HD11 2  
ATOM   3406  H  HD12 . LEU A 1 33 ? 132.615 1.979   -1.665  1.00 0.00 ? 33  LEU A HD12 2  
ATOM   3407  H  HD13 . LEU A 1 33 ? 132.040 2.207   -3.315  1.00 0.00 ? 33  LEU A HD13 2  
ATOM   3408  H  HD21 . LEU A 1 33 ? 130.796 4.026   -1.786  1.00 0.00 ? 33  LEU A HD21 2  
ATOM   3409  H  HD22 . LEU A 1 33 ? 131.094 3.191   -0.262  1.00 0.00 ? 33  LEU A HD22 2  
ATOM   3410  H  HD23 . LEU A 1 33 ? 129.440 3.459   -0.812  1.00 0.00 ? 33  LEU A HD23 2  
ATOM   3411  N  N    . LYS A 1 34 ? 127.377 -0.187  -2.204  1.00 0.00 ? 34  LYS A N    2  
ATOM   3412  C  CA   . LYS A 1 34 ? 126.821 -1.039  -1.157  1.00 0.00 ? 34  LYS A CA   2  
ATOM   3413  C  C    . LYS A 1 34 ? 126.953 -2.507  -1.543  1.00 0.00 ? 34  LYS A C    2  
ATOM   3414  O  O    . LYS A 1 34 ? 127.354 -3.345  -0.732  1.00 0.00 ? 34  LYS A O    2  
ATOM   3415  C  CB   . LYS A 1 34 ? 125.344 -0.717  -0.920  1.00 0.00 ? 34  LYS A CB   2  
ATOM   3416  C  CG   . LYS A 1 34 ? 125.198 0.703   -0.375  1.00 0.00 ? 34  LYS A CG   2  
ATOM   3417  C  CD   . LYS A 1 34 ? 123.729 0.959   -0.032  1.00 0.00 ? 34  LYS A CD   2  
ATOM   3418  C  CE   . LYS A 1 34 ? 123.550 2.412   0.407   1.00 0.00 ? 34  LYS A CE   2  
ATOM   3419  N  NZ   . LYS A 1 34 ? 122.098 2.710   0.565   1.00 0.00 ? 34  LYS A NZ   2  
ATOM   3420  H  H    . LYS A 1 34 ? 126.816 0.500   -2.651  1.00 0.00 ? 34  LYS A H    2  
ATOM   3421  H  HA   . LYS A 1 34 ? 127.366 -0.867  -0.240  1.00 0.00 ? 34  LYS A HA   2  
ATOM   3422  H  HB2  . LYS A 1 34 ? 124.806 -0.800  -1.851  1.00 0.00 ? 34  LYS A HB2  2  
ATOM   3423  H  HB3  . LYS A 1 34 ? 124.935 -1.417  -0.207  1.00 0.00 ? 34  LYS A HB3  2  
ATOM   3424  H  HG2  . LYS A 1 34 ? 125.803 0.812   0.513   1.00 0.00 ? 34  LYS A HG2  2  
ATOM   3425  H  HG3  . LYS A 1 34 ? 125.520 1.411   -1.122  1.00 0.00 ? 34  LYS A HG3  2  
ATOM   3426  H  HD2  . LYS A 1 34 ? 123.118 0.769   -0.902  1.00 0.00 ? 34  LYS A HD2  2  
ATOM   3427  H  HD3  . LYS A 1 34 ? 123.427 0.303   0.770   1.00 0.00 ? 34  LYS A HD3  2  
ATOM   3428  H  HE2  . LYS A 1 34 ? 124.054 2.567   1.349   1.00 0.00 ? 34  LYS A HE2  2  
ATOM   3429  H  HE3  . LYS A 1 34 ? 123.972 3.067   -0.340  1.00 0.00 ? 34  LYS A HE3  2  
ATOM   3430  H  HZ1  . LYS A 1 34 ? 121.927 3.111   1.509   1.00 0.00 ? 34  LYS A HZ1  2  
ATOM   3431  H  HZ2  . LYS A 1 34 ? 121.551 1.831   0.458   1.00 0.00 ? 34  LYS A HZ2  2  
ATOM   3432  H  HZ3  . LYS A 1 34 ? 121.803 3.393   -0.159  1.00 0.00 ? 34  LYS A HZ3  2  
ATOM   3433  N  N    . GLU A 1 35 ? 126.638 -2.814  -2.795  1.00 0.00 ? 35  GLU A N    2  
ATOM   3434  C  CA   . GLU A 1 35 ? 126.740 -4.185  -3.269  1.00 0.00 ? 35  GLU A CA   2  
ATOM   3435  C  C    . GLU A 1 35 ? 128.189 -4.652  -3.283  1.00 0.00 ? 35  GLU A C    2  
ATOM   3436  O  O    . GLU A 1 35 ? 128.479 -5.814  -2.999  1.00 0.00 ? 35  GLU A O    2  
ATOM   3437  C  CB   . GLU A 1 35 ? 126.160 -4.289  -4.682  1.00 0.00 ? 35  GLU A CB   2  
ATOM   3438  C  CG   . GLU A 1 35 ? 124.656 -3.997  -4.650  1.00 0.00 ? 35  GLU A CG   2  
ATOM   3439  C  CD   . GLU A 1 35 ? 123.932 -5.030  -3.792  1.00 0.00 ? 35  GLU A CD   2  
ATOM   3440  O  OE1  . GLU A 1 35 ? 124.511 -6.075  -3.541  1.00 0.00 ? 35  GLU A OE1  2  
ATOM   3441  O  OE2  . GLU A 1 35 ? 122.810 -4.760  -3.397  1.00 0.00 ? 35  GLU A OE2  2  
ATOM   3442  H  H    . GLU A 1 35 ? 126.341 -2.109  -3.407  1.00 0.00 ? 35  GLU A H    2  
ATOM   3443  H  HA   . GLU A 1 35 ? 126.174 -4.824  -2.611  1.00 0.00 ? 35  GLU A HA   2  
ATOM   3444  H  HB2  . GLU A 1 35 ? 126.651 -3.574  -5.325  1.00 0.00 ? 35  GLU A HB2  2  
ATOM   3445  H  HB3  . GLU A 1 35 ? 126.322 -5.286  -5.064  1.00 0.00 ? 35  GLU A HB3  2  
ATOM   3446  H  HG2  . GLU A 1 35 ? 124.492 -3.012  -4.238  1.00 0.00 ? 35  GLU A HG2  2  
ATOM   3447  H  HG3  . GLU A 1 35 ? 124.264 -4.032  -5.657  1.00 0.00 ? 35  GLU A HG3  2  
ATOM   3448  N  N    . LEU A 1 36 ? 129.093 -3.744  -3.637  1.00 0.00 ? 36  LEU A N    2  
ATOM   3449  C  CA   . LEU A 1 36 ? 130.504 -4.091  -3.706  1.00 0.00 ? 36  LEU A CA   2  
ATOM   3450  C  C    . LEU A 1 36 ? 131.039 -4.476  -2.329  1.00 0.00 ? 36  LEU A C    2  
ATOM   3451  O  O    . LEU A 1 36 ? 131.749 -5.476  -2.186  1.00 0.00 ? 36  LEU A O    2  
ATOM   3452  C  CB   . LEU A 1 36 ? 131.271 -2.880  -4.258  1.00 0.00 ? 36  LEU A CB   2  
ATOM   3453  C  CG   . LEU A 1 36 ? 132.712 -3.265  -4.639  1.00 0.00 ? 36  LEU A CG   2  
ATOM   3454  C  CD1  . LEU A 1 36 ? 133.202 -2.355  -5.771  1.00 0.00 ? 36  LEU A CD1  2  
ATOM   3455  C  CD2  . LEU A 1 36 ? 133.646 -3.075  -3.443  1.00 0.00 ? 36  LEU A CD2  2  
ATOM   3456  H  H    . LEU A 1 36 ? 128.805 -2.836  -3.868  1.00 0.00 ? 36  LEU A H    2  
ATOM   3457  H  HA   . LEU A 1 36 ? 130.631 -4.923  -4.382  1.00 0.00 ? 36  LEU A HA   2  
ATOM   3458  H  HB2  . LEU A 1 36 ? 130.753 -2.506  -5.129  1.00 0.00 ? 36  LEU A HB2  2  
ATOM   3459  H  HB3  . LEU A 1 36 ? 131.297 -2.106  -3.505  1.00 0.00 ? 36  LEU A HB3  2  
ATOM   3460  H  HG   . LEU A 1 36 ? 132.740 -4.294  -4.964  1.00 0.00 ? 36  LEU A HG   2  
ATOM   3461  H  HD11 . LEU A 1 36 ? 133.369 -1.360  -5.384  1.00 0.00 ? 36  LEU A HD11 2  
ATOM   3462  H  HD12 . LEU A 1 36 ? 132.462 -2.315  -6.552  1.00 0.00 ? 36  LEU A HD12 2  
ATOM   3463  H  HD13 . LEU A 1 36 ? 134.127 -2.743  -6.169  1.00 0.00 ? 36  LEU A HD13 2  
ATOM   3464  H  HD21 . LEU A 1 36 ? 133.416 -3.797  -2.677  1.00 0.00 ? 36  LEU A HD21 2  
ATOM   3465  H  HD22 . LEU A 1 36 ? 133.528 -2.078  -3.050  1.00 0.00 ? 36  LEU A HD22 2  
ATOM   3466  H  HD23 . LEU A 1 36 ? 134.666 -3.210  -3.767  1.00 0.00 ? 36  LEU A HD23 2  
ATOM   3467  N  N    . LEU A 1 37 ? 130.678 -3.694  -1.311  1.00 0.00 ? 37  LEU A N    2  
ATOM   3468  C  CA   . LEU A 1 37 ? 131.124 -3.991  0.045   1.00 0.00 ? 37  LEU A CA   2  
ATOM   3469  C  C    . LEU A 1 37 ? 130.461 -5.244  0.593   1.00 0.00 ? 37  LEU A C    2  
ATOM   3470  O  O    . LEU A 1 37 ? 131.117 -6.066  1.233   1.00 0.00 ? 37  LEU A O    2  
ATOM   3471  C  CB   . LEU A 1 37 ? 130.834 -2.813  0.989   1.00 0.00 ? 37  LEU A CB   2  
ATOM   3472  C  CG   . LEU A 1 37 ? 131.856 -1.671  0.818   1.00 0.00 ? 37  LEU A CG   2  
ATOM   3473  C  CD1  . LEU A 1 37 ? 133.074 -1.949  1.700   1.00 0.00 ? 37  LEU A CD1  2  
ATOM   3474  C  CD2  . LEU A 1 37 ? 132.320 -1.532  -0.636  1.00 0.00 ? 37  LEU A CD2  2  
ATOM   3475  H  H    . LEU A 1 37 ? 130.099 -2.919  -1.473  1.00 0.00 ? 37  LEU A H    2  
ATOM   3476  H  HA   . LEU A 1 37 ? 132.189 -4.160  0.030   1.00 0.00 ? 37  LEU A HA   2  
ATOM   3477  H  HB2  . LEU A 1 37 ? 129.846 -2.432  0.779   1.00 0.00 ? 37  LEU A HB2  2  
ATOM   3478  H  HB3  . LEU A 1 37 ? 130.865 -3.165  2.010   1.00 0.00 ? 37  LEU A HB3  2  
ATOM   3479  H  HG   . LEU A 1 37 ? 131.400 -0.744  1.137   1.00 0.00 ? 37  LEU A HG   2  
ATOM   3480  H  HD11 . LEU A 1 37 ? 133.806 -1.168  1.559   1.00 0.00 ? 37  LEU A HD11 2  
ATOM   3481  H  HD12 . LEU A 1 37 ? 133.506 -2.901  1.427   1.00 0.00 ? 37  LEU A HD12 2  
ATOM   3482  H  HD13 . LEU A 1 37 ? 132.769 -1.977  2.734   1.00 0.00 ? 37  LEU A HD13 2  
ATOM   3483  H  HD21 . LEU A 1 37 ? 133.000 -2.332  -0.879  1.00 0.00 ? 37  LEU A HD21 2  
ATOM   3484  H  HD22 . LEU A 1 37 ? 132.829 -0.587  -0.757  1.00 0.00 ? 37  LEU A HD22 2  
ATOM   3485  H  HD23 . LEU A 1 37 ? 131.474 -1.561  -1.294  1.00 0.00 ? 37  LEU A HD23 2  
ATOM   3486  N  N    . GLN A 1 38 ? 129.159 -5.394  0.357   1.00 0.00 ? 38  GLN A N    2  
ATOM   3487  C  CA   . GLN A 1 38 ? 128.471 -6.570  0.869   1.00 0.00 ? 38  GLN A CA   2  
ATOM   3488  C  C    . GLN A 1 38 ? 129.003 -7.857  0.246   1.00 0.00 ? 38  GLN A C    2  
ATOM   3489  O  O    . GLN A 1 38 ? 129.212 -8.850  0.941   1.00 0.00 ? 38  GLN A O    2  
ATOM   3490  C  CB   . GLN A 1 38 ? 126.968 -6.448  0.593   1.00 0.00 ? 38  GLN A CB   2  
ATOM   3491  C  CG   . GLN A 1 38 ? 126.382 -5.292  1.412   1.00 0.00 ? 38  GLN A CG   2  
ATOM   3492  C  CD   . GLN A 1 38 ? 124.905 -5.115  1.079   1.00 0.00 ? 38  GLN A CD   2  
ATOM   3493  O  OE1  . GLN A 1 38 ? 124.431 -5.629  0.066   1.00 0.00 ? 38  GLN A OE1  2  
ATOM   3494  N  NE2  . GLN A 1 38 ? 124.145 -4.414  1.875   1.00 0.00 ? 38  GLN A NE2  2  
ATOM   3495  H  H    . GLN A 1 38 ? 128.662 -4.709  -0.152  1.00 0.00 ? 38  GLN A H    2  
ATOM   3496  H  HA   . GLN A 1 38 ? 128.620 -6.615  1.935   1.00 0.00 ? 38  GLN A HA   2  
ATOM   3497  H  HB2  . GLN A 1 38 ? 126.815 -6.255  -0.459  1.00 0.00 ? 38  GLN A HB2  2  
ATOM   3498  H  HB3  . GLN A 1 38 ? 126.474 -7.368  0.862   1.00 0.00 ? 38  GLN A HB3  2  
ATOM   3499  H  HG2  . GLN A 1 38 ? 126.486 -5.510  2.464   1.00 0.00 ? 38  GLN A HG2  2  
ATOM   3500  H  HG3  . GLN A 1 38 ? 126.912 -4.384  1.186   1.00 0.00 ? 38  GLN A HG3  2  
ATOM   3501  H  HE21 . GLN A 1 38 ? 124.525 -4.005  2.680   1.00 0.00 ? 38  GLN A HE21 2  
ATOM   3502  H  HE22 . GLN A 1 38 ? 123.195 -4.296  1.666   1.00 0.00 ? 38  GLN A HE22 2  
ATOM   3503  N  N    . THR A 1 39 ? 129.220 -7.835  -1.064  1.00 0.00 ? 39  THR A N    2  
ATOM   3504  C  CA   . THR A 1 39 ? 129.726 -9.014  -1.758  1.00 0.00 ? 39  THR A CA   2  
ATOM   3505  C  C    . THR A 1 39 ? 131.193 -9.308  -1.442  1.00 0.00 ? 39  THR A C    2  
ATOM   3506  O  O    . THR A 1 39 ? 131.577 -10.463 -1.254  1.00 0.00 ? 39  THR A O    2  
ATOM   3507  C  CB   . THR A 1 39 ? 129.567 -8.830  -3.269  1.00 0.00 ? 39  THR A CB   2  
ATOM   3508  O  OG1  . THR A 1 39 ? 128.210 -8.534  -3.568  1.00 0.00 ? 39  THR A OG1  2  
ATOM   3509  C  CG2  . THR A 1 39 ? 129.983 -10.114 -3.988  1.00 0.00 ? 39  THR A CG2  2  
ATOM   3510  H  H    . THR A 1 39 ? 129.035 -7.017  -1.573  1.00 0.00 ? 39  THR A H    2  
ATOM   3511  H  HA   . THR A 1 39 ? 129.135 -9.867  -1.461  1.00 0.00 ? 39  THR A HA   2  
ATOM   3512  H  HB   . THR A 1 39 ? 130.194 -8.017  -3.601  1.00 0.00 ? 39  THR A HB   2  
ATOM   3513  H  HG1  . THR A 1 39 ? 127.777 -8.273  -2.752  1.00 0.00 ? 39  THR A HG1  2  
ATOM   3514  H  HG21 . THR A 1 39 ? 131.058 -10.212 -3.958  1.00 0.00 ? 39  THR A HG21 2  
ATOM   3515  H  HG22 . THR A 1 39 ? 129.653 -10.073 -5.015  1.00 0.00 ? 39  THR A HG22 2  
ATOM   3516  H  HG23 . THR A 1 39 ? 129.530 -10.963 -3.498  1.00 0.00 ? 39  THR A HG23 2  
ATOM   3517  N  N    . GLU A 1 40 ? 132.015 -8.260  -1.444  1.00 0.00 ? 40  GLU A N    2  
ATOM   3518  C  CA   . GLU A 1 40 ? 133.451 -8.425  -1.218  1.00 0.00 ? 40  GLU A CA   2  
ATOM   3519  C  C    . GLU A 1 40 ? 133.850 -8.683  0.233   1.00 0.00 ? 40  GLU A C    2  
ATOM   3520  O  O    . GLU A 1 40 ? 134.856 -9.347  0.481   1.00 0.00 ? 40  GLU A O    2  
ATOM   3521  C  CB   . GLU A 1 40 ? 134.198 -7.192  -1.716  1.00 0.00 ? 40  GLU A CB   2  
ATOM   3522  C  CG   . GLU A 1 40 ? 134.049 -7.075  -3.232  1.00 0.00 ? 40  GLU A CG   2  
ATOM   3523  C  CD   . GLU A 1 40 ? 134.872 -5.899  -3.737  1.00 0.00 ? 40  GLU A CD   2  
ATOM   3524  O  OE1  . GLU A 1 40 ? 135.404 -5.179  -2.909  1.00 0.00 ? 40  GLU A OE1  2  
ATOM   3525  O  OE2  . GLU A 1 40 ? 134.971 -5.743  -4.942  1.00 0.00 ? 40  GLU A OE2  2  
ATOM   3526  H  H    . GLU A 1 40 ? 131.659 -7.365  -1.643  1.00 0.00 ? 40  GLU A H    2  
ATOM   3527  H  HA   . GLU A 1 40 ? 133.784 -9.266  -1.806  1.00 0.00 ? 40  GLU A HA   2  
ATOM   3528  H  HB2  . GLU A 1 40 ? 133.789 -6.309  -1.245  1.00 0.00 ? 40  GLU A HB2  2  
ATOM   3529  H  HB3  . GLU A 1 40 ? 135.243 -7.280  -1.467  1.00 0.00 ? 40  GLU A HB3  2  
ATOM   3530  H  HG2  . GLU A 1 40 ? 134.396 -7.986  -3.699  1.00 0.00 ? 40  GLU A HG2  2  
ATOM   3531  H  HG3  . GLU A 1 40 ? 133.009 -6.917  -3.480  1.00 0.00 ? 40  GLU A HG3  2  
ATOM   3532  N  N    . LEU A 1 41 ? 133.130 -8.113  1.195   1.00 0.00 ? 41  LEU A N    2  
ATOM   3533  C  CA   . LEU A 1 41 ? 133.536 -8.273  2.594   1.00 0.00 ? 41  LEU A CA   2  
ATOM   3534  C  C    . LEU A 1 41 ? 132.703 -9.335  3.329   1.00 0.00 ? 41  LEU A C    2  
ATOM   3535  O  O    . LEU A 1 41 ? 131.468 -9.277  3.367   1.00 0.00 ? 41  LEU A O    2  
ATOM   3536  C  CB   . LEU A 1 41 ? 133.406 -6.911  3.286   1.00 0.00 ? 41  LEU A CB   2  
ATOM   3537  C  CG   . LEU A 1 41 ? 134.047 -6.961  4.673   1.00 0.00 ? 41  LEU A CG   2  
ATOM   3538  C  CD1  . LEU A 1 41 ? 135.575 -6.993  4.547   1.00 0.00 ? 41  LEU A CD1  2  
ATOM   3539  C  CD2  . LEU A 1 41 ? 133.630 -5.724  5.471   1.00 0.00 ? 41  LEU A CD2  2  
ATOM   3540  H  H    . LEU A 1 41 ? 132.365 -7.544  0.966   1.00 0.00 ? 41  LEU A H    2  
ATOM   3541  H  HA   . LEU A 1 41 ? 134.573 -8.570  2.625   1.00 0.00 ? 41  LEU A HA   2  
ATOM   3542  H  HB2  . LEU A 1 41 ? 133.894 -6.156  2.687   1.00 0.00 ? 41  LEU A HB2  2  
ATOM   3543  H  HB3  . LEU A 1 41 ? 132.360 -6.663  3.387   1.00 0.00 ? 41  LEU A HB3  2  
ATOM   3544  H  HG   . LEU A 1 41 ? 133.720 -7.844  5.179   1.00 0.00 ? 41  LEU A HG   2  
ATOM   3545  H  HD11 . LEU A 1 41 ? 135.885 -6.377  3.717   1.00 0.00 ? 41  LEU A HD11 2  
ATOM   3546  H  HD12 . LEU A 1 41 ? 135.902 -8.009  4.383   1.00 0.00 ? 41  LEU A HD12 2  
ATOM   3547  H  HD13 . LEU A 1 41 ? 136.017 -6.617  5.458   1.00 0.00 ? 41  LEU A HD13 2  
ATOM   3548  H  HD21 . LEU A 1 41 ? 133.909 -5.854  6.506   1.00 0.00 ? 41  LEU A HD21 2  
ATOM   3549  H  HD22 . LEU A 1 41 ? 132.561 -5.592  5.400   1.00 0.00 ? 41  LEU A HD22 2  
ATOM   3550  H  HD23 . LEU A 1 41 ? 134.128 -4.854  5.071   1.00 0.00 ? 41  LEU A HD23 2  
ATOM   3551  N  N    . SER A 1 42 ? 133.402 -10.293 3.945   1.00 0.00 ? 42  SER A N    2  
ATOM   3552  C  CA   . SER A 1 42 ? 132.740 -11.358 4.697   1.00 0.00 ? 42  SER A CA   2  
ATOM   3553  C  C    . SER A 1 42 ? 131.931 -10.748 5.827   1.00 0.00 ? 42  SER A C    2  
ATOM   3554  O  O    . SER A 1 42 ? 130.923 -11.304 6.271   1.00 0.00 ? 42  SER A O    2  
ATOM   3555  C  CB   . SER A 1 42 ? 133.778 -12.325 5.266   1.00 0.00 ? 42  SER A CB   2  
ATOM   3556  O  OG   . SER A 1 42 ? 134.540 -11.661 6.267   1.00 0.00 ? 42  SER A OG   2  
ATOM   3557  H  H    . SER A 1 42 ? 134.381 -10.275 3.901   1.00 0.00 ? 42  SER A H    2  
ATOM   3558  H  HA   . SER A 1 42 ? 132.077 -11.898 4.038   1.00 0.00 ? 42  SER A HA   2  
ATOM   3559  H  HB2  . SER A 1 42 ? 133.281 -13.175 5.704   1.00 0.00 ? 42  SER A HB2  2  
ATOM   3560  H  HB3  . SER A 1 42 ? 134.429 -12.663 4.470   1.00 0.00 ? 42  SER A HB3  2  
ATOM   3561  H  HG   . SER A 1 42 ? 135.461 -11.906 6.150   1.00 0.00 ? 42  SER A HG   2  
ATOM   3562  N  N    . GLY A 1 43 ? 132.374 -9.580  6.264   1.00 0.00 ? 43  GLY A N    2  
ATOM   3563  C  CA   . GLY A 1 43 ? 131.695 -8.858  7.321   1.00 0.00 ? 43  GLY A CA   2  
ATOM   3564  C  C    . GLY A 1 43 ? 130.210 -8.811  7.018   1.00 0.00 ? 43  GLY A C    2  
ATOM   3565  O  O    . GLY A 1 43 ? 129.398 -8.470  7.877   1.00 0.00 ? 43  GLY A O    2  
ATOM   3566  H  H    . GLY A 1 43 ? 133.169 -9.194  5.855   1.00 0.00 ? 43  GLY A H    2  
ATOM   3567  H  HA2  . GLY A 1 43 ? 131.858 -9.362  8.264   1.00 0.00 ? 43  GLY A HA2  2  
ATOM   3568  H  HA3  . GLY A 1 43 ? 132.079 -7.852  7.376   1.00 0.00 ? 43  GLY A HA3  2  
ATOM   3569  N  N    . PHE A 1 44 ? 129.859 -9.158  5.780   1.00 0.00 ? 44  PHE A N    2  
ATOM   3570  C  CA   . PHE A 1 44 ? 128.464 -9.149  5.376   1.00 0.00 ? 44  PHE A CA   2  
ATOM   3571  C  C    . PHE A 1 44 ? 127.598 -9.914  6.365   1.00 0.00 ? 44  PHE A C    2  
ATOM   3572  O  O    . PHE A 1 44 ? 126.482 -9.494  6.670   1.00 0.00 ? 44  PHE A O    2  
ATOM   3573  C  CB   . PHE A 1 44 ? 128.314 -9.781  3.994   1.00 0.00 ? 44  PHE A CB   2  
ATOM   3574  C  CG   . PHE A 1 44 ? 126.864 -9.714  3.579   1.00 0.00 ? 44  PHE A CG   2  
ATOM   3575  C  CD1  . PHE A 1 44 ? 126.326 -8.513  3.119   1.00 0.00 ? 44  PHE A CD1  2  
ATOM   3576  C  CD2  . PHE A 1 44 ? 126.057 -10.853 3.675   1.00 0.00 ? 44  PHE A CD2  2  
ATOM   3577  C  CE1  . PHE A 1 44 ? 124.978 -8.446  2.745   1.00 0.00 ? 44  PHE A CE1  2  
ATOM   3578  C  CE2  . PHE A 1 44 ? 124.709 -10.789 3.302   1.00 0.00 ? 44  PHE A CE2  2  
ATOM   3579  C  CZ   . PHE A 1 44 ? 124.170 -9.584  2.836   1.00 0.00 ? 44  PHE A CZ   2  
ATOM   3580  H  H    . PHE A 1 44 ? 130.554 -9.421  5.126   1.00 0.00 ? 44  PHE A H    2  
ATOM   3581  H  HA   . PHE A 1 44 ? 128.121 -8.132  5.323   1.00 0.00 ? 44  PHE A HA   2  
ATOM   3582  H  HB2  . PHE A 1 44 ? 128.920 -9.239  3.283   1.00 0.00 ? 44  PHE A HB2  2  
ATOM   3583  H  HB3  . PHE A 1 44 ? 128.631 -10.812 4.031   1.00 0.00 ? 44  PHE A HB3  2  
ATOM   3584  H  HD1  . PHE A 1 44 ? 126.948 -7.637  3.056   1.00 0.00 ? 44  PHE A HD1  2  
ATOM   3585  H  HD2  . PHE A 1 44 ? 126.474 -11.783 4.031   1.00 0.00 ? 44  PHE A HD2  2  
ATOM   3586  H  HE1  . PHE A 1 44 ? 124.563 -7.515  2.385   1.00 0.00 ? 44  PHE A HE1  2  
ATOM   3587  H  HE2  . PHE A 1 44 ? 124.085 -11.667 3.376   1.00 0.00 ? 44  PHE A HE2  2  
ATOM   3588  H  HZ   . PHE A 1 44 ? 123.130 -9.533  2.548   1.00 0.00 ? 44  PHE A HZ   2  
ATOM   3589  N  N    . LEU A 1 45 ? 128.094 -11.039 6.858   1.00 0.00 ? 45  LEU A N    2  
ATOM   3590  C  CA   . LEU A 1 45 ? 127.313 -11.829 7.798   1.00 0.00 ? 45  LEU A CA   2  
ATOM   3591  C  C    . LEU A 1 45 ? 126.930 -11.003 9.032   1.00 0.00 ? 45  LEU A C    2  
ATOM   3592  O  O    . LEU A 1 45 ? 125.800 -11.087 9.513   1.00 0.00 ? 45  LEU A O    2  
ATOM   3593  C  CB   . LEU A 1 45 ? 128.122 -13.056 8.228   1.00 0.00 ? 45  LEU A CB   2  
ATOM   3594  C  CG   . LEU A 1 45 ? 127.275 -13.960 9.130   1.00 0.00 ? 45  LEU A CG   2  
ATOM   3595  C  CD1  . LEU A 1 45 ? 126.192 -14.657 8.300   1.00 0.00 ? 45  LEU A CD1  2  
ATOM   3596  C  CD2  . LEU A 1 45 ? 128.177 -15.016 9.774   1.00 0.00 ? 45  LEU A CD2  2  
ATOM   3597  H  H    . LEU A 1 45 ? 128.987 -11.345 6.582   1.00 0.00 ? 45  LEU A H    2  
ATOM   3598  H  HA   . LEU A 1 45 ? 126.412 -12.161 7.308   1.00 0.00 ? 45  LEU A HA   2  
ATOM   3599  H  HB2  . LEU A 1 45 ? 128.431 -13.607 7.352   1.00 0.00 ? 45  LEU A HB2  2  
ATOM   3600  H  HB3  . LEU A 1 45 ? 128.997 -12.732 8.772   1.00 0.00 ? 45  LEU A HB3  2  
ATOM   3601  H  HG   . LEU A 1 45 ? 126.808 -13.366 9.903   1.00 0.00 ? 45  LEU A HG   2  
ATOM   3602  H  HD11 . LEU A 1 45 ? 125.355 -13.989 8.168   1.00 0.00 ? 45  LEU A HD11 2  
ATOM   3603  H  HD12 . LEU A 1 45 ? 125.864 -15.547 8.815   1.00 0.00 ? 45  LEU A HD12 2  
ATOM   3604  H  HD13 . LEU A 1 45 ? 126.594 -14.927 7.335   1.00 0.00 ? 45  LEU A HD13 2  
ATOM   3605  H  HD21 . LEU A 1 45 ? 127.568 -15.788 10.217  1.00 0.00 ? 45  LEU A HD21 2  
ATOM   3606  H  HD22 . LEU A 1 45 ? 128.784 -14.553 10.538  1.00 0.00 ? 45  LEU A HD22 2  
ATOM   3607  H  HD23 . LEU A 1 45 ? 128.817 -15.450 9.019   1.00 0.00 ? 45  LEU A HD23 2  
ATOM   3608  N  N    . ASP A 1 46 ? 127.869 -10.200 9.537   1.00 0.00 ? 46  ASP A N    2  
ATOM   3609  C  CA   . ASP A 1 46 ? 127.601 -9.362  10.712  1.00 0.00 ? 46  ASP A CA   2  
ATOM   3610  C  C    . ASP A 1 46 ? 127.478 -7.885  10.338  1.00 0.00 ? 46  ASP A C    2  
ATOM   3611  O  O    . ASP A 1 46 ? 127.373 -7.024  11.213  1.00 0.00 ? 46  ASP A O    2  
ATOM   3612  C  CB   . ASP A 1 46 ? 128.727 -9.533  11.733  1.00 0.00 ? 46  ASP A CB   2  
ATOM   3613  C  CG   . ASP A 1 46 ? 128.719 -10.953 12.287  1.00 0.00 ? 46  ASP A CG   2  
ATOM   3614  O  OD1  . ASP A 1 46 ? 127.741 -11.649 12.065  1.00 0.00 ? 46  ASP A OD1  2  
ATOM   3615  O  OD2  . ASP A 1 46 ? 129.690 -11.325 12.925  1.00 0.00 ? 46  ASP A OD2  2  
ATOM   3616  H  H    . ASP A 1 46 ? 128.752 -10.167 9.113   1.00 0.00 ? 46  ASP A H    2  
ATOM   3617  H  HA   . ASP A 1 46 ? 126.675 -9.682  11.167  1.00 0.00 ? 46  ASP A HA   2  
ATOM   3618  H  HB2  . ASP A 1 46 ? 129.675 -9.340  11.254  1.00 0.00 ? 46  ASP A HB2  2  
ATOM   3619  H  HB3  . ASP A 1 46 ? 128.585 -8.832  12.543  1.00 0.00 ? 46  ASP A HB3  2  
ATOM   3620  N  N    . ALA A 1 47 ? 127.527 -7.591  9.047   1.00 0.00 ? 47  ALA A N    2  
ATOM   3621  C  CA   . ALA A 1 47 ? 127.457 -6.206  8.581   1.00 0.00 ? 47  ALA A CA   2  
ATOM   3622  C  C    . ALA A 1 47 ? 126.123 -5.536  8.907   1.00 0.00 ? 47  ALA A C    2  
ATOM   3623  O  O    . ALA A 1 47 ? 126.059 -4.317  9.044   1.00 0.00 ? 47  ALA A O    2  
ATOM   3624  C  CB   . ALA A 1 47 ? 127.679 -6.151  7.074   1.00 0.00 ? 47  ALA A CB   2  
ATOM   3625  H  H    . ALA A 1 47 ? 127.637 -8.313  8.393   1.00 0.00 ? 47  ALA A H    2  
ATOM   3626  H  HA   . ALA A 1 47 ? 128.249 -5.655  9.057   1.00 0.00 ? 47  ALA A HA   2  
ATOM   3627  H  HB1  . ALA A 1 47 ? 128.649 -6.563  6.840   1.00 0.00 ? 47  ALA A HB1  2  
ATOM   3628  H  HB2  . ALA A 1 47 ? 127.635 -5.125  6.741   1.00 0.00 ? 47  ALA A HB2  2  
ATOM   3629  H  HB3  . ALA A 1 47 ? 126.911 -6.724  6.579   1.00 0.00 ? 47  ALA A HB3  2  
ATOM   3630  N  N    . GLN A 1 48 ? 125.064 -6.333  8.977   1.00 0.00 ? 48  GLN A N    2  
ATOM   3631  C  CA   . GLN A 1 48 ? 123.710 -5.822  9.226   1.00 0.00 ? 48  GLN A CA   2  
ATOM   3632  C  C    . GLN A 1 48 ? 123.673 -4.326  9.576   1.00 0.00 ? 48  GLN A C    2  
ATOM   3633  O  O    . GLN A 1 48 ? 123.705 -3.472  8.686   1.00 0.00 ? 48  GLN A O    2  
ATOM   3634  C  CB   . GLN A 1 48 ? 123.070 -6.615  10.368  1.00 0.00 ? 48  GLN A CB   2  
ATOM   3635  C  CG   . GLN A 1 48 ? 122.930 -8.082  9.959   1.00 0.00 ? 48  GLN A CG   2  
ATOM   3636  C  CD   . GLN A 1 48 ? 122.338 -8.890  11.109  1.00 0.00 ? 48  GLN A CD   2  
ATOM   3637  O  OE1  . GLN A 1 48 ? 122.323 -8.429  12.250  1.00 0.00 ? 48  GLN A OE1  2  
ATOM   3638  N  NE2  . GLN A 1 48 ? 121.846 -10.076 10.875  1.00 0.00 ? 48  GLN A NE2  2  
ATOM   3639  H  H    . GLN A 1 48 ? 125.185 -7.292  8.820   1.00 0.00 ? 48  GLN A H    2  
ATOM   3640  H  HA   . GLN A 1 48 ? 123.118 -5.979  8.337   1.00 0.00 ? 48  GLN A HA   2  
ATOM   3641  H  HB2  . GLN A 1 48 ? 123.694 -6.543  11.247  1.00 0.00 ? 48  GLN A HB2  2  
ATOM   3642  H  HB3  . GLN A 1 48 ? 122.093 -6.209  10.585  1.00 0.00 ? 48  GLN A HB3  2  
ATOM   3643  H  HG2  . GLN A 1 48 ? 122.282 -8.154  9.098   1.00 0.00 ? 48  GLN A HG2  2  
ATOM   3644  H  HG3  . GLN A 1 48 ? 123.903 -8.478  9.708   1.00 0.00 ? 48  GLN A HG3  2  
ATOM   3645  H  HE21 . GLN A 1 48 ? 121.858 -10.441 9.966   1.00 0.00 ? 48  GLN A HE21 2  
ATOM   3646  H  HE22 . GLN A 1 48 ? 121.464 -10.601 11.609  1.00 0.00 ? 48  GLN A HE22 2  
ATOM   3647  N  N    . LYS A 1 49 ? 123.603 -4.011  10.867  1.00 0.00 ? 49  LYS A N    2  
ATOM   3648  C  CA   . LYS A 1 49 ? 123.530 -2.613  11.302  1.00 0.00 ? 49  LYS A CA   2  
ATOM   3649  C  C    . LYS A 1 49 ? 124.717 -1.797  10.807  1.00 0.00 ? 49  LYS A C    2  
ATOM   3650  O  O    . LYS A 1 49 ? 124.575 -0.618  10.467  1.00 0.00 ? 49  LYS A O    2  
ATOM   3651  C  CB   . LYS A 1 49 ? 123.465 -2.552  12.830  1.00 0.00 ? 49  LYS A CB   2  
ATOM   3652  C  CG   . LYS A 1 49 ? 124.803 -2.998  13.421  1.00 0.00 ? 49  LYS A CG   2  
ATOM   3653  C  CD   . LYS A 1 49 ? 124.690 -3.061  14.945  1.00 0.00 ? 49  LYS A CD   2  
ATOM   3654  C  CE   . LYS A 1 49 ? 126.085 -3.199  15.557  1.00 0.00 ? 49  LYS A CE   2  
ATOM   3655  N  NZ   . LYS A 1 49 ? 125.968 -3.738  16.941  1.00 0.00 ? 49  LYS A NZ   2  
ATOM   3656  H  H    . LYS A 1 49 ? 123.580 -4.726  11.537  1.00 0.00 ? 49  LYS A H    2  
ATOM   3657  H  HA   . LYS A 1 49 ? 122.625 -2.179  10.906  1.00 0.00 ? 49  LYS A HA   2  
ATOM   3658  H  HB2  . LYS A 1 49 ? 123.254 -1.537  13.139  1.00 0.00 ? 49  LYS A HB2  2  
ATOM   3659  H  HB3  . LYS A 1 49 ? 122.682 -3.206  13.183  1.00 0.00 ? 49  LYS A HB3  2  
ATOM   3660  H  HG2  . LYS A 1 49 ? 125.059 -3.975  13.036  1.00 0.00 ? 49  LYS A HG2  2  
ATOM   3661  H  HG3  . LYS A 1 49 ? 125.572 -2.291  13.149  1.00 0.00 ? 49  LYS A HG3  2  
ATOM   3662  H  HD2  . LYS A 1 49 ? 124.224 -2.156  15.309  1.00 0.00 ? 49  LYS A HD2  2  
ATOM   3663  H  HD3  . LYS A 1 49 ? 124.090 -3.914  15.227  1.00 0.00 ? 49  LYS A HD3  2  
ATOM   3664  H  HE2  . LYS A 1 49 ? 126.677 -3.873  14.956  1.00 0.00 ? 49  LYS A HE2  2  
ATOM   3665  H  HE3  . LYS A 1 49 ? 126.562 -2.230  15.586  1.00 0.00 ? 49  LYS A HE3  2  
ATOM   3666  H  HZ1  . LYS A 1 49 ? 126.917 -3.849  17.352  1.00 0.00 ? 49  LYS A HZ1  2  
ATOM   3667  H  HZ2  . LYS A 1 49 ? 125.492 -4.664  16.913  1.00 0.00 ? 49  LYS A HZ2  2  
ATOM   3668  H  HZ3  . LYS A 1 49 ? 125.415 -3.080  17.526  1.00 0.00 ? 49  LYS A HZ3  2  
ATOM   3669  N  N    . ASP A 1 50 ? 125.877 -2.424  10.746  1.00 0.00 ? 50  ASP A N    2  
ATOM   3670  C  CA   . ASP A 1 50 ? 127.067 -1.734  10.280  1.00 0.00 ? 50  ASP A CA   2  
ATOM   3671  C  C    . ASP A 1 50 ? 126.817 -1.130  8.907   1.00 0.00 ? 50  ASP A C    2  
ATOM   3672  O  O    . ASP A 1 50 ? 127.424 -0.120  8.557   1.00 0.00 ? 50  ASP A O    2  
ATOM   3673  C  CB   . ASP A 1 50 ? 128.278 -2.668  10.235  1.00 0.00 ? 50  ASP A CB   2  
ATOM   3674  C  CG   . ASP A 1 50 ? 128.676 -3.076  11.649  1.00 0.00 ? 50  ASP A CG   2  
ATOM   3675  O  OD1  . ASP A 1 50 ? 128.179 -2.467  12.583  1.00 0.00 ? 50  ASP A OD1  2  
ATOM   3676  O  OD2  . ASP A 1 50 ? 129.472 -3.991  11.778  1.00 0.00 ? 50  ASP A OD2  2  
ATOM   3677  H  H    . ASP A 1 50 ? 125.935 -3.365  11.013  1.00 0.00 ? 50  ASP A H    2  
ATOM   3678  H  HA   . ASP A 1 50 ? 127.282 -0.930  10.969  1.00 0.00 ? 50  ASP A HA   2  
ATOM   3679  H  HB2  . ASP A 1 50 ? 128.039 -3.540  9.662   1.00 0.00 ? 50  ASP A HB2  2  
ATOM   3680  H  HB3  . ASP A 1 50 ? 129.106 -2.153  9.771   1.00 0.00 ? 50  ASP A HB3  2  
ATOM   3681  N  N    . VAL A 1 51 ? 125.939 -1.751  8.113   1.00 0.00 ? 51  VAL A N    2  
ATOM   3682  C  CA   . VAL A 1 51 ? 125.679 -1.226  6.777   1.00 0.00 ? 51  VAL A CA   2  
ATOM   3683  C  C    . VAL A 1 51 ? 125.276 0.243   6.853   1.00 0.00 ? 51  VAL A C    2  
ATOM   3684  O  O    . VAL A 1 51 ? 125.629 1.028   5.976   1.00 0.00 ? 51  VAL A O    2  
ATOM   3685  C  CB   . VAL A 1 51 ? 124.557 -2.016  6.086   1.00 0.00 ? 51  VAL A CB   2  
ATOM   3686  C  CG1  . VAL A 1 51 ? 124.883 -3.518  6.104   1.00 0.00 ? 51  VAL A CG1  2  
ATOM   3687  C  CG2  . VAL A 1 51 ? 123.219 -1.750  6.800   1.00 0.00 ? 51  VAL A CG2  2  
ATOM   3688  H  H    . VAL A 1 51 ? 125.468 -2.567  8.425   1.00 0.00 ? 51  VAL A H    2  
ATOM   3689  H  HA   . VAL A 1 51 ? 126.579 -1.313  6.188   1.00 0.00 ? 51  VAL A HA   2  
ATOM   3690  H  HB   . VAL A 1 51 ? 124.482 -1.687  5.058   1.00 0.00 ? 51  VAL A HB   2  
ATOM   3691  H  HG11 . VAL A 1 51 ? 125.361 -3.791  5.174   1.00 0.00 ? 51  VAL A HG11 2  
ATOM   3692  H  HG12 . VAL A 1 51 ? 123.971 -4.086  6.216   1.00 0.00 ? 51  VAL A HG12 2  
ATOM   3693  H  HG13 . VAL A 1 51 ? 125.545 -3.737  6.925   1.00 0.00 ? 51  VAL A HG13 2  
ATOM   3694  H  HG21 . VAL A 1 51 ? 122.672 -0.990  6.262   1.00 0.00 ? 51  VAL A HG21 2  
ATOM   3695  H  HG22 . VAL A 1 51 ? 123.400 -1.409  7.809   1.00 0.00 ? 51  VAL A HG22 2  
ATOM   3696  H  HG23 . VAL A 1 51 ? 122.633 -2.658  6.827   1.00 0.00 ? 51  VAL A HG23 2  
ATOM   3697  N  N    . ASP A 1 52 ? 124.555 0.627   7.902   1.00 0.00 ? 52  ASP A N    2  
ATOM   3698  C  CA   . ASP A 1 52 ? 124.148 2.021   8.034   1.00 0.00 ? 52  ASP A CA   2  
ATOM   3699  C  C    . ASP A 1 52 ? 125.375 2.933   8.089   1.00 0.00 ? 52  ASP A C    2  
ATOM   3700  O  O    . ASP A 1 52 ? 125.356 4.059   7.576   1.00 0.00 ? 52  ASP A O    2  
ATOM   3701  C  CB   . ASP A 1 52 ? 123.262 2.211   9.276   1.00 0.00 ? 52  ASP A CB   2  
ATOM   3702  C  CG   . ASP A 1 52 ? 124.031 1.911   10.563  1.00 0.00 ? 52  ASP A CG   2  
ATOM   3703  O  OD1  . ASP A 1 52 ? 125.241 1.809   10.508  1.00 0.00 ? 52  ASP A OD1  2  
ATOM   3704  O  OD2  . ASP A 1 52 ? 123.387 1.788   11.593  1.00 0.00 ? 52  ASP A OD2  2  
ATOM   3705  H  H    . ASP A 1 52 ? 124.306 -0.028  8.598   1.00 0.00 ? 52  ASP A H    2  
ATOM   3706  H  HA   . ASP A 1 52 ? 123.570 2.287   7.161   1.00 0.00 ? 52  ASP A HA   2  
ATOM   3707  H  HB2  . ASP A 1 52 ? 122.910 3.231   9.307   1.00 0.00 ? 52  ASP A HB2  2  
ATOM   3708  H  HB3  . ASP A 1 52 ? 122.413 1.546   9.209   1.00 0.00 ? 52  ASP A HB3  2  
ATOM   3709  N  N    . ALA A 1 53 ? 126.449 2.421   8.678   1.00 0.00 ? 53  ALA A N    2  
ATOM   3710  C  CA   . ALA A 1 53 ? 127.689 3.171   8.787   1.00 0.00 ? 53  ALA A CA   2  
ATOM   3711  C  C    . ALA A 1 53 ? 128.157 3.591   7.408   1.00 0.00 ? 53  ALA A C    2  
ATOM   3712  O  O    . ALA A 1 53 ? 128.850 4.604   7.252   1.00 0.00 ? 53  ALA A O    2  
ATOM   3713  C  CB   . ALA A 1 53 ? 128.764 2.315   9.461   1.00 0.00 ? 53  ALA A CB   2  
ATOM   3714  H  H    . ALA A 1 53 ? 126.413 1.504   9.036   1.00 0.00 ? 53  ALA A H    2  
ATOM   3715  H  HA   . ALA A 1 53 ? 127.517 4.053   9.386   1.00 0.00 ? 53  ALA A HA   2  
ATOM   3716  H  HB1  . ALA A 1 53 ? 128.325 1.765   10.280  1.00 0.00 ? 53  ALA A HB1  2  
ATOM   3717  H  HB2  . ALA A 1 53 ? 129.549 2.954   9.836   1.00 0.00 ? 53  ALA A HB2  2  
ATOM   3718  H  HB3  . ALA A 1 53 ? 129.176 1.623   8.742   1.00 0.00 ? 53  ALA A HB3  2  
ATOM   3719  N  N    . VAL A 1 54 ? 127.776 2.814   6.401   1.00 0.00 ? 54  VAL A N    2  
ATOM   3720  C  CA   . VAL A 1 54 ? 128.175 3.142   5.050   1.00 0.00 ? 54  VAL A CA   2  
ATOM   3721  C  C    . VAL A 1 54 ? 127.730 4.562   4.733   1.00 0.00 ? 54  VAL A C    2  
ATOM   3722  O  O    . VAL A 1 54 ? 128.461 5.319   4.102   1.00 0.00 ? 54  VAL A O    2  
ATOM   3723  C  CB   . VAL A 1 54 ? 127.530 2.183   4.045   1.00 0.00 ? 54  VAL A CB   2  
ATOM   3724  C  CG1  . VAL A 1 54 ? 127.809 2.676   2.624   1.00 0.00 ? 54  VAL A CG1  2  
ATOM   3725  C  CG2  . VAL A 1 54 ? 128.113 0.780   4.218   1.00 0.00 ? 54  VAL A CG2  2  
ATOM   3726  H  H    . VAL A 1 54 ? 127.219 2.021   6.570   1.00 0.00 ? 54  VAL A H    2  
ATOM   3727  H  HA   . VAL A 1 54 ? 129.246 3.073   4.967   1.00 0.00 ? 54  VAL A HA   2  
ATOM   3728  H  HB   . VAL A 1 54 ? 126.464 2.157   4.206   1.00 0.00 ? 54  VAL A HB   2  
ATOM   3729  H  HG11 . VAL A 1 54 ? 128.858 2.911   2.523   1.00 0.00 ? 54  VAL A HG11 2  
ATOM   3730  H  HG12 . VAL A 1 54 ? 127.222 3.562   2.428   1.00 0.00 ? 54  VAL A HG12 2  
ATOM   3731  H  HG13 . VAL A 1 54 ? 127.543 1.905   1.917   1.00 0.00 ? 54  VAL A HG13 2  
ATOM   3732  H  HG21 . VAL A 1 54 ? 127.826 0.386   5.182   1.00 0.00 ? 54  VAL A HG21 2  
ATOM   3733  H  HG22 . VAL A 1 54 ? 129.189 0.826   4.154   1.00 0.00 ? 54  VAL A HG22 2  
ATOM   3734  H  HG23 . VAL A 1 54 ? 127.732 0.134   3.439   1.00 0.00 ? 54  VAL A HG23 2  
ATOM   3735  N  N    . ASP A 1 55 ? 126.528 4.931   5.174   1.00 0.00 ? 55  ASP A N    2  
ATOM   3736  C  CA   . ASP A 1 55 ? 126.052 6.280   4.907   1.00 0.00 ? 55  ASP A CA   2  
ATOM   3737  C  C    . ASP A 1 55 ? 126.940 7.323   5.587   1.00 0.00 ? 55  ASP A C    2  
ATOM   3738  O  O    . ASP A 1 55 ? 127.257 8.361   5.007   1.00 0.00 ? 55  ASP A O    2  
ATOM   3739  C  CB   . ASP A 1 55 ? 124.616 6.432   5.414   1.00 0.00 ? 55  ASP A CB   2  
ATOM   3740  C  CG   . ASP A 1 55 ? 123.678 5.549   4.598   1.00 0.00 ? 55  ASP A CG   2  
ATOM   3741  O  OD1  . ASP A 1 55 ? 124.105 5.063   3.564   1.00 0.00 ? 55  ASP A OD1  2  
ATOM   3742  O  OD2  . ASP A 1 55 ? 122.547 5.372   5.020   1.00 0.00 ? 55  ASP A OD2  2  
ATOM   3743  H  H    . ASP A 1 55 ? 125.970 4.301   5.694   1.00 0.00 ? 55  ASP A H    2  
ATOM   3744  H  HA   . ASP A 1 55 ? 126.064 6.452   3.842   1.00 0.00 ? 55  ASP A HA   2  
ATOM   3745  H  HB2  . ASP A 1 55 ? 124.571 6.141   6.452   1.00 0.00 ? 55  ASP A HB2  2  
ATOM   3746  H  HB3  . ASP A 1 55 ? 124.309 7.464   5.317   1.00 0.00 ? 55  ASP A HB3  2  
ATOM   3747  N  N    . LYS A 1 56 ? 127.318 7.041   6.834   1.00 0.00 ? 56  LYS A N    2  
ATOM   3748  C  CA   . LYS A 1 56 ? 128.150 7.961   7.609   1.00 0.00 ? 56  LYS A CA   2  
ATOM   3749  C  C    . LYS A 1 56 ? 129.546 8.180   7.024   1.00 0.00 ? 56  LYS A C    2  
ATOM   3750  O  O    . LYS A 1 56 ? 130.062 9.297   7.051   1.00 0.00 ? 56  LYS A O    2  
ATOM   3751  C  CB   . LYS A 1 56 ? 128.289 7.439   9.040   1.00 0.00 ? 56  LYS A CB   2  
ATOM   3752  C  CG   . LYS A 1 56 ? 126.920 7.443   9.722   1.00 0.00 ? 56  LYS A CG   2  
ATOM   3753  C  CD   . LYS A 1 56 ? 127.080 7.033   11.188  1.00 0.00 ? 56  LYS A CD   2  
ATOM   3754  C  CE   . LYS A 1 56 ? 125.701 6.921   11.839  1.00 0.00 ? 56  LYS A CE   2  
ATOM   3755  N  NZ   . LYS A 1 56 ? 125.852 6.444   13.243  1.00 0.00 ? 56  LYS A NZ   2  
ATOM   3756  H  H    . LYS A 1 56 ? 127.019 6.204   7.246   1.00 0.00 ? 56  LYS A H    2  
ATOM   3757  H  HA   . LYS A 1 56 ? 127.648 8.916   7.652   1.00 0.00 ? 56  LYS A HA   2  
ATOM   3758  H  HB2  . LYS A 1 56 ? 128.679 6.432   9.018   1.00 0.00 ? 56  LYS A HB2  2  
ATOM   3759  H  HB3  . LYS A 1 56 ? 128.965 8.075   9.591   1.00 0.00 ? 56  LYS A HB3  2  
ATOM   3760  H  HG2  . LYS A 1 56 ? 126.495 8.434   9.669   1.00 0.00 ? 56  LYS A HG2  2  
ATOM   3761  H  HG3  . LYS A 1 56 ? 126.267 6.742   9.224   1.00 0.00 ? 56  LYS A HG3  2  
ATOM   3762  H  HD2  . LYS A 1 56 ? 127.583 6.077   11.240  1.00 0.00 ? 56  LYS A HD2  2  
ATOM   3763  H  HD3  . LYS A 1 56 ? 127.663 7.777   11.709  1.00 0.00 ? 56  LYS A HD3  2  
ATOM   3764  H  HE2  . LYS A 1 56 ? 125.223 7.888   11.838  1.00 0.00 ? 56  LYS A HE2  2  
ATOM   3765  H  HE3  . LYS A 1 56 ? 125.096 6.219   11.284  1.00 0.00 ? 56  LYS A HE3  2  
ATOM   3766  H  HZ1  . LYS A 1 56 ? 125.558 5.449   13.305  1.00 0.00 ? 56  LYS A HZ1  2  
ATOM   3767  H  HZ2  . LYS A 1 56 ? 125.257 7.022   13.872  1.00 0.00 ? 56  LYS A HZ2  2  
ATOM   3768  H  HZ3  . LYS A 1 56 ? 126.847 6.527   13.533  1.00 0.00 ? 56  LYS A HZ3  2  
ATOM   3769  N  N    . VAL A 1 57 ? 130.182 7.112   6.544   1.00 0.00 ? 57  VAL A N    2  
ATOM   3770  C  CA   . VAL A 1 57 ? 131.547 7.240   6.021   1.00 0.00 ? 57  VAL A CA   2  
ATOM   3771  C  C    . VAL A 1 57 ? 131.620 7.937   4.663   1.00 0.00 ? 57  VAL A C    2  
ATOM   3772  O  O    . VAL A 1 57 ? 132.586 8.641   4.386   1.00 0.00 ? 57  VAL A O    2  
ATOM   3773  C  CB   . VAL A 1 57 ? 132.210 5.865   5.920   1.00 0.00 ? 57  VAL A CB   2  
ATOM   3774  C  CG1  . VAL A 1 57 ? 132.146 5.162   7.277   1.00 0.00 ? 57  VAL A CG1  2  
ATOM   3775  C  CG2  . VAL A 1 57 ? 131.484 5.023   4.875   1.00 0.00 ? 57  VAL A CG2  2  
ATOM   3776  H  H    . VAL A 1 57 ? 129.747 6.227   6.578   1.00 0.00 ? 57  VAL A H    2  
ATOM   3777  H  HA   . VAL A 1 57 ? 132.118 7.829   6.725   1.00 0.00 ? 57  VAL A HA   2  
ATOM   3778  H  HB   . VAL A 1 57 ? 133.245 5.988   5.630   1.00 0.00 ? 57  VAL A HB   2  
ATOM   3779  H  HG11 . VAL A 1 57 ? 132.535 4.159   7.182   1.00 0.00 ? 57  VAL A HG11 2  
ATOM   3780  H  HG12 . VAL A 1 57 ? 131.121 5.120   7.614   1.00 0.00 ? 57  VAL A HG12 2  
ATOM   3781  H  HG13 . VAL A 1 57 ? 132.739 5.710   7.995   1.00 0.00 ? 57  VAL A HG13 2  
ATOM   3782  H  HG21 . VAL A 1 57 ? 131.594 5.480   3.903   1.00 0.00 ? 57  VAL A HG21 2  
ATOM   3783  H  HG22 . VAL A 1 57 ? 130.441 4.968   5.129   1.00 0.00 ? 57  VAL A HG22 2  
ATOM   3784  H  HG23 . VAL A 1 57 ? 131.905 4.029   4.857   1.00 0.00 ? 57  VAL A HG23 2  
ATOM   3785  N  N    . MET A 1 58 ? 130.625 7.741   3.808   1.00 0.00 ? 58  MET A N    2  
ATOM   3786  C  CA   . MET A 1 58 ? 130.672 8.369   2.489   1.00 0.00 ? 58  MET A CA   2  
ATOM   3787  C  C    . MET A 1 58 ? 130.778 9.885   2.590   1.00 0.00 ? 58  MET A C    2  
ATOM   3788  O  O    . MET A 1 58 ? 131.492 10.511  1.805   1.00 0.00 ? 58  MET A O    2  
ATOM   3789  C  CB   . MET A 1 58 ? 129.418 8.001   1.690   1.00 0.00 ? 58  MET A CB   2  
ATOM   3790  C  CG   . MET A 1 58 ? 129.448 6.513   1.327   1.00 0.00 ? 58  MET A CG   2  
ATOM   3791  S  SD   . MET A 1 58 ? 130.841 6.173   0.223   1.00 0.00 ? 58  MET A SD   2  
ATOM   3792  C  CE   . MET A 1 58 ? 130.245 7.136   -1.191  1.00 0.00 ? 58  MET A CE   2  
ATOM   3793  H  H    . MET A 1 58 ? 129.871 7.165   4.053   1.00 0.00 ? 58  MET A H    2  
ATOM   3794  H  HA   . MET A 1 58 ? 131.539 7.998   1.962   1.00 0.00 ? 58  MET A HA   2  
ATOM   3795  H  HB2  . MET A 1 58 ? 128.541 8.206   2.288   1.00 0.00 ? 58  MET A HB2  2  
ATOM   3796  H  HB3  . MET A 1 58 ? 129.382 8.592   0.790   1.00 0.00 ? 58  MET A HB3  2  
ATOM   3797  H  HG2  . MET A 1 58 ? 129.560 5.928   2.222   1.00 0.00 ? 58  MET A HG2  2  
ATOM   3798  H  HG3  . MET A 1 58 ? 128.527 6.245   0.834   1.00 0.00 ? 58  MET A HG3  2  
ATOM   3799  H  HE1  . MET A 1 58 ? 130.400 6.570   -2.098  1.00 0.00 ? 58  MET A HE1  2  
ATOM   3800  H  HE2  . MET A 1 58 ? 130.786 8.066   -1.252  1.00 0.00 ? 58  MET A HE2  2  
ATOM   3801  H  HE3  . MET A 1 58 ? 129.190 7.342   -1.070  1.00 0.00 ? 58  MET A HE3  2  
ATOM   3802  N  N    . LYS A 1 59 ? 130.082 10.477  3.550   1.00 0.00 ? 59  LYS A N    2  
ATOM   3803  C  CA   . LYS A 1 59 ? 130.145 11.922  3.703   1.00 0.00 ? 59  LYS A CA   2  
ATOM   3804  C  C    . LYS A 1 59 ? 131.568 12.375  4.018   1.00 0.00 ? 59  LYS A C    2  
ATOM   3805  O  O    . LYS A 1 59 ? 132.061 13.348  3.448   1.00 0.00 ? 59  LYS A O    2  
ATOM   3806  C  CB   . LYS A 1 59 ? 129.208 12.368  4.827   1.00 0.00 ? 59  LYS A CB   2  
ATOM   3807  C  CG   . LYS A 1 59 ? 129.179 13.897  4.891   1.00 0.00 ? 59  LYS A CG   2  
ATOM   3808  C  CD   . LYS A 1 59 ? 128.295 14.343  6.056   1.00 0.00 ? 59  LYS A CD   2  
ATOM   3809  C  CE   . LYS A 1 59 ? 128.136 15.864  6.023   1.00 0.00 ? 59  LYS A CE   2  
ATOM   3810  N  NZ   . LYS A 1 59 ? 127.389 16.310  7.232   1.00 0.00 ? 59  LYS A NZ   2  
ATOM   3811  H  H    . LYS A 1 59 ? 129.528 9.942   4.157   1.00 0.00 ? 59  LYS A H    2  
ATOM   3812  H  HA   . LYS A 1 59 ? 129.826 12.386  2.783   1.00 0.00 ? 59  LYS A HA   2  
ATOM   3813  H  HB2  . LYS A 1 59 ? 128.213 11.997  4.634   1.00 0.00 ? 59  LYS A HB2  2  
ATOM   3814  H  HB3  . LYS A 1 59 ? 129.563 11.978  5.769   1.00 0.00 ? 59  LYS A HB3  2  
ATOM   3815  H  HG2  . LYS A 1 59 ? 130.183 14.270  5.036   1.00 0.00 ? 59  LYS A HG2  2  
ATOM   3816  H  HG3  . LYS A 1 59 ? 128.780 14.288  3.967   1.00 0.00 ? 59  LYS A HG3  2  
ATOM   3817  H  HD2  . LYS A 1 59 ? 127.324 13.877  5.969   1.00 0.00 ? 59  LYS A HD2  2  
ATOM   3818  H  HD3  . LYS A 1 59 ? 128.753 14.051  6.989   1.00 0.00 ? 59  LYS A HD3  2  
ATOM   3819  H  HE2  . LYS A 1 59 ? 129.112 16.327  6.011   1.00 0.00 ? 59  LYS A HE2  2  
ATOM   3820  H  HE3  . LYS A 1 59 ? 127.590 16.150  5.136   1.00 0.00 ? 59  LYS A HE3  2  
ATOM   3821  H  HZ1  . LYS A 1 59 ? 126.368 16.293  7.036   1.00 0.00 ? 59  LYS A HZ1  2  
ATOM   3822  H  HZ2  . LYS A 1 59 ? 127.679 17.279  7.480   1.00 0.00 ? 59  LYS A HZ2  2  
ATOM   3823  H  HZ3  . LYS A 1 59 ? 127.598 15.672  8.026   1.00 0.00 ? 59  LYS A HZ3  2  
ATOM   3824  N  N    . GLU A 1 60 ? 132.223 11.665  4.936   1.00 0.00 ? 60  GLU A N    2  
ATOM   3825  C  CA   . GLU A 1 60 ? 133.586 12.011  5.323   1.00 0.00 ? 60  GLU A CA   2  
ATOM   3826  C  C    . GLU A 1 60 ? 134.590 11.764  4.199   1.00 0.00 ? 60  GLU A C    2  
ATOM   3827  O  O    . GLU A 1 60 ? 135.477 12.582  3.957   1.00 0.00 ? 60  GLU A O    2  
ATOM   3828  C  CB   . GLU A 1 60 ? 133.987 11.188  6.551   1.00 0.00 ? 60  GLU A CB   2  
ATOM   3829  C  CG   . GLU A 1 60 ? 135.362 11.636  7.049   1.00 0.00 ? 60  GLU A CG   2  
ATOM   3830  C  CD   . GLU A 1 60 ? 135.808 10.756  8.210   1.00 0.00 ? 60  GLU A CD   2  
ATOM   3831  O  OE1  . GLU A 1 60 ? 135.072 9.847   8.556   1.00 0.00 ? 60  GLU A OE1  2  
ATOM   3832  O  OE2  . GLU A 1 60 ? 136.881 11.002  8.736   1.00 0.00 ? 60  GLU A OE2  2  
ATOM   3833  H  H    . GLU A 1 60 ? 131.779 10.902  5.362   1.00 0.00 ? 60  GLU A H    2  
ATOM   3834  H  HA   . GLU A 1 60 ? 133.616 13.056  5.590   1.00 0.00 ? 60  GLU A HA   2  
ATOM   3835  H  HB2  . GLU A 1 60 ? 133.256 11.333  7.333   1.00 0.00 ? 60  GLU A HB2  2  
ATOM   3836  H  HB3  . GLU A 1 60 ? 134.026 10.142  6.285   1.00 0.00 ? 60  GLU A HB3  2  
ATOM   3837  H  HG2  . GLU A 1 60 ? 136.077 11.557  6.244   1.00 0.00 ? 60  GLU A HG2  2  
ATOM   3838  H  HG3  . GLU A 1 60 ? 135.306 12.662  7.379   1.00 0.00 ? 60  GLU A HG3  2  
ATOM   3839  N  N    . LEU A 1 61 ? 134.457 10.624  3.525   1.00 0.00 ? 61  LEU A N    2  
ATOM   3840  C  CA   . LEU A 1 61 ? 135.375 10.279  2.441   1.00 0.00 ? 61  LEU A CA   2  
ATOM   3841  C  C    . LEU A 1 61 ? 135.233 11.204  1.242   1.00 0.00 ? 61  LEU A C    2  
ATOM   3842  O  O    . LEU A 1 61 ? 136.225 11.538  0.594   1.00 0.00 ? 61  LEU A O    2  
ATOM   3843  C  CB   . LEU A 1 61 ? 135.146 8.830   2.007   1.00 0.00 ? 61  LEU A CB   2  
ATOM   3844  C  CG   . LEU A 1 61 ? 135.401 7.887   3.188   1.00 0.00 ? 61  LEU A CG   2  
ATOM   3845  C  CD1  . LEU A 1 61 ? 135.180 6.444   2.742   1.00 0.00 ? 61  LEU A CD1  2  
ATOM   3846  C  CD2  . LEU A 1 61 ? 136.845 8.045   3.674   1.00 0.00 ? 61  LEU A CD2  2  
ATOM   3847  H  H    . LEU A 1 61 ? 133.739 10.002  3.767   1.00 0.00 ? 61  LEU A H    2  
ATOM   3848  H  HA   . LEU A 1 61 ? 136.382 10.367  2.811   1.00 0.00 ? 61  LEU A HA   2  
ATOM   3849  H  HB2  . LEU A 1 61 ? 134.126 8.714   1.668   1.00 0.00 ? 61  LEU A HB2  2  
ATOM   3850  H  HB3  . LEU A 1 61 ? 135.822 8.585   1.202   1.00 0.00 ? 61  LEU A HB3  2  
ATOM   3851  H  HG   . LEU A 1 61 ? 134.726 8.122   3.990   1.00 0.00 ? 61  LEU A HG   2  
ATOM   3852  H  HD11 . LEU A 1 61 ? 135.620 6.298   1.768   1.00 0.00 ? 61  LEU A HD11 2  
ATOM   3853  H  HD12 . LEU A 1 61 ? 134.120 6.240   2.693   1.00 0.00 ? 61  LEU A HD12 2  
ATOM   3854  H  HD13 . LEU A 1 61 ? 135.644 5.775   3.451   1.00 0.00 ? 61  LEU A HD13 2  
ATOM   3855  H  HD21 . LEU A 1 61 ? 137.179 7.121   4.123   1.00 0.00 ? 61  LEU A HD21 2  
ATOM   3856  H  HD22 . LEU A 1 61 ? 136.891 8.836   4.408   1.00 0.00 ? 61  LEU A HD22 2  
ATOM   3857  H  HD23 . LEU A 1 61 ? 137.482 8.291   2.838   1.00 0.00 ? 61  LEU A HD23 2  
ATOM   3858  N  N    . ASP A 1 62 ? 134.007 11.608  0.929   1.00 0.00 ? 62  ASP A N    2  
ATOM   3859  C  CA   . ASP A 1 62 ? 133.801 12.480  -0.217  1.00 0.00 ? 62  ASP A CA   2  
ATOM   3860  C  C    . ASP A 1 62 ? 133.933 13.946  0.168   1.00 0.00 ? 62  ASP A C    2  
ATOM   3861  O  O    . ASP A 1 62 ? 133.018 14.526  0.751   1.00 0.00 ? 62  ASP A O    2  
ATOM   3862  C  CB   . ASP A 1 62 ? 132.407 12.244  -0.793  1.00 0.00 ? 62  ASP A CB   2  
ATOM   3863  C  CG   . ASP A 1 62 ? 132.226 13.060  -2.065  1.00 0.00 ? 62  ASP A CG   2  
ATOM   3864  O  OD1  . ASP A 1 62 ? 133.225 13.439  -2.653  1.00 0.00 ? 62  ASP A OD1  2  
ATOM   3865  O  OD2  . ASP A 1 62 ? 131.088 13.311  -2.421  1.00 0.00 ? 62  ASP A OD2  2  
ATOM   3866  H  H    . ASP A 1 62 ? 133.240 11.310  1.465   1.00 0.00 ? 62  ASP A H    2  
ATOM   3867  H  HA   . ASP A 1 62 ? 134.534 12.246  -0.975  1.00 0.00 ? 62  ASP A HA   2  
ATOM   3868  H  HB2  . ASP A 1 62 ? 132.287 11.194  -1.019  1.00 0.00 ? 62  ASP A HB2  2  
ATOM   3869  H  HB3  . ASP A 1 62 ? 131.665 12.541  -0.068  1.00 0.00 ? 62  ASP A HB3  2  
ATOM   3870  N  N    . GLU A 1 63 ? 135.050 14.558  -0.204  1.00 0.00 ? 63  GLU A N    2  
ATOM   3871  C  CA   . GLU A 1 63 ? 135.241 15.973  0.071   1.00 0.00 ? 63  GLU A CA   2  
ATOM   3872  C  C    . GLU A 1 63 ? 134.276 16.794  -0.777  1.00 0.00 ? 63  GLU A C    2  
ATOM   3873  O  O    . GLU A 1 63 ? 133.782 17.840  -0.358  1.00 0.00 ? 63  GLU A O    2  
ATOM   3874  C  CB   . GLU A 1 63 ? 136.682 16.383  -0.243  1.00 0.00 ? 63  GLU A CB   2  
ATOM   3875  C  CG   . GLU A 1 63 ? 137.638 15.650  0.700   1.00 0.00 ? 63  GLU A CG   2  
ATOM   3876  C  CD   . GLU A 1 63 ? 137.946 14.255  0.163   1.00 0.00 ? 63  GLU A CD   2  
ATOM   3877  O  OE1  . GLU A 1 63 ? 137.496 13.946  -0.928  1.00 0.00 ? 63  GLU A OE1  2  
ATOM   3878  O  OE2  . GLU A 1 63 ? 138.629 13.516  0.852   1.00 0.00 ? 63  GLU A OE2  2  
ATOM   3879  H  H    . GLU A 1 63 ? 135.735 14.063  -0.699  1.00 0.00 ? 63  GLU A H    2  
ATOM   3880  H  HA   . GLU A 1 63 ? 135.041 16.161  1.115   1.00 0.00 ? 63  GLU A HA   2  
ATOM   3881  H  HB2  . GLU A 1 63 ? 136.914 16.128  -1.267  1.00 0.00 ? 63  GLU A HB2  2  
ATOM   3882  H  HB3  . GLU A 1 63 ? 136.790 17.448  -0.105  1.00 0.00 ? 63  GLU A HB3  2  
ATOM   3883  H  HG2  . GLU A 1 63 ? 138.558 16.212  0.784   1.00 0.00 ? 63  GLU A HG2  2  
ATOM   3884  H  HG3  . GLU A 1 63 ? 137.183 15.564  1.675   1.00 0.00 ? 63  GLU A HG3  2  
ATOM   3885  N  N    . ASN A 1 64 ? 134.041 16.303  -1.994  1.00 0.00 ? 64  ASN A N    2  
ATOM   3886  C  CA   . ASN A 1 64 ? 133.164 16.976  -2.946  1.00 0.00 ? 64  ASN A CA   2  
ATOM   3887  C  C    . ASN A 1 64 ? 131.749 17.144  -2.403  1.00 0.00 ? 64  ASN A C    2  
ATOM   3888  O  O    . ASN A 1 64 ? 131.091 18.152  -2.655  1.00 0.00 ? 64  ASN A O    2  
ATOM   3889  C  CB   . ASN A 1 64 ? 133.071 16.134  -4.221  1.00 0.00 ? 64  ASN A CB   2  
ATOM   3890  C  CG   . ASN A 1 64 ? 134.456 15.870  -4.795  1.00 0.00 ? 64  ASN A CG   2  
ATOM   3891  O  OD1  . ASN A 1 64 ? 134.772 14.727  -5.137  1.00 0.00 ? 64  ASN A OD1  2  
ATOM   3892  N  ND2  . ASN A 1 64 ? 135.304 16.854  -4.920  1.00 0.00 ? 64  ASN A ND2  2  
ATOM   3893  H  H    . ASN A 1 64 ? 134.486 15.473  -2.263  1.00 0.00 ? 64  ASN A H    2  
ATOM   3894  H  HA   . ASN A 1 64 ? 133.573 17.942  -3.193  1.00 0.00 ? 64  ASN A HA   2  
ATOM   3895  H  HB2  . ASN A 1 64 ? 132.595 15.193  -3.992  1.00 0.00 ? 64  ASN A HB2  2  
ATOM   3896  H  HB3  . ASN A 1 64 ? 132.479 16.663  -4.953  1.00 0.00 ? 64  ASN A HB3  2  
ATOM   3897  H  HD21 . ASN A 1 64 ? 135.048 17.758  -4.646  1.00 0.00 ? 64  ASN A HD21 2  
ATOM   3898  H  HD22 . ASN A 1 64 ? 136.198 16.687  -5.288  1.00 0.00 ? 64  ASN A HD22 2  
ATOM   3899  N  N    . GLY A 1 65 ? 131.273 16.124  -1.699  1.00 0.00 ? 65  GLY A N    2  
ATOM   3900  C  CA   . GLY A 1 65 ? 129.914 16.144  -1.174  1.00 0.00 ? 65  GLY A CA   2  
ATOM   3901  C  C    . GLY A 1 65 ? 128.967 15.762  -2.307  1.00 0.00 ? 65  GLY A C    2  
ATOM   3902  O  O    . GLY A 1 65 ? 127.745 15.837  -2.183  1.00 0.00 ? 65  GLY A O    2  
ATOM   3903  H  H    . GLY A 1 65 ? 131.831 15.330  -1.561  1.00 0.00 ? 65  GLY A H    2  
ATOM   3904  H  HA2  . GLY A 1 65 ? 129.826 15.432  -0.363  1.00 0.00 ? 65  GLY A HA2  2  
ATOM   3905  H  HA3  . GLY A 1 65 ? 129.671 17.134  -0.822  1.00 0.00 ? 65  GLY A HA3  2  
ATOM   3906  N  N    . ASP A 1 66 ? 129.579 15.368  -3.421  1.00 0.00 ? 66  ASP A N    2  
ATOM   3907  C  CA   . ASP A 1 66 ? 128.861 14.979  -4.630  1.00 0.00 ? 66  ASP A CA   2  
ATOM   3908  C  C    . ASP A 1 66 ? 127.979 13.744  -4.432  1.00 0.00 ? 66  ASP A C    2  
ATOM   3909  O  O    . ASP A 1 66 ? 126.924 13.622  -5.055  1.00 0.00 ? 66  ASP A O    2  
ATOM   3910  C  CB   . ASP A 1 66 ? 129.881 14.746  -5.759  1.00 0.00 ? 66  ASP A CB   2  
ATOM   3911  C  CG   . ASP A 1 66 ? 130.823 13.583  -5.425  1.00 0.00 ? 66  ASP A CG   2  
ATOM   3912  O  OD1  . ASP A 1 66 ? 130.502 12.814  -4.543  1.00 0.00 ? 66  ASP A OD1  2  
ATOM   3913  O  OD2  . ASP A 1 66 ? 131.860 13.479  -6.063  1.00 0.00 ? 66  ASP A OD2  2  
ATOM   3914  H  H    . ASP A 1 66 ? 130.559 15.352  -3.435  1.00 0.00 ? 66  ASP A H    2  
ATOM   3915  H  HA   . ASP A 1 66 ? 128.225 15.801  -4.922  1.00 0.00 ? 66  ASP A HA   2  
ATOM   3916  H  HB2  . ASP A 1 66 ? 129.352 14.522  -6.673  1.00 0.00 ? 66  ASP A HB2  2  
ATOM   3917  H  HB3  . ASP A 1 66 ? 130.464 15.645  -5.899  1.00 0.00 ? 66  ASP A HB3  2  
ATOM   3918  N  N    . GLY A 1 67 ? 128.423 12.822  -3.590  1.00 0.00 ? 67  GLY A N    2  
ATOM   3919  C  CA   . GLY A 1 67 ? 127.677 11.591  -3.350  1.00 0.00 ? 67  GLY A CA   2  
ATOM   3920  C  C    . GLY A 1 67 ? 128.229 10.490  -4.244  1.00 0.00 ? 67  GLY A C    2  
ATOM   3921  O  O    . GLY A 1 67 ? 127.850 9.323   -4.138  1.00 0.00 ? 67  GLY A O    2  
ATOM   3922  H  H    . GLY A 1 67 ? 129.280 12.961  -3.136  1.00 0.00 ? 67  GLY A H    2  
ATOM   3923  H  HA2  . GLY A 1 67 ? 127.782 11.303  -2.313  1.00 0.00 ? 67  GLY A HA2  2  
ATOM   3924  H  HA3  . GLY A 1 67 ? 126.635 11.746  -3.578  1.00 0.00 ? 67  GLY A HA3  2  
ATOM   3925  N  N    . GLU A 1 68 ? 129.158 10.888  -5.107  1.00 0.00 ? 68  GLU A N    2  
ATOM   3926  C  CA   . GLU A 1 68 ? 129.823 9.969   -6.019  1.00 0.00 ? 68  GLU A CA   2  
ATOM   3927  C  C    . GLU A 1 68 ? 131.281 9.855   -5.606  1.00 0.00 ? 68  GLU A C    2  
ATOM   3928  O  O    . GLU A 1 68 ? 131.824 10.773  -4.978  1.00 0.00 ? 68  GLU A O    2  
ATOM   3929  C  CB   . GLU A 1 68 ? 129.732 10.482  -7.460  1.00 0.00 ? 68  GLU A CB   2  
ATOM   3930  C  CG   . GLU A 1 68 ? 128.264 10.578  -7.880  1.00 0.00 ? 68  GLU A CG   2  
ATOM   3931  C  CD   . GLU A 1 68 ? 128.168 11.024  -9.334  1.00 0.00 ? 68  GLU A CD   2  
ATOM   3932  O  OE1  . GLU A 1 68 ? 129.189 11.394  -9.889  1.00 0.00 ? 68  GLU A OE1  2  
ATOM   3933  O  OE2  . GLU A 1 68 ? 127.073 10.988  -9.873  1.00 0.00 ? 68  GLU A OE2  2  
ATOM   3934  H  H    . GLU A 1 68 ? 129.418 11.830  -5.116  1.00 0.00 ? 68  GLU A H    2  
ATOM   3935  H  HA   . GLU A 1 68 ? 129.357 8.997   -5.955  1.00 0.00 ? 68  GLU A HA   2  
ATOM   3936  H  HB2  . GLU A 1 68 ? 130.190 11.458  -7.523  1.00 0.00 ? 68  GLU A HB2  2  
ATOM   3937  H  HB3  . GLU A 1 68 ? 130.248 9.799   -8.118  1.00 0.00 ? 68  GLU A HB3  2  
ATOM   3938  H  HG2  . GLU A 1 68 ? 127.798 9.609   -7.771  1.00 0.00 ? 68  GLU A HG2  2  
ATOM   3939  H  HG3  . GLU A 1 68 ? 127.756 11.294  -7.251  1.00 0.00 ? 68  GLU A HG3  2  
ATOM   3940  N  N    . VAL A 1 69 ? 131.922 8.736   -5.932  1.00 0.00 ? 69  VAL A N    2  
ATOM   3941  C  CA   . VAL A 1 69 ? 133.315 8.555   -5.542  1.00 0.00 ? 69  VAL A CA   2  
ATOM   3942  C  C    . VAL A 1 69 ? 134.215 8.250   -6.729  1.00 0.00 ? 69  VAL A C    2  
ATOM   3943  O  O    . VAL A 1 69 ? 133.805 7.642   -7.717  1.00 0.00 ? 69  VAL A O    2  
ATOM   3944  C  CB   . VAL A 1 69 ? 133.419 7.413   -4.525  1.00 0.00 ? 69  VAL A CB   2  
ATOM   3945  C  CG1  . VAL A 1 69 ? 132.509 7.706   -3.332  1.00 0.00 ? 69  VAL A CG1  2  
ATOM   3946  C  CG2  . VAL A 1 69 ? 132.999 6.096   -5.184  1.00 0.00 ? 69  VAL A CG2  2  
ATOM   3947  H  H    . VAL A 1 69 ? 131.454 8.026   -6.420  1.00 0.00 ? 69  VAL A H    2  
ATOM   3948  H  HA   . VAL A 1 69 ? 133.671 9.456   -5.075  1.00 0.00 ? 69  VAL A HA   2  
ATOM   3949  H  HB   . VAL A 1 69 ? 134.435 7.330   -4.184  1.00 0.00 ? 69  VAL A HB   2  
ATOM   3950  H  HG11 . VAL A 1 69 ? 132.587 6.900   -2.615  1.00 0.00 ? 69  VAL A HG11 2  
ATOM   3951  H  HG12 . VAL A 1 69 ? 131.488 7.791   -3.670  1.00 0.00 ? 69  VAL A HG12 2  
ATOM   3952  H  HG13 . VAL A 1 69 ? 132.814 8.630   -2.865  1.00 0.00 ? 69  VAL A HG13 2  
ATOM   3953  H  HG21 . VAL A 1 69 ? 133.855 5.650   -5.671  1.00 0.00 ? 69  VAL A HG21 2  
ATOM   3954  H  HG22 . VAL A 1 69 ? 132.227 6.286   -5.916  1.00 0.00 ? 69  VAL A HG22 2  
ATOM   3955  H  HG23 . VAL A 1 69 ? 132.622 5.420   -4.432  1.00 0.00 ? 69  VAL A HG23 2  
ATOM   3956  N  N    . ASP A 1 70 ? 135.461 8.676   -6.581  1.00 0.00 ? 70  ASP A N    2  
ATOM   3957  C  CA   . ASP A 1 70 ? 136.489 8.469   -7.583  1.00 0.00 ? 70  ASP A CA   2  
ATOM   3958  C  C    . ASP A 1 70 ? 137.414 7.364   -7.106  1.00 0.00 ? 70  ASP A C    2  
ATOM   3959  O  O    . ASP A 1 70 ? 137.405 7.016   -5.926  1.00 0.00 ? 70  ASP A O    2  
ATOM   3960  C  CB   . ASP A 1 70 ? 137.286 9.758   -7.800  1.00 0.00 ? 70  ASP A CB   2  
ATOM   3961  C  CG   . ASP A 1 70 ? 136.388 10.831  -8.407  1.00 0.00 ? 70  ASP A CG   2  
ATOM   3962  O  OD1  . ASP A 1 70 ? 135.307 10.487  -8.855  1.00 0.00 ? 70  ASP A OD1  2  
ATOM   3963  O  OD2  . ASP A 1 70 ? 136.795 11.981  -8.413  1.00 0.00 ? 70  ASP A OD2  2  
ATOM   3964  H  H    . ASP A 1 70 ? 135.701 9.138   -5.751  1.00 0.00 ? 70  ASP A H    2  
ATOM   3965  H  HA   . ASP A 1 70 ? 136.029 8.173   -8.514  1.00 0.00 ? 70  ASP A HA   2  
ATOM   3966  H  HB2  . ASP A 1 70 ? 137.670 10.105  -6.853  1.00 0.00 ? 70  ASP A HB2  2  
ATOM   3967  H  HB3  . ASP A 1 70 ? 138.110 9.562   -8.471  1.00 0.00 ? 70  ASP A HB3  2  
ATOM   3968  N  N    . PHE A 1 71 ? 138.207 6.803   -8.003  1.00 0.00 ? 71  PHE A N    2  
ATOM   3969  C  CA   . PHE A 1 71 ? 139.105 5.739   -7.593  1.00 0.00 ? 71  PHE A CA   2  
ATOM   3970  C  C    . PHE A 1 71 ? 139.914 6.186   -6.385  1.00 0.00 ? 71  PHE A C    2  
ATOM   3971  O  O    . PHE A 1 71 ? 140.116 5.413   -5.448  1.00 0.00 ? 71  PHE A O    2  
ATOM   3972  C  CB   . PHE A 1 71 ? 140.053 5.372   -8.737  1.00 0.00 ? 71  PHE A CB   2  
ATOM   3973  C  CG   . PHE A 1 71 ? 140.910 4.200   -8.316  1.00 0.00 ? 71  PHE A CG   2  
ATOM   3974  C  CD1  . PHE A 1 71 ? 140.424 2.893   -8.438  1.00 0.00 ? 71  PHE A CD1  2  
ATOM   3975  C  CD2  . PHE A 1 71 ? 142.193 4.426   -7.804  1.00 0.00 ? 71  PHE A CD2  2  
ATOM   3976  C  CE1  . PHE A 1 71 ? 141.222 1.811   -8.045  1.00 0.00 ? 71  PHE A CE1  2  
ATOM   3977  C  CE2  . PHE A 1 71 ? 142.990 3.344   -7.412  1.00 0.00 ? 71  PHE A CE2  2  
ATOM   3978  C  CZ   . PHE A 1 71 ? 142.505 2.037   -7.532  1.00 0.00 ? 71  PHE A CZ   2  
ATOM   3979  H  H    . PHE A 1 71 ? 138.187 7.102   -8.936  1.00 0.00 ? 71  PHE A H    2  
ATOM   3980  H  HA   . PHE A 1 71 ? 138.522 4.869   -7.327  1.00 0.00 ? 71  PHE A HA   2  
ATOM   3981  H  HB2  . PHE A 1 71 ? 139.477 5.103   -9.611  1.00 0.00 ? 71  PHE A HB2  2  
ATOM   3982  H  HB3  . PHE A 1 71 ? 140.685 6.215   -8.966  1.00 0.00 ? 71  PHE A HB3  2  
ATOM   3983  H  HD1  . PHE A 1 71 ? 139.434 2.719   -8.833  1.00 0.00 ? 71  PHE A HD1  2  
ATOM   3984  H  HD2  . PHE A 1 71 ? 142.568 5.434   -7.711  1.00 0.00 ? 71  PHE A HD2  2  
ATOM   3985  H  HE1  . PHE A 1 71 ? 140.848 0.803   -8.137  1.00 0.00 ? 71  PHE A HE1  2  
ATOM   3986  H  HE2  . PHE A 1 71 ? 143.981 3.519   -7.017  1.00 0.00 ? 71  PHE A HE2  2  
ATOM   3987  H  HZ   . PHE A 1 71 ? 143.121 1.203   -7.228  1.00 0.00 ? 71  PHE A HZ   2  
ATOM   3988  N  N    . GLN A 1 72 ? 140.366 7.437   -6.392  1.00 0.00 ? 72  GLN A N    2  
ATOM   3989  C  CA   . GLN A 1 72 ? 141.135 7.943   -5.264  1.00 0.00 ? 72  GLN A CA   2  
ATOM   3990  C  C    . GLN A 1 72 ? 140.333 7.857   -3.967  1.00 0.00 ? 72  GLN A C    2  
ATOM   3991  O  O    . GLN A 1 72 ? 140.870 7.486   -2.930  1.00 0.00 ? 72  GLN A O    2  
ATOM   3992  C  CB   . GLN A 1 72 ? 141.546 9.394   -5.510  1.00 0.00 ? 72  GLN A CB   2  
ATOM   3993  C  CG   . GLN A 1 72 ? 142.474 9.856   -4.383  1.00 0.00 ? 72  GLN A CG   2  
ATOM   3994  C  CD   . GLN A 1 72 ? 142.823 11.329  -4.564  1.00 0.00 ? 72  GLN A CD   2  
ATOM   3995  O  OE1  . GLN A 1 72 ? 141.947 12.190  -4.484  1.00 0.00 ? 72  GLN A OE1  2  
ATOM   3996  N  NE2  . GLN A 1 72 ? 144.060 11.672  -4.805  1.00 0.00 ? 72  GLN A NE2  2  
ATOM   3997  H  H    . GLN A 1 72 ? 140.173 8.022   -7.154  1.00 0.00 ? 72  GLN A H    2  
ATOM   3998  H  HA   . GLN A 1 72 ? 142.028 7.346   -5.158  1.00 0.00 ? 72  GLN A HA   2  
ATOM   3999  H  HB2  . GLN A 1 72 ? 142.062 9.467   -6.457  1.00 0.00 ? 72  GLN A HB2  2  
ATOM   4000  H  HB3  . GLN A 1 72 ? 140.667 10.021  -5.529  1.00 0.00 ? 72  GLN A HB3  2  
ATOM   4001  H  HG2  . GLN A 1 72 ? 141.976 9.722   -3.434  1.00 0.00 ? 72  GLN A HG2  2  
ATOM   4002  H  HG3  . GLN A 1 72 ? 143.377 9.267   -4.397  1.00 0.00 ? 72  GLN A HG3  2  
ATOM   4003  H  HE21 . GLN A 1 72 ? 144.755 10.984  -4.868  1.00 0.00 ? 72  GLN A HE21 2  
ATOM   4004  H  HE22 . GLN A 1 72 ? 144.292 12.616  -4.922  1.00 0.00 ? 72  GLN A HE22 2  
ATOM   4005  N  N    . GLU A 1 73 ? 139.046 8.196   -4.014  1.00 0.00 ? 73  GLU A N    2  
ATOM   4006  C  CA   . GLU A 1 73 ? 138.233 8.115   -2.806  1.00 0.00 ? 73  GLU A CA   2  
ATOM   4007  C  C    . GLU A 1 73 ? 138.030 6.649   -2.396  1.00 0.00 ? 73  GLU A C    2  
ATOM   4008  O  O    . GLU A 1 73 ? 138.036 6.304   -1.210  1.00 0.00 ? 73  GLU A O    2  
ATOM   4009  C  CB   . GLU A 1 73 ? 136.866 8.769   -3.036  1.00 0.00 ? 73  GLU A CB   2  
ATOM   4010  C  CG   . GLU A 1 73 ? 137.020 10.272  -3.307  1.00 0.00 ? 73  GLU A CG   2  
ATOM   4011  C  CD   . GLU A 1 73 ? 135.635 10.917  -3.419  1.00 0.00 ? 73  GLU A CD   2  
ATOM   4012  O  OE1  . GLU A 1 73 ? 134.664 10.209  -3.235  1.00 0.00 ? 73  GLU A OE1  2  
ATOM   4013  O  OE2  . GLU A 1 73 ? 135.565 12.117  -3.649  1.00 0.00 ? 73  GLU A OE2  2  
ATOM   4014  H  H    . GLU A 1 73 ? 138.645 8.487   -4.860  1.00 0.00 ? 73  GLU A H    2  
ATOM   4015  H  HA   . GLU A 1 73 ? 138.739 8.636   -2.008  1.00 0.00 ? 73  GLU A HA   2  
ATOM   4016  H  HB2  . GLU A 1 73 ? 136.398 8.306   -3.887  1.00 0.00 ? 73  GLU A HB2  2  
ATOM   4017  H  HB3  . GLU A 1 73 ? 136.247 8.626   -2.163  1.00 0.00 ? 73  GLU A HB3  2  
ATOM   4018  H  HG2  . GLU A 1 73 ? 137.567 10.730  -2.496  1.00 0.00 ? 73  GLU A HG2  2  
ATOM   4019  H  HG3  . GLU A 1 73 ? 137.557 10.418  -4.232  1.00 0.00 ? 73  GLU A HG3  2  
ATOM   4020  N  N    . TYR A 1 74 ? 137.836 5.791   -3.398  1.00 0.00 ? 74  TYR A N    2  
ATOM   4021  C  CA   . TYR A 1 74 ? 137.615 4.368   -3.150  1.00 0.00 ? 74  TYR A CA   2  
ATOM   4022  C  C    . TYR A 1 74 ? 138.804 3.675   -2.487  1.00 0.00 ? 74  TYR A C    2  
ATOM   4023  O  O    . TYR A 1 74 ? 138.628 2.875   -1.560  1.00 0.00 ? 74  TYR A O    2  
ATOM   4024  C  CB   . TYR A 1 74 ? 137.305 3.659   -4.469  1.00 0.00 ? 74  TYR A CB   2  
ATOM   4025  C  CG   . TYR A 1 74 ? 137.066 2.196   -4.195  1.00 0.00 ? 74  TYR A CG   2  
ATOM   4026  C  CD1  . TYR A 1 74 ? 135.800 1.743   -3.807  1.00 0.00 ? 74  TYR A CD1  2  
ATOM   4027  C  CD2  . TYR A 1 74 ? 138.126 1.290   -4.321  1.00 0.00 ? 74  TYR A CD2  2  
ATOM   4028  C  CE1  . TYR A 1 74 ? 135.596 0.382   -3.545  1.00 0.00 ? 74  TYR A CE1  2  
ATOM   4029  C  CE2  . TYR A 1 74 ? 137.923 -0.068  -4.061  1.00 0.00 ? 74  TYR A CE2  2  
ATOM   4030  C  CZ   . TYR A 1 74 ? 136.658 -0.523  -3.672  1.00 0.00 ? 74  TYR A CZ   2  
ATOM   4031  O  OH   . TYR A 1 74 ? 136.461 -1.862  -3.413  1.00 0.00 ? 74  TYR A OH   2  
ATOM   4032  H  H    . TYR A 1 74 ? 137.832 6.125   -4.319  1.00 0.00 ? 74  TYR A H    2  
ATOM   4033  H  HA   . TYR A 1 74 ? 136.757 4.264   -2.505  1.00 0.00 ? 74  TYR A HA   2  
ATOM   4034  H  HB2  . TYR A 1 74 ? 136.420 4.094   -4.916  1.00 0.00 ? 74  TYR A HB2  2  
ATOM   4035  H  HB3  . TYR A 1 74 ? 138.141 3.768   -5.144  1.00 0.00 ? 74  TYR A HB3  2  
ATOM   4036  H  HD1  . TYR A 1 74 ? 134.982 2.442   -3.709  1.00 0.00 ? 74  TYR A HD1  2  
ATOM   4037  H  HD2  . TYR A 1 74 ? 139.102 1.641   -4.622  1.00 0.00 ? 74  TYR A HD2  2  
ATOM   4038  H  HE1  . TYR A 1 74 ? 134.620 0.030   -3.246  1.00 0.00 ? 74  TYR A HE1  2  
ATOM   4039  H  HE2  . TYR A 1 74 ? 138.743 -0.765  -4.160  1.00 0.00 ? 74  TYR A HE2  2  
ATOM   4040  H  HH   . TYR A 1 74 ? 136.281 -2.303  -4.246  1.00 0.00 ? 74  TYR A HH   2  
ATOM   4041  N  N    . VAL A 1 75 ? 140.010 3.954   -2.975  1.00 0.00 ? 75  VAL A N    2  
ATOM   4042  C  CA   . VAL A 1 75 ? 141.184 3.297   -2.413  1.00 0.00 ? 75  VAL A CA   2  
ATOM   4043  C  C    . VAL A 1 75 ? 141.311 3.605   -0.928  1.00 0.00 ? 75  VAL A C    2  
ATOM   4044  O  O    . VAL A 1 75 ? 141.643 2.726   -0.134  1.00 0.00 ? 75  VAL A O    2  
ATOM   4045  C  CB   . VAL A 1 75 ? 142.460 3.710   -3.157  1.00 0.00 ? 75  VAL A CB   2  
ATOM   4046  C  CG1  . VAL A 1 75 ? 142.908 5.094   -2.692  1.00 0.00 ? 75  VAL A CG1  2  
ATOM   4047  C  CG2  . VAL A 1 75 ? 143.570 2.674   -2.883  1.00 0.00 ? 75  VAL A CG2  2  
ATOM   4048  H  H    . VAL A 1 75 ? 140.102 4.578   -3.725  1.00 0.00 ? 75  VAL A H    2  
ATOM   4049  H  HA   . VAL A 1 75 ? 141.057 2.231   -2.527  1.00 0.00 ? 75  VAL A HA   2  
ATOM   4050  H  HB   . VAL A 1 75 ? 142.255 3.742   -4.217  1.00 0.00 ? 75  VAL A HB   2  
ATOM   4051  H  HG11 . VAL A 1 75 ? 143.469 5.575   -3.480  1.00 0.00 ? 75  VAL A HG11 2  
ATOM   4052  H  HG12 . VAL A 1 75 ? 143.529 4.999   -1.814  1.00 0.00 ? 75  VAL A HG12 2  
ATOM   4053  H  HG13 . VAL A 1 75 ? 142.044 5.685   -2.456  1.00 0.00 ? 75  VAL A HG13 2  
ATOM   4054  H  HG21 . VAL A 1 75 ? 143.671 2.022   -3.740  1.00 0.00 ? 75  VAL A HG21 2  
ATOM   4055  H  HG22 . VAL A 1 75 ? 143.317 2.083   -2.014  1.00 0.00 ? 75  VAL A HG22 2  
ATOM   4056  H  HG23 . VAL A 1 75 ? 144.506 3.181   -2.707  1.00 0.00 ? 75  VAL A HG23 2  
ATOM   4057  N  N    . VAL A 1 76 ? 141.015 4.843   -0.541  1.00 0.00 ? 76  VAL A N    2  
ATOM   4058  C  CA   . VAL A 1 76 ? 141.073 5.192   0.867   1.00 0.00 ? 76  VAL A CA   2  
ATOM   4059  C  C    . VAL A 1 76 ? 139.865 4.609   1.586   1.00 0.00 ? 76  VAL A C    2  
ATOM   4060  O  O    . VAL A 1 76 ? 139.952 4.230   2.754   1.00 0.00 ? 76  VAL A O    2  
ATOM   4061  C  CB   . VAL A 1 76 ? 141.137 6.713   1.066   1.00 0.00 ? 76  VAL A CB   2  
ATOM   4062  C  CG1  . VAL A 1 76 ? 142.398 7.266   0.401   1.00 0.00 ? 76  VAL A CG1  2  
ATOM   4063  C  CG2  . VAL A 1 76 ? 139.912 7.371   0.433   1.00 0.00 ? 76  VAL A CG2  2  
ATOM   4064  H  H    . VAL A 1 76 ? 140.730 5.509   -1.201  1.00 0.00 ? 76  VAL A H    2  
ATOM   4065  H  HA   . VAL A 1 76 ? 141.966 4.754   1.290   1.00 0.00 ? 76  VAL A HA   2  
ATOM   4066  H  HB   . VAL A 1 76 ? 141.161 6.936   2.122   1.00 0.00 ? 76  VAL A HB   2  
ATOM   4067  H  HG11 . VAL A 1 76 ? 143.245 7.113   1.054   1.00 0.00 ? 76  VAL A HG11 2  
ATOM   4068  H  HG12 . VAL A 1 76 ? 142.273 8.321   0.213   1.00 0.00 ? 76  VAL A HG12 2  
ATOM   4069  H  HG13 . VAL A 1 76 ? 142.567 6.753   -0.532  1.00 0.00 ? 76  VAL A HG13 2  
ATOM   4070  H  HG21 . VAL A 1 76 ? 139.990 7.312   -0.642  1.00 0.00 ? 76  VAL A HG21 2  
ATOM   4071  H  HG22 . VAL A 1 76 ? 139.867 8.408   0.733   1.00 0.00 ? 76  VAL A HG22 2  
ATOM   4072  H  HG23 . VAL A 1 76 ? 139.017 6.864   0.762   1.00 0.00 ? 76  VAL A HG23 2  
ATOM   4073  N  N    . LEU A 1 77 ? 138.732 4.533   0.880   1.00 0.00 ? 77  LEU A N    2  
ATOM   4074  C  CA   . LEU A 1 77 ? 137.524 3.984   1.486   1.00 0.00 ? 77  LEU A CA   2  
ATOM   4075  C  C    . LEU A 1 77 ? 137.754 2.549   1.949   1.00 0.00 ? 77  LEU A C    2  
ATOM   4076  O  O    . LEU A 1 77 ? 137.339 2.172   3.046   1.00 0.00 ? 77  LEU A O    2  
ATOM   4077  C  CB   . LEU A 1 77 ? 136.382 4.010   0.463   1.00 0.00 ? 77  LEU A CB   2  
ATOM   4078  C  CG   . LEU A 1 77 ? 135.049 3.637   1.140   1.00 0.00 ? 77  LEU A CG   2  
ATOM   4079  C  CD1  . LEU A 1 77 ? 133.894 4.301   0.389   1.00 0.00 ? 77  LEU A CD1  2  
ATOM   4080  C  CD2  . LEU A 1 77 ? 134.837 2.114   1.124   1.00 0.00 ? 77  LEU A CD2  2  
ATOM   4081  H  H    . LEU A 1 77 ? 138.710 4.853   -0.052  1.00 0.00 ? 77  LEU A H    2  
ATOM   4082  H  HA   . LEU A 1 77 ? 137.248 4.589   2.335   1.00 0.00 ? 77  LEU A HA   2  
ATOM   4083  H  HB2  . LEU A 1 77 ? 136.306 5.002   0.042   1.00 0.00 ? 77  LEU A HB2  2  
ATOM   4084  H  HB3  . LEU A 1 77 ? 136.596 3.307   -0.327  1.00 0.00 ? 77  LEU A HB3  2  
ATOM   4085  H  HG   . LEU A 1 77 ? 135.056 3.986   2.162   1.00 0.00 ? 77  LEU A HG   2  
ATOM   4086  H  HD11 . LEU A 1 77 ? 133.834 3.895   -0.610  1.00 0.00 ? 77  LEU A HD11 2  
ATOM   4087  H  HD12 . LEU A 1 77 ? 134.064 5.366   0.335   1.00 0.00 ? 77  LEU A HD12 2  
ATOM   4088  H  HD13 . LEU A 1 77 ? 132.968 4.110   0.911   1.00 0.00 ? 77  LEU A HD13 2  
ATOM   4089  H  HD21 . LEU A 1 77 ? 133.788 1.901   1.270   1.00 0.00 ? 77  LEU A HD21 2  
ATOM   4090  H  HD22 . LEU A 1 77 ? 135.404 1.660   1.920   1.00 0.00 ? 77  LEU A HD22 2  
ATOM   4091  H  HD23 . LEU A 1 77 ? 135.155 1.706   0.176   1.00 0.00 ? 77  LEU A HD23 2  
ATOM   4092  N  N    . VAL A 1 78 ? 138.429 1.753   1.122   1.00 0.00 ? 78  VAL A N    2  
ATOM   4093  C  CA   . VAL A 1 78 ? 138.707 0.366   1.495   1.00 0.00 ? 78  VAL A CA   2  
ATOM   4094  C  C    . VAL A 1 78 ? 139.795 0.288   2.564   1.00 0.00 ? 78  VAL A C    2  
ATOM   4095  O  O    . VAL A 1 78 ? 139.803 -0.619  3.406   1.00 0.00 ? 78  VAL A O    2  
ATOM   4096  C  CB   . VAL A 1 78 ? 139.115 -0.452  0.263   1.00 0.00 ? 78  VAL A CB   2  
ATOM   4097  C  CG1  . VAL A 1 78 ? 138.007 -0.371  -0.789  1.00 0.00 ? 78  VAL A CG1  2  
ATOM   4098  C  CG2  . VAL A 1 78 ? 140.412 0.103   -0.332  1.00 0.00 ? 78  VAL A CG2  2  
ATOM   4099  H  H    . VAL A 1 78 ? 138.748 2.103   0.255   1.00 0.00 ? 78  VAL A H    2  
ATOM   4100  H  HA   . VAL A 1 78 ? 137.803 -0.063  1.901   1.00 0.00 ? 78  VAL A HA   2  
ATOM   4101  H  HB   . VAL A 1 78 ? 139.261 -1.484  0.551   1.00 0.00 ? 78  VAL A HB   2  
ATOM   4102  H  HG11 . VAL A 1 78 ? 137.045 -0.364  -0.298  1.00 0.00 ? 78  VAL A HG11 2  
ATOM   4103  H  HG12 . VAL A 1 78 ? 138.070 -1.225  -1.445  1.00 0.00 ? 78  VAL A HG12 2  
ATOM   4104  H  HG13 . VAL A 1 78 ? 138.124 0.535   -1.365  1.00 0.00 ? 78  VAL A HG13 2  
ATOM   4105  H  HG21 . VAL A 1 78 ? 140.216 1.070   -0.766  1.00 0.00 ? 78  VAL A HG21 2  
ATOM   4106  H  HG22 . VAL A 1 78 ? 140.772 -0.568  -1.099  1.00 0.00 ? 78  VAL A HG22 2  
ATOM   4107  H  HG23 . VAL A 1 78 ? 141.157 0.198   0.441   1.00 0.00 ? 78  VAL A HG23 2  
ATOM   4108  N  N    . ALA A 1 79 ? 140.726 1.236   2.514   1.00 0.00 ? 79  ALA A N    2  
ATOM   4109  C  CA   . ALA A 1 79 ? 141.830 1.253   3.462   1.00 0.00 ? 79  ALA A CA   2  
ATOM   4110  C  C    . ALA A 1 79 ? 141.329 1.400   4.894   1.00 0.00 ? 79  ALA A C    2  
ATOM   4111  O  O    . ALA A 1 79 ? 141.869 0.778   5.810   1.00 0.00 ? 79  ALA A O    2  
ATOM   4112  C  CB   . ALA A 1 79 ? 142.784 2.403   3.120   1.00 0.00 ? 79  ALA A CB   2  
ATOM   4113  H  H    . ALA A 1 79 ? 140.678 1.923   1.816   1.00 0.00 ? 79  ALA A H    2  
ATOM   4114  H  HA   . ALA A 1 79 ? 142.371 0.321   3.379   1.00 0.00 ? 79  ALA A HA   2  
ATOM   4115  H  HB1  . ALA A 1 79 ? 143.801 2.098   3.316   1.00 0.00 ? 79  ALA A HB1  2  
ATOM   4116  H  HB2  . ALA A 1 79 ? 142.545 3.267   3.722   1.00 0.00 ? 79  ALA A HB2  2  
ATOM   4117  H  HB3  . ALA A 1 79 ? 142.681 2.655   2.075   1.00 0.00 ? 79  ALA A HB3  2  
ATOM   4118  N  N    . ALA A 1 80 ? 140.293 2.210   5.093   1.00 0.00 ? 80  ALA A N    2  
ATOM   4119  C  CA   . ALA A 1 80 ? 139.756 2.389   6.434   1.00 0.00 ? 80  ALA A CA   2  
ATOM   4120  C  C    . ALA A 1 80 ? 139.175 1.077   6.943   1.00 0.00 ? 80  ALA A C    2  
ATOM   4121  O  O    . ALA A 1 80 ? 139.382 0.696   8.096   1.00 0.00 ? 80  ALA A O    2  
ATOM   4122  C  CB   . ALA A 1 80 ? 138.669 3.465   6.424   1.00 0.00 ? 80  ALA A CB   2  
ATOM   4123  H  H    . ALA A 1 80 ? 139.888 2.681   4.335   1.00 0.00 ? 80  ALA A H    2  
ATOM   4124  H  HA   . ALA A 1 80 ? 140.552 2.702   7.094   1.00 0.00 ? 80  ALA A HA   2  
ATOM   4125  H  HB1  . ALA A 1 80 ? 138.030 3.324   5.566   1.00 0.00 ? 80  ALA A HB1  2  
ATOM   4126  H  HB2  . ALA A 1 80 ? 139.129 4.441   6.374   1.00 0.00 ? 80  ALA A HB2  2  
ATOM   4127  H  HB3  . ALA A 1 80 ? 138.082 3.390   7.327   1.00 0.00 ? 80  ALA A HB3  2  
ATOM   4128  N  N    . LEU A 1 81 ? 138.461 0.378   6.063   1.00 0.00 ? 81  LEU A N    2  
ATOM   4129  C  CA   . LEU A 1 81 ? 137.870 -0.905  6.418   1.00 0.00 ? 81  LEU A CA   2  
ATOM   4130  C  C    . LEU A 1 81 ? 138.957 -1.927  6.720   1.00 0.00 ? 81  LEU A C    2  
ATOM   4131  O  O    . LEU A 1 81 ? 138.807 -2.774  7.603   1.00 0.00 ? 81  LEU A O    2  
ATOM   4132  C  CB   . LEU A 1 81 ? 136.992 -1.412  5.271   1.00 0.00 ? 81  LEU A CB   2  
ATOM   4133  C  CG   . LEU A 1 81 ? 135.907 -0.379  4.950   1.00 0.00 ? 81  LEU A CG   2  
ATOM   4134  C  CD1  . LEU A 1 81 ? 134.967 -0.946  3.886   1.00 0.00 ? 81  LEU A CD1  2  
ATOM   4135  C  CD2  . LEU A 1 81 ? 135.104 -0.058  6.214   1.00 0.00 ? 81  LEU A CD2  2  
ATOM   4136  H  H    . LEU A 1 81 ? 138.343 0.727   5.154   1.00 0.00 ? 81  LEU A H    2  
ATOM   4137  H  HA   . LEU A 1 81 ? 137.259 -0.779  7.298   1.00 0.00 ? 81  LEU A HA   2  
ATOM   4138  H  HB2  . LEU A 1 81 ? 137.605 -1.574  4.396   1.00 0.00 ? 81  LEU A HB2  2  
ATOM   4139  H  HB3  . LEU A 1 81 ? 136.525 -2.341  5.560   1.00 0.00 ? 81  LEU A HB3  2  
ATOM   4140  H  HG   . LEU A 1 81 ? 136.370 0.524   4.575   1.00 0.00 ? 81  LEU A HG   2  
ATOM   4141  H  HD11 . LEU A 1 81 ? 134.281 -0.177  3.565   1.00 0.00 ? 81  LEU A HD11 2  
ATOM   4142  H  HD12 . LEU A 1 81 ? 134.412 -1.774  4.304   1.00 0.00 ? 81  LEU A HD12 2  
ATOM   4143  H  HD13 . LEU A 1 81 ? 135.546 -1.290  3.041   1.00 0.00 ? 81  LEU A HD13 2  
ATOM   4144  H  HD21 . LEU A 1 81 ? 134.118 0.286   5.938   1.00 0.00 ? 81  LEU A HD21 2  
ATOM   4145  H  HD22 . LEU A 1 81 ? 135.609 0.713   6.775   1.00 0.00 ? 81  LEU A HD22 2  
ATOM   4146  H  HD23 . LEU A 1 81 ? 135.018 -0.948  6.820   1.00 0.00 ? 81  LEU A HD23 2  
ATOM   4147  N  N    . THR A 1 82 ? 140.059 -1.834  5.979   1.00 0.00 ? 82  THR A N    2  
ATOM   4148  C  CA   . THR A 1 82 ? 141.172 -2.761  6.159   1.00 0.00 ? 82  THR A CA   2  
ATOM   4149  C  C    . THR A 1 82 ? 141.605 -2.804  7.615   1.00 0.00 ? 82  THR A C    2  
ATOM   4150  O  O    . THR A 1 82 ? 141.965 -3.861  8.134   1.00 0.00 ? 82  THR A O    2  
ATOM   4151  C  CB   . THR A 1 82 ? 142.355 -2.330  5.291   1.00 0.00 ? 82  THR A CB   2  
ATOM   4152  O  OG1  . THR A 1 82 ? 141.938 -2.229  3.937   1.00 0.00 ? 82  THR A OG1  2  
ATOM   4153  C  CG2  . THR A 1 82 ? 143.493 -3.349  5.409   1.00 0.00 ? 82  THR A CG2  2  
ATOM   4154  H  H    . THR A 1 82 ? 140.119 -1.135  5.285   1.00 0.00 ? 82  THR A H    2  
ATOM   4155  H  HA   . THR A 1 82 ? 140.859 -3.746  5.856   1.00 0.00 ? 82  THR A HA   2  
ATOM   4156  H  HB   . THR A 1 82 ? 142.706 -1.369  5.628   1.00 0.00 ? 82  THR A HB   2  
ATOM   4157  H  HG1  . THR A 1 82 ? 141.768 -3.116  3.612   1.00 0.00 ? 82  THR A HG1  2  
ATOM   4158  H  HG21 . THR A 1 82 ? 144.188 -3.024  6.169   1.00 0.00 ? 82  THR A HG21 2  
ATOM   4159  H  HG22 . THR A 1 82 ? 144.006 -3.426  4.462   1.00 0.00 ? 82  THR A HG22 2  
ATOM   4160  H  HG23 . THR A 1 82 ? 143.092 -4.316  5.679   1.00 0.00 ? 82  THR A HG23 2  
ATOM   4161  N  N    . VAL A 1 83 ? 141.569 -1.657  8.269   1.00 0.00 ? 83  VAL A N    2  
ATOM   4162  C  CA   . VAL A 1 83 ? 141.959 -1.583  9.666   1.00 0.00 ? 83  VAL A CA   2  
ATOM   4163  C  C    . VAL A 1 83 ? 141.086 -2.507  10.508  1.00 0.00 ? 83  VAL A C    2  
ATOM   4164  O  O    . VAL A 1 83 ? 141.558 -3.102  11.477  1.00 0.00 ? 83  VAL A O    2  
ATOM   4165  C  CB   . VAL A 1 83 ? 141.837 -0.149  10.179  1.00 0.00 ? 83  VAL A CB   2  
ATOM   4166  C  CG1  . VAL A 1 83 ? 142.101 -0.125  11.686  1.00 0.00 ? 83  VAL A CG1  2  
ATOM   4167  C  CG2  . VAL A 1 83 ? 142.863 0.737   9.468   1.00 0.00 ? 83  VAL A CG2  2  
ATOM   4168  H  H    . VAL A 1 83 ? 141.273 -0.845  7.806   1.00 0.00 ? 83  VAL A H    2  
ATOM   4169  H  HA   . VAL A 1 83 ? 142.988 -1.898  9.757   1.00 0.00 ? 83  VAL A HA   2  
ATOM   4170  H  HB   . VAL A 1 83 ? 140.840 0.220   9.982   1.00 0.00 ? 83  VAL A HB   2  
ATOM   4171  H  HG11 . VAL A 1 83 ? 142.215 0.897   12.016  1.00 0.00 ? 83  VAL A HG11 2  
ATOM   4172  H  HG12 . VAL A 1 83 ? 143.006 -0.677  11.902  1.00 0.00 ? 83  VAL A HG12 2  
ATOM   4173  H  HG13 . VAL A 1 83 ? 141.269 -0.579  12.205  1.00 0.00 ? 83  VAL A HG13 2  
ATOM   4174  H  HG21 . VAL A 1 83 ? 143.813 0.668   9.979   1.00 0.00 ? 83  VAL A HG21 2  
ATOM   4175  H  HG22 . VAL A 1 83 ? 142.523 1.762   9.478   1.00 0.00 ? 83  VAL A HG22 2  
ATOM   4176  H  HG23 . VAL A 1 83 ? 142.979 0.406   8.446   1.00 0.00 ? 83  VAL A HG23 2  
ATOM   4177  N  N    . ALA A 1 84 ? 139.806 -2.622  10.146  1.00 0.00 ? 84  ALA A N    2  
ATOM   4178  C  CA   . ALA A 1 84 ? 138.897 -3.476  10.903  1.00 0.00 ? 84  ALA A CA   2  
ATOM   4179  C  C    . ALA A 1 84 ? 139.376 -4.925  10.882  1.00 0.00 ? 84  ALA A C    2  
ATOM   4180  O  O    . ALA A 1 84 ? 139.271 -5.639  11.885  1.00 0.00 ? 84  ALA A O    2  
ATOM   4181  C  CB   . ALA A 1 84 ? 137.488 -3.394  10.311  1.00 0.00 ? 84  ALA A CB   2  
ATOM   4182  H  H    . ALA A 1 84 ? 139.470 -2.128  9.359   1.00 0.00 ? 84  ALA A H    2  
ATOM   4183  H  HA   . ALA A 1 84 ? 138.865 -3.133  11.926  1.00 0.00 ? 84  ALA A HA   2  
ATOM   4184  H  HB1  . ALA A 1 84 ? 136.783 -3.835  10.998  1.00 0.00 ? 84  ALA A HB1  2  
ATOM   4185  H  HB2  . ALA A 1 84 ? 137.460 -3.929  9.373   1.00 0.00 ? 84  ALA A HB2  2  
ATOM   4186  H  HB3  . ALA A 1 84 ? 137.229 -2.359  10.144  1.00 0.00 ? 84  ALA A HB3  2  
ATOM   4187  N  N    . MET A 1 85 ? 139.922 -5.356  9.748   1.00 0.00 ? 85  MET A N    2  
ATOM   4188  C  CA   . MET A 1 85 ? 140.424 -6.718  9.647   1.00 0.00 ? 85  MET A CA   2  
ATOM   4189  C  C    . MET A 1 85 ? 141.505 -6.942  10.692  1.00 0.00 ? 85  MET A C    2  
ATOM   4190  O  O    . MET A 1 85 ? 141.580 -8.009  11.301  1.00 0.00 ? 85  MET A O    2  
ATOM   4191  C  CB   . MET A 1 85 ? 140.989 -6.974  8.244   1.00 0.00 ? 85  MET A CB   2  
ATOM   4192  C  CG   . MET A 1 85 ? 141.496 -8.419  8.128   1.00 0.00 ? 85  MET A CG   2  
ATOM   4193  S  SD   . MET A 1 85 ? 140.093 -9.556  8.001   1.00 0.00 ? 85  MET A SD   2  
ATOM   4194  C  CE   . MET A 1 85 ? 140.931 -11.014 8.678   1.00 0.00 ? 85  MET A CE   2  
ATOM   4195  H  H    . MET A 1 85 ? 139.999 -4.750  8.982   1.00 0.00 ? 85  MET A H    2  
ATOM   4196  H  HA   . MET A 1 85 ? 139.612 -7.406  9.830   1.00 0.00 ? 85  MET A HA   2  
ATOM   4197  H  HB2  . MET A 1 85 ? 140.212 -6.807  7.511   1.00 0.00 ? 85  MET A HB2  2  
ATOM   4198  H  HB3  . MET A 1 85 ? 141.808 -6.294  8.059   1.00 0.00 ? 85  MET A HB3  2  
ATOM   4199  H  HG2  . MET A 1 85 ? 142.107 -8.511  7.244   1.00 0.00 ? 85  MET A HG2  2  
ATOM   4200  H  HG3  . MET A 1 85 ? 142.085 -8.673  8.996   1.00 0.00 ? 85  MET A HG3  2  
ATOM   4201  H  HE1  . MET A 1 85 ? 141.164 -10.843 9.721   1.00 0.00 ? 85  MET A HE1  2  
ATOM   4202  H  HE2  . MET A 1 85 ? 141.845 -11.192 8.135   1.00 0.00 ? 85  MET A HE2  2  
ATOM   4203  H  HE3  . MET A 1 85 ? 140.285 -11.875 8.585   1.00 0.00 ? 85  MET A HE3  2  
ATOM   4204  N  N    . ASN A 1 86 ? 142.334 -5.926  10.907  1.00 0.00 ? 86  ASN A N    2  
ATOM   4205  C  CA   . ASN A 1 86 ? 143.389 -6.038  11.898  1.00 0.00 ? 86  ASN A CA   2  
ATOM   4206  C  C    . ASN A 1 86 ? 142.794 -6.348  13.263  1.00 0.00 ? 86  ASN A C    2  
ATOM   4207  O  O    . ASN A 1 86 ? 143.280 -7.219  13.984  1.00 0.00 ? 86  ASN A O    2  
ATOM   4208  C  CB   . ASN A 1 86 ? 144.156 -4.720  11.967  1.00 0.00 ? 86  ASN A CB   2  
ATOM   4209  C  CG   . ASN A 1 86 ? 145.414 -4.881  12.808  1.00 0.00 ? 86  ASN A CG   2  
ATOM   4210  O  OD1  . ASN A 1 86 ? 146.037 -5.942  12.805  1.00 0.00 ? 86  ASN A OD1  2  
ATOM   4211  N  ND2  . ASN A 1 86 ? 145.816 -3.882  13.546  1.00 0.00 ? 86  ASN A ND2  2  
ATOM   4212  H  H    . ASN A 1 86 ? 142.225 -5.092  10.403  1.00 0.00 ? 86  ASN A H    2  
ATOM   4213  H  HA   . ASN A 1 86 ? 144.066 -6.829  11.613  1.00 0.00 ? 86  ASN A HA   2  
ATOM   4214  H  HB2  . ASN A 1 86 ? 144.430 -4.414  10.968  1.00 0.00 ? 86  ASN A HB2  2  
ATOM   4215  H  HB3  . ASN A 1 86 ? 143.526 -3.964  12.411  1.00 0.00 ? 86  ASN A HB3  2  
ATOM   4216  H  HD21 . ASN A 1 86 ? 145.307 -3.045  13.553  1.00 0.00 ? 86  ASN A HD21 2  
ATOM   4217  H  HD22 . ASN A 1 86 ? 146.624 -3.970  14.091  1.00 0.00 ? 86  ASN A HD22 2  
ATOM   4218  N  N    . ASN A 1 87 ? 141.718 -5.641  13.601  1.00 0.00 ? 87  ASN A N    2  
ATOM   4219  C  CA   . ASN A 1 87 ? 141.046 -5.868  14.871  1.00 0.00 ? 87  ASN A CA   2  
ATOM   4220  C  C    . ASN A 1 87 ? 140.488 -7.283  14.925  1.00 0.00 ? 87  ASN A C    2  
ATOM   4221  O  O    . ASN A 1 87 ? 140.572 -7.962  15.948  1.00 0.00 ? 87  ASN A O    2  
ATOM   4222  C  CB   . ASN A 1 87 ? 139.919 -4.852  15.053  1.00 0.00 ? 87  ASN A CB   2  
ATOM   4223  C  CG   . ASN A 1 87 ? 139.418 -4.881  16.493  1.00 0.00 ? 87  ASN A CG   2  
ATOM   4224  O  OD1  . ASN A 1 87 ? 140.179 -4.606  17.421  1.00 0.00 ? 87  ASN A OD1  2  
ATOM   4225  N  ND2  . ASN A 1 87 ? 138.175 -5.196  16.736  1.00 0.00 ? 87  ASN A ND2  2  
ATOM   4226  H  H    . ASN A 1 87 ? 141.364 -4.972  12.978  1.00 0.00 ? 87  ASN A H    2  
ATOM   4227  H  HA   . ASN A 1 87 ? 141.760 -5.743  15.671  1.00 0.00 ? 87  ASN A HA   2  
ATOM   4228  H  HB2  . ASN A 1 87 ? 140.292 -3.863  14.822  1.00 0.00 ? 87  ASN A HB2  2  
ATOM   4229  H  HB3  . ASN A 1 87 ? 139.105 -5.094  14.386  1.00 0.00 ? 87  ASN A HB3  2  
ATOM   4230  H  HD21 . ASN A 1 87 ? 137.571 -5.413  15.996  1.00 0.00 ? 87  ASN A HD21 2  
ATOM   4231  H  HD22 . ASN A 1 87 ? 137.846 -5.217  17.659  1.00 0.00 ? 87  ASN A HD22 2  
ATOM   4232  N  N    . PHE A 1 88 ? 139.921 -7.718  13.802  1.00 0.00 ? 88  PHE A N    2  
ATOM   4233  C  CA   . PHE A 1 88 ? 139.351 -9.058  13.709  1.00 0.00 ? 88  PHE A CA   2  
ATOM   4234  C  C    . PHE A 1 88 ? 140.419 -10.116 13.952  1.00 0.00 ? 88  PHE A C    2  
ATOM   4235  O  O    . PHE A 1 88 ? 140.199 -11.090 14.671  1.00 0.00 ? 88  PHE A O    2  
ATOM   4236  C  CB   . PHE A 1 88 ? 138.737 -9.259  12.321  1.00 0.00 ? 88  PHE A CB   2  
ATOM   4237  C  CG   . PHE A 1 88 ? 138.036 -10.594 12.261  1.00 0.00 ? 88  PHE A CG   2  
ATOM   4238  C  CD1  . PHE A 1 88 ? 136.714 -10.711 12.706  1.00 0.00 ? 88  PHE A CD1  2  
ATOM   4239  C  CD2  . PHE A 1 88 ? 138.707 -11.714 11.756  1.00 0.00 ? 88  PHE A CD2  2  
ATOM   4240  C  CE1  . PHE A 1 88 ? 136.062 -11.949 12.645  1.00 0.00 ? 88  PHE A CE1  2  
ATOM   4241  C  CE2  . PHE A 1 88 ? 138.054 -12.952 11.696  1.00 0.00 ? 88  PHE A CE2  2  
ATOM   4242  C  CZ   . PHE A 1 88 ? 136.732 -13.069 12.140  1.00 0.00 ? 88  PHE A CZ   2  
ATOM   4243  H  H    . PHE A 1 88 ? 139.888 -7.125  13.017  1.00 0.00 ? 88  PHE A H    2  
ATOM   4244  H  HA   . PHE A 1 88 ? 138.575 -9.162  14.452  1.00 0.00 ? 88  PHE A HA   2  
ATOM   4245  H  HB2  . PHE A 1 88 ? 138.026 -8.470  12.125  1.00 0.00 ? 88  PHE A HB2  2  
ATOM   4246  H  HB3  . PHE A 1 88 ? 139.518 -9.230  11.577  1.00 0.00 ? 88  PHE A HB3  2  
ATOM   4247  H  HD1  . PHE A 1 88 ? 136.196 -9.846  13.095  1.00 0.00 ? 88  PHE A HD1  2  
ATOM   4248  H  HD2  . PHE A 1 88 ? 139.727 -11.625 11.413  1.00 0.00 ? 88  PHE A HD2  2  
ATOM   4249  H  HE1  . PHE A 1 88 ? 135.042 -12.038 12.989  1.00 0.00 ? 88  PHE A HE1  2  
ATOM   4250  H  HE2  . PHE A 1 88 ? 138.572 -13.817 11.307  1.00 0.00 ? 88  PHE A HE2  2  
ATOM   4251  H  HZ   . PHE A 1 88 ? 136.230 -14.023 12.094  1.00 0.00 ? 88  PHE A HZ   2  
ATOM   4252  N  N    . PHE A 1 89 ? 141.579 -9.907  13.343  1.00 0.00 ? 89  PHE A N    2  
ATOM   4253  C  CA   . PHE A 1 89 ? 142.692 -10.838 13.470  1.00 0.00 ? 89  PHE A CA   2  
ATOM   4254  C  C    . PHE A 1 89 ? 143.016 -11.079 14.936  1.00 0.00 ? 89  PHE A C    2  
ATOM   4255  O  O    . PHE A 1 89 ? 143.373 -12.188 15.336  1.00 0.00 ? 89  PHE A O    2  
ATOM   4256  C  CB   . PHE A 1 89 ? 143.921 -10.276 12.756  1.00 0.00 ? 89  PHE A CB   2  
ATOM   4257  C  CG   . PHE A 1 89 ? 145.010 -11.316 12.740  1.00 0.00 ? 89  PHE A CG   2  
ATOM   4258  C  CD1  . PHE A 1 89 ? 145.025 -12.281 11.728  1.00 0.00 ? 89  PHE A CD1  2  
ATOM   4259  C  CD2  . PHE A 1 89 ? 146.000 -11.321 13.730  1.00 0.00 ? 89  PHE A CD2  2  
ATOM   4260  C  CE1  . PHE A 1 89 ? 146.029 -13.253 11.701  1.00 0.00 ? 89  PHE A CE1  2  
ATOM   4261  C  CE2  . PHE A 1 89 ? 147.007 -12.294 13.704  1.00 0.00 ? 89  PHE A CE2  2  
ATOM   4262  C  CZ   . PHE A 1 89 ? 147.021 -13.260 12.689  1.00 0.00 ? 89  PHE A CZ   2  
ATOM   4263  H  H    . PHE A 1 89 ? 141.687 -9.108  12.786  1.00 0.00 ? 89  PHE A H    2  
ATOM   4264  H  HA   . PHE A 1 89 ? 142.420 -11.776 13.010  1.00 0.00 ? 89  PHE A HA   2  
ATOM   4265  H  HB2  . PHE A 1 89 ? 143.658 -10.011 11.742  1.00 0.00 ? 89  PHE A HB2  2  
ATOM   4266  H  HB3  . PHE A 1 89 ? 144.270 -9.397  13.278  1.00 0.00 ? 89  PHE A HB3  2  
ATOM   4267  H  HD1  . PHE A 1 89 ? 144.261 -12.275 10.966  1.00 0.00 ? 89  PHE A HD1  2  
ATOM   4268  H  HD2  . PHE A 1 89 ? 145.988 -10.575 14.510  1.00 0.00 ? 89  PHE A HD2  2  
ATOM   4269  H  HE1  . PHE A 1 89 ? 146.037 -13.996 10.918  1.00 0.00 ? 89  PHE A HE1  2  
ATOM   4270  H  HE2  . PHE A 1 89 ? 147.772 -12.299 14.466  1.00 0.00 ? 89  PHE A HE2  2  
ATOM   4271  H  HZ   . PHE A 1 89 ? 147.798 -14.011 12.670  1.00 0.00 ? 89  PHE A HZ   2  
ATOM   4272  N  N    . TRP A 1 90 ? 142.896 -10.026 15.727  1.00 0.00 ? 90  TRP A N    2  
ATOM   4273  C  CA   . TRP A 1 90 ? 143.184 -10.103 17.151  1.00 0.00 ? 90  TRP A CA   2  
ATOM   4274  C  C    . TRP A 1 90 ? 142.417 -11.246 17.812  1.00 0.00 ? 90  TRP A C    2  
ATOM   4275  O  O    . TRP A 1 90 ? 142.888 -11.821 18.794  1.00 0.00 ? 90  TRP A O    2  
ATOM   4276  C  CB   . TRP A 1 90 ? 142.818 -8.782  17.829  1.00 0.00 ? 90  TRP A CB   2  
ATOM   4277  C  CG   . TRP A 1 90 ? 143.287 -8.810  19.248  1.00 0.00 ? 90  TRP A CG   2  
ATOM   4278  C  CD1  . TRP A 1 90 ? 142.488 -8.954  20.330  1.00 0.00 ? 90  TRP A CD1  2  
ATOM   4279  C  CD2  . TRP A 1 90 ? 144.648 -8.696  19.756  1.00 0.00 ? 90  TRP A CD2  2  
ATOM   4280  N  NE1  . TRP A 1 90 ? 143.272 -8.934  21.470  1.00 0.00 ? 90  TRP A NE1  2  
ATOM   4281  C  CE2  . TRP A 1 90 ? 144.611 -8.778  21.168  1.00 0.00 ? 90  TRP A CE2  2  
ATOM   4282  C  CE3  . TRP A 1 90 ? 145.899 -8.531  19.133  1.00 0.00 ? 90  TRP A CE3  2  
ATOM   4283  C  CZ2  . TRP A 1 90 ? 145.773 -8.699  21.935  1.00 0.00 ? 90  TRP A CZ2  2  
ATOM   4284  C  CZ3  . TRP A 1 90 ? 147.071 -8.451  19.903  1.00 0.00 ? 90  TRP A CZ3  2  
ATOM   4285  C  CH2  . TRP A 1 90 ? 147.008 -8.535  21.301  1.00 0.00 ? 90  TRP A CH2  2  
ATOM   4286  H  H    . TRP A 1 90 ? 142.614 -9.170  15.342  1.00 0.00 ? 90  TRP A H    2  
ATOM   4287  H  HA   . TRP A 1 90 ? 144.241 -10.274 17.281  1.00 0.00 ? 90  TRP A HA   2  
ATOM   4288  H  HB2  . TRP A 1 90 ? 143.294 -7.964  17.308  1.00 0.00 ? 90  TRP A HB2  2  
ATOM   4289  H  HB3  . TRP A 1 90 ? 141.746 -8.650  17.807  1.00 0.00 ? 90  TRP A HB3  2  
ATOM   4290  H  HD1  . TRP A 1 90 ? 141.414 -9.065  20.308  1.00 0.00 ? 90  TRP A HD1  2  
ATOM   4291  H  HE1  . TRP A 1 90 ? 142.939 -9.020  22.388  1.00 0.00 ? 90  TRP A HE1  2  
ATOM   4292  H  HE3  . TRP A 1 90 ? 145.958 -8.466  18.057  1.00 0.00 ? 90  TRP A HE3  2  
ATOM   4293  H  HZ2  . TRP A 1 90 ? 145.720 -8.764  23.012  1.00 0.00 ? 90  TRP A HZ2  2  
ATOM   4294  H  HZ3  . TRP A 1 90 ? 148.026 -8.325  19.415  1.00 0.00 ? 90  TRP A HZ3  2  
ATOM   4295  H  HH2  . TRP A 1 90 ? 147.912 -8.472  21.888  1.00 0.00 ? 90  TRP A HH2  2  
ATOM   4296  N  N    . GLU A 1 91 ? 141.227 -11.566 17.302  1.00 0.00 ? 91  GLU A N    2  
ATOM   4297  C  CA   . GLU A 1 91 ? 140.433 -12.634 17.908  1.00 0.00 ? 91  GLU A CA   2  
ATOM   4298  C  C    . GLU A 1 91 ? 141.212 -13.947 17.897  1.00 0.00 ? 91  GLU A C    2  
ATOM   4299  O  O    . GLU A 1 91 ? 141.026 -14.797 18.767  1.00 0.00 ? 91  GLU A O    2  
ATOM   4300  C  CB   . GLU A 1 91 ? 139.106 -12.810 17.151  1.00 0.00 ? 91  GLU A CB   2  
ATOM   4301  C  CG   . GLU A 1 91 ? 139.312 -13.659 15.887  1.00 0.00 ? 91  GLU A CG   2  
ATOM   4302  C  CD   . GLU A 1 91 ? 138.030 -13.683 15.064  1.00 0.00 ? 91  GLU A CD   2  
ATOM   4303  O  OE1  . GLU A 1 91 ? 137.039 -13.144 15.530  1.00 0.00 ? 91  GLU A OE1  2  
ATOM   4304  O  OE2  . GLU A 1 91 ? 138.057 -14.241 13.980  1.00 0.00 ? 91  GLU A OE2  2  
ATOM   4305  H  H    . GLU A 1 91 ? 140.876 -11.075 16.523  1.00 0.00 ? 91  GLU A H    2  
ATOM   4306  H  HA   . GLU A 1 91 ? 140.216 -12.367 18.932  1.00 0.00 ? 91  GLU A HA   2  
ATOM   4307  H  HB2  . GLU A 1 91 ? 138.390 -13.298 17.796  1.00 0.00 ? 91  GLU A HB2  2  
ATOM   4308  H  HB3  . GLU A 1 91 ? 138.726 -11.839 16.868  1.00 0.00 ? 91  GLU A HB3  2  
ATOM   4309  H  HG2  . GLU A 1 91 ? 140.114 -13.246 15.298  1.00 0.00 ? 91  GLU A HG2  2  
ATOM   4310  H  HG3  . GLU A 1 91 ? 139.563 -14.670 16.171  1.00 0.00 ? 91  GLU A HG3  2  
ATOM   4311  N  N    . ASN A 1 92 ? 142.088 -14.101 16.909  1.00 0.00 ? 92  ASN A N    2  
ATOM   4312  C  CA   . ASN A 1 92 ? 142.894 -15.311 16.798  1.00 0.00 ? 92  ASN A CA   2  
ATOM   4313  C  C    . ASN A 1 92 ? 143.684 -15.547 18.082  1.00 0.00 ? 92  ASN A C    2  
ATOM   4314  O  O    . ASN A 1 92 ? 143.903 -16.689 18.486  1.00 0.00 ? 92  ASN A O    2  
ATOM   4315  C  CB   . ASN A 1 92 ? 143.855 -15.193 15.614  1.00 0.00 ? 92  ASN A CB   2  
ATOM   4316  C  CG   . ASN A 1 92 ? 143.068 -15.111 14.312  1.00 0.00 ? 92  ASN A CG   2  
ATOM   4317  O  OD1  . ASN A 1 92 ? 143.655 -15.034 13.234  1.00 0.00 ? 92  ASN A OD1  2  
ATOM   4318  N  ND2  . ASN A 1 92 ? 141.762 -15.125 14.348  1.00 0.00 ? 92  ASN A ND2  2  
ATOM   4319  H  H    . ASN A 1 92 ? 142.197 -13.388 16.246  1.00 0.00 ? 92  ASN A H    2  
ATOM   4320  H  HA   . ASN A 1 92 ? 142.238 -16.153 16.631  1.00 0.00 ? 92  ASN A HA   2  
ATOM   4321  H  HB2  . ASN A 1 92 ? 144.455 -14.302 15.728  1.00 0.00 ? 92  ASN A HB2  2  
ATOM   4322  H  HB3  . ASN A 1 92 ? 144.500 -16.059 15.589  1.00 0.00 ? 92  ASN A HB3  2  
ATOM   4323  H  HD21 . ASN A 1 92 ? 141.296 -15.188 15.207  1.00 0.00 ? 92  ASN A HD21 2  
ATOM   4324  H  HD22 . ASN A 1 92 ? 141.249 -15.074 13.515  1.00 0.00 ? 92  ASN A HD22 2  
ATOM   4325  N  N    . SER A 1 93 ? 144.109 -14.459 18.715  1.00 0.00 ? 93  SER A N    2  
ATOM   4326  C  CA   . SER A 1 93 ? 144.875 -14.558 19.952  1.00 0.00 ? 93  SER A CA   2  
ATOM   4327  C  C    . SER A 1 93 ? 144.658 -13.320 20.818  1.00 0.00 ? 93  SER A C    2  
ATOM   4328  O  O    . SER A 1 93 ? 144.252 -13.481 21.957  1.00 0.00 ? 93  SER A O    2  
ATOM   4329  C  CB   . SER A 1 93 ? 146.364 -14.705 19.635  1.00 0.00 ? 93  SER A CB   2  
ATOM   4330  O  OG   . SER A 1 93 ? 147.125 -14.352 20.782  1.00 0.00 ? 93  SER A OG   2  
ATOM   4331  O  OXT  . SER A 1 93 ? 144.903 -12.230 20.328  1.00 0.00 ? 93  SER A OXT  2  
ATOM   4332  H  H    . SER A 1 93 ? 143.904 -13.575 18.346  1.00 0.00 ? 93  SER A H    2  
ATOM   4333  H  HA   . SER A 1 93 ? 144.549 -15.429 20.499  1.00 0.00 ? 93  SER A HA   2  
ATOM   4334  H  HB2  . SER A 1 93 ? 146.578 -15.726 19.368  1.00 0.00 ? 93  SER A HB2  2  
ATOM   4335  H  HB3  . SER A 1 93 ? 146.618 -14.057 18.806  1.00 0.00 ? 93  SER A HB3  2  
ATOM   4336  H  HG   . SER A 1 93 ? 146.951 -15.001 21.466  1.00 0.00 ? 93  SER A HG   2  
ATOM   4337  N  N    . GLY B 1 1  ? 135.898 -16.377 1.072   1.00 0.00 ? 1   GLY B N    2  
ATOM   4338  C  CA   . GLY B 1 1  ? 137.215 -15.802 0.822   1.00 0.00 ? 1   GLY B CA   2  
ATOM   4339  C  C    . GLY B 1 1  ? 137.200 -14.927 -0.427  1.00 0.00 ? 1   GLY B C    2  
ATOM   4340  O  O    . GLY B 1 1  ? 137.724 -15.312 -1.472  1.00 0.00 ? 1   GLY B O    2  
ATOM   4341  H  H1   . GLY B 1 1  ? 135.446 -16.890 0.369   1.00 0.00 ? 1   GLY B H1   2  
ATOM   4342  H  HA2  . GLY B 1 1  ? 137.508 -15.204 1.673   1.00 0.00 ? 1   GLY B HA2  2  
ATOM   4343  H  HA3  . GLY B 1 1  ? 137.930 -16.600 0.685   1.00 0.00 ? 1   GLY B HA3  2  
ATOM   4344  N  N    . SER B 1 2  ? 136.595 -13.749 -0.312  1.00 0.00 ? 2   SER B N    2  
ATOM   4345  C  CA   . SER B 1 2  ? 136.517 -12.831 -1.440  1.00 0.00 ? 2   SER B CA   2  
ATOM   4346  C  C    . SER B 1 2  ? 137.912 -12.385 -1.868  1.00 0.00 ? 2   SER B C    2  
ATOM   4347  O  O    . SER B 1 2  ? 138.850 -12.372 -1.063  1.00 0.00 ? 2   SER B O    2  
ATOM   4348  C  CB   . SER B 1 2  ? 135.686 -11.606 -1.060  1.00 0.00 ? 2   SER B CB   2  
ATOM   4349  O  OG   . SER B 1 2  ? 134.392 -12.025 -0.648  1.00 0.00 ? 2   SER B OG   2  
ATOM   4350  H  H    . SER B 1 2  ? 136.193 -13.495 0.545   1.00 0.00 ? 2   SER B H    2  
ATOM   4351  H  HA   . SER B 1 2  ? 136.039 -13.331 -2.269  1.00 0.00 ? 2   SER B HA   2  
ATOM   4352  H  HB2  . SER B 1 2  ? 136.164 -11.084 -0.248  1.00 0.00 ? 2   SER B HB2  2  
ATOM   4353  H  HB3  . SER B 1 2  ? 135.608 -10.945 -1.913  1.00 0.00 ? 2   SER B HB3  2  
ATOM   4354  H  HG   . SER B 1 2  ? 134.428 -12.968 -0.470  1.00 0.00 ? 2   SER B HG   2  
ATOM   4355  N  N    . GLU B 1 3  ? 138.047 -12.013 -3.137  1.00 0.00 ? 3   GLU B N    2  
ATOM   4356  C  CA   . GLU B 1 3  ? 139.337 -11.569 -3.639  1.00 0.00 ? 3   GLU B CA   2  
ATOM   4357  C  C    . GLU B 1 3  ? 139.790 -10.332 -2.881  1.00 0.00 ? 3   GLU B C    2  
ATOM   4358  O  O    . GLU B 1 3  ? 140.979 -10.164 -2.608  1.00 0.00 ? 3   GLU B O    2  
ATOM   4359  C  CB   . GLU B 1 3  ? 139.239 -11.247 -5.132  1.00 0.00 ? 3   GLU B CB   2  
ATOM   4360  C  CG   . GLU B 1 3  ? 138.914 -12.522 -5.912  1.00 0.00 ? 3   GLU B CG   2  
ATOM   4361  C  CD   . GLU B 1 3  ? 138.881 -12.221 -7.408  1.00 0.00 ? 3   GLU B CD   2  
ATOM   4362  O  OE1  . GLU B 1 3  ? 138.936 -11.055 -7.760  1.00 0.00 ? 3   GLU B OE1  2  
ATOM   4363  O  OE2  . GLU B 1 3  ? 138.802 -13.164 -8.179  1.00 0.00 ? 3   GLU B OE2  2  
ATOM   4364  H  H    . GLU B 1 3  ? 137.272 -12.037 -3.737  1.00 0.00 ? 3   GLU B H    2  
ATOM   4365  H  HA   . GLU B 1 3  ? 140.061 -12.357 -3.497  1.00 0.00 ? 3   GLU B HA   2  
ATOM   4366  H  HB2  . GLU B 1 3  ? 138.457 -10.518 -5.292  1.00 0.00 ? 3   GLU B HB2  2  
ATOM   4367  H  HB3  . GLU B 1 3  ? 140.181 -10.847 -5.476  1.00 0.00 ? 3   GLU B HB3  2  
ATOM   4368  H  HG2  . GLU B 1 3  ? 139.670 -13.267 -5.712  1.00 0.00 ? 3   GLU B HG2  2  
ATOM   4369  H  HG3  . GLU B 1 3  ? 137.951 -12.896 -5.602  1.00 0.00 ? 3   GLU B HG3  2  
ATOM   4370  N  N    . LEU B 1 4  ? 138.838 -9.473  -2.523  1.00 0.00 ? 4   LEU B N    2  
ATOM   4371  C  CA   . LEU B 1 4  ? 139.178 -8.274  -1.775  1.00 0.00 ? 4   LEU B CA   2  
ATOM   4372  C  C    . LEU B 1 4  ? 139.836 -8.670  -0.461  1.00 0.00 ? 4   LEU B C    2  
ATOM   4373  O  O    . LEU B 1 4  ? 140.839 -8.084  -0.044  1.00 0.00 ? 4   LEU B O    2  
ATOM   4374  C  CB   . LEU B 1 4  ? 137.898 -7.484  -1.471  1.00 0.00 ? 4   LEU B CB   2  
ATOM   4375  C  CG   . LEU B 1 4  ? 138.236 -6.158  -0.780  1.00 0.00 ? 4   LEU B CG   2  
ATOM   4376  C  CD1  . LEU B 1 4  ? 138.679 -5.125  -1.820  1.00 0.00 ? 4   LEU B CD1  2  
ATOM   4377  C  CD2  . LEU B 1 4  ? 137.002 -5.643  -0.027  1.00 0.00 ? 4   LEU B CD2  2  
ATOM   4378  H  H    . LEU B 1 4  ? 137.903 -9.658  -2.750  1.00 0.00 ? 4   LEU B H    2  
ATOM   4379  H  HA   . LEU B 1 4  ? 139.852 -7.661  -2.353  1.00 0.00 ? 4   LEU B HA   2  
ATOM   4380  H  HB2  . LEU B 1 4  ? 137.374 -7.284  -2.394  1.00 0.00 ? 4   LEU B HB2  2  
ATOM   4381  H  HB3  . LEU B 1 4  ? 137.268 -8.072  -0.822  1.00 0.00 ? 4   LEU B HB3  2  
ATOM   4382  H  HG   . LEU B 1 4  ? 139.041 -6.314  -0.081  1.00 0.00 ? 4   LEU B HG   2  
ATOM   4383  H  HD11 . LEU B 1 4  ? 138.741 -4.153  -1.355  1.00 0.00 ? 4   LEU B HD11 2  
ATOM   4384  H  HD12 . LEU B 1 4  ? 137.959 -5.093  -2.624  1.00 0.00 ? 4   LEU B HD12 2  
ATOM   4385  H  HD13 . LEU B 1 4  ? 139.646 -5.399  -2.212  1.00 0.00 ? 4   LEU B HD13 2  
ATOM   4386  H  HD21 . LEU B 1 4  ? 136.622 -6.421  0.623   1.00 0.00 ? 4   LEU B HD21 2  
ATOM   4387  H  HD22 . LEU B 1 4  ? 136.239 -5.361  -0.735  1.00 0.00 ? 4   LEU B HD22 2  
ATOM   4388  H  HD23 . LEU B 1 4  ? 137.276 -4.783  0.567   1.00 0.00 ? 4   LEU B HD23 2  
ATOM   4389  N  N    . GLU B 1 5  ? 139.267 -9.691  0.179   1.00 0.00 ? 5   GLU B N    2  
ATOM   4390  C  CA   . GLU B 1 5  ? 139.807 -10.172 1.437   1.00 0.00 ? 5   GLU B CA   2  
ATOM   4391  C  C    . GLU B 1 5  ? 141.188 -10.768 1.228   1.00 0.00 ? 5   GLU B C    2  
ATOM   4392  O  O    . GLU B 1 5  ? 142.094 -10.550 2.030   1.00 0.00 ? 5   GLU B O    2  
ATOM   4393  C  CB   . GLU B 1 5  ? 138.878 -11.231 2.031   1.00 0.00 ? 5   GLU B CB   2  
ATOM   4394  C  CG   . GLU B 1 5  ? 139.383 -11.634 3.418   1.00 0.00 ? 5   GLU B CG   2  
ATOM   4395  C  CD   . GLU B 1 5  ? 138.524 -12.761 3.979   1.00 0.00 ? 5   GLU B CD   2  
ATOM   4396  O  OE1  . GLU B 1 5  ? 137.617 -13.190 3.285   1.00 0.00 ? 5   GLU B OE1  2  
ATOM   4397  O  OE2  . GLU B 1 5  ? 138.787 -13.182 5.095   1.00 0.00 ? 5   GLU B OE2  2  
ATOM   4398  H  H    . GLU B 1 5  ? 138.478 -10.126 -0.208  1.00 0.00 ? 5   GLU B H    2  
ATOM   4399  H  HA   . GLU B 1 5  ? 139.882 -9.347  2.127   1.00 0.00 ? 5   GLU B HA   2  
ATOM   4400  H  HB2  . GLU B 1 5  ? 137.879 -10.828 2.115   1.00 0.00 ? 5   GLU B HB2  2  
ATOM   4401  H  HB3  . GLU B 1 5  ? 138.863 -12.099 1.391   1.00 0.00 ? 5   GLU B HB3  2  
ATOM   4402  H  HG2  . GLU B 1 5  ? 140.408 -11.966 3.343   1.00 0.00 ? 5   GLU B HG2  2  
ATOM   4403  H  HG3  . GLU B 1 5  ? 139.331 -10.782 4.080   1.00 0.00 ? 5   GLU B HG3  2  
ATOM   4404  N  N    . THR B 1 6  ? 141.348 -11.519 0.141   1.00 0.00 ? 6   THR B N    2  
ATOM   4405  C  CA   . THR B 1 6  ? 142.639 -12.129 -0.143  1.00 0.00 ? 6   THR B CA   2  
ATOM   4406  C  C    . THR B 1 6  ? 143.708 -11.062 -0.337  1.00 0.00 ? 6   THR B C    2  
ATOM   4407  O  O    . THR B 1 6  ? 144.828 -11.191 0.159   1.00 0.00 ? 6   THR B O    2  
ATOM   4408  C  CB   . THR B 1 6  ? 142.545 -12.994 -1.401  1.00 0.00 ? 6   THR B CB   2  
ATOM   4409  O  OG1  . THR B 1 6  ? 141.494 -13.937 -1.249  1.00 0.00 ? 6   THR B OG1  2  
ATOM   4410  C  CG2  . THR B 1 6  ? 143.867 -13.730 -1.615  1.00 0.00 ? 6   THR B CG2  2  
ATOM   4411  H  H    . THR B 1 6  ? 140.591 -11.663 -0.472  1.00 0.00 ? 6   THR B H    2  
ATOM   4412  H  HA   . THR B 1 6  ? 142.920 -12.758 0.689   1.00 0.00 ? 6   THR B HA   2  
ATOM   4413  H  HB   . THR B 1 6  ? 142.345 -12.365 -2.256  1.00 0.00 ? 6   THR B HB   2  
ATOM   4414  H  HG1  . THR B 1 6  ? 141.329 -14.339 -2.105  1.00 0.00 ? 6   THR B HG1  2  
ATOM   4415  H  HG21 . THR B 1 6  ? 144.630 -13.023 -1.907  1.00 0.00 ? 6   THR B HG21 2  
ATOM   4416  H  HG22 . THR B 1 6  ? 143.746 -14.471 -2.392  1.00 0.00 ? 6   THR B HG22 2  
ATOM   4417  H  HG23 . THR B 1 6  ? 144.161 -14.216 -0.695  1.00 0.00 ? 6   THR B HG23 2  
ATOM   4418  N  N    . ALA B 1 7  ? 143.352 -10.008 -1.064  1.00 0.00 ? 7   ALA B N    2  
ATOM   4419  C  CA   . ALA B 1 7  ? 144.286 -8.921  -1.322  1.00 0.00 ? 7   ALA B CA   2  
ATOM   4420  C  C    . ALA B 1 7  ? 144.616 -8.149  -0.050  1.00 0.00 ? 7   ALA B C    2  
ATOM   4421  O  O    . ALA B 1 7  ? 145.756 -7.738  0.159   1.00 0.00 ? 7   ALA B O    2  
ATOM   4422  C  CB   . ALA B 1 7  ? 143.693 -7.963  -2.356  1.00 0.00 ? 7   ALA B CB   2  
ATOM   4423  H  H    . ALA B 1 7  ? 142.445 -9.962  -1.434  1.00 0.00 ? 7   ALA B H    2  
ATOM   4424  H  HA   . ALA B 1 7  ? 145.199 -9.335  -1.722  1.00 0.00 ? 7   ALA B HA   2  
ATOM   4425  H  HB1  . ALA B 1 7  ? 143.079 -7.228  -1.857  1.00 0.00 ? 7   ALA B HB1  2  
ATOM   4426  H  HB2  . ALA B 1 7  ? 143.089 -8.520  -3.056  1.00 0.00 ? 7   ALA B HB2  2  
ATOM   4427  H  HB3  . ALA B 1 7  ? 144.492 -7.465  -2.886  1.00 0.00 ? 7   ALA B HB3  2  
ATOM   4428  N  N    . MET B 1 8  ? 143.606 -7.925  0.786   1.00 0.00 ? 8   MET B N    2  
ATOM   4429  C  CA   . MET B 1 8  ? 143.810 -7.167  2.016   1.00 0.00 ? 8   MET B CA   2  
ATOM   4430  C  C    . MET B 1 8  ? 144.826 -7.835  2.944   1.00 0.00 ? 8   MET B C    2  
ATOM   4431  O  O    . MET B 1 8  ? 145.726 -7.177  3.483   1.00 0.00 ? 8   MET B O    2  
ATOM   4432  C  CB   . MET B 1 8  ? 142.476 -7.060  2.753   1.00 0.00 ? 8   MET B CB   2  
ATOM   4433  C  CG   . MET B 1 8  ? 142.607 -6.102  3.933   1.00 0.00 ? 8   MET B CG   2  
ATOM   4434  S  SD   . MET B 1 8  ? 141.102 -6.184  4.936   1.00 0.00 ? 8   MET B SD   2  
ATOM   4435  C  CE   . MET B 1 8  ? 139.948 -5.613  3.665   1.00 0.00 ? 8   MET B CE   2  
ATOM   4436  H  H    . MET B 1 8  ? 142.704 -8.253  0.561   1.00 0.00 ? 8   MET B H    2  
ATOM   4437  H  HA   . MET B 1 8  ? 144.152 -6.174  1.770   1.00 0.00 ? 8   MET B HA   2  
ATOM   4438  H  HB2  . MET B 1 8  ? 141.721 -6.693  2.073   1.00 0.00 ? 8   MET B HB2  2  
ATOM   4439  H  HB3  . MET B 1 8  ? 142.188 -8.036  3.115   1.00 0.00 ? 8   MET B HB3  2  
ATOM   4440  H  HG2  . MET B 1 8  ? 143.459 -6.383  4.535   1.00 0.00 ? 8   MET B HG2  2  
ATOM   4441  H  HG3  . MET B 1 8  ? 142.740 -5.096  3.565   1.00 0.00 ? 8   MET B HG3  2  
ATOM   4442  H  HE1  . MET B 1 8  ? 139.094 -5.148  4.139   1.00 0.00 ? 8   MET B HE1  2  
ATOM   4443  H  HE2  . MET B 1 8  ? 139.617 -6.454  3.076   1.00 0.00 ? 8   MET B HE2  2  
ATOM   4444  H  HE3  . MET B 1 8  ? 140.445 -4.900  3.024   1.00 0.00 ? 8   MET B HE3  2  
ATOM   4445  N  N    . GLU B 1 9  ? 144.695 -9.149  3.103   1.00 0.00 ? 9   GLU B N    2  
ATOM   4446  C  CA   . GLU B 1 9  ? 145.594 -9.892  3.977   1.00 0.00 ? 9   GLU B CA   2  
ATOM   4447  C  C    . GLU B 1 9  ? 147.024 -9.715  3.529   1.00 0.00 ? 9   GLU B C    2  
ATOM   4448  O  O    . GLU B 1 9  ? 147.947 -9.703  4.343   1.00 0.00 ? 9   GLU B O    2  
ATOM   4449  C  CB   . GLU B 1 9  ? 145.226 -11.376 3.977   1.00 0.00 ? 9   GLU B CB   2  
ATOM   4450  C  CG   . GLU B 1 9  ? 143.838 -11.556 4.595   1.00 0.00 ? 9   GLU B CG   2  
ATOM   4451  C  CD   . GLU B 1 9  ? 143.482 -13.037 4.658   1.00 0.00 ? 9   GLU B CD   2  
ATOM   4452  O  OE1  . GLU B 1 9  ? 144.215 -13.828 4.090   1.00 0.00 ? 9   GLU B OE1  2  
ATOM   4453  O  OE2  . GLU B 1 9  ? 142.480 -13.360 5.275   1.00 0.00 ? 9   GLU B OE2  2  
ATOM   4454  H  H    . GLU B 1 9  ? 143.975 -9.623  2.636   1.00 0.00 ? 9   GLU B H    2  
ATOM   4455  H  HA   . GLU B 1 9  ? 145.495 -9.511  4.983   1.00 0.00 ? 9   GLU B HA   2  
ATOM   4456  H  HB2  . GLU B 1 9  ? 145.222 -11.747 2.962   1.00 0.00 ? 9   GLU B HB2  2  
ATOM   4457  H  HB3  . GLU B 1 9  ? 145.951 -11.926 4.559   1.00 0.00 ? 9   GLU B HB3  2  
ATOM   4458  H  HG2  . GLU B 1 9  ? 143.834 -11.144 5.593   1.00 0.00 ? 9   GLU B HG2  2  
ATOM   4459  H  HG3  . GLU B 1 9  ? 143.108 -11.039 3.994   1.00 0.00 ? 9   GLU B HG3  2  
ATOM   4460  N  N    . THR B 1 10 ? 147.206 -9.563  2.234   1.00 0.00 ? 10  THR B N    2  
ATOM   4461  C  CA   . THR B 1 10 ? 148.534 -9.370  1.703   1.00 0.00 ? 10  THR B CA   2  
ATOM   4462  C  C    . THR B 1 10 ? 149.190 -8.157  2.353   1.00 0.00 ? 10  THR B C    2  
ATOM   4463  O  O    . THR B 1 10 ? 150.397 -8.168  2.600   1.00 0.00 ? 10  THR B O    2  
ATOM   4464  C  CB   . THR B 1 10 ? 148.482 -9.179  0.183   1.00 0.00 ? 10  THR B CB   2  
ATOM   4465  O  OG1  . THR B 1 10 ? 147.785 -10.269 -0.403  1.00 0.00 ? 10  THR B OG1  2  
ATOM   4466  C  CG2  . THR B 1 10 ? 149.904 -9.119  -0.381  1.00 0.00 ? 10  THR B CG2  2  
ATOM   4467  H  H    . THR B 1 10 ? 146.436 -9.570  1.628   1.00 0.00 ? 10  THR B H    2  
ATOM   4468  H  HA   . THR B 1 10 ? 149.126 -10.246 1.922   1.00 0.00 ? 10  THR B HA   2  
ATOM   4469  H  HB   . THR B 1 10 ? 147.971 -8.258  -0.046  1.00 0.00 ? 10  THR B HB   2  
ATOM   4470  H  HG1  . THR B 1 10 ? 147.536 -10.875 0.298   1.00 0.00 ? 10  THR B HG1  2  
ATOM   4471  H  HG21 . THR B 1 10 ? 150.571 -9.695  0.245   1.00 0.00 ? 10  THR B HG21 2  
ATOM   4472  H  HG22 . THR B 1 10 ? 150.238 -8.093  -0.411  1.00 0.00 ? 10  THR B HG22 2  
ATOM   4473  H  HG23 . THR B 1 10 ? 149.912 -9.528  -1.381  1.00 0.00 ? 10  THR B HG23 2  
ATOM   4474  N  N    . LEU B 1 11 ? 148.414 -7.096  2.624   1.00 0.00 ? 11  LEU B N    2  
ATOM   4475  C  CA   . LEU B 1 11 ? 149.015 -5.911  3.235   1.00 0.00 ? 11  LEU B CA   2  
ATOM   4476  C  C    . LEU B 1 11 ? 149.568 -6.238  4.616   1.00 0.00 ? 11  LEU B C    2  
ATOM   4477  O  O    . LEU B 1 11 ? 150.656 -5.790  4.997   1.00 0.00 ? 11  LEU B O    2  
ATOM   4478  C  CB   . LEU B 1 11 ? 147.970 -4.800  3.380   1.00 0.00 ? 11  LEU B CB   2  
ATOM   4479  C  CG   . LEU B 1 11 ? 147.363 -4.466  2.018   1.00 0.00 ? 11  LEU B CG   2  
ATOM   4480  C  CD1  . LEU B 1 11 ? 146.428 -3.263  2.157   1.00 0.00 ? 11  LEU B CD1  2  
ATOM   4481  C  CD2  . LEU B 1 11 ? 148.475 -4.131  1.020   1.00 0.00 ? 11  LEU B CD2  2  
ATOM   4482  H  H    . LEU B 1 11 ? 147.440 -7.116  2.424   1.00 0.00 ? 11  LEU B H    2  
ATOM   4483  H  HA   . LEU B 1 11 ? 149.817 -5.558  2.609   1.00 0.00 ? 11  LEU B HA   2  
ATOM   4484  H  HB2  . LEU B 1 11 ? 147.189 -5.128  4.050   1.00 0.00 ? 11  LEU B HB2  2  
ATOM   4485  H  HB3  . LEU B 1 11 ? 148.441 -3.917  3.786   1.00 0.00 ? 11  LEU B HB3  2  
ATOM   4486  H  HG   . LEU B 1 11 ? 146.800 -5.314  1.665   1.00 0.00 ? 11  LEU B HG   2  
ATOM   4487  H  HD11 . LEU B 1 11 ? 146.893 -2.516  2.782   1.00 0.00 ? 11  LEU B HD11 2  
ATOM   4488  H  HD12 . LEU B 1 11 ? 145.498 -3.580  2.606   1.00 0.00 ? 11  LEU B HD12 2  
ATOM   4489  H  HD13 . LEU B 1 11 ? 146.232 -2.845  1.181   1.00 0.00 ? 11  LEU B HD13 2  
ATOM   4490  H  HD21 . LEU B 1 11 ? 149.270 -3.607  1.529   1.00 0.00 ? 11  LEU B HD21 2  
ATOM   4491  H  HD22 . LEU B 1 11 ? 148.078 -3.507  0.233   1.00 0.00 ? 11  LEU B HD22 2  
ATOM   4492  H  HD23 . LEU B 1 11 ? 148.862 -5.045  0.592   1.00 0.00 ? 11  LEU B HD23 2  
ATOM   4493  N  N    . ILE B 1 12 ? 148.804 -7.019  5.367   1.00 0.00 ? 12  ILE B N    2  
ATOM   4494  C  CA   . ILE B 1 12 ? 149.208 -7.400  6.708   1.00 0.00 ? 12  ILE B CA   2  
ATOM   4495  C  C    . ILE B 1 12 ? 150.460 -8.271  6.703   1.00 0.00 ? 12  ILE B C    2  
ATOM   4496  O  O    . ILE B 1 12 ? 151.364 -8.071  7.512   1.00 0.00 ? 12  ILE B O    2  
ATOM   4497  C  CB   . ILE B 1 12 ? 148.057 -8.131  7.396   1.00 0.00 ? 12  ILE B CB   2  
ATOM   4498  C  CG1  . ILE B 1 12 ? 146.836 -7.203  7.433   1.00 0.00 ? 12  ILE B CG1  2  
ATOM   4499  C  CG2  . ILE B 1 12 ? 148.467 -8.498  8.824   1.00 0.00 ? 12  ILE B CG2  2  
ATOM   4500  C  CD1  . ILE B 1 12 ? 145.629 -7.951  8.010   1.00 0.00 ? 12  ILE B CD1  2  
ATOM   4501  H  H    . ILE B 1 12 ? 147.948 -7.340  5.012   1.00 0.00 ? 12  ILE B H    2  
ATOM   4502  H  HA   . ILE B 1 12 ? 149.420 -6.502  7.267   1.00 0.00 ? 12  ILE B HA   2  
ATOM   4503  H  HB   . ILE B 1 12 ? 147.816 -9.029  6.845   1.00 0.00 ? 12  ILE B HB   2  
ATOM   4504  H  HG12 . ILE B 1 12 ? 147.056 -6.345  8.051   1.00 0.00 ? 12  ILE B HG12 2  
ATOM   4505  H  HG13 . ILE B 1 12 ? 146.606 -6.873  6.426   1.00 0.00 ? 12  ILE B HG13 2  
ATOM   4506  H  HG21 . ILE B 1 12 ? 148.789 -7.610  9.346   1.00 0.00 ? 12  ILE B HG21 2  
ATOM   4507  H  HG22 . ILE B 1 12 ? 149.278 -9.211  8.793   1.00 0.00 ? 12  ILE B HG22 2  
ATOM   4508  H  HG23 . ILE B 1 12 ? 147.625 -8.933  9.340   1.00 0.00 ? 12  ILE B HG23 2  
ATOM   4509  H  HD11 . ILE B 1 12 ? 145.930 -8.500  8.889   1.00 0.00 ? 12  ILE B HD11 2  
ATOM   4510  H  HD12 . ILE B 1 12 ? 145.244 -8.637  7.270   1.00 0.00 ? 12  ILE B HD12 2  
ATOM   4511  H  HD13 . ILE B 1 12 ? 144.860 -7.241  8.277   1.00 0.00 ? 12  ILE B HD13 2  
ATOM   4512  N  N    . ASN B 1 13 ? 150.502 -9.254  5.803   1.00 0.00 ? 13  ASN B N    2  
ATOM   4513  C  CA   . ASN B 1 13 ? 151.651 -10.150 5.743   1.00 0.00 ? 13  ASN B CA   2  
ATOM   4514  C  C    . ASN B 1 13 ? 152.943 -9.397  5.440   1.00 0.00 ? 13  ASN B C    2  
ATOM   4515  O  O    . ASN B 1 13 ? 153.986 -9.672  6.044   1.00 0.00 ? 13  ASN B O    2  
ATOM   4516  C  CB   . ASN B 1 13 ? 151.420 -11.212 4.666   1.00 0.00 ? 13  ASN B CB   2  
ATOM   4517  C  CG   . ASN B 1 13 ? 150.237 -12.094 5.050   1.00 0.00 ? 13  ASN B CG   2  
ATOM   4518  O  OD1  . ASN B 1 13 ? 149.833 -12.122 6.212   1.00 0.00 ? 13  ASN B OD1  2  
ATOM   4519  N  ND2  . ASN B 1 13 ? 149.653 -12.821 4.136   1.00 0.00 ? 13  ASN B ND2  2  
ATOM   4520  H  H    . ASN B 1 13 ? 149.750 -9.383  5.189   1.00 0.00 ? 13  ASN B H    2  
ATOM   4521  H  HA   . ASN B 1 13 ? 151.754 -10.645 6.695   1.00 0.00 ? 13  ASN B HA   2  
ATOM   4522  H  HB2  . ASN B 1 13 ? 151.216 -10.727 3.723   1.00 0.00 ? 13  ASN B HB2  2  
ATOM   4523  H  HB3  . ASN B 1 13 ? 152.305 -11.823 4.571   1.00 0.00 ? 13  ASN B HB3  2  
ATOM   4524  H  HD21 . ASN B 1 13 ? 149.977 -12.797 3.211   1.00 0.00 ? 13  ASN B HD21 2  
ATOM   4525  H  HD22 . ASN B 1 13 ? 148.893 -13.391 4.374   1.00 0.00 ? 13  ASN B HD22 2  
ATOM   4526  N  N    . VAL B 1 14 ? 152.880 -8.435  4.520   1.00 0.00 ? 14  VAL B N    2  
ATOM   4527  C  CA   . VAL B 1 14 ? 154.073 -7.672  4.189   1.00 0.00 ? 14  VAL B CA   2  
ATOM   4528  C  C    . VAL B 1 14 ? 154.411 -6.707  5.313   1.00 0.00 ? 14  VAL B C    2  
ATOM   4529  O  O    . VAL B 1 14 ? 155.578 -6.536  5.664   1.00 0.00 ? 14  VAL B O    2  
ATOM   4530  C  CB   . VAL B 1 14 ? 153.891 -6.923  2.860   1.00 0.00 ? 14  VAL B CB   2  
ATOM   4531  C  CG1  . VAL B 1 14 ? 153.572 -7.930  1.753   1.00 0.00 ? 14  VAL B CG1  2  
ATOM   4532  C  CG2  . VAL B 1 14 ? 152.739 -5.924  2.970   1.00 0.00 ? 14  VAL B CG2  2  
ATOM   4533  H  H    . VAL B 1 14 ? 152.031 -8.239  4.072   1.00 0.00 ? 14  VAL B H    2  
ATOM   4534  H  HA   . VAL B 1 14 ? 154.896 -8.364  4.078   1.00 0.00 ? 14  VAL B HA   2  
ATOM   4535  H  HB   . VAL B 1 14 ? 154.803 -6.399  2.615   1.00 0.00 ? 14  VAL B HB   2  
ATOM   4536  H  HG11 . VAL B 1 14 ? 153.095 -7.420  0.930   1.00 0.00 ? 14  VAL B HG11 2  
ATOM   4537  H  HG12 . VAL B 1 14 ? 152.911 -8.692  2.138   1.00 0.00 ? 14  VAL B HG12 2  
ATOM   4538  H  HG13 . VAL B 1 14 ? 154.488 -8.389  1.410   1.00 0.00 ? 14  VAL B HG13 2  
ATOM   4539  H  HG21 . VAL B 1 14 ? 152.934 -5.232  3.775   1.00 0.00 ? 14  VAL B HG21 2  
ATOM   4540  H  HG22 . VAL B 1 14 ? 151.824 -6.458  3.164   1.00 0.00 ? 14  VAL B HG22 2  
ATOM   4541  H  HG23 . VAL B 1 14 ? 152.646 -5.378  2.039   1.00 0.00 ? 14  VAL B HG23 2  
ATOM   4542  N  N    . PHE B 1 15 ? 153.386 -6.097  5.904   1.00 0.00 ? 15  PHE B N    2  
ATOM   4543  C  CA   . PHE B 1 15 ? 153.621 -5.181  7.009   1.00 0.00 ? 15  PHE B CA   2  
ATOM   4544  C  C    . PHE B 1 15 ? 154.286 -5.917  8.166   1.00 0.00 ? 15  PHE B C    2  
ATOM   4545  O  O    . PHE B 1 15 ? 155.281 -5.453  8.731   1.00 0.00 ? 15  PHE B O    2  
ATOM   4546  C  CB   . PHE B 1 15 ? 152.286 -4.595  7.477   1.00 0.00 ? 15  PHE B CB   2  
ATOM   4547  C  CG   . PHE B 1 15 ? 152.521 -3.565  8.558   1.00 0.00 ? 15  PHE B CG   2  
ATOM   4548  C  CD1  . PHE B 1 15 ? 152.796 -2.236  8.218   1.00 0.00 ? 15  PHE B CD1  2  
ATOM   4549  C  CD2  . PHE B 1 15 ? 152.451 -3.943  9.905   1.00 0.00 ? 15  PHE B CD2  2  
ATOM   4550  C  CE1  . PHE B 1 15 ? 153.003 -1.285  9.225   1.00 0.00 ? 15  PHE B CE1  2  
ATOM   4551  C  CE2  . PHE B 1 15 ? 152.659 -2.991  10.911  1.00 0.00 ? 15  PHE B CE2  2  
ATOM   4552  C  CZ   . PHE B 1 15 ? 152.935 -1.663  10.571  1.00 0.00 ? 15  PHE B CZ   2  
ATOM   4553  H  H    . PHE B 1 15 ? 152.465 -6.280  5.605   1.00 0.00 ? 15  PHE B H    2  
ATOM   4554  H  HA   . PHE B 1 15 ? 154.263 -4.379  6.679   1.00 0.00 ? 15  PHE B HA   2  
ATOM   4555  H  HB2  . PHE B 1 15 ? 151.787 -4.129  6.641   1.00 0.00 ? 15  PHE B HB2  2  
ATOM   4556  H  HB3  . PHE B 1 15 ? 151.665 -5.389  7.868   1.00 0.00 ? 15  PHE B HB3  2  
ATOM   4557  H  HD1  . PHE B 1 15 ? 152.852 -1.943  7.181   1.00 0.00 ? 15  PHE B HD1  2  
ATOM   4558  H  HD2  . PHE B 1 15 ? 152.238 -4.968  10.168  1.00 0.00 ? 15  PHE B HD2  2  
ATOM   4559  H  HE1  . PHE B 1 15 ? 153.213 -0.259  8.963   1.00 0.00 ? 15  PHE B HE1  2  
ATOM   4560  H  HE2  . PHE B 1 15 ? 152.606 -3.284  11.949  1.00 0.00 ? 15  PHE B HE2  2  
ATOM   4561  H  HZ   . PHE B 1 15 ? 153.094 -0.928  11.346  1.00 0.00 ? 15  PHE B HZ   2  
ATOM   4562  N  N    . HIS B 1 16 ? 153.723 -7.074  8.505   1.00 0.00 ? 16  HIS B N    2  
ATOM   4563  C  CA   . HIS B 1 16 ? 154.249 -7.886  9.593   1.00 0.00 ? 16  HIS B CA   2  
ATOM   4564  C  C    . HIS B 1 16 ? 155.666 -8.375  9.313   1.00 0.00 ? 16  HIS B C    2  
ATOM   4565  O  O    . HIS B 1 16 ? 156.533 -8.307  10.187  1.00 0.00 ? 16  HIS B O    2  
ATOM   4566  C  CB   . HIS B 1 16 ? 153.335 -9.091  9.822   1.00 0.00 ? 16  HIS B CB   2  
ATOM   4567  C  CG   . HIS B 1 16 ? 153.837 -9.885  10.996  1.00 0.00 ? 16  HIS B CG   2  
ATOM   4568  N  ND1  . HIS B 1 16 ? 154.674 -10.978 10.844  1.00 0.00 ? 16  HIS B ND1  2  
ATOM   4569  C  CD2  . HIS B 1 16 ? 153.628 -9.756  12.347  1.00 0.00 ? 16  HIS B CD2  2  
ATOM   4570  C  CE1  . HIS B 1 16 ? 154.937 -11.461 12.072  1.00 0.00 ? 16  HIS B CE1  2  
ATOM   4571  N  NE2  . HIS B 1 16 ? 154.324 -10.753 13.025  1.00 0.00 ? 16  HIS B NE2  2  
ATOM   4572  H  H    . HIS B 1 16 ? 152.935 -7.385  8.013   1.00 0.00 ? 16  HIS B H    2  
ATOM   4573  H  HA   . HIS B 1 16 ? 154.260 -7.292  10.494  1.00 0.00 ? 16  HIS B HA   2  
ATOM   4574  H  HB2  . HIS B 1 16 ? 152.330 -8.748  10.021  1.00 0.00 ? 16  HIS B HB2  2  
ATOM   4575  H  HB3  . HIS B 1 16 ? 153.335 -9.715  8.940   1.00 0.00 ? 16  HIS B HB3  2  
ATOM   4576  H  HD1  . HIS B 1 16 ? 155.012 -11.337 9.997   1.00 0.00 ? 16  HIS B HD1  2  
ATOM   4577  H  HD2  . HIS B 1 16 ? 153.017 -8.998  12.812  1.00 0.00 ? 16  HIS B HD2  2  
ATOM   4578  H  HE1  . HIS B 1 16 ? 155.567 -12.317 12.265  1.00 0.00 ? 16  HIS B HE1  2  
ATOM   4579  H  HE2  . HIS B 1 16 ? 154.358 -10.902 13.992  1.00 0.00 ? 16  HIS B HE2  2  
ATOM   4580  N  N    . ALA B 1 17 ? 155.900 -8.893  8.107   1.00 0.00 ? 17  ALA B N    2  
ATOM   4581  C  CA   . ALA B 1 17 ? 157.224 -9.412  7.778   1.00 0.00 ? 17  ALA B CA   2  
ATOM   4582  C  C    . ALA B 1 17 ? 158.276 -8.311  7.746   1.00 0.00 ? 17  ALA B C    2  
ATOM   4583  O  O    . ALA B 1 17 ? 159.343 -8.453  8.345   1.00 0.00 ? 17  ALA B O    2  
ATOM   4584  C  CB   . ALA B 1 17 ? 157.183 -10.111 6.418   1.00 0.00 ? 17  ALA B CB   2  
ATOM   4585  H  H    . ALA B 1 17 ? 155.172 -8.950  7.444   1.00 0.00 ? 17  ALA B H    2  
ATOM   4586  H  HA   . ALA B 1 17 ? 157.510 -10.135 8.525   1.00 0.00 ? 17  ALA B HA   2  
ATOM   4587  H  HB1  . ALA B 1 17 ? 158.190 -10.256 6.057   1.00 0.00 ? 17  ALA B HB1  2  
ATOM   4588  H  HB2  . ALA B 1 17 ? 156.632 -9.501  5.717   1.00 0.00 ? 17  ALA B HB2  2  
ATOM   4589  H  HB3  . ALA B 1 17 ? 156.696 -11.069 6.521   1.00 0.00 ? 17  ALA B HB3  2  
ATOM   4590  N  N    . HIS B 1 18 ? 157.987 -7.219  7.049   1.00 0.00 ? 18  HIS B N    2  
ATOM   4591  C  CA   . HIS B 1 18 ? 158.950 -6.128  6.972   1.00 0.00 ? 18  HIS B CA   2  
ATOM   4592  C  C    . HIS B 1 18 ? 159.212 -5.513  8.342   1.00 0.00 ? 18  HIS B C    2  
ATOM   4593  O  O    . HIS B 1 18 ? 160.364 -5.325  8.735   1.00 0.00 ? 18  HIS B O    2  
ATOM   4594  C  CB   . HIS B 1 18 ? 158.453 -5.049  6.012   1.00 0.00 ? 18  HIS B CB   2  
ATOM   4595  C  CG   . HIS B 1 18 ? 158.340 -5.620  4.626   1.00 0.00 ? 18  HIS B CG   2  
ATOM   4596  N  ND1  . HIS B 1 18 ? 159.415 -6.215  3.981   1.00 0.00 ? 18  HIS B ND1  2  
ATOM   4597  C  CD2  . HIS B 1 18 ? 157.294 -5.682  3.740   1.00 0.00 ? 18  HIS B CD2  2  
ATOM   4598  C  CE1  . HIS B 1 18 ? 158.993 -6.605  2.765   1.00 0.00 ? 18  HIS B CE1  2  
ATOM   4599  N  NE2  . HIS B 1 18 ? 157.706 -6.306  2.567   1.00 0.00 ? 18  HIS B NE2  2  
ATOM   4600  H  H    . HIS B 1 18 ? 157.128 -7.147  6.584   1.00 0.00 ? 18  HIS B H    2  
ATOM   4601  H  HA   . HIS B 1 18 ? 159.880 -6.521  6.589   1.00 0.00 ? 18  HIS B HA   2  
ATOM   4602  H  HB2  . HIS B 1 18 ? 157.484 -4.702  6.339   1.00 0.00 ? 18  HIS B HB2  2  
ATOM   4603  H  HB3  . HIS B 1 18 ? 159.151 -4.225  6.008   1.00 0.00 ? 18  HIS B HB3  2  
ATOM   4604  H  HD1  . HIS B 1 18 ? 160.318 -6.328  4.345   1.00 0.00 ? 18  HIS B HD1  2  
ATOM   4605  H  HD2  . HIS B 1 18 ? 156.304 -5.292  3.921   1.00 0.00 ? 18  HIS B HD2  2  
ATOM   4606  H  HE1  . HIS B 1 18 ? 159.618 -7.103  2.038   1.00 0.00 ? 18  HIS B HE1  2  
ATOM   4607  H  HE2  . HIS B 1 18 ? 157.169 -6.487  1.768   1.00 0.00 ? 18  HIS B HE2  2  
ATOM   4608  N  N    . SER B 1 19 ? 158.141 -5.193  9.066   1.00 0.00 ? 19  SER B N    2  
ATOM   4609  C  CA   . SER B 1 19 ? 158.290 -4.592  10.387  1.00 0.00 ? 19  SER B CA   2  
ATOM   4610  C  C    . SER B 1 19 ? 159.014 -5.533  11.343  1.00 0.00 ? 19  SER B C    2  
ATOM   4611  O  O    . SER B 1 19 ? 159.837 -5.104  12.154  1.00 0.00 ? 19  SER B O    2  
ATOM   4612  C  CB   . SER B 1 19 ? 156.912 -4.257  10.959  1.00 0.00 ? 19  SER B CB   2  
ATOM   4613  O  OG   . SER B 1 19 ? 156.196 -3.461  10.024  1.00 0.00 ? 19  SER B OG   2  
ATOM   4614  H  H    . SER B 1 19 ? 157.240 -5.359  8.707   1.00 0.00 ? 19  SER B H    2  
ATOM   4615  H  HA   . SER B 1 19 ? 158.859 -3.681  10.295  1.00 0.00 ? 19  SER B HA   2  
ATOM   4616  H  HB2  . SER B 1 19 ? 156.366 -5.167  11.141  1.00 0.00 ? 19  SER B HB2  2  
ATOM   4617  H  HB3  . SER B 1 19 ? 157.032 -3.719  11.890  1.00 0.00 ? 19  SER B HB3  2  
ATOM   4618  H  HG   . SER B 1 19 ? 155.908 -2.663  10.474  1.00 0.00 ? 19  SER B HG   2  
ATOM   4619  N  N    . GLY B 1 20 ? 158.676 -6.815  11.246  1.00 0.00 ? 20  GLY B N    2  
ATOM   4620  C  CA   . GLY B 1 20 ? 159.268 -7.833  12.106  1.00 0.00 ? 20  GLY B CA   2  
ATOM   4621  C  C    . GLY B 1 20 ? 160.772 -7.986  11.910  1.00 0.00 ? 20  GLY B C    2  
ATOM   4622  O  O    . GLY B 1 20 ? 161.501 -8.288  12.855  1.00 0.00 ? 20  GLY B O    2  
ATOM   4623  H  H    . GLY B 1 20 ? 158.001 -7.083  10.588  1.00 0.00 ? 20  GLY B H    2  
ATOM   4624  H  HA2  . GLY B 1 20 ? 159.084 -7.555  13.126  1.00 0.00 ? 20  GLY B HA2  2  
ATOM   4625  H  HA3  . GLY B 1 20 ? 158.790 -8.781  11.912  1.00 0.00 ? 20  GLY B HA3  2  
ATOM   4626  N  N    . LYS B 1 21 ? 161.226 -7.830  10.675  1.00 0.00 ? 21  LYS B N    2  
ATOM   4627  C  CA   . LYS B 1 21 ? 162.640 -8.011  10.367  1.00 0.00 ? 21  LYS B CA   2  
ATOM   4628  C  C    . LYS B 1 21 ? 163.546 -7.079  11.172  1.00 0.00 ? 21  LYS B C    2  
ATOM   4629  O  O    . LYS B 1 21 ? 164.611 -7.496  11.627  1.00 0.00 ? 21  LYS B O    2  
ATOM   4630  C  CB   . LYS B 1 21 ? 162.869 -7.776  8.873   1.00 0.00 ? 21  LYS B CB   2  
ATOM   4631  C  CG   . LYS B 1 21 ? 164.326 -8.090  8.528   1.00 0.00 ? 21  LYS B CG   2  
ATOM   4632  C  CD   . LYS B 1 21 ? 164.581 -7.795  7.051   1.00 0.00 ? 21  LYS B CD   2  
ATOM   4633  C  CE   . LYS B 1 21 ? 166.002 -8.226  6.691   1.00 0.00 ? 21  LYS B CE   2  
ATOM   4634  N  NZ   . LYS B 1 21 ? 166.100 -8.445  5.222   1.00 0.00 ? 21  LYS B NZ   2  
ATOM   4635  H  H    . LYS B 1 21 ? 160.596 -7.626  9.951   1.00 0.00 ? 21  LYS B H    2  
ATOM   4636  H  HA   . LYS B 1 21 ? 162.911 -9.030  10.592  1.00 0.00 ? 21  LYS B HA   2  
ATOM   4637  H  HB2  . LYS B 1 21 ? 162.212 -8.422  8.305   1.00 0.00 ? 21  LYS B HB2  2  
ATOM   4638  H  HB3  . LYS B 1 21 ? 162.658 -6.745  8.634   1.00 0.00 ? 21  LYS B HB3  2  
ATOM   4639  H  HG2  . LYS B 1 21 ? 164.981 -7.480  9.133   1.00 0.00 ? 21  LYS B HG2  2  
ATOM   4640  H  HG3  . LYS B 1 21 ? 164.525 -9.133  8.724   1.00 0.00 ? 21  LYS B HG3  2  
ATOM   4641  H  HD2  . LYS B 1 21 ? 163.872 -8.343  6.447   1.00 0.00 ? 21  LYS B HD2  2  
ATOM   4642  H  HD3  . LYS B 1 21 ? 164.469 -6.737  6.869   1.00 0.00 ? 21  LYS B HD3  2  
ATOM   4643  H  HE2  . LYS B 1 21 ? 166.696 -7.453  6.988   1.00 0.00 ? 21  LYS B HE2  2  
ATOM   4644  H  HE3  . LYS B 1 21 ? 166.243 -9.142  7.211   1.00 0.00 ? 21  LYS B HE3  2  
ATOM   4645  H  HZ1  . LYS B 1 21 ? 166.563 -7.628  4.778   1.00 0.00 ? 21  LYS B HZ1  2  
ATOM   4646  H  HZ2  . LYS B 1 21 ? 165.145 -8.561  4.825   1.00 0.00 ? 21  LYS B HZ2  2  
ATOM   4647  H  HZ3  . LYS B 1 21 ? 166.660 -9.301  5.035   1.00 0.00 ? 21  LYS B HZ3  2  
ATOM   4648  N  N    . GLU B 1 22 ? 163.142 -5.822  11.339  1.00 0.00 ? 22  GLU B N    2  
ATOM   4649  C  CA   . GLU B 1 22 ? 163.967 -4.868  12.085  1.00 0.00 ? 22  GLU B CA   2  
ATOM   4650  C  C    . GLU B 1 22 ? 163.179 -4.179  13.196  1.00 0.00 ? 22  GLU B C    2  
ATOM   4651  O  O    . GLU B 1 22 ? 161.966 -4.004  13.096  1.00 0.00 ? 22  GLU B O    2  
ATOM   4652  C  CB   . GLU B 1 22 ? 164.523 -3.810  11.132  1.00 0.00 ? 22  GLU B CB   2  
ATOM   4653  C  CG   . GLU B 1 22 ? 165.388 -4.486  10.066  1.00 0.00 ? 22  GLU B CG   2  
ATOM   4654  C  CD   . GLU B 1 22 ? 166.010 -3.434  9.155   1.00 0.00 ? 22  GLU B CD   2  
ATOM   4655  O  OE1  . GLU B 1 22 ? 165.625 -2.281  9.266   1.00 0.00 ? 22  GLU B OE1  2  
ATOM   4656  O  OE2  . GLU B 1 22 ? 166.860 -3.795  8.360   1.00 0.00 ? 22  GLU B OE2  2  
ATOM   4657  H  H    . GLU B 1 22 ? 162.292 -5.529  10.951  1.00 0.00 ? 22  GLU B H    2  
ATOM   4658  H  HA   . GLU B 1 22 ? 164.800 -5.394  12.530  1.00 0.00 ? 22  GLU B HA   2  
ATOM   4659  H  HB2  . GLU B 1 22 ? 163.705 -3.292  10.657  1.00 0.00 ? 22  GLU B HB2  2  
ATOM   4660  H  HB3  . GLU B 1 22 ? 165.124 -3.105  11.686  1.00 0.00 ? 22  GLU B HB3  2  
ATOM   4661  H  HG2  . GLU B 1 22 ? 166.171 -5.052  10.547  1.00 0.00 ? 22  GLU B HG2  2  
ATOM   4662  H  HG3  . GLU B 1 22 ? 164.775 -5.152  9.477   1.00 0.00 ? 22  GLU B HG3  2  
ATOM   4663  N  N    . GLY B 1 23 ? 163.887 -3.767  14.243  1.00 0.00 ? 23  GLY B N    2  
ATOM   4664  C  CA   . GLY B 1 23 ? 163.258 -3.057  15.354  1.00 0.00 ? 23  GLY B CA   2  
ATOM   4665  C  C    . GLY B 1 23 ? 162.198 -3.908  16.033  1.00 0.00 ? 23  GLY B C    2  
ATOM   4666  O  O    . GLY B 1 23 ? 162.172 -5.130  15.884  1.00 0.00 ? 23  GLY B O    2  
ATOM   4667  H  H    . GLY B 1 23 ? 164.855 -3.918  14.259  1.00 0.00 ? 23  GLY B H    2  
ATOM   4668  H  HA2  . GLY B 1 23 ? 164.016 -2.793  16.077  1.00 0.00 ? 23  GLY B HA2  2  
ATOM   4669  H  HA3  . GLY B 1 23 ? 162.797 -2.156  14.980  1.00 0.00 ? 23  GLY B HA3  2  
ATOM   4670  N  N    . ASP B 1 24 ? 161.307 -3.244  16.763  1.00 0.00 ? 24  ASP B N    2  
ATOM   4671  C  CA   . ASP B 1 24 ? 160.226 -3.939  17.443  1.00 0.00 ? 24  ASP B CA   2  
ATOM   4672  C  C    . ASP B 1 24 ? 159.200 -4.415  16.424  1.00 0.00 ? 24  ASP B C    2  
ATOM   4673  O  O    . ASP B 1 24 ? 158.868 -3.693  15.477  1.00 0.00 ? 24  ASP B O    2  
ATOM   4674  C  CB   . ASP B 1 24 ? 159.555 -3.008  18.454  1.00 0.00 ? 24  ASP B CB   2  
ATOM   4675  C  CG   . ASP B 1 24 ? 160.530 -2.664  19.575  1.00 0.00 ? 24  ASP B CG   2  
ATOM   4676  O  OD1  . ASP B 1 24 ? 161.554 -3.323  19.665  1.00 0.00 ? 24  ASP B OD1  2  
ATOM   4677  O  OD2  . ASP B 1 24 ? 160.240 -1.748  20.327  1.00 0.00 ? 24  ASP B OD2  2  
ATOM   4678  H  H    . ASP B 1 24 ? 161.370 -2.268  16.830  1.00 0.00 ? 24  ASP B H    2  
ATOM   4679  H  HA   . ASP B 1 24 ? 160.629 -4.794  17.966  1.00 0.00 ? 24  ASP B HA   2  
ATOM   4680  H  HB2  . ASP B 1 24 ? 159.247 -2.100  17.956  1.00 0.00 ? 24  ASP B HB2  2  
ATOM   4681  H  HB3  . ASP B 1 24 ? 158.689 -3.498  18.873  1.00 0.00 ? 24  ASP B HB3  2  
ATOM   4682  N  N    . LYS B 1 25 ? 158.709 -5.633  16.613  1.00 0.00 ? 25  LYS B N    2  
ATOM   4683  C  CA   . LYS B 1 25 ? 157.723 -6.191  15.700  1.00 0.00 ? 25  LYS B CA   2  
ATOM   4684  C  C    . LYS B 1 25 ? 156.458 -5.332  15.687  1.00 0.00 ? 25  LYS B C    2  
ATOM   4685  O  O    . LYS B 1 25 ? 155.819 -5.153  14.650  1.00 0.00 ? 25  LYS B O    2  
ATOM   4686  C  CB   . LYS B 1 25 ? 157.351 -7.606  16.154  1.00 0.00 ? 25  LYS B CB   2  
ATOM   4687  C  CG   . LYS B 1 25 ? 158.584 -8.515  16.102  1.00 0.00 ? 25  LYS B CG   2  
ATOM   4688  C  CD   . LYS B 1 25 ? 158.176 -9.950  16.433  1.00 0.00 ? 25  LYS B CD   2  
ATOM   4689  C  CE   . LYS B 1 25 ? 159.425 -10.829 16.512  1.00 0.00 ? 25  LYS B CE   2  
ATOM   4690  N  NZ   . LYS B 1 25 ? 160.264 -10.396 17.664  1.00 0.00 ? 25  LYS B NZ   2  
ATOM   4691  H  H    . LYS B 1 25 ? 159.016 -6.164  17.377  1.00 0.00 ? 25  LYS B H    2  
ATOM   4692  H  HA   . LYS B 1 25 ? 158.137 -6.234  14.706  1.00 0.00 ? 25  LYS B HA   2  
ATOM   4693  H  HB2  . LYS B 1 25 ? 156.975 -7.570  17.167  1.00 0.00 ? 25  LYS B HB2  2  
ATOM   4694  H  HB3  . LYS B 1 25 ? 156.588 -8.004  15.503  1.00 0.00 ? 25  LYS B HB3  2  
ATOM   4695  H  HG2  . LYS B 1 25 ? 159.016 -8.484  15.119  1.00 0.00 ? 25  LYS B HG2  2  
ATOM   4696  H  HG3  . LYS B 1 25 ? 159.310 -8.176  16.825  1.00 0.00 ? 25  LYS B HG3  2  
ATOM   4697  H  HD2  . LYS B 1 25 ? 157.660 -9.967  17.380  1.00 0.00 ? 25  LYS B HD2  2  
ATOM   4698  H  HD3  . LYS B 1 25 ? 157.522 -10.326 15.660  1.00 0.00 ? 25  LYS B HD3  2  
ATOM   4699  H  HE2  . LYS B 1 25 ? 159.132 -11.860 16.647  1.00 0.00 ? 25  LYS B HE2  2  
ATOM   4700  H  HE3  . LYS B 1 25 ? 159.990 -10.733 15.597  1.00 0.00 ? 25  LYS B HE3  2  
ATOM   4701  H  HZ1  . LYS B 1 25 ? 160.296 -9.359  17.699  1.00 0.00 ? 25  LYS B HZ1  2  
ATOM   4702  H  HZ2  . LYS B 1 25 ? 161.229 -10.770 17.550  1.00 0.00 ? 25  LYS B HZ2  2  
ATOM   4703  H  HZ3  . LYS B 1 25 ? 159.853 -10.757 18.548  1.00 0.00 ? 25  LYS B HZ3  2  
ATOM   4704  N  N    . TYR B 1 26 ? 156.097 -4.835  16.866  1.00 0.00 ? 26  TYR B N    2  
ATOM   4705  C  CA   . TYR B 1 26 ? 154.893 -4.024  17.036  1.00 0.00 ? 26  TYR B CA   2  
ATOM   4706  C  C    . TYR B 1 26 ? 154.956 -2.665  16.333  1.00 0.00 ? 26  TYR B C    2  
ATOM   4707  O  O    . TYR B 1 26 ? 153.922 -2.143  15.915  1.00 0.00 ? 26  TYR B O    2  
ATOM   4708  C  CB   . TYR B 1 26 ? 154.642 -3.801  18.528  1.00 0.00 ? 26  TYR B CB   2  
ATOM   4709  C  CG   . TYR B 1 26 ? 154.413 -5.132  19.202  1.00 0.00 ? 26  TYR B CG   2  
ATOM   4710  C  CD1  . TYR B 1 26 ? 153.146 -5.727  19.165  1.00 0.00 ? 26  TYR B CD1  2  
ATOM   4711  C  CD2  . TYR B 1 26 ? 155.467 -5.772  19.866  1.00 0.00 ? 26  TYR B CD2  2  
ATOM   4712  C  CE1  . TYR B 1 26 ? 152.934 -6.960  19.791  1.00 0.00 ? 26  TYR B CE1  2  
ATOM   4713  C  CE2  . TYR B 1 26 ? 155.254 -7.005  20.492  1.00 0.00 ? 26  TYR B CE2  2  
ATOM   4714  C  CZ   . TYR B 1 26 ? 153.987 -7.600  20.455  1.00 0.00 ? 26  TYR B CZ   2  
ATOM   4715  O  OH   . TYR B 1 26 ? 153.777 -8.817  21.071  1.00 0.00 ? 26  TYR B OH   2  
ATOM   4716  H  H    . TYR B 1 26 ? 156.644 -5.040  17.654  1.00 0.00 ? 26  TYR B H    2  
ATOM   4717  H  HA   . TYR B 1 26 ? 154.055 -4.573  16.637  1.00 0.00 ? 26  TYR B HA   2  
ATOM   4718  H  HB2  . TYR B 1 26 ? 155.501 -3.316  18.969  1.00 0.00 ? 26  TYR B HB2  2  
ATOM   4719  H  HB3  . TYR B 1 26 ? 153.770 -3.178  18.658  1.00 0.00 ? 26  TYR B HB3  2  
ATOM   4720  H  HD1  . TYR B 1 26 ? 152.334 -5.233  18.653  1.00 0.00 ? 26  TYR B HD1  2  
ATOM   4721  H  HD2  . TYR B 1 26 ? 156.445 -5.312  19.895  1.00 0.00 ? 26  TYR B HD2  2  
ATOM   4722  H  HE1  . TYR B 1 26 ? 151.956 -7.420  19.762  1.00 0.00 ? 26  TYR B HE1  2  
ATOM   4723  H  HE2  . TYR B 1 26 ? 156.067 -7.499  21.004  1.00 0.00 ? 26  TYR B HE2  2  
ATOM   4724  H  HH   . TYR B 1 26 ? 154.558 -9.025  21.589  1.00 0.00 ? 26  TYR B HH   2  
ATOM   4725  N  N    . LYS B 1 27 ? 156.144 -2.063  16.244  1.00 0.00 ? 27  LYS B N    2  
ATOM   4726  C  CA   . LYS B 1 27 ? 156.260 -0.733  15.632  1.00 0.00 ? 27  LYS B CA   2  
ATOM   4727  C  C    . LYS B 1 27 ? 157.077 -0.730  14.345  1.00 0.00 ? 27  LYS B C    2  
ATOM   4728  O  O    . LYS B 1 27 ? 158.054 -1.471  14.196  1.00 0.00 ? 27  LYS B O    2  
ATOM   4729  C  CB   . LYS B 1 27 ? 156.898 0.235   16.630  1.00 0.00 ? 27  LYS B CB   2  
ATOM   4730  C  CG   . LYS B 1 27 ? 155.984 0.386   17.847  1.00 0.00 ? 27  LYS B CG   2  
ATOM   4731  C  CD   . LYS B 1 27 ? 156.558 1.442   18.793  1.00 0.00 ? 27  LYS B CD   2  
ATOM   4732  C  CE   . LYS B 1 27 ? 155.710 1.501   20.064  1.00 0.00 ? 27  LYS B CE   2  
ATOM   4733  N  NZ   . LYS B 1 27 ? 156.174 2.630   20.920  1.00 0.00 ? 27  LYS B NZ   2  
ATOM   4734  H  H    . LYS B 1 27 ? 156.937 -2.496  16.623  1.00 0.00 ? 27  LYS B H    2  
ATOM   4735  H  HA   . LYS B 1 27 ? 155.270 -0.367  15.402  1.00 0.00 ? 27  LYS B HA   2  
ATOM   4736  H  HB2  . LYS B 1 27 ? 157.858 -0.151  16.944  1.00 0.00 ? 27  LYS B HB2  2  
ATOM   4737  H  HB3  . LYS B 1 27 ? 157.034 1.201   16.163  1.00 0.00 ? 27  LYS B HB3  2  
ATOM   4738  H  HG2  . LYS B 1 27 ? 155.000 0.690   17.522  1.00 0.00 ? 27  LYS B HG2  2  
ATOM   4739  H  HG3  . LYS B 1 27 ? 155.916 -0.560  18.365  1.00 0.00 ? 27  LYS B HG3  2  
ATOM   4740  H  HD2  . LYS B 1 27 ? 157.575 1.183   19.049  1.00 0.00 ? 27  LYS B HD2  2  
ATOM   4741  H  HD3  . LYS B 1 27 ? 156.543 2.406   18.308  1.00 0.00 ? 27  LYS B HD3  2  
ATOM   4742  H  HE2  . LYS B 1 27 ? 154.674 1.654   19.799  1.00 0.00 ? 27  LYS B HE2  2  
ATOM   4743  H  HE3  . LYS B 1 27 ? 155.809 0.572   20.607  1.00 0.00 ? 27  LYS B HE3  2  
ATOM   4744  H  HZ1  . LYS B 1 27 ? 155.581 3.465   20.745  1.00 0.00 ? 27  LYS B HZ1  2  
ATOM   4745  H  HZ2  . LYS B 1 27 ? 157.165 2.851   20.691  1.00 0.00 ? 27  LYS B HZ2  2  
ATOM   4746  H  HZ3  . LYS B 1 27 ? 156.101 2.358   21.921  1.00 0.00 ? 27  LYS B HZ3  2  
ATOM   4747  N  N    . LEU B 1 28 ? 156.667 0.146   13.427  1.00 0.00 ? 28  LEU B N    2  
ATOM   4748  C  CA   . LEU B 1 28 ? 157.348 0.309   12.149  1.00 0.00 ? 28  LEU B CA   2  
ATOM   4749  C  C    . LEU B 1 28 ? 158.160 1.606   12.169  1.00 0.00 ? 28  LEU B C    2  
ATOM   4750  O  O    . LEU B 1 28 ? 157.646 2.661   12.542  1.00 0.00 ? 28  LEU B O    2  
ATOM   4751  C  CB   . LEU B 1 28 ? 156.321 0.363   11.004  1.00 0.00 ? 28  LEU B CB   2  
ATOM   4752  C  CG   . LEU B 1 28 ? 157.043 0.388   9.647   1.00 0.00 ? 28  LEU B CG   2  
ATOM   4753  C  CD1  . LEU B 1 28 ? 157.452 -1.036  9.241   1.00 0.00 ? 28  LEU B CD1  2  
ATOM   4754  C  CD2  . LEU B 1 28 ? 156.118 0.979   8.578   1.00 0.00 ? 28  LEU B CD2  2  
ATOM   4755  H  H    . LEU B 1 28 ? 155.895 0.715   13.628  1.00 0.00 ? 28  LEU B H    2  
ATOM   4756  H  HA   . LEU B 1 28 ? 158.016 -0.523  11.996  1.00 0.00 ? 28  LEU B HA   2  
ATOM   4757  H  HB2  . LEU B 1 28 ? 155.685 -0.510  11.052  1.00 0.00 ? 28  LEU B HB2  2  
ATOM   4758  H  HB3  . LEU B 1 28 ? 155.716 1.252   11.104  1.00 0.00 ? 28  LEU B HB3  2  
ATOM   4759  H  HG   . LEU B 1 28 ? 157.930 1.000   9.728   1.00 0.00 ? 28  LEU B HG   2  
ATOM   4760  H  HD11 . LEU B 1 28 ? 156.683 -1.470  8.619   1.00 0.00 ? 28  LEU B HD11 2  
ATOM   4761  H  HD12 . LEU B 1 28 ? 157.584 -1.645  10.120  1.00 0.00 ? 28  LEU B HD12 2  
ATOM   4762  H  HD13 . LEU B 1 28 ? 158.377 -0.996  8.690   1.00 0.00 ? 28  LEU B HD13 2  
ATOM   4763  H  HD21 . LEU B 1 28 ? 155.693 1.905   8.936   1.00 0.00 ? 28  LEU B HD21 2  
ATOM   4764  H  HD22 . LEU B 1 28 ? 155.328 0.279   8.360   1.00 0.00 ? 28  LEU B HD22 2  
ATOM   4765  H  HD23 . LEU B 1 28 ? 156.686 1.170   7.680   1.00 0.00 ? 28  LEU B HD23 2  
ATOM   4766  N  N    . SER B 1 29 ? 159.421 1.524   11.760  1.00 0.00 ? 29  SER B N    2  
ATOM   4767  C  CA   . SER B 1 29 ? 160.289 2.701   11.728  1.00 0.00 ? 29  SER B CA   2  
ATOM   4768  C  C    . SER B 1 29 ? 160.425 3.195   10.292  1.00 0.00 ? 29  SER B C    2  
ATOM   4769  O  O    . SER B 1 29 ? 160.351 2.407   9.348   1.00 0.00 ? 29  SER B O    2  
ATOM   4770  C  CB   . SER B 1 29 ? 161.668 2.361   12.293  1.00 0.00 ? 29  SER B CB   2  
ATOM   4771  O  OG   . SER B 1 29 ? 162.445 3.549   12.378  1.00 0.00 ? 29  SER B OG   2  
ATOM   4772  H  H    . SER B 1 29 ? 159.775 0.659   11.469  1.00 0.00 ? 29  SER B H    2  
ATOM   4773  H  HA   . SER B 1 29 ? 159.847 3.485   12.327  1.00 0.00 ? 29  SER B HA   2  
ATOM   4774  H  HB2  . SER B 1 29 ? 161.561 1.937   13.277  1.00 0.00 ? 29  SER B HB2  2  
ATOM   4775  H  HB3  . SER B 1 29 ? 162.156 1.647   11.647  1.00 0.00 ? 29  SER B HB3  2  
ATOM   4776  H  HG   . SER B 1 29 ? 162.871 3.686   11.528  1.00 0.00 ? 29  SER B HG   2  
ATOM   4777  N  N    . LYS B 1 30 ? 160.597 4.496   10.105  1.00 0.00 ? 30  LYS B N    2  
ATOM   4778  C  CA   . LYS B 1 30 ? 160.701 5.002   8.749   1.00 0.00 ? 30  LYS B CA   2  
ATOM   4779  C  C    . LYS B 1 30 ? 161.814 4.282   8.011   1.00 0.00 ? 30  LYS B C    2  
ATOM   4780  O  O    . LYS B 1 30 ? 161.698 4.018   6.817   1.00 0.00 ? 30  LYS B O    2  
ATOM   4781  C  CB   . LYS B 1 30 ? 161.022 6.488   8.701   1.00 0.00 ? 30  LYS B CB   2  
ATOM   4782  C  CG   . LYS B 1 30 ? 160.951 6.943   7.235   1.00 0.00 ? 30  LYS B CG   2  
ATOM   4783  C  CD   . LYS B 1 30 ? 161.430 8.377   7.122   1.00 0.00 ? 30  LYS B CD   2  
ATOM   4784  C  CE   . LYS B 1 30 ? 161.182 8.909   5.708   1.00 0.00 ? 30  LYS B CE   2  
ATOM   4785  N  NZ   . LYS B 1 30 ? 162.270 9.860   5.342   1.00 0.00 ? 30  LYS B NZ   2  
ATOM   4786  H  H    . LYS B 1 30 ? 160.634 5.109   10.869  1.00 0.00 ? 30  LYS B H    2  
ATOM   4787  H  HA   . LYS B 1 30 ? 159.768 4.829   8.242   1.00 0.00 ? 30  LYS B HA   2  
ATOM   4788  H  HB2  . LYS B 1 30 ? 160.299 7.036   9.292   1.00 0.00 ? 30  LYS B HB2  2  
ATOM   4789  H  HB3  . LYS B 1 30 ? 162.015 6.661   9.086   1.00 0.00 ? 30  LYS B HB3  2  
ATOM   4790  H  HG2  . LYS B 1 30 ? 161.578 6.313   6.625   1.00 0.00 ? 30  LYS B HG2  2  
ATOM   4791  H  HG3  . LYS B 1 30 ? 159.931 6.880   6.888   1.00 0.00 ? 30  LYS B HG3  2  
ATOM   4792  H  HD2  . LYS B 1 30 ? 160.909 8.988   7.839   1.00 0.00 ? 30  LYS B HD2  2  
ATOM   4793  H  HD3  . LYS B 1 30 ? 162.487 8.395   7.325   1.00 0.00 ? 30  LYS B HD3  2  
ATOM   4794  H  HE2  . LYS B 1 30 ? 161.172 8.089   5.004   1.00 0.00 ? 30  LYS B HE2  2  
ATOM   4795  H  HE3  . LYS B 1 30 ? 160.234 9.421   5.677   1.00 0.00 ? 30  LYS B HE3  2  
ATOM   4796  H  HZ1  . LYS B 1 30 ? 163.174 9.519   5.726   1.00 0.00 ? 30  LYS B HZ1  2  
ATOM   4797  H  HZ2  . LYS B 1 30 ? 162.057 10.798  5.739   1.00 0.00 ? 30  LYS B HZ2  2  
ATOM   4798  H  HZ3  . LYS B 1 30 ? 162.339 9.928   4.307   1.00 0.00 ? 30  LYS B HZ3  2  
ATOM   4799  N  N    . LYS B 1 31 ? 162.901 3.972   8.708   1.00 0.00 ? 31  LYS B N    2  
ATOM   4800  C  CA   . LYS B 1 31 ? 163.995 3.298   8.042   1.00 0.00 ? 31  LYS B CA   2  
ATOM   4801  C  C    . LYS B 1 31 ? 163.448 2.038   7.407   1.00 0.00 ? 31  LYS B C    2  
ATOM   4802  O  O    . LYS B 1 31 ? 163.772 1.712   6.266   1.00 0.00 ? 31  LYS B O    2  
ATOM   4803  C  CB   . LYS B 1 31 ? 165.100 2.947   9.048   1.00 0.00 ? 31  LYS B CB   2  
ATOM   4804  C  CG   . LYS B 1 31 ? 166.301 2.312   8.329   1.00 0.00 ? 31  LYS B CG   2  
ATOM   4805  C  CD   . LYS B 1 31 ? 167.125 3.386   7.609   1.00 0.00 ? 31  LYS B CD   2  
ATOM   4806  C  CE   . LYS B 1 31 ? 168.385 2.748   7.018   1.00 0.00 ? 31  LYS B CE   2  
ATOM   4807  N  NZ   . LYS B 1 31 ? 168.026 1.985   5.789   1.00 0.00 ? 31  LYS B NZ   2  
ATOM   4808  H  H    . LYS B 1 31 ? 162.966 4.207   9.657   1.00 0.00 ? 31  LYS B H    2  
ATOM   4809  H  HA   . LYS B 1 31 ? 164.391 3.941   7.275   1.00 0.00 ? 31  LYS B HA   2  
ATOM   4810  H  HB2  . LYS B 1 31 ? 165.421 3.848   9.551   1.00 0.00 ? 31  LYS B HB2  2  
ATOM   4811  H  HB3  . LYS B 1 31 ? 164.711 2.250   9.775   1.00 0.00 ? 31  LYS B HB3  2  
ATOM   4812  H  HG2  . LYS B 1 31 ? 166.925 1.810   9.054   1.00 0.00 ? 31  LYS B HG2  2  
ATOM   4813  H  HG3  . LYS B 1 31 ? 165.945 1.592   7.607   1.00 0.00 ? 31  LYS B HG3  2  
ATOM   4814  H  HD2  . LYS B 1 31 ? 166.543 3.821   6.811   1.00 0.00 ? 31  LYS B HD2  2  
ATOM   4815  H  HD3  . LYS B 1 31 ? 167.409 4.155   8.311   1.00 0.00 ? 31  LYS B HD3  2  
ATOM   4816  H  HE2  . LYS B 1 31 ? 169.096 3.520   6.768   1.00 0.00 ? 31  LYS B HE2  2  
ATOM   4817  H  HE3  . LYS B 1 31 ? 168.821 2.077   7.743   1.00 0.00 ? 31  LYS B HE3  2  
ATOM   4818  H  HZ1  . LYS B 1 31 ? 167.061 1.611   5.882   1.00 0.00 ? 31  LYS B HZ1  2  
ATOM   4819  H  HZ2  . LYS B 1 31 ? 168.693 1.198   5.663   1.00 0.00 ? 31  LYS B HZ2  2  
ATOM   4820  H  HZ3  . LYS B 1 31 ? 168.073 2.616   4.964   1.00 0.00 ? 31  LYS B HZ3  2  
ATOM   4821  N  N    . GLU B 1 32 ? 162.566 1.360   8.132   1.00 0.00 ? 32  GLU B N    2  
ATOM   4822  C  CA   . GLU B 1 32 ? 161.934 0.176   7.590   1.00 0.00 ? 32  GLU B CA   2  
ATOM   4823  C  C    . GLU B 1 32 ? 161.046 0.588   6.422   1.00 0.00 ? 32  GLU B C    2  
ATOM   4824  O  O    . GLU B 1 32 ? 160.918 -0.137  5.437   1.00 0.00 ? 32  GLU B O    2  
ATOM   4825  C  CB   . GLU B 1 32 ? 161.055 -0.498  8.650   1.00 0.00 ? 32  GLU B CB   2  
ATOM   4826  C  CG   . GLU B 1 32 ? 161.904 -0.982  9.825   1.00 0.00 ? 32  GLU B CG   2  
ATOM   4827  C  CD   . GLU B 1 32 ? 161.004 -1.673  10.851  1.00 0.00 ? 32  GLU B CD   2  
ATOM   4828  O  OE1  . GLU B 1 32 ? 159.800 -1.623  10.676  1.00 0.00 ? 32  GLU B OE1  2  
ATOM   4829  O  OE2  . GLU B 1 32 ? 161.526 -2.222  11.803  1.00 0.00 ? 32  GLU B OE2  2  
ATOM   4830  H  H    . GLU B 1 32 ? 162.310 1.686   9.020   1.00 0.00 ? 32  GLU B H    2  
ATOM   4831  H  HA   . GLU B 1 32 ? 162.688 -0.517  7.250   1.00 0.00 ? 32  GLU B HA   2  
ATOM   4832  H  HB2  . GLU B 1 32 ? 160.315 0.198   9.005   1.00 0.00 ? 32  GLU B HB2  2  
ATOM   4833  H  HB3  . GLU B 1 32 ? 160.559 -1.347  8.204   1.00 0.00 ? 32  GLU B HB3  2  
ATOM   4834  H  HG2  . GLU B 1 32 ? 162.645 -1.681  9.466   1.00 0.00 ? 32  GLU B HG2  2  
ATOM   4835  H  HG3  . GLU B 1 32 ? 162.396 -0.142  10.287  1.00 0.00 ? 32  GLU B HG3  2  
ATOM   4836  N  N    . LEU B 1 33 ? 160.400 1.756   6.566   1.00 0.00 ? 33  LEU B N    2  
ATOM   4837  C  CA   . LEU B 1 33 ? 159.486 2.240   5.531   1.00 0.00 ? 33  LEU B CA   2  
ATOM   4838  C  C    . LEU B 1 33 ? 160.191 2.517   4.206   1.00 0.00 ? 33  LEU B C    2  
ATOM   4839  O  O    . LEU B 1 33 ? 159.701 2.105   3.158   1.00 0.00 ? 33  LEU B O    2  
ATOM   4840  C  CB   . LEU B 1 33 ? 158.801 3.527   6.003   1.00 0.00 ? 33  LEU B CB   2  
ATOM   4841  C  CG   . LEU B 1 33 ? 157.735 3.968   4.991   1.00 0.00 ? 33  LEU B CG   2  
ATOM   4842  C  CD1  . LEU B 1 33 ? 156.527 3.029   5.058   1.00 0.00 ? 33  LEU B CD1  2  
ATOM   4843  C  CD2  . LEU B 1 33 ? 157.284 5.391   5.325   1.00 0.00 ? 33  LEU B CD2  2  
ATOM   4844  H  H    . LEU B 1 33 ? 160.520 2.279   7.393   1.00 0.00 ? 33  LEU B H    2  
ATOM   4845  H  HA   . LEU B 1 33 ? 158.727 1.492   5.368   1.00 0.00 ? 33  LEU B HA   2  
ATOM   4846  H  HB2  . LEU B 1 33 ? 158.340 3.359   6.966   1.00 0.00 ? 33  LEU B HB2  2  
ATOM   4847  H  HB3  . LEU B 1 33 ? 159.542 4.305   6.091   1.00 0.00 ? 33  LEU B HB3  2  
ATOM   4848  H  HG   . LEU B 1 33 ? 158.148 3.948   3.993   1.00 0.00 ? 33  LEU B HG   2  
ATOM   4849  H  HD11 . LEU B 1 33 ? 156.732 2.133   4.491   1.00 0.00 ? 33  LEU B HD11 2  
ATOM   4850  H  HD12 . LEU B 1 33 ? 155.663 3.526   4.642   1.00 0.00 ? 33  LEU B HD12 2  
ATOM   4851  H  HD13 . LEU B 1 33 ? 156.329 2.767   6.086   1.00 0.00 ? 33  LEU B HD13 2  
ATOM   4852  H  HD21 . LEU B 1 33 ? 156.801 5.399   6.291   1.00 0.00 ? 33  LEU B HD21 2  
ATOM   4853  H  HD22 . LEU B 1 33 ? 156.590 5.736   4.573   1.00 0.00 ? 33  LEU B HD22 2  
ATOM   4854  H  HD23 . LEU B 1 33 ? 158.144 6.045   5.347   1.00 0.00 ? 33  LEU B HD23 2  
ATOM   4855  N  N    . LYS B 1 34 ? 161.333 3.208   4.219   1.00 0.00 ? 34  LYS B N    2  
ATOM   4856  C  CA   . LYS B 1 34 ? 161.992 3.471   2.943   1.00 0.00 ? 34  LYS B CA   2  
ATOM   4857  C  C    . LYS B 1 34 ? 162.341 2.160   2.248   1.00 0.00 ? 34  LYS B C    2  
ATOM   4858  O  O    . LYS B 1 34 ? 162.114 1.996   1.048   1.00 0.00 ? 34  LYS B O    2  
ATOM   4859  C  CB   . LYS B 1 34 ? 163.272 4.283   3.148   1.00 0.00 ? 34  LYS B CB   2  
ATOM   4860  C  CG   . LYS B 1 34 ? 162.931 5.669   3.694   1.00 0.00 ? 34  LYS B CG   2  
ATOM   4861  C  CD   . LYS B 1 34 ? 164.211 6.504   3.776   1.00 0.00 ? 34  LYS B CD   2  
ATOM   4862  C  CE   . LYS B 1 34 ? 163.902 7.852   4.426   1.00 0.00 ? 34  LYS B CE   2  
ATOM   4863  N  NZ   . LYS B 1 34 ? 165.175 8.589   4.670   1.00 0.00 ? 34  LYS B NZ   2  
ATOM   4864  H  H    . LYS B 1 34 ? 161.715 3.556   5.068   1.00 0.00 ? 34  LYS B H    2  
ATOM   4865  H  HA   . LYS B 1 34 ? 161.319 4.033   2.312   1.00 0.00 ? 34  LYS B HA   2  
ATOM   4866  H  HB2  . LYS B 1 34 ? 163.912 3.771   3.848   1.00 0.00 ? 34  LYS B HB2  2  
ATOM   4867  H  HB3  . LYS B 1 34 ? 163.785 4.389   2.204   1.00 0.00 ? 34  LYS B HB3  2  
ATOM   4868  H  HG2  . LYS B 1 34 ? 162.223 6.152   3.036   1.00 0.00 ? 34  LYS B HG2  2  
ATOM   4869  H  HG3  . LYS B 1 34 ? 162.502 5.572   4.678   1.00 0.00 ? 34  LYS B HG3  2  
ATOM   4870  H  HD2  . LYS B 1 34 ? 164.946 5.978   4.368   1.00 0.00 ? 34  LYS B HD2  2  
ATOM   4871  H  HD3  . LYS B 1 34 ? 164.599 6.667   2.782   1.00 0.00 ? 34  LYS B HD3  2  
ATOM   4872  H  HE2  . LYS B 1 34 ? 163.271 8.432   3.770   1.00 0.00 ? 34  LYS B HE2  2  
ATOM   4873  H  HE3  . LYS B 1 34 ? 163.395 7.690   5.364   1.00 0.00 ? 34  LYS B HE3  2  
ATOM   4874  H  HZ1  . LYS B 1 34 ? 165.112 9.539   4.253   1.00 0.00 ? 34  LYS B HZ1  2  
ATOM   4875  H  HZ2  . LYS B 1 34 ? 165.964 8.069   4.235   1.00 0.00 ? 34  LYS B HZ2  2  
ATOM   4876  H  HZ3  . LYS B 1 34 ? 165.337 8.673   5.694   1.00 0.00 ? 34  LYS B HZ3  2  
ATOM   4877  N  N    . GLU B 1 35 ? 162.873 1.215   3.014   1.00 0.00 ? 35  GLU B N    2  
ATOM   4878  C  CA   . GLU B 1 35 ? 163.233 -0.078  2.453   1.00 0.00 ? 35  GLU B CA   2  
ATOM   4879  C  C    . GLU B 1 35 ? 161.998 -0.835  1.991   1.00 0.00 ? 35  GLU B C    2  
ATOM   4880  O  O    . GLU B 1 35 ? 162.030 -1.537  0.980   1.00 0.00 ? 35  GLU B O    2  
ATOM   4881  C  CB   . GLU B 1 35 ? 163.976 -0.909  3.503   1.00 0.00 ? 35  GLU B CB   2  
ATOM   4882  C  CG   . GLU B 1 35 ? 165.313 -0.244  3.843   1.00 0.00 ? 35  GLU B CG   2  
ATOM   4883  C  CD   . GLU B 1 35 ? 166.206 -0.182  2.607   1.00 0.00 ? 35  GLU B CD   2  
ATOM   4884  O  OE1  . GLU B 1 35 ? 165.936 -0.911  1.667   1.00 0.00 ? 35  GLU B OE1  2  
ATOM   4885  O  OE2  . GLU B 1 35 ? 167.146 0.595   2.618   1.00 0.00 ? 35  GLU B OE2  2  
ATOM   4886  H  H    . GLU B 1 35 ? 163.018 1.387   3.968   1.00 0.00 ? 35  GLU B H    2  
ATOM   4887  H  HA   . GLU B 1 35 ? 163.884 0.078   1.607   1.00 0.00 ? 35  GLU B HA   2  
ATOM   4888  H  HB2  . GLU B 1 35 ? 163.373 -0.981  4.395   1.00 0.00 ? 35  GLU B HB2  2  
ATOM   4889  H  HB3  . GLU B 1 35 ? 164.159 -1.899  3.112   1.00 0.00 ? 35  GLU B HB3  2  
ATOM   4890  H  HG2  . GLU B 1 35 ? 165.132 0.758   4.203   1.00 0.00 ? 35  GLU B HG2  2  
ATOM   4891  H  HG3  . GLU B 1 35 ? 165.809 -0.815  4.613   1.00 0.00 ? 35  GLU B HG3  2  
ATOM   4892  N  N    . LEU B 1 36 ? 160.913 -0.705  2.748   1.00 0.00 ? 36  LEU B N    2  
ATOM   4893  C  CA   . LEU B 1 36 ? 159.684 -1.405  2.410   1.00 0.00 ? 36  LEU B CA   2  
ATOM   4894  C  C    . LEU B 1 36 ? 159.132 -0.922  1.070   1.00 0.00 ? 36  LEU B C    2  
ATOM   4895  O  O    . LEU B 1 36 ? 158.735 -1.730  0.224   1.00 0.00 ? 36  LEU B O    2  
ATOM   4896  C  CB   . LEU B 1 36 ? 158.662 -1.153  3.529   1.00 0.00 ? 36  LEU B CB   2  
ATOM   4897  C  CG   . LEU B 1 36 ? 157.451 -2.095  3.394   1.00 0.00 ? 36  LEU B CG   2  
ATOM   4898  C  CD1  . LEU B 1 36 ? 156.848 -2.352  4.779   1.00 0.00 ? 36  LEU B CD1  2  
ATOM   4899  C  CD2  . LEU B 1 36 ? 156.373 -1.450  2.522   1.00 0.00 ? 36  LEU B CD2  2  
ATOM   4900  H  H    . LEU B 1 36 ? 160.947 -0.144  3.551   1.00 0.00 ? 36  LEU B H    2  
ATOM   4901  H  HA   . LEU B 1 36 ? 159.885 -2.463  2.350   1.00 0.00 ? 36  LEU B HA   2  
ATOM   4902  H  HB2  . LEU B 1 36 ? 159.143 -1.316  4.481   1.00 0.00 ? 36  LEU B HB2  2  
ATOM   4903  H  HB3  . LEU B 1 36 ? 158.325 -0.130  3.476   1.00 0.00 ? 36  LEU B HB3  2  
ATOM   4904  H  HG   . LEU B 1 36 ? 157.764 -3.031  2.956   1.00 0.00 ? 36  LEU B HG   2  
ATOM   4905  H  HD11 . LEU B 1 36 ? 156.353 -1.457  5.127   1.00 0.00 ? 36  LEU B HD11 2  
ATOM   4906  H  HD12 . LEU B 1 36 ? 157.627 -2.623  5.472   1.00 0.00 ? 36  LEU B HD12 2  
ATOM   4907  H  HD13 . LEU B 1 36 ? 156.130 -3.156  4.714   1.00 0.00 ? 36  LEU B HD13 2  
ATOM   4908  H  HD21 . LEU B 1 36 ? 156.717 -1.377  1.503   1.00 0.00 ? 36  LEU B HD21 2  
ATOM   4909  H  HD22 . LEU B 1 36 ? 156.147 -0.465  2.901   1.00 0.00 ? 36  LEU B HD22 2  
ATOM   4910  H  HD23 . LEU B 1 36 ? 155.482 -2.057  2.557   1.00 0.00 ? 36  LEU B HD23 2  
ATOM   4911  N  N    . LEU B 1 37 ? 159.129 0.396   0.868   1.00 0.00 ? 37  LEU B N    2  
ATOM   4912  C  CA   . LEU B 1 37 ? 158.638 0.952   -0.387  1.00 0.00 ? 37  LEU B CA   2  
ATOM   4913  C  C    . LEU B 1 37 ? 159.573 0.639   -1.544  1.00 0.00 ? 37  LEU B C    2  
ATOM   4914  O  O    . LEU B 1 37 ? 159.118 0.298   -2.637  1.00 0.00 ? 37  LEU B O    2  
ATOM   4915  C  CB   . LEU B 1 37 ? 158.459 2.475   -0.281  1.00 0.00 ? 37  LEU B CB   2  
ATOM   4916  C  CG   . LEU B 1 37 ? 157.173 2.853   0.481   1.00 0.00 ? 37  LEU B CG   2  
ATOM   4917  C  CD1  . LEU B 1 37 ? 156.000 2.883   -0.497  1.00 0.00 ? 37  LEU B CD1  2  
ATOM   4918  C  CD2  . LEU B 1 37 ? 156.857 1.855   1.601   1.00 0.00 ? 37  LEU B CD2  2  
ATOM   4919  H  H    . LEU B 1 37 ? 159.471 0.997   1.566   1.00 0.00 ? 37  LEU B H    2  
ATOM   4920  H  HA   . LEU B 1 37 ? 157.680 0.512   -0.609  1.00 0.00 ? 37  LEU B HA   2  
ATOM   4921  H  HB2  . LEU B 1 37 ? 159.310 2.892   0.238   1.00 0.00 ? 37  LEU B HB2  2  
ATOM   4922  H  HB3  . LEU B 1 37 ? 158.417 2.893   -1.276  1.00 0.00 ? 37  LEU B HB3  2  
ATOM   4923  H  HG   . LEU B 1 37 ? 157.297 3.840   0.907   1.00 0.00 ? 37  LEU B HG   2  
ATOM   4924  H  HD11 . LEU B 1 37 ? 155.091 3.118   0.037   1.00 0.00 ? 37  LEU B HD11 2  
ATOM   4925  H  HD12 . LEU B 1 37 ? 155.900 1.916   -0.970  1.00 0.00 ? 37  LEU B HD12 2  
ATOM   4926  H  HD13 . LEU B 1 37 ? 156.179 3.635   -1.251  1.00 0.00 ? 37  LEU B HD13 2  
ATOM   4927  H  HD21 . LEU B 1 37 ? 156.477 0.942   1.177   1.00 0.00 ? 37  LEU B HD21 2  
ATOM   4928  H  HD22 . LEU B 1 37 ? 156.110 2.281   2.255   1.00 0.00 ? 37  LEU B HD22 2  
ATOM   4929  H  HD23 . LEU B 1 37 ? 157.745 1.651   2.168   1.00 0.00 ? 37  LEU B HD23 2  
ATOM   4930  N  N    . GLN B 1 38 ? 160.880 0.763   -1.318  1.00 0.00 ? 38  GLN B N    2  
ATOM   4931  C  CA   . GLN B 1 38 ? 161.820 0.487   -2.394  1.00 0.00 ? 38  GLN B CA   2  
ATOM   4932  C  C    . GLN B 1 38 ? 161.764 -0.972  -2.838  1.00 0.00 ? 38  GLN B C    2  
ATOM   4933  O  O    . GLN B 1 38 ? 161.780 -1.265  -4.033  1.00 0.00 ? 38  GLN B O    2  
ATOM   4934  C  CB   . GLN B 1 38 ? 163.241 0.831   -1.937  1.00 0.00 ? 38  GLN B CB   2  
ATOM   4935  C  CG   . GLN B 1 38 ? 163.364 2.343   -1.717  1.00 0.00 ? 38  GLN B CG   2  
ATOM   4936  C  CD   . GLN B 1 38 ? 164.752 2.680   -1.184  1.00 0.00 ? 38  GLN B CD   2  
ATOM   4937  O  OE1  . GLN B 1 38 ? 165.469 1.796   -0.714  1.00 0.00 ? 38  GLN B OE1  2  
ATOM   4938  N  NE2  . GLN B 1 38 ? 165.177 3.914   -1.228  1.00 0.00 ? 38  GLN B NE2  2  
ATOM   4939  H  H    . GLN B 1 38 ? 161.207 1.048   -0.432  1.00 0.00 ? 38  GLN B H    2  
ATOM   4940  H  HA   . GLN B 1 38 ? 161.570 1.113   -3.235  1.00 0.00 ? 38  GLN B HA   2  
ATOM   4941  H  HB2  . GLN B 1 38 ? 163.450 0.318   -1.008  1.00 0.00 ? 38  GLN B HB2  2  
ATOM   4942  H  HB3  . GLN B 1 38 ? 163.951 0.517   -2.684  1.00 0.00 ? 38  GLN B HB3  2  
ATOM   4943  H  HG2  . GLN B 1 38 ? 163.210 2.855   -2.655  1.00 0.00 ? 38  GLN B HG2  2  
ATOM   4944  H  HG3  . GLN B 1 38 ? 162.621 2.668   -1.013  1.00 0.00 ? 38  GLN B HG3  2  
ATOM   4945  H  HE21 . GLN B 1 38 ? 164.605 4.617   -1.601  1.00 0.00 ? 38  GLN B HE21 2  
ATOM   4946  H  HE22 . GLN B 1 38 ? 166.069 4.137   -0.885  1.00 0.00 ? 38  GLN B HE22 2  
ATOM   4947  N  N    . THR B 1 39 ? 161.701 -1.884  -1.874  1.00 0.00 ? 39  THR B N    2  
ATOM   4948  C  CA   . THR B 1 39 ? 161.647 -3.306  -2.191  1.00 0.00 ? 39  THR B CA   2  
ATOM   4949  C  C    . THR B 1 39 ? 160.305 -3.733  -2.789  1.00 0.00 ? 39  THR B C    2  
ATOM   4950  O  O    . THR B 1 39 ? 160.259 -4.522  -3.733  1.00 0.00 ? 39  THR B O    2  
ATOM   4951  C  CB   . THR B 1 39 ? 161.916 -4.126  -0.928  1.00 0.00 ? 39  THR B CB   2  
ATOM   4952  O  OG1  . THR B 1 39 ? 163.151 -3.720  -0.357  1.00 0.00 ? 39  THR B OG1  2  
ATOM   4953  C  CG2  . THR B 1 39 ? 161.980 -5.611  -1.285  1.00 0.00 ? 39  THR B CG2  2  
ATOM   4954  H  H    . THR B 1 39 ? 161.693 -1.597  -0.937  1.00 0.00 ? 39  THR B H    2  
ATOM   4955  H  HA   . THR B 1 39 ? 162.424 -3.527  -2.907  1.00 0.00 ? 39  THR B HA   2  
ATOM   4956  H  HB   . THR B 1 39 ? 161.119 -3.966  -0.218  1.00 0.00 ? 39  THR B HB   2  
ATOM   4957  H  HG1  . THR B 1 39 ? 163.392 -2.873  -0.741  1.00 0.00 ? 39  THR B HG1  2  
ATOM   4958  H  HG21 . THR B 1 39 ? 160.986 -5.975  -1.495  1.00 0.00 ? 39  THR B HG21 2  
ATOM   4959  H  HG22 . THR B 1 39 ? 162.398 -6.163  -0.456  1.00 0.00 ? 39  THR B HG22 2  
ATOM   4960  H  HG23 . THR B 1 39 ? 162.605 -5.746  -2.157  1.00 0.00 ? 39  THR B HG23 2  
ATOM   4961  N  N    . GLU B 1 40 ? 159.217 -3.250  -2.192  1.00 0.00 ? 40  GLU B N    2  
ATOM   4962  C  CA   . GLU B 1 40 ? 157.877 -3.636  -2.633  1.00 0.00 ? 40  GLU B CA   2  
ATOM   4963  C  C    . GLU B 1 40 ? 157.409 -2.977  -3.928  1.00 0.00 ? 40  GLU B C    2  
ATOM   4964  O  O    . GLU B 1 40 ? 156.622 -3.570  -4.666  1.00 0.00 ? 40  GLU B O    2  
ATOM   4965  C  CB   . GLU B 1 40 ? 156.862 -3.329  -1.536  1.00 0.00 ? 40  GLU B CB   2  
ATOM   4966  C  CG   . GLU B 1 40 ? 157.143 -4.202  -0.314  1.00 0.00 ? 40  GLU B CG   2  
ATOM   4967  C  CD   . GLU B 1 40 ? 156.073 -3.962  0.742   1.00 0.00 ? 40  GLU B CD   2  
ATOM   4968  O  OE1  . GLU B 1 40 ? 155.260 -3.075  0.537   1.00 0.00 ? 40  GLU B OE1  2  
ATOM   4969  O  OE2  . GLU B 1 40 ? 156.072 -4.675  1.730   1.00 0.00 ? 40  GLU B OE2  2  
ATOM   4970  H  H    . GLU B 1 40 ? 159.315 -2.655  -1.413  1.00 0.00 ? 40  GLU B H    2  
ATOM   4971  H  HA   . GLU B 1 40 ? 157.875 -4.704  -2.786  1.00 0.00 ? 40  GLU B HA   2  
ATOM   4972  H  HB2  . GLU B 1 40 ? 156.938 -2.287  -1.259  1.00 0.00 ? 40  GLU B HB2  2  
ATOM   4973  H  HB3  . GLU B 1 40 ? 155.869 -3.533  -1.899  1.00 0.00 ? 40  GLU B HB3  2  
ATOM   4974  H  HG2  . GLU B 1 40 ? 157.133 -5.243  -0.607  1.00 0.00 ? 40  GLU B HG2  2  
ATOM   4975  H  HG3  . GLU B 1 40 ? 158.111 -3.952  0.093   1.00 0.00 ? 40  GLU B HG3  2  
ATOM   4976  N  N    . LEU B 1 41 ? 157.815 -1.737  -4.186  1.00 0.00 ? 41  LEU B N    2  
ATOM   4977  C  CA   . LEU B 1 41 ? 157.318 -1.046  -5.378  1.00 0.00 ? 41  LEU B CA   2  
ATOM   4978  C  C    . LEU B 1 41 ? 158.336 -1.054  -6.529  1.00 0.00 ? 41  LEU B C    2  
ATOM   4979  O  O    . LEU B 1 41 ? 159.486 -0.626  -6.379  1.00 0.00 ? 41  LEU B O    2  
ATOM   4980  C  CB   . LEU B 1 41 ? 156.962 0.392   -4.982  1.00 0.00 ? 41  LEU B CB   2  
ATOM   4981  C  CG   . LEU B 1 41 ? 156.211 1.081   -6.121  1.00 0.00 ? 41  LEU B CG   2  
ATOM   4982  C  CD1  . LEU B 1 41 ? 154.784 0.528   -6.222  1.00 0.00 ? 41  LEU B CD1  2  
ATOM   4983  C  CD2  . LEU B 1 41 ? 156.152 2.586   -5.853  1.00 0.00 ? 41  LEU B CD2  2  
ATOM   4984  H  H    . LEU B 1 41 ? 158.400 -1.269  -3.553  1.00 0.00 ? 41  LEU B H    2  
ATOM   4985  H  HA   . LEU B 1 41 ? 156.417 -1.536  -5.716  1.00 0.00 ? 41  LEU B HA   2  
ATOM   4986  H  HB2  . LEU B 1 41 ? 156.345 0.377   -4.096  1.00 0.00 ? 41  LEU B HB2  2  
ATOM   4987  H  HB3  . LEU B 1 41 ? 157.869 0.937   -4.775  1.00 0.00 ? 41  LEU B HB3  2  
ATOM   4988  H  HG   . LEU B 1 41 ? 156.723 0.899   -7.041  1.00 0.00 ? 41  LEU B HG   2  
ATOM   4989  H  HD11 . LEU B 1 41 ? 154.403 0.318   -5.235  1.00 0.00 ? 41  LEU B HD11 2  
ATOM   4990  H  HD12 . LEU B 1 41 ? 154.790 -0.380  -6.806  1.00 0.00 ? 41  LEU B HD12 2  
ATOM   4991  H  HD13 . LEU B 1 41 ? 154.150 1.259   -6.703  1.00 0.00 ? 41  LEU B HD13 2  
ATOM   4992  H  HD21 . LEU B 1 41 ? 155.807 3.097   -6.741  1.00 0.00 ? 41  LEU B HD21 2  
ATOM   4993  H  HD22 . LEU B 1 41 ? 157.135 2.945   -5.591  1.00 0.00 ? 41  LEU B HD22 2  
ATOM   4994  H  HD23 . LEU B 1 41 ? 155.468 2.780   -5.039  1.00 0.00 ? 41  LEU B HD23 2  
ATOM   4995  N  N    . SER B 1 42 ? 157.883 -1.517  -7.698  1.00 0.00 ? 42  SER B N    2  
ATOM   4996  C  CA   . SER B 1 42 ? 158.739 -1.566  -8.883  1.00 0.00 ? 42  SER B CA   2  
ATOM   4997  C  C    . SER B 1 42 ? 159.200 -0.161  -9.229  1.00 0.00 ? 42  SER B C    2  
ATOM   4998  O  O    . SER B 1 42 ? 160.269 0.041   -9.810  1.00 0.00 ? 42  SER B O    2  
ATOM   4999  C  CB   . SER B 1 42 ? 157.974 -2.165  -10.062 1.00 0.00 ? 42  SER B CB   2  
ATOM   5000  O  OG   . SER B 1 42 ? 156.941 -1.271  -10.456 1.00 0.00 ? 42  SER B OG   2  
ATOM   5001  H  H    . SER B 1 42 ? 156.954 -1.822  -7.765  1.00 0.00 ? 42  SER B H    2  
ATOM   5002  H  HA   . SER B 1 42 ? 159.602 -2.180  -8.671  1.00 0.00 ? 42  SER B HA   2  
ATOM   5003  H  HB2  . SER B 1 42 ? 158.645 -2.318  -10.889 1.00 0.00 ? 42  SER B HB2  2  
ATOM   5004  H  HB3  . SER B 1 42 ? 157.547 -3.116  -9.767  1.00 0.00 ? 42  SER B HB3  2  
ATOM   5005  H  HG   . SER B 1 42 ? 156.153 -1.789  -10.637 1.00 0.00 ? 42  SER B HG   2  
ATOM   5006  N  N    . GLY B 1 43 ? 158.386 0.805   -8.837  1.00 0.00 ? 43  GLY B N    2  
ATOM   5007  C  CA   . GLY B 1 43 ? 158.698 2.201   -9.070  1.00 0.00 ? 43  GLY B CA   2  
ATOM   5008  C  C    . GLY B 1 43 ? 160.128 2.470   -8.643  1.00 0.00 ? 43  GLY B C    2  
ATOM   5009  O  O    . GLY B 1 43 ? 160.699 3.512   -8.965  1.00 0.00 ? 43  GLY B O    2  
ATOM   5010  H  H    . GLY B 1 43 ? 157.563 0.571   -8.370  1.00 0.00 ? 43  GLY B H    2  
ATOM   5011  H  HA2  . GLY B 1 43 ? 158.584 2.425   -10.122 1.00 0.00 ? 43  GLY B HA2  2  
ATOM   5012  H  HA3  . GLY B 1 43 ? 158.031 2.822   -8.493  1.00 0.00 ? 43  GLY B HA3  2  
ATOM   5013  N  N    . PHE B 1 44 ? 160.704 1.518   -7.911  1.00 0.00 ? 44  PHE B N    2  
ATOM   5014  C  CA   . PHE B 1 44 ? 162.072 1.668   -7.445  1.00 0.00 ? 44  PHE B CA   2  
ATOM   5015  C  C    . PHE B 1 44 ? 163.006 2.043   -8.585  1.00 0.00 ? 44  PHE B C    2  
ATOM   5016  O  O    . PHE B 1 44 ? 163.907 2.862   -8.407  1.00 0.00 ? 44  PHE B O    2  
ATOM   5017  C  CB   . PHE B 1 44 ? 162.557 0.366   -6.813  1.00 0.00 ? 44  PHE B CB   2  
ATOM   5018  C  CG   . PHE B 1 44 ? 163.959 0.563   -6.296  1.00 0.00 ? 44  PHE B CG   2  
ATOM   5019  C  CD1  . PHE B 1 44 ? 164.171 1.251   -5.101  1.00 0.00 ? 44  PHE B CD1  2  
ATOM   5020  C  CD2  . PHE B 1 44 ? 165.051 0.073   -7.024  1.00 0.00 ? 44  PHE B CD2  2  
ATOM   5021  C  CE1  . PHE B 1 44 ? 165.473 1.448   -4.625  1.00 0.00 ? 44  PHE B CE1  2  
ATOM   5022  C  CE2  . PHE B 1 44 ? 166.353 0.269   -6.550  1.00 0.00 ? 44  PHE B CE2  2  
ATOM   5023  C  CZ   . PHE B 1 44 ? 166.565 0.955   -5.349  1.00 0.00 ? 44  PHE B CZ   2  
ATOM   5024  H  H    . PHE B 1 44 ? 160.196 0.701   -7.677  1.00 0.00 ? 44  PHE B H    2  
ATOM   5025  H  HA   . PHE B 1 44 ? 162.104 2.439   -6.696  1.00 0.00 ? 44  PHE B HA   2  
ATOM   5026  H  HB2  . PHE B 1 44 ? 161.903 0.094   -5.997  1.00 0.00 ? 44  PHE B HB2  2  
ATOM   5027  H  HB3  . PHE B 1 44 ? 162.554 -0.419  -7.555  1.00 0.00 ? 44  PHE B HB3  2  
ATOM   5028  H  HD1  . PHE B 1 44 ? 163.330 1.633   -4.549  1.00 0.00 ? 44  PHE B HD1  2  
ATOM   5029  H  HD2  . PHE B 1 44 ? 164.887 -0.459  -7.950  1.00 0.00 ? 44  PHE B HD2  2  
ATOM   5030  H  HE1  . PHE B 1 44 ? 165.634 1.977   -3.697  1.00 0.00 ? 44  PHE B HE1  2  
ATOM   5031  H  HE2  . PHE B 1 44 ? 167.195 -0.109  -7.113  1.00 0.00 ? 44  PHE B HE2  2  
ATOM   5032  H  HZ   . PHE B 1 44 ? 167.568 1.106   -4.983  1.00 0.00 ? 44  PHE B HZ   2  
ATOM   5033  N  N    . LEU B 1 45 ? 162.808 1.442   -9.749  1.00 0.00 ? 45  LEU B N    2  
ATOM   5034  C  CA   . LEU B 1 45 ? 163.676 1.743   -10.880 1.00 0.00 ? 45  LEU B CA   2  
ATOM   5035  C  C    . LEU B 1 45 ? 163.655 3.241   -11.210 1.00 0.00 ? 45  LEU B C    2  
ATOM   5036  O  O    . LEU B 1 45 ? 164.698 3.831   -11.493 1.00 0.00 ? 45  LEU B O    2  
ATOM   5037  C  CB   . LEU B 1 45 ? 163.218 0.938   -12.100 1.00 0.00 ? 45  LEU B CB   2  
ATOM   5038  C  CG   . LEU B 1 45 ? 164.185 1.155   -13.269 1.00 0.00 ? 45  LEU B CG   2  
ATOM   5039  C  CD1  . LEU B 1 45 ? 165.513 0.444   -12.986 1.00 0.00 ? 45  LEU B CD1  2  
ATOM   5040  C  CD2  . LEU B 1 45 ? 163.567 0.581   -14.545 1.00 0.00 ? 45  LEU B CD2  2  
ATOM   5041  H  H    . LEU B 1 45 ? 162.082 0.787   -9.847  1.00 0.00 ? 45  LEU B H    2  
ATOM   5042  H  HA   . LEU B 1 45 ? 164.684 1.455   -10.630 1.00 0.00 ? 45  LEU B HA   2  
ATOM   5043  H  HB2  . LEU B 1 45 ? 163.187 -0.112  -11.846 1.00 0.00 ? 45  LEU B HB2  2  
ATOM   5044  H  HB3  . LEU B 1 45 ? 162.231 1.263   -12.391 1.00 0.00 ? 45  LEU B HB3  2  
ATOM   5045  H  HG   . LEU B 1 45 ? 164.366 2.212   -13.400 1.00 0.00 ? 45  LEU B HG   2  
ATOM   5046  H  HD11 . LEU B 1 45 ? 166.126 1.065   -12.350 1.00 0.00 ? 45  LEU B HD11 2  
ATOM   5047  H  HD12 . LEU B 1 45 ? 166.028 0.262   -13.917 1.00 0.00 ? 45  LEU B HD12 2  
ATOM   5048  H  HD13 . LEU B 1 45 ? 165.321 -0.498  -12.492 1.00 0.00 ? 45  LEU B HD13 2  
ATOM   5049  H  HD21 . LEU B 1 45 ? 164.323 0.515   -15.314 1.00 0.00 ? 45  LEU B HD21 2  
ATOM   5050  H  HD22 . LEU B 1 45 ? 162.768 1.227   -14.879 1.00 0.00 ? 45  LEU B HD22 2  
ATOM   5051  H  HD23 . LEU B 1 45 ? 163.173 -0.403  -14.342 1.00 0.00 ? 45  LEU B HD23 2  
ATOM   5052  N  N    . ASP B 1 46 ? 162.470 3.853   -11.165 1.00 0.00 ? 46  ASP B N    2  
ATOM   5053  C  CA   . ASP B 1 46 ? 162.345 5.287   -11.456 1.00 0.00 ? 46  ASP B CA   2  
ATOM   5054  C  C    . ASP B 1 46 ? 162.069 6.101   -10.191 1.00 0.00 ? 46  ASP B C    2  
ATOM   5055  O  O    . ASP B 1 46 ? 161.815 7.303   -10.265 1.00 0.00 ? 46  ASP B O    2  
ATOM   5056  C  CB   . ASP B 1 46 ? 161.210 5.510   -12.457 1.00 0.00 ? 46  ASP B CB   2  
ATOM   5057  C  CG   . ASP B 1 46 ? 161.572 4.893   -13.803 1.00 0.00 ? 46  ASP B CG   2  
ATOM   5058  O  OD1  . ASP B 1 46 ? 162.730 4.551   -13.983 1.00 0.00 ? 46  ASP B OD1  2  
ATOM   5059  O  OD2  . ASP B 1 46 ? 160.688 4.771   -14.633 1.00 0.00 ? 46  ASP B OD2  2  
ATOM   5060  H  H    . ASP B 1 46 ? 161.671 3.339   -10.928 1.00 0.00 ? 46  ASP B H    2  
ATOM   5061  H  HA   . ASP B 1 46 ? 163.266 5.636   -11.899 1.00 0.00 ? 46  ASP B HA   2  
ATOM   5062  H  HB2  . ASP B 1 46 ? 160.307 5.051   -12.083 1.00 0.00 ? 46  ASP B HB2  2  
ATOM   5063  H  HB3  . ASP B 1 46 ? 161.047 6.571   -12.583 1.00 0.00 ? 46  ASP B HB3  2  
ATOM   5064  N  N    . ALA B 1 47 ? 162.085 5.440   -9.042  1.00 0.00 ? 47  ALA B N    2  
ATOM   5065  C  CA   . ALA B 1 47 ? 161.797 6.114   -7.776  1.00 0.00 ? 47  ALA B CA   2  
ATOM   5066  C  C    . ALA B 1 47 ? 162.829 7.186   -7.424  1.00 0.00 ? 47  ALA B C    2  
ATOM   5067  O  O    . ALA B 1 47 ? 162.516 8.139   -6.717  1.00 0.00 ? 47  ALA B O    2  
ATOM   5068  C  CB   . ALA B 1 47 ? 161.743 5.094   -6.644  1.00 0.00 ? 47  ALA B CB   2  
ATOM   5069  H  H    . ALA B 1 47 ? 162.268 4.477   -9.043  1.00 0.00 ? 47  ALA B H    2  
ATOM   5070  H  HA   . ALA B 1 47 ? 160.829 6.577   -7.857  1.00 0.00 ? 47  ALA B HA   2  
ATOM   5071  H  HB1  . ALA B 1 47 ? 160.970 4.369   -6.852  1.00 0.00 ? 47  ALA B HB1  2  
ATOM   5072  H  HB2  . ALA B 1 47 ? 161.521 5.599   -5.715  1.00 0.00 ? 47  ALA B HB2  2  
ATOM   5073  H  HB3  . ALA B 1 47 ? 162.697 4.596   -6.564  1.00 0.00 ? 47  ALA B HB3  2  
ATOM   5074  N  N    . GLN B 1 48 ? 164.060 6.990   -7.881  1.00 0.00 ? 48  GLN B N    2  
ATOM   5075  C  CA   . GLN B 1 48 ? 165.167 7.904   -7.575  1.00 0.00 ? 48  GLN B CA   2  
ATOM   5076  C  C    . GLN B 1 48 ? 164.723 9.182   -6.846  1.00 0.00 ? 48  GLN B C    2  
ATOM   5077  O  O    . GLN B 1 48 ? 164.543 9.178   -5.625  1.00 0.00 ? 48  GLN B O    2  
ATOM   5078  C  CB   . GLN B 1 48 ? 165.876 8.295   -8.873  1.00 0.00 ? 48  GLN B CB   2  
ATOM   5079  C  CG   . GLN B 1 48 ? 166.487 7.049   -9.518  1.00 0.00 ? 48  GLN B CG   2  
ATOM   5080  C  CD   . GLN B 1 48 ? 167.156 7.421   -10.838 1.00 0.00 ? 48  GLN B CD   2  
ATOM   5081  O  OE1  . GLN B 1 48 ? 166.905 8.496   -11.381 1.00 0.00 ? 48  GLN B OE1  2  
ATOM   5082  N  NE2  . GLN B 1 48 ? 167.998 6.589   -11.388 1.00 0.00 ? 48  GLN B NE2  2  
ATOM   5083  H  H    . GLN B 1 48 ? 164.245 6.186   -8.410  1.00 0.00 ? 48  GLN B H    2  
ATOM   5084  H  HA   . GLN B 1 48 ? 165.876 7.384   -6.950  1.00 0.00 ? 48  GLN B HA   2  
ATOM   5085  H  HB2  . GLN B 1 48 ? 165.163 8.741   -9.552  1.00 0.00 ? 48  GLN B HB2  2  
ATOM   5086  H  HB3  . GLN B 1 48 ? 166.659 9.005   -8.656  1.00 0.00 ? 48  GLN B HB3  2  
ATOM   5087  H  HG2  . GLN B 1 48 ? 167.221 6.624   -8.851  1.00 0.00 ? 48  GLN B HG2  2  
ATOM   5088  H  HG3  . GLN B 1 48 ? 165.708 6.324   -9.705  1.00 0.00 ? 48  GLN B HG3  2  
ATOM   5089  H  HE21 . GLN B 1 48 ? 168.197 5.734   -10.954 1.00 0.00 ? 48  GLN B HE21 2  
ATOM   5090  H  HE22 . GLN B 1 48 ? 168.432 6.822   -12.236 1.00 0.00 ? 48  GLN B HE22 2  
ATOM   5091  N  N    . LYS B 1 49 ? 164.549 10.271  -7.591  1.00 0.00 ? 49  LYS B N    2  
ATOM   5092  C  CA   . LYS B 1 49 ? 164.159 11.548  -6.987  1.00 0.00 ? 49  LYS B CA   2  
ATOM   5093  C  C    . LYS B 1 49 ? 162.848 11.439  -6.216  1.00 0.00 ? 49  LYS B C    2  
ATOM   5094  O  O    . LYS B 1 49 ? 162.677 12.074  -5.171  1.00 0.00 ? 49  LYS B O    2  
ATOM   5095  C  CB   . LYS B 1 49 ? 164.027 12.615  -8.075  1.00 0.00 ? 49  LYS B CB   2  
ATOM   5096  C  CG   . LYS B 1 49 ? 162.821 12.302  -8.962  1.00 0.00 ? 49  LYS B CG   2  
ATOM   5097  C  CD   . LYS B 1 49 ? 162.773 13.295  -10.124 1.00 0.00 ? 49  LYS B CD   2  
ATOM   5098  C  CE   . LYS B 1 49 ? 161.421 13.193  -10.830 1.00 0.00 ? 49  LYS B CE   2  
ATOM   5099  N  NZ   . LYS B 1 49 ? 161.532 13.765  -12.201 1.00 0.00 ? 49  LYS B NZ   2  
ATOM   5100  H  H    . LYS B 1 49 ? 164.704 10.224  -8.557  1.00 0.00 ? 49  LYS B H    2  
ATOM   5101  H  HA   . LYS B 1 49 ? 164.935 11.855  -6.302  1.00 0.00 ? 49  LYS B HA   2  
ATOM   5102  H  HB2  . LYS B 1 49 ? 163.894 13.583  -7.615  1.00 0.00 ? 49  LYS B HB2  2  
ATOM   5103  H  HB3  . LYS B 1 49 ? 164.923 12.626  -8.679  1.00 0.00 ? 49  LYS B HB3  2  
ATOM   5104  H  HG2  . LYS B 1 49 ? 162.910 11.297  -9.349  1.00 0.00 ? 49  LYS B HG2  2  
ATOM   5105  H  HG3  . LYS B 1 49 ? 161.915 12.386  -8.383  1.00 0.00 ? 49  LYS B HG3  2  
ATOM   5106  H  HD2  . LYS B 1 49 ? 162.908 14.298  -9.745  1.00 0.00 ? 49  LYS B HD2  2  
ATOM   5107  H  HD3  . LYS B 1 49 ? 163.561 13.067  -10.827 1.00 0.00 ? 49  LYS B HD3  2  
ATOM   5108  H  HE2  . LYS B 1 49 ? 161.125 12.157  -10.895 1.00 0.00 ? 49  LYS B HE2  2  
ATOM   5109  H  HE3  . LYS B 1 49 ? 160.680 13.744  -10.269 1.00 0.00 ? 49  LYS B HE3  2  
ATOM   5110  H  HZ1  . LYS B 1 49 ? 160.618 13.679  -12.688 1.00 0.00 ? 49  LYS B HZ1  2  
ATOM   5111  H  HZ2  . LYS B 1 49 ? 162.259 13.245  -12.735 1.00 0.00 ? 49  LYS B HZ2  2  
ATOM   5112  H  HZ3  . LYS B 1 49 ? 161.797 14.768  -12.139 1.00 0.00 ? 49  LYS B HZ3  2  
ATOM   5113  N  N    . ASP B 1 50 ? 161.938 10.624  -6.716  1.00 0.00 ? 50  ASP B N    2  
ATOM   5114  C  CA   . ASP B 1 50 ? 160.659 10.446  -6.053  1.00 0.00 ? 50  ASP B CA   2  
ATOM   5115  C  C    . ASP B 1 50 ? 160.875 10.034  -4.605  1.00 0.00 ? 50  ASP B C    2  
ATOM   5116  O  O    . ASP B 1 50 ? 160.042 10.325  -3.748  1.00 0.00 ? 50  ASP B O    2  
ATOM   5117  C  CB   . ASP B 1 50 ? 159.789 9.413   -6.772  1.00 0.00 ? 50  ASP B CB   2  
ATOM   5118  C  CG   . ASP B 1 50 ? 159.371 9.944   -8.139  1.00 0.00 ? 50  ASP B CG   2  
ATOM   5119  O  OD1  . ASP B 1 50 ? 159.557 11.127  -8.375  1.00 0.00 ? 50  ASP B OD1  2  
ATOM   5120  O  OD2  . ASP B 1 50 ? 158.870 9.161   -8.928  1.00 0.00 ? 50  ASP B OD2  2  
ATOM   5121  H  H    . ASP B 1 50 ? 162.129 10.131  -7.541  1.00 0.00 ? 50  ASP B H    2  
ATOM   5122  H  HA   . ASP B 1 50 ? 160.140 11.393  -6.060  1.00 0.00 ? 50  ASP B HA   2  
ATOM   5123  H  HB2  . ASP B 1 50 ? 160.336 8.502   -6.892  1.00 0.00 ? 50  ASP B HB2  2  
ATOM   5124  H  HB3  . ASP B 1 50 ? 158.905 9.222   -6.182  1.00 0.00 ? 50  ASP B HB3  2  
ATOM   5125  N  N    . VAL B 1 51 ? 161.981 9.340   -4.322  1.00 0.00 ? 51  VAL B N    2  
ATOM   5126  C  CA   . VAL B 1 51 ? 162.226 8.900   -2.954  1.00 0.00 ? 51  VAL B CA   2  
ATOM   5127  C  C    . VAL B 1 51 ? 162.168 10.086  -1.996  1.00 0.00 ? 51  VAL B C    2  
ATOM   5128  O  O    . VAL B 1 51 ? 161.701 9.949   -0.867  1.00 0.00 ? 51  VAL B O    2  
ATOM   5129  C  CB   . VAL B 1 51 ? 163.601 8.227   -2.830  1.00 0.00 ? 51  VAL B CB   2  
ATOM   5130  C  CG1  . VAL B 1 51 ? 163.732 7.102   -3.869  1.00 0.00 ? 51  VAL B CG1  2  
ATOM   5131  C  CG2  . VAL B 1 51 ? 164.713 9.275   -3.033  1.00 0.00 ? 51  VAL B CG2  2  
ATOM   5132  H  H    . VAL B 1 51 ? 162.633 9.118   -5.037  1.00 0.00 ? 51  VAL B H    2  
ATOM   5133  H  HA   . VAL B 1 51 ? 161.464 8.188   -2.674  1.00 0.00 ? 51  VAL B HA   2  
ATOM   5134  H  HB   . VAL B 1 51 ? 163.692 7.801   -1.840  1.00 0.00 ? 51  VAL B HB   2  
ATOM   5135  H  HG11 . VAL B 1 51 ? 163.465 6.160   -3.412  1.00 0.00 ? 51  VAL B HG11 2  
ATOM   5136  H  HG12 . VAL B 1 51 ? 164.752 7.050   -4.222  1.00 0.00 ? 51  VAL B HG12 2  
ATOM   5137  H  HG13 . VAL B 1 51 ? 163.075 7.295   -4.699  1.00 0.00 ? 51  VAL B HG13 2  
ATOM   5138  H  HG21 . VAL B 1 51 ? 165.070 9.606   -2.069  1.00 0.00 ? 51  VAL B HG21 2  
ATOM   5139  H  HG22 . VAL B 1 51 ? 164.324 10.121  -3.579  1.00 0.00 ? 51  VAL B HG22 2  
ATOM   5140  H  HG23 . VAL B 1 51 ? 165.532 8.835   -3.585  1.00 0.00 ? 51  VAL B HG23 2  
ATOM   5141  N  N    . ASP B 1 52 ? 162.619 11.254  -2.442  1.00 0.00 ? 52  ASP B N    2  
ATOM   5142  C  CA   . ASP B 1 52 ? 162.581 12.427  -1.576  1.00 0.00 ? 52  ASP B CA   2  
ATOM   5143  C  C    . ASP B 1 52 ? 161.143 12.735  -1.156  1.00 0.00 ? 52  ASP B C    2  
ATOM   5144  O  O    . ASP B 1 52 ? 160.889 13.184  -0.031  1.00 0.00 ? 52  ASP B O    2  
ATOM   5145  C  CB   . ASP B 1 52 ? 163.225 13.636  -2.273  1.00 0.00 ? 52  ASP B CB   2  
ATOM   5146  C  CG   . ASP B 1 52 ? 162.437 14.050  -3.516  1.00 0.00 ? 52  ASP B CG   2  
ATOM   5147  O  OD1  . ASP B 1 52 ? 161.324 13.586  -3.681  1.00 0.00 ? 52  ASP B OD1  2  
ATOM   5148  O  OD2  . ASP B 1 52 ? 162.965 14.831  -4.289  1.00 0.00 ? 52  ASP B OD2  2  
ATOM   5149  H  H    . ASP B 1 52 ? 162.969 11.332  -3.361  1.00 0.00 ? 52  ASP B H    2  
ATOM   5150  H  HA   . ASP B 1 52 ? 163.152 12.207  -0.684  1.00 0.00 ? 52  ASP B HA   2  
ATOM   5151  H  HB2  . ASP B 1 52 ? 163.255 14.466  -1.584  1.00 0.00 ? 52  ASP B HB2  2  
ATOM   5152  H  HB3  . ASP B 1 52 ? 164.234 13.381  -2.563  1.00 0.00 ? 52  ASP B HB3  2  
ATOM   5153  N  N    . ALA B 1 53 ? 160.206 12.452  -2.054  1.00 0.00 ? 53  ALA B N    2  
ATOM   5154  C  CA   . ALA B 1 53 ? 158.797 12.681  -1.784  1.00 0.00 ? 53  ALA B CA   2  
ATOM   5155  C  C    . ALA B 1 53 ? 158.385 11.925  -0.535  1.00 0.00 ? 53  ALA B C    2  
ATOM   5156  O  O    . ALA B 1 53 ? 157.448 12.322  0.169   1.00 0.00 ? 53  ALA B O    2  
ATOM   5157  C  CB   . ALA B 1 53 ? 157.951 12.215  -2.971  1.00 0.00 ? 53  ALA B CB   2  
ATOM   5158  H  H    . ALA B 1 53 ? 160.470 12.063  -2.919  1.00 0.00 ? 53  ALA B H    2  
ATOM   5159  H  HA   . ALA B 1 53 ? 158.633 13.736  -1.630  1.00 0.00 ? 53  ALA B HA   2  
ATOM   5160  H  HB1  . ALA B 1 53 ? 158.437 12.501  -3.893  1.00 0.00 ? 53  ALA B HB1  2  
ATOM   5161  H  HB2  . ALA B 1 53 ? 156.975 12.673  -2.920  1.00 0.00 ? 53  ALA B HB2  2  
ATOM   5162  H  HB3  . ALA B 1 53 ? 157.847 11.140  -2.939  1.00 0.00 ? 53  ALA B HB3  2  
ATOM   5163  N  N    . VAL B 1 54 ? 159.091 10.836  -0.253  1.00 0.00 ? 54  VAL B N    2  
ATOM   5164  C  CA   . VAL B 1 54 ? 158.771 10.057  0.922   1.00 0.00 ? 54  VAL B CA   2  
ATOM   5165  C  C    . VAL B 1 54 ? 158.811 10.962  2.142   1.00 0.00 ? 54  VAL B C    2  
ATOM   5166  O  O    . VAL B 1 54 ? 157.966 10.858  3.026   1.00 0.00 ? 54  VAL B O    2  
ATOM   5167  C  CB   . VAL B 1 54 ? 159.778 8.920   1.112   1.00 0.00 ? 54  VAL B CB   2  
ATOM   5168  C  CG1  . VAL B 1 54 ? 159.531 8.245   2.463   1.00 0.00 ? 54  VAL B CG1  2  
ATOM   5169  C  CG2  . VAL B 1 54 ? 159.618 7.890   -0.008  1.00 0.00 ? 54  VAL B CG2  2  
ATOM   5170  H  H    . VAL B 1 54 ? 159.833 10.562  -0.837  1.00 0.00 ? 54  VAL B H    2  
ATOM   5171  H  HA   . VAL B 1 54 ? 157.783 9.640   0.814   1.00 0.00 ? 54  VAL B HA   2  
ATOM   5172  H  HB   . VAL B 1 54 ? 160.779 9.322   1.097   1.00 0.00 ? 54  VAL B HB   2  
ATOM   5173  H  HG11 . VAL B 1 54 ? 158.477 8.033   2.572   1.00 0.00 ? 54  VAL B HG11 2  
ATOM   5174  H  HG12 . VAL B 1 54 ? 159.850 8.903   3.257   1.00 0.00 ? 54  VAL B HG12 2  
ATOM   5175  H  HG13 . VAL B 1 54 ? 160.091 7.323   2.512   1.00 0.00 ? 54  VAL B HG13 2  
ATOM   5176  H  HG21 . VAL B 1 54 ? 159.896 8.336   -0.951  1.00 0.00 ? 54  VAL B HG21 2  
ATOM   5177  H  HG22 . VAL B 1 54 ? 158.590 7.563   -0.053  1.00 0.00 ? 54  VAL B HG22 2  
ATOM   5178  H  HG23 . VAL B 1 54 ? 160.257 7.041   0.191   1.00 0.00 ? 54  VAL B HG23 2  
ATOM   5179  N  N    . ASP B 1 55 ? 159.793 11.862  2.196   1.00 0.00 ? 55  ASP B N    2  
ATOM   5180  C  CA   . ASP B 1 55 ? 159.878 12.761  3.337   1.00 0.00 ? 55  ASP B CA   2  
ATOM   5181  C  C    . ASP B 1 55 ? 158.652 13.671  3.415   1.00 0.00 ? 55  ASP B C    2  
ATOM   5182  O  O    . ASP B 1 55 ? 158.112 13.915  4.494   1.00 0.00 ? 55  ASP B O    2  
ATOM   5183  C  CB   . ASP B 1 55 ? 161.139 13.622  3.225   1.00 0.00 ? 55  ASP B CB   2  
ATOM   5184  C  CG   . ASP B 1 55 ? 162.381 12.748  3.358   1.00 0.00 ? 55  ASP B CG   2  
ATOM   5185  O  OD1  . ASP B 1 55 ? 162.237 11.605  3.757   1.00 0.00 ? 55  ASP B OD1  2  
ATOM   5186  O  OD2  . ASP B 1 55 ? 163.459 13.235  3.057   1.00 0.00 ? 55  ASP B OD2  2  
ATOM   5187  H  H    . ASP B 1 55 ? 160.449 11.931  1.458   1.00 0.00 ? 55  ASP B H    2  
ATOM   5188  H  HA   . ASP B 1 55 ? 159.938 12.176  4.241   1.00 0.00 ? 55  ASP B HA   2  
ATOM   5189  H  HB2  . ASP B 1 55 ? 161.150 14.117  2.264   1.00 0.00 ? 55  ASP B HB2  2  
ATOM   5190  H  HB3  . ASP B 1 55 ? 161.138 14.363  4.010   1.00 0.00 ? 55  ASP B HB3  2  
ATOM   5191  N  N    . LYS B 1 56 ? 158.234 14.184  2.260   1.00 0.00 ? 56  LYS B N    2  
ATOM   5192  C  CA   . LYS B 1 56 ? 157.086 15.089  2.192   1.00 0.00 ? 56  LYS B CA   2  
ATOM   5193  C  C    . LYS B 1 56 ? 155.763 14.445  2.612   1.00 0.00 ? 56  LYS B C    2  
ATOM   5194  O  O    . LYS B 1 56 ? 154.942 15.087  3.269   1.00 0.00 ? 56  LYS B O    2  
ATOM   5195  C  CB   . LYS B 1 56 ? 156.943 15.629  0.769   1.00 0.00 ? 56  LYS B CB   2  
ATOM   5196  C  CG   . LYS B 1 56 ? 158.164 16.482  0.420   1.00 0.00 ? 56  LYS B CG   2  
ATOM   5197  C  CD   . LYS B 1 56 ? 157.967 17.115  -0.959  1.00 0.00 ? 56  LYS B CD   2  
ATOM   5198  C  CE   . LYS B 1 56 ? 159.234 17.872  -1.360  1.00 0.00 ? 56  LYS B CE   2  
ATOM   5199  N  NZ   . LYS B 1 56 ? 159.072 18.420  -2.736  1.00 0.00 ? 56  LYS B NZ   2  
ATOM   5200  H  H    . LYS B 1 56 ? 158.716 13.963  1.436   1.00 0.00 ? 56  LYS B H    2  
ATOM   5201  H  HA   . LYS B 1 56 ? 157.277 15.926  2.846   1.00 0.00 ? 56  LYS B HA   2  
ATOM   5202  H  HB2  . LYS B 1 56 ? 156.872 14.802  0.077   1.00 0.00 ? 56  LYS B HB2  2  
ATOM   5203  H  HB3  . LYS B 1 56 ? 156.053 16.234  0.701   1.00 0.00 ? 56  LYS B HB3  2  
ATOM   5204  H  HG2  . LYS B 1 56 ? 158.283 17.259  1.161   1.00 0.00 ? 56  LYS B HG2  2  
ATOM   5205  H  HG3  . LYS B 1 56 ? 159.046 15.859  0.405   1.00 0.00 ? 56  LYS B HG3  2  
ATOM   5206  H  HD2  . LYS B 1 56 ? 157.763 16.341  -1.684  1.00 0.00 ? 56  LYS B HD2  2  
ATOM   5207  H  HD3  . LYS B 1 56 ? 157.135 17.803  -0.923  1.00 0.00 ? 56  LYS B HD3  2  
ATOM   5208  H  HE2  . LYS B 1 56 ? 159.404 18.683  -0.667  1.00 0.00 ? 56  LYS B HE2  2  
ATOM   5209  H  HE3  . LYS B 1 56 ? 160.077 17.198  -1.338  1.00 0.00 ? 56  LYS B HE3  2  
ATOM   5210  H  HZ1  . LYS B 1 56 ? 159.637 17.858  -3.402  1.00 0.00 ? 56  LYS B HZ1  2  
ATOM   5211  H  HZ2  . LYS B 1 56 ? 159.394 19.409  -2.755  1.00 0.00 ? 56  LYS B HZ2  2  
ATOM   5212  H  HZ3  . LYS B 1 56 ? 158.070 18.376  -3.011  1.00 0.00 ? 56  LYS B HZ3  2  
ATOM   5213  N  N    . VAL B 1 57 ? 155.529 13.203  2.193   1.00 0.00 ? 57  VAL B N    2  
ATOM   5214  C  CA   . VAL B 1 57 ? 154.255 12.546  2.510   1.00 0.00 ? 57  VAL B CA   2  
ATOM   5215  C  C    . VAL B 1 57 ? 154.136 12.113  3.970   1.00 0.00 ? 57  VAL B C    2  
ATOM   5216  O  O    . VAL B 1 57 ? 153.043 12.136  4.529   1.00 0.00 ? 57  VAL B O    2  
ATOM   5217  C  CB   . VAL B 1 57 ? 154.040 11.332  1.604   1.00 0.00 ? 57  VAL B CB   2  
ATOM   5218  C  CG1  . VAL B 1 57 ? 154.153 11.757  0.139   1.00 0.00 ? 57  VAL B CG1  2  
ATOM   5219  C  CG2  . VAL B 1 57 ? 155.097 10.274  1.911   1.00 0.00 ? 57  VAL B CG2  2  
ATOM   5220  H  H    . VAL B 1 57 ? 156.197 12.740  1.635   1.00 0.00 ? 57  VAL B H    2  
ATOM   5221  H  HA   . VAL B 1 57 ? 153.459 13.250  2.309   1.00 0.00 ? 57  VAL B HA   2  
ATOM   5222  H  HB   . VAL B 1 57 ? 153.057 10.922  1.783   1.00 0.00 ? 57  VAL B HB   2  
ATOM   5223  H  HG11 . VAL B 1 57 ? 154.090 10.884  -0.494  1.00 0.00 ? 57  VAL B HG11 2  
ATOM   5224  H  HG12 . VAL B 1 57 ? 155.101 12.249  -0.022  1.00 0.00 ? 57  VAL B HG12 2  
ATOM   5225  H  HG13 . VAL B 1 57 ? 153.349 12.436  -0.102  1.00 0.00 ? 57  VAL B HG13 2  
ATOM   5226  H  HG21 . VAL B 1 57 ? 154.968 9.918   2.923   1.00 0.00 ? 57  VAL B HG21 2  
ATOM   5227  H  HG22 . VAL B 1 57 ? 156.073 10.709  1.805   1.00 0.00 ? 57  VAL B HG22 2  
ATOM   5228  H  HG23 . VAL B 1 57 ? 154.992 9.449   1.222   1.00 0.00 ? 57  VAL B HG23 2  
ATOM   5229  N  N    . MET B 1 58 ? 155.235 11.708  4.593   1.00 0.00 ? 58  MET B N    2  
ATOM   5230  C  CA   . MET B 1 58 ? 155.156 11.261  5.982   1.00 0.00 ? 58  MET B CA   2  
ATOM   5231  C  C    . MET B 1 58 ? 154.599 12.345  6.892   1.00 0.00 ? 58  MET B C    2  
ATOM   5232  O  O    . MET B 1 58 ? 153.826 12.055  7.806   1.00 0.00 ? 58  MET B O    2  
ATOM   5233  C  CB   . MET B 1 58 ? 156.545 10.847  6.477   1.00 0.00 ? 58  MET B CB   2  
ATOM   5234  C  CG   . MET B 1 58 ? 156.995 9.568   5.765   1.00 0.00 ? 58  MET B CG   2  
ATOM   5235  S  SD   . MET B 1 58 ? 155.900 8.197   6.203   1.00 0.00 ? 58  MET B SD   2  
ATOM   5236  C  CE   . MET B 1 58 ? 156.343 8.108   7.957   1.00 0.00 ? 58  MET B CE   2  
ATOM   5237  H  H    . MET B 1 58 ? 156.092 11.691  4.117   1.00 0.00 ? 58  MET B H    2  
ATOM   5238  H  HA   . MET B 1 58 ? 154.503 10.402  6.030   1.00 0.00 ? 58  MET B HA   2  
ATOM   5239  H  HB2  . MET B 1 58 ? 157.249 11.640  6.269   1.00 0.00 ? 58  MET B HB2  2  
ATOM   5240  H  HB3  . MET B 1 58 ? 156.507 10.673  7.541   1.00 0.00 ? 58  MET B HB3  2  
ATOM   5241  H  HG2  . MET B 1 58 ? 156.958 9.720   4.701   1.00 0.00 ? 58  MET B HG2  2  
ATOM   5242  H  HG3  . MET B 1 58 ? 158.004 9.329   6.060   1.00 0.00 ? 58  MET B HG3  2  
ATOM   5243  H  HE1  . MET B 1 58 ? 156.464 7.073   8.241   1.00 0.00 ? 58  MET B HE1  2  
ATOM   5244  H  HE2  . MET B 1 58 ? 155.563 8.555   8.553   1.00 0.00 ? 58  MET B HE2  2  
ATOM   5245  H  HE3  . MET B 1 58 ? 157.269 8.640   8.123   1.00 0.00 ? 58  MET B HE3  2  
ATOM   5246  N  N    . LYS B 1 59 ? 154.975 13.594  6.647   1.00 0.00 ? 59  LYS B N    2  
ATOM   5247  C  CA   . LYS B 1 59 ? 154.473 14.677  7.477   1.00 0.00 ? 59  LYS B CA   2  
ATOM   5248  C  C    . LYS B 1 59 ? 152.953 14.781  7.378   1.00 0.00 ? 59  LYS B C    2  
ATOM   5249  O  O    . LYS B 1 59 ? 152.266 14.937  8.388   1.00 0.00 ? 59  LYS B O    2  
ATOM   5250  C  CB   . LYS B 1 59 ? 155.103 16.002  7.042   1.00 0.00 ? 59  LYS B CB   2  
ATOM   5251  C  CG   . LYS B 1 59 ? 154.674 17.112  8.004   1.00 0.00 ? 59  LYS B CG   2  
ATOM   5252  C  CD   . LYS B 1 59 ? 155.250 18.446  7.533   1.00 0.00 ? 59  LYS B CD   2  
ATOM   5253  C  CE   . LYS B 1 59 ? 154.958 19.526  8.575   1.00 0.00 ? 59  LYS B CE   2  
ATOM   5254  N  NZ   . LYS B 1 59 ? 155.398 20.852  8.055   1.00 0.00 ? 59  LYS B NZ   2  
ATOM   5255  H  H    . LYS B 1 59 ? 155.588 13.786  5.907   1.00 0.00 ? 59  LYS B H    2  
ATOM   5256  H  HA   . LYS B 1 59 ? 154.744 14.485  8.503   1.00 0.00 ? 59  LYS B HA   2  
ATOM   5257  H  HB2  . LYS B 1 59 ? 156.179 15.909  7.054   1.00 0.00 ? 59  LYS B HB2  2  
ATOM   5258  H  HB3  . LYS B 1 59 ? 154.774 16.247  6.044   1.00 0.00 ? 59  LYS B HB3  2  
ATOM   5259  H  HG2  . LYS B 1 59 ? 153.596 17.171  8.027   1.00 0.00 ? 59  LYS B HG2  2  
ATOM   5260  H  HG3  . LYS B 1 59 ? 155.043 16.892  8.995   1.00 0.00 ? 59  LYS B HG3  2  
ATOM   5261  H  HD2  . LYS B 1 59 ? 156.318 18.351  7.402   1.00 0.00 ? 59  LYS B HD2  2  
ATOM   5262  H  HD3  . LYS B 1 59 ? 154.795 18.724  6.594   1.00 0.00 ? 59  LYS B HD3  2  
ATOM   5263  H  HE2  . LYS B 1 59 ? 153.897 19.554  8.778   1.00 0.00 ? 59  LYS B HE2  2  
ATOM   5264  H  HE3  . LYS B 1 59 ? 155.492 19.302  9.487   1.00 0.00 ? 59  LYS B HE3  2  
ATOM   5265  H  HZ1  . LYS B 1 59 ? 156.395 21.008  8.306   1.00 0.00 ? 59  LYS B HZ1  2  
ATOM   5266  H  HZ2  . LYS B 1 59 ? 154.812 21.601  8.476   1.00 0.00 ? 59  LYS B HZ2  2  
ATOM   5267  H  HZ3  . LYS B 1 59 ? 155.296 20.869  7.021   1.00 0.00 ? 59  LYS B HZ3  2  
ATOM   5268  N  N    . GLU B 1 60 ? 152.436 14.700  6.153   1.00 0.00 ? 60  GLU B N    2  
ATOM   5269  C  CA   . GLU B 1 60 ? 150.996 14.795  5.936   1.00 0.00 ? 60  GLU B CA   2  
ATOM   5270  C  C    . GLU B 1 60 ? 150.244 13.588  6.496   1.00 0.00 ? 60  GLU B C    2  
ATOM   5271  O  O    . GLU B 1 60 ? 149.189 13.736  7.112   1.00 0.00 ? 60  GLU B O    2  
ATOM   5272  C  CB   . GLU B 1 60 ? 150.719 14.915  4.435   1.00 0.00 ? 60  GLU B CB   2  
ATOM   5273  C  CG   . GLU B 1 60 ? 149.226 15.150  4.202   1.00 0.00 ? 60  GLU B CG   2  
ATOM   5274  C  CD   . GLU B 1 60 ? 148.928 15.172  2.708   1.00 0.00 ? 60  GLU B CD   2  
ATOM   5275  O  OE1  . GLU B 1 60 ? 149.855 14.987  1.937   1.00 0.00 ? 60  GLU B OE1  2  
ATOM   5276  O  OE2  . GLU B 1 60 ? 147.778 15.375  2.355   1.00 0.00 ? 60  GLU B OE2  2  
ATOM   5277  H  H    . GLU B 1 60 ? 153.033 14.581  5.385   1.00 0.00 ? 60  GLU B H    2  
ATOM   5278  H  HA   . GLU B 1 60 ? 150.631 15.685  6.422   1.00 0.00 ? 60  GLU B HA   2  
ATOM   5279  H  HB2  . GLU B 1 60 ? 151.281 15.745  4.032   1.00 0.00 ? 60  GLU B HB2  2  
ATOM   5280  H  HB3  . GLU B 1 60 ? 151.018 14.003  3.940   1.00 0.00 ? 60  GLU B HB3  2  
ATOM   5281  H  HG2  . GLU B 1 60 ? 148.662 14.355  4.667   1.00 0.00 ? 60  GLU B HG2  2  
ATOM   5282  H  HG3  . GLU B 1 60 ? 148.939 16.095  4.638   1.00 0.00 ? 60  GLU B HG3  2  
ATOM   5283  N  N    . LEU B 1 61 ? 150.783 12.394  6.262   1.00 0.00 ? 61  LEU B N    2  
ATOM   5284  C  CA   . LEU B 1 61 ? 150.137 11.172  6.736   1.00 0.00 ? 61  LEU B CA   2  
ATOM   5285  C  C    . LEU B 1 61 ? 150.135 11.064  8.254   1.00 0.00 ? 61  LEU B C    2  
ATOM   5286  O  O    . LEU B 1 61 ? 149.170 10.579  8.842   1.00 0.00 ? 61  LEU B O    2  
ATOM   5287  C  CB   . LEU B 1 61 ? 150.831 9.949   6.131   1.00 0.00 ? 61  LEU B CB   2  
ATOM   5288  C  CG   . LEU B 1 61 ? 150.731 9.998   4.603   1.00 0.00 ? 61  LEU B CG   2  
ATOM   5289  C  CD1  . LEU B 1 61 ? 151.415 8.769   4.011   1.00 0.00 ? 61  LEU B CD1  2  
ATOM   5290  C  CD2  . LEU B 1 61 ? 149.258 10.004  4.179   1.00 0.00 ? 61  LEU B CD2  2  
ATOM   5291  H  H    . LEU B 1 61 ? 151.619 12.331  5.755   1.00 0.00 ? 61  LEU B H    2  
ATOM   5292  H  HA   . LEU B 1 61 ? 149.112 11.179  6.403   1.00 0.00 ? 61  LEU B HA   2  
ATOM   5293  H  HB2  . LEU B 1 61 ? 151.870 9.945   6.424   1.00 0.00 ? 61  LEU B HB2  2  
ATOM   5294  H  HB3  . LEU B 1 61 ? 150.353 9.050   6.492   1.00 0.00 ? 61  LEU B HB3  2  
ATOM   5295  H  HG   . LEU B 1 61 ? 151.210 10.887  4.238   1.00 0.00 ? 61  LEU B HG   2  
ATOM   5296  H  HD11 . LEU B 1 61 ? 151.152 7.898   4.589   1.00 0.00 ? 61  LEU B HD11 2  
ATOM   5297  H  HD12 . LEU B 1 61 ? 152.487 8.907   4.033   1.00 0.00 ? 61  LEU B HD12 2  
ATOM   5298  H  HD13 . LEU B 1 61 ? 151.091 8.635   2.989   1.00 0.00 ? 61  LEU B HD13 2  
ATOM   5299  H  HD21 . LEU B 1 61 ? 149.161 9.560   3.199   1.00 0.00 ? 61  LEU B HD21 2  
ATOM   5300  H  HD22 . LEU B 1 61 ? 148.898 11.020  4.149   1.00 0.00 ? 61  LEU B HD22 2  
ATOM   5301  H  HD23 . LEU B 1 61 ? 148.676 9.435   4.890   1.00 0.00 ? 61  LEU B HD23 2  
ATOM   5302  N  N    . ASP B 1 62 ? 151.216 11.498  8.891   1.00 0.00 ? 62  ASP B N    2  
ATOM   5303  C  CA   . ASP B 1 62 ? 151.286 11.409  10.343  1.00 0.00 ? 62  ASP B CA   2  
ATOM   5304  C  C    . ASP B 1 62 ? 150.686 12.639  11.006  1.00 0.00 ? 62  ASP B C    2  
ATOM   5305  O  O    . ASP B 1 62 ? 151.317 13.694  11.058  1.00 0.00 ? 62  ASP B O    2  
ATOM   5306  C  CB   . ASP B 1 62 ? 152.744 11.275  10.776  1.00 0.00 ? 62  ASP B CB   2  
ATOM   5307  C  CG   . ASP B 1 62 ? 152.823 11.058  12.280  1.00 0.00 ? 62  ASP B CG   2  
ATOM   5308  O  OD1  . ASP B 1 62 ? 151.829 10.640  12.853  1.00 0.00 ? 62  ASP B OD1  2  
ATOM   5309  O  OD2  . ASP B 1 62 ? 153.868 11.332  12.840  1.00 0.00 ? 62  ASP B OD2  2  
ATOM   5310  H  H    . ASP B 1 62 ? 151.970 11.869  8.385   1.00 0.00 ? 62  ASP B H    2  
ATOM   5311  H  HA   . ASP B 1 62 ? 150.746 10.534  10.669  1.00 0.00 ? 62  ASP B HA   2  
ATOM   5312  H  HB2  . ASP B 1 62 ? 153.192 10.434  10.267  1.00 0.00 ? 62  ASP B HB2  2  
ATOM   5313  H  HB3  . ASP B 1 62 ? 153.279 12.177  10.517  1.00 0.00 ? 62  ASP B HB3  2  
ATOM   5314  N  N    . GLU B 1 63 ? 149.489 12.491  11.559  1.00 0.00 ? 63  GLU B N    2  
ATOM   5315  C  CA   . GLU B 1 63 ? 148.861 13.596  12.263  1.00 0.00 ? 63  GLU B CA   2  
ATOM   5316  C  C    . GLU B 1 63 ? 149.632 13.890  13.545  1.00 0.00 ? 63  GLU B C    2  
ATOM   5317  O  O    . GLU B 1 63 ? 149.745 15.037  13.978  1.00 0.00 ? 63  GLU B O    2  
ATOM   5318  C  CB   . GLU B 1 63 ? 147.408 13.251  12.601  1.00 0.00 ? 63  GLU B CB   2  
ATOM   5319  C  CG   . GLU B 1 63 ? 146.609 13.083  11.307  1.00 0.00 ? 63  GLU B CG   2  
ATOM   5320  C  CD   . GLU B 1 63 ? 146.788 11.673  10.754  1.00 0.00 ? 63  GLU B CD   2  
ATOM   5321  O  OE1  . GLU B 1 63 ? 147.431 10.874  11.413  1.00 0.00 ? 63  GLU B OE1  2  
ATOM   5322  O  OE2  . GLU B 1 63 ? 146.279 11.412  9.675   1.00 0.00 ? 63  GLU B OE2  2  
ATOM   5323  H  H    . GLU B 1 63 ? 149.041 11.619  11.522  1.00 0.00 ? 63  GLU B H    2  
ATOM   5324  H  HA   . GLU B 1 63 ? 148.876 14.473  11.632  1.00 0.00 ? 63  GLU B HA   2  
ATOM   5325  H  HB2  . GLU B 1 63 ? 147.379 12.332  13.168  1.00 0.00 ? 63  GLU B HB2  2  
ATOM   5326  H  HB3  . GLU B 1 63 ? 146.977 14.049  13.188  1.00 0.00 ? 63  GLU B HB3  2  
ATOM   5327  H  HG2  . GLU B 1 63 ? 145.561 13.258  11.509  1.00 0.00 ? 63  GLU B HG2  2  
ATOM   5328  H  HG3  . GLU B 1 63 ? 146.954 13.800  10.577  1.00 0.00 ? 63  GLU B HG3  2  
ATOM   5329  N  N    . ASN B 1 64 ? 150.138 12.819  14.155  1.00 0.00 ? 64  ASN B N    2  
ATOM   5330  C  CA   . ASN B 1 64 ? 150.881 12.917  15.406  1.00 0.00 ? 64  ASN B CA   2  
ATOM   5331  C  C    . ASN B 1 64 ? 152.112 13.805  15.274  1.00 0.00 ? 64  ASN B C    2  
ATOM   5332  O  O    . ASN B 1 64 ? 152.470 14.532  16.201  1.00 0.00 ? 64  ASN B O    2  
ATOM   5333  C  CB   . ASN B 1 64 ? 151.362 11.521  15.810  1.00 0.00 ? 64  ASN B CB   2  
ATOM   5334  C  CG   . ASN B 1 64 ? 150.189 10.553  15.905  1.00 0.00 ? 64  ASN B CG   2  
ATOM   5335  O  OD1  . ASN B 1 64 ? 150.265 9.443   15.371  1.00 0.00 ? 64  ASN B OD1  2  
ATOM   5336  N  ND2  . ASN B 1 64 ? 149.109 10.903  16.549  1.00 0.00 ? 64  ASN B ND2  2  
ATOM   5337  H  H    . ASN B 1 64 ? 149.990 11.935  13.758  1.00 0.00 ? 64  ASN B H    2  
ATOM   5338  H  HA   . ASN B 1 64 ? 150.238 13.303  16.180  1.00 0.00 ? 64  ASN B HA   2  
ATOM   5339  H  HB2  . ASN B 1 64 ? 152.064 11.159  15.075  1.00 0.00 ? 64  ASN B HB2  2  
ATOM   5340  H  HB3  . ASN B 1 64 ? 151.853 11.579  16.772  1.00 0.00 ? 64  ASN B HB3  2  
ATOM   5341  H  HD21 . ASN B 1 64 ? 149.055 11.787  16.970  1.00 0.00 ? 64  ASN B HD21 2  
ATOM   5342  H  HD22 . ASN B 1 64 ? 148.354 10.283  16.612  1.00 0.00 ? 64  ASN B HD22 2  
ATOM   5343  N  N    . GLY B 1 65 ? 152.783 13.702  14.134  1.00 0.00 ? 65  GLY B N    2  
ATOM   5344  C  CA   . GLY B 1 65 ? 154.007 14.459  13.912  1.00 0.00 ? 65  GLY B CA   2  
ATOM   5345  C  C    . GLY B 1 65 ? 155.148 13.727  14.611  1.00 0.00 ? 65  GLY B C    2  
ATOM   5346  O  O    . GLY B 1 65 ? 156.271 14.220  14.709  1.00 0.00 ? 65  GLY B O    2  
ATOM   5347  H  H    . GLY B 1 65 ? 152.471 13.080  13.445  1.00 0.00 ? 65  GLY B H    2  
ATOM   5348  H  HA2  . GLY B 1 65 ? 154.207 14.527  12.851  1.00 0.00 ? 65  GLY B HA2  2  
ATOM   5349  H  HA3  . GLY B 1 65 ? 153.907 15.449  14.330  1.00 0.00 ? 65  GLY B HA3  2  
ATOM   5350  N  N    . ASP B 1 66 ? 154.808 12.540  15.111  1.00 0.00 ? 66  ASP B N    2  
ATOM   5351  C  CA   . ASP B 1 66 ? 155.744 11.686  15.837  1.00 0.00 ? 66  ASP B CA   2  
ATOM   5352  C  C    . ASP B 1 66 ? 156.921 11.219  14.977  1.00 0.00 ? 66  ASP B C    2  
ATOM   5353  O  O    . ASP B 1 66 ? 158.028 11.034  15.481  1.00 0.00 ? 66  ASP B O    2  
ATOM   5354  C  CB   . ASP B 1 66 ? 154.971 10.482  16.408  1.00 0.00 ? 66  ASP B CB   2  
ATOM   5355  C  CG   . ASP B 1 66 ? 154.382 9.619   15.286  1.00 0.00 ? 66  ASP B CG   2  
ATOM   5356  O  OD1  . ASP B 1 66 ? 154.811 9.762   14.160  1.00 0.00 ? 66  ASP B OD1  2  
ATOM   5357  O  OD2  . ASP B 1 66 ? 153.500 8.824   15.573  1.00 0.00 ? 66  ASP B OD2  2  
ATOM   5358  H  H    . ASP B 1 66 ? 153.885 12.233  14.999  1.00 0.00 ? 66  ASP B H    2  
ATOM   5359  H  HA   . ASP B 1 66 ? 156.138 12.249  16.668  1.00 0.00 ? 66  ASP B HA   2  
ATOM   5360  H  HB2  . ASP B 1 66 ? 155.643 9.880   17.001  1.00 0.00 ? 66  ASP B HB2  2  
ATOM   5361  H  HB3  . ASP B 1 66 ? 154.170 10.842  17.036  1.00 0.00 ? 66  ASP B HB3  2  
ATOM   5362  N  N    . GLY B 1 67 ? 156.674 11.004  13.693  1.00 0.00 ? 67  GLY B N    2  
ATOM   5363  C  CA   . GLY B 1 67 ? 157.716 10.528  12.789  1.00 0.00 ? 67  GLY B CA   2  
ATOM   5364  C  C    . GLY B 1 67 ? 157.618 9.014   12.666  1.00 0.00 ? 67  GLY B C    2  
ATOM   5365  O  O    . GLY B 1 67 ? 158.308 8.387   11.863  1.00 0.00 ? 67  GLY B O    2  
ATOM   5366  H  H    . GLY B 1 67 ? 155.768 11.148  13.349  1.00 0.00 ? 67  GLY B H    2  
ATOM   5367  H  HA2  . GLY B 1 67 ? 157.583 10.982  11.816  1.00 0.00 ? 67  GLY B HA2  2  
ATOM   5368  H  HA3  . GLY B 1 67 ? 158.685 10.791  13.182  1.00 0.00 ? 67  GLY B HA3  2  
ATOM   5369  N  N    . GLU B 1 68 ? 156.718 8.450   13.464  1.00 0.00 ? 68  GLU B N    2  
ATOM   5370  C  CA   . GLU B 1 68 ? 156.460 7.017   13.461  1.00 0.00 ? 68  GLU B CA   2  
ATOM   5371  C  C    . GLU B 1 68 ? 155.063 6.783   12.913  1.00 0.00 ? 68  GLU B C    2  
ATOM   5372  O  O    . GLU B 1 68 ? 154.207 7.673   12.989  1.00 0.00 ? 68  GLU B O    2  
ATOM   5373  C  CB   . GLU B 1 68 ? 156.560 6.451   14.881  1.00 0.00 ? 68  GLU B CB   2  
ATOM   5374  C  CG   . GLU B 1 68 ? 157.972 6.671   15.426  1.00 0.00 ? 68  GLU B CG   2  
ATOM   5375  C  CD   . GLU B 1 68 ? 158.099 6.051   16.813  1.00 0.00 ? 68  GLU B CD   2  
ATOM   5376  O  OE1  . GLU B 1 68 ? 157.083 5.643   17.353  1.00 0.00 ? 68  GLU B OE1  2  
ATOM   5377  O  OE2  . GLU B 1 68 ? 159.209 5.994   17.316  1.00 0.00 ? 68  GLU B OE2  2  
ATOM   5378  H  H    . GLU B 1 68 ? 156.194 9.021   14.061  1.00 0.00 ? 68  GLU B H    2  
ATOM   5379  H  HA   . GLU B 1 68 ? 157.181 6.522   12.827  1.00 0.00 ? 68  GLU B HA   2  
ATOM   5380  H  HB2  . GLU B 1 68 ? 155.846 6.952   15.519  1.00 0.00 ? 68  GLU B HB2  2  
ATOM   5381  H  HB3  . GLU B 1 68 ? 156.345 5.393   14.864  1.00 0.00 ? 68  GLU B HB3  2  
ATOM   5382  H  HG2  . GLU B 1 68 ? 158.687 6.208   14.762  1.00 0.00 ? 68  GLU B HG2  2  
ATOM   5383  H  HG3  . GLU B 1 68 ? 158.173 7.731   15.487  1.00 0.00 ? 68  GLU B HG3  2  
ATOM   5384  N  N    . VAL B 1 69 ? 154.821 5.604   12.346  1.00 0.00 ? 69  VAL B N    2  
ATOM   5385  C  CA   . VAL B 1 69 ? 153.507 5.326   11.776  1.00 0.00 ? 69  VAL B CA   2  
ATOM   5386  C  C    . VAL B 1 69 ? 152.879 4.070   12.356  1.00 0.00 ? 69  VAL B C    2  
ATOM   5387  O  O    . VAL B 1 69 ? 153.559 3.118   12.737  1.00 0.00 ? 69  VAL B O    2  
ATOM   5388  C  CB   . VAL B 1 69 ? 153.630 5.173   10.258  1.00 0.00 ? 69  VAL B CB   2  
ATOM   5389  C  CG1  . VAL B 1 69 ? 154.271 6.429   9.666   1.00 0.00 ? 69  VAL B CG1  2  
ATOM   5390  C  CG2  . VAL B 1 69 ? 154.490 3.950   9.928   1.00 0.00 ? 69  VAL B CG2  2  
ATOM   5391  H  H    . VAL B 1 69 ? 155.530 4.929   12.296  1.00 0.00 ? 69  VAL B H    2  
ATOM   5392  H  HA   . VAL B 1 69 ? 152.852 6.153   11.981  1.00 0.00 ? 69  VAL B HA   2  
ATOM   5393  H  HB   . VAL B 1 69 ? 152.650 5.043   9.831   1.00 0.00 ? 69  VAL B HB   2  
ATOM   5394  H  HG11 . VAL B 1 69 ? 154.353 6.319   8.593   1.00 0.00 ? 69  VAL B HG11 2  
ATOM   5395  H  HG12 . VAL B 1 69 ? 155.253 6.565   10.092  1.00 0.00 ? 69  VAL B HG12 2  
ATOM   5396  H  HG13 . VAL B 1 69 ? 153.658 7.288   9.892   1.00 0.00 ? 69  VAL B HG13 2  
ATOM   5397  H  HG21 . VAL B 1 69 ? 153.863 3.069   9.899   1.00 0.00 ? 69  VAL B HG21 2  
ATOM   5398  H  HG22 . VAL B 1 69 ? 155.249 3.827   10.686  1.00 0.00 ? 69  VAL B HG22 2  
ATOM   5399  H  HG23 . VAL B 1 69 ? 154.960 4.088   8.965   1.00 0.00 ? 69  VAL B HG23 2  
ATOM   5400  N  N    . ASP B 1 70 ? 151.555 4.096   12.384  1.00 0.00 ? 70  ASP B N    2  
ATOM   5401  C  CA   . ASP B 1 70 ? 150.753 2.991   12.877  1.00 0.00 ? 70  ASP B CA   2  
ATOM   5402  C  C    . ASP B 1 70 ? 150.145 2.267   11.687  1.00 0.00 ? 70  ASP B C    2  
ATOM   5403  O  O    . ASP B 1 70 ? 150.122 2.806   10.582  1.00 0.00 ? 70  ASP B O    2  
ATOM   5404  C  CB   . ASP B 1 70 ? 149.643 3.506   13.794  1.00 0.00 ? 70  ASP B CB   2  
ATOM   5405  C  CG   . ASP B 1 70 ? 150.248 4.115   15.055  1.00 0.00 ? 70  ASP B CG   2  
ATOM   5406  O  OD1  . ASP B 1 70 ? 151.427 3.897   15.287  1.00 0.00 ? 70  ASP B OD1  2  
ATOM   5407  O  OD2  . ASP B 1 70 ? 149.525 4.790   15.769  1.00 0.00 ? 70  ASP B OD2  2  
ATOM   5408  H  H    . ASP B 1 70 ? 151.095 4.893   12.044  1.00 0.00 ? 70  ASP B H    2  
ATOM   5409  H  HA   . ASP B 1 70 ? 151.384 2.308   13.426  1.00 0.00 ? 70  ASP B HA   2  
ATOM   5410  H  HB2  . ASP B 1 70 ? 149.068 4.258   13.274  1.00 0.00 ? 70  ASP B HB2  2  
ATOM   5411  H  HB3  . ASP B 1 70 ? 148.996 2.687   14.069  1.00 0.00 ? 70  ASP B HB3  2  
ATOM   5412  N  N    . PHE B 1 71 ? 149.659 1.055   11.895  1.00 0.00 ? 71  PHE B N    2  
ATOM   5413  C  CA   . PHE B 1 71 ? 149.074 0.323   10.788  1.00 0.00 ? 71  PHE B CA   2  
ATOM   5414  C  C    . PHE B 1 71 ? 148.037 1.193   10.089  1.00 0.00 ? 71  PHE B C    2  
ATOM   5415  O  O    . PHE B 1 71 ? 147.966 1.214   8.860   1.00 0.00 ? 71  PHE B O    2  
ATOM   5416  C  CB   . PHE B 1 71 ? 148.410 -0.963  11.287  1.00 0.00 ? 71  PHE B CB   2  
ATOM   5417  C  CG   . PHE B 1 71 ? 147.894 -1.749  10.104  1.00 0.00 ? 71  PHE B CG   2  
ATOM   5418  C  CD1  . PHE B 1 71 ? 148.752 -2.589  9.385   1.00 0.00 ? 71  PHE B CD1  2  
ATOM   5419  C  CD2  . PHE B 1 71 ? 146.550 -1.632  9.726   1.00 0.00 ? 71  PHE B CD2  2  
ATOM   5420  C  CE1  . PHE B 1 71 ? 148.266 -3.312  8.288   1.00 0.00 ? 71  PHE B CE1  2  
ATOM   5421  C  CE2  . PHE B 1 71 ? 146.066 -2.355  8.631   1.00 0.00 ? 71  PHE B CE2  2  
ATOM   5422  C  CZ   . PHE B 1 71 ? 146.923 -3.195  7.911   1.00 0.00 ? 71  PHE B CZ   2  
ATOM   5423  H  H    . PHE B 1 71 ? 149.697 0.653   12.788  1.00 0.00 ? 71  PHE B H    2  
ATOM   5424  H  HA   . PHE B 1 71 ? 149.851 0.066   10.084  1.00 0.00 ? 71  PHE B HA   2  
ATOM   5425  H  HB2  . PHE B 1 71 ? 149.133 -1.556  11.827  1.00 0.00 ? 71  PHE B HB2  2  
ATOM   5426  H  HB3  . PHE B 1 71 ? 147.585 -0.714  11.939  1.00 0.00 ? 71  PHE B HB3  2  
ATOM   5427  H  HD1  . PHE B 1 71 ? 149.789 -2.679  9.676   1.00 0.00 ? 71  PHE B HD1  2  
ATOM   5428  H  HD2  . PHE B 1 71 ? 145.889 -0.984  10.280  1.00 0.00 ? 71  PHE B HD2  2  
ATOM   5429  H  HE1  . PHE B 1 71 ? 148.926 -3.959  7.730   1.00 0.00 ? 71  PHE B HE1  2  
ATOM   5430  H  HE2  . PHE B 1 71 ? 145.029 -2.266  8.341   1.00 0.00 ? 71  PHE B HE2  2  
ATOM   5431  H  HZ   . PHE B 1 71 ? 146.549 -3.753  7.066   1.00 0.00 ? 71  PHE B HZ   2  
ATOM   5432  N  N    . GLN B 1 72 ? 147.241 1.921   10.866  1.00 0.00 ? 72  GLN B N    2  
ATOM   5433  C  CA   . GLN B 1 72 ? 146.235 2.789   10.272  1.00 0.00 ? 72  GLN B CA   2  
ATOM   5434  C  C    . GLN B 1 72 ? 146.873 3.819   9.342   1.00 0.00 ? 72  GLN B C    2  
ATOM   5435  O  O    . GLN B 1 72 ? 146.355 4.087   8.264   1.00 0.00 ? 72  GLN B O    2  
ATOM   5436  C  CB   . GLN B 1 72 ? 145.446 3.512   11.364  1.00 0.00 ? 72  GLN B CB   2  
ATOM   5437  C  CG   . GLN B 1 72 ? 144.301 4.300   10.723  1.00 0.00 ? 72  GLN B CG   2  
ATOM   5438  C  CD   . GLN B 1 72 ? 143.558 5.100   11.786  1.00 0.00 ? 72  GLN B CD   2  
ATOM   5439  O  OE1  . GLN B 1 72 ? 144.126 6.007   12.394  1.00 0.00 ? 72  GLN B OE1  2  
ATOM   5440  N  NE2  . GLN B 1 72 ? 142.311 4.817   12.049  1.00 0.00 ? 72  GLN B NE2  2  
ATOM   5441  H  H    . GLN B 1 72 ? 147.339 1.881   11.840  1.00 0.00 ? 72  GLN B H    2  
ATOM   5442  H  HA   . GLN B 1 72 ? 145.551 2.183   9.698   1.00 0.00 ? 72  GLN B HA   2  
ATOM   5443  H  HB2  . GLN B 1 72 ? 145.043 2.788   12.057  1.00 0.00 ? 72  GLN B HB2  2  
ATOM   5444  H  HB3  . GLN B 1 72 ? 146.099 4.192   11.890  1.00 0.00 ? 72  GLN B HB3  2  
ATOM   5445  H  HG2  . GLN B 1 72 ? 144.706 4.978   9.985   1.00 0.00 ? 72  GLN B HG2  2  
ATOM   5446  H  HG3  . GLN B 1 72 ? 143.619 3.617   10.242  1.00 0.00 ? 72  GLN B HG3  2  
ATOM   5447  H  HE21 . GLN B 1 72 ? 141.859 4.095   11.564  1.00 0.00 ? 72  GLN B HE21 2  
ATOM   5448  H  HE22 . GLN B 1 72 ? 141.826 5.327   12.731  1.00 0.00 ? 72  GLN B HE22 2  
ATOM   5449  N  N    . GLU B 1 73 ? 148.000 4.398   9.748   1.00 0.00 ? 73  GLU B N    2  
ATOM   5450  C  CA   . GLU B 1 73 ? 148.658 5.377   8.888   1.00 0.00 ? 73  GLU B CA   2  
ATOM   5451  C  C    . GLU B 1 73 ? 149.235 4.692   7.642   1.00 0.00 ? 73  GLU B C    2  
ATOM   5452  O  O    . GLU B 1 73 ? 149.195 5.230   6.531   1.00 0.00 ? 73  GLU B O    2  
ATOM   5453  C  CB   . GLU B 1 73 ? 149.791 6.081   9.647   1.00 0.00 ? 73  GLU B CB   2  
ATOM   5454  C  CG   . GLU B 1 73 ? 149.233 6.899   10.820  1.00 0.00 ? 73  GLU B CG   2  
ATOM   5455  C  CD   . GLU B 1 73 ? 150.370 7.680   11.486  1.00 0.00 ? 73  GLU B CD   2  
ATOM   5456  O  OE1  . GLU B 1 73 ? 151.480 7.594   10.994  1.00 0.00 ? 73  GLU B OE1  2  
ATOM   5457  O  OE2  . GLU B 1 73 ? 150.110 8.382   12.454  1.00 0.00 ? 73  GLU B OE2  2  
ATOM   5458  H  H    . GLU B 1 73 ? 148.392 4.161   10.614  1.00 0.00 ? 73  GLU B H    2  
ATOM   5459  H  HA   . GLU B 1 73 ? 147.934 6.116   8.580   1.00 0.00 ? 73  GLU B HA   2  
ATOM   5460  H  HB2  . GLU B 1 73 ? 150.467 5.337   10.029  1.00 0.00 ? 73  GLU B HB2  2  
ATOM   5461  H  HB3  . GLU B 1 73 ? 150.320 6.738   8.973   1.00 0.00 ? 73  GLU B HB3  2  
ATOM   5462  H  HG2  . GLU B 1 73 ? 148.487 7.589   10.456  1.00 0.00 ? 73  GLU B HG2  2  
ATOM   5463  H  HG3  . GLU B 1 73 ? 148.786 6.232   11.543  1.00 0.00 ? 73  GLU B HG3  2  
ATOM   5464  N  N    . TYR B 1 74 ? 149.785 3.495   7.844   1.00 0.00 ? 74  TYR B N    2  
ATOM   5465  C  CA   . TYR B 1 74 ? 150.386 2.736   6.748   1.00 0.00 ? 74  TYR B CA   2  
ATOM   5466  C  C    . TYR B 1 74 ? 149.385 2.343   5.664   1.00 0.00 ? 74  TYR B C    2  
ATOM   5467  O  O    . TYR B 1 74 ? 149.681 2.451   4.466   1.00 0.00 ? 74  TYR B O    2  
ATOM   5468  C  CB   . TYR B 1 74 ? 151.038 1.468   7.299   1.00 0.00 ? 74  TYR B CB   2  
ATOM   5469  C  CG   . TYR B 1 74 ? 151.663 0.704   6.159   1.00 0.00 ? 74  TYR B CG   2  
ATOM   5470  C  CD1  . TYR B 1 74 ? 152.954 1.017   5.717   1.00 0.00 ? 74  TYR B CD1  2  
ATOM   5471  C  CD2  . TYR B 1 74 ? 150.939 -0.319  5.536   1.00 0.00 ? 74  TYR B CD2  2  
ATOM   5472  C  CE1  . TYR B 1 74 ? 153.518 0.307   4.650   1.00 0.00 ? 74  TYR B CE1  2  
ATOM   5473  C  CE2  . TYR B 1 74 ? 151.501 -1.029  4.472   1.00 0.00 ? 74  TYR B CE2  2  
ATOM   5474  C  CZ   . TYR B 1 74 ? 152.790 -0.716  4.028   1.00 0.00 ? 74  TYR B CZ   2  
ATOM   5475  O  OH   . TYR B 1 74 ? 153.341 -1.416  2.975   1.00 0.00 ? 74  TYR B OH   2  
ATOM   5476  H  H    . TYR B 1 74 ? 149.797 3.119   8.749   1.00 0.00 ? 74  TYR B H    2  
ATOM   5477  H  HA   . TYR B 1 74 ? 151.156 3.340   6.298   1.00 0.00 ? 74  TYR B HA   2  
ATOM   5478  H  HB2  . TYR B 1 74 ? 151.802 1.735   8.018   1.00 0.00 ? 74  TYR B HB2  2  
ATOM   5479  H  HB3  . TYR B 1 74 ? 150.290 0.853   7.776   1.00 0.00 ? 74  TYR B HB3  2  
ATOM   5480  H  HD1  . TYR B 1 74 ? 153.514 1.806   6.198   1.00 0.00 ? 74  TYR B HD1  2  
ATOM   5481  H  HD2  . TYR B 1 74 ? 149.943 -0.560  5.879   1.00 0.00 ? 74  TYR B HD2  2  
ATOM   5482  H  HE1  . TYR B 1 74 ? 154.513 0.546   4.307   1.00 0.00 ? 74  TYR B HE1  2  
ATOM   5483  H  HE2  . TYR B 1 74 ? 150.940 -1.818  3.993   1.00 0.00 ? 74  TYR B HE2  2  
ATOM   5484  H  HH   . TYR B 1 74 ? 153.736 -2.217  3.326   1.00 0.00 ? 74  TYR B HH   2  
ATOM   5485  N  N    . VAL B 1 75 ? 148.215 1.861   6.072   1.00 0.00 ? 75  VAL B N    2  
ATOM   5486  C  CA   . VAL B 1 75 ? 147.230 1.431   5.087   1.00 0.00 ? 75  VAL B CA   2  
ATOM   5487  C  C    . VAL B 1 75 ? 146.848 2.585   4.171   1.00 0.00 ? 75  VAL B C    2  
ATOM   5488  O  O    . VAL B 1 75 ? 146.702 2.401   2.963   1.00 0.00 ? 75  VAL B O    2  
ATOM   5489  C  CB   . VAL B 1 75 ? 145.983 0.852   5.767   1.00 0.00 ? 75  VAL B CB   2  
ATOM   5490  C  CG1  . VAL B 1 75 ? 145.097 1.987   6.279   1.00 0.00 ? 75  VAL B CG1  2  
ATOM   5491  C  CG2  . VAL B 1 75 ? 145.205 -0.015  4.758   1.00 0.00 ? 75  VAL B CG2  2  
ATOM   5492  H  H    . VAL B 1 75 ? 148.029 1.773   7.030   1.00 0.00 ? 75  VAL B H    2  
ATOM   5493  H  HA   . VAL B 1 75 ? 147.676 0.654   4.485   1.00 0.00 ? 75  VAL B HA   2  
ATOM   5494  H  HB   . VAL B 1 75 ? 146.289 0.240   6.603   1.00 0.00 ? 75  VAL B HB   2  
ATOM   5495  H  HG11 . VAL B 1 75 ? 144.512 1.637   7.117   1.00 0.00 ? 75  VAL B HG11 2  
ATOM   5496  H  HG12 . VAL B 1 75 ? 144.436 2.314   5.491   1.00 0.00 ? 75  VAL B HG12 2  
ATOM   5497  H  HG13 . VAL B 1 75 ? 145.715 2.806   6.590   1.00 0.00 ? 75  VAL B HG13 2  
ATOM   5498  H  HG21 . VAL B 1 75 ? 145.401 -1.061  4.959   1.00 0.00 ? 75  VAL B HG21 2  
ATOM   5499  H  HG22 . VAL B 1 75 ? 145.520 0.218   3.751   1.00 0.00 ? 75  VAL B HG22 2  
ATOM   5500  H  HG23 . VAL B 1 75 ? 144.146 0.175   4.852   1.00 0.00 ? 75  VAL B HG23 2  
ATOM   5501  N  N    . VAL B 1 76 ? 146.721 3.785   4.731   1.00 0.00 ? 76  VAL B N    2  
ATOM   5502  C  CA   . VAL B 1 76 ? 146.402 4.937   3.906   1.00 0.00 ? 76  VAL B CA   2  
ATOM   5503  C  C    . VAL B 1 76 ? 147.638 5.359   3.125   1.00 0.00 ? 76  VAL B C    2  
ATOM   5504  O  O    . VAL B 1 76 ? 147.534 5.840   1.997   1.00 0.00 ? 76  VAL B O    2  
ATOM   5505  C  CB   . VAL B 1 76 ? 145.874 6.102   4.752   1.00 0.00 ? 76  VAL B CB   2  
ATOM   5506  C  CG1  . VAL B 1 76 ? 144.590 5.677   5.466   1.00 0.00 ? 76  VAL B CG1  2  
ATOM   5507  C  CG2  . VAL B 1 76 ? 146.915 6.503   5.796   1.00 0.00 ? 76  VAL B CG2  2  
ATOM   5508  H  H    . VAL B 1 76 ? 146.872 3.895   5.693   1.00 0.00 ? 76  VAL B H    2  
ATOM   5509  H  HA   . VAL B 1 76 ? 145.636 4.648   3.201   1.00 0.00 ? 76  VAL B HA   2  
ATOM   5510  H  HB   . VAL B 1 76 ? 145.663 6.946   4.109   1.00 0.00 ? 76  VAL B HB   2  
ATOM   5511  H  HG11 . VAL B 1 76 ? 143.756 5.753   4.783   1.00 0.00 ? 76  VAL B HG11 2  
ATOM   5512  H  HG12 . VAL B 1 76 ? 144.418 6.324   6.314   1.00 0.00 ? 76  VAL B HG12 2  
ATOM   5513  H  HG13 . VAL B 1 76 ? 144.684 4.659   5.804   1.00 0.00 ? 76  VAL B HG13 2  
ATOM   5514  H  HG21 . VAL B 1 76 ? 146.980 5.730   6.549   1.00 0.00 ? 76  VAL B HG21 2  
ATOM   5515  H  HG22 . VAL B 1 76 ? 146.619 7.433   6.261   1.00 0.00 ? 76  VAL B HG22 2  
ATOM   5516  H  HG23 . VAL B 1 76 ? 147.876 6.629   5.319   1.00 0.00 ? 76  VAL B HG23 2  
ATOM   5517  N  N    . LEU B 1 77 ? 148.817 5.175   3.729   1.00 0.00 ? 77  LEU B N    2  
ATOM   5518  C  CA   . LEU B 1 77 ? 150.055 5.549   3.055   1.00 0.00 ? 77  LEU B CA   2  
ATOM   5519  C  C    . LEU B 1 77 ? 150.206 4.791   1.740   1.00 0.00 ? 77  LEU B C    2  
ATOM   5520  O  O    . LEU B 1 77 ? 150.586 5.374   0.724   1.00 0.00 ? 77  LEU B O    2  
ATOM   5521  C  CB   . LEU B 1 77 ? 151.249 5.227   3.965   1.00 0.00 ? 77  LEU B CB   2  
ATOM   5522  C  CG   . LEU B 1 77 ? 152.546 5.807   3.369   1.00 0.00 ? 77  LEU B CG   2  
ATOM   5523  C  CD1  . LEU B 1 77 ? 153.533 6.112   4.497   1.00 0.00 ? 77  LEU B CD1  2  
ATOM   5524  C  CD2  . LEU B 1 77 ? 153.197 4.804   2.403   1.00 0.00 ? 77  LEU B CD2  2  
ATOM   5525  H  H    . LEU B 1 77 ? 148.849 4.789   4.636   1.00 0.00 ? 77  LEU B H    2  
ATOM   5526  H  HA   . LEU B 1 77 ? 150.043 6.608   2.855   1.00 0.00 ? 77  LEU B HA   2  
ATOM   5527  H  HB2  . LEU B 1 77 ? 151.077 5.659   4.940   1.00 0.00 ? 77  LEU B HB2  2  
ATOM   5528  H  HB3  . LEU B 1 77 ? 151.342 4.158   4.065   1.00 0.00 ? 77  LEU B HB3  2  
ATOM   5529  H  HG   . LEU B 1 77 ? 152.320 6.719   2.837   1.00 0.00 ? 77  LEU B HG   2  
ATOM   5530  H  HD11 . LEU B 1 77 ? 153.823 5.190   4.981   1.00 0.00 ? 77  LEU B HD11 2  
ATOM   5531  H  HD12 . LEU B 1 77 ? 153.064 6.764   5.219   1.00 0.00 ? 77  LEU B HD12 2  
ATOM   5532  H  HD13 . LEU B 1 77 ? 154.408 6.595   4.089   1.00 0.00 ? 77  LEU B HD13 2  
ATOM   5533  H  HD21 . LEU B 1 77 ? 154.238 5.059   2.275   1.00 0.00 ? 77  LEU B HD21 2  
ATOM   5534  H  HD22 . LEU B 1 77 ? 152.702 4.846   1.446   1.00 0.00 ? 77  LEU B HD22 2  
ATOM   5535  H  HD23 . LEU B 1 77 ? 153.123 3.804   2.803   1.00 0.00 ? 77  LEU B HD23 2  
ATOM   5536  N  N    . VAL B 1 78 ? 149.895 3.496   1.754   1.00 0.00 ? 78  VAL B N    2  
ATOM   5537  C  CA   . VAL B 1 78 ? 149.995 2.698   0.533   1.00 0.00 ? 78  VAL B CA   2  
ATOM   5538  C  C    . VAL B 1 78 ? 148.864 3.029   -0.438  1.00 0.00 ? 78  VAL B C    2  
ATOM   5539  O  O    . VAL B 1 78 ? 149.026 2.952   -1.663  1.00 0.00 ? 78  VAL B O    2  
ATOM   5540  C  CB   . VAL B 1 78 ? 149.989 1.201   0.864   1.00 0.00 ? 78  VAL B CB   2  
ATOM   5541  C  CG1  . VAL B 1 78 ? 151.136 0.892   1.827   1.00 0.00 ? 78  VAL B CG1  2  
ATOM   5542  C  CG2  . VAL B 1 78 ? 148.664 0.814   1.525   1.00 0.00 ? 78  VAL B CG2  2  
ATOM   5543  H  H    . VAL B 1 78 ? 149.588 3.075   2.593   1.00 0.00 ? 78  VAL B H    2  
ATOM   5544  H  HA   . VAL B 1 78 ? 150.934 2.935   0.051   1.00 0.00 ? 78  VAL B HA   2  
ATOM   5545  H  HB   . VAL B 1 78 ? 150.121 0.632   -0.045  1.00 0.00 ? 78  VAL B HB   2  
ATOM   5546  H  HG11 . VAL B 1 78 ? 151.991 1.503   1.577   1.00 0.00 ? 78  VAL B HG11 2  
ATOM   5547  H  HG12 . VAL B 1 78 ? 151.403 -0.152  1.747   1.00 0.00 ? 78  VAL B HG12 2  
ATOM   5548  H  HG13 . VAL B 1 78 ? 150.825 1.106   2.839   1.00 0.00 ? 78  VAL B HG13 2  
ATOM   5549  H  HG21 . VAL B 1 78 ? 148.614 1.256   2.507   1.00 0.00 ? 78  VAL B HG21 2  
ATOM   5550  H  HG22 . VAL B 1 78 ? 148.606 -0.262  1.612   1.00 0.00 ? 78  VAL B HG22 2  
ATOM   5551  H  HG23 . VAL B 1 78 ? 147.839 1.169   0.925   1.00 0.00 ? 78  VAL B HG23 2  
ATOM   5552  N  N    . ALA B 1 79 ? 147.707 3.379   0.117   1.00 0.00 ? 79  ALA B N    2  
ATOM   5553  C  CA   . ALA B 1 79 ? 146.547 3.691   -0.705  1.00 0.00 ? 79  ALA B CA   2  
ATOM   5554  C  C    . ALA B 1 79 ? 146.816 4.884   -1.617  1.00 0.00 ? 79  ALA B C    2  
ATOM   5555  O  O    . ALA B 1 79 ? 146.382 4.897   -2.768  1.00 0.00 ? 79  ALA B O    2  
ATOM   5556  C  CB   . ALA B 1 79 ? 145.342 3.984   0.196   1.00 0.00 ? 79  ALA B CB   2  
ATOM   5557  H  H    . ALA B 1 79 ? 147.631 3.410   1.093   1.00 0.00 ? 79  ALA B H    2  
ATOM   5558  H  HA   . ALA B 1 79 ? 146.316 2.833   -1.318  1.00 0.00 ? 79  ALA B HA   2  
ATOM   5559  H  HB1  . ALA B 1 79 ? 144.444 3.603   -0.267  1.00 0.00 ? 79  ALA B HB1  2  
ATOM   5560  H  HB2  . ALA B 1 79 ? 145.246 5.051   0.344   1.00 0.00 ? 79  ALA B HB2  2  
ATOM   5561  H  HB3  . ALA B 1 79 ? 145.484 3.501   1.152   1.00 0.00 ? 79  ALA B HB3  2  
ATOM   5562  N  N    . ALA B 1 80 ? 147.538 5.879   -1.112  1.00 0.00 ? 80  ALA B N    2  
ATOM   5563  C  CA   . ALA B 1 80 ? 147.842 7.044   -1.930  1.00 0.00 ? 80  ALA B CA   2  
ATOM   5564  C  C    . ALA B 1 80 ? 148.722 6.639   -3.106  1.00 0.00 ? 80  ALA B C    2  
ATOM   5565  O  O    . ALA B 1 80 ? 148.506 7.074   -4.239  1.00 0.00 ? 80  ALA B O    2  
ATOM   5566  C  CB   . ALA B 1 80 ? 148.558 8.104   -1.091  1.00 0.00 ? 80  ALA B CB   2  
ATOM   5567  H  H    . ALA B 1 80 ? 147.871 5.826   -0.192  1.00 0.00 ? 80  ALA B H    2  
ATOM   5568  H  HA   . ALA B 1 80 ? 146.920 7.461   -2.307  1.00 0.00 ? 80  ALA B HA   2  
ATOM   5569  H  HB1  . ALA B 1 80 ? 149.305 7.628   -0.472  1.00 0.00 ? 80  ALA B HB1  2  
ATOM   5570  H  HB2  . ALA B 1 80 ? 147.840 8.612   -0.464  1.00 0.00 ? 80  ALA B HB2  2  
ATOM   5571  H  HB3  . ALA B 1 80 ? 149.036 8.819   -1.744  1.00 0.00 ? 80  ALA B HB3  2  
ATOM   5572  N  N    . LEU B 1 81 ? 149.704 5.786   -2.830  1.00 0.00 ? 81  LEU B N    2  
ATOM   5573  C  CA   . LEU B 1 81 ? 150.604 5.305   -3.871  1.00 0.00 ? 81  LEU B CA   2  
ATOM   5574  C  C    . LEU B 1 81 ? 149.836 4.476   -4.893  1.00 0.00 ? 81  LEU B C    2  
ATOM   5575  O  O    . LEU B 1 81 ? 150.128 4.514   -6.090  1.00 0.00 ? 81  LEU B O    2  
ATOM   5576  C  CB   . LEU B 1 81 ? 151.715 4.456   -3.250  1.00 0.00 ? 81  LEU B CB   2  
ATOM   5577  C  CG   . LEU B 1 81 ? 152.478 5.279   -2.207  1.00 0.00 ? 81  LEU B CG   2  
ATOM   5578  C  CD1  . LEU B 1 81 ? 153.658 4.462   -1.681  1.00 0.00 ? 81  LEU B CD1  2  
ATOM   5579  C  CD2  . LEU B 1 81 ? 153.002 6.569   -2.845  1.00 0.00 ? 81  LEU B CD2  2  
ATOM   5580  H  H    . LEU B 1 81 ? 149.818 5.465   -1.911  1.00 0.00 ? 81  LEU B H    2  
ATOM   5581  H  HA   . LEU B 1 81 ? 151.045 6.151   -4.373  1.00 0.00 ? 81  LEU B HA   2  
ATOM   5582  H  HB2  . LEU B 1 81 ? 151.282 3.588   -2.776  1.00 0.00 ? 81  LEU B HB2  2  
ATOM   5583  H  HB3  . LEU B 1 81 ? 152.399 4.140   -4.024  1.00 0.00 ? 81  LEU B HB3  2  
ATOM   5584  H  HG   . LEU B 1 81 ? 151.816 5.523   -1.388  1.00 0.00 ? 81  LEU B HG   2  
ATOM   5585  H  HD11 . LEU B 1 81 ? 154.119 4.985   -0.857  1.00 0.00 ? 81  LEU B HD11 2  
ATOM   5586  H  HD12 . LEU B 1 81 ? 154.381 4.326   -2.472  1.00 0.00 ? 81  LEU B HD12 2  
ATOM   5587  H  HD13 . LEU B 1 81 ? 153.306 3.497   -1.344  1.00 0.00 ? 81  LEU B HD13 2  
ATOM   5588  H  HD21 . LEU B 1 81 ? 153.867 6.916   -2.300  1.00 0.00 ? 81  LEU B HD21 2  
ATOM   5589  H  HD22 . LEU B 1 81 ? 152.231 7.325   -2.813  1.00 0.00 ? 81  LEU B HD22 2  
ATOM   5590  H  HD23 . LEU B 1 81 ? 153.276 6.377   -3.872  1.00 0.00 ? 81  LEU B HD23 2  
ATOM   5591  N  N    . THR B 1 82 ? 148.847 3.729   -4.406  1.00 0.00 ? 82  THR B N    2  
ATOM   5592  C  CA   . THR B 1 82 ? 148.043 2.878   -5.278  1.00 0.00 ? 82  THR B CA   2  
ATOM   5593  C  C    . THR B 1 82 ? 147.478 3.679   -6.439  1.00 0.00 ? 82  THR B C    2  
ATOM   5594  O  O    . THR B 1 82 ? 147.390 3.183   -7.562  1.00 0.00 ? 82  THR B O    2  
ATOM   5595  C  CB   . THR B 1 82 ? 146.892 2.258   -4.484  1.00 0.00 ? 82  THR B CB   2  
ATOM   5596  O  OG1  . THR B 1 82 ? 147.414 1.559   -3.362  1.00 0.00 ? 82  THR B OG1  2  
ATOM   5597  C  CG2  . THR B 1 82 ? 146.099 1.295   -5.373  1.00 0.00 ? 82  THR B CG2  2  
ATOM   5598  H  H    . THR B 1 82 ? 148.665 3.739   -3.437  1.00 0.00 ? 82  THR B H    2  
ATOM   5599  H  HA   . THR B 1 82 ? 148.664 2.087   -5.666  1.00 0.00 ? 82  THR B HA   2  
ATOM   5600  H  HB   . THR B 1 82 ? 146.237 3.042   -4.142  1.00 0.00 ? 82  THR B HB   2  
ATOM   5601  H  HG1  . THR B 1 82 ? 147.877 0.783   -3.685  1.00 0.00 ? 82  THR B HG1  2  
ATOM   5602  H  HG21 . THR B 1 82 ? 145.257 1.817   -5.805  1.00 0.00 ? 82  THR B HG21 2  
ATOM   5603  H  HG22 . THR B 1 82 ? 145.741 0.468   -4.778  1.00 0.00 ? 82  THR B HG22 2  
ATOM   5604  H  HG23 . THR B 1 82 ? 146.734 0.921   -6.163  1.00 0.00 ? 82  THR B HG23 2  
ATOM   5605  N  N    . VAL B 1 83 ? 147.102 4.917   -6.166  1.00 0.00 ? 83  VAL B N    2  
ATOM   5606  C  CA   . VAL B 1 83 ? 146.551 5.772   -7.201  1.00 0.00 ? 83  VAL B CA   2  
ATOM   5607  C  C    . VAL B 1 83 ? 147.557 5.944   -8.337  1.00 0.00 ? 83  VAL B C    2  
ATOM   5608  O  O    . VAL B 1 83 ? 147.173 6.030   -9.503  1.00 0.00 ? 83  VAL B O    2  
ATOM   5609  C  CB   . VAL B 1 83 ? 146.189 7.140   -6.624  1.00 0.00 ? 83  VAL B CB   2  
ATOM   5610  C  CG1  . VAL B 1 83 ? 145.763 8.073   -7.761  1.00 0.00 ? 83  VAL B CG1  2  
ATOM   5611  C  CG2  . VAL B 1 83 ? 145.034 6.986   -5.632  1.00 0.00 ? 83  VAL B CG2  2  
ATOM   5612  H  H    . VAL B 1 83 ? 147.197 5.260   -5.254  1.00 0.00 ? 83  VAL B H    2  
ATOM   5613  H  HA   . VAL B 1 83 ? 145.656 5.313   -7.595  1.00 0.00 ? 83  VAL B HA   2  
ATOM   5614  H  HB   . VAL B 1 83 ? 147.049 7.558   -6.119  1.00 0.00 ? 83  VAL B HB   2  
ATOM   5615  H  HG11 . VAL B 1 83 ? 145.315 8.965   -7.346  1.00 0.00 ? 83  VAL B HG11 2  
ATOM   5616  H  HG12 . VAL B 1 83 ? 145.043 7.569   -8.391  1.00 0.00 ? 83  VAL B HG12 2  
ATOM   5617  H  HG13 . VAL B 1 83 ? 146.627 8.344   -8.348  1.00 0.00 ? 83  VAL B HG13 2  
ATOM   5618  H  HG21 . VAL B 1 83 ? 144.095 6.996   -6.165  1.00 0.00 ? 83  VAL B HG21 2  
ATOM   5619  H  HG22 . VAL B 1 83 ? 145.055 7.802   -4.925  1.00 0.00 ? 83  VAL B HG22 2  
ATOM   5620  H  HG23 . VAL B 1 83 ? 145.137 6.049   -5.102  1.00 0.00 ? 83  VAL B HG23 2  
ATOM   5621  N  N    . ALA B 1 84 ? 148.846 6.001   -7.996  1.00 0.00 ? 84  ALA B N    2  
ATOM   5622  C  CA   . ALA B 1 84 ? 149.873 6.173   -9.018  1.00 0.00 ? 84  ALA B CA   2  
ATOM   5623  C  C    . ALA B 1 84 ? 149.846 5.015   -10.012 1.00 0.00 ? 84  ALA B C    2  
ATOM   5624  O  O    . ALA B 1 84 ? 150.041 5.211   -11.215 1.00 0.00 ? 84  ALA B O    2  
ATOM   5625  C  CB   . ALA B 1 84 ? 151.252 6.255   -8.362  1.00 0.00 ? 84  ALA B CB   2  
ATOM   5626  H  H    . ALA B 1 84 ? 149.109 5.923   -7.048  1.00 0.00 ? 84  ALA B H    2  
ATOM   5627  H  HA   . ALA B 1 84 ? 149.686 7.094   -9.549  1.00 0.00 ? 84  ALA B HA   2  
ATOM   5628  H  HB1  . ALA B 1 84 ? 151.974 6.609   -9.084  1.00 0.00 ? 84  ALA B HB1  2  
ATOM   5629  H  HB2  . ALA B 1 84 ? 151.544 5.275   -8.013  1.00 0.00 ? 84  ALA B HB2  2  
ATOM   5630  H  HB3  . ALA B 1 84 ? 151.214 6.938   -7.525  1.00 0.00 ? 84  ALA B HB3  2  
ATOM   5631  N  N    . MET B 1 85 ? 149.583 3.809   -9.513  1.00 0.00 ? 85  MET B N    2  
ATOM   5632  C  CA   . MET B 1 85 ? 149.519 2.652   -10.393 1.00 0.00 ? 85  MET B CA   2  
ATOM   5633  C  C    . MET B 1 85 ? 148.440 2.867   -11.440 1.00 0.00 ? 85  MET B C    2  
ATOM   5634  O  O    . MET B 1 85 ? 148.613 2.507   -12.606 1.00 0.00 ? 85  MET B O    2  
ATOM   5635  C  CB   . MET B 1 85 ? 149.218 1.386   -9.581  1.00 0.00 ? 85  MET B CB   2  
ATOM   5636  C  CG   . MET B 1 85 ? 149.176 0.160   -10.504 1.00 0.00 ? 85  MET B CG   2  
ATOM   5637  S  SD   . MET B 1 85 ? 150.854 -0.300  -10.997 1.00 0.00 ? 85  MET B SD   2  
ATOM   5638  C  CE   . MET B 1 85 ? 150.411 -1.112  -12.556 1.00 0.00 ? 85  MET B CE   2  
ATOM   5639  H  H    . MET B 1 85 ? 149.419 3.703   -8.553  1.00 0.00 ? 85  MET B H    2  
ATOM   5640  H  HA   . MET B 1 85 ? 150.471 2.533   -10.888 1.00 0.00 ? 85  MET B HA   2  
ATOM   5641  H  HB2  . MET B 1 85 ? 149.988 1.248   -8.837  1.00 0.00 ? 85  MET B HB2  2  
ATOM   5642  H  HB3  . MET B 1 85 ? 148.262 1.495   -9.091  1.00 0.00 ? 85  MET B HB3  2  
ATOM   5643  H  HG2  . MET B 1 85 ? 148.724 -0.667  -9.976  1.00 0.00 ? 85  MET B HG2  2  
ATOM   5644  H  HG3  . MET B 1 85 ? 148.591 0.380   -11.384 1.00 0.00 ? 85  MET B HG3  2  
ATOM   5645  H  HE1  . MET B 1 85 ? 150.023 -0.375  -13.247 1.00 0.00 ? 85  MET B HE1  2  
ATOM   5646  H  HE2  . MET B 1 85 ? 149.657 -1.861  -12.374 1.00 0.00 ? 85  MET B HE2  2  
ATOM   5647  H  HE3  . MET B 1 85 ? 151.289 -1.581  -12.980 1.00 0.00 ? 85  MET B HE3  2  
ATOM   5648  N  N    . ASN B 1 86 ? 147.331 3.471   -11.027 1.00 0.00 ? 86  ASN B N    2  
ATOM   5649  C  CA   . ASN B 1 86 ? 146.250 3.735   -11.959 1.00 0.00 ? 86  ASN B CA   2  
ATOM   5650  C  C    . ASN B 1 86 ? 146.750 4.594   -13.110 1.00 0.00 ? 86  ASN B C    2  
ATOM   5651  O  O    . ASN B 1 86 ? 146.462 4.321   -14.275 1.00 0.00 ? 86  ASN B O    2  
ATOM   5652  C  CB   . ASN B 1 86 ? 145.126 4.469   -11.230 1.00 0.00 ? 86  ASN B CB   2  
ATOM   5653  C  CG   . ASN B 1 86 ? 143.884 4.541   -12.105 1.00 0.00 ? 86  ASN B CG   2  
ATOM   5654  O  OD1  . ASN B 1 86 ? 143.604 3.620   -12.873 1.00 0.00 ? 86  ASN B OD1  2  
ATOM   5655  N  ND2  . ASN B 1 86 ? 143.125 5.600   -12.043 1.00 0.00 ? 86  ASN B ND2  2  
ATOM   5656  H  H    . ASN B 1 86 ? 147.246 3.747   -10.091 1.00 0.00 ? 86  ASN B H    2  
ATOM   5657  H  HA   . ASN B 1 86 ? 145.871 2.801   -12.345 1.00 0.00 ? 86  ASN B HA   2  
ATOM   5658  H  HB2  . ASN B 1 86 ? 144.890 3.941   -10.317 1.00 0.00 ? 86  ASN B HB2  2  
ATOM   5659  H  HB3  . ASN B 1 86 ? 145.452 5.468   -10.989 1.00 0.00 ? 86  ASN B HB3  2  
ATOM   5660  H  HD21 . ASN B 1 86 ? 143.362 6.336   -11.439 1.00 0.00 ? 86  ASN B HD21 2  
ATOM   5661  H  HD22 . ASN B 1 86 ? 142.322 5.663   -12.597 1.00 0.00 ? 86  ASN B HD22 2  
ATOM   5662  N  N    . ASN B 1 87 ? 147.525 5.622   -12.774 1.00 0.00 ? 87  ASN B N    2  
ATOM   5663  C  CA   . ASN B 1 87 ? 148.085 6.498   -13.791 1.00 0.00 ? 87  ASN B CA   2  
ATOM   5664  C  C    . ASN B 1 87 ? 149.023 5.717   -14.699 1.00 0.00 ? 87  ASN B C    2  
ATOM   5665  O  O    . ASN B 1 87 ? 149.026 5.895   -15.917 1.00 0.00 ? 87  ASN B O    2  
ATOM   5666  C  CB   . ASN B 1 87 ? 148.835 7.654   -13.128 1.00 0.00 ? 87  ASN B CB   2  
ATOM   5667  C  CG   . ASN B 1 87 ? 149.155 8.728   -14.161 1.00 0.00 ? 87  ASN B CG   2  
ATOM   5668  O  OD1  . ASN B 1 87 ? 148.247 9.307   -14.758 1.00 0.00 ? 87  ASN B OD1  2  
ATOM   5669  N  ND2  . ASN B 1 87 ? 150.399 9.035   -14.407 1.00 0.00 ? 87  ASN B ND2  2  
ATOM   5670  H  H    . ASN B 1 87 ? 147.735 5.779   -11.829 1.00 0.00 ? 87  ASN B H    2  
ATOM   5671  H  HA   . ASN B 1 87 ? 147.279 6.902   -14.386 1.00 0.00 ? 87  ASN B HA   2  
ATOM   5672  H  HB2  . ASN B 1 87 ? 148.217 8.077   -12.349 1.00 0.00 ? 87  ASN B HB2  2  
ATOM   5673  H  HB3  . ASN B 1 87 ? 149.754 7.285   -12.698 1.00 0.00 ? 87  ASN B HB3  2  
ATOM   5674  H  HD21 . ASN B 1 87 ? 151.121 8.575   -13.930 1.00 0.00 ? 87  ASN B HD21 2  
ATOM   5675  H  HD22 . ASN B 1 87 ? 150.612 9.725   -15.070 1.00 0.00 ? 87  ASN B HD22 2  
ATOM   5676  N  N    . PHE B 1 88 ? 149.817 4.842   -14.085 1.00 0.00 ? 88  PHE B N    2  
ATOM   5677  C  CA   . PHE B 1 88 ? 150.762 4.020   -14.832 1.00 0.00 ? 88  PHE B CA   2  
ATOM   5678  C  C    . PHE B 1 88 ? 150.032 3.133   -15.832 1.00 0.00 ? 88  PHE B C    2  
ATOM   5679  O  O    . PHE B 1 88 ? 150.446 2.998   -16.983 1.00 0.00 ? 88  PHE B O    2  
ATOM   5680  C  CB   . PHE B 1 88 ? 151.562 3.148   -13.861 1.00 0.00 ? 88  PHE B CB   2  
ATOM   5681  C  CG   . PHE B 1 88 ? 152.626 2.389   -14.615 1.00 0.00 ? 88  PHE B CG   2  
ATOM   5682  C  CD1  . PHE B 1 88 ? 153.865 2.989   -14.871 1.00 0.00 ? 88  PHE B CD1  2  
ATOM   5683  C  CD2  . PHE B 1 88 ? 152.377 1.083   -15.053 1.00 0.00 ? 88  PHE B CD2  2  
ATOM   5684  C  CE1  . PHE B 1 88 ? 154.855 2.282   -15.566 1.00 0.00 ? 88  PHE B CE1  2  
ATOM   5685  C  CE2  . PHE B 1 88 ? 153.366 0.377   -15.748 1.00 0.00 ? 88  PHE B CE2  2  
ATOM   5686  C  CZ   . PHE B 1 88 ? 154.605 0.976   -16.004 1.00 0.00 ? 88  PHE B CZ   2  
ATOM   5687  H  H    . PHE B 1 88 ? 149.763 4.747   -13.106 1.00 0.00 ? 88  PHE B H    2  
ATOM   5688  H  HA   . PHE B 1 88 ? 151.445 4.664   -15.365 1.00 0.00 ? 88  PHE B HA   2  
ATOM   5689  H  HB2  . PHE B 1 88 ? 152.027 3.775   -13.115 1.00 0.00 ? 88  PHE B HB2  2  
ATOM   5690  H  HB3  . PHE B 1 88 ? 150.898 2.447   -13.377 1.00 0.00 ? 88  PHE B HB3  2  
ATOM   5691  H  HD1  . PHE B 1 88 ? 154.057 3.996   -14.534 1.00 0.00 ? 88  PHE B HD1  2  
ATOM   5692  H  HD2  . PHE B 1 88 ? 151.422 0.620   -14.856 1.00 0.00 ? 88  PHE B HD2  2  
ATOM   5693  H  HE1  . PHE B 1 88 ? 155.810 2.745   -15.764 1.00 0.00 ? 88  PHE B HE1  2  
ATOM   5694  H  HE2  . PHE B 1 88 ? 153.175 -0.631  -16.087 1.00 0.00 ? 88  PHE B HE2  2  
ATOM   5695  H  HZ   . PHE B 1 88 ? 155.368 0.432   -16.540 1.00 0.00 ? 88  PHE B HZ   2  
ATOM   5696  N  N    . PHE B 1 89 ? 148.940 2.536   -15.375 1.00 0.00 ? 89  PHE B N    2  
ATOM   5697  C  CA   . PHE B 1 89 ? 148.142 1.647   -16.209 1.00 0.00 ? 89  PHE B CA   2  
ATOM   5698  C  C    . PHE B 1 89 ? 147.739 2.351   -17.497 1.00 0.00 ? 89  PHE B C    2  
ATOM   5699  O  O    . PHE B 1 89 ? 147.679 1.741   -18.564 1.00 0.00 ? 89  PHE B O    2  
ATOM   5700  C  CB   . PHE B 1 89 ? 146.893 1.207   -15.448 1.00 0.00 ? 89  PHE B CB   2  
ATOM   5701  C  CG   . PHE B 1 89 ? 146.167 0.155   -16.246 1.00 0.00 ? 89  PHE B CG   2  
ATOM   5702  C  CD1  . PHE B 1 89 ? 146.551 -1.184  -16.130 1.00 0.00 ? 89  PHE B CD1  2  
ATOM   5703  C  CD2  . PHE B 1 89 ? 145.116 0.513   -17.098 1.00 0.00 ? 89  PHE B CD2  2  
ATOM   5704  C  CE1  . PHE B 1 89 ? 145.886 -2.170  -16.864 1.00 0.00 ? 89  PHE B CE1  2  
ATOM   5705  C  CE2  . PHE B 1 89 ? 144.449 -0.475  -17.836 1.00 0.00 ? 89  PHE B CE2  2  
ATOM   5706  C  CZ   . PHE B 1 89 ? 144.835 -1.816  -17.718 1.00 0.00 ? 89  PHE B CZ   2  
ATOM   5707  H  H    . PHE B 1 89 ? 148.666 2.691   -14.446 1.00 0.00 ? 89  PHE B H    2  
ATOM   5708  H  HA   . PHE B 1 89 ? 148.729 0.775   -16.455 1.00 0.00 ? 89  PHE B HA   2  
ATOM   5709  H  HB2  . PHE B 1 89 ? 147.180 0.798   -14.490 1.00 0.00 ? 89  PHE B HB2  2  
ATOM   5710  H  HB3  . PHE B 1 89 ? 146.244 2.057   -15.298 1.00 0.00 ? 89  PHE B HB3  2  
ATOM   5711  H  HD1  . PHE B 1 89 ? 147.361 -1.457  -15.471 1.00 0.00 ? 89  PHE B HD1  2  
ATOM   5712  H  HD2  . PHE B 1 89 ? 144.819 1.547   -17.188 1.00 0.00 ? 89  PHE B HD2  2  
ATOM   5713  H  HE1  . PHE B 1 89 ? 146.187 -3.203  -16.770 1.00 0.00 ? 89  PHE B HE1  2  
ATOM   5714  H  HE2  . PHE B 1 89 ? 143.638 -0.201  -18.494 1.00 0.00 ? 89  PHE B HE2  2  
ATOM   5715  H  HZ   . PHE B 1 89 ? 144.321 -2.578  -18.286 1.00 0.00 ? 89  PHE B HZ   2  
ATOM   5716  N  N    . TRP B 1 90 ? 147.453 3.637   -17.378 1.00 0.00 ? 90  TRP B N    2  
ATOM   5717  C  CA   . TRP B 1 90 ? 147.040 4.436   -18.520 1.00 0.00 ? 90  TRP B CA   2  
ATOM   5718  C  C    . TRP B 1 90 ? 148.029 4.306   -19.677 1.00 0.00 ? 90  TRP B C    2  
ATOM   5719  O  O    . TRP B 1 90 ? 147.639 4.414   -20.839 1.00 0.00 ? 90  TRP B O    2  
ATOM   5720  C  CB   . TRP B 1 90 ? 146.922 5.905   -18.114 1.00 0.00 ? 90  TRP B CB   2  
ATOM   5721  C  CG   . TRP B 1 90 ? 146.323 6.683   -19.240 1.00 0.00 ? 90  TRP B CG   2  
ATOM   5722  C  CD1  . TRP B 1 90 ? 147.000 7.529   -20.049 1.00 0.00 ? 90  TRP B CD1  2  
ATOM   5723  C  CD2  . TRP B 1 90 ? 144.940 6.696   -19.700 1.00 0.00 ? 90  TRP B CD2  2  
ATOM   5724  N  NE1  . TRP B 1 90 ? 146.120 8.063   -20.974 1.00 0.00 ? 90  TRP B NE1  2  
ATOM   5725  C  CE2  . TRP B 1 90 ? 144.838 7.580   -20.799 1.00 0.00 ? 90  TRP B CE2  2  
ATOM   5726  C  CE3  . TRP B 1 90 ? 143.775 6.034   -19.271 1.00 0.00 ? 90  TRP B CE3  2  
ATOM   5727  C  CZ2  . TRP B 1 90 ? 143.624 7.799   -21.452 1.00 0.00 ? 90  TRP B CZ2  2  
ATOM   5728  C  CZ3  . TRP B 1 90 ? 142.552 6.251   -19.926 1.00 0.00 ? 90  TRP B CZ3  2  
ATOM   5729  C  CH2  . TRP B 1 90 ? 142.477 7.132   -21.014 1.00 0.00 ? 90  TRP B CH2  2  
ATOM   5730  H  H    . TRP B 1 90 ? 147.512 4.060   -16.496 1.00 0.00 ? 90  TRP B H    2  
ATOM   5731  H  HA   . TRP B 1 90 ? 146.072 4.093   -18.850 1.00 0.00 ? 90  TRP B HA   2  
ATOM   5732  H  HB2  . TRP B 1 90 ? 146.290 5.989   -17.242 1.00 0.00 ? 90  TRP B HB2  2  
ATOM   5733  H  HB3  . TRP B 1 90 ? 147.902 6.297   -17.887 1.00 0.00 ? 90  TRP B HB3  2  
ATOM   5734  H  HD1  . TRP B 1 90 ? 148.055 7.753   -19.983 1.00 0.00 ? 90  TRP B HD1  2  
ATOM   5735  H  HE1  . TRP B 1 90 ? 146.358 8.705   -21.675 1.00 0.00 ? 90  TRP B HE1  2  
ATOM   5736  H  HE3  . TRP B 1 90 ? 143.822 5.353   -18.434 1.00 0.00 ? 90  TRP B HE3  2  
ATOM   5737  H  HZ2  . TRP B 1 90 ? 143.572 8.478   -22.290 1.00 0.00 ? 90  TRP B HZ2  2  
ATOM   5738  H  HZ3  . TRP B 1 90 ? 141.664 5.738   -19.588 1.00 0.00 ? 90  TRP B HZ3  2  
ATOM   5739  H  HH2  . TRP B 1 90 ? 141.533 7.295   -21.513 1.00 0.00 ? 90  TRP B HH2  2  
ATOM   5740  N  N    . GLU B 1 91 ? 149.310 4.096   -19.371 1.00 0.00 ? 91  GLU B N    2  
ATOM   5741  C  CA   . GLU B 1 91 ? 150.309 3.989   -20.435 1.00 0.00 ? 91  GLU B CA   2  
ATOM   5742  C  C    . GLU B 1 91 ? 149.956 2.843   -21.379 1.00 0.00 ? 91  GLU B C    2  
ATOM   5743  O  O    . GLU B 1 91 ? 150.284 2.881   -22.565 1.00 0.00 ? 91  GLU B O    2  
ATOM   5744  C  CB   . GLU B 1 91 ? 151.706 3.758   -19.835 1.00 0.00 ? 91  GLU B CB   2  
ATOM   5745  C  CG   . GLU B 1 91 ? 151.903 2.278   -19.477 1.00 0.00 ? 91  GLU B CG   2  
ATOM   5746  C  CD   . GLU B 1 91 ? 153.221 2.096   -18.733 1.00 0.00 ? 91  GLU B CD   2  
ATOM   5747  O  OE1  . GLU B 1 91 ? 153.950 3.066   -18.612 1.00 0.00 ? 91  GLU B OE1  2  
ATOM   5748  O  OE2  . GLU B 1 91 ? 153.483 0.987   -18.296 1.00 0.00 ? 91  GLU B OE2  2  
ATOM   5749  H  H    . GLU B 1 91 ? 149.588 4.028   -18.428 1.00 0.00 ? 91  GLU B H    2  
ATOM   5750  H  HA   . GLU B 1 91 ? 150.320 4.911   -20.995 1.00 0.00 ? 91  GLU B HA   2  
ATOM   5751  H  HB2  . GLU B 1 91 ? 152.455 4.054   -20.555 1.00 0.00 ? 91  GLU B HB2  2  
ATOM   5752  H  HB3  . GLU B 1 91 ? 151.814 4.357   -18.943 1.00 0.00 ? 91  GLU B HB3  2  
ATOM   5753  H  HG2  . GLU B 1 91 ? 151.089 1.940   -18.859 1.00 0.00 ? 91  GLU B HG2  2  
ATOM   5754  H  HG3  . GLU B 1 91 ? 151.931 1.689   -20.383 1.00 0.00 ? 91  GLU B HG3  2  
ATOM   5755  N  N    . ASN B 1 92 ? 149.283 1.830   -20.847 1.00 0.00 ? 92  ASN B N    2  
ATOM   5756  C  CA   . ASN B 1 92 ? 148.887 0.681   -21.654 1.00 0.00 ? 92  ASN B CA   2  
ATOM   5757  C  C    . ASN B 1 92 ? 148.060 1.129   -22.855 1.00 0.00 ? 92  ASN B C    2  
ATOM   5758  O  O    . ASN B 1 92 ? 148.142 0.540   -23.932 1.00 0.00 ? 92  ASN B O    2  
ATOM   5759  C  CB   . ASN B 1 92 ? 148.074 -0.299  -20.805 1.00 0.00 ? 92  ASN B CB   2  
ATOM   5760  C  CG   . ASN B 1 92 ? 148.947 -0.869  -19.692 1.00 0.00 ? 92  ASN B CG   2  
ATOM   5761  O  OD1  . ASN B 1 92 ? 148.489 -1.699  -18.906 1.00 0.00 ? 92  ASN B OD1  2  
ATOM   5762  N  ND2  . ASN B 1 92 ? 150.185 -0.473  -19.577 1.00 0.00 ? 92  ASN B ND2  2  
ATOM   5763  H  H    . ASN B 1 92 ? 149.046 1.855   -19.897 1.00 0.00 ? 92  ASN B H    2  
ATOM   5764  H  HA   . ASN B 1 92 ? 149.775 0.180   -22.008 1.00 0.00 ? 92  ASN B HA   2  
ATOM   5765  H  HB2  . ASN B 1 92 ? 147.231 0.218   -20.370 1.00 0.00 ? 92  ASN B HB2  2  
ATOM   5766  H  HB3  . ASN B 1 92 ? 147.719 -1.105  -21.429 1.00 0.00 ? 92  ASN B HB3  2  
ATOM   5767  H  HD21 . ASN B 1 92 ? 150.548 0.187   -20.204 1.00 0.00 ? 92  ASN B HD21 2  
ATOM   5768  H  HD22 . ASN B 1 92 ? 150.752 -0.835  -18.865 1.00 0.00 ? 92  ASN B HD22 2  
ATOM   5769  N  N    . SER B 1 93 ? 147.265 2.176   -22.660 1.00 0.00 ? 93  SER B N    2  
ATOM   5770  C  CA   . SER B 1 93 ? 146.425 2.698   -23.732 1.00 0.00 ? 93  SER B CA   2  
ATOM   5771  C  C    . SER B 1 93 ? 146.168 4.188   -23.535 1.00 0.00 ? 93  SER B C    2  
ATOM   5772  O  O    . SER B 1 93 ? 146.471 4.946   -24.441 1.00 0.00 ? 93  SER B O    2  
ATOM   5773  C  CB   . SER B 1 93 ? 145.093 1.948   -23.762 1.00 0.00 ? 93  SER B CB   2  
ATOM   5774  O  OG   . SER B 1 93 ? 144.135 2.724   -24.469 1.00 0.00 ? 93  SER B OG   2  
ATOM   5775  O  OXT  . SER B 1 93 ? 145.672 4.549   -22.481 1.00 0.00 ? 93  SER B OXT  2  
ATOM   5776  H  H    . SER B 1 93 ? 147.242 2.605   -21.778 1.00 0.00 ? 93  SER B H    2  
ATOM   5777  H  HA   . SER B 1 93 ? 146.929 2.550   -24.675 1.00 0.00 ? 93  SER B HA   2  
ATOM   5778  H  HB2  . SER B 1 93 ? 145.220 1.003   -24.260 1.00 0.00 ? 93  SER B HB2  2  
ATOM   5779  H  HB3  . SER B 1 93 ? 144.755 1.776   -22.748 1.00 0.00 ? 93  SER B HB3  2  
ATOM   5780  H  HG   . SER B 1 93 ? 144.412 2.776   -25.386 1.00 0.00 ? 93  SER B HG   2  
HETATM 5781  CA CA   . CA  C 2 .  ? 129.571 1.971   -12.812 1.00 0.00 ? 201 CA  A CA   2  
HETATM 5782  CA CA   . CA  D 2 .  ? 133.507 12.625  -4.668  1.00 0.00 ? 202 CA  A CA   2  
HETATM 5783  CA CA   . CA  E 2 .  ? 159.825 -2.923  13.282  1.00 0.00 ? 101 CA  B CA   2  
HETATM 5784  CA CA   . CA  F 2 .  ? 152.031 8.666   13.785  1.00 0.00 ? 102 CA  B CA   2  
ATOM   5785  N  N    . GLY A 1 1  ? 156.853 -10.091 -9.947  1.00 0.00 ? 1   GLY A N    3  
ATOM   5786  C  CA   . GLY A 1 1  ? 157.112 -8.781  -9.360  1.00 0.00 ? 1   GLY A CA   3  
ATOM   5787  C  C    . GLY A 1 1  ? 157.092 -8.853  -7.837  1.00 0.00 ? 1   GLY A C    3  
ATOM   5788  O  O    . GLY A 1 1  ? 157.702 -9.739  -7.240  1.00 0.00 ? 1   GLY A O    3  
ATOM   5789  H  H1   . GLY A 1 1  ? 157.545 -10.536 -10.478 1.00 0.00 ? 1   GLY A H1   3  
ATOM   5790  H  HA2  . GLY A 1 1  ? 158.080 -8.432  -9.687  1.00 0.00 ? 1   GLY A HA2  3  
ATOM   5791  H  HA3  . GLY A 1 1  ? 156.354 -8.088  -9.690  1.00 0.00 ? 1   GLY A HA3  3  
ATOM   5792  N  N    . SER A 1 2  ? 156.385 -7.914  -7.214  1.00 0.00 ? 2   SER A N    3  
ATOM   5793  C  CA   . SER A 1 2  ? 156.287 -7.876  -5.758  1.00 0.00 ? 2   SER A CA   3  
ATOM   5794  C  C    . SER A 1 2  ? 154.881 -8.259  -5.308  1.00 0.00 ? 2   SER A C    3  
ATOM   5795  O  O    . SER A 1 2  ? 153.898 -7.985  -6.004  1.00 0.00 ? 2   SER A O    3  
ATOM   5796  C  CB   . SER A 1 2  ? 156.622 -6.474  -5.251  1.00 0.00 ? 2   SER A CB   3  
ATOM   5797  O  OG   . SER A 1 2  ? 157.933 -6.124  -5.674  1.00 0.00 ? 2   SER A OG   3  
ATOM   5798  H  H    . SER A 1 2  ? 155.917 -7.234  -7.744  1.00 0.00 ? 2   SER A H    3  
ATOM   5799  H  HA   . SER A 1 2  ? 156.993 -8.577  -5.335  1.00 0.00 ? 2   SER A HA   3  
ATOM   5800  H  HB2  . SER A 1 2  ? 155.918 -5.765  -5.655  1.00 0.00 ? 2   SER A HB2  3  
ATOM   5801  H  HB3  . SER A 1 2  ? 156.565 -6.459  -4.170  1.00 0.00 ? 2   SER A HB3  3  
ATOM   5802  H  HG   . SER A 1 2  ? 158.172 -5.297  -5.248  1.00 0.00 ? 2   SER A HG   3  
ATOM   5803  N  N    . GLU A 1 3  ? 154.785 -8.892  -4.143  1.00 0.00 ? 3   GLU A N    3  
ATOM   5804  C  CA   . GLU A 1 3  ? 153.487 -9.299  -3.633  1.00 0.00 ? 3   GLU A CA   3  
ATOM   5805  C  C    . GLU A 1 3  ? 152.601 -8.078  -3.436  1.00 0.00 ? 3   GLU A C    3  
ATOM   5806  O  O    . GLU A 1 3  ? 151.395 -8.132  -3.675  1.00 0.00 ? 3   GLU A O    3  
ATOM   5807  C  CB   . GLU A 1 3  ? 153.651 -10.023 -2.294  1.00 0.00 ? 3   GLU A CB   3  
ATOM   5808  C  CG   . GLU A 1 3  ? 154.437 -11.318 -2.501  1.00 0.00 ? 3   GLU A CG   3  
ATOM   5809  C  CD   . GLU A 1 3  ? 154.545 -12.076 -1.182  1.00 0.00 ? 3   GLU A CD   3  
ATOM   5810  O  OE1  . GLU A 1 3  ? 154.172 -11.514 -0.166  1.00 0.00 ? 3   GLU A OE1  3  
ATOM   5811  O  OE2  . GLU A 1 3  ? 154.999 -13.208 -1.209  1.00 0.00 ? 3   GLU A OE2  3  
ATOM   5812  H  H    . GLU A 1 3  ? 155.595 -9.087  -3.628  1.00 0.00 ? 3   GLU A H    3  
ATOM   5813  H  HA   . GLU A 1 3  ? 153.019 -9.967  -4.340  1.00 0.00 ? 3   GLU A HA   3  
ATOM   5814  H  HB2  . GLU A 1 3  ? 154.183 -9.385  -1.604  1.00 0.00 ? 3   GLU A HB2  3  
ATOM   5815  H  HB3  . GLU A 1 3  ? 152.677 -10.257 -1.890  1.00 0.00 ? 3   GLU A HB3  3  
ATOM   5816  H  HG2  . GLU A 1 3  ? 153.928 -11.932 -3.228  1.00 0.00 ? 3   GLU A HG2  3  
ATOM   5817  H  HG3  . GLU A 1 3  ? 155.427 -11.083 -2.860  1.00 0.00 ? 3   GLU A HG3  3  
ATOM   5818  N  N    . LEU A 1 4  ? 153.206 -6.972  -3.013  1.00 0.00 ? 4   LEU A N    3  
ATOM   5819  C  CA   . LEU A 1 4  ? 152.445 -5.748  -2.812  1.00 0.00 ? 4   LEU A CA   3  
ATOM   5820  C  C    . LEU A 1 4  ? 151.803 -5.327  -4.128  1.00 0.00 ? 4   LEU A C    3  
ATOM   5821  O  O    . LEU A 1 4  ? 150.631 -4.934  -4.172  1.00 0.00 ? 4   LEU A O    3  
ATOM   5822  C  CB   . LEU A 1 4  ? 153.393 -4.637  -2.334  1.00 0.00 ? 4   LEU A CB   3  
ATOM   5823  C  CG   . LEU A 1 4  ? 152.609 -3.359  -2.009  1.00 0.00 ? 4   LEU A CG   3  
ATOM   5824  C  CD1  . LEU A 1 4  ? 152.022 -3.446  -0.594  1.00 0.00 ? 4   LEU A CD1  3  
ATOM   5825  C  CD2  . LEU A 1 4  ? 153.547 -2.147  -2.114  1.00 0.00 ? 4   LEU A CD2  3  
ATOM   5826  H  H    . LEU A 1 4  ? 154.172 -6.977  -2.847  1.00 0.00 ? 4   LEU A H    3  
ATOM   5827  H  HA   . LEU A 1 4  ? 151.681 -5.916  -2.072  1.00 0.00 ? 4   LEU A HA   3  
ATOM   5828  H  HB2  . LEU A 1 4  ? 153.912 -4.971  -1.447  1.00 0.00 ? 4   LEU A HB2  3  
ATOM   5829  H  HB3  . LEU A 1 4  ? 154.112 -4.426  -3.110  1.00 0.00 ? 4   LEU A HB3  3  
ATOM   5830  H  HG   . LEU A 1 4  ? 151.802 -3.247  -2.713  1.00 0.00 ? 4   LEU A HG   3  
ATOM   5831  H  HD11 . LEU A 1 4  ? 152.724 -3.030  0.114   1.00 0.00 ? 4   LEU A HD11 3  
ATOM   5832  H  HD12 . LEU A 1 4  ? 151.827 -4.476  -0.342  1.00 0.00 ? 4   LEU A HD12 3  
ATOM   5833  H  HD13 . LEU A 1 4  ? 151.100 -2.886  -0.555  1.00 0.00 ? 4   LEU A HD13 3  
ATOM   5834  H  HD21 . LEU A 1 4  ? 153.022 -1.258  -1.799  1.00 0.00 ? 4   LEU A HD21 3  
ATOM   5835  H  HD22 . LEU A 1 4  ? 153.873 -2.028  -3.141  1.00 0.00 ? 4   LEU A HD22 3  
ATOM   5836  H  HD23 . LEU A 1 4  ? 154.407 -2.301  -1.480  1.00 0.00 ? 4   LEU A HD23 3  
ATOM   5837  N  N    . GLU A 1 5  ? 152.578 -5.425  -5.206  1.00 0.00 ? 5   GLU A N    3  
ATOM   5838  C  CA   . GLU A 1 5  ? 152.073 -5.061  -6.518  1.00 0.00 ? 5   GLU A CA   3  
ATOM   5839  C  C    . GLU A 1 5  ? 150.966 -6.006  -6.950  1.00 0.00 ? 5   GLU A C    3  
ATOM   5840  O  O    . GLU A 1 5  ? 149.954 -5.578  -7.499  1.00 0.00 ? 5   GLU A O    3  
ATOM   5841  C  CB   . GLU A 1 5  ? 153.208 -5.102  -7.543  1.00 0.00 ? 5   GLU A CB   3  
ATOM   5842  C  CG   . GLU A 1 5  ? 152.700 -4.584  -8.889  1.00 0.00 ? 5   GLU A CG   3  
ATOM   5843  C  CD   . GLU A 1 5  ? 153.792 -4.714  -9.945  1.00 0.00 ? 5   GLU A CD   3  
ATOM   5844  O  OE1  . GLU A 1 5  ? 154.855 -5.209  -9.611  1.00 0.00 ? 5   GLU A OE1  3  
ATOM   5845  O  OE2  . GLU A 1 5  ? 153.550 -4.316  -11.072 1.00 0.00 ? 5   GLU A OE2  3  
ATOM   5846  H  H    . GLU A 1 5  ? 153.497 -5.754  -5.114  1.00 0.00 ? 5   GLU A H    3  
ATOM   5847  H  HA   . GLU A 1 5  ? 151.680 -4.057  -6.476  1.00 0.00 ? 5   GLU A HA   3  
ATOM   5848  H  HB2  . GLU A 1 5  ? 154.024 -4.482  -7.201  1.00 0.00 ? 5   GLU A HB2  3  
ATOM   5849  H  HB3  . GLU A 1 5  ? 153.552 -6.119  -7.658  1.00 0.00 ? 5   GLU A HB3  3  
ATOM   5850  H  HG2  . GLU A 1 5  ? 151.837 -5.159  -9.193  1.00 0.00 ? 5   GLU A HG2  3  
ATOM   5851  H  HG3  . GLU A 1 5  ? 152.420 -3.545  -8.791  1.00 0.00 ? 5   GLU A HG3  3  
ATOM   5852  N  N    . THR A 1 6  ? 151.158 -7.297  -6.696  1.00 0.00 ? 6   THR A N    3  
ATOM   5853  C  CA   . THR A 1 6  ? 150.148 -8.276  -7.073  1.00 0.00 ? 6   THR A CA   3  
ATOM   5854  C  C    . THR A 1 6  ? 148.839 -8.010  -6.343  1.00 0.00 ? 6   THR A C    3  
ATOM   5855  O  O    . THR A 1 6  ? 147.761 -8.083  -6.932  1.00 0.00 ? 6   THR A O    3  
ATOM   5856  C  CB   . THR A 1 6  ? 150.640 -9.688  -6.746  1.00 0.00 ? 6   THR A CB   3  
ATOM   5857  O  OG1  . THR A 1 6  ? 151.896 -9.907  -7.372  1.00 0.00 ? 6   THR A OG1  3  
ATOM   5858  C  CG2  . THR A 1 6  ? 149.626 -10.714 -7.255  1.00 0.00 ? 6   THR A CG2  3  
ATOM   5859  H  H    . THR A 1 6  ? 151.986 -7.592  -6.251  1.00 0.00 ? 6   THR A H    3  
ATOM   5860  H  HA   . THR A 1 6  ? 149.976 -8.207  -8.135  1.00 0.00 ? 6   THR A HA   3  
ATOM   5861  H  HB   . THR A 1 6  ? 150.746 -9.794  -5.677  1.00 0.00 ? 6   THR A HB   3  
ATOM   5862  H  HG1  . THR A 1 6  ? 152.349 -10.605 -6.894  1.00 0.00 ? 6   THR A HG1  3  
ATOM   5863  H  HG21 . THR A 1 6  ? 148.758 -10.712 -6.612  1.00 0.00 ? 6   THR A HG21 3  
ATOM   5864  H  HG22 . THR A 1 6  ? 150.075 -11.696 -7.252  1.00 0.00 ? 6   THR A HG22 3  
ATOM   5865  H  HG23 . THR A 1 6  ? 149.329 -10.458 -8.261  1.00 0.00 ? 6   THR A HG23 3  
ATOM   5866  N  N    . ALA A 1 7  ? 148.943 -7.700  -5.055  1.00 0.00 ? 7   ALA A N    3  
ATOM   5867  C  CA   . ALA A 1 7  ? 147.761 -7.423  -4.251  1.00 0.00 ? 7   ALA A CA   3  
ATOM   5868  C  C    . ALA A 1 7  ? 147.078 -6.133  -4.686  1.00 0.00 ? 7   ALA A C    3  
ATOM   5869  O  O    . ALA A 1 7  ? 145.852 -6.046  -4.699  1.00 0.00 ? 7   ALA A O    3  
ATOM   5870  C  CB   . ALA A 1 7  ? 148.148 -7.325  -2.776  1.00 0.00 ? 7   ALA A CB   3  
ATOM   5871  H  H    . ALA A 1 7  ? 149.830 -7.657  -4.638  1.00 0.00 ? 7   ALA A H    3  
ATOM   5872  H  HA   . ALA A 1 7  ? 147.064 -8.240  -4.368  1.00 0.00 ? 7   ALA A HA   3  
ATOM   5873  H  HB1  . ALA A 1 7  ? 148.213 -8.316  -2.356  1.00 0.00 ? 7   ALA A HB1  3  
ATOM   5874  H  HB2  . ALA A 1 7  ? 147.398 -6.758  -2.242  1.00 0.00 ? 7   ALA A HB2  3  
ATOM   5875  H  HB3  . ALA A 1 7  ? 149.104 -6.832  -2.686  1.00 0.00 ? 7   ALA A HB3  3  
ATOM   5876  N  N    . MET A 1 8  ? 147.874 -5.121  -5.015  1.00 0.00 ? 8   MET A N    3  
ATOM   5877  C  CA   . MET A 1 8  ? 147.311 -3.836  -5.416  1.00 0.00 ? 8   MET A CA   3  
ATOM   5878  C  C    . MET A 1 8  ? 146.430 -3.963  -6.658  1.00 0.00 ? 8   MET A C    3  
ATOM   5879  O  O    . MET A 1 8  ? 145.325 -3.406  -6.716  1.00 0.00 ? 8   MET A O    3  
ATOM   5880  C  CB   . MET A 1 8  ? 148.455 -2.873  -5.727  1.00 0.00 ? 8   MET A CB   3  
ATOM   5881  C  CG   . MET A 1 8  ? 147.900 -1.470  -5.943  1.00 0.00 ? 8   MET A CG   3  
ATOM   5882  S  SD   . MET A 1 8  ? 149.223 -0.392  -6.545  1.00 0.00 ? 8   MET A SD   3  
ATOM   5883  C  CE   . MET A 1 8  ? 150.305 -0.547  -5.107  1.00 0.00 ? 8   MET A CE   3  
ATOM   5884  H  H    . MET A 1 8  ? 148.852 -5.232  -4.965  1.00 0.00 ? 8   MET A H    3  
ATOM   5885  H  HA   . MET A 1 8  ? 146.727 -3.434  -4.604  1.00 0.00 ? 8   MET A HA   3  
ATOM   5886  H  HB2  . MET A 1 8  ? 149.150 -2.863  -4.900  1.00 0.00 ? 8   MET A HB2  3  
ATOM   5887  H  HB3  . MET A 1 8  ? 148.965 -3.198  -6.622  1.00 0.00 ? 8   MET A HB3  3  
ATOM   5888  H  HG2  . MET A 1 8  ? 147.102 -1.504  -6.670  1.00 0.00 ? 8   MET A HG2  3  
ATOM   5889  H  HG3  . MET A 1 8  ? 147.522 -1.087  -5.008  1.00 0.00 ? 8   MET A HG3  3  
ATOM   5890  H  HE1  . MET A 1 8  ? 150.940 -1.416  -5.230  1.00 0.00 ? 8   MET A HE1  3  
ATOM   5891  H  HE2  . MET A 1 8  ? 149.709 -0.665  -4.217  1.00 0.00 ? 8   MET A HE2  3  
ATOM   5892  H  HE3  . MET A 1 8  ? 150.915 0.341   -5.017  1.00 0.00 ? 8   MET A HE3  3  
ATOM   5893  N  N    . GLU A 1 9  ? 146.910 -4.723  -7.637  1.00 0.00 ? 9   GLU A N    3  
ATOM   5894  C  CA   . GLU A 1 9  ? 146.168 -4.911  -8.875  1.00 0.00 ? 9   GLU A CA   3  
ATOM   5895  C  C    . GLU A 1 9  ? 144.809 -5.501  -8.585  1.00 0.00 ? 9   GLU A C    3  
ATOM   5896  O  O    . GLU A 1 9  ? 143.836 -5.225  -9.287  1.00 0.00 ? 9   GLU A O    3  
ATOM   5897  C  CB   . GLU A 1 9  ? 146.946 -5.820  -9.826  1.00 0.00 ? 9   GLU A CB   3  
ATOM   5898  C  CG   . GLU A 1 9  ? 148.241 -5.121  -10.246 1.00 0.00 ? 9   GLU A CG   3  
ATOM   5899  C  CD   . GLU A 1 9  ? 149.005 -5.988  -11.242 1.00 0.00 ? 9   GLU A CD   3  
ATOM   5900  O  OE1  . GLU A 1 9  ? 148.610 -7.127  -11.430 1.00 0.00 ? 9   GLU A OE1  3  
ATOM   5901  O  OE2  . GLU A 1 9  ? 149.971 -5.500  -11.802 1.00 0.00 ? 9   GLU A OE2  3  
ATOM   5902  H  H    . GLU A 1 9  ? 147.782 -5.157  -7.527  1.00 0.00 ? 9   GLU A H    3  
ATOM   5903  H  HA   . GLU A 1 9  ? 146.034 -3.949  -9.349  1.00 0.00 ? 9   GLU A HA   3  
ATOM   5904  H  HB2  . GLU A 1 9  ? 147.180 -6.749  -9.325  1.00 0.00 ? 9   GLU A HB2  3  
ATOM   5905  H  HB3  . GLU A 1 9  ? 146.348 -6.024  -10.703 1.00 0.00 ? 9   GLU A HB3  3  
ATOM   5906  H  HG2  . GLU A 1 9  ? 148.002 -4.174  -10.705 1.00 0.00 ? 9   GLU A HG2  3  
ATOM   5907  H  HG3  . GLU A 1 9  ? 148.854 -4.950  -9.375  1.00 0.00 ? 9   GLU A HG3  3  
ATOM   5908  N  N    . THR A 1 10 ? 144.740 -6.303  -7.542  1.00 0.00 ? 10  THR A N    3  
ATOM   5909  C  CA   . THR A 1 10 ? 143.483 -6.905  -7.172  1.00 0.00 ? 10  THR A CA   3  
ATOM   5910  C  C    . THR A 1 10 ? 142.433 -5.824  -6.946  1.00 0.00 ? 10  THR A C    3  
ATOM   5911  O  O    . THR A 1 10 ? 141.266 -6.018  -7.286  1.00 0.00 ? 10  THR A O    3  
ATOM   5912  C  CB   . THR A 1 10 ? 143.639 -7.740  -5.900  1.00 0.00 ? 10  THR A CB   3  
ATOM   5913  O  OG1  . THR A 1 10 ? 144.690 -8.680  -6.077  1.00 0.00 ? 10  THR A OG1  3  
ATOM   5914  C  CG2  . THR A 1 10 ? 142.332 -8.483  -5.614  1.00 0.00 ? 10  THR A CG2  3  
ATOM   5915  H  H    . THR A 1 10 ? 145.544 -6.482  -7.010  1.00 0.00 ? 10  THR A H    3  
ATOM   5916  H  HA   . THR A 1 10 ? 143.154 -7.549  -7.974  1.00 0.00 ? 10  THR A HA   3  
ATOM   5917  H  HB   . THR A 1 10 ? 143.867 -7.093  -5.069  1.00 0.00 ? 10  THR A HB   3  
ATOM   5918  H  HG1  . THR A 1 10 ? 145.352 -8.513  -5.404  1.00 0.00 ? 10  THR A HG1  3  
ATOM   5919  H  HG21 . THR A 1 10 ? 141.663 -7.837  -5.063  1.00 0.00 ? 10  THR A HG21 3  
ATOM   5920  H  HG22 . THR A 1 10 ? 142.540 -9.367  -5.029  1.00 0.00 ? 10  THR A HG22 3  
ATOM   5921  H  HG23 . THR A 1 10 ? 141.867 -8.770  -6.546  1.00 0.00 ? 10  THR A HG23 3  
ATOM   5922  N  N    . LEU A 1 11 ? 142.829 -4.681  -6.365  1.00 0.00 ? 11  LEU A N    3  
ATOM   5923  C  CA   . LEU A 1 11 ? 141.842 -3.631  -6.130  1.00 0.00 ? 11  LEU A CA   3  
ATOM   5924  C  C    . LEU A 1 11 ? 141.269 -3.146  -7.452  1.00 0.00 ? 11  LEU A C    3  
ATOM   5925  O  O    . LEU A 1 11 ? 140.064 -2.921  -7.584  1.00 0.00 ? 11  LEU A O    3  
ATOM   5926  C  CB   . LEU A 1 11 ? 142.484 -2.440  -5.410  1.00 0.00 ? 11  LEU A CB   3  
ATOM   5927  C  CG   . LEU A 1 11 ? 143.115 -2.897  -4.096  1.00 0.00 ? 11  LEU A CG   3  
ATOM   5928  C  CD1  . LEU A 1 11 ? 143.631 -1.678  -3.328  1.00 0.00 ? 11  LEU A CD1  3  
ATOM   5929  C  CD2  . LEU A 1 11 ? 142.073 -3.631  -3.248  1.00 0.00 ? 11  LEU A CD2  3  
ATOM   5930  H  H    . LEU A 1 11 ? 143.779 -4.542  -6.110  1.00 0.00 ? 11  LEU A H    3  
ATOM   5931  H  HA   . LEU A 1 11 ? 141.042 -4.024  -5.521  1.00 0.00 ? 11  LEU A HA   3  
ATOM   5932  H  HB2  . LEU A 1 11 ? 143.247 -2.010  -6.043  1.00 0.00 ? 11  LEU A HB2  3  
ATOM   5933  H  HB3  . LEU A 1 11 ? 141.729 -1.697  -5.204  1.00 0.00 ? 11  LEU A HB3  3  
ATOM   5934  H  HG   . LEU A 1 11 ? 143.939 -3.557  -4.312  1.00 0.00 ? 11  LEU A HG   3  
ATOM   5935  H  HD11 . LEU A 1 11 ? 144.326 -2.000  -2.567  1.00 0.00 ? 11  LEU A HD11 3  
ATOM   5936  H  HD12 . LEU A 1 11 ? 142.800 -1.167  -2.864  1.00 0.00 ? 11  LEU A HD12 3  
ATOM   5937  H  HD13 . LEU A 1 11 ? 144.130 -1.007  -4.012  1.00 0.00 ? 11  LEU A HD13 3  
ATOM   5938  H  HD21 . LEU A 1 11 ? 142.025 -4.665  -3.552  1.00 0.00 ? 11  LEU A HD21 3  
ATOM   5939  H  HD22 . LEU A 1 11 ? 141.106 -3.169  -3.386  1.00 0.00 ? 11  LEU A HD22 3  
ATOM   5940  H  HD23 . LEU A 1 11 ? 142.353 -3.575  -2.206  1.00 0.00 ? 11  LEU A HD23 3  
ATOM   5941  N  N    . ILE A 1 12 ? 142.151 -2.991  -8.431  1.00 0.00 ? 12  ILE A N    3  
ATOM   5942  C  CA   . ILE A 1 12 ? 141.742 -2.533  -9.745  1.00 0.00 ? 12  ILE A CA   3  
ATOM   5943  C  C    . ILE A 1 12 ? 140.853 -3.546  -10.453 1.00 0.00 ? 12  ILE A C    3  
ATOM   5944  O  O    . ILE A 1 12 ? 139.885 -3.174  -11.105 1.00 0.00 ? 12  ILE A O    3  
ATOM   5945  C  CB   . ILE A 1 12 ? 142.973 -2.227  -10.593 1.00 0.00 ? 12  ILE A CB   3  
ATOM   5946  C  CG1  . ILE A 1 12 ? 143.804 -1.150  -9.885  1.00 0.00 ? 12  ILE A CG1  3  
ATOM   5947  C  CG2  . ILE A 1 12 ? 142.532 -1.721  -11.969 1.00 0.00 ? 12  ILE A CG2  3  
ATOM   5948  C  CD1  . ILE A 1 12 ? 145.098 -0.897  -10.663 1.00 0.00 ? 12  ILE A CD1  3  
ATOM   5949  H  H    . ILE A 1 12 ? 143.097 -3.188  -8.262  1.00 0.00 ? 12  ILE A H    3  
ATOM   5950  H  HA   . ILE A 1 12 ? 141.181 -1.617  -9.624  1.00 0.00 ? 12  ILE A HA   3  
ATOM   5951  H  HB   . ILE A 1 12 ? 143.564 -3.123  -10.710 1.00 0.00 ? 12  ILE A HB   3  
ATOM   5952  H  HG12 . ILE A 1 12 ? 143.232 -0.234  -9.831  1.00 0.00 ? 12  ILE A HG12 3  
ATOM   5953  H  HG13 . ILE A 1 12 ? 144.047 -1.484  -8.882  1.00 0.00 ? 12  ILE A HG13 3  
ATOM   5954  H  HG21 . ILE A 1 12 ? 141.838 -0.902  -11.845 1.00 0.00 ? 12  ILE A HG21 3  
ATOM   5955  H  HG22 . ILE A 1 12 ? 142.049 -2.522  -12.510 1.00 0.00 ? 12  ILE A HG22 3  
ATOM   5956  H  HG23 . ILE A 1 12 ? 143.396 -1.382  -12.522 1.00 0.00 ? 12  ILE A HG23 3  
ATOM   5957  H  HD11 . ILE A 1 12 ? 145.762 -1.737  -10.538 1.00 0.00 ? 12  ILE A HD11 3  
ATOM   5958  H  HD12 . ILE A 1 12 ? 145.574 -0.001  -10.290 1.00 0.00 ? 12  ILE A HD12 3  
ATOM   5959  H  HD13 . ILE A 1 12 ? 144.871 -0.771  -11.712 1.00 0.00 ? 12  ILE A HD13 3  
ATOM   5960  N  N    . ASN A 1 13 ? 141.197 -4.828  -10.350 1.00 0.00 ? 13  ASN A N    3  
ATOM   5961  C  CA   . ASN A 1 13 ? 140.407 -5.853  -11.021 1.00 0.00 ? 13  ASN A CA   3  
ATOM   5962  C  C    . ASN A 1 13 ? 138.961 -5.857  -10.536 1.00 0.00 ? 13  ASN A C    3  
ATOM   5963  O  O    . ASN A 1 13 ? 138.026 -5.944  -11.340 1.00 0.00 ? 13  ASN A O    3  
ATOM   5964  C  CB   . ASN A 1 13 ? 141.027 -7.229  -10.773 1.00 0.00 ? 13  ASN A CB   3  
ATOM   5965  C  CG   . ASN A 1 13 ? 140.395 -8.262  -11.700 1.00 0.00 ? 13  ASN A CG   3  
ATOM   5966  O  OD1  . ASN A 1 13 ? 140.507 -8.153  -12.921 1.00 0.00 ? 13  ASN A OD1  3  
ATOM   5967  N  ND2  . ASN A 1 13 ? 139.733 -9.265  -11.190 1.00 0.00 ? 13  ASN A ND2  3  
ATOM   5968  H  H    . ASN A 1 13 ? 141.991 -5.081  -9.835  1.00 0.00 ? 13  ASN A H    3  
ATOM   5969  H  HA   . ASN A 1 13 ? 140.416 -5.660  -12.082 1.00 0.00 ? 13  ASN A HA   3  
ATOM   5970  H  HB2  . ASN A 1 13 ? 142.090 -7.183  -10.961 1.00 0.00 ? 13  ASN A HB2  3  
ATOM   5971  H  HB3  . ASN A 1 13 ? 140.857 -7.520  -9.747  1.00 0.00 ? 13  ASN A HB3  3  
ATOM   5972  H  HD21 . ASN A 1 13 ? 139.645 -9.351  -10.218 1.00 0.00 ? 13  ASN A HD21 3  
ATOM   5973  H  HD22 . ASN A 1 13 ? 139.324 -9.932  -11.780 1.00 0.00 ? 13  ASN A HD22 3  
ATOM   5974  N  N    . VAL A 1 14 ? 138.771 -5.753  -9.220  1.00 0.00 ? 14  VAL A N    3  
ATOM   5975  C  CA   . VAL A 1 14 ? 137.421 -5.748  -8.674  1.00 0.00 ? 14  VAL A CA   3  
ATOM   5976  C  C    . VAL A 1 14 ? 136.732 -4.415  -8.928  1.00 0.00 ? 14  VAL A C    3  
ATOM   5977  O  O    . VAL A 1 14 ? 135.546 -4.374  -9.256  1.00 0.00 ? 14  VAL A O    3  
ATOM   5978  C  CB   . VAL A 1 14 ? 137.448 -6.054  -7.171  1.00 0.00 ? 14  VAL A CB   3  
ATOM   5979  C  CG1  . VAL A 1 14 ? 138.124 -7.409  -6.940  1.00 0.00 ? 14  VAL A CG1  3  
ATOM   5980  C  CG2  . VAL A 1 14 ? 138.232 -4.968  -6.429  1.00 0.00 ? 14  VAL A CG2  3  
ATOM   5981  H  H    . VAL A 1 14 ? 139.541 -5.678  -8.620  1.00 0.00 ? 14  VAL A H    3  
ATOM   5982  H  HA   . VAL A 1 14 ? 136.853 -6.523  -9.167  1.00 0.00 ? 14  VAL A HA   3  
ATOM   5983  H  HB   . VAL A 1 14 ? 136.435 -6.091  -6.795  1.00 0.00 ? 14  VAL A HB   3  
ATOM   5984  H  HG11 . VAL A 1 14 ? 137.753 -8.125  -7.659  1.00 0.00 ? 14  VAL A HG11 3  
ATOM   5985  H  HG12 . VAL A 1 14 ? 137.904 -7.756  -5.941  1.00 0.00 ? 14  VAL A HG12 3  
ATOM   5986  H  HG13 . VAL A 1 14 ? 139.192 -7.303  -7.056  1.00 0.00 ? 14  VAL A HG13 3  
ATOM   5987  H  HG21 . VAL A 1 14 ? 138.267 -5.205  -5.374  1.00 0.00 ? 14  VAL A HG21 3  
ATOM   5988  H  HG22 . VAL A 1 14 ? 137.745 -4.013  -6.568  1.00 0.00 ? 14  VAL A HG22 3  
ATOM   5989  H  HG23 . VAL A 1 14 ? 139.237 -4.920  -6.820  1.00 0.00 ? 14  VAL A HG23 3  
ATOM   5990  N  N    . PHE A 1 15 ? 137.472 -3.322  -8.793  1.00 0.00 ? 15  PHE A N    3  
ATOM   5991  C  CA   . PHE A 1 15 ? 136.882 -2.015  -9.031  1.00 0.00 ? 15  PHE A CA   3  
ATOM   5992  C  C    . PHE A 1 15 ? 136.431 -1.896  -10.482 1.00 0.00 ? 15  PHE A C    3  
ATOM   5993  O  O    . PHE A 1 15 ? 135.301 -1.506  -10.767 1.00 0.00 ? 15  PHE A O    3  
ATOM   5994  C  CB   . PHE A 1 15 ? 137.913 -0.924  -8.725  1.00 0.00 ? 15  PHE A CB   3  
ATOM   5995  C  CG   . PHE A 1 15 ? 137.273 0.439   -8.844  1.00 0.00 ? 15  PHE A CG   3  
ATOM   5996  C  CD1  . PHE A 1 15 ? 136.592 0.990   -7.752  1.00 0.00 ? 15  PHE A CD1  3  
ATOM   5997  C  CD2  . PHE A 1 15 ? 137.364 1.152   -10.046 1.00 0.00 ? 15  PHE A CD2  3  
ATOM   5998  C  CE1  . PHE A 1 15 ? 136.002 2.255   -7.862  1.00 0.00 ? 15  PHE A CE1  3  
ATOM   5999  C  CE2  . PHE A 1 15 ? 136.773 2.417   -10.155 1.00 0.00 ? 15  PHE A CE2  3  
ATOM   6000  C  CZ   . PHE A 1 15 ? 136.093 2.968   -9.063  1.00 0.00 ? 15  PHE A CZ   3  
ATOM   6001  H  H    . PHE A 1 15 ? 138.419 -3.395  -8.539  1.00 0.00 ? 15  PHE A H    3  
ATOM   6002  H  HA   . PHE A 1 15 ? 136.029 -1.885  -8.382  1.00 0.00 ? 15  PHE A HA   3  
ATOM   6003  H  HB2  . PHE A 1 15 ? 138.288 -1.058  -7.721  1.00 0.00 ? 15  PHE A HB2  3  
ATOM   6004  H  HB3  . PHE A 1 15 ? 138.731 -0.998  -9.426  1.00 0.00 ? 15  PHE A HB3  3  
ATOM   6005  H  HD1  . PHE A 1 15 ? 136.521 0.440   -6.825  1.00 0.00 ? 15  PHE A HD1  3  
ATOM   6006  H  HD2  . PHE A 1 15 ? 137.889 0.726   -10.888 1.00 0.00 ? 15  PHE A HD2  3  
ATOM   6007  H  HE1  . PHE A 1 15 ? 135.478 2.682   -7.019  1.00 0.00 ? 15  PHE A HE1  3  
ATOM   6008  H  HE2  . PHE A 1 15 ? 136.843 2.967   -11.082 1.00 0.00 ? 15  PHE A HE2  3  
ATOM   6009  H  HZ   . PHE A 1 15 ? 135.638 3.944   -9.148  1.00 0.00 ? 15  PHE A HZ   3  
ATOM   6010  N  N    . HIS A 1 16 ? 137.334 -2.241  -11.391 1.00 0.00 ? 16  HIS A N    3  
ATOM   6011  C  CA   . HIS A 1 16 ? 137.048 -2.176  -12.817 1.00 0.00 ? 16  HIS A CA   3  
ATOM   6012  C  C    . HIS A 1 16 ? 135.950 -3.150  -13.238 1.00 0.00 ? 16  HIS A C    3  
ATOM   6013  O  O    . HIS A 1 16 ? 135.033 -2.775  -13.972 1.00 0.00 ? 16  HIS A O    3  
ATOM   6014  C  CB   . HIS A 1 16 ? 138.324 -2.476  -13.604 1.00 0.00 ? 16  HIS A CB   3  
ATOM   6015  C  CG   . HIS A 1 16 ? 138.059 -2.312  -15.074 1.00 0.00 ? 16  HIS A CG   3  
ATOM   6016  N  ND1  . HIS A 1 16 ? 137.732 -1.088  -15.637 1.00 0.00 ? 16  HIS A ND1  3  
ATOM   6017  C  CD2  . HIS A 1 16 ? 138.077 -3.210  -16.113 1.00 0.00 ? 16  HIS A CD2  3  
ATOM   6018  C  CE1  . HIS A 1 16 ? 137.568 -1.280  -16.958 1.00 0.00 ? 16  HIS A CE1  3  
ATOM   6019  N  NE2  . HIS A 1 16 ? 137.766 -2.556  -17.302 1.00 0.00 ? 16  HIS A NE2  3  
ATOM   6020  H  H    . HIS A 1 16 ? 138.218 -2.544  -11.095 1.00 0.00 ? 16  HIS A H    3  
ATOM   6021  H  HA   . HIS A 1 16 ? 136.729 -1.174  -13.059 1.00 0.00 ? 16  HIS A HA   3  
ATOM   6022  H  HB2  . HIS A 1 16 ? 139.104 -1.793  -13.301 1.00 0.00 ? 16  HIS A HB2  3  
ATOM   6023  H  HB3  . HIS A 1 16 ? 138.638 -3.490  -13.407 1.00 0.00 ? 16  HIS A HB3  3  
ATOM   6024  H  HD1  . HIS A 1 16 ? 137.638 -0.237  -15.159 1.00 0.00 ? 16  HIS A HD1  3  
ATOM   6025  H  HD2  . HIS A 1 16 ? 138.304 -4.261  -16.022 1.00 0.00 ? 16  HIS A HD2  3  
ATOM   6026  H  HE1  . HIS A 1 16 ? 137.308 -0.498  -17.656 1.00 0.00 ? 16  HIS A HE1  3  
ATOM   6027  H  HE2  . HIS A 1 16 ? 137.705 -2.948  -18.199 1.00 0.00 ? 16  HIS A HE2  3  
ATOM   6028  N  N    . ALA A 1 17 ? 136.050 -4.407  -12.798 1.00 0.00 ? 17  ALA A N    3  
ATOM   6029  C  CA   . ALA A 1 17 ? 135.052 -5.399  -13.189 1.00 0.00 ? 17  ALA A CA   3  
ATOM   6030  C  C    . ALA A 1 17 ? 133.685 -5.082  -12.601 1.00 0.00 ? 17  ALA A C    3  
ATOM   6031  O  O    . ALA A 1 17 ? 132.687 -5.047  -13.321 1.00 0.00 ? 17  ALA A O    3  
ATOM   6032  C  CB   . ALA A 1 17 ? 135.495 -6.787  -12.726 1.00 0.00 ? 17  ALA A CB   3  
ATOM   6033  H  H    . ALA A 1 17 ? 136.810 -4.672  -12.228 1.00 0.00 ? 17  ALA A H    3  
ATOM   6034  H  HA   . ALA A 1 17 ? 134.970 -5.407  -14.264 1.00 0.00 ? 17  ALA A HA   3  
ATOM   6035  H  HB1  . ALA A 1 17 ? 136.495 -6.984  -13.082 1.00 0.00 ? 17  ALA A HB1  3  
ATOM   6036  H  HB2  . ALA A 1 17 ? 134.819 -7.530  -13.121 1.00 0.00 ? 17  ALA A HB2  3  
ATOM   6037  H  HB3  . ALA A 1 17 ? 135.483 -6.828  -11.647 1.00 0.00 ? 17  ALA A HB3  3  
ATOM   6038  N  N    . HIS A 1 18 ? 133.638 -4.848  -11.297 1.00 0.00 ? 18  HIS A N    3  
ATOM   6039  C  CA   . HIS A 1 18 ? 132.373 -4.533  -10.653 1.00 0.00 ? 18  HIS A CA   3  
ATOM   6040  C  C    . HIS A 1 18 ? 131.775 -3.245  -11.209 1.00 0.00 ? 18  HIS A C    3  
ATOM   6041  O  O    . HIS A 1 18 ? 130.585 -3.191  -11.522 1.00 0.00 ? 18  HIS A O    3  
ATOM   6042  C  CB   . HIS A 1 18 ? 132.567 -4.426  -9.141  1.00 0.00 ? 18  HIS A CB   3  
ATOM   6043  C  CG   . HIS A 1 18 ? 132.910 -5.787  -8.593  1.00 0.00 ? 18  HIS A CG   3  
ATOM   6044  N  ND1  . HIS A 1 18 ? 134.218 -6.222  -8.440  1.00 0.00 ? 18  HIS A ND1  3  
ATOM   6045  C  CD2  . HIS A 1 18 ? 132.119 -6.823  -8.160  1.00 0.00 ? 18  HIS A CD2  3  
ATOM   6046  C  CE1  . HIS A 1 18 ? 134.175 -7.468  -7.936  1.00 0.00 ? 18  HIS A CE1  3  
ATOM   6047  N  NE2  . HIS A 1 18 ? 132.920 -7.882  -7.745  1.00 0.00 ? 18  HIS A NE2  3  
ATOM   6048  H  H    . HIS A 1 18 ? 134.461 -4.883  -10.764 1.00 0.00 ? 18  HIS A H    3  
ATOM   6049  H  HA   . HIS A 1 18 ? 131.683 -5.340  -10.849 1.00 0.00 ? 18  HIS A HA   3  
ATOM   6050  H  HB2  . HIS A 1 18 ? 133.368 -3.735  -8.926  1.00 0.00 ? 18  HIS A HB2  3  
ATOM   6051  H  HB3  . HIS A 1 18 ? 131.654 -4.073  -8.684  1.00 0.00 ? 18  HIS A HB3  3  
ATOM   6052  H  HD1  . HIS A 1 18 ? 135.026 -5.717  -8.660  1.00 0.00 ? 18  HIS A HD1  3  
ATOM   6053  H  HD2  . HIS A 1 18 ? 131.039 -6.817  -8.144  1.00 0.00 ? 18  HIS A HD2  3  
ATOM   6054  H  HE1  . HIS A 1 18 ? 135.049 -8.061  -7.711  1.00 0.00 ? 18  HIS A HE1  3  
ATOM   6055  H  HE2  . HIS A 1 18 ? 132.626 -8.747  -7.390  1.00 0.00 ? 18  HIS A HE2  3  
ATOM   6056  N  N    . SER A 1 19 ? 132.603 -2.208  -11.336 1.00 0.00 ? 19  SER A N    3  
ATOM   6057  C  CA   . SER A 1 19 ? 132.124 -0.935  -11.862 1.00 0.00 ? 19  SER A CA   3  
ATOM   6058  C  C    . SER A 1 19 ? 131.609 -1.096  -13.285 1.00 0.00 ? 19  SER A C    3  
ATOM   6059  O  O    . SER A 1 19 ? 130.588 -0.516  -13.662 1.00 0.00 ? 19  SER A O    3  
ATOM   6060  C  CB   . SER A 1 19 ? 133.261 0.089   -11.867 1.00 0.00 ? 19  SER A CB   3  
ATOM   6061  O  OG   . SER A 1 19 ? 132.737 1.373   -12.178 1.00 0.00 ? 19  SER A OG   3  
ATOM   6062  H  H    . SER A 1 19 ? 133.544 -2.302  -11.075 1.00 0.00 ? 19  SER A H    3  
ATOM   6063  H  HA   . SER A 1 19 ? 131.326 -0.568  -11.235 1.00 0.00 ? 19  SER A HA   3  
ATOM   6064  H  HB2  . SER A 1 19 ? 133.728 0.121   -10.901 1.00 0.00 ? 19  SER A HB2  3  
ATOM   6065  H  HB3  . SER A 1 19 ? 133.996 -0.197  -12.608 1.00 0.00 ? 19  SER A HB3  3  
ATOM   6066  H  HG   . SER A 1 19 ? 132.725 1.465   -13.133 1.00 0.00 ? 19  SER A HG   3  
ATOM   6067  N  N    . GLY A 1 20 ? 132.343 -1.876  -14.073 1.00 0.00 ? 20  GLY A N    3  
ATOM   6068  C  CA   . GLY A 1 20 ? 131.985 -2.109  -15.465 1.00 0.00 ? 20  GLY A CA   3  
ATOM   6069  C  C    . GLY A 1 20 ? 130.644 -2.821  -15.624 1.00 0.00 ? 20  GLY A C    3  
ATOM   6070  O  O    . GLY A 1 20 ? 129.886 -2.531  -16.549 1.00 0.00 ? 20  GLY A O    3  
ATOM   6071  H  H    . GLY A 1 20 ? 133.154 -2.296  -13.711 1.00 0.00 ? 20  GLY A H    3  
ATOM   6072  H  HA2  . GLY A 1 20 ? 131.939 -1.160  -15.970 1.00 0.00 ? 20  GLY A HA2  3  
ATOM   6073  H  HA3  . GLY A 1 20 ? 132.755 -2.711  -15.925 1.00 0.00 ? 20  GLY A HA3  3  
ATOM   6074  N  N    . LYS A 1 21 ? 130.381 -3.784  -14.750 1.00 0.00 ? 21  LYS A N    3  
ATOM   6075  C  CA   . LYS A 1 21 ? 129.151 -4.566  -14.843 1.00 0.00 ? 21  LYS A CA   3  
ATOM   6076  C  C    . LYS A 1 21 ? 127.888 -3.713  -14.732 1.00 0.00 ? 21  LYS A C    3  
ATOM   6077  O  O    . LYS A 1 21 ? 126.928 -3.931  -15.471 1.00 0.00 ? 21  LYS A O    3  
ATOM   6078  C  CB   . LYS A 1 21 ? 129.140 -5.631  -13.746 1.00 0.00 ? 21  LYS A CB   3  
ATOM   6079  C  CG   . LYS A 1 21 ? 127.924 -6.539  -13.938 1.00 0.00 ? 21  LYS A CG   3  
ATOM   6080  C  CD   . LYS A 1 21 ? 127.864 -7.567  -12.809 1.00 0.00 ? 21  LYS A CD   3  
ATOM   6081  C  CE   . LYS A 1 21 ? 126.713 -8.537  -13.077 1.00 0.00 ? 21  LYS A CE   3  
ATOM   6082  N  NZ   . LYS A 1 21 ? 127.168 -9.607  -14.008 1.00 0.00 ? 21  LYS A NZ   3  
ATOM   6083  H  H    . LYS A 1 21 ? 131.036 -3.998  -14.054 1.00 0.00 ? 21  LYS A H    3  
ATOM   6084  H  HA   . LYS A 1 21 ? 129.140 -5.068  -15.798 1.00 0.00 ? 21  LYS A HA   3  
ATOM   6085  H  HB2  . LYS A 1 21 ? 130.048 -6.218  -13.806 1.00 0.00 ? 21  LYS A HB2  3  
ATOM   6086  H  HB3  . LYS A 1 21 ? 129.083 -5.152  -12.781 1.00 0.00 ? 21  LYS A HB3  3  
ATOM   6087  H  HG2  . LYS A 1 21 ? 127.023 -5.944  -13.928 1.00 0.00 ? 21  LYS A HG2  3  
ATOM   6088  H  HG3  . LYS A 1 21 ? 128.004 -7.052  -14.884 1.00 0.00 ? 21  LYS A HG3  3  
ATOM   6089  H  HD2  . LYS A 1 21 ? 128.796 -8.112  -12.769 1.00 0.00 ? 21  LYS A HD2  3  
ATOM   6090  H  HD3  . LYS A 1 21 ? 127.698 -7.064  -11.869 1.00 0.00 ? 21  LYS A HD3  3  
ATOM   6091  H  HE2  . LYS A 1 21 ? 126.393 -8.981  -12.146 1.00 0.00 ? 21  LYS A HE2  3  
ATOM   6092  H  HE3  . LYS A 1 21 ? 125.887 -7.998  -13.522 1.00 0.00 ? 21  LYS A HE3  3  
ATOM   6093  H  HZ1  . LYS A 1 21 ? 127.279 -10.498 -13.486 1.00 0.00 ? 21  LYS A HZ1  3  
ATOM   6094  H  HZ2  . LYS A 1 21 ? 128.081 -9.334  -14.429 1.00 0.00 ? 21  LYS A HZ2  3  
ATOM   6095  H  HZ3  . LYS A 1 21 ? 126.464 -9.734  -14.762 1.00 0.00 ? 21  LYS A HZ3  3  
ATOM   6096  N  N    . GLU A 1 22 ? 127.871 -2.754  -13.807 1.00 0.00 ? 22  GLU A N    3  
ATOM   6097  C  CA   . GLU A 1 22 ? 126.686 -1.908  -13.634 1.00 0.00 ? 22  GLU A CA   3  
ATOM   6098  C  C    . GLU A 1 22 ? 127.043 -0.424  -13.630 1.00 0.00 ? 22  GLU A C    3  
ATOM   6099  O  O    . GLU A 1 22 ? 128.122 -0.034  -13.181 1.00 0.00 ? 22  GLU A O    3  
ATOM   6100  C  CB   . GLU A 1 22 ? 125.988 -2.261  -12.321 1.00 0.00 ? 22  GLU A CB   3  
ATOM   6101  C  CG   . GLU A 1 22 ? 125.553 -3.726  -12.347 1.00 0.00 ? 22  GLU A CG   3  
ATOM   6102  C  CD   . GLU A 1 22 ? 124.782 -4.063  -11.075 1.00 0.00 ? 22  GLU A CD   3  
ATOM   6103  O  OE1  . GLU A 1 22 ? 124.763 -3.233  -10.181 1.00 0.00 ? 22  GLU A OE1  3  
ATOM   6104  O  OE2  . GLU A 1 22 ? 124.222 -5.145  -11.014 1.00 0.00 ? 22  GLU A OE2  3  
ATOM   6105  H  H    . GLU A 1 22 ? 128.653 -2.620  -13.231 1.00 0.00 ? 22  GLU A H    3  
ATOM   6106  H  HA   . GLU A 1 22 ? 125.998 -2.098  -14.445 1.00 0.00 ? 22  GLU A HA   3  
ATOM   6107  H  HB2  . GLU A 1 22 ? 126.672 -2.104  -11.501 1.00 0.00 ? 22  GLU A HB2  3  
ATOM   6108  H  HB3  . GLU A 1 22 ? 125.121 -1.632  -12.193 1.00 0.00 ? 22  GLU A HB3  3  
ATOM   6109  H  HG2  . GLU A 1 22 ? 124.922 -3.898  -13.206 1.00 0.00 ? 22  GLU A HG2  3  
ATOM   6110  H  HG3  . GLU A 1 22 ? 126.426 -4.357  -12.411 1.00 0.00 ? 22  GLU A HG3  3  
ATOM   6111  N  N    . GLY A 1 23 ? 126.118 0.402   -14.110 1.00 0.00 ? 23  GLY A N    3  
ATOM   6112  C  CA   . GLY A 1 23 ? 126.337 1.843   -14.128 1.00 0.00 ? 23  GLY A CA   3  
ATOM   6113  C  C    . GLY A 1 23 ? 127.283 2.229   -15.252 1.00 0.00 ? 23  GLY A C    3  
ATOM   6114  O  O    . GLY A 1 23 ? 127.560 1.426   -16.144 1.00 0.00 ? 23  GLY A O    3  
ATOM   6115  H  H    . GLY A 1 23 ? 125.269 0.038   -14.438 1.00 0.00 ? 23  GLY A H    3  
ATOM   6116  H  HA2  . GLY A 1 23 ? 125.390 2.344   -14.270 1.00 0.00 ? 23  GLY A HA2  3  
ATOM   6117  H  HA3  . GLY A 1 23 ? 126.766 2.149   -13.185 1.00 0.00 ? 23  GLY A HA3  3  
ATOM   6118  N  N    . ASP A 1 24 ? 127.805 3.448   -15.191 1.00 0.00 ? 24  ASP A N    3  
ATOM   6119  C  CA   . ASP A 1 24 ? 128.748 3.893   -16.202 1.00 0.00 ? 24  ASP A CA   3  
ATOM   6120  C  C    . ASP A 1 24 ? 130.054 3.136   -16.013 1.00 0.00 ? 24  ASP A C    3  
ATOM   6121  O  O    . ASP A 1 24 ? 130.509 2.945   -14.879 1.00 0.00 ? 24  ASP A O    3  
ATOM   6122  C  CB   . ASP A 1 24 ? 128.993 5.399   -16.075 1.00 0.00 ? 24  ASP A CB   3  
ATOM   6123  C  CG   . ASP A 1 24 ? 127.716 6.165   -16.404 1.00 0.00 ? 24  ASP A CG   3  
ATOM   6124  O  OD1  . ASP A 1 24 ? 126.805 5.556   -16.941 1.00 0.00 ? 24  ASP A OD1  3  
ATOM   6125  O  OD2  . ASP A 1 24 ? 127.668 7.349   -16.115 1.00 0.00 ? 24  ASP A OD2  3  
ATOM   6126  H  H    . ASP A 1 24 ? 127.571 4.042   -14.447 1.00 0.00 ? 24  ASP A H    3  
ATOM   6127  H  HA   . ASP A 1 24 ? 128.349 3.678   -17.182 1.00 0.00 ? 24  ASP A HA   3  
ATOM   6128  H  HB2  . ASP A 1 24 ? 129.299 5.628   -15.064 1.00 0.00 ? 24  ASP A HB2  3  
ATOM   6129  H  HB3  . ASP A 1 24 ? 129.773 5.693   -16.760 1.00 0.00 ? 24  ASP A HB3  3  
ATOM   6130  N  N    . LYS A 1 25 ? 130.644 2.683   -17.112 1.00 0.00 ? 25  LYS A N    3  
ATOM   6131  C  CA   . LYS A 1 25 ? 131.888 1.933   -17.025 1.00 0.00 ? 25  LYS A CA   3  
ATOM   6132  C  C    . LYS A 1 25 ? 132.984 2.790   -16.394 1.00 0.00 ? 25  LYS A C    3  
ATOM   6133  O  O    . LYS A 1 25 ? 133.780 2.311   -15.586 1.00 0.00 ? 25  LYS A O    3  
ATOM   6134  C  CB   . LYS A 1 25 ? 132.339 1.520   -18.432 1.00 0.00 ? 25  LYS A CB   3  
ATOM   6135  C  CG   . LYS A 1 25 ? 131.240 0.722   -19.154 1.00 0.00 ? 25  LYS A CG   3  
ATOM   6136  C  CD   . LYS A 1 25 ? 130.960 -0.600  -18.432 1.00 0.00 ? 25  LYS A CD   3  
ATOM   6137  C  CE   . LYS A 1 25 ? 130.052 -1.475  -19.302 1.00 0.00 ? 25  LYS A CE   3  
ATOM   6138  N  NZ   . LYS A 1 25 ? 130.178 -2.897  -18.873 1.00 0.00 ? 25  LYS A NZ   3  
ATOM   6139  H  H    . LYS A 1 25 ? 130.233 2.844   -17.986 1.00 0.00 ? 25  LYS A H    3  
ATOM   6140  H  HA   . LYS A 1 25 ? 131.738 1.054   -16.423 1.00 0.00 ? 25  LYS A HA   3  
ATOM   6141  H  HB2  . LYS A 1 25 ? 132.567 2.407   -19.005 1.00 0.00 ? 25  LYS A HB2  3  
ATOM   6142  H  HB3  . LYS A 1 25 ? 133.227 0.910   -18.354 1.00 0.00 ? 25  LYS A HB3  3  
ATOM   6143  H  HG2  . LYS A 1 25 ? 130.334 1.311   -19.183 1.00 0.00 ? 25  LYS A HG2  3  
ATOM   6144  H  HG3  . LYS A 1 25 ? 131.561 0.516   -20.165 1.00 0.00 ? 25  LYS A HG3  3  
ATOM   6145  H  HD2  . LYS A 1 25 ? 131.889 -1.116  -18.247 1.00 0.00 ? 25  LYS A HD2  3  
ATOM   6146  H  HD3  . LYS A 1 25 ? 130.460 -0.401  -17.499 1.00 0.00 ? 25  LYS A HD3  3  
ATOM   6147  H  HE2  . LYS A 1 25 ? 129.028 -1.154  -19.189 1.00 0.00 ? 25  LYS A HE2  3  
ATOM   6148  H  HE3  . LYS A 1 25 ? 130.346 -1.386  -20.338 1.00 0.00 ? 25  LYS A HE3  3  
ATOM   6149  H  HZ1  . LYS A 1 25 ? 130.944 -2.983  -18.176 1.00 0.00 ? 25  LYS A HZ1  3  
ATOM   6150  H  HZ2  . LYS A 1 25 ? 130.391 -3.490  -19.701 1.00 0.00 ? 25  LYS A HZ2  3  
ATOM   6151  H  HZ3  . LYS A 1 25 ? 129.285 -3.209  -18.442 1.00 0.00 ? 25  LYS A HZ3  3  
ATOM   6152  N  N    . TYR A 1 26 ? 133.018 4.059   -16.788 1.00 0.00 ? 26  TYR A N    3  
ATOM   6153  C  CA   . TYR A 1 26 ? 134.019 4.997   -16.286 1.00 0.00 ? 26  TYR A CA   3  
ATOM   6154  C  C    . TYR A 1 26 ? 133.825 5.356   -14.811 1.00 0.00 ? 26  TYR A C    3  
ATOM   6155  O  O    . TYR A 1 26 ? 134.795 5.640   -14.109 1.00 0.00 ? 26  TYR A O    3  
ATOM   6156  C  CB   . TYR A 1 26 ? 133.982 6.278   -17.120 1.00 0.00 ? 26  TYR A CB   3  
ATOM   6157  C  CG   . TYR A 1 26 ? 134.319 5.955   -18.557 1.00 0.00 ? 26  TYR A CG   3  
ATOM   6158  C  CD1  . TYR A 1 26 ? 135.656 5.821   -18.949 1.00 0.00 ? 26  TYR A CD1  3  
ATOM   6159  C  CD2  . TYR A 1 26 ? 133.294 5.792   -19.496 1.00 0.00 ? 26  TYR A CD2  3  
ATOM   6160  C  CE1  . TYR A 1 26 ? 135.968 5.522   -20.280 1.00 0.00 ? 26  TYR A CE1  3  
ATOM   6161  C  CE2  . TYR A 1 26 ? 133.606 5.492   -20.829 1.00 0.00 ? 26  TYR A CE2  3  
ATOM   6162  C  CZ   . TYR A 1 26 ? 134.943 5.358   -21.221 1.00 0.00 ? 26  TYR A CZ   3  
ATOM   6163  O  OH   . TYR A 1 26 ? 135.251 5.064   -22.533 1.00 0.00 ? 26  TYR A OH   3  
ATOM   6164  H  H    . TYR A 1 26 ? 132.360 4.372   -17.444 1.00 0.00 ? 26  TYR A H    3  
ATOM   6165  H  HA   . TYR A 1 26 ? 134.994 4.550   -16.402 1.00 0.00 ? 26  TYR A HA   3  
ATOM   6166  H  HB2  . TYR A 1 26 ? 132.993 6.712   -17.070 1.00 0.00 ? 26  TYR A HB2  3  
ATOM   6167  H  HB3  . TYR A 1 26 ? 134.703 6.981   -16.731 1.00 0.00 ? 26  TYR A HB3  3  
ATOM   6168  H  HD1  . TYR A 1 26 ? 136.447 5.948   -18.224 1.00 0.00 ? 26  TYR A HD1  3  
ATOM   6169  H  HD2  . TYR A 1 26 ? 132.262 5.896   -19.194 1.00 0.00 ? 26  TYR A HD2  3  
ATOM   6170  H  HE1  . TYR A 1 26 ? 137.000 5.419   -20.583 1.00 0.00 ? 26  TYR A HE1  3  
ATOM   6171  H  HE2  . TYR A 1 26 ? 132.816 5.366   -21.553 1.00 0.00 ? 26  TYR A HE2  3  
ATOM   6172  H  HH   . TYR A 1 26 ? 135.057 4.136   -22.682 1.00 0.00 ? 26  TYR A HH   3  
ATOM   6173  N  N    . LYS A 1 27 ? 132.571 5.401   -14.354 1.00 0.00 ? 27  LYS A N    3  
ATOM   6174  C  CA   . LYS A 1 27 ? 132.291 5.800   -12.970 1.00 0.00 ? 27  LYS A CA   3  
ATOM   6175  C  C    . LYS A 1 27 ? 131.624 4.703   -12.142 1.00 0.00 ? 27  LYS A C    3  
ATOM   6176  O  O    . LYS A 1 27 ? 130.889 3.857   -12.657 1.00 0.00 ? 27  LYS A O    3  
ATOM   6177  C  CB   . LYS A 1 27 ? 131.391 7.036   -12.971 1.00 0.00 ? 27  LYS A CB   3  
ATOM   6178  C  CG   . LYS A 1 27 ? 132.126 8.204   -13.632 1.00 0.00 ? 27  LYS A CG   3  
ATOM   6179  C  CD   . LYS A 1 27 ? 131.273 9.468   -13.530 1.00 0.00 ? 27  LYS A CD   3  
ATOM   6180  C  CE   . LYS A 1 27 ? 131.952 10.606  -14.293 1.00 0.00 ? 27  LYS A CE   3  
ATOM   6181  N  NZ   . LYS A 1 27 ? 130.947 11.661  -14.610 1.00 0.00 ? 27  LYS A NZ   3  
ATOM   6182  H  H    . LYS A 1 27 ? 131.828 5.208   -14.963 1.00 0.00 ? 27  LYS A H    3  
ATOM   6183  H  HA   . LYS A 1 27 ? 133.221 6.067   -12.490 1.00 0.00 ? 27  LYS A HA   3  
ATOM   6184  H  HB2  . LYS A 1 27 ? 130.486 6.823   -13.521 1.00 0.00 ? 27  LYS A HB2  3  
ATOM   6185  H  HB3  . LYS A 1 27 ? 131.141 7.301   -11.955 1.00 0.00 ? 27  LYS A HB3  3  
ATOM   6186  H  HG2  . LYS A 1 27 ? 133.071 8.363   -13.131 1.00 0.00 ? 27  LYS A HG2  3  
ATOM   6187  H  HG3  . LYS A 1 27 ? 132.305 7.975   -14.671 1.00 0.00 ? 27  LYS A HG3  3  
ATOM   6188  H  HD2  . LYS A 1 27 ? 130.299 9.278   -13.956 1.00 0.00 ? 27  LYS A HD2  3  
ATOM   6189  H  HD3  . LYS A 1 27 ? 131.165 9.747   -12.492 1.00 0.00 ? 27  LYS A HD3  3  
ATOM   6190  H  HE2  . LYS A 1 27 ? 132.737 11.030  -13.684 1.00 0.00 ? 27  LYS A HE2  3  
ATOM   6191  H  HE3  . LYS A 1 27 ? 132.374 10.224  -15.209 1.00 0.00 ? 27  LYS A HE3  3  
ATOM   6192  H  HZ1  . LYS A 1 27 ? 130.363 11.353  -15.412 1.00 0.00 ? 27  LYS A HZ1  3  
ATOM   6193  H  HZ2  . LYS A 1 27 ? 131.438 12.544  -14.856 1.00 0.00 ? 27  LYS A HZ2  3  
ATOM   6194  H  HZ3  . LYS A 1 27 ? 130.339 11.820  -13.782 1.00 0.00 ? 27  LYS A HZ3  3  
ATOM   6195  N  N    . LEU A 1 28 ? 131.878 4.765   -10.835 1.00 0.00 ? 28  LEU A N    3  
ATOM   6196  C  CA   . LEU A 1 28 ? 131.302 3.826   -9.881  1.00 0.00 ? 28  LEU A CA   3  
ATOM   6197  C  C    . LEU A 1 28 ? 130.124 4.481   -9.164  1.00 0.00 ? 28  LEU A C    3  
ATOM   6198  O  O    . LEU A 1 28 ? 130.214 5.629   -8.728  1.00 0.00 ? 28  LEU A O    3  
ATOM   6199  C  CB   . LEU A 1 28 ? 132.357 3.389   -8.850  1.00 0.00 ? 28  LEU A CB   3  
ATOM   6200  C  CG   . LEU A 1 28 ? 131.757 2.343   -7.894  1.00 0.00 ? 28  LEU A CG   3  
ATOM   6201  C  CD1  . LEU A 1 28 ? 131.569 1.011   -8.621  1.00 0.00 ? 28  LEU A CD1  3  
ATOM   6202  C  CD2  . LEU A 1 28 ? 132.700 2.131   -6.708  1.00 0.00 ? 28  LEU A CD2  3  
ATOM   6203  H  H    . LEU A 1 28 ? 132.455 5.484   -10.501 1.00 0.00 ? 28  LEU A H    3  
ATOM   6204  H  HA   . LEU A 1 28 ? 130.950 2.958   -10.415 1.00 0.00 ? 28  LEU A HA   3  
ATOM   6205  H  HB2  . LEU A 1 28 ? 133.203 2.960   -9.367  1.00 0.00 ? 28  LEU A HB2  3  
ATOM   6206  H  HB3  . LEU A 1 28 ? 132.684 4.248   -8.280  1.00 0.00 ? 28  LEU A HB3  3  
ATOM   6207  H  HG   . LEU A 1 28 ? 130.800 2.689   -7.532  1.00 0.00 ? 28  LEU A HG   3  
ATOM   6208  H  HD11 . LEU A 1 28 ? 131.462 0.218   -7.896  1.00 0.00 ? 28  LEU A HD11 3  
ATOM   6209  H  HD12 . LEU A 1 28 ? 132.428 0.817   -9.237  1.00 0.00 ? 28  LEU A HD12 3  
ATOM   6210  H  HD13 . LEU A 1 28 ? 130.685 1.053   -9.238  1.00 0.00 ? 28  LEU A HD13 3  
ATOM   6211  H  HD21 . LEU A 1 28 ? 132.164 1.647   -5.906  1.00 0.00 ? 28  LEU A HD21 3  
ATOM   6212  H  HD22 . LEU A 1 28 ? 133.073 3.086   -6.366  1.00 0.00 ? 28  LEU A HD22 3  
ATOM   6213  H  HD23 . LEU A 1 28 ? 133.528 1.509   -7.014  1.00 0.00 ? 28  LEU A HD23 3  
ATOM   6214  N  N    . SER A 1 29 ? 129.022 3.749   -9.043  1.00 0.00 ? 29  SER A N    3  
ATOM   6215  C  CA   . SER A 1 29 ? 127.835 4.274   -8.373  1.00 0.00 ? 29  SER A CA   3  
ATOM   6216  C  C    . SER A 1 29 ? 127.729 3.672   -6.978  1.00 0.00 ? 29  SER A C    3  
ATOM   6217  O  O    . SER A 1 29 ? 128.200 2.556   -6.736  1.00 0.00 ? 29  SER A O    3  
ATOM   6218  C  CB   . SER A 1 29 ? 126.583 3.930   -9.179  1.00 0.00 ? 29  SER A CB   3  
ATOM   6219  O  OG   . SER A 1 29 ? 126.691 4.494   -10.480 1.00 0.00 ? 29  SER A OG   3  
ATOM   6220  H  H    . SER A 1 29 ? 129.005 2.840   -9.408  1.00 0.00 ? 29  SER A H    3  
ATOM   6221  H  HA   . SER A 1 29 ? 127.917 5.349   -8.290  1.00 0.00 ? 29  SER A HA   3  
ATOM   6222  H  HB2  . SER A 1 29 ? 126.489 2.860   -9.265  1.00 0.00 ? 29  SER A HB2  3  
ATOM   6223  H  HB3  . SER A 1 29 ? 125.711 4.327   -8.675  1.00 0.00 ? 29  SER A HB3  3  
ATOM   6224  H  HG   . SER A 1 29 ? 127.515 4.985   -10.523 1.00 0.00 ? 29  SER A HG   3  
ATOM   6225  N  N    . LYS A 1 30 ? 127.136 4.413   -6.047  1.00 0.00 ? 30  LYS A N    3  
ATOM   6226  C  CA   . LYS A 1 30 ? 127.031 3.904   -4.692  1.00 0.00 ? 30  LYS A CA   3  
ATOM   6227  C  C    . LYS A 1 30 ? 126.317 2.570   -4.683  1.00 0.00 ? 30  LYS A C    3  
ATOM   6228  O  O    . LYS A 1 30 ? 126.660 1.692   -3.898  1.00 0.00 ? 30  LYS A O    3  
ATOM   6229  C  CB   . LYS A 1 30 ? 126.267 4.846   -3.772  1.00 0.00 ? 30  LYS A CB   3  
ATOM   6230  C  CG   . LYS A 1 30 ? 126.362 4.288   -2.343  1.00 0.00 ? 30  LYS A CG   3  
ATOM   6231  C  CD   . LYS A 1 30 ? 125.505 5.118   -1.405  1.00 0.00 ? 30  LYS A CD   3  
ATOM   6232  C  CE   . LYS A 1 30 ? 125.759 4.686   0.041   1.00 0.00 ? 30  LYS A CE   3  
ATOM   6233  N  NZ   . LYS A 1 30 ? 124.613 5.110   0.894   1.00 0.00 ? 30  LYS A NZ   3  
ATOM   6234  H  H    . LYS A 1 30 ? 126.790 5.302   -6.270  1.00 0.00 ? 30  LYS A H    3  
ATOM   6235  H  HA   . LYS A 1 30 ? 128.026 3.773   -4.301  1.00 0.00 ? 30  LYS A HA   3  
ATOM   6236  H  HB2  . LYS A 1 30 ? 126.705 5.833   -3.813  1.00 0.00 ? 30  LYS A HB2  3  
ATOM   6237  H  HB3  . LYS A 1 30 ? 125.231 4.891   -4.073  1.00 0.00 ? 30  LYS A HB3  3  
ATOM   6238  H  HG2  . LYS A 1 30 ? 126.016 3.266   -2.324  1.00 0.00 ? 30  LYS A HG2  3  
ATOM   6239  H  HG3  . LYS A 1 30 ? 127.389 4.324   -2.012  1.00 0.00 ? 30  LYS A HG3  3  
ATOM   6240  H  HD2  . LYS A 1 30 ? 125.744 6.160   -1.524  1.00 0.00 ? 30  LYS A HD2  3  
ATOM   6241  H  HD3  . LYS A 1 30 ? 124.469 4.949   -1.647  1.00 0.00 ? 30  LYS A HD3  3  
ATOM   6242  H  HE2  . LYS A 1 30 ? 125.862 3.612   0.083   1.00 0.00 ? 30  LYS A HE2  3  
ATOM   6243  H  HE3  . LYS A 1 30 ? 126.664 5.149   0.399   1.00 0.00 ? 30  LYS A HE3  3  
ATOM   6244  H  HZ1  . LYS A 1 30 ? 124.251 4.291   1.422   1.00 0.00 ? 30  LYS A HZ1  3  
ATOM   6245  H  HZ2  . LYS A 1 30 ? 123.858 5.497   0.292   1.00 0.00 ? 30  LYS A HZ2  3  
ATOM   6246  H  HZ3  . LYS A 1 30 ? 124.930 5.839   1.564   1.00 0.00 ? 30  LYS A HZ3  3  
ATOM   6247  N  N    . LYS A 1 31 ? 125.316 2.406   -5.537  1.00 0.00 ? 31  LYS A N    3  
ATOM   6248  C  CA   . LYS A 1 31 ? 124.604 1.146   -5.542  1.00 0.00 ? 31  LYS A CA   3  
ATOM   6249  C  C    . LYS A 1 31 ? 125.615 0.040   -5.756  1.00 0.00 ? 31  LYS A C    3  
ATOM   6250  O  O    . LYS A 1 31 ? 125.574 -0.992  -5.088  1.00 0.00 ? 31  LYS A O    3  
ATOM   6251  C  CB   . LYS A 1 31 ? 123.555 1.120   -6.656  1.00 0.00 ? 31  LYS A CB   3  
ATOM   6252  C  CG   . LYS A 1 31 ? 122.735 -0.167  -6.548  1.00 0.00 ? 31  LYS A CG   3  
ATOM   6253  C  CD   . LYS A 1 31 ? 121.724 -0.231  -7.695  1.00 0.00 ? 31  LYS A CD   3  
ATOM   6254  C  CE   . LYS A 1 31 ? 120.808 -1.442  -7.501  1.00 0.00 ? 31  LYS A CE   3  
ATOM   6255  N  NZ   . LYS A 1 31 ? 119.747 -1.435  -8.546  1.00 0.00 ? 31  LYS A NZ   3  
ATOM   6256  H  H    . LYS A 1 31 ? 125.057 3.129   -6.146  1.00 0.00 ? 31  LYS A H    3  
ATOM   6257  H  HA   . LYS A 1 31 ? 124.118 1.007   -4.588  1.00 0.00 ? 31  LYS A HA   3  
ATOM   6258  H  HB2  . LYS A 1 31 ? 122.902 1.975   -6.554  1.00 0.00 ? 31  LYS A HB2  3  
ATOM   6259  H  HB3  . LYS A 1 31 ? 124.047 1.152   -7.615  1.00 0.00 ? 31  LYS A HB3  3  
ATOM   6260  H  HG2  . LYS A 1 31 ? 123.396 -1.020  -6.602  1.00 0.00 ? 31  LYS A HG2  3  
ATOM   6261  H  HG3  . LYS A 1 31 ? 122.207 -0.179  -5.606  1.00 0.00 ? 31  LYS A HG3  3  
ATOM   6262  H  HD2  . LYS A 1 31 ? 121.132 0.672   -7.704  1.00 0.00 ? 31  LYS A HD2  3  
ATOM   6263  H  HD3  . LYS A 1 31 ? 122.250 -0.328  -8.633  1.00 0.00 ? 31  LYS A HD3  3  
ATOM   6264  H  HE2  . LYS A 1 31 ? 121.389 -2.348  -7.584  1.00 0.00 ? 31  LYS A HE2  3  
ATOM   6265  H  HE3  . LYS A 1 31 ? 120.352 -1.395  -6.524  1.00 0.00 ? 31  LYS A HE3  3  
ATOM   6266  H  HZ1  . LYS A 1 31 ? 119.492 -0.454  -8.777  1.00 0.00 ? 31  LYS A HZ1  3  
ATOM   6267  H  HZ2  . LYS A 1 31 ? 118.907 -1.937  -8.191  1.00 0.00 ? 31  LYS A HZ2  3  
ATOM   6268  H  HZ3  . LYS A 1 31 ? 120.099 -1.909  -9.401  1.00 0.00 ? 31  LYS A HZ3  3  
ATOM   6269  N  N    . GLU A 1 32 ? 126.562 0.284   -6.656  1.00 0.00 ? 32  GLU A N    3  
ATOM   6270  C  CA   . GLU A 1 32 ? 127.610 -0.685  -6.889  1.00 0.00 ? 32  GLU A CA   3  
ATOM   6271  C  C    . GLU A 1 32 ? 128.502 -0.793  -5.656  1.00 0.00 ? 32  GLU A C    3  
ATOM   6272  O  O    . GLU A 1 32 ? 128.980 -1.875  -5.320  1.00 0.00 ? 32  GLU A O    3  
ATOM   6273  C  CB   . GLU A 1 32 ? 128.466 -0.284  -8.097  1.00 0.00 ? 32  GLU A CB   3  
ATOM   6274  C  CG   . GLU A 1 32 ? 127.621 -0.321  -9.371  1.00 0.00 ? 32  GLU A CG   3  
ATOM   6275  C  CD   . GLU A 1 32 ? 128.504 -0.074  -10.597 1.00 0.00 ? 32  GLU A CD   3  
ATOM   6276  O  OE1  . GLU A 1 32 ? 128.825 1.077   -10.864 1.00 0.00 ? 32  GLU A OE1  3  
ATOM   6277  O  OE2  . GLU A 1 32 ? 128.841 -1.043  -11.257 1.00 0.00 ? 32  GLU A OE2  3  
ATOM   6278  H  H    . GLU A 1 32 ? 126.573 1.141   -7.133  1.00 0.00 ? 32  GLU A H    3  
ATOM   6279  H  HA   . GLU A 1 32 ? 127.161 -1.648  -7.083  1.00 0.00 ? 32  GLU A HA   3  
ATOM   6280  H  HB2  . GLU A 1 32 ? 128.846 0.715   -7.947  1.00 0.00 ? 32  GLU A HB2  3  
ATOM   6281  H  HB3  . GLU A 1 32 ? 129.292 -0.972  -8.196  1.00 0.00 ? 32  GLU A HB3  3  
ATOM   6282  H  HG2  . GLU A 1 32 ? 127.149 -1.288  -9.455  1.00 0.00 ? 32  GLU A HG2  3  
ATOM   6283  H  HG3  . GLU A 1 32 ? 126.861 0.445   -9.319  1.00 0.00 ? 32  GLU A HG3  3  
ATOM   6284  N  N    . LEU A 1 33 ? 128.751 0.349   -4.999  1.00 0.00 ? 33  LEU A N    3  
ATOM   6285  C  CA   . LEU A 1 33 ? 129.623 0.347   -3.824  1.00 0.00 ? 33  LEU A CA   3  
ATOM   6286  C  C    . LEU A 1 33 ? 129.042 -0.462  -2.665  1.00 0.00 ? 33  LEU A C    3  
ATOM   6287  O  O    . LEU A 1 33 ? 129.739 -1.286  -2.077  1.00 0.00 ? 33  LEU A O    3  
ATOM   6288  C  CB   . LEU A 1 33 ? 129.854 1.786   -3.353  1.00 0.00 ? 33  LEU A CB   3  
ATOM   6289  C  CG   . LEU A 1 33 ? 130.868 1.817   -2.201  1.00 0.00 ? 33  LEU A CG   3  
ATOM   6290  C  CD1  . LEU A 1 33 ? 132.275 1.530   -2.731  1.00 0.00 ? 33  LEU A CD1  3  
ATOM   6291  C  CD2  . LEU A 1 33 ? 130.847 3.205   -1.555  1.00 0.00 ? 33  LEU A CD2  3  
ATOM   6292  H  H    . LEU A 1 33 ? 128.365 1.194   -5.324  1.00 0.00 ? 33  LEU A H    3  
ATOM   6293  H  HA   . LEU A 1 33 ? 130.574 -0.079  -4.101  1.00 0.00 ? 33  LEU A HA   3  
ATOM   6294  H  HB2  . LEU A 1 33 ? 130.222 2.380   -4.176  1.00 0.00 ? 33  LEU A HB2  3  
ATOM   6295  H  HB3  . LEU A 1 33 ? 128.918 2.194   -3.006  1.00 0.00 ? 33  LEU A HB3  3  
ATOM   6296  H  HG   . LEU A 1 33 ? 130.606 1.076   -1.462  1.00 0.00 ? 33  LEU A HG   3  
ATOM   6297  H  HD11 . LEU A 1 33 ? 132.399 0.466   -2.869  1.00 0.00 ? 33  LEU A HD11 3  
ATOM   6298  H  HD12 . LEU A 1 33 ? 133.006 1.888   -2.021  1.00 0.00 ? 33  LEU A HD12 3  
ATOM   6299  H  HD13 . LEU A 1 33 ? 132.415 2.034   -3.675  1.00 0.00 ? 33  LEU A HD13 3  
ATOM   6300  H  HD21 . LEU A 1 33 ? 130.015 3.270   -0.869  1.00 0.00 ? 33  LEU A HD21 3  
ATOM   6301  H  HD22 . LEU A 1 33 ? 130.741 3.957   -2.322  1.00 0.00 ? 33  LEU A HD22 3  
ATOM   6302  H  HD23 . LEU A 1 33 ? 131.769 3.364   -1.019  1.00 0.00 ? 33  LEU A HD23 3  
ATOM   6303  N  N    . LYS A 1 34 ? 127.771 -0.247  -2.325  1.00 0.00 ? 34  LYS A N    3  
ATOM   6304  C  CA   . LYS A 1 34 ? 127.197 -0.988  -1.236  1.00 0.00 ? 34  LYS A CA   3  
ATOM   6305  C  C    . LYS A 1 34 ? 127.218 -2.483  -1.525  1.00 0.00 ? 34  LYS A C    3  
ATOM   6306  O  O    . LYS A 1 34 ? 127.610 -3.286  -0.679  1.00 0.00 ? 34  LYS A O    3  
ATOM   6307  C  CB   . LYS A 1 34 ? 125.774 -0.503  -1.051  1.00 0.00 ? 34  LYS A CB   3  
ATOM   6308  C  CG   . LYS A 1 34 ? 125.179 -1.112  0.198   1.00 0.00 ? 34  LYS A CG   3  
ATOM   6309  C  CD   . LYS A 1 34 ? 123.686 -0.834  0.193   1.00 0.00 ? 34  LYS A CD   3  
ATOM   6310  C  CE   . LYS A 1 34 ? 123.432 0.663   0.392   1.00 0.00 ? 34  LYS A CE   3  
ATOM   6311  N  NZ   . LYS A 1 34 ? 122.081 0.862   0.990   1.00 0.00 ? 34  LYS A NZ   3  
ATOM   6312  H  H    . LYS A 1 34 ? 127.214 0.423   -2.791  1.00 0.00 ? 34  LYS A H    3  
ATOM   6313  H  HA   . LYS A 1 34 ? 127.755 -0.791  -0.335  1.00 0.00 ? 34  LYS A HA   3  
ATOM   6314  H  HB2  . LYS A 1 34 ? 125.771 0.574   -0.958  1.00 0.00 ? 34  LYS A HB2  3  
ATOM   6315  H  HB3  . LYS A 1 34 ? 125.182 -0.791  -1.906  1.00 0.00 ? 34  LYS A HB3  3  
ATOM   6316  H  HG2  . LYS A 1 34 ? 125.353 -2.178  0.197   1.00 0.00 ? 34  LYS A HG2  3  
ATOM   6317  H  HG3  . LYS A 1 34 ? 125.629 -0.668  1.072   1.00 0.00 ? 34  LYS A HG3  3  
ATOM   6318  H  HD2  . LYS A 1 34 ? 123.261 -1.152  -0.748  1.00 0.00 ? 34  LYS A HD2  3  
ATOM   6319  H  HD3  . LYS A 1 34 ? 123.238 -1.378  0.984   1.00 0.00 ? 34  LYS A HD3  3  
ATOM   6320  H  HE2  . LYS A 1 34 ? 124.180 1.074   1.053   1.00 0.00 ? 34  LYS A HE2  3  
ATOM   6321  H  HE3  . LYS A 1 34 ? 123.479 1.166   -0.563  1.00 0.00 ? 34  LYS A HE3  3  
ATOM   6322  H  HZ1  . LYS A 1 34 ? 121.689 -0.058  1.275   1.00 0.00 ? 34  LYS A HZ1  3  
ATOM   6323  H  HZ2  . LYS A 1 34 ? 121.453 1.304   0.287   1.00 0.00 ? 34  LYS A HZ2  3  
ATOM   6324  H  HZ3  . LYS A 1 34 ? 122.158 1.477   1.823   1.00 0.00 ? 34  LYS A HZ3  3  
ATOM   6325  N  N    . GLU A 1 35 ? 126.816 -2.854  -2.732  1.00 0.00 ? 35  GLU A N    3  
ATOM   6326  C  CA   . GLU A 1 35 ? 126.811 -4.258  -3.105  1.00 0.00 ? 35  GLU A CA   3  
ATOM   6327  C  C    . GLU A 1 35 ? 128.224 -4.827  -3.136  1.00 0.00 ? 35  GLU A C    3  
ATOM   6328  O  O    . GLU A 1 35 ? 128.448 -5.975  -2.751  1.00 0.00 ? 35  GLU A O    3  
ATOM   6329  C  CB   . GLU A 1 35 ? 126.163 -4.430  -4.480  1.00 0.00 ? 35  GLU A CB   3  
ATOM   6330  C  CG   . GLU A 1 35 ? 126.033 -5.920  -4.803  1.00 0.00 ? 35  GLU A CG   3  
ATOM   6331  C  CD   . GLU A 1 35 ? 125.481 -6.104  -6.212  1.00 0.00 ? 35  GLU A CD   3  
ATOM   6332  O  OE1  . GLU A 1 35 ? 125.256 -5.103  -6.874  1.00 0.00 ? 35  GLU A OE1  3  
ATOM   6333  O  OE2  . GLU A 1 35 ? 125.292 -7.241  -6.611  1.00 0.00 ? 35  GLU A OE2  3  
ATOM   6334  H  H    . GLU A 1 35 ? 126.527 -2.177  -3.379  1.00 0.00 ? 35  GLU A H    3  
ATOM   6335  H  HA   . GLU A 1 35 ? 126.230 -4.808  -2.381  1.00 0.00 ? 35  GLU A HA   3  
ATOM   6336  H  HB2  . GLU A 1 35 ? 125.183 -3.974  -4.476  1.00 0.00 ? 35  GLU A HB2  3  
ATOM   6337  H  HB3  . GLU A 1 35 ? 126.778 -3.954  -5.230  1.00 0.00 ? 35  GLU A HB3  3  
ATOM   6338  H  HG2  . GLU A 1 35 ? 127.004 -6.388  -4.735  1.00 0.00 ? 35  GLU A HG2  3  
ATOM   6339  H  HG3  . GLU A 1 35 ? 125.362 -6.383  -4.094  1.00 0.00 ? 35  GLU A HG3  3  
ATOM   6340  N  N    . LEU A 1 36 ? 129.172 -4.030  -3.626  1.00 0.00 ? 36  LEU A N    3  
ATOM   6341  C  CA   . LEU A 1 36 ? 130.549 -4.496  -3.726  1.00 0.00 ? 36  LEU A CA   3  
ATOM   6342  C  C    . LEU A 1 36 ? 131.158 -4.786  -2.358  1.00 0.00 ? 36  LEU A C    3  
ATOM   6343  O  O    . LEU A 1 36 ? 131.766 -5.840  -2.153  1.00 0.00 ? 36  LEU A O    3  
ATOM   6344  C  CB   . LEU A 1 36 ? 131.383 -3.425  -4.436  1.00 0.00 ? 36  LEU A CB   3  
ATOM   6345  C  CG   . LEU A 1 36 ? 132.810 -3.936  -4.663  1.00 0.00 ? 36  LEU A CG   3  
ATOM   6346  C  CD1  . LEU A 1 36 ? 132.795 -5.043  -5.717  1.00 0.00 ? 36  LEU A CD1  3  
ATOM   6347  C  CD2  . LEU A 1 36 ? 133.686 -2.780  -5.154  1.00 0.00 ? 36  LEU A CD2  3  
ATOM   6348  H  H    . LEU A 1 36 ? 128.939 -3.131  -3.939  1.00 0.00 ? 36  LEU A H    3  
ATOM   6349  H  HA   . LEU A 1 36 ? 130.572 -5.397  -4.318  1.00 0.00 ? 36  LEU A HA   3  
ATOM   6350  H  HB2  . LEU A 1 36 ? 130.928 -3.185  -5.385  1.00 0.00 ? 36  LEU A HB2  3  
ATOM   6351  H  HB3  . LEU A 1 36 ? 131.417 -2.537  -3.824  1.00 0.00 ? 36  LEU A HB3  3  
ATOM   6352  H  HG   . LEU A 1 36 ? 133.211 -4.324  -3.739  1.00 0.00 ? 36  LEU A HG   3  
ATOM   6353  H  HD11 . LEU A 1 36 ? 132.017 -4.846  -6.438  1.00 0.00 ? 36  LEU A HD11 3  
ATOM   6354  H  HD12 . LEU A 1 36 ? 132.606 -5.992  -5.237  1.00 0.00 ? 36  LEU A HD12 3  
ATOM   6355  H  HD13 . LEU A 1 36 ? 133.750 -5.077  -6.219  1.00 0.00 ? 36  LEU A HD13 3  
ATOM   6356  H  HD21 . LEU A 1 36 ? 133.380 -2.493  -6.148  1.00 0.00 ? 36  LEU A HD21 3  
ATOM   6357  H  HD22 . LEU A 1 36 ? 134.720 -3.095  -5.173  1.00 0.00 ? 36  LEU A HD22 3  
ATOM   6358  H  HD23 . LEU A 1 36 ? 133.579 -1.939  -4.487  1.00 0.00 ? 36  LEU A HD23 3  
ATOM   6359  N  N    . LEU A 1 37 ? 130.987 -3.862  -1.413  1.00 0.00 ? 37  LEU A N    3  
ATOM   6360  C  CA   . LEU A 1 37 ? 131.532 -4.074  -0.079  1.00 0.00 ? 37  LEU A CA   3  
ATOM   6361  C  C    . LEU A 1 37 ? 130.781 -5.163  0.672   1.00 0.00 ? 37  LEU A C    3  
ATOM   6362  O  O    . LEU A 1 37 ? 131.396 -5.989  1.347   1.00 0.00 ? 37  LEU A O    3  
ATOM   6363  C  CB   . LEU A 1 37 ? 131.510 -2.771  0.732   1.00 0.00 ? 37  LEU A CB   3  
ATOM   6364  C  CG   . LEU A 1 37 ? 132.626 -1.809  0.273   1.00 0.00 ? 37  LEU A CG   3  
ATOM   6365  C  CD1  . LEU A 1 37 ? 133.942 -2.185  0.956   1.00 0.00 ? 37  LEU A CD1  3  
ATOM   6366  C  CD2  . LEU A 1 37 ? 132.821 -1.863  -1.248  1.00 0.00 ? 37  LEU A CD2  3  
ATOM   6367  H  H    . LEU A 1 37 ? 130.487 -3.039  -1.616  1.00 0.00 ? 37  LEU A H    3  
ATOM   6368  H  HA   . LEU A 1 37 ? 132.556 -4.394  -0.176  1.00 0.00 ? 37  LEU A HA   3  
ATOM   6369  H  HB2  . LEU A 1 37 ? 130.552 -2.290  0.602   1.00 0.00 ? 37  LEU A HB2  3  
ATOM   6370  H  HB3  . LEU A 1 37 ? 131.649 -3.003  1.778   1.00 0.00 ? 37  LEU A HB3  3  
ATOM   6371  H  HG   . LEU A 1 37 ? 132.358 -0.801  0.562   1.00 0.00 ? 37  LEU A HG   3  
ATOM   6372  H  HD11 . LEU A 1 37 ? 134.298 -3.124  0.559   1.00 0.00 ? 37  LEU A HD11 3  
ATOM   6373  H  HD12 . LEU A 1 37 ? 133.782 -2.281  2.018   1.00 0.00 ? 37  LEU A HD12 3  
ATOM   6374  H  HD13 . LEU A 1 37 ? 134.676 -1.415  0.771   1.00 0.00 ? 37  LEU A HD13 3  
ATOM   6375  H  HD21 . LEU A 1 37 ? 133.477 -1.059  -1.551  1.00 0.00 ? 37  LEU A HD21 3  
ATOM   6376  H  HD22 . LEU A 1 37 ? 131.874 -1.747  -1.738  1.00 0.00 ? 37  LEU A HD22 3  
ATOM   6377  H  HD23 . LEU A 1 37 ? 133.262 -2.804  -1.532  1.00 0.00 ? 37  LEU A HD23 3  
ATOM   6378  N  N    . GLN A 1 38 ? 129.455 -5.175  0.559   1.00 0.00 ? 38  GLN A N    3  
ATOM   6379  C  CA   . GLN A 1 38 ? 128.682 -6.194  1.254   1.00 0.00 ? 38  GLN A CA   3  
ATOM   6380  C  C    . GLN A 1 38 ? 129.001 -7.595  0.739   1.00 0.00 ? 38  GLN A C    3  
ATOM   6381  O  O    . GLN A 1 38 ? 129.152 -8.532  1.523   1.00 0.00 ? 38  GLN A O    3  
ATOM   6382  C  CB   . GLN A 1 38 ? 127.187 -5.905  1.091   1.00 0.00 ? 38  GLN A CB   3  
ATOM   6383  C  CG   . GLN A 1 38 ? 126.829 -4.613  1.838   1.00 0.00 ? 38  GLN A CG   3  
ATOM   6384  C  CD   . GLN A 1 38 ? 125.357 -4.280  1.628   1.00 0.00 ? 38  GLN A CD   3  
ATOM   6385  O  OE1  . GLN A 1 38 ? 124.727 -4.805  0.710   1.00 0.00 ? 38  GLN A OE1  3  
ATOM   6386  N  NE2  . GLN A 1 38 ? 124.768 -3.437  2.430   1.00 0.00 ? 38  GLN A NE2  3  
ATOM   6387  H  H    . GLN A 1 38 ? 128.997 -4.498  0.010   1.00 0.00 ? 38  GLN A H    3  
ATOM   6388  H  HA   . GLN A 1 38 ? 128.925 -6.151  2.305   1.00 0.00 ? 38  GLN A HA   3  
ATOM   6389  H  HB2  . GLN A 1 38 ? 126.962 -5.783  0.041   1.00 0.00 ? 38  GLN A HB2  3  
ATOM   6390  H  HB3  . GLN A 1 38 ? 126.610 -6.722  1.487   1.00 0.00 ? 38  GLN A HB3  3  
ATOM   6391  H  HG2  . GLN A 1 38 ? 127.017 -4.743  2.892   1.00 0.00 ? 38  GLN A HG2  3  
ATOM   6392  H  HG3  . GLN A 1 38 ? 127.436 -3.802  1.472   1.00 0.00 ? 38  GLN A HG3  3  
ATOM   6393  H  HE21 . GLN A 1 38 ? 125.272 -3.022  3.161   1.00 0.00 ? 38  GLN A HE21 3  
ATOM   6394  H  HE22 . GLN A 1 38 ? 123.821 -3.217  2.302   1.00 0.00 ? 38  GLN A HE22 3  
ATOM   6395  N  N    . THR A 1 39 ? 129.106 -7.736  -0.578  1.00 0.00 ? 39  THR A N    3  
ATOM   6396  C  CA   . THR A 1 39 ? 129.412 -9.035  -1.170  1.00 0.00 ? 39  THR A CA   3  
ATOM   6397  C  C    . THR A 1 39 ? 130.859 -9.465  -0.920  1.00 0.00 ? 39  THR A C    3  
ATOM   6398  O  O    . THR A 1 39 ? 131.129 -10.627 -0.617  1.00 0.00 ? 39  THR A O    3  
ATOM   6399  C  CB   . THR A 1 39 ? 129.153 -8.988  -2.677  1.00 0.00 ? 39  THR A CB   3  
ATOM   6400  O  OG1  . THR A 1 39 ? 127.819 -8.555  -2.912  1.00 0.00 ? 39  THR A OG1  3  
ATOM   6401  C  CG2  . THR A 1 39 ? 129.350 -10.383 -3.275  1.00 0.00 ? 39  THR A CG2  3  
ATOM   6402  H  H    . THR A 1 39 ? 128.980 -6.957  -1.160  1.00 0.00 ? 39  THR A H    3  
ATOM   6403  H  HA   . THR A 1 39 ? 128.756 -9.773  -0.736  1.00 0.00 ? 39  THR A HA   3  
ATOM   6404  H  HB   . THR A 1 39 ? 129.843 -8.301  -3.142  1.00 0.00 ? 39  THR A HB   3  
ATOM   6405  H  HG1  . THR A 1 39 ? 127.845 -7.873  -3.586  1.00 0.00 ? 39  THR A HG1  3  
ATOM   6406  H  HG21 . THR A 1 39 ? 128.804 -11.106 -2.687  1.00 0.00 ? 39  THR A HG21 3  
ATOM   6407  H  HG22 . THR A 1 39 ? 130.401 -10.633 -3.267  1.00 0.00 ? 39  THR A HG22 3  
ATOM   6408  H  HG23 . THR A 1 39 ? 128.985 -10.394 -4.291  1.00 0.00 ? 39  THR A HG23 3  
ATOM   6409  N  N    . GLU A 1 40 ? 131.786 -8.525  -1.096  1.00 0.00 ? 40  GLU A N    3  
ATOM   6410  C  CA   . GLU A 1 40 ? 133.211 -8.816  -0.940  1.00 0.00 ? 40  GLU A CA   3  
ATOM   6411  C  C    . GLU A 1 40 ? 133.678 -8.947  0.508   1.00 0.00 ? 40  GLU A C    3  
ATOM   6412  O  O    . GLU A 1 40 ? 134.631 -9.678  0.781   1.00 0.00 ? 40  GLU A O    3  
ATOM   6413  C  CB   . GLU A 1 40 ? 134.039 -7.730  -1.629  1.00 0.00 ? 40  GLU A CB   3  
ATOM   6414  C  CG   . GLU A 1 40 ? 133.796 -7.779  -3.139  1.00 0.00 ? 40  GLU A CG   3  
ATOM   6415  C  CD   . GLU A 1 40 ? 134.677 -6.750  -3.840  1.00 0.00 ? 40  GLU A CD   3  
ATOM   6416  O  OE1  . GLU A 1 40 ? 135.274 -5.942  -3.148  1.00 0.00 ? 40  GLU A OE1  3  
ATOM   6417  O  OE2  . GLU A 1 40 ? 134.743 -6.786  -5.057  1.00 0.00 ? 40  GLU A OE2  3  
ATOM   6418  H  H    . GLU A 1 40 ? 131.508 -7.622  -1.373  1.00 0.00 ? 40  GLU A H    3  
ATOM   6419  H  HA   . GLU A 1 40 ? 133.416 -9.749  -1.441  1.00 0.00 ? 40  GLU A HA   3  
ATOM   6420  H  HB2  . GLU A 1 40 ? 133.750 -6.762  -1.249  1.00 0.00 ? 40  GLU A HB2  3  
ATOM   6421  H  HB3  . GLU A 1 40 ? 135.088 -7.897  -1.430  1.00 0.00 ? 40  GLU A HB3  3  
ATOM   6422  H  HG2  . GLU A 1 40 ? 134.035 -8.767  -3.508  1.00 0.00 ? 40  GLU A HG2  3  
ATOM   6423  H  HG3  . GLU A 1 40 ? 132.759 -7.561  -3.343  1.00 0.00 ? 40  GLU A HG3  3  
ATOM   6424  N  N    . LEU A 1 41 ? 133.073 -8.202  1.429   1.00 0.00 ? 41  LEU A N    3  
ATOM   6425  C  CA   . LEU A 1 41 ? 133.543 -8.236  2.816   1.00 0.00 ? 41  LEU A CA   3  
ATOM   6426  C  C    . LEU A 1 41 ? 132.687 -9.147  3.711   1.00 0.00 ? 41  LEU A C    3  
ATOM   6427  O  O    . LEU A 1 41 ? 131.465 -8.992  3.815   1.00 0.00 ? 41  LEU A O    3  
ATOM   6428  C  CB   . LEU A 1 41 ? 133.533 -6.804  3.361   1.00 0.00 ? 41  LEU A CB   3  
ATOM   6429  C  CG   . LEU A 1 41 ? 134.229 -6.754  4.722   1.00 0.00 ? 41  LEU A CG   3  
ATOM   6430  C  CD1  . LEU A 1 41 ? 135.750 -6.837  4.541   1.00 0.00 ? 41  LEU A CD1  3  
ATOM   6431  C  CD2  . LEU A 1 41 ? 133.870 -5.448  5.433   1.00 0.00 ? 41  LEU A CD2  3  
ATOM   6432  H  H    . LEU A 1 41 ? 132.351 -7.591  1.170   1.00 0.00 ? 41  LEU A H    3  
ATOM   6433  H  HA   . LEU A 1 41 ? 134.559 -8.596  2.832   1.00 0.00 ? 41  LEU A HA   3  
ATOM   6434  H  HB2  . LEU A 1 41 ? 134.043 -6.152  2.668   1.00 0.00 ? 41  LEU A HB2  3  
ATOM   6435  H  HB3  . LEU A 1 41 ? 132.511 -6.473  3.474   1.00 0.00 ? 41  LEU A HB3  3  
ATOM   6436  H  HG   . LEU A 1 41 ? 133.904 -7.586  5.311   1.00 0.00 ? 41  LEU A HG   3  
ATOM   6437  H  HD11 . LEU A 1 41 ? 136.039 -7.867  4.394   1.00 0.00 ? 41  LEU A HD11 3  
ATOM   6438  H  HD12 . LEU A 1 41 ? 136.236 -6.451  5.424   1.00 0.00 ? 41  LEU A HD12 3  
ATOM   6439  H  HD13 . LEU A 1 41 ? 136.048 -6.253  3.683   1.00 0.00 ? 41  LEU A HD13 3  
ATOM   6440  H  HD21 . LEU A 1 41 ? 132.888 -5.538  5.876   1.00 0.00 ? 41  LEU A HD21 3  
ATOM   6441  H  HD22 . LEU A 1 41 ? 133.869 -4.638  4.720   1.00 0.00 ? 41  LEU A HD22 3  
ATOM   6442  H  HD23 . LEU A 1 41 ? 134.597 -5.247  6.206   1.00 0.00 ? 41  LEU A HD23 3  
ATOM   6443  N  N    . SER A 1 42 ? 133.362 -10.079 4.391   1.00 0.00 ? 42  SER A N    3  
ATOM   6444  C  CA   . SER A 1 42 ? 132.692 -11.004 5.303   1.00 0.00 ? 42  SER A CA   3  
ATOM   6445  C  C    . SER A 1 42 ? 131.947 -10.222 6.373   1.00 0.00 ? 42  SER A C    3  
ATOM   6446  O  O    . SER A 1 42 ? 130.901 -10.648 6.869   1.00 0.00 ? 42  SER A O    3  
ATOM   6447  C  CB   . SER A 1 42 ? 133.715 -11.930 5.960   1.00 0.00 ? 42  SER A CB   3  
ATOM   6448  O  OG   . SER A 1 42 ? 133.032 -12.919 6.719   1.00 0.00 ? 42  SER A OG   3  
ATOM   6449  H  H    . SER A 1 42 ? 134.336 -10.132 4.288   1.00 0.00 ? 42  SER A H    3  
ATOM   6450  H  HA   . SER A 1 42 ? 131.985 -11.599 4.744   1.00 0.00 ? 42  SER A HA   3  
ATOM   6451  H  HB2  . SER A 1 42 ? 134.307 -12.413 5.201   1.00 0.00 ? 42  SER A HB2  3  
ATOM   6452  H  HB3  . SER A 1 42 ? 134.362 -11.349 6.604   1.00 0.00 ? 42  SER A HB3  3  
ATOM   6453  H  HG   . SER A 1 42 ? 132.283 -12.499 7.150   1.00 0.00 ? 42  SER A HG   3  
ATOM   6454  N  N    . GLY A 1 43 ? 132.498 -9.067  6.711   1.00 0.00 ? 43  GLY A N    3  
ATOM   6455  C  CA   . GLY A 1 43 ? 131.901 -8.203  7.712   1.00 0.00 ? 43  GLY A CA   3  
ATOM   6456  C  C    . GLY A 1 43 ? 130.410 -8.067  7.460   1.00 0.00 ? 43  GLY A C    3  
ATOM   6457  O  O    . GLY A 1 43 ? 129.665 -7.612  8.323   1.00 0.00 ? 43  GLY A O    3  
ATOM   6458  H  H    . GLY A 1 43 ? 133.326 -8.791  6.273   1.00 0.00 ? 43  GLY A H    3  
ATOM   6459  H  HA2  . GLY A 1 43 ? 132.064 -8.625  8.693   1.00 0.00 ? 43  GLY A HA2  3  
ATOM   6460  H  HA3  . GLY A 1 43 ? 132.359 -7.226  7.661   1.00 0.00 ? 43  GLY A HA3  3  
ATOM   6461  N  N    . PHE A 1 44 ? 129.974 -8.461  6.269   1.00 0.00 ? 44  PHE A N    3  
ATOM   6462  C  CA   . PHE A 1 44 ? 128.560 -8.363  5.942   1.00 0.00 ? 44  PHE A CA   3  
ATOM   6463  C  C    . PHE A 1 44 ? 127.691 -9.005  7.019   1.00 0.00 ? 44  PHE A C    3  
ATOM   6464  O  O    . PHE A 1 44 ? 126.620 -8.491  7.343   1.00 0.00 ? 44  PHE A O    3  
ATOM   6465  C  CB   . PHE A 1 44 ? 128.279 -9.045  4.606   1.00 0.00 ? 44  PHE A CB   3  
ATOM   6466  C  CG   . PHE A 1 44 ? 126.816 -8.883  4.279   1.00 0.00 ? 44  PHE A CG   3  
ATOM   6467  C  CD1  . PHE A 1 44 ? 126.340 -7.657  3.818   1.00 0.00 ? 44  PHE A CD1  3  
ATOM   6468  C  CD2  . PHE A 1 44 ? 125.934 -9.955  4.462   1.00 0.00 ? 44  PHE A CD2  3  
ATOM   6469  C  CE1  . PHE A 1 44 ? 124.979 -7.497  3.527   1.00 0.00 ? 44  PHE A CE1  3  
ATOM   6470  C  CE2  . PHE A 1 44 ? 124.573 -9.797  4.174   1.00 0.00 ? 44  PHE A CE2  3  
ATOM   6471  C  CZ   . PHE A 1 44 ? 124.095 -8.568  3.704   1.00 0.00 ? 44  PHE A CZ   3  
ATOM   6472  H  H    . PHE A 1 44 ? 130.610 -8.816  5.599   1.00 0.00 ? 44  PHE A H    3  
ATOM   6473  H  HA   . PHE A 1 44 ? 128.300 -7.323  5.855   1.00 0.00 ? 44  PHE A HA   3  
ATOM   6474  H  HB2  . PHE A 1 44 ? 128.878 -8.585  3.832   1.00 0.00 ? 44  PHE A HB2  3  
ATOM   6475  H  HB3  . PHE A 1 44 ? 128.519 -10.094 4.676   1.00 0.00 ? 44  PHE A HB3  3  
ATOM   6476  H  HD1  . PHE A 1 44 ? 127.022 -6.835  3.688   1.00 0.00 ? 44  PHE A HD1  3  
ATOM   6477  H  HD2  . PHE A 1 44 ? 126.304 -10.904 4.819   1.00 0.00 ? 44  PHE A HD2  3  
ATOM   6478  H  HE1  . PHE A 1 44 ? 124.612 -6.547  3.166   1.00 0.00 ? 44  PHE A HE1  3  
ATOM   6479  H  HE2  . PHE A 1 44 ? 123.891 -10.623 4.315   1.00 0.00 ? 44  PHE A HE2  3  
ATOM   6480  H  HZ   . PHE A 1 44 ? 123.045 -8.445  3.482   1.00 0.00 ? 44  PHE A HZ   3  
ATOM   6481  N  N    . LEU A 1 45 ? 128.132 -10.130 7.560   1.00 0.00 ? 45  LEU A N    3  
ATOM   6482  C  CA   . LEU A 1 45 ? 127.348 -10.814 8.583   1.00 0.00 ? 45  LEU A CA   3  
ATOM   6483  C  C    . LEU A 1 45 ? 127.062 -9.900  9.782   1.00 0.00 ? 45  LEU A C    3  
ATOM   6484  O  O    . LEU A 1 45 ? 125.964 -9.927  10.337  1.00 0.00 ? 45  LEU A O    3  
ATOM   6485  C  CB   . LEU A 1 45 ? 128.106 -12.060 9.054   1.00 0.00 ? 45  LEU A CB   3  
ATOM   6486  C  CG   . LEU A 1 45 ? 127.254 -12.856 10.050  1.00 0.00 ? 45  LEU A CG   3  
ATOM   6487  C  CD1  . LEU A 1 45 ? 126.096 -13.540 9.317   1.00 0.00 ? 45  LEU A CD1  3  
ATOM   6488  C  CD2  . LEU A 1 45 ? 128.128 -13.921 10.717  1.00 0.00 ? 45  LEU A CD2  3  
ATOM   6489  H  H    . LEU A 1 45 ? 128.987 -10.513 7.262   1.00 0.00 ? 45  LEU A H    3  
ATOM   6490  H  HA   . LEU A 1 45 ? 126.409 -11.124 8.151   1.00 0.00 ? 45  LEU A HA   3  
ATOM   6491  H  HB2  . LEU A 1 45 ? 128.340 -12.680 8.201   1.00 0.00 ? 45  LEU A HB2  3  
ATOM   6492  H  HB3  . LEU A 1 45 ? 129.024 -11.756 9.535   1.00 0.00 ? 45  LEU A HB3  3  
ATOM   6493  H  HG   . LEU A 1 45 ? 126.859 -12.192 10.804  1.00 0.00 ? 45  LEU A HG   3  
ATOM   6494  H  HD11 . LEU A 1 45 ? 125.738 -14.369 9.908   1.00 0.00 ? 45  LEU A HD11 3  
ATOM   6495  H  HD12 . LEU A 1 45 ? 126.437 -13.902 8.359   1.00 0.00 ? 45  LEU A HD12 3  
ATOM   6496  H  HD13 . LEU A 1 45 ? 125.295 -12.831 9.169   1.00 0.00 ? 45  LEU A HD13 3  
ATOM   6497  H  HD21 . LEU A 1 45 ? 127.499 -14.704 11.118  1.00 0.00 ? 45  LEU A HD21 3  
ATOM   6498  H  HD22 . LEU A 1 45 ? 128.697 -13.471 11.517  1.00 0.00 ? 45  LEU A HD22 3  
ATOM   6499  H  HD23 . LEU A 1 45 ? 128.804 -14.342 9.988   1.00 0.00 ? 45  LEU A HD23 3  
ATOM   6500  N  N    . ASP A 1 46 ? 128.051 -9.101  10.187  1.00 0.00 ? 46  ASP A N    3  
ATOM   6501  C  CA   . ASP A 1 46 ? 127.876 -8.200  11.333  1.00 0.00 ? 46  ASP A CA   3  
ATOM   6502  C  C    . ASP A 1 46 ? 127.507 -6.776  10.904  1.00 0.00 ? 46  ASP A C    3  
ATOM   6503  O  O    . ASP A 1 46 ? 127.547 -5.856  11.721  1.00 0.00 ? 46  ASP A O    3  
ATOM   6504  C  CB   . ASP A 1 46 ? 129.154 -8.167  12.178  1.00 0.00 ? 46  ASP A CB   3  
ATOM   6505  C  CG   . ASP A 1 46 ? 130.292 -7.507  11.407  1.00 0.00 ? 46  ASP A CG   3  
ATOM   6506  O  OD1  . ASP A 1 46 ? 130.012 -6.838  10.429  1.00 0.00 ? 46  ASP A OD1  3  
ATOM   6507  O  OD2  . ASP A 1 46 ? 131.429 -7.666  11.821  1.00 0.00 ? 46  ASP A OD2  3  
ATOM   6508  H  H    . ASP A 1 46 ? 128.911 -9.121  9.716   1.00 0.00 ? 46  ASP A H    3  
ATOM   6509  H  HA   . ASP A 1 46 ? 127.076 -8.585  11.948  1.00 0.00 ? 46  ASP A HA   3  
ATOM   6510  H  HB2  . ASP A 1 46 ? 128.966 -7.609  13.084  1.00 0.00 ? 46  ASP A HB2  3  
ATOM   6511  H  HB3  . ASP A 1 46 ? 129.437 -9.177  12.434  1.00 0.00 ? 46  ASP A HB3  3  
ATOM   6512  N  N    . ALA A 1 47 ? 127.185 -6.583  9.628   1.00 0.00 ? 47  ALA A N    3  
ATOM   6513  C  CA   . ALA A 1 47 ? 126.859 -5.241  9.142   1.00 0.00 ? 47  ALA A CA   3  
ATOM   6514  C  C    . ALA A 1 47 ? 125.654 -4.650  9.876   1.00 0.00 ? 47  ALA A C    3  
ATOM   6515  O  O    . ALA A 1 47 ? 125.633 -3.455  10.160  1.00 0.00 ? 47  ALA A O    3  
ATOM   6516  C  CB   . ALA A 1 47 ? 126.570 -5.290  7.635   1.00 0.00 ? 47  ALA A CB   3  
ATOM   6517  H  H    . ALA A 1 47 ? 127.190 -7.338  9.006   1.00 0.00 ? 47  ALA A H    3  
ATOM   6518  H  HA   . ALA A 1 47 ? 127.711 -4.599  9.309   1.00 0.00 ? 47  ALA A HA   3  
ATOM   6519  H  HB1  . ALA A 1 47 ? 127.076 -4.472  7.142   1.00 0.00 ? 47  ALA A HB1  3  
ATOM   6520  H  HB2  . ALA A 1 47 ? 125.506 -5.210  7.459   1.00 0.00 ? 47  ALA A HB2  3  
ATOM   6521  H  HB3  . ALA A 1 47 ? 126.926 -6.223  7.237   1.00 0.00 ? 47  ALA A HB3  3  
ATOM   6522  N  N    . GLN A 1 48 ? 124.671 -5.498  10.180  1.00 0.00 ? 48  GLN A N    3  
ATOM   6523  C  CA   . GLN A 1 48 ? 123.455 -5.070  10.884  1.00 0.00 ? 48  GLN A CA   3  
ATOM   6524  C  C    . GLN A 1 48 ? 123.206 -3.562  10.731  1.00 0.00 ? 48  GLN A C    3  
ATOM   6525  O  O    . GLN A 1 48 ? 123.501 -2.972  9.686   1.00 0.00 ? 48  GLN A O    3  
ATOM   6526  C  CB   . GLN A 1 48 ? 123.569 -5.435  12.366  1.00 0.00 ? 48  GLN A CB   3  
ATOM   6527  C  CG   . GLN A 1 48 ? 123.651 -6.956  12.511  1.00 0.00 ? 48  GLN A CG   3  
ATOM   6528  C  CD   . GLN A 1 48 ? 123.811 -7.333  13.980  1.00 0.00 ? 48  GLN A CD   3  
ATOM   6529  O  OE1  . GLN A 1 48 ? 124.166 -6.489  14.804  1.00 0.00 ? 48  GLN A OE1  3  
ATOM   6530  N  NE2  . GLN A 1 48 ? 123.568 -8.558  14.359  1.00 0.00 ? 48  GLN A NE2  3  
ATOM   6531  H  H    . GLN A 1 48 ? 124.763 -6.439  9.926   1.00 0.00 ? 48  GLN A H    3  
ATOM   6532  H  HA   . GLN A 1 48 ? 122.613 -5.601  10.467  1.00 0.00 ? 48  GLN A HA   3  
ATOM   6533  H  HB2  . GLN A 1 48 ? 124.459 -4.983  12.782  1.00 0.00 ? 48  GLN A HB2  3  
ATOM   6534  H  HB3  . GLN A 1 48 ? 122.702 -5.075  12.896  1.00 0.00 ? 48  GLN A HB3  3  
ATOM   6535  H  HG2  . GLN A 1 48 ? 122.745 -7.400  12.123  1.00 0.00 ? 48  GLN A HG2  3  
ATOM   6536  H  HG3  . GLN A 1 48 ? 124.498 -7.324  11.953  1.00 0.00 ? 48  GLN A HG3  3  
ATOM   6537  H  HE21 . GLN A 1 48 ? 123.284 -9.227  13.702  1.00 0.00 ? 48  GLN A HE21 3  
ATOM   6538  H  HE22 . GLN A 1 48 ? 123.668 -8.808  15.301  1.00 0.00 ? 48  GLN A HE22 3  
ATOM   6539  N  N    . LYS A 1 49 ? 122.670 -2.940  11.780  1.00 0.00 ? 49  LYS A N    3  
ATOM   6540  C  CA   . LYS A 1 49 ? 122.390 -1.508  11.749  1.00 0.00 ? 49  LYS A CA   3  
ATOM   6541  C  C    . LYS A 1 49 ? 123.676 -0.737  11.498  1.00 0.00 ? 49  LYS A C    3  
ATOM   6542  O  O    . LYS A 1 49 ? 123.660 0.363   10.946  1.00 0.00 ? 49  LYS A O    3  
ATOM   6543  C  CB   . LYS A 1 49 ? 121.760 -1.063  13.072  1.00 0.00 ? 49  LYS A CB   3  
ATOM   6544  C  CG   . LYS A 1 49 ? 122.794 -1.149  14.195  1.00 0.00 ? 49  LYS A CG   3  
ATOM   6545  C  CD   . LYS A 1 49 ? 122.119 -0.829  15.531  1.00 0.00 ? 49  LYS A CD   3  
ATOM   6546  C  CE   . LYS A 1 49 ? 123.184 -0.594  16.605  1.00 0.00 ? 49  LYS A CE   3  
ATOM   6547  N  NZ   . LYS A 1 49 ? 123.598 0.838   16.586  1.00 0.00 ? 49  LYS A NZ   3  
ATOM   6548  H  H    . LYS A 1 49 ? 122.459 -3.450  12.587  1.00 0.00 ? 49  LYS A H    3  
ATOM   6549  H  HA   . LYS A 1 49 ? 121.698 -1.305  10.946  1.00 0.00 ? 49  LYS A HA   3  
ATOM   6550  H  HB2  . LYS A 1 49 ? 121.414 -0.044  12.978  1.00 0.00 ? 49  LYS A HB2  3  
ATOM   6551  H  HB3  . LYS A 1 49 ? 120.925 -1.707  13.305  1.00 0.00 ? 49  LYS A HB3  3  
ATOM   6552  H  HG2  . LYS A 1 49 ? 123.208 -2.147  14.229  1.00 0.00 ? 49  LYS A HG2  3  
ATOM   6553  H  HG3  . LYS A 1 49 ? 123.585 -0.437  14.016  1.00 0.00 ? 49  LYS A HG3  3  
ATOM   6554  H  HD2  . LYS A 1 49 ? 121.514 0.061   15.423  1.00 0.00 ? 49  LYS A HD2  3  
ATOM   6555  H  HD3  . LYS A 1 49 ? 121.492 -1.657  15.825  1.00 0.00 ? 49  LYS A HD3  3  
ATOM   6556  H  HE2  . LYS A 1 49 ? 122.776 -0.837  17.575  1.00 0.00 ? 49  LYS A HE2  3  
ATOM   6557  H  HE3  . LYS A 1 49 ? 124.041 -1.219  16.407  1.00 0.00 ? 49  LYS A HE3  3  
ATOM   6558  H  HZ1  . LYS A 1 49 ? 124.445 0.947   15.995  1.00 0.00 ? 49  LYS A HZ1  3  
ATOM   6559  H  HZ2  . LYS A 1 49 ? 123.808 1.151   17.557  1.00 0.00 ? 49  LYS A HZ2  3  
ATOM   6560  H  HZ3  . LYS A 1 49 ? 122.829 1.417   16.195  1.00 0.00 ? 49  LYS A HZ3  3  
ATOM   6561  N  N    . ASP A 1 50 ? 124.790 -1.334  11.897  1.00 0.00 ? 50  ASP A N    3  
ATOM   6562  C  CA   . ASP A 1 50 ? 126.091 -0.717  11.706  1.00 0.00 ? 50  ASP A CA   3  
ATOM   6563  C  C    . ASP A 1 50 ? 126.287 -0.362  10.236  1.00 0.00 ? 50  ASP A C    3  
ATOM   6564  O  O    . ASP A 1 50 ? 126.942 0.628   9.912   1.00 0.00 ? 50  ASP A O    3  
ATOM   6565  C  CB   . ASP A 1 50 ? 127.204 -1.660  12.169  1.00 0.00 ? 50  ASP A CB   3  
ATOM   6566  C  CG   . ASP A 1 50 ? 127.143 -1.833  13.683  1.00 0.00 ? 50  ASP A CG   3  
ATOM   6567  O  OD1  . ASP A 1 50 ? 126.427 -1.077  14.318  1.00 0.00 ? 50  ASP A OD1  3  
ATOM   6568  O  OD2  . ASP A 1 50 ? 127.813 -2.720  14.186  1.00 0.00 ? 50  ASP A OD2  3  
ATOM   6569  H  H    . ASP A 1 50 ? 124.735 -2.215  12.322  1.00 0.00 ? 50  ASP A H    3  
ATOM   6570  H  HA   . ASP A 1 50 ? 126.136 0.189   12.292  1.00 0.00 ? 50  ASP A HA   3  
ATOM   6571  H  HB2  . ASP A 1 50 ? 127.083 -2.621  11.694  1.00 0.00 ? 50  ASP A HB2  3  
ATOM   6572  H  HB3  . ASP A 1 50 ? 128.162 -1.243  11.897  1.00 0.00 ? 50  ASP A HB3  3  
ATOM   6573  N  N    . VAL A 1 51 ? 125.721 -1.178  9.346   1.00 0.00 ? 51  VAL A N    3  
ATOM   6574  C  CA   . VAL A 1 51 ? 125.858 -0.924  7.915   1.00 0.00 ? 51  VAL A CA   3  
ATOM   6575  C  C    . VAL A 1 51 ? 125.428 0.501   7.582   1.00 0.00 ? 51  VAL A C    3  
ATOM   6576  O  O    . VAL A 1 51 ? 125.954 1.115   6.655   1.00 0.00 ? 51  VAL A O    3  
ATOM   6577  C  CB   . VAL A 1 51 ? 125.008 -1.915  7.115   1.00 0.00 ? 51  VAL A CB   3  
ATOM   6578  C  CG1  . VAL A 1 51 ? 123.532 -1.530  7.228   1.00 0.00 ? 51  VAL A CG1  3  
ATOM   6579  C  CG2  . VAL A 1 51 ? 125.431 -1.872  5.643   1.00 0.00 ? 51  VAL A CG2  3  
ATOM   6580  H  H    . VAL A 1 51 ? 125.203 -1.959  9.655   1.00 0.00 ? 51  VAL A H    3  
ATOM   6581  H  HA   . VAL A 1 51 ? 126.894 -1.051  7.636   1.00 0.00 ? 51  VAL A HA   3  
ATOM   6582  H  HB   . VAL A 1 51 ? 125.152 -2.912  7.504   1.00 0.00 ? 51  VAL A HB   3  
ATOM   6583  H  HG11 . VAL A 1 51 ? 123.313 -0.734  6.532   1.00 0.00 ? 51  VAL A HG11 3  
ATOM   6584  H  HG12 . VAL A 1 51 ? 123.323 -1.197  8.234   1.00 0.00 ? 51  VAL A HG12 3  
ATOM   6585  H  HG13 . VAL A 1 51 ? 122.917 -2.389  6.998   1.00 0.00 ? 51  VAL A HG13 3  
ATOM   6586  H  HG21 . VAL A 1 51 ? 124.835 -2.571  5.075   1.00 0.00 ? 51  VAL A HG21 3  
ATOM   6587  H  HG22 . VAL A 1 51 ? 126.475 -2.137  5.559   1.00 0.00 ? 51  VAL A HG22 3  
ATOM   6588  H  HG23 . VAL A 1 51 ? 125.282 -0.874  5.254   1.00 0.00 ? 51  VAL A HG23 3  
ATOM   6589  N  N    . ASP A 1 52 ? 124.473 1.024   8.344   1.00 0.00 ? 52  ASP A N    3  
ATOM   6590  C  CA   . ASP A 1 52 ? 123.980 2.381   8.122   1.00 0.00 ? 52  ASP A CA   3  
ATOM   6591  C  C    . ASP A 1 52 ? 125.132 3.386   8.146   1.00 0.00 ? 52  ASP A C    3  
ATOM   6592  O  O    . ASP A 1 52 ? 125.132 4.365   7.395   1.00 0.00 ? 52  ASP A O    3  
ATOM   6593  C  CB   . ASP A 1 52 ? 122.961 2.749   9.200   1.00 0.00 ? 52  ASP A CB   3  
ATOM   6594  C  CG   . ASP A 1 52 ? 121.701 1.906   9.036   1.00 0.00 ? 52  ASP A CG   3  
ATOM   6595  O  OD1  . ASP A 1 52 ? 121.574 1.259   8.010   1.00 0.00 ? 52  ASP A OD1  3  
ATOM   6596  O  OD2  . ASP A 1 52 ? 120.882 1.918   9.941   1.00 0.00 ? 52  ASP A OD2  3  
ATOM   6597  H  H    . ASP A 1 52 ? 124.091 0.487   9.071   1.00 0.00 ? 52  ASP A H    3  
ATOM   6598  H  HA   . ASP A 1 52 ? 123.498 2.424   7.156   1.00 0.00 ? 52  ASP A HA   3  
ATOM   6599  H  HB2  . ASP A 1 52 ? 123.390 2.569   10.175  1.00 0.00 ? 52  ASP A HB2  3  
ATOM   6600  H  HB3  . ASP A 1 52 ? 122.705 3.794   9.108   1.00 0.00 ? 52  ASP A HB3  3  
ATOM   6601  N  N    . ALA A 1 53 ? 126.113 3.135   9.006   1.00 0.00 ? 53  ALA A N    3  
ATOM   6602  C  CA   . ALA A 1 53 ? 127.264 4.025   9.119   1.00 0.00 ? 53  ALA A CA   3  
ATOM   6603  C  C    . ALA A 1 53 ? 127.938 4.171   7.766   1.00 0.00 ? 53  ALA A C    3  
ATOM   6604  O  O    . ALA A 1 53 ? 128.577 5.194   7.477   1.00 0.00 ? 53  ALA A O    3  
ATOM   6605  C  CB   . ALA A 1 53 ? 128.272 3.475   10.129  1.00 0.00 ? 53  ALA A CB   3  
ATOM   6606  H  H    . ALA A 1 53 ? 126.064 2.337   9.575   1.00 0.00 ? 53  ALA A H    3  
ATOM   6607  H  HA   . ALA A 1 53 ? 126.928 4.996   9.452   1.00 0.00 ? 53  ALA A HA   3  
ATOM   6608  H  HB1  . ALA A 1 53 ? 129.222 3.976   9.998   1.00 0.00 ? 53  ALA A HB1  3  
ATOM   6609  H  HB2  . ALA A 1 53 ? 128.401 2.415   9.968   1.00 0.00 ? 53  ALA A HB2  3  
ATOM   6610  H  HB3  . ALA A 1 53 ? 127.909 3.646   11.131  1.00 0.00 ? 53  ALA A HB3  3  
ATOM   6611  N  N    . VAL A 1 54 ? 127.802 3.146   6.935   1.00 0.00 ? 54  VAL A N    3  
ATOM   6612  C  CA   . VAL A 1 54 ? 128.412 3.194   5.626   1.00 0.00 ? 54  VAL A CA   3  
ATOM   6613  C  C    . VAL A 1 54 ? 127.999 4.488   4.935   1.00 0.00 ? 54  VAL A C    3  
ATOM   6614  O  O    . VAL A 1 54 ? 128.798 5.116   4.250   1.00 0.00 ? 54  VAL A O    3  
ATOM   6615  C  CB   . VAL A 1 54 ? 127.972 1.988   4.786   1.00 0.00 ? 54  VAL A CB   3  
ATOM   6616  C  CG1  . VAL A 1 54 ? 126.541 2.192   4.281   1.00 0.00 ? 54  VAL A CG1  3  
ATOM   6617  C  CG2  . VAL A 1 54 ? 128.915 1.835   3.590   1.00 0.00 ? 54  VAL A CG2  3  
ATOM   6618  H  H    . VAL A 1 54 ? 127.289 2.358   7.209   1.00 0.00 ? 54  VAL A H    3  
ATOM   6619  H  HA   . VAL A 1 54 ? 129.484 3.171   5.736   1.00 0.00 ? 54  VAL A HA   3  
ATOM   6620  H  HB   . VAL A 1 54 ? 128.014 1.097   5.393   1.00 0.00 ? 54  VAL A HB   3  
ATOM   6621  H  HG11 . VAL A 1 54 ? 126.559 2.780   3.374   1.00 0.00 ? 54  VAL A HG11 3  
ATOM   6622  H  HG12 . VAL A 1 54 ? 125.962 2.708   5.031   1.00 0.00 ? 54  VAL A HG12 3  
ATOM   6623  H  HG13 . VAL A 1 54 ? 126.091 1.232   4.077   1.00 0.00 ? 54  VAL A HG13 3  
ATOM   6624  H  HG21 . VAL A 1 54 ? 129.841 1.387   3.917   1.00 0.00 ? 54  VAL A HG21 3  
ATOM   6625  H  HG22 . VAL A 1 54 ? 129.116 2.808   3.163   1.00 0.00 ? 54  VAL A HG22 3  
ATOM   6626  H  HG23 . VAL A 1 54 ? 128.452 1.205   2.846   1.00 0.00 ? 54  VAL A HG23 3  
ATOM   6627  N  N    . ASP A 1 55 ? 126.754 4.905   5.137   1.00 0.00 ? 55  ASP A N    3  
ATOM   6628  C  CA   . ASP A 1 55 ? 126.300 6.151   4.541   1.00 0.00 ? 55  ASP A CA   3  
ATOM   6629  C  C    . ASP A 1 55 ? 127.065 7.337   5.135   1.00 0.00 ? 55  ASP A C    3  
ATOM   6630  O  O    . ASP A 1 55 ? 127.441 8.270   4.427   1.00 0.00 ? 55  ASP A O    3  
ATOM   6631  C  CB   . ASP A 1 55 ? 124.802 6.332   4.795   1.00 0.00 ? 55  ASP A CB   3  
ATOM   6632  C  CG   . ASP A 1 55 ? 124.015 5.259   4.051   1.00 0.00 ? 55  ASP A CG   3  
ATOM   6633  O  OD1  . ASP A 1 55 ? 124.601 4.598   3.209   1.00 0.00 ? 55  ASP A OD1  3  
ATOM   6634  O  OD2  . ASP A 1 55 ? 122.836 5.114   4.334   1.00 0.00 ? 55  ASP A OD2  3  
ATOM   6635  H  H    . ASP A 1 55 ? 126.148 4.388   5.712   1.00 0.00 ? 55  ASP A H    3  
ATOM   6636  H  HA   . ASP A 1 55 ? 126.473 6.117   3.476   1.00 0.00 ? 55  ASP A HA   3  
ATOM   6637  H  HB2  . ASP A 1 55 ? 124.605 6.252   5.854   1.00 0.00 ? 55  ASP A HB2  3  
ATOM   6638  H  HB3  . ASP A 1 55 ? 124.494 7.307   4.445   1.00 0.00 ? 55  ASP A HB3  3  
ATOM   6639  N  N    . LYS A 1 56 ? 127.265 7.288   6.454   1.00 0.00 ? 56  LYS A N    3  
ATOM   6640  C  CA   . LYS A 1 56 ? 127.958 8.359   7.174   1.00 0.00 ? 56  LYS A CA   3  
ATOM   6641  C  C    . LYS A 1 56 ? 129.410 8.548   6.735   1.00 0.00 ? 56  LYS A C    3  
ATOM   6642  O  O    . LYS A 1 56 ? 129.891 9.678   6.656   1.00 0.00 ? 56  LYS A O    3  
ATOM   6643  C  CB   . LYS A 1 56 ? 127.923 8.072   8.675   1.00 0.00 ? 56  LYS A CB   3  
ATOM   6644  C  CG   . LYS A 1 56 ? 126.477 8.109   9.171   1.00 0.00 ? 56  LYS A CG   3  
ATOM   6645  C  CD   . LYS A 1 56 ? 126.457 7.938   10.691  1.00 0.00 ? 56  LYS A CD   3  
ATOM   6646  C  CE   . LYS A 1 56 ? 125.010 7.858   11.177  1.00 0.00 ? 56  LYS A CE   3  
ATOM   6647  N  NZ   . LYS A 1 56 ? 124.977 8.006   12.660  1.00 0.00 ? 56  LYS A NZ   3  
ATOM   6648  H  H    . LYS A 1 56 ? 126.923 6.521   6.960   1.00 0.00 ? 56  LYS A H    3  
ATOM   6649  H  HA   . LYS A 1 56 ? 127.429 9.283   6.999   1.00 0.00 ? 56  LYS A HA   3  
ATOM   6650  H  HB2  . LYS A 1 56 ? 128.346 7.095   8.864   1.00 0.00 ? 56  LYS A HB2  3  
ATOM   6651  H  HB3  . LYS A 1 56 ? 128.500 8.820   9.197   1.00 0.00 ? 56  LYS A HB3  3  
ATOM   6652  H  HG2  . LYS A 1 56 ? 126.030 9.057   8.908   1.00 0.00 ? 56  LYS A HG2  3  
ATOM   6653  H  HG3  . LYS A 1 56 ? 125.919 7.306   8.713   1.00 0.00 ? 56  LYS A HG3  3  
ATOM   6654  H  HD2  . LYS A 1 56 ? 126.978 7.029   10.957  1.00 0.00 ? 56  LYS A HD2  3  
ATOM   6655  H  HD3  . LYS A 1 56 ? 126.945 8.781   11.155  1.00 0.00 ? 56  LYS A HD3  3  
ATOM   6656  H  HE2  . LYS A 1 56 ? 124.433 8.649   10.723  1.00 0.00 ? 56  LYS A HE2  3  
ATOM   6657  H  HE3  . LYS A 1 56 ? 124.589 6.902   10.903  1.00 0.00 ? 56  LYS A HE3  3  
ATOM   6658  H  HZ1  . LYS A 1 56 ? 124.840 7.075   13.100  1.00 0.00 ? 56  LYS A HZ1  3  
ATOM   6659  H  HZ2  . LYS A 1 56 ? 124.193 8.637   12.928  1.00 0.00 ? 56  LYS A HZ2  3  
ATOM   6660  H  HZ3  . LYS A 1 56 ? 125.876 8.413   12.988  1.00 0.00 ? 56  LYS A HZ3  3  
ATOM   6661  N  N    . VAL A 1 57 ? 130.120 7.450   6.485   1.00 0.00 ? 57  VAL A N    3  
ATOM   6662  C  CA   . VAL A 1 57 ? 131.529 7.561   6.098   1.00 0.00 ? 57  VAL A CA   3  
ATOM   6663  C  C    . VAL A 1 57 ? 131.694 8.131   4.689   1.00 0.00 ? 57  VAL A C    3  
ATOM   6664  O  O    . VAL A 1 57 ? 132.685 8.799   4.403   1.00 0.00 ? 57  VAL A O    3  
ATOM   6665  C  CB   . VAL A 1 57 ? 132.240 6.207   6.216   1.00 0.00 ? 57  VAL A CB   3  
ATOM   6666  C  CG1  . VAL A 1 57 ? 132.025 5.642   7.620   1.00 0.00 ? 57  VAL A CG1  3  
ATOM   6667  C  CG2  . VAL A 1 57 ? 131.683 5.228   5.189   1.00 0.00 ? 57  VAL A CG2  3  
ATOM   6668  H  H    . VAL A 1 57 ? 129.701 6.561   6.589   1.00 0.00 ? 57  VAL A H    3  
ATOM   6669  H  HA   . VAL A 1 57 ? 132.008 8.246   6.785   1.00 0.00 ? 57  VAL A HA   3  
ATOM   6670  H  HB   . VAL A 1 57 ? 133.297 6.343   6.049   1.00 0.00 ? 57  VAL A HB   3  
ATOM   6671  H  HG11 . VAL A 1 57 ? 130.995 5.787   7.912   1.00 0.00 ? 57  VAL A HG11 3  
ATOM   6672  H  HG12 . VAL A 1 57 ? 132.672 6.155   8.318   1.00 0.00 ? 57  VAL A HG12 3  
ATOM   6673  H  HG13 . VAL A 1 57 ? 132.256 4.587   7.624   1.00 0.00 ? 57  VAL A HG13 3  
ATOM   6674  H  HG21 . VAL A 1 57 ? 131.753 5.655   4.201   1.00 0.00 ? 57  VAL A HG21 3  
ATOM   6675  H  HG22 . VAL A 1 57 ? 130.658 5.027   5.424   1.00 0.00 ? 57  VAL A HG22 3  
ATOM   6676  H  HG23 . VAL A 1 57 ? 132.248 4.307   5.225   1.00 0.00 ? 57  VAL A HG23 3  
ATOM   6677  N  N    . MET A 1 58 ? 130.731 7.870   3.808   1.00 0.00 ? 58  MET A N    3  
ATOM   6678  C  CA   . MET A 1 58 ? 130.823 8.378   2.440   1.00 0.00 ? 58  MET A CA   3  
ATOM   6679  C  C    . MET A 1 58 ? 130.972 9.892   2.421   1.00 0.00 ? 58  MET A C    3  
ATOM   6680  O  O    . MET A 1 58 ? 131.722 10.436  1.609   1.00 0.00 ? 58  MET A O    3  
ATOM   6681  C  CB   . MET A 1 58 ? 129.553 8.001   1.674   1.00 0.00 ? 58  MET A CB   3  
ATOM   6682  C  CG   . MET A 1 58 ? 129.520 6.494   1.422   1.00 0.00 ? 58  MET A CG   3  
ATOM   6683  S  SD   . MET A 1 58 ? 130.845 6.035   0.282   1.00 0.00 ? 58  MET A SD   3  
ATOM   6684  C  CE   . MET A 1 58 ? 130.188 6.888   -1.177  1.00 0.00 ? 58  MET A CE   3  
ATOM   6685  H  H    . MET A 1 58 ? 129.957 7.332   4.077   1.00 0.00 ? 58  MET A H    3  
ATOM   6686  H  HA   . MET A 1 58 ? 131.673 7.930   1.950   1.00 0.00 ? 58  MET A HA   3  
ATOM   6687  H  HB2  . MET A 1 58 ? 128.689 8.287   2.257   1.00 0.00 ? 58  MET A HB2  3  
ATOM   6688  H  HB3  . MET A 1 58 ? 129.539 8.526   0.733   1.00 0.00 ? 58  MET A HB3  3  
ATOM   6689  H  HG2  . MET A 1 58 ? 129.662 5.973   2.351   1.00 0.00 ? 58  MET A HG2  3  
ATOM   6690  H  HG3  . MET A 1 58 ? 128.568 6.221   0.996   1.00 0.00 ? 58  MET A HG3  3  
ATOM   6691  H  HE1  . MET A 1 58 ? 130.236 6.224   -2.026  1.00 0.00 ? 58  MET A HE1  3  
ATOM   6692  H  HE2  . MET A 1 58 ? 130.771 7.771   -1.378  1.00 0.00 ? 58  MET A HE2  3  
ATOM   6693  H  HE3  . MET A 1 58 ? 129.158 7.171   -1.000  1.00 0.00 ? 58  MET A HE3  3  
ATOM   6694  N  N    . LYS A 1 59 ? 130.268 10.574  3.313   1.00 0.00 ? 59  LYS A N    3  
ATOM   6695  C  CA   . LYS A 1 59 ? 130.362 12.023  3.362   1.00 0.00 ? 59  LYS A CA   3  
ATOM   6696  C  C    . LYS A 1 59 ? 131.788 12.465  3.674   1.00 0.00 ? 59  LYS A C    3  
ATOM   6697  O  O    . LYS A 1 59 ? 132.314 13.388  3.053   1.00 0.00 ? 59  LYS A O    3  
ATOM   6698  C  CB   . LYS A 1 59 ? 129.413 12.567  4.430   1.00 0.00 ? 59  LYS A CB   3  
ATOM   6699  C  CG   . LYS A 1 59 ? 129.412 14.096  4.384   1.00 0.00 ? 59  LYS A CG   3  
ATOM   6700  C  CD   . LYS A 1 59 ? 128.511 14.638  5.495   1.00 0.00 ? 59  LYS A CD   3  
ATOM   6701  C  CE   . LYS A 1 59 ? 128.387 16.154  5.355   1.00 0.00 ? 59  LYS A CE   3  
ATOM   6702  N  NZ   . LYS A 1 59 ? 127.626 16.698  6.515   1.00 0.00 ? 59  LYS A NZ   3  
ATOM   6703  H  H    . LYS A 1 59 ? 129.687 10.100  3.944   1.00 0.00 ? 59  LYS A H    3  
ATOM   6704  H  HA   . LYS A 1 59 ? 130.073 12.426  2.403   1.00 0.00 ? 59  LYS A HA   3  
ATOM   6705  H  HB2  . LYS A 1 59 ? 128.413 12.201  4.244   1.00 0.00 ? 59  LYS A HB2  3  
ATOM   6706  H  HB3  . LYS A 1 59 ? 129.741 12.240  5.404   1.00 0.00 ? 59  LYS A HB3  3  
ATOM   6707  H  HG2  . LYS A 1 59 ? 130.420 14.460  4.524   1.00 0.00 ? 59  LYS A HG2  3  
ATOM   6708  H  HG3  . LYS A 1 59 ? 129.039 14.427  3.427   1.00 0.00 ? 59  LYS A HG3  3  
ATOM   6709  H  HD2  . LYS A 1 59 ? 127.534 14.185  5.418   1.00 0.00 ? 59  LYS A HD2  3  
ATOM   6710  H  HD3  . LYS A 1 59 ? 128.943 14.401  6.456   1.00 0.00 ? 59  LYS A HD3  3  
ATOM   6711  H  HE2  . LYS A 1 59 ? 129.372 16.596  5.331   1.00 0.00 ? 59  LYS A HE2  3  
ATOM   6712  H  HE3  . LYS A 1 59 ? 127.865 16.390  4.440   1.00 0.00 ? 59  LYS A HE3  3  
ATOM   6713  H  HZ1  . LYS A 1 59 ? 128.260 17.270  7.108   1.00 0.00 ? 59  LYS A HZ1  3  
ATOM   6714  H  HZ2  . LYS A 1 59 ? 127.241 15.912  7.076   1.00 0.00 ? 59  LYS A HZ2  3  
ATOM   6715  H  HZ3  . LYS A 1 59 ? 126.847 17.294  6.171   1.00 0.00 ? 59  LYS A HZ3  3  
ATOM   6716  N  N    . GLU A 1 60 ? 132.406 11.800  4.651   1.00 0.00 ? 60  GLU A N    3  
ATOM   6717  C  CA   . GLU A 1 60 ? 133.769 12.138  5.044   1.00 0.00 ? 60  GLU A CA   3  
ATOM   6718  C  C    . GLU A 1 60 ? 134.786 11.804  3.954   1.00 0.00 ? 60  GLU A C    3  
ATOM   6719  O  O    . GLU A 1 60 ? 135.695 12.589  3.682   1.00 0.00 ? 60  GLU A O    3  
ATOM   6720  C  CB   . GLU A 1 60 ? 134.126 11.378  6.324   1.00 0.00 ? 60  GLU A CB   3  
ATOM   6721  C  CG   . GLU A 1 60 ? 135.499 11.824  6.823   1.00 0.00 ? 60  GLU A CG   3  
ATOM   6722  C  CD   . GLU A 1 60 ? 135.902 11.001  8.042   1.00 0.00 ? 60  GLU A CD   3  
ATOM   6723  O  OE1  . GLU A 1 60 ? 135.138 10.129  8.421   1.00 0.00 ? 60  GLU A OE1  3  
ATOM   6724  O  OE2  . GLU A 1 60 ? 136.968 11.255  8.578   1.00 0.00 ? 60  GLU A OE2  3  
ATOM   6725  H  H    . GLU A 1 60 ? 131.935 11.076  5.114   1.00 0.00 ? 60  GLU A H    3  
ATOM   6726  H  HA   . GLU A 1 60 ? 133.818 13.196  5.251   1.00 0.00 ? 60  GLU A HA   3  
ATOM   6727  H  HB2  . GLU A 1 60 ? 133.383 11.582  7.080   1.00 0.00 ? 60  GLU A HB2  3  
ATOM   6728  H  HB3  . GLU A 1 60 ? 134.146 10.318  6.117   1.00 0.00 ? 60  GLU A HB3  3  
ATOM   6729  H  HG2  . GLU A 1 60 ? 136.228 11.683  6.040   1.00 0.00 ? 60  GLU A HG2  3  
ATOM   6730  H  HG3  . GLU A 1 60 ? 135.460 12.868  7.094   1.00 0.00 ? 60  GLU A HG3  3  
ATOM   6731  N  N    . LEU A 1 61 ? 134.637 10.631  3.340   1.00 0.00 ? 61  LEU A N    3  
ATOM   6732  C  CA   . LEU A 1 61 ? 135.564 10.209  2.292   1.00 0.00 ? 61  LEU A CA   3  
ATOM   6733  C  C    . LEU A 1 61 ? 135.455 11.072  1.045   1.00 0.00 ? 61  LEU A C    3  
ATOM   6734  O  O    . LEU A 1 61 ? 136.459 11.345  0.387   1.00 0.00 ? 61  LEU A O    3  
ATOM   6735  C  CB   . LEU A 1 61 ? 135.314 8.745   1.922   1.00 0.00 ? 61  LEU A CB   3  
ATOM   6736  C  CG   . LEU A 1 61 ? 135.516 7.852   3.150   1.00 0.00 ? 61  LEU A CG   3  
ATOM   6737  C  CD1  . LEU A 1 61 ? 135.314 6.393   2.751   1.00 0.00 ? 61  LEU A CD1  3  
ATOM   6738  C  CD2  . LEU A 1 61 ? 136.938 8.033   3.697   1.00 0.00 ? 61  LEU A CD2  3  
ATOM   6739  H  H    . LEU A 1 61 ? 133.901 10.040  3.602   1.00 0.00 ? 61  LEU A H    3  
ATOM   6740  H  HA   . LEU A 1 61 ? 136.569 10.296  2.672   1.00 0.00 ? 61  LEU A HA   3  
ATOM   6741  H  HB2  . LEU A 1 61 ? 134.302 8.634   1.561   1.00 0.00 ? 61  LEU A HB2  3  
ATOM   6742  H  HB3  . LEU A 1 61 ? 136.005 8.447   1.148   1.00 0.00 ? 61  LEU A HB3  3  
ATOM   6743  H  HG   . LEU A 1 61 ? 134.801 8.118   3.910   1.00 0.00 ? 61  LEU A HG   3  
ATOM   6744  H  HD11 . LEU A 1 61 ? 134.257 6.176   2.701   1.00 0.00 ? 61  LEU A HD11 3  
ATOM   6745  H  HD12 . LEU A 1 61 ? 135.779 5.751   3.484   1.00 0.00 ? 61  LEU A HD12 3  
ATOM   6746  H  HD13 . LEU A 1 61 ? 135.762 6.219   1.783   1.00 0.00 ? 61  LEU A HD13 3  
ATOM   6747  H  HD21 . LEU A 1 61 ? 137.614 8.241   2.881   1.00 0.00 ? 61  LEU A HD21 3  
ATOM   6748  H  HD22 . LEU A 1 61 ? 137.250 7.130   4.203   1.00 0.00 ? 61  LEU A HD22 3  
ATOM   6749  H  HD23 . LEU A 1 61 ? 136.953 8.857   4.396   1.00 0.00 ? 61  LEU A HD23 3  
ATOM   6750  N  N    . ASP A 1 62 ? 134.242 11.492  0.708   1.00 0.00 ? 62  ASP A N    3  
ATOM   6751  C  CA   . ASP A 1 62 ? 134.062 12.307  -0.483  1.00 0.00 ? 62  ASP A CA   3  
ATOM   6752  C  C    . ASP A 1 62 ? 134.289 13.780  -0.180  1.00 0.00 ? 62  ASP A C    3  
ATOM   6753  O  O    . ASP A 1 62 ? 133.419 14.448  0.377   1.00 0.00 ? 62  ASP A O    3  
ATOM   6754  C  CB   . ASP A 1 62 ? 132.642 12.121  -1.014  1.00 0.00 ? 62  ASP A CB   3  
ATOM   6755  C  CG   . ASP A 1 62 ? 132.475 12.865  -2.332  1.00 0.00 ? 62  ASP A CG   3  
ATOM   6756  O  OD1  . ASP A 1 62 ? 133.481 13.174  -2.951  1.00 0.00 ? 62  ASP A OD1  3  
ATOM   6757  O  OD2  . ASP A 1 62 ? 131.341 13.105  -2.708  1.00 0.00 ? 62  ASP A OD2  3  
ATOM   6758  H  H    . ASP A 1 62 ? 133.466 11.242  1.253   1.00 0.00 ? 62  ASP A H    3  
ATOM   6759  H  HA   . ASP A 1 62 ? 134.762 11.988  -1.239  1.00 0.00 ? 62  ASP A HA   3  
ATOM   6760  H  HB2  . ASP A 1 62 ? 132.454 11.069  -1.171  1.00 0.00 ? 62  ASP A HB2  3  
ATOM   6761  H  HB3  . ASP A 1 62 ? 131.937 12.507  -0.294  1.00 0.00 ? 62  ASP A HB3  3  
ATOM   6762  N  N    . GLU A 1 63 ? 135.442 14.295  -0.587  1.00 0.00 ? 63  GLU A N    3  
ATOM   6763  C  CA   . GLU A 1 63 ? 135.732 15.705  -0.386  1.00 0.00 ? 63  GLU A CA   3  
ATOM   6764  C  C    . GLU A 1 63 ? 134.812 16.544  -1.263  1.00 0.00 ? 63  GLU A C    3  
ATOM   6765  O  O    . GLU A 1 63 ? 134.391 17.640  -0.889  1.00 0.00 ? 63  GLU A O    3  
ATOM   6766  C  CB   . GLU A 1 63 ? 137.193 15.998  -0.736  1.00 0.00 ? 63  GLU A CB   3  
ATOM   6767  C  CG   . GLU A 1 63 ? 138.109 15.259  0.242   1.00 0.00 ? 63  GLU A CG   3  
ATOM   6768  C  CD   . GLU A 1 63 ? 139.567 15.593  -0.054  1.00 0.00 ? 63  GLU A CD   3  
ATOM   6769  O  OE1  . GLU A 1 63 ? 139.817 16.220  -1.071  1.00 0.00 ? 63  GLU A OE1  3  
ATOM   6770  O  OE2  . GLU A 1 63 ? 140.413 15.218  0.742   1.00 0.00 ? 63  GLU A OE2  3  
ATOM   6771  H  H    . GLU A 1 63 ? 136.090 13.727  -1.055  1.00 0.00 ? 63  GLU A H    3  
ATOM   6772  H  HA   . GLU A 1 63 ? 135.560 15.957  0.649   1.00 0.00 ? 63  GLU A HA   3  
ATOM   6773  H  HB2  . GLU A 1 63 ? 137.396 15.664  -1.744  1.00 0.00 ? 63  GLU A HB2  3  
ATOM   6774  H  HB3  . GLU A 1 63 ? 137.375 17.060  -0.664  1.00 0.00 ? 63  GLU A HB3  3  
ATOM   6775  H  HG2  . GLU A 1 63 ? 137.870 15.558  1.252   1.00 0.00 ? 63  GLU A HG2  3  
ATOM   6776  H  HG3  . GLU A 1 63 ? 137.959 14.195  0.138   1.00 0.00 ? 63  GLU A HG3  3  
ATOM   6777  N  N    . ASN A 1 64 ? 134.524 16.012  -2.450  1.00 0.00 ? 64  ASN A N    3  
ATOM   6778  C  CA   . ASN A 1 64 ? 133.675 16.695  -3.417  1.00 0.00 ? 64  ASN A CA   3  
ATOM   6779  C  C    . ASN A 1 64 ? 132.290 16.975  -2.848  1.00 0.00 ? 64  ASN A C    3  
ATOM   6780  O  O    . ASN A 1 64 ? 131.686 18.010  -3.128  1.00 0.00 ? 64  ASN A O    3  
ATOM   6781  C  CB   . ASN A 1 64 ? 133.492 15.801  -4.646  1.00 0.00 ? 64  ASN A CB   3  
ATOM   6782  C  CG   . ASN A 1 64 ? 134.840 15.404  -5.233  1.00 0.00 ? 64  ASN A CG   3  
ATOM   6783  O  OD1  . ASN A 1 64 ? 135.061 14.224  -5.522  1.00 0.00 ? 64  ASN A OD1  3  
ATOM   6784  N  ND2  . ASN A 1 64 ? 135.756 16.313  -5.427  1.00 0.00 ? 64  ASN A ND2  3  
ATOM   6785  H  H    . ASN A 1 64 ? 134.907 15.141  -2.684  1.00 0.00 ? 64  ASN A H    3  
ATOM   6786  H  HA   . ASN A 1 64 ? 134.137 17.620  -3.719  1.00 0.00 ? 64  ASN A HA   3  
ATOM   6787  H  HB2  . ASN A 1 64 ? 132.953 14.910  -4.360  1.00 0.00 ? 64  ASN A HB2  3  
ATOM   6788  H  HB3  . ASN A 1 64 ? 132.924 16.335  -5.392  1.00 0.00 ? 64  ASN A HB3  3  
ATOM   6789  H  HD21 . ASN A 1 64 ? 135.574 17.249  -5.197  1.00 0.00 ? 64  ASN A HD21 3  
ATOM   6790  H  HD22 . ASN A 1 64 ? 136.624 16.062  -5.805  1.00 0.00 ? 64  ASN A HD22 3  
ATOM   6791  N  N    . GLY A 1 65 ? 131.776 16.017  -2.086  1.00 0.00 ? 65  GLY A N    3  
ATOM   6792  C  CA   . GLY A 1 65 ? 130.439 16.135  -1.525  1.00 0.00 ? 65  GLY A CA   3  
ATOM   6793  C  C    . GLY A 1 65 ? 129.441 15.754  -2.612  1.00 0.00 ? 65  GLY A C    3  
ATOM   6794  O  O    . GLY A 1 65 ? 128.226 15.863  -2.445  1.00 0.00 ? 65  GLY A O    3  
ATOM   6795  H  H    . GLY A 1 65 ? 132.293 15.199  -1.929  1.00 0.00 ? 65  GLY A H    3  
ATOM   6796  H  HA2  . GLY A 1 65 ? 130.337 15.469  -0.679  1.00 0.00 ? 65  GLY A HA2  3  
ATOM   6797  H  HA3  . GLY A 1 65 ? 130.259 17.153  -1.215  1.00 0.00 ? 65  GLY A HA3  3  
ATOM   6798  N  N    . ASP A 1 66 ? 130.003 15.319  -3.739  1.00 0.00 ? 66  ASP A N    3  
ATOM   6799  C  CA   . ASP A 1 66 ? 129.228 14.922  -4.909  1.00 0.00 ? 66  ASP A CA   3  
ATOM   6800  C  C    . ASP A 1 66 ? 128.338 13.704  -4.638  1.00 0.00 ? 66  ASP A C    3  
ATOM   6801  O  O    . ASP A 1 66 ? 127.249 13.587  -5.199  1.00 0.00 ? 66  ASP A O    3  
ATOM   6802  C  CB   . ASP A 1 66 ? 130.193 14.664  -6.080  1.00 0.00 ? 66  ASP A CB   3  
ATOM   6803  C  CG   . ASP A 1 66 ? 131.115 13.475  -5.788  1.00 0.00 ? 66  ASP A CG   3  
ATOM   6804  O  OD1  . ASP A 1 66 ? 130.820 12.724  -4.881  1.00 0.00 ? 66  ASP A OD1  3  
ATOM   6805  O  OD2  . ASP A 1 66 ? 132.111 13.336  -6.480  1.00 0.00 ? 66  ASP A OD2  3  
ATOM   6806  H  H    . ASP A 1 66 ? 130.981 15.277  -3.789  1.00 0.00 ? 66  ASP A H    3  
ATOM   6807  H  HA   . ASP A 1 66 ? 128.588 15.747  -5.182  1.00 0.00 ? 66  ASP A HA   3  
ATOM   6808  H  HB2  . ASP A 1 66 ? 129.624 14.467  -6.975  1.00 0.00 ? 66  ASP A HB2  3  
ATOM   6809  H  HB3  . ASP A 1 66 ? 130.797 15.546  -6.236  1.00 0.00 ? 66  ASP A HB3  3  
ATOM   6810  N  N    . GLY A 1 67 ? 128.805 12.799  -3.784  1.00 0.00 ? 67  GLY A N    3  
ATOM   6811  C  CA   . GLY A 1 67 ? 128.044 11.594  -3.457  1.00 0.00 ? 67  GLY A CA   3  
ATOM   6812  C  C    . GLY A 1 67 ? 128.505 10.417  -4.310  1.00 0.00 ? 67  GLY A C    3  
ATOM   6813  O  O    . GLY A 1 67 ? 128.045 9.289   -4.137  1.00 0.00 ? 67  GLY A O    3  
ATOM   6814  H  H    . GLY A 1 67 ? 129.682 12.940  -3.369  1.00 0.00 ? 67  GLY A H    3  
ATOM   6815  H  HA2  . GLY A 1 67 ? 128.191 11.355  -2.413  1.00 0.00 ? 67  GLY A HA2  3  
ATOM   6816  H  HA3  . GLY A 1 67 ? 126.997 11.770  -3.636  1.00 0.00 ? 67  GLY A HA3  3  
ATOM   6817  N  N    . GLU A 1 68 ? 129.439 10.691  -5.215  1.00 0.00 ? 68  GLU A N    3  
ATOM   6818  C  CA   . GLU A 1 68 ? 129.999 9.659   -6.082  1.00 0.00 ? 68  GLU A CA   3  
ATOM   6819  C  C    . GLU A 1 68 ? 131.433 9.377   -5.661  1.00 0.00 ? 68  GLU A C    3  
ATOM   6820  O  O    . GLU A 1 68 ? 132.103 10.245  -5.087  1.00 0.00 ? 68  GLU A O    3  
ATOM   6821  C  CB   . GLU A 1 68 ? 129.951 10.099  -7.547  1.00 0.00 ? 68  GLU A CB   3  
ATOM   6822  C  CG   . GLU A 1 68 ? 128.494 10.284  -7.977  1.00 0.00 ? 68  GLU A CG   3  
ATOM   6823  C  CD   . GLU A 1 68 ? 127.991 11.659  -7.561  1.00 0.00 ? 68  GLU A CD   3  
ATOM   6824  O  OE1  . GLU A 1 68 ? 128.767 12.397  -6.984  1.00 0.00 ? 68  GLU A OE1  3  
ATOM   6825  O  OE2  . GLU A 1 68 ? 126.838 11.953  -7.827  1.00 0.00 ? 68  GLU A OE2  3  
ATOM   6826  H  H    . GLU A 1 68 ? 129.775 11.606  -5.289  1.00 0.00 ? 68  GLU A H    3  
ATOM   6827  H  HA   . GLU A 1 68 ? 129.419 8.753   -5.971  1.00 0.00 ? 68  GLU A HA   3  
ATOM   6828  H  HB2  . GLU A 1 68 ? 130.484 11.033  -7.659  1.00 0.00 ? 68  GLU A HB2  3  
ATOM   6829  H  HB3  . GLU A 1 68 ? 130.414 9.345   -8.165  1.00 0.00 ? 68  GLU A HB3  3  
ATOM   6830  H  HG2  . GLU A 1 68 ? 128.423 10.187  -9.051  1.00 0.00 ? 68  GLU A HG2  3  
ATOM   6831  H  HG3  . GLU A 1 68 ? 127.884 9.525   -7.510  1.00 0.00 ? 68  GLU A HG3  3  
ATOM   6832  N  N    . VAL A 1 69 ? 131.897 8.156   -5.915  1.00 0.00 ? 69  VAL A N    3  
ATOM   6833  C  CA   . VAL A 1 69 ? 133.243 7.778   -5.509  1.00 0.00 ? 69  VAL A CA   3  
ATOM   6834  C  C    . VAL A 1 69 ? 134.188 7.654   -6.698  1.00 0.00 ? 69  VAL A C    3  
ATOM   6835  O  O    . VAL A 1 69 ? 133.880 7.014   -7.704  1.00 0.00 ? 69  VAL A O    3  
ATOM   6836  C  CB   . VAL A 1 69 ? 133.186 6.442   -4.761  1.00 0.00 ? 69  VAL A CB   3  
ATOM   6837  C  CG1  . VAL A 1 69 ? 134.565 6.090   -4.196  1.00 0.00 ? 69  VAL A CG1  3  
ATOM   6838  C  CG2  . VAL A 1 69 ? 132.184 6.553   -3.611  1.00 0.00 ? 69  VAL A CG2  3  
ATOM   6839  H  H    . VAL A 1 69 ? 131.318 7.497   -6.352  1.00 0.00 ? 69  VAL A H    3  
ATOM   6840  H  HA   . VAL A 1 69 ? 133.632 8.523   -4.839  1.00 0.00 ? 69  VAL A HA   3  
ATOM   6841  H  HB   . VAL A 1 69 ? 132.868 5.665   -5.441  1.00 0.00 ? 69  VAL A HB   3  
ATOM   6842  H  HG11 . VAL A 1 69 ? 134.569 5.058   -3.880  1.00 0.00 ? 69  VAL A HG11 3  
ATOM   6843  H  HG12 . VAL A 1 69 ? 134.776 6.724   -3.347  1.00 0.00 ? 69  VAL A HG12 3  
ATOM   6844  H  HG13 . VAL A 1 69 ? 135.319 6.238   -4.952  1.00 0.00 ? 69  VAL A HG13 3  
ATOM   6845  H  HG21 . VAL A 1 69 ? 132.465 7.373   -2.965  1.00 0.00 ? 69  VAL A HG21 3  
ATOM   6846  H  HG22 . VAL A 1 69 ? 132.184 5.632   -3.044  1.00 0.00 ? 69  VAL A HG22 3  
ATOM   6847  H  HG23 . VAL A 1 69 ? 131.198 6.729   -4.012  1.00 0.00 ? 69  VAL A HG23 3  
ATOM   6848  N  N    . ASP A 1 70 ? 135.360 8.251   -6.530  1.00 0.00 ? 70  ASP A N    3  
ATOM   6849  C  CA   . ASP A 1 70 ? 136.412 8.209   -7.533  1.00 0.00 ? 70  ASP A CA   3  
ATOM   6850  C  C    . ASP A 1 70 ? 137.416 7.150   -7.114  1.00 0.00 ? 70  ASP A C    3  
ATOM   6851  O  O    . ASP A 1 70 ? 137.450 6.770   -5.949  1.00 0.00 ? 70  ASP A O    3  
ATOM   6852  C  CB   . ASP A 1 70 ? 137.104 9.570   -7.640  1.00 0.00 ? 70  ASP A CB   3  
ATOM   6853  C  CG   . ASP A 1 70 ? 136.127 10.610  -8.177  1.00 0.00 ? 70  ASP A CG   3  
ATOM   6854  O  OD1  . ASP A 1 70 ? 135.081 10.216  -8.665  1.00 0.00 ? 70  ASP A OD1  3  
ATOM   6855  O  OD2  . ASP A 1 70 ? 136.440 11.787  -8.091  1.00 0.00 ? 70  ASP A OD2  3  
ATOM   6856  H  H    . ASP A 1 70 ? 135.535 8.715   -5.686  1.00 0.00 ? 70  ASP A H    3  
ATOM   6857  H  HA   . ASP A 1 70 ? 135.986 7.944   -8.490  1.00 0.00 ? 70  ASP A HA   3  
ATOM   6858  H  HB2  . ASP A 1 70 ? 137.451 9.873   -6.663  1.00 0.00 ? 70  ASP A HB2  3  
ATOM   6859  H  HB3  . ASP A 1 70 ? 137.945 9.492   -8.312  1.00 0.00 ? 70  ASP A HB3  3  
ATOM   6860  N  N    . PHE A 1 71 ? 138.222 6.654   -8.039  1.00 0.00 ? 71  PHE A N    3  
ATOM   6861  C  CA   . PHE A 1 71 ? 139.179 5.626   -7.665  1.00 0.00 ? 71  PHE A CA   3  
ATOM   6862  C  C    . PHE A 1 71 ? 139.990 6.083   -6.458  1.00 0.00 ? 71  PHE A C    3  
ATOM   6863  O  O    . PHE A 1 71 ? 140.218 5.307   -5.529  1.00 0.00 ? 71  PHE A O    3  
ATOM   6864  C  CB   . PHE A 1 71 ? 140.121 5.319   -8.831  1.00 0.00 ? 71  PHE A CB   3  
ATOM   6865  C  CG   . PHE A 1 71 ? 141.037 4.183   -8.440  1.00 0.00 ? 71  PHE A CG   3  
ATOM   6866  C  CD1  . PHE A 1 71 ? 140.608 2.858   -8.571  1.00 0.00 ? 71  PHE A CD1  3  
ATOM   6867  C  CD2  . PHE A 1 71 ? 142.318 4.458   -7.944  1.00 0.00 ? 71  PHE A CD2  3  
ATOM   6868  C  CE1  . PHE A 1 71 ? 141.458 1.807   -8.205  1.00 0.00 ? 71  PHE A CE1  3  
ATOM   6869  C  CE2  . PHE A 1 71 ? 143.168 3.408   -7.579  1.00 0.00 ? 71  PHE A CE2  3  
ATOM   6870  C  CZ   . PHE A 1 71 ? 142.738 2.082   -7.709  1.00 0.00 ? 71  PHE A CZ   3  
ATOM   6871  H  H    . PHE A 1 71 ? 138.166 6.967   -8.966  1.00 0.00 ? 71  PHE A H    3  
ATOM   6872  H  HA   . PHE A 1 71 ? 138.642 4.727   -7.405  1.00 0.00 ? 71  PHE A HA   3  
ATOM   6873  H  HB2  . PHE A 1 71 ? 139.542 5.036   -9.697  1.00 0.00 ? 71  PHE A HB2  3  
ATOM   6874  H  HB3  . PHE A 1 71 ? 140.710 6.195   -9.059  1.00 0.00 ? 71  PHE A HB3  3  
ATOM   6875  H  HD1  . PHE A 1 71 ? 139.620 2.645   -8.953  1.00 0.00 ? 71  PHE A HD1  3  
ATOM   6876  H  HD2  . PHE A 1 71 ? 142.650 5.481   -7.844  1.00 0.00 ? 71  PHE A HD2  3  
ATOM   6877  H  HE1  . PHE A 1 71 ? 141.128 0.785   -8.305  1.00 0.00 ? 71  PHE A HE1  3  
ATOM   6878  H  HE2  . PHE A 1 71 ? 144.156 3.621   -7.197  1.00 0.00 ? 71  PHE A HE2  3  
ATOM   6879  H  HZ   . PHE A 1 71 ? 143.394 1.273   -7.426  1.00 0.00 ? 71  PHE A HZ   3  
ATOM   6880  N  N    . GLN A 1 72 ? 140.408 7.345   -6.455  1.00 0.00 ? 72  GLN A N    3  
ATOM   6881  C  CA   . GLN A 1 72 ? 141.168 7.863   -5.325  1.00 0.00 ? 72  GLN A CA   3  
ATOM   6882  C  C    . GLN A 1 72 ? 140.358 7.748   -4.034  1.00 0.00 ? 72  GLN A C    3  
ATOM   6883  O  O    . GLN A 1 72 ? 140.893 7.388   -2.990  1.00 0.00 ? 72  GLN A O    3  
ATOM   6884  C  CB   . GLN A 1 72 ? 141.533 9.329   -5.565  1.00 0.00 ? 72  GLN A CB   3  
ATOM   6885  C  CG   . GLN A 1 72 ? 142.460 9.810   -4.446  1.00 0.00 ? 72  GLN A CG   3  
ATOM   6886  C  CD   . GLN A 1 72 ? 142.730 11.303  -4.600  1.00 0.00 ? 72  GLN A CD   3  
ATOM   6887  O  OE1  . GLN A 1 72 ? 141.799 12.108  -4.581  1.00 0.00 ? 72  GLN A OE1  3  
ATOM   6888  N  NE2  . GLN A 1 72 ? 143.957 11.723  -4.751  1.00 0.00 ? 72  GLN A NE2  3  
ATOM   6889  H  H    . GLN A 1 72 ? 140.190 7.934   -7.208  1.00 0.00 ? 72  GLN A H    3  
ATOM   6890  H  HA   . GLN A 1 72 ? 142.079 7.291   -5.218  1.00 0.00 ? 72  GLN A HA   3  
ATOM   6891  H  HB2  . GLN A 1 72 ? 142.036 9.423   -6.516  1.00 0.00 ? 72  GLN A HB2  3  
ATOM   6892  H  HB3  . GLN A 1 72 ? 140.636 9.928   -5.569  1.00 0.00 ? 72  GLN A HB3  3  
ATOM   6893  H  HG2  . GLN A 1 72 ? 141.989 9.629   -3.490  1.00 0.00 ? 72  GLN A HG2  3  
ATOM   6894  H  HG3  . GLN A 1 72 ? 143.391 9.269   -4.493  1.00 0.00 ? 72  GLN A HG3  3  
ATOM   6895  H  HE21 . GLN A 1 72 ? 144.696 11.081  -4.766  1.00 0.00 ? 72  GLN A HE21 3  
ATOM   6896  H  HE22 . GLN A 1 72 ? 144.137 12.681  -4.849  1.00 0.00 ? 72  GLN A HE22 3  
ATOM   6897  N  N    . GLU A 1 73 ? 139.064 8.056   -4.104  1.00 0.00 ? 73  GLU A N    3  
ATOM   6898  C  CA   . GLU A 1 73 ? 138.219 7.961   -2.917  1.00 0.00 ? 73  GLU A CA   3  
ATOM   6899  C  C    . GLU A 1 73 ? 138.026 6.495   -2.500  1.00 0.00 ? 73  GLU A C    3  
ATOM   6900  O  O    . GLU A 1 73 ? 138.001 6.164   -1.311  1.00 0.00 ? 73  GLU A O    3  
ATOM   6901  C  CB   . GLU A 1 73 ? 136.854 8.607   -3.196  1.00 0.00 ? 73  GLU A CB   3  
ATOM   6902  C  CG   . GLU A 1 73 ? 137.035 10.108  -3.463  1.00 0.00 ? 73  GLU A CG   3  
ATOM   6903  C  CD   . GLU A 1 73 ? 135.675 10.783  -3.653  1.00 0.00 ? 73  GLU A CD   3  
ATOM   6904  O  OE1  . GLU A 1 73 ? 134.683 10.081  -3.644  1.00 0.00 ? 73  GLU A OE1  3  
ATOM   6905  O  OE2  . GLU A 1 73 ? 135.646 11.993  -3.823  1.00 0.00 ? 73  GLU A OE2  3  
ATOM   6906  H  H    . GLU A 1 73 ? 138.675 8.340   -4.958  1.00 0.00 ? 73  GLU A H    3  
ATOM   6907  H  HA   . GLU A 1 73 ? 138.693 8.497   -2.110  1.00 0.00 ? 73  GLU A HA   3  
ATOM   6908  H  HB2  . GLU A 1 73 ? 136.407 8.140   -4.062  1.00 0.00 ? 73  GLU A HB2  3  
ATOM   6909  H  HB3  . GLU A 1 73 ? 136.209 8.471   -2.341  1.00 0.00 ? 73  GLU A HB3  3  
ATOM   6910  H  HG2  . GLU A 1 73 ? 137.544 10.560  -2.625  1.00 0.00 ? 73  GLU A HG2  3  
ATOM   6911  H  HG3  . GLU A 1 73 ? 137.627 10.243  -4.356  1.00 0.00 ? 73  GLU A HG3  3  
ATOM   6912  N  N    . TYR A 1 74 ? 137.873 5.625   -3.499  1.00 0.00 ? 74  TYR A N    3  
ATOM   6913  C  CA   . TYR A 1 74 ? 137.661 4.198   -3.256  1.00 0.00 ? 74  TYR A CA   3  
ATOM   6914  C  C    . TYR A 1 74 ? 138.844 3.512   -2.571  1.00 0.00 ? 74  TYR A C    3  
ATOM   6915  O  O    . TYR A 1 74 ? 138.656 2.724   -1.632  1.00 0.00 ? 74  TYR A O    3  
ATOM   6916  C  CB   . TYR A 1 74 ? 137.382 3.496   -4.589  1.00 0.00 ? 74  TYR A CB   3  
ATOM   6917  C  CG   . TYR A 1 74 ? 137.116 2.030   -4.343  1.00 0.00 ? 74  TYR A CG   3  
ATOM   6918  C  CD1  . TYR A 1 74 ? 135.825 1.586   -4.029  1.00 0.00 ? 74  TYR A CD1  3  
ATOM   6919  C  CD2  . TYR A 1 74 ? 138.169 1.112   -4.429  1.00 0.00 ? 74  TYR A CD2  3  
ATOM   6920  C  CE1  . TYR A 1 74 ? 135.590 0.223   -3.802  1.00 0.00 ? 74  TYR A CE1  3  
ATOM   6921  C  CE2  . TYR A 1 74 ? 137.936 -0.247  -4.201  1.00 0.00 ? 74  TYR A CE2  3  
ATOM   6922  C  CZ   . TYR A 1 74 ? 136.646 -0.693  -3.887  1.00 0.00 ? 74  TYR A CZ   3  
ATOM   6923  O  OH   . TYR A 1 74 ? 136.415 -2.035  -3.663  1.00 0.00 ? 74  TYR A OH   3  
ATOM   6924  H  H    . TYR A 1 74 ? 137.891 5.953   -4.423  1.00 0.00 ? 74  TYR A H    3  
ATOM   6925  H  HA   . TYR A 1 74 ? 136.791 4.085   -2.629  1.00 0.00 ? 74  TYR A HA   3  
ATOM   6926  H  HB2  . TYR A 1 74 ? 136.515 3.945   -5.061  1.00 0.00 ? 74  TYR A HB2  3  
ATOM   6927  H  HB3  . TYR A 1 74 ? 138.239 3.602   -5.236  1.00 0.00 ? 74  TYR A HB3  3  
ATOM   6928  H  HD1  . TYR A 1 74 ? 135.012 2.294   -3.963  1.00 0.00 ? 74  TYR A HD1  3  
ATOM   6929  H  HD2  . TYR A 1 74 ? 139.164 1.455   -4.670  1.00 0.00 ? 74  TYR A HD2  3  
ATOM   6930  H  HE1  . TYR A 1 74 ? 134.595 -0.122  -3.561  1.00 0.00 ? 74  TYR A HE1  3  
ATOM   6931  H  HE2  . TYR A 1 74 ? 138.752 -0.952  -4.265  1.00 0.00 ? 74  TYR A HE2  3  
ATOM   6932  H  HH   . TYR A 1 74 ? 135.678 -2.112  -3.054  1.00 0.00 ? 74  TYR A HH   3  
ATOM   6933  N  N    . VAL A 1 75 ? 140.062 3.783   -3.044  1.00 0.00 ? 75  VAL A N    3  
ATOM   6934  C  CA   . VAL A 1 75 ? 141.225 3.131   -2.455  1.00 0.00 ? 75  VAL A CA   3  
ATOM   6935  C  C    . VAL A 1 75 ? 141.338 3.473   -0.979  1.00 0.00 ? 75  VAL A C    3  
ATOM   6936  O  O    . VAL A 1 75 ? 141.654 2.612   -0.157  1.00 0.00 ? 75  VAL A O    3  
ATOM   6937  C  CB   . VAL A 1 75 ? 142.510 3.527   -3.187  1.00 0.00 ? 75  VAL A CB   3  
ATOM   6938  C  CG1  . VAL A 1 75 ? 142.972 4.907   -2.722  1.00 0.00 ? 75  VAL A CG1  3  
ATOM   6939  C  CG2  . VAL A 1 75 ? 143.597 2.488   -2.891  1.00 0.00 ? 75  VAL A CG2  3  
ATOM   6940  H  H    . VAL A 1 75 ? 140.172 4.398   -3.801  1.00 0.00 ? 75  VAL A H    3  
ATOM   6941  H  HA   . VAL A 1 75 ? 141.098 2.063   -2.550  1.00 0.00 ? 75  VAL A HA   3  
ATOM   6942  H  HB   . VAL A 1 75 ? 142.321 3.556   -4.250  1.00 0.00 ? 75  VAL A HB   3  
ATOM   6943  H  HG11 . VAL A 1 75 ? 142.127 5.566   -2.683  1.00 0.00 ? 75  VAL A HG11 3  
ATOM   6944  H  HG12 . VAL A 1 75 ? 143.704 5.296   -3.415  1.00 0.00 ? 75  VAL A HG12 3  
ATOM   6945  H  HG13 . VAL A 1 75 ? 143.413 4.828   -1.740  1.00 0.00 ? 75  VAL A HG13 3  
ATOM   6946  H  HG21 . VAL A 1 75 ? 144.567 2.955   -2.942  1.00 0.00 ? 75  VAL A HG21 3  
ATOM   6947  H  HG22 . VAL A 1 75 ? 143.542 1.694   -3.622  1.00 0.00 ? 75  VAL A HG22 3  
ATOM   6948  H  HG23 . VAL A 1 75 ? 143.447 2.076   -1.903  1.00 0.00 ? 75  VAL A HG23 3  
ATOM   6949  N  N    . VAL A 1 76 ? 141.055 4.724   -0.634  1.00 0.00 ? 76  VAL A N    3  
ATOM   6950  C  CA   . VAL A 1 76 ? 141.106 5.123   0.759   1.00 0.00 ? 76  VAL A CA   3  
ATOM   6951  C  C    . VAL A 1 76 ? 139.896 4.568   1.496   1.00 0.00 ? 76  VAL A C    3  
ATOM   6952  O  O    . VAL A 1 76 ? 139.976 4.228   2.677   1.00 0.00 ? 76  VAL A O    3  
ATOM   6953  C  CB   . VAL A 1 76 ? 141.164 6.651   0.890   1.00 0.00 ? 76  VAL A CB   3  
ATOM   6954  C  CG1  . VAL A 1 76 ? 142.401 7.175   0.160   1.00 0.00 ? 76  VAL A CG1  3  
ATOM   6955  C  CG2  . VAL A 1 76 ? 139.919 7.280   0.263   1.00 0.00 ? 76  VAL A CG2  3  
ATOM   6956  H  H    . VAL A 1 76 ? 140.789 5.371   -1.320  1.00 0.00 ? 76  VAL A H    3  
ATOM   6957  H  HA   . VAL A 1 76 ? 141.998 4.705   1.204   1.00 0.00 ? 76  VAL A HA   3  
ATOM   6958  H  HB   . VAL A 1 76 ? 141.221 6.922   1.935   1.00 0.00 ? 76  VAL A HB   3  
ATOM   6959  H  HG11 . VAL A 1 76 ? 142.334 6.923   -0.886  1.00 0.00 ? 76  VAL A HG11 3  
ATOM   6960  H  HG12 . VAL A 1 76 ? 143.287 6.725   0.581   1.00 0.00 ? 76  VAL A HG12 3  
ATOM   6961  H  HG13 . VAL A 1 76 ? 142.455 8.248   0.267   1.00 0.00 ? 76  VAL A HG13 3  
ATOM   6962  H  HG21 . VAL A 1 76 ? 139.883 8.330   0.511   1.00 0.00 ? 76  VAL A HG21 3  
ATOM   6963  H  HG22 . VAL A 1 76 ? 139.032 6.792   0.640   1.00 0.00 ? 76  VAL A HG22 3  
ATOM   6964  H  HG23 . VAL A 1 76 ? 139.970 7.166   -0.808  1.00 0.00 ? 76  VAL A HG23 3  
ATOM   6965  N  N    . LEU A 1 77 ? 138.768 4.476   0.787   1.00 0.00 ? 77  LEU A N    3  
ATOM   6966  C  CA   . LEU A 1 77 ? 137.551 3.956   1.396   1.00 0.00 ? 77  LEU A CA   3  
ATOM   6967  C  C    . LEU A 1 77 ? 137.752 2.528   1.887   1.00 0.00 ? 77  LEU A C    3  
ATOM   6968  O  O    . LEU A 1 77 ? 137.310 2.180   2.980   1.00 0.00 ? 77  LEU A O    3  
ATOM   6969  C  CB   . LEU A 1 77 ? 136.414 3.997   0.368   1.00 0.00 ? 77  LEU A CB   3  
ATOM   6970  C  CG   . LEU A 1 77 ? 135.073 3.649   1.036   1.00 0.00 ? 77  LEU A CG   3  
ATOM   6971  C  CD1  . LEU A 1 77 ? 133.938 4.358   0.293   1.00 0.00 ? 77  LEU A CD1  3  
ATOM   6972  C  CD2  . LEU A 1 77 ? 134.820 2.134   0.987   1.00 0.00 ? 77  LEU A CD2  3  
ATOM   6973  H  H    . LEU A 1 77 ? 138.757 4.765   -0.154  1.00 0.00 ? 77  LEU A H    3  
ATOM   6974  H  HA   . LEU A 1 77 ? 137.286 4.581   2.233   1.00 0.00 ? 77  LEU A HA   3  
ATOM   6975  H  HB2  . LEU A 1 77 ? 136.359 4.991   -0.054  1.00 0.00 ? 77  LEU A HB2  3  
ATOM   6976  H  HB3  . LEU A 1 77 ? 136.621 3.290   -0.420  1.00 0.00 ? 77  LEU A HB3  3  
ATOM   6977  H  HG   . LEU A 1 77 ? 135.087 3.978   2.065   1.00 0.00 ? 77  LEU A HG   3  
ATOM   6978  H  HD11 . LEU A 1 77 ? 132.995 4.113   0.756   1.00 0.00 ? 77  LEU A HD11 3  
ATOM   6979  H  HD12 . LEU A 1 77 ? 133.929 4.035   -0.738  1.00 0.00 ? 77  LEU A HD12 3  
ATOM   6980  H  HD13 . LEU A 1 77 ? 134.094 5.426   0.333   1.00 0.00 ? 77  LEU A HD13 3  
ATOM   6981  H  HD21 . LEU A 1 77 ? 133.773 1.943   1.170   1.00 0.00 ? 77  LEU A HD21 3  
ATOM   6982  H  HD22 . LEU A 1 77 ? 135.408 1.643   1.745   1.00 0.00 ? 77  LEU A HD22 3  
ATOM   6983  H  HD23 . LEU A 1 77 ? 135.088 1.747   0.016   1.00 0.00 ? 77  LEU A HD23 3  
ATOM   6984  N  N    . VAL A 1 78 ? 138.429 1.704   1.088   1.00 0.00 ? 78  VAL A N    3  
ATOM   6985  C  CA   . VAL A 1 78 ? 138.675 0.319   1.491   1.00 0.00 ? 78  VAL A CA   3  
ATOM   6986  C  C    . VAL A 1 78 ? 139.729 0.235   2.595   1.00 0.00 ? 78  VAL A C    3  
ATOM   6987  O  O    . VAL A 1 78 ? 139.701 -0.669  3.439   1.00 0.00 ? 78  VAL A O    3  
ATOM   6988  C  CB   . VAL A 1 78 ? 139.105 -0.527  0.284   1.00 0.00 ? 78  VAL A CB   3  
ATOM   6989  C  CG1  . VAL A 1 78 ? 138.022 -0.453  -0.795  1.00 0.00 ? 78  VAL A CG1  3  
ATOM   6990  C  CG2  . VAL A 1 78 ? 140.420 0.003   -0.292  1.00 0.00 ? 78  VAL A CG2  3  
ATOM   6991  H  H    . VAL A 1 78 ? 138.769 2.033   0.220   1.00 0.00 ? 78  VAL A H    3  
ATOM   6992  H  HA   . VAL A 1 78 ? 137.752 -0.088  1.876   1.00 0.00 ? 78  VAL A HA   3  
ATOM   6993  H  HB   . VAL A 1 78 ? 139.232 -1.554  0.594   1.00 0.00 ? 78  VAL A HB   3  
ATOM   6994  H  HG11 . VAL A 1 78 ? 137.181 -1.063  -0.502  1.00 0.00 ? 78  VAL A HG11 3  
ATOM   6995  H  HG12 . VAL A 1 78 ? 138.422 -0.816  -1.730  1.00 0.00 ? 78  VAL A HG12 3  
ATOM   6996  H  HG13 . VAL A 1 78 ? 137.701 0.571   -0.913  1.00 0.00 ? 78  VAL A HG13 3  
ATOM   6997  H  HG21 . VAL A 1 78 ? 141.138 0.142   0.502   1.00 0.00 ? 78  VAL A HG21 3  
ATOM   6998  H  HG22 . VAL A 1 78 ? 140.239 0.946   -0.782  1.00 0.00 ? 78  VAL A HG22 3  
ATOM   6999  H  HG23 . VAL A 1 78 ? 140.811 -0.706  -1.011  1.00 0.00 ? 78  VAL A HG23 3  
ATOM   7000  N  N    . ALA A 1 79 ? 140.674 1.167   2.569   1.00 0.00 ? 79  ALA A N    3  
ATOM   7001  C  CA   . ALA A 1 79 ? 141.752 1.172   3.549   1.00 0.00 ? 79  ALA A CA   3  
ATOM   7002  C  C    . ALA A 1 79 ? 141.220 1.323   4.974   1.00 0.00 ? 79  ALA A C    3  
ATOM   7003  O  O    . ALA A 1 79 ? 141.748 0.709   5.901   1.00 0.00 ? 79  ALA A O    3  
ATOM   7004  C  CB   . ALA A 1 79 ? 142.730 2.314   3.227   1.00 0.00 ? 79  ALA A CB   3  
ATOM   7005  H  H    . ALA A 1 79 ? 140.659 1.850   1.866   1.00 0.00 ? 79  ALA A H    3  
ATOM   7006  H  HA   . ALA A 1 79 ? 142.282 0.234   3.479   1.00 0.00 ? 79  ALA A HA   3  
ATOM   7007  H  HB1  . ALA A 1 79 ? 143.744 1.942   3.258   1.00 0.00 ? 79  ALA A HB1  3  
ATOM   7008  H  HB2  . ALA A 1 79 ? 142.618 3.111   3.948   1.00 0.00 ? 79  ALA A HB2  3  
ATOM   7009  H  HB3  . ALA A 1 79 ? 142.520 2.694   2.239   1.00 0.00 ? 79  ALA A HB3  3  
ATOM   7010  N  N    . ALA A 1 80 ? 140.182 2.133   5.155   1.00 0.00 ? 80  ALA A N    3  
ATOM   7011  C  CA   . ALA A 1 80 ? 139.632 2.318   6.492   1.00 0.00 ? 80  ALA A CA   3  
ATOM   7012  C  C    . ALA A 1 80 ? 139.037 1.013   7.013   1.00 0.00 ? 80  ALA A C    3  
ATOM   7013  O  O    . ALA A 1 80 ? 139.263 0.633   8.161   1.00 0.00 ? 80  ALA A O    3  
ATOM   7014  C  CB   . ALA A 1 80 ? 138.553 3.402   6.469   1.00 0.00 ? 80  ALA A CB   3  
ATOM   7015  H  H    . ALA A 1 80 ? 139.789 2.606   4.393   1.00 0.00 ? 80  ALA A H    3  
ATOM   7016  H  HA   . ALA A 1 80 ? 140.426 2.629   7.157   1.00 0.00 ? 80  ALA A HA   3  
ATOM   7017  H  HB1  . ALA A 1 80 ? 138.974 4.322   6.090   1.00 0.00 ? 80  ALA A HB1  3  
ATOM   7018  H  HB2  . ALA A 1 80 ? 138.182 3.563   7.471   1.00 0.00 ? 80  ALA A HB2  3  
ATOM   7019  H  HB3  . ALA A 1 80 ? 137.740 3.089   5.831   1.00 0.00 ? 80  ALA A HB3  3  
ATOM   7020  N  N    . LEU A 1 81 ? 138.296 0.314   6.153   1.00 0.00 ? 81  LEU A N    3  
ATOM   7021  C  CA   . LEU A 1 81 ? 137.705 -0.961  6.542   1.00 0.00 ? 81  LEU A CA   3  
ATOM   7022  C  C    . LEU A 1 81 ? 138.793 -1.992  6.800   1.00 0.00 ? 81  LEU A C    3  
ATOM   7023  O  O    . LEU A 1 81 ? 138.663 -2.840  7.682   1.00 0.00 ? 81  LEU A O    3  
ATOM   7024  C  CB   . LEU A 1 81 ? 136.743 -1.480  5.466   1.00 0.00 ? 81  LEU A CB   3  
ATOM   7025  C  CG   . LEU A 1 81 ? 135.483 -0.606  5.416   1.00 0.00 ? 81  LEU A CG   3  
ATOM   7026  C  CD1  . LEU A 1 81 ? 135.742 0.634   4.559   1.00 0.00 ? 81  LEU A CD1  3  
ATOM   7027  C  CD2  . LEU A 1 81 ? 134.329 -1.414  4.810   1.00 0.00 ? 81  LEU A CD2  3  
ATOM   7028  H  H    . LEU A 1 81 ? 138.164 0.652   5.243   1.00 0.00 ? 81  LEU A H    3  
ATOM   7029  H  HA   . LEU A 1 81 ? 137.152 -0.816  7.458   1.00 0.00 ? 81  LEU A HA   3  
ATOM   7030  H  HB2  . LEU A 1 81 ? 137.237 -1.456  4.505   1.00 0.00 ? 81  LEU A HB2  3  
ATOM   7031  H  HB3  . LEU A 1 81 ? 136.463 -2.497  5.698   1.00 0.00 ? 81  LEU A HB3  3  
ATOM   7032  H  HG   . LEU A 1 81 ? 135.217 -0.298  6.415   1.00 0.00 ? 81  LEU A HG   3  
ATOM   7033  H  HD11 . LEU A 1 81 ? 136.142 0.333   3.604   1.00 0.00 ? 81  LEU A HD11 3  
ATOM   7034  H  HD12 . LEU A 1 81 ? 136.447 1.279   5.061   1.00 0.00 ? 81  LEU A HD12 3  
ATOM   7035  H  HD13 . LEU A 1 81 ? 134.813 1.167   4.409   1.00 0.00 ? 81  LEU A HD13 3  
ATOM   7036  H  HD21 . LEU A 1 81 ? 133.825 -1.961  5.594   1.00 0.00 ? 81  LEU A HD21 3  
ATOM   7037  H  HD22 . LEU A 1 81 ? 134.719 -2.110  4.082   1.00 0.00 ? 81  LEU A HD22 3  
ATOM   7038  H  HD23 . LEU A 1 81 ? 133.630 -0.746  4.331   1.00 0.00 ? 81  LEU A HD23 3  
ATOM   7039  N  N    . THR A 1 82 ? 139.869 -1.908  6.019   1.00 0.00 ? 82  THR A N    3  
ATOM   7040  C  CA   . THR A 1 82 ? 140.975 -2.849  6.159   1.00 0.00 ? 82  THR A CA   3  
ATOM   7041  C  C    . THR A 1 82 ? 141.447 -2.917  7.601   1.00 0.00 ? 82  THR A C    3  
ATOM   7042  O  O    . THR A 1 82 ? 141.779 -3.991  8.105   1.00 0.00 ? 82  THR A O    3  
ATOM   7043  C  CB   . THR A 1 82 ? 142.138 -2.406  5.272   1.00 0.00 ? 82  THR A CB   3  
ATOM   7044  O  OG1  . THR A 1 82 ? 141.696 -2.297  3.927   1.00 0.00 ? 82  THR A OG1  3  
ATOM   7045  C  CG2  . THR A 1 82 ? 143.287 -3.412  5.370   1.00 0.00 ? 82  THR A CG2  3  
ATOM   7046  H  H    . THR A 1 82 ? 139.913 -1.209  5.327   1.00 0.00 ? 82  THR A H    3  
ATOM   7047  H  HA   . THR A 1 82 ? 140.649 -3.830  5.845   1.00 0.00 ? 82  THR A HA   3  
ATOM   7048  H  HB   . THR A 1 82 ? 142.486 -1.443  5.609   1.00 0.00 ? 82  THR A HB   3  
ATOM   7049  H  HG1  . THR A 1 82 ? 141.438 -3.172  3.627   1.00 0.00 ? 82  THR A HG1  3  
ATOM   7050  H  HG21 . THR A 1 82 ? 143.826 -3.435  4.435   1.00 0.00 ? 82  THR A HG21 3  
ATOM   7051  H  HG22 . THR A 1 82 ? 142.893 -4.394  5.584   1.00 0.00 ? 82  THR A HG22 3  
ATOM   7052  H  HG23 . THR A 1 82 ? 143.958 -3.114  6.162   1.00 0.00 ? 82  THR A HG23 3  
ATOM   7053  N  N    . VAL A 1 83 ? 141.469 -1.776  8.264   1.00 0.00 ? 83  VAL A N    3  
ATOM   7054  C  CA   . VAL A 1 83 ? 141.894 -1.731  9.650   1.00 0.00 ? 83  VAL A CA   3  
ATOM   7055  C  C    . VAL A 1 83 ? 140.983 -2.593  10.519  1.00 0.00 ? 83  VAL A C    3  
ATOM   7056  O  O    . VAL A 1 83 ? 141.437 -3.214  11.478  1.00 0.00 ? 83  VAL A O    3  
ATOM   7057  C  CB   . VAL A 1 83 ? 141.886 -0.294  10.169  1.00 0.00 ? 83  VAL A CB   3  
ATOM   7058  C  CG1  . VAL A 1 83 ? 142.189 -0.297  11.669  1.00 0.00 ? 83  VAL A CG1  3  
ATOM   7059  C  CG2  . VAL A 1 83 ? 142.954 0.519   9.434   1.00 0.00 ? 83  VAL A CG2  3  
ATOM   7060  H  H    . VAL A 1 83 ? 141.187 -0.951  7.817   1.00 0.00 ? 83  VAL A H    3  
ATOM   7061  H  HA   . VAL A 1 83 ? 142.901 -2.116  9.716   1.00 0.00 ? 83  VAL A HA   3  
ATOM   7062  H  HB   . VAL A 1 83 ? 140.913 0.144   9.999   1.00 0.00 ? 83  VAL A HB   3  
ATOM   7063  H  HG11 . VAL A 1 83 ? 141.319 -0.636  12.212  1.00 0.00 ? 83  VAL A HG11 3  
ATOM   7064  H  HG12 . VAL A 1 83 ? 142.446 0.702   11.987  1.00 0.00 ? 83  VAL A HG12 3  
ATOM   7065  H  HG13 . VAL A 1 83 ? 143.020 -0.962  11.868  1.00 0.00 ? 83  VAL A HG13 3  
ATOM   7066  H  HG21 . VAL A 1 83 ? 142.938 0.266   8.384   1.00 0.00 ? 83  VAL A HG21 3  
ATOM   7067  H  HG22 . VAL A 1 83 ? 143.926 0.291   9.845   1.00 0.00 ? 83  VAL A HG22 3  
ATOM   7068  H  HG23 . VAL A 1 83 ? 142.749 1.573   9.553   1.00 0.00 ? 83  VAL A HG23 3  
ATOM   7069  N  N    . ALA A 1 84 ? 139.690 -2.622  10.191  1.00 0.00 ? 84  ALA A N    3  
ATOM   7070  C  CA   . ALA A 1 84 ? 138.749 -3.410  10.978  1.00 0.00 ? 84  ALA A CA   3  
ATOM   7071  C  C    . ALA A 1 84 ? 139.095 -4.894  10.925  1.00 0.00 ? 84  ALA A C    3  
ATOM   7072  O  O    . ALA A 1 84 ? 139.017 -5.599  11.939  1.00 0.00 ? 84  ALA A O    3  
ATOM   7073  C  CB   . ALA A 1 84 ? 137.327 -3.199  10.454  1.00 0.00 ? 84  ALA A CB   3  
ATOM   7074  H  H    . ALA A 1 84 ? 139.364 -2.113  9.408   1.00 0.00 ? 84  ALA A H    3  
ATOM   7075  H  HA   . ALA A 1 84 ? 138.789 -3.079  12.006  1.00 0.00 ? 84  ALA A HA   3  
ATOM   7076  H  HB1  . ALA A 1 84 ? 136.639 -3.805  11.023  1.00 0.00 ? 84  ALA A HB1  3  
ATOM   7077  H  HB2  . ALA A 1 84 ? 137.282 -3.484  9.412   1.00 0.00 ? 84  ALA A HB2  3  
ATOM   7078  H  HB3  . ALA A 1 84 ? 137.058 -2.158  10.553  1.00 0.00 ? 84  ALA A HB3  3  
ATOM   7079  N  N    . MET A 1 85 ? 139.498 -5.376  9.750   1.00 0.00 ? 85  MET A N    3  
ATOM   7080  C  CA   . MET A 1 85 ? 139.855 -6.777  9.641   1.00 0.00 ? 85  MET A CA   3  
ATOM   7081  C  C    . MET A 1 85 ? 141.004 -7.063  10.587  1.00 0.00 ? 85  MET A C    3  
ATOM   7082  O  O    . MET A 1 85 ? 141.051 -8.113  11.221  1.00 0.00 ? 85  MET A O    3  
ATOM   7083  C  CB   . MET A 1 85 ? 140.264 -7.143  8.213   1.00 0.00 ? 85  MET A CB   3  
ATOM   7084  C  CG   . MET A 1 85 ? 140.416 -8.666  8.123   1.00 0.00 ? 85  MET A CG   3  
ATOM   7085  S  SD   . MET A 1 85 ? 141.057 -9.140  6.498   1.00 0.00 ? 85  MET A SD   3  
ATOM   7086  C  CE   . MET A 1 85 ? 142.809 -8.885  6.865   1.00 0.00 ? 85  MET A CE   3  
ATOM   7087  H  H    . MET A 1 85 ? 139.561 -4.786  8.969   1.00 0.00 ? 85  MET A H    3  
ATOM   7088  H  HA   . MET A 1 85 ? 139.006 -7.379  9.929   1.00 0.00 ? 85  MET A HA   3  
ATOM   7089  H  HB2  . MET A 1 85 ? 139.502 -6.810  7.522   1.00 0.00 ? 85  MET A HB2  3  
ATOM   7090  H  HB3  . MET A 1 85 ? 141.203 -6.671  7.973   1.00 0.00 ? 85  MET A HB3  3  
ATOM   7091  H  HG2  . MET A 1 85 ? 141.101 -9.002  8.887   1.00 0.00 ? 85  MET A HG2  3  
ATOM   7092  H  HG3  . MET A 1 85 ? 139.455 -9.130  8.279   1.00 0.00 ? 85  MET A HG3  3  
ATOM   7093  H  HE1  . MET A 1 85 ? 142.912 -8.107  7.605   1.00 0.00 ? 85  MET A HE1  3  
ATOM   7094  H  HE2  . MET A 1 85 ? 143.329 -8.595  5.967   1.00 0.00 ? 85  MET A HE2  3  
ATOM   7095  H  HE3  . MET A 1 85 ? 143.236 -9.807  7.243   1.00 0.00 ? 85  MET A HE3  3  
ATOM   7096  N  N    . ASN A 1 86 ? 141.924 -6.107  10.691  1.00 0.00 ? 86  ASN A N    3  
ATOM   7097  C  CA   . ASN A 1 86 ? 143.056 -6.264  11.587  1.00 0.00 ? 86  ASN A CA   3  
ATOM   7098  C  C    . ASN A 1 86 ? 142.561 -6.468  13.012  1.00 0.00 ? 86  ASN A C    3  
ATOM   7099  O  O    . ASN A 1 86 ? 143.061 -7.327  13.737  1.00 0.00 ? 86  ASN A O    3  
ATOM   7100  C  CB   . ASN A 1 86 ? 143.941 -5.017  11.520  1.00 0.00 ? 86  ASN A CB   3  
ATOM   7101  C  CG   . ASN A 1 86 ? 145.264 -5.264  12.234  1.00 0.00 ? 86  ASN A CG   3  
ATOM   7102  O  OD1  . ASN A 1 86 ? 146.010 -6.172  11.869  1.00 0.00 ? 86  ASN A OD1  3  
ATOM   7103  N  ND2  . ASN A 1 86 ? 145.601 -4.496  13.233  1.00 0.00 ? 86  ASN A ND2  3  
ATOM   7104  H  H    . ASN A 1 86 ? 141.828 -5.282  10.171  1.00 0.00 ? 86  ASN A H    3  
ATOM   7105  H  HA   . ASN A 1 86 ? 143.634 -7.124  11.284  1.00 0.00 ? 86  ASN A HA   3  
ATOM   7106  H  HB2  . ASN A 1 86 ? 144.134 -4.771  10.486  1.00 0.00 ? 86  ASN A HB2  3  
ATOM   7107  H  HB3  . ASN A 1 86 ? 143.432 -4.192  11.994  1.00 0.00 ? 86  ASN A HB3  3  
ATOM   7108  H  HD21 . ASN A 1 86 ? 145.005 -3.772  13.517  1.00 0.00 ? 86  ASN A HD21 3  
ATOM   7109  H  HD22 . ASN A 1 86 ? 146.449 -4.640  13.697  1.00 0.00 ? 86  ASN A HD22 3  
ATOM   7110  N  N    . ASN A 1 87 ? 141.552 -5.691  13.398  1.00 0.00 ? 87  ASN A N    3  
ATOM   7111  C  CA   . ASN A 1 87 ? 140.983 -5.829  14.732  1.00 0.00 ? 87  ASN A CA   3  
ATOM   7112  C  C    . ASN A 1 87 ? 140.412 -7.229  14.895  1.00 0.00 ? 87  ASN A C    3  
ATOM   7113  O  O    . ASN A 1 87 ? 140.596 -7.879  15.924  1.00 0.00 ? 87  ASN A O    3  
ATOM   7114  C  CB   . ASN A 1 87 ? 139.880 -4.792  14.948  1.00 0.00 ? 87  ASN A CB   3  
ATOM   7115  C  CG   . ASN A 1 87 ? 139.413 -4.823  16.400  1.00 0.00 ? 87  ASN A CG   3  
ATOM   7116  O  OD1  . ASN A 1 87 ? 138.333 -5.334  16.695  1.00 0.00 ? 87  ASN A OD1  3  
ATOM   7117  N  ND2  . ASN A 1 87 ? 140.167 -4.303  17.330  1.00 0.00 ? 87  ASN A ND2  3  
ATOM   7118  H  H    . ASN A 1 87 ? 141.176 -5.036  12.773  1.00 0.00 ? 87  ASN A H    3  
ATOM   7119  H  HA   . ASN A 1 87 ? 141.760 -5.676  15.466  1.00 0.00 ? 87  ASN A HA   3  
ATOM   7120  H  HB2  . ASN A 1 87 ? 140.263 -3.809  14.716  1.00 0.00 ? 87  ASN A HB2  3  
ATOM   7121  H  HB3  . ASN A 1 87 ? 139.046 -5.015  14.300  1.00 0.00 ? 87  ASN A HB3  3  
ATOM   7122  H  HD21 . ASN A 1 87 ? 141.027 -3.897  17.092  1.00 0.00 ? 87  ASN A HD21 3  
ATOM   7123  H  HD22 . ASN A 1 87 ? 139.874 -4.318  18.264  1.00 0.00 ? 87  ASN A HD22 3  
ATOM   7124  N  N    . PHE A 1 88 ? 139.731 -7.687  13.847  1.00 0.00 ? 88  PHE A N    3  
ATOM   7125  C  CA   . PHE A 1 88 ? 139.142 -9.022  13.843  1.00 0.00 ? 88  PHE A CA   3  
ATOM   7126  C  C    . PHE A 1 88 ? 140.228 -10.081 13.998  1.00 0.00 ? 88  PHE A C    3  
ATOM   7127  O  O    . PHE A 1 88 ? 140.052 -11.084 14.691  1.00 0.00 ? 88  PHE A O    3  
ATOM   7128  C  CB   . PHE A 1 88 ? 138.378 -9.254  12.539  1.00 0.00 ? 88  PHE A CB   3  
ATOM   7129  C  CG   . PHE A 1 88 ? 137.663 -10.583 12.603  1.00 0.00 ? 88  PHE A CG   3  
ATOM   7130  C  CD1  . PHE A 1 88 ? 136.398 -10.668 13.197  1.00 0.00 ? 88  PHE A CD1  3  
ATOM   7131  C  CD2  . PHE A 1 88 ? 138.263 -11.728 12.067  1.00 0.00 ? 88  PHE A CD2  3  
ATOM   7132  C  CE1  . PHE A 1 88 ? 135.734 -11.899 13.257  1.00 0.00 ? 88  PHE A CE1  3  
ATOM   7133  C  CE2  . PHE A 1 88 ? 137.599 -12.960 12.126  1.00 0.00 ? 88  PHE A CE2  3  
ATOM   7134  C  CZ   . PHE A 1 88 ? 136.334 -13.045 12.721  1.00 0.00 ? 88  PHE A CZ   3  
ATOM   7135  H  H    . PHE A 1 88 ? 139.632 -7.113  13.050  1.00 0.00 ? 88  PHE A H    3  
ATOM   7136  H  HA   . PHE A 1 88 ? 138.453 -9.104  14.671  1.00 0.00 ? 88  PHE A HA   3  
ATOM   7137  H  HB2  . PHE A 1 88 ? 137.656 -8.462  12.399  1.00 0.00 ? 88  PHE A HB2  3  
ATOM   7138  H  HB3  . PHE A 1 88 ? 139.072 -9.258  11.711  1.00 0.00 ? 88  PHE A HB3  3  
ATOM   7139  H  HD1  . PHE A 1 88 ? 135.935 -9.784  13.611  1.00 0.00 ? 88  PHE A HD1  3  
ATOM   7140  H  HD2  . PHE A 1 88 ? 139.238 -11.662 11.608  1.00 0.00 ? 88  PHE A HD2  3  
ATOM   7141  H  HE1  . PHE A 1 88 ? 134.758 -11.965 13.716  1.00 0.00 ? 88  PHE A HE1  3  
ATOM   7142  H  HE2  . PHE A 1 88 ? 138.062 -13.843 11.713  1.00 0.00 ? 88  PHE A HE2  3  
ATOM   7143  H  HZ   . PHE A 1 88 ? 135.822 -13.994 12.767  1.00 0.00 ? 88  PHE A HZ   3  
ATOM   7144  N  N    . PHE A 1 89 ? 141.345 -9.846  13.318  1.00 0.00 ? 89  PHE A N    3  
ATOM   7145  C  CA   . PHE A 1 89 ? 142.470 -10.769 13.332  1.00 0.00 ? 89  PHE A CA   3  
ATOM   7146  C  C    . PHE A 1 89 ? 142.878 -11.067 14.768  1.00 0.00 ? 89  PHE A C    3  
ATOM   7147  O  O    . PHE A 1 89 ? 143.213 -12.201 15.109  1.00 0.00 ? 89  PHE A O    3  
ATOM   7148  C  CB   . PHE A 1 89 ? 143.645 -10.140 12.580  1.00 0.00 ? 89  PHE A CB   3  
ATOM   7149  C  CG   . PHE A 1 89 ? 144.739 -11.158 12.388  1.00 0.00 ? 89  PHE A CG   3  
ATOM   7150  C  CD1  . PHE A 1 89 ? 144.718 -11.978 11.256  1.00 0.00 ? 89  PHE A CD1  3  
ATOM   7151  C  CD2  . PHE A 1 89 ? 145.771 -11.281 13.324  1.00 0.00 ? 89  PHE A CD2  3  
ATOM   7152  C  CE1  . PHE A 1 89 ? 145.726 -12.923 11.056  1.00 0.00 ? 89  PHE A CE1  3  
ATOM   7153  C  CE2  . PHE A 1 89 ? 146.783 -12.228 13.126  1.00 0.00 ? 89  PHE A CE2  3  
ATOM   7154  C  CZ   . PHE A 1 89 ? 146.760 -13.051 11.991  1.00 0.00 ? 89  PHE A CZ   3  
ATOM   7155  H  H    . PHE A 1 89 ? 141.406 -9.032  12.776  1.00 0.00 ? 89  PHE A H    3  
ATOM   7156  H  HA   . PHE A 1 89 ? 142.185 -11.688 12.841  1.00 0.00 ? 89  PHE A HA   3  
ATOM   7157  H  HB2  . PHE A 1 89 ? 143.308 -9.788  11.616  1.00 0.00 ? 89  PHE A HB2  3  
ATOM   7158  H  HB3  . PHE A 1 89 ? 144.029 -9.308  13.151  1.00 0.00 ? 89  PHE A HB3  3  
ATOM   7159  H  HD1  . PHE A 1 89 ? 143.920 -11.881 10.534  1.00 0.00 ? 89  PHE A HD1  3  
ATOM   7160  H  HD2  . PHE A 1 89 ? 145.787 -10.647 14.199  1.00 0.00 ? 89  PHE A HD2  3  
ATOM   7161  H  HE1  . PHE A 1 89 ? 145.706 -13.552 10.178  1.00 0.00 ? 89  PHE A HE1  3  
ATOM   7162  H  HE2  . PHE A 1 89 ? 147.580 -12.326 13.848  1.00 0.00 ? 89  PHE A HE2  3  
ATOM   7163  H  HZ   . PHE A 1 89 ? 147.541 -13.781 11.837  1.00 0.00 ? 89  PHE A HZ   3  
ATOM   7164  N  N    . TRP A 1 90 ? 142.836 -10.039 15.605  1.00 0.00 ? 90  TRP A N    3  
ATOM   7165  C  CA   . TRP A 1 90 ? 143.191 -10.192 17.008  1.00 0.00 ? 90  TRP A CA   3  
ATOM   7166  C  C    . TRP A 1 90 ? 142.373 -11.316 17.636  1.00 0.00 ? 90  TRP A C    3  
ATOM   7167  O  O    . TRP A 1 90 ? 142.861 -12.043 18.501  1.00 0.00 ? 90  TRP A O    3  
ATOM   7168  C  CB   . TRP A 1 90 ? 142.926 -8.886  17.758  1.00 0.00 ? 90  TRP A CB   3  
ATOM   7169  C  CG   . TRP A 1 90 ? 143.436 -8.998  19.158  1.00 0.00 ? 90  TRP A CG   3  
ATOM   7170  C  CD1  . TRP A 1 90 ? 142.663 -9.173  20.254  1.00 0.00 ? 90  TRP A CD1  3  
ATOM   7171  C  CD2  . TRP A 1 90 ? 144.813 -8.945  19.633  1.00 0.00 ? 90  TRP A CD2  3  
ATOM   7172  N  NE1  . TRP A 1 90 ? 143.476 -9.231  21.372  1.00 0.00 ? 90  TRP A NE1  3  
ATOM   7173  C  CE2  . TRP A 1 90 ? 144.810 -9.096  21.040  1.00 0.00 ? 90  TRP A CE2  3  
ATOM   7174  C  CE3  . TRP A 1 90 ? 146.051 -8.783  18.986  1.00 0.00 ? 90  TRP A CE3  3  
ATOM   7175  C  CZ2  . TRP A 1 90 ? 145.993 -9.085  21.780  1.00 0.00 ? 90  TRP A CZ2  3  
ATOM   7176  C  CZ3  . TRP A 1 90 ? 147.244 -8.773  19.729  1.00 0.00 ? 90  TRP A CZ3  3  
ATOM   7177  C  CH2  . TRP A 1 90 ? 147.215 -8.923  21.122  1.00 0.00 ? 90  TRP A CH2  3  
ATOM   7178  H  H    . TRP A 1 90 ? 142.554 -9.161  15.275  1.00 0.00 ? 90  TRP A H    3  
ATOM   7179  H  HA   . TRP A 1 90 ? 144.239 -10.434 17.084  1.00 0.00 ? 90  TRP A HA   3  
ATOM   7180  H  HB2  . TRP A 1 90 ? 143.432 -8.074  17.255  1.00 0.00 ? 90  TRP A HB2  3  
ATOM   7181  H  HB3  . TRP A 1 90 ? 141.864 -8.690  17.777  1.00 0.00 ? 90  TRP A HB3  3  
ATOM   7182  H  HD1  . TRP A 1 90 ? 141.586 -9.254  20.256  1.00 0.00 ? 90  TRP A HD1  3  
ATOM   7183  H  HE1  . TRP A 1 90 ? 143.164 -9.353  22.292  1.00 0.00 ? 90  TRP A HE1  3  
ATOM   7184  H  HE3  . TRP A 1 90 ? 146.085 -8.666  17.913  1.00 0.00 ? 90  TRP A HE3  3  
ATOM   7185  H  HZ2  . TRP A 1 90 ? 145.964 -9.202  22.853  1.00 0.00 ? 90  TRP A HZ2  3  
ATOM   7186  H  HZ3  . TRP A 1 90 ? 148.190 -8.647  19.222  1.00 0.00 ? 90  TRP A HZ3  3  
ATOM   7187  H  HH2  . TRP A 1 90 ? 148.135 -8.914  21.686  1.00 0.00 ? 90  TRP A HH2  3  
ATOM   7188  N  N    . GLU A 1 91 ? 141.126 -11.456 17.193  1.00 0.00 ? 91  GLU A N    3  
ATOM   7189  C  CA   . GLU A 1 91 ? 140.254 -12.499 17.719  1.00 0.00 ? 91  GLU A CA   3  
ATOM   7190  C  C    . GLU A 1 91 ? 140.895 -13.869 17.526  1.00 0.00 ? 91  GLU A C    3  
ATOM   7191  O  O    . GLU A 1 91 ? 140.715 -14.771 18.344  1.00 0.00 ? 91  GLU A O    3  
ATOM   7192  C  CB   . GLU A 1 91 ? 138.901 -12.462 17.008  1.00 0.00 ? 91  GLU A CB   3  
ATOM   7193  C  CG   . GLU A 1 91 ? 137.949 -13.464 17.664  1.00 0.00 ? 91  GLU A CG   3  
ATOM   7194  C  CD   . GLU A 1 91 ? 136.629 -13.510 16.902  1.00 0.00 ? 91  GLU A CD   3  
ATOM   7195  O  OE1  . GLU A 1 91 ? 136.514 -12.806 15.913  1.00 0.00 ? 91  GLU A OE1  3  
ATOM   7196  O  OE2  . GLU A 1 91 ? 135.752 -14.249 17.319  1.00 0.00 ? 91  GLU A OE2  3  
ATOM   7197  H  H    . GLU A 1 91 ? 140.788 -10.850 16.496  1.00 0.00 ? 91  GLU A H    3  
ATOM   7198  H  HA   . GLU A 1 91 ? 140.100 -12.328 18.774  1.00 0.00 ? 91  GLU A HA   3  
ATOM   7199  H  HB2  . GLU A 1 91 ? 138.483 -11.467 17.080  1.00 0.00 ? 91  GLU A HB2  3  
ATOM   7200  H  HB3  . GLU A 1 91 ? 139.033 -12.722 15.968  1.00 0.00 ? 91  GLU A HB3  3  
ATOM   7201  H  HG2  . GLU A 1 91 ? 138.402 -14.445 17.656  1.00 0.00 ? 91  GLU A HG2  3  
ATOM   7202  H  HG3  . GLU A 1 91 ? 137.762 -13.165 18.685  1.00 0.00 ? 91  GLU A HG3  3  
ATOM   7203  N  N    . ASN A 1 92 ? 141.647 -14.016 16.438  1.00 0.00 ? 92  ASN A N    3  
ATOM   7204  C  CA   . ASN A 1 92 ? 142.317 -15.279 16.142  1.00 0.00 ? 92  ASN A CA   3  
ATOM   7205  C  C    . ASN A 1 92 ? 143.801 -15.186 16.481  1.00 0.00 ? 92  ASN A C    3  
ATOM   7206  O  O    . ASN A 1 92 ? 144.455 -14.187 16.178  1.00 0.00 ? 92  ASN A O    3  
ATOM   7207  C  CB   . ASN A 1 92 ? 142.152 -15.619 14.660  1.00 0.00 ? 92  ASN A CB   3  
ATOM   7208  C  CG   . ASN A 1 92 ? 140.674 -15.739 14.311  1.00 0.00 ? 92  ASN A CG   3  
ATOM   7209  O  OD1  . ASN A 1 92 ? 140.231 -15.212 13.290  1.00 0.00 ? 92  ASN A OD1  3  
ATOM   7210  N  ND2  . ASN A 1 92 ? 139.878 -16.404 15.103  1.00 0.00 ? 92  ASN A ND2  3  
ATOM   7211  H  H    . ASN A 1 92 ? 141.754 -13.260 15.824  1.00 0.00 ? 92  ASN A H    3  
ATOM   7212  H  HA   . ASN A 1 92 ? 141.870 -16.066 16.732  1.00 0.00 ? 92  ASN A HA   3  
ATOM   7213  H  HB2  . ASN A 1 92 ? 142.600 -14.838 14.061  1.00 0.00 ? 92  ASN A HB2  3  
ATOM   7214  H  HB3  . ASN A 1 92 ? 142.646 -16.557 14.450  1.00 0.00 ? 92  ASN A HB3  3  
ATOM   7215  H  HD21 . ASN A 1 92 ? 140.233 -16.822 15.916  1.00 0.00 ? 92  ASN A HD21 3  
ATOM   7216  H  HD22 . ASN A 1 92 ? 138.926 -16.485 14.886  1.00 0.00 ? 92  ASN A HD22 3  
ATOM   7217  N  N    . SER A 1 93 ? 144.327 -16.232 17.109  1.00 0.00 ? 93  SER A N    3  
ATOM   7218  C  CA   . SER A 1 93 ? 145.736 -16.256 17.484  1.00 0.00 ? 93  SER A CA   3  
ATOM   7219  C  C    . SER A 1 93 ? 146.178 -17.678 17.815  1.00 0.00 ? 93  SER A C    3  
ATOM   7220  O  O    . SER A 1 93 ? 145.359 -18.430 18.315  1.00 0.00 ? 93  SER A O    3  
ATOM   7221  C  CB   . SER A 1 93 ? 145.970 -15.353 18.695  1.00 0.00 ? 93  SER A CB   3  
ATOM   7222  O  OG   . SER A 1 93 ? 147.169 -15.746 19.351  1.00 0.00 ? 93  SER A OG   3  
ATOM   7223  O  OXT  . SER A 1 93 ? 147.330 -17.994 17.561  1.00 0.00 ? 93  SER A OXT  3  
ATOM   7224  H  H    . SER A 1 93 ? 143.758 -17.000 17.325  1.00 0.00 ? 93  SER A H    3  
ATOM   7225  H  HA   . SER A 1 93 ? 146.325 -15.889 16.657  1.00 0.00 ? 93  SER A HA   3  
ATOM   7226  H  HB2  . SER A 1 93 ? 146.062 -14.330 18.372  1.00 0.00 ? 93  SER A HB2  3  
ATOM   7227  H  HB3  . SER A 1 93 ? 145.131 -15.439 19.374  1.00 0.00 ? 93  SER A HB3  3  
ATOM   7228  H  HG   . SER A 1 93 ? 147.423 -15.042 19.951  1.00 0.00 ? 93  SER A HG   3  
ATOM   7229  N  N    . GLY B 1 1  ? 137.156 -17.412 0.089   1.00 0.00 ? 1   GLY B N    3  
ATOM   7230  C  CA   . GLY B 1 1  ? 136.458 -16.195 0.486   1.00 0.00 ? 1   GLY B CA   3  
ATOM   7231  C  C    . GLY B 1 1  ? 136.323 -15.235 -0.691  1.00 0.00 ? 1   GLY B C    3  
ATOM   7232  O  O    . GLY B 1 1  ? 135.935 -15.635 -1.788  1.00 0.00 ? 1   GLY B O    3  
ATOM   7233  H  H1   . GLY B 1 1  ? 136.691 -18.275 0.115   1.00 0.00 ? 1   GLY B H1   3  
ATOM   7234  H  HA2  . GLY B 1 1  ? 135.473 -16.453 0.850   1.00 0.00 ? 1   GLY B HA2  3  
ATOM   7235  H  HA3  . GLY B 1 1  ? 137.012 -15.709 1.274   1.00 0.00 ? 1   GLY B HA3  3  
ATOM   7236  N  N    . SER B 1 2  ? 136.648 -13.967 -0.456  1.00 0.00 ? 2   SER B N    3  
ATOM   7237  C  CA   . SER B 1 2  ? 136.562 -12.953 -1.504  1.00 0.00 ? 2   SER B CA   3  
ATOM   7238  C  C    . SER B 1 2  ? 137.957 -12.509 -1.928  1.00 0.00 ? 2   SER B C    3  
ATOM   7239  O  O    . SER B 1 2  ? 138.890 -12.487 -1.119  1.00 0.00 ? 2   SER B O    3  
ATOM   7240  C  CB   . SER B 1 2  ? 135.774 -11.745 -0.996  1.00 0.00 ? 2   SER B CB   3  
ATOM   7241  O  OG   . SER B 1 2  ? 134.474 -12.166 -0.602  1.00 0.00 ? 2   SER B OG   3  
ATOM   7242  H  H    . SER B 1 2  ? 136.951 -13.707 0.439   1.00 0.00 ? 2   SER B H    3  
ATOM   7243  H  HA   . SER B 1 2  ? 136.051 -13.368 -2.360  1.00 0.00 ? 2   SER B HA   3  
ATOM   7244  H  HB2  . SER B 1 2  ? 136.279 -11.315 -0.148  1.00 0.00 ? 2   SER B HB2  3  
ATOM   7245  H  HB3  . SER B 1 2  ? 135.702 -11.007 -1.783  1.00 0.00 ? 2   SER B HB3  3  
ATOM   7246  H  HG   . SER B 1 2  ? 133.958 -11.383 -0.400  1.00 0.00 ? 2   SER B HG   3  
ATOM   7247  N  N    . GLU B 1 3  ? 138.101 -12.153 -3.201  1.00 0.00 ? 3   GLU B N    3  
ATOM   7248  C  CA   . GLU B 1 3  ? 139.395 -11.718 -3.701  1.00 0.00 ? 3   GLU B CA   3  
ATOM   7249  C  C    . GLU B 1 3  ? 139.854 -10.482 -2.943  1.00 0.00 ? 3   GLU B C    3  
ATOM   7250  O  O    . GLU B 1 3  ? 141.042 -10.322 -2.662  1.00 0.00 ? 3   GLU B O    3  
ATOM   7251  C  CB   . GLU B 1 3  ? 139.299 -11.386 -5.191  1.00 0.00 ? 3   GLU B CB   3  
ATOM   7252  C  CG   . GLU B 1 3  ? 138.957 -12.650 -5.980  1.00 0.00 ? 3   GLU B CG   3  
ATOM   7253  C  CD   . GLU B 1 3  ? 138.927 -12.340 -7.472  1.00 0.00 ? 3   GLU B CD   3  
ATOM   7254  O  OE1  . GLU B 1 3  ? 138.999 -11.172 -7.815  1.00 0.00 ? 3   GLU B OE1  3  
ATOM   7255  O  OE2  . GLU B 1 3  ? 138.833 -13.275 -8.250  1.00 0.00 ? 3   GLU B OE2  3  
ATOM   7256  H  H    . GLU B 1 3  ? 137.332 -12.187 -3.807  1.00 0.00 ? 3   GLU B H    3  
ATOM   7257  H  HA   . GLU B 1 3  ? 140.116 -12.508 -3.561  1.00 0.00 ? 3   GLU B HA   3  
ATOM   7258  H  HB2  . GLU B 1 3  ? 138.528 -10.645 -5.346  1.00 0.00 ? 3   GLU B HB2  3  
ATOM   7259  H  HB3  . GLU B 1 3  ? 140.246 -10.996 -5.535  1.00 0.00 ? 3   GLU B HB3  3  
ATOM   7260  H  HG2  . GLU B 1 3  ? 139.704 -13.404 -5.786  1.00 0.00 ? 3   GLU B HG2  3  
ATOM   7261  H  HG3  . GLU B 1 3  ? 137.990 -13.014 -5.671  1.00 0.00 ? 3   GLU B HG3  3  
ATOM   7262  N  N    . LEU B 1 4  ? 138.906 -9.614  -2.598  1.00 0.00 ? 4   LEU B N    3  
ATOM   7263  C  CA   . LEU B 1 4  ? 139.246 -8.411  -1.856  1.00 0.00 ? 4   LEU B CA   3  
ATOM   7264  C  C    . LEU B 1 4  ? 139.882 -8.796  -0.525  1.00 0.00 ? 4   LEU B C    3  
ATOM   7265  O  O    . LEU B 1 4  ? 140.884 -8.209  -0.100  1.00 0.00 ? 4   LEU B O    3  
ATOM   7266  C  CB   . LEU B 1 4  ? 137.965 -7.604  -1.587  1.00 0.00 ? 4   LEU B CB   3  
ATOM   7267  C  CG   . LEU B 1 4  ? 138.296 -6.274  -0.898  1.00 0.00 ? 4   LEU B CG   3  
ATOM   7268  C  CD1  . LEU B 1 4  ? 138.718 -5.231  -1.940  1.00 0.00 ? 4   LEU B CD1  3  
ATOM   7269  C  CD2  . LEU B 1 4  ? 137.062 -5.779  -0.130  1.00 0.00 ? 4   LEU B CD2  3  
ATOM   7270  H  H    . LEU B 1 4  ? 137.972 -9.794  -2.835  1.00 0.00 ? 4   LEU B H    3  
ATOM   7271  H  HA   . LEU B 1 4  ? 139.936 -7.814  -2.429  1.00 0.00 ? 4   LEU B HA   3  
ATOM   7272  H  HB2  . LEU B 1 4  ? 137.468 -7.405  -2.525  1.00 0.00 ? 4   LEU B HB2  3  
ATOM   7273  H  HB3  . LEU B 1 4  ? 137.309 -8.179  -0.953  1.00 0.00 ? 4   LEU B HB3  3  
ATOM   7274  H  HG   . LEU B 1 4  ? 139.109 -6.423  -0.208  1.00 0.00 ? 4   LEU B HG   3  
ATOM   7275  H  HD11 . LEU B 1 4  ? 137.849 -4.682  -2.274  1.00 0.00 ? 4   LEU B HD11 3  
ATOM   7276  H  HD12 . LEU B 1 4  ? 139.175 -5.723  -2.785  1.00 0.00 ? 4   LEU B HD12 3  
ATOM   7277  H  HD13 . LEU B 1 4  ? 139.426 -4.547  -1.497  1.00 0.00 ? 4   LEU B HD13 3  
ATOM   7278  H  HD21 . LEU B 1 4  ? 137.260 -4.800  0.279   1.00 0.00 ? 4   LEU B HD21 3  
ATOM   7279  H  HD22 . LEU B 1 4  ? 136.835 -6.466  0.677   1.00 0.00 ? 4   LEU B HD22 3  
ATOM   7280  H  HD23 . LEU B 1 4  ? 136.218 -5.724  -0.801  1.00 0.00 ? 4   LEU B HD23 3  
ATOM   7281  N  N    . GLU B 1 5  ? 139.297 -9.802  0.124   1.00 0.00 ? 5   GLU B N    3  
ATOM   7282  C  CA   . GLU B 1 5  ? 139.820 -10.264 1.397   1.00 0.00 ? 5   GLU B CA   3  
ATOM   7283  C  C    . GLU B 1 5  ? 141.198 -10.878 1.224   1.00 0.00 ? 5   GLU B C    3  
ATOM   7284  O  O    . GLU B 1 5  ? 142.095 -10.645 2.030   1.00 0.00 ? 5   GLU B O    3  
ATOM   7285  C  CB   . GLU B 1 5  ? 138.872 -11.301 2.003   1.00 0.00 ? 5   GLU B CB   3  
ATOM   7286  C  CG   . GLU B 1 5  ? 139.356 -11.678 3.404   1.00 0.00 ? 5   GLU B CG   3  
ATOM   7287  C  CD   . GLU B 1 5  ? 138.478 -12.785 3.978   1.00 0.00 ? 5   GLU B CD   3  
ATOM   7288  O  OE1  . GLU B 1 5  ? 137.578 -13.222 3.280   1.00 0.00 ? 5   GLU B OE1  3  
ATOM   7289  O  OE2  . GLU B 1 5  ? 138.717 -13.179 5.107   1.00 0.00 ? 5   GLU B OE2  3  
ATOM   7290  H  H    . GLU B 1 5  ? 138.511 -10.239 -0.266  1.00 0.00 ? 5   GLU B H    3  
ATOM   7291  H  HA   . GLU B 1 5  ? 139.892 -9.425  2.072   1.00 0.00 ? 5   GLU B HA   3  
ATOM   7292  H  HB2  . GLU B 1 5  ? 137.877 -10.885 2.065   1.00 0.00 ? 5   GLU B HB2  3  
ATOM   7293  H  HB3  . GLU B 1 5  ? 138.856 -12.182 1.380   1.00 0.00 ? 5   GLU B HB3  3  
ATOM   7294  H  HG2  . GLU B 1 5  ? 140.378 -12.024 3.349   1.00 0.00 ? 5   GLU B HG2  3  
ATOM   7295  H  HG3  . GLU B 1 5  ? 139.304 -10.812 4.047   1.00 0.00 ? 5   GLU B HG3  3  
ATOM   7296  N  N    . THR B 1 6  ? 141.367 -11.663 0.162   1.00 0.00 ? 6   THR B N    3  
ATOM   7297  C  CA   . THR B 1 6  ? 142.657 -12.292 -0.087  1.00 0.00 ? 6   THR B CA   3  
ATOM   7298  C  C    . THR B 1 6  ? 143.738 -11.242 -0.304  1.00 0.00 ? 6   THR B C    3  
ATOM   7299  O  O    . THR B 1 6  ? 144.850 -11.363 0.210   1.00 0.00 ? 6   THR B O    3  
ATOM   7300  C  CB   . THR B 1 6  ? 142.567 -13.200 -1.315  1.00 0.00 ? 6   THR B CB   3  
ATOM   7301  O  OG1  . THR B 1 6  ? 141.510 -14.133 -1.135  1.00 0.00 ? 6   THR B OG1  3  
ATOM   7302  C  CG2  . THR B 1 6  ? 143.888 -13.949 -1.496  1.00 0.00 ? 6   THR B CG2  3  
ATOM   7303  H  H    . THR B 1 6  ? 140.617 -11.817 -0.458  1.00 0.00 ? 6   THR B H    3  
ATOM   7304  H  HA   . THR B 1 6  ? 142.922 -12.894 0.769   1.00 0.00 ? 6   THR B HA   3  
ATOM   7305  H  HB   . THR B 1 6  ? 142.374 -12.601 -2.193  1.00 0.00 ? 6   THR B HB   3  
ATOM   7306  H  HG1  . THR B 1 6  ? 141.232 -14.438 -2.002  1.00 0.00 ? 6   THR B HG1  3  
ATOM   7307  H  HG21 . THR B 1 6  ? 144.639 -13.269 -1.871  1.00 0.00 ? 6   THR B HG21 3  
ATOM   7308  H  HG22 . THR B 1 6  ? 143.751 -14.757 -2.199  1.00 0.00 ? 6   THR B HG22 3  
ATOM   7309  H  HG23 . THR B 1 6  ? 144.208 -14.349 -0.545  1.00 0.00 ? 6   THR B HG23 3  
ATOM   7310  N  N    . ALA B 1 7  ? 143.401 -10.211 -1.072  1.00 0.00 ? 7   ALA B N    3  
ATOM   7311  C  CA   . ALA B 1 7  ? 144.349 -9.142  -1.352  1.00 0.00 ? 7   ALA B CA   3  
ATOM   7312  C  C    . ALA B 1 7  ? 144.668 -8.333  -0.101  1.00 0.00 ? 7   ALA B C    3  
ATOM   7313  O  O    . ALA B 1 7  ? 145.807 -7.920  0.107   1.00 0.00 ? 7   ALA B O    3  
ATOM   7314  C  CB   . ALA B 1 7  ? 143.783 -8.215  -2.429  1.00 0.00 ? 7   ALA B CB   3  
ATOM   7315  H  H    . ALA B 1 7  ? 142.500 -10.169 -1.454  1.00 0.00 ? 7   ALA B H    3  
ATOM   7316  H  HA   . ALA B 1 7  ? 145.264 -9.580  -1.723  1.00 0.00 ? 7   ALA B HA   3  
ATOM   7317  H  HB1  . ALA B 1 7  ? 143.966 -8.644  -3.402  1.00 0.00 ? 7   ALA B HB1  3  
ATOM   7318  H  HB2  . ALA B 1 7  ? 144.266 -7.250  -2.364  1.00 0.00 ? 7   ALA B HB2  3  
ATOM   7319  H  HB3  . ALA B 1 7  ? 142.721 -8.098  -2.280  1.00 0.00 ? 7   ALA B HB3  3  
ATOM   7320  N  N    . MET B 1 8  ? 143.651 -8.084  0.720   1.00 0.00 ? 8   MET B N    3  
ATOM   7321  C  CA   . MET B 1 8  ? 143.853 -7.292  1.928   1.00 0.00 ? 8   MET B CA   3  
ATOM   7322  C  C    . MET B 1 8  ? 144.868 -7.938  2.869   1.00 0.00 ? 8   MET B C    3  
ATOM   7323  O  O    . MET B 1 8  ? 145.760 -7.265  3.406   1.00 0.00 ? 8   MET B O    3  
ATOM   7324  C  CB   . MET B 1 8  ? 142.520 -7.165  2.662   1.00 0.00 ? 8   MET B CB   3  
ATOM   7325  C  CG   . MET B 1 8  ? 142.658 -6.172  3.810   1.00 0.00 ? 8   MET B CG   3  
ATOM   7326  S  SD   . MET B 1 8  ? 141.156 -6.209  4.817   1.00 0.00 ? 8   MET B SD   3  
ATOM   7327  C  CE   . MET B 1 8  ? 140.009 -5.688  3.520   1.00 0.00 ? 8   MET B CE   3  
ATOM   7328  H  H    . MET B 1 8  ? 142.750 -8.416  0.497   1.00 0.00 ? 8   MET B H    3  
ATOM   7329  H  HA   . MET B 1 8  ? 144.196 -6.306  1.655   1.00 0.00 ? 8   MET B HA   3  
ATOM   7330  H  HB2  . MET B 1 8  ? 141.763 -6.817  1.973   1.00 0.00 ? 8   MET B HB2  3  
ATOM   7331  H  HB3  . MET B 1 8  ? 142.232 -8.129  3.055   1.00 0.00 ? 8   MET B HB3  3  
ATOM   7332  H  HG2  . MET B 1 8  ? 143.508 -6.440  4.419   1.00 0.00 ? 8   MET B HG2  3  
ATOM   7333  H  HG3  . MET B 1 8  ? 142.798 -5.179  3.410   1.00 0.00 ? 8   MET B HG3  3  
ATOM   7334  H  HE1  . MET B 1 8  ? 139.678 -6.557  2.967   1.00 0.00 ? 8   MET B HE1  3  
ATOM   7335  H  HE2  . MET B 1 8  ? 140.508 -5.006  2.850   1.00 0.00 ? 8   MET B HE2  3  
ATOM   7336  H  HE3  . MET B 1 8  ? 139.159 -5.193  3.969   1.00 0.00 ? 8   MET B HE3  3  
ATOM   7337  N  N    . GLU B 1 9  ? 144.748 -9.250  3.042   1.00 0.00 ? 9   GLU B N    3  
ATOM   7338  C  CA   . GLU B 1 9  ? 145.649 -9.977  3.924   1.00 0.00 ? 9   GLU B CA   3  
ATOM   7339  C  C    . GLU B 1 9  ? 147.078 -9.796  3.475   1.00 0.00 ? 9   GLU B C    3  
ATOM   7340  O  O    . GLU B 1 9  ? 148.000 -9.781  4.290   1.00 0.00 ? 9   GLU B O    3  
ATOM   7341  C  CB   . GLU B 1 9  ? 145.287 -11.463 3.944   1.00 0.00 ? 9   GLU B CB   3  
ATOM   7342  C  CG   . GLU B 1 9  ? 143.902 -11.634 4.568   1.00 0.00 ? 9   GLU B CG   3  
ATOM   7343  C  CD   . GLU B 1 9  ? 143.545 -13.115 4.653   1.00 0.00 ? 9   GLU B CD   3  
ATOM   7344  O  OE1  . GLU B 1 9  ? 144.275 -13.913 4.089   1.00 0.00 ? 9   GLU B OE1  3  
ATOM   7345  O  OE2  . GLU B 1 9  ? 142.548 -13.428 5.282   1.00 0.00 ? 9   GLU B OE2  3  
ATOM   7346  H  H    . GLU B 1 9  ? 144.035 -9.735  2.575   1.00 0.00 ? 9   GLU B H    3  
ATOM   7347  H  HA   . GLU B 1 9  ? 145.547 -9.584  4.924   1.00 0.00 ? 9   GLU B HA   3  
ATOM   7348  H  HB2  . GLU B 1 9  ? 145.280 -11.845 2.933   1.00 0.00 ? 9   GLU B HB2  3  
ATOM   7349  H  HB3  . GLU B 1 9  ? 146.015 -12.005 4.529   1.00 0.00 ? 9   GLU B HB3  3  
ATOM   7350  H  HG2  . GLU B 1 9  ? 143.903 -11.210 5.561   1.00 0.00 ? 9   GLU B HG2  3  
ATOM   7351  H  HG3  . GLU B 1 9  ? 143.169 -11.123 3.964   1.00 0.00 ? 9   GLU B HG3  3  
ATOM   7352  N  N    . THR B 1 10 ? 147.261 -9.645  2.179   1.00 0.00 ? 10  THR B N    3  
ATOM   7353  C  CA   . THR B 1 10 ? 148.588 -9.449  1.651   1.00 0.00 ? 10  THR B CA   3  
ATOM   7354  C  C    . THR B 1 10 ? 149.242 -8.243  2.313   1.00 0.00 ? 10  THR B C    3  
ATOM   7355  O  O    . THR B 1 10 ? 150.446 -8.259  2.572   1.00 0.00 ? 10  THR B O    3  
ATOM   7356  C  CB   . THR B 1 10 ? 148.541 -9.238  0.136   1.00 0.00 ? 10  THR B CB   3  
ATOM   7357  O  OG1  . THR B 1 10 ? 147.842 -10.315 -0.470  1.00 0.00 ? 10  THR B OG1  3  
ATOM   7358  C  CG2  . THR B 1 10 ? 149.968 -9.180  -0.416  1.00 0.00 ? 10  THR B CG2  3  
ATOM   7359  H  H    . THR B 1 10 ? 146.491 -9.655  1.574   1.00 0.00 ? 10  THR B H    3  
ATOM   7360  H  HA   . THR B 1 10 ? 149.180 -10.327 1.862   1.00 0.00 ? 10  THR B HA   3  
ATOM   7361  H  HB   . THR B 1 10 ? 148.039 -8.309  -0.082  1.00 0.00 ? 10  THR B HB   3  
ATOM   7362  H  HG1  . THR B 1 10 ? 147.087 -9.952  -0.938  1.00 0.00 ? 10  THR B HG1  3  
ATOM   7363  H  HG21 . THR B 1 10 ? 150.349 -8.174  -0.323  1.00 0.00 ? 10  THR B HG21 3  
ATOM   7364  H  HG22 . THR B 1 10 ? 149.963 -9.469  -1.457  1.00 0.00 ? 10  THR B HG22 3  
ATOM   7365  H  HG23 . THR B 1 10 ? 150.598 -9.857  0.141   1.00 0.00 ? 10  THR B HG23 3  
ATOM   7366  N  N    . LEU B 1 11 ? 148.464 -7.184  2.590   1.00 0.00 ? 11  LEU B N    3  
ATOM   7367  C  CA   . LEU B 1 11 ? 149.065 -6.012  3.219   1.00 0.00 ? 11  LEU B CA   3  
ATOM   7368  C  C    . LEU B 1 11 ? 149.617 -6.378  4.588   1.00 0.00 ? 11  LEU B C    3  
ATOM   7369  O  O    . LEU B 1 11 ? 150.710 -5.954  4.972   1.00 0.00 ? 11  LEU B O    3  
ATOM   7370  C  CB   . LEU B 1 11 ? 148.024 -4.902  3.394   1.00 0.00 ? 11  LEU B CB   3  
ATOM   7371  C  CG   . LEU B 1 11 ? 147.409 -4.538  2.044   1.00 0.00 ? 11  LEU B CG   3  
ATOM   7372  C  CD1  . LEU B 1 11 ? 146.474 -3.340  2.215   1.00 0.00 ? 11  LEU B CD1  3  
ATOM   7373  C  CD2  . LEU B 1 11 ? 148.516 -4.183  1.048   1.00 0.00 ? 11  LEU B CD2  3  
ATOM   7374  H  H    . LEU B 1 11 ? 147.492 -7.200  2.383   1.00 0.00 ? 11  LEU B H    3  
ATOM   7375  H  HA   . LEU B 1 11 ? 149.870 -5.649  2.600   1.00 0.00 ? 11  LEU B HA   3  
ATOM   7376  H  HB2  . LEU B 1 11 ? 147.245 -5.244  4.061   1.00 0.00 ? 11  LEU B HB2  3  
ATOM   7377  H  HB3  . LEU B 1 11 ? 148.499 -4.029  3.817   1.00 0.00 ? 11  LEU B HB3  3  
ATOM   7378  H  HG   . LEU B 1 11 ? 146.845 -5.379  1.676   1.00 0.00 ? 11  LEU B HG   3  
ATOM   7379  H  HD11 . LEU B 1 11 ? 145.821 -3.267  1.358   1.00 0.00 ? 11  LEU B HD11 3  
ATOM   7380  H  HD12 . LEU B 1 11 ? 147.059 -2.435  2.299   1.00 0.00 ? 11  LEU B HD12 3  
ATOM   7381  H  HD13 . LEU B 1 11 ? 145.881 -3.471  3.108   1.00 0.00 ? 11  LEU B HD13 3  
ATOM   7382  H  HD21 . LEU B 1 11 ? 148.901 -5.087  0.598   1.00 0.00 ? 11  LEU B HD21 3  
ATOM   7383  H  HD22 . LEU B 1 11 ? 149.314 -3.670  1.564   1.00 0.00 ? 11  LEU B HD22 3  
ATOM   7384  H  HD23 . LEU B 1 11 ? 148.115 -3.540  0.277   1.00 0.00 ? 11  LEU B HD23 3  
ATOM   7385  N  N    . ILE B 1 12 ? 148.847 -7.174  5.316   1.00 0.00 ? 12  ILE B N    3  
ATOM   7386  C  CA   . ILE B 1 12 ? 149.252 -7.601  6.643   1.00 0.00 ? 12  ILE B CA   3  
ATOM   7387  C  C    . ILE B 1 12 ? 150.473 -8.509  6.603   1.00 0.00 ? 12  ILE B C    3  
ATOM   7388  O  O    . ILE B 1 12 ? 151.357 -8.397  7.444   1.00 0.00 ? 12  ILE B O    3  
ATOM   7389  C  CB   . ILE B 1 12 ? 148.091 -8.309  7.334   1.00 0.00 ? 12  ILE B CB   3  
ATOM   7390  C  CG1  . ILE B 1 12 ? 146.904 -7.341  7.421   1.00 0.00 ? 12  ILE B CG1  3  
ATOM   7391  C  CG2  . ILE B 1 12 ? 148.516 -8.733  8.741   1.00 0.00 ? 12  ILE B CG2  3  
ATOM   7392  C  CD1  . ILE B 1 12 ? 145.691 -8.057  8.019   1.00 0.00 ? 12  ILE B CD1  3  
ATOM   7393  H  H    . ILE B 1 12 ? 147.989 -7.478  4.953   1.00 0.00 ? 12  ILE B H    3  
ATOM   7394  H  HA   . ILE B 1 12 ? 149.501 -6.723  7.220   1.00 0.00 ? 12  ILE B HA   3  
ATOM   7395  H  HB   . ILE B 1 12 ? 147.807 -9.181  6.763   1.00 0.00 ? 12  ILE B HB   3  
ATOM   7396  H  HG12 . ILE B 1 12 ? 147.172 -6.502  8.046   1.00 0.00 ? 12  ILE B HG12 3  
ATOM   7397  H  HG13 . ILE B 1 12 ? 146.657 -6.986  6.426   1.00 0.00 ? 12  ILE B HG13 3  
ATOM   7398  H  HG21 . ILE B 1 12 ? 148.923 -7.882  9.267   1.00 0.00 ? 12  ILE B HG21 3  
ATOM   7399  H  HG22 . ILE B 1 12 ? 149.269 -9.506  8.673   1.00 0.00 ? 12  ILE B HG22 3  
ATOM   7400  H  HG23 . ILE B 1 12 ? 147.660 -9.113  9.278   1.00 0.00 ? 12  ILE B HG23 3  
ATOM   7401  H  HD11 . ILE B 1 12 ? 145.292 -8.753  7.297   1.00 0.00 ? 12  ILE B HD11 3  
ATOM   7402  H  HD12 . ILE B 1 12 ? 144.935 -7.330  8.277   1.00 0.00 ? 12  ILE B HD12 3  
ATOM   7403  H  HD13 . ILE B 1 12 ? 145.989 -8.594  8.908   1.00 0.00 ? 12  ILE B HD13 3  
ATOM   7404  N  N    . ASN B 1 13 ? 150.511 -9.430  5.643   1.00 0.00 ? 13  ASN B N    3  
ATOM   7405  C  CA   . ASN B 1 13 ? 151.637 -10.350 5.559   1.00 0.00 ? 13  ASN B CA   3  
ATOM   7406  C  C    . ASN B 1 13 ? 152.956 -9.609  5.360   1.00 0.00 ? 13  ASN B C    3  
ATOM   7407  O  O    . ASN B 1 13 ? 153.960 -9.925  6.009   1.00 0.00 ? 13  ASN B O    3  
ATOM   7408  C  CB   . ASN B 1 13 ? 151.425 -11.323 4.397   1.00 0.00 ? 13  ASN B CB   3  
ATOM   7409  C  CG   . ASN B 1 13 ? 152.436 -12.463 4.479   1.00 0.00 ? 13  ASN B CG   3  
ATOM   7410  O  OD1  . ASN B 1 13 ? 152.436 -13.224 5.447   1.00 0.00 ? 13  ASN B OD1  3  
ATOM   7411  N  ND2  . ASN B 1 13 ? 153.301 -12.628 3.516   1.00 0.00 ? 13  ASN B ND2  3  
ATOM   7412  H  H    . ASN B 1 13 ? 149.772 -9.500  5.003   1.00 0.00 ? 13  ASN B H    3  
ATOM   7413  H  HA   . ASN B 1 13 ? 151.692 -10.918 6.475   1.00 0.00 ? 13  ASN B HA   3  
ATOM   7414  H  HB2  . ASN B 1 13 ? 150.425 -11.727 4.447   1.00 0.00 ? 13  ASN B HB2  3  
ATOM   7415  H  HB3  . ASN B 1 13 ? 151.554 -10.798 3.462   1.00 0.00 ? 13  ASN B HB3  3  
ATOM   7416  H  HD21 . ASN B 1 13 ? 153.300 -12.021 2.747   1.00 0.00 ? 13  ASN B HD21 3  
ATOM   7417  H  HD22 . ASN B 1 13 ? 153.953 -13.359 3.564   1.00 0.00 ? 13  ASN B HD22 3  
ATOM   7418  N  N    . VAL B 1 14 ? 152.957 -8.616  4.473   1.00 0.00 ? 14  VAL B N    3  
ATOM   7419  C  CA   . VAL B 1 14 ? 154.173 -7.856  4.223   1.00 0.00 ? 14  VAL B CA   3  
ATOM   7420  C  C    . VAL B 1 14 ? 154.465 -6.896  5.368   1.00 0.00 ? 14  VAL B C    3  
ATOM   7421  O  O    . VAL B 1 14 ? 155.615 -6.736  5.775   1.00 0.00 ? 14  VAL B O    3  
ATOM   7422  C  CB   . VAL B 1 14 ? 154.065 -7.087  2.901   1.00 0.00 ? 14  VAL B CB   3  
ATOM   7423  C  CG1  . VAL B 1 14 ? 153.797 -8.071  1.759   1.00 0.00 ? 14  VAL B CG1  3  
ATOM   7424  C  CG2  . VAL B 1 14 ? 152.918 -6.075  2.974   1.00 0.00 ? 14  VAL B CG2  3  
ATOM   7425  H  H    . VAL B 1 14 ? 152.134 -8.395  3.987   1.00 0.00 ? 14  VAL B H    3  
ATOM   7426  H  HA   . VAL B 1 14 ? 154.996 -8.551  4.145   1.00 0.00 ? 14  VAL B HA   3  
ATOM   7427  H  HB   . VAL B 1 14 ? 154.994 -6.566  2.713   1.00 0.00 ? 14  VAL B HB   3  
ATOM   7428  H  HG11 . VAL B 1 14 ? 154.442 -8.931  1.865   1.00 0.00 ? 14  VAL B HG11 3  
ATOM   7429  H  HG12 . VAL B 1 14 ? 153.995 -7.589  0.812   1.00 0.00 ? 14  VAL B HG12 3  
ATOM   7430  H  HG13 . VAL B 1 14 ? 152.766 -8.388  1.791   1.00 0.00 ? 14  VAL B HG13 3  
ATOM   7431  H  HG21 . VAL B 1 14 ? 152.833 -5.557  2.028   1.00 0.00 ? 14  VAL B HG21 3  
ATOM   7432  H  HG22 . VAL B 1 14 ? 153.116 -5.362  3.760   1.00 0.00 ? 14  VAL B HG22 3  
ATOM   7433  H  HG23 . VAL B 1 14 ? 151.994 -6.594  3.182   1.00 0.00 ? 14  VAL B HG23 3  
ATOM   7434  N  N    . PHE B 1 15 ? 153.426 -6.267  5.903   1.00 0.00 ? 15  PHE B N    3  
ATOM   7435  C  CA   . PHE B 1 15 ? 153.628 -5.345  7.007   1.00 0.00 ? 15  PHE B CA   3  
ATOM   7436  C  C    . PHE B 1 15 ? 154.187 -6.084  8.216   1.00 0.00 ? 15  PHE B C    3  
ATOM   7437  O  O    . PHE B 1 15 ? 155.178 -5.670  8.814   1.00 0.00 ? 15  PHE B O    3  
ATOM   7438  C  CB   . PHE B 1 15 ? 152.295 -4.690  7.379   1.00 0.00 ? 15  PHE B CB   3  
ATOM   7439  C  CG   . PHE B 1 15 ? 152.516 -3.637  8.438   1.00 0.00 ? 15  PHE B CG   3  
ATOM   7440  C  CD1  . PHE B 1 15 ? 152.874 -2.335  8.067   1.00 0.00 ? 15  PHE B CD1  3  
ATOM   7441  C  CD2  . PHE B 1 15 ? 152.357 -3.960  9.792   1.00 0.00 ? 15  PHE B CD2  3  
ATOM   7442  C  CE1  . PHE B 1 15 ? 153.073 -1.356  9.048   1.00 0.00 ? 15  PHE B CE1  3  
ATOM   7443  C  CE2  . PHE B 1 15 ? 152.558 -2.982  10.773  1.00 0.00 ? 15  PHE B CE2  3  
ATOM   7444  C  CZ   . PHE B 1 15 ? 152.915 -1.680  10.402  1.00 0.00 ? 15  PHE B CZ   3  
ATOM   7445  H  H    . PHE B 1 15 ? 152.520 -6.428  5.556   1.00 0.00 ? 15  PHE B H    3  
ATOM   7446  H  HA   . PHE B 1 15 ? 154.325 -4.577  6.707   1.00 0.00 ? 15  PHE B HA   3  
ATOM   7447  H  HB2  . PHE B 1 15 ? 151.863 -4.231  6.500   1.00 0.00 ? 15  PHE B HB2  3  
ATOM   7448  H  HB3  . PHE B 1 15 ? 151.620 -5.443  7.758   1.00 0.00 ? 15  PHE B HB3  3  
ATOM   7449  H  HD1  . PHE B 1 15 ? 152.996 -2.086  7.023   1.00 0.00 ? 15  PHE B HD1  3  
ATOM   7450  H  HD2  . PHE B 1 15 ? 152.082 -4.964  10.078  1.00 0.00 ? 15  PHE B HD2  3  
ATOM   7451  H  HE1  . PHE B 1 15 ? 153.347 -0.352  8.763   1.00 0.00 ? 15  PHE B HE1  3  
ATOM   7452  H  HE2  . PHE B 1 15 ? 152.436 -3.231  11.817  1.00 0.00 ? 15  PHE B HE2  3  
ATOM   7453  H  HZ   . PHE B 1 15 ? 153.069 -0.926  11.159  1.00 0.00 ? 15  PHE B HZ   3  
ATOM   7454  N  N    . HIS B 1 16 ? 153.536 -7.188  8.563   1.00 0.00 ? 16  HIS B N    3  
ATOM   7455  C  CA   . HIS B 1 16 ? 153.951 -7.998  9.699   1.00 0.00 ? 16  HIS B CA   3  
ATOM   7456  C  C    . HIS B 1 16 ? 155.327 -8.626  9.498   1.00 0.00 ? 16  HIS B C    3  
ATOM   7457  O  O    . HIS B 1 16 ? 156.172 -8.581  10.395  1.00 0.00 ? 16  HIS B O    3  
ATOM   7458  C  CB   . HIS B 1 16 ? 152.918 -9.098  9.942   1.00 0.00 ? 16  HIS B CB   3  
ATOM   7459  C  CG   . HIS B 1 16 ? 153.289 -9.877  11.173  1.00 0.00 ? 16  HIS B CG   3  
ATOM   7460  N  ND1  . HIS B 1 16 ? 153.304 -9.302  12.434  1.00 0.00 ? 16  HIS B ND1  3  
ATOM   7461  C  CD2  . HIS B 1 16 ? 153.654 -11.187 11.352  1.00 0.00 ? 16  HIS B CD2  3  
ATOM   7462  C  CE1  . HIS B 1 16 ? 153.668 -10.256 13.309  1.00 0.00 ? 16  HIS B CE1  3  
ATOM   7463  N  NE2  . HIS B 1 16 ? 153.894 -11.424 12.703  1.00 0.00 ? 16  HIS B NE2  3  
ATOM   7464  H  H    . HIS B 1 16 ? 152.752 -7.463  8.042   1.00 0.00 ? 16  HIS B H    3  
ATOM   7465  H  HA   . HIS B 1 16 ? 153.986 -7.368  10.575  1.00 0.00 ? 16  HIS B HA   3  
ATOM   7466  H  HB2  . HIS B 1 16 ? 151.943 -8.654  10.078  1.00 0.00 ? 16  HIS B HB2  3  
ATOM   7467  H  HB3  . HIS B 1 16 ? 152.894 -9.763  9.090   1.00 0.00 ? 16  HIS B HB3  3  
ATOM   7468  H  HD1  . HIS B 1 16 ? 153.089 -8.371  12.649  1.00 0.00 ? 16  HIS B HD1  3  
ATOM   7469  H  HD2  . HIS B 1 16 ? 153.737 -11.922 10.566  1.00 0.00 ? 16  HIS B HD2  3  
ATOM   7470  H  HE1  . HIS B 1 16 ? 153.766 -10.098 14.372  1.00 0.00 ? 16  HIS B HE1  3  
ATOM   7471  H  HE2  . HIS B 1 16 ? 154.170 -12.268 13.119  1.00 0.00 ? 16  HIS B HE2  3  
ATOM   7472  N  N    . ALA B 1 17 ? 155.551 -9.238  8.332   1.00 0.00 ? 17  ALA B N    3  
ATOM   7473  C  CA   . ALA B 1 17 ? 156.835 -9.889  8.083   1.00 0.00 ? 17  ALA B CA   3  
ATOM   7474  C  C    . ALA B 1 17 ? 157.972 -8.881  8.011   1.00 0.00 ? 17  ALA B C    3  
ATOM   7475  O  O    . ALA B 1 17 ? 158.991 -9.038  8.685   1.00 0.00 ? 17  ALA B O    3  
ATOM   7476  C  CB   . ALA B 1 17 ? 156.769 -10.676 6.773   1.00 0.00 ? 17  ALA B CB   3  
ATOM   7477  H  H    . ALA B 1 17 ? 154.844 -9.269  7.646   1.00 0.00 ? 17  ALA B H    3  
ATOM   7478  H  HA   . ALA B 1 17 ? 157.038 -10.578 8.888   1.00 0.00 ? 17  ALA B HA   3  
ATOM   7479  H  HB1  . ALA B 1 17 ? 155.917 -11.340 6.795   1.00 0.00 ? 17  ALA B HB1  3  
ATOM   7480  H  HB2  . ALA B 1 17 ? 157.673 -11.254 6.656   1.00 0.00 ? 17  ALA B HB2  3  
ATOM   7481  H  HB3  . ALA B 1 17 ? 156.671 -9.990  5.946   1.00 0.00 ? 17  ALA B HB3  3  
ATOM   7482  N  N    . HIS B 1 18 ? 157.800 -7.846  7.199   1.00 0.00 ? 18  HIS B N    3  
ATOM   7483  C  CA   . HIS B 1 18 ? 158.834 -6.832  7.073   1.00 0.00 ? 18  HIS B CA   3  
ATOM   7484  C  C    . HIS B 1 18 ? 159.086 -6.130  8.403   1.00 0.00 ? 18  HIS B C    3  
ATOM   7485  O  O    . HIS B 1 18 ? 160.234 -5.947  8.808   1.00 0.00 ? 18  HIS B O    3  
ATOM   7486  C  CB   . HIS B 1 18 ? 158.447 -5.820  5.996   1.00 0.00 ? 18  HIS B CB   3  
ATOM   7487  C  CG   . HIS B 1 18 ? 158.457 -6.504  4.655   1.00 0.00 ? 18  HIS B CG   3  
ATOM   7488  N  ND1  . HIS B 1 18 ? 157.326 -7.089  4.105   1.00 0.00 ? 18  HIS B ND1  3  
ATOM   7489  C  CD2  . HIS B 1 18 ? 159.462 -6.703  3.740   1.00 0.00 ? 18  HIS B CD2  3  
ATOM   7490  C  CE1  . HIS B 1 18 ? 157.676 -7.607  2.913   1.00 0.00 ? 18  HIS B CE1  3  
ATOM   7491  N  NE2  . HIS B 1 18 ? 158.966 -7.399  2.642   1.00 0.00 ? 18  HIS B NE2  3  
ATOM   7492  H  H    . HIS B 1 18 ? 156.970 -7.762  6.685   1.00 0.00 ? 18  HIS B H    3  
ATOM   7493  H  HA   . HIS B 1 18 ? 159.749 -7.317  6.767   1.00 0.00 ? 18  HIS B HA   3  
ATOM   7494  H  HB2  . HIS B 1 18 ? 157.458 -5.436  6.201   1.00 0.00 ? 18  HIS B HB2  3  
ATOM   7495  H  HB3  . HIS B 1 18 ? 159.156 -5.007  5.992   1.00 0.00 ? 18  HIS B HB3  3  
ATOM   7496  H  HD1  . HIS B 1 18 ? 156.437 -7.122  4.508   1.00 0.00 ? 18  HIS B HD1  3  
ATOM   7497  H  HD2  . HIS B 1 18 ? 160.483 -6.372  3.856   1.00 0.00 ? 18  HIS B HD2  3  
ATOM   7498  H  HE1  . HIS B 1 18 ? 156.995 -8.127  2.256   1.00 0.00 ? 18  HIS B HE1  3  
ATOM   7499  H  HE2  . HIS B 1 18 ? 159.458 -7.678  1.842   1.00 0.00 ? 18  HIS B HE2  3  
ATOM   7500  N  N    . SER B 1 19 ? 158.009 -5.738  9.084   1.00 0.00 ? 19  SER B N    3  
ATOM   7501  C  CA   . SER B 1 19 ? 158.151 -5.062  10.369  1.00 0.00 ? 19  SER B CA   3  
ATOM   7502  C  C    . SER B 1 19 ? 158.849 -5.959  11.380  1.00 0.00 ? 19  SER B C    3  
ATOM   7503  O  O    . SER B 1 19 ? 159.688 -5.504  12.160  1.00 0.00 ? 19  SER B O    3  
ATOM   7504  C  CB   . SER B 1 19 ? 156.771 -4.690  10.917  1.00 0.00 ? 19  SER B CB   3  
ATOM   7505  O  OG   . SER B 1 19 ? 156.929 -3.849  12.052  1.00 0.00 ? 19  SER B OG   3  
ATOM   7506  H  H    . SER B 1 19 ? 157.115 -5.910  8.721   1.00 0.00 ? 19  SER B H    3  
ATOM   7507  H  HA   . SER B 1 19 ? 158.728 -4.161  10.234  1.00 0.00 ? 19  SER B HA   3  
ATOM   7508  H  HB2  . SER B 1 19 ? 156.208 -4.169  10.165  1.00 0.00 ? 19  SER B HB2  3  
ATOM   7509  H  HB3  . SER B 1 19 ? 156.243 -5.591  11.197  1.00 0.00 ? 19  SER B HB3  3  
ATOM   7510  H  HG   . SER B 1 19 ? 157.014 -4.409  12.827  1.00 0.00 ? 19  SER B HG   3  
ATOM   7511  N  N    . GLY B 1 20 ? 158.473 -7.235  11.368  1.00 0.00 ? 20  GLY B N    3  
ATOM   7512  C  CA   . GLY B 1 20 ? 159.039 -8.207  12.292  1.00 0.00 ? 20  GLY B CA   3  
ATOM   7513  C  C    . GLY B 1 20 ? 160.539 -8.411  12.096  1.00 0.00 ? 20  GLY B C    3  
ATOM   7514  O  O    . GLY B 1 20 ? 161.278 -8.596  13.063  1.00 0.00 ? 20  GLY B O    3  
ATOM   7515  H  H    . GLY B 1 20 ? 157.785 -7.525  10.731  1.00 0.00 ? 20  GLY B H    3  
ATOM   7516  H  HA2  . GLY B 1 20 ? 158.860 -7.869  13.298  1.00 0.00 ? 20  GLY B HA2  3  
ATOM   7517  H  HA3  . GLY B 1 20 ? 158.539 -9.153  12.149  1.00 0.00 ? 20  GLY B HA3  3  
ATOM   7518  N  N    . LYS B 1 21 ? 160.973 -8.425  10.842  1.00 0.00 ? 21  LYS B N    3  
ATOM   7519  C  CA   . LYS B 1 21 ? 162.379 -8.667  10.536  1.00 0.00 ? 21  LYS B CA   3  
ATOM   7520  C  C    . LYS B 1 21 ? 163.315 -7.632  11.160  1.00 0.00 ? 21  LYS B C    3  
ATOM   7521  O  O    . LYS B 1 21 ? 164.374 -7.988  11.677  1.00 0.00 ? 21  LYS B O    3  
ATOM   7522  C  CB   . LYS B 1 21 ? 162.577 -8.682  9.021   1.00 0.00 ? 21  LYS B CB   3  
ATOM   7523  C  CG   . LYS B 1 21 ? 164.020 -9.079  8.703   1.00 0.00 ? 21  LYS B CG   3  
ATOM   7524  C  CD   . LYS B 1 21 ? 164.250 -9.032  7.194   1.00 0.00 ? 21  LYS B CD   3  
ATOM   7525  C  CE   . LYS B 1 21 ? 165.659 -9.540  6.887   1.00 0.00 ? 21  LYS B CE   3  
ATOM   7526  N  NZ   . LYS B 1 21 ? 165.647 -11.028 6.823   1.00 0.00 ? 21  LYS B NZ   3  
ATOM   7527  H  H    . LYS B 1 21 ? 160.333 -8.308  10.108  1.00 0.00 ? 21  LYS B H    3  
ATOM   7528  H  HA   . LYS B 1 21 ? 162.647 -9.640  10.917  1.00 0.00 ? 21  LYS B HA   3  
ATOM   7529  H  HB2  . LYS B 1 21 ? 161.896 -9.395  8.575   1.00 0.00 ? 21  LYS B HB2  3  
ATOM   7530  H  HB3  . LYS B 1 21 ? 162.381 -7.697  8.623   1.00 0.00 ? 21  LYS B HB3  3  
ATOM   7531  H  HG2  . LYS B 1 21 ? 164.700 -8.395  9.190   1.00 0.00 ? 21  LYS B HG2  3  
ATOM   7532  H  HG3  . LYS B 1 21 ? 164.203 -10.081 9.062   1.00 0.00 ? 21  LYS B HG3  3  
ATOM   7533  H  HD2  . LYS B 1 21 ? 163.522 -9.659  6.698   1.00 0.00 ? 21  LYS B HD2  3  
ATOM   7534  H  HD3  . LYS B 1 21 ? 164.151 -8.016  6.844   1.00 0.00 ? 21  LYS B HD3  3  
ATOM   7535  H  HE2  . LYS B 1 21 ? 165.987 -9.141  5.937   1.00 0.00 ? 21  LYS B HE2  3  
ATOM   7536  H  HE3  . LYS B 1 21 ? 166.335 -9.216  7.667   1.00 0.00 ? 21  LYS B HE3  3  
ATOM   7537  H  HZ1  . LYS B 1 21 ? 165.744 -11.335 5.834   1.00 0.00 ? 21  LYS B HZ1  3  
ATOM   7538  H  HZ2  . LYS B 1 21 ? 164.749 -11.384 7.211   1.00 0.00 ? 21  LYS B HZ2  3  
ATOM   7539  H  HZ3  . LYS B 1 21 ? 166.439 -11.406 7.380   1.00 0.00 ? 21  LYS B HZ3  3  
ATOM   7540  N  N    . GLU B 1 22 ? 162.943 -6.353  11.104  1.00 0.00 ? 22  GLU B N    3  
ATOM   7541  C  CA   . GLU B 1 22 ? 163.800 -5.304  11.668  1.00 0.00 ? 22  GLU B CA   3  
ATOM   7542  C  C    . GLU B 1 22 ? 163.024 -4.379  12.602  1.00 0.00 ? 22  GLU B C    3  
ATOM   7543  O  O    . GLU B 1 22 ? 161.835 -4.129  12.402  1.00 0.00 ? 22  GLU B O    3  
ATOM   7544  C  CB   . GLU B 1 22 ? 164.415 -4.479  10.537  1.00 0.00 ? 22  GLU B CB   3  
ATOM   7545  C  CG   . GLU B 1 22 ? 165.262 -5.385  9.643   1.00 0.00 ? 22  GLU B CG   3  
ATOM   7546  C  CD   . GLU B 1 22 ? 165.946 -4.557  8.561   1.00 0.00 ? 22  GLU B CD   3  
ATOM   7547  O  OE1  . GLU B 1 22 ? 165.618 -3.387  8.442   1.00 0.00 ? 22  GLU B OE1  3  
ATOM   7548  O  OE2  . GLU B 1 22 ? 166.788 -5.102  7.868   1.00 0.00 ? 22  GLU B OE2  3  
ATOM   7549  H  H    . GLU B 1 22 ? 162.097 -6.111  10.674  1.00 0.00 ? 22  GLU B H    3  
ATOM   7550  H  HA   . GLU B 1 22 ? 164.602 -5.768  12.225  1.00 0.00 ? 22  GLU B HA   3  
ATOM   7551  H  HB2  . GLU B 1 22 ? 163.627 -4.033  9.953   1.00 0.00 ? 22  GLU B HB2  3  
ATOM   7552  H  HB3  . GLU B 1 22 ? 165.039 -3.704  10.955  1.00 0.00 ? 22  GLU B HB3  3  
ATOM   7553  H  HG2  . GLU B 1 22 ? 166.010 -5.883  10.241  1.00 0.00 ? 22  GLU B HG2  3  
ATOM   7554  H  HG3  . GLU B 1 22 ? 164.626 -6.122  9.176   1.00 0.00 ? 22  GLU B HG3  3  
ATOM   7555  N  N    . GLY B 1 23 ? 163.713 -3.850  13.609  1.00 0.00 ? 23  GLY B N    3  
ATOM   7556  C  CA   . GLY B 1 23 ? 163.084 -2.927  14.545  1.00 0.00 ? 23  GLY B CA   3  
ATOM   7557  C  C    . GLY B 1 23 ? 162.203 -3.678  15.527  1.00 0.00 ? 23  GLY B C    3  
ATOM   7558  O  O    . GLY B 1 23 ? 162.277 -4.902  15.630  1.00 0.00 ? 23  GLY B O    3  
ATOM   7559  H  H    . GLY B 1 23 ? 164.663 -4.069  13.711  1.00 0.00 ? 23  GLY B H    3  
ATOM   7560  H  HA2  . GLY B 1 23 ? 163.851 -2.395  15.089  1.00 0.00 ? 23  GLY B HA2  3  
ATOM   7561  H  HA3  . GLY B 1 23 ? 162.480 -2.220  13.997  1.00 0.00 ? 23  GLY B HA3  3  
ATOM   7562  N  N    . ASP B 1 24 ? 161.343 -2.946  16.225  1.00 0.00 ? 24  ASP B N    3  
ATOM   7563  C  CA   . ASP B 1 24 ? 160.433 -3.580  17.160  1.00 0.00 ? 24  ASP B CA   3  
ATOM   7564  C  C    . ASP B 1 24 ? 159.393 -4.364  16.372  1.00 0.00 ? 24  ASP B C    3  
ATOM   7565  O  O    . ASP B 1 24 ? 158.889 -3.883  15.351  1.00 0.00 ? 24  ASP B O    3  
ATOM   7566  C  CB   . ASP B 1 24 ? 159.743 -2.525  18.029  1.00 0.00 ? 24  ASP B CB   3  
ATOM   7567  C  CG   . ASP B 1 24 ? 160.767 -1.835  18.925  1.00 0.00 ? 24  ASP B CG   3  
ATOM   7568  O  OD1  . ASP B 1 24 ? 161.870 -2.344  19.030  1.00 0.00 ? 24  ASP B OD1  3  
ATOM   7569  O  OD2  . ASP B 1 24 ? 160.432 -0.809  19.493  1.00 0.00 ? 24  ASP B OD2  3  
ATOM   7570  H  H    . ASP B 1 24 ? 161.306 -1.975  16.089  1.00 0.00 ? 24  ASP B H    3  
ATOM   7571  H  HA   . ASP B 1 24 ? 160.987 -4.257  17.793  1.00 0.00 ? 24  ASP B HA   3  
ATOM   7572  H  HB2  . ASP B 1 24 ? 159.271 -1.790  17.393  1.00 0.00 ? 24  ASP B HB2  3  
ATOM   7573  H  HB3  . ASP B 1 24 ? 158.994 -3.001  18.643  1.00 0.00 ? 24  ASP B HB3  3  
ATOM   7574  N  N    . LYS B 1 25 ? 159.093 -5.575  16.823  1.00 0.00 ? 25  LYS B N    3  
ATOM   7575  C  CA   . LYS B 1 25 ? 158.123 -6.404  16.124  1.00 0.00 ? 25  LYS B CA   3  
ATOM   7576  C  C    . LYS B 1 25 ? 156.759 -5.715  16.094  1.00 0.00 ? 25  LYS B C    3  
ATOM   7577  O  O    . LYS B 1 25 ? 156.051 -5.749  15.087  1.00 0.00 ? 25  LYS B O    3  
ATOM   7578  C  CB   . LYS B 1 25 ? 157.977 -7.748  16.848  1.00 0.00 ? 25  LYS B CB   3  
ATOM   7579  C  CG   . LYS B 1 25 ? 159.336 -8.454  16.986  1.00 0.00 ? 25  LYS B CG   3  
ATOM   7580  C  CD   . LYS B 1 25 ? 159.908 -8.812  15.611  1.00 0.00 ? 25  LYS B CD   3  
ATOM   7581  C  CE   . LYS B 1 25 ? 161.124 -9.726  15.785  1.00 0.00 ? 25  LYS B CE   3  
ATOM   7582  N  NZ   . LYS B 1 25 ? 161.375 -10.464 14.514  1.00 0.00 ? 25  LYS B NZ   3  
ATOM   7583  H  H    . LYS B 1 25 ? 159.536 -5.919  17.627  1.00 0.00 ? 25  LYS B H    3  
ATOM   7584  H  HA   . LYS B 1 25 ? 158.453 -6.573  15.115  1.00 0.00 ? 25  LYS B HA   3  
ATOM   7585  H  HB2  . LYS B 1 25 ? 157.566 -7.577  17.832  1.00 0.00 ? 25  LYS B HB2  3  
ATOM   7586  H  HB3  . LYS B 1 25 ? 157.305 -8.382  16.288  1.00 0.00 ? 25  LYS B HB3  3  
ATOM   7587  H  HG2  . LYS B 1 25 ? 160.026 -7.800  17.499  1.00 0.00 ? 25  LYS B HG2  3  
ATOM   7588  H  HG3  . LYS B 1 25 ? 159.207 -9.356  17.565  1.00 0.00 ? 25  LYS B HG3  3  
ATOM   7589  H  HD2  . LYS B 1 25 ? 159.154 -9.320  15.027  1.00 0.00 ? 25  LYS B HD2  3  
ATOM   7590  H  HD3  . LYS B 1 25 ? 160.217 -7.914  15.104  1.00 0.00 ? 25  LYS B HD3  3  
ATOM   7591  H  HE2  . LYS B 1 25 ? 161.990 -9.128  16.031  1.00 0.00 ? 25  LYS B HE2  3  
ATOM   7592  H  HE3  . LYS B 1 25 ? 160.938 -10.433 16.579  1.00 0.00 ? 25  LYS B HE3  3  
ATOM   7593  H  HZ1  . LYS B 1 25 ? 160.591 -10.294 13.853  1.00 0.00 ? 25  LYS B HZ1  3  
ATOM   7594  H  HZ2  . LYS B 1 25 ? 161.446 -11.482 14.714  1.00 0.00 ? 25  LYS B HZ2  3  
ATOM   7595  H  HZ3  . LYS B 1 25 ? 162.263 -10.131 14.088  1.00 0.00 ? 25  LYS B HZ3  3  
ATOM   7596  N  N    . TYR B 1 26 ? 156.399 -5.106  17.219  1.00 0.00 ? 26  TYR B N    3  
ATOM   7597  C  CA   . TYR B 1 26 ? 155.115 -4.420  17.349  1.00 0.00 ? 26  TYR B CA   3  
ATOM   7598  C  C    . TYR B 1 26 ? 155.025 -3.143  16.509  1.00 0.00 ? 26  TYR B C    3  
ATOM   7599  O  O    . TYR B 1 26 ? 153.941 -2.769  16.064  1.00 0.00 ? 26  TYR B O    3  
ATOM   7600  C  CB   . TYR B 1 26 ? 154.869 -4.070  18.817  1.00 0.00 ? 26  TYR B CB   3  
ATOM   7601  C  CG   . TYR B 1 26 ? 154.809 -5.338  19.635  1.00 0.00 ? 26  TYR B CG   3  
ATOM   7602  C  CD1  . TYR B 1 26 ? 153.624 -6.082  19.686  1.00 0.00 ? 26  TYR B CD1  3  
ATOM   7603  C  CD2  . TYR B 1 26 ? 155.937 -5.769  20.342  1.00 0.00 ? 26  TYR B CD2  3  
ATOM   7604  C  CE1  . TYR B 1 26 ? 153.567 -7.257  20.444  1.00 0.00 ? 26  TYR B CE1  3  
ATOM   7605  C  CE2  . TYR B 1 26 ? 155.880 -6.945  21.101  1.00 0.00 ? 26  TYR B CE2  3  
ATOM   7606  C  CZ   . TYR B 1 26 ? 154.696 -7.690  21.151  1.00 0.00 ? 26  TYR B CZ   3  
ATOM   7607  O  OH   . TYR B 1 26 ? 154.639 -8.849  21.899  1.00 0.00 ? 26  TYR B OH   3  
ATOM   7608  H  H    . TYR B 1 26 ? 157.006 -5.127  17.988  1.00 0.00 ? 26  TYR B H    3  
ATOM   7609  H  HA   . TYR B 1 26 ? 154.335 -5.092  17.029  1.00 0.00 ? 26  TYR B HA   3  
ATOM   7610  H  HB2  . TYR B 1 26 ? 155.673 -3.446  19.179  1.00 0.00 ? 26  TYR B HB2  3  
ATOM   7611  H  HB3  . TYR B 1 26 ? 153.933 -3.540  18.909  1.00 0.00 ? 26  TYR B HB3  3  
ATOM   7612  H  HD1  . TYR B 1 26 ? 152.753 -5.749  19.140  1.00 0.00 ? 26  TYR B HD1  3  
ATOM   7613  H  HD2  . TYR B 1 26 ? 156.851 -5.195  20.303  1.00 0.00 ? 26  TYR B HD2  3  
ATOM   7614  H  HE1  . TYR B 1 26 ? 152.653 -7.832  20.483  1.00 0.00 ? 26  TYR B HE1  3  
ATOM   7615  H  HE2  . TYR B 1 26 ? 156.751 -7.278  21.647  1.00 0.00 ? 26  TYR B HE2  3  
ATOM   7616  H  HH   . TYR B 1 26 ? 155.113 -9.534  21.420  1.00 0.00 ? 26  TYR B HH   3  
ATOM   7617  N  N    . LYS B 1 27 ? 156.148 -2.444  16.343  1.00 0.00 ? 27  LYS B N    3  
ATOM   7618  C  CA   . LYS B 1 27 ? 156.141 -1.174  15.606  1.00 0.00 ? 27  LYS B CA   3  
ATOM   7619  C  C    . LYS B 1 27 ? 157.000 -1.193  14.344  1.00 0.00 ? 27  LYS B C    3  
ATOM   7620  O  O    . LYS B 1 27 ? 158.006 -1.902  14.255  1.00 0.00 ? 27  LYS B O    3  
ATOM   7621  C  CB   . LYS B 1 27 ? 156.631 -0.053  16.524  1.00 0.00 ? 27  LYS B CB   3  
ATOM   7622  C  CG   . LYS B 1 27 ? 155.665 0.106   17.699  1.00 0.00 ? 27  LYS B CG   3  
ATOM   7623  C  CD   . LYS B 1 27 ? 156.091 1.301   18.554  1.00 0.00 ? 27  LYS B CD   3  
ATOM   7624  C  CE   . LYS B 1 27 ? 155.199 1.387   19.794  1.00 0.00 ? 27  LYS B CE   3  
ATOM   7625  N  NZ   . LYS B 1 27 ? 155.879 2.204   20.839  1.00 0.00 ? 27  LYS B NZ   3  
ATOM   7626  H  H    . LYS B 1 27 ? 156.981 -2.759  16.752  1.00 0.00 ? 27  LYS B H    3  
ATOM   7627  H  HA   . LYS B 1 27 ? 155.125 -0.945  15.319  1.00 0.00 ? 27  LYS B HA   3  
ATOM   7628  H  HB2  . LYS B 1 27 ? 157.616 -0.297  16.896  1.00 0.00 ? 27  LYS B HB2  3  
ATOM   7629  H  HB3  . LYS B 1 27 ? 156.676 0.873   15.969  1.00 0.00 ? 27  LYS B HB3  3  
ATOM   7630  H  HG2  . LYS B 1 27 ? 154.665 0.269   17.323  1.00 0.00 ? 27  LYS B HG2  3  
ATOM   7631  H  HG3  . LYS B 1 27 ? 155.682 -0.789  18.303  1.00 0.00 ? 27  LYS B HG3  3  
ATOM   7632  H  HD2  . LYS B 1 27 ? 157.121 1.177   18.858  1.00 0.00 ? 27  LYS B HD2  3  
ATOM   7633  H  HD3  . LYS B 1 27 ? 155.992 2.209   17.979  1.00 0.00 ? 27  LYS B HD3  3  
ATOM   7634  H  HE2  . LYS B 1 27 ? 154.259 1.850   19.531  1.00 0.00 ? 27  LYS B HE2  3  
ATOM   7635  H  HE3  . LYS B 1 27 ? 155.016 0.394   20.175  1.00 0.00 ? 27  LYS B HE3  3  
ATOM   7636  H  HZ1  . LYS B 1 27 ? 156.618 1.634   21.298  1.00 0.00 ? 27  LYS B HZ1  3  
ATOM   7637  H  HZ2  . LYS B 1 27 ? 155.181 2.507   21.549  1.00 0.00 ? 27  LYS B HZ2  3  
ATOM   7638  H  HZ3  . LYS B 1 27 ? 156.313 3.039   20.399  1.00 0.00 ? 27  LYS B HZ3  3  
ATOM   7639  N  N    . LEU B 1 28 ? 156.590 -0.364  13.384  1.00 0.00 ? 28  LEU B N    3  
ATOM   7640  C  CA   . LEU B 1 28 ? 157.305 -0.217  12.123  1.00 0.00 ? 28  LEU B CA   3  
ATOM   7641  C  C    . LEU B 1 28 ? 158.148 1.054   12.155  1.00 0.00 ? 28  LEU B C    3  
ATOM   7642  O  O    . LEU B 1 28 ? 157.675 2.110   12.574  1.00 0.00 ? 28  LEU B O    3  
ATOM   7643  C  CB   . LEU B 1 28 ? 156.314 -0.152  10.948  1.00 0.00 ? 28  LEU B CB   3  
ATOM   7644  C  CG   . LEU B 1 28 ? 157.083 -0.071  9.617   1.00 0.00 ? 28  LEU B CG   3  
ATOM   7645  C  CD1  . LEU B 1 28 ? 157.734 -1.417  9.301   1.00 0.00 ? 28  LEU B CD1  3  
ATOM   7646  C  CD2  . LEU B 1 28 ? 156.114 0.287   8.488   1.00 0.00 ? 28  LEU B CD2  3  
ATOM   7647  H  H    . LEU B 1 28 ? 155.793 0.184   13.543  1.00 0.00 ? 28  LEU B H    3  
ATOM   7648  H  HA   . LEU B 1 28 ? 157.955 -1.067  11.989  1.00 0.00 ? 28  LEU B HA   3  
ATOM   7649  H  HB2  . LEU B 1 28 ? 155.697 -1.038  10.952  1.00 0.00 ? 28  LEU B HB2  3  
ATOM   7650  H  HB3  . LEU B 1 28 ? 155.685 0.723   11.052  1.00 0.00 ? 28  LEU B HB3  3  
ATOM   7651  H  HG   . LEU B 1 28 ? 157.847 0.689   9.686   1.00 0.00 ? 28  LEU B HG   3  
ATOM   7652  H  HD11 . LEU B 1 28 ? 157.986 -1.456  8.253   1.00 0.00 ? 28  LEU B HD11 3  
ATOM   7653  H  HD12 . LEU B 1 28 ? 157.046 -2.210  9.533   1.00 0.00 ? 28  LEU B HD12 3  
ATOM   7654  H  HD13 . LEU B 1 28 ? 158.632 -1.534  9.889   1.00 0.00 ? 28  LEU B HD13 3  
ATOM   7655  H  HD21 . LEU B 1 28 ? 156.674 0.634   7.633   1.00 0.00 ? 28  LEU B HD21 3  
ATOM   7656  H  HD22 . LEU B 1 28 ? 155.441 1.064   8.818   1.00 0.00 ? 28  LEU B HD22 3  
ATOM   7657  H  HD23 . LEU B 1 28 ? 155.545 -0.589  8.212   1.00 0.00 ? 28  LEU B HD23 3  
ATOM   7658  N  N    . SER B 1 29 ? 159.396 0.950   11.709  1.00 0.00 ? 29  SER B N    3  
ATOM   7659  C  CA   . SER B 1 29 ? 160.291 2.104   11.691  1.00 0.00 ? 29  SER B CA   3  
ATOM   7660  C  C    . SER B 1 29 ? 160.411 2.636   10.269  1.00 0.00 ? 29  SER B C    3  
ATOM   7661  O  O    . SER B 1 29 ? 160.265 1.885   9.300   1.00 0.00 ? 29  SER B O    3  
ATOM   7662  C  CB   . SER B 1 29 ? 161.673 1.704   12.209  1.00 0.00 ? 29  SER B CB   3  
ATOM   7663  O  OG   . SER B 1 29 ? 161.553 1.209   13.536  1.00 0.00 ? 29  SER B OG   3  
ATOM   7664  H  H    . SER B 1 29 ? 159.720 0.084   11.385  1.00 0.00 ? 29  SER B H    3  
ATOM   7665  H  HA   . SER B 1 29 ? 159.888 2.880   12.327  1.00 0.00 ? 29  SER B HA   3  
ATOM   7666  H  HB2  . SER B 1 29 ? 162.088 0.935   11.580  1.00 0.00 ? 29  SER B HB2  3  
ATOM   7667  H  HB3  . SER B 1 29 ? 162.326 2.567   12.194  1.00 0.00 ? 29  SER B HB3  3  
ATOM   7668  H  HG   . SER B 1 29 ? 160.632 1.279   13.796  1.00 0.00 ? 29  SER B HG   3  
ATOM   7669  N  N    . LYS B 1 30 ? 160.648 3.936   10.133  1.00 0.00 ? 30  LYS B N    3  
ATOM   7670  C  CA   . LYS B 1 30 ? 160.743 4.507   8.802   1.00 0.00 ? 30  LYS B CA   3  
ATOM   7671  C  C    . LYS B 1 30 ? 161.811 3.799   7.997   1.00 0.00 ? 30  LYS B C    3  
ATOM   7672  O  O    . LYS B 1 30 ? 161.653 3.607   6.797   1.00 0.00 ? 30  LYS B O    3  
ATOM   7673  C  CB   . LYS B 1 30 ? 161.087 5.991   8.823   1.00 0.00 ? 30  LYS B CB   3  
ATOM   7674  C  CG   . LYS B 1 30 ? 160.998 6.516   7.382   1.00 0.00 ? 30  LYS B CG   3  
ATOM   7675  C  CD   . LYS B 1 30 ? 161.459 7.961   7.328   1.00 0.00 ? 30  LYS B CD   3  
ATOM   7676  C  CE   . LYS B 1 30 ? 161.179 8.538   5.939   1.00 0.00 ? 30  LYS B CE   3  
ATOM   7677  N  NZ   . LYS B 1 30 ? 162.045 9.731   5.711   1.00 0.00 ? 30  LYS B NZ   3  
ATOM   7678  H  H    . LYS B 1 30 ? 160.739 4.508   10.922  1.00 0.00 ? 30  LYS B H    3  
ATOM   7679  H  HA   . LYS B 1 30 ? 159.793 4.382   8.310   1.00 0.00 ? 30  LYS B HA   3  
ATOM   7680  H  HB2  . LYS B 1 30 ? 160.384 6.519   9.453   1.00 0.00 ? 30  LYS B HB2  3  
ATOM   7681  H  HB3  . LYS B 1 30 ? 162.090 6.130   9.196   1.00 0.00 ? 30  LYS B HB3  3  
ATOM   7682  H  HG2  . LYS B 1 30 ? 161.625 5.924   6.736   1.00 0.00 ? 30  LYS B HG2  3  
ATOM   7683  H  HG3  . LYS B 1 30 ? 159.975 6.458   7.042   1.00 0.00 ? 30  LYS B HG3  3  
ATOM   7684  H  HD2  . LYS B 1 30 ? 160.939 8.535   8.076   1.00 0.00 ? 30  LYS B HD2  3  
ATOM   7685  H  HD3  . LYS B 1 30 ? 162.518 7.990   7.515   1.00 0.00 ? 30  LYS B HD3  3  
ATOM   7686  H  HE2  . LYS B 1 30 ? 161.392 7.791   5.190   1.00 0.00 ? 30  LYS B HE2  3  
ATOM   7687  H  HE3  . LYS B 1 30 ? 160.143 8.829   5.873   1.00 0.00 ? 30  LYS B HE3  3  
ATOM   7688  H  HZ1  . LYS B 1 30 ? 162.568 9.615   4.821   1.00 0.00 ? 30  LYS B HZ1  3  
ATOM   7689  H  HZ2  . LYS B 1 30 ? 162.718 9.825   6.500   1.00 0.00 ? 30  LYS B HZ2  3  
ATOM   7690  H  HZ3  . LYS B 1 30 ? 161.452 10.583  5.655   1.00 0.00 ? 30  LYS B HZ3  3  
ATOM   7691  N  N    . LYS B 1 31 ? 162.907 3.417   8.638   1.00 0.00 ? 31  LYS B N    3  
ATOM   7692  C  CA   . LYS B 1 31 ? 163.953 2.749   7.895   1.00 0.00 ? 31  LYS B CA   3  
ATOM   7693  C  C    . LYS B 1 31 ? 163.343 1.545   7.210   1.00 0.00 ? 31  LYS B C    3  
ATOM   7694  O  O    . LYS B 1 31 ? 163.608 1.282   6.038   1.00 0.00 ? 31  LYS B O    3  
ATOM   7695  C  CB   . LYS B 1 31 ? 165.084 2.307   8.826   1.00 0.00 ? 31  LYS B CB   3  
ATOM   7696  C  CG   . LYS B 1 31 ? 166.228 1.725   7.993   1.00 0.00 ? 31  LYS B CG   3  
ATOM   7697  C  CD   . LYS B 1 31 ? 167.336 1.222   8.919   1.00 0.00 ? 31  LYS B CD   3  
ATOM   7698  C  CE   . LYS B 1 31 ? 168.538 0.781   8.082   1.00 0.00 ? 31  LYS B CE   3  
ATOM   7699  N  NZ   . LYS B 1 31 ? 169.665 0.412   8.985   1.00 0.00 ? 31  LYS B NZ   3  
ATOM   7700  H  H    . LYS B 1 31 ? 163.011 3.593   9.597   1.00 0.00 ? 31  LYS B H    3  
ATOM   7701  H  HA   . LYS B 1 31 ? 164.348 3.423   7.147   1.00 0.00 ? 31  LYS B HA   3  
ATOM   7702  H  HB2  . LYS B 1 31 ? 165.441 3.159   9.387   1.00 0.00 ? 31  LYS B HB2  3  
ATOM   7703  H  HB3  . LYS B 1 31 ? 164.716 1.554   9.506   1.00 0.00 ? 31  LYS B HB3  3  
ATOM   7704  H  HG2  . LYS B 1 31 ? 165.857 0.903   7.397   1.00 0.00 ? 31  LYS B HG2  3  
ATOM   7705  H  HG3  . LYS B 1 31 ? 166.624 2.490   7.342   1.00 0.00 ? 31  LYS B HG3  3  
ATOM   7706  H  HD2  . LYS B 1 31 ? 167.634 2.017   9.588   1.00 0.00 ? 31  LYS B HD2  3  
ATOM   7707  H  HD3  . LYS B 1 31 ? 166.974 0.384   9.494   1.00 0.00 ? 31  LYS B HD3  3  
ATOM   7708  H  HE2  . LYS B 1 31 ? 168.265 -0.074  7.481   1.00 0.00 ? 31  LYS B HE2  3  
ATOM   7709  H  HE3  . LYS B 1 31 ? 168.845 1.591   7.436   1.00 0.00 ? 31  LYS B HE3  3  
ATOM   7710  H  HZ1  . LYS B 1 31 ? 169.644 1.016   9.830   1.00 0.00 ? 31  LYS B HZ1  3  
ATOM   7711  H  HZ2  . LYS B 1 31 ? 170.568 0.545   8.484   1.00 0.00 ? 31  LYS B HZ2  3  
ATOM   7712  H  HZ3  . LYS B 1 31 ? 169.569 -0.582  9.271   1.00 0.00 ? 31  LYS B HZ3  3  
ATOM   7713  N  N    . GLU B 1 32 ? 162.477 0.844   7.932   1.00 0.00 ? 32  GLU B N    3  
ATOM   7714  C  CA   . GLU B 1 32 ? 161.793 -0.289  7.348   1.00 0.00 ? 32  GLU B CA   3  
ATOM   7715  C  C    . GLU B 1 32 ? 160.837 0.185   6.258   1.00 0.00 ? 32  GLU B C    3  
ATOM   7716  O  O    . GLU B 1 32 ? 160.663 -0.485  5.241   1.00 0.00 ? 32  GLU B O    3  
ATOM   7717  C  CB   . GLU B 1 32 ? 161.001 -1.058  8.413   1.00 0.00 ? 32  GLU B CB   3  
ATOM   7718  C  CG   . GLU B 1 32 ? 161.960 -1.673  9.433   1.00 0.00 ? 32  GLU B CG   3  
ATOM   7719  C  CD   . GLU B 1 32 ? 161.189 -2.568  10.408  1.00 0.00 ? 32  GLU B CD   3  
ATOM   7720  O  OE1  . GLU B 1 32 ? 160.574 -2.040  11.325  1.00 0.00 ? 32  GLU B OE1  3  
ATOM   7721  O  OE2  . GLU B 1 32 ? 161.230 -3.773  10.223  1.00 0.00 ? 32  GLU B OE2  3  
ATOM   7722  H  H    . GLU B 1 32 ? 162.269 1.119   8.850   1.00 0.00 ? 32  GLU B H    3  
ATOM   7723  H  HA   . GLU B 1 32 ? 162.524 -0.953  6.910   1.00 0.00 ? 32  GLU B HA   3  
ATOM   7724  H  HB2  . GLU B 1 32 ? 160.330 -0.379  8.915   1.00 0.00 ? 32  GLU B HB2  3  
ATOM   7725  H  HB3  . GLU B 1 32 ? 160.431 -1.842  7.939   1.00 0.00 ? 32  GLU B HB3  3  
ATOM   7726  H  HG2  . GLU B 1 32 ? 162.700 -2.260  8.912   1.00 0.00 ? 32  GLU B HG2  3  
ATOM   7727  H  HG3  . GLU B 1 32 ? 162.451 -0.885  9.984   1.00 0.00 ? 32  GLU B HG3  3  
ATOM   7728  N  N    . LEU B 1 33 ? 160.190 1.336   6.492   1.00 0.00 ? 33  LEU B N    3  
ATOM   7729  C  CA   . LEU B 1 33 ? 159.228 1.852   5.517   1.00 0.00 ? 33  LEU B CA   3  
ATOM   7730  C  C    . LEU B 1 33 ? 159.886 2.225   4.189   1.00 0.00 ? 33  LEU B C    3  
ATOM   7731  O  O    . LEU B 1 33 ? 159.400 1.835   3.130   1.00 0.00 ? 33  LEU B O    3  
ATOM   7732  C  CB   . LEU B 1 33 ? 158.533 3.092   6.088   1.00 0.00 ? 33  LEU B CB   3  
ATOM   7733  C  CG   . LEU B 1 33 ? 157.429 3.575   5.135   1.00 0.00 ? 33  LEU B CG   3  
ATOM   7734  C  CD1  . LEU B 1 33 ? 156.240 2.613   5.179   1.00 0.00 ? 33  LEU B CD1  3  
ATOM   7735  C  CD2  . LEU B 1 33 ? 156.968 4.967   5.572   1.00 0.00 ? 33  LEU B CD2  3  
ATOM   7736  H  H    . LEU B 1 33 ? 160.346 1.821   7.334   1.00 0.00 ? 33  LEU B H    3  
ATOM   7737  H  HA   . LEU B 1 33 ? 158.484 1.094   5.334   1.00 0.00 ? 33  LEU B HA   3  
ATOM   7738  H  HB2  . LEU B 1 33 ? 158.102 2.854   7.048   1.00 0.00 ? 33  LEU B HB2  3  
ATOM   7739  H  HB3  . LEU B 1 33 ? 159.260 3.878   6.206   1.00 0.00 ? 33  LEU B HB3  3  
ATOM   7740  H  HG   . LEU B 1 33 ? 157.812 3.625   4.128   1.00 0.00 ? 33  LEU B HG   3  
ATOM   7741  H  HD11 . LEU B 1 33 ? 156.451 1.749   4.567   1.00 0.00 ? 33  LEU B HD11 3  
ATOM   7742  H  HD12 . LEU B 1 33 ? 155.360 3.113   4.802   1.00 0.00 ? 33  LEU B HD12 3  
ATOM   7743  H  HD13 . LEU B 1 33 ? 156.066 2.299   6.197   1.00 0.00 ? 33  LEU B HD13 3  
ATOM   7744  H  HD21 . LEU B 1 33 ? 157.659 5.709   5.200   1.00 0.00 ? 33  LEU B HD21 3  
ATOM   7745  H  HD22 . LEU B 1 33 ? 156.938 5.013   6.651   1.00 0.00 ? 33  LEU B HD22 3  
ATOM   7746  H  HD23 . LEU B 1 33 ? 155.985 5.160   5.176   1.00 0.00 ? 33  LEU B HD23 3  
ATOM   7747  N  N    . LYS B 1 34 ? 160.989 2.973   4.222   1.00 0.00 ? 34  LYS B N    3  
ATOM   7748  C  CA   . LYS B 1 34 ? 161.628 3.344   2.990   1.00 0.00 ? 34  LYS B CA   3  
ATOM   7749  C  C    . LYS B 1 34 ? 162.080 2.112   2.219   1.00 0.00 ? 34  LYS B C    3  
ATOM   7750  O  O    . LYS B 1 34 ? 161.847 1.997   1.016   1.00 0.00 ? 34  LYS B O    3  
ATOM   7751  C  CB   . LYS B 1 34 ? 162.816 4.220   3.334   1.00 0.00 ? 34  LYS B CB   3  
ATOM   7752  C  CG   . LYS B 1 34 ? 163.416 4.794   2.073   1.00 0.00 ? 34  LYS B CG   3  
ATOM   7753  C  CD   . LYS B 1 34 ? 164.751 5.423   2.428   1.00 0.00 ? 34  LYS B CD   3  
ATOM   7754  C  CE   . LYS B 1 34 ? 164.530 6.666   3.295   1.00 0.00 ? 34  LYS B CE   3  
ATOM   7755  N  NZ   . LYS B 1 34 ? 165.685 7.594   3.134   1.00 0.00 ? 34  LYS B NZ   3  
ATOM   7756  H  H    . LYS B 1 34 ? 161.373 3.294   5.073   1.00 0.00 ? 34  LYS B H    3  
ATOM   7757  H  HA   . LYS B 1 34 ? 160.937 3.910   2.385   1.00 0.00 ? 34  LYS B HA   3  
ATOM   7758  H  HB2  . LYS B 1 34 ? 162.491 5.028   3.973   1.00 0.00 ? 34  LYS B HB2  3  
ATOM   7759  H  HB3  . LYS B 1 34 ? 163.558 3.631   3.849   1.00 0.00 ? 34  LYS B HB3  3  
ATOM   7760  H  HG2  . LYS B 1 34 ? 163.564 4.003   1.350   1.00 0.00 ? 34  LYS B HG2  3  
ATOM   7761  H  HG3  . LYS B 1 34 ? 162.759 5.544   1.661   1.00 0.00 ? 34  LYS B HG3  3  
ATOM   7762  H  HD2  . LYS B 1 34 ? 165.356 4.708   2.967   1.00 0.00 ? 34  LYS B HD2  3  
ATOM   7763  H  HD3  . LYS B 1 34 ? 165.246 5.698   1.533   1.00 0.00 ? 34  LYS B HD3  3  
ATOM   7764  H  HE2  . LYS B 1 34 ? 163.623 7.165   2.988   1.00 0.00 ? 34  LYS B HE2  3  
ATOM   7765  H  HE3  . LYS B 1 34 ? 164.447 6.372   4.331   1.00 0.00 ? 34  LYS B HE3  3  
ATOM   7766  H  HZ1  . LYS B 1 34 ? 166.293 7.260   2.361   1.00 0.00 ? 34  LYS B HZ1  3  
ATOM   7767  H  HZ2  . LYS B 1 34 ? 166.231 7.624   4.019   1.00 0.00 ? 34  LYS B HZ2  3  
ATOM   7768  H  HZ3  . LYS B 1 34 ? 165.335 8.547   2.910   1.00 0.00 ? 34  LYS B HZ3  3  
ATOM   7769  N  N    . GLU B 1 35 ? 162.710 1.178   2.918   1.00 0.00 ? 35  GLU B N    3  
ATOM   7770  C  CA   . GLU B 1 35 ? 163.169 -0.040  2.272   1.00 0.00 ? 35  GLU B CA   3  
ATOM   7771  C  C    . GLU B 1 35 ? 161.999 -0.870  1.759   1.00 0.00 ? 35  GLU B C    3  
ATOM   7772  O  O    . GLU B 1 35 ? 162.078 -1.476  0.692   1.00 0.00 ? 35  GLU B O    3  
ATOM   7773  C  CB   . GLU B 1 35 ? 163.992 -0.874  3.257   1.00 0.00 ? 35  GLU B CB   3  
ATOM   7774  C  CG   . GLU B 1 35 ? 164.590 -2.080  2.529   1.00 0.00 ? 35  GLU B CG   3  
ATOM   7775  C  CD   . GLU B 1 35 ? 165.329 -2.974  3.520   1.00 0.00 ? 35  GLU B CD   3  
ATOM   7776  O  OE1  . GLU B 1 35 ? 165.325 -2.650  4.696   1.00 0.00 ? 35  GLU B OE1  3  
ATOM   7777  O  OE2  . GLU B 1 35 ? 165.887 -3.969  3.088   1.00 0.00 ? 35  GLU B OE2  3  
ATOM   7778  H  H    . GLU B 1 35 ? 162.859 1.306   3.878   1.00 0.00 ? 35  GLU B H    3  
ATOM   7779  H  HA   . GLU B 1 35 ? 163.799 0.226   1.437   1.00 0.00 ? 35  GLU B HA   3  
ATOM   7780  H  HB2  . GLU B 1 35 ? 164.787 -0.267  3.665   1.00 0.00 ? 35  GLU B HB2  3  
ATOM   7781  H  HB3  . GLU B 1 35 ? 163.354 -1.219  4.057   1.00 0.00 ? 35  GLU B HB3  3  
ATOM   7782  H  HG2  . GLU B 1 35 ? 163.798 -2.645  2.059   1.00 0.00 ? 35  GLU B HG2  3  
ATOM   7783  H  HG3  . GLU B 1 35 ? 165.281 -1.737  1.774   1.00 0.00 ? 35  GLU B HG3  3  
ATOM   7784  N  N    . LEU B 1 36 ? 160.921 -0.917  2.539   1.00 0.00 ? 36  LEU B N    3  
ATOM   7785  C  CA   . LEU B 1 36 ? 159.762 -1.711  2.151   1.00 0.00 ? 36  LEU B CA   3  
ATOM   7786  C  C    . LEU B 1 36 ? 159.112 -1.190  0.872   1.00 0.00 ? 36  LEU B C    3  
ATOM   7787  O  O    . LEU B 1 36 ? 158.822 -1.967  -0.043  1.00 0.00 ? 36  LEU B O    3  
ATOM   7788  C  CB   . LEU B 1 36 ? 158.736 -1.681  3.288   1.00 0.00 ? 36  LEU B CB   3  
ATOM   7789  C  CG   . LEU B 1 36 ? 157.559 -2.603  2.958   1.00 0.00 ? 36  LEU B CG   3  
ATOM   7790  C  CD1  . LEU B 1 36 ? 158.019 -4.062  3.016   1.00 0.00 ? 36  LEU B CD1  3  
ATOM   7791  C  CD2  . LEU B 1 36 ? 156.444 -2.384  3.983   1.00 0.00 ? 36  LEU B CD2  3  
ATOM   7792  H  H    . LEU B 1 36 ? 160.914 -0.433  3.392   1.00 0.00 ? 36  LEU B H    3  
ATOM   7793  H  HA   . LEU B 1 36 ? 160.073 -2.731  1.995   1.00 0.00 ? 36  LEU B HA   3  
ATOM   7794  H  HB2  . LEU B 1 36 ? 159.206 -2.005  4.204   1.00 0.00 ? 36  LEU B HB2  3  
ATOM   7795  H  HB3  . LEU B 1 36 ? 158.372 -0.673  3.413   1.00 0.00 ? 36  LEU B HB3  3  
ATOM   7796  H  HG   . LEU B 1 36 ? 157.187 -2.382  1.968   1.00 0.00 ? 36  LEU B HG   3  
ATOM   7797  H  HD11 . LEU B 1 36 ? 158.781 -4.169  3.771   1.00 0.00 ? 36  LEU B HD11 3  
ATOM   7798  H  HD12 . LEU B 1 36 ? 158.422 -4.348  2.056   1.00 0.00 ? 36  LEU B HD12 3  
ATOM   7799  H  HD13 . LEU B 1 36 ? 157.179 -4.696  3.258   1.00 0.00 ? 36  LEU B HD13 3  
ATOM   7800  H  HD21 . LEU B 1 36 ? 156.763 -2.749  4.948   1.00 0.00 ? 36  LEU B HD21 3  
ATOM   7801  H  HD22 . LEU B 1 36 ? 155.557 -2.918  3.672   1.00 0.00 ? 36  LEU B HD22 3  
ATOM   7802  H  HD23 . LEU B 1 36 ? 156.222 -1.330  4.054   1.00 0.00 ? 36  LEU B HD23 3  
ATOM   7803  N  N    . LEU B 1 37 ? 158.897 0.121   0.797   1.00 0.00 ? 37  LEU B N    3  
ATOM   7804  C  CA   . LEU B 1 37 ? 158.288 0.694   -0.397  1.00 0.00 ? 37  LEU B CA   3  
ATOM   7805  C  C    . LEU B 1 37 ? 159.235 0.652   -1.588  1.00 0.00 ? 37  LEU B C    3  
ATOM   7806  O  O    . LEU B 1 37 ? 158.817 0.344   -2.704  1.00 0.00 ? 37  LEU B O    3  
ATOM   7807  C  CB   . LEU B 1 37 ? 157.833 2.135   -0.142  1.00 0.00 ? 37  LEU B CB   3  
ATOM   7808  C  CG   . LEU B 1 37 ? 156.544 2.171   0.707   1.00 0.00 ? 37  LEU B CG   3  
ATOM   7809  C  CD1  . LEU B 1 37 ? 155.328 1.974   -0.199  1.00 0.00 ? 37  LEU B CD1  3  
ATOM   7810  C  CD2  . LEU B 1 37 ? 156.548 1.076   1.781   1.00 0.00 ? 37  LEU B CD2  3  
ATOM   7811  H  H    . LEU B 1 37 ? 159.153 0.705   1.546   1.00 0.00 ? 37  LEU B H    3  
ATOM   7812  H  HA   . LEU B 1 37 ? 157.422 0.106   -0.652  1.00 0.00 ? 37  LEU B HA   3  
ATOM   7813  H  HB2  . LEU B 1 37 ? 158.615 2.664   0.381   1.00 0.00 ? 37  LEU B HB2  3  
ATOM   7814  H  HB3  . LEU B 1 37 ? 157.650 2.621   -1.088  1.00 0.00 ? 37  LEU B HB3  3  
ATOM   7815  H  HG   . LEU B 1 37 ? 156.470 3.139   1.186   1.00 0.00 ? 37  LEU B HG   3  
ATOM   7816  H  HD11 . LEU B 1 37 ? 155.310 0.958   -0.565  1.00 0.00 ? 37  LEU B HD11 3  
ATOM   7817  H  HD12 . LEU B 1 37 ? 155.384 2.656   -1.034  1.00 0.00 ? 37  LEU B HD12 3  
ATOM   7818  H  HD13 . LEU B 1 37 ? 154.426 2.170   0.362   1.00 0.00 ? 37  LEU B HD13 3  
ATOM   7819  H  HD21 . LEU B 1 37 ? 155.725 1.242   2.460   1.00 0.00 ? 37  LEU B HD21 3  
ATOM   7820  H  HD22 . LEU B 1 37 ? 157.469 1.112   2.329   1.00 0.00 ? 37  LEU B HD22 3  
ATOM   7821  H  HD23 . LEU B 1 37 ? 156.439 0.108   1.321   1.00 0.00 ? 37  LEU B HD23 3  
ATOM   7822  N  N    . GLN B 1 38 ? 160.510 0.959   -1.361  1.00 0.00 ? 38  GLN B N    3  
ATOM   7823  C  CA   . GLN B 1 38 ? 161.464 0.937   -2.460  1.00 0.00 ? 38  GLN B CA   3  
ATOM   7824  C  C    . GLN B 1 38 ? 161.632 -0.466  -3.036  1.00 0.00 ? 38  GLN B C    3  
ATOM   7825  O  O    . GLN B 1 38 ? 161.674 -0.643  -4.254  1.00 0.00 ? 38  GLN B O    3  
ATOM   7826  C  CB   . GLN B 1 38 ? 162.815 1.470   -1.978  1.00 0.00 ? 38  GLN B CB   3  
ATOM   7827  C  CG   . GLN B 1 38 ? 162.690 2.961   -1.641  1.00 0.00 ? 38  GLN B CG   3  
ATOM   7828  C  CD   . GLN B 1 38 ? 164.014 3.487   -1.098  1.00 0.00 ? 38  GLN B CD   3  
ATOM   7829  O  OE1  . GLN B 1 38 ? 164.872 2.704   -0.689  1.00 0.00 ? 38  GLN B OE1  3  
ATOM   7830  N  NE2  . GLN B 1 38 ? 164.232 4.773   -1.069  1.00 0.00 ? 38  GLN B NE2  3  
ATOM   7831  H  H    . GLN B 1 38 ? 160.808 1.202   -0.454  1.00 0.00 ? 38  GLN B H    3  
ATOM   7832  H  HA   . GLN B 1 38 ? 161.101 1.589   -3.242  1.00 0.00 ? 38  GLN B HA   3  
ATOM   7833  H  HB2  . GLN B 1 38 ? 163.113 0.928   -1.091  1.00 0.00 ? 38  GLN B HB2  3  
ATOM   7834  H  HB3  . GLN B 1 38 ? 163.558 1.333   -2.744  1.00 0.00 ? 38  GLN B HB3  3  
ATOM   7835  H  HG2  . GLN B 1 38 ? 162.431 3.510   -2.533  1.00 0.00 ? 38  GLN B HG2  3  
ATOM   7836  H  HG3  . GLN B 1 38 ? 161.919 3.103   -0.906  1.00 0.00 ? 38  GLN B HG3  3  
ATOM   7837  H  HE21 . GLN B 1 38 ? 163.547 5.393   -1.396  1.00 0.00 ? 38  GLN B HE21 3  
ATOM   7838  H  HE22 . GLN B 1 38 ? 165.081 5.118   -0.722  1.00 0.00 ? 38  GLN B HE22 3  
ATOM   7839  N  N    . THR B 1 39 ? 161.724 -1.461  -2.159  1.00 0.00 ? 39  THR B N    3  
ATOM   7840  C  CA   . THR B 1 39 ? 161.883 -2.841  -2.609  1.00 0.00 ? 39  THR B CA   3  
ATOM   7841  C  C    . THR B 1 39 ? 160.608 -3.399  -3.244  1.00 0.00 ? 39  THR B C    3  
ATOM   7842  O  O    . THR B 1 39 ? 160.658 -4.085  -4.264  1.00 0.00 ? 39  THR B O    3  
ATOM   7843  C  CB   . THR B 1 39 ? 162.287 -3.725  -1.427  1.00 0.00 ? 39  THR B CB   3  
ATOM   7844  O  OG1  . THR B 1 39 ? 163.453 -3.189  -0.816  1.00 0.00 ? 39  THR B OG1  3  
ATOM   7845  C  CG2  . THR B 1 39 ? 162.577 -5.143  -1.925  1.00 0.00 ? 39  THR B CG2  3  
ATOM   7846  H  H    . THR B 1 39 ? 161.682 -1.267  -1.200  1.00 0.00 ? 39  THR B H    3  
ATOM   7847  H  HA   . THR B 1 39 ? 162.673 -2.874  -3.343  1.00 0.00 ? 39  THR B HA   3  
ATOM   7848  H  HB   . THR B 1 39 ? 161.484 -3.757  -0.708  1.00 0.00 ? 39  THR B HB   3  
ATOM   7849  H  HG1  . THR B 1 39 ? 163.307 -3.168  0.133   1.00 0.00 ? 39  THR B HG1  3  
ATOM   7850  H  HG21 . THR B 1 39 ? 163.239 -5.097  -2.777  1.00 0.00 ? 39  THR B HG21 3  
ATOM   7851  H  HG22 . THR B 1 39 ? 161.652 -5.620  -2.213  1.00 0.00 ? 39  THR B HG22 3  
ATOM   7852  H  HG23 . THR B 1 39 ? 163.046 -5.713  -1.135  1.00 0.00 ? 39  THR B HG23 3  
ATOM   7853  N  N    . GLU B 1 40 ? 159.473 -3.135  -2.599  1.00 0.00 ? 40  GLU B N    3  
ATOM   7854  C  CA   . GLU B 1 40 ? 158.187 -3.653  -3.069  1.00 0.00 ? 40  GLU B CA   3  
ATOM   7855  C  C    . GLU B 1 40 ? 157.617 -2.927  -4.286  1.00 0.00 ? 40  GLU B C    3  
ATOM   7856  O  O    . GLU B 1 40 ? 156.894 -3.533  -5.078  1.00 0.00 ? 40  GLU B O    3  
ATOM   7857  C  CB   . GLU B 1 40 ? 157.160 -3.598  -1.936  1.00 0.00 ? 40  GLU B CB   3  
ATOM   7858  C  CG   . GLU B 1 40 ? 157.577 -4.554  -0.818  1.00 0.00 ? 40  GLU B CG   3  
ATOM   7859  C  CD   . GLU B 1 40 ? 156.520 -4.561  0.280   1.00 0.00 ? 40  GLU B CD   3  
ATOM   7860  O  OE1  . GLU B 1 40 ? 155.636 -3.720  0.230   1.00 0.00 ? 40  GLU B OE1  3  
ATOM   7861  O  OE2  . GLU B 1 40 ? 156.606 -5.406  1.154   1.00 0.00 ? 40  GLU B OE2  3  
ATOM   7862  H  H    . GLU B 1 40 ? 159.502 -2.610  -1.768  1.00 0.00 ? 40  GLU B H    3  
ATOM   7863  H  HA   . GLU B 1 40 ? 158.323 -4.689  -3.335  1.00 0.00 ? 40  GLU B HA   3  
ATOM   7864  H  HB2  . GLU B 1 40 ? 157.106 -2.591  -1.550  1.00 0.00 ? 40  GLU B HB2  3  
ATOM   7865  H  HB3  . GLU B 1 40 ? 156.193 -3.892  -2.315  1.00 0.00 ? 40  GLU B HB3  3  
ATOM   7866  H  HG2  . GLU B 1 40 ? 157.683 -5.552  -1.219  1.00 0.00 ? 40  GLU B HG2  3  
ATOM   7867  H  HG3  . GLU B 1 40 ? 158.521 -4.231  -0.404  1.00 0.00 ? 40  GLU B HG3  3  
ATOM   7868  N  N    . LEU B 1 41 ? 157.868 -1.626  -4.413  1.00 0.00 ? 41  LEU B N    3  
ATOM   7869  C  CA   . LEU B 1 41 ? 157.272 -0.875  -5.521  1.00 0.00 ? 41  LEU B CA   3  
ATOM   7870  C  C    . LEU B 1 41 ? 158.249 -0.667  -6.690  1.00 0.00 ? 41  LEU B C    3  
ATOM   7871  O  O    . LEU B 1 41 ? 159.352 -0.133  -6.525  1.00 0.00 ? 41  LEU B O    3  
ATOM   7872  C  CB   . LEU B 1 41 ? 156.798 0.479   -4.982  1.00 0.00 ? 41  LEU B CB   3  
ATOM   7873  C  CG   . LEU B 1 41 ? 155.967 1.203   -6.042  1.00 0.00 ? 41  LEU B CG   3  
ATOM   7874  C  CD1  . LEU B 1 41 ? 154.569 0.581   -6.136  1.00 0.00 ? 41  LEU B CD1  3  
ATOM   7875  C  CD2  . LEU B 1 41 ? 155.844 2.683   -5.669  1.00 0.00 ? 41  LEU B CD2  3  
ATOM   7876  H  H    . LEU B 1 41 ? 158.404 -1.162  -3.736  1.00 0.00 ? 41  LEU B H    3  
ATOM   7877  H  HA   . LEU B 1 41 ? 156.411 -1.414  -5.885  1.00 0.00 ? 41  LEU B HA   3  
ATOM   7878  H  HB2  . LEU B 1 41 ? 156.201 0.323   -4.096  1.00 0.00 ? 41  LEU B HB2  3  
ATOM   7879  H  HB3  . LEU B 1 41 ? 157.657 1.083   -4.730  1.00 0.00 ? 41  LEU B HB3  3  
ATOM   7880  H  HG   . LEU B 1 41 ? 156.454 1.112   -6.989  1.00 0.00 ? 41  LEU B HG   3  
ATOM   7881  H  HD11 . LEU B 1 41 ? 154.614 -0.315  -6.738  1.00 0.00 ? 41  LEU B HD11 3  
ATOM   7882  H  HD12 . LEU B 1 41 ? 153.894 1.286   -6.595  1.00 0.00 ? 41  LEU B HD12 3  
ATOM   7883  H  HD13 . LEU B 1 41 ? 154.212 0.333   -5.148  1.00 0.00 ? 41  LEU B HD13 3  
ATOM   7884  H  HD21 . LEU B 1 41 ? 156.751 3.201   -5.945  1.00 0.00 ? 41  LEU B HD21 3  
ATOM   7885  H  HD22 . LEU B 1 41 ? 155.687 2.775   -4.605  1.00 0.00 ? 41  LEU B HD22 3  
ATOM   7886  H  HD23 . LEU B 1 41 ? 155.007 3.118   -6.196  1.00 0.00 ? 41  LEU B HD23 3  
ATOM   7887  N  N    . SER B 1 42 ? 157.804 -1.064  -7.884  1.00 0.00 ? 42  SER B N    3  
ATOM   7888  C  CA   . SER B 1 42 ? 158.609 -0.908  -9.096  1.00 0.00 ? 42  SER B CA   3  
ATOM   7889  C  C    . SER B 1 42 ? 158.964 0.557   -9.292  1.00 0.00 ? 42  SER B C    3  
ATOM   7890  O  O    . SER B 1 42 ? 160.025 0.895   -9.822  1.00 0.00 ? 42  SER B O    3  
ATOM   7891  C  CB   . SER B 1 42 ? 157.835 -1.418  -10.312 1.00 0.00 ? 42  SER B CB   3  
ATOM   7892  O  OG   . SER B 1 42 ? 158.685 -1.402  -11.451 1.00 0.00 ? 42  SER B OG   3  
ATOM   7893  H  H    . SER B 1 42 ? 156.908 -1.455  -7.955  1.00 0.00 ? 42  SER B H    3  
ATOM   7894  H  HA   . SER B 1 42 ? 159.518 -1.481  -8.991  1.00 0.00 ? 42  SER B HA   3  
ATOM   7895  H  HB2  . SER B 1 42 ? 157.502 -2.427  -10.133 1.00 0.00 ? 42  SER B HB2  3  
ATOM   7896  H  HB3  . SER B 1 42 ? 156.975 -0.782  -10.482 1.00 0.00 ? 42  SER B HB3  3  
ATOM   7897  H  HG   . SER B 1 42 ? 159.226 -0.609  -11.406 1.00 0.00 ? 42  SER B HG   3  
ATOM   7898  N  N    . GLY B 1 43 ? 158.062 1.418   -8.847  1.00 0.00 ? 43  GLY B N    3  
ATOM   7899  C  CA   . GLY B 1 43 ? 158.260 2.852   -8.954  1.00 0.00 ? 43  GLY B CA   3  
ATOM   7900  C  C    . GLY B 1 43 ? 159.664 3.218   -8.507  1.00 0.00 ? 43  GLY B C    3  
ATOM   7901  O  O    . GLY B 1 43 ? 160.140 4.321   -8.765  1.00 0.00 ? 43  GLY B O    3  
ATOM   7902  H  H    . GLY B 1 43 ? 157.245 1.079   -8.435  1.00 0.00 ? 43  GLY B H    3  
ATOM   7903  H  HA2  . GLY B 1 43 ? 158.118 3.157   -9.982  1.00 0.00 ? 43  GLY B HA2  3  
ATOM   7904  H  HA3  . GLY B 1 43 ? 157.544 3.360   -8.327  1.00 0.00 ? 43  GLY B HA3  3  
ATOM   7905  N  N    . PHE B 1 44 ? 160.330 2.290   -7.831  1.00 0.00 ? 44  PHE B N    3  
ATOM   7906  C  CA   . PHE B 1 44 ? 161.680 2.557   -7.362  1.00 0.00 ? 44  PHE B CA   3  
ATOM   7907  C  C    . PHE B 1 44 ? 162.571 3.077   -8.485  1.00 0.00 ? 44  PHE B C    3  
ATOM   7908  O  O    . PHE B 1 44 ? 163.399 3.960   -8.264  1.00 0.00 ? 44  PHE B O    3  
ATOM   7909  C  CB   . PHE B 1 44 ? 162.300 1.289   -6.784  1.00 0.00 ? 44  PHE B CB   3  
ATOM   7910  C  CG   . PHE B 1 44 ? 163.678 1.614   -6.268  1.00 0.00 ? 44  PHE B CG   3  
ATOM   7911  C  CD1  . PHE B 1 44 ? 163.823 2.299   -5.063  1.00 0.00 ? 44  PHE B CD1  3  
ATOM   7912  C  CD2  . PHE B 1 44 ? 164.810 1.252   -7.009  1.00 0.00 ? 44  PHE B CD2  3  
ATOM   7913  C  CE1  . PHE B 1 44 ? 165.100 2.619   -4.586  1.00 0.00 ? 44  PHE B CE1  3  
ATOM   7914  C  CE2  . PHE B 1 44 ? 166.089 1.571   -6.536  1.00 0.00 ? 44  PHE B CE2  3  
ATOM   7915  C  CZ   . PHE B 1 44 ? 166.234 2.253   -5.322  1.00 0.00 ? 44  PHE B CZ   3  
ATOM   7916  H  H    . PHE B 1 44 ? 159.907 1.415   -7.639  1.00 0.00 ? 44  PHE B H    3  
ATOM   7917  H  HA   . PHE B 1 44 ? 161.632 3.298   -6.581  1.00 0.00 ? 44  PHE B HA   3  
ATOM   7918  H  HB2  . PHE B 1 44 ? 161.686 0.921   -5.974  1.00 0.00 ? 44  PHE B HB2  3  
ATOM   7919  H  HB3  . PHE B 1 44 ? 162.372 0.536   -7.555  1.00 0.00 ? 44  PHE B HB3  3  
ATOM   7920  H  HD1  . PHE B 1 44 ? 162.949 2.583   -4.503  1.00 0.00 ? 44  PHE B HD1  3  
ATOM   7921  H  HD2  . PHE B 1 44 ? 164.697 0.721   -7.943  1.00 0.00 ? 44  PHE B HD2  3  
ATOM   7922  H  HE1  . PHE B 1 44 ? 165.212 3.145   -3.650  1.00 0.00 ? 44  PHE B HE1  3  
ATOM   7923  H  HE2  . PHE B 1 44 ? 166.962 1.292   -7.108  1.00 0.00 ? 44  PHE B HE2  3  
ATOM   7924  H  HZ   . PHE B 1 44 ? 167.219 2.499   -4.956  1.00 0.00 ? 44  PHE B HZ   3  
ATOM   7925  N  N    . LEU B 1 45 ? 162.421 2.524   -9.679  1.00 0.00 ? 45  LEU B N    3  
ATOM   7926  C  CA   . LEU B 1 45 ? 163.249 2.954   -10.801 1.00 0.00 ? 45  LEU B CA   3  
ATOM   7927  C  C    . LEU B 1 45 ? 163.114 4.460   -11.058 1.00 0.00 ? 45  LEU B C    3  
ATOM   7928  O  O    . LEU B 1 45 ? 164.101 5.129   -11.367 1.00 0.00 ? 45  LEU B O    3  
ATOM   7929  C  CB   . LEU B 1 45 ? 162.841 2.178   -12.058 1.00 0.00 ? 45  LEU B CB   3  
ATOM   7930  C  CG   . LEU B 1 45 ? 163.771 2.532   -13.227 1.00 0.00 ? 45  LEU B CG   3  
ATOM   7931  C  CD1  . LEU B 1 45 ? 165.154 1.914   -12.998 1.00 0.00 ? 45  LEU B CD1  3  
ATOM   7932  C  CD2  . LEU B 1 45 ? 163.179 1.977   -14.524 1.00 0.00 ? 45  LEU B CD2  3  
ATOM   7933  H  H    . LEU B 1 45 ? 161.755 1.813   -9.807  1.00 0.00 ? 45  LEU B H    3  
ATOM   7934  H  HA   . LEU B 1 45 ? 164.281 2.729   -10.577 1.00 0.00 ? 45  LEU B HA   3  
ATOM   7935  H  HB2  . LEU B 1 45 ? 162.898 1.118   -11.860 1.00 0.00 ? 45  LEU B HB2  3  
ATOM   7936  H  HB3  . LEU B 1 45 ? 161.827 2.437   -12.323 1.00 0.00 ? 45  LEU B HB3  3  
ATOM   7937  H  HG   . LEU B 1 45 ? 163.865 3.605   -13.304 1.00 0.00 ? 45  LEU B HG   3  
ATOM   7938  H  HD11 . LEU B 1 45 ? 165.671 1.835   -13.944 1.00 0.00 ? 45  LEU B HD11 3  
ATOM   7939  H  HD12 . LEU B 1 45 ? 165.046 0.931   -12.565 1.00 0.00 ? 45  LEU B HD12 3  
ATOM   7940  H  HD13 . LEU B 1 45 ? 165.724 2.543   -12.331 1.00 0.00 ? 45  LEU B HD13 3  
ATOM   7941  H  HD21 . LEU B 1 45 ? 163.960 1.884   -15.265 1.00 0.00 ? 45  LEU B HD21 3  
ATOM   7942  H  HD22 . LEU B 1 45 ? 162.417 2.649   -14.888 1.00 0.00 ? 45  LEU B HD22 3  
ATOM   7943  H  HD23 . LEU B 1 45 ? 162.744 1.007   -14.335 1.00 0.00 ? 45  LEU B HD23 3  
ATOM   7944  N  N    . ASP B 1 46 ? 161.896 4.990   -10.945 1.00 0.00 ? 46  ASP B N    3  
ATOM   7945  C  CA   . ASP B 1 46 ? 161.666 6.420   -11.186 1.00 0.00 ? 46  ASP B CA   3  
ATOM   7946  C  C    . ASP B 1 46 ? 161.646 7.233   -9.889  1.00 0.00 ? 46  ASP B C    3  
ATOM   7947  O  O    . ASP B 1 46 ? 161.246 8.397   -9.895  1.00 0.00 ? 46  ASP B O    3  
ATOM   7948  C  CB   . ASP B 1 46 ? 160.347 6.625   -11.940 1.00 0.00 ? 46  ASP B CB   3  
ATOM   7949  C  CG   . ASP B 1 46 ? 159.160 6.240   -11.062 1.00 0.00 ? 46  ASP B CG   3  
ATOM   7950  O  OD1  . ASP B 1 46 ? 159.342 6.143   -9.861  1.00 0.00 ? 46  ASP B OD1  3  
ATOM   7951  O  OD2  . ASP B 1 46 ? 158.081 6.066   -11.604 1.00 0.00 ? 46  ASP B OD2  3  
ATOM   7952  H  H    . ASP B 1 46 ? 161.140 4.414   -10.707 1.00 0.00 ? 46  ASP B H    3  
ATOM   7953  H  HA   . ASP B 1 46 ? 162.468 6.793   -11.807 1.00 0.00 ? 46  ASP B HA   3  
ATOM   7954  H  HB2  . ASP B 1 46 ? 160.257 7.663   -12.224 1.00 0.00 ? 46  ASP B HB2  3  
ATOM   7955  H  HB3  . ASP B 1 46 ? 160.345 6.010   -12.828 1.00 0.00 ? 46  ASP B HB3  3  
ATOM   7956  N  N    . ALA B 1 47 ? 162.041 6.622   -8.776  1.00 0.00 ? 47  ALA B N    3  
ATOM   7957  C  CA   . ALA B 1 47 ? 162.012 7.328   -7.493  1.00 0.00 ? 47  ALA B CA   3  
ATOM   7958  C  C    . ALA B 1 47 ? 162.898 8.574   -7.513  1.00 0.00 ? 47  ALA B C    3  
ATOM   7959  O  O    . ALA B 1 47 ? 162.535 9.596   -6.935  1.00 0.00 ? 47  ALA B O    3  
ATOM   7960  C  CB   . ALA B 1 47 ? 162.472 6.386   -6.371  1.00 0.00 ? 47  ALA B CB   3  
ATOM   7961  H  H    . ALA B 1 47 ? 162.329 5.686   -8.810  1.00 0.00 ? 47  ALA B H    3  
ATOM   7962  H  HA   . ALA B 1 47 ? 160.995 7.634   -7.292  1.00 0.00 ? 47  ALA B HA   3  
ATOM   7963  H  HB1  . ALA B 1 47 ? 161.808 6.480   -5.524  1.00 0.00 ? 47  ALA B HB1  3  
ATOM   7964  H  HB2  . ALA B 1 47 ? 163.479 6.637   -6.067  1.00 0.00 ? 47  ALA B HB2  3  
ATOM   7965  H  HB3  . ALA B 1 47 ? 162.453 5.373   -6.729  1.00 0.00 ? 47  ALA B HB3  3  
ATOM   7966  N  N    . GLN B 1 48 ? 164.046 8.475   -8.184  1.00 0.00 ? 48  GLN B N    3  
ATOM   7967  C  CA   . GLN B 1 48 ? 164.993 9.592   -8.287  1.00 0.00 ? 48  GLN B CA   3  
ATOM   7968  C  C    . GLN B 1 48 ? 164.803 10.611  -7.153  1.00 0.00 ? 48  GLN B C    3  
ATOM   7969  O  O    . GLN B 1 48 ? 164.470 10.245  -6.020  1.00 0.00 ? 48  GLN B O    3  
ATOM   7970  C  CB   . GLN B 1 48 ? 164.822 10.281  -9.644  1.00 0.00 ? 48  GLN B CB   3  
ATOM   7971  C  CG   . GLN B 1 48 ? 165.175 9.299   -10.762 1.00 0.00 ? 48  GLN B CG   3  
ATOM   7972  C  CD   . GLN B 1 48 ? 164.966 9.958   -12.120 1.00 0.00 ? 48  GLN B CD   3  
ATOM   7973  O  OE1  . GLN B 1 48 ? 164.288 10.980  -12.218 1.00 0.00 ? 48  GLN B OE1  3  
ATOM   7974  N  NE2  . GLN B 1 48 ? 165.513 9.431   -13.182 1.00 0.00 ? 48  GLN B NE2  3  
ATOM   7975  H  H    . GLN B 1 48 ? 164.264 7.628   -8.625  1.00 0.00 ? 48  GLN B H    3  
ATOM   7976  H  HA   . GLN B 1 48 ? 165.996 9.197   -8.229  1.00 0.00 ? 48  GLN B HA   3  
ATOM   7977  H  HB2  . GLN B 1 48 ? 163.797 10.605  -9.758  1.00 0.00 ? 48  GLN B HB2  3  
ATOM   7978  H  HB3  . GLN B 1 48 ? 165.479 11.134  -9.704  1.00 0.00 ? 48  GLN B HB3  3  
ATOM   7979  H  HG2  . GLN B 1 48 ? 166.209 9.001   -10.664 1.00 0.00 ? 48  GLN B HG2  3  
ATOM   7980  H  HG3  . GLN B 1 48 ? 164.542 8.427   -10.686 1.00 0.00 ? 48  GLN B HG3  3  
ATOM   7981  H  HE21 . GLN B 1 48 ? 166.055 8.618   -13.102 1.00 0.00 ? 48  GLN B HE21 3  
ATOM   7982  H  HE22 . GLN B 1 48 ? 165.383 9.849   -14.059 1.00 0.00 ? 48  GLN B HE22 3  
ATOM   7983  N  N    . LYS B 1 49 ? 165.010 11.890  -7.462  1.00 0.00 ? 49  LYS B N    3  
ATOM   7984  C  CA   . LYS B 1 49 ? 164.858 12.943  -6.465  1.00 0.00 ? 49  LYS B CA   3  
ATOM   7985  C  C    . LYS B 1 49 ? 163.439 12.936  -5.918  1.00 0.00 ? 49  LYS B C    3  
ATOM   7986  O  O    . LYS B 1 49 ? 163.194 13.340  -4.781  1.00 0.00 ? 49  LYS B O    3  
ATOM   7987  C  CB   . LYS B 1 49 ? 165.175 14.307  -7.084  1.00 0.00 ? 49  LYS B CB   3  
ATOM   7988  C  CG   . LYS B 1 49 ? 164.090 14.684  -8.095  1.00 0.00 ? 49  LYS B CG   3  
ATOM   7989  C  CD   . LYS B 1 49 ? 164.485 15.985  -8.800  1.00 0.00 ? 49  LYS B CD   3  
ATOM   7990  C  CE   . LYS B 1 49 ? 163.282 16.541  -9.566  1.00 0.00 ? 49  LYS B CE   3  
ATOM   7991  N  NZ   . LYS B 1 49 ? 162.472 17.399  -8.657  1.00 0.00 ? 49  LYS B NZ   3  
ATOM   7992  H  H    . LYS B 1 49 ? 165.268 12.130  -8.374  1.00 0.00 ? 49  LYS B H    3  
ATOM   7993  H  HA   . LYS B 1 49 ? 165.547 12.759  -5.654  1.00 0.00 ? 49  LYS B HA   3  
ATOM   7994  H  HB2  . LYS B 1 49 ? 165.216 15.053  -6.305  1.00 0.00 ? 49  LYS B HB2  3  
ATOM   7995  H  HB3  . LYS B 1 49 ? 166.130 14.259  -7.586  1.00 0.00 ? 49  LYS B HB3  3  
ATOM   7996  H  HG2  . LYS B 1 49 ? 163.986 13.895  -8.824  1.00 0.00 ? 49  LYS B HG2  3  
ATOM   7997  H  HG3  . LYS B 1 49 ? 163.151 14.828  -7.582  1.00 0.00 ? 49  LYS B HG3  3  
ATOM   7998  H  HD2  . LYS B 1 49 ? 164.809 16.707  -8.064  1.00 0.00 ? 49  LYS B HD2  3  
ATOM   7999  H  HD3  . LYS B 1 49 ? 165.290 15.788  -9.492  1.00 0.00 ? 49  LYS B HD3  3  
ATOM   8000  H  HE2  . LYS B 1 49 ? 163.630 17.129  -10.402 1.00 0.00 ? 49  LYS B HE2  3  
ATOM   8001  H  HE3  . LYS B 1 49 ? 162.674 15.724  -9.928  1.00 0.00 ? 49  LYS B HE3  3  
ATOM   8002  H  HZ1  . LYS B 1 49 ? 161.704 16.835  -8.240  1.00 0.00 ? 49  LYS B HZ1  3  
ATOM   8003  H  HZ2  . LYS B 1 49 ? 162.067 18.191  -9.198  1.00 0.00 ? 49  LYS B HZ2  3  
ATOM   8004  H  HZ3  . LYS B 1 49 ? 163.077 17.769  -7.898  1.00 0.00 ? 49  LYS B HZ3  3  
ATOM   8005  N  N    . ASP B 1 50 ? 162.513 12.456  -6.734  1.00 0.00 ? 50  ASP B N    3  
ATOM   8006  C  CA   . ASP B 1 50 ? 161.119 12.376  -6.334  1.00 0.00 ? 50  ASP B CA   3  
ATOM   8007  C  C    . ASP B 1 50 ? 160.997 11.597  -5.030  1.00 0.00 ? 50  ASP B C    3  
ATOM   8008  O  O    . ASP B 1 50 ? 160.122 11.877  -4.211  1.00 0.00 ? 50  ASP B O    3  
ATOM   8009  C  CB   . ASP B 1 50 ? 160.286 11.701  -7.426  1.00 0.00 ? 50  ASP B CB   3  
ATOM   8010  C  CG   . ASP B 1 50 ? 160.223 12.595  -8.659  1.00 0.00 ? 50  ASP B CG   3  
ATOM   8011  O  OD1  . ASP B 1 50 ? 160.607 13.748  -8.551  1.00 0.00 ? 50  ASP B OD1  3  
ATOM   8012  O  OD2  . ASP B 1 50 ? 159.792 12.114  -9.695  1.00 0.00 ? 50  ASP B OD2  3  
ATOM   8013  H  H    . ASP B 1 50 ? 162.775 12.140  -7.624  1.00 0.00 ? 50  ASP B H    3  
ATOM   8014  H  HA   . ASP B 1 50 ? 160.743 13.376  -6.178  1.00 0.00 ? 50  ASP B HA   3  
ATOM   8015  H  HB2  . ASP B 1 50 ? 160.736 10.757  -7.691  1.00 0.00 ? 50  ASP B HB2  3  
ATOM   8016  H  HB3  . ASP B 1 50 ? 159.285 11.529  -7.059  1.00 0.00 ? 50  ASP B HB3  3  
ATOM   8017  N  N    . VAL B 1 51 ? 161.875 10.611  -4.840  1.00 0.00 ? 51  VAL B N    3  
ATOM   8018  C  CA   . VAL B 1 51 ? 161.834 9.805   -3.624  1.00 0.00 ? 51  VAL B CA   3  
ATOM   8019  C  C    . VAL B 1 51 ? 161.861 10.700  -2.389  1.00 0.00 ? 51  VAL B C    3  
ATOM   8020  O  O    . VAL B 1 51 ? 161.288 10.360  -1.355  1.00 0.00 ? 51  VAL B O    3  
ATOM   8021  C  CB   . VAL B 1 51 ? 163.023 8.841   -3.584  1.00 0.00 ? 51  VAL B CB   3  
ATOM   8022  C  CG1  . VAL B 1 51 ? 164.298 9.617   -3.246  1.00 0.00 ? 51  VAL B CG1  3  
ATOM   8023  C  CG2  . VAL B 1 51 ? 162.777 7.778   -2.508  1.00 0.00 ? 51  VAL B CG2  3  
ATOM   8024  H  H    . VAL B 1 51 ? 162.561 10.425  -5.525  1.00 0.00 ? 51  VAL B H    3  
ATOM   8025  H  HA   . VAL B 1 51 ? 160.920 9.229   -3.619  1.00 0.00 ? 51  VAL B HA   3  
ATOM   8026  H  HB   . VAL B 1 51 ? 163.135 8.365   -4.547  1.00 0.00 ? 51  VAL B HB   3  
ATOM   8027  H  HG11 . VAL B 1 51 ? 164.352 9.774   -2.179  1.00 0.00 ? 51  VAL B HG11 3  
ATOM   8028  H  HG12 . VAL B 1 51 ? 164.283 10.571  -3.751  1.00 0.00 ? 51  VAL B HG12 3  
ATOM   8029  H  HG13 . VAL B 1 51 ? 165.159 9.051   -3.570  1.00 0.00 ? 51  VAL B HG13 3  
ATOM   8030  H  HG21 . VAL B 1 51 ? 163.613 7.094   -2.479  1.00 0.00 ? 51  VAL B HG21 3  
ATOM   8031  H  HG22 . VAL B 1 51 ? 161.874 7.233   -2.740  1.00 0.00 ? 51  VAL B HG22 3  
ATOM   8032  H  HG23 . VAL B 1 51 ? 162.670 8.257   -1.545  1.00 0.00 ? 51  VAL B HG23 3  
ATOM   8033  N  N    . ASP B 1 52 ? 162.527 11.844  -2.504  1.00 0.00 ? 52  ASP B N    3  
ATOM   8034  C  CA   . ASP B 1 52 ? 162.621 12.784  -1.387  1.00 0.00 ? 52  ASP B CA   3  
ATOM   8035  C  C    . ASP B 1 52 ? 161.230 13.159  -0.876  1.00 0.00 ? 52  ASP B C    3  
ATOM   8036  O  O    . ASP B 1 52 ? 161.029 13.342  0.327   1.00 0.00 ? 52  ASP B O    3  
ATOM   8037  C  CB   . ASP B 1 52 ? 163.358 14.048  -1.830  1.00 0.00 ? 52  ASP B CB   3  
ATOM   8038  C  CG   . ASP B 1 52 ? 164.821 13.726  -2.119  1.00 0.00 ? 52  ASP B CG   3  
ATOM   8039  O  OD1  . ASP B 1 52 ? 165.249 12.640  -1.764  1.00 0.00 ? 52  ASP B OD1  3  
ATOM   8040  O  OD2  . ASP B 1 52 ? 165.490 14.569  -2.693  1.00 0.00 ? 52  ASP B OD2  3  
ATOM   8041  H  H    . ASP B 1 52 ? 162.963 12.063  -3.353  1.00 0.00 ? 52  ASP B H    3  
ATOM   8042  H  HA   . ASP B 1 52 ? 163.177 12.320  -0.585  1.00 0.00 ? 52  ASP B HA   3  
ATOM   8043  H  HB2  . ASP B 1 52 ? 162.894 14.439  -2.723  1.00 0.00 ? 52  ASP B HB2  3  
ATOM   8044  H  HB3  . ASP B 1 52 ? 163.305 14.787  -1.045  1.00 0.00 ? 52  ASP B HB3  3  
ATOM   8045  N  N    . ALA B 1 53 ? 160.274 13.262  -1.793  1.00 0.00 ? 53  ALA B N    3  
ATOM   8046  C  CA   . ALA B 1 53 ? 158.908 13.616  -1.422  1.00 0.00 ? 53  ALA B CA   3  
ATOM   8047  C  C    . ALA B 1 53 ? 158.379 12.629  -0.397  1.00 0.00 ? 53  ALA B C    3  
ATOM   8048  O  O    . ALA B 1 53 ? 157.504 12.958  0.418   1.00 0.00 ? 53  ALA B O    3  
ATOM   8049  C  CB   . ALA B 1 53 ? 157.998 13.602  -2.652  1.00 0.00 ? 53  ALA B CB   3  
ATOM   8050  H  H    . ALA B 1 53 ? 160.490 13.100  -2.735  1.00 0.00 ? 53  ALA B H    3  
ATOM   8051  H  HA   . ALA B 1 53 ? 158.903 14.607  -0.993  1.00 0.00 ? 53  ALA B HA   3  
ATOM   8052  H  HB1  . ALA B 1 53 ? 156.964 13.586  -2.333  1.00 0.00 ? 53  ALA B HB1  3  
ATOM   8053  H  HB2  . ALA B 1 53 ? 158.206 12.723  -3.243  1.00 0.00 ? 53  ALA B HB2  3  
ATOM   8054  H  HB3  . ALA B 1 53 ? 158.178 14.487  -3.244  1.00 0.00 ? 53  ALA B HB3  3  
ATOM   8055  N  N    . VAL B 1 54 ? 158.907 11.411  -0.437  1.00 0.00 ? 54  VAL B N    3  
ATOM   8056  C  CA   . VAL B 1 54 ? 158.463 10.402  0.498   1.00 0.00 ? 54  VAL B CA   3  
ATOM   8057  C  C    . VAL B 1 54 ? 158.553 10.966  1.911   1.00 0.00 ? 54  VAL B C    3  
ATOM   8058  O  O    . VAL B 1 54 ? 157.689 10.714  2.744   1.00 0.00 ? 54  VAL B O    3  
ATOM   8059  C  CB   . VAL B 1 54 ? 159.329 9.144   0.380   1.00 0.00 ? 54  VAL B CB   3  
ATOM   8060  C  CG1  . VAL B 1 54 ? 160.685 9.372   1.054   1.00 0.00 ? 54  VAL B CG1  3  
ATOM   8061  C  CG2  . VAL B 1 54 ? 158.616 7.972   1.060   1.00 0.00 ? 54  VAL B CG2  3  
ATOM   8062  H  H    . VAL B 1 54 ? 159.594 11.195  -1.102  1.00 0.00 ? 54  VAL B H    3  
ATOM   8063  H  HA   . VAL B 1 54 ? 157.440 10.146  0.278   1.00 0.00 ? 54  VAL B HA   3  
ATOM   8064  H  HB   . VAL B 1 54 ? 159.484 8.913   -0.665  1.00 0.00 ? 54  VAL B HB   3  
ATOM   8065  H  HG11 . VAL B 1 54 ? 160.599 9.176   2.112   1.00 0.00 ? 54  VAL B HG11 3  
ATOM   8066  H  HG12 . VAL B 1 54 ? 160.999 10.393  0.902   1.00 0.00 ? 54  VAL B HG12 3  
ATOM   8067  H  HG13 . VAL B 1 54 ? 161.417 8.705   0.623   1.00 0.00 ? 54  VAL B HG13 3  
ATOM   8068  H  HG21 . VAL B 1 54 ? 157.830 7.607   0.416   1.00 0.00 ? 54  VAL B HG21 3  
ATOM   8069  H  HG22 . VAL B 1 54 ? 158.190 8.305   1.995   1.00 0.00 ? 54  VAL B HG22 3  
ATOM   8070  H  HG23 . VAL B 1 54 ? 159.325 7.180   1.249   1.00 0.00 ? 54  VAL B HG23 3  
ATOM   8071  N  N    . ASP B 1 55 ? 159.590 11.753  2.178   1.00 0.00 ? 55  ASP B N    3  
ATOM   8072  C  CA   . ASP B 1 55 ? 159.722 12.359  3.493   1.00 0.00 ? 55  ASP B CA   3  
ATOM   8073  C  C    . ASP B 1 55 ? 158.581 13.347  3.745   1.00 0.00 ? 55  ASP B C    3  
ATOM   8074  O  O    . ASP B 1 55 ? 158.031 13.417  4.845   1.00 0.00 ? 55  ASP B O    3  
ATOM   8075  C  CB   . ASP B 1 55 ? 161.062 13.090  3.595   1.00 0.00 ? 55  ASP B CB   3  
ATOM   8076  C  CG   . ASP B 1 55 ? 162.209 12.087  3.530   1.00 0.00 ? 55  ASP B CG   3  
ATOM   8077  O  OD1  . ASP B 1 55 ? 161.942 10.904  3.654   1.00 0.00 ? 55  ASP B OD1  3  
ATOM   8078  O  OD2  . ASP B 1 55 ? 163.337 12.519  3.356   1.00 0.00 ? 55  ASP B OD2  3  
ATOM   8079  H  H    . ASP B 1 55 ? 160.250 11.952  1.477   1.00 0.00 ? 55  ASP B H    3  
ATOM   8080  H  HA   . ASP B 1 55 ? 159.690 11.584  4.243   1.00 0.00 ? 55  ASP B HA   3  
ATOM   8081  H  HB2  . ASP B 1 55 ? 161.152 13.791  2.778   1.00 0.00 ? 55  ASP B HB2  3  
ATOM   8082  H  HB3  . ASP B 1 55 ? 161.108 13.626  4.532   1.00 0.00 ? 55  ASP B HB3  3  
ATOM   8083  N  N    . LYS B 1 56 ? 158.253 14.122  2.709   1.00 0.00 ? 56  LYS B N    3  
ATOM   8084  C  CA   . LYS B 1 56 ? 157.199 15.135  2.799   1.00 0.00 ? 56  LYS B CA   3  
ATOM   8085  C  C    . LYS B 1 56 ? 155.815 14.551  3.083   1.00 0.00 ? 56  LYS B C    3  
ATOM   8086  O  O    . LYS B 1 56 ? 155.035 15.141  3.831   1.00 0.00 ? 56  LYS B O    3  
ATOM   8087  C  CB   . LYS B 1 56 ? 157.144 15.934  1.496   1.00 0.00 ? 56  LYS B CB   3  
ATOM   8088  C  CG   . LYS B 1 56 ? 158.450 16.711  1.317   1.00 0.00 ? 56  LYS B CG   3  
ATOM   8089  C  CD   . LYS B 1 56 ? 158.346 17.599  0.077   1.00 0.00 ? 56  LYS B CD   3  
ATOM   8090  C  CE   . LYS B 1 56 ? 159.688 18.290  -0.172  1.00 0.00 ? 56  LYS B CE   3  
ATOM   8091  N  NZ   . LYS B 1 56 ? 159.506 19.378  -1.174  1.00 0.00 ? 56  LYS B NZ   3  
ATOM   8092  H  H    . LYS B 1 56 ? 158.745 14.023  1.867   1.00 0.00 ? 56  LYS B H    3  
ATOM   8093  H  HA   . LYS B 1 56 ? 157.450 15.816  3.597   1.00 0.00 ? 56  LYS B HA   3  
ATOM   8094  H  HB2  . LYS B 1 56 ? 157.009 15.258  0.665   1.00 0.00 ? 56  LYS B HB2  3  
ATOM   8095  H  HB3  . LYS B 1 56 ? 156.318 16.627  1.534   1.00 0.00 ? 56  LYS B HB3  3  
ATOM   8096  H  HG2  . LYS B 1 56 ? 158.625 17.325  2.189   1.00 0.00 ? 56  LYS B HG2  3  
ATOM   8097  H  HG3  . LYS B 1 56 ? 159.268 16.017  1.193   1.00 0.00 ? 56  LYS B HG3  3  
ATOM   8098  H  HD2  . LYS B 1 56 ? 158.088 16.992  -0.779  1.00 0.00 ? 56  LYS B HD2  3  
ATOM   8099  H  HD3  . LYS B 1 56 ? 157.582 18.346  0.232   1.00 0.00 ? 56  LYS B HD3  3  
ATOM   8100  H  HE2  . LYS B 1 56 ? 160.054 18.709  0.754   1.00 0.00 ? 56  LYS B HE2  3  
ATOM   8101  H  HE3  . LYS B 1 56 ? 160.399 17.569  -0.548  1.00 0.00 ? 56  LYS B HE3  3  
ATOM   8102  H  HZ1  . LYS B 1 56 ? 159.861 19.062  -2.098  1.00 0.00 ? 56  LYS B HZ1  3  
ATOM   8103  H  HZ2  . LYS B 1 56 ? 160.035 20.221  -0.868  1.00 0.00 ? 56  LYS B HZ2  3  
ATOM   8104  H  HZ3  . LYS B 1 56 ? 158.497 19.612  -1.254  1.00 0.00 ? 56  LYS B HZ3  3  
ATOM   8105  N  N    . VAL B 1 57 ? 155.493 13.417  2.467   1.00 0.00 ? 57  VAL B N    3  
ATOM   8106  C  CA   . VAL B 1 57 ? 154.167 12.823  2.666   1.00 0.00 ? 57  VAL B CA   3  
ATOM   8107  C  C    . VAL B 1 57 ? 154.005 12.244  4.071   1.00 0.00 ? 57  VAL B C    3  
ATOM   8108  O  O    . VAL B 1 57 ? 152.900 12.228  4.612   1.00 0.00 ? 57  VAL B O    3  
ATOM   8109  C  CB   . VAL B 1 57 ? 153.876 11.754  1.606   1.00 0.00 ? 57  VAL B CB   3  
ATOM   8110  C  CG1  . VAL B 1 57 ? 154.087 12.351  0.213   1.00 0.00 ? 57  VAL B CG1  3  
ATOM   8111  C  CG2  . VAL B 1 57 ? 154.810 10.563  1.789   1.00 0.00 ? 57  VAL B CG2  3  
ATOM   8112  H  H    . VAL B 1 57 ? 156.140 12.991  1.852   1.00 0.00 ? 57  VAL B H    3  
ATOM   8113  H  HA   . VAL B 1 57 ? 153.432 13.610  2.552   1.00 0.00 ? 57  VAL B HA   3  
ATOM   8114  H  HB   . VAL B 1 57 ? 152.853 11.429  1.698   1.00 0.00 ? 57  VAL B HB   3  
ATOM   8115  H  HG11 . VAL B 1 57 ? 154.990 12.944  0.208   1.00 0.00 ? 57  VAL B HG11 3  
ATOM   8116  H  HG12 . VAL B 1 57 ? 153.244 12.975  -0.042  1.00 0.00 ? 57  VAL B HG12 3  
ATOM   8117  H  HG13 . VAL B 1 57 ? 154.176 11.553  -0.510  1.00 0.00 ? 57  VAL B HG13 3  
ATOM   8118  H  HG21 . VAL B 1 57 ? 154.731 10.187  2.798   1.00 0.00 ? 57  VAL B HG21 3  
ATOM   8119  H  HG22 . VAL B 1 57 ? 155.816 10.879  1.600   1.00 0.00 ? 57  VAL B HG22 3  
ATOM   8120  H  HG23 . VAL B 1 57 ? 154.540 9.784   1.092   1.00 0.00 ? 57  VAL B HG23 3  
ATOM   8121  N  N    . MET B 1 58 ? 155.095 11.765  4.664   1.00 0.00 ? 58  MET B N    3  
ATOM   8122  C  CA   . MET B 1 58 ? 155.015 11.189  6.006   1.00 0.00 ? 58  MET B CA   3  
ATOM   8123  C  C    . MET B 1 58 ? 154.431 12.183  7.000   1.00 0.00 ? 58  MET B C    3  
ATOM   8124  O  O    . MET B 1 58 ? 153.652 11.805  7.877   1.00 0.00 ? 58  MET B O    3  
ATOM   8125  C  CB   . MET B 1 58 ? 156.418 10.797  6.475   1.00 0.00 ? 58  MET B CB   3  
ATOM   8126  C  CG   . MET B 1 58 ? 156.921 9.596   5.673   1.00 0.00 ? 58  MET B CG   3  
ATOM   8127  S  SD   . MET B 1 58 ? 155.927 8.139   6.066   1.00 0.00 ? 58  MET B SD   3  
ATOM   8128  C  CE   . MET B 1 58 ? 156.467 7.964   7.789   1.00 0.00 ? 58  MET B CE   3  
ATOM   8129  H  H    . MET B 1 58 ? 155.956 11.796  4.198   1.00 0.00 ? 58  MET B H    3  
ATOM   8130  H  HA   . MET B 1 58 ? 154.396 10.307  5.979   1.00 0.00 ? 58  MET B HA   3  
ATOM   8131  H  HB2  . MET B 1 58 ? 157.088 11.632  6.329   1.00 0.00 ? 58  MET B HB2  3  
ATOM   8132  H  HB3  . MET B 1 58 ? 156.385 10.545  7.522   1.00 0.00 ? 58  MET B HB3  3  
ATOM   8133  H  HG2  . MET B 1 58 ? 156.833 9.807   4.623   1.00 0.00 ? 58  MET B HG2  3  
ATOM   8134  H  HG3  . MET B 1 58 ? 157.953 9.406   5.918   1.00 0.00 ? 58  MET B HG3  3  
ATOM   8135  H  HE1  . MET B 1 58 ? 156.715 6.931   7.979   1.00 0.00 ? 58  MET B HE1  3  
ATOM   8136  H  HE2  . MET B 1 58 ? 155.676 8.271   8.453   1.00 0.00 ? 58  MET B HE2  3  
ATOM   8137  H  HE3  . MET B 1 58 ? 157.340 8.579   7.962   1.00 0.00 ? 58  MET B HE3  3  
ATOM   8138  N  N    . LYS B 1 59 ? 154.797 13.450  6.866   1.00 0.00 ? 59  LYS B N    3  
ATOM   8139  C  CA   . LYS B 1 59 ? 154.277 14.459  7.774   1.00 0.00 ? 59  LYS B CA   3  
ATOM   8140  C  C    . LYS B 1 59 ? 152.758 14.550  7.668   1.00 0.00 ? 59  LYS B C    3  
ATOM   8141  O  O    . LYS B 1 59 ? 152.059 14.626  8.679   1.00 0.00 ? 59  LYS B O    3  
ATOM   8142  C  CB   . LYS B 1 59 ? 154.895 15.818  7.446   1.00 0.00 ? 59  LYS B CB   3  
ATOM   8143  C  CG   . LYS B 1 59 ? 154.451 16.847  8.486   1.00 0.00 ? 59  LYS B CG   3  
ATOM   8144  C  CD   . LYS B 1 59 ? 155.019 18.218  8.119   1.00 0.00 ? 59  LYS B CD   3  
ATOM   8145  C  CE   . LYS B 1 59 ? 154.708 19.214  9.237   1.00 0.00 ? 59  LYS B CE   3  
ATOM   8146  N  NZ   . LYS B 1 59 ? 155.138 20.578  8.819   1.00 0.00 ? 59  LYS B NZ   3  
ATOM   8147  H  H    . LYS B 1 59 ? 155.415 13.707  6.150   1.00 0.00 ? 59  LYS B H    3  
ATOM   8148  H  HA   . LYS B 1 59 ? 154.543 14.190  8.785   1.00 0.00 ? 59  LYS B HA   3  
ATOM   8149  H  HB2  . LYS B 1 59 ? 155.972 15.735  7.458   1.00 0.00 ? 59  LYS B HB2  3  
ATOM   8150  H  HB3  . LYS B 1 59 ? 154.568 16.136  6.467   1.00 0.00 ? 59  LYS B HB3  3  
ATOM   8151  H  HG2  . LYS B 1 59 ? 153.372 16.896  8.507   1.00 0.00 ? 59  LYS B HG2  3  
ATOM   8152  H  HG3  . LYS B 1 59 ? 154.817 16.557  9.460   1.00 0.00 ? 59  LYS B HG3  3  
ATOM   8153  H  HD2  . LYS B 1 59 ? 156.090 18.142  7.991   1.00 0.00 ? 59  LYS B HD2  3  
ATOM   8154  H  HD3  . LYS B 1 59 ? 154.569 18.560  7.200   1.00 0.00 ? 59  LYS B HD3  3  
ATOM   8155  H  HE2  . LYS B 1 59 ? 153.647 19.215  9.433   1.00 0.00 ? 59  LYS B HE2  3  
ATOM   8156  H  HE3  . LYS B 1 59 ? 155.240 18.928  10.133  1.00 0.00 ? 59  LYS B HE3  3  
ATOM   8157  H  HZ1  . LYS B 1 59 ? 154.301 21.179  8.681   1.00 0.00 ? 59  LYS B HZ1  3  
ATOM   8158  H  HZ2  . LYS B 1 59 ? 155.673 20.516  7.928   1.00 0.00 ? 59  LYS B HZ2  3  
ATOM   8159  H  HZ3  . LYS B 1 59 ? 155.741 20.994  9.557   1.00 0.00 ? 59  LYS B HZ3  3  
ATOM   8160  N  N    . GLU B 1 60 ? 152.256 14.551  6.435   1.00 0.00 ? 60  GLU B N    3  
ATOM   8161  C  CA   . GLU B 1 60 ? 150.817 14.643  6.208   1.00 0.00 ? 60  GLU B CA   3  
ATOM   8162  C  C    . GLU B 1 60 ? 150.074 13.395  6.682   1.00 0.00 ? 60  GLU B C    3  
ATOM   8163  O  O    . GLU B 1 60 ? 149.014 13.492  7.298   1.00 0.00 ? 60  GLU B O    3  
ATOM   8164  C  CB   . GLU B 1 60 ? 150.555 14.854  4.715   1.00 0.00 ? 60  GLU B CB   3  
ATOM   8165  C  CG   . GLU B 1 60 ? 149.063 15.090  4.480   1.00 0.00 ? 60  GLU B CG   3  
ATOM   8166  C  CD   . GLU B 1 60 ? 148.783 15.203  2.986   1.00 0.00 ? 60  GLU B CD   3  
ATOM   8167  O  OE1  . GLU B 1 60 ? 149.721 15.071  2.216   1.00 0.00 ? 60  GLU B OE1  3  
ATOM   8168  O  OE2  . GLU B 1 60 ? 147.637 15.421  2.632   1.00 0.00 ? 60  GLU B OE2  3  
ATOM   8169  H  H    . GLU B 1 60 ? 152.862 14.493  5.667   1.00 0.00 ? 60  GLU B H    3  
ATOM   8170  H  HA   . GLU B 1 60 ? 150.436 15.498  6.746   1.00 0.00 ? 60  GLU B HA   3  
ATOM   8171  H  HB2  . GLU B 1 60 ? 151.113 15.713  4.371   1.00 0.00 ? 60  GLU B HB2  3  
ATOM   8172  H  HB3  . GLU B 1 60 ? 150.870 13.979  4.168   1.00 0.00 ? 60  GLU B HB3  3  
ATOM   8173  H  HG2  . GLU B 1 60 ? 148.502 14.262  4.887   1.00 0.00 ? 60  GLU B HG2  3  
ATOM   8174  H  HG3  . GLU B 1 60 ? 148.763 16.003  4.971   1.00 0.00 ? 60  GLU B HG3  3  
ATOM   8175  N  N    . LEU B 1 61 ? 150.630 12.222  6.384   1.00 0.00 ? 61  LEU B N    3  
ATOM   8176  C  CA   . LEU B 1 61 ? 149.995 10.967  6.779   1.00 0.00 ? 61  LEU B CA   3  
ATOM   8177  C  C    . LEU B 1 61 ? 149.987 10.778  8.288   1.00 0.00 ? 61  LEU B C    3  
ATOM   8178  O  O    . LEU B 1 61 ? 149.030 10.238  8.843   1.00 0.00 ? 61  LEU B O    3  
ATOM   8179  C  CB   . LEU B 1 61 ? 150.706 9.783   6.120   1.00 0.00 ? 61  LEU B CB   3  
ATOM   8180  C  CG   . LEU B 1 61 ? 150.635 9.914   4.595   1.00 0.00 ? 61  LEU B CG   3  
ATOM   8181  C  CD1  . LEU B 1 61 ? 151.302 8.699   3.955   1.00 0.00 ? 61  LEU B CD1  3  
ATOM   8182  C  CD2  . LEU B 1 61 ? 149.171 9.981   4.144   1.00 0.00 ? 61  LEU B CD2  3  
ATOM   8183  H  H    . LEU B 1 61 ? 151.473 12.200  5.884   1.00 0.00 ? 61  LEU B H    3  
ATOM   8184  H  HA   . LEU B 1 61 ? 148.973 10.983  6.439   1.00 0.00 ? 61  LEU B HA   3  
ATOM   8185  H  HB2  . LEU B 1 61 ? 151.741 9.768   6.431   1.00 0.00 ? 61  LEU B HB2  3  
ATOM   8186  H  HB3  . LEU B 1 61 ? 150.227 8.864   6.421   1.00 0.00 ? 61  LEU B HB3  3  
ATOM   8187  H  HG   . LEU B 1 61 ? 151.149 10.808  4.287   1.00 0.00 ? 61  LEU B HG   3  
ATOM   8188  H  HD11 . LEU B 1 61 ? 152.374 8.827   3.969   1.00 0.00 ? 61  LEU B HD11 3  
ATOM   8189  H  HD12 . LEU B 1 61 ? 150.964 8.600   2.934   1.00 0.00 ? 61  LEU B HD12 3  
ATOM   8190  H  HD13 . LEU B 1 61 ? 151.038 7.811   4.509   1.00 0.00 ? 61  LEU B HD13 3  
ATOM   8191  H  HD21 . LEU B 1 61 ? 148.561 9.390   4.811   1.00 0.00 ? 61  LEU B HD21 3  
ATOM   8192  H  HD22 . LEU B 1 61 ? 149.083 9.595   3.139   1.00 0.00 ? 61  LEU B HD22 3  
ATOM   8193  H  HD23 . LEU B 1 61 ? 148.836 11.008  4.163   1.00 0.00 ? 61  LEU B HD23 3  
ATOM   8194  N  N    . ASP B 1 62 ? 151.054 11.204  8.954   1.00 0.00 ? 62  ASP B N    3  
ATOM   8195  C  CA   . ASP B 1 62 ? 151.120 11.037  10.397  1.00 0.00 ? 62  ASP B CA   3  
ATOM   8196  C  C    . ASP B 1 62 ? 150.437 12.190  11.116  1.00 0.00 ? 62  ASP B C    3  
ATOM   8197  O  O    . ASP B 1 62 ? 151.004 13.276  11.242  1.00 0.00 ? 62  ASP B O    3  
ATOM   8198  C  CB   . ASP B 1 62 ? 152.583 10.975  10.832  1.00 0.00 ? 62  ASP B CB   3  
ATOM   8199  C  CG   . ASP B 1 62 ? 152.675 10.673  12.323  1.00 0.00 ? 62  ASP B CG   3  
ATOM   8200  O  OD1  . ASP B 1 62 ? 151.700 10.186  12.872  1.00 0.00 ? 62  ASP B OD1  3  
ATOM   8201  O  OD2  . ASP B 1 62 ? 153.724 10.924  12.888  1.00 0.00 ? 62  ASP B OD2  3  
ATOM   8202  H  H    . ASP B 1 62 ? 151.801 11.617  8.472   1.00 0.00 ? 62  ASP B H    3  
ATOM   8203  H  HA   . ASP B 1 62 ? 150.636 10.113  10.670  1.00 0.00 ? 62  ASP B HA   3  
ATOM   8204  H  HB2  . ASP B 1 62 ? 153.088 10.196  10.278  1.00 0.00 ? 62  ASP B HB2  3  
ATOM   8205  H  HB3  . ASP B 1 62 ? 153.057 11.923  10.630  1.00 0.00 ? 62  ASP B HB3  3  
ATOM   8206  N  N    . GLU B 1 63 ? 149.239 11.941  11.626  1.00 0.00 ? 63  GLU B N    3  
ATOM   8207  C  CA   . GLU B 1 63 ? 148.527 12.964  12.372  1.00 0.00 ? 63  GLU B CA   3  
ATOM   8208  C  C    . GLU B 1 63 ? 149.254 13.238  13.682  1.00 0.00 ? 63  GLU B C    3  
ATOM   8209  O  O    . GLU B 1 63 ? 149.287 14.368  14.174  1.00 0.00 ? 63  GLU B O    3  
ATOM   8210  C  CB   . GLU B 1 63 ? 147.095 12.508  12.659  1.00 0.00 ? 63  GLU B CB   3  
ATOM   8211  C  CG   . GLU B 1 63 ? 146.332 12.368  11.341  1.00 0.00 ? 63  GLU B CG   3  
ATOM   8212  C  CD   . GLU B 1 63 ? 144.883 11.979  11.615  1.00 0.00 ? 63  GLU B CD   3  
ATOM   8213  O  OE1  . GLU B 1 63 ? 144.579 11.669  12.755  1.00 0.00 ? 63  GLU B OE1  3  
ATOM   8214  O  OE2  . GLU B 1 63 ? 144.099 11.994  10.680  1.00 0.00 ? 63  GLU B OE2  3  
ATOM   8215  H  H    . GLU B 1 63 ? 148.844 11.049  11.525  1.00 0.00 ? 63  GLU B H    3  
ATOM   8216  H  HA   . GLU B 1 63 ? 148.497 13.872  11.787  1.00 0.00 ? 63  GLU B HA   3  
ATOM   8217  H  HB2  . GLU B 1 63 ? 147.116 11.554  13.167  1.00 0.00 ? 63  GLU B HB2  3  
ATOM   8218  H  HB3  . GLU B 1 63 ? 146.602 13.238  13.283  1.00 0.00 ? 63  GLU B HB3  3  
ATOM   8219  H  HG2  . GLU B 1 63 ? 146.355 13.311  10.812  1.00 0.00 ? 63  GLU B HG2  3  
ATOM   8220  H  HG3  . GLU B 1 63 ? 146.798 11.606  10.736  1.00 0.00 ? 63  GLU B HG3  3  
ATOM   8221  N  N    . ASN B 1 64 ? 149.819 12.173  14.247  1.00 0.00 ? 64  ASN B N    3  
ATOM   8222  C  CA   . ASN B 1 64 ? 150.535 12.260  15.514  1.00 0.00 ? 64  ASN B CA   3  
ATOM   8223  C  C    . ASN B 1 64 ? 151.701 13.235  15.433  1.00 0.00 ? 64  ASN B C    3  
ATOM   8224  O  O    . ASN B 1 64 ? 152.003 13.945  16.393  1.00 0.00 ? 64  ASN B O    3  
ATOM   8225  C  CB   . ASN B 1 64 ? 151.111 10.885  15.862  1.00 0.00 ? 64  ASN B CB   3  
ATOM   8226  C  CG   . ASN B 1 64 ? 150.016 9.827   15.884  1.00 0.00 ? 64  ASN B CG   3  
ATOM   8227  O  OD1  . ASN B 1 64 ? 150.185 8.755   15.296  1.00 0.00 ? 64  ASN B OD1  3  
ATOM   8228  N  ND2  . ASN B 1 64 ? 148.903 10.061  16.524  1.00 0.00 ? 64  ASN B ND2  3  
ATOM   8229  H  H    . ASN B 1 64 ? 149.740 11.302  13.804  1.00 0.00 ? 64  ASN B H    3  
ATOM   8230  H  HA   . ASN B 1 64 ? 149.857 12.566  16.295  1.00 0.00 ? 64  ASN B HA   3  
ATOM   8231  H  HB2  . ASN B 1 64 ? 151.852 10.613  15.124  1.00 0.00 ? 64  ASN B HB2  3  
ATOM   8232  H  HB3  . ASN B 1 64 ? 151.578 10.932  16.834  1.00 0.00 ? 64  ASN B HB3  3  
ATOM   8233  H  HD21 . ASN B 1 64 ? 148.775 10.914  16.989  1.00 0.00 ? 64  ASN B HD21 3  
ATOM   8234  H  HD22 . ASN B 1 64 ? 148.196 9.382   16.541  1.00 0.00 ? 64  ASN B HD22 3  
ATOM   8235  N  N    . GLY B 1 65 ? 152.383 13.224  14.295  1.00 0.00 ? 65  GLY B N    3  
ATOM   8236  C  CA   . GLY B 1 65 ? 153.554 14.068  14.107  1.00 0.00 ? 65  GLY B CA   3  
ATOM   8237  C  C    . GLY B 1 65 ? 154.736 13.381  14.778  1.00 0.00 ? 65  GLY B C    3  
ATOM   8238  O  O    . GLY B 1 65 ? 155.838 13.923  14.864  1.00 0.00 ? 65  GLY B O    3  
ATOM   8239  H  H    . GLY B 1 65 ? 152.114 12.609  13.581  1.00 0.00 ? 65  GLY B H    3  
ATOM   8240  H  HA2  . GLY B 1 65 ? 153.748 14.192  13.050  1.00 0.00 ? 65  GLY B HA2  3  
ATOM   8241  H  HA3  . GLY B 1 65 ? 153.389 15.030  14.566  1.00 0.00 ? 65  GLY B HA3  3  
ATOM   8242  N  N    . ASP B 1 66 ? 154.460 12.173  15.267  1.00 0.00 ? 66  ASP B N    3  
ATOM   8243  C  CA   . ASP B 1 66 ? 155.445 11.356  15.965  1.00 0.00 ? 66  ASP B CA   3  
ATOM   8244  C  C    . ASP B 1 66 ? 156.616 10.951  15.062  1.00 0.00 ? 66  ASP B C    3  
ATOM   8245  O  O    . ASP B 1 66 ? 157.748 10.821  15.527  1.00 0.00 ? 66  ASP B O    3  
ATOM   8246  C  CB   . ASP B 1 66 ? 154.739 10.123  16.556  1.00 0.00 ? 66  ASP B CB   3  
ATOM   8247  C  CG   . ASP B 1 66 ? 154.181 9.219   15.451  1.00 0.00 ? 66  ASP B CG   3  
ATOM   8248  O  OD1  . ASP B 1 66 ? 154.575 9.386   14.315  1.00 0.00 ? 66  ASP B OD1  3  
ATOM   8249  O  OD2  . ASP B 1 66 ? 153.357 8.373   15.760  1.00 0.00 ? 66  ASP B OD2  3  
ATOM   8250  H  H    . ASP B 1 66 ? 153.550 11.824  15.164  1.00 0.00 ? 66  ASP B H    3  
ATOM   8251  H  HA   . ASP B 1 66 ? 155.841 11.936  16.784  1.00 0.00 ? 66  ASP B HA   3  
ATOM   8252  H  HB2  . ASP B 1 66 ? 155.439 9.565   17.156  1.00 0.00 ? 66  ASP B HB2  3  
ATOM   8253  H  HB3  . ASP B 1 66 ? 153.925 10.453  17.184  1.00 0.00 ? 66  ASP B HB3  3  
ATOM   8254  N  N    . GLY B 1 67 ? 156.342 10.749  13.777  1.00 0.00 ? 67  GLY B N    3  
ATOM   8255  C  CA   . GLY B 1 67 ? 157.382 10.353  12.828  1.00 0.00 ? 67  GLY B CA   3  
ATOM   8256  C  C    . GLY B 1 67 ? 157.386 8.839   12.636  1.00 0.00 ? 67  GLY B C    3  
ATOM   8257  O  O    . GLY B 1 67 ? 158.133 8.306   11.814  1.00 0.00 ? 67  GLY B O    3  
ATOM   8258  H  H    . GLY B 1 67 ? 155.421 10.862  13.460  1.00 0.00 ? 67  GLY B H    3  
ATOM   8259  H  HA2  . GLY B 1 67 ? 157.195 10.831  11.877  1.00 0.00 ? 67  GLY B HA2  3  
ATOM   8260  H  HA3  . GLY B 1 67 ? 158.344 10.663  13.198  1.00 0.00 ? 67  GLY B HA3  3  
ATOM   8261  N  N    . GLU B 1 68 ? 156.524 8.159   13.383  1.00 0.00 ? 68  GLU B N    3  
ATOM   8262  C  CA   . GLU B 1 68 ? 156.394 6.709   13.285  1.00 0.00 ? 68  GLU B CA   3  
ATOM   8263  C  C    . GLU B 1 68 ? 155.068 6.370   12.622  1.00 0.00 ? 68  GLU B C    3  
ATOM   8264  O  O    . GLU B 1 68 ? 154.112 7.153   12.689  1.00 0.00 ? 68  GLU B O    3  
ATOM   8265  C  CB   . GLU B 1 68 ? 156.478 6.064   14.670  1.00 0.00 ? 68  GLU B CB   3  
ATOM   8266  C  CG   . GLU B 1 68 ? 157.857 6.339   15.278  1.00 0.00 ? 68  GLU B CG   3  
ATOM   8267  C  CD   . GLU B 1 68 ? 157.881 7.713   15.930  1.00 0.00 ? 68  GLU B CD   3  
ATOM   8268  O  OE1  . GLU B 1 68 ? 156.861 8.375   15.898  1.00 0.00 ? 68  GLU B OE1  3  
ATOM   8269  O  OE2  . GLU B 1 68 ? 158.919 8.082   16.454  1.00 0.00 ? 68  GLU B OE2  3  
ATOM   8270  H  H    . GLU B 1 68 ? 155.946 8.647   14.004  1.00 0.00 ? 68  GLU B H    3  
ATOM   8271  H  HA   . GLU B 1 68 ? 157.197 6.324   12.671  1.00 0.00 ? 68  GLU B HA   3  
ATOM   8272  H  HB2  . GLU B 1 68 ? 155.712 6.480   15.309  1.00 0.00 ? 68  GLU B HB2  3  
ATOM   8273  H  HB3  . GLU B 1 68 ? 156.333 4.999   14.581  1.00 0.00 ? 68  GLU B HB3  3  
ATOM   8274  H  HG2  . GLU B 1 68 ? 158.075 5.586   16.021  1.00 0.00 ? 68  GLU B HG2  3  
ATOM   8275  H  HG3  . GLU B 1 68 ? 158.605 6.300   14.500  1.00 0.00 ? 68  GLU B HG3  3  
ATOM   8276  N  N    . VAL B 1 69 ? 155.016 5.221   11.954  1.00 0.00 ? 69  VAL B N    3  
ATOM   8277  C  CA   . VAL B 1 69 ? 153.803 4.830   11.249  1.00 0.00 ? 69  VAL B CA   3  
ATOM   8278  C  C    . VAL B 1 69 ? 153.079 3.684   11.943  1.00 0.00 ? 69  VAL B C    3  
ATOM   8279  O  O    . VAL B 1 69 ? 153.674 2.668   12.304  1.00 0.00 ? 69  VAL B O    3  
ATOM   8280  C  CB   . VAL B 1 69 ? 154.165 4.414   9.820   1.00 0.00 ? 69  VAL B CB   3  
ATOM   8281  C  CG1  . VAL B 1 69 ? 152.895 4.136   9.010   1.00 0.00 ? 69  VAL B CG1  3  
ATOM   8282  C  CG2  . VAL B 1 69 ? 154.952 5.541   9.152   1.00 0.00 ? 69  VAL B CG2  3  
ATOM   8283  H  H    . VAL B 1 69 ? 155.809 4.647   11.911  1.00 0.00 ? 69  VAL B H    3  
ATOM   8284  H  HA   . VAL B 1 69 ? 153.139 5.674   11.195  1.00 0.00 ? 69  VAL B HA   3  
ATOM   8285  H  HB   . VAL B 1 69 ? 154.773 3.522   9.850   1.00 0.00 ? 69  VAL B HB   3  
ATOM   8286  H  HG11 . VAL B 1 69 ? 153.158 3.627   8.094   1.00 0.00 ? 69  VAL B HG11 3  
ATOM   8287  H  HG12 . VAL B 1 69 ? 152.410 5.071   8.773   1.00 0.00 ? 69  VAL B HG12 3  
ATOM   8288  H  HG13 . VAL B 1 69 ? 152.223 3.518   9.583   1.00 0.00 ? 69  VAL B HG13 3  
ATOM   8289  H  HG21 . VAL B 1 69 ? 154.372 6.454   9.181   1.00 0.00 ? 69  VAL B HG21 3  
ATOM   8290  H  HG22 . VAL B 1 69 ? 155.158 5.279   8.125   1.00 0.00 ? 69  VAL B HG22 3  
ATOM   8291  H  HG23 . VAL B 1 69 ? 155.882 5.690   9.680   1.00 0.00 ? 69  VAL B HG23 3  
ATOM   8292  N  N    . ASP B 1 70 ? 151.772 3.864   12.079  1.00 0.00 ? 70  ASP B N    3  
ATOM   8293  C  CA   . ASP B 1 70 ? 150.900 2.865   12.677  1.00 0.00 ? 70  ASP B CA   3  
ATOM   8294  C  C    . ASP B 1 70 ? 150.210 2.111   11.554  1.00 0.00 ? 70  ASP B C    3  
ATOM   8295  O  O    . ASP B 1 70 ? 150.155 2.606   10.432  1.00 0.00 ? 70  ASP B O    3  
ATOM   8296  C  CB   . ASP B 1 70 ? 149.856 3.534   13.574  1.00 0.00 ? 70  ASP B CB   3  
ATOM   8297  C  CG   . ASP B 1 70 ? 150.538 4.189   14.770  1.00 0.00 ? 70  ASP B CG   3  
ATOM   8298  O  OD1  . ASP B 1 70 ? 151.703 3.900   14.994  1.00 0.00 ? 70  ASP B OD1  3  
ATOM   8299  O  OD2  . ASP B 1 70 ? 149.888 4.970   15.445  1.00 0.00 ? 70  ASP B OD2  3  
ATOM   8300  H  H    . ASP B 1 70 ? 151.373 4.691   11.737  1.00 0.00 ? 70  ASP B H    3  
ATOM   8301  H  HA   . ASP B 1 70 ? 151.490 2.176   13.263  1.00 0.00 ? 70  ASP B HA   3  
ATOM   8302  H  HB2  . ASP B 1 70 ? 149.325 4.286   13.009  1.00 0.00 ? 70  ASP B HB2  3  
ATOM   8303  H  HB3  . ASP B 1 70 ? 149.156 2.790   13.926  1.00 0.00 ? 70  ASP B HB3  3  
ATOM   8304  N  N    . PHE B 1 71 ? 149.697 0.922   11.823  1.00 0.00 ? 71  PHE B N    3  
ATOM   8305  C  CA   . PHE B 1 71 ? 149.047 0.174   10.759  1.00 0.00 ? 71  PHE B CA   3  
ATOM   8306  C  C    . PHE B 1 71 ? 148.005 1.047   10.069  1.00 0.00 ? 71  PHE B C    3  
ATOM   8307  O  O    . PHE B 1 71 ? 147.910 1.053   8.841   1.00 0.00 ? 71  PHE B O    3  
ATOM   8308  C  CB   . PHE B 1 71 ? 148.377 -1.082  11.317  1.00 0.00 ? 71  PHE B CB   3  
ATOM   8309  C  CG   . PHE B 1 71 ? 147.796 -1.882  10.173  1.00 0.00 ? 71  PHE B CG   3  
ATOM   8310  C  CD1  . PHE B 1 71 ? 148.608 -2.759  9.444   1.00 0.00 ? 71  PHE B CD1  3  
ATOM   8311  C  CD2  . PHE B 1 71 ? 146.443 -1.741  9.840   1.00 0.00 ? 71  PHE B CD2  3  
ATOM   8312  C  CE1  . PHE B 1 71 ? 148.066 -3.494  8.381   1.00 0.00 ? 71  PHE B CE1  3  
ATOM   8313  C  CE2  . PHE B 1 71 ? 145.902 -2.477  8.780   1.00 0.00 ? 71  PHE B CE2  3  
ATOM   8314  C  CZ   . PHE B 1 71 ? 146.713 -3.353  8.051   1.00 0.00 ? 71  PHE B CZ   3  
ATOM   8315  H  H    . PHE B 1 71 ? 149.764 0.546   12.725  1.00 0.00 ? 71  PHE B H    3  
ATOM   8316  H  HA   . PHE B 1 71 ? 149.791 -0.119  10.033  1.00 0.00 ? 71  PHE B HA   3  
ATOM   8317  H  HB2  . PHE B 1 71 ? 149.109 -1.679  11.841  1.00 0.00 ? 71  PHE B HB2  3  
ATOM   8318  H  HB3  . PHE B 1 71 ? 147.587 -0.799  11.995  1.00 0.00 ? 71  PHE B HB3  3  
ATOM   8319  H  HD1  . PHE B 1 71 ? 149.652 -2.868  9.699   1.00 0.00 ? 71  PHE B HD1  3  
ATOM   8320  H  HD2  . PHE B 1 71 ? 145.817 -1.065  10.404  1.00 0.00 ? 71  PHE B HD2  3  
ATOM   8321  H  HE1  . PHE B 1 71 ? 148.691 -4.170  7.817   1.00 0.00 ? 71  PHE B HE1  3  
ATOM   8322  H  HE2  . PHE B 1 71 ? 144.859 -2.368  8.524   1.00 0.00 ? 71  PHE B HE2  3  
ATOM   8323  H  HZ   . PHE B 1 71 ? 146.296 -3.920  7.231   1.00 0.00 ? 71  PHE B HZ   3  
ATOM   8324  N  N    . GLN B 1 72 ? 147.238 1.801   10.850  1.00 0.00 ? 72  GLN B N    3  
ATOM   8325  C  CA   . GLN B 1 72 ? 146.235 2.682   10.263  1.00 0.00 ? 72  GLN B CA   3  
ATOM   8326  C  C    . GLN B 1 72 ? 146.890 3.689   9.320   1.00 0.00 ? 72  GLN B C    3  
ATOM   8327  O  O    . GLN B 1 72 ? 146.371 3.970   8.245   1.00 0.00 ? 72  GLN B O    3  
ATOM   8328  C  CB   . GLN B 1 72 ? 145.486 3.433   11.364  1.00 0.00 ? 72  GLN B CB   3  
ATOM   8329  C  CG   . GLN B 1 72 ? 144.338 4.230   10.743  1.00 0.00 ? 72  GLN B CG   3  
ATOM   8330  C  CD   . GLN B 1 72 ? 143.659 5.084   11.810  1.00 0.00 ? 72  GLN B CD   3  
ATOM   8331  O  OE1  . GLN B 1 72 ? 144.304 5.928   12.432  1.00 0.00 ? 72  GLN B OE1  3  
ATOM   8332  N  NE2  . GLN B 1 72 ? 142.389 4.915   12.059  1.00 0.00 ? 72  GLN B NE2  3  
ATOM   8333  H  H    . GLN B 1 72 ? 147.359 1.778   11.822  1.00 0.00 ? 72  GLN B H    3  
ATOM   8334  H  HA   . GLN B 1 72 ? 145.526 2.087   9.704   1.00 0.00 ? 72  GLN B HA   3  
ATOM   8335  H  HB2  . GLN B 1 72 ? 145.091 2.724   12.079  1.00 0.00 ? 72  GLN B HB2  3  
ATOM   8336  H  HB3  . GLN B 1 72 ? 146.163 4.109   11.864  1.00 0.00 ? 72  GLN B HB3  3  
ATOM   8337  H  HG2  . GLN B 1 72 ? 144.729 4.872   9.968   1.00 0.00 ? 72  GLN B HG2  3  
ATOM   8338  H  HG3  . GLN B 1 72 ? 143.618 3.549   10.315  1.00 0.00 ? 72  GLN B HG3  3  
ATOM   8339  H  HE21 . GLN B 1 72 ? 141.877 4.244   11.562  1.00 0.00 ? 72  GLN B HE21 3  
ATOM   8340  H  HE22 . GLN B 1 72 ? 141.948 5.461   12.743  1.00 0.00 ? 72  GLN B HE22 3  
ATOM   8341  N  N    . GLU B 1 73 ? 148.037 4.236   9.723   1.00 0.00 ? 73  GLU B N    3  
ATOM   8342  C  CA   . GLU B 1 73 ? 148.730 5.199   8.873   1.00 0.00 ? 73  GLU B CA   3  
ATOM   8343  C  C    . GLU B 1 73 ? 149.297 4.515   7.620   1.00 0.00 ? 73  GLU B C    3  
ATOM   8344  O  O    . GLU B 1 73 ? 149.284 5.077   6.520   1.00 0.00 ? 73  GLU B O    3  
ATOM   8345  C  CB   . GLU B 1 73 ? 149.867 5.865   9.663   1.00 0.00 ? 73  GLU B CB   3  
ATOM   8346  C  CG   . GLU B 1 73 ? 149.283 6.677   10.829  1.00 0.00 ? 73  GLU B CG   3  
ATOM   8347  C  CD   . GLU B 1 73 ? 150.399 7.418   11.570  1.00 0.00 ? 73  GLU B CD   3  
ATOM   8348  O  OE1  . GLU B 1 73 ? 151.545 7.228   11.213  1.00 0.00 ? 73  GLU B OE1  3  
ATOM   8349  O  OE2  . GLU B 1 73 ? 150.091 8.154   12.494  1.00 0.00 ? 73  GLU B OE2  3  
ATOM   8350  H  H    . GLU B 1 73 ? 148.419 3.984   10.589  1.00 0.00 ? 73  GLU B H    3  
ATOM   8351  H  HA   . GLU B 1 73 ? 148.030 5.962   8.571   1.00 0.00 ? 73  GLU B HA   3  
ATOM   8352  H  HB2  . GLU B 1 73 ? 150.527 5.103   10.051  1.00 0.00 ? 73  GLU B HB2  3  
ATOM   8353  H  HB3  . GLU B 1 73 ? 150.421 6.523   9.010   1.00 0.00 ? 73  GLU B HB3  3  
ATOM   8354  H  HG2  . GLU B 1 73 ? 148.572 7.393   10.444  1.00 0.00 ? 73  GLU B HG2  3  
ATOM   8355  H  HG3  . GLU B 1 73 ? 148.783 6.009   11.513  1.00 0.00 ? 73  GLU B HG3  3  
ATOM   8356  N  N    . TYR B 1 74 ? 149.812 3.300   7.808   1.00 0.00 ? 74  TYR B N    3  
ATOM   8357  C  CA   . TYR B 1 74 ? 150.406 2.534   6.711   1.00 0.00 ? 74  TYR B CA   3  
ATOM   8358  C  C    . TYR B 1 74 ? 149.405 2.163   5.614   1.00 0.00 ? 74  TYR B C    3  
ATOM   8359  O  O    . TYR B 1 74 ? 149.707 2.290   4.419   1.00 0.00 ? 74  TYR B O    3  
ATOM   8360  C  CB   . TYR B 1 74 ? 151.028 1.253   7.272   1.00 0.00 ? 74  TYR B CB   3  
ATOM   8361  C  CG   . TYR B 1 74 ? 151.683 0.477   6.154   1.00 0.00 ? 74  TYR B CG   3  
ATOM   8362  C  CD1  . TYR B 1 74 ? 153.002 0.755   5.777   1.00 0.00 ? 74  TYR B CD1  3  
ATOM   8363  C  CD2  . TYR B 1 74 ? 150.962 -0.525  5.494   1.00 0.00 ? 74  TYR B CD2  3  
ATOM   8364  C  CE1  . TYR B 1 74 ? 153.599 0.029   4.737   1.00 0.00 ? 74  TYR B CE1  3  
ATOM   8365  C  CE2  . TYR B 1 74 ? 151.557 -1.250  4.457   1.00 0.00 ? 74  TYR B CE2  3  
ATOM   8366  C  CZ   . TYR B 1 74 ? 152.877 -0.973  4.078   1.00 0.00 ? 74  TYR B CZ   3  
ATOM   8367  O  OH   . TYR B 1 74 ? 153.464 -1.688  3.055   1.00 0.00 ? 74  TYR B OH   3  
ATOM   8368  H  H    . TYR B 1 74 ? 149.804 2.914   8.708   1.00 0.00 ? 74  TYR B H    3  
ATOM   8369  H  HA   . TYR B 1 74 ? 151.193 3.124   6.270   1.00 0.00 ? 74  TYR B HA   3  
ATOM   8370  H  HB2  . TYR B 1 74 ? 151.772 1.507   8.019   1.00 0.00 ? 74  TYR B HB2  3  
ATOM   8371  H  HB3  . TYR B 1 74 ? 150.257 0.648   7.726   1.00 0.00 ? 74  TYR B HB3  3  
ATOM   8372  H  HD1  . TYR B 1 74 ? 153.558 1.528   6.285   1.00 0.00 ? 74  TYR B HD1  3  
ATOM   8373  H  HD2  . TYR B 1 74 ? 149.945 -0.740  5.786   1.00 0.00 ? 74  TYR B HD2  3  
ATOM   8374  H  HE1  . TYR B 1 74 ? 154.617 0.240   4.444   1.00 0.00 ? 74  TYR B HE1  3  
ATOM   8375  H  HE2  . TYR B 1 74 ? 150.999 -2.022  3.949   1.00 0.00 ? 74  TYR B HE2  3  
ATOM   8376  H  HH   . TYR B 1 74 ? 154.115 -1.122  2.633   1.00 0.00 ? 74  TYR B HH   3  
ATOM   8377  N  N    . VAL B 1 75 ? 148.223 1.680   6.006   1.00 0.00 ? 75  VAL B N    3  
ATOM   8378  C  CA   . VAL B 1 75 ? 147.243 1.275   5.006   1.00 0.00 ? 75  VAL B CA   3  
ATOM   8379  C  C    . VAL B 1 75 ? 146.866 2.450   4.119   1.00 0.00 ? 75  VAL B C    3  
ATOM   8380  O  O    . VAL B 1 75 ? 146.725 2.301   2.906   1.00 0.00 ? 75  VAL B O    3  
ATOM   8381  C  CB   . VAL B 1 75 ? 145.991 0.690   5.666   1.00 0.00 ? 75  VAL B CB   3  
ATOM   8382  C  CG1  . VAL B 1 75 ? 145.094 1.817   6.174   1.00 0.00 ? 75  VAL B CG1  3  
ATOM   8383  C  CG2  . VAL B 1 75 ? 145.232 -0.158  4.640   1.00 0.00 ? 75  VAL B CG2  3  
ATOM   8384  H  H    . VAL B 1 75 ? 148.026 1.575   6.961   1.00 0.00 ? 75  VAL B H    3  
ATOM   8385  H  HA   . VAL B 1 75 ? 147.688 0.509   4.388   1.00 0.00 ? 75  VAL B HA   3  
ATOM   8386  H  HB   . VAL B 1 75 ? 146.285 0.067   6.498   1.00 0.00 ? 75  VAL B HB   3  
ATOM   8387  H  HG11 . VAL B 1 75 ? 145.697 2.547   6.676   1.00 0.00 ? 75  VAL B HG11 3  
ATOM   8388  H  HG12 . VAL B 1 75 ? 144.364 1.415   6.863   1.00 0.00 ? 75  VAL B HG12 3  
ATOM   8389  H  HG13 . VAL B 1 75 ? 144.587 2.279   5.341   1.00 0.00 ? 75  VAL B HG13 3  
ATOM   8390  H  HG21 . VAL B 1 75 ? 144.180 -0.151  4.873   1.00 0.00 ? 75  VAL B HG21 3  
ATOM   8391  H  HG22 . VAL B 1 75 ? 145.602 -1.173  4.671   1.00 0.00 ? 75  VAL B HG22 3  
ATOM   8392  H  HG23 . VAL B 1 75 ? 145.383 0.248   3.650   1.00 0.00 ? 75  VAL B HG23 3  
ATOM   8393  N  N    . VAL B 1 76 ? 146.730 3.628   4.719   1.00 0.00 ? 76  VAL B N    3  
ATOM   8394  C  CA   . VAL B 1 76 ? 146.404 4.807   3.939   1.00 0.00 ? 76  VAL B CA   3  
ATOM   8395  C  C    . VAL B 1 76 ? 147.632 5.262   3.166   1.00 0.00 ? 76  VAL B C    3  
ATOM   8396  O  O    . VAL B 1 76 ? 147.521 5.781   2.054   1.00 0.00 ? 76  VAL B O    3  
ATOM   8397  C  CB   . VAL B 1 76 ? 145.886 5.935   4.842   1.00 0.00 ? 76  VAL B CB   3  
ATOM   8398  C  CG1  . VAL B 1 76 ? 144.640 5.453   5.589   1.00 0.00 ? 76  VAL B CG1  3  
ATOM   8399  C  CG2  . VAL B 1 76 ? 146.953 6.322   5.865   1.00 0.00 ? 76  VAL B CG2  3  
ATOM   8400  H  H    . VAL B 1 76 ? 146.872 3.703   5.687   1.00 0.00 ? 76  VAL B H    3  
ATOM   8401  H  HA   . VAL B 1 76 ? 145.630 4.547   3.232   1.00 0.00 ? 76  VAL B HA   3  
ATOM   8402  H  HB   . VAL B 1 76 ? 145.633 6.792   4.237   1.00 0.00 ? 76  VAL B HB   3  
ATOM   8403  H  HG11 . VAL B 1 76 ? 144.898 4.610   6.209   1.00 0.00 ? 76  VAL B HG11 3  
ATOM   8404  H  HG12 . VAL B 1 76 ? 143.885 5.157   4.876   1.00 0.00 ? 76  VAL B HG12 3  
ATOM   8405  H  HG13 . VAL B 1 76 ? 144.260 6.252   6.207   1.00 0.00 ? 76  VAL B HG13 3  
ATOM   8406  H  HG21 . VAL B 1 76 ? 146.650 7.225   6.376   1.00 0.00 ? 76  VAL B HG21 3  
ATOM   8407  H  HG22 . VAL B 1 76 ? 147.895 6.495   5.365   1.00 0.00 ? 76  VAL B HG22 3  
ATOM   8408  H  HG23 . VAL B 1 76 ? 147.063 5.524   6.581   1.00 0.00 ? 76  VAL B HG23 3  
ATOM   8409  N  N    . LEU B 1 77 ? 148.811 5.064   3.761   1.00 0.00 ? 77  LEU B N    3  
ATOM   8410  C  CA   . LEU B 1 77 ? 150.048 5.460   3.105   1.00 0.00 ? 77  LEU B CA   3  
ATOM   8411  C  C    . LEU B 1 77 ? 150.221 4.735   1.776   1.00 0.00 ? 77  LEU B C    3  
ATOM   8412  O  O    . LEU B 1 77 ? 150.618 5.343   0.783   1.00 0.00 ? 77  LEU B O    3  
ATOM   8413  C  CB   . LEU B 1 77 ? 151.232 5.146   4.026   1.00 0.00 ? 77  LEU B CB   3  
ATOM   8414  C  CG   . LEU B 1 77 ? 152.530 5.740   3.454   1.00 0.00 ? 77  LEU B CG   3  
ATOM   8415  C  CD1  . LEU B 1 77 ? 153.484 6.074   4.602   1.00 0.00 ? 77  LEU B CD1  3  
ATOM   8416  C  CD2  . LEU B 1 77 ? 153.222 4.732   2.520   1.00 0.00 ? 77  LEU B CD2  3  
ATOM   8417  H  H    . LEU B 1 77 ? 148.843 4.647   4.651   1.00 0.00 ? 77  LEU B H    3  
ATOM   8418  H  HA   . LEU B 1 77 ? 150.021 6.523   2.923   1.00 0.00 ? 77  LEU B HA   3  
ATOM   8419  H  HB2  . LEU B 1 77 ? 151.041 5.574   5.001   1.00 0.00 ? 77  LEU B HB2  3  
ATOM   8420  H  HB3  . LEU B 1 77 ? 151.333 4.077   4.124   1.00 0.00 ? 77  LEU B HB3  3  
ATOM   8421  H  HG   . LEU B 1 77 ? 152.303 6.640   2.903   1.00 0.00 ? 77  LEU B HG   3  
ATOM   8422  H  HD11 . LEU B 1 77 ? 154.398 6.487   4.204   1.00 0.00 ? 77  LEU B HD11 3  
ATOM   8423  H  HD12 . LEU B 1 77 ? 153.705 5.175   5.158   1.00 0.00 ? 77  LEU B HD12 3  
ATOM   8424  H  HD13 . LEU B 1 77 ? 153.018 6.796   5.257   1.00 0.00 ? 77  LEU B HD13 3  
ATOM   8425  H  HD21 . LEU B 1 77 ? 154.250 5.028   2.377   1.00 0.00 ? 77  LEU B HD21 3  
ATOM   8426  H  HD22 . LEU B 1 77 ? 152.721 4.719   1.566   1.00 0.00 ? 77  LEU B HD22 3  
ATOM   8427  H  HD23 . LEU B 1 77 ? 153.193 3.746   2.957   1.00 0.00 ? 77  LEU B HD23 3  
ATOM   8428  N  N    . VAL B 1 78 ? 149.912 3.439   1.751   1.00 0.00 ? 78  VAL B N    3  
ATOM   8429  C  CA   . VAL B 1 78 ? 150.039 2.672   0.510   1.00 0.00 ? 78  VAL B CA   3  
ATOM   8430  C  C    . VAL B 1 78 ? 148.937 3.031   -0.487  1.00 0.00 ? 78  VAL B C    3  
ATOM   8431  O  O    . VAL B 1 78 ? 149.135 2.969   -1.707  1.00 0.00 ? 78  VAL B O    3  
ATOM   8432  C  CB   . VAL B 1 78 ? 150.018 1.166   0.803   1.00 0.00 ? 78  VAL B CB   3  
ATOM   8433  C  CG1  . VAL B 1 78 ? 151.146 0.825   1.777   1.00 0.00 ? 78  VAL B CG1  3  
ATOM   8434  C  CG2  . VAL B 1 78 ? 148.679 0.767   1.429   1.00 0.00 ? 78  VAL B CG2  3  
ATOM   8435  H  H    . VAL B 1 78 ? 149.591 2.996   2.574   1.00 0.00 ? 78  VAL B H    3  
ATOM   8436  H  HA   . VAL B 1 78 ? 150.992 2.915   0.062   1.00 0.00 ? 78  VAL B HA   3  
ATOM   8437  H  HB   . VAL B 1 78 ? 150.163 0.619   -0.119  1.00 0.00 ? 78  VAL B HB   3  
ATOM   8438  H  HG11 . VAL B 1 78 ? 152.091 0.842   1.254   1.00 0.00 ? 78  VAL B HG11 3  
ATOM   8439  H  HG12 . VAL B 1 78 ? 150.982 -0.160  2.188   1.00 0.00 ? 78  VAL B HG12 3  
ATOM   8440  H  HG13 . VAL B 1 78 ? 151.163 1.551   2.576   1.00 0.00 ? 78  VAL B HG13 3  
ATOM   8441  H  HG21 . VAL B 1 78 ? 147.867 1.176   0.848   1.00 0.00 ? 78  VAL B HG21 3  
ATOM   8442  H  HG22 . VAL B 1 78 ? 148.631 1.151   2.435   1.00 0.00 ? 78  VAL B HG22 3  
ATOM   8443  H  HG23 . VAL B 1 78 ? 148.599 -0.312  1.452   1.00 0.00 ? 78  VAL B HG23 3  
ATOM   8444  N  N    . ALA B 1 79 ? 147.769 3.383   0.038   1.00 0.00 ? 79  ALA B N    3  
ATOM   8445  C  CA   . ALA B 1 79 ? 146.633 3.715   -0.811  1.00 0.00 ? 79  ALA B CA   3  
ATOM   8446  C  C    . ALA B 1 79 ? 146.931 4.912   -1.712  1.00 0.00 ? 79  ALA B C    3  
ATOM   8447  O  O    . ALA B 1 79 ? 146.505 4.942   -2.866  1.00 0.00 ? 79  ALA B O    3  
ATOM   8448  C  CB   . ALA B 1 79 ? 145.406 4.006   0.067   1.00 0.00 ? 79  ALA B CB   3  
ATOM   8449  H  H    . ALA B 1 79 ? 147.664 3.399   1.013   1.00 0.00 ? 79  ALA B H    3  
ATOM   8450  H  HA   . ALA B 1 79 ? 146.413 2.862   -1.437  1.00 0.00 ? 79  ALA B HA   3  
ATOM   8451  H  HB1  . ALA B 1 79 ? 144.549 3.472   -0.316  1.00 0.00 ? 79  ALA B HB1  3  
ATOM   8452  H  HB2  . ALA B 1 79 ? 145.197 5.067   0.070   1.00 0.00 ? 79  ALA B HB2  3  
ATOM   8453  H  HB3  . ALA B 1 79 ? 145.606 3.680   1.078   1.00 0.00 ? 79  ALA B HB3  3  
ATOM   8454  N  N    . ALA B 1 80 ? 147.656 5.900   -1.194  1.00 0.00 ? 80  ALA B N    3  
ATOM   8455  C  CA   . ALA B 1 80 ? 147.972 7.069   -2.004  1.00 0.00 ? 80  ALA B CA   3  
ATOM   8456  C  C    . ALA B 1 80 ? 148.862 6.682   -3.182  1.00 0.00 ? 80  ALA B C    3  
ATOM   8457  O  O    . ALA B 1 80 ? 148.628 7.109   -4.313  1.00 0.00 ? 80  ALA B O    3  
ATOM   8458  C  CB   . ALA B 1 80 ? 148.681 8.123   -1.150  1.00 0.00 ? 80  ALA B CB   3  
ATOM   8459  H  H    . ALA B 1 80 ? 147.977 5.841   -0.270  1.00 0.00 ? 80  ALA B H    3  
ATOM   8460  H  HA   . ALA B 1 80 ? 147.051 7.491   -2.385  1.00 0.00 ? 80  ALA B HA   3  
ATOM   8461  H  HB1  . ALA B 1 80 ? 148.053 8.388   -0.312  1.00 0.00 ? 80  ALA B HB1  3  
ATOM   8462  H  HB2  . ALA B 1 80 ? 148.873 9.001   -1.748  1.00 0.00 ? 80  ALA B HB2  3  
ATOM   8463  H  HB3  . ALA B 1 80 ? 149.615 7.722   -0.787  1.00 0.00 ? 80  ALA B HB3  3  
ATOM   8464  N  N    . LEU B 1 81 ? 149.868 5.850   -2.917  1.00 0.00 ? 81  LEU B N    3  
ATOM   8465  C  CA   . LEU B 1 81 ? 150.759 5.396   -3.979  1.00 0.00 ? 81  LEU B CA   3  
ATOM   8466  C  C    . LEU B 1 81 ? 149.999 4.530   -4.973  1.00 0.00 ? 81  LEU B C    3  
ATOM   8467  O  O    . LEU B 1 81 ? 150.270 4.562   -6.173  1.00 0.00 ? 81  LEU B O    3  
ATOM   8468  C  CB   . LEU B 1 81 ? 151.947 4.611   -3.411  1.00 0.00 ? 81  LEU B CB   3  
ATOM   8469  C  CG   . LEU B 1 81 ? 152.892 5.554   -2.654  1.00 0.00 ? 81  LEU B CG   3  
ATOM   8470  C  CD1  . LEU B 1 81 ? 152.379 5.775   -1.231  1.00 0.00 ? 81  LEU B CD1  3  
ATOM   8471  C  CD2  . LEU B 1 81 ? 154.294 4.933   -2.604  1.00 0.00 ? 81  LEU B CD2  3  
ATOM   8472  H  H    . LEU B 1 81 ? 149.997 5.523   -2.003  1.00 0.00 ? 81  LEU B H    3  
ATOM   8473  H  HA   . LEU B 1 81 ? 151.136 6.261   -4.503  1.00 0.00 ? 81  LEU B HA   3  
ATOM   8474  H  HB2  . LEU B 1 81 ? 151.583 3.850   -2.736  1.00 0.00 ? 81  LEU B HB2  3  
ATOM   8475  H  HB3  . LEU B 1 81 ? 152.486 4.141   -4.221  1.00 0.00 ? 81  LEU B HB3  3  
ATOM   8476  H  HG   . LEU B 1 81 ? 152.941 6.503   -3.167  1.00 0.00 ? 81  LEU B HG   3  
ATOM   8477  H  HD11 . LEU B 1 81 ? 152.198 4.819   -0.764  1.00 0.00 ? 81  LEU B HD11 3  
ATOM   8478  H  HD12 . LEU B 1 81 ? 151.463 6.344   -1.261  1.00 0.00 ? 81  LEU B HD12 3  
ATOM   8479  H  HD13 . LEU B 1 81 ? 153.120 6.317   -0.662  1.00 0.00 ? 81  LEU B HD13 3  
ATOM   8480  H  HD21 . LEU B 1 81 ? 154.844 5.218   -3.488  1.00 0.00 ? 81  LEU B HD21 3  
ATOM   8481  H  HD22 . LEU B 1 81 ? 154.211 3.857   -2.564  1.00 0.00 ? 81  LEU B HD22 3  
ATOM   8482  H  HD23 . LEU B 1 81 ? 154.816 5.288   -1.727  1.00 0.00 ? 81  LEU B HD23 3  
ATOM   8483  N  N    . THR B 1 82 ? 149.043 3.759   -4.461  1.00 0.00 ? 82  THR B N    3  
ATOM   8484  C  CA   . THR B 1 82 ? 148.255 2.874   -5.310  1.00 0.00 ? 82  THR B CA   3  
ATOM   8485  C  C    . THR B 1 82 ? 147.662 3.638   -6.482  1.00 0.00 ? 82  THR B C    3  
ATOM   8486  O  O    . THR B 1 82 ? 147.607 3.128   -7.602  1.00 0.00 ? 82  THR B O    3  
ATOM   8487  C  CB   . THR B 1 82 ? 147.122 2.257   -4.492  1.00 0.00 ? 82  THR B CB   3  
ATOM   8488  O  OG1  . THR B 1 82 ? 147.662 1.576   -3.369  1.00 0.00 ? 82  THR B OG1  3  
ATOM   8489  C  CG2  . THR B 1 82 ? 146.315 1.286   -5.359  1.00 0.00 ? 82  THR B CG2  3  
ATOM   8490  H  H    . THR B 1 82 ? 148.875 3.775   -3.490  1.00 0.00 ? 82  THR B H    3  
ATOM   8491  H  HA   . THR B 1 82 ? 148.887 2.084   -5.684  1.00 0.00 ? 82  THR B HA   3  
ATOM   8492  H  HB   . THR B 1 82 ? 146.470 3.042   -4.149  1.00 0.00 ? 82  THR B HB   3  
ATOM   8493  H  HG1  . THR B 1 82 ? 148.199 0.849   -3.693  1.00 0.00 ? 82  THR B HG1  3  
ATOM   8494  H  HG21 . THR B 1 82 ? 145.919 0.496   -4.740  1.00 0.00 ? 82  THR B HG21 3  
ATOM   8495  H  HG22 . THR B 1 82 ? 146.954 0.864   -6.121  1.00 0.00 ? 82  THR B HG22 3  
ATOM   8496  H  HG23 . THR B 1 82 ? 145.501 1.817   -5.829  1.00 0.00 ? 82  THR B HG23 3  
ATOM   8497  N  N    . VAL B 1 83 ? 147.230 4.859   -6.226  1.00 0.00 ? 83  VAL B N    3  
ATOM   8498  C  CA   . VAL B 1 83 ? 146.655 5.677   -7.277  1.00 0.00 ? 83  VAL B CA   3  
ATOM   8499  C  C    . VAL B 1 83 ? 147.674 5.919   -8.386  1.00 0.00 ? 83  VAL B C    3  
ATOM   8500  O  O    . VAL B 1 83 ? 147.314 5.987   -9.560  1.00 0.00 ? 83  VAL B O    3  
ATOM   8501  C  CB   . VAL B 1 83 ? 146.182 7.017   -6.715  1.00 0.00 ? 83  VAL B CB   3  
ATOM   8502  C  CG1  . VAL B 1 83 ? 145.723 7.912   -7.870  1.00 0.00 ? 83  VAL B CG1  3  
ATOM   8503  C  CG2  . VAL B 1 83 ? 145.014 6.783   -5.756  1.00 0.00 ? 83  VAL B CG2  3  
ATOM   8504  H  H    . VAL B 1 83 ? 147.304 5.218   -5.317  1.00 0.00 ? 83  VAL B H    3  
ATOM   8505  H  HA   . VAL B 1 83 ? 145.804 5.157   -7.694  1.00 0.00 ? 83  VAL B HA   3  
ATOM   8506  H  HB   . VAL B 1 83 ? 146.996 7.494   -6.189  1.00 0.00 ? 83  VAL B HB   3  
ATOM   8507  H  HG11 . VAL B 1 83 ? 146.587 8.290   -8.397  1.00 0.00 ? 83  VAL B HG11 3  
ATOM   8508  H  HG12 . VAL B 1 83 ? 145.150 8.739   -7.478  1.00 0.00 ? 83  VAL B HG12 3  
ATOM   8509  H  HG13 . VAL B 1 83 ? 145.110 7.337   -8.550  1.00 0.00 ? 83  VAL B HG13 3  
ATOM   8510  H  HG21 . VAL B 1 83 ? 145.221 5.922   -5.138  1.00 0.00 ? 83  VAL B HG21 3  
ATOM   8511  H  HG22 . VAL B 1 83 ? 144.111 6.611   -6.323  1.00 0.00 ? 83  VAL B HG22 3  
ATOM   8512  H  HG23 . VAL B 1 83 ? 144.883 7.653   -5.129  1.00 0.00 ? 83  VAL B HG23 3  
ATOM   8513  N  N    . ALA B 1 84 ? 148.946 6.064   -8.015  1.00 0.00 ? 84  ALA B N    3  
ATOM   8514  C  CA   . ALA B 1 84 ? 149.981 6.314   -9.012  1.00 0.00 ? 84  ALA B CA   3  
ATOM   8515  C  C    . ALA B 1 84 ? 150.094 5.148   -9.988  1.00 0.00 ? 84  ALA B C    3  
ATOM   8516  O  O    . ALA B 1 84 ? 150.260 5.351   -11.199 1.00 0.00 ? 84  ALA B O    3  
ATOM   8517  C  CB   . ALA B 1 84 ? 151.327 6.530   -8.319  1.00 0.00 ? 84  ALA B CB   3  
ATOM   8518  H  H    . ALA B 1 84 ? 149.194 5.997   -7.060  1.00 0.00 ? 84  ALA B H    3  
ATOM   8519  H  HA   . ALA B 1 84 ? 149.728 7.206   -9.562  1.00 0.00 ? 84  ALA B HA   3  
ATOM   8520  H  HB1  . ALA B 1 84 ? 152.094 6.688   -9.064  1.00 0.00 ? 84  ALA B HB1  3  
ATOM   8521  H  HB2  . ALA B 1 84 ? 151.572 5.660   -7.729  1.00 0.00 ? 84  ALA B HB2  3  
ATOM   8522  H  HB3  . ALA B 1 84 ? 151.266 7.396   -7.676  1.00 0.00 ? 84  ALA B HB3  3  
ATOM   8523  N  N    . MET B 1 85 ? 149.987 3.923   -9.478  1.00 0.00 ? 85  MET B N    3  
ATOM   8524  C  CA   . MET B 1 85 ? 150.073 2.774   -10.359 1.00 0.00 ? 85  MET B CA   3  
ATOM   8525  C  C    . MET B 1 85 ? 148.959 2.860   -11.384 1.00 0.00 ? 85  MET B C    3  
ATOM   8526  O  O    . MET B 1 85 ? 149.150 2.536   -12.551 1.00 0.00 ? 85  MET B O    3  
ATOM   8527  C  CB   . MET B 1 85 ? 149.954 1.459   -9.585  1.00 0.00 ? 85  MET B CB   3  
ATOM   8528  C  CG   . MET B 1 85 ? 150.269 0.301   -10.538 1.00 0.00 ? 85  MET B CG   3  
ATOM   8529  S  SD   . MET B 1 85 ? 149.986 -1.287  -9.716  1.00 0.00 ? 85  MET B SD   3  
ATOM   8530  C  CE   . MET B 1 85 ? 148.207 -1.385  -10.020 1.00 0.00 ? 85  MET B CE   3  
ATOM   8531  H  H    . MET B 1 85 ? 149.843 3.798   -8.516  1.00 0.00 ? 85  MET B H    3  
ATOM   8532  H  HA   . MET B 1 85 ? 151.024 2.796   -10.872 1.00 0.00 ? 85  MET B HA   3  
ATOM   8533  H  HB2  . MET B 1 85 ? 150.658 1.458   -8.764  1.00 0.00 ? 85  MET B HB2  3  
ATOM   8534  H  HB3  . MET B 1 85 ? 148.951 1.352   -9.204  1.00 0.00 ? 85  MET B HB3  3  
ATOM   8535  H  HG2  . MET B 1 85 ? 149.631 0.369   -11.407 1.00 0.00 ? 85  MET B HG2  3  
ATOM   8536  H  HG3  . MET B 1 85 ? 151.300 0.363   -10.849 1.00 0.00 ? 85  MET B HG3  3  
ATOM   8537  H  HE1  . MET B 1 85 ? 147.796 -0.389  -10.069 1.00 0.00 ? 85  MET B HE1  3  
ATOM   8538  H  HE2  . MET B 1 85 ? 147.731 -1.929  -9.221  1.00 0.00 ? 85  MET B HE2  3  
ATOM   8539  H  HE3  . MET B 1 85 ? 148.030 -1.899  -10.958 1.00 0.00 ? 85  MET B HE3  3  
ATOM   8540  N  N    . ASN B 1 86 ? 147.793 3.322   -10.936 1.00 0.00 ? 86  ASN B N    3  
ATOM   8541  C  CA   . ASN B 1 86 ? 146.662 3.469   -11.836 1.00 0.00 ? 86  ASN B CA   3  
ATOM   8542  C  C    . ASN B 1 86 ? 147.030 4.410   -12.974 1.00 0.00 ? 86  ASN B C    3  
ATOM   8543  O  O    . ASN B 1 86 ? 146.724 4.146   -14.135 1.00 0.00 ? 86  ASN B O    3  
ATOM   8544  C  CB   . ASN B 1 86 ? 145.464 4.029   -11.065 1.00 0.00 ? 86  ASN B CB   3  
ATOM   8545  C  CG   . ASN B 1 86 ? 144.200 3.940   -11.910 1.00 0.00 ? 86  ASN B CG   3  
ATOM   8546  O  OD1  . ASN B 1 86 ? 143.798 2.851   -12.321 1.00 0.00 ? 86  ASN B OD1  3  
ATOM   8547  N  ND2  . ASN B 1 86 ? 143.542 5.032   -12.189 1.00 0.00 ? 86  ASN B ND2  3  
ATOM   8548  H  H    . ASN B 1 86 ? 147.702 3.579   -9.995  1.00 0.00 ? 86  ASN B H    3  
ATOM   8549  H  HA   . ASN B 1 86 ? 146.402 2.504   -12.242 1.00 0.00 ? 86  ASN B HA   3  
ATOM   8550  H  HB2  . ASN B 1 86 ? 145.327 3.461   -10.157 1.00 0.00 ? 86  ASN B HB2  3  
ATOM   8551  H  HB3  . ASN B 1 86 ? 145.651 5.061   -10.815 1.00 0.00 ? 86  ASN B HB3  3  
ATOM   8552  H  HD21 . ASN B 1 86 ? 143.864 5.896   -11.855 1.00 0.00 ? 86  ASN B HD21 3  
ATOM   8553  H  HD22 . ASN B 1 86 ? 142.725 4.989   -12.725 1.00 0.00 ? 86  ASN B HD22 3  
ATOM   8554  N  N    . ASN B 1 87 ? 147.715 5.502   -12.634 1.00 0.00 ? 87  ASN B N    3  
ATOM   8555  C  CA   . ASN B 1 87 ? 148.143 6.450   -13.652 1.00 0.00 ? 87  ASN B CA   3  
ATOM   8556  C  C    . ASN B 1 87 ? 149.078 5.755   -14.631 1.00 0.00 ? 87  ASN B C    3  
ATOM   8557  O  O    . ASN B 1 87 ? 148.976 5.928   -15.845 1.00 0.00 ? 87  ASN B O    3  
ATOM   8558  C  CB   . ASN B 1 87 ? 148.860 7.636   -13.004 1.00 0.00 ? 87  ASN B CB   3  
ATOM   8559  C  CG   . ASN B 1 87 ? 149.147 8.707   -14.050 1.00 0.00 ? 87  ASN B CG   3  
ATOM   8560  O  OD1  . ASN B 1 87 ? 150.288 8.864   -14.482 1.00 0.00 ? 87  ASN B OD1  3  
ATOM   8561  N  ND2  . ASN B 1 87 ? 148.172 9.458   -14.485 1.00 0.00 ? 87  ASN B ND2  3  
ATOM   8562  H  H    . ASN B 1 87 ? 147.950 5.654   -11.695 1.00 0.00 ? 87  ASN B H    3  
ATOM   8563  H  HA   . ASN B 1 87 ? 147.276 6.811   -14.186 1.00 0.00 ? 87  ASN B HA   3  
ATOM   8564  H  HB2  . ASN B 1 87 ? 148.234 8.051   -12.227 1.00 0.00 ? 87  ASN B HB2  3  
ATOM   8565  H  HB3  . ASN B 1 87 ? 149.791 7.299   -12.573 1.00 0.00 ? 87  ASN B HB3  3  
ATOM   8566  H  HD21 . ASN B 1 87 ? 147.263 9.332   -14.140 1.00 0.00 ? 87  ASN B HD21 3  
ATOM   8567  H  HD22 . ASN B 1 87 ? 148.348 10.149  -15.158 1.00 0.00 ? 87  ASN B HD22 3  
ATOM   8568  N  N    . PHE B 1 88 ? 149.979 4.948   -14.075 1.00 0.00 ? 88  PHE B N    3  
ATOM   8569  C  CA   . PHE B 1 88 ? 150.929 4.193   -14.884 1.00 0.00 ? 88  PHE B CA   3  
ATOM   8570  C  C    . PHE B 1 88 ? 150.192 3.241   -15.820 1.00 0.00 ? 88  PHE B C    3  
ATOM   8571  O  O    . PHE B 1 88 ? 150.574 3.055   -16.976 1.00 0.00 ? 88  PHE B O    3  
ATOM   8572  C  CB   . PHE B 1 88 ? 151.872 3.399   -13.979 1.00 0.00 ? 88  PHE B CB   3  
ATOM   8573  C  CG   . PHE B 1 88 ? 152.933 2.730   -14.820 1.00 0.00 ? 88  PHE B CG   3  
ATOM   8574  C  CD1  . PHE B 1 88 ? 154.091 3.433   -15.173 1.00 0.00 ? 88  PHE B CD1  3  
ATOM   8575  C  CD2  . PHE B 1 88 ? 152.761 1.407   -15.244 1.00 0.00 ? 88  PHE B CD2  3  
ATOM   8576  C  CE1  . PHE B 1 88 ? 155.077 2.815   -15.952 1.00 0.00 ? 88  PHE B CE1  3  
ATOM   8577  C  CE2  . PHE B 1 88 ? 153.747 0.787   -16.022 1.00 0.00 ? 88  PHE B CE2  3  
ATOM   8578  C  CZ   . PHE B 1 88 ? 154.905 1.492   -16.375 1.00 0.00 ? 88  PHE B CZ   3  
ATOM   8579  H  H    . PHE B 1 88 ? 149.995 4.848   -13.092 1.00 0.00 ? 88  PHE B H    3  
ATOM   8580  H  HA   . PHE B 1 88 ? 151.512 4.883   -15.475 1.00 0.00 ? 88  PHE B HA   3  
ATOM   8581  H  HB2  . PHE B 1 88 ? 152.340 4.068   -13.272 1.00 0.00 ? 88  PHE B HB2  3  
ATOM   8582  H  HB3  . PHE B 1 88 ? 151.310 2.647   -13.446 1.00 0.00 ? 88  PHE B HB3  3  
ATOM   8583  H  HD1  . PHE B 1 88 ? 154.223 4.454   -14.845 1.00 0.00 ? 88  PHE B HD1  3  
ATOM   8584  H  HD2  . PHE B 1 88 ? 151.868 0.864   -14.971 1.00 0.00 ? 88  PHE B HD2  3  
ATOM   8585  H  HE1  . PHE B 1 88 ? 155.969 3.358   -16.224 1.00 0.00 ? 88  PHE B HE1  3  
ATOM   8586  H  HE2  . PHE B 1 88 ? 153.615 -0.232  -16.349 1.00 0.00 ? 88  PHE B HE2  3  
ATOM   8587  H  HZ   . PHE B 1 88 ? 155.664 1.014   -16.975 1.00 0.00 ? 88  PHE B HZ   3  
ATOM   8588  N  N    . PHE B 1 89 ? 149.141 2.629   -15.287 1.00 0.00 ? 89  PHE B N    3  
ATOM   8589  C  CA   . PHE B 1 89 ? 148.343 1.667   -16.033 1.00 0.00 ? 89  PHE B CA   3  
ATOM   8590  C  C    . PHE B 1 89 ? 147.880 2.287   -17.344 1.00 0.00 ? 89  PHE B C    3  
ATOM   8591  O  O    . PHE B 1 89 ? 147.857 1.629   -18.384 1.00 0.00 ? 89  PHE B O    3  
ATOM   8592  C  CB   . PHE B 1 89 ? 147.129 1.264   -15.194 1.00 0.00 ? 89  PHE B CB   3  
ATOM   8593  C  CG   . PHE B 1 89 ? 146.411 0.111   -15.845 1.00 0.00 ? 89  PHE B CG   3  
ATOM   8594  C  CD1  . PHE B 1 89 ? 146.802 -1.198  -15.542 1.00 0.00 ? 89  PHE B CD1  3  
ATOM   8595  C  CD2  . PHE B 1 89 ? 145.360 0.339   -16.740 1.00 0.00 ? 89  PHE B CD2  3  
ATOM   8596  C  CE1  . PHE B 1 89 ? 146.146 -2.280  -16.129 1.00 0.00 ? 89  PHE B CE1  3  
ATOM   8597  C  CE2  . PHE B 1 89 ? 144.700 -0.745  -17.332 1.00 0.00 ? 89  PHE B CE2  3  
ATOM   8598  C  CZ   . PHE B 1 89 ? 145.093 -2.055  -17.027 1.00 0.00 ? 89  PHE B CZ   3  
ATOM   8599  H  H    . PHE B 1 89 ? 148.906 2.817   -14.354 1.00 0.00 ? 89  PHE B H    3  
ATOM   8600  H  HA   . PHE B 1 89 ? 148.938 0.791   -16.241 1.00 0.00 ? 89  PHE B HA   3  
ATOM   8601  H  HB2  . PHE B 1 89 ? 147.456 0.972   -14.208 1.00 0.00 ? 89  PHE B HB2  3  
ATOM   8602  H  HB3  . PHE B 1 89 ? 146.455 2.103   -15.115 1.00 0.00 ? 89  PHE B HB3  3  
ATOM   8603  H  HD1  . PHE B 1 89 ? 147.614 -1.371  -14.851 1.00 0.00 ? 89  PHE B HD1  3  
ATOM   8604  H  HD2  . PHE B 1 89 ? 145.059 1.350   -16.974 1.00 0.00 ? 89  PHE B HD2  3  
ATOM   8605  H  HE1  . PHE B 1 89 ? 146.449 -3.288  -15.889 1.00 0.00 ? 89  PHE B HE1  3  
ATOM   8606  H  HE2  . PHE B 1 89 ? 143.889 -0.572  -18.024 1.00 0.00 ? 89  PHE B HE2  3  
ATOM   8607  H  HZ   . PHE B 1 89 ? 144.584 -2.892  -17.483 1.00 0.00 ? 89  PHE B HZ   3  
ATOM   8608  N  N    . TRP B 1 90 ? 147.520 3.564   -17.285 1.00 0.00 ? 90  TRP B N    3  
ATOM   8609  C  CA   . TRP B 1 90 ? 147.070 4.278   -18.470 1.00 0.00 ? 90  TRP B CA   3  
ATOM   8610  C  C    . TRP B 1 90 ? 148.104 4.152   -19.584 1.00 0.00 ? 90  TRP B C    3  
ATOM   8611  O  O    . TRP B 1 90 ? 147.755 4.073   -20.762 1.00 0.00 ? 90  TRP B O    3  
ATOM   8612  C  CB   . TRP B 1 90 ? 146.851 5.754   -18.137 1.00 0.00 ? 90  TRP B CB   3  
ATOM   8613  C  CG   . TRP B 1 90 ? 146.239 6.448   -19.312 1.00 0.00 ? 90  TRP B CG   3  
ATOM   8614  C  CD1  . TRP B 1 90 ? 146.900 7.276   -20.153 1.00 0.00 ? 90  TRP B CD1  3  
ATOM   8615  C  CD2  . TRP B 1 90 ? 144.863 6.394   -19.787 1.00 0.00 ? 90  TRP B CD2  3  
ATOM   8616  N  NE1  . TRP B 1 90 ? 146.018 7.732   -21.115 1.00 0.00 ? 90  TRP B NE1  3  
ATOM   8617  C  CE2  . TRP B 1 90 ? 144.750 7.217   -20.933 1.00 0.00 ? 90  TRP B CE2  3  
ATOM   8618  C  CE3  . TRP B 1 90 ? 143.713 5.717   -19.341 1.00 0.00 ? 90  TRP B CE3  3  
ATOM   8619  C  CZ2  . TRP B 1 90 ? 143.540 7.363   -21.612 1.00 0.00 ? 90  TRP B CZ2  3  
ATOM   8620  C  CZ3  . TRP B 1 90 ? 142.493 5.862   -20.022 1.00 0.00 ? 90  TRP B CZ3  3  
ATOM   8621  C  CH2  . TRP B 1 90 ? 142.407 6.684   -21.155 1.00 0.00 ? 90  TRP B CH2  3  
ATOM   8622  H  H    . TRP B 1 90 ? 147.568 4.038   -16.427 1.00 0.00 ? 90  TRP B H    3  
ATOM   8623  H  HA   . TRP B 1 90 ? 146.136 3.851   -18.805 1.00 0.00 ? 90  TRP B HA   3  
ATOM   8624  H  HB2  . TRP B 1 90 ? 146.189 5.837   -17.287 1.00 0.00 ? 90  TRP B HB2  3  
ATOM   8625  H  HB3  . TRP B 1 90 ? 147.799 6.214   -17.901 1.00 0.00 ? 90  TRP B HB3  3  
ATOM   8626  H  HD1  . TRP B 1 90 ? 147.946 7.538   -20.084 1.00 0.00 ? 90  TRP B HD1  3  
ATOM   8627  H  HE1  . TRP B 1 90 ? 146.245 8.345   -21.846 1.00 0.00 ? 90  TRP B HE1  3  
ATOM   8628  H  HE3  . TRP B 1 90 ? 143.769 5.082   -18.469 1.00 0.00 ? 90  TRP B HE3  3  
ATOM   8629  H  HZ2  . TRP B 1 90 ? 143.478 7.996   -22.484 1.00 0.00 ? 90  TRP B HZ2  3  
ATOM   8630  H  HZ3  . TRP B 1 90 ? 141.617 5.338   -19.671 1.00 0.00 ? 90  TRP B HZ3  3  
ATOM   8631  H  HH2  . TRP B 1 90 ? 141.467 6.791   -21.674 1.00 0.00 ? 90  TRP B HH2  3  
ATOM   8632  N  N    . GLU B 1 91 ? 149.379 4.130   -19.203 1.00 0.00 ? 91  GLU B N    3  
ATOM   8633  C  CA   . GLU B 1 91 ? 150.452 4.008   -20.182 1.00 0.00 ? 91  GLU B CA   3  
ATOM   8634  C  C    . GLU B 1 91 ? 150.268 2.743   -21.013 1.00 0.00 ? 91  GLU B C    3  
ATOM   8635  O  O    . GLU B 1 91 ? 150.611 2.709   -22.195 1.00 0.00 ? 91  GLU B O    3  
ATOM   8636  C  CB   . GLU B 1 91 ? 151.807 3.964   -19.473 1.00 0.00 ? 91  GLU B CB   3  
ATOM   8637  C  CG   . GLU B 1 91 ? 152.929 3.981   -20.514 1.00 0.00 ? 91  GLU B CG   3  
ATOM   8638  C  CD   . GLU B 1 91 ? 154.282 3.835   -19.826 1.00 0.00 ? 91  GLU B CD   3  
ATOM   8639  O  OE1  . GLU B 1 91 ? 154.296 3.704   -18.614 1.00 0.00 ? 91  GLU B OE1  3  
ATOM   8640  O  OE2  . GLU B 1 91 ? 155.283 3.856   -20.522 1.00 0.00 ? 91  GLU B OE2  3  
ATOM   8641  H  H    . GLU B 1 91 ? 149.601 4.191   -18.248 1.00 0.00 ? 91  GLU B H    3  
ATOM   8642  H  HA   . GLU B 1 91 ? 150.429 4.866   -20.837 1.00 0.00 ? 91  GLU B HA   3  
ATOM   8643  H  HB2  . GLU B 1 91 ? 151.903 4.824   -18.825 1.00 0.00 ? 91  GLU B HB2  3  
ATOM   8644  H  HB3  . GLU B 1 91 ? 151.877 3.061   -18.886 1.00 0.00 ? 91  GLU B HB3  3  
ATOM   8645  H  HG2  . GLU B 1 91 ? 152.788 3.163   -21.205 1.00 0.00 ? 91  GLU B HG2  3  
ATOM   8646  H  HG3  . GLU B 1 91 ? 152.901 4.916   -21.054 1.00 0.00 ? 91  GLU B HG3  3  
ATOM   8647  N  N    . ASN B 1 92 ? 149.721 1.705   -20.385 1.00 0.00 ? 92  ASN B N    3  
ATOM   8648  C  CA   . ASN B 1 92 ? 149.490 0.438   -21.073 1.00 0.00 ? 92  ASN B CA   3  
ATOM   8649  C  C    . ASN B 1 92 ? 148.016 0.289   -21.434 1.00 0.00 ? 92  ASN B C    3  
ATOM   8650  O  O    . ASN B 1 92 ? 147.136 0.591   -20.627 1.00 0.00 ? 92  ASN B O    3  
ATOM   8651  C  CB   . ASN B 1 92 ? 149.916 -0.726  -20.176 1.00 0.00 ? 92  ASN B CB   3  
ATOM   8652  C  CG   . ASN B 1 92 ? 151.395 -0.603  -19.828 1.00 0.00 ? 92  ASN B CG   3  
ATOM   8653  O  OD1  . ASN B 1 92 ? 151.777 -0.778  -18.670 1.00 0.00 ? 92  ASN B OD1  3  
ATOM   8654  N  ND2  . ASN B 1 92 ? 152.254 -0.310  -20.764 1.00 0.00 ? 92  ASN B ND2  3  
ATOM   8655  H  H    . ASN B 1 92 ? 149.467 1.793   -19.444 1.00 0.00 ? 92  ASN B H    3  
ATOM   8656  H  HA   . ASN B 1 92 ? 150.078 0.413   -21.979 1.00 0.00 ? 92  ASN B HA   3  
ATOM   8657  H  HB2  . ASN B 1 92 ? 149.330 -0.711  -19.267 1.00 0.00 ? 92  ASN B HB2  3  
ATOM   8658  H  HB3  . ASN B 1 92 ? 149.747 -1.658  -20.695 1.00 0.00 ? 92  ASN B HB3  3  
ATOM   8659  H  HD21 . ASN B 1 92 ? 151.947 -0.169  -21.685 1.00 0.00 ? 92  ASN B HD21 3  
ATOM   8660  H  HD22 . ASN B 1 92 ? 153.207 -0.229  -20.547 1.00 0.00 ? 92  ASN B HD22 3  
ATOM   8661  N  N    . SER B 1 93 ? 147.752 -0.177  -22.650 1.00 0.00 ? 93  SER B N    3  
ATOM   8662  C  CA   . SER B 1 93 ? 146.380 -0.361  -23.107 1.00 0.00 ? 93  SER B CA   3  
ATOM   8663  C  C    . SER B 1 93 ? 146.339 -1.258  -24.340 1.00 0.00 ? 93  SER B C    3  
ATOM   8664  O  O    . SER B 1 93 ? 147.280 -1.208  -25.115 1.00 0.00 ? 93  SER B O    3  
ATOM   8665  C  CB   . SER B 1 93 ? 145.755 0.994   -23.439 1.00 0.00 ? 93  SER B CB   3  
ATOM   8666  O  OG   . SER B 1 93 ? 144.657 0.801   -24.323 1.00 0.00 ? 93  SER B OG   3  
ATOM   8667  O  OXT  . SER B 1 93 ? 145.369 -1.981  -24.491 1.00 0.00 ? 93  SER B OXT  3  
ATOM   8668  H  H    . SER B 1 93 ? 148.494 -0.401  -23.251 1.00 0.00 ? 93  SER B H    3  
ATOM   8669  H  HA   . SER B 1 93 ? 145.808 -0.826  -22.317 1.00 0.00 ? 93  SER B HA   3  
ATOM   8670  H  HB2  . SER B 1 93 ? 145.401 1.461   -22.534 1.00 0.00 ? 93  SER B HB2  3  
ATOM   8671  H  HB3  . SER B 1 93 ? 146.499 1.628   -23.902 1.00 0.00 ? 93  SER B HB3  3  
ATOM   8672  H  HG   . SER B 1 93 ? 144.141 1.609   -24.335 1.00 0.00 ? 93  SER B HG   3  
HETATM 8673  CA CA   . CA  C 2 .  ? 129.820 1.660   -12.837 1.00 0.00 ? 201 CA  A CA   3  
HETATM 8674  CA CA   . CA  D 2 .  ? 133.579 12.287  -4.954  1.00 0.00 ? 202 CA  A CA   3  
HETATM 8675  CA CA   . CA  E 2 .  ? 159.682 -3.227  13.062  1.00 0.00 ? 101 CA  B CA   3  
HETATM 8676  CA CA   . CA  F 2 .  ? 152.097 8.223   13.768  1.00 0.00 ? 102 CA  B CA   3  
ATOM   8677  N  N    . GLY A 1 1  ? 156.939 -6.995  -10.749 1.00 0.00 ? 1   GLY A N    4  
ATOM   8678  C  CA   . GLY A 1 1  ? 156.946 -8.401  -10.359 1.00 0.00 ? 1   GLY A CA   4  
ATOM   8679  C  C    . GLY A 1 1  ? 157.038 -8.544  -8.844  1.00 0.00 ? 1   GLY A C    4  
ATOM   8680  O  O    . GLY A 1 1  ? 157.694 -9.454  -8.336  1.00 0.00 ? 1   GLY A O    4  
ATOM   8681  H  H1   . GLY A 1 1  ? 156.404 -6.702  -11.516 1.00 0.00 ? 1   GLY A H1   4  
ATOM   8682  H  HA2  . GLY A 1 1  ? 156.035 -8.869  -10.706 1.00 0.00 ? 1   GLY A HA2  4  
ATOM   8683  H  HA3  . GLY A 1 1  ? 157.793 -8.891  -10.811 1.00 0.00 ? 1   GLY A HA3  4  
ATOM   8684  N  N    . SER A 1 2  ? 156.377 -7.639  -8.126  1.00 0.00 ? 2   SER A N    4  
ATOM   8685  C  CA   . SER A 1 2  ? 156.390 -7.671  -6.665  1.00 0.00 ? 2   SER A CA   4  
ATOM   8686  C  C    . SER A 1 2  ? 155.039 -8.135  -6.129  1.00 0.00 ? 2   SER A C    4  
ATOM   8687  O  O    . SER A 1 2  ? 153.986 -7.797  -6.681  1.00 0.00 ? 2   SER A O    4  
ATOM   8688  C  CB   . SER A 1 2  ? 156.711 -6.282  -6.117  1.00 0.00 ? 2   SER A CB   4  
ATOM   8689  O  OG   . SER A 1 2  ? 156.835 -6.353  -4.703  1.00 0.00 ? 2   SER A OG   4  
ATOM   8690  H  H    . SER A 1 2  ? 155.873 -6.936  -8.586  1.00 0.00 ? 2   SER A H    4  
ATOM   8691  H  HA   . SER A 1 2  ? 157.152 -8.360  -6.332  1.00 0.00 ? 2   SER A HA   4  
ATOM   8692  H  HB2  . SER A 1 2  ? 157.638 -5.931  -6.537  1.00 0.00 ? 2   SER A HB2  4  
ATOM   8693  H  HB3  . SER A 1 2  ? 155.917 -5.599  -6.385  1.00 0.00 ? 2   SER A HB3  4  
ATOM   8694  H  HG   . SER A 1 2  ? 156.251 -7.048  -4.389  1.00 0.00 ? 2   SER A HG   4  
ATOM   8695  N  N    . GLU A 1 3  ? 155.072 -8.918  -5.056  1.00 0.00 ? 3   GLU A N    4  
ATOM   8696  C  CA   . GLU A 1 3  ? 153.841 -9.426  -4.469  1.00 0.00 ? 3   GLU A CA   4  
ATOM   8697  C  C    . GLU A 1 3  ? 152.911 -8.280  -4.088  1.00 0.00 ? 3   GLU A C    4  
ATOM   8698  O  O    . GLU A 1 3  ? 151.694 -8.385  -4.245  1.00 0.00 ? 3   GLU A O    4  
ATOM   8699  C  CB   . GLU A 1 3  ? 154.165 -10.254 -3.224  1.00 0.00 ? 3   GLU A CB   4  
ATOM   8700  C  CG   . GLU A 1 3  ? 152.884 -10.892 -2.684  1.00 0.00 ? 3   GLU A CG   4  
ATOM   8701  C  CD   . GLU A 1 3  ? 153.180 -11.639 -1.387  1.00 0.00 ? 3   GLU A CD   4  
ATOM   8702  O  OE1  . GLU A 1 3  ? 154.321 -11.612 -0.959  1.00 0.00 ? 3   GLU A OE1  4  
ATOM   8703  O  OE2  . GLU A 1 3  ? 152.260 -12.227 -0.842  1.00 0.00 ? 3   GLU A OE2  4  
ATOM   8704  H  H    . GLU A 1 3  ? 155.935 -9.162  -4.660  1.00 0.00 ? 3   GLU A H    4  
ATOM   8705  H  HA   . GLU A 1 3  ? 153.343 -10.058 -5.187  1.00 0.00 ? 3   GLU A HA   4  
ATOM   8706  H  HB2  . GLU A 1 3  ? 154.872 -11.028 -3.482  1.00 0.00 ? 3   GLU A HB2  4  
ATOM   8707  H  HB3  . GLU A 1 3  ? 154.593 -9.614  -2.466  1.00 0.00 ? 3   GLU A HB3  4  
ATOM   8708  H  HG2  . GLU A 1 3  ? 152.151 -10.121 -2.495  1.00 0.00 ? 3   GLU A HG2  4  
ATOM   8709  H  HG3  . GLU A 1 3  ? 152.494 -11.585 -3.413  1.00 0.00 ? 3   GLU A HG3  4  
ATOM   8710  N  N    . LEU A 1 4  ? 153.480 -7.180  -3.599  1.00 0.00 ? 4   LEU A N    4  
ATOM   8711  C  CA   . LEU A 1 4  ? 152.659 -6.038  -3.224  1.00 0.00 ? 4   LEU A CA   4  
ATOM   8712  C  C    . LEU A 1 4  ? 151.880 -5.554  -4.441  1.00 0.00 ? 4   LEU A C    4  
ATOM   8713  O  O    . LEU A 1 4  ? 150.682 -5.256  -4.357  1.00 0.00 ? 4   LEU A O    4  
ATOM   8714  C  CB   . LEU A 1 4  ? 153.559 -4.905  -2.712  1.00 0.00 ? 4   LEU A CB   4  
ATOM   8715  C  CG   . LEU A 1 4  ? 152.710 -3.728  -2.214  1.00 0.00 ? 4   LEU A CG   4  
ATOM   8716  C  CD1  . LEU A 1 4  ? 152.132 -4.046  -0.832  1.00 0.00 ? 4   LEU A CD1  4  
ATOM   8717  C  CD2  . LEU A 1 4  ? 153.583 -2.470  -2.133  1.00 0.00 ? 4   LEU A CD2  4  
ATOM   8718  H  H    . LEU A 1 4  ? 154.454 -7.136  -3.499  1.00 0.00 ? 4   LEU A H    4  
ATOM   8719  H  HA   . LEU A 1 4  ? 151.969 -6.330  -2.446  1.00 0.00 ? 4   LEU A HA   4  
ATOM   8720  H  HB2  . LEU A 1 4  ? 154.172 -5.275  -1.903  1.00 0.00 ? 4   LEU A HB2  4  
ATOM   8721  H  HB3  . LEU A 1 4  ? 154.197 -4.569  -3.515  1.00 0.00 ? 4   LEU A HB3  4  
ATOM   8722  H  HG   . LEU A 1 4  ? 151.898 -3.556  -2.902  1.00 0.00 ? 4   LEU A HG   4  
ATOM   8723  H  HD11 . LEU A 1 4  ? 151.326 -4.757  -0.931  1.00 0.00 ? 4   LEU A HD11 4  
ATOM   8724  H  HD12 . LEU A 1 4  ? 151.758 -3.139  -0.383  1.00 0.00 ? 4   LEU A HD12 4  
ATOM   8725  H  HD13 . LEU A 1 4  ? 152.905 -4.463  -0.203  1.00 0.00 ? 4   LEU A HD13 4  
ATOM   8726  H  HD21 . LEU A 1 4  ? 152.959 -1.612  -1.926  1.00 0.00 ? 4   LEU A HD21 4  
ATOM   8727  H  HD22 . LEU A 1 4  ? 154.094 -2.323  -3.075  1.00 0.00 ? 4   LEU A HD22 4  
ATOM   8728  H  HD23 . LEU A 1 4  ? 154.310 -2.586  -1.344  1.00 0.00 ? 4   LEU A HD23 4  
ATOM   8729  N  N    . GLU A 1 5  ? 152.563 -5.503  -5.583  1.00 0.00 ? 5   GLU A N    4  
ATOM   8730  C  CA   . GLU A 1 5  ? 151.918 -5.079  -6.811  1.00 0.00 ? 5   GLU A CA   4  
ATOM   8731  C  C    . GLU A 1 5  ? 150.863 -6.086  -7.229  1.00 0.00 ? 5   GLU A C    4  
ATOM   8732  O  O    . GLU A 1 5  ? 149.795 -5.714  -7.705  1.00 0.00 ? 5   GLU A O    4  
ATOM   8733  C  CB   . GLU A 1 5  ? 152.954 -4.926  -7.928  1.00 0.00 ? 5   GLU A CB   4  
ATOM   8734  C  CG   . GLU A 1 5  ? 153.903 -3.770  -7.602  1.00 0.00 ? 5   GLU A CG   4  
ATOM   8735  C  CD   . GLU A 1 5  ? 153.130 -2.457  -7.536  1.00 0.00 ? 5   GLU A CD   4  
ATOM   8736  O  OE1  . GLU A 1 5  ? 152.022 -2.417  -8.046  1.00 0.00 ? 5   GLU A OE1  4  
ATOM   8737  O  OE2  . GLU A 1 5  ? 153.660 -1.509  -6.981  1.00 0.00 ? 5   GLU A OE2  4  
ATOM   8738  H  H    . GLU A 1 5  ? 153.506 -5.770  -5.596  1.00 0.00 ? 5   GLU A H    4  
ATOM   8739  H  HA   . GLU A 1 5  ? 151.440 -4.126  -6.644  1.00 0.00 ? 5   GLU A HA   4  
ATOM   8740  H  HB2  . GLU A 1 5  ? 153.520 -5.842  -8.018  1.00 0.00 ? 5   GLU A HB2  4  
ATOM   8741  H  HB3  . GLU A 1 5  ? 152.450 -4.722  -8.860  1.00 0.00 ? 5   GLU A HB3  4  
ATOM   8742  H  HG2  . GLU A 1 5  ? 154.374 -3.953  -6.648  1.00 0.00 ? 5   GLU A HG2  4  
ATOM   8743  H  HG3  . GLU A 1 5  ? 154.660 -3.700  -8.368  1.00 0.00 ? 5   GLU A HG3  4  
ATOM   8744  N  N    . THR A 1 6  ? 151.161 -7.370  -7.040  1.00 0.00 ? 6   THR A N    4  
ATOM   8745  C  CA   . THR A 1 6  ? 150.203 -8.400  -7.410  1.00 0.00 ? 6   THR A CA   4  
ATOM   8746  C  C    . THR A 1 6  ? 148.911 -8.221  -6.626  1.00 0.00 ? 6   THR A C    4  
ATOM   8747  O  O    . THR A 1 6  ? 147.817 -8.322  -7.181  1.00 0.00 ? 6   THR A O    4  
ATOM   8748  C  CB   . THR A 1 6  ? 150.788 -9.786  -7.125  1.00 0.00 ? 6   THR A CB   4  
ATOM   8749  O  OG1  . THR A 1 6  ? 152.038 -9.914  -7.787  1.00 0.00 ? 6   THR A OG1  4  
ATOM   8750  C  CG2  . THR A 1 6  ? 149.827 -10.862 -7.635  1.00 0.00 ? 6   THR A CG2  4  
ATOM   8751  H  H    . THR A 1 6  ? 152.029 -7.621  -6.650  1.00 0.00 ? 6   THR A H    4  
ATOM   8752  H  HA   . THR A 1 6  ? 149.989 -8.320  -8.465  1.00 0.00 ? 6   THR A HA   4  
ATOM   8753  H  HB   . THR A 1 6  ? 150.927 -9.907  -6.063  1.00 0.00 ? 6   THR A HB   4  
ATOM   8754  H  HG1  . THR A 1 6  ? 152.601 -10.477 -7.251  1.00 0.00 ? 6   THR A HG1  4  
ATOM   8755  H  HG21 . THR A 1 6  ? 149.025 -10.993 -6.923  1.00 0.00 ? 6   THR A HG21 4  
ATOM   8756  H  HG22 . THR A 1 6  ? 150.359 -11.793 -7.753  1.00 0.00 ? 6   THR A HG22 4  
ATOM   8757  H  HG23 . THR A 1 6  ? 149.417 -10.557 -8.586  1.00 0.00 ? 6   THR A HG23 4  
ATOM   8758  N  N    . ALA A 1 7  ? 149.048 -7.938  -5.335  1.00 0.00 ? 7   ALA A N    4  
ATOM   8759  C  CA   . ALA A 1 7  ? 147.883 -7.727  -4.487  1.00 0.00 ? 7   ALA A CA   4  
ATOM   8760  C  C    . ALA A 1 7  ? 147.152 -6.445  -4.870  1.00 0.00 ? 7   ALA A C    4  
ATOM   8761  O  O    . ALA A 1 7  ? 145.923 -6.389  -4.848  1.00 0.00 ? 7   ALA A O    4  
ATOM   8762  C  CB   . ALA A 1 7  ? 148.315 -7.652  -3.020  1.00 0.00 ? 7   ALA A CB   4  
ATOM   8763  H  H    . ALA A 1 7  ? 149.947 -7.859  -4.950  1.00 0.00 ? 7   ALA A H    4  
ATOM   8764  H  HA   . ALA A 1 7  ? 147.210 -8.562  -4.606  1.00 0.00 ? 7   ALA A HA   4  
ATOM   8765  H  HB1  . ALA A 1 7  ? 147.569 -7.114  -2.453  1.00 0.00 ? 7   ALA A HB1  4  
ATOM   8766  H  HB2  . ALA A 1 7  ? 149.261 -7.137  -2.949  1.00 0.00 ? 7   ALA A HB2  4  
ATOM   8767  H  HB3  . ALA A 1 7  ? 148.417 -8.651  -2.625  1.00 0.00 ? 7   ALA A HB3  4  
ATOM   8768  N  N    . MET A 1 8  ? 147.922 -5.408  -5.194  1.00 0.00 ? 8   MET A N    4  
ATOM   8769  C  CA   . MET A 1 8  ? 147.336 -4.118  -5.550  1.00 0.00 ? 8   MET A CA   4  
ATOM   8770  C  C    . MET A 1 8  ? 146.421 -4.209  -6.773  1.00 0.00 ? 8   MET A C    4  
ATOM   8771  O  O    . MET A 1 8  ? 145.316 -3.649  -6.784  1.00 0.00 ? 8   MET A O    4  
ATOM   8772  C  CB   . MET A 1 8  ? 148.470 -3.144  -5.869  1.00 0.00 ? 8   MET A CB   4  
ATOM   8773  C  CG   . MET A 1 8  ? 147.911 -1.735  -6.051  1.00 0.00 ? 8   MET A CG   4  
ATOM   8774  S  SD   . MET A 1 8  ? 149.221 -0.657  -6.679  1.00 0.00 ? 8   MET A SD   4  
ATOM   8775  C  CE   . MET A 1 8  ? 150.346 -0.826  -5.274  1.00 0.00 ? 8   MET A CE   4  
ATOM   8776  H  H    . MET A 1 8  ? 148.903 -5.505  -5.170  1.00 0.00 ? 8   MET A H    4  
ATOM   8777  H  HA   . MET A 1 8  ? 146.775 -3.735  -4.711  1.00 0.00 ? 8   MET A HA   4  
ATOM   8778  H  HB2  . MET A 1 8  ? 149.181 -3.146  -5.056  1.00 0.00 ? 8   MET A HB2  4  
ATOM   8779  H  HB3  . MET A 1 8  ? 148.962 -3.453  -6.779  1.00 0.00 ? 8   MET A HB3  4  
ATOM   8780  H  HG2  . MET A 1 8  ? 147.093 -1.760  -6.755  1.00 0.00 ? 8   MET A HG2  4  
ATOM   8781  H  HG3  . MET A 1 8  ? 147.561 -1.361  -5.100  1.00 0.00 ? 8   MET A HG3  4  
ATOM   8782  H  HE1  . MET A 1 8  ? 150.940 -1.722  -5.398  1.00 0.00 ? 8   MET A HE1  4  
ATOM   8783  H  HE2  . MET A 1 8  ? 149.777 -0.896  -4.361  1.00 0.00 ? 8   MET A HE2  4  
ATOM   8784  H  HE3  . MET A 1 8  ? 150.996 0.039   -5.228  1.00 0.00 ? 8   MET A HE3  4  
ATOM   8785  N  N    . GLU A 1 9  ? 146.875 -4.934  -7.789  1.00 0.00 ? 9   GLU A N    4  
ATOM   8786  C  CA   . GLU A 1 9  ? 146.098 -5.076  -9.015  1.00 0.00 ? 9   GLU A CA   4  
ATOM   8787  C  C    . GLU A 1 9  ? 144.741 -5.663  -8.709  1.00 0.00 ? 9   GLU A C    4  
ATOM   8788  O  O    . GLU A 1 9  ? 143.756 -5.361  -9.384  1.00 0.00 ? 9   GLU A O    4  
ATOM   8789  C  CB   . GLU A 1 9  ? 146.840 -5.962  -10.017 1.00 0.00 ? 9   GLU A CB   4  
ATOM   8790  C  CG   . GLU A 1 9  ? 148.125 -5.260  -10.461 1.00 0.00 ? 9   GLU A CG   4  
ATOM   8791  C  CD   . GLU A 1 9  ? 148.848 -6.105  -11.504 1.00 0.00 ? 9   GLU A CD   4  
ATOM   8792  O  OE1  . GLU A 1 9  ? 148.439 -7.236  -11.710 1.00 0.00 ? 9   GLU A OE1  4  
ATOM   8793  O  OE2  . GLU A 1 9  ? 149.801 -5.608  -12.083 1.00 0.00 ? 9   GLU A OE2  4  
ATOM   8794  H  H    . GLU A 1 9  ? 147.750 -5.370  -7.720  1.00 0.00 ? 9   GLU A H    4  
ATOM   8795  H  HA   . GLU A 1 9  ? 145.962 -4.099  -9.453  1.00 0.00 ? 9   GLU A HA   4  
ATOM   8796  H  HB2  . GLU A 1 9  ? 147.086 -6.905  -9.551  1.00 0.00 ? 9   GLU A HB2  4  
ATOM   8797  H  HB3  . GLU A 1 9  ? 146.212 -6.137  -10.877 1.00 0.00 ? 9   GLU A HB3  4  
ATOM   8798  H  HG2  . GLU A 1 9  ? 147.877 -4.300  -10.888 1.00 0.00 ? 9   GLU A HG2  4  
ATOM   8799  H  HG3  . GLU A 1 9  ? 148.769 -5.114  -9.610  1.00 0.00 ? 9   GLU A HG3  4  
ATOM   8800  N  N    . THR A 1 10 ? 144.687 -6.490  -7.687  1.00 0.00 ? 10  THR A N    4  
ATOM   8801  C  CA   . THR A 1 10 ? 143.433 -7.093  -7.306  1.00 0.00 ? 10  THR A CA   4  
ATOM   8802  C  C    . THR A 1 10 ? 142.388 -6.015  -7.036  1.00 0.00 ? 10  THR A C    4  
ATOM   8803  O  O    . THR A 1 10 ? 141.216 -6.200  -7.360  1.00 0.00 ? 10  THR A O    4  
ATOM   8804  C  CB   . THR A 1 10 ? 143.614 -7.958  -6.055  1.00 0.00 ? 10  THR A CB   4  
ATOM   8805  O  OG1  . THR A 1 10 ? 144.655 -8.898  -6.278  1.00 0.00 ? 10  THR A OG1  4  
ATOM   8806  C  CG2  . THR A 1 10 ? 142.310 -8.702  -5.755  1.00 0.00 ? 10  THR A CG2  4  
ATOM   8807  H  H    . THR A 1 10 ? 145.499 -6.691  -7.177  1.00 0.00 ? 10  THR A H    4  
ATOM   8808  H  HA   . THR A 1 10 ? 143.087 -7.719  -8.116  1.00 0.00 ? 10  THR A HA   4  
ATOM   8809  H  HB   . THR A 1 10 ? 143.865 -7.330  -5.214  1.00 0.00 ? 10  THR A HB   4  
ATOM   8810  H  HG1  . THR A 1 10 ? 144.659 -9.516  -5.544  1.00 0.00 ? 10  THR A HG1  4  
ATOM   8811  H  HG21 . THR A 1 10 ? 141.814 -8.954  -6.680  1.00 0.00 ? 10  THR A HG21 4  
ATOM   8812  H  HG22 . THR A 1 10 ? 141.665 -8.073  -5.160  1.00 0.00 ? 10  THR A HG22 4  
ATOM   8813  H  HG23 . THR A 1 10 ? 142.531 -9.608  -5.209  1.00 0.00 ? 10  THR A HG23 4  
ATOM   8814  N  N    . LEU A 1 11 ? 142.794 -4.887  -6.431  1.00 0.00 ? 11  LEU A N    4  
ATOM   8815  C  CA   . LEU A 1 11 ? 141.814 -3.840  -6.142  1.00 0.00 ? 11  LEU A CA   4  
ATOM   8816  C  C    . LEU A 1 11 ? 141.216 -3.285  -7.433  1.00 0.00 ? 11  LEU A C    4  
ATOM   8817  O  O    . LEU A 1 11 ? 140.005 -3.048  -7.537  1.00 0.00 ? 11  LEU A O    4  
ATOM   8818  C  CB   . LEU A 1 11 ? 142.481 -2.689  -5.383  1.00 0.00 ? 11  LEU A CB   4  
ATOM   8819  C  CG   . LEU A 1 11 ? 143.130 -3.213  -4.101  1.00 0.00 ? 11  LEU A CG   4  
ATOM   8820  C  CD1  . LEU A 1 11 ? 143.675 -2.036  -3.289  1.00 0.00 ? 11  LEU A CD1  4  
ATOM   8821  C  CD2  . LEU A 1 11 ? 142.093 -3.970  -3.266  1.00 0.00 ? 11  LEU A CD2  4  
ATOM   8822  H  H    . LEU A 1 11 ? 143.749 -4.760  -6.186  1.00 0.00 ? 11  LEU A H    4  
ATOM   8823  H  HA   . LEU A 1 11 ? 141.025 -4.250  -5.534  1.00 0.00 ? 11  LEU A HA   4  
ATOM   8824  H  HB2  . LEU A 1 11 ? 143.236 -2.236  -6.008  1.00 0.00 ? 11  LEU A HB2  4  
ATOM   8825  H  HB3  . LEU A 1 11 ? 141.736 -1.949  -5.129  1.00 0.00 ? 11  LEU A HB3  4  
ATOM   8826  H  HG   . LEU A 1 11 ? 143.942 -3.874  -4.361  1.00 0.00 ? 11  LEU A HG   4  
ATOM   8827  H  HD11 . LEU A 1 11 ? 144.249 -1.388  -3.936  1.00 0.00 ? 11  LEU A HD11 4  
ATOM   8828  H  HD12 . LEU A 1 11 ? 144.309 -2.408  -2.498  1.00 0.00 ? 11  LEU A HD12 4  
ATOM   8829  H  HD13 . LEU A 1 11 ? 142.853 -1.482  -2.861  1.00 0.00 ? 11  LEU A HD13 4  
ATOM   8830  H  HD21 . LEU A 1 11 ? 141.130 -3.491  -3.367  1.00 0.00 ? 11  LEU A HD21 4  
ATOM   8831  H  HD22 . LEU A 1 11 ? 142.391 -3.961  -2.227  1.00 0.00 ? 11  LEU A HD22 4  
ATOM   8832  H  HD23 . LEU A 1 11 ? 142.026 -4.990  -3.613  1.00 0.00 ? 11  LEU A HD23 4  
ATOM   8833  N  N    . ILE A 1 12 ? 142.081 -3.077  -8.415  1.00 0.00 ? 12  ILE A N    4  
ATOM   8834  C  CA   . ILE A 1 12 ? 141.648 -2.544  -9.693  1.00 0.00 ? 12  ILE A CA   4  
ATOM   8835  C  C    . ILE A 1 12 ? 140.722 -3.507  -10.428 1.00 0.00 ? 12  ILE A C    4  
ATOM   8836  O  O    . ILE A 1 12 ? 139.711 -3.092  -10.995 1.00 0.00 ? 12  ILE A O    4  
ATOM   8837  C  CB   . ILE A 1 12 ? 142.872 -2.218  -10.547 1.00 0.00 ? 12  ILE A CB   4  
ATOM   8838  C  CG1  . ILE A 1 12 ? 143.736 -1.191  -9.798  1.00 0.00 ? 12  ILE A CG1  4  
ATOM   8839  C  CG2  . ILE A 1 12 ? 142.421 -1.632  -11.886 1.00 0.00 ? 12  ILE A CG2  4  
ATOM   8840  C  CD1  . ILE A 1 12 ? 145.032 -0.907  -10.574 1.00 0.00 ? 12  ILE A CD1  4  
ATOM   8841  H  H    . ILE A 1 12 ? 143.029 -3.281  -8.274  1.00 0.00 ? 12  ILE A H    4  
ATOM   8842  H  HA   . ILE A 1 12 ? 141.109 -1.627  -9.512  1.00 0.00 ? 12  ILE A HA   4  
ATOM   8843  H  HB   . ILE A 1 12 ? 143.444 -3.117  -10.721 1.00 0.00 ? 12  ILE A HB   4  
ATOM   8844  H  HG12 . ILE A 1 12 ? 143.179 -0.274  -9.684  1.00 0.00 ? 12  ILE A HG12 4  
ATOM   8845  H  HG13 . ILE A 1 12 ? 143.985 -1.583  -8.819  1.00 0.00 ? 12  ILE A HG13 4  
ATOM   8846  H  HG21 . ILE A 1 12 ? 143.268 -1.196  -12.393 1.00 0.00 ? 12  ILE A HG21 4  
ATOM   8847  H  HG22 . ILE A 1 12 ? 141.675 -0.870  -11.710 1.00 0.00 ? 12  ILE A HG22 4  
ATOM   8848  H  HG23 . ILE A 1 12 ? 142.000 -2.416  -12.496 1.00 0.00 ? 12  ILE A HG23 4  
ATOM   8849  H  HD11 . ILE A 1 12 ? 145.870 -1.307  -10.026 1.00 0.00 ? 12  ILE A HD11 4  
ATOM   8850  H  HD12 . ILE A 1 12 ? 145.155 0.163   -10.685 1.00 0.00 ? 12  ILE A HD12 4  
ATOM   8851  H  HD13 . ILE A 1 12 ? 144.987 -1.365  -11.552 1.00 0.00 ? 12  ILE A HD13 4  
ATOM   8852  N  N    . ASN A 1 13 ? 141.073 -4.791  -10.432 1.00 0.00 ? 13  ASN A N    4  
ATOM   8853  C  CA   . ASN A 1 13 ? 140.254 -5.778  -11.124 1.00 0.00 ? 13  ASN A CA   4  
ATOM   8854  C  C    . ASN A 1 13 ? 138.841 -5.837  -10.555 1.00 0.00 ? 13  ASN A C    4  
ATOM   8855  O  O    . ASN A 1 13 ? 137.863 -5.929  -11.305 1.00 0.00 ? 13  ASN A O    4  
ATOM   8856  C  CB   . ASN A 1 13 ? 140.904 -7.158  -11.016 1.00 0.00 ? 13  ASN A CB   4  
ATOM   8857  C  CG   . ASN A 1 13 ? 142.245 -7.162  -11.741 1.00 0.00 ? 13  ASN A CG   4  
ATOM   8858  O  OD1  . ASN A 1 13 ? 142.511 -6.283  -12.562 1.00 0.00 ? 13  ASN A OD1  4  
ATOM   8859  N  ND2  . ASN A 1 13 ? 143.113 -8.102  -11.487 1.00 0.00 ? 13  ASN A ND2  4  
ATOM   8860  H  H    . ASN A 1 13 ? 141.893 -5.072  -9.975  1.00 0.00 ? 13  ASN A H    4  
ATOM   8861  H  HA   . ASN A 1 13 ? 140.196 -5.509  -12.168 1.00 0.00 ? 13  ASN A HA   4  
ATOM   8862  H  HB2  . ASN A 1 13 ? 141.060 -7.400  -9.973  1.00 0.00 ? 13  ASN A HB2  4  
ATOM   8863  H  HB3  . ASN A 1 13 ? 140.255 -7.897  -11.461 1.00 0.00 ? 13  ASN A HB3  4  
ATOM   8864  H  HD21 . ASN A 1 13 ? 142.901 -8.801  -10.833 1.00 0.00 ? 13  ASN A HD21 4  
ATOM   8865  H  HD22 . ASN A 1 13 ? 143.978 -8.110  -11.950 1.00 0.00 ? 13  ASN A HD22 4  
ATOM   8866  N  N    . VAL A 1 14 ? 138.723 -5.767  -9.229  1.00 0.00 ? 14  VAL A N    4  
ATOM   8867  C  CA   . VAL A 1 14 ? 137.404 -5.806  -8.617  1.00 0.00 ? 14  VAL A CA   4  
ATOM   8868  C  C    . VAL A 1 14 ? 136.675 -4.492  -8.845  1.00 0.00 ? 14  VAL A C    4  
ATOM   8869  O  O    . VAL A 1 14 ? 135.471 -4.481  -9.094  1.00 0.00 ? 14  VAL A O    4  
ATOM   8870  C  CB   . VAL A 1 14 ? 137.498 -6.122  -7.119  1.00 0.00 ? 14  VAL A CB   4  
ATOM   8871  C  CG1  . VAL A 1 14 ? 138.191 -7.473  -6.928  1.00 0.00 ? 14  VAL A CG1  4  
ATOM   8872  C  CG2  . VAL A 1 14 ? 138.311 -5.042  -6.406  1.00 0.00 ? 14  VAL A CG2  4  
ATOM   8873  H  H    . VAL A 1 14 ? 139.522 -5.681  -8.668  1.00 0.00 ? 14  VAL A H    4  
ATOM   8874  H  HA   . VAL A 1 14 ? 136.836 -6.592  -9.094  1.00 0.00 ? 14  VAL A HA   4  
ATOM   8875  H  HB   . VAL A 1 14 ? 136.505 -6.165  -6.698  1.00 0.00 ? 14  VAL A HB   4  
ATOM   8876  H  HG11 . VAL A 1 14 ? 137.857 -8.160  -7.693  1.00 0.00 ? 14  VAL A HG11 4  
ATOM   8877  H  HG12 . VAL A 1 14 ? 137.942 -7.872  -5.955  1.00 0.00 ? 14  VAL A HG12 4  
ATOM   8878  H  HG13 . VAL A 1 14 ? 139.260 -7.346  -7.000  1.00 0.00 ? 14  VAL A HG13 4  
ATOM   8879  H  HG21 . VAL A 1 14 ? 138.307 -5.233  -5.341  1.00 0.00 ? 14  VAL A HG21 4  
ATOM   8880  H  HG22 . VAL A 1 14 ? 137.875 -4.074  -6.601  1.00 0.00 ? 14  VAL A HG22 4  
ATOM   8881  H  HG23 . VAL A 1 14 ? 139.323 -5.065  -6.770  1.00 0.00 ? 14  VAL A HG23 4  
ATOM   8882  N  N    . PHE A 1 15 ? 137.404 -3.379  -8.786  1.00 0.00 ? 15  PHE A N    4  
ATOM   8883  C  CA   . PHE A 1 15 ? 136.766 -2.091  -9.018  1.00 0.00 ? 15  PHE A CA   4  
ATOM   8884  C  C    . PHE A 1 15 ? 136.170 -2.059  -10.423 1.00 0.00 ? 15  PHE A C    4  
ATOM   8885  O  O    . PHE A 1 15 ? 135.003 -1.703  -10.612 1.00 0.00 ? 15  PHE A O    4  
ATOM   8886  C  CB   . PHE A 1 15 ? 137.802 -0.973  -8.870  1.00 0.00 ? 15  PHE A CB   4  
ATOM   8887  C  CG   . PHE A 1 15 ? 137.130 0.376   -8.981  1.00 0.00 ? 15  PHE A CG   4  
ATOM   8888  C  CD1  . PHE A 1 15 ? 136.575 0.983   -7.846  1.00 0.00 ? 15  PHE A CD1  4  
ATOM   8889  C  CD2  . PHE A 1 15 ? 137.072 1.027   -10.218 1.00 0.00 ? 15  PHE A CD2  4  
ATOM   8890  C  CE1  . PHE A 1 15 ? 135.964 2.238   -7.953  1.00 0.00 ? 15  PHE A CE1  4  
ATOM   8891  C  CE2  . PHE A 1 15 ? 136.460 2.280   -10.325 1.00 0.00 ? 15  PHE A CE2  4  
ATOM   8892  C  CZ   . PHE A 1 15 ? 135.906 2.886   -9.191  1.00 0.00 ? 15  PHE A CZ   4  
ATOM   8893  H  H    . PHE A 1 15 ? 138.373 -3.425  -8.596  1.00 0.00 ? 15  PHE A H    4  
ATOM   8894  H  HA   . PHE A 1 15 ? 135.980 -1.946  -8.292  1.00 0.00 ? 15  PHE A HA   4  
ATOM   8895  H  HB2  . PHE A 1 15 ? 138.282 -1.056  -7.906  1.00 0.00 ? 15  PHE A HB2  4  
ATOM   8896  H  HB3  . PHE A 1 15 ? 138.544 -1.067  -9.649  1.00 0.00 ? 15  PHE A HB3  4  
ATOM   8897  H  HD1  . PHE A 1 15 ? 136.618 0.483   -6.892  1.00 0.00 ? 15  PHE A HD1  4  
ATOM   8898  H  HD2  . PHE A 1 15 ? 137.500 0.560   -11.091 1.00 0.00 ? 15  PHE A HD2  4  
ATOM   8899  H  HE1  . PHE A 1 15 ? 135.540 2.707   -7.078  1.00 0.00 ? 15  PHE A HE1  4  
ATOM   8900  H  HE2  . PHE A 1 15 ? 136.415 2.780   -11.281 1.00 0.00 ? 15  PHE A HE2  4  
ATOM   8901  H  HZ   . PHE A 1 15 ? 135.434 3.854   -9.273  1.00 0.00 ? 15  PHE A HZ   4  
ATOM   8902  N  N    . HIS A 1 16 ? 136.980 -2.457  -11.405 1.00 0.00 ? 16  HIS A N    4  
ATOM   8903  C  CA   . HIS A 1 16 ? 136.533 -2.492  -12.794 1.00 0.00 ? 16  HIS A CA   4  
ATOM   8904  C  C    . HIS A 1 16 ? 135.377 -3.465  -13.003 1.00 0.00 ? 16  HIS A C    4  
ATOM   8905  O  O    . HIS A 1 16 ? 134.402 -3.138  -13.682 1.00 0.00 ? 16  HIS A O    4  
ATOM   8906  C  CB   . HIS A 1 16 ? 137.693 -2.894  -13.710 1.00 0.00 ? 16  HIS A CB   4  
ATOM   8907  C  CG   . HIS A 1 16 ? 138.731 -1.801  -13.756 1.00 0.00 ? 16  HIS A CG   4  
ATOM   8908  N  ND1  . HIS A 1 16 ? 140.054 -2.060  -14.081 1.00 0.00 ? 16  HIS A ND1  4  
ATOM   8909  C  CD2  . HIS A 1 16 ? 138.656 -0.443  -13.553 1.00 0.00 ? 16  HIS A CD2  4  
ATOM   8910  C  CE1  . HIS A 1 16 ? 140.714 -0.888  -14.065 1.00 0.00 ? 16  HIS A CE1  4  
ATOM   8911  N  NE2  . HIS A 1 16 ? 139.909 0.129   -13.748 1.00 0.00 ? 16  HIS A NE2  4  
ATOM   8912  H  H    . HIS A 1 16 ? 137.892 -2.741  -11.187 1.00 0.00 ? 16  HIS A H    4  
ATOM   8913  H  HA   . HIS A 1 16 ? 136.203 -1.506  -13.075 1.00 0.00 ? 16  HIS A HA   4  
ATOM   8914  H  HB2  . HIS A 1 16 ? 138.146 -3.799  -13.336 1.00 0.00 ? 16  HIS A HB2  4  
ATOM   8915  H  HB3  . HIS A 1 16 ? 137.315 -3.070  -14.707 1.00 0.00 ? 16  HIS A HB3  4  
ATOM   8916  H  HD1  . HIS A 1 16 ? 140.438 -2.938  -14.285 1.00 0.00 ? 16  HIS A HD1  4  
ATOM   8917  H  HD2  . HIS A 1 16 ? 137.761 0.101   -13.297 1.00 0.00 ? 16  HIS A HD2  4  
ATOM   8918  H  HE1  . HIS A 1 16 ? 141.766 -0.783  -14.281 1.00 0.00 ? 16  HIS A HE1  4  
ATOM   8919  H  HE2  . HIS A 1 16 ? 140.150 1.076   -13.671 1.00 0.00 ? 16  HIS A HE2  4  
ATOM   8920  N  N    . ALA A 1 17 ? 135.494 -4.672  -12.448 1.00 0.00 ? 17  ALA A N    4  
ATOM   8921  C  CA   . ALA A 1 17 ? 134.445 -5.669  -12.638 1.00 0.00 ? 17  ALA A CA   4  
ATOM   8922  C  C    . ALA A 1 17 ? 133.132 -5.236  -12.001 1.00 0.00 ? 17  ALA A C    4  
ATOM   8923  O  O    . ALA A 1 17 ? 132.080 -5.297  -12.638 1.00 0.00 ? 17  ALA A O    4  
ATOM   8924  C  CB   . ALA A 1 17 ? 134.885 -7.004  -12.035 1.00 0.00 ? 17  ALA A CB   4  
ATOM   8925  H  H    . ALA A 1 17 ? 136.303 -4.902  -11.933 1.00 0.00 ? 17  ALA A H    4  
ATOM   8926  H  HA   . ALA A 1 17 ? 134.284 -5.807  -13.696 1.00 0.00 ? 17  ALA A HA   4  
ATOM   8927  H  HB1  . ALA A 1 17 ? 134.041 -7.677  -11.997 1.00 0.00 ? 17  ALA A HB1  4  
ATOM   8928  H  HB2  . ALA A 1 17 ? 135.261 -6.842  -11.036 1.00 0.00 ? 17  ALA A HB2  4  
ATOM   8929  H  HB3  . ALA A 1 17 ? 135.663 -7.436  -12.647 1.00 0.00 ? 17  ALA A HB3  4  
ATOM   8930  N  N    . HIS A 1 18 ? 133.186 -4.794  -10.751 1.00 0.00 ? 18  HIS A N    4  
ATOM   8931  C  CA   . HIS A 1 18 ? 131.974 -4.354  -10.077 1.00 0.00 ? 18  HIS A CA   4  
ATOM   8932  C  C    . HIS A 1 18 ? 131.348 -3.151  -10.773 1.00 0.00 ? 18  HIS A C    4  
ATOM   8933  O  O    . HIS A 1 18 ? 130.140 -3.125  -11.013 1.00 0.00 ? 18  HIS A O    4  
ATOM   8934  C  CB   . HIS A 1 18 ? 132.269 -4.017  -8.619  1.00 0.00 ? 18  HIS A CB   4  
ATOM   8935  C  CG   . HIS A 1 18 ? 132.577 -5.284  -7.864  1.00 0.00 ? 18  HIS A CG   4  
ATOM   8936  N  ND1  . HIS A 1 18 ? 133.870 -5.752  -7.684  1.00 0.00 ? 18  HIS A ND1  4  
ATOM   8937  C  CD2  . HIS A 1 18 ? 131.760 -6.195  -7.239  1.00 0.00 ? 18  HIS A CD2  4  
ATOM   8938  C  CE1  . HIS A 1 18 ? 133.793 -6.896  -6.980  1.00 0.00 ? 18  HIS A CE1  4  
ATOM   8939  N  NE2  . HIS A 1 18 ? 132.530 -7.211  -6.682  1.00 0.00 ? 18  HIS A NE2  4  
ATOM   8940  H  H    . HIS A 1 18 ? 134.046 -4.757  -10.282 1.00 0.00 ? 18  HIS A H    4  
ATOM   8941  H  HA   . HIS A 1 18 ? 131.262 -5.166  -10.098 1.00 0.00 ? 18  HIS A HA   4  
ATOM   8942  H  HB2  . HIS A 1 18 ? 133.119 -3.353  -8.571  1.00 0.00 ? 18  HIS A HB2  4  
ATOM   8943  H  HB3  . HIS A 1 18 ? 131.409 -3.536  -8.177  1.00 0.00 ? 18  HIS A HB3  4  
ATOM   8944  H  HD1  . HIS A 1 18 ? 134.688 -5.327  -8.007  1.00 0.00 ? 18  HIS A HD1  4  
ATOM   8945  H  HD2  . HIS A 1 18 ? 130.683 -6.132  -7.187  1.00 0.00 ? 18  HIS A HD2  4  
ATOM   8946  H  HE1  . HIS A 1 18 ? 134.648 -7.489  -6.692  1.00 0.00 ? 18  HIS A HE1  4  
ATOM   8947  H  HE2  . HIS A 1 18 ? 132.213 -7.990  -6.180  1.00 0.00 ? 18  HIS A HE2  4  
ATOM   8948  N  N    . SER A 1 19 ? 132.167 -2.150  -11.092 1.00 0.00 ? 19  SER A N    4  
ATOM   8949  C  CA   . SER A 1 19 ? 131.650 -0.958  -11.754 1.00 0.00 ? 19  SER A CA   4  
ATOM   8950  C  C    . SER A 1 19 ? 131.037 -1.307  -13.106 1.00 0.00 ? 19  SER A C    4  
ATOM   8951  O  O    . SER A 1 19 ? 129.990 -0.775  -13.481 1.00 0.00 ? 19  SER A O    4  
ATOM   8952  C  CB   . SER A 1 19 ? 132.774 0.058   -11.951 1.00 0.00 ? 19  SER A CB   4  
ATOM   8953  O  OG   . SER A 1 19 ? 132.226 1.278   -12.432 1.00 0.00 ? 19  SER A OG   4  
ATOM   8954  H  H    . SER A 1 19 ? 133.125 -2.212  -10.877 1.00 0.00 ? 19  SER A H    4  
ATOM   8955  H  HA   . SER A 1 19 ? 130.888 -0.515  -11.131 1.00 0.00 ? 19  SER A HA   4  
ATOM   8956  H  HB2  . SER A 1 19 ? 133.268 0.237   -11.011 1.00 0.00 ? 19  SER A HB2  4  
ATOM   8957  H  HB3  . SER A 1 19 ? 133.490 -0.333  -12.663 1.00 0.00 ? 19  SER A HB3  4  
ATOM   8958  H  HG   . SER A 1 19 ? 132.441 1.352   -13.365 1.00 0.00 ? 19  SER A HG   4  
ATOM   8959  N  N    . GLY A 1 20 ? 131.708 -2.201  -13.832 1.00 0.00 ? 20  GLY A N    4  
ATOM   8960  C  CA   . GLY A 1 20 ? 131.241 -2.625  -15.147 1.00 0.00 ? 20  GLY A CA   4  
ATOM   8961  C  C    . GLY A 1 20 ? 129.893 -3.338  -15.084 1.00 0.00 ? 20  GLY A C    4  
ATOM   8962  O  O    . GLY A 1 20 ? 129.058 -3.184  -15.975 1.00 0.00 ? 20  GLY A O    4  
ATOM   8963  H  H    . GLY A 1 20 ? 132.540 -2.580  -13.475 1.00 0.00 ? 20  GLY A H    4  
ATOM   8964  H  HA2  . GLY A 1 20 ? 131.146 -1.758  -15.782 1.00 0.00 ? 20  GLY A HA2  4  
ATOM   8965  H  HA3  . GLY A 1 20 ? 131.970 -3.296  -15.577 1.00 0.00 ? 20  GLY A HA3  4  
ATOM   8966  N  N    . LYS A 1 21 ? 129.703 -4.145  -14.046 1.00 0.00 ? 21  LYS A N    4  
ATOM   8967  C  CA   . LYS A 1 21 ? 128.466 -4.906  -13.903 1.00 0.00 ? 21  LYS A CA   4  
ATOM   8968  C  C    . LYS A 1 21 ? 127.240 -4.002  -13.844 1.00 0.00 ? 21  LYS A C    4  
ATOM   8969  O  O    . LYS A 1 21 ? 126.207 -4.311  -14.438 1.00 0.00 ? 21  LYS A O    4  
ATOM   8970  C  CB   . LYS A 1 21 ? 128.531 -5.756  -12.634 1.00 0.00 ? 21  LYS A CB   4  
ATOM   8971  C  CG   . LYS A 1 21 ? 127.289 -6.646  -12.554 1.00 0.00 ? 21  LYS A CG   4  
ATOM   8972  C  CD   . LYS A 1 21 ? 127.314 -7.451  -11.256 1.00 0.00 ? 21  LYS A CD   4  
ATOM   8973  C  CE   . LYS A 1 21 ? 126.136 -8.424  -11.244 1.00 0.00 ? 21  LYS A CE   4  
ATOM   8974  N  NZ   . LYS A 1 21 ? 125.991 -9.013  -9.882  1.00 0.00 ? 21  LYS A NZ   4  
ATOM   8975  H  H    . LYS A 1 21 ? 130.414 -4.249  -13.378 1.00 0.00 ? 21  LYS A H    4  
ATOM   8976  H  HA   . LYS A 1 21 ? 128.368 -5.566  -14.751 1.00 0.00 ? 21  LYS A HA   4  
ATOM   8977  H  HB2  . LYS A 1 21 ? 129.420 -6.373  -12.659 1.00 0.00 ? 21  LYS A HB2  4  
ATOM   8978  H  HB3  . LYS A 1 21 ? 128.565 -5.111  -11.769 1.00 0.00 ? 21  LYS A HB3  4  
ATOM   8979  H  HG2  . LYS A 1 21 ? 126.402 -6.029  -12.577 1.00 0.00 ? 21  LYS A HG2  4  
ATOM   8980  H  HG3  . LYS A 1 21 ? 127.278 -7.323  -13.394 1.00 0.00 ? 21  LYS A HG3  4  
ATOM   8981  H  HD2  . LYS A 1 21 ? 128.241 -8.003  -11.192 1.00 0.00 ? 21  LYS A HD2  4  
ATOM   8982  H  HD3  . LYS A 1 21 ? 127.234 -6.781  -10.414 1.00 0.00 ? 21  LYS A HD3  4  
ATOM   8983  H  HE2  . LYS A 1 21 ? 125.231 -7.895  -11.507 1.00 0.00 ? 21  LYS A HE2  4  
ATOM   8984  H  HE3  . LYS A 1 21 ? 126.313 -9.213  -11.961 1.00 0.00 ? 21  LYS A HE3  4  
ATOM   8985  H  HZ1  . LYS A 1 21 ? 126.085 -10.047 -9.939  1.00 0.00 ? 21  LYS A HZ1  4  
ATOM   8986  H  HZ2  . LYS A 1 21 ? 125.054 -8.771  -9.499  1.00 0.00 ? 21  LYS A HZ2  4  
ATOM   8987  H  HZ3  . LYS A 1 21 ? 126.731 -8.634  -9.260  1.00 0.00 ? 21  LYS A HZ3  4  
ATOM   8988  N  N    . GLU A 1 22 ? 127.349 -2.890  -13.124 1.00 0.00 ? 22  GLU A N    4  
ATOM   8989  C  CA   . GLU A 1 22 ? 126.225 -1.963  -13.001 1.00 0.00 ? 22  GLU A CA   4  
ATOM   8990  C  C    . GLU A 1 22 ? 126.627 -0.551  -13.415 1.00 0.00 ? 22  GLU A C    4  
ATOM   8991  O  O    . GLU A 1 22 ? 127.776 -0.145  -13.242 1.00 0.00 ? 22  GLU A O    4  
ATOM   8992  C  CB   . GLU A 1 22 ? 125.730 -1.952  -11.557 1.00 0.00 ? 22  GLU A CB   4  
ATOM   8993  C  CG   . GLU A 1 22 ? 125.255 -3.353  -11.168 1.00 0.00 ? 22  GLU A CG   4  
ATOM   8994  C  CD   . GLU A 1 22 ? 124.688 -3.337  -9.754  1.00 0.00 ? 22  GLU A CD   4  
ATOM   8995  O  OE1  . GLU A 1 22 ? 124.836 -2.325  -9.088  1.00 0.00 ? 22  GLU A OE1  4  
ATOM   8996  O  OE2  . GLU A 1 22 ? 124.114 -4.338  -9.355  1.00 0.00 ? 22  GLU A OE2  4  
ATOM   8997  H  H    . GLU A 1 22 ? 128.191 -2.692  -12.666 1.00 0.00 ? 22  GLU A H    4  
ATOM   8998  H  HA   . GLU A 1 22 ? 125.418 -2.297  -13.639 1.00 0.00 ? 22  GLU A HA   4  
ATOM   8999  H  HB2  . GLU A 1 22 ? 126.538 -1.654  -10.909 1.00 0.00 ? 22  GLU A HB2  4  
ATOM   9000  H  HB3  . GLU A 1 22 ? 124.910 -1.255  -11.460 1.00 0.00 ? 22  GLU A HB3  4  
ATOM   9001  H  HG2  . GLU A 1 22 ? 124.489 -3.677  -11.858 1.00 0.00 ? 22  GLU A HG2  4  
ATOM   9002  H  HG3  . GLU A 1 22 ? 126.089 -4.039  -11.211 1.00 0.00 ? 22  GLU A HG3  4  
ATOM   9003  N  N    . GLY A 1 23 ? 125.667 0.199   -13.947 1.00 0.00 ? 23  GLY A N    4  
ATOM   9004  C  CA   . GLY A 1 23 ? 125.929 1.570   -14.363 1.00 0.00 ? 23  GLY A CA   4  
ATOM   9005  C  C    . GLY A 1 23 ? 127.114 1.625   -15.314 1.00 0.00 ? 23  GLY A C    4  
ATOM   9006  O  O    . GLY A 1 23 ? 127.516 0.608   -15.879 1.00 0.00 ? 23  GLY A O    4  
ATOM   9007  H  H    . GLY A 1 23 ? 124.766 -0.173  -14.050 1.00 0.00 ? 23  GLY A H    4  
ATOM   9008  H  HA2  . GLY A 1 23 ? 125.054 1.965   -14.859 1.00 0.00 ? 23  GLY A HA2  4  
ATOM   9009  H  HA3  . GLY A 1 23 ? 126.146 2.171   -13.493 1.00 0.00 ? 23  GLY A HA3  4  
ATOM   9010  N  N    . ASP A 1 24 ? 127.685 2.814   -15.476 1.00 0.00 ? 24  ASP A N    4  
ATOM   9011  C  CA   . ASP A 1 24 ? 128.839 2.971   -16.348 1.00 0.00 ? 24  ASP A CA   4  
ATOM   9012  C  C    . ASP A 1 24 ? 130.075 2.365   -15.692 1.00 0.00 ? 24  ASP A C    4  
ATOM   9013  O  O    . ASP A 1 24 ? 130.320 2.572   -14.501 1.00 0.00 ? 24  ASP A O    4  
ATOM   9014  C  CB   . ASP A 1 24 ? 129.081 4.453   -16.636 1.00 0.00 ? 24  ASP A CB   4  
ATOM   9015  C  CG   . ASP A 1 24 ? 127.925 5.023   -17.451 1.00 0.00 ? 24  ASP A CG   4  
ATOM   9016  O  OD1  . ASP A 1 24 ? 127.141 4.237   -17.958 1.00 0.00 ? 24  ASP A OD1  4  
ATOM   9017  O  OD2  . ASP A 1 24 ? 127.841 6.235   -17.555 1.00 0.00 ? 24  ASP A OD2  4  
ATOM   9018  H  H    . ASP A 1 24 ? 127.334 3.590   -14.991 1.00 0.00 ? 24  ASP A H    4  
ATOM   9019  H  HA   . ASP A 1 24 ? 128.648 2.458   -17.280 1.00 0.00 ? 24  ASP A HA   4  
ATOM   9020  H  HB2  . ASP A 1 24 ? 129.161 4.990   -15.702 1.00 0.00 ? 24  ASP A HB2  4  
ATOM   9021  H  HB3  . ASP A 1 24 ? 130.000 4.564   -17.193 1.00 0.00 ? 24  ASP A HB3  4  
ATOM   9022  N  N    . LYS A 1 25 ? 130.849 1.621   -16.470 1.00 0.00 ? 25  LYS A N    4  
ATOM   9023  C  CA   . LYS A 1 25 ? 132.061 0.999   -15.952 1.00 0.00 ? 25  LYS A CA   4  
ATOM   9024  C  C    . LYS A 1 25 ? 133.033 2.053   -15.432 1.00 0.00 ? 25  LYS A C    4  
ATOM   9025  O  O    . LYS A 1 25 ? 133.708 1.852   -14.422 1.00 0.00 ? 25  LYS A O    4  
ATOM   9026  C  CB   . LYS A 1 25 ? 132.742 0.191   -17.058 1.00 0.00 ? 25  LYS A CB   4  
ATOM   9027  C  CG   . LYS A 1 25 ? 133.943 -0.559  -16.478 1.00 0.00 ? 25  LYS A CG   4  
ATOM   9028  C  CD   . LYS A 1 25 ? 134.657 -1.321  -17.597 1.00 0.00 ? 25  LYS A CD   4  
ATOM   9029  C  CE   . LYS A 1 25 ? 135.760 -2.195  -16.996 1.00 0.00 ? 25  LYS A CE   4  
ATOM   9030  N  NZ   . LYS A 1 25 ? 136.943 -1.349  -16.670 1.00 0.00 ? 25  LYS A NZ   4  
ATOM   9031  H  H    . LYS A 1 25 ? 130.606 1.492   -17.411 1.00 0.00 ? 25  LYS A H    4  
ATOM   9032  H  HA   . LYS A 1 25 ? 131.799 0.334   -15.144 1.00 0.00 ? 25  LYS A HA   4  
ATOM   9033  H  HB2  . LYS A 1 25 ? 132.039 -0.517  -17.473 1.00 0.00 ? 25  LYS A HB2  4  
ATOM   9034  H  HB3  . LYS A 1 25 ? 133.081 0.860   -17.835 1.00 0.00 ? 25  LYS A HB3  4  
ATOM   9035  H  HG2  . LYS A 1 25 ? 134.626 0.149   -16.032 1.00 0.00 ? 25  LYS A HG2  4  
ATOM   9036  H  HG3  . LYS A 1 25 ? 133.605 -1.257  -15.728 1.00 0.00 ? 25  LYS A HG3  4  
ATOM   9037  H  HD2  . LYS A 1 25 ? 133.946 -1.944  -18.118 1.00 0.00 ? 25  LYS A HD2  4  
ATOM   9038  H  HD3  . LYS A 1 25 ? 135.095 -0.618  -18.289 1.00 0.00 ? 25  LYS A HD3  4  
ATOM   9039  H  HE2  . LYS A 1 25 ? 135.395 -2.666  -16.095 1.00 0.00 ? 25  LYS A HE2  4  
ATOM   9040  H  HE3  . LYS A 1 25 ? 136.045 -2.955  -17.709 1.00 0.00 ? 25  LYS A HE3  4  
ATOM   9041  H  HZ1  . LYS A 1 25 ? 136.932 -1.113  -15.658 1.00 0.00 ? 25  LYS A HZ1  4  
ATOM   9042  H  HZ2  . LYS A 1 25 ? 136.907 -0.474  -17.232 1.00 0.00 ? 25  LYS A HZ2  4  
ATOM   9043  H  HZ3  . LYS A 1 25 ? 137.813 -1.871  -16.894 1.00 0.00 ? 25  LYS A HZ3  4  
ATOM   9044  N  N    . TYR A 1 26 ? 133.113 3.166   -16.151 1.00 0.00 ? 26  TYR A N    4  
ATOM   9045  C  CA   . TYR A 1 26 ? 134.021 4.246   -15.789 1.00 0.00 ? 26  TYR A CA   4  
ATOM   9046  C  C    . TYR A 1 26 ? 133.655 4.890   -14.453 1.00 0.00 ? 26  TYR A C    4  
ATOM   9047  O  O    . TYR A 1 26 ? 134.531 5.368   -13.733 1.00 0.00 ? 26  TYR A O    4  
ATOM   9048  C  CB   . TYR A 1 26 ? 134.019 5.310   -16.886 1.00 0.00 ? 26  TYR A CB   4  
ATOM   9049  C  CG   . TYR A 1 26 ? 134.474 4.687   -18.184 1.00 0.00 ? 26  TYR A CG   4  
ATOM   9050  C  CD1  . TYR A 1 26 ? 135.830 4.416   -18.393 1.00 0.00 ? 26  TYR A CD1  4  
ATOM   9051  C  CD2  . TYR A 1 26 ? 133.537 4.387   -19.180 1.00 0.00 ? 26  TYR A CD2  4  
ATOM   9052  C  CE1  . TYR A 1 26 ? 136.252 3.844   -19.599 1.00 0.00 ? 26  TYR A CE1  4  
ATOM   9053  C  CE2  . TYR A 1 26 ? 133.959 3.813   -20.386 1.00 0.00 ? 26  TYR A CE2  4  
ATOM   9054  C  CZ   . TYR A 1 26 ? 135.316 3.542   -20.595 1.00 0.00 ? 26  TYR A CZ   4  
ATOM   9055  O  OH   . TYR A 1 26 ? 135.732 2.977   -21.783 1.00 0.00 ? 26  TYR A OH   4  
ATOM   9056  H  H    . TYR A 1 26 ? 132.561 3.255   -16.957 1.00 0.00 ? 26  TYR A H    4  
ATOM   9057  H  HA   . TYR A 1 26 ? 135.019 3.842   -15.712 1.00 0.00 ? 26  TYR A HA   4  
ATOM   9058  H  HB2  . TYR A 1 26 ? 133.020 5.704   -17.003 1.00 0.00 ? 26  TYR A HB2  4  
ATOM   9059  H  HB3  . TYR A 1 26 ? 134.692 6.110   -16.615 1.00 0.00 ? 26  TYR A HB3  4  
ATOM   9060  H  HD1  . TYR A 1 26 ? 136.550 4.645   -17.623 1.00 0.00 ? 26  TYR A HD1  4  
ATOM   9061  H  HD2  . TYR A 1 26 ? 132.490 4.596   -19.019 1.00 0.00 ? 26  TYR A HD2  4  
ATOM   9062  H  HE1  . TYR A 1 26 ? 137.299 3.634   -19.761 1.00 0.00 ? 26  TYR A HE1  4  
ATOM   9063  H  HE2  . TYR A 1 26 ? 133.237 3.581   -21.154 1.00 0.00 ? 26  TYR A HE2  4  
ATOM   9064  H  HH   . TYR A 1 26 ? 136.651 2.718   -21.684 1.00 0.00 ? 26  TYR A HH   4  
ATOM   9065  N  N    . LYS A 1 27 ? 132.362 4.926   -14.128 1.00 0.00 ? 27  LYS A N    4  
ATOM   9066  C  CA   . LYS A 1 27 ? 131.925 5.551   -12.876 1.00 0.00 ? 27  LYS A CA   4  
ATOM   9067  C  C    . LYS A 1 27 ? 131.311 4.535   -11.916 1.00 0.00 ? 27  LYS A C    4  
ATOM   9068  O  O    . LYS A 1 27 ? 130.575 3.631   -12.323 1.00 0.00 ? 27  LYS A O    4  
ATOM   9069  C  CB   . LYS A 1 27 ? 130.896 6.640   -13.180 1.00 0.00 ? 27  LYS A CB   4  
ATOM   9070  C  CG   . LYS A 1 27 ? 131.552 7.746   -14.010 1.00 0.00 ? 27  LYS A CG   4  
ATOM   9071  C  CD   . LYS A 1 27 ? 130.558 8.892   -14.213 1.00 0.00 ? 27  LYS A CD   4  
ATOM   9072  C  CE   . LYS A 1 27 ? 131.170 9.940   -15.144 1.00 0.00 ? 27  LYS A CE   4  
ATOM   9073  N  NZ   . LYS A 1 27 ? 130.090 10.813  -15.687 1.00 0.00 ? 27  LYS A NZ   4  
ATOM   9074  H  H    . LYS A 1 27 ? 131.698 4.548   -14.740 1.00 0.00 ? 27  LYS A H    4  
ATOM   9075  H  HA   . LYS A 1 27 ? 132.775 6.010   -12.394 1.00 0.00 ? 27  LYS A HA   4  
ATOM   9076  H  HB2  . LYS A 1 27 ? 130.072 6.215   -13.733 1.00 0.00 ? 27  LYS A HB2  4  
ATOM   9077  H  HB3  . LYS A 1 27 ? 130.530 7.059   -12.254 1.00 0.00 ? 27  LYS A HB3  4  
ATOM   9078  H  HG2  . LYS A 1 27 ? 132.426 8.114   -13.492 1.00 0.00 ? 27  LYS A HG2  4  
ATOM   9079  H  HG3  . LYS A 1 27 ? 131.843 7.350   -14.971 1.00 0.00 ? 27  LYS A HG3  4  
ATOM   9080  H  HD2  . LYS A 1 27 ? 129.650 8.505   -14.652 1.00 0.00 ? 27  LYS A HD2  4  
ATOM   9081  H  HD3  . LYS A 1 27 ? 130.333 9.346   -13.260 1.00 0.00 ? 27  LYS A HD3  4  
ATOM   9082  H  HE2  . LYS A 1 27 ? 131.875 10.542  -14.592 1.00 0.00 ? 27  LYS A HE2  4  
ATOM   9083  H  HE3  . LYS A 1 27 ? 131.677 9.446   -15.959 1.00 0.00 ? 27  LYS A HE3  4  
ATOM   9084  H  HZ1  . LYS A 1 27 ? 130.222 10.931  -16.711 1.00 0.00 ? 27  LYS A HZ1  4  
ATOM   9085  H  HZ2  . LYS A 1 27 ? 130.130 11.742  -15.221 1.00 0.00 ? 27  LYS A HZ2  4  
ATOM   9086  H  HZ3  . LYS A 1 27 ? 129.166 10.374  -15.507 1.00 0.00 ? 27  LYS A HZ3  4  
ATOM   9087  N  N    . LEU A 1 28 ? 131.609 4.716   -10.629 1.00 0.00 ? 28  LEU A N    4  
ATOM   9088  C  CA   . LEU A 1 28 ? 131.077 3.845   -9.588  1.00 0.00 ? 28  LEU A CA   4  
ATOM   9089  C  C    . LEU A 1 28 ? 130.074 4.621   -8.740  1.00 0.00 ? 28  LEU A C    4  
ATOM   9090  O  O    . LEU A 1 28 ? 130.349 5.744   -8.316  1.00 0.00 ? 28  LEU A O    4  
ATOM   9091  C  CB   . LEU A 1 28 ? 132.221 3.298   -8.715  1.00 0.00 ? 28  LEU A CB   4  
ATOM   9092  C  CG   . LEU A 1 28 ? 131.698 2.178   -7.794  1.00 0.00 ? 28  LEU A CG   4  
ATOM   9093  C  CD1  . LEU A 1 28 ? 132.807 1.155   -7.533  1.00 0.00 ? 28  LEU A CD1  4  
ATOM   9094  C  CD2  . LEU A 1 28 ? 131.263 2.768   -6.448  1.00 0.00 ? 28  LEU A CD2  4  
ATOM   9095  H  H    . LEU A 1 28 ? 132.185 5.467   -10.371 1.00 0.00 ? 28  LEU A H    4  
ATOM   9096  H  HA   . LEU A 1 28 ? 130.565 3.014   -10.056 1.00 0.00 ? 28  LEU A HA   4  
ATOM   9097  H  HB2  . LEU A 1 28 ? 132.999 2.906   -9.356  1.00 0.00 ? 28  LEU A HB2  4  
ATOM   9098  H  HB3  . LEU A 1 28 ? 132.627 4.098   -8.113  1.00 0.00 ? 28  LEU A HB3  4  
ATOM   9099  H  HG   . LEU A 1 28 ? 130.857 1.684   -8.259  1.00 0.00 ? 28  LEU A HG   4  
ATOM   9100  H  HD11 . LEU A 1 28 ? 133.239 0.840   -8.471  1.00 0.00 ? 28  LEU A HD11 4  
ATOM   9101  H  HD12 . LEU A 1 28 ? 132.392 0.298   -7.025  1.00 0.00 ? 28  LEU A HD12 4  
ATOM   9102  H  HD13 . LEU A 1 28 ? 133.570 1.603   -6.917  1.00 0.00 ? 28  LEU A HD13 4  
ATOM   9103  H  HD21 . LEU A 1 28 ? 131.020 1.965   -5.769  1.00 0.00 ? 28  LEU A HD21 4  
ATOM   9104  H  HD22 . LEU A 1 28 ? 130.398 3.393   -6.585  1.00 0.00 ? 28  LEU A HD22 4  
ATOM   9105  H  HD23 . LEU A 1 28 ? 132.069 3.355   -6.033  1.00 0.00 ? 28  LEU A HD23 4  
ATOM   9106  N  N    . SER A 1 29 ? 128.916 4.022   -8.489  1.00 0.00 ? 29  SER A N    4  
ATOM   9107  C  CA   . SER A 1 29 ? 127.887 4.672   -7.681  1.00 0.00 ? 29  SER A CA   4  
ATOM   9108  C  C    . SER A 1 29 ? 127.869 4.048   -6.293  1.00 0.00 ? 29  SER A C    4  
ATOM   9109  O  O    . SER A 1 29 ? 128.228 2.882   -6.126  1.00 0.00 ? 29  SER A O    4  
ATOM   9110  C  CB   . SER A 1 29 ? 126.516 4.508   -8.339  1.00 0.00 ? 29  SER A CB   4  
ATOM   9111  O  OG   . SER A 1 29 ? 126.548 5.082   -9.639  1.00 0.00 ? 29  SER A OG   4  
ATOM   9112  H  H    . SER A 1 29 ? 128.750 3.125   -8.847  1.00 0.00 ? 29  SER A H    4  
ATOM   9113  H  HA   . SER A 1 29 ? 128.112 5.725   -7.593  1.00 0.00 ? 29  SER A HA   4  
ATOM   9114  H  HB2  . SER A 1 29 ? 126.277 3.462   -8.420  1.00 0.00 ? 29  SER A HB2  4  
ATOM   9115  H  HB3  . SER A 1 29 ? 125.767 5.001   -7.734  1.00 0.00 ? 29  SER A HB3  4  
ATOM   9116  H  HG   . SER A 1 29 ? 126.881 5.979   -9.559  1.00 0.00 ? 29  SER A HG   4  
ATOM   9117  N  N    . LYS A 1 30 ? 127.481 4.815   -5.283  1.00 0.00 ? 30  LYS A N    4  
ATOM   9118  C  CA   . LYS A 1 30 ? 127.487 4.258   -3.946  1.00 0.00 ? 30  LYS A CA   4  
ATOM   9119  C  C    . LYS A 1 30 ? 126.641 3.004   -3.921  1.00 0.00 ? 30  LYS A C    4  
ATOM   9120  O  O    . LYS A 1 30 ? 126.958 2.054   -3.215  1.00 0.00 ? 30  LYS A O    4  
ATOM   9121  C  CB   . LYS A 1 30 ? 126.921 5.207   -2.901  1.00 0.00 ? 30  LYS A CB   4  
ATOM   9122  C  CG   . LYS A 1 30 ? 127.210 4.595   -1.526  1.00 0.00 ? 30  LYS A CG   4  
ATOM   9123  C  CD   . LYS A 1 30 ? 126.521 5.396   -0.439  1.00 0.00 ? 30  LYS A CD   4  
ATOM   9124  C  CE   . LYS A 1 30 ? 127.110 5.021   0.922   1.00 0.00 ? 30  LYS A CE   4  
ATOM   9125  N  NZ   . LYS A 1 30 ? 127.513 3.587   0.911   1.00 0.00 ? 30  LYS A NZ   4  
ATOM   9126  H  H    . LYS A 1 30 ? 127.218 5.747   -5.437  1.00 0.00 ? 30  LYS A H    4  
ATOM   9127  H  HA   . LYS A 1 30 ? 128.501 4.007   -3.680  1.00 0.00 ? 30  LYS A HA   4  
ATOM   9128  H  HB2  . LYS A 1 30 ? 127.400 6.173   -2.985  1.00 0.00 ? 30  LYS A HB2  4  
ATOM   9129  H  HB3  . LYS A 1 30 ? 125.856 5.311   -3.036  1.00 0.00 ? 30  LYS A HB3  4  
ATOM   9130  H  HG2  . LYS A 1 30 ? 126.850 3.578   -1.497  1.00 0.00 ? 30  LYS A HG2  4  
ATOM   9131  H  HG3  . LYS A 1 30 ? 128.275 4.600   -1.350  1.00 0.00 ? 30  LYS A HG3  4  
ATOM   9132  H  HD2  . LYS A 1 30 ? 126.642 6.444   -0.626  1.00 0.00 ? 30  LYS A HD2  4  
ATOM   9133  H  HD3  . LYS A 1 30 ? 125.479 5.147   -0.446  1.00 0.00 ? 30  LYS A HD3  4  
ATOM   9134  H  HE2  . LYS A 1 30 ? 127.975 5.636   1.122   1.00 0.00 ? 30  LYS A HE2  4  
ATOM   9135  H  HE3  . LYS A 1 30 ? 126.371 5.184   1.692   1.00 0.00 ? 30  LYS A HE3  4  
ATOM   9136  H  HZ1  . LYS A 1 30 ? 127.725 3.278   1.881   1.00 0.00 ? 30  LYS A HZ1  4  
ATOM   9137  H  HZ2  . LYS A 1 30 ? 128.360 3.471   0.318   1.00 0.00 ? 30  LYS A HZ2  4  
ATOM   9138  H  HZ3  . LYS A 1 30 ? 126.738 3.011   0.527   1.00 0.00 ? 30  LYS A HZ3  4  
ATOM   9139  N  N    . LYS A 1 31 ? 125.556 2.995   -4.685  1.00 0.00 ? 31  LYS A N    4  
ATOM   9140  C  CA   . LYS A 1 31 ? 124.707 1.822   -4.692  1.00 0.00 ? 31  LYS A CA   4  
ATOM   9141  C  C    . LYS A 1 31 ? 125.566 0.628   -5.055  1.00 0.00 ? 31  LYS A C    4  
ATOM   9142  O  O    . LYS A 1 31 ? 125.457 -0.436  -4.445  1.00 0.00 ? 31  LYS A O    4  
ATOM   9143  C  CB   . LYS A 1 31 ? 123.577 1.991   -5.716  1.00 0.00 ? 31  LYS A CB   4  
ATOM   9144  C  CG   . LYS A 1 31 ? 122.619 0.791   -5.664  1.00 0.00 ? 31  LYS A CG   4  
ATOM   9145  C  CD   . LYS A 1 31 ? 121.693 0.896   -4.447  1.00 0.00 ? 31  LYS A CD   4  
ATOM   9146  C  CE   . LYS A 1 31 ? 120.663 -0.234  -4.494  1.00 0.00 ? 31  LYS A CE   4  
ATOM   9147  N  NZ   . LYS A 1 31 ? 119.777 -0.050  -5.678  1.00 0.00 ? 31  LYS A NZ   4  
ATOM   9148  H  H    . LYS A 1 31 ? 125.329 3.775   -5.233  1.00 0.00 ? 31  LYS A H    4  
ATOM   9149  H  HA   . LYS A 1 31 ? 124.292 1.681   -3.709  1.00 0.00 ? 31  LYS A HA   4  
ATOM   9150  H  HB2  . LYS A 1 31 ? 123.029 2.894   -5.496  1.00 0.00 ? 31  LYS A HB2  4  
ATOM   9151  H  HB3  . LYS A 1 31 ? 124.002 2.064   -6.706  1.00 0.00 ? 31  LYS A HB3  4  
ATOM   9152  H  HG2  . LYS A 1 31 ? 122.024 0.772   -6.565  1.00 0.00 ? 31  LYS A HG2  4  
ATOM   9153  H  HG3  . LYS A 1 31 ? 123.193 -0.121  -5.596  1.00 0.00 ? 31  LYS A HG3  4  
ATOM   9154  H  HD2  . LYS A 1 31 ? 122.269 0.812   -3.539  1.00 0.00 ? 31  LYS A HD2  4  
ATOM   9155  H  HD3  . LYS A 1 31 ? 121.180 1.846   -4.464  1.00 0.00 ? 31  LYS A HD3  4  
ATOM   9156  H  HE2  . LYS A 1 31 ? 121.172 -1.182  -4.568  1.00 0.00 ? 31  LYS A HE2  4  
ATOM   9157  H  HE3  . LYS A 1 31 ? 120.067 -0.215  -3.593  1.00 0.00 ? 31  LYS A HE3  4  
ATOM   9158  H  HZ1  . LYS A 1 31 ? 118.784 -0.046  -5.372  1.00 0.00 ? 31  LYS A HZ1  4  
ATOM   9159  H  HZ2  . LYS A 1 31 ? 119.931 -0.832  -6.349  1.00 0.00 ? 31  LYS A HZ2  4  
ATOM   9160  H  HZ3  . LYS A 1 31 ? 119.999 0.853   -6.141  1.00 0.00 ? 31  LYS A HZ3  4  
ATOM   9161  N  N    . GLU A 1 32 ? 126.462 0.825   -6.016  1.00 0.00 ? 32  GLU A N    4  
ATOM   9162  C  CA   . GLU A 1 32 ? 127.373 -0.238  -6.393  1.00 0.00 ? 32  GLU A CA   4  
ATOM   9163  C  C    . GLU A 1 32 ? 128.313 -0.521  -5.227  1.00 0.00 ? 32  GLU A C    4  
ATOM   9164  O  O    . GLU A 1 32 ? 128.690 -1.668  -4.975  1.00 0.00 ? 32  GLU A O    4  
ATOM   9165  C  CB   . GLU A 1 32 ? 128.207 0.174   -7.613  1.00 0.00 ? 32  GLU A CB   4  
ATOM   9166  C  CG   . GLU A 1 32 ? 127.300 0.395   -8.822  1.00 0.00 ? 32  GLU A CG   4  
ATOM   9167  C  CD   . GLU A 1 32 ? 128.147 0.730   -10.052 1.00 0.00 ? 32  GLU A CD   4  
ATOM   9168  O  OE1  . GLU A 1 32 ? 129.338 0.932   -9.889  1.00 0.00 ? 32  GLU A OE1  4  
ATOM   9169  O  OE2  . GLU A 1 32 ? 127.593 0.780   -11.138 1.00 0.00 ? 32  GLU A OE2  4  
ATOM   9170  H  H    . GLU A 1 32 ? 126.536 1.704   -6.442  1.00 0.00 ? 32  GLU A H    4  
ATOM   9171  H  HA   . GLU A 1 32 ? 126.811 -1.129  -6.627  1.00 0.00 ? 32  GLU A HA   4  
ATOM   9172  H  HB2  . GLU A 1 32 ? 128.743 1.083   -7.394  1.00 0.00 ? 32  GLU A HB2  4  
ATOM   9173  H  HB3  . GLU A 1 32 ? 128.916 -0.610  -7.840  1.00 0.00 ? 32  GLU A HB3  4  
ATOM   9174  H  HG2  . GLU A 1 32 ? 126.728 -0.500  -9.006  1.00 0.00 ? 32  GLU A HG2  4  
ATOM   9175  H  HG3  . GLU A 1 32 ? 126.626 1.214   -8.619  1.00 0.00 ? 32  GLU A HG3  4  
ATOM   9176  N  N    . LEU A 1 33 ? 128.710 0.553   -4.530  1.00 0.00 ? 33  LEU A N    4  
ATOM   9177  C  CA   . LEU A 1 33 ? 129.635 0.415   -3.408  1.00 0.00 ? 33  LEU A CA   4  
ATOM   9178  C  C    . LEU A 1 33 ? 129.050 -0.434  -2.285  1.00 0.00 ? 33  LEU A C    4  
ATOM   9179  O  O    . LEU A 1 33 ? 129.739 -1.290  -1.739  1.00 0.00 ? 33  LEU A O    4  
ATOM   9180  C  CB   . LEU A 1 33 ? 129.983 1.800   -2.852  1.00 0.00 ? 33  LEU A CB   4  
ATOM   9181  C  CG   . LEU A 1 33 ? 131.061 1.675   -1.764  1.00 0.00 ? 33  LEU A CG   4  
ATOM   9182  C  CD1  . LEU A 1 33 ? 132.406 1.315   -2.405  1.00 0.00 ? 33  LEU A CD1  4  
ATOM   9183  C  CD2  . LEU A 1 33 ? 131.200 3.010   -1.017  1.00 0.00 ? 33  LEU A CD2  4  
ATOM   9184  H  H    . LEU A 1 33 ? 128.391 1.446   -4.793  1.00 0.00 ? 33  LEU A H    4  
ATOM   9185  H  HA   . LEU A 1 33 ? 130.541 -0.050  -3.762  1.00 0.00 ? 33  LEU A HA   4  
ATOM   9186  H  HB2  . LEU A 1 33 ? 130.341 2.432   -3.649  1.00 0.00 ? 33  LEU A HB2  4  
ATOM   9187  H  HB3  . LEU A 1 33 ? 129.095 2.235   -2.420  1.00 0.00 ? 33  LEU A HB3  4  
ATOM   9188  H  HG   . LEU A 1 33 ? 130.783 0.902   -1.063  1.00 0.00 ? 33  LEU A HG   4  
ATOM   9189  H  HD11 . LEU A 1 33 ? 133.209 1.609   -1.745  1.00 0.00 ? 33  LEU A HD11 4  
ATOM   9190  H  HD12 . LEU A 1 33 ? 132.508 1.833   -3.347  1.00 0.00 ? 33  LEU A HD12 4  
ATOM   9191  H  HD13 . LEU A 1 33 ? 132.452 0.249   -2.573  1.00 0.00 ? 33  LEU A HD13 4  
ATOM   9192  H  HD21 . LEU A 1 33 ? 131.536 2.821   -0.010  1.00 0.00 ? 33  LEU A HD21 4  
ATOM   9193  H  HD22 . LEU A 1 33 ? 130.246 3.513   -0.986  1.00 0.00 ? 33  LEU A HD22 4  
ATOM   9194  H  HD23 . LEU A 1 33 ? 131.920 3.636   -1.524  1.00 0.00 ? 33  LEU A HD23 4  
ATOM   9195  N  N    . LYS A 1 34 ? 127.786 -0.212  -1.928  1.00 0.00 ? 34  LYS A N    4  
ATOM   9196  C  CA   . LYS A 1 34 ? 127.205 -1.005  -0.856  1.00 0.00 ? 34  LYS A CA   4  
ATOM   9197  C  C    . LYS A 1 34 ? 127.233 -2.482  -1.220  1.00 0.00 ? 34  LYS A C    4  
ATOM   9198  O  O    . LYS A 1 34 ? 127.567 -3.334  -0.393  1.00 0.00 ? 34  LYS A O    4  
ATOM   9199  C  CB   . LYS A 1 34 ? 125.756 -0.578  -0.604  1.00 0.00 ? 34  LYS A CB   4  
ATOM   9200  C  CG   . LYS A 1 34 ? 125.720 0.865   -0.099  1.00 0.00 ? 34  LYS A CG   4  
ATOM   9201  C  CD   . LYS A 1 34 ? 124.280 1.237   0.262   1.00 0.00 ? 34  LYS A CD   4  
ATOM   9202  C  CE   . LYS A 1 34 ? 124.212 2.714   0.653   1.00 0.00 ? 34  LYS A CE   4  
ATOM   9203  N  NZ   . LYS A 1 34 ? 123.022 2.944   1.522   1.00 0.00 ? 34  LYS A NZ   4  
ATOM   9204  H  H    . LYS A 1 34 ? 127.255 0.495   -2.372  1.00 0.00 ? 34  LYS A H    4  
ATOM   9205  H  HA   . LYS A 1 34 ? 127.777 -0.852  0.047   1.00 0.00 ? 34  LYS A HA   4  
ATOM   9206  H  HB2  . LYS A 1 34 ? 125.196 -0.650  -1.525  1.00 0.00 ? 34  LYS A HB2  4  
ATOM   9207  H  HB3  . LYS A 1 34 ? 125.315 -1.228  0.137   1.00 0.00 ? 34  LYS A HB3  4  
ATOM   9208  H  HG2  . LYS A 1 34 ? 126.348 0.956   0.776   1.00 0.00 ? 34  LYS A HG2  4  
ATOM   9209  H  HG3  . LYS A 1 34 ? 126.078 1.526   -0.872  1.00 0.00 ? 34  LYS A HG3  4  
ATOM   9210  H  HD2  . LYS A 1 34 ? 123.638 1.060   -0.589  1.00 0.00 ? 34  LYS A HD2  4  
ATOM   9211  H  HD3  . LYS A 1 34 ? 123.949 0.632   1.093   1.00 0.00 ? 34  LYS A HD3  4  
ATOM   9212  H  HE2  . LYS A 1 34 ? 125.108 2.986   1.191   1.00 0.00 ? 34  LYS A HE2  4  
ATOM   9213  H  HE3  . LYS A 1 34 ? 124.129 3.318   -0.238  1.00 0.00 ? 34  LYS A HE3  4  
ATOM   9214  H  HZ1  . LYS A 1 34 ? 122.937 2.167   2.206   1.00 0.00 ? 34  LYS A HZ1  4  
ATOM   9215  H  HZ2  . LYS A 1 34 ? 122.166 2.983   0.931   1.00 0.00 ? 34  LYS A HZ2  4  
ATOM   9216  H  HZ3  . LYS A 1 34 ? 123.134 3.843   2.032   1.00 0.00 ? 34  LYS A HZ3  4  
ATOM   9217  N  N    . GLU A 1 35 ? 126.896 -2.782  -2.468  1.00 0.00 ? 35  GLU A N    4  
ATOM   9218  C  CA   . GLU A 1 35 ? 126.895 -4.161  -2.923  1.00 0.00 ? 35  GLU A CA   4  
ATOM   9219  C  C    . GLU A 1 35 ? 128.300 -4.747  -2.918  1.00 0.00 ? 35  GLU A C    4  
ATOM   9220  O  O    . GLU A 1 35 ? 128.493 -5.909  -2.557  1.00 0.00 ? 35  GLU A O    4  
ATOM   9221  C  CB   . GLU A 1 35 ? 126.314 -4.240  -4.336  1.00 0.00 ? 35  GLU A CB   4  
ATOM   9222  C  CG   . GLU A 1 35 ? 126.183 -5.706  -4.757  1.00 0.00 ? 35  GLU A CG   4  
ATOM   9223  C  CD   . GLU A 1 35 ? 125.699 -5.794  -6.200  1.00 0.00 ? 35  GLU A CD   4  
ATOM   9224  O  OE1  . GLU A 1 35 ? 125.515 -4.751  -6.806  1.00 0.00 ? 35  GLU A OE1  4  
ATOM   9225  O  OE2  . GLU A 1 35 ? 125.520 -6.902  -6.678  1.00 0.00 ? 35  GLU A OE2  4  
ATOM   9226  H  H    . GLU A 1 35 ? 126.648 -2.066  -3.090  1.00 0.00 ? 35  GLU A H    4  
ATOM   9227  H  HA   . GLU A 1 35 ? 126.273 -4.745  -2.263  1.00 0.00 ? 35  GLU A HA   4  
ATOM   9228  H  HB2  . GLU A 1 35 ? 125.340 -3.772  -4.352  1.00 0.00 ? 35  GLU A HB2  4  
ATOM   9229  H  HB3  . GLU A 1 35 ? 126.971 -3.729  -5.025  1.00 0.00 ? 35  GLU A HB3  4  
ATOM   9230  H  HG2  . GLU A 1 35 ? 127.145 -6.191  -4.670  1.00 0.00 ? 35  GLU A HG2  4  
ATOM   9231  H  HG3  . GLU A 1 35 ? 125.474 -6.202  -4.111  1.00 0.00 ? 35  GLU A HG3  4  
ATOM   9232  N  N    . LEU A 1 36 ? 129.282 -3.950  -3.338  1.00 0.00 ? 36  LEU A N    4  
ATOM   9233  C  CA   . LEU A 1 36 ? 130.654 -4.439  -3.384  1.00 0.00 ? 36  LEU A CA   4  
ATOM   9234  C  C    . LEU A 1 36 ? 131.171 -4.750  -1.984  1.00 0.00 ? 36  LEU A C    4  
ATOM   9235  O  O    . LEU A 1 36 ? 131.811 -5.778  -1.767  1.00 0.00 ? 36  LEU A O    4  
ATOM   9236  C  CB   . LEU A 1 36 ? 131.551 -3.381  -4.043  1.00 0.00 ? 36  LEU A CB   4  
ATOM   9237  C  CG   . LEU A 1 36 ? 132.932 -3.975  -4.393  1.00 0.00 ? 36  LEU A CG   4  
ATOM   9238  C  CD1  . LEU A 1 36 ? 133.532 -3.217  -5.581  1.00 0.00 ? 36  LEU A CD1  4  
ATOM   9239  C  CD2  . LEU A 1 36 ? 133.895 -3.836  -3.211  1.00 0.00 ? 36  LEU A CD2  4  
ATOM   9240  H  H    . LEU A 1 36 ? 129.079 -3.035  -3.631  1.00 0.00 ? 36  LEU A H    4  
ATOM   9241  H  HA   . LEU A 1 36 ? 130.683 -5.341  -3.977  1.00 0.00 ? 36  LEU A HA   4  
ATOM   9242  H  HB2  . LEU A 1 36 ? 131.069 -3.026  -4.941  1.00 0.00 ? 36  LEU A HB2  4  
ATOM   9243  H  HB3  . LEU A 1 36 ? 131.681 -2.553  -3.362  1.00 0.00 ? 36  LEU A HB3  4  
ATOM   9244  H  HG   . LEU A 1 36 ? 132.823 -5.019  -4.652  1.00 0.00 ? 36  LEU A HG   4  
ATOM   9245  H  HD11 . LEU A 1 36 ? 133.889 -2.255  -5.249  1.00 0.00 ? 36  LEU A HD11 4  
ATOM   9246  H  HD12 . LEU A 1 36 ? 132.783 -3.079  -6.341  1.00 0.00 ? 36  LEU A HD12 4  
ATOM   9247  H  HD13 . LEU A 1 36 ? 134.356 -3.784  -5.989  1.00 0.00 ? 36  LEU A HD13 4  
ATOM   9248  H  HD21 . LEU A 1 36 ? 133.886 -2.817  -2.859  1.00 0.00 ? 36  LEU A HD21 4  
ATOM   9249  H  HD22 . LEU A 1 36 ? 134.893 -4.094  -3.534  1.00 0.00 ? 36  LEU A HD22 4  
ATOM   9250  H  HD23 . LEU A 1 36 ? 133.599 -4.497  -2.414  1.00 0.00 ? 36  LEU A HD23 4  
ATOM   9251  N  N    . LEU A 1 37 ? 130.890 -3.859  -1.033  1.00 0.00 ? 37  LEU A N    4  
ATOM   9252  C  CA   . LEU A 1 37 ? 131.346 -4.069  0.335   1.00 0.00 ? 37  LEU A CA   4  
ATOM   9253  C  C    . LEU A 1 37 ? 130.637 -5.236  1.003   1.00 0.00 ? 37  LEU A C    4  
ATOM   9254  O  O    . LEU A 1 37 ? 131.271 -6.037  1.683   1.00 0.00 ? 37  LEU A O    4  
ATOM   9255  C  CB   . LEU A 1 37 ? 131.129 -2.803  1.182   1.00 0.00 ? 37  LEU A CB   4  
ATOM   9256  C  CG   . LEU A 1 37 ? 132.208 -1.729  0.914   1.00 0.00 ? 37  LEU A CG   4  
ATOM   9257  C  CD1  . LEU A 1 37 ? 133.399 -1.972  1.841   1.00 0.00 ? 37  LEU A CD1  4  
ATOM   9258  C  CD2  . LEU A 1 37 ? 132.700 -1.753  -0.537  1.00 0.00 ? 37  LEU A CD2  4  
ATOM   9259  H  H    . LEU A 1 37 ? 130.376 -3.055  -1.256  1.00 0.00 ? 37  LEU A H    4  
ATOM   9260  H  HA   . LEU A 1 37 ? 132.400 -4.290  0.319   1.00 0.00 ? 37  LEU A HA   4  
ATOM   9261  H  HB2  . LEU A 1 37 ? 130.160 -2.388  0.948   1.00 0.00 ? 37  LEU A HB2  4  
ATOM   9262  H  HB3  . LEU A 1 37 ? 131.151 -3.072  2.228   1.00 0.00 ? 37  LEU A HB3  4  
ATOM   9263  H  HG   . LEU A 1 37 ? 131.790 -0.755  1.132   1.00 0.00 ? 37  LEU A HG   4  
ATOM   9264  H  HD11 . LEU A 1 37 ? 133.781 -2.969  1.683   1.00 0.00 ? 37  LEU A HD11 4  
ATOM   9265  H  HD12 . LEU A 1 37 ? 133.082 -1.866  2.868   1.00 0.00 ? 37  LEU A HD12 4  
ATOM   9266  H  HD13 . LEU A 1 37 ? 134.174 -1.250  1.627   1.00 0.00 ? 37  LEU A HD13 4  
ATOM   9267  H  HD21 . LEU A 1 37 ? 133.351 -2.597  -0.688  1.00 0.00 ? 37  LEU A HD21 4  
ATOM   9268  H  HD22 . LEU A 1 37 ? 133.249 -0.845  -0.738  1.00 0.00 ? 37  LEU A HD22 4  
ATOM   9269  H  HD23 . LEU A 1 37 ? 131.863 -1.814  -1.208  1.00 0.00 ? 37  LEU A HD23 4  
ATOM   9270  N  N    . GLN A 1 38 ? 129.325 -5.338  0.829   1.00 0.00 ? 38  GLN A N    4  
ATOM   9271  C  CA   . GLN A 1 38 ? 128.611 -6.432  1.468   1.00 0.00 ? 38  GLN A CA   4  
ATOM   9272  C  C    . GLN A 1 38 ? 129.046 -7.791  0.926   1.00 0.00 ? 38  GLN A C    4  
ATOM   9273  O  O    . GLN A 1 38 ? 129.251 -8.731  1.691   1.00 0.00 ? 38  GLN A O    4  
ATOM   9274  C  CB   . GLN A 1 38 ? 127.104 -6.246  1.276   1.00 0.00 ? 38  GLN A CB   4  
ATOM   9275  C  CG   . GLN A 1 38 ? 126.646 -4.994  2.028   1.00 0.00 ? 38  GLN A CG   4  
ATOM   9276  C  CD   . GLN A 1 38 ? 125.158 -4.757  1.790   1.00 0.00 ? 38  GLN A CD   4  
ATOM   9277  O  OE1  . GLN A 1 38 ? 124.580 -5.321  0.862   1.00 0.00 ? 38  GLN A OE1  4  
ATOM   9278  N  NE2  . GLN A 1 38 ? 124.501 -3.950  2.578   1.00 0.00 ? 38  GLN A NE2  4  
ATOM   9279  H  H    . GLN A 1 38 ? 128.840 -4.674  0.287   1.00 0.00 ? 38  GLN A H    4  
ATOM   9280  H  HA   . GLN A 1 38 ? 128.823 -6.404  2.527   1.00 0.00 ? 38  GLN A HA   4  
ATOM   9281  H  HB2  . GLN A 1 38 ? 126.886 -6.134  0.223   1.00 0.00 ? 38  GLN A HB2  4  
ATOM   9282  H  HB3  . GLN A 1 38 ? 126.580 -7.104  1.662   1.00 0.00 ? 38  GLN A HB3  4  
ATOM   9283  H  HG2  . GLN A 1 38 ? 126.820 -5.131  3.086   1.00 0.00 ? 38  GLN A HG2  4  
ATOM   9284  H  HG3  . GLN A 1 38 ? 127.204 -4.140  1.684   1.00 0.00 ? 38  GLN A HG3  4  
ATOM   9285  H  HE21 . GLN A 1 38 ? 124.963 -3.502  3.317   1.00 0.00 ? 38  GLN A HE21 4  
ATOM   9286  H  HE22 . GLN A 1 38 ? 123.545 -3.793  2.432   1.00 0.00 ? 38  GLN A HE22 4  
ATOM   9287  N  N    . THR A 1 39 ? 129.190 -7.899  -0.391  1.00 0.00 ? 39  THR A N    4  
ATOM   9288  C  CA   . THR A 1 39 ? 129.600 -9.166  -0.993  1.00 0.00 ? 39  THR A CA   4  
ATOM   9289  C  C    . THR A 1 39 ? 131.067 -9.509  -0.730  1.00 0.00 ? 39  THR A C    4  
ATOM   9290  O  O    . THR A 1 39 ? 131.400 -10.645 -0.394  1.00 0.00 ? 39  THR A O    4  
ATOM   9291  C  CB   . THR A 1 39 ? 129.359 -9.116  -2.503  1.00 0.00 ? 39  THR A CB   4  
ATOM   9292  O  OG1  . THR A 1 39 ? 128.001 -8.783  -2.753  1.00 0.00 ? 39  THR A OG1  4  
ATOM   9293  C  CG2  . THR A 1 39 ? 129.675 -10.480 -3.118  1.00 0.00 ? 39  THR A CG2  4  
ATOM   9294  H  H    . THR A 1 39 ? 129.016 -7.122  -0.964  1.00 0.00 ? 39  THR A H    4  
ATOM   9295  H  HA   . THR A 1 39 ? 128.987 -9.953  -0.582  1.00 0.00 ? 39  THR A HA   4  
ATOM   9296  H  HB   . THR A 1 39 ? 130.000 -8.369  -2.944  1.00 0.00 ? 39  THR A HB   4  
ATOM   9297  H  HG1  . THR A 1 39 ? 127.496 -8.980  -1.960  1.00 0.00 ? 39  THR A HG1  4  
ATOM   9298  H  HG21 . THR A 1 39 ? 130.736 -10.551 -3.307  1.00 0.00 ? 39  THR A HG21 4  
ATOM   9299  H  HG22 . THR A 1 39 ? 129.136 -10.589 -4.047  1.00 0.00 ? 39  THR A HG22 4  
ATOM   9300  H  HG23 . THR A 1 39 ? 129.377 -11.261 -2.434  1.00 0.00 ? 39  THR A HG23 4  
ATOM   9301  N  N    . GLU A 1 40 ? 131.944 -8.528  -0.936  1.00 0.00 ? 40  GLU A N    4  
ATOM   9302  C  CA   . GLU A 1 40 ? 133.384 -8.741  -0.772  1.00 0.00 ? 40  GLU A CA   4  
ATOM   9303  C  C    . GLU A 1 40 ? 133.845 -8.773  0.685   1.00 0.00 ? 40  GLU A C    4  
ATOM   9304  O  O    . GLU A 1 40 ? 134.818 -9.451  1.012   1.00 0.00 ? 40  GLU A O    4  
ATOM   9305  C  CB   . GLU A 1 40 ? 134.146 -7.633  -1.504  1.00 0.00 ? 40  GLU A CB   4  
ATOM   9306  C  CG   . GLU A 1 40 ? 133.887 -7.725  -3.012  1.00 0.00 ? 40  GLU A CG   4  
ATOM   9307  C  CD   . GLU A 1 40 ? 134.400 -9.054  -3.560  1.00 0.00 ? 40  GLU A CD   4  
ATOM   9308  O  OE1  . GLU A 1 40 ? 135.207 -9.678  -2.891  1.00 0.00 ? 40  GLU A OE1  4  
ATOM   9309  O  OE2  . GLU A 1 40 ? 133.986 -9.421  -4.647  1.00 0.00 ? 40  GLU A OE2  4  
ATOM   9310  H  H    . GLU A 1 40 ? 131.621 -7.651  -1.237  1.00 0.00 ? 40  GLU A H    4  
ATOM   9311  H  HA   . GLU A 1 40 ? 133.640 -9.682  -1.227  1.00 0.00 ? 40  GLU A HA   4  
ATOM   9312  H  HB2  . GLU A 1 40 ? 133.820 -6.671  -1.140  1.00 0.00 ? 40  GLU A HB2  4  
ATOM   9313  H  HB3  . GLU A 1 40 ? 135.204 -7.746  -1.317  1.00 0.00 ? 40  GLU A HB3  4  
ATOM   9314  H  HG2  . GLU A 1 40 ? 132.826 -7.649  -3.196  1.00 0.00 ? 40  GLU A HG2  4  
ATOM   9315  H  HG3  . GLU A 1 40 ? 134.396 -6.914  -3.511  1.00 0.00 ? 40  GLU A HG3  4  
ATOM   9316  N  N    . LEU A 1 41 ? 133.201 -7.988  1.542   1.00 0.00 ? 41  LEU A N    4  
ATOM   9317  C  CA   . LEU A 1 41 ? 133.631 -7.896  2.938   1.00 0.00 ? 41  LEU A CA   4  
ATOM   9318  C  C    . LEU A 1 41 ? 132.733 -8.696  3.889   1.00 0.00 ? 41  LEU A C    4  
ATOM   9319  O  O    . LEU A 1 41 ? 131.500 -8.675  3.787   1.00 0.00 ? 41  LEU A O    4  
ATOM   9320  C  CB   . LEU A 1 41 ? 133.659 -6.425  3.369   1.00 0.00 ? 41  LEU A CB   4  
ATOM   9321  C  CG   . LEU A 1 41 ? 134.380 -6.293  4.714   1.00 0.00 ? 41  LEU A CG   4  
ATOM   9322  C  CD1  . LEU A 1 41 ? 135.906 -6.303  4.499   1.00 0.00 ? 41  LEU A CD1  4  
ATOM   9323  C  CD2  . LEU A 1 41 ? 133.954 -4.989  5.397   1.00 0.00 ? 41  LEU A CD2  4  
ATOM   9324  H  H    . LEU A 1 41 ? 132.464 -7.425  1.224   1.00 0.00 ? 41  LEU A H    4  
ATOM   9325  H  HA   . LEU A 1 41 ? 134.635 -8.286  3.016   1.00 0.00 ? 41  LEU A HA   4  
ATOM   9326  H  HB2  . LEU A 1 41 ? 134.176 -5.840  2.623   1.00 0.00 ? 41  LEU A HB2  4  
ATOM   9327  H  HB3  . LEU A 1 41 ? 132.648 -6.062  3.472   1.00 0.00 ? 41  LEU A HB3  4  
ATOM   9328  H  HG   . LEU A 1 41 ? 134.115 -7.128  5.336   1.00 0.00 ? 41  LEU A HG   4  
ATOM   9329  H  HD11 . LEU A 1 41 ? 136.301 -5.304  4.621   1.00 0.00 ? 41  LEU A HD11 4  
ATOM   9330  H  HD12 . LEU A 1 41 ? 136.136 -6.657  3.505   1.00 0.00 ? 41  LEU A HD12 4  
ATOM   9331  H  HD13 . LEU A 1 41 ? 136.363 -6.959  5.225   1.00 0.00 ? 41  LEU A HD13 4  
ATOM   9332  H  HD21 . LEU A 1 41 ? 132.876 -4.943  5.450   1.00 0.00 ? 41  LEU A HD21 4  
ATOM   9333  H  HD22 . LEU A 1 41 ? 134.323 -4.148  4.830   1.00 0.00 ? 41  LEU A HD22 4  
ATOM   9334  H  HD23 . LEU A 1 41 ? 134.364 -4.956  6.397   1.00 0.00 ? 41  LEU A HD23 4  
ATOM   9335  N  N    . SER A 1 42 ? 133.369 -9.370  4.843   1.00 0.00 ? 42  SER A N    4  
ATOM   9336  C  CA   . SER A 1 42 ? 132.642 -10.148 5.838   1.00 0.00 ? 42  SER A CA   4  
ATOM   9337  C  C    . SER A 1 42 ? 131.574 -9.259  6.455   1.00 0.00 ? 42  SER A C    4  
ATOM   9338  O  O    . SER A 1 42 ? 130.532 -9.732  6.918   1.00 0.00 ? 42  SER A O    4  
ATOM   9339  C  CB   . SER A 1 42 ? 133.596 -10.648 6.923   1.00 0.00 ? 42  SER A CB   4  
ATOM   9340  O  OG   . SER A 1 42 ? 134.652 -11.383 6.317   1.00 0.00 ? 42  SER A OG   4  
ATOM   9341  H  H    . SER A 1 42 ? 134.346 -9.325  4.890   1.00 0.00 ? 42  SER A H    4  
ATOM   9342  H  HA   . SER A 1 42 ? 132.171 -10.993 5.358   1.00 0.00 ? 42  SER A HA   4  
ATOM   9343  H  HB2  . SER A 1 42 ? 134.009 -9.808  7.456   1.00 0.00 ? 42  SER A HB2  4  
ATOM   9344  H  HB3  . SER A 1 42 ? 133.054 -11.280 7.614   1.00 0.00 ? 42  SER A HB3  4  
ATOM   9345  H  HG   . SER A 1 42 ? 134.317 -11.768 5.505   1.00 0.00 ? 42  SER A HG   4  
ATOM   9346  N  N    . GLY A 1 43 ? 131.851 -7.960  6.438   1.00 0.00 ? 43  GLY A N    4  
ATOM   9347  C  CA   . GLY A 1 43 ? 130.929 -6.971  6.969   1.00 0.00 ? 43  GLY A CA   4  
ATOM   9348  C  C    . GLY A 1 43 ? 129.503 -7.283  6.532   1.00 0.00 ? 43  GLY A C    4  
ATOM   9349  O  O    . GLY A 1 43 ? 128.553 -6.699  7.041   1.00 0.00 ? 43  GLY A O    4  
ATOM   9350  H  H    . GLY A 1 43 ? 132.692 -7.660  6.045   1.00 0.00 ? 43  GLY A H    4  
ATOM   9351  H  HA2  . GLY A 1 43 ? 130.982 -6.977  8.048   1.00 0.00 ? 43  GLY A HA2  4  
ATOM   9352  H  HA3  . GLY A 1 43 ? 131.204 -5.993  6.603   1.00 0.00 ? 43  GLY A HA3  4  
ATOM   9353  N  N    . PHE A 1 44 ? 129.349 -8.225  5.606   1.00 0.00 ? 44  PHE A N    4  
ATOM   9354  C  CA   . PHE A 1 44 ? 128.014 -8.591  5.154   1.00 0.00 ? 44  PHE A CA   4  
ATOM   9355  C  C    . PHE A 1 44 ? 127.118 -8.750  6.375   1.00 0.00 ? 44  PHE A C    4  
ATOM   9356  O  O    . PHE A 1 44 ? 125.947 -8.368  6.357   1.00 0.00 ? 44  PHE A O    4  
ATOM   9357  C  CB   . PHE A 1 44 ? 128.068 -9.930  4.410   1.00 0.00 ? 44  PHE A CB   4  
ATOM   9358  C  CG   . PHE A 1 44 ? 126.704 -10.262 3.848   1.00 0.00 ? 44  PHE A CG   4  
ATOM   9359  C  CD1  . PHE A 1 44 ? 126.351 -9.841  2.562   1.00 0.00 ? 44  PHE A CD1  4  
ATOM   9360  C  CD2  . PHE A 1 44 ? 125.797 -11.006 4.613   1.00 0.00 ? 44  PHE A CD2  4  
ATOM   9361  C  CE1  . PHE A 1 44 ? 125.091 -10.157 2.041   1.00 0.00 ? 44  PHE A CE1  4  
ATOM   9362  C  CE2  . PHE A 1 44 ? 124.537 -11.323 4.093   1.00 0.00 ? 44  PHE A CE2  4  
ATOM   9363  C  CZ   . PHE A 1 44 ? 124.183 -10.897 2.808   1.00 0.00 ? 44  PHE A CZ   4  
ATOM   9364  H  H    . PHE A 1 44 ? 130.137 -8.680  5.226   1.00 0.00 ? 44  PHE A H    4  
ATOM   9365  H  HA   . PHE A 1 44 ? 127.620 -7.826  4.503   1.00 0.00 ? 44  PHE A HA   4  
ATOM   9366  H  HB2  . PHE A 1 44 ? 128.782 -9.865  3.605   1.00 0.00 ? 44  PHE A HB2  4  
ATOM   9367  H  HB3  . PHE A 1 44 ? 128.371 -10.708 5.095   1.00 0.00 ? 44  PHE A HB3  4  
ATOM   9368  H  HD1  . PHE A 1 44 ? 127.052 -9.276  1.970   1.00 0.00 ? 44  PHE A HD1  4  
ATOM   9369  H  HD2  . PHE A 1 44 ? 126.070 -11.331 5.606   1.00 0.00 ? 44  PHE A HD2  4  
ATOM   9370  H  HE1  . PHE A 1 44 ? 124.819 -9.828  1.049   1.00 0.00 ? 44  PHE A HE1  4  
ATOM   9371  H  HE2  . PHE A 1 44 ? 123.838 -11.896 4.684   1.00 0.00 ? 44  PHE A HE2  4  
ATOM   9372  H  HZ   . PHE A 1 44 ? 123.210 -11.141 2.406   1.00 0.00 ? 44  PHE A HZ   4  
ATOM   9373  N  N    . LEU A 1 45 ? 127.687 -9.297  7.441   1.00 0.00 ? 45  LEU A N    4  
ATOM   9374  C  CA   . LEU A 1 45 ? 126.946 -9.486  8.683   1.00 0.00 ? 45  LEU A CA   4  
ATOM   9375  C  C    . LEU A 1 45 ? 126.380 -8.152  9.186   1.00 0.00 ? 45  LEU A C    4  
ATOM   9376  O  O    . LEU A 1 45 ? 125.289 -8.108  9.753   1.00 0.00 ? 45  LEU A O    4  
ATOM   9377  C  CB   . LEU A 1 45 ? 127.864 -10.091 9.749   1.00 0.00 ? 45  LEU A CB   4  
ATOM   9378  C  CG   . LEU A 1 45 ? 127.062 -10.400 11.019  1.00 0.00 ? 45  LEU A CG   4  
ATOM   9379  C  CD1  . LEU A 1 45 ? 126.133 -11.593 10.774  1.00 0.00 ? 45  LEU A CD1  4  
ATOM   9380  C  CD2  . LEU A 1 45 ? 128.029 -10.738 12.157  1.00 0.00 ? 45  LEU A CD2  4  
ATOM   9381  H  H    . LEU A 1 45 ? 128.632 -9.567  7.397   1.00 0.00 ? 45  LEU A H    4  
ATOM   9382  H  HA   . LEU A 1 45 ? 126.128 -10.166 8.501   1.00 0.00 ? 45  LEU A HA   4  
ATOM   9383  H  HB2  . LEU A 1 45 ? 128.304 -11.002 9.368   1.00 0.00 ? 45  LEU A HB2  4  
ATOM   9384  H  HB3  . LEU A 1 45 ? 128.649 -9.388  9.986   1.00 0.00 ? 45  LEU A HB3  4  
ATOM   9385  H  HG   . LEU A 1 45 ? 126.472 -9.537  11.293  1.00 0.00 ? 45  LEU A HG   4  
ATOM   9386  H  HD11 . LEU A 1 45 ? 125.888 -12.056 11.718  1.00 0.00 ? 45  LEU A HD11 4  
ATOM   9387  H  HD12 . LEU A 1 45 ? 126.626 -12.313 10.138  1.00 0.00 ? 45  LEU A HD12 4  
ATOM   9388  H  HD13 . LEU A 1 45 ? 125.227 -11.252 10.296  1.00 0.00 ? 45  LEU A HD13 4  
ATOM   9389  H  HD21 . LEU A 1 45 ? 128.504 -9.834  12.507  1.00 0.00 ? 45  LEU A HD21 4  
ATOM   9390  H  HD22 . LEU A 1 45 ? 128.781 -11.425 11.797  1.00 0.00 ? 45  LEU A HD22 4  
ATOM   9391  H  HD23 . LEU A 1 45 ? 127.482 -11.196 12.969  1.00 0.00 ? 45  LEU A HD23 4  
ATOM   9392  N  N    . ASP A 1 46 ? 127.135 -7.069  8.989   1.00 0.00 ? 46  ASP A N    4  
ATOM   9393  C  CA   . ASP A 1 46 ? 126.701 -5.745  9.445   1.00 0.00 ? 46  ASP A CA   4  
ATOM   9394  C  C    . ASP A 1 46 ? 125.768 -5.102  8.423   1.00 0.00 ? 46  ASP A C    4  
ATOM   9395  O  O    . ASP A 1 46 ? 125.465 -3.911  8.504   1.00 0.00 ? 46  ASP A O    4  
ATOM   9396  C  CB   . ASP A 1 46 ? 127.910 -4.831  9.694   1.00 0.00 ? 46  ASP A CB   4  
ATOM   9397  C  CG   . ASP A 1 46 ? 128.607 -4.464  8.384   1.00 0.00 ? 46  ASP A CG   4  
ATOM   9398  O  OD1  . ASP A 1 46 ? 127.977 -4.564  7.344   1.00 0.00 ? 46  ASP A OD1  4  
ATOM   9399  O  OD2  . ASP A 1 46 ? 129.751 -4.046  8.446   1.00 0.00 ? 46  ASP A OD2  4  
ATOM   9400  H  H    . ASP A 1 46 ? 128.002 -7.162  8.542   1.00 0.00 ? 46  ASP A H    4  
ATOM   9401  H  HA   . ASP A 1 46 ? 126.163 -5.863  10.374  1.00 0.00 ? 46  ASP A HA   4  
ATOM   9402  H  HB2  . ASP A 1 46 ? 127.575 -3.927  10.181  1.00 0.00 ? 46  ASP A HB2  4  
ATOM   9403  H  HB3  . ASP A 1 46 ? 128.611 -5.340  10.338  1.00 0.00 ? 46  ASP A HB3  4  
ATOM   9404  N  N    . ALA A 1 47 ? 125.327 -5.897  7.455   1.00 0.00 ? 47  ALA A N    4  
ATOM   9405  C  CA   . ALA A 1 47 ? 124.440 -5.402  6.408   1.00 0.00 ? 47  ALA A CA   4  
ATOM   9406  C  C    . ALA A 1 47 ? 123.163 -4.826  7.016   1.00 0.00 ? 47  ALA A C    4  
ATOM   9407  O  O    . ALA A 1 47 ? 122.507 -3.977  6.411   1.00 0.00 ? 47  ALA A O    4  
ATOM   9408  C  CB   . ALA A 1 47 ? 124.081 -6.539  5.449   1.00 0.00 ? 47  ALA A CB   4  
ATOM   9409  H  H    . ALA A 1 47 ? 125.610 -6.835  7.439   1.00 0.00 ? 47  ALA A H    4  
ATOM   9410  H  HA   . ALA A 1 47 ? 124.948 -4.628  5.855   1.00 0.00 ? 47  ALA A HA   4  
ATOM   9411  H  HB1  . ALA A 1 47 ? 123.212 -6.261  4.871   1.00 0.00 ? 47  ALA A HB1  4  
ATOM   9412  H  HB2  . ALA A 1 47 ? 123.867 -7.433  6.015   1.00 0.00 ? 47  ALA A HB2  4  
ATOM   9413  H  HB3  . ALA A 1 47 ? 124.911 -6.724  4.784   1.00 0.00 ? 47  ALA A HB3  4  
ATOM   9414  N  N    . GLN A 1 48 ? 122.815 -5.295  8.209   1.00 0.00 ? 48  GLN A N    4  
ATOM   9415  C  CA   . GLN A 1 48 ? 121.616 -4.819  8.890   1.00 0.00 ? 48  GLN A CA   4  
ATOM   9416  C  C    . GLN A 1 48 ? 121.635 -3.295  9.028   1.00 0.00 ? 48  GLN A C    4  
ATOM   9417  O  O    . GLN A 1 48 ? 122.242 -2.592  8.218   1.00 0.00 ? 48  GLN A O    4  
ATOM   9418  C  CB   . GLN A 1 48 ? 121.517 -5.455  10.278  1.00 0.00 ? 48  GLN A CB   4  
ATOM   9419  C  CG   . GLN A 1 48 ? 121.564 -6.979  10.144  1.00 0.00 ? 48  GLN A CG   4  
ATOM   9420  C  CD   . GLN A 1 48 ? 120.418 -7.459  9.261   1.00 0.00 ? 48  GLN A CD   4  
ATOM   9421  O  OE1  . GLN A 1 48 ? 119.268 -7.077  9.472   1.00 0.00 ? 48  GLN A OE1  4  
ATOM   9422  N  NE2  . GLN A 1 48 ? 120.665 -8.280  8.277   1.00 0.00 ? 48  GLN A NE2  4  
ATOM   9423  H  H    . GLN A 1 48 ? 123.376 -5.973  8.640   1.00 0.00 ? 48  GLN A H    4  
ATOM   9424  H  HA   . GLN A 1 48 ? 120.750 -5.107  8.314   1.00 0.00 ? 48  GLN A HA   4  
ATOM   9425  H  HB2  . GLN A 1 48 ? 122.346 -5.121  10.887  1.00 0.00 ? 48  GLN A HB2  4  
ATOM   9426  H  HB3  . GLN A 1 48 ? 120.587 -5.165  10.743  1.00 0.00 ? 48  GLN A HB3  4  
ATOM   9427  H  HG2  . GLN A 1 48 ? 122.505 -7.271  9.703   1.00 0.00 ? 48  GLN A HG2  4  
ATOM   9428  H  HG3  . GLN A 1 48 ? 121.472 -7.427  11.123  1.00 0.00 ? 48  GLN A HG3  4  
ATOM   9429  H  HE21 . GLN A 1 48 ? 121.581 -8.584  8.111   1.00 0.00 ? 48  GLN A HE21 4  
ATOM   9430  H  HE22 . GLN A 1 48 ? 119.934 -8.593  7.705   1.00 0.00 ? 48  GLN A HE22 4  
ATOM   9431  N  N    . LYS A 1 49 ? 120.959 -2.792  10.059  1.00 0.00 ? 49  LYS A N    4  
ATOM   9432  C  CA   . LYS A 1 49 ? 120.888 -1.351  10.288  1.00 0.00 ? 49  LYS A CA   4  
ATOM   9433  C  C    . LYS A 1 49 ? 122.284 -0.753  10.404  1.00 0.00 ? 49  LYS A C    4  
ATOM   9434  O  O    . LYS A 1 49 ? 122.497 0.416   10.082  1.00 0.00 ? 49  LYS A O    4  
ATOM   9435  C  CB   . LYS A 1 49 ? 120.099 -1.064  11.567  1.00 0.00 ? 49  LYS A CB   4  
ATOM   9436  C  CG   . LYS A 1 49 ? 120.860 -1.620  12.773  1.00 0.00 ? 49  LYS A CG   4  
ATOM   9437  C  CD   . LYS A 1 49 ? 119.985 -1.510  14.023  1.00 0.00 ? 49  LYS A CD   4  
ATOM   9438  C  CE   . LYS A 1 49 ? 119.747 -0.035  14.352  1.00 0.00 ? 49  LYS A CE   4  
ATOM   9439  N  NZ   . LYS A 1 49 ? 119.404 0.103   15.796  1.00 0.00 ? 49  LYS A NZ   4  
ATOM   9440  H  H    . LYS A 1 49 ? 120.492 -3.399  10.669  1.00 0.00 ? 49  LYS A H    4  
ATOM   9441  H  HA   . LYS A 1 49 ? 120.378 -0.889  9.456   1.00 0.00 ? 49  LYS A HA   4  
ATOM   9442  H  HB2  . LYS A 1 49 ? 119.973 0.003   11.681  1.00 0.00 ? 49  LYS A HB2  4  
ATOM   9443  H  HB3  . LYS A 1 49 ? 119.131 -1.537  11.507  1.00 0.00 ? 49  LYS A HB3  4  
ATOM   9444  H  HG2  . LYS A 1 49 ? 121.107 -2.657  12.595  1.00 0.00 ? 49  LYS A HG2  4  
ATOM   9445  H  HG3  . LYS A 1 49 ? 121.767 -1.052  12.919  1.00 0.00 ? 49  LYS A HG3  4  
ATOM   9446  H  HD2  . LYS A 1 49 ? 119.038 -1.997  13.843  1.00 0.00 ? 49  LYS A HD2  4  
ATOM   9447  H  HD3  . LYS A 1 49 ? 120.483 -1.985  14.854  1.00 0.00 ? 49  LYS A HD3  4  
ATOM   9448  H  HE2  . LYS A 1 49 ? 120.641 0.531   14.139  1.00 0.00 ? 49  LYS A HE2  4  
ATOM   9449  H  HE3  . LYS A 1 49 ? 118.932 0.341   13.752  1.00 0.00 ? 49  LYS A HE3  4  
ATOM   9450  H  HZ1  . LYS A 1 49 ? 119.521 1.094   16.087  1.00 0.00 ? 49  LYS A HZ1  4  
ATOM   9451  H  HZ2  . LYS A 1 49 ? 120.035 -0.502  16.360  1.00 0.00 ? 49  LYS A HZ2  4  
ATOM   9452  H  HZ3  . LYS A 1 49 ? 118.418 -0.187  15.948  1.00 0.00 ? 49  LYS A HZ3  4  
ATOM   9453  N  N    . ASP A 1 50 ? 123.233 -1.561  10.852  1.00 0.00 ? 50  ASP A N    4  
ATOM   9454  C  CA   . ASP A 1 50 ? 124.607 -1.099  10.989  1.00 0.00 ? 50  ASP A CA   4  
ATOM   9455  C  C    . ASP A 1 50 ? 125.101 -0.535  9.659   1.00 0.00 ? 50  ASP A C    4  
ATOM   9456  O  O    . ASP A 1 50 ? 125.872 0.427   9.626   1.00 0.00 ? 50  ASP A O    4  
ATOM   9457  C  CB   . ASP A 1 50 ? 125.509 -2.256  11.425  1.00 0.00 ? 50  ASP A CB   4  
ATOM   9458  C  CG   . ASP A 1 50 ? 125.159 -2.682  12.846  1.00 0.00 ? 50  ASP A CG   4  
ATOM   9459  O  OD1  . ASP A 1 50 ? 124.426 -1.957  13.498  1.00 0.00 ? 50  ASP A OD1  4  
ATOM   9460  O  OD2  . ASP A 1 50 ? 125.629 -3.729  13.262  1.00 0.00 ? 50  ASP A OD2  4  
ATOM   9461  H  H    . ASP A 1 50 ? 123.010 -2.486  11.085  1.00 0.00 ? 50  ASP A H    4  
ATOM   9462  H  HA   . ASP A 1 50 ? 124.646 -0.322  11.738  1.00 0.00 ? 50  ASP A HA   4  
ATOM   9463  H  HB2  . ASP A 1 50 ? 125.369 -3.091  10.755  1.00 0.00 ? 50  ASP A HB2  4  
ATOM   9464  H  HB3  . ASP A 1 50 ? 126.541 -1.938  11.391  1.00 0.00 ? 50  ASP A HB3  4  
ATOM   9465  N  N    . VAL A 1 51 ? 124.649 -1.141  8.565   1.00 0.00 ? 51  VAL A N    4  
ATOM   9466  C  CA   . VAL A 1 51 ? 125.050 -0.700  7.233   1.00 0.00 ? 51  VAL A CA   4  
ATOM   9467  C  C    . VAL A 1 51 ? 124.781 0.790   7.055   1.00 0.00 ? 51  VAL A C    4  
ATOM   9468  O  O    . VAL A 1 51 ? 125.476 1.467   6.303   1.00 0.00 ? 51  VAL A O    4  
ATOM   9469  C  CB   . VAL A 1 51 ? 124.286 -1.488  6.168   1.00 0.00 ? 51  VAL A CB   4  
ATOM   9470  C  CG1  . VAL A 1 51 ? 122.843 -0.977  6.081   1.00 0.00 ? 51  VAL A CG1  4  
ATOM   9471  C  CG2  . VAL A 1 51 ? 124.975 -1.311  4.812   1.00 0.00 ? 51  VAL A CG2  4  
ATOM   9472  H  H    . VAL A 1 51 ? 124.031 -1.902  8.653   1.00 0.00 ? 51  VAL A H    4  
ATOM   9473  H  HA   . VAL A 1 51 ? 126.107 -0.882  7.108   1.00 0.00 ? 51  VAL A HA   4  
ATOM   9474  H  HB   . VAL A 1 51 ? 124.280 -2.533  6.436   1.00 0.00 ? 51  VAL A HB   4  
ATOM   9475  H  HG11 . VAL A 1 51 ? 122.198 -1.777  5.747   1.00 0.00 ? 51  VAL A HG11 4  
ATOM   9476  H  HG12 . VAL A 1 51 ? 122.791 -0.156  5.381   1.00 0.00 ? 51  VAL A HG12 4  
ATOM   9477  H  HG13 . VAL A 1 51 ? 122.520 -0.638  7.054   1.00 0.00 ? 51  VAL A HG13 4  
ATOM   9478  H  HG21 . VAL A 1 51 ? 124.365 -1.752  4.038   1.00 0.00 ? 51  VAL A HG21 4  
ATOM   9479  H  HG22 . VAL A 1 51 ? 125.939 -1.797  4.832   1.00 0.00 ? 51  VAL A HG22 4  
ATOM   9480  H  HG23 . VAL A 1 51 ? 125.107 -0.258  4.611   1.00 0.00 ? 51  VAL A HG23 4  
ATOM   9481  N  N    . ASP A 1 52 ? 123.767 1.289   7.749   1.00 0.00 ? 52  ASP A N    4  
ATOM   9482  C  CA   . ASP A 1 52 ? 123.407 2.700   7.658   1.00 0.00 ? 52  ASP A CA   4  
ATOM   9483  C  C    . ASP A 1 52 ? 124.616 3.588   7.944   1.00 0.00 ? 52  ASP A C    4  
ATOM   9484  O  O    . ASP A 1 52 ? 124.764 4.659   7.352   1.00 0.00 ? 52  ASP A O    4  
ATOM   9485  C  CB   . ASP A 1 52 ? 122.292 3.017   8.656   1.00 0.00 ? 52  ASP A CB   4  
ATOM   9486  C  CG   . ASP A 1 52 ? 121.003 2.320   8.237   1.00 0.00 ? 52  ASP A CG   4  
ATOM   9487  O  OD1  . ASP A 1 52 ? 120.955 1.825   7.123   1.00 0.00 ? 52  ASP A OD1  4  
ATOM   9488  O  OD2  . ASP A 1 52 ? 120.081 2.293   9.036   1.00 0.00 ? 52  ASP A OD2  4  
ATOM   9489  H  H    . ASP A 1 52 ? 123.246 0.697   8.332   1.00 0.00 ? 52  ASP A H    4  
ATOM   9490  H  HA   . ASP A 1 52 ? 123.050 2.906   6.661   1.00 0.00 ? 52  ASP A HA   4  
ATOM   9491  H  HB2  . ASP A 1 52 ? 122.582 2.675   9.639   1.00 0.00 ? 52  ASP A HB2  4  
ATOM   9492  H  HB3  . ASP A 1 52 ? 122.128 4.085   8.683   1.00 0.00 ? 52  ASP A HB3  4  
ATOM   9493  N  N    . ALA A 1 53 ? 125.478 3.141   8.853   1.00 0.00 ? 53  ALA A N    4  
ATOM   9494  C  CA   . ALA A 1 53 ? 126.663 3.917   9.206   1.00 0.00 ? 53  ALA A CA   4  
ATOM   9495  C  C    . ALA A 1 53 ? 127.499 4.201   7.967   1.00 0.00 ? 53  ALA A C    4  
ATOM   9496  O  O    . ALA A 1 53 ? 128.194 5.219   7.893   1.00 0.00 ? 53  ALA A O    4  
ATOM   9497  C  CB   . ALA A 1 53 ? 127.505 3.152   10.228  1.00 0.00 ? 53  ALA A CB   4  
ATOM   9498  H  H    . ALA A 1 53 ? 125.314 2.278   9.295   1.00 0.00 ? 53  ALA A H    4  
ATOM   9499  H  HA   . ALA A 1 53 ? 126.356 4.855   9.639   1.00 0.00 ? 53  ALA A HA   4  
ATOM   9500  H  HB1  . ALA A 1 53 ? 127.862 2.234   9.785   1.00 0.00 ? 53  ALA A HB1  4  
ATOM   9501  H  HB2  . ALA A 1 53 ? 126.901 2.923   11.093  1.00 0.00 ? 53  ALA A HB2  4  
ATOM   9502  H  HB3  . ALA A 1 53 ? 128.348 3.757   10.527  1.00 0.00 ? 53  ALA A HB3  4  
ATOM   9503  N  N    . VAL A 1 54 ? 127.424 3.309   6.989   1.00 0.00 ? 54  VAL A N    4  
ATOM   9504  C  CA   . VAL A 1 54 ? 128.177 3.497   5.761   1.00 0.00 ? 54  VAL A CA   4  
ATOM   9505  C  C    . VAL A 1 54 ? 127.838 4.853   5.148   1.00 0.00 ? 54  VAL A C    4  
ATOM   9506  O  O    . VAL A 1 54 ? 128.682 5.502   4.535   1.00 0.00 ? 54  VAL A O    4  
ATOM   9507  C  CB   . VAL A 1 54 ? 127.853 2.381   4.763   1.00 0.00 ? 54  VAL A CB   4  
ATOM   9508  C  CG1  . VAL A 1 54 ? 126.485 2.634   4.117   1.00 0.00 ? 54  VAL A CG1  4  
ATOM   9509  C  CG2  . VAL A 1 54 ? 128.932 2.345   3.676   1.00 0.00 ? 54  VAL A CG2  4  
ATOM   9510  H  H    . VAL A 1 54 ? 126.852 2.520   7.093   1.00 0.00 ? 54  VAL A H    4  
ATOM   9511  H  HA   . VAL A 1 54 ? 129.231 3.465   5.990   1.00 0.00 ? 54  VAL A HA   4  
ATOM   9512  H  HB   . VAL A 1 54 ? 127.833 1.433   5.280   1.00 0.00 ? 54  VAL A HB   4  
ATOM   9513  H  HG11 . VAL A 1 54 ? 125.838 3.133   4.821   1.00 0.00 ? 54  VAL A HG11 4  
ATOM   9514  H  HG12 . VAL A 1 54 ? 126.043 1.692   3.829   1.00 0.00 ? 54  VAL A HG12 4  
ATOM   9515  H  HG13 . VAL A 1 54 ? 126.607 3.254   3.241   1.00 0.00 ? 54  VAL A HG13 4  
ATOM   9516  H  HG21 . VAL A 1 54 ? 128.669 1.606   2.933   1.00 0.00 ? 54  VAL A HG21 4  
ATOM   9517  H  HG22 . VAL A 1 54 ? 129.881 2.085   4.121   1.00 0.00 ? 54  VAL A HG22 4  
ATOM   9518  H  HG23 . VAL A 1 54 ? 129.005 3.316   3.209   1.00 0.00 ? 54  VAL A HG23 4  
ATOM   9519  N  N    . ASP A 1 55 ? 126.592 5.277   5.292   1.00 0.00 ? 55  ASP A N    4  
ATOM   9520  C  CA   . ASP A 1 55 ? 126.193 6.559   4.735   1.00 0.00 ? 55  ASP A CA   4  
ATOM   9521  C  C    . ASP A 1 55 ? 126.924 7.730   5.402   1.00 0.00 ? 55  ASP A C    4  
ATOM   9522  O  O    . ASP A 1 55 ? 127.361 8.661   4.726   1.00 0.00 ? 55  ASP A O    4  
ATOM   9523  C  CB   . ASP A 1 55 ? 124.683 6.745   4.900   1.00 0.00 ? 55  ASP A CB   4  
ATOM   9524  C  CG   . ASP A 1 55 ? 124.224 7.980   4.135   1.00 0.00 ? 55  ASP A CG   4  
ATOM   9525  O  OD1  . ASP A 1 55 ? 125.044 8.564   3.444   1.00 0.00 ? 55  ASP A OD1  4  
ATOM   9526  O  OD2  . ASP A 1 55 ? 123.059 8.325   4.248   1.00 0.00 ? 55  ASP A OD2  4  
ATOM   9527  H  H    . ASP A 1 55 ? 125.936 4.728   5.778   1.00 0.00 ? 55  ASP A H    4  
ATOM   9528  H  HA   . ASP A 1 55 ? 126.423 6.564   3.680   1.00 0.00 ? 55  ASP A HA   4  
ATOM   9529  H  HB2  . ASP A 1 55 ? 124.171 5.874   4.518   1.00 0.00 ? 55  ASP A HB2  4  
ATOM   9530  H  HB3  . ASP A 1 55 ? 124.451 6.867   5.947   1.00 0.00 ? 55  ASP A HB3  4  
ATOM   9531  N  N    . LYS A 1 56 ? 127.042 7.687   6.736   1.00 0.00 ? 56  LYS A N    4  
ATOM   9532  C  CA   . LYS A 1 56 ? 127.706 8.761   7.470   1.00 0.00 ? 56  LYS A CA   4  
ATOM   9533  C  C    . LYS A 1 56 ? 129.199 8.791   7.209   1.00 0.00 ? 56  LYS A C    4  
ATOM   9534  O  O    . LYS A 1 56 ? 129.792 9.847   6.990   1.00 0.00 ? 56  LYS A O    4  
ATOM   9535  C  CB   . LYS A 1 56 ? 127.460 8.587   8.969   1.00 0.00 ? 56  LYS A CB   4  
ATOM   9536  C  CG   . LYS A 1 56 ? 125.968 8.740   9.266   1.00 0.00 ? 56  LYS A CG   4  
ATOM   9537  C  CD   . LYS A 1 56 ? 125.738 8.683   10.778  1.00 0.00 ? 56  LYS A CD   4  
ATOM   9538  C  CE   . LYS A 1 56 ? 124.237 8.710   11.069  1.00 0.00 ? 56  LYS A CE   4  
ATOM   9539  N  NZ   . LYS A 1 56 ? 123.688 7.328   10.979  1.00 0.00 ? 56  LYS A NZ   4  
ATOM   9540  H  H    . LYS A 1 56 ? 126.690 6.922   7.229   1.00 0.00 ? 56  LYS A H    4  
ATOM   9541  H  HA   . LYS A 1 56 ? 127.282 9.704   7.162   1.00 0.00 ? 56  LYS A HA   4  
ATOM   9542  H  HB2  . LYS A 1 56 ? 127.791 7.605   9.276   1.00 0.00 ? 56  LYS A HB2  4  
ATOM   9543  H  HB3  . LYS A 1 56 ? 128.012 9.340   9.514   1.00 0.00 ? 56  LYS A HB3  4  
ATOM   9544  H  HG2  . LYS A 1 56 ? 125.620 9.689   8.884   1.00 0.00 ? 56  LYS A HG2  4  
ATOM   9545  H  HG3  . LYS A 1 56 ? 125.422 7.939   8.790   1.00 0.00 ? 56  LYS A HG3  4  
ATOM   9546  H  HD2  . LYS A 1 56 ? 126.165 7.771   11.171  1.00 0.00 ? 56  LYS A HD2  4  
ATOM   9547  H  HD3  . LYS A 1 56 ? 126.209 9.533   11.246  1.00 0.00 ? 56  LYS A HD3  4  
ATOM   9548  H  HE2  . LYS A 1 56 ? 124.070 9.100   12.063  1.00 0.00 ? 56  LYS A HE2  4  
ATOM   9549  H  HE3  . LYS A 1 56 ? 123.741 9.341   10.347  1.00 0.00 ? 56  LYS A HE3  4  
ATOM   9550  H  HZ1  . LYS A 1 56 ? 123.000 7.176   11.745  1.00 0.00 ? 56  LYS A HZ1  4  
ATOM   9551  H  HZ2  . LYS A 1 56 ? 124.464 6.640   11.070  1.00 0.00 ? 56  LYS A HZ2  4  
ATOM   9552  H  HZ3  . LYS A 1 56 ? 123.216 7.200   10.062  1.00 0.00 ? 56  LYS A HZ3  4  
ATOM   9553  N  N    . VAL A 1 57 ? 129.795 7.613   7.269   1.00 0.00 ? 57  VAL A N    4  
ATOM   9554  C  CA   . VAL A 1 57 ? 131.226 7.475   7.075   1.00 0.00 ? 57  VAL A CA   4  
ATOM   9555  C  C    . VAL A 1 57 ? 131.645 7.882   5.663   1.00 0.00 ? 57  VAL A C    4  
ATOM   9556  O  O    . VAL A 1 57 ? 132.753 8.375   5.453   1.00 0.00 ? 57  VAL A O    4  
ATOM   9557  C  CB   . VAL A 1 57 ? 131.649 6.042   7.384   1.00 0.00 ? 57  VAL A CB   4  
ATOM   9558  C  CG1  . VAL A 1 57 ? 131.355 5.136   6.200   1.00 0.00 ? 57  VAL A CG1  4  
ATOM   9559  C  CG2  . VAL A 1 57 ? 133.129 6.016   7.695   1.00 0.00 ? 57  VAL A CG2  4  
ATOM   9560  H  H    . VAL A 1 57 ? 129.259 6.813   7.470   1.00 0.00 ? 57  VAL A H    4  
ATOM   9561  H  HA   . VAL A 1 57 ? 131.723 8.131   7.774   1.00 0.00 ? 57  VAL A HA   4  
ATOM   9562  H  HB   . VAL A 1 57 ? 131.098 5.688   8.244   1.00 0.00 ? 57  VAL A HB   4  
ATOM   9563  H  HG11 . VAL A 1 57 ? 130.400 5.391   5.798   1.00 0.00 ? 57  VAL A HG11 4  
ATOM   9564  H  HG12 . VAL A 1 57 ? 131.347 4.107   6.528   1.00 0.00 ? 57  VAL A HG12 4  
ATOM   9565  H  HG13 . VAL A 1 57 ? 132.115 5.270   5.445   1.00 0.00 ? 57  VAL A HG13 4  
ATOM   9566  H  HG21 . VAL A 1 57 ? 133.461 4.994   7.764   1.00 0.00 ? 57  VAL A HG21 4  
ATOM   9567  H  HG22 . VAL A 1 57 ? 133.298 6.520   8.633   1.00 0.00 ? 57  VAL A HG22 4  
ATOM   9568  H  HG23 . VAL A 1 57 ? 133.665 6.522   6.909   1.00 0.00 ? 57  VAL A HG23 4  
ATOM   9569  N  N    . MET A 1 58 ? 130.761 7.652   4.698   1.00 0.00 ? 58  MET A N    4  
ATOM   9570  C  CA   . MET A 1 58 ? 131.056 7.977   3.305   1.00 0.00 ? 58  MET A CA   4  
ATOM   9571  C  C    . MET A 1 58 ? 131.440 9.445   3.144   1.00 0.00 ? 58  MET A C    4  
ATOM   9572  O  O    . MET A 1 58 ? 132.311 9.785   2.336   1.00 0.00 ? 58  MET A O    4  
ATOM   9573  C  CB   . MET A 1 58 ? 129.809 7.724   2.454   1.00 0.00 ? 58  MET A CB   4  
ATOM   9574  C  CG   . MET A 1 58 ? 130.147 7.894   0.972   1.00 0.00 ? 58  MET A CG   4  
ATOM   9575  S  SD   . MET A 1 58 ? 128.624 7.915   0.007   1.00 0.00 ? 58  MET A SD   4  
ATOM   9576  C  CE   . MET A 1 58 ? 129.392 7.899   -1.631  1.00 0.00 ? 58  MET A CE   4  
ATOM   9577  H  H    . MET A 1 58 ? 129.900 7.242   4.924   1.00 0.00 ? 58  MET A H    4  
ATOM   9578  H  HA   . MET A 1 58 ? 131.859 7.350   2.946   1.00 0.00 ? 58  MET A HA   4  
ATOM   9579  H  HB2  . MET A 1 58 ? 129.452 6.719   2.629   1.00 0.00 ? 58  MET A HB2  4  
ATOM   9580  H  HB3  . MET A 1 58 ? 129.039 8.431   2.728   1.00 0.00 ? 58  MET A HB3  4  
ATOM   9581  H  HG2  . MET A 1 58 ? 130.683 8.817   0.821   1.00 0.00 ? 58  MET A HG2  4  
ATOM   9582  H  HG3  . MET A 1 58 ? 130.756 7.063   0.649   1.00 0.00 ? 58  MET A HG3  4  
ATOM   9583  H  HE1  . MET A 1 58 ? 128.760 8.431   -2.328  1.00 0.00 ? 58  MET A HE1  4  
ATOM   9584  H  HE2  . MET A 1 58 ? 129.512 6.881   -1.961  1.00 0.00 ? 58  MET A HE2  4  
ATOM   9585  H  HE3  . MET A 1 58 ? 130.361 8.376   -1.578  1.00 0.00 ? 58  MET A HE3  4  
ATOM   9586  N  N    . LYS A 1 59 ? 130.770 10.319  3.888   1.00 0.00 ? 59  LYS A N    4  
ATOM   9587  C  CA   . LYS A 1 59 ? 131.041 11.745  3.777   1.00 0.00 ? 59  LYS A CA   4  
ATOM   9588  C  C    . LYS A 1 59 ? 132.494 12.070  4.099   1.00 0.00 ? 59  LYS A C    4  
ATOM   9589  O  O    . LYS A 1 59 ? 133.110 12.898  3.428   1.00 0.00 ? 59  LYS A O    4  
ATOM   9590  C  CB   . LYS A 1 59 ? 130.127 12.518  4.730   1.00 0.00 ? 59  LYS A CB   4  
ATOM   9591  C  CG   . LYS A 1 59 ? 128.670 12.339  4.301   1.00 0.00 ? 59  LYS A CG   4  
ATOM   9592  C  CD   . LYS A 1 59 ? 127.767 13.203  5.182   1.00 0.00 ? 59  LYS A CD   4  
ATOM   9593  C  CE   . LYS A 1 59 ? 126.302 12.932  4.836   1.00 0.00 ? 59  LYS A CE   4  
ATOM   9594  N  NZ   . LYS A 1 59 ? 125.442 13.978  5.459   1.00 0.00 ? 59  LYS A NZ   4  
ATOM   9595  H  H    . LYS A 1 59 ? 130.072 10.002  4.499   1.00 0.00 ? 59  LYS A H    4  
ATOM   9596  H  HA   . LYS A 1 59 ? 130.830 12.061  2.768   1.00 0.00 ? 59  LYS A HA   4  
ATOM   9597  H  HB2  . LYS A 1 59 ? 130.257 12.145  5.735   1.00 0.00 ? 59  LYS A HB2  4  
ATOM   9598  H  HB3  . LYS A 1 59 ? 130.382 13.568  4.700   1.00 0.00 ? 59  LYS A HB3  4  
ATOM   9599  H  HG2  . LYS A 1 59 ? 128.560 12.636  3.269   1.00 0.00 ? 59  LYS A HG2  4  
ATOM   9600  H  HG3  . LYS A 1 59 ? 128.388 11.302  4.409   1.00 0.00 ? 59  LYS A HG3  4  
ATOM   9601  H  HD2  . LYS A 1 59 ? 127.943 12.964  6.221   1.00 0.00 ? 59  LYS A HD2  4  
ATOM   9602  H  HD3  . LYS A 1 59 ? 127.988 14.246  5.011   1.00 0.00 ? 59  LYS A HD3  4  
ATOM   9603  H  HE2  . LYS A 1 59 ? 126.176 12.953  3.764   1.00 0.00 ? 59  LYS A HE2  4  
ATOM   9604  H  HE3  . LYS A 1 59 ? 126.017 11.960  5.213   1.00 0.00 ? 59  LYS A HE3  4  
ATOM   9605  H  HZ1  . LYS A 1 59 ? 124.492 13.590  5.628   1.00 0.00 ? 59  LYS A HZ1  4  
ATOM   9606  H  HZ2  . LYS A 1 59 ? 125.376 14.796  4.820   1.00 0.00 ? 59  LYS A HZ2  4  
ATOM   9607  H  HZ3  . LYS A 1 59 ? 125.858 14.276  6.364   1.00 0.00 ? 59  LYS A HZ3  4  
ATOM   9608  N  N    . GLU A 1 60 ? 133.048 11.423  5.121   1.00 0.00 ? 60  GLU A N    4  
ATOM   9609  C  CA   . GLU A 1 60 ? 134.435 11.684  5.482   1.00 0.00 ? 60  GLU A CA   4  
ATOM   9610  C  C    . GLU A 1 60 ? 135.388 11.209  4.390   1.00 0.00 ? 60  GLU A C    4  
ATOM   9611  O  O    . GLU A 1 60 ? 136.379 11.872  4.087   1.00 0.00 ? 60  GLU A O    4  
ATOM   9612  C  CB   . GLU A 1 60 ? 134.772 10.976  6.796   1.00 0.00 ? 60  GLU A CB   4  
ATOM   9613  C  CG   . GLU A 1 60 ? 133.938 11.577  7.929   1.00 0.00 ? 60  GLU A CG   4  
ATOM   9614  C  CD   . GLU A 1 60 ? 134.314 10.924  9.255   1.00 0.00 ? 60  GLU A CD   4  
ATOM   9615  O  OE1  . GLU A 1 60 ? 135.051 9.952   9.227   1.00 0.00 ? 60  GLU A OE1  4  
ATOM   9616  O  OE2  . GLU A 1 60 ? 133.860 11.407  10.280  1.00 0.00 ? 60  GLU A OE2  4  
ATOM   9617  H  H    . GLU A 1 60 ? 132.524 10.771  5.629   1.00 0.00 ? 60  GLU A H    4  
ATOM   9618  H  HA   . GLU A 1 60 ? 134.565 12.747  5.620   1.00 0.00 ? 60  GLU A HA   4  
ATOM   9619  H  HB2  . GLU A 1 60 ? 134.550 9.923   6.703   1.00 0.00 ? 60  GLU A HB2  4  
ATOM   9620  H  HB3  . GLU A 1 60 ? 135.820 11.105  7.016   1.00 0.00 ? 60  GLU A HB3  4  
ATOM   9621  H  HG2  . GLU A 1 60 ? 134.124 12.639  7.986   1.00 0.00 ? 60  GLU A HG2  4  
ATOM   9622  H  HG3  . GLU A 1 60 ? 132.890 11.406  7.732   1.00 0.00 ? 60  GLU A HG3  4  
ATOM   9623  N  N    . LEU A 1 61 ? 135.079 10.055  3.802   1.00 0.00 ? 61  LEU A N    4  
ATOM   9624  C  CA   . LEU A 1 61 ? 135.920 9.504   2.746   1.00 0.00 ? 61  LEU A CA   4  
ATOM   9625  C  C    . LEU A 1 61 ? 135.877 10.355  1.486   1.00 0.00 ? 61  LEU A C    4  
ATOM   9626  O  O    . LEU A 1 61 ? 136.888 10.508  0.800   1.00 0.00 ? 61  LEU A O    4  
ATOM   9627  C  CB   . LEU A 1 61 ? 135.481 8.078   2.413   1.00 0.00 ? 61  LEU A CB   4  
ATOM   9628  C  CG   . LEU A 1 61 ? 135.565 7.199   3.664   1.00 0.00 ? 61  LEU A CG   4  
ATOM   9629  C  CD1  . LEU A 1 61 ? 135.223 5.762   3.287   1.00 0.00 ? 61  LEU A CD1  4  
ATOM   9630  C  CD2  . LEU A 1 61 ? 136.986 7.244   4.240   1.00 0.00 ? 61  LEU A CD2  4  
ATOM   9631  H  H    . LEU A 1 61 ? 134.277 9.568   4.085   1.00 0.00 ? 61  LEU A H    4  
ATOM   9632  H  HA   . LEU A 1 61 ? 136.939 9.475   3.098   1.00 0.00 ? 61  LEU A HA   4  
ATOM   9633  H  HB2  . LEU A 1 61 ? 134.463 8.092   2.053   1.00 0.00 ? 61  LEU A HB2  4  
ATOM   9634  H  HB3  . LEU A 1 61 ? 136.127 7.673   1.649   1.00 0.00 ? 61  LEU A HB3  4  
ATOM   9635  H  HG   . LEU A 1 61 ? 134.864 7.556   4.401   1.00 0.00 ? 61  LEU A HG   4  
ATOM   9636  H  HD11 . LEU A 1 61 ? 134.152 5.653   3.208   1.00 0.00 ? 61  LEU A HD11 4  
ATOM   9637  H  HD12 . LEU A 1 61 ? 135.600 5.090   4.045   1.00 0.00 ? 61  LEU A HD12 4  
ATOM   9638  H  HD13 . LEU A 1 61 ? 135.680 5.526   2.338   1.00 0.00 ? 61  LEU A HD13 4  
ATOM   9639  H  HD21 . LEU A 1 61 ? 137.077 8.090   4.906   1.00 0.00 ? 61  LEU A HD21 4  
ATOM   9640  H  HD22 . LEU A 1 61 ? 137.698 7.342   3.434   1.00 0.00 ? 61  LEU A HD22 4  
ATOM   9641  H  HD23 . LEU A 1 61 ? 137.185 6.334   4.786   1.00 0.00 ? 61  LEU A HD23 4  
ATOM   9642  N  N    . ASP A 1 62 ? 134.705 10.901  1.170   1.00 0.00 ? 62  ASP A N    4  
ATOM   9643  C  CA   . ASP A 1 62 ? 134.582 11.718  -0.029  1.00 0.00 ? 62  ASP A CA   4  
ATOM   9644  C  C    . ASP A 1 62 ? 134.967 13.163  0.247   1.00 0.00 ? 62  ASP A C    4  
ATOM   9645  O  O    . ASP A 1 62 ? 134.215 13.905  0.879   1.00 0.00 ? 62  ASP A O    4  
ATOM   9646  C  CB   . ASP A 1 62 ? 133.143 11.664  -0.545  1.00 0.00 ? 62  ASP A CB   4  
ATOM   9647  C  CG   . ASP A 1 62 ? 133.031 12.426  -1.860  1.00 0.00 ? 62  ASP A CG   4  
ATOM   9648  O  OD1  . ASP A 1 62 ? 134.044 12.929  -2.317  1.00 0.00 ? 62  ASP A OD1  4  
ATOM   9649  O  OD2  . ASP A 1 62 ? 131.935 12.496  -2.391  1.00 0.00 ? 62  ASP A OD2  4  
ATOM   9650  H  H    . ASP A 1 62 ? 133.919 10.743  1.742   1.00 0.00 ? 62  ASP A H    4  
ATOM   9651  H  HA   . ASP A 1 62 ? 135.237 11.321  -0.790  1.00 0.00 ? 62  ASP A HA   4  
ATOM   9652  H  HB2  . ASP A 1 62 ? 132.858 10.633  -0.703  1.00 0.00 ? 62  ASP A HB2  4  
ATOM   9653  H  HB3  . ASP A 1 62 ? 132.484 12.110  0.184   1.00 0.00 ? 62  ASP A HB3  4  
ATOM   9654  N  N    . GLU A 1 63 ? 136.126 13.568  -0.258  1.00 0.00 ? 63  GLU A N    4  
ATOM   9655  C  CA   . GLU A 1 63 ? 136.571 14.941  -0.085  1.00 0.00 ? 63  GLU A CA   4  
ATOM   9656  C  C    . GLU A 1 63 ? 135.656 15.886  -0.853  1.00 0.00 ? 63  GLU A C    4  
ATOM   9657  O  O    . GLU A 1 63 ? 135.387 17.006  -0.418  1.00 0.00 ? 63  GLU A O    4  
ATOM   9658  C  CB   . GLU A 1 63 ? 138.008 15.095  -0.584  1.00 0.00 ? 63  GLU A CB   4  
ATOM   9659  C  CG   . GLU A 1 63 ? 138.945 14.255  0.286   1.00 0.00 ? 63  GLU A CG   4  
ATOM   9660  C  CD   . GLU A 1 63 ? 140.389 14.453  -0.162  1.00 0.00 ? 63  GLU A CD   4  
ATOM   9661  O  OE1  . GLU A 1 63 ? 140.590 15.071  -1.194  1.00 0.00 ? 63  GLU A OE1  4  
ATOM   9662  O  OE2  . GLU A 1 63 ? 141.274 13.984  0.535   1.00 0.00 ? 63  GLU A OE2  4  
ATOM   9663  H  H    . GLU A 1 63 ? 136.675 12.942  -0.775  1.00 0.00 ? 63  GLU A H    4  
ATOM   9664  H  HA   . GLU A 1 63 ? 136.536 15.192  0.965   1.00 0.00 ? 63  GLU A HA   4  
ATOM   9665  H  HB2  . GLU A 1 63 ? 138.070 14.760  -1.610  1.00 0.00 ? 63  GLU A HB2  4  
ATOM   9666  H  HB3  . GLU A 1 63 ? 138.300 16.132  -0.526  1.00 0.00 ? 63  GLU A HB3  4  
ATOM   9667  H  HG2  . GLU A 1 63 ? 138.844 14.559  1.317   1.00 0.00 ? 63  GLU A HG2  4  
ATOM   9668  H  HG3  . GLU A 1 63 ? 138.681 13.212  0.191   1.00 0.00 ? 63  GLU A HG3  4  
ATOM   9669  N  N    . ASN A 1 64 ? 135.193 15.421  -2.013  1.00 0.00 ? 64  ASN A N    4  
ATOM   9670  C  CA   . ASN A 1 64 ? 134.321 16.223  -2.862  1.00 0.00 ? 64  ASN A CA   4  
ATOM   9671  C  C    . ASN A 1 64 ? 133.048 16.615  -2.128  1.00 0.00 ? 64  ASN A C    4  
ATOM   9672  O  O    . ASN A 1 64 ? 132.535 17.722  -2.295  1.00 0.00 ? 64  ASN A O    4  
ATOM   9673  C  CB   . ASN A 1 64 ? 133.921 15.412  -4.097  1.00 0.00 ? 64  ASN A CB   4  
ATOM   9674  C  CG   . ASN A 1 64 ? 135.156 14.956  -4.861  1.00 0.00 ? 64  ASN A CG   4  
ATOM   9675  O  OD1  . ASN A 1 64 ? 135.238 13.790  -5.254  1.00 0.00 ? 64  ASN A OD1  4  
ATOM   9676  N  ND2  . ASN A 1 64 ? 136.120 15.801  -5.097  1.00 0.00 ? 64  ASN A ND2  4  
ATOM   9677  H  H    . ASN A 1 64 ? 135.456 14.523  -2.306  1.00 0.00 ? 64  ASN A H    4  
ATOM   9678  H  HA   . ASN A 1 64 ? 134.843 17.112  -3.178  1.00 0.00 ? 64  ASN A HA   4  
ATOM   9679  H  HB2  . ASN A 1 64 ? 133.353 14.548  -3.788  1.00 0.00 ? 64  ASN A HB2  4  
ATOM   9680  H  HB3  . ASN A 1 64 ? 133.310 16.027  -4.742  1.00 0.00 ? 64  ASN A HB3  4  
ATOM   9681  H  HD21 . ASN A 1 64 ? 136.049 16.727  -4.782  1.00 0.00 ? 64  ASN A HD21 4  
ATOM   9682  H  HD22 . ASN A 1 64 ? 136.917 15.511  -5.589  1.00 0.00 ? 64  ASN A HD22 4  
ATOM   9683  N  N    . GLY A 1 65 ? 132.526 15.683  -1.338  1.00 0.00 ? 65  GLY A N    4  
ATOM   9684  C  CA   . GLY A 1 65 ? 131.291 15.928  -0.610  1.00 0.00 ? 65  GLY A CA   4  
ATOM   9685  C  C    . GLY A 1 65 ? 130.125 15.858  -1.587  1.00 0.00 ? 65  GLY A C    4  
ATOM   9686  O  O    . GLY A 1 65 ? 129.016 16.304  -1.292  1.00 0.00 ? 65  GLY A O    4  
ATOM   9687  H  H    . GLY A 1 65 ? 132.966 14.812  -1.262  1.00 0.00 ? 65  GLY A H    4  
ATOM   9688  H  HA2  . GLY A 1 65 ? 131.169 15.177  0.159   1.00 0.00 ? 65  GLY A HA2  4  
ATOM   9689  H  HA3  . GLY A 1 65 ? 131.322 16.908  -0.160  1.00 0.00 ? 65  GLY A HA3  4  
ATOM   9690  N  N    . ASP A 1 66 ? 130.407 15.319  -2.774  1.00 0.00 ? 66  ASP A N    4  
ATOM   9691  C  CA   . ASP A 1 66 ? 129.403 15.216  -3.828  1.00 0.00 ? 66  ASP A CA   4  
ATOM   9692  C  C    . ASP A 1 66 ? 128.613 13.909  -3.779  1.00 0.00 ? 66  ASP A C    4  
ATOM   9693  O  O    . ASP A 1 66 ? 127.752 13.673  -4.628  1.00 0.00 ? 66  ASP A O    4  
ATOM   9694  C  CB   . ASP A 1 66 ? 130.103 15.342  -5.184  1.00 0.00 ? 66  ASP A CB   4  
ATOM   9695  C  CG   . ASP A 1 66 ? 131.097 14.192  -5.386  1.00 0.00 ? 66  ASP A CG   4  
ATOM   9696  O  OD1  . ASP A 1 66 ? 131.094 13.269  -4.585  1.00 0.00 ? 66  ASP A OD1  4  
ATOM   9697  O  OD2  . ASP A 1 66 ? 131.873 14.268  -6.324  1.00 0.00 ? 66  ASP A OD2  4  
ATOM   9698  H  H    . ASP A 1 66 ? 131.318 15.005  -2.950  1.00 0.00 ? 66  ASP A H    4  
ATOM   9699  H  HA   . ASP A 1 66 ? 128.712 16.038  -3.728  1.00 0.00 ? 66  ASP A HA   4  
ATOM   9700  H  HB2  . ASP A 1 66 ? 129.364 15.316  -5.971  1.00 0.00 ? 66  ASP A HB2  4  
ATOM   9701  H  HB3  . ASP A 1 66 ? 130.634 16.282  -5.225  1.00 0.00 ? 66  ASP A HB3  4  
ATOM   9702  N  N    . GLY A 1 67 ? 128.882 13.071  -2.790  1.00 0.00 ? 67  GLY A N    4  
ATOM   9703  C  CA   . GLY A 1 67 ? 128.153 11.812  -2.666  1.00 0.00 ? 67  GLY A CA   4  
ATOM   9704  C  C    . GLY A 1 67 ? 128.531 10.857  -3.795  1.00 0.00 ? 67  GLY A C    4  
ATOM   9705  O  O    . GLY A 1 67 ? 127.904 9.814   -3.978  1.00 0.00 ? 67  GLY A O    4  
ATOM   9706  H  H    . GLY A 1 67 ? 129.567 13.303  -2.128  1.00 0.00 ? 67  GLY A H    4  
ATOM   9707  H  HA2  . GLY A 1 67 ? 128.393 11.355  -1.717  1.00 0.00 ? 67  GLY A HA2  4  
ATOM   9708  H  HA3  . GLY A 1 67 ? 127.093 12.008  -2.710  1.00 0.00 ? 67  GLY A HA3  4  
ATOM   9709  N  N    . GLU A 1 68 ? 129.560 11.227  -4.549  1.00 0.00 ? 68  GLU A N    4  
ATOM   9710  C  CA   . GLU A 1 68 ? 130.028 10.410  -5.665  1.00 0.00 ? 68  GLU A CA   4  
ATOM   9711  C  C    . GLU A 1 68 ? 131.320 9.713   -5.277  1.00 0.00 ? 68  GLU A C    4  
ATOM   9712  O  O    . GLU A 1 68 ? 132.144 10.288  -4.561  1.00 0.00 ? 68  GLU A O    4  
ATOM   9713  C  CB   . GLU A 1 68 ? 130.265 11.287  -6.896  1.00 0.00 ? 68  GLU A CB   4  
ATOM   9714  C  CG   . GLU A 1 68 ? 130.616 10.402  -8.094  1.00 0.00 ? 68  GLU A CG   4  
ATOM   9715  C  CD   . GLU A 1 68 ? 130.953 11.270  -9.302  1.00 0.00 ? 68  GLU A CD   4  
ATOM   9716  O  OE1  . GLU A 1 68 ? 130.925 12.481  -9.163  1.00 0.00 ? 68  GLU A OE1  4  
ATOM   9717  O  OE2  . GLU A 1 68 ? 131.231 10.709  -10.349 1.00 0.00 ? 68  GLU A OE2  4  
ATOM   9718  H  H    . GLU A 1 68 ? 130.016 12.071  -4.351  1.00 0.00 ? 68  GLU A H    4  
ATOM   9719  H  HA   . GLU A 1 68 ? 129.282 9.666   -5.901  1.00 0.00 ? 68  GLU A HA   4  
ATOM   9720  H  HB2  . GLU A 1 68 ? 129.368 11.850  -7.114  1.00 0.00 ? 68  GLU A HB2  4  
ATOM   9721  H  HB3  . GLU A 1 68 ? 131.079 11.968  -6.703  1.00 0.00 ? 68  GLU A HB3  4  
ATOM   9722  H  HG2  . GLU A 1 68 ? 131.469 9.786   -7.845  1.00 0.00 ? 68  GLU A HG2  4  
ATOM   9723  H  HG3  . GLU A 1 68 ? 129.775 9.769   -8.331  1.00 0.00 ? 68  GLU A HG3  4  
ATOM   9724  N  N    . VAL A 1 69 ? 131.503 8.472   -5.730  1.00 0.00 ? 69  VAL A N    4  
ATOM   9725  C  CA   . VAL A 1 69 ? 132.714 7.739   -5.378  1.00 0.00 ? 69  VAL A CA   4  
ATOM   9726  C  C    . VAL A 1 69 ? 133.639 7.585   -6.574  1.00 0.00 ? 69  VAL A C    4  
ATOM   9727  O  O    . VAL A 1 69 ? 133.237 7.147   -7.652  1.00 0.00 ? 69  VAL A O    4  
ATOM   9728  C  CB   . VAL A 1 69 ? 132.342 6.356   -4.842  1.00 0.00 ? 69  VAL A CB   4  
ATOM   9729  C  CG1  . VAL A 1 69 ? 133.607 5.630   -4.380  1.00 0.00 ? 69  VAL A CG1  4  
ATOM   9730  C  CG2  . VAL A 1 69 ? 131.386 6.513   -3.656  1.00 0.00 ? 69  VAL A CG2  4  
ATOM   9731  H  H    . VAL A 1 69 ? 130.820 8.045   -6.293  1.00 0.00 ? 69  VAL A H    4  
ATOM   9732  H  HA   . VAL A 1 69 ? 133.238 8.272   -4.606  1.00 0.00 ? 69  VAL A HA   4  
ATOM   9733  H  HB   . VAL A 1 69 ? 131.861 5.783   -5.622  1.00 0.00 ? 69  VAL A HB   4  
ATOM   9734  H  HG11 . VAL A 1 69 ? 133.340 4.666   -3.973  1.00 0.00 ? 69  VAL A HG11 4  
ATOM   9735  H  HG12 . VAL A 1 69 ? 134.102 6.217   -3.621  1.00 0.00 ? 69  VAL A HG12 4  
ATOM   9736  H  HG13 . VAL A 1 69 ? 134.271 5.496   -5.221  1.00 0.00 ? 69  VAL A HG13 4  
ATOM   9737  H  HG21 . VAL A 1 69 ? 131.951 6.750   -2.765  1.00 0.00 ? 69  VAL A HG21 4  
ATOM   9738  H  HG22 . VAL A 1 69 ? 130.846 5.590   -3.504  1.00 0.00 ? 69  VAL A HG22 4  
ATOM   9739  H  HG23 . VAL A 1 69 ? 130.687 7.309   -3.861  1.00 0.00 ? 69  VAL A HG23 4  
ATOM   9740  N  N    . ASP A 1 70 ? 134.898 7.930   -6.340  1.00 0.00 ? 70  ASP A N    4  
ATOM   9741  C  CA   . ASP A 1 70 ? 135.940 7.824   -7.348  1.00 0.00 ? 70  ASP A CA   4  
ATOM   9742  C  C    . ASP A 1 70 ? 136.896 6.715   -6.947  1.00 0.00 ? 70  ASP A C    4  
ATOM   9743  O  O    . ASP A 1 70 ? 136.939 6.331   -5.778  1.00 0.00 ? 70  ASP A O    4  
ATOM   9744  C  CB   . ASP A 1 70 ? 136.698 9.147   -7.467  1.00 0.00 ? 70  ASP A CB   4  
ATOM   9745  C  CG   . ASP A 1 70 ? 135.771 10.234  -8.000  1.00 0.00 ? 70  ASP A CG   4  
ATOM   9746  O  OD1  . ASP A 1 70 ? 134.705 9.891   -8.484  1.00 0.00 ? 70  ASP A OD1  4  
ATOM   9747  O  OD2  . ASP A 1 70 ? 136.141 11.394  -7.918  1.00 0.00 ? 70  ASP A OD2  4  
ATOM   9748  H  H    . ASP A 1 70 ? 135.140 8.250   -5.446  1.00 0.00 ? 70  ASP A H    4  
ATOM   9749  H  HA   . ASP A 1 70 ? 135.494 7.582   -8.303  1.00 0.00 ? 70  ASP A HA   4  
ATOM   9750  H  HB2  . ASP A 1 70 ? 137.068 9.436   -6.493  1.00 0.00 ? 70  ASP A HB2  4  
ATOM   9751  H  HB3  . ASP A 1 70 ? 137.531 9.024   -8.144  1.00 0.00 ? 70  ASP A HB3  4  
ATOM   9752  N  N    . PHE A 1 71 ? 137.671 6.201   -7.888  1.00 0.00 ? 71  PHE A N    4  
ATOM   9753  C  CA   . PHE A 1 71 ? 138.606 5.147   -7.540  1.00 0.00 ? 71  PHE A CA   4  
ATOM   9754  C  C    . PHE A 1 71 ? 139.471 5.596   -6.375  1.00 0.00 ? 71  PHE A C    4  
ATOM   9755  O  O    . PHE A 1 71 ? 139.733 4.822   -5.453  1.00 0.00 ? 71  PHE A O    4  
ATOM   9756  C  CB   . PHE A 1 71 ? 139.501 4.801   -8.731  1.00 0.00 ? 71  PHE A CB   4  
ATOM   9757  C  CG   . PHE A 1 71 ? 140.414 3.661   -8.345  1.00 0.00 ? 71  PHE A CG   4  
ATOM   9758  C  CD1  . PHE A 1 71 ? 139.964 2.338   -8.418  1.00 0.00 ? 71  PHE A CD1  4  
ATOM   9759  C  CD2  . PHE A 1 71 ? 141.716 3.934   -7.908  1.00 0.00 ? 71  PHE A CD2  4  
ATOM   9760  C  CE1  . PHE A 1 71 ? 140.816 1.288   -8.053  1.00 0.00 ? 71  PHE A CE1  4  
ATOM   9761  C  CE2  . PHE A 1 71 ? 142.567 2.885   -7.543  1.00 0.00 ? 71  PHE A CE2  4  
ATOM   9762  C  CZ   . PHE A 1 71 ? 142.117 1.561   -7.614  1.00 0.00 ? 71  PHE A CZ   4  
ATOM   9763  H  H    . PHE A 1 71 ? 137.619 6.534   -8.808  1.00 0.00 ? 71  PHE A H    4  
ATOM   9764  H  HA   . PHE A 1 71 ? 138.052 4.267   -7.250  1.00 0.00 ? 71  PHE A HA   4  
ATOM   9765  H  HB2  . PHE A 1 71 ? 138.889 4.508   -9.572  1.00 0.00 ? 71  PHE A HB2  4  
ATOM   9766  H  HB3  . PHE A 1 71 ? 140.095 5.662   -8.999  1.00 0.00 ? 71  PHE A HB3  4  
ATOM   9767  H  HD1  . PHE A 1 71 ? 138.960 2.127   -8.756  1.00 0.00 ? 71  PHE A HD1  4  
ATOM   9768  H  HD2  . PHE A 1 71 ? 142.064 4.954   -7.852  1.00 0.00 ? 71  PHE A HD2  4  
ATOM   9769  H  HE1  . PHE A 1 71 ? 140.469 0.267   -8.107  1.00 0.00 ? 71  PHE A HE1  4  
ATOM   9770  H  HE2  . PHE A 1 71 ? 143.571 3.096   -7.206  1.00 0.00 ? 71  PHE A HE2  4  
ATOM   9771  H  HZ   . PHE A 1 71 ? 142.774 0.751   -7.332  1.00 0.00 ? 71  PHE A HZ   4  
ATOM   9772  N  N    . GLN A 1 72 ? 139.911 6.849   -6.410  1.00 0.00 ? 72  GLN A N    4  
ATOM   9773  C  CA   . GLN A 1 72 ? 140.739 7.364   -5.333  1.00 0.00 ? 72  GLN A CA   4  
ATOM   9774  C  C    . GLN A 1 72 ? 140.009 7.286   -3.995  1.00 0.00 ? 72  GLN A C    4  
ATOM   9775  O  O    . GLN A 1 72 ? 140.606 6.935   -2.982  1.00 0.00 ? 72  GLN A O    4  
ATOM   9776  C  CB   . GLN A 1 72 ? 141.143 8.809   -5.620  1.00 0.00 ? 72  GLN A CB   4  
ATOM   9777  C  CG   . GLN A 1 72 ? 142.172 9.257   -4.582  1.00 0.00 ? 72  GLN A CG   4  
ATOM   9778  C  CD   . GLN A 1 72 ? 142.661 10.665  -4.900  1.00 0.00 ? 72  GLN A CD   4  
ATOM   9779  O  OE1  . GLN A 1 72 ? 142.278 11.242  -5.918  1.00 0.00 ? 72  GLN A OE1  4  
ATOM   9780  N  NE2  . GLN A 1 72 ? 143.514 11.242  -4.100  1.00 0.00 ? 72  GLN A NE2  4  
ATOM   9781  H  H    . GLN A 1 72 ? 139.673 7.429   -7.162  1.00 0.00 ? 72  GLN A H    4  
ATOM   9782  H  HA   . GLN A 1 72 ? 141.633 6.764   -5.270  1.00 0.00 ? 72  GLN A HA   4  
ATOM   9783  H  HB2  . GLN A 1 72 ? 141.573 8.874   -6.610  1.00 0.00 ? 72  GLN A HB2  4  
ATOM   9784  H  HB3  . GLN A 1 72 ? 140.274 9.447   -5.561  1.00 0.00 ? 72  GLN A HB3  4  
ATOM   9785  H  HG2  . GLN A 1 72 ? 141.716 9.251   -3.603  1.00 0.00 ? 72  GLN A HG2  4  
ATOM   9786  H  HG3  . GLN A 1 72 ? 143.007 8.577   -4.589  1.00 0.00 ? 72  GLN A HG3  4  
ATOM   9787  H  HE21 . GLN A 1 72 ? 143.835 10.769  -3.303  1.00 0.00 ? 72  GLN A HE21 4  
ATOM   9788  H  HE22 . GLN A 1 72 ? 143.836 12.146  -4.296  1.00 0.00 ? 72  GLN A HE22 4  
ATOM   9789  N  N    . GLU A 1 73 ? 138.717 7.604   -3.982  1.00 0.00 ? 73  GLU A N    4  
ATOM   9790  C  CA   . GLU A 1 73 ? 137.967 7.531   -2.733  1.00 0.00 ? 73  GLU A CA   4  
ATOM   9791  C  C    . GLU A 1 73 ? 137.841 6.069   -2.287  1.00 0.00 ? 73  GLU A C    4  
ATOM   9792  O  O    . GLU A 1 73 ? 137.914 5.745   -1.095  1.00 0.00 ? 73  GLU A O    4  
ATOM   9793  C  CB   . GLU A 1 73 ? 136.566 8.132   -2.920  1.00 0.00 ? 73  GLU A CB   4  
ATOM   9794  C  CG   . GLU A 1 73 ? 136.677 9.623   -3.272  1.00 0.00 ? 73  GLU A CG   4  
ATOM   9795  C  CD   . GLU A 1 73 ? 135.283 10.248  -3.356  1.00 0.00 ? 73  GLU A CD   4  
ATOM   9796  O  OE1  . GLU A 1 73 ? 134.326 9.535   -3.120  1.00 0.00 ? 73  GLU A OE1  4  
ATOM   9797  O  OE2  . GLU A 1 73 ? 135.194 11.438  -3.622  1.00 0.00 ? 73  GLU A OE2  4  
ATOM   9798  H  H    . GLU A 1 73 ? 138.269 7.875   -4.810  1.00 0.00 ? 73  GLU A H    4  
ATOM   9799  H  HA   . GLU A 1 73 ? 138.490 8.090   -1.974  1.00 0.00 ? 73  GLU A HA   4  
ATOM   9800  H  HB2  . GLU A 1 73 ? 136.056 7.612   -3.717  1.00 0.00 ? 73  GLU A HB2  4  
ATOM   9801  H  HB3  . GLU A 1 73 ? 136.005 8.023   -2.003  1.00 0.00 ? 73  GLU A HB3  4  
ATOM   9802  H  HG2  . GLU A 1 73 ? 137.252 10.129  -2.510  1.00 0.00 ? 73  GLU A HG2  4  
ATOM   9803  H  HG3  . GLU A 1 73 ? 137.174 9.729   -4.225  1.00 0.00 ? 73  GLU A HG3  4  
ATOM   9804  N  N    . TYR A 1 74 ? 137.646 5.191   -3.268  1.00 0.00 ? 74  TYR A N    4  
ATOM   9805  C  CA   . TYR A 1 74 ? 137.498 3.764   -3.002  1.00 0.00 ? 74  TYR A CA   4  
ATOM   9806  C  C    . TYR A 1 74 ? 138.743 3.132   -2.383  1.00 0.00 ? 74  TYR A C    4  
ATOM   9807  O  O    . TYR A 1 74 ? 138.640 2.329   -1.448  1.00 0.00 ? 74  TYR A O    4  
ATOM   9808  C  CB   . TYR A 1 74 ? 137.169 3.034   -4.305  1.00 0.00 ? 74  TYR A CB   4  
ATOM   9809  C  CG   . TYR A 1 74 ? 136.982 1.566   -4.015  1.00 0.00 ? 74  TYR A CG   4  
ATOM   9810  C  CD1  . TYR A 1 74 ? 135.739 1.082   -3.590  1.00 0.00 ? 74  TYR A CD1  4  
ATOM   9811  C  CD2  . TYR A 1 74 ? 138.062 0.689   -4.166  1.00 0.00 ? 74  TYR A CD2  4  
ATOM   9812  C  CE1  . TYR A 1 74 ? 135.578 -0.281  -3.315  1.00 0.00 ? 74  TYR A CE1  4  
ATOM   9813  C  CE2  . TYR A 1 74 ? 137.901 -0.674  -3.893  1.00 0.00 ? 74  TYR A CE2  4  
ATOM   9814  C  CZ   . TYR A 1 74 ? 136.660 -1.159  -3.467  1.00 0.00 ? 74  TYR A CZ   4  
ATOM   9815  O  OH   . TYR A 1 74 ? 136.501 -2.502  -3.196  1.00 0.00 ? 74  TYR A OH   4  
ATOM   9816  H  H    . TYR A 1 74 ? 137.593 5.512   -4.193  1.00 0.00 ? 74  TYR A H    4  
ATOM   9817  H  HA   . TYR A 1 74 ? 136.670 3.627   -2.323  1.00 0.00 ? 74  TYR A HA   4  
ATOM   9818  H  HB2  . TYR A 1 74 ? 136.259 3.439   -4.729  1.00 0.00 ? 74  TYR A HB2  4  
ATOM   9819  H  HB3  . TYR A 1 74 ? 137.981 3.162   -5.004  1.00 0.00 ? 74  TYR A HB3  4  
ATOM   9820  H  HD1  . TYR A 1 74 ? 134.907 1.760   -3.473  1.00 0.00 ? 74  TYR A HD1  4  
ATOM   9821  H  HD2  . TYR A 1 74 ? 139.020 1.063   -4.494  1.00 0.00 ? 74  TYR A HD2  4  
ATOM   9822  H  HE1  . TYR A 1 74 ? 134.620 -0.656  -2.987  1.00 0.00 ? 74  TYR A HE1  4  
ATOM   9823  H  HE2  . TYR A 1 74 ? 138.736 -1.349  -4.011  1.00 0.00 ? 74  TYR A HE2  4  
ATOM   9824  H  HH   . TYR A 1 74 ? 136.761 -2.995  -3.978  1.00 0.00 ? 74  TYR A HH   4  
ATOM   9825  N  N    . VAL A 1 75 ? 139.917 3.464   -2.916  1.00 0.00 ? 75  VAL A N    4  
ATOM   9826  C  CA   . VAL A 1 75 ? 141.140 2.866   -2.400  1.00 0.00 ? 75  VAL A CA   4  
ATOM   9827  C  C    . VAL A 1 75 ? 141.315 3.191   -0.922  1.00 0.00 ? 75  VAL A C    4  
ATOM   9828  O  O    . VAL A 1 75 ? 141.731 2.338   -0.139  1.00 0.00 ? 75  VAL A O    4  
ATOM   9829  C  CB   . VAL A 1 75 ? 142.362 3.329   -3.204  1.00 0.00 ? 75  VAL A CB   4  
ATOM   9830  C  CG1  . VAL A 1 75 ? 142.817 4.712   -2.737  1.00 0.00 ? 75  VAL A CG1  4  
ATOM   9831  C  CG2  . VAL A 1 75 ? 143.502 2.314   -3.027  1.00 0.00 ? 75  VAL A CG2  4  
ATOM   9832  H  H    . VAL A 1 75 ? 139.957 4.087   -3.671  1.00 0.00 ? 75  VAL A H    4  
ATOM   9833  H  HA   . VAL A 1 75 ? 141.057 1.794   -2.500  1.00 0.00 ? 75  VAL A HA   4  
ATOM   9834  H  HB   . VAL A 1 75 ? 142.094 3.382   -4.249  1.00 0.00 ? 75  VAL A HB   4  
ATOM   9835  H  HG11 . VAL A 1 75 ? 143.305 5.225   -3.553  1.00 0.00 ? 75  VAL A HG11 4  
ATOM   9836  H  HG12 . VAL A 1 75 ? 143.509 4.607   -1.914  1.00 0.00 ? 75  VAL A HG12 4  
ATOM   9837  H  HG13 . VAL A 1 75 ? 141.966 5.280   -2.415  1.00 0.00 ? 75  VAL A HG13 4  
ATOM   9838  H  HG21 . VAL A 1 75 ? 143.472 1.600   -3.838  1.00 0.00 ? 75  VAL A HG21 4  
ATOM   9839  H  HG22 . VAL A 1 75 ? 143.385 1.793   -2.088  1.00 0.00 ? 75  VAL A HG22 4  
ATOM   9840  H  HG23 . VAL A 1 75 ? 144.450 2.827   -3.037  1.00 0.00 ? 75  VAL A HG23 4  
ATOM   9841  N  N    . VAL A 1 76 ? 140.972 4.415   -0.532  1.00 0.00 ? 76  VAL A N    4  
ATOM   9842  C  CA   . VAL A 1 76 ? 141.080 4.787   0.867   1.00 0.00 ? 76  VAL A CA   4  
ATOM   9843  C  C    . VAL A 1 76 ? 139.939 4.162   1.658   1.00 0.00 ? 76  VAL A C    4  
ATOM   9844  O  O    . VAL A 1 76 ? 140.111 3.790   2.820   1.00 0.00 ? 76  VAL A O    4  
ATOM   9845  C  CB   . VAL A 1 76 ? 141.089 6.312   1.034   1.00 0.00 ? 76  VAL A CB   4  
ATOM   9846  C  CG1  . VAL A 1 76 ? 142.271 6.896   0.257   1.00 0.00 ? 76  VAL A CG1  4  
ATOM   9847  C  CG2  . VAL A 1 76 ? 139.794 6.913   0.486   1.00 0.00 ? 76  VAL A CG2  4  
ATOM   9848  H  H    . VAL A 1 76 ? 140.626 5.059   -1.185  1.00 0.00 ? 76  VAL A H    4  
ATOM   9849  H  HA   . VAL A 1 76 ? 142.011 4.395   1.251   1.00 0.00 ? 76  VAL A HA   4  
ATOM   9850  H  HB   . VAL A 1 76 ? 141.190 6.558   2.080   1.00 0.00 ? 76  VAL A HB   4  
ATOM   9851  H  HG11 . VAL A 1 76 ? 142.457 7.906   0.592   1.00 0.00 ? 76  VAL A HG11 4  
ATOM   9852  H  HG12 . VAL A 1 76 ? 142.041 6.903   -0.797  1.00 0.00 ? 76  VAL A HG12 4  
ATOM   9853  H  HG13 . VAL A 1 76 ? 143.150 6.292   0.431   1.00 0.00 ? 76  VAL A HG13 4  
ATOM   9854  H  HG21 . VAL A 1 76 ? 138.947 6.359   0.858   1.00 0.00 ? 76  VAL A HG21 4  
ATOM   9855  H  HG22 . VAL A 1 76 ? 139.813 6.871   -0.593  1.00 0.00 ? 76  VAL A HG22 4  
ATOM   9856  H  HG23 . VAL A 1 76 ? 139.716 7.943   0.802   1.00 0.00 ? 76  VAL A HG23 4  
ATOM   9857  N  N    . LEU A 1 77 ? 138.766 4.044   1.027   1.00 0.00 ? 77  LEU A N    4  
ATOM   9858  C  CA   . LEU A 1 77 ? 137.621 3.453   1.709   1.00 0.00 ? 77  LEU A CA   4  
ATOM   9859  C  C    . LEU A 1 77 ? 137.914 2.021   2.136   1.00 0.00 ? 77  LEU A C    4  
ATOM   9860  O  O    . LEU A 1 77 ? 137.571 1.618   3.247   1.00 0.00 ? 77  LEU A O    4  
ATOM   9861  C  CB   . LEU A 1 77 ? 136.401 3.472   0.780   1.00 0.00 ? 77  LEU A CB   4  
ATOM   9862  C  CG   . LEU A 1 77 ? 135.138 3.038   1.549   1.00 0.00 ? 77  LEU A CG   4  
ATOM   9863  C  CD1  . LEU A 1 77 ? 133.910 3.721   0.943   1.00 0.00 ? 77  LEU A CD1  4  
ATOM   9864  C  CD2  . LEU A 1 77 ? 134.945 1.516   1.457   1.00 0.00 ? 77  LEU A CD2  4  
ATOM   9865  H  H    . LEU A 1 77 ? 138.674 4.360   0.096   1.00 0.00 ? 77  LEU A H    4  
ATOM   9866  H  HA   . LEU A 1 77 ? 137.397 4.040   2.587   1.00 0.00 ? 77  LEU A HA   4  
ATOM   9867  H  HB2  . LEU A 1 77 ? 136.265 4.475   0.398   1.00 0.00 ? 77  LEU A HB2  4  
ATOM   9868  H  HB3  . LEU A 1 77 ? 136.573 2.800   -0.046  1.00 0.00 ? 77  LEU A HB3  4  
ATOM   9869  H  HG   . LEU A 1 77 ? 135.232 3.324   2.587   1.00 0.00 ? 77  LEU A HG   4  
ATOM   9870  H  HD11 . LEU A 1 77 ? 133.751 3.350   -0.058  1.00 0.00 ? 77  LEU A HD11 4  
ATOM   9871  H  HD12 . LEU A 1 77 ? 134.068 4.789   0.910   1.00 0.00 ? 77  LEU A HD12 4  
ATOM   9872  H  HD13 . LEU A 1 77 ? 133.044 3.504   1.549   1.00 0.00 ? 77  LEU A HD13 4  
ATOM   9873  H  HD21 . LEU A 1 77 ? 135.143 1.179   0.450   1.00 0.00 ? 77  LEU A HD21 4  
ATOM   9874  H  HD22 . LEU A 1 77 ? 133.927 1.271   1.719   1.00 0.00 ? 77  LEU A HD22 4  
ATOM   9875  H  HD23 . LEU A 1 77 ? 135.616 1.021   2.141   1.00 0.00 ? 77  LEU A HD23 4  
ATOM   9876  N  N    . VAL A 1 78 ? 138.560 1.252   1.260   1.00 0.00 ? 78  VAL A N    4  
ATOM   9877  C  CA   . VAL A 1 78 ? 138.889 -0.132  1.598   1.00 0.00 ? 78  VAL A CA   4  
ATOM   9878  C  C    . VAL A 1 78 ? 140.029 -0.195  2.612   1.00 0.00 ? 78  VAL A C    4  
ATOM   9879  O  O    . VAL A 1 78 ? 140.084 -1.096  3.458   1.00 0.00 ? 78  VAL A O    4  
ATOM   9880  C  CB   . VAL A 1 78 ? 139.261 -0.918  0.336   1.00 0.00 ? 78  VAL A CB   4  
ATOM   9881  C  CG1  . VAL A 1 78 ? 138.101 -0.855  -0.660  1.00 0.00 ? 78  VAL A CG1  4  
ATOM   9882  C  CG2  . VAL A 1 78 ? 140.507 -0.308  -0.310  1.00 0.00 ? 78  VAL A CG2  4  
ATOM   9883  H  H    . VAL A 1 78 ? 138.819 1.618   0.383   1.00 0.00 ? 78  VAL A H    4  
ATOM   9884  H  HA   . VAL A 1 78 ? 138.016 -0.591  2.040   1.00 0.00 ? 78  VAL A HA   4  
ATOM   9885  H  HB   . VAL A 1 78 ? 139.455 -1.948  0.598   1.00 0.00 ? 78  VAL A HB   4  
ATOM   9886  H  HG11 . VAL A 1 78 ? 138.170 -1.688  -1.344  1.00 0.00 ? 78  VAL A HG11 4  
ATOM   9887  H  HG12 . VAL A 1 78 ? 138.152 0.071   -1.213  1.00 0.00 ? 78  VAL A HG12 4  
ATOM   9888  H  HG13 . VAL A 1 78 ? 137.165 -0.905  -0.125  1.00 0.00 ? 78  VAL A HG13 4  
ATOM   9889  H  HG21 . VAL A 1 78 ? 140.828 -0.932  -1.131  1.00 0.00 ? 78  VAL A HG21 4  
ATOM   9890  H  HG22 . VAL A 1 78 ? 141.299 -0.242  0.421   1.00 0.00 ? 78  VAL A HG22 4  
ATOM   9891  H  HG23 . VAL A 1 78 ? 140.272 0.677   -0.678  1.00 0.00 ? 78  VAL A HG23 4  
ATOM   9892  N  N    . ALA A 1 79 ? 140.948 0.761   2.514   1.00 0.00 ? 79  ALA A N    4  
ATOM   9893  C  CA   . ALA A 1 79 ? 142.093 0.793   3.411   1.00 0.00 ? 79  ALA A CA   4  
ATOM   9894  C  C    . ALA A 1 79 ? 141.654 0.966   4.860   1.00 0.00 ? 79  ALA A C    4  
ATOM   9895  O  O    . ALA A 1 79 ? 142.224 0.355   5.764   1.00 0.00 ? 79  ALA A O    4  
ATOM   9896  C  CB   . ALA A 1 79 ? 143.032 1.935   3.006   1.00 0.00 ? 79  ALA A CB   4  
ATOM   9897  H  H    . ALA A 1 79 ? 140.859 1.445   1.817   1.00 0.00 ? 79  ALA A H    4  
ATOM   9898  H  HA   . ALA A 1 79 ? 142.628 -0.142  3.322   1.00 0.00 ? 79  ALA A HA   4  
ATOM   9899  H  HB1  . ALA A 1 79 ? 142.858 2.191   1.971   1.00 0.00 ? 79  ALA A HB1  4  
ATOM   9900  H  HB2  . ALA A 1 79 ? 144.058 1.620   3.128   1.00 0.00 ? 79  ALA A HB2  4  
ATOM   9901  H  HB3  . ALA A 1 79 ? 142.845 2.801   3.626   1.00 0.00 ? 79  ALA A HB3  4  
ATOM   9902  N  N    . ALA A 1 80 ? 140.636 1.794   5.085   1.00 0.00 ? 80  ALA A N    4  
ATOM   9903  C  CA   . ALA A 1 80 ? 140.154 2.008   6.442   1.00 0.00 ? 80  ALA A CA   4  
ATOM   9904  C  C    . ALA A 1 80 ? 139.562 0.721   7.002   1.00 0.00 ? 80  ALA A C    4  
ATOM   9905  O  O    . ALA A 1 80 ? 139.809 0.360   8.152   1.00 0.00 ? 80  ALA A O    4  
ATOM   9906  C  CB   . ALA A 1 80 ? 139.092 3.109   6.452   1.00 0.00 ? 80  ALA A CB   4  
ATOM   9907  H  H    . ALA A 1 80 ? 140.209 2.257   4.335   1.00 0.00 ? 80  ALA A H    4  
ATOM   9908  H  HA   . ALA A 1 80 ? 140.980 2.314   7.064   1.00 0.00 ? 80  ALA A HA   4  
ATOM   9909  H  HB1  . ALA A 1 80 ? 138.617 3.141   7.420   1.00 0.00 ? 80  ALA A HB1  4  
ATOM   9910  H  HB2  . ALA A 1 80 ? 138.351 2.901   5.694   1.00 0.00 ? 80  ALA A HB2  4  
ATOM   9911  H  HB3  . ALA A 1 80 ? 139.558 4.061   6.247   1.00 0.00 ? 80  ALA A HB3  4  
ATOM   9912  N  N    . LEU A 1 81 ? 138.789 0.025   6.171   1.00 0.00 ? 81  LEU A N    4  
ATOM   9913  C  CA   . LEU A 1 81 ? 138.178 -1.230  6.589   1.00 0.00 ? 81  LEU A CA   4  
ATOM   9914  C  C    . LEU A 1 81 ? 139.246 -2.278  6.872   1.00 0.00 ? 81  LEU A C    4  
ATOM   9915  O  O    . LEU A 1 81 ? 139.116 -3.080  7.799   1.00 0.00 ? 81  LEU A O    4  
ATOM   9916  C  CB   . LEU A 1 81 ? 137.234 -1.739  5.497   1.00 0.00 ? 81  LEU A CB   4  
ATOM   9917  C  CG   . LEU A 1 81 ? 136.165 -0.683  5.201   1.00 0.00 ? 81  LEU A CG   4  
ATOM   9918  C  CD1  . LEU A 1 81 ? 135.165 -1.241  4.187   1.00 0.00 ? 81  LEU A CD1  4  
ATOM   9919  C  CD2  . LEU A 1 81 ? 135.423 -0.318  6.491   1.00 0.00 ? 81  LEU A CD2  4  
ATOM   9920  H  H    . LEU A 1 81 ? 138.636 0.356   5.262   1.00 0.00 ? 81  LEU A H    4  
ATOM   9921  H  HA   . LEU A 1 81 ? 137.612 -1.062  7.491   1.00 0.00 ? 81  LEU A HA   4  
ATOM   9922  H  HB2  . LEU A 1 81 ? 137.800 -1.941  4.598   1.00 0.00 ? 81  LEU A HB2  4  
ATOM   9923  H  HB3  . LEU A 1 81 ? 136.755 -2.648  5.830   1.00 0.00 ? 81  LEU A HB3  4  
ATOM   9924  H  HG   . LEU A 1 81 ? 136.635 0.200   4.792   1.00 0.00 ? 81  LEU A HG   4  
ATOM   9925  H  HD11 . LEU A 1 81 ? 134.450 -1.869  4.697   1.00 0.00 ? 81  LEU A HD11 4  
ATOM   9926  H  HD12 . LEU A 1 81 ? 135.692 -1.825  3.446   1.00 0.00 ? 81  LEU A HD12 4  
ATOM   9927  H  HD13 . LEU A 1 81 ? 134.649 -0.426  3.705   1.00 0.00 ? 81  LEU A HD13 4  
ATOM   9928  H  HD21 . LEU A 1 81 ? 135.345 -1.193  7.120   1.00 0.00 ? 81  LEU A HD21 4  
ATOM   9929  H  HD22 . LEU A 1 81 ? 134.434 0.043   6.251   1.00 0.00 ? 81  LEU A HD22 4  
ATOM   9930  H  HD23 . LEU A 1 81 ? 135.970 0.453   7.014   1.00 0.00 ? 81  LEU A HD23 4  
ATOM   9931  N  N    . THR A 1 82 ? 140.311 -2.258  6.071   1.00 0.00 ? 82  THR A N    4  
ATOM   9932  C  CA   . THR A 1 82 ? 141.398 -3.216  6.239   1.00 0.00 ? 82  THR A CA   4  
ATOM   9933  C  C    . THR A 1 82 ? 141.910 -3.205  7.667   1.00 0.00 ? 82  THR A C    4  
ATOM   9934  O  O    . THR A 1 82 ? 142.248 -4.248  8.227   1.00 0.00 ? 82  THR A O    4  
ATOM   9935  C  CB   . THR A 1 82 ? 142.545 -2.874  5.288   1.00 0.00 ? 82  THR A CB   4  
ATOM   9936  O  OG1  . THR A 1 82 ? 142.061 -2.831  3.954   1.00 0.00 ? 82  THR A OG1  4  
ATOM   9937  C  CG2  . THR A 1 82 ? 143.652 -3.925  5.410   1.00 0.00 ? 82  THR A CG2  4  
ATOM   9938  H  H    . THR A 1 82 ? 140.360 -1.589  5.348   1.00 0.00 ? 82  THR A H    4  
ATOM   9939  H  HA   . THR A 1 82 ? 141.033 -4.204  6.003   1.00 0.00 ? 82  THR A HA   4  
ATOM   9940  H  HB   . THR A 1 82 ? 142.945 -1.910  5.553   1.00 0.00 ? 82  THR A HB   4  
ATOM   9941  H  HG1  . THR A 1 82 ? 142.764 -3.133  3.373   1.00 0.00 ? 82  THR A HG1  4  
ATOM   9942  H  HG21 . THR A 1 82 ? 144.174 -4.008  4.469   1.00 0.00 ? 82  THR A HG21 4  
ATOM   9943  H  HG22 . THR A 1 82 ? 143.217 -4.879  5.668   1.00 0.00 ? 82  THR A HG22 4  
ATOM   9944  H  HG23 . THR A 1 82 ? 144.346 -3.627  6.181   1.00 0.00 ? 82  THR A HG23 4  
ATOM   9945  N  N    . VAL A 1 83 ? 141.960 -2.024  8.252   1.00 0.00 ? 83  VAL A N    4  
ATOM   9946  C  CA   . VAL A 1 83 ? 142.428 -1.884  9.618   1.00 0.00 ? 83  VAL A CA   4  
ATOM   9947  C  C    . VAL A 1 83 ? 141.546 -2.694  10.563  1.00 0.00 ? 83  VAL A C    4  
ATOM   9948  O  O    . VAL A 1 83 ? 142.027 -3.245  11.554  1.00 0.00 ? 83  VAL A O    4  
ATOM   9949  C  CB   . VAL A 1 83 ? 142.417 -0.408  10.025  1.00 0.00 ? 83  VAL A CB   4  
ATOM   9950  C  CG1  . VAL A 1 83 ? 142.792 -0.281  11.505  1.00 0.00 ? 83  VAL A CG1  4  
ATOM   9951  C  CG2  . VAL A 1 83 ? 143.427 0.363   9.169   1.00 0.00 ? 83  VAL A CG2  4  
ATOM   9952  H  H    . VAL A 1 83 ? 141.675 -1.227  7.757   1.00 0.00 ? 83  VAL A H    4  
ATOM   9953  H  HA   . VAL A 1 83 ? 143.440 -2.254  9.680   1.00 0.00 ? 83  VAL A HA   4  
ATOM   9954  H  HB   . VAL A 1 83 ? 141.428 0.003   9.871   1.00 0.00 ? 83  VAL A HB   4  
ATOM   9955  H  HG11 . VAL A 1 83 ? 142.884 0.764   11.764  1.00 0.00 ? 83  VAL A HG11 4  
ATOM   9956  H  HG12 . VAL A 1 83 ? 143.735 -0.780  11.682  1.00 0.00 ? 83  VAL A HG12 4  
ATOM   9957  H  HG13 . VAL A 1 83 ? 142.024 -0.736  12.112  1.00 0.00 ? 83  VAL A HG13 4  
ATOM   9958  H  HG21 . VAL A 1 83 ? 144.391 0.356   9.654   1.00 0.00 ? 83  VAL A HG21 4  
ATOM   9959  H  HG22 . VAL A 1 83 ? 143.090 1.381   9.049   1.00 0.00 ? 83  VAL A HG22 4  
ATOM   9960  H  HG23 . VAL A 1 83 ? 143.510 -0.102  8.197   1.00 0.00 ? 83  VAL A HG23 4  
ATOM   9961  N  N    . ALA A 1 84 ? 140.251 -2.753  10.260  1.00 0.00 ? 84  ALA A N    4  
ATOM   9962  C  CA   . ALA A 1 84 ? 139.313 -3.488  11.103  1.00 0.00 ? 84  ALA A CA   4  
ATOM   9963  C  C    . ALA A 1 84 ? 139.651 -4.978  11.162  1.00 0.00 ? 84  ALA A C    4  
ATOM   9964  O  O    . ALA A 1 84 ? 139.443 -5.625  12.191  1.00 0.00 ? 84  ALA A O    4  
ATOM   9965  C  CB   . ALA A 1 84 ? 137.892 -3.312  10.569  1.00 0.00 ? 84  ALA A CB   4  
ATOM   9966  H  H    . ALA A 1 84 ? 139.915 -2.295  9.450   1.00 0.00 ? 84  ALA A H    4  
ATOM   9967  H  HA   . ALA A 1 84 ? 139.357 -3.083  12.102  1.00 0.00 ? 84  ALA A HA   4  
ATOM   9968  H  HB1  . ALA A 1 84 ? 137.185 -3.462  11.372  1.00 0.00 ? 84  ALA A HB1  4  
ATOM   9969  H  HB2  . ALA A 1 84 ? 137.709 -4.036  9.788   1.00 0.00 ? 84  ALA A HB2  4  
ATOM   9970  H  HB3  . ALA A 1 84 ? 137.777 -2.315  10.169  1.00 0.00 ? 84  ALA A HB3  4  
ATOM   9971  N  N    . MET A 1 85 ? 140.157 -5.532  10.063  1.00 0.00 ? 85  MET A N    4  
ATOM   9972  C  CA   . MET A 1 85 ? 140.481 -6.952  10.052  1.00 0.00 ? 85  MET A CA   4  
ATOM   9973  C  C    . MET A 1 85 ? 141.493 -7.273  11.142  1.00 0.00 ? 85  MET A C    4  
ATOM   9974  O  O    . MET A 1 85 ? 141.411 -8.322  11.780  1.00 0.00 ? 85  MET A O    4  
ATOM   9975  C  CB   . MET A 1 85 ? 141.064 -7.375  8.705   1.00 0.00 ? 85  MET A CB   4  
ATOM   9976  C  CG   . MET A 1 85 ? 141.136 -8.904  8.672   1.00 0.00 ? 85  MET A CG   4  
ATOM   9977  S  SD   . MET A 1 85 ? 142.141 -9.446  7.271   1.00 0.00 ? 85  MET A SD   4  
ATOM   9978  C  CE   . MET A 1 85 ? 143.513 -10.108 8.251   1.00 0.00 ? 85  MET A CE   4  
ATOM   9979  H  H    . MET A 1 85 ? 140.298 -4.988  9.260   1.00 0.00 ? 85  MET A H    4  
ATOM   9980  H  HA   . MET A 1 85 ? 139.585 -7.522  10.233  1.00 0.00 ? 85  MET A HA   4  
ATOM   9981  H  HB2  . MET A 1 85 ? 140.427 -7.021  7.907   1.00 0.00 ? 85  MET A HB2  4  
ATOM   9982  H  HB3  . MET A 1 85 ? 142.054 -6.965  8.591   1.00 0.00 ? 85  MET A HB3  4  
ATOM   9983  H  HG2  . MET A 1 85 ? 141.570 -9.264  9.591   1.00 0.00 ? 85  MET A HG2  4  
ATOM   9984  H  HG3  . MET A 1 85 ? 140.137 -9.303  8.570   1.00 0.00 ? 85  MET A HG3  4  
ATOM   9985  H  HE1  . MET A 1 85 ? 143.781 -9.389  9.014   1.00 0.00 ? 85  MET A HE1  4  
ATOM   9986  H  HE2  . MET A 1 85 ? 144.362 -10.291 7.614   1.00 0.00 ? 85  MET A HE2  4  
ATOM   9987  H  HE3  . MET A 1 85 ? 143.206 -11.035 8.715   1.00 0.00 ? 85  MET A HE3  4  
ATOM   9988  N  N    . ASN A 1 86 ? 142.449 -6.372  11.356  1.00 0.00 ? 86  ASN A N    4  
ATOM   9989  C  CA   . ASN A 1 86 ? 143.454 -6.609  12.382  1.00 0.00 ? 86  ASN A CA   4  
ATOM   9990  C  C    . ASN A 1 86 ? 142.752 -6.799  13.707  1.00 0.00 ? 86  ASN A C    4  
ATOM   9991  O  O    . ASN A 1 86 ? 143.082 -7.682  14.499  1.00 0.00 ? 86  ASN A O    4  
ATOM   9992  C  CB   . ASN A 1 86 ? 144.335 -5.373  12.522  1.00 0.00 ? 86  ASN A CB   4  
ATOM   9993  C  CG   . ASN A 1 86 ? 144.953 -4.998  11.190  1.00 0.00 ? 86  ASN A CG   4  
ATOM   9994  O  OD1  . ASN A 1 86 ? 145.497 -5.846  10.482  1.00 0.00 ? 86  ASN A OD1  4  
ATOM   9995  N  ND2  . ASN A 1 86 ? 144.851 -3.764  10.795  1.00 0.00 ? 86  ASN A ND2  4  
ATOM   9996  H  H    . ASN A 1 86 ? 142.476 -5.551  10.823  1.00 0.00 ? 86  ASN A H    4  
ATOM   9997  H  HA   . ASN A 1 86 ? 144.055 -7.470  12.139  1.00 0.00 ? 86  ASN A HA   4  
ATOM   9998  H  HB2  . ASN A 1 86 ? 143.735 -4.549  12.879  1.00 0.00 ? 86  ASN A HB2  4  
ATOM   9999  H  HB3  . ASN A 1 86 ? 145.120 -5.575  13.234  1.00 0.00 ? 86  ASN A HB3  4  
ATOM   10000 H  HD21 . ASN A 1 86 ? 144.377 -3.109  11.360  1.00 0.00 ? 86  ASN A HD21 4  
ATOM   10001 H  HD22 . ASN A 1 86 ? 145.241 -3.486  9.941   1.00 0.00 ? 86  ASN A HD22 4  
ATOM   10002 N  N    . ASN A 1 87 ? 141.764 -5.942  13.916  1.00 0.00 ? 87  ASN A N    4  
ATOM   10003 C  CA   . ASN A 1 87 ? 140.967 -5.970  15.123  1.00 0.00 ? 87  ASN A CA   4  
ATOM   10004 C  C    . ASN A 1 87 ? 140.221 -7.293  15.229  1.00 0.00 ? 87  ASN A C    4  
ATOM   10005 O  O    . ASN A 1 87 ? 140.130 -7.891  16.301  1.00 0.00 ? 87  ASN A O    4  
ATOM   10006 C  CB   . ASN A 1 87 ? 139.992 -4.798  15.086  1.00 0.00 ? 87  ASN A CB   4  
ATOM   10007 C  CG   . ASN A 1 87 ? 139.391 -4.570  16.470  1.00 0.00 ? 87  ASN A CG   4  
ATOM   10008 O  OD1  . ASN A 1 87 ? 139.912 -5.076  17.465  1.00 0.00 ? 87  ASN A OD1  4  
ATOM   10009 N  ND2  . ASN A 1 87 ? 138.321 -3.834  16.593  1.00 0.00 ? 87  ASN A ND2  4  
ATOM   10010 H  H    . ASN A 1 87 ? 141.564 -5.273  13.227  1.00 0.00 ? 87  ASN A H    4  
ATOM   10011 H  HA   . ASN A 1 87 ? 141.616 -5.861  15.979  1.00 0.00 ? 87  ASN A HA   4  
ATOM   10012 H  HB2  . ASN A 1 87 ? 140.525 -3.908  14.762  1.00 0.00 ? 87  ASN A HB2  4  
ATOM   10013 H  HB3  . ASN A 1 87 ? 139.200 -5.014  14.385  1.00 0.00 ? 87  ASN A HB3  4  
ATOM   10014 H  HD21 . ASN A 1 87 ? 137.909 -3.432  15.800  1.00 0.00 ? 87  ASN A HD21 4  
ATOM   10015 H  HD22 . ASN A 1 87 ? 137.929 -3.683  17.478  1.00 0.00 ? 87  ASN A HD22 4  
ATOM   10016 N  N    . PHE A 1 88 ? 139.704 -7.748  14.090  1.00 0.00 ? 88  PHE A N    4  
ATOM   10017 C  CA   . PHE A 1 88 ? 138.980 -9.012  14.035  1.00 0.00 ? 88  PHE A CA   4  
ATOM   10018 C  C    . PHE A 1 88 ? 139.885 -10.161 14.459  1.00 0.00 ? 88  PHE A C    4  
ATOM   10019 O  O    . PHE A 1 88 ? 139.470 -11.071 15.176  1.00 0.00 ? 88  PHE A O    4  
ATOM   10020 C  CB   . PHE A 1 88 ? 138.467 -9.261  12.615  1.00 0.00 ? 88  PHE A CB   4  
ATOM   10021 C  CG   . PHE A 1 88 ? 137.613 -10.507 12.602  1.00 0.00 ? 88  PHE A CG   4  
ATOM   10022 C  CD1  . PHE A 1 88 ? 136.255 -10.428 12.934  1.00 0.00 ? 88  PHE A CD1  4  
ATOM   10023 C  CD2  . PHE A 1 88 ? 138.178 -11.740 12.257  1.00 0.00 ? 88  PHE A CD2  4  
ATOM   10024 C  CE1  . PHE A 1 88 ? 135.462 -11.581 12.922  1.00 0.00 ? 88  PHE A CE1  4  
ATOM   10025 C  CE2  . PHE A 1 88 ? 137.385 -12.894 12.245  1.00 0.00 ? 88  PHE A CE2  4  
ATOM   10026 C  CZ   . PHE A 1 88 ? 136.028 -12.815 12.578  1.00 0.00 ? 88  PHE A CZ   4  
ATOM   10027 H  H    . PHE A 1 88 ? 139.823 -7.225  13.265  1.00 0.00 ? 88  PHE A H    4  
ATOM   10028 H  HA   . PHE A 1 88 ? 138.136 -8.963  14.707  1.00 0.00 ? 88  PHE A HA   4  
ATOM   10029 H  HB2  . PHE A 1 88 ? 137.878 -8.416  12.292  1.00 0.00 ? 88  PHE A HB2  4  
ATOM   10030 H  HB3  . PHE A 1 88 ? 139.305 -9.394  11.947  1.00 0.00 ? 88  PHE A HB3  4  
ATOM   10031 H  HD1  . PHE A 1 88 ? 135.819 -9.476  13.200  1.00 0.00 ? 88  PHE A HD1  4  
ATOM   10032 H  HD2  . PHE A 1 88 ? 139.225 -11.801 12.000  1.00 0.00 ? 88  PHE A HD2  4  
ATOM   10033 H  HE1  . PHE A 1 88 ? 134.416 -11.520 13.179  1.00 0.00 ? 88  PHE A HE1  4  
ATOM   10034 H  HE2  . PHE A 1 88 ? 137.822 -13.846 11.979  1.00 0.00 ? 88  PHE A HE2  4  
ATOM   10035 H  HZ   . PHE A 1 88 ? 135.417 -13.706 12.569  1.00 0.00 ? 88  PHE A HZ   4  
ATOM   10036 N  N    . PHE A 1 89 ? 141.129 -10.106 13.998  1.00 0.00 ? 89  PHE A N    4  
ATOM   10037 C  CA   . PHE A 1 89 ? 142.101 -11.145 14.304  1.00 0.00 ? 89  PHE A CA   4  
ATOM   10038 C  C    . PHE A 1 89 ? 142.176 -11.357 15.810  1.00 0.00 ? 89  PHE A C    4  
ATOM   10039 O  O    . PHE A 1 89 ? 142.281 -12.487 16.285  1.00 0.00 ? 89  PHE A O    4  
ATOM   10040 C  CB   . PHE A 1 89 ? 143.472 -10.728 13.770  1.00 0.00 ? 89  PHE A CB   4  
ATOM   10041 C  CG   . PHE A 1 89 ? 144.447 -11.869 13.916  1.00 0.00 ? 89  PHE A CG   4  
ATOM   10042 C  CD1  . PHE A 1 89 ? 144.537 -12.832 12.905  1.00 0.00 ? 89  PHE A CD1  4  
ATOM   10043 C  CD2  . PHE A 1 89 ? 145.260 -11.965 15.050  1.00 0.00 ? 89  PHE A CD2  4  
ATOM   10044 C  CE1  . PHE A 1 89 ? 145.439 -13.892 13.025  1.00 0.00 ? 89  PHE A CE1  4  
ATOM   10045 C  CE2  . PHE A 1 89 ? 146.164 -13.028 15.172  1.00 0.00 ? 89  PHE A CE2  4  
ATOM   10046 C  CZ   . PHE A 1 89 ? 146.254 -13.992 14.159  1.00 0.00 ? 89  PHE A CZ   4  
ATOM   10047 H  H    . PHE A 1 89 ? 141.394 -9.356  13.426  1.00 0.00 ? 89  PHE A H    4  
ATOM   10048 H  HA   . PHE A 1 89 ? 141.801 -12.066 13.828  1.00 0.00 ? 89  PHE A HA   4  
ATOM   10049 H  HB2  . PHE A 1 89 ? 143.385 -10.460 12.727  1.00 0.00 ? 89  PHE A HB2  4  
ATOM   10050 H  HB3  . PHE A 1 89 ? 143.831 -9.877  14.330  1.00 0.00 ? 89  PHE A HB3  4  
ATOM   10051 H  HD1  . PHE A 1 89 ? 143.909 -12.755 12.030  1.00 0.00 ? 89  PHE A HD1  4  
ATOM   10052 H  HD2  . PHE A 1 89 ? 145.191 -11.222 15.831  1.00 0.00 ? 89  PHE A HD2  4  
ATOM   10053 H  HE1  . PHE A 1 89 ? 145.506 -14.633 12.242  1.00 0.00 ? 89  PHE A HE1  4  
ATOM   10054 H  HE2  . PHE A 1 89 ? 146.793 -13.104 16.048  1.00 0.00 ? 89  PHE A HE2  4  
ATOM   10055 H  HZ   . PHE A 1 89 ? 146.952 -14.811 14.254  1.00 0.00 ? 89  PHE A HZ   4  
ATOM   10056 N  N    . TRP A 1 90 ? 142.114 -10.261 16.552  1.00 0.00 ? 90  TRP A N    4  
ATOM   10057 C  CA   . TRP A 1 90 ? 142.166 -10.327 18.004  1.00 0.00 ? 90  TRP A CA   4  
ATOM   10058 C  C    . TRP A 1 90 ? 141.085 -11.263 18.541  1.00 0.00 ? 90  TRP A C    4  
ATOM   10059 O  O    . TRP A 1 90 ? 141.291 -11.947 19.544  1.00 0.00 ? 90  TRP A O    4  
ATOM   10060 C  CB   . TRP A 1 90 ? 141.975 -8.931  18.600  1.00 0.00 ? 90  TRP A CB   4  
ATOM   10061 C  CG   . TRP A 1 90 ? 142.198 -8.985  20.077  1.00 0.00 ? 90  TRP A CG   4  
ATOM   10062 C  CD1  . TRP A 1 90 ? 141.222 -8.924  21.012  1.00 0.00 ? 90  TRP A CD1  4  
ATOM   10063 C  CD2  . TRP A 1 90 ? 143.455 -9.109  20.803  1.00 0.00 ? 90  TRP A CD2  4  
ATOM   10064 N  NE1  . TRP A 1 90 ? 141.801 -9.003  22.266  1.00 0.00 ? 90  TRP A NE1  4  
ATOM   10065 C  CE2  . TRP A 1 90 ? 143.175 -9.118  22.190  1.00 0.00 ? 90  TRP A CE2  4  
ATOM   10066 C  CE3  . TRP A 1 90 ? 144.798 -9.214  20.397  1.00 0.00 ? 90  TRP A CE3  4  
ATOM   10067 C  CZ2  . TRP A 1 90 ? 144.191 -9.228  23.140  1.00 0.00 ? 90  TRP A CZ2  4  
ATOM   10068 C  CZ3  . TRP A 1 90 ? 145.823 -9.323  21.352  1.00 0.00 ? 90  TRP A CZ3  4  
ATOM   10069 C  CH2  . TRP A 1 90 ? 145.519 -9.330  22.720  1.00 0.00 ? 90  TRP A CH2  4  
ATOM   10070 H  H    . TRP A 1 90 ? 142.024 -9.388  16.114  1.00 0.00 ? 90  TRP A H    4  
ATOM   10071 H  HA   . TRP A 1 90 ? 143.133 -10.702 18.303  1.00 0.00 ? 90  TRP A HA   4  
ATOM   10072 H  HB2  . TRP A 1 90 ? 142.684 -8.250  18.152  1.00 0.00 ? 90  TRP A HB2  4  
ATOM   10073 H  HB3  . TRP A 1 90 ? 140.971 -8.588  18.399  1.00 0.00 ? 90  TRP A HB3  4  
ATOM   10074 H  HD1  . TRP A 1 90 ? 140.166 -8.830  20.812  1.00 0.00 ? 90  TRP A HD1  4  
ATOM   10075 H  HE1  . TRP A 1 90 ? 141.313 -8.982  23.116  1.00 0.00 ? 90  TRP A HE1  4  
ATOM   10076 H  HE3  . TRP A 1 90 ? 145.042 -9.209  19.345  1.00 0.00 ? 90  TRP A HE3  4  
ATOM   10077 H  HZ2  . TRP A 1 90 ? 143.951 -9.232  24.194  1.00 0.00 ? 90  TRP A HZ2  4  
ATOM   10078 H  HZ3  . TRP A 1 90 ? 146.850 -9.403  21.029  1.00 0.00 ? 90  TRP A HZ3  4  
ATOM   10079 H  HH2  . TRP A 1 90 ? 146.312 -9.415  23.449  1.00 0.00 ? 90  TRP A HH2  4  
ATOM   10080 N  N    . GLU A 1 91 ? 139.929 -11.286 17.878  1.00 0.00 ? 91  GLU A N    4  
ATOM   10081 C  CA   . GLU A 1 91 ? 138.832 -12.142 18.321  1.00 0.00 ? 91  GLU A CA   4  
ATOM   10082 C  C    . GLU A 1 91 ? 139.246 -13.610 18.284  1.00 0.00 ? 91  GLU A C    4  
ATOM   10083 O  O    . GLU A 1 91 ? 138.797 -14.411 19.104  1.00 0.00 ? 91  GLU A O    4  
ATOM   10084 C  CB   . GLU A 1 91 ? 137.603 -11.935 17.432  1.00 0.00 ? 91  GLU A CB   4  
ATOM   10085 C  CG   . GLU A 1 91 ? 137.098 -10.499 17.584  1.00 0.00 ? 91  GLU A CG   4  
ATOM   10086 C  CD   . GLU A 1 91 ? 135.833 -10.300 16.756  1.00 0.00 ? 91  GLU A CD   4  
ATOM   10087 O  OE1  . GLU A 1 91 ? 135.505 -11.191 15.990  1.00 0.00 ? 91  GLU A OE1  4  
ATOM   10088 O  OE2  . GLU A 1 91 ? 135.213 -9.260  16.899  1.00 0.00 ? 91  GLU A OE2  4  
ATOM   10089 H  H    . GLU A 1 91 ? 139.811 -10.720 17.082  1.00 0.00 ? 91  GLU A H    4  
ATOM   10090 H  HA   . GLU A 1 91 ? 138.573 -11.879 19.336  1.00 0.00 ? 91  GLU A HA   4  
ATOM   10091 H  HB2  . GLU A 1 91 ? 137.867 -12.120 16.403  1.00 0.00 ? 91  GLU A HB2  4  
ATOM   10092 H  HB3  . GLU A 1 91 ? 136.824 -12.620 17.732  1.00 0.00 ? 91  GLU A HB3  4  
ATOM   10093 H  HG2  . GLU A 1 91 ? 136.880 -10.304 18.625  1.00 0.00 ? 91  GLU A HG2  4  
ATOM   10094 H  HG3  . GLU A 1 91 ? 137.860 -9.813  17.244  1.00 0.00 ? 91  GLU A HG3  4  
ATOM   10095 N  N    . ASN A 1 92 ? 140.102 -13.956 17.329  1.00 0.00 ? 92  ASN A N    4  
ATOM   10096 C  CA   . ASN A 1 92 ? 140.570 -15.333 17.196  1.00 0.00 ? 92  ASN A CA   4  
ATOM   10097 C  C    . ASN A 1 92 ? 141.956 -15.489 17.813  1.00 0.00 ? 92  ASN A C    4  
ATOM   10098 O  O    . ASN A 1 92 ? 142.910 -14.834 17.394  1.00 0.00 ? 92  ASN A O    4  
ATOM   10099 C  CB   . ASN A 1 92 ? 140.622 -15.726 15.718  1.00 0.00 ? 92  ASN A CB   4  
ATOM   10100 C  CG   . ASN A 1 92 ? 140.991 -17.199 15.583  1.00 0.00 ? 92  ASN A CG   4  
ATOM   10101 O  OD1  . ASN A 1 92 ? 142.120 -17.527 15.219  1.00 0.00 ? 92  ASN A OD1  4  
ATOM   10102 N  ND2  . ASN A 1 92 ? 140.100 -18.112 15.857  1.00 0.00 ? 92  ASN A ND2  4  
ATOM   10103 H  H    . ASN A 1 92 ? 140.427 -13.275 16.703  1.00 0.00 ? 92  ASN A H    4  
ATOM   10104 H  HA   . ASN A 1 92 ? 139.883 -15.991 17.707  1.00 0.00 ? 92  ASN A HA   4  
ATOM   10105 H  HB2  . ASN A 1 92 ? 139.654 -15.555 15.268  1.00 0.00 ? 92  ASN A HB2  4  
ATOM   10106 H  HB3  . ASN A 1 92 ? 141.363 -15.124 15.213  1.00 0.00 ? 92  ASN A HB3  4  
ATOM   10107 H  HD21 . ASN A 1 92 ? 139.201 -17.849 16.146  1.00 0.00 ? 92  ASN A HD21 4  
ATOM   10108 H  HD22 . ASN A 1 92 ? 140.329 -19.062 15.772  1.00 0.00 ? 92  ASN A HD22 4  
ATOM   10109 N  N    . SER A 1 93 ? 142.059 -16.361 18.811  1.00 0.00 ? 93  SER A N    4  
ATOM   10110 C  CA   . SER A 1 93 ? 143.333 -16.596 19.480  1.00 0.00 ? 93  SER A CA   4  
ATOM   10111 C  C    . SER A 1 93 ? 144.329 -17.245 18.524  1.00 0.00 ? 93  SER A C    4  
ATOM   10112 O  O    . SER A 1 93 ? 144.095 -18.377 18.136  1.00 0.00 ? 93  SER A O    4  
ATOM   10113 C  CB   . SER A 1 93 ? 143.127 -17.499 20.696  1.00 0.00 ? 93  SER A CB   4  
ATOM   10114 O  OG   . SER A 1 93 ? 142.130 -16.933 21.537  1.00 0.00 ? 93  SER A OG   4  
ATOM   10115 O  OXT  . SER A 1 93 ? 145.311 -16.600 18.194  1.00 0.00 ? 93  SER A OXT  4  
ATOM   10116 H  H    . SER A 1 93 ? 141.264 -16.855 19.103  1.00 0.00 ? 93  SER A H    4  
ATOM   10117 H  HA   . SER A 1 93 ? 143.733 -15.649 19.813  1.00 0.00 ? 93  SER A HA   4  
ATOM   10118 H  HB2  . SER A 1 93 ? 142.805 -18.475 20.371  1.00 0.00 ? 93  SER A HB2  4  
ATOM   10119 H  HB3  . SER A 1 93 ? 144.059 -17.591 21.236  1.00 0.00 ? 93  SER A HB3  4  
ATOM   10120 H  HG   . SER A 1 93 ? 142.037 -17.498 22.308  1.00 0.00 ? 93  SER A HG   4  
ATOM   10121 N  N    . GLY B 1 1  ? 136.253 -15.821 2.716   1.00 0.00 ? 1   GLY B N    4  
ATOM   10122 C  CA   . GLY B 1 1  ? 136.616 -16.538 1.500   1.00 0.00 ? 1   GLY B CA   4  
ATOM   10123 C  C    . GLY B 1 1  ? 136.397 -15.668 0.268   1.00 0.00 ? 1   GLY B C    4  
ATOM   10124 O  O    . GLY B 1 1  ? 135.986 -16.157 -0.785  1.00 0.00 ? 1   GLY B O    4  
ATOM   10125 H  H1   . GLY B 1 1  ? 136.763 -15.965 3.540   1.00 0.00 ? 1   GLY B H1   4  
ATOM   10126 H  HA2  . GLY B 1 1  ? 137.657 -16.824 1.554   1.00 0.00 ? 1   GLY B HA2  4  
ATOM   10127 H  HA3  . GLY B 1 1  ? 136.007 -17.427 1.417   1.00 0.00 ? 1   GLY B HA3  4  
ATOM   10128 N  N    . SER B 1 2  ? 136.675 -14.375 0.405   1.00 0.00 ? 2   SER B N    4  
ATOM   10129 C  CA   . SER B 1 2  ? 136.507 -13.439 -0.705  1.00 0.00 ? 2   SER B CA   4  
ATOM   10130 C  C    . SER B 1 2  ? 137.865 -13.011 -1.254  1.00 0.00 ? 2   SER B C    4  
ATOM   10131 O  O    . SER B 1 2  ? 138.827 -12.830 -0.501  1.00 0.00 ? 2   SER B O    4  
ATOM   10132 C  CB   . SER B 1 2  ? 135.732 -12.209 -0.235  1.00 0.00 ? 2   SER B CB   4  
ATOM   10133 O  OG   . SER B 1 2  ? 135.473 -11.364 -1.348  1.00 0.00 ? 2   SER B OG   4  
ATOM   10134 H  H    . SER B 1 2  ? 137.001 -14.042 1.268   1.00 0.00 ? 2   SER B H    4  
ATOM   10135 H  HA   . SER B 1 2  ? 135.947 -13.921 -1.493  1.00 0.00 ? 2   SER B HA   4  
ATOM   10136 H  HB2  . SER B 1 2  ? 134.796 -12.516 0.202   1.00 0.00 ? 2   SER B HB2  4  
ATOM   10137 H  HB3  . SER B 1 2  ? 136.315 -11.679 0.505   1.00 0.00 ? 2   SER B HB3  4  
ATOM   10138 H  HG   . SER B 1 2  ? 136.195 -11.468 -1.972  1.00 0.00 ? 2   SER B HG   4  
ATOM   10139 N  N    . GLU B 1 3  ? 137.941 -12.857 -2.572  1.00 0.00 ? 3   GLU B N    4  
ATOM   10140 C  CA   . GLU B 1 3  ? 139.190 -12.460 -3.202  1.00 0.00 ? 3   GLU B CA   4  
ATOM   10141 C  C    . GLU B 1 3  ? 139.692 -11.141 -2.626  1.00 0.00 ? 3   GLU B C    4  
ATOM   10142 O  O    . GLU B 1 3  ? 140.897 -10.959 -2.439  1.00 0.00 ? 3   GLU B O    4  
ATOM   10143 C  CB   . GLU B 1 3  ? 138.985 -12.310 -4.712  1.00 0.00 ? 3   GLU B CB   4  
ATOM   10144 C  CG   . GLU B 1 3  ? 140.326 -12.021 -5.387  1.00 0.00 ? 3   GLU B CG   4  
ATOM   10145 C  CD   . GLU B 1 3  ? 140.116 -11.771 -6.876  1.00 0.00 ? 3   GLU B CD   4  
ATOM   10146 O  OE1  . GLU B 1 3  ? 138.976 -11.805 -7.309  1.00 0.00 ? 3   GLU B OE1  4  
ATOM   10147 O  OE2  . GLU B 1 3  ? 141.100 -11.550 -7.563  1.00 0.00 ? 3   GLU B OE2  4  
ATOM   10148 H  H    . GLU B 1 3  ? 137.148 -13.018 -3.125  1.00 0.00 ? 3   GLU B H    4  
ATOM   10149 H  HA   . GLU B 1 3  ? 139.931 -13.225 -3.027  1.00 0.00 ? 3   GLU B HA   4  
ATOM   10150 H  HB2  . GLU B 1 3  ? 138.570 -13.225 -5.110  1.00 0.00 ? 3   GLU B HB2  4  
ATOM   10151 H  HB3  . GLU B 1 3  ? 138.304 -11.494 -4.902  1.00 0.00 ? 3   GLU B HB3  4  
ATOM   10152 H  HG2  . GLU B 1 3  ? 140.772 -11.147 -4.936  1.00 0.00 ? 3   GLU B HG2  4  
ATOM   10153 H  HG3  . GLU B 1 3  ? 140.983 -12.866 -5.256  1.00 0.00 ? 3   GLU B HG3  4  
ATOM   10154 N  N    . LEU B 1 4  ? 138.773 -10.225 -2.331  1.00 0.00 ? 4   LEU B N    4  
ATOM   10155 C  CA   . LEU B 1 4  ? 139.176 -8.946  -1.764  1.00 0.00 ? 4   LEU B CA   4  
ATOM   10156 C  C    . LEU B 1 4  ? 139.912 -9.181  -0.451  1.00 0.00 ? 4   LEU B C    4  
ATOM   10157 O  O    . LEU B 1 4  ? 140.951 -8.570  -0.180  1.00 0.00 ? 4   LEU B O    4  
ATOM   10158 C  CB   . LEU B 1 4  ? 137.929 -8.089  -1.503  1.00 0.00 ? 4   LEU B CB   4  
ATOM   10159 C  CG   . LEU B 1 4  ? 138.333 -6.696  -1.000  1.00 0.00 ? 4   LEU B CG   4  
ATOM   10160 C  CD1  . LEU B 1 4  ? 138.815 -5.836  -2.172  1.00 0.00 ? 4   LEU B CD1  4  
ATOM   10161 C  CD2  . LEU B 1 4  ? 137.126 -6.026  -0.332  1.00 0.00 ? 4   LEU B CD2  4  
ATOM   10162 H  H    . LEU B 1 4  ? 137.825 -10.415 -2.487  1.00 0.00 ? 4   LEU B H    4  
ATOM   10163 H  HA   . LEU B 1 4  ? 139.826 -8.433  -2.457  1.00 0.00 ? 4   LEU B HA   4  
ATOM   10164 H  HB2  . LEU B 1 4  ? 137.364 -7.991  -2.417  1.00 0.00 ? 4   LEU B HB2  4  
ATOM   10165 H  HB3  . LEU B 1 4  ? 137.316 -8.571  -0.756  1.00 0.00 ? 4   LEU B HB3  4  
ATOM   10166 H  HG   . LEU B 1 4  ? 139.132 -6.790  -0.283  1.00 0.00 ? 4   LEU B HG   4  
ATOM   10167 H  HD11 . LEU B 1 4  ? 139.801 -6.157  -2.474  1.00 0.00 ? 4   LEU B HD11 4  
ATOM   10168 H  HD12 . LEU B 1 4  ? 138.853 -4.801  -1.865  1.00 0.00 ? 4   LEU B HD12 4  
ATOM   10169 H  HD13 . LEU B 1 4  ? 138.133 -5.938  -3.002  1.00 0.00 ? 4   LEU B HD13 4  
ATOM   10170 H  HD21 . LEU B 1 4  ? 137.441 -5.113  0.150   1.00 0.00 ? 4   LEU B HD21 4  
ATOM   10171 H  HD22 . LEU B 1 4  ? 136.705 -6.695  0.409   1.00 0.00 ? 4   LEU B HD22 4  
ATOM   10172 H  HD23 . LEU B 1 4  ? 136.379 -5.800  -1.078  1.00 0.00 ? 4   LEU B HD23 4  
ATOM   10173 N  N    . GLU B 1 5  ? 139.378 -10.099 0.354   1.00 0.00 ? 5   GLU B N    4  
ATOM   10174 C  CA   . GLU B 1 5  ? 140.007 -10.425 1.622   1.00 0.00 ? 5   GLU B CA   4  
ATOM   10175 C  C    . GLU B 1 5  ? 141.351 -11.088 1.389   1.00 0.00 ? 5   GLU B C    4  
ATOM   10176 O  O    . GLU B 1 5  ? 142.310 -10.829 2.111   1.00 0.00 ? 5   GLU B O    4  
ATOM   10177 C  CB   . GLU B 1 5  ? 139.105 -11.358 2.434   1.00 0.00 ? 5   GLU B CB   4  
ATOM   10178 C  CG   . GLU B 1 5  ? 137.828 -10.621 2.845   1.00 0.00 ? 5   GLU B CG   4  
ATOM   10179 C  CD   . GLU B 1 5  ? 138.168 -9.440  3.748   1.00 0.00 ? 5   GLU B CD   4  
ATOM   10180 O  OE1  . GLU B 1 5  ? 139.266 -9.423  4.281   1.00 0.00 ? 5   GLU B OE1  4  
ATOM   10181 O  OE2  . GLU B 1 5  ? 137.324 -8.574  3.899   1.00 0.00 ? 5   GLU B OE2  4  
ATOM   10182 H  H    . GLU B 1 5  ? 138.563 -10.570 0.081   1.00 0.00 ? 5   GLU B H    4  
ATOM   10183 H  HA   . GLU B 1 5  ? 140.160 -9.514  2.178   1.00 0.00 ? 5   GLU B HA   4  
ATOM   10184 H  HB2  . GLU B 1 5  ? 138.847 -12.219 1.834   1.00 0.00 ? 5   GLU B HB2  4  
ATOM   10185 H  HB3  . GLU B 1 5  ? 139.630 -11.682 3.321   1.00 0.00 ? 5   GLU B HB3  4  
ATOM   10186 H  HG2  . GLU B 1 5  ? 137.326 -10.259 1.960   1.00 0.00 ? 5   GLU B HG2  4  
ATOM   10187 H  HG3  . GLU B 1 5  ? 137.177 -11.300 3.374   1.00 0.00 ? 5   GLU B HG3  4  
ATOM   10188 N  N    . THR B 1 6  ? 141.424 -11.941 0.370   1.00 0.00 ? 6   THR B N    4  
ATOM   10189 C  CA   . THR B 1 6  ? 142.678 -12.616 0.075   1.00 0.00 ? 6   THR B CA   4  
ATOM   10190 C  C    . THR B 1 6  ? 143.762 -11.597 -0.240  1.00 0.00 ? 6   THR B C    4  
ATOM   10191 O  O    . THR B 1 6  ? 144.894 -11.711 0.230   1.00 0.00 ? 6   THR B O    4  
ATOM   10192 C  CB   . THR B 1 6  ? 142.497 -13.562 -1.114  1.00 0.00 ? 6   THR B CB   4  
ATOM   10193 O  OG1  . THR B 1 6  ? 141.423 -14.453 -0.849  1.00 0.00 ? 6   THR B OG1  4  
ATOM   10194 C  CG2  . THR B 1 6  ? 143.783 -14.360 -1.334  1.00 0.00 ? 6   THR B CG2  4  
ATOM   10195 H  H    . THR B 1 6  ? 140.629 -12.112 -0.184  1.00 0.00 ? 6   THR B H    4  
ATOM   10196 H  HA   . THR B 1 6  ? 142.977 -13.193 0.938   1.00 0.00 ? 6   THR B HA   4  
ATOM   10197 H  HB   . THR B 1 6  ? 142.279 -12.987 -2.001  1.00 0.00 ? 6   THR B HB   4  
ATOM   10198 H  HG1  . THR B 1 6  ? 140.994 -14.656 -1.683  1.00 0.00 ? 6   THR B HG1  4  
ATOM   10199 H  HG21 . THR B 1 6  ? 144.502 -13.747 -1.858  1.00 0.00 ? 6   THR B HG21 4  
ATOM   10200 H  HG22 . THR B 1 6  ? 143.565 -15.240 -1.919  1.00 0.00 ? 6   THR B HG22 4  
ATOM   10201 H  HG23 . THR B 1 6  ? 144.192 -14.654 -0.378  1.00 0.00 ? 6   THR B HG23 4  
ATOM   10202 N  N    . ALA B 1 7  ? 143.401 -10.591 -1.031  1.00 0.00 ? 7   ALA B N    4  
ATOM   10203 C  CA   . ALA B 1 7  ? 144.347 -9.544  -1.391  1.00 0.00 ? 7   ALA B CA   4  
ATOM   10204 C  C    . ALA B 1 7  ? 144.709 -8.693  -0.177  1.00 0.00 ? 7   ALA B C    4  
ATOM   10205 O  O    . ALA B 1 7  ? 145.855 -8.279  -0.016  1.00 0.00 ? 7   ALA B O    4  
ATOM   10206 C  CB   . ALA B 1 7  ? 143.749 -8.654  -2.481  1.00 0.00 ? 7   ALA B CB   4  
ATOM   10207 H  H    . ALA B 1 7  ? 142.481 -10.547 -1.368  1.00 0.00 ? 7   ALA B H    4  
ATOM   10208 H  HA   . ALA B 1 7  ? 145.246 -10.004 -1.774  1.00 0.00 ? 7   ALA B HA   4  
ATOM   10209 H  HB1  . ALA B 1 7  ? 144.234 -7.688  -2.465  1.00 0.00 ? 7   ALA B HB1  4  
ATOM   10210 H  HB2  . ALA B 1 7  ? 142.691 -8.528  -2.303  1.00 0.00 ? 7   ALA B HB2  4  
ATOM   10211 H  HB3  . ALA B 1 7  ? 143.900 -9.115  -3.445  1.00 0.00 ? 7   ALA B HB3  4  
ATOM   10212 N  N    . MET B 1 8  ? 143.711 -8.414  0.658   1.00 0.00 ? 8   MET B N    4  
ATOM   10213 C  CA   . MET B 1 8  ? 143.928 -7.581  1.839   1.00 0.00 ? 8   MET B CA   4  
ATOM   10214 C  C    . MET B 1 8  ? 144.963 -8.181  2.793   1.00 0.00 ? 8   MET B C    4  
ATOM   10215 O  O    . MET B 1 8  ? 145.848 -7.476  3.298   1.00 0.00 ? 8   MET B O    4  
ATOM   10216 C  CB   . MET B 1 8  ? 142.603 -7.450  2.588   1.00 0.00 ? 8   MET B CB   4  
ATOM   10217 C  CG   . MET B 1 8  ? 142.739 -6.430  3.714   1.00 0.00 ? 8   MET B CG   4  
ATOM   10218 S  SD   . MET B 1 8  ? 141.251 -6.481  4.742   1.00 0.00 ? 8   MET B SD   4  
ATOM   10219 C  CE   . MET B 1 8  ? 140.071 -6.003  3.458   1.00 0.00 ? 8   MET B CE   4  
ATOM   10220 H  H    . MET B 1 8  ? 142.805 -8.753  0.464   1.00 0.00 ? 8   MET B H    4  
ATOM   10221 H  HA   . MET B 1 8  ? 144.252 -6.601  1.530   1.00 0.00 ? 8   MET B HA   4  
ATOM   10222 H  HB2  . MET B 1 8  ? 141.835 -7.125  1.901   1.00 0.00 ? 8   MET B HB2  4  
ATOM   10223 H  HB3  . MET B 1 8  ? 142.329 -8.408  3.004   1.00 0.00 ? 8   MET B HB3  4  
ATOM   10224 H  HG2  . MET B 1 8  ? 143.603 -6.669  4.316   1.00 0.00 ? 8   MET B HG2  4  
ATOM   10225 H  HG3  . MET B 1 8  ? 142.852 -5.442  3.293   1.00 0.00 ? 8   MET B HG3  4  
ATOM   10226 H  HE1  . MET B 1 8  ? 139.786 -6.880  2.892   1.00 0.00 ? 8   MET B HE1  4  
ATOM   10227 H  HE2  . MET B 1 8  ? 140.528 -5.285  2.797   1.00 0.00 ? 8   MET B HE2  4  
ATOM   10228 H  HE3  . MET B 1 8  ? 139.197 -5.565  3.918   1.00 0.00 ? 8   MET B HE3  4  
ATOM   10229 N  N    . GLU B 1 9  ? 144.862 -9.487  3.021   1.00 0.00 ? 9   GLU B N    4  
ATOM   10230 C  CA   . GLU B 1 9  ? 145.780 -10.163 3.927   1.00 0.00 ? 9   GLU B CA   4  
ATOM   10231 C  C    . GLU B 1 9  ? 147.206 -9.970  3.469   1.00 0.00 ? 9   GLU B C    4  
ATOM   10232 O  O    . GLU B 1 9  ? 148.129 -9.916  4.281   1.00 0.00 ? 9   GLU B O    4  
ATOM   10233 C  CB   . GLU B 1 9  ? 145.450 -11.655 4.005   1.00 0.00 ? 9   GLU B CB   4  
ATOM   10234 C  CG   . GLU B 1 9  ? 144.075 -11.839 4.651   1.00 0.00 ? 9   GLU B CG   4  
ATOM   10235 C  CD   . GLU B 1 9  ? 143.757 -13.323 4.789   1.00 0.00 ? 9   GLU B CD   4  
ATOM   10236 O  OE1  . GLU B 1 9  ? 144.501 -14.121 4.244   1.00 0.00 ? 9   GLU B OE1  4  
ATOM   10237 O  OE2  . GLU B 1 9  ? 142.773 -13.640 5.437   1.00 0.00 ? 9   GLU B OE2  4  
ATOM   10238 H  H    . GLU B 1 9  ? 144.151 -9.999  2.582   1.00 0.00 ? 9   GLU B H    4  
ATOM   10239 H  HA   . GLU B 1 9  ? 145.672 -9.735  4.912   1.00 0.00 ? 9   GLU B HA   4  
ATOM   10240 H  HB2  . GLU B 1 9  ? 145.442 -12.074 3.009   1.00 0.00 ? 9   GLU B HB2  4  
ATOM   10241 H  HB3  . GLU B 1 9  ? 146.197 -12.158 4.602   1.00 0.00 ? 9   GLU B HB3  4  
ATOM   10242 H  HG2  . GLU B 1 9  ? 144.078 -11.381 5.629   1.00 0.00 ? 9   GLU B HG2  4  
ATOM   10243 H  HG3  . GLU B 1 9  ? 143.324 -11.366 4.041   1.00 0.00 ? 9   GLU B HG3  4  
ATOM   10244 N  N    . THR B 1 10 ? 147.383 -9.854  2.170   1.00 0.00 ? 10  THR B N    4  
ATOM   10245 C  CA   . THR B 1 10 ? 148.706 -9.654  1.633   1.00 0.00 ? 10  THR B CA   4  
ATOM   10246 C  C    . THR B 1 10 ? 149.350 -8.420  2.261   1.00 0.00 ? 10  THR B C    4  
ATOM   10247 O  O    . THR B 1 10 ? 150.554 -8.419  2.514   1.00 0.00 ? 10  THR B O    4  
ATOM   10248 C  CB   . THR B 1 10 ? 148.647 -9.482  0.113   1.00 0.00 ? 10  THR B CB   4  
ATOM   10249 O  OG1  . THR B 1 10 ? 147.959 -10.587 -0.459  1.00 0.00 ? 10  THR B OG1  4  
ATOM   10250 C  CG2  . THR B 1 10 ? 150.068 -9.418  -0.453  1.00 0.00 ? 10  THR B CG2  4  
ATOM   10251 H  H    . THR B 1 10 ? 146.612 -9.896  1.566   1.00 0.00 ? 10  THR B H    4  
ATOM   10252 H  HA   . THR B 1 10 ? 149.311 -10.519 1.863   1.00 0.00 ? 10  THR B HA   4  
ATOM   10253 H  HB   . THR B 1 10 ? 148.128 -8.568  -0.129  1.00 0.00 ? 10  THR B HB   4  
ATOM   10254 H  HG1  . THR B 1 10 ? 148.053 -10.532 -1.413  1.00 0.00 ? 10  THR B HG1  4  
ATOM   10255 H  HG21 . THR B 1 10 ? 150.717 -10.056 0.128   1.00 0.00 ? 10  THR B HG21 4  
ATOM   10256 H  HG22 . THR B 1 10 ? 150.427 -8.400  -0.407  1.00 0.00 ? 10  THR B HG22 4  
ATOM   10257 H  HG23 . THR B 1 10 ? 150.061 -9.751  -1.480  1.00 0.00 ? 10  THR B HG23 4  
ATOM   10258 N  N    . LEU B 1 11 ? 148.565 -7.361  2.506   1.00 0.00 ? 11  LEU B N    4  
ATOM   10259 C  CA   . LEU B 1 11 ? 149.155 -6.156  3.094   1.00 0.00 ? 11  LEU B CA   4  
ATOM   10260 C  C    . LEU B 1 11 ? 149.706 -6.446  4.487   1.00 0.00 ? 11  LEU B C    4  
ATOM   10261 O  O    . LEU B 1 11 ? 150.798 -5.995  4.859   1.00 0.00 ? 11  LEU B O    4  
ATOM   10262 C  CB   . LEU B 1 11 ? 148.097 -5.055  3.209   1.00 0.00 ? 11  LEU B CB   4  
ATOM   10263 C  CG   . LEU B 1 11 ? 147.489 -4.765  1.837   1.00 0.00 ? 11  LEU B CG   4  
ATOM   10264 C  CD1  . LEU B 1 11 ? 146.532 -3.576  1.945   1.00 0.00 ? 11  LEU B CD1  4  
ATOM   10265 C  CD2  . LEU B 1 11 ? 148.600 -4.435  0.836   1.00 0.00 ? 11  LEU B CD2  4  
ATOM   10266 H  H    . LEU B 1 11 ? 147.594 -7.391  2.299   1.00 0.00 ? 11  LEU B H    4  
ATOM   10267 H  HA   . LEU B 1 11 ? 149.955 -5.809  2.462   1.00 0.00 ? 11  LEU B HA   4  
ATOM   10268 H  HB2  . LEU B 1 11 ? 147.319 -5.374  3.886   1.00 0.00 ? 11  LEU B HB2  4  
ATOM   10269 H  HB3  . LEU B 1 11 ? 148.557 -4.157  3.592   1.00 0.00 ? 11  LEU B HB3  4  
ATOM   10270 H  HG   . LEU B 1 11 ? 146.944 -5.635  1.502   1.00 0.00 ? 11  LEU B HG   4  
ATOM   10271 H  HD11 . LEU B 1 11 ? 145.871 -3.721  2.787   1.00 0.00 ? 11  LEU B HD11 4  
ATOM   10272 H  HD12 . LEU B 1 11 ? 145.950 -3.499  1.039   1.00 0.00 ? 11  LEU B HD12 4  
ATOM   10273 H  HD13 . LEU B 1 11 ? 147.101 -2.668  2.085   1.00 0.00 ? 11  LEU B HD13 4  
ATOM   10274 H  HD21 . LEU B 1 11 ? 149.384 -3.887  1.337   1.00 0.00 ? 11  LEU B HD21 4  
ATOM   10275 H  HD22 . LEU B 1 11 ? 148.195 -3.833  0.035   1.00 0.00 ? 11  LEU B HD22 4  
ATOM   10276 H  HD23 . LEU B 1 11 ? 149.002 -5.351  0.431   1.00 0.00 ? 11  LEU B HD23 4  
ATOM   10277 N  N    . ILE B 1 12 ? 148.936 -7.202  5.255   1.00 0.00 ? 12  ILE B N    4  
ATOM   10278 C  CA   . ILE B 1 12 ? 149.337 -7.548  6.606   1.00 0.00 ? 12  ILE B CA   4  
ATOM   10279 C  C    . ILE B 1 12 ? 150.582 -8.427  6.626   1.00 0.00 ? 12  ILE B C    4  
ATOM   10280 O  O    . ILE B 1 12 ? 151.485 -8.215  7.436   1.00 0.00 ? 12  ILE B O    4  
ATOM   10281 C  CB   . ILE B 1 12 ? 148.178 -8.243  7.318   1.00 0.00 ? 12  ILE B CB   4  
ATOM   10282 C  CG1  . ILE B 1 12 ? 146.970 -7.293  7.338   1.00 0.00 ? 12  ILE B CG1  4  
ATOM   10283 C  CG2  . ILE B 1 12 ? 148.586 -8.585  8.751   1.00 0.00 ? 12  ILE B CG2  4  
ATOM   10284 C  CD1  . ILE B 1 12 ? 145.746 -7.986  7.954   1.00 0.00 ? 12  ILE B CD1  4  
ATOM   10285 H  H    . ILE B 1 12 ? 148.081 -7.529  4.908   1.00 0.00 ? 12  ILE B H    4  
ATOM   10286 H  HA   . ILE B 1 12 ? 149.559 -6.635  7.138   1.00 0.00 ? 12  ILE B HA   4  
ATOM   10287 H  HB   . ILE B 1 12 ? 147.919 -9.148  6.790   1.00 0.00 ? 12  ILE B HB   4  
ATOM   10288 H  HG12 . ILE B 1 12 ? 147.216 -6.418  7.921   1.00 0.00 ? 12  ILE B HG12 4  
ATOM   10289 H  HG13 . ILE B 1 12 ? 146.737 -6.993  6.323   1.00 0.00 ? 12  ILE B HG13 4  
ATOM   10290 H  HG21 . ILE B 1 12 ? 147.710 -8.867  9.318   1.00 0.00 ? 12  ILE B HG21 4  
ATOM   10291 H  HG22 . ILE B 1 12 ? 149.049 -7.723  9.208   1.00 0.00 ? 12  ILE B HG22 4  
ATOM   10292 H  HG23 . ILE B 1 12 ? 149.286 -9.407  8.737   1.00 0.00 ? 12  ILE B HG23 4  
ATOM   10293 H  HD11 . ILE B 1 12 ? 145.004 -8.150  7.187   1.00 0.00 ? 12  ILE B HD11 4  
ATOM   10294 H  HD12 . ILE B 1 12 ? 145.327 -7.356  8.727   1.00 0.00 ? 12  ILE B HD12 4  
ATOM   10295 H  HD13 . ILE B 1 12 ? 146.034 -8.935  8.385   1.00 0.00 ? 12  ILE B HD13 4  
ATOM   10296 N  N    . ASN B 1 13 ? 150.626 -9.422  5.743   1.00 0.00 ? 13  ASN B N    4  
ATOM   10297 C  CA   . ASN B 1 13 ? 151.773 -10.323 5.703   1.00 0.00 ? 13  ASN B CA   4  
ATOM   10298 C  C    . ASN B 1 13 ? 153.067 -9.572  5.401   1.00 0.00 ? 13  ASN B C    4  
ATOM   10299 O  O    . ASN B 1 13 ? 154.107 -9.843  6.011   1.00 0.00 ? 13  ASN B O    4  
ATOM   10300 C  CB   . ASN B 1 13 ? 151.549 -11.397 4.638   1.00 0.00 ? 13  ASN B CB   4  
ATOM   10301 C  CG   . ASN B 1 13 ? 150.360 -12.271 5.023   1.00 0.00 ? 13  ASN B CG   4  
ATOM   10302 O  OD1  . ASN B 1 13 ? 149.945 -12.281 6.183   1.00 0.00 ? 13  ASN B OD1  4  
ATOM   10303 N  ND2  . ASN B 1 13 ? 149.784 -13.011 4.116   1.00 0.00 ? 13  ASN B ND2  4  
ATOM   10304 H  H    . ASN B 1 13 ? 149.878 -9.558  5.125   1.00 0.00 ? 13  ASN B H    4  
ATOM   10305 H  HA   . ASN B 1 13 ? 151.868 -10.805 6.663   1.00 0.00 ? 13  ASN B HA   4  
ATOM   10306 H  HB2  . ASN B 1 13 ? 151.353 -10.925 3.687   1.00 0.00 ? 13  ASN B HB2  4  
ATOM   10307 H  HB3  . ASN B 1 13 ? 152.433 -12.012 4.559   1.00 0.00 ? 13  ASN B HB3  4  
ATOM   10308 H  HD21 . ASN B 1 13 ? 150.116 -13.003 3.193   1.00 0.00 ? 13  ASN B HD21 4  
ATOM   10309 H  HD22 . ASN B 1 13 ? 149.019 -13.576 4.355   1.00 0.00 ? 13  ASN B HD22 4  
ATOM   10310 N  N    . VAL B 1 14 ? 153.007 -8.616  4.475   1.00 0.00 ? 14  VAL B N    4  
ATOM   10311 C  CA   . VAL B 1 14 ? 154.200 -7.853  4.145   1.00 0.00 ? 14  VAL B CA   4  
ATOM   10312 C  C    . VAL B 1 14 ? 154.532 -6.879  5.262   1.00 0.00 ? 14  VAL B C    4  
ATOM   10313 O  O    . VAL B 1 14 ? 155.700 -6.680  5.593   1.00 0.00 ? 14  VAL B O    4  
ATOM   10314 C  CB   . VAL B 1 14 ? 154.032 -7.114  2.811   1.00 0.00 ? 14  VAL B CB   4  
ATOM   10315 C  CG1  . VAL B 1 14 ? 153.751 -8.129  1.700   1.00 0.00 ? 14  VAL B CG1  4  
ATOM   10316 C  CG2  . VAL B 1 14 ? 152.863 -6.135  2.899   1.00 0.00 ? 14  VAL B CG2  4  
ATOM   10317 H  H    . VAL B 1 14 ? 152.159 -8.423  4.023   1.00 0.00 ? 14  VAL B H    4  
ATOM   10318 H  HA   . VAL B 1 14 ? 155.025 -8.545  4.047   1.00 0.00 ? 14  VAL B HA   4  
ATOM   10319 H  HB   . VAL B 1 14 ? 154.940 -6.575  2.584   1.00 0.00 ? 14  VAL B HB   4  
ATOM   10320 H  HG11 . VAL B 1 14 ? 154.355 -9.010  1.856   1.00 0.00 ? 14  VAL B HG11 4  
ATOM   10321 H  HG12 . VAL B 1 14 ? 153.993 -7.691  0.743   1.00 0.00 ? 14  VAL B HG12 4  
ATOM   10322 H  HG13 . VAL B 1 14 ? 152.706 -8.401  1.717   1.00 0.00 ? 14  VAL B HG13 4  
ATOM   10323 H  HG21 . VAL B 1 14 ? 152.801 -5.565  1.981   1.00 0.00 ? 14  VAL B HG21 4  
ATOM   10324 H  HG22 . VAL B 1 14 ? 153.013 -5.464  3.731   1.00 0.00 ? 14  VAL B HG22 4  
ATOM   10325 H  HG23 . VAL B 1 14 ? 151.951 -6.687  3.039   1.00 0.00 ? 14  VAL B HG23 4  
ATOM   10326 N  N    . PHE B 1 15 ? 153.507 -6.281  5.868   1.00 0.00 ? 15  PHE B N    4  
ATOM   10327 C  CA   . PHE B 1 15 ? 153.760 -5.355  6.961   1.00 0.00 ? 15  PHE B CA   4  
ATOM   10328 C  C    . PHE B 1 15 ? 154.477 -6.082  8.096   1.00 0.00 ? 15  PHE B C    4  
ATOM   10329 O  O    . PHE B 1 15 ? 155.502 -5.617  8.604   1.00 0.00 ? 15  PHE B O    4  
ATOM   10330 C  CB   . PHE B 1 15 ? 152.431 -4.786  7.469   1.00 0.00 ? 15  PHE B CB   4  
ATOM   10331 C  CG   . PHE B 1 15 ? 152.685 -3.728  8.516   1.00 0.00 ? 15  PHE B CG   4  
ATOM   10332 C  CD1  . PHE B 1 15 ? 152.904 -2.398  8.135   1.00 0.00 ? 15  PHE B CD1  4  
ATOM   10333 C  CD2  . PHE B 1 15 ? 152.689 -4.075  9.872   1.00 0.00 ? 15  PHE B CD2  4  
ATOM   10334 C  CE1  . PHE B 1 15 ? 153.127 -1.418  9.110   1.00 0.00 ? 15  PHE B CE1  4  
ATOM   10335 C  CE2  . PHE B 1 15 ? 152.916 -3.096  10.846  1.00 0.00 ? 15  PHE B CE2  4  
ATOM   10336 C  CZ   . PHE B 1 15 ? 153.133 -1.767  10.465  1.00 0.00 ? 15  PHE B CZ   4  
ATOM   10337 H  H    . PHE B 1 15 ? 152.579 -6.474  5.586   1.00 0.00 ? 15  PHE B H    4  
ATOM   10338 H  HA   . PHE B 1 15 ? 154.380 -4.545  6.606   1.00 0.00 ? 15  PHE B HA   4  
ATOM   10339 H  HB2  . PHE B 1 15 ? 151.890 -4.350  6.643   1.00 0.00 ? 15  PHE B HB2  4  
ATOM   10340 H  HB3  . PHE B 1 15 ? 151.844 -5.583  7.901   1.00 0.00 ? 15  PHE B HB3  4  
ATOM   10341 H  HD1  . PHE B 1 15 ? 152.901 -2.128  7.090   1.00 0.00 ? 15  PHE B HD1  4  
ATOM   10342 H  HD2  . PHE B 1 15 ? 152.521 -5.098  10.165  1.00 0.00 ? 15  PHE B HD2  4  
ATOM   10343 H  HE1  . PHE B 1 15 ? 153.292 -0.392  8.817   1.00 0.00 ? 15  PHE B HE1  4  
ATOM   10344 H  HE2  . PHE B 1 15 ? 152.920 -3.366  11.891  1.00 0.00 ? 15  PHE B HE2  4  
ATOM   10345 H  HZ   . PHE B 1 15 ? 153.306 -1.010  11.217  1.00 0.00 ? 15  PHE B HZ   4  
ATOM   10346 N  N    . HIS B 1 16 ? 153.936 -7.242  8.472   1.00 0.00 ? 16  HIS B N    4  
ATOM   10347 C  CA   . HIS B 1 16 ? 154.530 -8.050  9.533   1.00 0.00 ? 16  HIS B CA   4  
ATOM   10348 C  C    . HIS B 1 16 ? 155.937 -8.522  9.181   1.00 0.00 ? 16  HIS B C    4  
ATOM   10349 O  O    . HIS B 1 16 ? 156.844 -8.457  10.012  1.00 0.00 ? 16  HIS B O    4  
ATOM   10350 C  CB   . HIS B 1 16 ? 153.652 -9.272  9.818   1.00 0.00 ? 16  HIS B CB   4  
ATOM   10351 C  CG   . HIS B 1 16 ? 152.352 -8.851  10.453  1.00 0.00 ? 16  HIS B CG   4  
ATOM   10352 N  ND1  . HIS B 1 16 ? 151.209 -9.632  10.373  1.00 0.00 ? 16  HIS B ND1  4  
ATOM   10353 C  CD2  . HIS B 1 16 ? 152.000 -7.754  11.204  1.00 0.00 ? 16  HIS B CD2  4  
ATOM   10354 C  CE1  . HIS B 1 16 ? 150.237 -9.003  11.057  1.00 0.00 ? 16  HIS B CE1  4  
ATOM   10355 N  NE2  . HIS B 1 16 ? 150.665 -7.854  11.583  1.00 0.00 ? 16  HIS B NE2  4  
ATOM   10356 H  H    . HIS B 1 16 ? 153.130 -7.565  8.018   1.00 0.00 ? 16  HIS B H    4  
ATOM   10357 H  HA   . HIS B 1 16 ? 154.586 -7.454  10.429  1.00 0.00 ? 16  HIS B HA   4  
ATOM   10358 H  HB2  . HIS B 1 16 ? 153.445 -9.787  8.891   1.00 0.00 ? 16  HIS B HB2  4  
ATOM   10359 H  HB3  . HIS B 1 16 ? 154.176 -9.939  10.487  1.00 0.00 ? 16  HIS B HB3  4  
ATOM   10360 H  HD1  . HIS B 1 16 ? 151.126 -10.488 9.903   1.00 0.00 ? 16  HIS B HD1  4  
ATOM   10361 H  HD2  . HIS B 1 16 ? 152.661 -6.944  11.474  1.00 0.00 ? 16  HIS B HD2  4  
ATOM   10362 H  HE1  . HIS B 1 16 ? 149.231 -9.382  11.167  1.00 0.00 ? 16  HIS B HE1  4  
ATOM   10363 H  HE2  . HIS B 1 16 ? 150.150 -7.217  12.121  1.00 0.00 ? 16  HIS B HE2  4  
ATOM   10364 N  N    . ALA B 1 17 ? 156.116 -9.028  7.960   1.00 0.00 ? 17  ALA B N    4  
ATOM   10365 C  CA   . ALA B 1 17 ? 157.427 -9.535  7.565   1.00 0.00 ? 17  ALA B CA   4  
ATOM   10366 C  C    . ALA B 1 17 ? 158.474 -8.430  7.525   1.00 0.00 ? 17  ALA B C    4  
ATOM   10367 O  O    . ALA B 1 17 ? 159.562 -8.583  8.079   1.00 0.00 ? 17  ALA B O    4  
ATOM   10368 C  CB   . ALA B 1 17 ? 157.333 -10.193 6.187   1.00 0.00 ? 17  ALA B CB   4  
ATOM   10369 H  H    . ALA B 1 17 ? 155.358 -9.087  7.332   1.00 0.00 ? 17  ALA B H    4  
ATOM   10370 H  HA   . ALA B 1 17 ? 157.742 -10.280 8.278   1.00 0.00 ? 17  ALA B HA   4  
ATOM   10371 H  HB1  . ALA B 1 17 ? 158.327 -10.386 5.812   1.00 0.00 ? 17  ALA B HB1  4  
ATOM   10372 H  HB2  . ALA B 1 17 ? 156.814 -9.534  5.507   1.00 0.00 ? 17  ALA B HB2  4  
ATOM   10373 H  HB3  . ALA B 1 17 ? 156.792 -11.124 6.269   1.00 0.00 ? 17  ALA B HB3  4  
ATOM   10374 N  N    . HIS B 1 18 ? 158.149 -7.317  6.881   1.00 0.00 ? 18  HIS B N    4  
ATOM   10375 C  CA   . HIS B 1 18 ? 159.094 -6.212  6.807   1.00 0.00 ? 18  HIS B CA   4  
ATOM   10376 C  C    . HIS B 1 18 ? 159.413 -5.652  8.188   1.00 0.00 ? 18  HIS B C    4  
ATOM   10377 O  O    . HIS B 1 18 ? 160.579 -5.438  8.521   1.00 0.00 ? 18  HIS B O    4  
ATOM   10378 C  CB   . HIS B 1 18 ? 158.548 -5.105  5.909   1.00 0.00 ? 18  HIS B CB   4  
ATOM   10379 C  CG   . HIS B 1 18 ? 158.542 -5.577  4.479   1.00 0.00 ? 18  HIS B CG   4  
ATOM   10380 N  ND1  . HIS B 1 18 ? 157.432 -6.163  3.890   1.00 0.00 ? 18  HIS B ND1  4  
ATOM   10381 C  CD2  . HIS B 1 18 ? 159.512 -5.557  3.507   1.00 0.00 ? 18  HIS B CD2  4  
ATOM   10382 C  CE1  . HIS B 1 18 ? 157.761 -6.469  2.621   1.00 0.00 ? 18  HIS B CE1  4  
ATOM   10383 N  NE2  . HIS B 1 18 ? 159.017 -6.121  2.337   1.00 0.00 ? 18  HIS B NE2  4  
ATOM   10384 H  H    . HIS B 1 18 ? 157.268 -7.235  6.458   1.00 0.00 ? 18  HIS B H    4  
ATOM   10385 H  HA   . HIS B 1 18 ? 160.010 -6.580  6.370   1.00 0.00 ? 18  HIS B HA   4  
ATOM   10386 H  HB2  . HIS B 1 18 ? 157.540 -4.863  6.214   1.00 0.00 ? 18  HIS B HB2  4  
ATOM   10387 H  HB3  . HIS B 1 18 ? 159.172 -4.229  5.997   1.00 0.00 ? 18  HIS B HB3  4  
ATOM   10388 H  HD1  . HIS B 1 18 ? 156.566 -6.321  4.316   1.00 0.00 ? 18  HIS B HD1  4  
ATOM   10389 H  HD2  . HIS B 1 18 ? 160.510 -5.163  3.634   1.00 0.00 ? 18  HIS B HD2  4  
ATOM   10390 H  HE1  . HIS B 1 18 ? 157.090 -6.942  1.918   1.00 0.00 ? 18  HIS B HE1  4  
ATOM   10391 H  HE2  . HIS B 1 18 ? 159.489 -6.237  1.486   1.00 0.00 ? 18  HIS B HE2  4  
ATOM   10392 N  N    . SER B 1 19 ? 158.379 -5.410  8.991   1.00 0.00 ? 19  SER B N    4  
ATOM   10393 C  CA   . SER B 1 19 ? 158.596 -4.868  10.327  1.00 0.00 ? 19  SER B CA   4  
ATOM   10394 C  C    . SER B 1 19 ? 159.433 -5.820  11.173  1.00 0.00 ? 19  SER B C    4  
ATOM   10395 O  O    . SER B 1 19 ? 160.314 -5.390  11.921  1.00 0.00 ? 19  SER B O    4  
ATOM   10396 C  CB   . SER B 1 19 ? 157.252 -4.624  11.014  1.00 0.00 ? 19  SER B CB   4  
ATOM   10397 O  OG   . SER B 1 19 ? 157.468 -3.934  12.238  1.00 0.00 ? 19  SER B OG   4  
ATOM   10398 H  H    . SER B 1 19 ? 157.464 -5.593  8.681   1.00 0.00 ? 19  SER B H    4  
ATOM   10399 H  HA   . SER B 1 19 ? 159.117 -3.927  10.242  1.00 0.00 ? 19  SER B HA   4  
ATOM   10400 H  HB2  . SER B 1 19 ? 156.623 -4.025  10.377  1.00 0.00 ? 19  SER B HB2  4  
ATOM   10401 H  HB3  . SER B 1 19 ? 156.769 -5.573  11.204  1.00 0.00 ? 19  SER B HB3  4  
ATOM   10402 H  HG   . SER B 1 19 ? 157.348 -4.559  12.957  1.00 0.00 ? 19  SER B HG   4  
ATOM   10403 N  N    . GLY B 1 20 ? 159.142 -7.114  11.049  1.00 0.00 ? 20  GLY B N    4  
ATOM   10404 C  CA   . GLY B 1 20 ? 159.861 -8.137  11.801  1.00 0.00 ? 20  GLY B CA   4  
ATOM   10405 C  C    . GLY B 1 20 ? 161.341 -8.193  11.439  1.00 0.00 ? 20  GLY B C    4  
ATOM   10406 O  O    . GLY B 1 20 ? 162.191 -8.426  12.299  1.00 0.00 ? 20  GLY B O    4  
ATOM   10407 H  H    . GLY B 1 20 ? 158.424 -7.386  10.438  1.00 0.00 ? 20  GLY B H    4  
ATOM   10408 H  HA2  . GLY B 1 20 ? 159.768 -7.925  12.855  1.00 0.00 ? 20  GLY B HA2  4  
ATOM   10409 H  HA3  . GLY B 1 20 ? 159.415 -9.099  11.597  1.00 0.00 ? 20  GLY B HA3  4  
ATOM   10410 N  N    . LYS B 1 21 ? 161.640 -8.013  10.157  1.00 0.00 ? 21  LYS B N    4  
ATOM   10411 C  CA   . LYS B 1 21 ? 163.022 -8.083  9.691   1.00 0.00 ? 21  LYS B CA   4  
ATOM   10412 C  C    . LYS B 1 21 ? 163.913 -7.057  10.382  1.00 0.00 ? 21  LYS B C    4  
ATOM   10413 O  O    . LYS B 1 21 ? 165.052 -7.360  10.739  1.00 0.00 ? 21  LYS B O    4  
ATOM   10414 C  CB   . LYS B 1 21 ? 163.065 -7.855  8.179   1.00 0.00 ? 21  LYS B CB   4  
ATOM   10415 C  CG   . LYS B 1 21 ? 164.496 -8.055  7.677   1.00 0.00 ? 21  LYS B CG   4  
ATOM   10416 C  CD   . LYS B 1 21 ? 164.560 -7.766  6.178   1.00 0.00 ? 21  LYS B CD   4  
ATOM   10417 C  CE   . LYS B 1 21 ? 165.963 -8.087  5.662   1.00 0.00 ? 21  LYS B CE   4  
ATOM   10418 N  NZ   . LYS B 1 21 ? 166.118 -7.556  4.278   1.00 0.00 ? 21  LYS B NZ   4  
ATOM   10419 H  H    . LYS B 1 21 ? 160.921 -7.854  9.511   1.00 0.00 ? 21  LYS B H    4  
ATOM   10420 H  HA   . LYS B 1 21 ? 163.406 -9.070  9.897   1.00 0.00 ? 21  LYS B HA   4  
ATOM   10421 H  HB2  . LYS B 1 21 ? 162.406 -8.561  7.690   1.00 0.00 ? 21  LYS B HB2  4  
ATOM   10422 H  HB3  . LYS B 1 21 ? 162.744 -6.849  7.957   1.00 0.00 ? 21  LYS B HB3  4  
ATOM   10423 H  HG2  . LYS B 1 21 ? 165.160 -7.383  8.200   1.00 0.00 ? 21  LYS B HG2  4  
ATOM   10424 H  HG3  . LYS B 1 21 ? 164.802 -9.074  7.857   1.00 0.00 ? 21  LYS B HG3  4  
ATOM   10425 H  HD2  . LYS B 1 21 ? 163.835 -8.379  5.660   1.00 0.00 ? 21  LYS B HD2  4  
ATOM   10426 H  HD3  . LYS B 1 21 ? 164.343 -6.722  6.001   1.00 0.00 ? 21  LYS B HD3  4  
ATOM   10427 H  HE2  . LYS B 1 21 ? 166.696 -7.627  6.310   1.00 0.00 ? 21  LYS B HE2  4  
ATOM   10428 H  HE3  . LYS B 1 21 ? 166.108 -9.157  5.657   1.00 0.00 ? 21  LYS B HE3  4  
ATOM   10429 H  HZ1  . LYS B 1 21 ? 166.338 -8.337  3.630   1.00 0.00 ? 21  LYS B HZ1  4  
ATOM   10430 H  HZ2  . LYS B 1 21 ? 166.892 -6.860  4.260   1.00 0.00 ? 21  LYS B HZ2  4  
ATOM   10431 H  HZ3  . LYS B 1 21 ? 165.233 -7.100  3.980   1.00 0.00 ? 21  LYS B HZ3  4  
ATOM   10432 N  N    . GLU B 1 22 ? 163.401 -5.845  10.566  1.00 0.00 ? 22  GLU B N    4  
ATOM   10433 C  CA   . GLU B 1 22 ? 164.180 -4.791  11.212  1.00 0.00 ? 22  GLU B CA   4  
ATOM   10434 C  C    . GLU B 1 22 ? 163.432 -4.203  12.404  1.00 0.00 ? 22  GLU B C    4  
ATOM   10435 O  O    . GLU B 1 22 ? 162.201 -4.146  12.411  1.00 0.00 ? 22  GLU B O    4  
ATOM   10436 C  CB   . GLU B 1 22 ? 164.483 -3.687  10.202  1.00 0.00 ? 22  GLU B CB   4  
ATOM   10437 C  CG   . GLU B 1 22 ? 165.300 -4.263  9.045   1.00 0.00 ? 22  GLU B CG   4  
ATOM   10438 C  CD   . GLU B 1 22 ? 165.672 -3.154  8.067   1.00 0.00 ? 22  GLU B CD   4  
ATOM   10439 O  OE1  . GLU B 1 22 ? 165.158 -2.058  8.221   1.00 0.00 ? 22  GLU B OE1  4  
ATOM   10440 O  OE2  . GLU B 1 22 ? 166.466 -3.416  7.178   1.00 0.00 ? 22  GLU B OE2  4  
ATOM   10441 H  H    . GLU B 1 22 ? 162.490 -5.654  10.259  1.00 0.00 ? 22  GLU B H    4  
ATOM   10442 H  HA   . GLU B 1 22 ? 165.117 -5.205  11.559  1.00 0.00 ? 22  GLU B HA   4  
ATOM   10443 H  HB2  . GLU B 1 22 ? 163.555 -3.292  9.824   1.00 0.00 ? 22  GLU B HB2  4  
ATOM   10444 H  HB3  . GLU B 1 22 ? 165.044 -2.900  10.683  1.00 0.00 ? 22  GLU B HB3  4  
ATOM   10445 H  HG2  . GLU B 1 22 ? 166.200 -4.717  9.433   1.00 0.00 ? 22  GLU B HG2  4  
ATOM   10446 H  HG3  . GLU B 1 22 ? 164.715 -5.012  8.530   1.00 0.00 ? 22  GLU B HG3  4  
ATOM   10447 N  N    . GLY B 1 23 ? 164.184 -3.752  13.403  1.00 0.00 ? 23  GLY B N    4  
ATOM   10448 C  CA   . GLY B 1 23 ? 163.579 -3.151  14.586  1.00 0.00 ? 23  GLY B CA   4  
ATOM   10449 C  C    . GLY B 1 23 ? 162.547 -4.089  15.195  1.00 0.00 ? 23  GLY B C    4  
ATOM   10450 O  O    . GLY B 1 23 ? 162.530 -5.283  14.899  1.00 0.00 ? 23  GLY B O    4  
ATOM   10451 H  H    . GLY B 1 23 ? 165.159 -3.812  13.339  1.00 0.00 ? 23  GLY B H    4  
ATOM   10452 H  HA2  . GLY B 1 23 ? 164.351 -2.947  15.315  1.00 0.00 ? 23  GLY B HA2  4  
ATOM   10453 H  HA3  . GLY B 1 23 ? 163.096 -2.226  14.309  1.00 0.00 ? 23  GLY B HA3  4  
ATOM   10454 N  N    . ASP B 1 24 ? 161.674 -3.538  16.032  1.00 0.00 ? 24  ASP B N    4  
ATOM   10455 C  CA   . ASP B 1 24 ? 160.634 -4.344  16.652  1.00 0.00 ? 24  ASP B CA   4  
ATOM   10456 C  C    . ASP B 1 24 ? 159.563 -4.693  15.624  1.00 0.00 ? 24  ASP B C    4  
ATOM   10457 O  O    . ASP B 1 24 ? 159.133 -3.839  14.846  1.00 0.00 ? 24  ASP B O    4  
ATOM   10458 C  CB   . ASP B 1 24 ? 160.000 -3.577  17.815  1.00 0.00 ? 24  ASP B CB   4  
ATOM   10459 C  CG   . ASP B 1 24 ? 161.023 -3.378  18.929  1.00 0.00 ? 24  ASP B CG   4  
ATOM   10460 O  OD1  . ASP B 1 24 ? 162.056 -4.026  18.879  1.00 0.00 ? 24  ASP B OD1  4  
ATOM   10461 O  OD2  . ASP B 1 24 ? 160.758 -2.583  19.814  1.00 0.00 ? 24  ASP B OD2  4  
ATOM   10462 H  H    . ASP B 1 24 ? 161.724 -2.578  16.223  1.00 0.00 ? 24  ASP B H    4  
ATOM   10463 H  HA   . ASP B 1 24 ? 161.071 -5.255  17.031  1.00 0.00 ? 24  ASP B HA   4  
ATOM   10464 H  HB2  . ASP B 1 24 ? 159.660 -2.614  17.465  1.00 0.00 ? 24  ASP B HB2  4  
ATOM   10465 H  HB3  . ASP B 1 24 ? 159.160 -4.137  18.198  1.00 0.00 ? 24  ASP B HB3  4  
ATOM   10466 N  N    . LYS B 1 25 ? 159.135 -5.950  15.625  1.00 0.00 ? 25  LYS B N    4  
ATOM   10467 C  CA   . LYS B 1 25 ? 158.108 -6.396  14.692  1.00 0.00 ? 25  LYS B CA   4  
ATOM   10468 C  C    . LYS B 1 25 ? 156.817 -5.608  14.888  1.00 0.00 ? 25  LYS B C    4  
ATOM   10469 O  O    . LYS B 1 25 ? 156.121 -5.281  13.927  1.00 0.00 ? 25  LYS B O    4  
ATOM   10470 C  CB   . LYS B 1 25 ? 157.827 -7.884  14.904  1.00 0.00 ? 25  LYS B CB   4  
ATOM   10471 C  CG   . LYS B 1 25 ? 156.841 -8.374  13.843  1.00 0.00 ? 25  LYS B CG   4  
ATOM   10472 C  CD   . LYS B 1 25 ? 156.515 -9.849  14.092  1.00 0.00 ? 25  LYS B CD   4  
ATOM   10473 C  CE   . LYS B 1 25 ? 155.657 -10.384 12.944  1.00 0.00 ? 25  LYS B CE   4  
ATOM   10474 N  NZ   . LYS B 1 25 ? 154.249 -9.931  13.123  1.00 0.00 ? 25  LYS B NZ   4  
ATOM   10475 H  H    . LYS B 1 25 ? 159.512 -6.587  16.267  1.00 0.00 ? 25  LYS B H    4  
ATOM   10476 H  HA   . LYS B 1 25 ? 158.461 -6.247  13.683  1.00 0.00 ? 25  LYS B HA   4  
ATOM   10477 H  HB2  . LYS B 1 25 ? 158.749 -8.441  14.828  1.00 0.00 ? 25  LYS B HB2  4  
ATOM   10478 H  HB3  . LYS B 1 25 ? 157.398 -8.031  15.884  1.00 0.00 ? 25  LYS B HB3  4  
ATOM   10479 H  HG2  . LYS B 1 25 ? 155.933 -7.790  13.899  1.00 0.00 ? 25  LYS B HG2  4  
ATOM   10480 H  HG3  . LYS B 1 25 ? 157.282 -8.265  12.863  1.00 0.00 ? 25  LYS B HG3  4  
ATOM   10481 H  HD2  . LYS B 1 25 ? 157.433 -10.415 14.151  1.00 0.00 ? 25  LYS B HD2  4  
ATOM   10482 H  HD3  . LYS B 1 25 ? 155.972 -9.946  15.020  1.00 0.00 ? 25  LYS B HD3  4  
ATOM   10483 H  HE2  . LYS B 1 25 ? 156.038 -10.010 12.005  1.00 0.00 ? 25  LYS B HE2  4  
ATOM   10484 H  HE3  . LYS B 1 25 ? 155.691 -11.463 12.942  1.00 0.00 ? 25  LYS B HE3  4  
ATOM   10485 H  HZ1  . LYS B 1 25 ? 154.074 -9.097  12.527  1.00 0.00 ? 25  LYS B HZ1  4  
ATOM   10486 H  HZ2  . LYS B 1 25 ? 154.089 -9.683  14.121  1.00 0.00 ? 25  LYS B HZ2  4  
ATOM   10487 H  HZ3  . LYS B 1 25 ? 153.601 -10.695 12.846  1.00 0.00 ? 25  LYS B HZ3  4  
ATOM   10488 N  N    . TYR B 1 26 ? 156.497 -5.334  16.147  1.00 0.00 ? 26  TYR B N    4  
ATOM   10489 C  CA   . TYR B 1 26 ? 155.276 -4.614  16.484  1.00 0.00 ? 26  TYR B CA   4  
ATOM   10490 C  C    . TYR B 1 26 ? 155.283 -3.180  15.956  1.00 0.00 ? 26  TYR B C    4  
ATOM   10491 O  O    . TYR B 1 26 ? 154.228 -2.632  15.635  1.00 0.00 ? 26  TYR B O    4  
ATOM   10492 C  CB   . TYR B 1 26 ? 155.091 -4.598  18.000  1.00 0.00 ? 26  TYR B CB   4  
ATOM   10493 C  CG   . TYR B 1 26 ? 154.991 -6.017  18.505  1.00 0.00 ? 26  TYR B CG   4  
ATOM   10494 C  CD1  . TYR B 1 26 ? 153.807 -6.741  18.327  1.00 0.00 ? 26  TYR B CD1  4  
ATOM   10495 C  CD2  . TYR B 1 26 ? 156.081 -6.607  19.156  1.00 0.00 ? 26  TYR B CD2  4  
ATOM   10496 C  CE1  . TYR B 1 26 ? 153.713 -8.056  18.799  1.00 0.00 ? 26  TYR B CE1  4  
ATOM   10497 C  CE2  . TYR B 1 26 ? 155.988 -7.921  19.627  1.00 0.00 ? 26  TYR B CE2  4  
ATOM   10498 C  CZ   . TYR B 1 26 ? 154.803 -8.646  19.449  1.00 0.00 ? 26  TYR B CZ   4  
ATOM   10499 O  OH   . TYR B 1 26 ? 154.710 -9.942  19.913  1.00 0.00 ? 26  TYR B OH   4  
ATOM   10500 H  H    . TYR B 1 26 ? 157.086 -5.640  16.868  1.00 0.00 ? 26  TYR B H    4  
ATOM   10501 H  HA   . TYR B 1 26 ? 154.438 -5.135  16.047  1.00 0.00 ? 26  TYR B HA   4  
ATOM   10502 H  HB2  . TYR B 1 26 ? 155.937 -4.109  18.462  1.00 0.00 ? 26  TYR B HB2  4  
ATOM   10503 H  HB3  . TYR B 1 26 ? 154.186 -4.063  18.248  1.00 0.00 ? 26  TYR B HB3  4  
ATOM   10504 H  HD1  . TYR B 1 26 ? 152.968 -6.287  17.822  1.00 0.00 ? 26  TYR B HD1  4  
ATOM   10505 H  HD2  . TYR B 1 26 ? 156.995 -6.047  19.292  1.00 0.00 ? 26  TYR B HD2  4  
ATOM   10506 H  HE1  . TYR B 1 26 ? 152.799 -8.615  18.662  1.00 0.00 ? 26  TYR B HE1  4  
ATOM   10507 H  HE2  . TYR B 1 26 ? 156.830 -8.377  20.128  1.00 0.00 ? 26  TYR B HE2  4  
ATOM   10508 H  HH   . TYR B 1 26 ? 153.903 -10.326 19.564  1.00 0.00 ? 26  TYR B HH   4  
ATOM   10509 N  N    . LYS B 1 27 ? 156.461 -2.561  15.886  1.00 0.00 ? 27  LYS B N    4  
ATOM   10510 C  CA   . LYS B 1 27 ? 156.550 -1.177  15.416  1.00 0.00 ? 27  LYS B CA   4  
ATOM   10511 C  C    . LYS B 1 27 ? 157.321 -1.068  14.103  1.00 0.00 ? 27  LYS B C    4  
ATOM   10512 O  O    . LYS B 1 27 ? 158.332 -1.746  13.894  1.00 0.00 ? 27  LYS B O    4  
ATOM   10513 C  CB   . LYS B 1 27 ? 157.241 -0.319  16.477  1.00 0.00 ? 27  LYS B CB   4  
ATOM   10514 C  CG   . LYS B 1 27 ? 156.388 -0.291  17.746  1.00 0.00 ? 27  LYS B CG   4  
ATOM   10515 C  CD   . LYS B 1 27 ? 157.019 0.661   18.765  1.00 0.00 ? 27  LYS B CD   4  
ATOM   10516 C  CE   . LYS B 1 27 ? 156.236 0.595   20.078  1.00 0.00 ? 27  LYS B CE   4  
ATOM   10517 N  NZ   . LYS B 1 27 ? 157.066 1.160   21.180  1.00 0.00 ? 27  LYS B NZ   4  
ATOM   10518 H  H    . LYS B 1 27 ? 157.274 -3.031  16.168  1.00 0.00 ? 27  LYS B H    4  
ATOM   10519 H  HA   . LYS B 1 27 ? 155.552 -0.791  15.262  1.00 0.00 ? 27  LYS B HA   4  
ATOM   10520 H  HB2  . LYS B 1 27 ? 158.211 -0.736  16.702  1.00 0.00 ? 27  LYS B HB2  4  
ATOM   10521 H  HB3  . LYS B 1 27 ? 157.360 0.688   16.105  1.00 0.00 ? 27  LYS B HB3  4  
ATOM   10522 H  HG2  . LYS B 1 27 ? 155.392 0.048   17.504  1.00 0.00 ? 27  LYS B HG2  4  
ATOM   10523 H  HG3  . LYS B 1 27 ? 156.338 -1.284  18.168  1.00 0.00 ? 27  LYS B HG3  4  
ATOM   10524 H  HD2  . LYS B 1 27 ? 158.044 0.371   18.941  1.00 0.00 ? 27  LYS B HD2  4  
ATOM   10525 H  HD3  . LYS B 1 27 ? 156.990 1.669   18.381  1.00 0.00 ? 27  LYS B HD3  4  
ATOM   10526 H  HE2  . LYS B 1 27 ? 155.325 1.169   19.983  1.00 0.00 ? 27  LYS B HE2  4  
ATOM   10527 H  HE3  . LYS B 1 27 ? 155.993 -0.433  20.301  1.00 0.00 ? 27  LYS B HE3  4  
ATOM   10528 H  HZ1  . LYS B 1 27 ? 157.024 0.529   22.004  1.00 0.00 ? 27  LYS B HZ1  4  
ATOM   10529 H  HZ2  . LYS B 1 27 ? 156.702 2.099   21.441  1.00 0.00 ? 27  LYS B HZ2  4  
ATOM   10530 H  HZ3  . LYS B 1 27 ? 158.052 1.245   20.862  1.00 0.00 ? 27  LYS B HZ3  4  
ATOM   10531 N  N    . LEU B 1 28 ? 156.839 -0.183  13.230  1.00 0.00 ? 28  LEU B N    4  
ATOM   10532 C  CA   . LEU B 1 28 ? 157.480 0.055   11.943  1.00 0.00 ? 28  LEU B CA   4  
ATOM   10533 C  C    . LEU B 1 28 ? 158.106 1.447   11.937  1.00 0.00 ? 28  LEU B C    4  
ATOM   10534 O  O    . LEU B 1 28 ? 157.468 2.423   12.329  1.00 0.00 ? 28  LEU B O    4  
ATOM   10535 C  CB   . LEU B 1 28 ? 156.455 -0.085  10.803  1.00 0.00 ? 28  LEU B CB   4  
ATOM   10536 C  CG   . LEU B 1 28 ? 157.176 -0.101  9.439   1.00 0.00 ? 28  LEU B CG   4  
ATOM   10537 C  CD1  . LEU B 1 28 ? 156.393 -0.965  8.446   1.00 0.00 ? 28  LEU B CD1  4  
ATOM   10538 C  CD2  . LEU B 1 28 ? 157.261 1.322   8.876   1.00 0.00 ? 28  LEU B CD2  4  
ATOM   10539 H  H    . LEU B 1 28 ? 156.042 0.338   13.466  1.00 0.00 ? 28  LEU B H    4  
ATOM   10540 H  HA   . LEU B 1 28 ? 158.262 -0.678  11.802  1.00 0.00 ? 28  LEU B HA   4  
ATOM   10541 H  HB2  . LEU B 1 28 ? 155.905 -1.007  10.933  1.00 0.00 ? 28  LEU B HB2  4  
ATOM   10542 H  HB3  . LEU B 1 28 ? 155.766 0.747   10.835  1.00 0.00 ? 28  LEU B HB3  4  
ATOM   10543 H  HG   . LEU B 1 28 ? 158.171 -0.504  9.557   1.00 0.00 ? 28  LEU B HG   4  
ATOM   10544 H  HD11 . LEU B 1 28 ? 156.183 -1.928  8.887   1.00 0.00 ? 28  LEU B HD11 4  
ATOM   10545 H  HD12 . LEU B 1 28 ? 156.982 -1.101  7.550   1.00 0.00 ? 28  LEU B HD12 4  
ATOM   10546 H  HD13 . LEU B 1 28 ? 155.467 -0.473  8.194   1.00 0.00 ? 28  LEU B HD13 4  
ATOM   10547 H  HD21 . LEU B 1 28 ? 157.650 1.283   7.870   1.00 0.00 ? 28  LEU B HD21 4  
ATOM   10548 H  HD22 . LEU B 1 28 ? 157.915 1.919   9.490   1.00 0.00 ? 28  LEU B HD22 4  
ATOM   10549 H  HD23 . LEU B 1 28 ? 156.276 1.764   8.862   1.00 0.00 ? 28  LEU B HD23 4  
ATOM   10550 N  N    . SER B 1 29 ? 159.354 1.536   11.488  1.00 0.00 ? 29  SER B N    4  
ATOM   10551 C  CA   . SER B 1 29 ? 160.047 2.822   11.433  1.00 0.00 ? 29  SER B CA   4  
ATOM   10552 C  C    . SER B 1 29 ? 160.088 3.307   9.991   1.00 0.00 ? 29  SER B C    4  
ATOM   10553 O  O    . SER B 1 29 ? 160.072 2.503   9.058   1.00 0.00 ? 29  SER B O    4  
ATOM   10554 C  CB   . SER B 1 29 ? 161.471 2.677   11.971  1.00 0.00 ? 29  SER B CB   4  
ATOM   10555 O  OG   . SER B 1 29 ? 161.421 2.210   13.312  1.00 0.00 ? 29  SER B OG   4  
ATOM   10556 H  H    . SER B 1 29 ? 159.815 0.726   11.183  1.00 0.00 ? 29  SER B H    4  
ATOM   10557 H  HA   . SER B 1 29 ? 159.513 3.543   12.034  1.00 0.00 ? 29  SER B HA   4  
ATOM   10558 H  HB2  . SER B 1 29 ? 162.016 1.969   11.369  1.00 0.00 ? 29  SER B HB2  4  
ATOM   10559 H  HB3  . SER B 1 29 ? 161.968 3.637   11.930  1.00 0.00 ? 29  SER B HB3  4  
ATOM   10560 H  HG   . SER B 1 29 ? 160.831 2.787   13.804  1.00 0.00 ? 29  SER B HG   4  
ATOM   10561 N  N    . LYS B 1 30 ? 160.116 4.618   9.789   1.00 0.00 ? 30  LYS B N    4  
ATOM   10562 C  CA   . LYS B 1 30 ? 160.120 5.111   8.427   1.00 0.00 ? 30  LYS B CA   4  
ATOM   10563 C  C    . LYS B 1 30 ? 161.289 4.506   7.680   1.00 0.00 ? 30  LYS B C    4  
ATOM   10564 O  O    . LYS B 1 30 ? 161.187 4.220   6.492   1.00 0.00 ? 30  LYS B O    4  
ATOM   10565 C  CB   . LYS B 1 30 ? 160.260 6.622   8.339   1.00 0.00 ? 30  LYS B CB   4  
ATOM   10566 C  CG   . LYS B 1 30 ? 160.009 7.018   6.879   1.00 0.00 ? 30  LYS B CG   4  
ATOM   10567 C  CD   . LYS B 1 30 ? 160.302 8.492   6.677   1.00 0.00 ? 30  LYS B CD   4  
ATOM   10568 C  CE   . LYS B 1 30 ? 159.698 8.956   5.350   1.00 0.00 ? 30  LYS B CE   4  
ATOM   10569 N  NZ   . LYS B 1 30 ? 159.738 7.835   4.368   1.00 0.00 ? 30  LYS B NZ   4  
ATOM   10570 H  H    . LYS B 1 30 ? 160.108 5.240   10.546  1.00 0.00 ? 30  LYS B H    4  
ATOM   10571 H  HA   . LYS B 1 30 ? 159.202 4.815   7.948   1.00 0.00 ? 30  LYS B HA   4  
ATOM   10572 H  HB2  . LYS B 1 30 ? 159.531 7.096   8.983   1.00 0.00 ? 30  LYS B HB2  4  
ATOM   10573 H  HB3  . LYS B 1 30 ? 161.255 6.919   8.629   1.00 0.00 ? 30  LYS B HB3  4  
ATOM   10574 H  HG2  . LYS B 1 30 ? 160.646 6.440   6.231   1.00 0.00 ? 30  LYS B HG2  4  
ATOM   10575 H  HG3  . LYS B 1 30 ? 158.977 6.825   6.630   1.00 0.00 ? 30  LYS B HG3  4  
ATOM   10576 H  HD2  . LYS B 1 30 ? 159.902 9.060   7.493   1.00 0.00 ? 30  LYS B HD2  4  
ATOM   10577 H  HD3  . LYS B 1 30 ? 161.366 8.621   6.638   1.00 0.00 ? 30  LYS B HD3  4  
ATOM   10578 H  HE2  . LYS B 1 30 ? 158.673 9.258   5.508   1.00 0.00 ? 30  LYS B HE2  4  
ATOM   10579 H  HE3  . LYS B 1 30 ? 160.264 9.792   4.968   1.00 0.00 ? 30  LYS B HE3  4  
ATOM   10580 H  HZ1  . LYS B 1 30 ? 159.517 8.197   3.419   1.00 0.00 ? 30  LYS B HZ1  4  
ATOM   10581 H  HZ2  . LYS B 1 30 ? 159.037 7.114   4.636   1.00 0.00 ? 30  LYS B HZ2  4  
ATOM   10582 H  HZ3  . LYS B 1 30 ? 160.686 7.411   4.363   1.00 0.00 ? 30  LYS B HZ3  4  
ATOM   10583 N  N    . LYS B 1 31 ? 162.409 4.316   8.366   1.00 0.00 ? 31  LYS B N    4  
ATOM   10584 C  CA   . LYS B 1 31 ? 163.560 3.748   7.696   1.00 0.00 ? 31  LYS B CA   4  
ATOM   10585 C  C    . LYS B 1 31 ? 163.137 2.429   7.081   1.00 0.00 ? 31  LYS B C    4  
ATOM   10586 O  O    . LYS B 1 31 ? 163.483 2.125   5.940   1.00 0.00 ? 31  LYS B O    4  
ATOM   10587 C  CB   . LYS B 1 31 ? 164.700 3.522   8.698   1.00 0.00 ? 31  LYS B CB   4  
ATOM   10588 C  CG   . LYS B 1 31 ? 165.955 3.006   7.979   1.00 0.00 ? 31  LYS B CG   4  
ATOM   10589 C  CD   . LYS B 1 31 ? 166.665 4.153   7.248   1.00 0.00 ? 31  LYS B CD   4  
ATOM   10590 C  CE   . LYS B 1 31 ? 167.980 3.643   6.657   1.00 0.00 ? 31  LYS B CE   4  
ATOM   10591 N  NZ   . LYS B 1 31 ? 168.901 3.249   7.760   1.00 0.00 ? 31  LYS B NZ   4  
ATOM   10592 H  H    . LYS B 1 31 ? 162.458 4.562   9.313   1.00 0.00 ? 31  LYS B H    4  
ATOM   10593 H  HA   . LYS B 1 31 ? 163.883 4.419   6.920   1.00 0.00 ? 31  LYS B HA   4  
ATOM   10594 H  HB2  . LYS B 1 31 ? 164.929 4.455   9.191   1.00 0.00 ? 31  LYS B HB2  4  
ATOM   10595 H  HB3  . LYS B 1 31 ? 164.389 2.796   9.434   1.00 0.00 ? 31  LYS B HB3  4  
ATOM   10596 H  HG2  . LYS B 1 31 ? 166.629 2.574   8.704   1.00 0.00 ? 31  LYS B HG2  4  
ATOM   10597 H  HG3  . LYS B 1 31 ? 165.671 2.250   7.262   1.00 0.00 ? 31  LYS B HG3  4  
ATOM   10598 H  HD2  . LYS B 1 31 ? 166.039 4.523   6.452   1.00 0.00 ? 31  LYS B HD2  4  
ATOM   10599 H  HD3  . LYS B 1 31 ? 166.873 4.951   7.946   1.00 0.00 ? 31  LYS B HD3  4  
ATOM   10600 H  HE2  . LYS B 1 31 ? 167.783 2.786   6.030   1.00 0.00 ? 31  LYS B HE2  4  
ATOM   10601 H  HE3  . LYS B 1 31 ? 168.437 4.423   6.067   1.00 0.00 ? 31  LYS B HE3  4  
ATOM   10602 H  HZ1  . LYS B 1 31 ? 169.808 3.746   7.649   1.00 0.00 ? 31  LYS B HZ1  4  
ATOM   10603 H  HZ2  . LYS B 1 31 ? 169.061 2.221   7.728   1.00 0.00 ? 31  LYS B HZ2  4  
ATOM   10604 H  HZ3  . LYS B 1 31 ? 168.477 3.506   8.674   1.00 0.00 ? 31  LYS B HZ3  4  
ATOM   10605 N  N    . GLU B 1 32 ? 162.339 1.669   7.824   1.00 0.00 ? 32  GLU B N    4  
ATOM   10606 C  CA   . GLU B 1 32 ? 161.830 0.417   7.301   1.00 0.00 ? 32  GLU B CA   4  
ATOM   10607 C  C    . GLU B 1 32 ? 160.887 0.712   6.139   1.00 0.00 ? 32  GLU B C    4  
ATOM   10608 O  O    . GLU B 1 32 ? 160.837 -0.027  5.154   1.00 0.00 ? 32  GLU B O    4  
ATOM   10609 C  CB   . GLU B 1 32 ? 161.056 -0.347  8.384   1.00 0.00 ? 32  GLU B CB   4  
ATOM   10610 C  CG   . GLU B 1 32 ? 161.991 -0.722  9.533   1.00 0.00 ? 32  GLU B CG   4  
ATOM   10611 C  CD   . GLU B 1 32 ? 161.229 -1.549  10.572  1.00 0.00 ? 32  GLU B CD   4  
ATOM   10612 O  OE1  . GLU B 1 32 ? 160.020 -1.652  10.448  1.00 0.00 ? 32  GLU B OE1  4  
ATOM   10613 O  OE2  . GLU B 1 32 ? 161.863 -2.067  11.476  1.00 0.00 ? 32  GLU B OE2  4  
ATOM   10614 H  H    . GLU B 1 32 ? 162.059 1.976   8.712   1.00 0.00 ? 32  GLU B H    4  
ATOM   10615 H  HA   . GLU B 1 32 ? 162.653 -0.190  6.953   1.00 0.00 ? 32  GLU B HA   4  
ATOM   10616 H  HB2  . GLU B 1 32 ? 160.256 0.271   8.759   1.00 0.00 ? 32  GLU B HB2  4  
ATOM   10617 H  HB3  . GLU B 1 32 ? 160.640 -1.247  7.956   1.00 0.00 ? 32  GLU B HB3  4  
ATOM   10618 H  HG2  . GLU B 1 32 ? 162.817 -1.295  9.146   1.00 0.00 ? 32  GLU B HG2  4  
ATOM   10619 H  HG3  . GLU B 1 32 ? 162.366 0.176   9.998   1.00 0.00 ? 32  GLU B HG3  4  
ATOM   10620 N  N    . LEU B 1 33 ? 160.116 1.799   6.283   1.00 0.00 ? 33  LEU B N    4  
ATOM   10621 C  CA   . LEU B 1 33 ? 159.151 2.170   5.252   1.00 0.00 ? 33  LEU B CA   4  
ATOM   10622 C  C    . LEU B 1 33 ? 159.826 2.493   3.924   1.00 0.00 ? 33  LEU B C    4  
ATOM   10623 O  O    . LEU B 1 33 ? 159.362 2.057   2.875   1.00 0.00 ? 33  LEU B O    4  
ATOM   10624 C  CB   . LEU B 1 33 ? 158.349 3.394   5.709   1.00 0.00 ? 33  LEU B CB   4  
ATOM   10625 C  CG   . LEU B 1 33 ? 157.239 3.707   4.694   1.00 0.00 ? 33  LEU B CG   4  
ATOM   10626 C  CD1  . LEU B 1 33 ? 156.142 2.640   4.781   1.00 0.00 ? 33  LEU B CD1  4  
ATOM   10627 C  CD2  . LEU B 1 33 ? 156.629 5.082   5.001   1.00 0.00 ? 33  LEU B CD2  4  
ATOM   10628 H  H    . LEU B 1 33 ? 160.186 2.339   7.102   1.00 0.00 ? 33  LEU B H    4  
ATOM   10629 H  HA   . LEU B 1 33 ? 158.468 1.350   5.105   1.00 0.00 ? 33  LEU B HA   4  
ATOM   10630 H  HB2  . LEU B 1 33 ? 157.915 3.202   6.678   1.00 0.00 ? 33  LEU B HB2  4  
ATOM   10631 H  HB3  . LEU B 1 33 ? 159.015 4.240   5.777   1.00 0.00 ? 33  LEU B HB3  4  
ATOM   10632 H  HG   . LEU B 1 33 ? 157.650 3.714   3.696   1.00 0.00 ? 33  LEU B HG   4  
ATOM   10633 H  HD11 . LEU B 1 33 ? 155.218 3.042   4.392   1.00 0.00 ? 33  LEU B HD11 4  
ATOM   10634 H  HD12 . LEU B 1 33 ? 156.001 2.348   5.811   1.00 0.00 ? 33  LEU B HD12 4  
ATOM   10635 H  HD13 . LEU B 1 33 ? 156.430 1.778   4.199   1.00 0.00 ? 33  LEU B HD13 4  
ATOM   10636 H  HD21 . LEU B 1 33 ? 156.251 5.516   4.089   1.00 0.00 ? 33  LEU B HD21 4  
ATOM   10637 H  HD22 . LEU B 1 33 ? 157.383 5.731   5.418   1.00 0.00 ? 33  LEU B HD22 4  
ATOM   10638 H  HD23 . LEU B 1 33 ? 155.820 4.971   5.709   1.00 0.00 ? 33  LEU B HD23 4  
ATOM   10639 N  N    . LYS B 1 34 ? 160.920 3.254   3.949   1.00 0.00 ? 34  LYS B N    4  
ATOM   10640 C  CA   . LYS B 1 34 ? 161.582 3.580   2.695   1.00 0.00 ? 34  LYS B CA   4  
ATOM   10641 C  C    . LYS B 1 34 ? 162.030 2.309   1.990   1.00 0.00 ? 34  LYS B C    4  
ATOM   10642 O  O    . LYS B 1 34 ? 161.868 2.164   0.776   1.00 0.00 ? 34  LYS B O    4  
ATOM   10643 C  CB   . LYS B 1 34 ? 162.802 4.468   2.954   1.00 0.00 ? 34  LYS B CB   4  
ATOM   10644 C  CG   . LYS B 1 34 ? 162.356 5.811   3.533   1.00 0.00 ? 34  LYS B CG   4  
ATOM   10645 C  CD   . LYS B 1 34 ? 163.572 6.730   3.673   1.00 0.00 ? 34  LYS B CD   4  
ATOM   10646 C  CE   . LYS B 1 34 ? 163.157 8.030   4.362   1.00 0.00 ? 34  LYS B CE   4  
ATOM   10647 N  NZ   . LYS B 1 34 ? 164.119 9.111   4.004   1.00 0.00 ? 34  LYS B NZ   4  
ATOM   10648 H  H    . LYS B 1 34 ? 161.267 3.607   4.804   1.00 0.00 ? 34  LYS B H    4  
ATOM   10649 H  HA   . LYS B 1 34 ? 160.891 4.112   2.060   1.00 0.00 ? 34  LYS B HA   4  
ATOM   10650 H  HB2  . LYS B 1 34 ? 163.460 3.975   3.656   1.00 0.00 ? 34  LYS B HB2  4  
ATOM   10651 H  HB3  . LYS B 1 34 ? 163.327 4.635   2.026   1.00 0.00 ? 34  LYS B HB3  4  
ATOM   10652 H  HG2  . LYS B 1 34 ? 161.633 6.266   2.871   1.00 0.00 ? 34  LYS B HG2  4  
ATOM   10653 H  HG3  . LYS B 1 34 ? 161.910 5.655   4.502   1.00 0.00 ? 34  LYS B HG3  4  
ATOM   10654 H  HD2  . LYS B 1 34 ? 164.329 6.234   4.263   1.00 0.00 ? 34  LYS B HD2  4  
ATOM   10655 H  HD3  . LYS B 1 34 ? 163.968 6.954   2.694   1.00 0.00 ? 34  LYS B HD3  4  
ATOM   10656 H  HE2  . LYS B 1 34 ? 162.166 8.310   4.039   1.00 0.00 ? 34  LYS B HE2  4  
ATOM   10657 H  HE3  . LYS B 1 34 ? 163.159 7.886   5.433   1.00 0.00 ? 34  LYS B HE3  4  
ATOM   10658 H  HZ1  . LYS B 1 34 ? 164.350 9.047   2.992   1.00 0.00 ? 34  LYS B HZ1  4  
ATOM   10659 H  HZ2  . LYS B 1 34 ? 164.988 9.000   4.567   1.00 0.00 ? 34  LYS B HZ2  4  
ATOM   10660 H  HZ3  . LYS B 1 34 ? 163.691 10.036  4.203   1.00 0.00 ? 34  LYS B HZ3  4  
ATOM   10661 N  N    . GLU B 1 35 ? 162.582 1.378   2.761   1.00 0.00 ? 35  GLU B N    4  
ATOM   10662 C  CA   . GLU B 1 35 ? 163.040 0.122   2.191   1.00 0.00 ? 35  GLU B CA   4  
ATOM   10663 C  C    . GLU B 1 35 ? 161.878 -0.693  1.641   1.00 0.00 ? 35  GLU B C    4  
ATOM   10664 O  O    . GLU B 1 35 ? 161.995 -1.317  0.586   1.00 0.00 ? 35  GLU B O    4  
ATOM   10665 C  CB   . GLU B 1 35 ? 163.775 -0.691  3.258   1.00 0.00 ? 35  GLU B CB   4  
ATOM   10666 C  CG   . GLU B 1 35 ? 164.378 -1.945  2.619   1.00 0.00 ? 35  GLU B CG   4  
ATOM   10667 C  CD   . GLU B 1 35 ? 165.027 -2.814  3.691   1.00 0.00 ? 35  GLU B CD   4  
ATOM   10668 O  OE1  . GLU B 1 35 ? 164.965 -2.437  4.849   1.00 0.00 ? 35  GLU B OE1  4  
ATOM   10669 O  OE2  . GLU B 1 35 ? 165.578 -3.844  3.337   1.00 0.00 ? 35  GLU B OE2  4  
ATOM   10670 H  H    . GLU B 1 35 ? 162.677 1.538   3.723   1.00 0.00 ? 35  GLU B H    4  
ATOM   10671 H  HA   . GLU B 1 35 ? 163.727 0.336   1.387   1.00 0.00 ? 35  GLU B HA   4  
ATOM   10672 H  HB2  . GLU B 1 35 ? 164.564 -0.091  3.688   1.00 0.00 ? 35  GLU B HB2  4  
ATOM   10673 H  HB3  . GLU B 1 35 ? 163.081 -0.983  4.031   1.00 0.00 ? 35  GLU B HB3  4  
ATOM   10674 H  HG2  . GLU B 1 35 ? 163.598 -2.507  2.127   1.00 0.00 ? 35  GLU B HG2  4  
ATOM   10675 H  HG3  . GLU B 1 35 ? 165.123 -1.655  1.894   1.00 0.00 ? 35  GLU B HG3  4  
ATOM   10676 N  N    . LEU B 1 36 ? 160.760 -0.706  2.366   1.00 0.00 ? 36  LEU B N    4  
ATOM   10677 C  CA   . LEU B 1 36 ? 159.607 -1.477  1.921   1.00 0.00 ? 36  LEU B CA   4  
ATOM   10678 C  C    . LEU B 1 36 ? 159.048 -0.923  0.617   1.00 0.00 ? 36  LEU B C    4  
ATOM   10679 O  O    . LEU B 1 36 ? 158.717 -1.680  -0.296  1.00 0.00 ? 36  LEU B O    4  
ATOM   10680 C  CB   . LEU B 1 36 ? 158.520 -1.442  3.006   1.00 0.00 ? 36  LEU B CB   4  
ATOM   10681 C  CG   . LEU B 1 36 ? 157.424 -2.490  2.718   1.00 0.00 ? 36  LEU B CG   4  
ATOM   10682 C  CD1  . LEU B 1 36 ? 156.767 -2.923  4.032   1.00 0.00 ? 36  LEU B CD1  4  
ATOM   10683 C  CD2  . LEU B 1 36 ? 156.334 -1.897  1.820   1.00 0.00 ? 36  LEU B CD2  4  
ATOM   10684 H  H    . LEU B 1 36 ? 160.717 -0.204  3.209   1.00 0.00 ? 36  LEU B H    4  
ATOM   10685 H  HA   . LEU B 1 36 ? 159.911 -2.501  1.766   1.00 0.00 ? 36  LEU B HA   4  
ATOM   10686 H  HB2  . LEU B 1 36 ? 158.975 -1.646  3.963   1.00 0.00 ? 36  LEU B HB2  4  
ATOM   10687 H  HB3  . LEU B 1 36 ? 158.075 -0.458  3.029   1.00 0.00 ? 36  LEU B HB3  4  
ATOM   10688 H  HG   . LEU B 1 36 ? 157.863 -3.351  2.236   1.00 0.00 ? 36  LEU B HG   4  
ATOM   10689 H  HD11 . LEU B 1 36 ? 156.107 -2.142  4.378   1.00 0.00 ? 36  LEU B HD11 4  
ATOM   10690 H  HD12 . LEU B 1 36 ? 157.524 -3.107  4.775   1.00 0.00 ? 36  LEU B HD12 4  
ATOM   10691 H  HD13 . LEU B 1 36 ? 156.198 -3.826  3.869   1.00 0.00 ? 36  LEU B HD13 4  
ATOM   10692 H  HD21 . LEU B 1 36 ? 156.002 -0.958  2.231   1.00 0.00 ? 36  LEU B HD21 4  
ATOM   10693 H  HD22 . LEU B 1 36 ? 155.500 -2.582  1.776   1.00 0.00 ? 36  LEU B HD22 4  
ATOM   10694 H  HD23 . LEU B 1 36 ? 156.718 -1.744  0.826   1.00 0.00 ? 36  LEU B HD23 4  
ATOM   10695 N  N    . LEU B 1 37 ? 158.943 0.403   0.528   1.00 0.00 ? 37  LEU B N    4  
ATOM   10696 C  CA   . LEU B 1 37 ? 158.416 1.024   -0.681  1.00 0.00 ? 37  LEU B CA   4  
ATOM   10697 C  C    . LEU B 1 37 ? 159.355 0.864   -1.865  1.00 0.00 ? 37  LEU B C    4  
ATOM   10698 O  O    . LEU B 1 37 ? 158.910 0.570   -2.971  1.00 0.00 ? 37  LEU B O    4  
ATOM   10699 C  CB   . LEU B 1 37 ? 158.152 2.523   -0.452  1.00 0.00 ? 37  LEU B CB   4  
ATOM   10700 C  CG   . LEU B 1 37 ? 156.844 2.774   0.330   1.00 0.00 ? 37  LEU B CG   4  
ATOM   10701 C  CD1  . LEU B 1 37 ? 155.679 2.866   -0.655  1.00 0.00 ? 37  LEU B CD1  4  
ATOM   10702 C  CD2  . LEU B 1 37 ? 156.551 1.657   1.338   1.00 0.00 ? 37  LEU B CD2  4  
ATOM   10703 H  H    . LEU B 1 37 ? 159.221 0.964   1.281   1.00 0.00 ? 37  LEU B H    4  
ATOM   10704 H  HA   . LEU B 1 37 ? 157.483 0.550   -0.934  1.00 0.00 ? 37  LEU B HA   4  
ATOM   10705 H  HB2  . LEU B 1 37 ? 158.977 2.940   0.105   1.00 0.00 ? 37  LEU B HB2  4  
ATOM   10706 H  HB3  . LEU B 1 37 ? 158.092 3.019   -1.410  1.00 0.00 ? 37  LEU B HB3  4  
ATOM   10707 H  HG   . LEU B 1 37 ? 156.930 3.714   0.856   1.00 0.00 ? 37  LEU B HG   4  
ATOM   10708 H  HD11 . LEU B 1 37 ? 155.628 1.957   -1.237  1.00 0.00 ? 37  LEU B HD11 4  
ATOM   10709 H  HD12 . LEU B 1 37 ? 155.833 3.708   -1.314  1.00 0.00 ? 37  LEU B HD12 4  
ATOM   10710 H  HD13 . LEU B 1 37 ? 154.756 2.997   -0.110  1.00 0.00 ? 37  LEU B HD13 4  
ATOM   10711 H  HD21 . LEU B 1 37 ? 156.198 0.782   0.819   1.00 0.00 ? 37  LEU B HD21 4  
ATOM   10712 H  HD22 . LEU B 1 37 ? 155.786 1.993   2.023   1.00 0.00 ? 37  LEU B HD22 4  
ATOM   10713 H  HD23 . LEU B 1 37 ? 157.439 1.419   1.892   1.00 0.00 ? 37  LEU B HD23 4  
ATOM   10714 N  N    . GLN B 1 38 ? 160.650 1.064   -1.653  1.00 0.00 ? 38  GLN B N    4  
ATOM   10715 C  CA   . GLN B 1 38 ? 161.576 0.936   -2.767  1.00 0.00 ? 38  GLN B CA   4  
ATOM   10716 C  C    . GLN B 1 38 ? 161.625 -0.491  -3.309  1.00 0.00 ? 38  GLN B C    4  
ATOM   10717 O  O    . GLN B 1 38 ? 161.619 -0.699  -4.520  1.00 0.00 ? 38  GLN B O    4  
ATOM   10718 C  CB   . GLN B 1 38 ? 162.975 1.381   -2.329  1.00 0.00 ? 38  GLN B CB   4  
ATOM   10719 C  CG   . GLN B 1 38 ? 162.955 2.879   -2.013  1.00 0.00 ? 38  GLN B CG   4  
ATOM   10720 C  CD   . GLN B 1 38 ? 164.324 3.323   -1.510  1.00 0.00 ? 38  GLN B CD   4  
ATOM   10721 O  OE1  . GLN B 1 38 ? 165.145 2.490   -1.124  1.00 0.00 ? 38  GLN B OE1  4  
ATOM   10722 N  NE2  . GLN B 1 38 ? 164.622 4.594   -1.491  1.00 0.00 ? 38  GLN B NE2  4  
ATOM   10723 H  H    . GLN B 1 38 ? 160.979 1.309   -0.757  1.00 0.00 ? 38  GLN B H    4  
ATOM   10724 H  HA   . GLN B 1 38 ? 161.247 1.590   -3.560  1.00 0.00 ? 38  GLN B HA   4  
ATOM   10725 H  HB2  . GLN B 1 38 ? 163.268 0.830   -1.448  1.00 0.00 ? 38  GLN B HB2  4  
ATOM   10726 H  HB3  . GLN B 1 38 ? 163.679 1.195   -3.121  1.00 0.00 ? 38  GLN B HB3  4  
ATOM   10727 H  HG2  . GLN B 1 38 ? 162.709 3.429   -2.909  1.00 0.00 ? 38  GLN B HG2  4  
ATOM   10728 H  HG3  . GLN B 1 38 ? 162.213 3.079   -1.258  1.00 0.00 ? 38  GLN B HG3  4  
ATOM   10729 H  HE21 . GLN B 1 38 ? 163.967 5.254   -1.798  1.00 0.00 ? 38  GLN B HE21 4  
ATOM   10730 H  HE22 . GLN B 1 38 ? 165.499 4.886   -1.168  1.00 0.00 ? 38  GLN B HE22 4  
ATOM   10731 N  N    . THR B 1 39 ? 161.671 -1.475  -2.415  1.00 0.00 ? 39  THR B N    4  
ATOM   10732 C  CA   . THR B 1 39 ? 161.723 -2.869  -2.849  1.00 0.00 ? 39  THR B CA   4  
ATOM   10733 C  C    . THR B 1 39 ? 160.400 -3.366  -3.438  1.00 0.00 ? 39  THR B C    4  
ATOM   10734 O  O    . THR B 1 39 ? 160.380 -4.029  -4.474  1.00 0.00 ? 39  THR B O    4  
ATOM   10735 C  CB   . THR B 1 39 ? 162.108 -3.757  -1.665  1.00 0.00 ? 39  THR B CB   4  
ATOM   10736 O  OG1  . THR B 1 39 ? 163.329 -3.294  -1.105  1.00 0.00 ? 39  THR B OG1  4  
ATOM   10737 C  CG2  . THR B 1 39 ? 162.279 -5.201  -2.141  1.00 0.00 ? 39  THR B CG2  4  
ATOM   10738 H  H    . THR B 1 39 ? 161.672 -1.263  -1.459  1.00 0.00 ? 39  THR B H    4  
ATOM   10739 H  HA   . THR B 1 39 ? 162.488 -2.964  -3.602  1.00 0.00 ? 39  THR B HA   4  
ATOM   10740 H  HB   . THR B 1 39 ? 161.331 -3.720  -0.917  1.00 0.00 ? 39  THR B HB   4  
ATOM   10741 H  HG1  . THR B 1 39 ? 163.775 -2.760  -1.767  1.00 0.00 ? 39  THR B HG1  4  
ATOM   10742 H  HG21 . THR B 1 39 ? 161.315 -5.687  -2.169  1.00 0.00 ? 39  THR B HG21 4  
ATOM   10743 H  HG22 . THR B 1 39 ? 162.929 -5.730  -1.460  1.00 0.00 ? 39  THR B HG22 4  
ATOM   10744 H  HG23 . THR B 1 39 ? 162.713 -5.205  -3.130  1.00 0.00 ? 39  THR B HG23 4  
ATOM   10745 N  N    . GLU B 1 40 ? 159.303 -3.079  -2.739  1.00 0.00 ? 40  GLU B N    4  
ATOM   10746 C  CA   . GLU B 1 40 ? 157.982 -3.542  -3.165  1.00 0.00 ? 40  GLU B CA   4  
ATOM   10747 C  C    . GLU B 1 40 ? 157.387 -2.740  -4.322  1.00 0.00 ? 40  GLU B C    4  
ATOM   10748 O  O    . GLU B 1 40 ? 156.623 -3.281  -5.124  1.00 0.00 ? 40  GLU B O    4  
ATOM   10749 C  CB   . GLU B 1 40 ? 157.016 -3.480  -1.978  1.00 0.00 ? 40  GLU B CB   4  
ATOM   10750 C  CG   . GLU B 1 40 ? 157.461 -4.461  -0.888  1.00 0.00 ? 40  GLU B CG   4  
ATOM   10751 C  CD   . GLU B 1 40 ? 157.427 -5.893  -1.413  1.00 0.00 ? 40  GLU B CD   4  
ATOM   10752 O  OE1  . GLU B 1 40 ? 156.769 -6.122  -2.413  1.00 0.00 ? 40  GLU B OE1  4  
ATOM   10753 O  OE2  . GLU B 1 40 ? 158.052 -6.742  -0.799  1.00 0.00 ? 40  GLU B OE2  4  
ATOM   10754 H  H    . GLU B 1 40 ? 159.387 -2.576  -1.900  1.00 0.00 ? 40  GLU B H    4  
ATOM   10755 H  HA   . GLU B 1 40 ? 158.066 -4.569  -3.475  1.00 0.00 ? 40  GLU B HA   4  
ATOM   10756 H  HB2  . GLU B 1 40 ? 157.002 -2.477  -1.579  1.00 0.00 ? 40  GLU B HB2  4  
ATOM   10757 H  HB3  . GLU B 1 40 ? 156.024 -3.745  -2.312  1.00 0.00 ? 40  GLU B HB3  4  
ATOM   10758 H  HG2  . GLU B 1 40 ? 158.467 -4.217  -0.579  1.00 0.00 ? 40  GLU B HG2  4  
ATOM   10759 H  HG3  . GLU B 1 40 ? 156.797 -4.376  -0.041  1.00 0.00 ? 40  GLU B HG3  4  
ATOM   10760 N  N    . LEU B 1 41 ? 157.669 -1.443  -4.370  1.00 0.00 ? 41  LEU B N    4  
ATOM   10761 C  CA   . LEU B 1 41 ? 157.074 -0.587  -5.398  1.00 0.00 ? 41  LEU B CA   4  
ATOM   10762 C  C    . LEU B 1 41 ? 158.054 -0.251  -6.530  1.00 0.00 ? 41  LEU B C    4  
ATOM   10763 O  O    . LEU B 1 41 ? 159.228 0.058   -6.299  1.00 0.00 ? 41  LEU B O    4  
ATOM   10764 C  CB   . LEU B 1 41 ? 156.567 0.709   -4.753  1.00 0.00 ? 41  LEU B CB   4  
ATOM   10765 C  CG   . LEU B 1 41 ? 155.690 1.473   -5.749  1.00 0.00 ? 41  LEU B CG   4  
ATOM   10766 C  CD1  . LEU B 1 41 ? 154.270 0.877   -5.771  1.00 0.00 ? 41  LEU B CD1  4  
ATOM   10767 C  CD2  . LEU B 1 41 ? 155.633 2.953   -5.351  1.00 0.00 ? 41  LEU B CD2  4  
ATOM   10768 H  H    . LEU B 1 41 ? 158.239 -1.045  -3.679  1.00 0.00 ? 41  LEU B H    4  
ATOM   10769 H  HA   . LEU B 1 41 ? 156.227 -1.100  -5.828  1.00 0.00 ? 41  LEU B HA   4  
ATOM   10770 H  HB2  . LEU B 1 41 ? 155.989 0.470   -3.872  1.00 0.00 ? 41  LEU B HB2  4  
ATOM   10771 H  HB3  . LEU B 1 41 ? 157.407 1.326   -4.476  1.00 0.00 ? 41  LEU B HB3  4  
ATOM   10772 H  HG   . LEU B 1 41 ? 156.115 1.381   -6.731  1.00 0.00 ? 41  LEU B HG   4  
ATOM   10773 H  HD11 . LEU B 1 41 ? 153.587 1.533   -5.249  1.00 0.00 ? 41  LEU B HD11 4  
ATOM   10774 H  HD12 . LEU B 1 41 ? 154.268 -0.090  -5.290  1.00 0.00 ? 41  LEU B HD12 4  
ATOM   10775 H  HD13 . LEU B 1 41 ? 153.945 0.766   -6.795  1.00 0.00 ? 41  LEU B HD13 4  
ATOM   10776 H  HD21 . LEU B 1 41 ? 156.636 3.335   -5.237  1.00 0.00 ? 41  LEU B HD21 4  
ATOM   10777 H  HD22 . LEU B 1 41 ? 155.101 3.053   -4.417  1.00 0.00 ? 41  LEU B HD22 4  
ATOM   10778 H  HD23 . LEU B 1 41 ? 155.120 3.513   -6.120  1.00 0.00 ? 41  LEU B HD23 4  
ATOM   10779 N  N    . SER B 1 42 ? 157.538 -0.277  -7.756  1.00 0.00 ? 42  SER B N    4  
ATOM   10780 C  CA   . SER B 1 42 ? 158.343 0.053   -8.925  1.00 0.00 ? 42  SER B CA   4  
ATOM   10781 C  C    . SER B 1 42 ? 159.025 1.388   -8.677  1.00 0.00 ? 42  SER B C    4  
ATOM   10782 O  O    . SER B 1 42 ? 160.100 1.672   -9.214  1.00 0.00 ? 42  SER B O    4  
ATOM   10783 C  CB   . SER B 1 42 ? 157.461 0.140   -10.171 1.00 0.00 ? 42  SER B CB   4  
ATOM   10784 O  OG   . SER B 1 42 ? 156.743 -1.078  -10.324 1.00 0.00 ? 42  SER B OG   4  
ATOM   10785 H  H    . SER B 1 42 ? 156.592 -0.501  -7.873  1.00 0.00 ? 42  SER B H    4  
ATOM   10786 H  HA   . SER B 1 42 ? 159.094 -0.711  -9.070  1.00 0.00 ? 42  SER B HA   4  
ATOM   10787 H  HB2  . SER B 1 42 ? 156.761 0.952   -10.062 1.00 0.00 ? 42  SER B HB2  4  
ATOM   10788 H  HB3  . SER B 1 42 ? 158.082 0.317   -11.039 1.00 0.00 ? 42  SER B HB3  4  
ATOM   10789 H  HG   . SER B 1 42 ? 157.268 -1.782  -9.936  1.00 0.00 ? 42  SER B HG   4  
ATOM   10790 N  N    . GLY B 1 43 ? 158.383 2.196   -7.841  1.00 0.00 ? 43  GLY B N    4  
ATOM   10791 C  CA   . GLY B 1 43 ? 158.907 3.503   -7.479  1.00 0.00 ? 43  GLY B CA   4  
ATOM   10792 C  C    . GLY B 1 43 ? 160.401 3.417   -7.198  1.00 0.00 ? 43  GLY B C    4  
ATOM   10793 O  O    . GLY B 1 43 ? 161.074 4.437   -7.083  1.00 0.00 ? 43  GLY B O    4  
ATOM   10794 H  H    . GLY B 1 43 ? 157.541 1.900   -7.447  1.00 0.00 ? 43  GLY B H    4  
ATOM   10795 H  HA2  . GLY B 1 43 ? 158.734 4.193   -8.293  1.00 0.00 ? 43  GLY B HA2  4  
ATOM   10796 H  HA3  . GLY B 1 43 ? 158.401 3.858   -6.596  1.00 0.00 ? 43  GLY B HA3  4  
ATOM   10797 N  N    . PHE B 1 44 ? 160.931 2.200   -7.111  1.00 0.00 ? 44  PHE B N    4  
ATOM   10798 C  CA   . PHE B 1 44 ? 162.357 2.041   -6.863  1.00 0.00 ? 44  PHE B CA   4  
ATOM   10799 C  C    . PHE B 1 44 ? 163.114 2.998   -7.774  1.00 0.00 ? 44  PHE B C    4  
ATOM   10800 O  O    . PHE B 1 44 ? 164.115 3.594   -7.375  1.00 0.00 ? 44  PHE B O    4  
ATOM   10801 C  CB   . PHE B 1 44 ? 162.784 0.607   -7.196  1.00 0.00 ? 44  PHE B CB   4  
ATOM   10802 C  CG   . PHE B 1 44 ? 164.239 0.408   -6.842  1.00 0.00 ? 44  PHE B CG   4  
ATOM   10803 C  CD1  . PHE B 1 44 ? 164.597 -0.044  -5.567  1.00 0.00 ? 44  PHE B CD1  4  
ATOM   10804 C  CD2  . PHE B 1 44 ? 165.231 0.663   -7.797  1.00 0.00 ? 44  PHE B CD2  4  
ATOM   10805 C  CE1  . PHE B 1 44 ? 165.946 -0.234  -5.244  1.00 0.00 ? 44  PHE B CE1  4  
ATOM   10806 C  CE2  . PHE B 1 44 ? 166.580 0.471   -7.475  1.00 0.00 ? 44  PHE B CE2  4  
ATOM   10807 C  CZ   . PHE B 1 44 ? 166.937 0.024   -6.197  1.00 0.00 ? 44  PHE B CZ   4  
ATOM   10808 H  H    . PHE B 1 44 ? 160.360 1.404   -7.217  1.00 0.00 ? 44  PHE B H    4  
ATOM   10809 H  HA   . PHE B 1 44 ? 162.580 2.259   -5.830  1.00 0.00 ? 44  PHE B HA   4  
ATOM   10810 H  HB2  . PHE B 1 44 ? 162.178 -0.088  -6.636  1.00 0.00 ? 44  PHE B HB2  4  
ATOM   10811 H  HB3  . PHE B 1 44 ? 162.647 0.430   -8.253  1.00 0.00 ? 44  PHE B HB3  4  
ATOM   10812 H  HD1  . PHE B 1 44 ? 163.835 -0.247  -4.834  1.00 0.00 ? 44  PHE B HD1  4  
ATOM   10813 H  HD2  . PHE B 1 44 ? 164.955 1.010   -8.781  1.00 0.00 ? 44  PHE B HD2  4  
ATOM   10814 H  HE1  . PHE B 1 44 ? 166.222 -0.580  -4.258  1.00 0.00 ? 44  PHE B HE1  4  
ATOM   10815 H  HE2  . PHE B 1 44 ? 167.344 0.668   -8.211  1.00 0.00 ? 44  PHE B HE2  4  
ATOM   10816 H  HZ   . PHE B 1 44 ? 167.978 -0.124  -5.948  1.00 0.00 ? 44  PHE B HZ   4  
ATOM   10817 N  N    . LEU B 1 45 ? 162.613 3.153   -8.992  1.00 0.00 ? 45  LEU B N    4  
ATOM   10818 C  CA   . LEU B 1 45 ? 163.230 4.059   -9.955  1.00 0.00 ? 45  LEU B CA   4  
ATOM   10819 C  C    . LEU B 1 45 ? 163.318 5.480   -9.386  1.00 0.00 ? 45  LEU B C    4  
ATOM   10820 O  O    . LEU B 1 45 ? 164.275 6.205   -9.655  1.00 0.00 ? 45  LEU B O    4  
ATOM   10821 C  CB   . LEU B 1 45 ? 162.415 4.070   -11.253 1.00 0.00 ? 45  LEU B CB   4  
ATOM   10822 C  CG   . LEU B 1 45 ? 163.121 4.928   -12.309 1.00 0.00 ? 45  LEU B CG   4  
ATOM   10823 C  CD1  . LEU B 1 45 ? 164.381 4.213   -12.805 1.00 0.00 ? 45  LEU B CD1  4  
ATOM   10824 C  CD2  . LEU B 1 45 ? 162.174 5.158   -13.488 1.00 0.00 ? 45  LEU B CD2  4  
ATOM   10825 H  H    . LEU B 1 45 ? 161.800 2.659   -9.246  1.00 0.00 ? 45  LEU B H    4  
ATOM   10826 H  HA   . LEU B 1 45 ? 164.227 3.708   -10.174 1.00 0.00 ? 45  LEU B HA   4  
ATOM   10827 H  HB2  . LEU B 1 45 ? 162.308 3.059   -11.618 1.00 0.00 ? 45  LEU B HB2  4  
ATOM   10828 H  HB3  . LEU B 1 45 ? 161.436 4.483   -11.054 1.00 0.00 ? 45  LEU B HB3  4  
ATOM   10829 H  HG   . LEU B 1 45 ? 163.395 5.880   -11.878 1.00 0.00 ? 45  LEU B HG   4  
ATOM   10830 H  HD11 . LEU B 1 45 ? 164.643 4.584   -13.785 1.00 0.00 ? 45  LEU B HD11 4  
ATOM   10831 H  HD12 . LEU B 1 45 ? 164.198 3.151   -12.863 1.00 0.00 ? 45  LEU B HD12 4  
ATOM   10832 H  HD13 . LEU B 1 45 ? 165.195 4.401   -12.121 1.00 0.00 ? 45  LEU B HD13 4  
ATOM   10833 H  HD21 . LEU B 1 45 ? 161.416 5.876   -13.207 1.00 0.00 ? 45  LEU B HD21 4  
ATOM   10834 H  HD22 . LEU B 1 45 ? 161.703 4.225   -13.758 1.00 0.00 ? 45  LEU B HD22 4  
ATOM   10835 H  HD23 . LEU B 1 45 ? 162.733 5.536   -14.331 1.00 0.00 ? 45  LEU B HD23 4  
ATOM   10836 N  N    . ASP B 1 46 ? 162.304 5.879   -8.613  1.00 0.00 ? 46  ASP B N    4  
ATOM   10837 C  CA   . ASP B 1 46 ? 162.276 7.224   -8.032  1.00 0.00 ? 46  ASP B CA   4  
ATOM   10838 C  C    . ASP B 1 46 ? 163.089 7.271   -6.741  1.00 0.00 ? 46  ASP B C    4  
ATOM   10839 O  O    . ASP B 1 46 ? 163.017 8.238   -5.983  1.00 0.00 ? 46  ASP B O    4  
ATOM   10840 C  CB   . ASP B 1 46 ? 160.832 7.666   -7.754  1.00 0.00 ? 46  ASP B CB   4  
ATOM   10841 C  CG   . ASP B 1 46 ? 160.213 6.853   -6.617  1.00 0.00 ? 46  ASP B CG   4  
ATOM   10842 O  OD1  . ASP B 1 46 ? 160.958 6.285   -5.838  1.00 0.00 ? 46  ASP B OD1  4  
ATOM   10843 O  OD2  . ASP B 1 46 ? 158.997 6.848   -6.519  1.00 0.00 ? 46  ASP B OD2  4  
ATOM   10844 H  H    . ASP B 1 46 ? 161.560 5.265   -8.441  1.00 0.00 ? 46  ASP B H    4  
ATOM   10845 H  HA   . ASP B 1 46 ? 162.715 7.912   -8.739  1.00 0.00 ? 46  ASP B HA   4  
ATOM   10846 H  HB2  . ASP B 1 46 ? 160.829 8.712   -7.482  1.00 0.00 ? 46  ASP B HB2  4  
ATOM   10847 H  HB3  . ASP B 1 46 ? 160.242 7.531   -8.648  1.00 0.00 ? 46  ASP B HB3  4  
ATOM   10848 N  N    . ALA B 1 47 ? 163.853 6.212   -6.495  1.00 0.00 ? 47  ALA B N    4  
ATOM   10849 C  CA   . ALA B 1 47 ? 164.669 6.126   -5.289  1.00 0.00 ? 47  ALA B CA   4  
ATOM   10850 C  C    . ALA B 1 47 ? 165.641 7.301   -5.215  1.00 0.00 ? 47  ALA B C    4  
ATOM   10851 O  O    . ALA B 1 47 ? 166.083 7.684   -4.132  1.00 0.00 ? 47  ALA B O    4  
ATOM   10852 C  CB   . ALA B 1 47 ? 165.452 4.813   -5.281  1.00 0.00 ? 47  ALA B CB   4  
ATOM   10853 H  H    . ALA B 1 47 ? 163.861 5.469   -7.132  1.00 0.00 ? 47  ALA B H    4  
ATOM   10854 H  HA   . ALA B 1 47 ? 164.021 6.149   -4.425  1.00 0.00 ? 47  ALA B HA   4  
ATOM   10855 H  HB1  . ALA B 1 47 ? 166.261 4.880   -4.570  1.00 0.00 ? 47  ALA B HB1  4  
ATOM   10856 H  HB2  . ALA B 1 47 ? 165.854 4.628   -6.267  1.00 0.00 ? 47  ALA B HB2  4  
ATOM   10857 H  HB3  . ALA B 1 47 ? 164.795 4.003   -5.003  1.00 0.00 ? 47  ALA B HB3  4  
ATOM   10858 N  N    . GLN B 1 48 ? 165.972 7.864   -6.371  1.00 0.00 ? 48  GLN B N    4  
ATOM   10859 C  CA   . GLN B 1 48 ? 166.892 8.995   -6.428  1.00 0.00 ? 48  GLN B CA   4  
ATOM   10860 C  C    . GLN B 1 48 ? 166.412 10.137  -5.530  1.00 0.00 ? 48  GLN B C    4  
ATOM   10861 O  O    . GLN B 1 48 ? 165.722 9.912   -4.534  1.00 0.00 ? 48  GLN B O    4  
ATOM   10862 C  CB   . GLN B 1 48 ? 167.015 9.496   -7.869  1.00 0.00 ? 48  GLN B CB   4  
ATOM   10863 C  CG   . GLN B 1 48 ? 167.434 8.338   -8.777  1.00 0.00 ? 48  GLN B CG   4  
ATOM   10864 C  CD   . GLN B 1 48 ? 168.763 7.761   -8.306  1.00 0.00 ? 48  GLN B CD   4  
ATOM   10865 O  OE1  . GLN B 1 48 ? 169.719 8.503   -8.079  1.00 0.00 ? 48  GLN B OE1  4  
ATOM   10866 N  NE2  . GLN B 1 48 ? 168.882 6.472   -8.142  1.00 0.00 ? 48  GLN B NE2  4  
ATOM   10867 H  H    . GLN B 1 48 ? 165.590 7.513   -7.203  1.00 0.00 ? 48  GLN B H    4  
ATOM   10868 H  HA   . GLN B 1 48 ? 167.865 8.670   -6.090  1.00 0.00 ? 48  GLN B HA   4  
ATOM   10869 H  HB2  . GLN B 1 48 ? 166.061 9.885   -8.196  1.00 0.00 ? 48  GLN B HB2  4  
ATOM   10870 H  HB3  . GLN B 1 48 ? 167.759 10.276  -7.917  1.00 0.00 ? 48  GLN B HB3  4  
ATOM   10871 H  HG2  . GLN B 1 48 ? 166.677 7.568   -8.748  1.00 0.00 ? 48  GLN B HG2  4  
ATOM   10872 H  HG3  . GLN B 1 48 ? 167.540 8.699   -9.790  1.00 0.00 ? 48  GLN B HG3  4  
ATOM   10873 H  HE21 . GLN B 1 48 ? 168.121 5.882   -8.323  1.00 0.00 ? 48  GLN B HE21 4  
ATOM   10874 H  HE22 . GLN B 1 48 ? 169.734 6.093   -7.839  1.00 0.00 ? 48  GLN B HE22 4  
ATOM   10875 N  N    . LYS B 1 49 ? 166.787 11.361  -5.888  1.00 0.00 ? 49  LYS B N    4  
ATOM   10876 C  CA   . LYS B 1 49 ? 166.406 12.533  -5.102  1.00 0.00 ? 49  LYS B CA   4  
ATOM   10877 C  C    . LYS B 1 49 ? 164.892 12.613  -4.954  1.00 0.00 ? 49  LYS B C    4  
ATOM   10878 O  O    . LYS B 1 49 ? 164.383 13.149  -3.969  1.00 0.00 ? 49  LYS B O    4  
ATOM   10879 C  CB   . LYS B 1 49 ? 166.924 13.805  -5.775  1.00 0.00 ? 49  LYS B CB   4  
ATOM   10880 C  CG   . LYS B 1 49 ? 166.227 13.990  -7.125  1.00 0.00 ? 49  LYS B CG   4  
ATOM   10881 C  CD   . LYS B 1 49 ? 166.882 15.146  -7.884  1.00 0.00 ? 49  LYS B CD   4  
ATOM   10882 C  CE   . LYS B 1 49 ? 166.637 16.455  -7.130  1.00 0.00 ? 49  LYS B CE   4  
ATOM   10883 N  NZ   . LYS B 1 49 ? 166.756 17.601  -8.075  1.00 0.00 ? 49  LYS B NZ   4  
ATOM   10884 H  H    . LYS B 1 49 ? 167.339 11.480  -6.690  1.00 0.00 ? 49  LYS B H    4  
ATOM   10885 H  HA   . LYS B 1 49 ? 166.849 12.454  -4.120  1.00 0.00 ? 49  LYS B HA   4  
ATOM   10886 H  HB2  . LYS B 1 49 ? 166.717 14.657  -5.142  1.00 0.00 ? 49  LYS B HB2  4  
ATOM   10887 H  HB3  . LYS B 1 49 ? 167.989 13.722  -5.930  1.00 0.00 ? 49  LYS B HB3  4  
ATOM   10888 H  HG2  . LYS B 1 49 ? 166.317 13.082  -7.704  1.00 0.00 ? 49  LYS B HG2  4  
ATOM   10889 H  HG3  . LYS B 1 49 ? 165.184 14.213  -6.964  1.00 0.00 ? 49  LYS B HG3  4  
ATOM   10890 H  HD2  . LYS B 1 49 ? 167.945 14.969  -7.963  1.00 0.00 ? 49  LYS B HD2  4  
ATOM   10891 H  HD3  . LYS B 1 49 ? 166.454 15.217  -8.872  1.00 0.00 ? 49  LYS B HD3  4  
ATOM   10892 H  HE2  . LYS B 1 49 ? 165.647 16.444  -6.701  1.00 0.00 ? 49  LYS B HE2  4  
ATOM   10893 H  HE3  . LYS B 1 49 ? 167.369 16.560  -6.343  1.00 0.00 ? 49  LYS B HE3  4  
ATOM   10894 H  HZ1  . LYS B 1 49 ? 166.322 18.446  -7.652  1.00 0.00 ? 49  LYS B HZ1  4  
ATOM   10895 H  HZ2  . LYS B 1 49 ? 166.270 17.369  -8.965  1.00 0.00 ? 49  LYS B HZ2  4  
ATOM   10896 H  HZ3  . LYS B 1 49 ? 167.761 17.791  -8.265  1.00 0.00 ? 49  LYS B HZ3  4  
ATOM   10897 N  N    . ASP B 1 50 ? 164.177 12.069  -5.928  1.00 0.00 ? 50  ASP B N    4  
ATOM   10898 C  CA   . ASP B 1 50 ? 162.721 12.076  -5.883  1.00 0.00 ? 50  ASP B CA   4  
ATOM   10899 C  C    . ASP B 1 50 ? 162.239 11.447  -4.579  1.00 0.00 ? 50  ASP B C    4  
ATOM   10900 O  O    . ASP B 1 50 ? 161.228 11.865  -4.008  1.00 0.00 ? 50  ASP B O    4  
ATOM   10901 C  CB   . ASP B 1 50 ? 162.156 11.296  -7.072  1.00 0.00 ? 50  ASP B CB   4  
ATOM   10902 C  CG   . ASP B 1 50 ? 162.451 12.039  -8.370  1.00 0.00 ? 50  ASP B CG   4  
ATOM   10903 O  OD1  . ASP B 1 50 ? 162.858 13.185  -8.294  1.00 0.00 ? 50  ASP B OD1  4  
ATOM   10904 O  OD2  . ASP B 1 50 ? 162.264 11.448  -9.422  1.00 0.00 ? 50  ASP B OD2  4  
ATOM   10905 H  H    . ASP B 1 50 ? 164.635 11.647  -6.685  1.00 0.00 ? 50  ASP B H    4  
ATOM   10906 H  HA   . ASP B 1 50 ? 162.372 13.096  -5.933  1.00 0.00 ? 50  ASP B HA   4  
ATOM   10907 H  HB2  . ASP B 1 50 ? 162.611 10.316  -7.107  1.00 0.00 ? 50  ASP B HB2  4  
ATOM   10908 H  HB3  . ASP B 1 50 ? 161.088 11.190  -6.955  1.00 0.00 ? 50  ASP B HB3  4  
ATOM   10909 N  N    . VAL B 1 51 ? 162.972 10.438  -4.112  1.00 0.00 ? 51  VAL B N    4  
ATOM   10910 C  CA   . VAL B 1 51 ? 162.612 9.749   -2.876  1.00 0.00 ? 51  VAL B CA   4  
ATOM   10911 C  C    . VAL B 1 51 ? 162.452 10.743  -1.733  1.00 0.00 ? 51  VAL B C    4  
ATOM   10912 O  O    . VAL B 1 51 ? 161.678 10.513  -0.807  1.00 0.00 ? 51  VAL B O    4  
ATOM   10913 C  CB   . VAL B 1 51 ? 163.692 8.727   -2.516  1.00 0.00 ? 51  VAL B CB   4  
ATOM   10914 C  CG1  . VAL B 1 51 ? 164.920 9.447   -1.950  1.00 0.00 ? 51  VAL B CG1  4  
ATOM   10915 C  CG2  . VAL B 1 51 ? 163.140 7.754   -1.469  1.00 0.00 ? 51  VAL B CG2  4  
ATOM   10916 H  H    . VAL B 1 51 ? 163.772 10.151  -4.608  1.00 0.00 ? 51  VAL B H    4  
ATOM   10917 H  HA   . VAL B 1 51 ? 161.678 9.230   -3.024  1.00 0.00 ? 51  VAL B HA   4  
ATOM   10918 H  HB   . VAL B 1 51 ? 163.974 8.180   -3.401  1.00 0.00 ? 51  VAL B HB   4  
ATOM   10919 H  HG11 . VAL B 1 51 ? 165.805 8.862   -2.154  1.00 0.00 ? 51  VAL B HG11 4  
ATOM   10920 H  HG12 . VAL B 1 51 ? 164.809 9.570   -0.882  1.00 0.00 ? 51  VAL B HG12 4  
ATOM   10921 H  HG13 . VAL B 1 51 ? 165.016 10.418  -2.414  1.00 0.00 ? 51  VAL B HG13 4  
ATOM   10922 H  HG21 . VAL B 1 51 ? 163.937 7.118   -1.114  1.00 0.00 ? 51  VAL B HG21 4  
ATOM   10923 H  HG22 . VAL B 1 51 ? 162.366 7.148   -1.914  1.00 0.00 ? 51  VAL B HG22 4  
ATOM   10924 H  HG23 . VAL B 1 51 ? 162.729 8.312   -0.640  1.00 0.00 ? 51  VAL B HG23 4  
ATOM   10925 N  N    . ASP B 1 52 ? 163.187 11.844  -1.804  1.00 0.00 ? 52  ASP B N    4  
ATOM   10926 C  CA   . ASP B 1 52 ? 163.126 12.868  -0.767  1.00 0.00 ? 52  ASP B CA   4  
ATOM   10927 C  C    . ASP B 1 52 ? 161.684 13.317  -0.534  1.00 0.00 ? 52  ASP B C    4  
ATOM   10928 O  O    . ASP B 1 52 ? 161.296 13.625  0.596   1.00 0.00 ? 52  ASP B O    4  
ATOM   10929 C  CB   . ASP B 1 52 ? 163.976 14.073  -1.173  1.00 0.00 ? 52  ASP B CB   4  
ATOM   10930 C  CG   . ASP B 1 52 ? 165.452 13.693  -1.173  1.00 0.00 ? 52  ASP B CG   4  
ATOM   10931 O  OD1  . ASP B 1 52 ? 165.770 12.630  -0.665  1.00 0.00 ? 52  ASP B OD1  4  
ATOM   10932 O  OD2  . ASP B 1 52 ? 166.244 14.470  -1.680  1.00 0.00 ? 52  ASP B OD2  4  
ATOM   10933 H  H    . ASP B 1 52 ? 163.789 11.971  -2.568  1.00 0.00 ? 52  ASP B H    4  
ATOM   10934 H  HA   . ASP B 1 52 ? 163.517 12.459  0.151   1.00 0.00 ? 52  ASP B HA   4  
ATOM   10935 H  HB2  . ASP B 1 52 ? 163.689 14.397  -2.163  1.00 0.00 ? 52  ASP B HB2  4  
ATOM   10936 H  HB3  . ASP B 1 52 ? 163.815 14.879  -0.471  1.00 0.00 ? 52  ASP B HB3  4  
ATOM   10937 N  N    . ALA B 1 53 ? 160.893 13.352  -1.602  1.00 0.00 ? 53  ALA B N    4  
ATOM   10938 C  CA   . ALA B 1 53 ? 159.500 13.774  -1.489  1.00 0.00 ? 53  ALA B CA   4  
ATOM   10939 C  C    . ALA B 1 53 ? 158.766 12.909  -0.475  1.00 0.00 ? 53  ALA B C    4  
ATOM   10940 O  O    . ALA B 1 53 ? 157.816 13.363  0.170   1.00 0.00 ? 53  ALA B O    4  
ATOM   10941 C  CB   . ALA B 1 53 ? 158.809 13.668  -2.850  1.00 0.00 ? 53  ALA B CB   4  
ATOM   10942 H  H    . ALA B 1 53 ? 161.251 13.093  -2.479  1.00 0.00 ? 53  ALA B H    4  
ATOM   10943 H  HA   . ALA B 1 53 ? 159.467 14.800  -1.159  1.00 0.00 ? 53  ALA B HA   4  
ATOM   10944 H  HB1  . ALA B 1 53 ? 158.791 12.636  -3.165  1.00 0.00 ? 53  ALA B HB1  4  
ATOM   10945 H  HB2  . ALA B 1 53 ? 159.351 14.257  -3.575  1.00 0.00 ? 53  ALA B HB2  4  
ATOM   10946 H  HB3  . ALA B 1 53 ? 157.798 14.038  -2.769  1.00 0.00 ? 53  ALA B HB3  4  
ATOM   10947 N  N    . VAL B 1 54 ? 159.210 11.669  -0.327  1.00 0.00 ? 54  VAL B N    4  
ATOM   10948 C  CA   . VAL B 1 54 ? 158.580 10.771  0.624   1.00 0.00 ? 54  VAL B CA   4  
ATOM   10949 C  C    . VAL B 1 54 ? 158.574 11.406  2.012   1.00 0.00 ? 54  VAL B C    4  
ATOM   10950 O  O    . VAL B 1 54 ? 157.651 11.204  2.798   1.00 0.00 ? 54  VAL B O    4  
ATOM   10951 C  CB   . VAL B 1 54 ? 159.330 9.435   0.670   1.00 0.00 ? 54  VAL B CB   4  
ATOM   10952 C  CG1  . VAL B 1 54 ? 160.627 9.587   1.474   1.00 0.00 ? 54  VAL B CG1  4  
ATOM   10953 C  CG2  . VAL B 1 54 ? 158.441 8.378   1.331   1.00 0.00 ? 54  VAL B CG2  4  
ATOM   10954 H  H    . VAL B 1 54 ? 159.973 11.359  -0.858  1.00 0.00 ? 54  VAL B H    4  
ATOM   10955 H  HA   . VAL B 1 54 ? 157.564 10.589  0.313   1.00 0.00 ? 54  VAL B HA   4  
ATOM   10956 H  HB   . VAL B 1 54 ? 159.569 9.125   -0.337  1.00 0.00 ? 54  VAL B HB   4  
ATOM   10957 H  HG11 . VAL B 1 54 ? 161.014 10.586  1.352   1.00 0.00 ? 54  VAL B HG11 4  
ATOM   10958 H  HG12 . VAL B 1 54 ? 161.356 8.875   1.117   1.00 0.00 ? 54  VAL B HG12 4  
ATOM   10959 H  HG13 . VAL B 1 54 ? 160.429 9.405   2.520   1.00 0.00 ? 54  VAL B HG13 4  
ATOM   10960 H  HG21 . VAL B 1 54 ? 158.993 7.454   1.429   1.00 0.00 ? 54  VAL B HG21 4  
ATOM   10961 H  HG22 . VAL B 1 54 ? 157.566 8.211   0.721   1.00 0.00 ? 54  VAL B HG22 4  
ATOM   10962 H  HG23 . VAL B 1 54 ? 158.139 8.722   2.309   1.00 0.00 ? 54  VAL B HG23 4  
ATOM   10963 N  N    . ASP B 1 55 ? 159.616 12.161  2.327   1.00 0.00 ? 55  ASP B N    4  
ATOM   10964 C  CA   . ASP B 1 55 ? 159.682 12.800  3.630   1.00 0.00 ? 55  ASP B CA   4  
ATOM   10965 C  C    . ASP B 1 55 ? 158.567 13.836  3.821   1.00 0.00 ? 55  ASP B C    4  
ATOM   10966 O  O    . ASP B 1 55 ? 157.956 13.908  4.887   1.00 0.00 ? 55  ASP B O    4  
ATOM   10967 C  CB   . ASP B 1 55 ? 161.040 13.481  3.802   1.00 0.00 ? 55  ASP B CB   4  
ATOM   10968 C  CG   . ASP B 1 55 ? 161.201 13.968  5.238   1.00 0.00 ? 55  ASP B CG   4  
ATOM   10969 O  OD1  . ASP B 1 55 ? 160.331 13.678  6.043   1.00 0.00 ? 55  ASP B OD1  4  
ATOM   10970 O  OD2  . ASP B 1 55 ? 162.192 14.624  5.513   1.00 0.00 ? 55  ASP B OD2  4  
ATOM   10971 H  H    . ASP B 1 55 ? 160.342 12.292  1.679   1.00 0.00 ? 55  ASP B H    4  
ATOM   10972 H  HA   . ASP B 1 55 ? 159.582 12.042  4.392   1.00 0.00 ? 55  ASP B HA   4  
ATOM   10973 H  HB2  . ASP B 1 55 ? 161.826 12.777  3.572   1.00 0.00 ? 55  ASP B HB2  4  
ATOM   10974 H  HB3  . ASP B 1 55 ? 161.106 14.324  3.130   1.00 0.00 ? 55  ASP B HB3  4  
ATOM   10975 N  N    . LYS B 1 56 ? 158.316 14.650  2.787   1.00 0.00 ? 56  LYS B N    4  
ATOM   10976 C  CA   . LYS B 1 56 ? 157.286 15.682  2.872   1.00 0.00 ? 56  LYS B CA   4  
ATOM   10977 C  C    . LYS B 1 56 ? 155.890 15.093  2.916   1.00 0.00 ? 56  LYS B C    4  
ATOM   10978 O  O    . LYS B 1 56 ? 155.042 15.506  3.706   1.00 0.00 ? 56  LYS B O    4  
ATOM   10979 C  CB   . LYS B 1 56 ? 157.399 16.621  1.670   1.00 0.00 ? 56  LYS B CB   4  
ATOM   10980 C  CG   . LYS B 1 56 ? 158.737 17.360  1.721   1.00 0.00 ? 56  LYS B CG   4  
ATOM   10981 C  CD   . LYS B 1 56 ? 158.799 18.383  0.584   1.00 0.00 ? 56  LYS B CD   4  
ATOM   10982 C  CE   . LYS B 1 56 ? 160.183 19.035  0.557   1.00 0.00 ? 56  LYS B CE   4  
ATOM   10983 N  NZ   . LYS B 1 56 ? 161.120 18.179  -0.224  1.00 0.00 ? 56  LYS B NZ   4  
ATOM   10984 H  H    . LYS B 1 56 ? 158.818 14.548  1.957   1.00 0.00 ? 56  LYS B H    4  
ATOM   10985 H  HA   . LYS B 1 56 ? 157.446 16.258  3.771   1.00 0.00 ? 56  LYS B HA   4  
ATOM   10986 H  HB2  . LYS B 1 56 ? 157.339 16.046  0.758   1.00 0.00 ? 56  LYS B HB2  4  
ATOM   10987 H  HB3  . LYS B 1 56 ? 156.593 17.339  1.698   1.00 0.00 ? 56  LYS B HB3  4  
ATOM   10988 H  HG2  . LYS B 1 56 ? 158.832 17.870  2.670   1.00 0.00 ? 56  LYS B HG2  4  
ATOM   10989 H  HG3  . LYS B 1 56 ? 159.544 16.653  1.609   1.00 0.00 ? 56  LYS B HG3  4  
ATOM   10990 H  HD2  . LYS B 1 56 ? 158.616 17.885  -0.357  1.00 0.00 ? 56  LYS B HD2  4  
ATOM   10991 H  HD3  . LYS B 1 56 ? 158.048 19.143  0.742   1.00 0.00 ? 56  LYS B HD3  4  
ATOM   10992 H  HE2  . LYS B 1 56 ? 160.112 20.008  0.094   1.00 0.00 ? 56  LYS B HE2  4  
ATOM   10993 H  HE3  . LYS B 1 56 ? 160.549 19.143  1.567   1.00 0.00 ? 56  LYS B HE3  4  
ATOM   10994 H  HZ1  . LYS B 1 56 ? 161.729 18.780  -0.814  1.00 0.00 ? 56  LYS B HZ1  4  
ATOM   10995 H  HZ2  . LYS B 1 56 ? 160.575 17.534  -0.831  1.00 0.00 ? 56  LYS B HZ2  4  
ATOM   10996 H  HZ3  . LYS B 1 56 ? 161.710 17.627  0.429   1.00 0.00 ? 56  LYS B HZ3  4  
ATOM   10997 N  N    . VAL B 1 57 ? 155.663 14.140  2.027   1.00 0.00 ? 57  VAL B N    4  
ATOM   10998 C  CA   . VAL B 1 57 ? 154.368 13.497  1.917   1.00 0.00 ? 57  VAL B CA   4  
ATOM   10999 C  C    . VAL B 1 57 ? 154.012 12.726  3.188   1.00 0.00 ? 57  VAL B C    4  
ATOM   11000 O  O    . VAL B 1 57 ? 152.840 12.604  3.542   1.00 0.00 ? 57  VAL B O    4  
ATOM   11001 C  CB   . VAL B 1 57 ? 154.353 12.582  0.695   1.00 0.00 ? 57  VAL B CB   4  
ATOM   11002 C  CG1  . VAL B 1 57 ? 155.033 11.262  1.014   1.00 0.00 ? 57  VAL B CG1  4  
ATOM   11003 C  CG2  . VAL B 1 57 ? 152.920 12.334  0.279   1.00 0.00 ? 57  VAL B CG2  4  
ATOM   11004 H  H    . VAL B 1 57 ? 156.383 13.875  1.412   1.00 0.00 ? 57  VAL B H    4  
ATOM   11005 H  HA   . VAL B 1 57 ? 153.624 14.266  1.772   1.00 0.00 ? 57  VAL B HA   4  
ATOM   11006 H  HB   . VAL B 1 57 ? 154.881 13.066  -0.114  1.00 0.00 ? 57  VAL B HB   4  
ATOM   11007 H  HG11 . VAL B 1 57 ? 155.911 11.455  1.591   1.00 0.00 ? 57  VAL B HG11 4  
ATOM   11008 H  HG12 . VAL B 1 57 ? 155.306 10.766  0.094   1.00 0.00 ? 57  VAL B HG12 4  
ATOM   11009 H  HG13 . VAL B 1 57 ? 154.359 10.634  1.577   1.00 0.00 ? 57  VAL B HG13 4  
ATOM   11010 H  HG21 . VAL B 1 57 ? 152.897 11.574  -0.484  1.00 0.00 ? 57  VAL B HG21 4  
ATOM   11011 H  HG22 . VAL B 1 57 ? 152.505 13.251  -0.107  1.00 0.00 ? 57  VAL B HG22 4  
ATOM   11012 H  HG23 . VAL B 1 57 ? 152.352 12.010  1.135   1.00 0.00 ? 57  VAL B HG23 4  
ATOM   11013 N  N    . MET B 1 58 ? 155.029 12.191  3.854   1.00 0.00 ? 58  MET B N    4  
ATOM   11014 C  CA   . MET B 1 58 ? 154.813 11.412  5.072   1.00 0.00 ? 58  MET B CA   4  
ATOM   11015 C  C    . MET B 1 58 ? 154.035 12.212  6.116   1.00 0.00 ? 58  MET B C    4  
ATOM   11016 O  O    . MET B 1 58 ? 153.201 11.660  6.840   1.00 0.00 ? 58  MET B O    4  
ATOM   11017 C  CB   . MET B 1 58 ? 156.168 11.044  5.681   1.00 0.00 ? 58  MET B CB   4  
ATOM   11018 C  CG   . MET B 1 58 ? 155.965 10.086  6.857   1.00 0.00 ? 58  MET B CG   4  
ATOM   11019 S  SD   . MET B 1 58 ? 157.516 9.913   7.763   1.00 0.00 ? 58  MET B SD   4  
ATOM   11020 C  CE   . MET B 1 58 ? 156.979 8.598   8.883   1.00 0.00 ? 58  MET B CE   4  
ATOM   11021 H  H    . MET B 1 58 ? 155.941 12.309  3.516   1.00 0.00 ? 58  MET B H    4  
ATOM   11022 H  HA   . MET B 1 58 ? 154.277 10.506  4.835   1.00 0.00 ? 58  MET B HA   4  
ATOM   11023 H  HB2  . MET B 1 58 ? 156.782 10.568  4.930   1.00 0.00 ? 58  MET B HB2  4  
ATOM   11024 H  HB3  . MET B 1 58 ? 156.659 11.940  6.031   1.00 0.00 ? 58  MET B HB3  4  
ATOM   11025 H  HG2  . MET B 1 58 ? 155.204 10.469  7.516   1.00 0.00 ? 58  MET B HG2  4  
ATOM   11026 H  HG3  . MET B 1 58 ? 155.669 9.119   6.482   1.00 0.00 ? 58  MET B HG3  4  
ATOM   11027 H  HE1  . MET B 1 58 ? 157.503 8.693   9.825   1.00 0.00 ? 58  MET B HE1  4  
ATOM   11028 H  HE2  . MET B 1 58 ? 157.202 7.640   8.444   1.00 0.00 ? 58  MET B HE2  4  
ATOM   11029 H  HE3  . MET B 1 58 ? 155.914 8.679   9.048   1.00 0.00 ? 58  MET B HE3  4  
ATOM   11030 N  N    . LYS B 1 59 ? 154.329 13.504  6.212   1.00 0.00 ? 59  LYS B N    4  
ATOM   11031 C  CA   . LYS B 1 59 ? 153.666 14.340  7.202   1.00 0.00 ? 59  LYS B CA   4  
ATOM   11032 C  C    . LYS B 1 59 ? 152.154 14.349  7.012   1.00 0.00 ? 59  LYS B C    4  
ATOM   11033 O  O    . LYS B 1 59 ? 151.404 14.301  7.986   1.00 0.00 ? 59  LYS B O    4  
ATOM   11034 C  CB   . LYS B 1 59 ? 154.197 15.771  7.109   1.00 0.00 ? 59  LYS B CB   4  
ATOM   11035 C  CG   . LYS B 1 59 ? 155.683 15.792  7.475   1.00 0.00 ? 59  LYS B CG   4  
ATOM   11036 C  CD   . LYS B 1 59 ? 156.184 17.237  7.491   1.00 0.00 ? 59  LYS B CD   4  
ATOM   11037 C  CE   . LYS B 1 59 ? 157.693 17.251  7.738   1.00 0.00 ? 59  LYS B CE   4  
ATOM   11038 N  NZ   . LYS B 1 59 ? 158.132 18.638  8.062   1.00 0.00 ? 59  LYS B NZ   4  
ATOM   11039 H  H    . LYS B 1 59 ? 155.015 13.891  5.629   1.00 0.00 ? 59  LYS B H    4  
ATOM   11040 H  HA   . LYS B 1 59 ? 153.888 13.956  8.186   1.00 0.00 ? 59  LYS B HA   4  
ATOM   11041 H  HB2  . LYS B 1 59 ? 154.069 16.135  6.099   1.00 0.00 ? 59  LYS B HB2  4  
ATOM   11042 H  HB3  . LYS B 1 59 ? 153.651 16.404  7.792   1.00 0.00 ? 59  LYS B HB3  4  
ATOM   11043 H  HG2  . LYS B 1 59 ? 155.817 15.351  8.452   1.00 0.00 ? 59  LYS B HG2  4  
ATOM   11044 H  HG3  . LYS B 1 59 ? 156.241 15.227  6.744   1.00 0.00 ? 59  LYS B HG3  4  
ATOM   11045 H  HD2  . LYS B 1 59 ? 155.969 17.704  6.541   1.00 0.00 ? 59  LYS B HD2  4  
ATOM   11046 H  HD3  . LYS B 1 59 ? 155.688 17.782  8.281   1.00 0.00 ? 59  LYS B HD3  4  
ATOM   11047 H  HE2  . LYS B 1 59 ? 157.930 16.597  8.564   1.00 0.00 ? 59  LYS B HE2  4  
ATOM   11048 H  HE3  . LYS B 1 59 ? 158.206 16.910  6.851   1.00 0.00 ? 59  LYS B HE3  4  
ATOM   11049 H  HZ1  . LYS B 1 59 ? 159.128 18.760  7.790   1.00 0.00 ? 59  LYS B HZ1  4  
ATOM   11050 H  HZ2  . LYS B 1 59 ? 158.027 18.806  9.083   1.00 0.00 ? 59  LYS B HZ2  4  
ATOM   11051 H  HZ3  . LYS B 1 59 ? 157.546 19.319  7.537   1.00 0.00 ? 59  LYS B HZ3  4  
ATOM   11052 N  N    . GLU B 1 60 ? 151.702 14.411  5.763   1.00 0.00 ? 60  GLU B N    4  
ATOM   11053 C  CA   . GLU B 1 60 ? 150.268 14.422  5.506   1.00 0.00 ? 60  GLU B CA   4  
ATOM   11054 C  C    . GLU B 1 60 ? 149.629 13.094  5.897   1.00 0.00 ? 60  GLU B C    4  
ATOM   11055 O  O    . GLU B 1 60 ? 148.527 13.063  6.446   1.00 0.00 ? 60  GLU B O    4  
ATOM   11056 C  CB   . GLU B 1 60 ? 150.006 14.697  4.024   1.00 0.00 ? 60  GLU B CB   4  
ATOM   11057 C  CG   . GLU B 1 60 ? 150.492 16.105  3.672   1.00 0.00 ? 60  GLU B CG   4  
ATOM   11058 C  CD   . GLU B 1 60 ? 150.175 16.415  2.214   1.00 0.00 ? 60  GLU B CD   4  
ATOM   11059 O  OE1  . GLU B 1 60 ? 149.766 15.506  1.511   1.00 0.00 ? 60  GLU B OE1  4  
ATOM   11060 O  OE2  . GLU B 1 60 ? 150.347 17.557  1.821   1.00 0.00 ? 60  GLU B OE2  4  
ATOM   11061 H  H    . GLU B 1 60 ? 152.334 14.448  5.015   1.00 0.00 ? 60  GLU B H    4  
ATOM   11062 H  HA   . GLU B 1 60 ? 149.817 15.211  6.088   1.00 0.00 ? 60  GLU B HA   4  
ATOM   11063 H  HB2  . GLU B 1 60 ? 150.537 13.971  3.426   1.00 0.00 ? 60  GLU B HB2  4  
ATOM   11064 H  HB3  . GLU B 1 60 ? 148.948 14.623  3.826   1.00 0.00 ? 60  GLU B HB3  4  
ATOM   11065 H  HG2  . GLU B 1 60 ? 149.998 16.824  4.308   1.00 0.00 ? 60  GLU B HG2  4  
ATOM   11066 H  HG3  . GLU B 1 60 ? 151.559 16.164  3.826   1.00 0.00 ? 60  GLU B HG3  4  
ATOM   11067 N  N    . LEU B 1 61 ? 150.327 11.998  5.610   1.00 0.00 ? 61  LEU B N    4  
ATOM   11068 C  CA   . LEU B 1 61 ? 149.812 10.674  5.938   1.00 0.00 ? 61  LEU B CA   4  
ATOM   11069 C  C    . LEU B 1 61 ? 149.747 10.448  7.441   1.00 0.00 ? 61  LEU B C    4  
ATOM   11070 O  O    . LEU B 1 61 ? 148.822 9.804   7.936   1.00 0.00 ? 61  LEU B O    4  
ATOM   11071 C  CB   . LEU B 1 61 ? 150.686 9.596   5.297   1.00 0.00 ? 61  LEU B CB   4  
ATOM   11072 C  CG   . LEU B 1 61 ? 150.720 9.785   3.778   1.00 0.00 ? 61  LEU B CG   4  
ATOM   11073 C  CD1  . LEU B 1 61 ? 151.511 8.641   3.152   1.00 0.00 ? 61  LEU B CD1  4  
ATOM   11074 C  CD2  . LEU B 1 61 ? 149.294 9.778   3.217   1.00 0.00 ? 61  LEU B CD2  4  
ATOM   11075 H  H    . LEU B 1 61 ? 151.199 12.083  5.172   1.00 0.00 ? 61  LEU B H    4  
ATOM   11076 H  HA   . LEU B 1 61 ? 148.814 10.586  5.541   1.00 0.00 ? 61  LEU B HA   4  
ATOM   11077 H  HB2  . LEU B 1 61 ? 151.689 9.667   5.691   1.00 0.00 ? 61  LEU B HB2  4  
ATOM   11078 H  HB3  . LEU B 1 61 ? 150.279 8.622   5.526   1.00 0.00 ? 61  LEU B HB3  4  
ATOM   11079 H  HG   . LEU B 1 61 ? 151.198 10.723  3.544   1.00 0.00 ? 61  LEU B HG   4  
ATOM   11080 H  HD11 . LEU B 1 61 ? 152.568 8.829   3.262   1.00 0.00 ? 61  LEU B HD11 4  
ATOM   11081 H  HD12 . LEU B 1 61 ? 151.264 8.564   2.102   1.00 0.00 ? 61  LEU B HD12 4  
ATOM   11082 H  HD13 . LEU B 1 61 ? 151.255 7.719   3.651   1.00 0.00 ? 61  LEU B HD13 4  
ATOM   11083 H  HD21 . LEU B 1 61 ? 148.883 10.775  3.268   1.00 0.00 ? 61  LEU B HD21 4  
ATOM   11084 H  HD22 . LEU B 1 61 ? 148.681 9.107   3.800   1.00 0.00 ? 61  LEU B HD22 4  
ATOM   11085 H  HD23 . LEU B 1 61 ? 149.311 9.449   2.188   1.00 0.00 ? 61  LEU B HD23 4  
ATOM   11086 N  N    . ASP B 1 62 ? 150.734 10.962  8.168   1.00 0.00 ? 62  ASP B N    4  
ATOM   11087 C  CA   . ASP B 1 62 ? 150.748 10.774  9.612   1.00 0.00 ? 62  ASP B CA   4  
ATOM   11088 C  C    . ASP B 1 62 ? 149.927 11.845  10.315  1.00 0.00 ? 62  ASP B C    4  
ATOM   11089 O  O    . ASP B 1 62 ? 150.350 12.996  10.419  1.00 0.00 ? 62  ASP B O    4  
ATOM   11090 C  CB   . ASP B 1 62 ? 152.189 10.820  10.125  1.00 0.00 ? 62  ASP B CB   4  
ATOM   11091 C  CG   . ASP B 1 62 ? 152.221 10.515  11.619  1.00 0.00 ? 62  ASP B CG   4  
ATOM   11092 O  OD1  . ASP B 1 62 ? 151.164 10.266  12.174  1.00 0.00 ? 62  ASP B OD1  4  
ATOM   11093 O  OD2  . ASP B 1 62 ? 153.301 10.537  12.185  1.00 0.00 ? 62  ASP B OD2  4  
ATOM   11094 H  H    . ASP B 1 62 ? 151.462 11.459  7.730   1.00 0.00 ? 62  ASP B H    4  
ATOM   11095 H  HA   . ASP B 1 62 ? 150.331 9.807   9.843   1.00 0.00 ? 62  ASP B HA   4  
ATOM   11096 H  HB2  . ASP B 1 62 ? 152.781 10.086  9.597   1.00 0.00 ? 62  ASP B HB2  4  
ATOM   11097 H  HB3  . ASP B 1 62 ? 152.600 11.803  9.953   1.00 0.00 ? 62  ASP B HB3  4  
ATOM   11098 N  N    . GLU B 1 63 ? 148.766 11.452  10.826  1.00 0.00 ? 63  GLU B N    4  
ATOM   11099 C  CA   . GLU B 1 63 ? 147.921 12.388  11.549  1.00 0.00 ? 63  GLU B CA   4  
ATOM   11100 C  C    . GLU B 1 63 ? 148.599 12.805  12.848  1.00 0.00 ? 63  GLU B C    4  
ATOM   11101 O  O    . GLU B 1 63 ? 148.475 13.947  13.291  1.00 0.00 ? 63  GLU B O    4  
ATOM   11102 C  CB   . GLU B 1 63 ? 146.568 11.742  11.858  1.00 0.00 ? 63  GLU B CB   4  
ATOM   11103 C  CG   . GLU B 1 63 ? 145.827 11.458  10.550  1.00 0.00 ? 63  GLU B CG   4  
ATOM   11104 C  CD   . GLU B 1 63 ? 144.449 10.876  10.849  1.00 0.00 ? 63  GLU B CD   4  
ATOM   11105 O  OE1  . GLU B 1 63 ? 144.196 10.566  12.001  1.00 0.00 ? 63  GLU B OE1  4  
ATOM   11106 O  OE2  . GLU B 1 63 ? 143.668 10.750  9.920   1.00 0.00 ? 63  GLU B OE2  4  
ATOM   11107 H  H    . GLU B 1 63 ? 148.488 10.517  10.735  1.00 0.00 ? 63  GLU B H    4  
ATOM   11108 H  HA   . GLU B 1 63 ? 147.760 13.263  10.938  1.00 0.00 ? 63  GLU B HA   4  
ATOM   11109 H  HB2  . GLU B 1 63 ? 146.726 10.818  12.394  1.00 0.00 ? 63  GLU B HB2  4  
ATOM   11110 H  HB3  . GLU B 1 63 ? 145.979 12.415  12.464  1.00 0.00 ? 63  GLU B HB3  4  
ATOM   11111 H  HG2  . GLU B 1 63 ? 145.716 12.377  9.994   1.00 0.00 ? 63  GLU B HG2  4  
ATOM   11112 H  HG3  . GLU B 1 63 ? 146.394 10.751  9.964   1.00 0.00 ? 63  GLU B HG3  4  
ATOM   11113 N  N    . ASN B 1 64 ? 149.306 11.855  13.456  1.00 0.00 ? 64  ASN B N    4  
ATOM   11114 C  CA   . ASN B 1 64 ? 149.997 12.109  14.716  1.00 0.00 ? 64  ASN B CA   4  
ATOM   11115 C  C    . ASN B 1 64 ? 151.005 13.237  14.573  1.00 0.00 ? 64  ASN B C    4  
ATOM   11116 O  O    . ASN B 1 64 ? 151.185 14.045  15.484  1.00 0.00 ? 64  ASN B O    4  
ATOM   11117 C  CB   . ASN B 1 64 ? 150.755 10.852  15.147  1.00 0.00 ? 64  ASN B CB   4  
ATOM   11118 C  CG   . ASN B 1 64 ? 149.805 9.669   15.274  1.00 0.00 ? 64  ASN B CG   4  
ATOM   11119 O  OD1  . ASN B 1 64 ? 150.114 8.578   14.790  1.00 0.00 ? 64  ASN B OD1  4  
ATOM   11120 N  ND2  . ASN B 1 64 ? 148.668 9.816   15.895  1.00 0.00 ? 64  ASN B ND2  4  
ATOM   11121 H  H    . ASN B 1 64 ? 149.355 10.963  13.054  1.00 0.00 ? 64  ASN B H    4  
ATOM   11122 H  HA   . ASN B 1 64 ? 149.275 12.364  15.477  1.00 0.00 ? 64  ASN B HA   4  
ATOM   11123 H  HB2  . ASN B 1 64 ? 151.512 10.623  14.412  1.00 0.00 ? 64  ASN B HB2  4  
ATOM   11124 H  HB3  . ASN B 1 64 ? 151.228 11.032  16.101  1.00 0.00 ? 64  ASN B HB3  4  
ATOM   11125 H  HD21 . ASN B 1 64 ? 148.428 10.686  16.279  1.00 0.00 ? 64  ASN B HD21 4  
ATOM   11126 H  HD22 . ASN B 1 64 ? 148.054 9.057   15.980  1.00 0.00 ? 64  ASN B HD22 4  
ATOM   11127 N  N    . GLY B 1 65 ? 151.684 13.266  13.432  1.00 0.00 ? 65  GLY B N    4  
ATOM   11128 C  CA   . GLY B 1 65 ? 152.701 14.277  13.192  1.00 0.00 ? 65  GLY B CA   4  
ATOM   11129 C  C    . GLY B 1 65 ? 153.940 13.928  14.007  1.00 0.00 ? 65  GLY B C    4  
ATOM   11130 O  O    . GLY B 1 65 ? 154.827 14.758  14.208  1.00 0.00 ? 65  GLY B O    4  
ATOM   11131 H  H    . GLY B 1 65 ? 151.514 12.582  12.751  1.00 0.00 ? 65  GLY B H    4  
ATOM   11132 H  HA2  . GLY B 1 65 ? 152.949 14.299  12.140  1.00 0.00 ? 65  GLY B HA2  4  
ATOM   11133 H  HA3  . GLY B 1 65 ? 152.333 15.243  13.499  1.00 0.00 ? 65  GLY B HA3  4  
ATOM   11134 N  N    . ASP B 1 66 ? 153.966 12.690  14.502  1.00 0.00 ? 66  ASP B N    4  
ATOM   11135 C  CA   . ASP B 1 66 ? 155.070 12.219  15.333  1.00 0.00 ? 66  ASP B CA   4  
ATOM   11136 C  C    . ASP B 1 66 ? 156.198 11.578  14.527  1.00 0.00 ? 66  ASP B C    4  
ATOM   11137 O  O    . ASP B 1 66 ? 157.181 11.109  15.102  1.00 0.00 ? 66  ASP B O    4  
ATOM   11138 C  CB   . ASP B 1 66 ? 154.523 11.209  16.346  1.00 0.00 ? 66  ASP B CB   4  
ATOM   11139 C  CG   . ASP B 1 66 ? 153.941 9.986   15.625  1.00 0.00 ? 66  ASP B CG   4  
ATOM   11140 O  OD1  . ASP B 1 66 ? 154.123 9.875   14.422  1.00 0.00 ? 66  ASP B OD1  4  
ATOM   11141 O  OD2  . ASP B 1 66 ? 153.290 9.193   16.285  1.00 0.00 ? 66  ASP B OD2  4  
ATOM   11142 H  H    . ASP B 1 66 ? 153.214 12.088  14.323  1.00 0.00 ? 66  ASP B H    4  
ATOM   11143 H  HA   . ASP B 1 66 ? 155.472 13.058  15.878  1.00 0.00 ? 66  ASP B HA   4  
ATOM   11144 H  HB2  . ASP B 1 66 ? 155.323 10.890  16.998  1.00 0.00 ? 66  ASP B HB2  4  
ATOM   11145 H  HB3  . ASP B 1 66 ? 153.748 11.677  16.934  1.00 0.00 ? 66  ASP B HB3  4  
ATOM   11146 N  N    . GLY B 1 67 ? 156.075 11.569  13.209  1.00 0.00 ? 67  GLY B N    4  
ATOM   11147 C  CA   . GLY B 1 67 ? 157.123 10.992  12.371  1.00 0.00 ? 67  GLY B CA   4  
ATOM   11148 C  C    . GLY B 1 67 ? 157.174 9.477   12.539  1.00 0.00 ? 67  GLY B C    4  
ATOM   11149 O  O    . GLY B 1 67 ? 158.097 8.818   12.060  1.00 0.00 ? 67  GLY B O    4  
ATOM   11150 H  H    . GLY B 1 67 ? 155.282 11.965  12.792  1.00 0.00 ? 67  GLY B H    4  
ATOM   11151 H  HA2  . GLY B 1 67 ? 156.922 11.231  11.337  1.00 0.00 ? 67  GLY B HA2  4  
ATOM   11152 H  HA3  . GLY B 1 67 ? 158.077 11.411  12.654  1.00 0.00 ? 67  GLY B HA3  4  
ATOM   11153 N  N    . GLU B 1 68 ? 156.176 8.935   13.226  1.00 0.00 ? 68  GLU B N    4  
ATOM   11154 C  CA   . GLU B 1 68 ? 156.098 7.496   13.466  1.00 0.00 ? 68  GLU B CA   4  
ATOM   11155 C  C    . GLU B 1 68 ? 155.033 6.888   12.570  1.00 0.00 ? 68  GLU B C    4  
ATOM   11156 O  O    . GLU B 1 68 ? 154.001 7.517   12.322  1.00 0.00 ? 68  GLU B O    4  
ATOM   11157 C  CB   . GLU B 1 68 ? 155.757 7.223   14.932  1.00 0.00 ? 68  GLU B CB   4  
ATOM   11158 C  CG   . GLU B 1 68 ? 155.820 5.718   15.200  1.00 0.00 ? 68  GLU B CG   4  
ATOM   11159 C  CD   . GLU B 1 68 ? 155.384 5.425   16.632  1.00 0.00 ? 68  GLU B CD   4  
ATOM   11160 O  OE1  . GLU B 1 68 ? 155.037 6.365   17.329  1.00 0.00 ? 68  GLU B OE1  4  
ATOM   11161 O  OE2  . GLU B 1 68 ? 155.403 4.266   17.009  1.00 0.00 ? 68  GLU B OE2  4  
ATOM   11162 H  H    . GLU B 1 68 ? 155.472 9.516   13.583  1.00 0.00 ? 68  GLU B H    4  
ATOM   11163 H  HA   . GLU B 1 68 ? 157.053 7.044   13.237  1.00 0.00 ? 68  GLU B HA   4  
ATOM   11164 H  HB2  . GLU B 1 68 ? 156.467 7.734   15.567  1.00 0.00 ? 68  GLU B HB2  4  
ATOM   11165 H  HB3  . GLU B 1 68 ? 154.761 7.584   15.143  1.00 0.00 ? 68  GLU B HB3  4  
ATOM   11166 H  HG2  . GLU B 1 68 ? 155.163 5.205   14.513  1.00 0.00 ? 68  GLU B HG2  4  
ATOM   11167 H  HG3  . GLU B 1 68 ? 156.831 5.371   15.057  1.00 0.00 ? 68  GLU B HG3  4  
ATOM   11168 N  N    . VAL B 1 69 ? 155.275 5.676   12.069  1.00 0.00 ? 69  VAL B N    4  
ATOM   11169 C  CA   . VAL B 1 69 ? 154.302 5.045   11.188  1.00 0.00 ? 69  VAL B CA   4  
ATOM   11170 C  C    . VAL B 1 69 ? 153.605 3.878   11.869  1.00 0.00 ? 69  VAL B C    4  
ATOM   11171 O  O    . VAL B 1 69 ? 154.239 2.984   12.430  1.00 0.00 ? 69  VAL B O    4  
ATOM   11172 C  CB   . VAL B 1 69 ? 154.999 4.548   9.920   1.00 0.00 ? 69  VAL B CB   4  
ATOM   11173 C  CG1  . VAL B 1 69 ? 153.959 3.978   8.954   1.00 0.00 ? 69  VAL B CG1  4  
ATOM   11174 C  CG2  . VAL B 1 69 ? 155.725 5.719   9.250   1.00 0.00 ? 69  VAL B CG2  4  
ATOM   11175 H  H    . VAL B 1 69 ? 156.113 5.211   12.286  1.00 0.00 ? 69  VAL B H    4  
ATOM   11176 H  HA   . VAL B 1 69 ? 153.559 5.768   10.903  1.00 0.00 ? 69  VAL B HA   4  
ATOM   11177 H  HB   . VAL B 1 69 ? 155.713 3.779   10.178  1.00 0.00 ? 69  VAL B HB   4  
ATOM   11178 H  HG11 . VAL B 1 69 ? 154.449 3.655   8.047   1.00 0.00 ? 69  VAL B HG11 4  
ATOM   11179 H  HG12 . VAL B 1 69 ? 153.230 4.739   8.719   1.00 0.00 ? 69  VAL B HG12 4  
ATOM   11180 H  HG13 . VAL B 1 69 ? 153.465 3.136   9.415   1.00 0.00 ? 69  VAL B HG13 4  
ATOM   11181 H  HG21 . VAL B 1 69 ? 155.017 6.303   8.679   1.00 0.00 ? 69  VAL B HG21 4  
ATOM   11182 H  HG22 . VAL B 1 69 ? 156.491 5.337   8.592   1.00 0.00 ? 69  VAL B HG22 4  
ATOM   11183 H  HG23 . VAL B 1 69 ? 156.177 6.341   10.007  1.00 0.00 ? 69  VAL B HG23 4  
ATOM   11184 N  N    . ASP B 1 70 ? 152.282 3.901   11.779  1.00 0.00 ? 70  ASP B N    4  
ATOM   11185 C  CA   . ASP B 1 70 ? 151.439 2.858   12.341  1.00 0.00 ? 70  ASP B CA   4  
ATOM   11186 C  C    . ASP B 1 70 ? 150.811 2.073   11.202  1.00 0.00 ? 70  ASP B C    4  
ATOM   11187 O  O    . ASP B 1 70 ? 150.750 2.563   10.076  1.00 0.00 ? 70  ASP B O    4  
ATOM   11188 C  CB   . ASP B 1 70 ? 150.345 3.474   13.213  1.00 0.00 ? 70  ASP B CB   4  
ATOM   11189 C  CG   . ASP B 1 70 ? 150.966 4.149   14.431  1.00 0.00 ? 70  ASP B CG   4  
ATOM   11190 O  OD1  . ASP B 1 70 ? 152.134 3.907   14.686  1.00 0.00 ? 70  ASP B OD1  4  
ATOM   11191 O  OD2  . ASP B 1 70 ? 150.266 4.898   15.091  1.00 0.00 ? 70  ASP B OD2  4  
ATOM   11192 H  H    . ASP B 1 70 ? 151.857 4.640   11.296  1.00 0.00 ? 70  ASP B H    4  
ATOM   11193 H  HA   . ASP B 1 70 ? 152.043 2.194   12.942  1.00 0.00 ? 70  ASP B HA   4  
ATOM   11194 H  HB2  . ASP B 1 70 ? 149.798 4.207   12.637  1.00 0.00 ? 70  ASP B HB2  4  
ATOM   11195 H  HB3  . ASP B 1 70 ? 149.669 2.699   13.542  1.00 0.00 ? 70  ASP B HB3  4  
ATOM   11196 N  N    . PHE B 1 71 ? 150.335 0.869   11.477  1.00 0.00 ? 71  PHE B N    4  
ATOM   11197 C  CA   . PHE B 1 71 ? 149.716 0.092   10.417  1.00 0.00 ? 71  PHE B CA   4  
ATOM   11198 C  C    . PHE B 1 71 ? 148.631 0.918   9.746   1.00 0.00 ? 71  PHE B C    4  
ATOM   11199 O  O    . PHE B 1 71 ? 148.505 0.911   8.521   1.00 0.00 ? 71  PHE B O    4  
ATOM   11200 C  CB   . PHE B 1 71 ? 149.099 -1.193  10.973  1.00 0.00 ? 71  PHE B CB   4  
ATOM   11201 C  CG   . PHE B 1 71 ? 148.526 -1.995  9.829   1.00 0.00 ? 71  PHE B CG   4  
ATOM   11202 C  CD1  . PHE B 1 71 ? 149.350 -2.823  9.057   1.00 0.00 ? 71  PHE B CD1  4  
ATOM   11203 C  CD2  . PHE B 1 71 ? 147.159 -1.903  9.536   1.00 0.00 ? 71  PHE B CD2  4  
ATOM   11204 C  CE1  . PHE B 1 71 ? 148.804 -3.557  7.994   1.00 0.00 ? 71  PHE B CE1  4  
ATOM   11205 C  CE2  . PHE B 1 71 ? 146.616 -2.637  8.477   1.00 0.00 ? 71  PHE B CE2  4  
ATOM   11206 C  CZ   . PHE B 1 71 ? 147.440 -3.463  7.705   1.00 0.00 ? 71  PHE B CZ   4  
ATOM   11207 H  H    . PHE B 1 71 ? 150.391 0.509   12.387  1.00 0.00 ? 71  PHE B H    4  
ATOM   11208 H  HA   . PHE B 1 71 ? 150.466 -0.165  9.685   1.00 0.00 ? 71  PHE B HA   4  
ATOM   11209 H  HB2  . PHE B 1 71 ? 149.860 -1.771  11.478  1.00 0.00 ? 71  PHE B HB2  4  
ATOM   11210 H  HB3  . PHE B 1 71 ? 148.308 -0.945  11.668  1.00 0.00 ? 71  PHE B HB3  4  
ATOM   11211 H  HD1  . PHE B 1 71 ? 150.404 -2.897  9.281   1.00 0.00 ? 71  PHE B HD1  4  
ATOM   11212 H  HD2  . PHE B 1 71 ? 146.523 -1.265  10.132  1.00 0.00 ? 71  PHE B HD2  4  
ATOM   11213 H  HE1  . PHE B 1 71 ? 149.436 -4.192  7.394   1.00 0.00 ? 71  PHE B HE1  4  
ATOM   11214 H  HE2  . PHE B 1 71 ? 145.562 -2.565  8.254   1.00 0.00 ? 71  PHE B HE2  4  
ATOM   11215 H  HZ   . PHE B 1 71 ? 147.021 -4.029  6.886   1.00 0.00 ? 71  PHE B HZ   4  
ATOM   11216 N  N    . GLN B 1 72 ? 147.850 1.634   10.546  1.00 0.00 ? 72  GLN B N    4  
ATOM   11217 C  CA   . GLN B 1 72 ? 146.790 2.457   9.989   1.00 0.00 ? 72  GLN B CA   4  
ATOM   11218 C  C    . GLN B 1 72 ? 147.353 3.498   9.026   1.00 0.00 ? 72  GLN B C    4  
ATOM   11219 O  O    . GLN B 1 72 ? 146.775 3.747   7.973   1.00 0.00 ? 72  GLN B O    4  
ATOM   11220 C  CB   . GLN B 1 72 ? 146.015 3.151   11.108  1.00 0.00 ? 72  GLN B CB   4  
ATOM   11221 C  CG   . GLN B 1 72 ? 144.788 3.842   10.513  1.00 0.00 ? 72  GLN B CG   4  
ATOM   11222 C  CD   . GLN B 1 72 ? 143.947 4.464   11.621  1.00 0.00 ? 72  GLN B CD   4  
ATOM   11223 O  OE1  . GLN B 1 72 ? 144.257 4.308   12.802  1.00 0.00 ? 72  GLN B OE1  4  
ATOM   11224 N  NE2  . GLN B 1 72 ? 142.877 5.141   11.308  1.00 0.00 ? 72  GLN B NE2  4  
ATOM   11225 H  H    . GLN B 1 72 ? 147.991 1.611   11.516  1.00 0.00 ? 72  GLN B H    4  
ATOM   11226 H  HA   . GLN B 1 72 ? 146.111 1.821   9.445   1.00 0.00 ? 72  GLN B HA   4  
ATOM   11227 H  HB2  . GLN B 1 72 ? 145.701 2.418   11.838  1.00 0.00 ? 72  GLN B HB2  4  
ATOM   11228 H  HB3  . GLN B 1 72 ? 146.646 3.887   11.583  1.00 0.00 ? 72  GLN B HB3  4  
ATOM   11229 H  HG2  . GLN B 1 72 ? 145.111 4.616   9.834   1.00 0.00 ? 72  GLN B HG2  4  
ATOM   11230 H  HG3  . GLN B 1 72 ? 144.196 3.121   9.976   1.00 0.00 ? 72  GLN B HG3  4  
ATOM   11231 H  HE21 . GLN B 1 72 ? 142.620 5.243   10.368  1.00 0.00 ? 72  GLN B HE21 4  
ATOM   11232 H  HE22 . GLN B 1 72 ? 142.328 5.544   12.013  1.00 0.00 ? 72  GLN B HE22 4  
ATOM   11233 N  N    . GLU B 1 73 ? 148.484 4.106   9.374   1.00 0.00 ? 73  GLU B N    4  
ATOM   11234 C  CA   . GLU B 1 73 ? 149.076 5.098   8.482   1.00 0.00 ? 73  GLU B CA   4  
ATOM   11235 C  C    . GLU B 1 73 ? 149.573 4.415   7.202   1.00 0.00 ? 73  GLU B C    4  
ATOM   11236 O  O    . GLU B 1 73 ? 149.463 4.954   6.094   1.00 0.00 ? 73  GLU B O    4  
ATOM   11237 C  CB   . GLU B 1 73 ? 150.249 5.804   9.176   1.00 0.00 ? 73  GLU B CB   4  
ATOM   11238 C  CG   . GLU B 1 73 ? 149.746 6.572   10.407  1.00 0.00 ? 73  GLU B CG   4  
ATOM   11239 C  CD   . GLU B 1 73 ? 150.895 7.360   11.040  1.00 0.00 ? 73  GLU B CD   4  
ATOM   11240 O  OE1  . GLU B 1 73 ? 151.986 7.301   10.505  1.00 0.00 ? 73  GLU B OE1  4  
ATOM   11241 O  OE2  . GLU B 1 73 ? 150.661 8.036   12.032  1.00 0.00 ? 73  GLU B OE2  4  
ATOM   11242 H  H    . GLU B 1 73 ? 148.924 3.881   10.219  1.00 0.00 ? 73  GLU B H    4  
ATOM   11243 H  HA   . GLU B 1 73 ? 148.328 5.832   8.225   1.00 0.00 ? 73  GLU B HA   4  
ATOM   11244 H  HB2  . GLU B 1 73 ? 150.977 5.068   9.485   1.00 0.00 ? 73  GLU B HB2  4  
ATOM   11245 H  HB3  . GLU B 1 73 ? 150.709 6.496   8.488   1.00 0.00 ? 73  GLU B HB3  4  
ATOM   11246 H  HG2  . GLU B 1 73 ? 148.965 7.255   10.107  1.00 0.0