data_2LVN
# 
_entry.id   2LVN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2LVN         
RCSB  RCSB102888   
BMRB  18581        
WWPDB D_1000102888 
# 
loop_
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
18581 BMRB unspecified . 
2LVO  PDB  unspecified . 
2LVP  PDB  unspecified . 
2LVQ  PDB  unspecified . 
# 
_pdbx_database_status.deposit_site                    BMRB 
_pdbx_database_status.entry_id                        2LVN 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2012-07-09 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Liu, S.'        1 
'Chen, Y.'       2 
'Huang, T.'      3 
'Tarasov, S.G.'  4 
'King, A.'       5 
'Li, J.'         6 
'Weissman, A.M.' 7 
'Byrd, R.A.'     8 
'Das, R.'        9 
# 
_citation.id                        primary 
_citation.title                     'Promiscuous Interactions of gp78 E3 Ligase CUE Domain with Polyubiquitin Chains.' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            20 
_citation.page_first                2138 
_citation.page_last                 2150 
_citation.year                      2012 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   23123110 
_citation.pdbx_database_id_DOI      10.1016/j.str.2012.09.020 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Liu, S.'        1 
primary 'Chen, Y.'       2 
primary 'Li, J.'         3 
primary 'Huang, T.'      4 
primary 'Tarasov, S.'    5 
primary 'King, A.'       6 
primary 'Weissman, A.M.' 7 
primary 'Byrd, R.A.'     8 
primary 'Das, R.'        9 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'E3 ubiquitin-protein ligase AMFR' 
_entity.formula_weight             5966.752 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    6.3.2.- 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CUE domain residues 453-504' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Autocrine motility factor receptor, isoform 2, AMF receptor, isoform 2, RING finger protein 45, gp78' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT 
_entity_poly.pdbx_seq_one_letter_code_can   SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT 
_entity_poly.pdbx_strand_id                 C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  SER n 
1 2  ASN n 
1 3  SER n 
1 4  GLN n 
1 5  LEU n 
1 6  ASN n 
1 7  ALA n 
1 8  MET n 
1 9  ALA n 
1 10 HIS n 
1 11 GLN n 
1 12 ILE n 
1 13 GLN n 
1 14 GLU n 
1 15 MET n 
1 16 PHE n 
1 17 PRO n 
1 18 GLN n 
1 19 VAL n 
1 20 PRO n 
1 21 TYR n 
1 22 HIS n 
1 23 LEU n 
1 24 VAL n 
1 25 LEU n 
1 26 GLN n 
1 27 ASP n 
1 28 LEU n 
1 29 GLN n 
1 30 LEU n 
1 31 THR n 
1 32 ARG n 
1 33 SER n 
1 34 VAL n 
1 35 GLU n 
1 36 ILE n 
1 37 THR n 
1 38 THR n 
1 39 ASP n 
1 40 ASN n 
1 41 ILE n 
1 42 LEU n 
1 43 GLU n 
1 44 GLY n 
1 45 ARG n 
1 46 ILE n 
1 47 GLN n 
1 48 VAL n 
1 49 PRO n 
1 50 PHE n 
1 51 PRO n 
1 52 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AMFR, RNF45' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               pET3a 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AMFR2_HUMAN 
_struct_ref.pdbx_db_accession          Q9UKV5 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   SNSQLNAMAHQIQEMFPQVPYHLVLQDLQLTRSVEITTDNILEGRIQVPFPT 
_struct_ref.pdbx_align_begin           453 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2LVN 
_struct_ref_seq.pdbx_strand_id                C 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 52 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UKV5 
_struct_ref_seq.db_align_beg                  453 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  504 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       453 
_struct_ref_seq.pdbx_auth_seq_align_end       504 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
1 1 1 '2D 1H-15N HSQC'          
1 2 1 '2D 1H-13C HSQC'          
1 3 1 '3D HNCO'                 
1 4 1 '3D CBCA(CO)NH'           
1 5 1 '3D C(CO)NH'              
1 6 1 '3D H(CCO)NH'             
1 7 1 '3D HNCACB'               
1 8 1 '2D 1H-13C HSQC aromatic' 
1 9 1 '3D 1H-15N NOESY'         
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pH                  7.2 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature         298 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.contents         '50 mM TRIS, 50 mM sodium chloride, 90% H2O/10% D2O' 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
600 Bruker INOVA 1 'Bruker INOVA' 
700 Bruker INOVA 2 'Bruker INOVA' 
600 Varian INOVA 3 'Varian INOVA' 
800 Varian INOVA 4 'Varian INOVA' 
# 
_pdbx_nmr_refine.entry_id           2LVN 
_pdbx_nmr_refine.method             'simulated annealing' 
_pdbx_nmr_refine.details            'FINAL STEP IN WATER' 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.entry_id                                      2LVN 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   1.8 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   6 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.entry_id             2LVN 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.authors 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.ordinal 
Goddard                                             'chemical shift assignment' SPARKY     ? 1 
Goddard                                             'peak picking'              SPARKY     ? 2 
'Delaglio, Grzesiek, Vuister, Zhu, Pfeifer and Bax' processing                  NMRPipe    ? 3 
'Schwieters, Kuszewski, Tjandra and Clore'          'structure solution'        X-PLOR_NIH ? 4 
'Schwieters, Kuszewski, Tjandra and Clore'          refinement                  X-PLOR_NIH ? 5 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.crystals_number            ? 
_exptl.details                    '1H, 13C, 15N assignments of gp78 CUE domain' 
_exptl.entry_id                   2LVN 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                  2LVN 
_struct.title                     'Structure of the gp78 CUE domain' 
_struct.pdbx_descriptor           'E3 ubiquitin-protein ligase AMFR (E.C.6.3.2.-)' 
_struct.pdbx_model_details        'lowest energy, model 1' 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2LVN 
_struct_keywords.pdbx_keywords   LIGASE 
_struct_keywords.text            'CUE domain, LIGASE' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASN A 2  ? PHE A 16 ? ASN C 454 PHE C 468 1 ? 15 
HELX_P HELX_P2 2 PRO A 20 ? THR A 31 ? PRO C 472 THR C 483 1 ? 12 
HELX_P HELX_P3 3 SER A 33 ? GLY A 44 ? SER C 485 GLY C 496 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    2LVN 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1  ? -8.068  2.279   2.807   1.00 0.00 ? 453 SER C N    1  
ATOM 2     C CA   . SER A 1 1  ? -8.591  2.846   4.056   1.00 0.00 ? 453 SER C CA   1  
ATOM 3     C C    . SER A 1 1  ? -9.686  1.949   4.649   1.00 0.00 ? 453 SER C C    1  
ATOM 4     O O    . SER A 1 1  ? -10.526 2.408   5.423   1.00 0.00 ? 453 SER C O    1  
ATOM 5     C CB   . SER A 1 1  ? -9.146  4.245   3.785   1.00 0.00 ? 453 SER C CB   1  
ATOM 6     O OG   . SER A 1 1  ? -8.187  5.050   3.108   1.00 0.00 ? 453 SER C OG   1  
ATOM 7     H H1   . SER A 1 1  ? -8.842  2.151   2.125   1.00 0.00 ? 453 SER C H1   1  
ATOM 8     H H2   . SER A 1 1  ? -7.612  1.363   2.981   1.00 0.00 ? 453 SER C H2   1  
ATOM 9     H H3   . SER A 1 1  ? -7.371  2.930   2.395   1.00 0.00 ? 453 SER C H3   1  
ATOM 10    H HA   . SER A 1 1  ? -7.777  2.918   4.761   1.00 0.00 ? 453 SER C HA   1  
ATOM 11    H HB2  . SER A 1 1  ? -10.031 4.170   3.173   1.00 0.00 ? 453 SER C HB2  1  
ATOM 12    H HB3  . SER A 1 1  ? -9.395  4.718   4.723   1.00 0.00 ? 453 SER C HB3  1  
ATOM 13    H HG   . SER A 1 1  ? -8.087  5.886   3.584   1.00 0.00 ? 453 SER C HG   1  
ATOM 14    N N    . ASN A 1 2  ? -9.658  0.664   4.310   1.00 0.00 ? 454 ASN C N    1  
ATOM 15    C CA   . ASN A 1 2  ? -10.669 -0.280  4.787   1.00 0.00 ? 454 ASN C CA   1  
ATOM 16    C C    . ASN A 1 2  ? -10.066 -1.263  5.775   1.00 0.00 ? 454 ASN C C    1  
ATOM 17    O O    . ASN A 1 2  ? -10.537 -2.392  5.903   1.00 0.00 ? 454 ASN C O    1  
ATOM 18    C CB   . ASN A 1 2  ? -11.288 -1.048  3.612   1.00 0.00 ? 454 ASN C CB   1  
ATOM 19    C CG   . ASN A 1 2  ? -12.035 -0.152  2.643   1.00 0.00 ? 454 ASN C CG   1  
ATOM 20    O OD1  . ASN A 1 2  ? -12.596 0.872   3.028   1.00 0.00 ? 454 ASN C OD1  1  
ATOM 21    N ND2  . ASN A 1 2  ? -12.047 -0.533  1.381   1.00 0.00 ? 454 ASN C ND2  1  
ATOM 22    H H    . ASN A 1 2  ? -8.938  0.330   3.731   1.00 0.00 ? 454 ASN C H    1  
ATOM 23    H HA   . ASN A 1 2  ? -11.446 0.285   5.283   1.00 0.00 ? 454 ASN C HA   1  
ATOM 24    H HB2  . ASN A 1 2  ? -10.504 -1.552  3.069   1.00 0.00 ? 454 ASN C HB2  1  
ATOM 25    H HB3  . ASN A 1 2  ? -11.978 -1.783  3.997   1.00 0.00 ? 454 ASN C HB3  1  
ATOM 26    H HD21 . ASN A 1 2  ? -11.582 -1.363  1.142   1.00 0.00 ? 454 ASN C HD21 1  
ATOM 27    H HD22 . ASN A 1 2  ? -12.516 0.032   0.728   1.00 0.00 ? 454 ASN C HD22 1  
ATOM 28    N N    . SER A 1 3  ? -9.042  -0.818  6.494   1.00 0.00 ? 455 SER C N    1  
ATOM 29    C CA   . SER A 1 3  ? -8.344  -1.661  7.456   1.00 0.00 ? 455 SER C CA   1  
ATOM 30    C C    . SER A 1 3  ? -9.304  -2.242  8.501   1.00 0.00 ? 455 SER C C    1  
ATOM 31    O O    . SER A 1 3  ? -9.175  -3.399  8.897   1.00 0.00 ? 455 SER C O    1  
ATOM 32    C CB   . SER A 1 3  ? -7.241  -0.863  8.137   1.00 0.00 ? 455 SER C CB   1  
ATOM 33    O OG   . SER A 1 3  ? -6.421  -0.217  7.168   1.00 0.00 ? 455 SER C OG   1  
ATOM 34    H H    . SER A 1 3  ? -8.746  0.109   6.377   1.00 0.00 ? 455 SER C H    1  
ATOM 35    H HA   . SER A 1 3  ? -7.893  -2.474  6.909   1.00 0.00 ? 455 SER C HA   1  
ATOM 36    H HB2  . SER A 1 3  ? -7.683  -0.116  8.778   1.00 0.00 ? 455 SER C HB2  1  
ATOM 37    H HB3  . SER A 1 3  ? -6.626  -1.527  8.726   1.00 0.00 ? 455 SER C HB3  1  
ATOM 38    H HG   . SER A 1 3  ? -5.526  -0.573  7.230   1.00 0.00 ? 455 SER C HG   1  
ATOM 39    N N    . GLN A 1 4  ? -10.276 -1.437  8.926   1.00 0.00 ? 456 GLN C N    1  
ATOM 40    C CA   . GLN A 1 4  ? -11.258 -1.879  9.912   1.00 0.00 ? 456 GLN C CA   1  
ATOM 41    C C    . GLN A 1 4  ? -12.111 -3.011  9.358   1.00 0.00 ? 456 GLN C C    1  
ATOM 42    O O    . GLN A 1 4  ? -12.377 -3.992  10.045  1.00 0.00 ? 456 GLN C O    1  
ATOM 43    C CB   . GLN A 1 4  ? -12.156 -0.718  10.341  1.00 0.00 ? 456 GLN C CB   1  
ATOM 44    C CG   . GLN A 1 4  ? -11.422 0.385   11.082  1.00 0.00 ? 456 GLN C CG   1  
ATOM 45    C CD   . GLN A 1 4  ? -10.779 -0.096  12.370  1.00 0.00 ? 456 GLN C CD   1  
ATOM 46    O OE1  . GLN A 1 4  ? -11.269 -1.024  13.020  1.00 0.00 ? 456 GLN C OE1  1  
ATOM 47    N NE2  . GLN A 1 4  ? -9.684  0.531   12.746  1.00 0.00 ? 456 GLN C NE2  1  
ATOM 48    H H    . GLN A 1 4  ? -10.334 -0.525  8.567   1.00 0.00 ? 456 GLN C H    1  
ATOM 49    H HA   . GLN A 1 4  ? -10.720 -2.239  10.776  1.00 0.00 ? 456 GLN C HA   1  
ATOM 50    H HB2  . GLN A 1 4  ? -12.613 -0.289  9.462   1.00 0.00 ? 456 GLN C HB2  1  
ATOM 51    H HB3  . GLN A 1 4  ? -12.934 -1.102  10.986  1.00 0.00 ? 456 GLN C HB3  1  
ATOM 52    H HG2  . GLN A 1 4  ? -10.650 0.778   10.440  1.00 0.00 ? 456 GLN C HG2  1  
ATOM 53    H HG3  . GLN A 1 4  ? -12.127 1.167   11.319  1.00 0.00 ? 456 GLN C HG3  1  
ATOM 54    H HE21 . GLN A 1 4  ? -9.352  1.262   12.180  1.00 0.00 ? 456 GLN C HE21 1  
ATOM 55    H HE22 . GLN A 1 4  ? -9.242  0.245   13.575  1.00 0.00 ? 456 GLN C HE22 1  
ATOM 56    N N    . LEU A 1 5  ? -12.517 -2.877  8.101   1.00 0.00 ? 457 LEU C N    1  
ATOM 57    C CA   . LEU A 1 5  ? -13.344 -3.887  7.458   1.00 0.00 ? 457 LEU C CA   1  
ATOM 58    C C    . LEU A 1 5  ? -12.557 -5.175  7.276   1.00 0.00 ? 457 LEU C C    1  
ATOM 59    O O    . LEU A 1 5  ? -13.086 -6.272  7.473   1.00 0.00 ? 457 LEU C O    1  
ATOM 60    C CB   . LEU A 1 5  ? -13.864 -3.391  6.104   1.00 0.00 ? 457 LEU C CB   1  
ATOM 61    C CG   . LEU A 1 5  ? -14.622 -2.056  6.117   1.00 0.00 ? 457 LEU C CG   1  
ATOM 62    C CD1  . LEU A 1 5  ? -15.247 -1.789  4.770   1.00 0.00 ? 457 LEU C CD1  1  
ATOM 63    C CD2  . LEU A 1 5  ? -15.682 -2.039  7.199   1.00 0.00 ? 457 LEU C CD2  1  
ATOM 64    H H    . LEU A 1 5  ? -12.246 -2.084  7.594   1.00 0.00 ? 457 LEU C H    1  
ATOM 65    H HA   . LEU A 1 5  ? -14.187 -4.084  8.107   1.00 0.00 ? 457 LEU C HA   1  
ATOM 66    H HB2  . LEU A 1 5  ? -13.018 -3.289  5.439   1.00 0.00 ? 457 LEU C HB2  1  
ATOM 67    H HB3  . LEU A 1 5  ? -14.523 -4.145  5.700   1.00 0.00 ? 457 LEU C HB3  1  
ATOM 68    H HG   . LEU A 1 5  ? -13.921 -1.257  6.319   1.00 0.00 ? 457 LEU C HG   1  
ATOM 69    H HD11 . LEU A 1 5  ? -15.929 -2.592  4.526   1.00 0.00 ? 457 LEU C HD11 1  
ATOM 70    H HD12 . LEU A 1 5  ? -14.477 -1.732  4.016   1.00 0.00 ? 457 LEU C HD12 1  
ATOM 71    H HD13 . LEU A 1 5  ? -15.790 -0.857  4.801   1.00 0.00 ? 457 LEU C HD13 1  
ATOM 72    H HD21 . LEU A 1 5  ? -15.203 -2.103  8.165   1.00 0.00 ? 457 LEU C HD21 1  
ATOM 73    H HD22 . LEU A 1 5  ? -16.347 -2.879  7.063   1.00 0.00 ? 457 LEU C HD22 1  
ATOM 74    H HD23 . LEU A 1 5  ? -16.247 -1.120  7.137   1.00 0.00 ? 457 LEU C HD23 1  
ATOM 75    N N    . ASN A 1 6  ? -11.288 -5.030  6.914   1.00 0.00 ? 458 ASN C N    1  
ATOM 76    C CA   . ASN A 1 6  ? -10.407 -6.175  6.726   1.00 0.00 ? 458 ASN C CA   1  
ATOM 77    C C    . ASN A 1 6  ? -10.212 -6.911  8.038   1.00 0.00 ? 458 ASN C C    1  
ATOM 78    O O    . ASN A 1 6  ? -10.264 -8.143  8.087   1.00 0.00 ? 458 ASN C O    1  
ATOM 79    C CB   . ASN A 1 6  ? -9.043  -5.741  6.171   1.00 0.00 ? 458 ASN C CB   1  
ATOM 80    C CG   . ASN A 1 6  ? -9.116  -5.136  4.774   1.00 0.00 ? 458 ASN C CG   1  
ATOM 81    O OD1  . ASN A 1 6  ? -9.975  -5.492  3.970   1.00 0.00 ? 458 ASN C OD1  1  
ATOM 82    N ND2  . ASN A 1 6  ? -8.204  -4.225  4.475   1.00 0.00 ? 458 ASN C ND2  1  
ATOM 83    H H    . ASN A 1 6  ? -10.936 -4.126  6.765   1.00 0.00 ? 458 ASN C H    1  
ATOM 84    H HA   . ASN A 1 6  ? -10.876 -6.842  6.022   1.00 0.00 ? 458 ASN C HA   1  
ATOM 85    H HB2  . ASN A 1 6  ? -8.611  -5.009  6.836   1.00 0.00 ? 458 ASN C HB2  1  
ATOM 86    H HB3  . ASN A 1 6  ? -8.393  -6.603  6.135   1.00 0.00 ? 458 ASN C HB3  1  
ATOM 87    H HD21 . ASN A 1 6  ? -7.536  -3.990  5.156   1.00 0.00 ? 458 ASN C HD21 1  
ATOM 88    H HD22 . ASN A 1 6  ? -8.237  -3.816  3.583   1.00 0.00 ? 458 ASN C HD22 1  
ATOM 89    N N    . ALA A 1 7  ? -10.005 -6.150  9.102   1.00 0.00 ? 459 ALA C N    1  
ATOM 90    C CA   . ALA A 1 7  ? -9.799  -6.711  10.427  1.00 0.00 ? 459 ALA C CA   1  
ATOM 91    C C    . ALA A 1 7  ? -11.048 -7.416  10.930  1.00 0.00 ? 459 ALA C C    1  
ATOM 92    O O    . ALA A 1 7  ? -10.956 -8.478  11.530  1.00 0.00 ? 459 ALA C O    1  
ATOM 93    C CB   . ALA A 1 7  ? -9.369  -5.626  11.403  1.00 0.00 ? 459 ALA C CB   1  
ATOM 94    H H    . ALA A 1 7  ? -9.980  -5.173  8.991   1.00 0.00 ? 459 ALA C H    1  
ATOM 95    H HA   . ALA A 1 7  ? -9.001  -7.441  10.358  1.00 0.00 ? 459 ALA C HA   1  
ATOM 96    H HB1  . ALA A 1 7  ? -9.156  -6.071  12.364  1.00 0.00 ? 459 ALA C HB1  1  
ATOM 97    H HB2  . ALA A 1 7  ? -10.166 -4.904  11.511  1.00 0.00 ? 459 ALA C HB2  1  
ATOM 98    H HB3  . ALA A 1 7  ? -8.486  -5.133  11.029  1.00 0.00 ? 459 ALA C HB3  1  
ATOM 99    N N    . MET A 1 8  ? -12.216 -6.828  10.681  1.00 0.00 ? 460 MET C N    1  
ATOM 100   C CA   . MET A 1 8  ? -13.475 -7.426  11.117  1.00 0.00 ? 460 MET C CA   1  
ATOM 101   C C    . MET A 1 8  ? -13.687 -8.795  10.489  1.00 0.00 ? 460 MET C C    1  
ATOM 102   O O    . MET A 1 8  ? -14.107 -9.745  11.160  1.00 0.00 ? 460 MET C O    1  
ATOM 103   C CB   . MET A 1 8  ? -14.658 -6.523  10.788  1.00 0.00 ? 460 MET C CB   1  
ATOM 104   C CG   . MET A 1 8  ? -14.731 -5.261  11.631  1.00 0.00 ? 460 MET C CG   1  
ATOM 105   S SD   . MET A 1 8  ? -16.376 -4.523  11.618  1.00 0.00 ? 460 MET C SD   1  
ATOM 106   C CE   . MET A 1 8  ? -16.568 -4.178  9.881   1.00 0.00 ? 460 MET C CE   1  
ATOM 107   H H    . MET A 1 8  ? -12.235 -5.968  10.204  1.00 0.00 ? 460 MET C H    1  
ATOM 108   H HA   . MET A 1 8  ? -13.423 -7.548  12.190  1.00 0.00 ? 460 MET C HA   1  
ATOM 109   H HB2  . MET A 1 8  ? -14.594 -6.237  9.749   1.00 0.00 ? 460 MET C HB2  1  
ATOM 110   H HB3  . MET A 1 8  ? -15.569 -7.082  10.931  1.00 0.00 ? 460 MET C HB3  1  
ATOM 111   H HG2  . MET A 1 8  ? -14.466 -5.500  12.648  1.00 0.00 ? 460 MET C HG2  1  
ATOM 112   H HG3  . MET A 1 8  ? -14.031 -4.540  11.231  1.00 0.00 ? 460 MET C HG3  1  
ATOM 113   H HE1  . MET A 1 8  ? -16.387 -5.081  9.310   1.00 0.00 ? 460 MET C HE1  1  
ATOM 114   H HE2  . MET A 1 8  ? -15.861 -3.422  9.590   1.00 0.00 ? 460 MET C HE2  1  
ATOM 115   H HE3  . MET A 1 8  ? -17.574 -3.832  9.693   1.00 0.00 ? 460 MET C HE3  1  
ATOM 116   N N    . ALA A 1 9  ? -13.379 -8.901  9.204   1.00 0.00 ? 461 ALA C N    1  
ATOM 117   C CA   . ALA A 1 9  ? -13.533 -10.154 8.480   1.00 0.00 ? 461 ALA C CA   1  
ATOM 118   C C    . ALA A 1 9  ? -12.616 -11.235 9.042   1.00 0.00 ? 461 ALA C C    1  
ATOM 119   O O    . ALA A 1 9  ? -12.856 -12.426 8.849   1.00 0.00 ? 461 ALA C O    1  
ATOM 120   C CB   . ALA A 1 9  ? -13.256 -9.946  7.004   1.00 0.00 ? 461 ALA C CB   1  
ATOM 121   H H    . ALA A 1 9  ? -13.043 -8.112  8.724   1.00 0.00 ? 461 ALA C H    1  
ATOM 122   H HA   . ALA A 1 9  ? -14.558 -10.476 8.590   1.00 0.00 ? 461 ALA C HA   1  
ATOM 123   H HB1  . ALA A 1 9  ? -13.912 -9.179  6.621   1.00 0.00 ? 461 ALA C HB1  1  
ATOM 124   H HB2  . ALA A 1 9  ? -13.430 -10.870 6.472   1.00 0.00 ? 461 ALA C HB2  1  
ATOM 125   H HB3  . ALA A 1 9  ? -12.229 -9.640  6.871   1.00 0.00 ? 461 ALA C HB3  1  
ATOM 126   N N    . HIS A 1 10 ? -11.577 -10.813 9.751   1.00 0.00 ? 462 HIS C N    1  
ATOM 127   C CA   . HIS A 1 10 ? -10.623 -11.739 10.335  1.00 0.00 ? 462 HIS C CA   1  
ATOM 128   C C    . HIS A 1 10 ? -11.300 -12.595 11.395  1.00 0.00 ? 462 HIS C C    1  
ATOM 129   O O    . HIS A 1 10 ? -11.087 -13.796 11.454  1.00 0.00 ? 462 HIS C O    1  
ATOM 130   C CB   . HIS A 1 10 ? -9.444  -10.986 10.946  1.00 0.00 ? 462 HIS C CB   1  
ATOM 131   C CG   . HIS A 1 10 ? -8.187  -11.788 11.027  1.00 0.00 ? 462 HIS C CG   1  
ATOM 132   N ND1  . HIS A 1 10 ? -7.949  -12.741 11.995  1.00 0.00 ? 462 HIS C ND1  1  
ATOM 133   C CD2  . HIS A 1 10 ? -7.093  -11.777 10.242  1.00 0.00 ? 462 HIS C CD2  1  
ATOM 134   C CE1  . HIS A 1 10 ? -6.762  -13.277 11.797  1.00 0.00 ? 462 HIS C CE1  1  
ATOM 135   N NE2  . HIS A 1 10 ? -6.223  -12.711 10.736  1.00 0.00 ? 462 HIS C NE2  1  
ATOM 136   H H    . HIS A 1 10 ? -11.453 -9.847  9.885   1.00 0.00 ? 462 HIS C H    1  
ATOM 137   H HA   . HIS A 1 10 ? -10.261 -12.383 9.551   1.00 0.00 ? 462 HIS C HA   1  
ATOM 138   H HB2  . HIS A 1 10 ? -9.236  -10.111 10.348  1.00 0.00 ? 462 HIS C HB2  1  
ATOM 139   H HB3  . HIS A 1 10 ? -9.707  -10.674 11.947  1.00 0.00 ? 462 HIS C HB3  1  
ATOM 140   H HD1  . HIS A 1 10 ? -8.557  -12.977 12.732  1.00 0.00 ? 462 HIS C HD1  1  
ATOM 141   H HD2  . HIS A 1 10 ? -6.936  -11.135 9.386   1.00 0.00 ? 462 HIS C HD2  1  
ATOM 142   H HE1  . HIS A 1 10 ? -6.310  -14.052 12.397  1.00 0.00 ? 462 HIS C HE1  1  
ATOM 143   H HE2  . HIS A 1 10 ? -5.276  -12.775 10.487  1.00 0.00 ? 462 HIS C HE2  1  
ATOM 144   N N    . GLN A 1 11 ? -12.131 -11.964 12.221  1.00 0.00 ? 463 GLN C N    1  
ATOM 145   C CA   . GLN A 1 11 ? -12.856 -12.680 13.274  1.00 0.00 ? 463 GLN C CA   1  
ATOM 146   C C    . GLN A 1 11 ? -13.820 -13.680 12.660  1.00 0.00 ? 463 GLN C C    1  
ATOM 147   O O    . GLN A 1 11 ? -13.964 -14.802 13.144  1.00 0.00 ? 463 GLN C O    1  
ATOM 148   C CB   . GLN A 1 11 ? -13.636 -11.715 14.188  1.00 0.00 ? 463 GLN C CB   1  
ATOM 149   C CG   . GLN A 1 11 ? -12.781 -10.815 15.082  1.00 0.00 ? 463 GLN C CG   1  
ATOM 150   C CD   . GLN A 1 11 ? -12.049 -9.732  14.317  1.00 0.00 ? 463 GLN C CD   1  
ATOM 151   O OE1  . GLN A 1 11 ? -12.587 -8.654  14.084  1.00 0.00 ? 463 GLN C OE1  1  
ATOM 152   N NE2  . GLN A 1 11 ? -10.810 -9.998  13.950  1.00 0.00 ? 463 GLN C NE2  1  
ATOM 153   H H    . GLN A 1 11 ? -12.260 -10.994 12.121  1.00 0.00 ? 463 GLN C H    1  
ATOM 154   H HA   . GLN A 1 11 ? -12.132 -13.224 13.868  1.00 0.00 ? 463 GLN C HA   1  
ATOM 155   H HB2  . GLN A 1 11 ? -14.247 -11.076 13.567  1.00 0.00 ? 463 GLN C HB2  1  
ATOM 156   H HB3  . GLN A 1 11 ? -14.287 -12.298 14.824  1.00 0.00 ? 463 GLN C HB3  1  
ATOM 157   H HG2  . GLN A 1 11 ? -13.421 -10.341 15.812  1.00 0.00 ? 463 GLN C HG2  1  
ATOM 158   H HG3  . GLN A 1 11 ? -12.053 -11.430 15.592  1.00 0.00 ? 463 GLN C HG3  1  
ATOM 159   H HE21 . GLN A 1 11 ? -10.429 -10.871 14.194  1.00 0.00 ? 463 GLN C HE21 1  
ATOM 160   H HE22 . GLN A 1 11 ? -10.324 -9.315  13.441  1.00 0.00 ? 463 GLN C HE22 1  
ATOM 161   N N    . ILE A 1 12 ? -14.475 -13.272 11.582  1.00 0.00 ? 464 ILE C N    1  
ATOM 162   C CA   . ILE A 1 12 ? -15.411 -14.142 10.893  1.00 0.00 ? 464 ILE C CA   1  
ATOM 163   C C    . ILE A 1 12 ? -14.675 -15.319 10.267  1.00 0.00 ? 464 ILE C C    1  
ATOM 164   O O    . ILE A 1 12 ? -15.156 -16.436 10.297  1.00 0.00 ? 464 ILE C O    1  
ATOM 165   C CB   . ILE A 1 12 ? -16.199 -13.392 9.804   1.00 0.00 ? 464 ILE C CB   1  
ATOM 166   C CG1  . ILE A 1 12 ? -16.911 -12.177 10.400  1.00 0.00 ? 464 ILE C CG1  1  
ATOM 167   C CG2  . ILE A 1 12 ? -17.213 -14.329 9.149   1.00 0.00 ? 464 ILE C CG2  1  
ATOM 168   C CD1  . ILE A 1 12 ? -17.571 -11.305 9.359   1.00 0.00 ? 464 ILE C CD1  1  
ATOM 169   H H    . ILE A 1 12 ? -14.327 -12.361 11.247  1.00 0.00 ? 464 ILE C H    1  
ATOM 170   H HA   . ILE A 1 12 ? -16.108 -14.521 11.626  1.00 0.00 ? 464 ILE C HA   1  
ATOM 171   H HB   . ILE A 1 12 ? -15.504 -13.060 9.047   1.00 0.00 ? 464 ILE C HB   1  
ATOM 172   H HG12 . ILE A 1 12 ? -17.680 -12.516 11.078  1.00 0.00 ? 464 ILE C HG12 1  
ATOM 173   H HG13 . ILE A 1 12 ? -16.208 -11.570 10.947  1.00 0.00 ? 464 ILE C HG13 1  
ATOM 174   H HG21 . ILE A 1 12 ? -16.697 -15.163 8.694   1.00 0.00 ? 464 ILE C HG21 1  
ATOM 175   H HG22 . ILE A 1 12 ? -17.765 -13.790 8.395   1.00 0.00 ? 464 ILE C HG22 1  
ATOM 176   H HG23 . ILE A 1 12 ? -17.896 -14.698 9.902   1.00 0.00 ? 464 ILE C HG23 1  
ATOM 177   H HD11 . ILE A 1 12 ? -18.342 -11.868 8.855   1.00 0.00 ? 464 ILE C HD11 1  
ATOM 178   H HD12 . ILE A 1 12 ? -16.832 -10.986 8.641   1.00 0.00 ? 464 ILE C HD12 1  
ATOM 179   H HD13 . ILE A 1 12 ? -18.007 -10.441 9.834   1.00 0.00 ? 464 ILE C HD13 1  
ATOM 180   N N    . GLN A 1 13 ? -13.495 -15.056 9.717   1.00 0.00 ? 465 GLN C N    1  
ATOM 181   C CA   . GLN A 1 13 ? -12.673 -16.111 9.121   1.00 0.00 ? 465 GLN C CA   1  
ATOM 182   C C    . GLN A 1 13 ? -12.227 -17.101 10.193  1.00 0.00 ? 465 GLN C C    1  
ATOM 183   O O    . GLN A 1 13 ? -12.015 -18.282 9.923   1.00 0.00 ? 465 GLN C O    1  
ATOM 184   C CB   . GLN A 1 13 ? -11.452 -15.507 8.421   1.00 0.00 ? 465 GLN C CB   1  
ATOM 185   C CG   . GLN A 1 13 ? -10.565 -16.534 7.719   1.00 0.00 ? 465 GLN C CG   1  
ATOM 186   C CD   . GLN A 1 13 ? -11.291 -17.306 6.626   1.00 0.00 ? 465 GLN C CD   1  
ATOM 187   O OE1  . GLN A 1 13 ? -10.967 -18.457 6.350   1.00 0.00 ? 465 GLN C OE1  1  
ATOM 188   N NE2  . GLN A 1 13 ? -12.268 -16.680 5.994   1.00 0.00 ? 465 GLN C NE2  1  
ATOM 189   H H    . GLN A 1 13 ? -13.168 -14.129 9.703   1.00 0.00 ? 465 GLN C H    1  
ATOM 190   H HA   . GLN A 1 13 ? -13.278 -16.632 8.393   1.00 0.00 ? 465 GLN C HA   1  
ATOM 191   H HB2  . GLN A 1 13 ? -11.790 -14.790 7.686   1.00 0.00 ? 465 GLN C HB2  1  
ATOM 192   H HB3  . GLN A 1 13 ? -10.853 -14.995 9.162   1.00 0.00 ? 465 GLN C HB3  1  
ATOM 193   H HG2  . GLN A 1 13 ? -9.719  -16.028 7.279   1.00 0.00 ? 465 GLN C HG2  1  
ATOM 194   H HG3  . GLN A 1 13 ? -10.211 -17.237 8.456   1.00 0.00 ? 465 GLN C HG3  1  
ATOM 195   H HE21 . GLN A 1 13 ? -12.478 -15.761 6.253   1.00 0.00 ? 465 GLN C HE21 1  
ATOM 196   H HE22 . GLN A 1 13 ? -12.753 -17.172 5.292   1.00 0.00 ? 465 GLN C HE22 1  
ATOM 197   N N    . GLU A 1 14 ? -12.080 -16.607 11.404  1.00 0.00 ? 466 GLU C N    1  
ATOM 198   C CA   . GLU A 1 14 ? -11.704 -17.435 12.522  1.00 0.00 ? 466 GLU C CA   1  
ATOM 199   C C    . GLU A 1 14 ? -12.865 -18.330 12.938  1.00 0.00 ? 466 GLU C C    1  
ATOM 200   O O    . GLU A 1 14 ? -12.689 -19.529 13.175  1.00 0.00 ? 466 GLU C O    1  
ATOM 201   C CB   . GLU A 1 14 ? -11.253 -16.560 13.684  1.00 0.00 ? 466 GLU C CB   1  
ATOM 202   C CG   . GLU A 1 14 ? -9.948  -15.830 13.419  1.00 0.00 ? 466 GLU C CG   1  
ATOM 203   C CD   . GLU A 1 14 ? -8.831  -16.777 13.050  1.00 0.00 ? 466 GLU C CD   1  
ATOM 204   O OE1  . GLU A 1 14 ? -8.260  -17.408 13.961  1.00 0.00 ? 466 GLU C OE1  1  
ATOM 205   O OE2  . GLU A 1 14 ? -8.522  -16.902 11.848  1.00 0.00 ? 466 GLU C OE2  1  
ATOM 206   H H    . GLU A 1 14 ? -12.223 -15.648 11.549  1.00 0.00 ? 466 GLU C H    1  
ATOM 207   H HA   . GLU A 1 14 ? -10.877 -18.057 12.212  1.00 0.00 ? 466 GLU C HA   1  
ATOM 208   H HB2  . GLU A 1 14 ? -12.017 -15.820 13.873  1.00 0.00 ? 466 GLU C HB2  1  
ATOM 209   H HB3  . GLU A 1 14 ? -11.133 -17.166 14.565  1.00 0.00 ? 466 GLU C HB3  1  
ATOM 210   H HG2  . GLU A 1 14 ? -10.096 -15.136 12.604  1.00 0.00 ? 466 GLU C HG2  1  
ATOM 211   H HG3  . GLU A 1 14 ? -9.664  -15.286 14.308  1.00 0.00 ? 466 GLU C HG3  1  
ATOM 212   N N    . MET A 1 15 ? -14.047 -17.745 13.006  1.00 0.00 ? 467 MET C N    1  
ATOM 213   C CA   . MET A 1 15 ? -15.244 -18.479 13.382  1.00 0.00 ? 467 MET C CA   1  
ATOM 214   C C    . MET A 1 15 ? -15.696 -19.399 12.253  1.00 0.00 ? 467 MET C C    1  
ATOM 215   O O    . MET A 1 15 ? -16.096 -20.537 12.487  1.00 0.00 ? 467 MET C O    1  
ATOM 216   C CB   . MET A 1 15 ? -16.374 -17.517 13.750  1.00 0.00 ? 467 MET C CB   1  
ATOM 217   C CG   . MET A 1 15 ? -16.067 -16.620 14.940  1.00 0.00 ? 467 MET C CG   1  
ATOM 218   S SD   . MET A 1 15 ? -17.477 -15.597 15.426  1.00 0.00 ? 467 MET C SD   1  
ATOM 219   C CE   . MET A 1 15 ? -17.758 -14.652 13.927  1.00 0.00 ? 467 MET C CE   1  
ATOM 220   H H    . MET A 1 15 ? -14.120 -16.787 12.804  1.00 0.00 ? 467 MET C H    1  
ATOM 221   H HA   . MET A 1 15 ? -15.005 -19.081 14.245  1.00 0.00 ? 467 MET C HA   1  
ATOM 222   H HB2  . MET A 1 15 ? -16.575 -16.885 12.899  1.00 0.00 ? 467 MET C HB2  1  
ATOM 223   H HB3  . MET A 1 15 ? -17.257 -18.090 13.976  1.00 0.00 ? 467 MET C HB3  1  
ATOM 224   H HG2  . MET A 1 15 ? -15.786 -17.242 15.778  1.00 0.00 ? 467 MET C HG2  1  
ATOM 225   H HG3  . MET A 1 15 ? -15.241 -15.973 14.682  1.00 0.00 ? 467 MET C HG3  1  
ATOM 226   H HE1  . MET A 1 15 ? -17.993 -15.323 13.116  1.00 0.00 ? 467 MET C HE1  1  
ATOM 227   H HE2  . MET A 1 15 ? -16.870 -14.089 13.685  1.00 0.00 ? 467 MET C HE2  1  
ATOM 228   H HE3  . MET A 1 15 ? -18.583 -13.971 14.081  1.00 0.00 ? 467 MET C HE3  1  
ATOM 229   N N    . PHE A 1 16 ? -15.626 -18.900 11.034  1.00 0.00 ? 468 PHE C N    1  
ATOM 230   C CA   . PHE A 1 16 ? -16.042 -19.649 9.861   1.00 0.00 ? 468 PHE C CA   1  
ATOM 231   C C    . PHE A 1 16 ? -14.920 -19.713 8.823   1.00 0.00 ? 468 PHE C C    1  
ATOM 232   O O    . PHE A 1 16 ? -14.922 -18.958 7.853   1.00 0.00 ? 468 PHE C O    1  
ATOM 233   C CB   . PHE A 1 16 ? -17.293 -19.009 9.236   1.00 0.00 ? 468 PHE C CB   1  
ATOM 234   C CG   . PHE A 1 16 ? -18.533 -19.138 10.075  1.00 0.00 ? 468 PHE C CG   1  
ATOM 235   C CD1  . PHE A 1 16 ? -18.746 -18.299 11.154  1.00 0.00 ? 468 PHE C CD1  1  
ATOM 236   C CD2  . PHE A 1 16 ? -19.481 -20.101 9.785   1.00 0.00 ? 468 PHE C CD2  1  
ATOM 237   C CE1  . PHE A 1 16 ? -19.880 -18.419 11.927  1.00 0.00 ? 468 PHE C CE1  1  
ATOM 238   C CE2  . PHE A 1 16 ? -20.621 -20.227 10.557  1.00 0.00 ? 468 PHE C CE2  1  
ATOM 239   C CZ   . PHE A 1 16 ? -20.819 -19.384 11.630  1.00 0.00 ? 468 PHE C CZ   1  
ATOM 240   H H    . PHE A 1 16 ? -15.283 -17.986 10.906  1.00 0.00 ? 468 PHE C H    1  
ATOM 241   H HA   . PHE A 1 16 ? -16.287 -20.651 10.177  1.00 0.00 ? 468 PHE C HA   1  
ATOM 242   H HB2  . PHE A 1 16 ? -17.106 -17.956 9.090   1.00 0.00 ? 468 PHE C HB2  1  
ATOM 243   H HB3  . PHE A 1 16 ? -17.483 -19.464 8.278   1.00 0.00 ? 468 PHE C HB3  1  
ATOM 244   H HD1  . PHE A 1 16 ? -18.013 -17.542 11.387  1.00 0.00 ? 468 PHE C HD1  1  
ATOM 245   H HD2  . PHE A 1 16 ? -19.325 -20.759 8.946   1.00 0.00 ? 468 PHE C HD2  1  
ATOM 246   H HE1  . PHE A 1 16 ? -20.029 -17.753 12.765  1.00 0.00 ? 468 PHE C HE1  1  
ATOM 247   H HE2  . PHE A 1 16 ? -21.354 -20.984 10.319  1.00 0.00 ? 468 PHE C HE2  1  
ATOM 248   H HZ   . PHE A 1 16 ? -21.709 -19.479 12.234  1.00 0.00 ? 468 PHE C HZ   1  
ATOM 249   N N    . PRO A 1 17 ? -13.937 -20.613 9.019   1.00 0.00 ? 469 PRO C N    1  
ATOM 250   C CA   . PRO A 1 17 ? -12.811 -20.781 8.086   1.00 0.00 ? 469 PRO C CA   1  
ATOM 251   C C    . PRO A 1 17 ? -13.240 -21.426 6.768   1.00 0.00 ? 469 PRO C C    1  
ATOM 252   O O    . PRO A 1 17 ? -12.437 -21.585 5.845   1.00 0.00 ? 469 PRO C O    1  
ATOM 253   C CB   . PRO A 1 17 ? -11.869 -21.716 8.842   1.00 0.00 ? 469 PRO C CB   1  
ATOM 254   C CG   . PRO A 1 17 ? -12.767 -22.486 9.735   1.00 0.00 ? 469 PRO C CG   1  
ATOM 255   C CD   . PRO A 1 17 ? -13.819 -21.517 10.174  1.00 0.00 ? 469 PRO C CD   1  
ATOM 256   H HA   . PRO A 1 17 ? -12.318 -19.844 7.898   1.00 0.00 ? 469 PRO C HA   1  
ATOM 257   H HB2  . PRO A 1 17 ? -11.354 -22.359 8.142   1.00 0.00 ? 469 PRO C HB2  1  
ATOM 258   H HB3  . PRO A 1 17 ? -11.154 -21.136 9.406   1.00 0.00 ? 469 PRO C HB3  1  
ATOM 259   H HG2  . PRO A 1 17 ? -13.214 -23.302 9.188   1.00 0.00 ? 469 PRO C HG2  1  
ATOM 260   H HG3  . PRO A 1 17 ? -12.218 -22.855 10.586  1.00 0.00 ? 469 PRO C HG3  1  
ATOM 261   H HD2  . PRO A 1 17 ? -14.750 -22.021 10.375  1.00 0.00 ? 469 PRO C HD2  1  
ATOM 262   H HD3  . PRO A 1 17 ? -13.485 -20.972 11.043  1.00 0.00 ? 469 PRO C HD3  1  
ATOM 263   N N    . GLN A 1 18 ? -14.502 -21.808 6.695   1.00 0.00 ? 470 GLN C N    1  
ATOM 264   C CA   . GLN A 1 18 ? -15.050 -22.438 5.506   1.00 0.00 ? 470 GLN C CA   1  
ATOM 265   C C    . GLN A 1 18 ? -15.298 -21.431 4.380   1.00 0.00 ? 470 GLN C C    1  
ATOM 266   O O    . GLN A 1 18 ? -15.347 -21.802 3.213   1.00 0.00 ? 470 GLN C O    1  
ATOM 267   C CB   . GLN A 1 18 ? -16.355 -23.181 5.832   1.00 0.00 ? 470 GLN C CB   1  
ATOM 268   C CG   . GLN A 1 18 ? -17.380 -22.336 6.577   1.00 0.00 ? 470 GLN C CG   1  
ATOM 269   C CD   . GLN A 1 18 ? -18.806 -22.809 6.357   1.00 0.00 ? 470 GLN C CD   1  
ATOM 270   O OE1  . GLN A 1 18 ? -19.145 -23.319 5.289   1.00 0.00 ? 470 GLN C OE1  1  
ATOM 271   N NE2  . GLN A 1 18 ? -19.650 -22.650 7.363   1.00 0.00 ? 470 GLN C NE2  1  
ATOM 272   H H    . GLN A 1 18 ? -15.076 -21.669 7.476   1.00 0.00 ? 470 GLN C H    1  
ATOM 273   H HA   . GLN A 1 18 ? -14.326 -23.162 5.161   1.00 0.00 ? 470 GLN C HA   1  
ATOM 274   H HB2  . GLN A 1 18 ? -16.804 -23.515 4.908   1.00 0.00 ? 470 GLN C HB2  1  
ATOM 275   H HB3  . GLN A 1 18 ? -16.122 -24.043 6.439   1.00 0.00 ? 470 GLN C HB3  1  
ATOM 276   H HG2  . GLN A 1 18 ? -17.163 -22.378 7.633   1.00 0.00 ? 470 GLN C HG2  1  
ATOM 277   H HG3  . GLN A 1 18 ? -17.296 -21.315 6.236   1.00 0.00 ? 470 GLN C HG3  1  
ATOM 278   H HE21 . GLN A 1 18 ? -19.320 -22.245 8.192   1.00 0.00 ? 470 GLN C HE21 1  
ATOM 279   H HE22 . GLN A 1 18 ? -20.579 -22.943 7.241   1.00 0.00 ? 470 GLN C HE22 1  
ATOM 280   N N    . VAL A 1 19 ? -15.444 -20.161 4.727   1.00 0.00 ? 471 VAL C N    1  
ATOM 281   C CA   . VAL A 1 19 ? -15.757 -19.151 3.730   1.00 0.00 ? 471 VAL C CA   1  
ATOM 282   C C    . VAL A 1 19 ? -14.510 -18.374 3.282   1.00 0.00 ? 471 VAL C C    1  
ATOM 283   O O    . VAL A 1 19 ? -13.508 -18.313 4.005   1.00 0.00 ? 471 VAL C O    1  
ATOM 284   C CB   . VAL A 1 19 ? -16.827 -18.162 4.239   1.00 0.00 ? 471 VAL C CB   1  
ATOM 285   C CG1  . VAL A 1 19 ? -18.060 -18.900 4.722   1.00 0.00 ? 471 VAL C CG1  1  
ATOM 286   C CG2  . VAL A 1 19 ? -16.268 -17.268 5.325   1.00 0.00 ? 471 VAL C CG2  1  
ATOM 287   H H    . VAL A 1 19 ? -15.329 -19.890 5.660   1.00 0.00 ? 471 VAL C H    1  
ATOM 288   H HA   . VAL A 1 19 ? -16.162 -19.670 2.874   1.00 0.00 ? 471 VAL C HA   1  
ATOM 289   H HB   . VAL A 1 19 ? -17.119 -17.540 3.408   1.00 0.00 ? 471 VAL C HB   1  
ATOM 290   H HG11 . VAL A 1 19 ? -17.799 -19.519 5.565   1.00 0.00 ? 471 VAL C HG11 1  
ATOM 291   H HG12 . VAL A 1 19 ? -18.446 -19.518 3.925   1.00 0.00 ? 471 VAL C HG12 1  
ATOM 292   H HG13 . VAL A 1 19 ? -18.812 -18.185 5.019   1.00 0.00 ? 471 VAL C HG13 1  
ATOM 293   H HG21 . VAL A 1 19 ? -15.459 -16.687 4.908   1.00 0.00 ? 471 VAL C HG21 1  
ATOM 294   H HG22 . VAL A 1 19 ? -15.900 -17.876 6.139   1.00 0.00 ? 471 VAL C HG22 1  
ATOM 295   H HG23 . VAL A 1 19 ? -17.042 -16.607 5.683   1.00 0.00 ? 471 VAL C HG23 1  
ATOM 296   N N    . PRO A 1 20 ? -14.564 -17.775 2.077   1.00 0.00 ? 472 PRO C N    1  
ATOM 297   C CA   . PRO A 1 20 ? -13.462 -16.992 1.511   1.00 0.00 ? 472 PRO C CA   1  
ATOM 298   C C    . PRO A 1 20 ? -13.339 -15.622 2.164   1.00 0.00 ? 472 PRO C C    1  
ATOM 299   O O    . PRO A 1 20 ? -14.297 -14.848 2.199   1.00 0.00 ? 472 PRO C O    1  
ATOM 300   C CB   . PRO A 1 20 ? -13.846 -16.834 0.031   1.00 0.00 ? 472 PRO C CB   1  
ATOM 301   C CG   . PRO A 1 20 ? -15.008 -17.745 -0.163  1.00 0.00 ? 472 PRO C CG   1  
ATOM 302   C CD   . PRO A 1 20 ? -15.691 -17.820 1.161   1.00 0.00 ? 472 PRO C CD   1  
ATOM 303   H HA   . PRO A 1 20 ? -12.521 -17.513 1.588   1.00 0.00 ? 472 PRO C HA   1  
ATOM 304   H HB2  . PRO A 1 20 ? -14.113 -15.805 -0.166  1.00 0.00 ? 472 PRO C HB2  1  
ATOM 305   H HB3  . PRO A 1 20 ? -13.013 -17.120 -0.593  1.00 0.00 ? 472 PRO C HB3  1  
ATOM 306   H HG2  . PRO A 1 20 ? -15.671 -17.347 -0.912  1.00 0.00 ? 472 PRO C HG2  1  
ATOM 307   H HG3  . PRO A 1 20 ? -14.652 -18.722 -0.454  1.00 0.00 ? 472 PRO C HG3  1  
ATOM 308   H HD2  . PRO A 1 20 ? -16.343 -16.973 1.318   1.00 0.00 ? 472 PRO C HD2  1  
ATOM 309   H HD3  . PRO A 1 20 ? -16.233 -18.745 1.262   1.00 0.00 ? 472 PRO C HD3  1  
ATOM 310   N N    . TYR A 1 21 ? -12.147 -15.332 2.642   1.00 0.00 ? 473 TYR C N    1  
ATOM 311   C CA   . TYR A 1 21 ? -11.842 -14.087 3.352   1.00 0.00 ? 473 TYR C CA   1  
ATOM 312   C C    . TYR A 1 21 ? -12.246 -12.848 2.542   1.00 0.00 ? 473 TYR C C    1  
ATOM 313   O O    . TYR A 1 21 ? -12.869 -11.927 3.066   1.00 0.00 ? 473 TYR C O    1  
ATOM 314   C CB   . TYR A 1 21 ? -10.339 -14.040 3.652   1.00 0.00 ? 473 TYR C CB   1  
ATOM 315   C CG   . TYR A 1 21 ? -9.924  -13.018 4.688   1.00 0.00 ? 473 TYR C CG   1  
ATOM 316   C CD1  . TYR A 1 21 ? -9.669  -11.696 4.343   1.00 0.00 ? 473 TYR C CD1  1  
ATOM 317   C CD2  . TYR A 1 21 ? -9.774  -13.385 6.011   1.00 0.00 ? 473 TYR C CD2  1  
ATOM 318   C CE1  . TYR A 1 21 ? -9.277  -10.775 5.298   1.00 0.00 ? 473 TYR C CE1  1  
ATOM 319   C CE2  . TYR A 1 21 ? -9.384  -12.476 6.968   1.00 0.00 ? 473 TYR C CE2  1  
ATOM 320   C CZ   . TYR A 1 21 ? -9.138  -11.174 6.609   1.00 0.00 ? 473 TYR C CZ   1  
ATOM 321   O OH   . TYR A 1 21 ? -8.747  -10.267 7.568   1.00 0.00 ? 473 TYR C OH   1  
ATOM 322   H H    . TYR A 1 21 ? -11.430 -15.989 2.509   1.00 0.00 ? 473 TYR C H    1  
ATOM 323   H HA   . TYR A 1 21 ? -12.381 -14.091 4.288   1.00 0.00 ? 473 TYR C HA   1  
ATOM 324   H HB2  . TYR A 1 21 ? -10.022 -15.008 4.007   1.00 0.00 ? 473 TYR C HB2  1  
ATOM 325   H HB3  . TYR A 1 21 ? -9.813  -13.816 2.737   1.00 0.00 ? 473 TYR C HB3  1  
ATOM 326   H HD1  . TYR A 1 21 ? -9.781  -11.390 3.313   1.00 0.00 ? 473 TYR C HD1  1  
ATOM 327   H HD2  . TYR A 1 21 ? -9.972  -14.407 6.292   1.00 0.00 ? 473 TYR C HD2  1  
ATOM 328   H HE1  . TYR A 1 21 ? -9.084  -9.750  5.014   1.00 0.00 ? 473 TYR C HE1  1  
ATOM 329   H HE2  . TYR A 1 21 ? -9.274  -12.792 7.992   1.00 0.00 ? 473 TYR C HE2  1  
ATOM 330   H HH   . TYR A 1 21 ? -9.323  -9.488  7.529   1.00 0.00 ? 473 TYR C HH   1  
ATOM 331   N N    . HIS A 1 22 ? -11.906 -12.846 1.264   1.00 0.00 ? 474 HIS C N    1  
ATOM 332   C CA   . HIS A 1 22 ? -12.151 -11.693 0.400   1.00 0.00 ? 474 HIS C CA   1  
ATOM 333   C C    . HIS A 1 22 ? -13.638 -11.489 0.128   1.00 0.00 ? 474 HIS C C    1  
ATOM 334   O O    . HIS A 1 22 ? -14.097 -10.356 0.007   1.00 0.00 ? 474 HIS C O    1  
ATOM 335   C CB   . HIS A 1 22 ? -11.387 -11.846 -0.907  1.00 0.00 ? 474 HIS C CB   1  
ATOM 336   C CG   . HIS A 1 22 ? -11.202 -10.563 -1.660  1.00 0.00 ? 474 HIS C CG   1  
ATOM 337   N ND1  . HIS A 1 22 ? -10.079 -9.775  -1.534  1.00 0.00 ? 474 HIS C ND1  1  
ATOM 338   C CD2  . HIS A 1 22 ? -11.999 -9.933  -2.551  1.00 0.00 ? 474 HIS C CD2  1  
ATOM 339   C CE1  . HIS A 1 22 ? -10.194 -8.719  -2.313  1.00 0.00 ? 474 HIS C CE1  1  
ATOM 340   N NE2  . HIS A 1 22 ? -11.351 -8.790  -2.943  1.00 0.00 ? 474 HIS C NE2  1  
ATOM 341   H H    . HIS A 1 22 ? -11.474 -13.644 0.888   1.00 0.00 ? 474 HIS C H    1  
ATOM 342   H HA   . HIS A 1 22 ? -11.787 -10.812 0.913   1.00 0.00 ? 474 HIS C HA   1  
ATOM 343   H HB2  . HIS A 1 22 ? -10.415 -12.254 -0.688  1.00 0.00 ? 474 HIS C HB2  1  
ATOM 344   H HB3  . HIS A 1 22 ? -11.922 -12.533 -1.545  1.00 0.00 ? 474 HIS C HB3  1  
ATOM 345   H HD1  . HIS A 1 22 ? -9.301  -9.973  -0.963  1.00 0.00 ? 474 HIS C HD1  1  
ATOM 346   H HD2  . HIS A 1 22 ? -12.969 -10.271 -2.890  1.00 0.00 ? 474 HIS C HD2  1  
ATOM 347   H HE1  . HIS A 1 22 ? -9.465  -7.930  -2.419  1.00 0.00 ? 474 HIS C HE1  1  
ATOM 348   H HE2  . HIS A 1 22 ? -11.575 -8.274  -3.749  1.00 0.00 ? 474 HIS C HE2  1  
ATOM 349   N N    . LEU A 1 23 ? -14.394 -12.574 0.032   1.00 0.00 ? 475 LEU C N    1  
ATOM 350   C CA   . LEU A 1 23 ? -15.826 -12.455 -0.189  1.00 0.00 ? 475 LEU C CA   1  
ATOM 351   C C    . LEU A 1 23 ? -16.504 -11.947 1.067   1.00 0.00 ? 475 LEU C C    1  
ATOM 352   O O    . LEU A 1 23 ? -17.571 -11.333 1.011   1.00 0.00 ? 475 LEU C O    1  
ATOM 353   C CB   . LEU A 1 23 ? -16.441 -13.775 -0.647  1.00 0.00 ? 475 LEU C CB   1  
ATOM 354   C CG   . LEU A 1 23 ? -16.017 -14.269 -2.038  1.00 0.00 ? 475 LEU C CG   1  
ATOM 355   C CD1  . LEU A 1 23 ? -16.897 -15.424 -2.482  1.00 0.00 ? 475 LEU C CD1  1  
ATOM 356   C CD2  . LEU A 1 23 ? -16.072 -13.137 -3.056  1.00 0.00 ? 475 LEU C CD2  1  
ATOM 357   H H    . LEU A 1 23 ? -13.989 -13.463 0.115   1.00 0.00 ? 475 LEU C H    1  
ATOM 358   H HA   . LEU A 1 23 ? -15.967 -11.714 -0.965  1.00 0.00 ? 475 LEU C HA   1  
ATOM 359   H HB2  . LEU A 1 23 ? -16.179 -14.534 0.075   1.00 0.00 ? 475 LEU C HB2  1  
ATOM 360   H HB3  . LEU A 1 23 ? -17.512 -13.659 -0.643  1.00 0.00 ? 475 LEU C HB3  1  
ATOM 361   H HG   . LEU A 1 23 ? -14.999 -14.629 -1.986  1.00 0.00 ? 475 LEU C HG   1  
ATOM 362   H HD11 . LEU A 1 23 ? -17.902 -15.065 -2.646  1.00 0.00 ? 475 LEU C HD11 1  
ATOM 363   H HD12 . LEU A 1 23 ? -16.915 -16.181 -1.713  1.00 0.00 ? 475 LEU C HD12 1  
ATOM 364   H HD13 . LEU A 1 23 ? -16.510 -15.846 -3.398  1.00 0.00 ? 475 LEU C HD13 1  
ATOM 365   H HD21 . LEU A 1 23 ? -15.351 -12.377 -2.792  1.00 0.00 ? 475 LEU C HD21 1  
ATOM 366   H HD22 . LEU A 1 23 ? -17.061 -12.706 -3.061  1.00 0.00 ? 475 LEU C HD22 1  
ATOM 367   H HD23 . LEU A 1 23 ? -15.842 -13.524 -4.038  1.00 0.00 ? 475 LEU C HD23 1  
ATOM 368   N N    . VAL A 1 24 ? -15.866 -12.190 2.202   1.00 0.00 ? 476 VAL C N    1  
ATOM 369   C CA   . VAL A 1 24 ? -16.359 -11.682 3.469   1.00 0.00 ? 476 VAL C CA   1  
ATOM 370   C C    . VAL A 1 24 ? -16.103 -10.182 3.525   1.00 0.00 ? 476 VAL C C    1  
ATOM 371   O O    . VAL A 1 24 ? -16.970 -9.407  3.913   1.00 0.00 ? 476 VAL C O    1  
ATOM 372   C CB   . VAL A 1 24 ? -15.675 -12.382 4.673   1.00 0.00 ? 476 VAL C CB   1  
ATOM 373   C CG1  . VAL A 1 24 ? -16.189 -11.826 5.986   1.00 0.00 ? 476 VAL C CG1  1  
ATOM 374   C CG2  . VAL A 1 24 ? -15.905 -13.877 4.616   1.00 0.00 ? 476 VAL C CG2  1  
ATOM 375   H H    . VAL A 1 24 ? -15.038 -12.722 2.178   1.00 0.00 ? 476 VAL C H    1  
ATOM 376   H HA   . VAL A 1 24 ? -17.424 -11.861 3.512   1.00 0.00 ? 476 VAL C HA   1  
ATOM 377   H HB   . VAL A 1 24 ? -14.613 -12.199 4.617   1.00 0.00 ? 476 VAL C HB   1  
ATOM 378   H HG11 . VAL A 1 24 ? -15.976 -10.769 6.037   1.00 0.00 ? 476 VAL C HG11 1  
ATOM 379   H HG12 . VAL A 1 24 ? -15.703 -12.332 6.806   1.00 0.00 ? 476 VAL C HG12 1  
ATOM 380   H HG13 . VAL A 1 24 ? -17.256 -11.981 6.050   1.00 0.00 ? 476 VAL C HG13 1  
ATOM 381   H HG21 . VAL A 1 24 ? -15.488 -14.271 3.702   1.00 0.00 ? 476 VAL C HG21 1  
ATOM 382   H HG22 . VAL A 1 24 ? -16.966 -14.079 4.644   1.00 0.00 ? 476 VAL C HG22 1  
ATOM 383   H HG23 . VAL A 1 24 ? -15.425 -14.347 5.461   1.00 0.00 ? 476 VAL C HG23 1  
ATOM 384   N N    . LEU A 1 25 ? -14.904 -9.789  3.090   1.00 0.00 ? 477 LEU C N    1  
ATOM 385   C CA   . LEU A 1 25 ? -14.509 -8.381  3.001   1.00 0.00 ? 477 LEU C CA   1  
ATOM 386   C C    . LEU A 1 25 ? -15.541 -7.584  2.218   1.00 0.00 ? 477 LEU C C    1  
ATOM 387   O O    . LEU A 1 25 ? -15.842 -6.434  2.548   1.00 0.00 ? 477 LEU C O    1  
ATOM 388   C CB   . LEU A 1 25 ? -13.154 -8.274  2.292   1.00 0.00 ? 477 LEU C CB   1  
ATOM 389   C CG   . LEU A 1 25 ? -11.956 -8.858  3.026   1.00 0.00 ? 477 LEU C CG   1  
ATOM 390   C CD1  . LEU A 1 25 ? -10.691 -8.674  2.205   1.00 0.00 ? 477 LEU C CD1  1  
ATOM 391   C CD2  . LEU A 1 25 ? -11.801 -8.207  4.380   1.00 0.00 ? 477 LEU C CD2  1  
ATOM 392   H H    . LEU A 1 25 ? -14.251 -10.474 2.829   1.00 0.00 ? 477 LEU C H    1  
ATOM 393   H HA   . LEU A 1 25 ? -14.429 -7.967  3.997   1.00 0.00 ? 477 LEU C HA   1  
ATOM 394   H HB2  . LEU A 1 25 ? -13.241 -8.790  1.347   1.00 0.00 ? 477 LEU C HB2  1  
ATOM 395   H HB3  . LEU A 1 25 ? -12.953 -7.241  2.085   1.00 0.00 ? 477 LEU C HB3  1  
ATOM 396   H HG   . LEU A 1 25 ? -12.110 -9.918  3.175   1.00 0.00 ? 477 LEU C HG   1  
ATOM 397   H HD11 . LEU A 1 25 ? -10.497 -7.618  2.081   1.00 0.00 ? 477 LEU C HD11 1  
ATOM 398   H HD12 . LEU A 1 25 ? -10.817 -9.130  1.235   1.00 0.00 ? 477 LEU C HD12 1  
ATOM 399   H HD13 . LEU A 1 25 ? -9.859  -9.135  2.716   1.00 0.00 ? 477 LEU C HD13 1  
ATOM 400   H HD21 . LEU A 1 25 ? -12.676 -8.411  4.982   1.00 0.00 ? 477 LEU C HD21 1  
ATOM 401   H HD22 . LEU A 1 25 ? -11.695 -7.141  4.251   1.00 0.00 ? 477 LEU C HD22 1  
ATOM 402   H HD23 . LEU A 1 25 ? -10.926 -8.603  4.872   1.00 0.00 ? 477 LEU C HD23 1  
ATOM 403   N N    . GLN A 1 26 ? -16.072 -8.204  1.174   1.00 0.00 ? 478 GLN C N    1  
ATOM 404   C CA   . GLN A 1 26 ? -17.073 -7.586  0.343   1.00 0.00 ? 478 GLN C CA   1  
ATOM 405   C C    . GLN A 1 26 ? -18.346 -7.310  1.138   1.00 0.00 ? 478 GLN C C    1  
ATOM 406   O O    . GLN A 1 26 ? -18.899 -6.222  1.067   1.00 0.00 ? 478 GLN C O    1  
ATOM 407   C CB   . GLN A 1 26 ? -17.381 -8.476  -0.854  1.00 0.00 ? 478 GLN C CB   1  
ATOM 408   C CG   . GLN A 1 26 ? -18.313 -7.837  -1.859  1.00 0.00 ? 478 GLN C CG   1  
ATOM 409   C CD   . GLN A 1 26 ? -18.584 -8.720  -3.059  1.00 0.00 ? 478 GLN C CD   1  
ATOM 410   O OE1  . GLN A 1 26 ? -18.783 -8.228  -4.168  1.00 0.00 ? 478 GLN C OE1  1  
ATOM 411   N NE2  . GLN A 1 26 ? -18.618 -10.020 -2.848  1.00 0.00 ? 478 GLN C NE2  1  
ATOM 412   H H    . GLN A 1 26 ? -15.768 -9.107  0.954   1.00 0.00 ? 478 GLN C H    1  
ATOM 413   H HA   . GLN A 1 26 ? -16.676 -6.648  -0.014  1.00 0.00 ? 478 GLN C HA   1  
ATOM 414   H HB2  . GLN A 1 26 ? -16.456 -8.718  -1.357  1.00 0.00 ? 478 GLN C HB2  1  
ATOM 415   H HB3  . GLN A 1 26 ? -17.837 -9.388  -0.500  1.00 0.00 ? 478 GLN C HB3  1  
ATOM 416   H HG2  . GLN A 1 26 ? -19.249 -7.625  -1.365  1.00 0.00 ? 478 GLN C HG2  1  
ATOM 417   H HG3  . GLN A 1 26 ? -17.868 -6.914  -2.197  1.00 0.00 ? 478 GLN C HG3  1  
ATOM 418   H HE21 . GLN A 1 26 ? -18.474 -10.350 -1.934  1.00 0.00 ? 478 GLN C HE21 1  
ATOM 419   H HE22 . GLN A 1 26 ? -18.786 -10.608 -3.617  1.00 0.00 ? 478 GLN C HE22 1  
ATOM 420   N N    . ASP A 1 27 ? -18.793 -8.289  1.915   1.00 0.00 ? 479 ASP C N    1  
ATOM 421   C CA   . ASP A 1 27 ? -20.012 -8.126  2.712   1.00 0.00 ? 479 ASP C CA   1  
ATOM 422   C C    . ASP A 1 27 ? -19.810 -7.063  3.774   1.00 0.00 ? 479 ASP C C    1  
ATOM 423   O O    . ASP A 1 27 ? -20.739 -6.366  4.150   1.00 0.00 ? 479 ASP C O    1  
ATOM 424   C CB   . ASP A 1 27 ? -20.419 -9.435  3.371   1.00 0.00 ? 479 ASP C CB   1  
ATOM 425   C CG   . ASP A 1 27 ? -21.833 -9.385  3.942   1.00 0.00 ? 479 ASP C CG   1  
ATOM 426   O OD1  . ASP A 1 27 ? -22.025 -8.857  5.069   1.00 0.00 ? 479 ASP C OD1  1  
ATOM 427   O OD2  . ASP A 1 27 ? -22.755 -9.874  3.263   1.00 0.00 ? 479 ASP C OD2  1  
ATOM 428   H H    . ASP A 1 27 ? -18.296 -9.133  1.963   1.00 0.00 ? 479 ASP C H    1  
ATOM 429   H HA   . ASP A 1 27 ? -20.802 -7.803  2.045   1.00 0.00 ? 479 ASP C HA   1  
ATOM 430   H HB2  . ASP A 1 27 ? -20.371 -10.225 2.638   1.00 0.00 ? 479 ASP C HB2  1  
ATOM 431   H HB3  . ASP A 1 27 ? -19.731 -9.649  4.174   1.00 0.00 ? 479 ASP C HB3  1  
ATOM 432   N N    . LEU A 1 28 ? -18.582 -6.930  4.250   1.00 0.00 ? 480 LEU C N    1  
ATOM 433   C CA   . LEU A 1 28 ? -18.262 -5.907  5.219   1.00 0.00 ? 480 LEU C CA   1  
ATOM 434   C C    . LEU A 1 28 ? -18.357 -4.515  4.598   1.00 0.00 ? 480 LEU C C    1  
ATOM 435   O O    . LEU A 1 28 ? -18.385 -3.520  5.301   1.00 0.00 ? 480 LEU C O    1  
ATOM 436   C CB   . LEU A 1 28 ? -16.901 -6.145  5.879   1.00 0.00 ? 480 LEU C CB   1  
ATOM 437   C CG   . LEU A 1 28 ? -16.914 -7.011  7.146   1.00 0.00 ? 480 LEU C CG   1  
ATOM 438   C CD1  . LEU A 1 28 ? -18.040 -6.600  8.077   1.00 0.00 ? 480 LEU C CD1  1  
ATOM 439   C CD2  . LEU A 1 28 ? -17.048 -8.459  6.796   1.00 0.00 ? 480 LEU C CD2  1  
ATOM 440   H H    . LEU A 1 28 ? -17.881 -7.545  3.953   1.00 0.00 ? 480 LEU C H    1  
ATOM 441   H HA   . LEU A 1 28 ? -19.025 -5.967  5.981   1.00 0.00 ? 480 LEU C HA   1  
ATOM 442   H HB2  . LEU A 1 28 ? -16.259 -6.624  5.159   1.00 0.00 ? 480 LEU C HB2  1  
ATOM 443   H HB3  . LEU A 1 28 ? -16.464 -5.202  6.122   1.00 0.00 ? 480 LEU C HB3  1  
ATOM 444   H HG   . LEU A 1 28 ? -15.981 -6.876  7.675   1.00 0.00 ? 480 LEU C HG   1  
ATOM 445   H HD11 . LEU A 1 28 ? -18.984 -6.930  7.667   1.00 0.00 ? 480 LEU C HD11 1  
ATOM 446   H HD12 . LEU A 1 28 ? -18.052 -5.525  8.177   1.00 0.00 ? 480 LEU C HD12 1  
ATOM 447   H HD13 . LEU A 1 28 ? -17.892 -7.053  9.046   1.00 0.00 ? 480 LEU C HD13 1  
ATOM 448   H HD21 . LEU A 1 28 ? -17.058 -9.044  7.703   1.00 0.00 ? 480 LEU C HD21 1  
ATOM 449   H HD22 . LEU A 1 28 ? -16.214 -8.753  6.177   1.00 0.00 ? 480 LEU C HD22 1  
ATOM 450   H HD23 . LEU A 1 28 ? -17.975 -8.601  6.258   1.00 0.00 ? 480 LEU C HD23 1  
ATOM 451   N N    . GLN A 1 29 ? -18.384 -4.460  3.275   1.00 0.00 ? 481 GLN C N    1  
ATOM 452   C CA   . GLN A 1 29 ? -18.641 -3.216  2.568   1.00 0.00 ? 481 GLN C CA   1  
ATOM 453   C C    . GLN A 1 29 ? -20.147 -3.009  2.503   1.00 0.00 ? 481 GLN C C    1  
ATOM 454   O O    . GLN A 1 29 ? -20.653 -1.888  2.582   1.00 0.00 ? 481 GLN C O    1  
ATOM 455   C CB   . GLN A 1 29 ? -18.093 -3.285  1.144   1.00 0.00 ? 481 GLN C CB   1  
ATOM 456   C CG   . GLN A 1 29 ? -16.587 -3.229  1.039   1.00 0.00 ? 481 GLN C CG   1  
ATOM 457   C CD   . GLN A 1 29 ? -16.031 -1.844  1.276   1.00 0.00 ? 481 GLN C CD   1  
ATOM 458   O OE1  . GLN A 1 29 ? -16.704 -0.839  1.045   1.00 0.00 ? 481 GLN C OE1  1  
ATOM 459   N NE2  . GLN A 1 29 ? -14.792 -1.778  1.698   1.00 0.00 ? 481 GLN C NE2  1  
ATOM 460   H H    . GLN A 1 29 ? -18.228 -5.279  2.757   1.00 0.00 ? 481 GLN C H    1  
ATOM 461   H HA   . GLN A 1 29 ? -18.169 -2.406  3.104   1.00 0.00 ? 481 GLN C HA   1  
ATOM 462   H HB2  . GLN A 1 29 ? -18.423 -4.209  0.694   1.00 0.00 ? 481 GLN C HB2  1  
ATOM 463   H HB3  . GLN A 1 29 ? -18.502 -2.461  0.582   1.00 0.00 ? 481 GLN C HB3  1  
ATOM 464   H HG2  . GLN A 1 29 ? -16.165 -3.899  1.774   1.00 0.00 ? 481 GLN C HG2  1  
ATOM 465   H HG3  . GLN A 1 29 ? -16.297 -3.554  0.055   1.00 0.00 ? 481 GLN C HG3  1  
ATOM 466   H HE21 . GLN A 1 29 ? -14.304 -2.620  1.831   1.00 0.00 ? 481 GLN C HE21 1  
ATOM 467   H HE22 . GLN A 1 29 ? -14.401 -0.893  1.865   1.00 0.00 ? 481 GLN C HE22 1  
ATOM 468   N N    . LEU A 1 30 ? -20.849 -4.123  2.359   1.00 0.00 ? 482 LEU C N    1  
ATOM 469   C CA   . LEU A 1 30 ? -22.292 -4.154  2.264   1.00 0.00 ? 482 LEU C CA   1  
ATOM 470   C C    . LEU A 1 30 ? -22.952 -3.807  3.591   1.00 0.00 ? 482 LEU C C    1  
ATOM 471   O O    . LEU A 1 30 ? -23.783 -2.904  3.662   1.00 0.00 ? 482 LEU C O    1  
ATOM 472   C CB   . LEU A 1 30 ? -22.750 -5.555  1.832   1.00 0.00 ? 482 LEU C CB   1  
ATOM 473   C CG   . LEU A 1 30 ? -22.797 -5.850  0.328   1.00 0.00 ? 482 LEU C CG   1  
ATOM 474   C CD1  . LEU A 1 30 ? -23.928 -5.094  -0.320  1.00 0.00 ? 482 LEU C CD1  1  
ATOM 475   C CD2  . LEU A 1 30 ? -21.482 -5.517  -0.352  1.00 0.00 ? 482 LEU C CD2  1  
ATOM 476   H H    . LEU A 1 30 ? -20.371 -4.978  2.308   1.00 0.00 ? 482 LEU C H    1  
ATOM 477   H HA   . LEU A 1 30 ? -22.601 -3.446  1.513   1.00 0.00 ? 482 LEU C HA   1  
ATOM 478   H HB2  . LEU A 1 30 ? -22.083 -6.271  2.288   1.00 0.00 ? 482 LEU C HB2  1  
ATOM 479   H HB3  . LEU A 1 30 ? -23.736 -5.715  2.237   1.00 0.00 ? 482 LEU C HB3  1  
ATOM 480   H HG   . LEU A 1 30 ? -22.984 -6.905  0.195   1.00 0.00 ? 482 LEU C HG   1  
ATOM 481   H HD11 . LEU A 1 30 ? -23.761 -4.034  -0.208  1.00 0.00 ? 482 LEU C HD11 1  
ATOM 482   H HD12 . LEU A 1 30 ? -24.856 -5.370  0.158   1.00 0.00 ? 482 LEU C HD12 1  
ATOM 483   H HD13 . LEU A 1 30 ? -23.970 -5.348  -1.368  1.00 0.00 ? 482 LEU C HD13 1  
ATOM 484   H HD21 . LEU A 1 30 ? -20.685 -6.085  0.107   1.00 0.00 ? 482 LEU C HD21 1  
ATOM 485   H HD22 . LEU A 1 30 ? -21.278 -4.462  -0.247  1.00 0.00 ? 482 LEU C HD22 1  
ATOM 486   H HD23 . LEU A 1 30 ? -21.546 -5.770  -1.400  1.00 0.00 ? 482 LEU C HD23 1  
ATOM 487   N N    . THR A 1 31 ? -22.590 -4.526  4.635   1.00 0.00 ? 483 THR C N    1  
ATOM 488   C CA   . THR A 1 31 ? -23.243 -4.363  5.915   1.00 0.00 ? 483 THR C CA   1  
ATOM 489   C C    . THR A 1 31 ? -22.371 -3.650  6.936   1.00 0.00 ? 483 THR C C    1  
ATOM 490   O O    . THR A 1 31 ? -22.883 -2.939  7.799   1.00 0.00 ? 483 THR C O    1  
ATOM 491   C CB   . THR A 1 31 ? -23.665 -5.727  6.476   1.00 0.00 ? 483 THR C CB   1  
ATOM 492   O OG1  . THR A 1 31 ? -22.514 -6.582  6.578   1.00 0.00 ? 483 THR C OG1  1  
ATOM 493   C CG2  . THR A 1 31 ? -24.698 -6.375  5.570   1.00 0.00 ? 483 THR C CG2  1  
ATOM 494   H H    . THR A 1 31 ? -21.865 -5.195  4.549   1.00 0.00 ? 483 THR C H    1  
ATOM 495   H HA   . THR A 1 31 ? -24.139 -3.782  5.754   1.00 0.00 ? 483 THR C HA   1  
ATOM 496   H HB   . THR A 1 31 ? -24.094 -5.586  7.456   1.00 0.00 ? 483 THR C HB   1  
ATOM 497   H HG1  . THR A 1 31 ? -22.537 -7.266  5.888   1.00 0.00 ? 483 THR C HG1  1  
ATOM 498   H HG21 . THR A 1 31 ? -24.275 -6.518  4.588   1.00 0.00 ? 483 THR C HG21 1  
ATOM 499   H HG22 . THR A 1 31 ? -25.566 -5.736  5.500   1.00 0.00 ? 483 THR C HG22 1  
ATOM 500   H HG23 . THR A 1 31 ? -24.986 -7.331  5.981   1.00 0.00 ? 483 THR C HG23 1  
ATOM 501   N N    . ARG A 1 32 ? -21.046 -3.842  6.835   1.00 0.00 ? 484 ARG C N    1  
ATOM 502   C CA   . ARG A 1 32 ? -20.099 -3.286  7.797   1.00 0.00 ? 484 ARG C CA   1  
ATOM 503   C C    . ARG A 1 32 ? -20.371 -3.827  9.203   1.00 0.00 ? 484 ARG C C    1  
ATOM 504   O O    . ARG A 1 32 ? -19.982 -3.222  10.203  1.00 0.00 ? 484 ARG C O    1  
ATOM 505   C CB   . ARG A 1 32 ? -20.147 -1.760  7.793   1.00 0.00 ? 484 ARG C CB   1  
ATOM 506   C CG   . ARG A 1 32 ? -19.769 -1.129  6.469   1.00 0.00 ? 484 ARG C CG   1  
ATOM 507   C CD   . ARG A 1 32 ? -19.749 0.375   6.576   1.00 0.00 ? 484 ARG C CD   1  
ATOM 508   N NE   . ARG A 1 32 ? -19.323 1.018   5.329   1.00 0.00 ? 484 ARG C NE   1  
ATOM 509   C CZ   . ARG A 1 32 ? -19.089 2.331   5.198   1.00 0.00 ? 484 ARG C CZ   1  
ATOM 510   N NH1  . ARG A 1 32 ? -19.215 3.145   6.241   1.00 0.00 ? 484 ARG C NH1  1  
ATOM 511   N NH2  . ARG A 1 32 ? -18.719 2.824   4.025   1.00 0.00 ? 484 ARG C NH2  1  
ATOM 512   H H    . ARG A 1 32 ? -20.694 -4.359  6.087   1.00 0.00 ? 484 ARG C H    1  
ATOM 513   H HA   . ARG A 1 32 ? -19.111 -3.602  7.495   1.00 0.00 ? 484 ARG C HA   1  
ATOM 514   H HB2  . ARG A 1 32 ? -21.146 -1.441  8.044   1.00 0.00 ? 484 ARG C HB2  1  
ATOM 515   H HB3  . ARG A 1 32 ? -19.465 -1.403  8.544   1.00 0.00 ? 484 ARG C HB3  1  
ATOM 516   H HG2  . ARG A 1 32 ? -18.788 -1.476  6.187   1.00 0.00 ? 484 ARG C HG2  1  
ATOM 517   H HG3  . ARG A 1 32 ? -20.489 -1.422  5.720   1.00 0.00 ? 484 ARG C HG3  1  
ATOM 518   H HD2  . ARG A 1 32 ? -20.744 0.709   6.823   1.00 0.00 ? 484 ARG C HD2  1  
ATOM 519   H HD3  . ARG A 1 32 ? -19.067 0.649   7.366   1.00 0.00 ? 484 ARG C HD3  1  
ATOM 520   H HE   . ARG A 1 32 ? -19.209 0.434   4.541   1.00 0.00 ? 484 ARG C HE   1  
ATOM 521   H HH11 . ARG A 1 32 ? -19.486 2.789   7.140   1.00 0.00 ? 484 ARG C HH11 1  
ATOM 522   H HH12 . ARG A 1 32 ? -19.046 4.128   6.138   1.00 0.00 ? 484 ARG C HH12 1  
ATOM 523   H HH21 . ARG A 1 32 ? -18.610 2.220   3.232   1.00 0.00 ? 484 ARG C HH21 1  
ATOM 524   H HH22 . ARG A 1 32 ? -18.549 3.807   3.916   1.00 0.00 ? 484 ARG C HH22 1  
ATOM 525   N N    . SER A 1 33 ? -21.022 -4.979  9.265   1.00 0.00 ? 485 SER C N    1  
ATOM 526   C CA   . SER A 1 33 ? -21.373 -5.597  10.524  1.00 0.00 ? 485 SER C CA   1  
ATOM 527   C C    . SER A 1 33 ? -21.099 -7.083  10.461  1.00 0.00 ? 485 SER C C    1  
ATOM 528   O O    . SER A 1 33 ? -21.794 -7.807  9.754   1.00 0.00 ? 485 SER C O    1  
ATOM 529   C CB   . SER A 1 33 ? -22.854 -5.366  10.823  1.00 0.00 ? 485 SER C CB   1  
ATOM 530   O OG   . SER A 1 33 ? -23.184 -5.777  12.140  1.00 0.00 ? 485 SER C OG   1  
ATOM 531   H H    . SER A 1 33 ? -21.274 -5.434  8.431   1.00 0.00 ? 485 SER C H    1  
ATOM 532   H HA   . SER A 1 33 ? -20.780 -5.152  11.303  1.00 0.00 ? 485 SER C HA   1  
ATOM 533   H HB2  . SER A 1 33 ? -23.098 -4.326  10.701  1.00 0.00 ? 485 SER C HB2  1  
ATOM 534   H HB3  . SER A 1 33 ? -23.440 -5.948  10.127  1.00 0.00 ? 485 SER C HB3  1  
ATOM 535   H HG   . SER A 1 33 ? -22.982 -5.058  12.750  1.00 0.00 ? 485 SER C HG   1  
ATOM 536   N N    . VAL A 1 34 ? -20.098 -7.546  11.208  1.00 0.00 ? 486 VAL C N    1  
ATOM 537   C CA   . VAL A 1 34 ? -19.749 -8.957  11.202  1.00 0.00 ? 486 VAL C CA   1  
ATOM 538   C C    . VAL A 1 34 ? -20.909 -9.810  11.704  1.00 0.00 ? 486 VAL C C    1  
ATOM 539   O O    . VAL A 1 34 ? -21.047 -10.975 11.325  1.00 0.00 ? 486 VAL C O    1  
ATOM 540   C CB   . VAL A 1 34 ? -18.473 -9.259  12.031  1.00 0.00 ? 486 VAL C CB   1  
ATOM 541   C CG1  . VAL A 1 34 ? -17.336 -8.361  11.608  1.00 0.00 ? 486 VAL C CG1  1  
ATOM 542   C CG2  . VAL A 1 34 ? -18.719 -9.146  13.524  1.00 0.00 ? 486 VAL C CG2  1  
ATOM 543   H H    . VAL A 1 34 ? -19.583 -6.929  11.771  1.00 0.00 ? 486 VAL C H    1  
ATOM 544   H HA   . VAL A 1 34 ? -19.556 -9.228  10.175  1.00 0.00 ? 486 VAL C HA   1  
ATOM 545   H HB   . VAL A 1 34 ? -18.182 -10.273 11.816  1.00 0.00 ? 486 VAL C HB   1  
ATOM 546   H HG11 . VAL A 1 34 ? -17.617 -7.329  11.755  1.00 0.00 ? 486 VAL C HG11 1  
ATOM 547   H HG12 . VAL A 1 34 ? -17.115 -8.530  10.564  1.00 0.00 ? 486 VAL C HG12 1  
ATOM 548   H HG13 . VAL A 1 34 ? -16.463 -8.585  12.203  1.00 0.00 ? 486 VAL C HG13 1  
ATOM 549   H HG21 . VAL A 1 34 ? -19.528 -9.804  13.803  1.00 0.00 ? 486 VAL C HG21 1  
ATOM 550   H HG22 . VAL A 1 34 ? -18.972 -8.127  13.775  1.00 0.00 ? 486 VAL C HG22 1  
ATOM 551   H HG23 . VAL A 1 34 ? -17.821 -9.441  14.045  1.00 0.00 ? 486 VAL C HG23 1  
ATOM 552   N N    . GLU A 1 35 ? -21.752 -9.217  12.541  1.00 0.00 ? 487 GLU C N    1  
ATOM 553   C CA   . GLU A 1 35 ? -22.917 -9.903  13.065  1.00 0.00 ? 487 GLU C CA   1  
ATOM 554   C C    . GLU A 1 35 ? -23.889 -10.210 11.940  1.00 0.00 ? 487 GLU C C    1  
ATOM 555   O O    . GLU A 1 35 ? -24.517 -11.271 11.917  1.00 0.00 ? 487 GLU C O    1  
ATOM 556   C CB   . GLU A 1 35 ? -23.603 -9.060  14.133  1.00 0.00 ? 487 GLU C CB   1  
ATOM 557   C CG   . GLU A 1 35 ? -22.720 -8.748  15.326  1.00 0.00 ? 487 GLU C CG   1  
ATOM 558   C CD   . GLU A 1 35 ? -22.158 -9.992  15.970  1.00 0.00 ? 487 GLU C CD   1  
ATOM 559   O OE1  . GLU A 1 35 ? -22.949 -10.829 16.452  1.00 0.00 ? 487 GLU C OE1  1  
ATOM 560   O OE2  . GLU A 1 35 ? -20.926 -10.139 16.004  1.00 0.00 ? 487 GLU C OE2  1  
ATOM 561   H H    . GLU A 1 35 ? -21.577 -8.290  12.814  1.00 0.00 ? 487 GLU C H    1  
ATOM 562   H HA   . GLU A 1 35 ? -22.588 -10.832 13.505  1.00 0.00 ? 487 GLU C HA   1  
ATOM 563   H HB2  . GLU A 1 35 ? -23.914 -8.126  13.690  1.00 0.00 ? 487 GLU C HB2  1  
ATOM 564   H HB3  . GLU A 1 35 ? -24.475 -9.589  14.487  1.00 0.00 ? 487 GLU C HB3  1  
ATOM 565   H HG2  . GLU A 1 35 ? -21.896 -8.130  14.999  1.00 0.00 ? 487 GLU C HG2  1  
ATOM 566   H HG3  . GLU A 1 35 ? -23.302 -8.211  16.061  1.00 0.00 ? 487 GLU C HG3  1  
ATOM 567   N N    . ILE A 1 36 ? -24.003 -9.286  10.999  1.00 0.00 ? 488 ILE C N    1  
ATOM 568   C CA   . ILE A 1 36 ? -24.865 -9.485  9.857   1.00 0.00 ? 488 ILE C CA   1  
ATOM 569   C C    . ILE A 1 36 ? -24.167 -10.369 8.846   1.00 0.00 ? 488 ILE C C    1  
ATOM 570   O O    . ILE A 1 36 ? -24.720 -11.341 8.409   1.00 0.00 ? 488 ILE C O    1  
ATOM 571   C CB   . ILE A 1 36 ? -25.265 -8.157  9.179   1.00 0.00 ? 488 ILE C CB   1  
ATOM 572   C CG1  . ILE A 1 36 ? -25.849 -7.183  10.210  1.00 0.00 ? 488 ILE C CG1  1  
ATOM 573   C CG2  . ILE A 1 36 ? -26.281 -8.423  8.071   1.00 0.00 ? 488 ILE C CG2  1  
ATOM 574   C CD1  . ILE A 1 36 ? -26.265 -5.846  9.629   1.00 0.00 ? 488 ILE C CD1  1  
ATOM 575   H H    . ILE A 1 36 ? -23.483 -8.456  11.075  1.00 0.00 ? 488 ILE C H    1  
ATOM 576   H HA   . ILE A 1 36 ? -25.761 -9.986  10.198  1.00 0.00 ? 488 ILE C HA   1  
ATOM 577   H HB   . ILE A 1 36 ? -24.380 -7.729  8.735   1.00 0.00 ? 488 ILE C HB   1  
ATOM 578   H HG12 . ILE A 1 36 ? -26.723 -7.630  10.661  1.00 0.00 ? 488 ILE C HG12 1  
ATOM 579   H HG13 . ILE A 1 36 ? -25.112 -6.999  10.978  1.00 0.00 ? 488 ILE C HG13 1  
ATOM 580   H HG21 . ILE A 1 36 ? -27.162 -8.885  8.493   1.00 0.00 ? 488 ILE C HG21 1  
ATOM 581   H HG22 . ILE A 1 36 ? -25.847 -9.080  7.333   1.00 0.00 ? 488 ILE C HG22 1  
ATOM 582   H HG23 . ILE A 1 36 ? -26.556 -7.488  7.603   1.00 0.00 ? 488 ILE C HG23 1  
ATOM 583   H HD11 . ILE A 1 36 ? -26.668 -5.221  10.412  1.00 0.00 ? 488 ILE C HD11 1  
ATOM 584   H HD12 . ILE A 1 36 ? -27.018 -6.003  8.870   1.00 0.00 ? 488 ILE C HD12 1  
ATOM 585   H HD13 . ILE A 1 36 ? -25.407 -5.360  9.188   1.00 0.00 ? 488 ILE C HD13 1  
ATOM 586   N N    . THR A 1 37 ? -22.934 -10.006 8.501   1.00 0.00 ? 489 THR C N    1  
ATOM 587   C CA   . THR A 1 37 ? -22.092 -10.760 7.579   1.00 0.00 ? 489 THR C CA   1  
ATOM 588   C C    . THR A 1 37 ? -22.099 -12.271 7.884   1.00 0.00 ? 489 THR C C    1  
ATOM 589   O O    . THR A 1 37 ? -22.199 -13.086 6.973   1.00 0.00 ? 489 THR C O    1  
ATOM 590   C CB   . THR A 1 37 ? -20.648 -10.225 7.640   1.00 0.00 ? 489 THR C CB   1  
ATOM 591   O OG1  . THR A 1 37 ? -20.656 -8.816  7.407   1.00 0.00 ? 489 THR C OG1  1  
ATOM 592   C CG2  . THR A 1 37 ? -19.761 -10.889 6.604   1.00 0.00 ? 489 THR C CG2  1  
ATOM 593   H H    . THR A 1 37 ? -22.572 -9.170  8.852   1.00 0.00 ? 489 THR C H    1  
ATOM 594   H HA   . THR A 1 37 ? -22.464 -10.600 6.580   1.00 0.00 ? 489 THR C HA   1  
ATOM 595   H HB   . THR A 1 37 ? -20.253 -10.424 8.625   1.00 0.00 ? 489 THR C HB   1  
ATOM 596   H HG1  . THR A 1 37 ? -21.116 -8.646  6.566   1.00 0.00 ? 489 THR C HG1  1  
ATOM 597   H HG21 . THR A 1 37 ? -20.236 -10.827 5.637   1.00 0.00 ? 489 THR C HG21 1  
ATOM 598   H HG22 . THR A 1 37 ? -19.597 -11.922 6.868   1.00 0.00 ? 489 THR C HG22 1  
ATOM 599   H HG23 . THR A 1 37 ? -18.816 -10.363 6.569   1.00 0.00 ? 489 THR C HG23 1  
ATOM 600   N N    . THR A 1 38 ? -22.015 -12.633 9.158   1.00 0.00 ? 490 THR C N    1  
ATOM 601   C CA   . THR A 1 38 ? -22.021 -14.034 9.545   1.00 0.00 ? 490 THR C CA   1  
ATOM 602   C C    . THR A 1 38 ? -23.371 -14.683 9.224   1.00 0.00 ? 490 THR C C    1  
ATOM 603   O O    . THR A 1 38 ? -23.432 -15.781 8.666   1.00 0.00 ? 490 THR C O    1  
ATOM 604   C CB   . THR A 1 38 ? -21.702 -14.200 11.043  1.00 0.00 ? 490 THR C CB   1  
ATOM 605   O OG1  . THR A 1 38 ? -20.449 -13.565 11.340  1.00 0.00 ? 490 THR C OG1  1  
ATOM 606   C CG2  . THR A 1 38 ? -21.620 -15.668 11.407  1.00 0.00 ? 490 THR C CG2  1  
ATOM 607   H H    . THR A 1 38 ? -21.950 -11.948 9.854   1.00 0.00 ? 490 THR C H    1  
ATOM 608   H HA   . THR A 1 38 ? -21.254 -14.538 8.973   1.00 0.00 ? 490 THR C HA   1  
ATOM 609   H HB   . THR A 1 38 ? -22.486 -13.734 11.623  1.00 0.00 ? 490 THR C HB   1  
ATOM 610   H HG1  . THR A 1 38 ? -20.591 -12.615 11.448  1.00 0.00 ? 490 THR C HG1  1  
ATOM 611   H HG21 . THR A 1 38 ? -20.860 -16.141 10.800  1.00 0.00 ? 490 THR C HG21 1  
ATOM 612   H HG22 . THR A 1 38 ? -22.574 -16.139 11.219  1.00 0.00 ? 490 THR C HG22 1  
ATOM 613   H HG23 . THR A 1 38 ? -21.363 -15.769 12.450  1.00 0.00 ? 490 THR C HG23 1  
ATOM 614   N N    . ASP A 1 39 ? -24.447 -13.983 9.553   1.00 0.00 ? 491 ASP C N    1  
ATOM 615   C CA   . ASP A 1 39 ? -25.797 -14.474 9.273   1.00 0.00 ? 491 ASP C CA   1  
ATOM 616   C C    . ASP A 1 39 ? -26.031 -14.424 7.771   1.00 0.00 ? 491 ASP C C    1  
ATOM 617   O O    . ASP A 1 39 ? -26.729 -15.261 7.201   1.00 0.00 ? 491 ASP C O    1  
ATOM 618   C CB   . ASP A 1 39 ? -26.832 -13.615 10.006  1.00 0.00 ? 491 ASP C CB   1  
ATOM 619   C CG   . ASP A 1 39 ? -28.213 -14.243 10.052  1.00 0.00 ? 491 ASP C CG   1  
ATOM 620   O OD1  . ASP A 1 39 ? -29.023 -13.993 9.135   1.00 0.00 ? 491 ASP C OD1  1  
ATOM 621   O OD2  . ASP A 1 39 ? -28.502 -14.983 11.026  1.00 0.00 ? 491 ASP C OD2  1  
ATOM 622   H H    . ASP A 1 39 ? -24.331 -13.107 9.980   1.00 0.00 ? 491 ASP C H    1  
ATOM 623   H HA   . ASP A 1 39 ? -25.871 -15.501 9.606   1.00 0.00 ? 491 ASP C HA   1  
ATOM 624   H HB2  . ASP A 1 39 ? -26.499 -13.456 11.019  1.00 0.00 ? 491 ASP C HB2  1  
ATOM 625   H HB3  . ASP A 1 39 ? -26.905 -12.660 9.505   1.00 0.00 ? 491 ASP C HB3  1  
ATOM 626   N N    . ASN A 1 40 ? -25.406 -13.434 7.146   1.00 0.00 ? 492 ASN C N    1  
ATOM 627   C CA   . ASN A 1 40 ? -25.428 -13.248 5.710   1.00 0.00 ? 492 ASN C CA   1  
ATOM 628   C C    . ASN A 1 40 ? -24.869 -14.484 5.026   1.00 0.00 ? 492 ASN C C    1  
ATOM 629   O O    . ASN A 1 40 ? -25.462 -15.009 4.083   1.00 0.00 ? 492 ASN C O    1  
ATOM 630   C CB   . ASN A 1 40 ? -24.611 -11.999 5.322   1.00 0.00 ? 492 ASN C CB   1  
ATOM 631   C CG   . ASN A 1 40 ? -25.477 -10.797 5.022   1.00 0.00 ? 492 ASN C CG   1  
ATOM 632   O OD1  . ASN A 1 40 ? -26.640 -10.930 4.629   1.00 0.00 ? 492 ASN C OD1  1  
ATOM 633   N ND2  . ASN A 1 40 ? -24.915 -9.619  5.166   1.00 0.00 ? 492 ASN C ND2  1  
ATOM 634   H H    . ASN A 1 40 ? -24.912 -12.780 7.692   1.00 0.00 ? 492 ASN C H    1  
ATOM 635   H HA   . ASN A 1 40 ? -26.455 -13.094 5.417   1.00 0.00 ? 492 ASN C HA   1  
ATOM 636   H HB2  . ASN A 1 40 ? -23.978 -11.734 6.158   1.00 0.00 ? 492 ASN C HB2  1  
ATOM 637   H HB3  . ASN A 1 40 ? -23.982 -12.198 4.475   1.00 0.00 ? 492 ASN C HB3  1  
ATOM 638   H HD21 . ASN A 1 40 ? -23.970 -9.586  5.449   1.00 0.00 ? 492 ASN C HD21 1  
ATOM 639   H HD22 . ASN A 1 40 ? -25.445 -8.820  4.984   1.00 0.00 ? 492 ASN C HD22 1  
ATOM 640   N N    . ILE A 1 41 ? -23.723 -14.953 5.525   1.00 0.00 ? 493 ILE C N    1  
ATOM 641   C CA   . ILE A 1 41 ? -23.096 -16.180 5.036   1.00 0.00 ? 493 ILE C CA   1  
ATOM 642   C C    . ILE A 1 41 ? -24.105 -17.317 5.063   1.00 0.00 ? 493 ILE C C    1  
ATOM 643   O O    . ILE A 1 41 ? -24.269 -18.056 4.088   1.00 0.00 ? 493 ILE C O    1  
ATOM 644   C CB   . ILE A 1 41 ? -21.907 -16.596 5.948   1.00 0.00 ? 493 ILE C CB   1  
ATOM 645   C CG1  . ILE A 1 41 ? -20.810 -15.545 5.944   1.00 0.00 ? 493 ILE C CG1  1  
ATOM 646   C CG2  . ILE A 1 41 ? -21.348 -17.943 5.528   1.00 0.00 ? 493 ILE C CG2  1  
ATOM 647   C CD1  . ILE A 1 41 ? -19.718 -15.812 6.959   1.00 0.00 ? 493 ILE C CD1  1  
ATOM 648   H H    . ILE A 1 41 ? -23.274 -14.447 6.241   1.00 0.00 ? 493 ILE C H    1  
ATOM 649   H HA   . ILE A 1 41 ? -22.737 -16.014 4.033   1.00 0.00 ? 493 ILE C HA   1  
ATOM 650   H HB   . ILE A 1 41 ? -22.285 -16.698 6.955   1.00 0.00 ? 493 ILE C HB   1  
ATOM 651   H HG12 . ILE A 1 41 ? -20.357 -15.511 4.966   1.00 0.00 ? 493 ILE C HG12 1  
ATOM 652   H HG13 . ILE A 1 41 ? -21.247 -14.587 6.168   1.00 0.00 ? 493 ILE C HG13 1  
ATOM 653   H HG21 . ILE A 1 41 ? -20.552 -18.223 6.203   1.00 0.00 ? 493 ILE C HG21 1  
ATOM 654   H HG22 . ILE A 1 41 ? -20.960 -17.869 4.524   1.00 0.00 ? 493 ILE C HG22 1  
ATOM 655   H HG23 . ILE A 1 41 ? -22.129 -18.687 5.562   1.00 0.00 ? 493 ILE C HG23 1  
ATOM 656   H HD11 . ILE A 1 41 ? -19.228 -16.746 6.730   1.00 0.00 ? 493 ILE C HD11 1  
ATOM 657   H HD12 . ILE A 1 41 ? -20.153 -15.874 7.944   1.00 0.00 ? 493 ILE C HD12 1  
ATOM 658   H HD13 . ILE A 1 41 ? -18.996 -15.009 6.938   1.00 0.00 ? 493 ILE C HD13 1  
ATOM 659   N N    . LEU A 1 42 ? -24.787 -17.418 6.183   1.00 0.00 ? 494 LEU C N    1  
ATOM 660   C CA   . LEU A 1 42 ? -25.752 -18.464 6.433   1.00 0.00 ? 494 LEU C CA   1  
ATOM 661   C C    . LEU A 1 42 ? -27.001 -18.328 5.546   1.00 0.00 ? 494 LEU C C    1  
ATOM 662   O O    . LEU A 1 42 ? -27.676 -19.320 5.263   1.00 0.00 ? 494 LEU C O    1  
ATOM 663   C CB   . LEU A 1 42 ? -26.104 -18.458 7.921   1.00 0.00 ? 494 LEU C CB   1  
ATOM 664   C CG   . LEU A 1 42 ? -24.913 -18.750 8.851   1.00 0.00 ? 494 LEU C CG   1  
ATOM 665   C CD1  . LEU A 1 42 ? -25.219 -18.358 10.284  1.00 0.00 ? 494 LEU C CD1  1  
ATOM 666   C CD2  . LEU A 1 42 ? -24.520 -20.218 8.774   1.00 0.00 ? 494 LEU C CD2  1  
ATOM 667   H H    . LEU A 1 42 ? -24.626 -16.752 6.887   1.00 0.00 ? 494 LEU C H    1  
ATOM 668   H HA   . LEU A 1 42 ? -25.275 -19.404 6.203   1.00 0.00 ? 494 LEU C HA   1  
ATOM 669   H HB2  . LEU A 1 42 ? -26.501 -17.483 8.168   1.00 0.00 ? 494 LEU C HB2  1  
ATOM 670   H HB3  . LEU A 1 42 ? -26.868 -19.194 8.107   1.00 0.00 ? 494 LEU C HB3  1  
ATOM 671   H HG   . LEU A 1 42 ? -24.067 -18.162 8.526   1.00 0.00 ? 494 LEU C HG   1  
ATOM 672   H HD11 . LEU A 1 42 ? -26.123 -18.845 10.609  1.00 0.00 ? 494 LEU C HD11 1  
ATOM 673   H HD12 . LEU A 1 42 ? -25.333 -17.285 10.348  1.00 0.00 ? 494 LEU C HD12 1  
ATOM 674   H HD13 . LEU A 1 42 ? -24.397 -18.666 10.913  1.00 0.00 ? 494 LEU C HD13 1  
ATOM 675   H HD21 . LEU A 1 42 ? -24.218 -20.459 7.766   1.00 0.00 ? 494 LEU C HD21 1  
ATOM 676   H HD22 . LEU A 1 42 ? -25.363 -20.831 9.053   1.00 0.00 ? 494 LEU C HD22 1  
ATOM 677   H HD23 . LEU A 1 42 ? -23.698 -20.406 9.450   1.00 0.00 ? 494 LEU C HD23 1  
ATOM 678   N N    . GLU A 1 43 ? -27.299 -17.107 5.096   1.00 0.00 ? 495 GLU C N    1  
ATOM 679   C CA   . GLU A 1 43 ? -28.437 -16.881 4.194   1.00 0.00 ? 495 GLU C CA   1  
ATOM 680   C C    . GLU A 1 43 ? -28.072 -17.279 2.771   1.00 0.00 ? 495 GLU C C    1  
ATOM 681   O O    . GLU A 1 43 ? -28.946 -17.473 1.923   1.00 0.00 ? 495 GLU C O    1  
ATOM 682   C CB   . GLU A 1 43 ? -28.868 -15.410 4.186   1.00 0.00 ? 495 GLU C CB   1  
ATOM 683   C CG   . GLU A 1 43 ? -29.360 -14.882 5.511   1.00 0.00 ? 495 GLU C CG   1  
ATOM 684   C CD   . GLU A 1 43 ? -30.019 -13.528 5.375   1.00 0.00 ? 495 GLU C CD   1  
ATOM 685   O OE1  . GLU A 1 43 ? -29.313 -12.539 5.088   1.00 0.00 ? 495 GLU C OE1  1  
ATOM 686   O OE2  . GLU A 1 43 ? -31.247 -13.444 5.558   1.00 0.00 ? 495 GLU C OE2  1  
ATOM 687   H H    . GLU A 1 43 ? -26.751 -16.343 5.383   1.00 0.00 ? 495 GLU C H    1  
ATOM 688   H HA   . GLU A 1 43 ? -29.261 -17.490 4.529   1.00 0.00 ? 495 GLU C HA   1  
ATOM 689   H HB2  . GLU A 1 43 ? -28.025 -14.807 3.882   1.00 0.00 ? 495 GLU C HB2  1  
ATOM 690   H HB3  . GLU A 1 43 ? -29.658 -15.288 3.459   1.00 0.00 ? 495 GLU C HB3  1  
ATOM 691   H HG2  . GLU A 1 43 ? -30.080 -15.578 5.918   1.00 0.00 ? 495 GLU C HG2  1  
ATOM 692   H HG3  . GLU A 1 43 ? -28.522 -14.795 6.187   1.00 0.00 ? 495 GLU C HG3  1  
ATOM 693   N N    . GLY A 1 44 ? -26.780 -17.404 2.523   1.00 0.00 ? 496 GLY C N    1  
ATOM 694   C CA   . GLY A 1 44 ? -26.305 -17.701 1.193   1.00 0.00 ? 496 GLY C CA   1  
ATOM 695   C C    . GLY A 1 44 ? -25.851 -16.444 0.491   1.00 0.00 ? 496 GLY C C    1  
ATOM 696   O O    . GLY A 1 44 ? -25.569 -16.450 -0.709  1.00 0.00 ? 496 GLY C O    1  
ATOM 697   H H    . GLY A 1 44 ? -26.139 -17.304 3.259   1.00 0.00 ? 496 GLY C H    1  
ATOM 698   H HA2  . GLY A 1 44 ? -25.477 -18.392 1.259   1.00 0.00 ? 496 GLY C HA2  1  
ATOM 699   H HA3  . GLY A 1 44 ? -27.100 -18.152 0.624   1.00 0.00 ? 496 GLY C HA3  1  
ATOM 700   N N    . ARG A 1 45 ? -25.786 -15.352 1.253   1.00 0.00 ? 497 ARG C N    1  
ATOM 701   C CA   . ARG A 1 45 ? -25.346 -14.063 0.739   1.00 0.00 ? 497 ARG C CA   1  
ATOM 702   C C    . ARG A 1 45 ? -23.922 -14.192 0.233   1.00 0.00 ? 497 ARG C C    1  
ATOM 703   O O    . ARG A 1 45 ? -23.563 -13.666 -0.818  1.00 0.00 ? 497 ARG C O    1  
ATOM 704   C CB   . ARG A 1 45 ? -25.393 -13.020 1.857   1.00 0.00 ? 497 ARG C CB   1  
ATOM 705   C CG   . ARG A 1 45 ? -25.408 -11.584 1.385   1.00 0.00 ? 497 ARG C CG   1  
ATOM 706   C CD   . ARG A 1 45 ? -26.778 -11.199 0.869   1.00 0.00 ? 497 ARG C CD   1  
ATOM 707   N NE   . ARG A 1 45 ? -27.826 -11.430 1.873   1.00 0.00 ? 497 ARG C NE   1  
ATOM 708   C CZ   . ARG A 1 45 ? -29.135 -11.300 1.642   1.00 0.00 ? 497 ARG C CZ   1  
ATOM 709   N NH1  . ARG A 1 45 ? -29.569 -10.881 0.456   1.00 0.00 ? 497 ARG C NH1  1  
ATOM 710   N NH2  . ARG A 1 45 ? -30.011 -11.576 2.602   1.00 0.00 ? 497 ARG C NH2  1  
ATOM 711   H H    . ARG A 1 45 ? -26.048 -15.420 2.197   1.00 0.00 ? 497 ARG C H    1  
ATOM 712   H HA   . ARG A 1 45 ? -25.998 -13.764 -0.066  1.00 0.00 ? 497 ARG C HA   1  
ATOM 713   H HB2  . ARG A 1 45 ? -26.284 -13.187 2.442   1.00 0.00 ? 497 ARG C HB2  1  
ATOM 714   H HB3  . ARG A 1 45 ? -24.533 -13.156 2.496   1.00 0.00 ? 497 ARG C HB3  1  
ATOM 715   H HG2  . ARG A 1 45 ? -25.148 -10.940 2.211   1.00 0.00 ? 497 ARG C HG2  1  
ATOM 716   H HG3  . ARG A 1 45 ? -24.685 -11.469 0.590   1.00 0.00 ? 497 ARG C HG3  1  
ATOM 717   H HD2  . ARG A 1 45 ? -26.759 -10.152 0.618   1.00 0.00 ? 497 ARG C HD2  1  
ATOM 718   H HD3  . ARG A 1 45 ? -26.999 -11.779 -0.013  1.00 0.00 ? 497 ARG C HD3  1  
ATOM 719   H HE   . ARG A 1 45 ? -27.530 -11.712 2.771   1.00 0.00 ? 497 ARG C HE   1  
ATOM 720   H HH11 . ARG A 1 45 ? -28.922 -10.660 -0.278  1.00 0.00 ? 497 ARG C HH11 1  
ATOM 721   H HH12 . ARG A 1 45 ? -30.554 -10.779 0.288   1.00 0.00 ? 497 ARG C HH12 1  
ATOM 722   H HH21 . ARG A 1 45 ? -29.699 -11.888 3.512   1.00 0.00 ? 497 ARG C HH21 1  
ATOM 723   H HH22 . ARG A 1 45 ? -30.995 -11.479 2.434   1.00 0.00 ? 497 ARG C HH22 1  
ATOM 724   N N    . ILE A 1 46 ? -23.127 -14.917 0.993   1.00 0.00 ? 498 ILE C N    1  
ATOM 725   C CA   . ILE A 1 46 ? -21.749 -15.159 0.655   1.00 0.00 ? 498 ILE C CA   1  
ATOM 726   C C    . ILE A 1 46 ? -21.574 -16.613 0.245   1.00 0.00 ? 498 ILE C C    1  
ATOM 727   O O    . ILE A 1 46 ? -21.606 -17.522 1.088   1.00 0.00 ? 498 ILE C O    1  
ATOM 728   C CB   . ILE A 1 46 ? -20.815 -14.832 1.844   1.00 0.00 ? 498 ILE C CB   1  
ATOM 729   C CG1  . ILE A 1 46 ? -21.008 -13.374 2.272   1.00 0.00 ? 498 ILE C CG1  1  
ATOM 730   C CG2  . ILE A 1 46 ? -19.359 -15.091 1.467   1.00 0.00 ? 498 ILE C CG2  1  
ATOM 731   C CD1  . ILE A 1 46 ? -20.301 -13.009 3.556   1.00 0.00 ? 498 ILE C CD1  1  
ATOM 732   H H    . ILE A 1 46 ? -23.490 -15.316 1.809   1.00 0.00 ? 498 ILE C H    1  
ATOM 733   H HA   . ILE A 1 46 ? -21.489 -14.522 -0.178  1.00 0.00 ? 498 ILE C HA   1  
ATOM 734   H HB   . ILE A 1 46 ? -21.073 -15.479 2.670   1.00 0.00 ? 498 ILE C HB   1  
ATOM 735   H HG12 . ILE A 1 46 ? -20.634 -12.726 1.496   1.00 0.00 ? 498 ILE C HG12 1  
ATOM 736   H HG13 . ILE A 1 46 ? -22.062 -13.189 2.407   1.00 0.00 ? 498 ILE C HG13 1  
ATOM 737   H HG21 . ILE A 1 46 ? -19.091 -14.464 0.630   1.00 0.00 ? 498 ILE C HG21 1  
ATOM 738   H HG22 . ILE A 1 46 ? -19.238 -16.130 1.195   1.00 0.00 ? 498 ILE C HG22 1  
ATOM 739   H HG23 . ILE A 1 46 ? -18.725 -14.860 2.310   1.00 0.00 ? 498 ILE C HG23 1  
ATOM 740   H HD11 . ILE A 1 46 ? -19.245 -13.217 3.460   1.00 0.00 ? 498 ILE C HD11 1  
ATOM 741   H HD12 . ILE A 1 46 ? -20.715 -13.586 4.370   1.00 0.00 ? 498 ILE C HD12 1  
ATOM 742   H HD13 . ILE A 1 46 ? -20.444 -11.959 3.759   1.00 0.00 ? 498 ILE C HD13 1  
ATOM 743   N N    . GLN A 1 47 ? -21.436 -16.830 -1.044  1.00 0.00 ? 499 GLN C N    1  
ATOM 744   C CA   . GLN A 1 47 ? -21.265 -18.163 -1.583  1.00 0.00 ? 499 GLN C CA   1  
ATOM 745   C C    . GLN A 1 47 ? -19.834 -18.631 -1.405  1.00 0.00 ? 499 GLN C C    1  
ATOM 746   O O    . GLN A 1 47 ? -18.903 -17.828 -1.406  1.00 0.00 ? 499 GLN C O    1  
ATOM 747   C CB   . GLN A 1 47 ? -21.652 -18.192 -3.061  1.00 0.00 ? 499 GLN C CB   1  
ATOM 748   C CG   . GLN A 1 47 ? -23.138 -17.980 -3.308  1.00 0.00 ? 499 GLN C CG   1  
ATOM 749   C CD   . GLN A 1 47 ? -23.983 -19.112 -2.755  1.00 0.00 ? 499 GLN C CD   1  
ATOM 750   O OE1  . GLN A 1 47 ? -23.543 -20.259 -2.695  1.00 0.00 ? 499 GLN C OE1  1  
ATOM 751   N NE2  . GLN A 1 47 ? -25.193 -18.803 -2.350  1.00 0.00 ? 499 GLN C NE2  1  
ATOM 752   H H    . GLN A 1 47 ? -21.441 -16.065 -1.659  1.00 0.00 ? 499 GLN C H    1  
ATOM 753   H HA   . GLN A 1 47 ? -21.919 -18.826 -1.039  1.00 0.00 ? 499 GLN C HA   1  
ATOM 754   H HB2  . GLN A 1 47 ? -21.110 -17.415 -3.580  1.00 0.00 ? 499 GLN C HB2  1  
ATOM 755   H HB3  . GLN A 1 47 ? -21.374 -19.150 -3.474  1.00 0.00 ? 499 GLN C HB3  1  
ATOM 756   H HG2  . GLN A 1 47 ? -23.440 -17.062 -2.829  1.00 0.00 ? 499 GLN C HG2  1  
ATOM 757   H HG3  . GLN A 1 47 ? -23.310 -17.905 -4.371  1.00 0.00 ? 499 GLN C HG3  1  
ATOM 758   H HE21 . GLN A 1 47 ? -25.487 -17.871 -2.425  1.00 0.00 ? 499 GLN C HE21 1  
ATOM 759   H HE22 . GLN A 1 47 ? -25.754 -19.520 -1.984  1.00 0.00 ? 499 GLN C HE22 1  
ATOM 760   N N    . VAL A 1 48 ? -19.665 -19.922 -1.239  1.00 0.00 ? 500 VAL C N    1  
ATOM 761   C CA   . VAL A 1 48 ? -18.351 -20.495 -1.056  1.00 0.00 ? 500 VAL C CA   1  
ATOM 762   C C    . VAL A 1 48 ? -17.931 -21.269 -2.298  1.00 0.00 ? 500 VAL C C    1  
ATOM 763   O O    . VAL A 1 48 ? -18.462 -22.344 -2.573  1.00 0.00 ? 500 VAL C O    1  
ATOM 764   C CB   . VAL A 1 48 ? -18.308 -21.443 0.169   1.00 0.00 ? 500 VAL C CB   1  
ATOM 765   C CG1  . VAL A 1 48 ? -16.913 -22.024 0.354   1.00 0.00 ? 500 VAL C CG1  1  
ATOM 766   C CG2  . VAL A 1 48 ? -18.755 -20.711 1.426   1.00 0.00 ? 500 VAL C CG2  1  
ATOM 767   H H    . VAL A 1 48 ? -20.446 -20.515 -1.244  1.00 0.00 ? 500 VAL C H    1  
ATOM 768   H HA   . VAL A 1 48 ? -17.655 -19.689 -0.887  1.00 0.00 ? 500 VAL C HA   1  
ATOM 769   H HB   . VAL A 1 48 ? -18.992 -22.258 -0.011  1.00 0.00 ? 500 VAL C HB   1  
ATOM 770   H HG11 . VAL A 1 48 ? -16.207 -21.223 0.512   1.00 0.00 ? 500 VAL C HG11 1  
ATOM 771   H HG12 . VAL A 1 48 ? -16.635 -22.579 -0.530  1.00 0.00 ? 500 VAL C HG12 1  
ATOM 772   H HG13 . VAL A 1 48 ? -16.907 -22.682 1.210   1.00 0.00 ? 500 VAL C HG13 1  
ATOM 773   H HG21 . VAL A 1 48 ? -18.703 -21.383 2.270   1.00 0.00 ? 500 VAL C HG21 1  
ATOM 774   H HG22 . VAL A 1 48 ? -19.770 -20.369 1.301   1.00 0.00 ? 500 VAL C HG22 1  
ATOM 775   H HG23 . VAL A 1 48 ? -18.108 -19.866 1.600   1.00 0.00 ? 500 VAL C HG23 1  
ATOM 776   N N    . PRO A 1 49 ? -17.006 -20.716 -3.089  1.00 0.00 ? 501 PRO C N    1  
ATOM 777   C CA   . PRO A 1 49 ? -16.481 -21.390 -4.266  1.00 0.00 ? 501 PRO C CA   1  
ATOM 778   C C    . PRO A 1 49 ? -15.600 -22.560 -3.859  1.00 0.00 ? 501 PRO C C    1  
ATOM 779   O O    . PRO A 1 49 ? -14.520 -22.370 -3.296  1.00 0.00 ? 501 PRO C O    1  
ATOM 780   C CB   . PRO A 1 49 ? -15.642 -20.310 -4.977  1.00 0.00 ? 501 PRO C CB   1  
ATOM 781   C CG   . PRO A 1 49 ? -15.989 -19.028 -4.297  1.00 0.00 ? 501 PRO C CG   1  
ATOM 782   C CD   . PRO A 1 49 ? -16.405 -19.397 -2.908  1.00 0.00 ? 501 PRO C CD   1  
ATOM 783   H HA   . PRO A 1 49 ? -17.271 -21.737 -4.915  1.00 0.00 ? 501 PRO C HA   1  
ATOM 784   H HB2  . PRO A 1 49 ? -14.592 -20.542 -4.869  1.00 0.00 ? 501 PRO C HB2  1  
ATOM 785   H HB3  . PRO A 1 49 ? -15.901 -20.283 -6.026  1.00 0.00 ? 501 PRO C HB3  1  
ATOM 786   H HG2  . PRO A 1 49 ? -15.126 -18.381 -4.271  1.00 0.00 ? 501 PRO C HG2  1  
ATOM 787   H HG3  . PRO A 1 49 ? -16.804 -18.545 -4.816  1.00 0.00 ? 501 PRO C HG3  1  
ATOM 788   H HD2  . PRO A 1 49 ? -15.543 -19.455 -2.261  1.00 0.00 ? 501 PRO C HD2  1  
ATOM 789   H HD3  . PRO A 1 49 ? -17.126 -18.690 -2.527  1.00 0.00 ? 501 PRO C HD3  1  
ATOM 790   N N    . PHE A 1 50 ? -16.070 -23.760 -4.120  1.00 0.00 ? 502 PHE C N    1  
ATOM 791   C CA   . PHE A 1 50 ? -15.346 -24.959 -3.754  1.00 0.00 ? 502 PHE C CA   1  
ATOM 792   C C    . PHE A 1 50 ? -14.193 -25.196 -4.718  1.00 0.00 ? 502 PHE C C    1  
ATOM 793   O O    . PHE A 1 50 ? -14.217 -24.696 -5.848  1.00 0.00 ? 502 PHE C O    1  
ATOM 794   C CB   . PHE A 1 50 ? -16.283 -26.167 -3.742  1.00 0.00 ? 502 PHE C CB   1  
ATOM 795   C CG   . PHE A 1 50 ? -17.340 -26.099 -2.678  1.00 0.00 ? 502 PHE C CG   1  
ATOM 796   C CD1  . PHE A 1 50 ? -18.560 -25.512 -2.937  1.00 0.00 ? 502 PHE C CD1  1  
ATOM 797   C CD2  . PHE A 1 50 ? -17.110 -26.628 -1.418  1.00 0.00 ? 502 PHE C CD2  1  
ATOM 798   C CE1  . PHE A 1 50 ? -19.537 -25.448 -1.964  1.00 0.00 ? 502 PHE C CE1  1  
ATOM 799   C CE2  . PHE A 1 50 ? -18.081 -26.568 -0.440  1.00 0.00 ? 502 PHE C CE2  1  
ATOM 800   C CZ   . PHE A 1 50 ? -19.296 -25.977 -0.713  1.00 0.00 ? 502 PHE C CZ   1  
ATOM 801   H H    . PHE A 1 50 ? -16.926 -23.845 -4.588  1.00 0.00 ? 502 PHE C H    1  
ATOM 802   H HA   . PHE A 1 50 ? -14.955 -24.812 -2.761  1.00 0.00 ? 502 PHE C HA   1  
ATOM 803   H HB2  . PHE A 1 50 ? -16.782 -26.238 -4.697  1.00 0.00 ? 502 PHE C HB2  1  
ATOM 804   H HB3  . PHE A 1 50 ? -15.702 -27.063 -3.581  1.00 0.00 ? 502 PHE C HB3  1  
ATOM 805   H HD1  . PHE A 1 50 ? -18.741 -25.097 -3.916  1.00 0.00 ? 502 PHE C HD1  1  
ATOM 806   H HD2  . PHE A 1 50 ? -16.158 -27.091 -1.204  1.00 0.00 ? 502 PHE C HD2  1  
ATOM 807   H HE1  . PHE A 1 50 ? -20.488 -24.985 -2.179  1.00 0.00 ? 502 PHE C HE1  1  
ATOM 808   H HE2  . PHE A 1 50 ? -17.891 -26.983 0.537   1.00 0.00 ? 502 PHE C HE2  1  
ATOM 809   H HZ   . PHE A 1 50 ? -20.058 -25.930 0.050   1.00 0.00 ? 502 PHE C HZ   1  
ATOM 810   N N    . PRO A 1 51 ? -13.155 -25.940 -4.283  1.00 0.00 ? 503 PRO C N    1  
ATOM 811   C CA   . PRO A 1 51 ? -12.008 -26.258 -5.133  1.00 0.00 ? 503 PRO C CA   1  
ATOM 812   C C    . PRO A 1 51 ? -12.453 -26.862 -6.461  1.00 0.00 ? 503 PRO C C    1  
ATOM 813   O O    . PRO A 1 51 ? -13.161 -27.877 -6.493  1.00 0.00 ? 503 PRO C O    1  
ATOM 814   C CB   . PRO A 1 51 ? -11.232 -27.288 -4.310  1.00 0.00 ? 503 PRO C CB   1  
ATOM 815   C CG   . PRO A 1 51 ? -11.591 -26.985 -2.900  1.00 0.00 ? 503 PRO C CG   1  
ATOM 816   C CD   . PRO A 1 51 ? -13.017 -26.518 -2.930  1.00 0.00 ? 503 PRO C CD   1  
ATOM 817   H HA   . PRO A 1 51 ? -11.393 -25.389 -5.317  1.00 0.00 ? 503 PRO C HA   1  
ATOM 818   H HB2  . PRO A 1 51 ? -11.540 -28.284 -4.593  1.00 0.00 ? 503 PRO C HB2  1  
ATOM 819   H HB3  . PRO A 1 51 ? -10.174 -27.167 -4.481  1.00 0.00 ? 503 PRO C HB3  1  
ATOM 820   H HG2  . PRO A 1 51 ? -11.500 -27.877 -2.297  1.00 0.00 ? 503 PRO C HG2  1  
ATOM 821   H HG3  . PRO A 1 51 ? -10.950 -26.205 -2.515  1.00 0.00 ? 503 PRO C HG3  1  
ATOM 822   H HD2  . PRO A 1 51 ? -13.689 -27.350 -2.795  1.00 0.00 ? 503 PRO C HD2  1  
ATOM 823   H HD3  . PRO A 1 51 ? -13.185 -25.766 -2.173  1.00 0.00 ? 503 PRO C HD3  1  
ATOM 824   N N    . THR A 1 52 ? -12.055 -26.237 -7.540  1.00 0.00 ? 504 THR C N    1  
ATOM 825   C CA   . THR A 1 52 ? -12.435 -26.679 -8.852  1.00 0.00 ? 504 THR C CA   1  
ATOM 826   C C    . THR A 1 52 ? -11.285 -26.453 -9.846  1.00 0.00 ? 504 THR C C    1  
ATOM 827   O O    . THR A 1 52 ? -10.754 -27.453 -10.368 1.00 0.00 ? 504 THR C O    1  
ATOM 828   C CB   . THR A 1 52 ? -13.755 -25.981 -9.325  1.00 0.00 ? 504 THR C CB   1  
ATOM 829   O OG1  . THR A 1 52 ? -14.152 -26.470 -10.608 1.00 0.00 ? 504 THR C OG1  1  
ATOM 830   C CG2  . THR A 1 52 ? -13.608 -24.463 -9.379  1.00 0.00 ? 504 THR C CG2  1  
ATOM 831   O OXT  . THR A 1 52 ? -10.875 -25.282 -10.053 1.00 0.00 ? 504 THR C OXT  1  
ATOM 832   H H    . THR A 1 52 ? -11.482 -25.446 -7.456  1.00 0.00 ? 504 THR C H    1  
ATOM 833   H HA   . THR A 1 52 ? -12.619 -27.742 -8.788  1.00 0.00 ? 504 THR C HA   1  
ATOM 834   H HB   . THR A 1 52 ? -14.532 -26.222 -8.609  1.00 0.00 ? 504 THR C HB   1  
ATOM 835   H HG1  . THR A 1 52 ? -14.766 -25.844 -11.004 1.00 0.00 ? 504 THR C HG1  1  
ATOM 836   H HG21 . THR A 1 52 ? -12.814 -24.204 -10.066 1.00 0.00 ? 504 THR C HG21 1  
ATOM 837   H HG22 . THR A 1 52 ? -13.368 -24.088 -8.396  1.00 0.00 ? 504 THR C HG22 1  
ATOM 838   H HG23 . THR A 1 52 ? -14.535 -24.022 -9.717  1.00 0.00 ? 504 THR C HG23 1  
ATOM 839   N N    . SER A 1 1  ? -9.407  -2.333  0.459   1.00 0.00 ? 453 SER C N    2  
ATOM 840   C CA   . SER A 1 1  ? -10.359 -2.373  1.571   1.00 0.00 ? 453 SER C CA   2  
ATOM 841   C C    . SER A 1 1  ? -9.788  -1.670  2.796   1.00 0.00 ? 453 SER C C    2  
ATOM 842   O O    . SER A 1 1  ? -8.592  -1.783  3.088   1.00 0.00 ? 453 SER C O    2  
ATOM 843   C CB   . SER A 1 1  ? -10.718 -3.824  1.902   1.00 0.00 ? 453 SER C CB   2  
ATOM 844   O OG   . SER A 1 1  ? -9.554  -4.637  1.982   1.00 0.00 ? 453 SER C OG   2  
ATOM 845   H H1   . SER A 1 1  ? -8.532  -2.818  0.736   1.00 0.00 ? 453 SER C H1   2  
ATOM 846   H H2   . SER A 1 1  ? -9.180  -1.347  0.223   1.00 0.00 ? 453 SER C H2   2  
ATOM 847   H H3   . SER A 1 1  ? -9.805  -2.803  -0.377  1.00 0.00 ? 453 SER C H3   2  
ATOM 848   H HA   . SER A 1 1  ? -11.251 -1.852  1.262   1.00 0.00 ? 453 SER C HA   2  
ATOM 849   H HB2  . SER A 1 1  ? -11.228 -3.858  2.853   1.00 0.00 ? 453 SER C HB2  2  
ATOM 850   H HB3  . SER A 1 1  ? -11.365 -4.218  1.131   1.00 0.00 ? 453 SER C HB3  2  
ATOM 851   H HG   . SER A 1 1  ? -9.509  -5.193  1.195   1.00 0.00 ? 453 SER C HG   2  
ATOM 852   N N    . ASN A 1 2  ? -10.645 -0.938  3.500   1.00 0.00 ? 454 ASN C N    2  
ATOM 853   C CA   . ASN A 1 2  ? -10.248 -0.199  4.696   1.00 0.00 ? 454 ASN C CA   2  
ATOM 854   C C    . ASN A 1 2  ? -9.708  -1.151  5.766   1.00 0.00 ? 454 ASN C C    2  
ATOM 855   O O    . ASN A 1 2  ? -10.143 -2.303  5.861   1.00 0.00 ? 454 ASN C O    2  
ATOM 856   C CB   . ASN A 1 2  ? -11.443 0.589   5.247   1.00 0.00 ? 454 ASN C CB   2  
ATOM 857   C CG   . ASN A 1 2  ? -11.057 1.538   6.365   1.00 0.00 ? 454 ASN C CG   2  
ATOM 858   O OD1  . ASN A 1 2  ? -10.998 1.151   7.531   1.00 0.00 ? 454 ASN C OD1  2  
ATOM 859   N ND2  . ASN A 1 2  ? -10.807 2.783   6.021   1.00 0.00 ? 454 ASN C ND2  2  
ATOM 860   H H    . ASN A 1 2  ? -11.579 -0.888  3.203   1.00 0.00 ? 454 ASN C H    2  
ATOM 861   H HA   . ASN A 1 2  ? -9.467  0.494   4.417   1.00 0.00 ? 454 ASN C HA   2  
ATOM 862   H HB2  . ASN A 1 2  ? -11.882 1.168   4.448   1.00 0.00 ? 454 ASN C HB2  2  
ATOM 863   H HB3  . ASN A 1 2  ? -12.180 -0.105  5.627   1.00 0.00 ? 454 ASN C HB3  2  
ATOM 864   H HD21 . ASN A 1 2  ? -10.882 3.032   5.073   1.00 0.00 ? 454 ASN C HD21 2  
ATOM 865   H HD22 . ASN A 1 2  ? -10.561 3.421   6.724   1.00 0.00 ? 454 ASN C HD22 2  
ATOM 866   N N    . SER A 1 3  ? -8.774  -0.659  6.571   1.00 0.00 ? 455 SER C N    2  
ATOM 867   C CA   . SER A 1 3  ? -8.136  -1.455  7.616   1.00 0.00 ? 455 SER C CA   2  
ATOM 868   C C    . SER A 1 3  ? -9.158  -2.016  8.616   1.00 0.00 ? 455 SER C C    2  
ATOM 869   O O    . SER A 1 3  ? -8.966  -3.099  9.168   1.00 0.00 ? 455 SER C O    2  
ATOM 870   C CB   . SER A 1 3  ? -7.094  -0.608  8.344   1.00 0.00 ? 455 SER C CB   2  
ATOM 871   O OG   . SER A 1 3  ? -6.226  0.030   7.414   1.00 0.00 ? 455 SER C OG   2  
ATOM 872   H H    . SER A 1 3  ? -8.496  0.275   6.461   1.00 0.00 ? 455 SER C H    2  
ATOM 873   H HA   . SER A 1 3  ? -7.634  -2.281  7.138   1.00 0.00 ? 455 SER C HA   2  
ATOM 874   H HB2  . SER A 1 3  ? -7.593  0.148   8.930   1.00 0.00 ? 455 SER C HB2  2  
ATOM 875   H HB3  . SER A 1 3  ? -6.508  -1.239  8.993   1.00 0.00 ? 455 SER C HB3  2  
ATOM 876   H HG   . SER A 1 3  ? -5.311  -0.115  7.685   1.00 0.00 ? 455 SER C HG   2  
ATOM 877   N N    . GLN A 1 4  ? -10.250 -1.281  8.829   1.00 0.00 ? 456 GLN C N    2  
ATOM 878   C CA   . GLN A 1 4  ? -11.304 -1.720  9.740   1.00 0.00 ? 456 GLN C CA   2  
ATOM 879   C C    . GLN A 1 4  ? -11.943 -3.008  9.246   1.00 0.00 ? 456 GLN C C    2  
ATOM 880   O O    . GLN A 1 4  ? -12.329 -3.864  10.037  1.00 0.00 ? 456 GLN C O    2  
ATOM 881   C CB   . GLN A 1 4  ? -12.377 -0.640  9.892   1.00 0.00 ? 456 GLN C CB   2  
ATOM 882   C CG   . GLN A 1 4  ? -11.900 0.607   10.608  1.00 0.00 ? 456 GLN C CG   2  
ATOM 883   C CD   . GLN A 1 4  ? -11.449 0.324   12.025  1.00 0.00 ? 456 GLN C CD   2  
ATOM 884   O OE1  . GLN A 1 4  ? -10.273 0.045   12.275  1.00 0.00 ? 456 GLN C OE1  2  
ATOM 885   N NE2  . GLN A 1 4  ? -12.376 0.386   12.958  1.00 0.00 ? 456 GLN C NE2  2  
ATOM 886   H H    . GLN A 1 4  ? -10.350 -0.422  8.360   1.00 0.00 ? 456 GLN C H    2  
ATOM 887   H HA   . GLN A 1 4  ? -10.854 -1.900  10.705  1.00 0.00 ? 456 GLN C HA   2  
ATOM 888   H HB2  . GLN A 1 4  ? -12.721 -0.354  8.909   1.00 0.00 ? 456 GLN C HB2  2  
ATOM 889   H HB3  . GLN A 1 4  ? -13.206 -1.053  10.446  1.00 0.00 ? 456 GLN C HB3  2  
ATOM 890   H HG2  . GLN A 1 4  ? -11.072 1.027   10.061  1.00 0.00 ? 456 GLN C HG2  2  
ATOM 891   H HG3  . GLN A 1 4  ? -12.709 1.320   10.639  1.00 0.00 ? 456 GLN C HG3  2  
ATOM 892   H HE21 . GLN A 1 4  ? -13.291 0.612   12.685  1.00 0.00 ? 456 GLN C HE21 2  
ATOM 893   H HE22 . GLN A 1 4  ? -12.120 0.203   13.887  1.00 0.00 ? 456 GLN C HE22 2  
ATOM 894   N N    . LEU A 1 5  ? -12.026 -3.150  7.930   1.00 0.00 ? 457 LEU C N    2  
ATOM 895   C CA   . LEU A 1 5  ? -12.638 -4.322  7.330   1.00 0.00 ? 457 LEU C CA   2  
ATOM 896   C C    . LEU A 1 5  ? -11.793 -5.552  7.577   1.00 0.00 ? 457 LEU C C    2  
ATOM 897   O O    . LEU A 1 5  ? -12.319 -6.643  7.780   1.00 0.00 ? 457 LEU C O    2  
ATOM 898   C CB   . LEU A 1 5  ? -12.844 -4.127  5.831   1.00 0.00 ? 457 LEU C CB   2  
ATOM 899   C CG   . LEU A 1 5  ? -13.628 -2.885  5.416   1.00 0.00 ? 457 LEU C CG   2  
ATOM 900   C CD1  . LEU A 1 5  ? -13.937 -2.936  3.941   1.00 0.00 ? 457 LEU C CD1  2  
ATOM 901   C CD2  . LEU A 1 5  ? -14.905 -2.749  6.228   1.00 0.00 ? 457 LEU C CD2  2  
ATOM 902   H H    . LEU A 1 5  ? -11.656 -2.453  7.348   1.00 0.00 ? 457 LEU C H    2  
ATOM 903   H HA   . LEU A 1 5  ? -13.601 -4.463  7.798   1.00 0.00 ? 457 LEU C HA   2  
ATOM 904   H HB2  . LEU A 1 5  ? -11.871 -4.080  5.365   1.00 0.00 ? 457 LEU C HB2  2  
ATOM 905   H HB3  . LEU A 1 5  ? -13.361 -4.994  5.449   1.00 0.00 ? 457 LEU C HB3  2  
ATOM 906   H HG   . LEU A 1 5  ? -13.019 -2.012  5.595   1.00 0.00 ? 457 LEU C HG   2  
ATOM 907   H HD11 . LEU A 1 5  ? -14.512 -3.824  3.729   1.00 0.00 ? 457 LEU C HD11 2  
ATOM 908   H HD12 . LEU A 1 5  ? -13.017 -2.956  3.377   1.00 0.00 ? 457 LEU C HD12 2  
ATOM 909   H HD13 . LEU A 1 5  ? -14.511 -2.065  3.666   1.00 0.00 ? 457 LEU C HD13 2  
ATOM 910   H HD21 . LEU A 1 5  ? -14.649 -2.630  7.269   1.00 0.00 ? 457 LEU C HD21 2  
ATOM 911   H HD22 . LEU A 1 5  ? -15.508 -3.636  6.102   1.00 0.00 ? 457 LEU C HD22 2  
ATOM 912   H HD23 . LEU A 1 5  ? -15.457 -1.885  5.891   1.00 0.00 ? 457 LEU C HD23 2  
ATOM 913   N N    . ASN A 1 6  ? -10.477 -5.366  7.567   1.00 0.00 ? 458 ASN C N    2  
ATOM 914   C CA   . ASN A 1 6  ? -9.539  -6.460  7.804   1.00 0.00 ? 458 ASN C CA   2  
ATOM 915   C C    . ASN A 1 6  ? -9.795  -7.116  9.144   1.00 0.00 ? 458 ASN C C    2  
ATOM 916   O O    . ASN A 1 6  ? -9.963  -8.326  9.225   1.00 0.00 ? 458 ASN C O    2  
ATOM 917   C CB   . ASN A 1 6  ? -8.085  -5.963  7.720   1.00 0.00 ? 458 ASN C CB   2  
ATOM 918   C CG   . ASN A 1 6  ? -7.096  -6.886  8.431   1.00 0.00 ? 458 ASN C CG   2  
ATOM 919   O OD1  . ASN A 1 6  ? -6.720  -6.644  9.579   1.00 0.00 ? 458 ASN C OD1  2  
ATOM 920   N ND2  . ASN A 1 6  ? -6.692  -7.949  7.772   1.00 0.00 ? 458 ASN C ND2  2  
ATOM 921   H H    . ASN A 1 6  ? -10.128 -4.466  7.401   1.00 0.00 ? 458 ASN C H    2  
ATOM 922   H HA   . ASN A 1 6  ? -9.697  -7.196  7.029   1.00 0.00 ? 458 ASN C HA   2  
ATOM 923   H HB2  . ASN A 1 6  ? -7.797  -5.893  6.682   1.00 0.00 ? 458 ASN C HB2  2  
ATOM 924   H HB3  . ASN A 1 6  ? -8.024  -4.984  8.172   1.00 0.00 ? 458 ASN C HB3  2  
ATOM 925   H HD21 . ASN A 1 6  ? -7.050  -8.096  6.866   1.00 0.00 ? 458 ASN C HD21 2  
ATOM 926   H HD22 . ASN A 1 6  ? -6.050  -8.551  8.206   1.00 0.00 ? 458 ASN C HD22 2  
ATOM 927   N N    . ALA A 1 7  ? -9.849  -6.306  10.189  1.00 0.00 ? 459 ALA C N    2  
ATOM 928   C CA   . ALA A 1 7  ? -10.078 -6.804  11.536  1.00 0.00 ? 459 ALA C CA   2  
ATOM 929   C C    . ALA A 1 7  ? -11.418 -7.523  11.633  1.00 0.00 ? 459 ALA C C    2  
ATOM 930   O O    . ALA A 1 7  ? -11.518 -8.587  12.243  1.00 0.00 ? 459 ALA C O    2  
ATOM 931   C CB   . ALA A 1 7  ? -10.017 -5.660  12.534  1.00 0.00 ? 459 ALA C CB   2  
ATOM 932   H H    . ALA A 1 7  ? -9.729  -5.341  10.049  1.00 0.00 ? 459 ALA C H    2  
ATOM 933   H HA   . ALA A 1 7  ? -9.292  -7.509  11.777  1.00 0.00 ? 459 ALA C HA   2  
ATOM 934   H HB1  . ALA A 1 7  ? -10.155 -6.045  13.533  1.00 0.00 ? 459 ALA C HB1  2  
ATOM 935   H HB2  . ALA A 1 7  ? -10.799 -4.947  12.314  1.00 0.00 ? 459 ALA C HB2  2  
ATOM 936   H HB3  . ALA A 1 7  ? -9.056  -5.172  12.465  1.00 0.00 ? 459 ALA C HB3  2  
ATOM 937   N N    . MET A 1 8  ? -12.440 -6.952  11.004  1.00 0.00 ? 460 MET C N    2  
ATOM 938   C CA   . MET A 1 8  ? -13.771 -7.526  11.040  1.00 0.00 ? 460 MET C CA   2  
ATOM 939   C C    . MET A 1 8  ? -13.835 -8.852  10.286  1.00 0.00 ? 460 MET C C    2  
ATOM 940   O O    . MET A 1 8  ? -14.262 -9.872  10.839  1.00 0.00 ? 460 MET C O    2  
ATOM 941   C CB   . MET A 1 8  ? -14.797 -6.547  10.474  1.00 0.00 ? 460 MET C CB   2  
ATOM 942   C CG   . MET A 1 8  ? -14.863 -5.224  11.222  1.00 0.00 ? 460 MET C CG   2  
ATOM 943   S SD   . MET A 1 8  ? -16.443 -4.384  11.008  1.00 0.00 ? 460 MET C SD   2  
ATOM 944   C CE   . MET A 1 8  ? -16.453 -4.138  9.245   1.00 0.00 ? 460 MET C CE   2  
ATOM 945   H H    . MET A 1 8  ? -12.294 -6.118  10.504  1.00 0.00 ? 460 MET C H    2  
ATOM 946   H HA   . MET A 1 8  ? -14.011 -7.714  12.073  1.00 0.00 ? 460 MET C HA   2  
ATOM 947   H HB2  . MET A 1 8  ? -14.560 -6.351  9.440   1.00 0.00 ? 460 MET C HB2  2  
ATOM 948   H HB3  . MET A 1 8  ? -15.771 -7.009  10.518  1.00 0.00 ? 460 MET C HB3  2  
ATOM 949   H HG2  . MET A 1 8  ? -14.706 -5.405  12.274  1.00 0.00 ? 460 MET C HG2  2  
ATOM 950   H HG3  . MET A 1 8  ? -14.082 -4.581  10.844  1.00 0.00 ? 460 MET C HG3  2  
ATOM 951   H HE1  . MET A 1 8  ? -16.225 -5.074  8.755   1.00 0.00 ? 460 MET C HE1  2  
ATOM 952   H HE2  . MET A 1 8  ? -15.718 -3.396  8.980   1.00 0.00 ? 460 MET C HE2  2  
ATOM 953   H HE3  . MET A 1 8  ? -17.434 -3.806  8.940   1.00 0.00 ? 460 MET C HE3  2  
ATOM 954   N N    . ALA A 1 9  ? -13.402 -8.838  9.033   1.00 0.00 ? 461 ALA C N    2  
ATOM 955   C CA   . ALA A 1 9  ? -13.420 -10.032 8.201   1.00 0.00 ? 461 ALA C CA   2  
ATOM 956   C C    . ALA A 1 9  ? -12.535 -11.121 8.786   1.00 0.00 ? 461 ALA C C    2  
ATOM 957   O O    . ALA A 1 9  ? -12.863 -12.303 8.714   1.00 0.00 ? 461 ALA C O    2  
ATOM 958   C CB   . ALA A 1 9  ? -12.985 -9.699  6.787   1.00 0.00 ? 461 ALA C CB   2  
ATOM 959   H H    . ALA A 1 9  ? -13.059 -7.999  8.651   1.00 0.00 ? 461 ALA C H    2  
ATOM 960   H HA   . ALA A 1 9  ? -14.438 -10.395 8.164   1.00 0.00 ? 461 ALA C HA   2  
ATOM 961   H HB1  . ALA A 1 9  ? -13.030 -10.589 6.176   1.00 0.00 ? 461 ALA C HB1  2  
ATOM 962   H HB2  . ALA A 1 9  ? -11.971 -9.324  6.801   1.00 0.00 ? 461 ALA C HB2  2  
ATOM 963   H HB3  . ALA A 1 9  ? -13.642 -8.947  6.376   1.00 0.00 ? 461 ALA C HB3  2  
ATOM 964   N N    . HIS A 1 10 ? -11.419 -10.710 9.374   1.00 0.00 ? 462 HIS C N    2  
ATOM 965   C CA   . HIS A 1 10 ? -10.483 -11.641 9.984   1.00 0.00 ? 462 HIS C CA   2  
ATOM 966   C C    . HIS A 1 10 ? -11.159 -12.442 11.085  1.00 0.00 ? 462 HIS C C    2  
ATOM 967   O O    . HIS A 1 10 ? -11.000 -13.648 11.154  1.00 0.00 ? 462 HIS C O    2  
ATOM 968   C CB   . HIS A 1 10 ? -9.259  -10.892 10.529  1.00 0.00 ? 462 HIS C CB   2  
ATOM 969   C CG   . HIS A 1 10 ? -8.186  -11.778 11.085  1.00 0.00 ? 462 HIS C CG   2  
ATOM 970   N ND1  . HIS A 1 10 ? -7.415  -12.610 10.308  1.00 0.00 ? 462 HIS C ND1  2  
ATOM 971   C CD2  . HIS A 1 10 ? -7.757  -11.950 12.353  1.00 0.00 ? 462 HIS C CD2  2  
ATOM 972   C CE1  . HIS A 1 10 ? -6.559  -13.255 11.074  1.00 0.00 ? 462 HIS C CE1  2  
ATOM 973   N NE2  . HIS A 1 10 ? -6.745  -12.874 12.320  1.00 0.00 ? 462 HIS C NE2  2  
ATOM 974   H H    . HIS A 1 10 ? -11.215 -9.748  9.392   1.00 0.00 ? 462 HIS C H    2  
ATOM 975   H HA   . HIS A 1 10 ? -10.155 -12.327 9.221   1.00 0.00 ? 462 HIS C HA   2  
ATOM 976   H HB2  . HIS A 1 10 ? -8.821  -10.309 9.732   1.00 0.00 ? 462 HIS C HB2  2  
ATOM 977   H HB3  . HIS A 1 10 ? -9.580  -10.224 11.315  1.00 0.00 ? 462 HIS C HB3  2  
ATOM 978   H HD1  . HIS A 1 10 ? -7.482  -12.714 9.329   1.00 0.00 ? 462 HIS C HD1  2  
ATOM 979   H HD2  . HIS A 1 10 ? -8.141  -11.442 13.227  1.00 0.00 ? 462 HIS C HD2  2  
ATOM 980   H HE1  . HIS A 1 10 ? -5.826  -13.973 10.738  1.00 0.00 ? 462 HIS C HE1  2  
ATOM 981   H HE2  . HIS A 1 10 ? -6.106  -13.029 13.051  1.00 0.00 ? 462 HIS C HE2  2  
ATOM 982   N N    . GLN A 1 11 ? -11.939 -11.767 11.925  1.00 0.00 ? 463 GLN C N    2  
ATOM 983   C CA   . GLN A 1 11 ? -12.626 -12.442 13.026  1.00 0.00 ? 463 GLN C CA   2  
ATOM 984   C C    . GLN A 1 11 ? -13.634 -13.454 12.504  1.00 0.00 ? 463 GLN C C    2  
ATOM 985   O O    . GLN A 1 11 ? -13.707 -14.576 13.002  1.00 0.00 ? 463 GLN C O    2  
ATOM 986   C CB   . GLN A 1 11 ? -13.327 -11.437 13.947  1.00 0.00 ? 463 GLN C CB   2  
ATOM 987   C CG   . GLN A 1 11 ? -12.388 -10.463 14.643  1.00 0.00 ? 463 GLN C CG   2  
ATOM 988   C CD   . GLN A 1 11 ? -11.188 -11.152 15.251  1.00 0.00 ? 463 GLN C CD   2  
ATOM 989   O OE1  . GLN A 1 11 ? -11.231 -11.619 16.388  1.00 0.00 ? 463 GLN C OE1  2  
ATOM 990   N NE2  . GLN A 1 11 ? -10.105 -11.200 14.506  1.00 0.00 ? 463 GLN C NE2  2  
ATOM 991   H H    . GLN A 1 11 ? -12.061 -10.801 11.799  1.00 0.00 ? 463 GLN C H    2  
ATOM 992   H HA   . GLN A 1 11 ? -11.881 -12.981 13.598  1.00 0.00 ? 463 GLN C HA   2  
ATOM 993   H HB2  . GLN A 1 11 ? -14.030 -10.864 13.363  1.00 0.00 ? 463 GLN C HB2  2  
ATOM 994   H HB3  . GLN A 1 11 ? -13.869 -11.984 14.705  1.00 0.00 ? 463 GLN C HB3  2  
ATOM 995   H HG2  . GLN A 1 11 ? -12.040 -9.740  13.921  1.00 0.00 ? 463 GLN C HG2  2  
ATOM 996   H HG3  . GLN A 1 11 ? -12.931 -9.955  15.427  1.00 0.00 ? 463 GLN C HG3  2  
ATOM 997   H HE21 . GLN A 1 11 ? -10.141 -10.788 13.620  1.00 0.00 ? 463 GLN C HE21 2  
ATOM 998   H HE22 . GLN A 1 11 ? -9.306  -11.645 14.865  1.00 0.00 ? 463 GLN C HE22 2  
ATOM 999   N N    . ILE A 1 12 ? -14.402 -13.060 11.498  1.00 0.00 ? 464 ILE C N    2  
ATOM 1000  C CA   . ILE A 1 12 ? -15.382 -13.956 10.914  1.00 0.00 ? 464 ILE C CA   2  
ATOM 1001  C C    . ILE A 1 12 ? -14.695 -15.147 10.269  1.00 0.00 ? 464 ILE C C    2  
ATOM 1002  O O    . ILE A 1 12 ? -15.099 -16.273 10.473  1.00 0.00 ? 464 ILE C O    2  
ATOM 1003  C CB   . ILE A 1 12 ? -16.256 -13.260 9.854   1.00 0.00 ? 464 ILE C CB   2  
ATOM 1004  C CG1  . ILE A 1 12 ? -16.969 -12.047 10.442  1.00 0.00 ? 464 ILE C CG1  2  
ATOM 1005  C CG2  . ILE A 1 12 ? -17.274 -14.243 9.283   1.00 0.00 ? 464 ILE C CG2  2  
ATOM 1006  C CD1  . ILE A 1 12 ? -17.735 -11.261 9.408   1.00 0.00 ? 464 ILE C CD1  2  
ATOM 1007  H H    . ILE A 1 12 ? -14.307 -12.148 11.146  1.00 0.00 ? 464 ILE C H    2  
ATOM 1008  H HA   . ILE A 1 12 ? -16.022 -14.312 11.708  1.00 0.00 ? 464 ILE C HA   2  
ATOM 1009  H HB   . ILE A 1 12 ? -15.612 -12.936 9.049   1.00 0.00 ? 464 ILE C HB   2  
ATOM 1010  H HG12 . ILE A 1 12 ? -17.671 -12.380 11.192  1.00 0.00 ? 464 ILE C HG12 2  
ATOM 1011  H HG13 . ILE A 1 12 ? -16.251 -11.384 10.904  1.00 0.00 ? 464 ILE C HG13 2  
ATOM 1012  H HG21 . ILE A 1 12 ? -16.757 -15.053 8.791   1.00 0.00 ? 464 ILE C HG21 2  
ATOM 1013  H HG22 . ILE A 1 12 ? -17.909 -13.733 8.574   1.00 0.00 ? 464 ILE C HG22 2  
ATOM 1014  H HG23 . ILE A 1 12 ? -17.878 -14.640 10.087  1.00 0.00 ? 464 ILE C HG23 2  
ATOM 1015  H HD11 . ILE A 1 12 ? -18.544 -11.864 9.024   1.00 0.00 ? 464 ILE C HD11 2  
ATOM 1016  H HD12 . ILE A 1 12 ? -17.070 -11.000 8.599   1.00 0.00 ? 464 ILE C HD12 2  
ATOM 1017  H HD13 . ILE A 1 12 ? -18.131 -10.363 9.850   1.00 0.00 ? 464 ILE C HD13 2  
ATOM 1018  N N    . GLN A 1 13 ? -13.642 -14.878 9.509   1.00 0.00 ? 465 GLN C N    2  
ATOM 1019  C CA   . GLN A 1 13 ? -12.894 -15.930 8.824   1.00 0.00 ? 465 GLN C CA   2  
ATOM 1020  C C    . GLN A 1 13 ? -12.322 -16.926 9.839   1.00 0.00 ? 465 GLN C C    2  
ATOM 1021  O O    . GLN A 1 13 ? -12.294 -18.133 9.596   1.00 0.00 ? 465 GLN C O    2  
ATOM 1022  C CB   . GLN A 1 13 ? -11.775 -15.303 7.973   1.00 0.00 ? 465 GLN C CB   2  
ATOM 1023  C CG   . GLN A 1 13 ? -11.216 -16.217 6.880   1.00 0.00 ? 465 GLN C CG   2  
ATOM 1024  C CD   . GLN A 1 13 ? -10.271 -17.286 7.397   1.00 0.00 ? 465 GLN C CD   2  
ATOM 1025  O OE1  . GLN A 1 13 ? -10.208 -18.388 6.851   1.00 0.00 ? 465 GLN C OE1  2  
ATOM 1026  N NE2  . GLN A 1 13 ? -9.511  -16.962 8.426   1.00 0.00 ? 465 GLN C NE2  2  
ATOM 1027  H H    . GLN A 1 13 ? -13.359 -13.943 9.395   1.00 0.00 ? 465 GLN C H    2  
ATOM 1028  H HA   . GLN A 1 13 ? -13.581 -16.452 8.174   1.00 0.00 ? 465 GLN C HA   2  
ATOM 1029  H HB2  . GLN A 1 13 ? -12.158 -14.413 7.499   1.00 0.00 ? 465 GLN C HB2  2  
ATOM 1030  H HB3  . GLN A 1 13 ? -10.962 -15.024 8.630   1.00 0.00 ? 465 GLN C HB3  2  
ATOM 1031  H HG2  . GLN A 1 13 ? -12.041 -16.708 6.386   1.00 0.00 ? 465 GLN C HG2  2  
ATOM 1032  H HG3  . GLN A 1 13 ? -10.686 -15.609 6.162   1.00 0.00 ? 465 GLN C HG3  2  
ATOM 1033  H HE21 . GLN A 1 13 ? -9.592  -16.061 8.801   1.00 0.00 ? 465 GLN C HE21 2  
ATOM 1034  H HE22 . GLN A 1 13 ? -8.893  -17.636 8.775   1.00 0.00 ? 465 GLN C HE22 2  
ATOM 1035  N N    . GLU A 1 14 ? -11.879 -16.412 10.978  1.00 0.00 ? 466 GLU C N    2  
ATOM 1036  C CA   . GLU A 1 14 ? -11.349 -17.247 12.047  1.00 0.00 ? 466 GLU C CA   2  
ATOM 1037  C C    . GLU A 1 14 ? -12.434 -18.181 12.600  1.00 0.00 ? 466 GLU C C    2  
ATOM 1038  O O    . GLU A 1 14 ? -12.153 -19.309 13.015  1.00 0.00 ? 466 GLU C O    2  
ATOM 1039  C CB   . GLU A 1 14 ? -10.786 -16.369 13.169  1.00 0.00 ? 466 GLU C CB   2  
ATOM 1040  C CG   . GLU A 1 14 ? -9.515  -15.622 12.793  1.00 0.00 ? 466 GLU C CG   2  
ATOM 1041  C CD   . GLU A 1 14 ? -8.383  -16.545 12.400  1.00 0.00 ? 466 GLU C CD   2  
ATOM 1042  O OE1  . GLU A 1 14 ? -7.763  -17.150 13.298  1.00 0.00 ? 466 GLU C OE1  2  
ATOM 1043  O OE2  . GLU A 1 14 ? -8.103  -16.666 11.195  1.00 0.00 ? 466 GLU C OE2  2  
ATOM 1044  H H    . GLU A 1 14 ? -11.897 -15.438 11.103  1.00 0.00 ? 466 GLU C H    2  
ATOM 1045  H HA   . GLU A 1 14 ? -10.550 -17.845 11.635  1.00 0.00 ? 466 GLU C HA   2  
ATOM 1046  H HB2  . GLU A 1 14 ? -11.534 -15.636 13.434  1.00 0.00 ? 466 GLU C HB2  2  
ATOM 1047  H HB3  . GLU A 1 14 ? -10.582 -16.977 14.032  1.00 0.00 ? 466 GLU C HB3  2  
ATOM 1048  H HG2  . GLU A 1 14 ? -9.730  -14.974 11.956  1.00 0.00 ? 466 GLU C HG2  2  
ATOM 1049  H HG3  . GLU A 1 14 ? -9.199  -15.024 13.637  1.00 0.00 ? 466 GLU C HG3  2  
ATOM 1050  N N    . MET A 1 15 ? -13.670 -17.710 12.589  1.00 0.00 ? 467 MET C N    2  
ATOM 1051  C CA   . MET A 1 15 ? -14.791 -18.487 13.095  1.00 0.00 ? 467 MET C CA   2  
ATOM 1052  C C    . MET A 1 15 ? -15.423 -19.332 11.985  1.00 0.00 ? 467 MET C C    2  
ATOM 1053  O O    . MET A 1 15 ? -15.947 -20.415 12.241  1.00 0.00 ? 467 MET C O    2  
ATOM 1054  C CB   . MET A 1 15 ? -15.845 -17.556 13.705  1.00 0.00 ? 467 MET C CB   2  
ATOM 1055  C CG   . MET A 1 15 ? -15.331 -16.704 14.856  1.00 0.00 ? 467 MET C CG   2  
ATOM 1056  S SD   . MET A 1 15 ? -16.625 -15.689 15.614  1.00 0.00 ? 467 MET C SD   2  
ATOM 1057  C CE   . MET A 1 15 ? -17.107 -14.647 14.235  1.00 0.00 ? 467 MET C CE   2  
ATOM 1058  H H    . MET A 1 15 ? -13.837 -16.812 12.230  1.00 0.00 ? 467 MET C H    2  
ATOM 1059  H HA   . MET A 1 15 ? -14.419 -19.144 13.865  1.00 0.00 ? 467 MET C HA   2  
ATOM 1060  H HB2  . MET A 1 15 ? -16.207 -16.894 12.934  1.00 0.00 ? 467 MET C HB2  2  
ATOM 1061  H HB3  . MET A 1 15 ? -16.665 -18.156 14.065  1.00 0.00 ? 467 MET C HB3  2  
ATOM 1062  H HG2  . MET A 1 15 ? -14.914 -17.353 15.610  1.00 0.00 ? 467 MET C HG2  2  
ATOM 1063  H HG3  . MET A 1 15 ? -14.558 -16.051 14.476  1.00 0.00 ? 467 MET C HG3  2  
ATOM 1064  H HE1  . MET A 1 15 ? -17.481 -15.262 13.431  1.00 0.00 ? 467 MET C HE1  2  
ATOM 1065  H HE2  . MET A 1 15 ? -16.251 -14.085 13.891  1.00 0.00 ? 467 MET C HE2  2  
ATOM 1066  H HE3  . MET A 1 15 ? -17.882 -13.963 14.554  1.00 0.00 ? 467 MET C HE3  2  
ATOM 1067  N N    . PHE A 1 16 ? -15.367 -18.826 10.763  1.00 0.00 ? 468 PHE C N    2  
ATOM 1068  C CA   . PHE A 1 16 ? -15.943 -19.488 9.599   1.00 0.00 ? 468 PHE C CA   2  
ATOM 1069  C C    . PHE A 1 16 ? -14.900 -19.635 8.488   1.00 0.00 ? 468 PHE C C    2  
ATOM 1070  O O    . PHE A 1 16 ? -14.825 -18.803 7.590   1.00 0.00 ? 468 PHE C O    2  
ATOM 1071  C CB   . PHE A 1 16 ? -17.157 -18.692 9.068   1.00 0.00 ? 468 PHE C CB   2  
ATOM 1072  C CG   . PHE A 1 16 ? -18.388 -18.767 9.936   1.00 0.00 ? 468 PHE C CG   2  
ATOM 1073  C CD1  . PHE A 1 16 ? -18.392 -18.232 11.211  1.00 0.00 ? 468 PHE C CD1  2  
ATOM 1074  C CD2  . PHE A 1 16 ? -19.541 -19.373 9.470   1.00 0.00 ? 468 PHE C CD2  2  
ATOM 1075  C CE1  . PHE A 1 16 ? -19.514 -18.307 12.007  1.00 0.00 ? 468 PHE C CE1  2  
ATOM 1076  C CE2  . PHE A 1 16 ? -20.669 -19.450 10.259  1.00 0.00 ? 468 PHE C CE2  2  
ATOM 1077  C CZ   . PHE A 1 16 ? -20.656 -18.919 11.530  1.00 0.00 ? 468 PHE C CZ   2  
ATOM 1078  H H    . PHE A 1 16 ? -14.921 -17.961 10.625  1.00 0.00 ? 468 PHE C H    2  
ATOM 1079  H HA   . PHE A 1 16 ? -16.273 -20.469 9.904   1.00 0.00 ? 468 PHE C HA   2  
ATOM 1080  H HB2  . PHE A 1 16 ? -16.881 -17.652 8.984   1.00 0.00 ? 468 PHE C HB2  2  
ATOM 1081  H HB3  . PHE A 1 16 ? -17.414 -19.065 8.089   1.00 0.00 ? 468 PHE C HB3  2  
ATOM 1082  H HD1  . PHE A 1 16 ? -17.498 -17.753 11.584  1.00 0.00 ? 468 PHE C HD1  2  
ATOM 1083  H HD2  . PHE A 1 16 ? -19.557 -19.783 8.472   1.00 0.00 ? 468 PHE C HD2  2  
ATOM 1084  H HE1  . PHE A 1 16 ? -19.499 -17.883 13.000  1.00 0.00 ? 468 PHE C HE1  2  
ATOM 1085  H HE2  . PHE A 1 16 ? -21.560 -19.929 9.882   1.00 0.00 ? 468 PHE C HE2  2  
ATOM 1086  H HZ   . PHE A 1 16 ? -21.537 -18.978 12.152  1.00 0.00 ? 468 PHE C HZ   2  
ATOM 1087  N N    . PRO A 1 17 ? -14.069 -20.687 8.552   1.00 0.00 ? 469 PRO C N    2  
ATOM 1088  C CA   . PRO A 1 17 ? -13.035 -20.945 7.541   1.00 0.00 ? 469 PRO C CA   2  
ATOM 1089  C C    . PRO A 1 17 ? -13.632 -21.261 6.172   1.00 0.00 ? 469 PRO C C    2  
ATOM 1090  O O    . PRO A 1 17 ? -12.957 -21.159 5.146   1.00 0.00 ? 469 PRO C O    2  
ATOM 1091  C CB   . PRO A 1 17 ? -12.300 -22.183 8.076   1.00 0.00 ? 469 PRO C CB   2  
ATOM 1092  C CG   . PRO A 1 17 ? -12.681 -22.274 9.509   1.00 0.00 ? 469 PRO C CG   2  
ATOM 1093  C CD   . PRO A 1 17 ? -14.046 -21.678 9.623   1.00 0.00 ? 469 PRO C CD   2  
ATOM 1094  H HA   . PRO A 1 17 ? -12.349 -20.116 7.471   1.00 0.00 ? 469 PRO C HA   2  
ATOM 1095  H HB2  . PRO A 1 17 ? -12.617 -23.057 7.528   1.00 0.00 ? 469 PRO C HB2  2  
ATOM 1096  H HB3  . PRO A 1 17 ? -11.234 -22.050 7.961   1.00 0.00 ? 469 PRO C HB3  2  
ATOM 1097  H HG2  . PRO A 1 17 ? -12.695 -23.307 9.826   1.00 0.00 ? 469 PRO C HG2  2  
ATOM 1098  H HG3  . PRO A 1 17 ? -11.982 -21.711 10.105  1.00 0.00 ? 469 PRO C HG3  2  
ATOM 1099  H HD2  . PRO A 1 17 ? -14.811 -22.422 9.478   1.00 0.00 ? 469 PRO C HD2  2  
ATOM 1100  H HD3  . PRO A 1 17 ? -14.157 -21.194 10.578  1.00 0.00 ? 469 PRO C HD3  2  
ATOM 1101  N N    . GLN A 1 18 ? -14.904 -21.644 6.174   1.00 0.00 ? 470 GLN C N    2  
ATOM 1102  C CA   . GLN A 1 18 ? -15.607 -22.019 4.948   1.00 0.00 ? 470 GLN C CA   2  
ATOM 1103  C C    . GLN A 1 18 ? -15.764 -20.847 3.978   1.00 0.00 ? 470 GLN C C    2  
ATOM 1104  O O    . GLN A 1 18 ? -16.023 -21.051 2.794   1.00 0.00 ? 470 GLN C O    2  
ATOM 1105  C CB   . GLN A 1 18 ? -16.980 -22.616 5.267   1.00 0.00 ? 470 GLN C CB   2  
ATOM 1106  C CG   . GLN A 1 18 ? -17.923 -21.665 5.992   1.00 0.00 ? 470 GLN C CG   2  
ATOM 1107  C CD   . GLN A 1 18 ? -19.324 -22.233 6.127   1.00 0.00 ? 470 GLN C CD   2  
ATOM 1108  O OE1  . GLN A 1 18 ? -19.513 -23.446 6.178   1.00 0.00 ? 470 GLN C OE1  2  
ATOM 1109  N NE2  . GLN A 1 18 ? -20.313 -21.362 6.196   1.00 0.00 ? 470 GLN C NE2  2  
ATOM 1110  H H    . GLN A 1 18 ? -15.375 -21.675 7.033   1.00 0.00 ? 470 GLN C H    2  
ATOM 1111  H HA   . GLN A 1 18 ? -15.015 -22.779 4.463   1.00 0.00 ? 470 GLN C HA   2  
ATOM 1112  H HB2  . GLN A 1 18 ? -17.451 -22.915 4.343   1.00 0.00 ? 470 GLN C HB2  2  
ATOM 1113  H HB3  . GLN A 1 18 ? -16.841 -23.490 5.887   1.00 0.00 ? 470 GLN C HB3  2  
ATOM 1114  H HG2  . GLN A 1 18 ? -17.531 -21.469 6.979   1.00 0.00 ? 470 GLN C HG2  2  
ATOM 1115  H HG3  . GLN A 1 18 ? -17.973 -20.742 5.434   1.00 0.00 ? 470 GLN C HG3  2  
ATOM 1116  H HE21 . GLN A 1 18 ? -20.098 -20.408 6.160   1.00 0.00 ? 470 GLN C HE21 2  
ATOM 1117  H HE22 . GLN A 1 18 ? -21.226 -21.713 6.277   1.00 0.00 ? 470 GLN C HE22 2  
ATOM 1118  N N    . VAL A 1 19 ? -15.616 -19.632 4.472   1.00 0.00 ? 471 VAL C N    2  
ATOM 1119  C CA   . VAL A 1 19 ? -15.762 -18.465 3.633   1.00 0.00 ? 471 VAL C CA   2  
ATOM 1120  C C    . VAL A 1 19 ? -14.434 -17.702 3.502   1.00 0.00 ? 471 VAL C C    2  
ATOM 1121  O O    . VAL A 1 19 ? -13.835 -17.295 4.498   1.00 0.00 ? 471 VAL C O    2  
ATOM 1122  C CB   . VAL A 1 19 ? -16.898 -17.526 4.144   1.00 0.00 ? 471 VAL C CB   2  
ATOM 1123  C CG1  . VAL A 1 19 ? -16.657 -17.086 5.578   1.00 0.00 ? 471 VAL C CG1  2  
ATOM 1124  C CG2  . VAL A 1 19 ? -17.066 -16.324 3.225   1.00 0.00 ? 471 VAL C CG2  2  
ATOM 1125  H H    . VAL A 1 19 ? -15.383 -19.515 5.419   1.00 0.00 ? 471 VAL C H    2  
ATOM 1126  H HA   . VAL A 1 19 ? -16.042 -18.822 2.652   1.00 0.00 ? 471 VAL C HA   2  
ATOM 1127  H HB   . VAL A 1 19 ? -17.820 -18.091 4.128   1.00 0.00 ? 471 VAL C HB   2  
ATOM 1128  H HG11 . VAL A 1 19 ? -15.703 -16.585 5.646   1.00 0.00 ? 471 VAL C HG11 2  
ATOM 1129  H HG12 . VAL A 1 19 ? -16.657 -17.950 6.226   1.00 0.00 ? 471 VAL C HG12 2  
ATOM 1130  H HG13 . VAL A 1 19 ? -17.440 -16.409 5.883   1.00 0.00 ? 471 VAL C HG13 2  
ATOM 1131  H HG21 . VAL A 1 19 ? -17.335 -16.662 2.235   1.00 0.00 ? 471 VAL C HG21 2  
ATOM 1132  H HG22 . VAL A 1 19 ? -16.139 -15.773 3.179   1.00 0.00 ? 471 VAL C HG22 2  
ATOM 1133  H HG23 . VAL A 1 19 ? -17.847 -15.683 3.610   1.00 0.00 ? 471 VAL C HG23 2  
ATOM 1134  N N    . PRO A 1 20 ? -13.938 -17.552 2.256   1.00 0.00 ? 472 PRO C N    2  
ATOM 1135  C CA   . PRO A 1 20 ? -12.691 -16.832 1.968   1.00 0.00 ? 472 PRO C CA   2  
ATOM 1136  C C    . PRO A 1 20 ? -12.695 -15.408 2.515   1.00 0.00 ? 472 PRO C C    2  
ATOM 1137  O O    . PRO A 1 20 ? -13.681 -14.682 2.379   1.00 0.00 ? 472 PRO C O    2  
ATOM 1138  C CB   . PRO A 1 20 ? -12.640 -16.805 0.438   1.00 0.00 ? 472 PRO C CB   2  
ATOM 1139  C CG   . PRO A 1 20 ? -13.442 -17.980 0.022   1.00 0.00 ? 472 PRO C CG   2  
ATOM 1140  C CD   . PRO A 1 20 ? -14.544 -18.101 1.034   1.00 0.00 ? 472 PRO C CD   2  
ATOM 1141  H HA   . PRO A 1 20 ? -11.832 -17.360 2.349   1.00 0.00 ? 472 PRO C HA   2  
ATOM 1142  H HB2  . PRO A 1 20 ? -13.069 -15.881 0.078   1.00 0.00 ? 472 PRO C HB2  2  
ATOM 1143  H HB3  . PRO A 1 20 ? -11.615 -16.889 0.107   1.00 0.00 ? 472 PRO C HB3  2  
ATOM 1144  H HG2  . PRO A 1 20 ? -13.849 -17.817 -0.965  1.00 0.00 ? 472 PRO C HG2  2  
ATOM 1145  H HG3  . PRO A 1 20 ? -12.824 -18.865 0.033   1.00 0.00 ? 472 PRO C HG3  2  
ATOM 1146  H HD2  . PRO A 1 20 ? -15.404 -17.522 0.735   1.00 0.00 ? 472 PRO C HD2  2  
ATOM 1147  H HD3  . PRO A 1 20 ? -14.812 -19.140 1.171   1.00 0.00 ? 472 PRO C HD3  2  
ATOM 1148  N N    . TYR A 1 21 ? -11.571 -15.023 3.103   1.00 0.00 ? 473 TYR C N    2  
ATOM 1149  C CA   . TYR A 1 21 ? -11.370 -13.699 3.715   1.00 0.00 ? 473 TYR C CA   2  
ATOM 1150  C C    . TYR A 1 21 ? -11.867 -12.546 2.822   1.00 0.00 ? 473 TYR C C    2  
ATOM 1151  O O    . TYR A 1 21 ? -12.533 -11.625 3.297   1.00 0.00 ? 473 TYR C O    2  
ATOM 1152  C CB   . TYR A 1 21 ? -9.877  -13.527 4.046   1.00 0.00 ? 473 TYR C CB   2  
ATOM 1153  C CG   . TYR A 1 21 ? -9.458  -12.131 4.456   1.00 0.00 ? 473 TYR C CG   2  
ATOM 1154  C CD1  . TYR A 1 21 ? -9.697  -11.651 5.737   1.00 0.00 ? 473 TYR C CD1  2  
ATOM 1155  C CD2  . TYR A 1 21 ? -8.805  -11.299 3.555   1.00 0.00 ? 473 TYR C CD2  2  
ATOM 1156  C CE1  . TYR A 1 21 ? -9.301  -10.378 6.105   1.00 0.00 ? 473 TYR C CE1  2  
ATOM 1157  C CE2  . TYR A 1 21 ? -8.403  -10.033 3.916   1.00 0.00 ? 473 TYR C CE2  2  
ATOM 1158  C CZ   . TYR A 1 21 ? -8.652  -9.575  5.187   1.00 0.00 ? 473 TYR C CZ   2  
ATOM 1159  O OH   . TYR A 1 21 ? -8.246  -8.313  5.544   1.00 0.00 ? 473 TYR C OH   2  
ATOM 1160  H H    . TYR A 1 21 ? -10.829 -15.668 3.134   1.00 0.00 ? 473 TYR C H    2  
ATOM 1161  H HA   . TYR A 1 21 ? -11.928 -13.677 4.637   1.00 0.00 ? 473 TYR C HA   2  
ATOM 1162  H HB2  . TYR A 1 21 ? -9.623  -14.189 4.859   1.00 0.00 ? 473 TYR C HB2  2  
ATOM 1163  H HB3  . TYR A 1 21 ? -9.297  -13.806 3.179   1.00 0.00 ? 473 TYR C HB3  2  
ATOM 1164  H HD1  . TYR A 1 21 ? -10.205 -12.285 6.451   1.00 0.00 ? 473 TYR C HD1  2  
ATOM 1165  H HD2  . TYR A 1 21 ? -8.613  -11.658 2.556   1.00 0.00 ? 473 TYR C HD2  2  
ATOM 1166  H HE1  . TYR A 1 21 ? -9.495  -10.020 7.104   1.00 0.00 ? 473 TYR C HE1  2  
ATOM 1167  H HE2  . TYR A 1 21 ? -7.897  -9.403  3.199   1.00 0.00 ? 473 TYR C HE2  2  
ATOM 1168  H HH   . TYR A 1 21 ? -8.583  -7.677  4.896   1.00 0.00 ? 473 TYR C HH   2  
ATOM 1169  N N    . HIS A 1 22 ? -11.561 -12.611 1.541   1.00 0.00 ? 474 HIS C N    2  
ATOM 1170  C CA   . HIS A 1 22 ? -11.952 -11.557 0.607   1.00 0.00 ? 474 HIS C CA   2  
ATOM 1171  C C    . HIS A 1 22 ? -13.458 -11.564 0.360   1.00 0.00 ? 474 HIS C C    2  
ATOM 1172  O O    . HIS A 1 22 ? -14.067 -10.508 0.193   1.00 0.00 ? 474 HIS C O    2  
ATOM 1173  C CB   . HIS A 1 22 ? -11.194 -11.708 -0.704  1.00 0.00 ? 474 HIS C CB   2  
ATOM 1174  C CG   . HIS A 1 22 ? -11.386 -10.568 -1.662  1.00 0.00 ? 474 HIS C CG   2  
ATOM 1175  N ND1  . HIS A 1 22 ? -10.508 -9.512  -1.760  1.00 0.00 ? 474 HIS C ND1  2  
ATOM 1176  C CD2  . HIS A 1 22 ? -12.363 -10.326 -2.568  1.00 0.00 ? 474 HIS C CD2  2  
ATOM 1177  C CE1  . HIS A 1 22 ? -10.938 -8.673  -2.682  1.00 0.00 ? 474 HIS C CE1  2  
ATOM 1178  N NE2  . HIS A 1 22 ? -12.059 -9.145  -3.184  1.00 0.00 ? 474 HIS C NE2  2  
ATOM 1179  H H    . HIS A 1 22 ? -11.052 -13.386 1.210   1.00 0.00 ? 474 HIS C H    2  
ATOM 1180  H HA   . HIS A 1 22 ? -11.694 -10.604 1.052   1.00 0.00 ? 474 HIS C HA   2  
ATOM 1181  H HB2  . HIS A 1 22 ? -10.144 -11.786 -0.480  1.00 0.00 ? 474 HIS C HB2  2  
ATOM 1182  H HB3  . HIS A 1 22 ? -11.519 -12.614 -1.189  1.00 0.00 ? 474 HIS C HB3  2  
ATOM 1183  H HD1  . HIS A 1 22 ? -9.681  -9.404  -1.241  1.00 0.00 ? 474 HIS C HD1  2  
ATOM 1184  H HD2  . HIS A 1 22 ? -13.223 -10.951 -2.767  1.00 0.00 ? 474 HIS C HD2  2  
ATOM 1185  H HE1  . HIS A 1 22 ? -10.454 -7.754  -2.975  1.00 0.00 ? 474 HIS C HE1  2  
ATOM 1186  H HE2  . HIS A 1 22 ? -12.635 -8.676  -3.832  1.00 0.00 ? 474 HIS C HE2  2  
ATOM 1187  N N    . LEU A 1 23 ? -14.058 -12.744 0.339   1.00 0.00 ? 475 LEU C N    2  
ATOM 1188  C CA   . LEU A 1 23 ? -15.495 -12.845 0.148   1.00 0.00 ? 475 LEU C CA   2  
ATOM 1189  C C    . LEU A 1 23 ? -16.216 -12.337 1.379   1.00 0.00 ? 475 LEU C C    2  
ATOM 1190  O O    . LEU A 1 23 ? -17.367 -11.907 1.306   1.00 0.00 ? 475 LEU C O    2  
ATOM 1191  C CB   . LEU A 1 23 ? -15.918 -14.278 -0.180  1.00 0.00 ? 475 LEU C CB   2  
ATOM 1192  C CG   . LEU A 1 23 ? -15.525 -14.787 -1.572  1.00 0.00 ? 475 LEU C CG   2  
ATOM 1193  C CD1  . LEU A 1 23 ? -16.103 -16.168 -1.821  1.00 0.00 ? 475 LEU C CD1  2  
ATOM 1194  C CD2  . LEU A 1 23 ? -15.988 -13.817 -2.650  1.00 0.00 ? 475 LEU C CD2  2  
ATOM 1195  H H    . LEU A 1 23 ? -13.533 -13.563 0.467   1.00 0.00 ? 475 LEU C H    2  
ATOM 1196  H HA   . LEU A 1 23 ? -15.755 -12.203 -0.679  1.00 0.00 ? 475 LEU C HA   2  
ATOM 1197  H HB2  . LEU A 1 23 ? -15.479 -14.935 0.557   1.00 0.00 ? 475 LEU C HB2  2  
ATOM 1198  H HB3  . LEU A 1 23 ? -16.991 -14.337 -0.091  1.00 0.00 ? 475 LEU C HB3  2  
ATOM 1199  H HG   . LEU A 1 23 ? -14.449 -14.862 -1.627  1.00 0.00 ? 475 LEU C HG   2  
ATOM 1200  H HD11 . LEU A 1 23 ? -17.180 -16.124 -1.751  1.00 0.00 ? 475 LEU C HD11 2  
ATOM 1201  H HD12 . LEU A 1 23 ? -15.721 -16.858 -1.085  1.00 0.00 ? 475 LEU C HD12 2  
ATOM 1202  H HD13 . LEU A 1 23 ? -15.822 -16.502 -2.809  1.00 0.00 ? 475 LEU C HD13 2  
ATOM 1203  H HD21 . LEU A 1 23 ? -15.472 -12.875 -2.539  1.00 0.00 ? 475 LEU C HD21 2  
ATOM 1204  H HD22 . LEU A 1 23 ? -17.052 -13.655 -2.556  1.00 0.00 ? 475 LEU C HD22 2  
ATOM 1205  H HD23 . LEU A 1 23 ? -15.772 -14.232 -3.624  1.00 0.00 ? 475 LEU C HD23 2  
ATOM 1206  N N    . VAL A 1 24 ? -15.523 -12.376 2.509   1.00 0.00 ? 476 VAL C N    2  
ATOM 1207  C CA   . VAL A 1 24 ? -16.059 -11.838 3.743   1.00 0.00 ? 476 VAL C CA   2  
ATOM 1208  C C    . VAL A 1 24 ? -16.023 -10.315 3.659   1.00 0.00 ? 476 VAL C C    2  
ATOM 1209  O O    . VAL A 1 24 ? -17.014 -9.645  3.925   1.00 0.00 ? 476 VAL C O    2  
ATOM 1210  C CB   . VAL A 1 24 ? -15.250 -12.309 4.979   1.00 0.00 ? 476 VAL C CB   2  
ATOM 1211  C CG1  . VAL A 1 24 ? -15.900 -11.834 6.262   1.00 0.00 ? 476 VAL C CG1  2  
ATOM 1212  C CG2  . VAL A 1 24 ? -15.110 -13.819 4.993   1.00 0.00 ? 476 VAL C CG2  2  
ATOM 1213  H H    . VAL A 1 24 ? -14.627 -12.783 2.503   1.00 0.00 ? 476 VAL C H    2  
ATOM 1214  H HA   . VAL A 1 24 ? -17.084 -12.165 3.840   1.00 0.00 ? 476 VAL C HA   2  
ATOM 1215  H HB   . VAL A 1 24 ? -14.262 -11.878 4.921   1.00 0.00 ? 476 VAL C HB   2  
ATOM 1216  H HG11 . VAL A 1 24 ? -16.910 -12.212 6.317   1.00 0.00 ? 476 VAL C HG11 2  
ATOM 1217  H HG12 . VAL A 1 24 ? -15.917 -10.755 6.278   1.00 0.00 ? 476 VAL C HG12 2  
ATOM 1218  H HG13 . VAL A 1 24 ? -15.333 -12.197 7.106   1.00 0.00 ? 476 VAL C HG13 2  
ATOM 1219  H HG21 . VAL A 1 24 ? -14.597 -14.140 4.099   1.00 0.00 ? 476 VAL C HG21 2  
ATOM 1220  H HG22 . VAL A 1 24 ? -16.090 -14.269 5.027   1.00 0.00 ? 476 VAL C HG22 2  
ATOM 1221  H HG23 . VAL A 1 24 ? -14.544 -14.120 5.862   1.00 0.00 ? 476 VAL C HG23 2  
ATOM 1222  N N    . LEU A 1 25 ? -14.863 -9.788  3.240   1.00 0.00 ? 477 LEU C N    2  
ATOM 1223  C CA   . LEU A 1 25 ? -14.661 -8.345  3.029   1.00 0.00 ? 477 LEU C CA   2  
ATOM 1224  C C    . LEU A 1 25 ? -15.778 -7.764  2.166   1.00 0.00 ? 477 LEU C C    2  
ATOM 1225  O O    . LEU A 1 25 ? -16.217 -6.632  2.375   1.00 0.00 ? 477 LEU C O    2  
ATOM 1226  C CB   . LEU A 1 25 ? -13.316 -8.110  2.327   1.00 0.00 ? 477 LEU C CB   2  
ATOM 1227  C CG   . LEU A 1 25 ? -12.056 -8.301  3.170   1.00 0.00 ? 477 LEU C CG   2  
ATOM 1228  C CD1  . LEU A 1 25 ? -10.819 -8.117  2.307   1.00 0.00 ? 477 LEU C CD1  2  
ATOM 1229  C CD2  . LEU A 1 25 ? -12.032 -7.320  4.327   1.00 0.00 ? 477 LEU C CD2  2  
ATOM 1230  H H    . LEU A 1 25 ? -14.105 -10.392 3.075   1.00 0.00 ? 477 LEU C H    2  
ATOM 1231  H HA   . LEU A 1 25 ? -14.657 -7.846  3.988   1.00 0.00 ? 477 LEU C HA   2  
ATOM 1232  H HB2  . LEU A 1 25 ? -13.259 -8.800  1.499   1.00 0.00 ? 477 LEU C HB2  2  
ATOM 1233  H HB3  . LEU A 1 25 ? -13.306 -7.114  1.924   1.00 0.00 ? 477 LEU C HB3  2  
ATOM 1234  H HG   . LEU A 1 25 ? -12.043 -9.304  3.572   1.00 0.00 ? 477 LEU C HG   2  
ATOM 1235  H HD11 . LEU A 1 25 ? -10.832 -8.832  1.498   1.00 0.00 ? 477 LEU C HD11 2  
ATOM 1236  H HD12 . LEU A 1 25 ? -9.936  -8.271  2.908   1.00 0.00 ? 477 LEU C HD12 2  
ATOM 1237  H HD13 . LEU A 1 25 ? -10.808 -7.116  1.903   1.00 0.00 ? 477 LEU C HD13 2  
ATOM 1238  H HD21 . LEU A 1 25 ? -12.890 -7.485  4.960   1.00 0.00 ? 477 LEU C HD21 2  
ATOM 1239  H HD22 . LEU A 1 25 ? -12.057 -6.310  3.945   1.00 0.00 ? 477 LEU C HD22 2  
ATOM 1240  H HD23 . LEU A 1 25 ? -11.129 -7.464  4.902   1.00 0.00 ? 477 LEU C HD23 2  
ATOM 1241  N N    . GLN A 1 26 ? -16.219 -8.558  1.201   1.00 0.00 ? 478 GLN C N    2  
ATOM 1242  C CA   . GLN A 1 26 ? -17.282 -8.186  0.292   1.00 0.00 ? 478 GLN C CA   2  
ATOM 1243  C C    . GLN A 1 26 ? -18.536 -7.747  1.050   1.00 0.00 ? 478 GLN C C    2  
ATOM 1244  O O    . GLN A 1 26 ? -19.033 -6.641  0.852   1.00 0.00 ? 478 GLN C O    2  
ATOM 1245  C CB   . GLN A 1 26 ? -17.612 -9.377  -0.600  1.00 0.00 ? 478 GLN C CB   2  
ATOM 1246  C CG   . GLN A 1 26 ? -18.714 -9.116  -1.601  1.00 0.00 ? 478 GLN C CG   2  
ATOM 1247  C CD   . GLN A 1 26 ? -19.189 -10.380 -2.291  1.00 0.00 ? 478 GLN C CD   2  
ATOM 1248  O OE1  . GLN A 1 26 ? -19.599 -10.352 -3.450  1.00 0.00 ? 478 GLN C OE1  2  
ATOM 1249  N NE2  . GLN A 1 26 ? -19.152 -11.496 -1.581  1.00 0.00 ? 478 GLN C NE2  2  
ATOM 1250  H H    . GLN A 1 26 ? -15.803 -9.437  1.095   1.00 0.00 ? 478 GLN C H    2  
ATOM 1251  H HA   . GLN A 1 26 ? -16.933 -7.374  -0.327  1.00 0.00 ? 478 GLN C HA   2  
ATOM 1252  H HB2  . GLN A 1 26 ? -16.722 -9.659  -1.143  1.00 0.00 ? 478 GLN C HB2  2  
ATOM 1253  H HB3  . GLN A 1 26 ? -17.913 -10.200 0.030   1.00 0.00 ? 478 GLN C HB3  2  
ATOM 1254  H HG2  . GLN A 1 26 ? -19.547 -8.668  -1.080  1.00 0.00 ? 478 GLN C HG2  2  
ATOM 1255  H HG3  . GLN A 1 26 ? -18.343 -8.429  -2.347  1.00 0.00 ? 478 GLN C HG3  2  
ATOM 1256  H HE21 . GLN A 1 26 ? -18.823 -11.456 -0.658  1.00 0.00 ? 478 GLN C HE21 2  
ATOM 1257  H HE22 . GLN A 1 26 ? -19.461 -12.325 -2.006  1.00 0.00 ? 478 GLN C HE22 2  
ATOM 1258  N N    . ASP A 1 27 ? -19.025 -8.609  1.936   1.00 0.00 ? 479 ASP C N    2  
ATOM 1259  C CA   . ASP A 1 27 ? -20.250 -8.327  2.686   1.00 0.00 ? 479 ASP C CA   2  
ATOM 1260  C C    . ASP A 1 27 ? -20.024 -7.225  3.699   1.00 0.00 ? 479 ASP C C    2  
ATOM 1261  O O    . ASP A 1 27 ? -20.941 -6.497  4.054   1.00 0.00 ? 479 ASP C O    2  
ATOM 1262  C CB   . ASP A 1 27 ? -20.754 -9.573  3.388   1.00 0.00 ? 479 ASP C CB   2  
ATOM 1263  C CG   . ASP A 1 27 ? -22.170 -9.409  3.917   1.00 0.00 ? 479 ASP C CG   2  
ATOM 1264  O OD1  . ASP A 1 27 ? -22.341 -8.940  5.075   1.00 0.00 ? 479 ASP C OD1  2  
ATOM 1265  O OD2  . ASP A 1 27 ? -23.115 -9.749  3.182   1.00 0.00 ? 479 ASP C OD2  2  
ATOM 1266  H H    . ASP A 1 27 ? -18.549 -9.452  2.100   1.00 0.00 ? 479 ASP C H    2  
ATOM 1267  H HA   . ASP A 1 27 ? -21.001 -7.999  1.983   1.00 0.00 ? 479 ASP C HA   2  
ATOM 1268  H HB2  . ASP A 1 27 ? -20.736 -10.397 2.692   1.00 0.00 ? 479 ASP C HB2  2  
ATOM 1269  H HB3  . ASP A 1 27 ? -20.099 -9.791  4.217   1.00 0.00 ? 479 ASP C HB3  2  
ATOM 1270  N N    . LEU A 1 28 ? -18.794 -7.081  4.143   1.00 0.00 ? 480 LEU C N    2  
ATOM 1271  C CA   . LEU A 1 28 ? -18.459 -6.043  5.092   1.00 0.00 ? 480 LEU C CA   2  
ATOM 1272  C C    . LEU A 1 28 ? -18.499 -4.679  4.429   1.00 0.00 ? 480 LEU C C    2  
ATOM 1273  O O    . LEU A 1 28 ? -18.525 -3.655  5.097   1.00 0.00 ? 480 LEU C O    2  
ATOM 1274  C CB   . LEU A 1 28 ? -17.110 -6.295  5.767   1.00 0.00 ? 480 LEU C CB   2  
ATOM 1275  C CG   . LEU A 1 28 ? -17.150 -7.142  7.045   1.00 0.00 ? 480 LEU C CG   2  
ATOM 1276  C CD1  . LEU A 1 28 ? -18.261 -6.684  7.974   1.00 0.00 ? 480 LEU C CD1  2  
ATOM 1277  C CD2  . LEU A 1 28 ? -17.325 -8.584  6.713   1.00 0.00 ? 480 LEU C CD2  2  
ATOM 1278  H H    . LEU A 1 28 ? -18.100 -7.683  3.817   1.00 0.00 ? 480 LEU C H    2  
ATOM 1279  H HA   . LEU A 1 28 ? -19.231 -6.060  5.847   1.00 0.00 ? 480 LEU C HA   2  
ATOM 1280  H HB2  . LEU A 1 28 ? -16.473 -6.798  5.057   1.00 0.00 ? 480 LEU C HB2  2  
ATOM 1281  H HB3  . LEU A 1 28 ? -16.665 -5.352  6.002   1.00 0.00 ? 480 LEU C HB3  2  
ATOM 1282  H HG   . LEU A 1 28 ? -16.211 -7.028  7.571   1.00 0.00 ? 480 LEU C HG   2  
ATOM 1283  H HD11 . LEU A 1 28 ? -19.216 -6.963  7.555   1.00 0.00 ? 480 LEU C HD11 2  
ATOM 1284  H HD12 . LEU A 1 28 ? -18.218 -5.611  8.086   1.00 0.00 ? 480 LEU C HD12 2  
ATOM 1285  H HD13 . LEU A 1 28 ? -18.140 -7.153  8.938   1.00 0.00 ? 480 LEU C HD13 2  
ATOM 1286  H HD21 . LEU A 1 28 ? -16.502 -8.909  6.098   1.00 0.00 ? 480 LEU C HD21 2  
ATOM 1287  H HD22 . LEU A 1 28 ? -18.255 -8.700  6.173   1.00 0.00 ? 480 LEU C HD22 2  
ATOM 1288  H HD23 . LEU A 1 28 ? -17.351 -9.160  7.626   1.00 0.00 ? 480 LEU C HD23 2  
ATOM 1289  N N    . GLN A 1 29 ? -18.492 -4.674  3.112   1.00 0.00 ? 481 GLN C N    2  
ATOM 1290  C CA   . GLN A 1 29 ? -18.672 -3.458  2.361   1.00 0.00 ? 481 GLN C CA   2  
ATOM 1291  C C    . GLN A 1 29 ? -20.147 -3.205  2.154   1.00 0.00 ? 481 GLN C C    2  
ATOM 1292  O O    . GLN A 1 29 ? -20.572 -2.082  1.907   1.00 0.00 ? 481 GLN C O    2  
ATOM 1293  C CB   . GLN A 1 29 ? -17.961 -3.545  1.020   1.00 0.00 ? 481 GLN C CB   2  
ATOM 1294  C CG   . GLN A 1 29 ? -16.521 -3.113  1.085   1.00 0.00 ? 481 GLN C CG   2  
ATOM 1295  C CD   . GLN A 1 29 ? -16.390 -1.638  1.403   1.00 0.00 ? 481 GLN C CD   2  
ATOM 1296  O OE1  . GLN A 1 29 ? -16.337 -0.795  0.507   1.00 0.00 ? 481 GLN C OE1  2  
ATOM 1297  N NE2  . GLN A 1 29 ? -16.363 -1.312  2.676   1.00 0.00 ? 481 GLN C NE2  2  
ATOM 1298  H H    . GLN A 1 29 ? -18.346 -5.515  2.626   1.00 0.00 ? 481 GLN C H    2  
ATOM 1299  H HA   . GLN A 1 29 ? -18.249 -2.645  2.932   1.00 0.00 ? 481 GLN C HA   2  
ATOM 1300  H HB2  . GLN A 1 29 ? -17.996 -4.568  0.673   1.00 0.00 ? 481 GLN C HB2  2  
ATOM 1301  H HB3  . GLN A 1 29 ? -18.475 -2.915  0.310   1.00 0.00 ? 481 GLN C HB3  2  
ATOM 1302  H HG2  . GLN A 1 29 ? -16.018 -3.681  1.854   1.00 0.00 ? 481 GLN C HG2  2  
ATOM 1303  H HG3  . GLN A 1 29 ? -16.059 -3.306  0.132   1.00 0.00 ? 481 GLN C HG3  2  
ATOM 1304  H HE21 . GLN A 1 29 ? -16.426 -2.031  3.339   1.00 0.00 ? 481 GLN C HE21 2  
ATOM 1305  H HE22 . GLN A 1 29 ? -16.281 -0.363  2.915   1.00 0.00 ? 481 GLN C HE22 2  
ATOM 1306  N N    . LEU A 1 30 ? -20.923 -4.261  2.280   1.00 0.00 ? 482 LEU C N    2  
ATOM 1307  C CA   . LEU A 1 30 ? -22.346 -4.197  2.078   1.00 0.00 ? 482 LEU C CA   2  
ATOM 1308  C C    . LEU A 1 30 ? -23.068 -3.860  3.381   1.00 0.00 ? 482 LEU C C    2  
ATOM 1309  O O    . LEU A 1 30 ? -23.876 -2.933  3.432   1.00 0.00 ? 482 LEU C O    2  
ATOM 1310  C CB   . LEU A 1 30 ? -22.855 -5.541  1.546   1.00 0.00 ? 482 LEU C CB   2  
ATOM 1311  C CG   . LEU A 1 30 ? -22.039 -6.177  0.416   1.00 0.00 ? 482 LEU C CG   2  
ATOM 1312  C CD1  . LEU A 1 30 ? -22.731 -7.422  -0.114  1.00 0.00 ? 482 LEU C CD1  2  
ATOM 1313  C CD2  . LEU A 1 30 ? -21.782 -5.185  -0.702  1.00 0.00 ? 482 LEU C CD2  2  
ATOM 1314  H H    . LEU A 1 30 ? -20.525 -5.123  2.517   1.00 0.00 ? 482 LEU C H    2  
ATOM 1315  H HA   . LEU A 1 30 ? -22.552 -3.432  1.345   1.00 0.00 ? 482 LEU C HA   2  
ATOM 1316  H HB2  . LEU A 1 30 ? -22.882 -6.237  2.371   1.00 0.00 ? 482 LEU C HB2  2  
ATOM 1317  H HB3  . LEU A 1 30 ? -23.860 -5.399  1.195   1.00 0.00 ? 482 LEU C HB3  2  
ATOM 1318  H HG   . LEU A 1 30 ? -21.081 -6.483  0.814   1.00 0.00 ? 482 LEU C HG   2  
ATOM 1319  H HD11 . LEU A 1 30 ? -23.704 -7.155  -0.499  1.00 0.00 ? 482 LEU C HD11 2  
ATOM 1320  H HD12 . LEU A 1 30 ? -22.845 -8.140  0.684   1.00 0.00 ? 482 LEU C HD12 2  
ATOM 1321  H HD13 . LEU A 1 30 ? -22.138 -7.854  -0.907  1.00 0.00 ? 482 LEU C HD13 2  
ATOM 1322  H HD21 . LEU A 1 30 ? -21.198 -4.364  -0.310  1.00 0.00 ? 482 LEU C HD21 2  
ATOM 1323  H HD22 . LEU A 1 30 ? -22.721 -4.817  -1.083  1.00 0.00 ? 482 LEU C HD22 2  
ATOM 1324  H HD23 . LEU A 1 30 ? -21.230 -5.673  -1.491  1.00 0.00 ? 482 LEU C HD23 2  
ATOM 1325  N N    . THR A 1 31 ? -22.767 -4.609  4.433   1.00 0.00 ? 483 THR C N    2  
ATOM 1326  C CA   . THR A 1 31 ? -23.446 -4.429  5.700   1.00 0.00 ? 483 THR C CA   2  
ATOM 1327  C C    . THR A 1 31 ? -22.571 -3.731  6.729   1.00 0.00 ? 483 THR C C    2  
ATOM 1328  O O    . THR A 1 31 ? -23.078 -3.017  7.600   1.00 0.00 ? 483 THR C O    2  
ATOM 1329  C CB   . THR A 1 31 ? -23.905 -5.778  6.270   1.00 0.00 ? 483 THR C CB   2  
ATOM 1330  O OG1  . THR A 1 31 ? -22.767 -6.637  6.446   1.00 0.00 ? 483 THR C OG1  2  
ATOM 1331  C CG2  . THR A 1 31 ? -24.899 -6.439  5.335   1.00 0.00 ? 483 THR C CG2  2  
ATOM 1332  H H    . THR A 1 31 ? -22.075 -5.312  4.357   1.00 0.00 ? 483 THR C H    2  
ATOM 1333  H HA   . THR A 1 31 ? -24.324 -3.828  5.522   1.00 0.00 ? 483 THR C HA   2  
ATOM 1334  H HB   . THR A 1 31 ? -24.377 -5.612  7.225   1.00 0.00 ? 483 THR C HB   2  
ATOM 1335  H HG1  . THR A 1 31 ? -22.785 -7.363  5.794   1.00 0.00 ? 483 THR C HG1  2  
ATOM 1336  H HG21 . THR A 1 31 ? -24.416 -6.674  4.399   1.00 0.00 ? 483 THR C HG21 2  
ATOM 1337  H HG22 . THR A 1 31 ? -25.722 -5.764  5.153   1.00 0.00 ? 483 THR C HG22 2  
ATOM 1338  H HG23 . THR A 1 31 ? -25.270 -7.346  5.789   1.00 0.00 ? 483 THR C HG23 2  
ATOM 1339  N N    . ARG A 1 32 ? -21.248 -3.938  6.627   1.00 0.00 ? 484 ARG C N    2  
ATOM 1340  C CA   . ARG A 1 32 ? -20.286 -3.369  7.572   1.00 0.00 ? 484 ARG C CA   2  
ATOM 1341  C C    . ARG A 1 32 ? -20.518 -3.900  8.989   1.00 0.00 ? 484 ARG C C    2  
ATOM 1342  O O    . ARG A 1 32 ? -20.012 -3.343  9.968   1.00 0.00 ? 484 ARG C O    2  
ATOM 1343  C CB   . ARG A 1 32 ? -20.363 -1.852  7.556   1.00 0.00 ? 484 ARG C CB   2  
ATOM 1344  C CG   . ARG A 1 32 ? -20.178 -1.253  6.182   1.00 0.00 ? 484 ARG C CG   2  
ATOM 1345  C CD   . ARG A 1 32 ? -20.331 0.243   6.214   1.00 0.00 ? 484 ARG C CD   2  
ATOM 1346  N NE   . ARG A 1 32 ? -21.666 0.651   6.663   1.00 0.00 ? 484 ARG C NE   2  
ATOM 1347  C CZ   . ARG A 1 32 ? -21.994 1.894   7.032   1.00 0.00 ? 484 ARG C CZ   2  
ATOM 1348  N NH1  . ARG A 1 32 ? -21.092 2.868   6.983   1.00 0.00 ? 484 ARG C NH1  2  
ATOM 1349  N NH2  . ARG A 1 32 ? -23.224 2.163   7.440   1.00 0.00 ? 484 ARG C NH2  2  
ATOM 1350  H H    . ARG A 1 32 ? -20.904 -4.475  5.887   1.00 0.00 ? 484 ARG C H    2  
ATOM 1351  H HA   . ARG A 1 32 ? -19.299 -3.666  7.248   1.00 0.00 ? 484 ARG C HA   2  
ATOM 1352  H HB2  . ARG A 1 32 ? -21.324 -1.542  7.933   1.00 0.00 ? 484 ARG C HB2  2  
ATOM 1353  H HB3  . ARG A 1 32 ? -19.590 -1.468  8.197   1.00 0.00 ? 484 ARG C HB3  2  
ATOM 1354  H HG2  . ARG A 1 32 ? -19.187 -1.496  5.828   1.00 0.00 ? 484 ARG C HG2  2  
ATOM 1355  H HG3  . ARG A 1 32 ? -20.915 -1.671  5.512   1.00 0.00 ? 484 ARG C HG3  2  
ATOM 1356  H HD2  . ARG A 1 32 ? -19.593 0.642   6.890   1.00 0.00 ? 484 ARG C HD2  2  
ATOM 1357  H HD3  . ARG A 1 32 ? -20.160 0.621   5.219   1.00 0.00 ? 484 ARG C HD3  2  
ATOM 1358  H HE   . ARG A 1 32 ? -22.358 -0.052  6.692   1.00 0.00 ? 484 ARG C HE   2  
ATOM 1359  H HH11 . ARG A 1 32 ? -20.158 2.686   6.670   1.00 0.00 ? 484 ARG C HH11 2  
ATOM 1360  H HH12 . ARG A 1 32 ? -21.341 3.799   7.264   1.00 0.00 ? 484 ARG C HH12 2  
ATOM 1361  H HH21 . ARG A 1 32 ? -23.919 1.441   7.478   1.00 0.00 ? 484 ARG C HH21 2  
ATOM 1362  H HH22 . ARG A 1 32 ? -23.476 3.094   7.722   1.00 0.00 ? 484 ARG C HH22 2  
ATOM 1363  N N    . SER A 1 33 ? -21.259 -4.994  9.084   1.00 0.00 ? 485 SER C N    2  
ATOM 1364  C CA   . SER A 1 33 ? -21.583 -5.594  10.358  1.00 0.00 ? 485 SER C CA   2  
ATOM 1365  C C    . SER A 1 33 ? -21.282 -7.072  10.326  1.00 0.00 ? 485 SER C C    2  
ATOM 1366  O O    . SER A 1 33 ? -21.995 -7.835  9.675   1.00 0.00 ? 485 SER C O    2  
ATOM 1367  C CB   . SER A 1 33 ? -23.061 -5.383  10.680  1.00 0.00 ? 485 SER C CB   2  
ATOM 1368  O OG   . SER A 1 33 ? -23.379 -5.879  11.972  1.00 0.00 ? 485 SER C OG   2  
ATOM 1369  H H    . SER A 1 33 ? -21.594 -5.420  8.266   1.00 0.00 ? 485 SER C H    2  
ATOM 1370  H HA   . SER A 1 33 ? -20.987 -5.122  11.120  1.00 0.00 ? 485 SER C HA   2  
ATOM 1371  H HB2  . SER A 1 33 ? -23.306 -4.337  10.629  1.00 0.00 ? 485 SER C HB2  2  
ATOM 1372  H HB3  . SER A 1 33 ? -23.655 -5.919  9.954   1.00 0.00 ? 485 SER C HB3  2  
ATOM 1373  H HG   . SER A 1 33 ? -23.963 -5.254  12.422  1.00 0.00 ? 485 SER C HG   2  
ATOM 1374  N N    . VAL A 1 34 ? -20.232 -7.483  11.024  1.00 0.00 ? 486 VAL C N    2  
ATOM 1375  C CA   . VAL A 1 34 ? -19.844 -8.882  11.065  1.00 0.00 ? 486 VAL C CA   2  
ATOM 1376  C C    . VAL A 1 34 ? -20.972 -9.770  11.585  1.00 0.00 ? 486 VAL C C    2  
ATOM 1377  O O    . VAL A 1 34 ? -21.093 -10.929 11.182  1.00 0.00 ? 486 VAL C O    2  
ATOM 1378  C CB   . VAL A 1 34 ? -18.569 -9.113  11.908  1.00 0.00 ? 486 VAL C CB   2  
ATOM 1379  C CG1  . VAL A 1 34 ? -17.446 -8.233  11.429  1.00 0.00 ? 486 VAL C CG1  2  
ATOM 1380  C CG2  . VAL A 1 34 ? -18.821 -8.905  13.385  1.00 0.00 ? 486 VAL C CG2  2  
ATOM 1381  H H    . VAL A 1 34 ? -19.689 -6.824  11.511  1.00 0.00 ? 486 VAL C H    2  
ATOM 1382  H HA   . VAL A 1 34 ? -19.630 -9.174  10.047  1.00 0.00 ? 486 VAL C HA   2  
ATOM 1383  H HB   . VAL A 1 34 ? -18.265 -10.137 11.764  1.00 0.00 ? 486 VAL C HB   2  
ATOM 1384  H HG11 . VAL A 1 34 ? -17.744 -7.198  11.498  1.00 0.00 ? 486 VAL C HG11 2  
ATOM 1385  H HG12 . VAL A 1 34 ? -17.213 -8.474  10.403  1.00 0.00 ? 486 VAL C HG12 2  
ATOM 1386  H HG13 . VAL A 1 34 ? -16.574 -8.397  12.044  1.00 0.00 ? 486 VAL C HG13 2  
ATOM 1387  H HG21 . VAL A 1 34 ? -19.578 -9.598  13.721  1.00 0.00 ? 486 VAL C HG21 2  
ATOM 1388  H HG22 . VAL A 1 34 ? -19.150 -7.892  13.561  1.00 0.00 ? 486 VAL C HG22 2  
ATOM 1389  H HG23 . VAL A 1 34 ? -17.904 -9.090  13.924  1.00 0.00 ? 486 VAL C HG23 2  
ATOM 1390  N N    . GLU A 1 35 ? -21.806 -9.220  12.464  1.00 0.00 ? 487 GLU C N    2  
ATOM 1391  C CA   . GLU A 1 35 ? -22.924 -9.960  13.021  1.00 0.00 ? 487 GLU C CA   2  
ATOM 1392  C C    . GLU A 1 35 ? -23.912 -10.308 11.922  1.00 0.00 ? 487 GLU C C    2  
ATOM 1393  O O    . GLU A 1 35 ? -24.448 -11.422 11.878  1.00 0.00 ? 487 GLU C O    2  
ATOM 1394  C CB   . GLU A 1 35 ? -23.608 -9.150  14.120  1.00 0.00 ? 487 GLU C CB   2  
ATOM 1395  C CG   . GLU A 1 35 ? -22.670 -8.730  15.241  1.00 0.00 ? 487 GLU C CG   2  
ATOM 1396  C CD   . GLU A 1 35 ? -22.015 -9.907  15.939  1.00 0.00 ? 487 GLU C CD   2  
ATOM 1397  O OE1  . GLU A 1 35 ? -22.612 -10.440 16.896  1.00 0.00 ? 487 GLU C OE1  2  
ATOM 1398  O OE2  . GLU A 1 35 ? -20.890 -10.291 15.545  1.00 0.00 ? 487 GLU C OE2  2  
ATOM 1399  H H    . GLU A 1 35 ? -21.658 -8.290  12.741  1.00 0.00 ? 487 GLU C H    2  
ATOM 1400  H HA   . GLU A 1 35 ? -22.537 -10.876 13.443  1.00 0.00 ? 487 GLU C HA   2  
ATOM 1401  H HB2  . GLU A 1 35 ? -24.033 -8.260  13.681  1.00 0.00 ? 487 GLU C HB2  2  
ATOM 1402  H HB3  . GLU A 1 35 ? -24.401 -9.745  14.547  1.00 0.00 ? 487 GLU C HB3  2  
ATOM 1403  H HG2  . GLU A 1 35 ? -21.896 -8.103  14.825  1.00 0.00 ? 487 GLU C HG2  2  
ATOM 1404  H HG3  . GLU A 1 35 ? -23.235 -8.165  15.968  1.00 0.00 ? 487 GLU C HG3  2  
ATOM 1405  N N    . ILE A 1 36 ? -24.133 -9.357  11.020  1.00 0.00 ? 488 ILE C N    2  
ATOM 1406  C CA   . ILE A 1 36 ? -25.008 -9.578  9.892   1.00 0.00 ? 488 ILE C CA   2  
ATOM 1407  C C    . ILE A 1 36 ? -24.311 -10.467 8.883   1.00 0.00 ? 488 ILE C C    2  
ATOM 1408  O O    . ILE A 1 36 ? -24.850 -11.454 8.477   1.00 0.00 ? 488 ILE C O    2  
ATOM 1409  C CB   . ILE A 1 36 ? -25.422 -8.259  9.205   1.00 0.00 ? 488 ILE C CB   2  
ATOM 1410  C CG1  . ILE A 1 36 ? -26.018 -7.285  10.229  1.00 0.00 ? 488 ILE C CG1  2  
ATOM 1411  C CG2  . ILE A 1 36 ? -26.428 -8.540  8.094   1.00 0.00 ? 488 ILE C CG2  2  
ATOM 1412  C CD1  . ILE A 1 36 ? -26.469 -5.964  9.635   1.00 0.00 ? 488 ILE C CD1  2  
ATOM 1413  H H    . ILE A 1 36 ? -23.686 -8.489  11.120  1.00 0.00 ? 488 ILE C H    2  
ATOM 1414  H HA   . ILE A 1 36 ? -25.895 -10.080 10.249  1.00 0.00 ? 488 ILE C HA   2  
ATOM 1415  H HB   . ILE A 1 36 ? -24.542 -7.824  8.758   1.00 0.00 ? 488 ILE C HB   2  
ATOM 1416  H HG12 . ILE A 1 36 ? -26.878 -7.745  10.692  1.00 0.00 ? 488 ILE C HG12 2  
ATOM 1417  H HG13 . ILE A 1 36 ? -25.279 -7.076  10.988  1.00 0.00 ? 488 ILE C HG13 2  
ATOM 1418  H HG21 . ILE A 1 36 ? -27.297 -9.025  8.514   1.00 0.00 ? 488 ILE C HG21 2  
ATOM 1419  H HG22 . ILE A 1 36 ? -25.977 -9.186  7.354   1.00 0.00 ? 488 ILE C HG22 2  
ATOM 1420  H HG23 . ILE A 1 36 ? -26.722 -7.611  7.631   1.00 0.00 ? 488 ILE C HG23 2  
ATOM 1421  H HD11 . ILE A 1 36 ? -27.230 -6.144  8.892   1.00 0.00 ? 488 ILE C HD11 2  
ATOM 1422  H HD12 . ILE A 1 36 ? -25.625 -5.470  9.175   1.00 0.00 ? 488 ILE C HD12 2  
ATOM 1423  H HD13 . ILE A 1 36 ? -26.868 -5.336  10.418  1.00 0.00 ? 488 ILE C HD13 2  
ATOM 1424  N N    . THR A 1 37 ? -23.092 -10.088 8.509   1.00 0.00 ? 489 THR C N    2  
ATOM 1425  C CA   . THR A 1 37 ? -22.254 -10.848 7.586   1.00 0.00 ? 489 THR C CA   2  
ATOM 1426  C C    . THR A 1 37 ? -22.241 -12.352 7.914   1.00 0.00 ? 489 THR C C    2  
ATOM 1427  O O    . THR A 1 37 ? -22.345 -13.182 7.020   1.00 0.00 ? 489 THR C O    2  
ATOM 1428  C CB   . THR A 1 37 ? -20.817 -10.299 7.611   1.00 0.00 ? 489 THR C CB   2  
ATOM 1429  O OG1  . THR A 1 37 ? -20.841 -8.899  7.321   1.00 0.00 ? 489 THR C OG1  2  
ATOM 1430  C CG2  . THR A 1 37 ? -19.933 -11.002 6.596   1.00 0.00 ? 489 THR C CG2  2  
ATOM 1431  H H    . THR A 1 37 ? -22.737 -9.238  8.838   1.00 0.00 ? 489 THR C H    2  
ATOM 1432  H HA   . THR A 1 37 ? -22.646 -10.708 6.590   1.00 0.00 ? 489 THR C HA   2  
ATOM 1433  H HB   . THR A 1 37 ? -20.413 -10.454 8.599   1.00 0.00 ? 489 THR C HB   2  
ATOM 1434  H HG1  . THR A 1 37 ? -21.376 -8.759  6.521   1.00 0.00 ? 489 THR C HG1  2  
ATOM 1435  H HG21 . THR A 1 37 ? -20.426 -11.012 5.638   1.00 0.00 ? 489 THR C HG21 2  
ATOM 1436  H HG22 . THR A 1 37 ? -19.738 -12.014 6.919   1.00 0.00 ? 489 THR C HG22 2  
ATOM 1437  H HG23 . THR A 1 37 ? -18.999 -10.459 6.512   1.00 0.00 ? 489 THR C HG23 2  
ATOM 1438  N N    . THR A 1 38 ? -22.134 -12.690 9.196   1.00 0.00 ? 490 THR C N    2  
ATOM 1439  C CA   . THR A 1 38 ? -22.130 -14.085 9.612   1.00 0.00 ? 490 THR C CA   2  
ATOM 1440  C C    . THR A 1 38 ? -23.469 -14.743 9.273   1.00 0.00 ? 490 THR C C    2  
ATOM 1441  O O    . THR A 1 38 ? -23.512 -15.849 8.730   1.00 0.00 ? 490 THR C O    2  
ATOM 1442  C CB   . THR A 1 38 ? -21.859 -14.217 11.124  1.00 0.00 ? 490 THR C CB   2  
ATOM 1443  O OG1  . THR A 1 38 ? -20.652 -13.513 11.466  1.00 0.00 ? 490 THR C OG1  2  
ATOM 1444  C CG2  . THR A 1 38 ? -21.712 -15.673 11.508  1.00 0.00 ? 490 THR C CG2  2  
ATOM 1445  H H    . THR A 1 38 ? -22.063 -11.989 9.875   1.00 0.00 ? 490 THR C H    2  
ATOM 1446  H HA   . THR A 1 38 ? -21.349 -14.608 9.074   1.00 0.00 ? 490 THR C HA   2  
ATOM 1447  H HB   . THR A 1 38 ? -22.690 -13.791 11.669  1.00 0.00 ? 490 THR C HB   2  
ATOM 1448  H HG1  . THR A 1 38 ? -20.742 -12.584 11.221  1.00 0.00 ? 490 THR C HG1  2  
ATOM 1449  H HG21 . THR A 1 38 ? -20.918 -16.116 10.919  1.00 0.00 ? 490 THR C HG21 2  
ATOM 1450  H HG22 . THR A 1 38 ? -22.639 -16.192 11.311  1.00 0.00 ? 490 THR C HG22 2  
ATOM 1451  H HG23 . THR A 1 38 ? -21.468 -15.749 12.557  1.00 0.00 ? 490 THR C HG23 2  
ATOM 1452  N N    . ASP A 1 39 ? -24.552 -14.038 9.566   1.00 0.00 ? 491 ASP C N    2  
ATOM 1453  C CA   . ASP A 1 39 ? -25.894 -14.536 9.272   1.00 0.00 ? 491 ASP C CA   2  
ATOM 1454  C C    . ASP A 1 39 ? -26.116 -14.505 7.772   1.00 0.00 ? 491 ASP C C    2  
ATOM 1455  O O    . ASP A 1 39 ? -26.775 -15.369 7.205   1.00 0.00 ? 491 ASP C O    2  
ATOM 1456  C CB   . ASP A 1 39 ? -26.946 -13.686 9.983   1.00 0.00 ? 491 ASP C CB   2  
ATOM 1457  C CG   . ASP A 1 39 ? -28.320 -14.319 9.952   1.00 0.00 ? 491 ASP C CG   2  
ATOM 1458  O OD1  . ASP A 1 39 ? -28.494 -15.396 10.572  1.00 0.00 ? 491 ASP C OD1  2  
ATOM 1459  O OD2  . ASP A 1 39 ? -29.233 -13.742 9.325   1.00 0.00 ? 491 ASP C OD2  2  
ATOM 1460  H H    . ASP A 1 39 ? -24.448 -13.150 9.974   1.00 0.00 ? 491 ASP C H    2  
ATOM 1461  H HA   . ASP A 1 39 ? -25.963 -15.559 9.615   1.00 0.00 ? 491 ASP C HA   2  
ATOM 1462  H HB2  . ASP A 1 39 ? -26.657 -13.549 11.014  1.00 0.00 ? 491 ASP C HB2  2  
ATOM 1463  H HB3  . ASP A 1 39 ? -27.004 -12.721 9.500   1.00 0.00 ? 491 ASP C HB3  2  
ATOM 1464  N N    . ASN A 1 40 ? -25.531 -13.499 7.144   1.00 0.00 ? 492 ASN C N    2  
ATOM 1465  C CA   . ASN A 1 40 ? -25.556 -13.331 5.711   1.00 0.00 ? 492 ASN C CA   2  
ATOM 1466  C C    . ASN A 1 40 ? -24.975 -14.563 5.035   1.00 0.00 ? 492 ASN C C    2  
ATOM 1467  O O    . ASN A 1 40 ? -25.554 -15.100 4.088   1.00 0.00 ? 492 ASN C O    2  
ATOM 1468  C CB   . ASN A 1 40 ? -24.773 -12.068 5.315   1.00 0.00 ? 492 ASN C CB   2  
ATOM 1469  C CG   . ASN A 1 40 ? -25.670 -10.869 5.105   1.00 0.00 ? 492 ASN C CG   2  
ATOM 1470  O OD1  . ASN A 1 40 ? -26.849 -11.004 4.772   1.00 0.00 ? 492 ASN C OD1  2  
ATOM 1471  N ND2  . ASN A 1 40 ? -25.117 -9.691  5.254   1.00 0.00 ? 492 ASN C ND2  2  
ATOM 1472  H H    . ASN A 1 40 ? -25.065 -12.825 7.687   1.00 0.00 ? 492 ASN C H    2  
ATOM 1473  H HA   . ASN A 1 40 ? -26.587 -13.201 5.420   1.00 0.00 ? 492 ASN C HA   2  
ATOM 1474  H HB2  . ASN A 1 40 ? -24.097 -11.821 6.120   1.00 0.00 ? 492 ASN C HB2  2  
ATOM 1475  H HB3  . ASN A 1 40 ? -24.195 -12.232 4.428   1.00 0.00 ? 492 ASN C HB3  2  
ATOM 1476  H HD21 . ASN A 1 40 ? -24.158 -9.650  5.482   1.00 0.00 ? 492 ASN C HD21 2  
ATOM 1477  H HD22 . ASN A 1 40 ? -25.670 -8.898  5.127   1.00 0.00 ? 492 ASN C HD22 2  
ATOM 1478  N N    . ILE A 1 41 ? -23.829 -15.022 5.542   1.00 0.00 ? 493 ILE C N    2  
ATOM 1479  C CA   . ILE A 1 41 ? -23.199 -16.246 5.058   1.00 0.00 ? 493 ILE C CA   2  
ATOM 1480  C C    . ILE A 1 41 ? -24.192 -17.398 5.152   1.00 0.00 ? 493 ILE C C    2  
ATOM 1481  O O    . ILE A 1 41 ? -24.388 -18.157 4.203   1.00 0.00 ? 493 ILE C O    2  
ATOM 1482  C CB   . ILE A 1 41 ? -21.964 -16.626 5.924   1.00 0.00 ? 493 ILE C CB   2  
ATOM 1483  C CG1  . ILE A 1 41 ? -20.918 -15.529 5.918   1.00 0.00 ? 493 ILE C CG1  2  
ATOM 1484  C CG2  . ILE A 1 41 ? -21.351 -17.931 5.446   1.00 0.00 ? 493 ILE C CG2  2  
ATOM 1485  C CD1  . ILE A 1 41 ? -19.847 -15.719 6.974   1.00 0.00 ? 493 ILE C CD1  2  
ATOM 1486  H H    . ILE A 1 41 ? -23.387 -14.509 6.258   1.00 0.00 ? 493 ILE C H    2  
ATOM 1487  H HA   . ILE A 1 41 ? -22.888 -16.093 4.035   1.00 0.00 ? 493 ILE C HA   2  
ATOM 1488  H HB   . ILE A 1 41 ? -22.305 -16.775 6.940   1.00 0.00 ? 493 ILE C HB   2  
ATOM 1489  H HG12 . ILE A 1 41 ? -20.434 -15.516 4.953   1.00 0.00 ? 493 ILE C HG12 2  
ATOM 1490  H HG13 . ILE A 1 41 ? -21.398 -14.583 6.092   1.00 0.00 ? 493 ILE C HG13 2  
ATOM 1491  H HG21 . ILE A 1 41 ? -21.037 -17.819 4.419   1.00 0.00 ? 493 ILE C HG21 2  
ATOM 1492  H HG22 . ILE A 1 41 ? -22.082 -18.722 5.518   1.00 0.00 ? 493 ILE C HG22 2  
ATOM 1493  H HG23 . ILE A 1 41 ? -20.496 -18.169 6.059   1.00 0.00 ? 493 ILE C HG23 2  
ATOM 1494  H HD11 . ILE A 1 41 ? -19.306 -16.630 6.781   1.00 0.00 ? 493 ILE C HD11 2  
ATOM 1495  H HD12 . ILE A 1 41 ? -20.316 -15.788 7.943   1.00 0.00 ? 493 ILE C HD12 2  
ATOM 1496  H HD13 . ILE A 1 41 ? -19.168 -14.881 6.964   1.00 0.00 ? 493 ILE C HD13 2  
ATOM 1497  N N    . LEU A 1 42 ? -24.828 -17.488 6.306   1.00 0.00 ? 494 LEU C N    2  
ATOM 1498  C CA   . LEU A 1 42 ? -25.764 -18.551 6.627   1.00 0.00 ? 494 LEU C CA   2  
ATOM 1499  C C    . LEU A 1 42 ? -27.027 -18.502 5.760   1.00 0.00 ? 494 LEU C C    2  
ATOM 1500  O O    . LEU A 1 42 ? -27.683 -19.524 5.556   1.00 0.00 ? 494 LEU C O    2  
ATOM 1501  C CB   . LEU A 1 42 ? -26.112 -18.481 8.112   1.00 0.00 ? 494 LEU C CB   2  
ATOM 1502  C CG   . LEU A 1 42 ? -24.920 -18.666 9.059   1.00 0.00 ? 494 LEU C CG   2  
ATOM 1503  C CD1  . LEU A 1 42 ? -25.305 -18.346 10.490  1.00 0.00 ? 494 LEU C CD1  2  
ATOM 1504  C CD2  . LEU A 1 42 ? -24.369 -20.078 8.956   1.00 0.00 ? 494 LEU C CD2  2  
ATOM 1505  H H    . LEU A 1 42 ? -24.660 -16.797 6.985   1.00 0.00 ? 494 LEU C H    2  
ATOM 1506  H HA   . LEU A 1 42 ? -25.262 -19.489 6.441   1.00 0.00 ? 494 LEU C HA   2  
ATOM 1507  H HB2  . LEU A 1 42 ? -26.558 -17.516 8.307   1.00 0.00 ? 494 LEU C HB2  2  
ATOM 1508  H HB3  . LEU A 1 42 ? -26.840 -19.244 8.333   1.00 0.00 ? 494 LEU C HB3  2  
ATOM 1509  H HG   . LEU A 1 42 ? -24.137 -17.980 8.770   1.00 0.00 ? 494 LEU C HG   2  
ATOM 1510  H HD11 . LEU A 1 42 ? -26.177 -18.917 10.769  1.00 0.00 ? 494 LEU C HD11 2  
ATOM 1511  H HD12 . LEU A 1 42 ? -25.509 -17.289 10.577  1.00 0.00 ? 494 LEU C HD12 2  
ATOM 1512  H HD13 . LEU A 1 42 ? -24.482 -18.603 11.143  1.00 0.00 ? 494 LEU C HD13 2  
ATOM 1513  H HD21 . LEU A 1 42 ? -23.970 -20.241 7.967   1.00 0.00 ? 494 LEU C HD21 2  
ATOM 1514  H HD22 . LEU A 1 42 ? -25.164 -20.784 9.143   1.00 0.00 ? 494 LEU C HD22 2  
ATOM 1515  H HD23 . LEU A 1 42 ? -23.588 -20.216 9.689   1.00 0.00 ? 494 LEU C HD23 2  
ATOM 1516  N N    . GLU A 1 43 ? -27.370 -17.326 5.255   1.00 0.00 ? 495 GLU C N    2  
ATOM 1517  C CA   . GLU A 1 43 ? -28.529 -17.191 4.377   1.00 0.00 ? 495 GLU C CA   2  
ATOM 1518  C C    . GLU A 1 43 ? -28.152 -17.468 2.934   1.00 0.00 ? 495 GLU C C    2  
ATOM 1519  O O    . GLU A 1 43 ? -29.019 -17.609 2.070   1.00 0.00 ? 495 GLU C O    2  
ATOM 1520  C CB   . GLU A 1 43 ? -29.139 -15.799 4.472   1.00 0.00 ? 495 GLU C CB   2  
ATOM 1521  C CG   . GLU A 1 43 ? -29.713 -15.458 5.825   1.00 0.00 ? 495 GLU C CG   2  
ATOM 1522  C CD   . GLU A 1 43 ? -30.596 -14.243 5.762   1.00 0.00 ? 495 GLU C CD   2  
ATOM 1523  O OE1  . GLU A 1 43 ? -30.064 -13.117 5.708   1.00 0.00 ? 495 GLU C OE1  2  
ATOM 1524  O OE2  . GLU A 1 43 ? -31.835 -14.406 5.738   1.00 0.00 ? 495 GLU C OE2  2  
ATOM 1525  H H    . GLU A 1 43 ? -26.846 -16.529 5.490   1.00 0.00 ? 495 GLU C H    2  
ATOM 1526  H HA   . GLU A 1 43 ? -29.265 -17.916 4.689   1.00 0.00 ? 495 GLU C HA   2  
ATOM 1527  H HB2  . GLU A 1 43 ? -28.374 -15.070 4.242   1.00 0.00 ? 495 GLU C HB2  2  
ATOM 1528  H HB3  . GLU A 1 43 ? -29.928 -15.717 3.740   1.00 0.00 ? 495 GLU C HB3  2  
ATOM 1529  H HG2  . GLU A 1 43 ? -30.297 -16.293 6.177   1.00 0.00 ? 495 GLU C HG2  2  
ATOM 1530  H HG3  . GLU A 1 43 ? -28.902 -15.264 6.512   1.00 0.00 ? 495 GLU C HG3  2  
ATOM 1531  N N    . GLY A 1 44 ? -26.864 -17.539 2.673   1.00 0.00 ? 496 GLY C N    2  
ATOM 1532  C CA   . GLY A 1 44 ? -26.400 -17.772 1.326   1.00 0.00 ? 496 GLY C CA   2  
ATOM 1533  C C    . GLY A 1 44 ? -26.131 -16.480 0.591   1.00 0.00 ? 496 GLY C C    2  
ATOM 1534  O O    . GLY A 1 44 ? -26.095 -16.451 -0.638  1.00 0.00 ? 496 GLY C O    2  
ATOM 1535  H H    . GLY A 1 44 ? -26.218 -17.440 3.406   1.00 0.00 ? 496 GLY C H    2  
ATOM 1536  H HA2  . GLY A 1 44 ? -25.489 -18.352 1.363   1.00 0.00 ? 496 GLY C HA2  2  
ATOM 1537  H HA3  . GLY A 1 44 ? -27.151 -18.330 0.787   1.00 0.00 ? 496 GLY C HA3  2  
ATOM 1538  N N    . ARG A 1 45 ? -25.956 -15.401 1.347   1.00 0.00 ? 497 ARG C N    2  
ATOM 1539  C CA   . ARG A 1 45 ? -25.652 -14.098 0.771   1.00 0.00 ? 497 ARG C CA   2  
ATOM 1540  C C    . ARG A 1 45 ? -24.285 -14.138 0.119   1.00 0.00 ? 497 ARG C C    2  
ATOM 1541  O O    . ARG A 1 45 ? -24.058 -13.536 -0.927  1.00 0.00 ? 497 ARG C O    2  
ATOM 1542  C CB   . ARG A 1 45 ? -25.671 -13.018 1.859   1.00 0.00 ? 497 ARG C CB   2  
ATOM 1543  C CG   . ARG A 1 45 ? -25.378 -11.603 1.353   1.00 0.00 ? 497 ARG C CG   2  
ATOM 1544  C CD   . ARG A 1 45 ? -26.593 -10.963 0.676   1.00 0.00 ? 497 ARG C CD   2  
ATOM 1545  N NE   . ARG A 1 45 ? -27.161 -11.797 -0.391  1.00 0.00 ? 497 ARG C NE   2  
ATOM 1546  C CZ   . ARG A 1 45 ? -26.984 -11.593 -1.700  1.00 0.00 ? 497 ARG C CZ   2  
ATOM 1547  N NH1  . ARG A 1 45 ? -26.230 -10.582 -2.131  1.00 0.00 ? 497 ARG C NH1  2  
ATOM 1548  N NH2  . ARG A 1 45 ? -27.559 -12.404 -2.578  1.00 0.00 ? 497 ARG C NH2  2  
ATOM 1549  H H    . ARG A 1 45 ? -26.033 -15.483 2.325   1.00 0.00 ? 497 ARG C H    2  
ATOM 1550  H HA   . ARG A 1 45 ? -26.400 -13.868 0.026   1.00 0.00 ? 497 ARG C HA   2  
ATOM 1551  H HB2  . ARG A 1 45 ? -26.645 -13.014 2.325   1.00 0.00 ? 497 ARG C HB2  2  
ATOM 1552  H HB3  . ARG A 1 45 ? -24.928 -13.274 2.605   1.00 0.00 ? 497 ARG C HB3  2  
ATOM 1553  H HG2  . ARG A 1 45 ? -25.085 -10.989 2.192   1.00 0.00 ? 497 ARG C HG2  2  
ATOM 1554  H HG3  . ARG A 1 45 ? -24.565 -11.653 0.643   1.00 0.00 ? 497 ARG C HG3  2  
ATOM 1555  H HD2  . ARG A 1 45 ? -27.353 -10.795 1.425   1.00 0.00 ? 497 ARG C HD2  2  
ATOM 1556  H HD3  . ARG A 1 45 ? -26.294 -10.013 0.257   1.00 0.00 ? 497 ARG C HD3  2  
ATOM 1557  H HE   . ARG A 1 45 ? -27.725 -12.555 -0.103  1.00 0.00 ? 497 ARG C HE   2  
ATOM 1558  H HH11 . ARG A 1 45 ? -25.785 -9.961  -1.484  1.00 0.00 ? 497 ARG C HH11 2  
ATOM 1559  H HH12 . ARG A 1 45 ? -26.096 -10.429 -3.114  1.00 0.00 ? 497 ARG C HH12 2  
ATOM 1560  H HH21 . ARG A 1 45 ? -28.127 -13.172 -2.261  1.00 0.00 ? 497 ARG C HH21 2  
ATOM 1561  H HH22 . ARG A 1 45 ? -27.435 -12.266 -3.563  1.00 0.00 ? 497 ARG C HH22 2  
ATOM 1562  N N    . ILE A 1 46 ? -23.389 -14.863 0.748   1.00 0.00 ? 498 ILE C N    2  
ATOM 1563  C CA   . ILE A 1 46 ? -22.043 -15.014 0.269   1.00 0.00 ? 498 ILE C CA   2  
ATOM 1564  C C    . ILE A 1 46 ? -21.858 -16.433 -0.234  1.00 0.00 ? 498 ILE C C    2  
ATOM 1565  O O    . ILE A 1 46 ? -22.270 -17.387 0.431   1.00 0.00 ? 498 ILE C O    2  
ATOM 1566  C CB   . ILE A 1 46 ? -21.025 -14.724 1.397   1.00 0.00 ? 498 ILE C CB   2  
ATOM 1567  C CG1  . ILE A 1 46 ? -21.324 -13.362 2.035   1.00 0.00 ? 498 ILE C CG1  2  
ATOM 1568  C CG2  . ILE A 1 46 ? -19.603 -14.757 0.856   1.00 0.00 ? 498 ILE C CG2  2  
ATOM 1569  C CD1  . ILE A 1 46 ? -20.537 -13.086 3.295   1.00 0.00 ? 498 ILE C CD1  2  
ATOM 1570  H H    . ILE A 1 46 ? -23.651 -15.334 1.563   1.00 0.00 ? 498 ILE C H    2  
ATOM 1571  H HA   . ILE A 1 46 ? -21.882 -14.317 -0.540  1.00 0.00 ? 498 ILE C HA   2  
ATOM 1572  H HB   . ILE A 1 46 ? -21.121 -15.492 2.149   1.00 0.00 ? 498 ILE C HB   2  
ATOM 1573  H HG12 . ILE A 1 46 ? -21.091 -12.583 1.323   1.00 0.00 ? 498 ILE C HG12 2  
ATOM 1574  H HG13 . ILE A 1 46 ? -22.375 -13.315 2.279   1.00 0.00 ? 498 ILE C HG13 2  
ATOM 1575  H HG21 . ILE A 1 46 ? -19.494 -14.002 0.090   1.00 0.00 ? 498 ILE C HG21 2  
ATOM 1576  H HG22 . ILE A 1 46 ? -19.399 -15.730 0.436   1.00 0.00 ? 498 ILE C HG22 2  
ATOM 1577  H HG23 . ILE A 1 46 ? -18.909 -14.557 1.659   1.00 0.00 ? 498 ILE C HG23 2  
ATOM 1578  H HD11 . ILE A 1 46 ? -20.839 -12.133 3.705   1.00 0.00 ? 498 ILE C HD11 2  
ATOM 1579  H HD12 . ILE A 1 46 ? -19.481 -13.063 3.068   1.00 0.00 ? 498 ILE C HD12 2  
ATOM 1580  H HD13 . ILE A 1 46 ? -20.735 -13.861 4.018   1.00 0.00 ? 498 ILE C HD13 2  
ATOM 1581  N N    . GLN A 1 47 ? -21.263 -16.572 -1.402  1.00 0.00 ? 499 GLN C N    2  
ATOM 1582  C CA   . GLN A 1 47 ? -21.064 -17.880 -2.002  1.00 0.00 ? 499 GLN C CA   2  
ATOM 1583  C C    . GLN A 1 47 ? -19.981 -18.659 -1.267  1.00 0.00 ? 499 GLN C C    2  
ATOM 1584  O O    . GLN A 1 47 ? -18.786 -18.402 -1.440  1.00 0.00 ? 499 GLN C O    2  
ATOM 1585  C CB   . GLN A 1 47 ? -20.695 -17.747 -3.482  1.00 0.00 ? 499 GLN C CB   2  
ATOM 1586  C CG   . GLN A 1 47 ? -21.737 -17.022 -4.319  1.00 0.00 ? 499 GLN C CG   2  
ATOM 1587  C CD   . GLN A 1 47 ? -21.344 -16.916 -5.784  1.00 0.00 ? 499 GLN C CD   2  
ATOM 1588  O OE1  . GLN A 1 47 ? -22.201 -16.881 -6.668  1.00 0.00 ? 499 GLN C OE1  2  
ATOM 1589  N NE2  . GLN A 1 47 ? -20.050 -16.865 -6.052  1.00 0.00 ? 499 GLN C NE2  2  
ATOM 1590  H H    . GLN A 1 47 ? -20.943 -15.771 -1.871  1.00 0.00 ? 499 GLN C H    2  
ATOM 1591  H HA   . GLN A 1 47 ? -21.994 -18.423 -1.924  1.00 0.00 ? 499 GLN C HA   2  
ATOM 1592  H HB2  . GLN A 1 47 ? -19.766 -17.203 -3.555  1.00 0.00 ? 499 GLN C HB2  2  
ATOM 1593  H HB3  . GLN A 1 47 ? -20.557 -18.736 -3.894  1.00 0.00 ? 499 GLN C HB3  2  
ATOM 1594  H HG2  . GLN A 1 47 ? -22.673 -17.559 -4.252  1.00 0.00 ? 499 GLN C HG2  2  
ATOM 1595  H HG3  . GLN A 1 47 ? -21.868 -16.026 -3.924  1.00 0.00 ? 499 GLN C HG3  2  
ATOM 1596  H HE21 . GLN A 1 47 ? -19.421 -16.898 -5.302  1.00 0.00 ? 499 GLN C HE21 2  
ATOM 1597  H HE22 . GLN A 1 47 ? -19.769 -16.795 -6.989  1.00 0.00 ? 499 GLN C HE22 2  
ATOM 1598  N N    . VAL A 1 48 ? -20.405 -19.601 -0.446  1.00 0.00 ? 500 VAL C N    2  
ATOM 1599  C CA   . VAL A 1 48 ? -19.489 -20.444 0.293   1.00 0.00 ? 500 VAL C CA   2  
ATOM 1600  C C    . VAL A 1 48 ? -18.995 -21.583 -0.597  1.00 0.00 ? 500 VAL C C    2  
ATOM 1601  O O    . VAL A 1 48 ? -19.795 -22.383 -1.085  1.00 0.00 ? 500 VAL C O    2  
ATOM 1602  C CB   . VAL A 1 48 ? -20.163 -21.032 1.555   1.00 0.00 ? 500 VAL C CB   2  
ATOM 1603  C CG1  . VAL A 1 48 ? -19.202 -21.934 2.313   1.00 0.00 ? 500 VAL C CG1  2  
ATOM 1604  C CG2  . VAL A 1 48 ? -20.668 -19.917 2.456   1.00 0.00 ? 500 VAL C CG2  2  
ATOM 1605  H H    . VAL A 1 48 ? -21.372 -19.728 -0.325  1.00 0.00 ? 500 VAL C H    2  
ATOM 1606  H HA   . VAL A 1 48 ? -18.651 -19.837 0.602   1.00 0.00 ? 500 VAL C HA   2  
ATOM 1607  H HB   . VAL A 1 48 ? -21.009 -21.626 1.242   1.00 0.00 ? 500 VAL C HB   2  
ATOM 1608  H HG11 . VAL A 1 48 ? -18.341 -21.362 2.625   1.00 0.00 ? 500 VAL C HG11 2  
ATOM 1609  H HG12 . VAL A 1 48 ? -18.883 -22.740 1.668   1.00 0.00 ? 500 VAL C HG12 2  
ATOM 1610  H HG13 . VAL A 1 48 ? -19.698 -22.342 3.182   1.00 0.00 ? 500 VAL C HG13 2  
ATOM 1611  H HG21 . VAL A 1 48 ? -21.387 -19.318 1.918   1.00 0.00 ? 500 VAL C HG21 2  
ATOM 1612  H HG22 . VAL A 1 48 ? -19.838 -19.297 2.761   1.00 0.00 ? 500 VAL C HG22 2  
ATOM 1613  H HG23 . VAL A 1 48 ? -21.137 -20.345 3.331   1.00 0.00 ? 500 VAL C HG23 2  
ATOM 1614  N N    . PRO A 1 49 ? -17.675 -21.655 -0.839  1.00 0.00 ? 501 PRO C N    2  
ATOM 1615  C CA   . PRO A 1 49 ? -17.084 -22.694 -1.674  1.00 0.00 ? 501 PRO C CA   2  
ATOM 1616  C C    . PRO A 1 49 ? -17.137 -24.067 -1.021  1.00 0.00 ? 501 PRO C C    2  
ATOM 1617  O O    . PRO A 1 49 ? -16.902 -24.215 0.184   1.00 0.00 ? 501 PRO C O    2  
ATOM 1618  C CB   . PRO A 1 49 ? -15.620 -22.252 -1.840  1.00 0.00 ? 501 PRO C CB   2  
ATOM 1619  C CG   . PRO A 1 49 ? -15.574 -20.849 -1.346  1.00 0.00 ? 501 PRO C CG   2  
ATOM 1620  C CD   . PRO A 1 49 ? -16.660 -20.737 -0.327  1.00 0.00 ? 501 PRO C CD   2  
ATOM 1621  H HA   . PRO A 1 49 ? -17.559 -22.738 -2.642  1.00 0.00 ? 501 PRO C HA   2  
ATOM 1622  H HB2  . PRO A 1 49 ? -14.979 -22.895 -1.257  1.00 0.00 ? 501 PRO C HB2  2  
ATOM 1623  H HB3  . PRO A 1 49 ? -15.343 -22.309 -2.881  1.00 0.00 ? 501 PRO C HB3  2  
ATOM 1624  H HG2  . PRO A 1 49 ? -14.613 -20.648 -0.894  1.00 0.00 ? 501 PRO C HG2  2  
ATOM 1625  H HG3  . PRO A 1 49 ? -15.754 -20.165 -2.163  1.00 0.00 ? 501 PRO C HG3  2  
ATOM 1626  H HD2  . PRO A 1 49 ? -16.306 -21.060 0.640   1.00 0.00 ? 501 PRO C HD2  2  
ATOM 1627  H HD3  . PRO A 1 49 ? -17.032 -19.725 -0.287  1.00 0.00 ? 501 PRO C HD3  2  
ATOM 1628  N N    . PHE A 1 50 ? -17.464 -25.058 -1.817  1.00 0.00 ? 502 PHE C N    2  
ATOM 1629  C CA   . PHE A 1 50 ? -17.502 -26.434 -1.370  1.00 0.00 ? 502 PHE C CA   2  
ATOM 1630  C C    . PHE A 1 50 ? -16.937 -27.332 -2.463  1.00 0.00 ? 502 PHE C C    2  
ATOM 1631  O O    . PHE A 1 50 ? -16.955 -26.952 -3.633  1.00 0.00 ? 502 PHE C O    2  
ATOM 1632  C CB   . PHE A 1 50 ? -18.938 -26.855 -1.011  1.00 0.00 ? 502 PHE C CB   2  
ATOM 1633  C CG   . PHE A 1 50 ? -19.949 -26.607 -2.093  1.00 0.00 ? 502 PHE C CG   2  
ATOM 1634  C CD1  . PHE A 1 50 ? -20.585 -25.387 -2.182  1.00 0.00 ? 502 PHE C CD1  2  
ATOM 1635  C CD2  . PHE A 1 50 ? -20.267 -27.592 -3.014  1.00 0.00 ? 502 PHE C CD2  2  
ATOM 1636  C CE1  . PHE A 1 50 ? -21.521 -25.147 -3.168  1.00 0.00 ? 502 PHE C CE1  2  
ATOM 1637  C CE2  . PHE A 1 50 ? -21.200 -27.360 -4.003  1.00 0.00 ? 502 PHE C CE2  2  
ATOM 1638  C CZ   . PHE A 1 50 ? -21.830 -26.136 -4.080  1.00 0.00 ? 502 PHE C CZ   2  
ATOM 1639  H H    . PHE A 1 50 ? -17.693 -24.861 -2.750  1.00 0.00 ? 502 PHE C H    2  
ATOM 1640  H HA   . PHE A 1 50 ? -16.883 -26.504 -0.492  1.00 0.00 ? 502 PHE C HA   2  
ATOM 1641  H HB2  . PHE A 1 50 ? -18.947 -27.912 -0.791  1.00 0.00 ? 502 PHE C HB2  2  
ATOM 1642  H HB3  . PHE A 1 50 ? -19.250 -26.312 -0.130  1.00 0.00 ? 502 PHE C HB3  2  
ATOM 1643  H HD1  . PHE A 1 50 ? -20.335 -24.619 -1.466  1.00 0.00 ? 502 PHE C HD1  2  
ATOM 1644  H HD2  . PHE A 1 50 ? -19.774 -28.552 -2.953  1.00 0.00 ? 502 PHE C HD2  2  
ATOM 1645  H HE1  . PHE A 1 50 ? -22.013 -24.188 -3.228  1.00 0.00 ? 502 PHE C HE1  2  
ATOM 1646  H HE2  . PHE A 1 50 ? -21.438 -28.137 -4.715  1.00 0.00 ? 502 PHE C HE2  2  
ATOM 1647  H HZ   . PHE A 1 50 ? -22.561 -25.951 -4.854  1.00 0.00 ? 502 PHE C HZ   2  
ATOM 1648  N N    . PRO A 1 51 ? -16.399 -28.511 -2.107  1.00 0.00 ? 503 PRO C N    2  
ATOM 1649  C CA   . PRO A 1 51 ? -15.858 -29.452 -3.096  1.00 0.00 ? 503 PRO C CA   2  
ATOM 1650  C C    . PRO A 1 51 ? -16.908 -29.833 -4.138  1.00 0.00 ? 503 PRO C C    2  
ATOM 1651  O O    . PRO A 1 51 ? -17.991 -30.329 -3.794  1.00 0.00 ? 503 PRO C O    2  
ATOM 1652  C CB   . PRO A 1 51 ? -15.480 -30.679 -2.254  1.00 0.00 ? 503 PRO C CB   2  
ATOM 1653  C CG   . PRO A 1 51 ? -15.288 -30.148 -0.877  1.00 0.00 ? 503 PRO C CG   2  
ATOM 1654  C CD   . PRO A 1 51 ? -16.261 -29.015 -0.730  1.00 0.00 ? 503 PRO C CD   2  
ATOM 1655  H HA   . PRO A 1 51 ? -14.982 -29.056 -3.587  1.00 0.00 ? 503 PRO C HA   2  
ATOM 1656  H HB2  . PRO A 1 51 ? -16.279 -31.403 -2.293  1.00 0.00 ? 503 PRO C HB2  2  
ATOM 1657  H HB3  . PRO A 1 51 ? -14.570 -31.116 -2.637  1.00 0.00 ? 503 PRO C HB3  2  
ATOM 1658  H HG2  . PRO A 1 51 ? -15.501 -30.921 -0.153  1.00 0.00 ? 503 PRO C HG2  2  
ATOM 1659  H HG3  . PRO A 1 51 ? -14.276 -29.791 -0.758  1.00 0.00 ? 503 PRO C HG3  2  
ATOM 1660  H HD2  . PRO A 1 51 ? -17.207 -29.374 -0.354  1.00 0.00 ? 503 PRO C HD2  2  
ATOM 1661  H HD3  . PRO A 1 51 ? -15.857 -28.255 -0.081  1.00 0.00 ? 503 PRO C HD3  2  
ATOM 1662  N N    . THR A 1 52 ? -16.596 -29.589 -5.401  1.00 0.00 ? 504 THR C N    2  
ATOM 1663  C CA   . THR A 1 52 ? -17.502 -29.893 -6.482  1.00 0.00 ? 504 THR C CA   2  
ATOM 1664  C C    . THR A 1 52 ? -16.784 -29.759 -7.842  1.00 0.00 ? 504 THR C C    2  
ATOM 1665  O O    . THR A 1 52 ? -16.707 -30.770 -8.577  1.00 0.00 ? 504 THR C O    2  
ATOM 1666  C CB   . THR A 1 52 ? -18.797 -29.003 -6.421  1.00 0.00 ? 504 THR C CB   2  
ATOM 1667  O OG1  . THR A 1 52 ? -19.767 -29.458 -7.369  1.00 0.00 ? 504 THR C OG1  2  
ATOM 1668  C CG2  . THR A 1 52 ? -18.496 -27.527 -6.673  1.00 0.00 ? 504 THR C CG2  2  
ATOM 1669  O OXT  . THR A 1 52 ? -16.257 -28.664 -8.147  1.00 0.00 ? 504 THR C OXT  2  
ATOM 1670  H H    . THR A 1 52 ? -15.724 -29.188 -5.613  1.00 0.00 ? 504 THR C H    2  
ATOM 1671  H HA   . THR A 1 52 ? -17.796 -30.926 -6.365  1.00 0.00 ? 504 THR C HA   2  
ATOM 1672  H HB   . THR A 1 52 ? -19.216 -29.100 -5.428  1.00 0.00 ? 504 THR C HB   2  
ATOM 1673  H HG1  . THR A 1 52 ? -19.480 -29.227 -8.262  1.00 0.00 ? 504 THR C HG1  2  
ATOM 1674  H HG21 . THR A 1 52 ? -18.062 -27.412 -7.655  1.00 0.00 ? 504 THR C HG21 2  
ATOM 1675  H HG22 . THR A 1 52 ? -17.800 -27.171 -5.928  1.00 0.00 ? 504 THR C HG22 2  
ATOM 1676  H HG23 . THR A 1 52 ? -19.411 -26.958 -6.612  1.00 0.00 ? 504 THR C HG23 2  
ATOM 1677  N N    . SER A 1 1  ? -11.409 3.608   5.097   1.00 0.00 ? 453 SER C N    3  
ATOM 1678  C CA   . SER A 1 1  ? -10.797 2.855   6.192   1.00 0.00 ? 453 SER C CA   3  
ATOM 1679  C C    . SER A 1 1  ? -10.977 1.354   5.985   1.00 0.00 ? 453 SER C C    3  
ATOM 1680  O O    . SER A 1 1  ? -11.933 0.761   6.474   1.00 0.00 ? 453 SER C O    3  
ATOM 1681  C CB   . SER A 1 1  ? -11.406 3.284   7.524   1.00 0.00 ? 453 SER C CB   3  
ATOM 1682  O OG   . SER A 1 1  ? -11.252 4.682   7.723   1.00 0.00 ? 453 SER C OG   3  
ATOM 1683  H H1   . SER A 1 1  ? -12.417 3.367   5.024   1.00 0.00 ? 453 SER C H1   3  
ATOM 1684  H H2   . SER A 1 1  ? -10.938 3.382   4.201   1.00 0.00 ? 453 SER C H2   3  
ATOM 1685  H H3   . SER A 1 1  ? -11.324 4.627   5.280   1.00 0.00 ? 453 SER C H3   3  
ATOM 1686  H HA   . SER A 1 1  ? -9.742  3.079   6.202   1.00 0.00 ? 453 SER C HA   3  
ATOM 1687  H HB2  . SER A 1 1  ? -12.459 3.046   7.529   1.00 0.00 ? 453 SER C HB2  3  
ATOM 1688  H HB3  . SER A 1 1  ? -10.913 2.760   8.328   1.00 0.00 ? 453 SER C HB3  3  
ATOM 1689  H HG   . SER A 1 1  ? -12.127 5.092   7.734   1.00 0.00 ? 453 SER C HG   3  
ATOM 1690  N N    . ASN A 1 2  ? -10.062 0.739   5.248   1.00 0.00 ? 454 ASN C N    3  
ATOM 1691  C CA   . ASN A 1 2  ? -10.155 -0.693  4.983   1.00 0.00 ? 454 ASN C CA   3  
ATOM 1692  C C    . ASN A 1 2  ? -9.503  -1.490  6.099   1.00 0.00 ? 454 ASN C C    3  
ATOM 1693  O O    . ASN A 1 2  ? -9.662  -2.704  6.174   1.00 0.00 ? 454 ASN C O    3  
ATOM 1694  C CB   . ASN A 1 2  ? -9.528  -1.068  3.627   1.00 0.00 ? 454 ASN C CB   3  
ATOM 1695  C CG   . ASN A 1 2  ? -8.014  -0.939  3.606   1.00 0.00 ? 454 ASN C CG   3  
ATOM 1696  O OD1  . ASN A 1 2  ? -7.441  -0.063  4.249   1.00 0.00 ? 454 ASN C OD1  3  
ATOM 1697  N ND2  . ASN A 1 2  ? -7.361  -1.824  2.875   1.00 0.00 ? 454 ASN C ND2  3  
ATOM 1698  H H    . ASN A 1 2  ? -9.306  1.249   4.880   1.00 0.00 ? 454 ASN C H    3  
ATOM 1699  H HA   . ASN A 1 2  ? -11.205 -0.944  4.960   1.00 0.00 ? 454 ASN C HA   3  
ATOM 1700  H HB2  . ASN A 1 2  ? -9.781  -2.092  3.396   1.00 0.00 ? 454 ASN C HB2  3  
ATOM 1701  H HB3  . ASN A 1 2  ? -9.938  -0.423  2.863   1.00 0.00 ? 454 ASN C HB3  3  
ATOM 1702  H HD21 . ASN A 1 2  ? -7.880  -2.508  2.396   1.00 0.00 ? 454 ASN C HD21 3  
ATOM 1703  H HD22 . ASN A 1 2  ? -6.381  -1.766  2.842   1.00 0.00 ? 454 ASN C HD22 3  
ATOM 1704  N N    . SER A 1 3  ? -8.775  -0.796  6.970   1.00 0.00 ? 455 SER C N    3  
ATOM 1705  C CA   . SER A 1 3  ? -8.123  -1.432  8.105   1.00 0.00 ? 455 SER C CA   3  
ATOM 1706  C C    . SER A 1 3  ? -9.158  -2.130  8.987   1.00 0.00 ? 455 SER C C    3  
ATOM 1707  O O    . SER A 1 3  ? -8.950  -3.258  9.445   1.00 0.00 ? 455 SER C O    3  
ATOM 1708  C CB   . SER A 1 3  ? -7.351  -0.389  8.914   1.00 0.00 ? 455 SER C CB   3  
ATOM 1709  O OG   . SER A 1 3  ? -6.448  0.328   8.081   1.00 0.00 ? 455 SER C OG   3  
ATOM 1710  H H    . SER A 1 3  ? -8.661  0.169   6.837   1.00 0.00 ? 455 SER C H    3  
ATOM 1711  H HA   . SER A 1 3  ? -7.431  -2.165  7.723   1.00 0.00 ? 455 SER C HA   3  
ATOM 1712  H HB2  . SER A 1 3  ? -8.048  0.310   9.353   1.00 0.00 ? 455 SER C HB2  3  
ATOM 1713  H HB3  . SER A 1 3  ? -6.791  -0.880  9.695   1.00 0.00 ? 455 SER C HB3  3  
ATOM 1714  H HG   . SER A 1 3  ? -5.545  0.096   8.333   1.00 0.00 ? 455 SER C HG   3  
ATOM 1715  N N    . GLN A 1 4  ? -10.277 -1.452  9.203   1.00 0.00 ? 456 GLN C N    3  
ATOM 1716  C CA   . GLN A 1 4  ? -11.379 -1.993  9.975   1.00 0.00 ? 456 GLN C CA   3  
ATOM 1717  C C    . GLN A 1 4  ? -11.958 -3.206  9.271   1.00 0.00 ? 456 GLN C C    3  
ATOM 1718  O O    . GLN A 1 4  ? -12.162 -4.247  9.882   1.00 0.00 ? 456 GLN C O    3  
ATOM 1719  C CB   . GLN A 1 4  ? -12.473 -0.933  10.177  1.00 0.00 ? 456 GLN C CB   3  
ATOM 1720  C CG   . GLN A 1 4  ? -12.139 0.141   11.213  1.00 0.00 ? 456 GLN C CG   3  
ATOM 1721  C CD   . GLN A 1 4  ? -10.920 0.974   10.854  1.00 0.00 ? 456 GLN C CD   3  
ATOM 1722  O OE1  . GLN A 1 4  ? -10.620 1.196   9.678   1.00 0.00 ? 456 GLN C OE1  3  
ATOM 1723  N NE2  . GLN A 1 4  ? -10.211 1.433   11.860  1.00 0.00 ? 456 GLN C NE2  3  
ATOM 1724  H H    . GLN A 1 4  ? -10.358 -0.541  8.839   1.00 0.00 ? 456 GLN C H    3  
ATOM 1725  H HA   . GLN A 1 4  ? -10.997 -2.294  10.938  1.00 0.00 ? 456 GLN C HA   3  
ATOM 1726  H HB2  . GLN A 1 4  ? -12.651 -0.440  9.232   1.00 0.00 ? 456 GLN C HB2  3  
ATOM 1727  H HB3  . GLN A 1 4  ? -13.380 -1.429  10.484  1.00 0.00 ? 456 GLN C HB3  3  
ATOM 1728  H HG2  . GLN A 1 4  ? -12.986 0.803   11.308  1.00 0.00 ? 456 GLN C HG2  3  
ATOM 1729  H HG3  . GLN A 1 4  ? -11.960 -0.344  12.161  1.00 0.00 ? 456 GLN C HG3  3  
ATOM 1730  H HE21 . GLN A 1 4  ? -10.505 1.218   12.772  1.00 0.00 ? 456 GLN C HE21 3  
ATOM 1731  H HE22 . GLN A 1 4  ? -9.413  1.969   11.663  1.00 0.00 ? 456 GLN C HE22 3  
ATOM 1732  N N    . LEU A 1 5  ? -12.202 -3.062  7.972   1.00 0.00 ? 457 LEU C N    3  
ATOM 1733  C CA   . LEU A 1 5  ? -12.735 -4.142  7.145   1.00 0.00 ? 457 LEU C CA   3  
ATOM 1734  C C    . LEU A 1 5  ? -11.850 -5.373  7.234   1.00 0.00 ? 457 LEU C C    3  
ATOM 1735  O O    . LEU A 1 5  ? -12.338 -6.491  7.411   1.00 0.00 ? 457 LEU C O    3  
ATOM 1736  C CB   . LEU A 1 5  ? -12.858 -3.686  5.684   1.00 0.00 ? 457 LEU C CB   3  
ATOM 1737  C CG   . LEU A 1 5  ? -14.080 -2.824  5.336   1.00 0.00 ? 457 LEU C CG   3  
ATOM 1738  C CD1  . LEU A 1 5  ? -15.350 -3.618  5.499   1.00 0.00 ? 457 LEU C CD1  3  
ATOM 1739  C CD2  . LEU A 1 5  ? -14.140 -1.571  6.189   1.00 0.00 ? 457 LEU C CD2  3  
ATOM 1740  H H    . LEU A 1 5  ? -12.020 -2.196  7.550   1.00 0.00 ? 457 LEU C H    3  
ATOM 1741  H HA   . LEU A 1 5  ? -13.717 -4.390  7.519   1.00 0.00 ? 457 LEU C HA   3  
ATOM 1742  H HB2  . LEU A 1 5  ? -11.970 -3.123  5.436   1.00 0.00 ? 457 LEU C HB2  3  
ATOM 1743  H HB3  . LEU A 1 5  ? -12.884 -4.568  5.062   1.00 0.00 ? 457 LEU C HB3  3  
ATOM 1744  H HG   . LEU A 1 5  ? -14.006 -2.522  4.303   1.00 0.00 ? 457 LEU C HG   3  
ATOM 1745  H HD11 . LEU A 1 5  ? -15.451 -3.930  6.528   1.00 0.00 ? 457 LEU C HD11 3  
ATOM 1746  H HD12 . LEU A 1 5  ? -15.313 -4.490  4.860   1.00 0.00 ? 457 LEU C HD12 3  
ATOM 1747  H HD13 . LEU A 1 5  ? -16.196 -3.007  5.224   1.00 0.00 ? 457 LEU C HD13 3  
ATOM 1748  H HD21 . LEU A 1 5  ? -13.264 -0.968  6.008   1.00 0.00 ? 457 LEU C HD21 3  
ATOM 1749  H HD22 . LEU A 1 5  ? -14.176 -1.856  7.233   1.00 0.00 ? 457 LEU C HD22 3  
ATOM 1750  H HD23 . LEU A 1 5  ? -15.028 -1.011  5.934   1.00 0.00 ? 457 LEU C HD23 3  
ATOM 1751  N N    . ASN A 1 6  ? -10.547 -5.149  7.116   1.00 0.00 ? 458 ASN C N    3  
ATOM 1752  C CA   . ASN A 1 6  ? -9.551  -6.211  7.220   1.00 0.00 ? 458 ASN C CA   3  
ATOM 1753  C C    . ASN A 1 6  ? -9.723  -6.962  8.530   1.00 0.00 ? 458 ASN C C    3  
ATOM 1754  O O    . ASN A 1 6  ? -9.812  -8.194  8.554   1.00 0.00 ? 458 ASN C O    3  
ATOM 1755  C CB   . ASN A 1 6  ? -8.140  -5.601  7.156   1.00 0.00 ? 458 ASN C CB   3  
ATOM 1756  C CG   . ASN A 1 6  ? -7.026  -6.636  7.231   1.00 0.00 ? 458 ASN C CG   3  
ATOM 1757  O OD1  . ASN A 1 6  ? -6.632  -7.064  8.315   1.00 0.00 ? 458 ASN C OD1  3  
ATOM 1758  N ND2  . ASN A 1 6  ? -6.498  -7.021  6.088   1.00 0.00 ? 458 ASN C ND2  3  
ATOM 1759  H H    . ASN A 1 6  ? -10.240 -4.231  6.944   1.00 0.00 ? 458 ASN C H    3  
ATOM 1760  H HA   . ASN A 1 6  ? -9.685  -6.893  6.394   1.00 0.00 ? 458 ASN C HA   3  
ATOM 1761  H HB2  . ASN A 1 6  ? -8.033  -5.060  6.229   1.00 0.00 ? 458 ASN C HB2  3  
ATOM 1762  H HB3  . ASN A 1 6  ? -8.023  -4.914  7.981   1.00 0.00 ? 458 ASN C HB3  3  
ATOM 1763  H HD21 . ASN A 1 6  ? -6.851  -6.623  5.259   1.00 0.00 ? 458 ASN C HD21 3  
ATOM 1764  H HD22 . ASN A 1 6  ? -5.770  -7.678  6.102   1.00 0.00 ? 458 ASN C HD22 3  
ATOM 1765  N N    . ALA A 1 7  ? -9.796  -6.209  9.613   1.00 0.00 ? 459 ALA C N    3  
ATOM 1766  C CA   . ALA A 1 7  ? -9.941  -6.770  10.940  1.00 0.00 ? 459 ALA C CA   3  
ATOM 1767  C C    . ALA A 1 7  ? -11.271 -7.501  11.102  1.00 0.00 ? 459 ALA C C    3  
ATOM 1768  O O    . ALA A 1 7  ? -11.309 -8.630  11.600  1.00 0.00 ? 459 ALA C O    3  
ATOM 1769  C CB   . ALA A 1 7  ? -9.801  -5.681  11.988  1.00 0.00 ? 459 ALA C CB   3  
ATOM 1770  H H    . ALA A 1 7  ? -9.749  -5.232  9.513   1.00 0.00 ? 459 ALA C H    3  
ATOM 1771  H HA   . ALA A 1 7  ? -9.140  -7.479  11.087  1.00 0.00 ? 459 ALA C HA   3  
ATOM 1772  H HB1  . ALA A 1 7  ? -9.819  -6.124  12.971  1.00 0.00 ? 459 ALA C HB1  3  
ATOM 1773  H HB2  . ALA A 1 7  ? -10.619 -4.982  11.893  1.00 0.00 ? 459 ALA C HB2  3  
ATOM 1774  H HB3  . ALA A 1 7  ? -8.866  -5.161  11.845  1.00 0.00 ? 459 ALA C HB3  3  
ATOM 1775  N N    . MET A 1 8  ? -12.359 -6.866  10.661  1.00 0.00 ? 460 MET C N    3  
ATOM 1776  C CA   . MET A 1 8  ? -13.690 -7.444  10.795  1.00 0.00 ? 460 MET C CA   3  
ATOM 1777  C C    . MET A 1 8  ? -13.800 -8.766  10.045  1.00 0.00 ? 460 MET C C    3  
ATOM 1778  O O    . MET A 1 8  ? -14.298 -9.756  10.589  1.00 0.00 ? 460 MET C O    3  
ATOM 1779  C CB   . MET A 1 8  ? -14.768 -6.469  10.308  1.00 0.00 ? 460 MET C CB   3  
ATOM 1780  C CG   . MET A 1 8  ? -14.780 -5.133  11.046  1.00 0.00 ? 460 MET C CG   3  
ATOM 1781  S SD   . MET A 1 8  ? -16.366 -4.279  10.930  1.00 0.00 ? 460 MET C SD   3  
ATOM 1782  C CE   . MET A 1 8  ? -16.501 -4.064  9.163   1.00 0.00 ? 460 MET C CE   3  
ATOM 1783  H H    . MET A 1 8  ? -12.264 -5.983  10.238  1.00 0.00 ? 460 MET C H    3  
ATOM 1784  H HA   . MET A 1 8  ? -13.851 -7.637  11.844  1.00 0.00 ? 460 MET C HA   3  
ATOM 1785  H HB2  . MET A 1 8  ? -14.620 -6.283  9.255   1.00 0.00 ? 460 MET C HB2  3  
ATOM 1786  H HB3  . MET A 1 8  ? -15.730 -6.934  10.440  1.00 0.00 ? 460 MET C HB3  3  
ATOM 1787  H HG2  . MET A 1 8  ? -14.551 -5.300  12.085  1.00 0.00 ? 460 MET C HG2  3  
ATOM 1788  H HG3  . MET A 1 8  ? -14.021 -4.497  10.605  1.00 0.00 ? 460 MET C HG3  3  
ATOM 1789  H HE1  . MET A 1 8  ? -16.306 -5.011  8.680   1.00 0.00 ? 460 MET C HE1  3  
ATOM 1790  H HE2  . MET A 1 8  ? -15.789 -3.326  8.828   1.00 0.00 ? 460 MET C HE2  3  
ATOM 1791  H HE3  . MET A 1 8  ? -17.503 -3.742  8.923   1.00 0.00 ? 460 MET C HE3  3  
ATOM 1792  N N    . ALA A 1 9  ? -13.324 -8.786  8.804   1.00 0.00 ? 461 ALA C N    3  
ATOM 1793  C CA   . ALA A 1 9  ? -13.361 -9.993  7.994   1.00 0.00 ? 461 ALA C CA   3  
ATOM 1794  C C    . ALA A 1 9  ? -12.552 -11.108 8.647   1.00 0.00 ? 461 ALA C C    3  
ATOM 1795  O O    . ALA A 1 9  ? -12.932 -12.278 8.599   1.00 0.00 ? 461 ALA C O    3  
ATOM 1796  C CB   . ALA A 1 9  ? -12.847 -9.708  6.595   1.00 0.00 ? 461 ALA C CB   3  
ATOM 1797  H H    . ALA A 1 9  ? -12.941 -7.966  8.418   1.00 0.00 ? 461 ALA C H    3  
ATOM 1798  H HA   . ALA A 1 9  ? -14.392 -10.310 7.921   1.00 0.00 ? 461 ALA C HA   3  
ATOM 1799  H HB1  . ALA A 1 9  ? -12.893 -10.611 6.003   1.00 0.00 ? 461 ALA C HB1  3  
ATOM 1800  H HB2  . ALA A 1 9  ? -11.825 -9.365  6.649   1.00 0.00 ? 461 ALA C HB2  3  
ATOM 1801  H HB3  . ALA A 1 9  ? -13.460 -8.947  6.136   1.00 0.00 ? 461 ALA C HB3  3  
ATOM 1802  N N    . HIS A 1 10 ? -11.440 -10.733 9.276   1.00 0.00 ? 462 HIS C N    3  
ATOM 1803  C CA   . HIS A 1 10 ? -10.597 -11.700 9.962   1.00 0.00 ? 462 HIS C CA   3  
ATOM 1804  C C    . HIS A 1 10 ? -11.325 -12.336 11.130  1.00 0.00 ? 462 HIS C C    3  
ATOM 1805  O O    . HIS A 1 10 ? -11.307 -13.545 11.276  1.00 0.00 ? 462 HIS C O    3  
ATOM 1806  C CB   . HIS A 1 10 ? -9.286  -11.064 10.443  1.00 0.00 ? 462 HIS C CB   3  
ATOM 1807  C CG   . HIS A 1 10 ? -8.162  -11.164 9.452   1.00 0.00 ? 462 HIS C CG   3  
ATOM 1808  N ND1  . HIS A 1 10 ? -7.323  -12.251 9.378   1.00 0.00 ? 462 HIS C ND1  3  
ATOM 1809  C CD2  . HIS A 1 10 ? -7.745  -10.310 8.490   1.00 0.00 ? 462 HIS C CD2  3  
ATOM 1810  C CE1  . HIS A 1 10 ? -6.442  -12.063 8.421   1.00 0.00 ? 462 HIS C CE1  3  
ATOM 1811  N NE2  . HIS A 1 10 ? -6.674  -10.893 7.862   1.00 0.00 ? 462 HIS C NE2  3  
ATOM 1812  H H    . HIS A 1 10 ? -11.191 -9.782  9.275   1.00 0.00 ? 462 HIS C H    3  
ATOM 1813  H HA   . HIS A 1 10 ? -10.357 -12.479 9.260   1.00 0.00 ? 462 HIS C HA   3  
ATOM 1814  H HB2  . HIS A 1 10 ? -9.453  -10.018 10.647  1.00 0.00 ? 462 HIS C HB2  3  
ATOM 1815  H HB3  . HIS A 1 10 ? -8.972  -11.556 11.353  1.00 0.00 ? 462 HIS C HB3  3  
ATOM 1816  H HD1  . HIS A 1 10 ? -7.357  -13.049 9.952   1.00 0.00 ? 462 HIS C HD1  3  
ATOM 1817  H HD2  . HIS A 1 10 ? -8.179  -9.347  8.259   1.00 0.00 ? 462 HIS C HD2  3  
ATOM 1818  H HE1  . HIS A 1 10 ? -5.659  -12.752 8.139   1.00 0.00 ? 462 HIS C HE1  3  
ATOM 1819  H HE2  . HIS A 1 10 ? -5.991  -10.396 7.357   1.00 0.00 ? 462 HIS C HE2  3  
ATOM 1820  N N    . GLN A 1 11 ? -11.998 -11.516 11.934  1.00 0.00 ? 463 GLN C N    3  
ATOM 1821  C CA   . GLN A 1 11 ? -12.699 -12.000 13.133  1.00 0.00 ? 463 GLN C CA   3  
ATOM 1822  C C    . GLN A 1 11 ? -13.753 -13.045 12.792  1.00 0.00 ? 463 GLN C C    3  
ATOM 1823  O O    . GLN A 1 11 ? -13.951 -14.006 13.540  1.00 0.00 ? 463 GLN C O    3  
ATOM 1824  C CB   . GLN A 1 11 ? -13.337 -10.837 13.898  1.00 0.00 ? 463 GLN C CB   3  
ATOM 1825  C CG   . GLN A 1 11 ? -12.349 -9.762  14.333  1.00 0.00 ? 463 GLN C CG   3  
ATOM 1826  C CD   . GLN A 1 11 ? -11.158 -10.331 15.075  1.00 0.00 ? 463 GLN C CD   3  
ATOM 1827  O OE1  . GLN A 1 11 ? -11.183 -10.474 16.299  1.00 0.00 ? 463 GLN C OE1  3  
ATOM 1828  N NE2  . GLN A 1 11 ? -10.104 -10.645 14.340  1.00 0.00 ? 463 GLN C NE2  3  
ATOM 1829  H H    . GLN A 1 11 ? -12.035 -10.557 11.715  1.00 0.00 ? 463 GLN C H    3  
ATOM 1830  H HA   . GLN A 1 11 ? -11.963 -12.474 13.772  1.00 0.00 ? 463 GLN C HA   3  
ATOM 1831  H HB2  . GLN A 1 11 ? -14.082 -10.375 13.269  1.00 0.00 ? 463 GLN C HB2  3  
ATOM 1832  H HB3  . GLN A 1 11 ? -13.821 -11.229 14.780  1.00 0.00 ? 463 GLN C HB3  3  
ATOM 1833  H HG2  . GLN A 1 11 ? -11.991 -9.246  13.455  1.00 0.00 ? 463 GLN C HG2  3  
ATOM 1834  H HG3  . GLN A 1 11 ? -12.859 -9.063  14.979  1.00 0.00 ? 463 GLN C HG3  3  
ATOM 1835  H HE21 . GLN A 1 11 ? -10.155 -10.487 13.375  1.00 0.00 ? 463 GLN C HE21 3  
ATOM 1836  H HE22 . GLN A 1 11 ? -9.319  -11.030 14.780  1.00 0.00 ? 463 GLN C HE22 3  
ATOM 1837  N N    . ILE A 1 12 ? -14.434 -12.858 11.675  1.00 0.00 ? 464 ILE C N    3  
ATOM 1838  C CA   . ILE A 1 12 ? -15.421 -13.827 11.237  1.00 0.00 ? 464 ILE C CA   3  
ATOM 1839  C C    . ILE A 1 12 ? -14.735 -15.079 10.731  1.00 0.00 ? 464 ILE C C    3  
ATOM 1840  O O    . ILE A 1 12 ? -15.124 -16.181 11.082  1.00 0.00 ? 464 ILE C O    3  
ATOM 1841  C CB   . ILE A 1 12 ? -16.329 -13.275 10.127  1.00 0.00 ? 464 ILE C CB   3  
ATOM 1842  C CG1  . ILE A 1 12 ? -17.060 -12.027 10.599  1.00 0.00 ? 464 ILE C CG1  3  
ATOM 1843  C CG2  . ILE A 1 12 ? -17.334 -14.340 9.684   1.00 0.00 ? 464 ILE C CG2  3  
ATOM 1844  C CD1  . ILE A 1 12 ? -17.895 -11.391 9.520   1.00 0.00 ? 464 ILE C CD1  3  
ATOM 1845  H H    . ILE A 1 12 ? -14.277 -12.050 11.141  1.00 0.00 ? 464 ILE C H    3  
ATOM 1846  H HA   . ILE A 1 12 ? -16.033 -14.089 12.090  1.00 0.00 ? 464 ILE C HA   3  
ATOM 1847  H HB   . ILE A 1 12 ? -15.711 -13.022 9.278   1.00 0.00 ? 464 ILE C HB   3  
ATOM 1848  H HG12 . ILE A 1 12 ? -17.716 -12.294 11.415  1.00 0.00 ? 464 ILE C HG12 3  
ATOM 1849  H HG13 . ILE A 1 12 ? -16.349 -11.293 10.951  1.00 0.00 ? 464 ILE C HG13 3  
ATOM 1850  H HG21 . ILE A 1 12 ? -17.926 -14.651 10.532  1.00 0.00 ? 464 ILE C HG21 3  
ATOM 1851  H HG22 . ILE A 1 12 ? -16.803 -15.192 9.286   1.00 0.00 ? 464 ILE C HG22 3  
ATOM 1852  H HG23 . ILE A 1 12 ? -17.979 -13.929 8.923   1.00 0.00 ? 464 ILE C HG23 3  
ATOM 1853  H HD11 . ILE A 1 12 ? -18.703 -12.055 9.251   1.00 0.00 ? 464 ILE C HD11 3  
ATOM 1854  H HD12 . ILE A 1 12 ? -17.276 -11.214 8.652   1.00 0.00 ? 464 ILE C HD12 3  
ATOM 1855  H HD13 . ILE A 1 12 ? -18.293 -10.457 9.874   1.00 0.00 ? 464 ILE C HD13 3  
ATOM 1856  N N    . GLN A 1 13 ? -13.693 -14.897 9.920   1.00 0.00 ? 465 GLN C N    3  
ATOM 1857  C CA   . GLN A 1 13 ? -12.943 -16.018 9.346   1.00 0.00 ? 465 GLN C CA   3  
ATOM 1858  C C    . GLN A 1 13 ? -12.378 -16.918 10.444  1.00 0.00 ? 465 GLN C C    3  
ATOM 1859  O O    . GLN A 1 13 ? -12.240 -18.130 10.264  1.00 0.00 ? 465 GLN C O    3  
ATOM 1860  C CB   . GLN A 1 13 ? -11.810 -15.504 8.465   1.00 0.00 ? 465 GLN C CB   3  
ATOM 1861  C CG   . GLN A 1 13 ? -11.069 -16.604 7.724   1.00 0.00 ? 465 GLN C CG   3  
ATOM 1862  C CD   . GLN A 1 13 ? -9.950  -16.079 6.861   1.00 0.00 ? 465 GLN C CD   3  
ATOM 1863  O OE1  . GLN A 1 13 ? -9.340  -15.049 7.163   1.00 0.00 ? 465 GLN C OE1  3  
ATOM 1864  N NE2  . GLN A 1 13 ? -9.666  -16.776 5.785   1.00 0.00 ? 465 GLN C NE2  3  
ATOM 1865  H H    . GLN A 1 13 ? -13.421 -13.981 9.693   1.00 0.00 ? 465 GLN C H    3  
ATOM 1866  H HA   . GLN A 1 13 ? -13.624 -16.597 8.740   1.00 0.00 ? 465 GLN C HA   3  
ATOM 1867  H HB2  . GLN A 1 13 ? -12.216 -14.815 7.738   1.00 0.00 ? 465 GLN C HB2  3  
ATOM 1868  H HB3  . GLN A 1 13 ? -11.101 -14.980 9.092   1.00 0.00 ? 465 GLN C HB3  3  
ATOM 1869  H HG2  . GLN A 1 13 ? -10.652 -17.289 8.447   1.00 0.00 ? 465 GLN C HG2  3  
ATOM 1870  H HG3  . GLN A 1 13 ? -11.772 -17.133 7.097   1.00 0.00 ? 465 GLN C HG3  3  
ATOM 1871  H HE21 . GLN A 1 13 ? -10.193 -17.588 5.609   1.00 0.00 ? 465 GLN C HE21 3  
ATOM 1872  H HE22 . GLN A 1 13 ? -8.942  -16.472 5.203   1.00 0.00 ? 465 GLN C HE22 3  
ATOM 1873  N N    . GLU A 1 14 ? -12.051 -16.312 11.578  1.00 0.00 ? 466 GLU C N    3  
ATOM 1874  C CA   . GLU A 1 14 ? -11.546 -17.039 12.734  1.00 0.00 ? 466 GLU C CA   3  
ATOM 1875  C C    . GLU A 1 14 ? -12.567 -18.081 13.198  1.00 0.00 ? 466 GLU C C    3  
ATOM 1876  O O    . GLU A 1 14 ? -12.209 -19.140 13.713  1.00 0.00 ? 466 GLU C O    3  
ATOM 1877  C CB   . GLU A 1 14 ? -11.244 -16.056 13.869  1.00 0.00 ? 466 GLU C CB   3  
ATOM 1878  C CG   . GLU A 1 14 ? -10.182 -15.025 13.528  1.00 0.00 ? 466 GLU C CG   3  
ATOM 1879  C CD   . GLU A 1 14 ? -8.852  -15.642 13.164  1.00 0.00 ? 466 GLU C CD   3  
ATOM 1880  O OE1  . GLU A 1 14 ? -8.087  -15.997 14.082  1.00 0.00 ? 466 GLU C OE1  3  
ATOM 1881  O OE2  . GLU A 1 14 ? -8.550  -15.750 11.958  1.00 0.00 ? 466 GLU C OE2  3  
ATOM 1882  H H    . GLU A 1 14 ? -12.139 -15.336 11.637  1.00 0.00 ? 466 GLU C H    3  
ATOM 1883  H HA   . GLU A 1 14 ? -10.633 -17.539 12.447  1.00 0.00 ? 466 GLU C HA   3  
ATOM 1884  H HB2  . GLU A 1 14 ? -12.152 -15.527 14.113  1.00 0.00 ? 466 GLU C HB2  3  
ATOM 1885  H HB3  . GLU A 1 14 ? -10.919 -16.598 14.739  1.00 0.00 ? 466 GLU C HB3  3  
ATOM 1886  H HG2  . GLU A 1 14 ? -10.526 -14.450 12.679  1.00 0.00 ? 466 GLU C HG2  3  
ATOM 1887  H HG3  . GLU A 1 14 ? -10.044 -14.370 14.376  1.00 0.00 ? 466 GLU C HG3  3  
ATOM 1888  N N    . MET A 1 15 ? -13.839 -17.770 13.001  1.00 0.00 ? 467 MET C N    3  
ATOM 1889  C CA   . MET A 1 15 ? -14.921 -18.662 13.377  1.00 0.00 ? 467 MET C CA   3  
ATOM 1890  C C    . MET A 1 15 ? -15.427 -19.445 12.162  1.00 0.00 ? 467 MET C C    3  
ATOM 1891  O O    . MET A 1 15 ? -15.804 -20.614 12.272  1.00 0.00 ? 467 MET C O    3  
ATOM 1892  C CB   . MET A 1 15 ? -16.078 -17.860 13.972  1.00 0.00 ? 467 MET C CB   3  
ATOM 1893  C CG   . MET A 1 15 ? -15.706 -16.999 15.160  1.00 0.00 ? 467 MET C CG   3  
ATOM 1894  S SD   . MET A 1 15 ? -17.135 -16.155 15.877  1.00 0.00 ? 467 MET C SD   3  
ATOM 1895  C CE   . MET A 1 15 ? -17.719 -15.200 14.473  1.00 0.00 ? 467 MET C CE   3  
ATOM 1896  H H    . MET A 1 15 ? -14.060 -16.911 12.582  1.00 0.00 ? 467 MET C H    3  
ATOM 1897  H HA   . MET A 1 15 ? -14.552 -19.351 14.120  1.00 0.00 ? 467 MET C HA   3  
ATOM 1898  H HB2  . MET A 1 15 ? -16.468 -17.207 13.207  1.00 0.00 ? 467 MET C HB2  3  
ATOM 1899  H HB3  . MET A 1 15 ? -16.854 -18.543 14.275  1.00 0.00 ? 467 MET C HB3  3  
ATOM 1900  H HG2  . MET A 1 15 ? -15.254 -17.622 15.916  1.00 0.00 ? 467 MET C HG2  3  
ATOM 1901  H HG3  . MET A 1 15 ? -14.995 -16.253 14.832  1.00 0.00 ? 467 MET C HG3  3  
ATOM 1902  H HE1  . MET A 1 15 ? -18.573 -14.609 14.771  1.00 0.00 ? 467 MET C HE1  3  
ATOM 1903  H HE2  . MET A 1 15 ? -18.008 -15.870 13.675  1.00 0.00 ? 467 MET C HE2  3  
ATOM 1904  H HE3  . MET A 1 15 ? -16.932 -14.546 14.129  1.00 0.00 ? 467 MET C HE3  3  
ATOM 1905  N N    . PHE A 1 16 ? -15.445 -18.784 11.010  1.00 0.00 ? 468 PHE C N    3  
ATOM 1906  C CA   . PHE A 1 16 ? -15.948 -19.369 9.773   1.00 0.00 ? 468 PHE C CA   3  
ATOM 1907  C C    . PHE A 1 16 ? -14.868 -19.396 8.684   1.00 0.00 ? 468 PHE C C    3  
ATOM 1908  O O    . PHE A 1 16 ? -14.783 -18.482 7.869   1.00 0.00 ? 468 PHE C O    3  
ATOM 1909  C CB   . PHE A 1 16 ? -17.177 -18.583 9.262   1.00 0.00 ? 468 PHE C CB   3  
ATOM 1910  C CG   . PHE A 1 16 ? -18.426 -18.762 10.091  1.00 0.00 ? 468 PHE C CG   3  
ATOM 1911  C CD1  . PHE A 1 16 ? -18.473 -18.340 11.405  1.00 0.00 ? 468 PHE C CD1  3  
ATOM 1912  C CD2  . PHE A 1 16 ? -19.551 -19.354 9.546   1.00 0.00 ? 468 PHE C CD2  3  
ATOM 1913  C CE1  . PHE A 1 16 ? -19.612 -18.510 12.166  1.00 0.00 ? 468 PHE C CE1  3  
ATOM 1914  C CE2  . PHE A 1 16 ? -20.694 -19.526 10.298  1.00 0.00 ? 468 PHE C CE2  3  
ATOM 1915  C CZ   . PHE A 1 16 ? -20.725 -19.106 11.611  1.00 0.00 ? 468 PHE C CZ   3  
ATOM 1916  H H    . PHE A 1 16 ? -15.107 -17.860 10.985  1.00 0.00 ? 468 PHE C H    3  
ATOM 1917  H HA   . PHE A 1 16 ? -16.251 -20.382 9.985   1.00 0.00 ? 468 PHE C HA   3  
ATOM 1918  H HB2  . PHE A 1 16 ? -16.938 -17.530 9.255   1.00 0.00 ? 468 PHE C HB2  3  
ATOM 1919  H HB3  . PHE A 1 16 ? -17.395 -18.898 8.255   1.00 0.00 ? 468 PHE C HB3  3  
ATOM 1920  H HD1  . PHE A 1 16 ? -17.600 -17.873 11.837  1.00 0.00 ? 468 PHE C HD1  3  
ATOM 1921  H HD2  . PHE A 1 16 ? -19.530 -19.677 8.517   1.00 0.00 ? 468 PHE C HD2  3  
ATOM 1922  H HE1  . PHE A 1 16 ? -19.629 -18.173 13.191  1.00 0.00 ? 468 PHE C HE1  3  
ATOM 1923  H HE2  . PHE A 1 16 ? -21.562 -19.994 9.858   1.00 0.00 ? 468 PHE C HE2  3  
ATOM 1924  H HZ   . PHE A 1 16 ? -21.619 -19.241 12.203  1.00 0.00 ? 468 PHE C HZ   3  
ATOM 1925  N N    . PRO A 1 17 ? -14.018 -20.434 8.672   1.00 0.00 ? 469 PRO C N    3  
ATOM 1926  C CA   . PRO A 1 17 ? -12.968 -20.585 7.657   1.00 0.00 ? 469 PRO C CA   3  
ATOM 1927  C C    . PRO A 1 17 ? -13.531 -21.035 6.306   1.00 0.00 ? 469 PRO C C    3  
ATOM 1928  O O    . PRO A 1 17 ? -12.858 -20.946 5.277   1.00 0.00 ? 469 PRO C O    3  
ATOM 1929  C CB   . PRO A 1 17 ? -12.075 -21.675 8.242   1.00 0.00 ? 469 PRO C CB   3  
ATOM 1930  C CG   . PRO A 1 17 ? -12.992 -22.488 9.078   1.00 0.00 ? 469 PRO C CG   3  
ATOM 1931  C CD   . PRO A 1 17 ? -13.974 -21.520 9.666   1.00 0.00 ? 469 PRO C CD   3  
ATOM 1932  H HA   . PRO A 1 17 ? -12.402 -19.676 7.540   1.00 0.00 ? 469 PRO C HA   3  
ATOM 1933  H HB2  . PRO A 1 17 ? -11.642 -22.257 7.442   1.00 0.00 ? 469 PRO C HB2  3  
ATOM 1934  H HB3  . PRO A 1 17 ? -11.295 -21.226 8.837   1.00 0.00 ? 469 PRO C HB3  3  
ATOM 1935  H HG2  . PRO A 1 17 ? -13.501 -23.212 8.463   1.00 0.00 ? 469 PRO C HG2  3  
ATOM 1936  H HG3  . PRO A 1 17 ? -12.435 -22.979 9.861   1.00 0.00 ? 469 PRO C HG3  3  
ATOM 1937  H HD2  . PRO A 1 17 ? -14.943 -21.980 9.786   1.00 0.00 ? 469 PRO C HD2  3  
ATOM 1938  H HD3  . PRO A 1 17 ? -13.608 -21.148 10.610  1.00 0.00 ? 469 PRO C HD3  3  
ATOM 1939  N N    . GLN A 1 18 ? -14.775 -21.515 6.324   1.00 0.00 ? 470 GLN C N    3  
ATOM 1940  C CA   . GLN A 1 18 ? -15.451 -22.002 5.119   1.00 0.00 ? 470 GLN C CA   3  
ATOM 1941  C C    . GLN A 1 18 ? -15.663 -20.894 4.091   1.00 0.00 ? 470 GLN C C    3  
ATOM 1942  O O    . GLN A 1 18 ? -15.740 -21.154 2.892   1.00 0.00 ? 470 GLN C O    3  
ATOM 1943  C CB   . GLN A 1 18 ? -16.801 -22.624 5.478   1.00 0.00 ? 470 GLN C CB   3  
ATOM 1944  C CG   . GLN A 1 18 ? -17.701 -21.705 6.287   1.00 0.00 ? 470 GLN C CG   3  
ATOM 1945  C CD   . GLN A 1 18 ? -19.093 -22.266 6.472   1.00 0.00 ? 470 GLN C CD   3  
ATOM 1946  O OE1  . GLN A 1 18 ? -19.612 -22.970 5.608   1.00 0.00 ? 470 GLN C OE1  3  
ATOM 1947  N NE2  . GLN A 1 18 ? -19.696 -21.974 7.600   1.00 0.00 ? 470 GLN C NE2  3  
ATOM 1948  H H    . GLN A 1 18 ? -15.246 -21.553 7.184   1.00 0.00 ? 470 GLN C H    3  
ATOM 1949  H HA   . GLN A 1 18 ? -14.830 -22.765 4.679   1.00 0.00 ? 470 GLN C HA   3  
ATOM 1950  H HB2  . GLN A 1 18 ? -17.317 -22.881 4.564   1.00 0.00 ? 470 GLN C HB2  3  
ATOM 1951  H HB3  . GLN A 1 18 ? -16.632 -23.524 6.050   1.00 0.00 ? 470 GLN C HB3  3  
ATOM 1952  H HG2  . GLN A 1 18 ? -17.260 -21.550 7.260   1.00 0.00 ? 470 GLN C HG2  3  
ATOM 1953  H HG3  . GLN A 1 18 ? -17.774 -20.759 5.774   1.00 0.00 ? 470 GLN C HG3  3  
ATOM 1954  H HE21 . GLN A 1 18 ? -19.222 -21.420 8.254   1.00 0.00 ? 470 GLN C HE21 3  
ATOM 1955  H HE22 . GLN A 1 18 ? -20.602 -22.321 7.744   1.00 0.00 ? 470 GLN C HE22 3  
ATOM 1956  N N    . VAL A 1 19 ? -15.760 -19.671 4.558   1.00 0.00 ? 471 VAL C N    3  
ATOM 1957  C CA   . VAL A 1 19 ? -15.995 -18.555 3.674   1.00 0.00 ? 471 VAL C CA   3  
ATOM 1958  C C    . VAL A 1 19 ? -14.687 -17.817 3.368   1.00 0.00 ? 471 VAL C C    3  
ATOM 1959  O O    . VAL A 1 19 ? -13.981 -17.381 4.280   1.00 0.00 ? 471 VAL C O    3  
ATOM 1960  C CB   . VAL A 1 19 ? -17.060 -17.582 4.257   1.00 0.00 ? 471 VAL C CB   3  
ATOM 1961  C CG1  . VAL A 1 19 ? -16.682 -17.119 5.654   1.00 0.00 ? 471 VAL C CG1  3  
ATOM 1962  C CG2  . VAL A 1 19 ? -17.285 -16.396 3.327   1.00 0.00 ? 471 VAL C CG2  3  
ATOM 1963  H H    . VAL A 1 19 ? -15.653 -19.509 5.518   1.00 0.00 ? 471 VAL C H    3  
ATOM 1964  H HA   . VAL A 1 19 ? -16.380 -18.959 2.749   1.00 0.00 ? 471 VAL C HA   3  
ATOM 1965  H HB   . VAL A 1 19 ? -17.991 -18.126 4.335   1.00 0.00 ? 471 VAL C HB   3  
ATOM 1966  H HG11 . VAL A 1 19 ? -17.375 -16.358 5.980   1.00 0.00 ? 471 VAL C HG11 3  
ATOM 1967  H HG12 . VAL A 1 19 ? -15.680 -16.717 5.642   1.00 0.00 ? 471 VAL C HG12 3  
ATOM 1968  H HG13 . VAL A 1 19 ? -16.728 -17.960 6.332   1.00 0.00 ? 471 VAL C HG13 3  
ATOM 1969  H HG21 . VAL A 1 19 ? -17.641 -16.751 2.373   1.00 0.00 ? 471 VAL C HG21 3  
ATOM 1970  H HG22 . VAL A 1 19 ? -16.355 -15.866 3.190   1.00 0.00 ? 471 VAL C HG22 3  
ATOM 1971  H HG23 . VAL A 1 19 ? -18.019 -15.733 3.761   1.00 0.00 ? 471 VAL C HG23 3  
ATOM 1972  N N    . PRO A 1 20 ? -14.323 -17.724 2.073   1.00 0.00 ? 472 PRO C N    3  
ATOM 1973  C CA   . PRO A 1 20 ? -13.106 -17.035 1.632   1.00 0.00 ? 472 PRO C CA   3  
ATOM 1974  C C    . PRO A 1 20 ? -13.025 -15.603 2.155   1.00 0.00 ? 472 PRO C C    3  
ATOM 1975  O O    . PRO A 1 20 ? -13.997 -14.846 2.084   1.00 0.00 ? 472 PRO C O    3  
ATOM 1976  C CB   . PRO A 1 20 ? -13.225 -17.041 0.110   1.00 0.00 ? 472 PRO C CB   3  
ATOM 1977  C CG   . PRO A 1 20 ? -14.065 -18.228 -0.184  1.00 0.00 ? 472 PRO C CG   3  
ATOM 1978  C CD   . PRO A 1 20 ? -15.058 -18.310 0.938   1.00 0.00 ? 472 PRO C CD   3  
ATOM 1979  H HA   . PRO A 1 20 ? -12.220 -17.574 1.931   1.00 0.00 ? 472 PRO C HA   3  
ATOM 1980  H HB2  . PRO A 1 20 ? -13.693 -16.127 -0.221  1.00 0.00 ? 472 PRO C HB2  3  
ATOM 1981  H HB3  . PRO A 1 20 ? -12.244 -17.134 -0.331  1.00 0.00 ? 472 PRO C HB3  3  
ATOM 1982  H HG2  . PRO A 1 20 ? -14.571 -18.096 -1.130  1.00 0.00 ? 472 PRO C HG2  3  
ATOM 1983  H HG3  . PRO A 1 20 ? -13.448 -19.114 -0.205  1.00 0.00 ? 472 PRO C HG3  3  
ATOM 1984  H HD2  . PRO A 1 20 ? -15.943 -17.733 0.708   1.00 0.00 ? 472 PRO C HD2  3  
ATOM 1985  H HD3  . PRO A 1 20 ? -15.315 -19.339 1.136   1.00 0.00 ? 472 PRO C HD3  3  
ATOM 1986  N N    . TYR A 1 21 ? -11.850 -15.246 2.647   1.00 0.00 ? 473 TYR C N    3  
ATOM 1987  C CA   . TYR A 1 21 ? -11.585 -13.940 3.257   1.00 0.00 ? 473 TYR C CA   3  
ATOM 1988  C C    . TYR A 1 21 ? -12.081 -12.752 2.404   1.00 0.00 ? 473 TYR C C    3  
ATOM 1989  O O    . TYR A 1 21 ? -12.742 -11.847 2.917   1.00 0.00 ? 473 TYR C O    3  
ATOM 1990  C CB   . TYR A 1 21 ? -10.083 -13.801 3.549   1.00 0.00 ? 473 TYR C CB   3  
ATOM 1991  C CG   . TYR A 1 21 ? -9.666  -12.412 3.964   1.00 0.00 ? 473 TYR C CG   3  
ATOM 1992  C CD1  . TYR A 1 21 ? -9.968  -11.920 5.225   1.00 0.00 ? 473 TYR C CD1  3  
ATOM 1993  C CD2  . TYR A 1 21 ? -8.981  -11.589 3.083   1.00 0.00 ? 473 TYR C CD2  3  
ATOM 1994  C CE1  . TYR A 1 21 ? -9.601  -10.644 5.592   1.00 0.00 ? 473 TYR C CE1  3  
ATOM 1995  C CE2  . TYR A 1 21 ? -8.607  -10.317 3.447   1.00 0.00 ? 473 TYR C CE2  3  
ATOM 1996  C CZ   . TYR A 1 21 ? -8.920  -9.848  4.699   1.00 0.00 ? 473 TYR C CZ   3  
ATOM 1997  O OH   . TYR A 1 21 ? -8.565  -8.574  5.054   1.00 0.00 ? 473 TYR C OH   3  
ATOM 1998  H H    . TYR A 1 21 ? -11.116 -15.897 2.597   1.00 0.00 ? 473 TYR C H    3  
ATOM 1999  H HA   . TYR A 1 21 ? -12.111 -13.916 4.200   1.00 0.00 ? 473 TYR C HA   3  
ATOM 2000  H HB2  . TYR A 1 21 ? -9.816  -14.476 4.349   1.00 0.00 ? 473 TYR C HB2  3  
ATOM 2001  H HB3  . TYR A 1 21 ? -9.526  -14.067 2.664   1.00 0.00 ? 473 TYR C HB3  3  
ATOM 2002  H HD1  . TYR A 1 21 ? -10.502 -12.548 5.921   1.00 0.00 ? 473 TYR C HD1  3  
ATOM 2003  H HD2  . TYR A 1 21 ? -8.736  -11.960 2.099   1.00 0.00 ? 473 TYR C HD2  3  
ATOM 2004  H HE1  . TYR A 1 21 ? -9.843  -10.274 6.578   1.00 0.00 ? 473 TYR C HE1  3  
ATOM 2005  H HE2  . TYR A 1 21 ? -8.072  -9.692  2.747   1.00 0.00 ? 473 TYR C HE2  3  
ATOM 2006  H HH   . TYR A 1 21 ? -8.082  -8.595  5.887   1.00 0.00 ? 473 TYR C HH   3  
ATOM 2007  N N    . HIS A 1 22 ? -11.770 -12.762 1.117   1.00 0.00 ? 474 HIS C N    3  
ATOM 2008  C CA   . HIS A 1 22 ? -12.160 -11.663 0.222   1.00 0.00 ? 474 HIS C CA   3  
ATOM 2009  C C    . HIS A 1 22 ? -13.671 -11.567 0.094   1.00 0.00 ? 474 HIS C C    3  
ATOM 2010  O O    . HIS A 1 22 ? -14.223 -10.475 -0.033  1.00 0.00 ? 474 HIS C O    3  
ATOM 2011  C CB   . HIS A 1 22 ? -11.524 -11.848 -1.152  1.00 0.00 ? 474 HIS C CB   3  
ATOM 2012  C CG   . HIS A 1 22 ? -11.704 -10.676 -2.086  1.00 0.00 ? 474 HIS C CG   3  
ATOM 2013  N ND1  . HIS A 1 22 ? -10.764 -9.684  -2.238  1.00 0.00 ? 474 HIS C ND1  3  
ATOM 2014  C CD2  . HIS A 1 22 ? -12.719 -10.357 -2.928  1.00 0.00 ? 474 HIS C CD2  3  
ATOM 2015  C CE1  . HIS A 1 22 ? -11.189 -8.808  -3.127  1.00 0.00 ? 474 HIS C CE1  3  
ATOM 2016  N NE2  . HIS A 1 22 ? -12.372 -9.193  -3.563  1.00 0.00 ? 474 HIS C NE2  3  
ATOM 2017  H H    . HIS A 1 22 ? -11.261 -13.522 0.756   1.00 0.00 ? 474 HIS C H    3  
ATOM 2018  H HA   . HIS A 1 22 ? -11.803 -10.736 0.653   1.00 0.00 ? 474 HIS C HA   3  
ATOM 2019  H HB2  . HIS A 1 22 ? -10.470 -12.010 -1.014  1.00 0.00 ? 474 HIS C HB2  3  
ATOM 2020  H HB3  . HIS A 1 22 ? -11.954 -12.719 -1.622  1.00 0.00 ? 474 HIS C HB3  3  
ATOM 2021  H HD1  . HIS A 1 22 ? -9.906  -9.626  -1.760  1.00 0.00 ? 474 HIS C HD1  3  
ATOM 2022  H HD2  . HIS A 1 22 ? -13.631 -10.917 -3.069  1.00 0.00 ? 474 HIS C HD2  3  
ATOM 2023  H HE1  . HIS A 1 22 ? -10.657 -7.924  -3.445  1.00 0.00 ? 474 HIS C HE1  3  
ATOM 2024  H HE2  . HIS A 1 22 ? -12.782 -8.874  -4.399  1.00 0.00 ? 474 HIS C HE2  3  
ATOM 2025  N N    . LEU A 1 23 ? -14.340 -12.702 0.133   1.00 0.00 ? 475 LEU C N    3  
ATOM 2026  C CA   . LEU A 1 23 ? -15.780 -12.721 0.034   1.00 0.00 ? 475 LEU C CA   3  
ATOM 2027  C C    . LEU A 1 23 ? -16.395 -12.196 1.319   1.00 0.00 ? 475 LEU C C    3  
ATOM 2028  O O    . LEU A 1 23 ? -17.503 -11.655 1.317   1.00 0.00 ? 475 LEU C O    3  
ATOM 2029  C CB   . LEU A 1 23 ? -16.284 -14.124 -0.280  1.00 0.00 ? 475 LEU C CB   3  
ATOM 2030  C CG   . LEU A 1 23 ? -15.838 -14.702 -1.627  1.00 0.00 ? 475 LEU C CG   3  
ATOM 2031  C CD1  . LEU A 1 23 ? -16.515 -16.031 -1.885  1.00 0.00 ? 475 LEU C CD1  3  
ATOM 2032  C CD2  . LEU A 1 23 ? -16.129 -13.728 -2.756  1.00 0.00 ? 475 LEU C CD2  3  
ATOM 2033  H H    . LEU A 1 23 ? -13.857 -13.548 0.242   1.00 0.00 ? 475 LEU C H    3  
ATOM 2034  H HA   . LEU A 1 23 ? -16.060 -12.058 -0.770  1.00 0.00 ? 475 LEU C HA   3  
ATOM 2035  H HB2  . LEU A 1 23 ? -15.942 -14.786 0.504   1.00 0.00 ? 475 LEU C HB2  3  
ATOM 2036  H HB3  . LEU A 1 23 ? -17.360 -14.103 -0.262  1.00 0.00 ? 475 LEU C HB3  3  
ATOM 2037  H HG   . LEU A 1 23 ? -14.772 -14.873 -1.597  1.00 0.00 ? 475 LEU C HG   3  
ATOM 2038  H HD11 . LEU A 1 23 ? -17.585 -15.892 -1.914  1.00 0.00 ? 475 LEU C HD11 3  
ATOM 2039  H HD12 . LEU A 1 23 ? -16.263 -16.721 -1.095  1.00 0.00 ? 475 LEU C HD12 3  
ATOM 2040  H HD13 . LEU A 1 23 ? -16.178 -16.429 -2.832  1.00 0.00 ? 475 LEU C HD13 3  
ATOM 2041  H HD21 . LEU A 1 23 ? -15.868 -14.182 -3.700  1.00 0.00 ? 475 LEU C HD21 3  
ATOM 2042  H HD22 . LEU A 1 23 ? -15.543 -12.831 -2.618  1.00 0.00 ? 475 LEU C HD22 3  
ATOM 2043  H HD23 . LEU A 1 23 ? -17.178 -13.476 -2.753  1.00 0.00 ? 475 LEU C HD23 3  
ATOM 2044  N N    . VAL A 1 24 ? -15.655 -12.340 2.412   1.00 0.00 ? 476 VAL C N    3  
ATOM 2045  C CA   . VAL A 1 24 ? -16.089 -11.818 3.696   1.00 0.00 ? 476 VAL C CA   3  
ATOM 2046  C C    . VAL A 1 24 ? -15.962 -10.300 3.667   1.00 0.00 ? 476 VAL C C    3  
ATOM 2047  O O    . VAL A 1 24 ? -16.875 -9.579  4.059   1.00 0.00 ? 476 VAL C O    3  
ATOM 2048  C CB   . VAL A 1 24 ? -15.242 -12.386 4.868   1.00 0.00 ? 476 VAL C CB   3  
ATOM 2049  C CG1  . VAL A 1 24 ? -15.795 -11.934 6.207   1.00 0.00 ? 476 VAL C CG1  3  
ATOM 2050  C CG2  . VAL A 1 24 ? -15.182 -13.898 4.811   1.00 0.00 ? 476 VAL C CG2  3  
ATOM 2051  H H    . VAL A 1 24 ? -14.791 -12.805 2.341   1.00 0.00 ? 476 VAL C H    3  
ATOM 2052  H HA   . VAL A 1 24 ? -17.125 -12.086 3.842   1.00 0.00 ? 476 VAL C HA   3  
ATOM 2053  H HB   . VAL A 1 24 ? -14.237 -12.001 4.774   1.00 0.00 ? 476 VAL C HB   3  
ATOM 2054  H HG11 . VAL A 1 24 ? -16.831 -12.227 6.288   1.00 0.00 ? 476 VAL C HG11 3  
ATOM 2055  H HG12 . VAL A 1 24 ? -15.714 -10.862 6.283   1.00 0.00 ? 476 VAL C HG12 3  
ATOM 2056  H HG13 . VAL A 1 24 ? -15.229 -12.394 7.002   1.00 0.00 ? 476 VAL C HG13 3  
ATOM 2057  H HG21 . VAL A 1 24 ? -14.739 -14.205 3.873   1.00 0.00 ? 476 VAL C HG21 3  
ATOM 2058  H HG22 . VAL A 1 24 ? -16.180 -14.301 4.887   1.00 0.00 ? 476 VAL C HG22 3  
ATOM 2059  H HG23 . VAL A 1 24 ? -14.581 -14.266 5.629   1.00 0.00 ? 476 VAL C HG23 3  
ATOM 2060  N N    . LEU A 1 25 ? -14.817 -9.833  3.160   1.00 0.00 ? 477 LEU C N    3  
ATOM 2061  C CA   . LEU A 1 25 ? -14.550 -8.403  2.988   1.00 0.00 ? 477 LEU C CA   3  
ATOM 2062  C C    . LEU A 1 25 ? -15.678 -7.731  2.223   1.00 0.00 ? 477 LEU C C    3  
ATOM 2063  O O    . LEU A 1 25 ? -16.117 -6.640  2.581   1.00 0.00 ? 477 LEU C O    3  
ATOM 2064  C CB   . LEU A 1 25 ? -13.244 -8.207  2.211   1.00 0.00 ? 477 LEU C CB   3  
ATOM 2065  C CG   . LEU A 1 25 ? -11.945 -8.311  2.998   1.00 0.00 ? 477 LEU C CG   3  
ATOM 2066  C CD1  . LEU A 1 25 ? -10.763 -8.141  2.062   1.00 0.00 ? 477 LEU C CD1  3  
ATOM 2067  C CD2  . LEU A 1 25 ? -11.900 -7.259  4.095   1.00 0.00 ? 477 LEU C CD2  3  
ATOM 2068  H H    . LEU A 1 25 ? -14.123 -10.475 2.898   1.00 0.00 ? 477 LEU C H    3  
ATOM 2069  H HA   . LEU A 1 25 ? -14.460 -7.943  3.961   1.00 0.00 ? 477 LEU C HA   3  
ATOM 2070  H HB2  . LEU A 1 25 ? -13.212 -8.962  1.438   1.00 0.00 ? 477 LEU C HB2  3  
ATOM 2071  H HB3  . LEU A 1 25 ? -13.270 -7.247  1.727   1.00 0.00 ? 477 LEU C HB3  3  
ATOM 2072  H HG   . LEU A 1 25 ? -11.879 -9.287  3.457   1.00 0.00 ? 477 LEU C HG   3  
ATOM 2073  H HD11 . LEU A 1 25 ? -10.810 -7.170  1.592   1.00 0.00 ? 477 LEU C HD11 3  
ATOM 2074  H HD12 . LEU A 1 25 ? -10.790 -8.909  1.304   1.00 0.00 ? 477 LEU C HD12 3  
ATOM 2075  H HD13 . LEU A 1 25 ? -9.844  -8.223  2.624   1.00 0.00 ? 477 LEU C HD13 3  
ATOM 2076  H HD21 . LEU A 1 25 ? -12.708 -7.423  4.790   1.00 0.00 ? 477 LEU C HD21 3  
ATOM 2077  H HD22 . LEU A 1 25 ? -11.997 -6.277  3.654   1.00 0.00 ? 477 LEU C HD22 3  
ATOM 2078  H HD23 . LEU A 1 25 ? -10.957 -7.327  4.617   1.00 0.00 ? 477 LEU C HD23 3  
ATOM 2079  N N    . GLN A 1 26 ? -16.139 -8.399  1.174   1.00 0.00 ? 478 GLN C N    3  
ATOM 2080  C CA   . GLN A 1 26 ? -17.191 -7.886  0.329   1.00 0.00 ? 478 GLN C CA   3  
ATOM 2081  C C    . GLN A 1 26 ? -18.432 -7.532  1.139   1.00 0.00 ? 478 GLN C C    3  
ATOM 2082  O O    . GLN A 1 26 ? -18.874 -6.385  1.127   1.00 0.00 ? 478 GLN C O    3  
ATOM 2083  C CB   . GLN A 1 26 ? -17.542 -8.911  -0.744  1.00 0.00 ? 478 GLN C CB   3  
ATOM 2084  C CG   . GLN A 1 26 ? -18.577 -8.423  -1.734  1.00 0.00 ? 478 GLN C CG   3  
ATOM 2085  C CD   . GLN A 1 26 ? -18.910 -9.451  -2.795  1.00 0.00 ? 478 GLN C CD   3  
ATOM 2086  O OE1  . GLN A 1 26 ? -19.222 -9.102  -3.934  1.00 0.00 ? 478 GLN C OE1  3  
ATOM 2087  N NE2  . GLN A 1 26 ? -18.859 -10.720 -2.434  1.00 0.00 ? 478 GLN C NE2  3  
ATOM 2088  H H    . GLN A 1 26 ? -15.749 -9.271  0.959   1.00 0.00 ? 478 GLN C H    3  
ATOM 2089  H HA   . GLN A 1 26 ? -16.824 -6.994  -0.154  1.00 0.00 ? 478 GLN C HA   3  
ATOM 2090  H HB2  . GLN A 1 26 ? -16.645 -9.167  -1.290  1.00 0.00 ? 478 GLN C HB2  3  
ATOM 2091  H HB3  . GLN A 1 26 ? -17.924 -9.799  -0.264  1.00 0.00 ? 478 GLN C HB3  3  
ATOM 2092  H HG2  . GLN A 1 26 ? -19.476 -8.179  -1.191  1.00 0.00 ? 478 GLN C HG2  3  
ATOM 2093  H HG3  . GLN A 1 26 ? -18.196 -7.534  -2.215  1.00 0.00 ? 478 GLN C HG3  3  
ATOM 2094  H HE21 . GLN A 1 26 ? -18.616 -10.934 -1.510  1.00 0.00 ? 478 GLN C HE21 3  
ATOM 2095  H HE22 . GLN A 1 26 ? -19.061 -11.401 -3.115  1.00 0.00 ? 478 GLN C HE22 3  
ATOM 2096  N N    . ASP A 1 27 ? -18.969 -8.507  1.864   1.00 0.00 ? 479 ASP C N    3  
ATOM 2097  C CA   . ASP A 1 27 ? -20.192 -8.298  2.643   1.00 0.00 ? 479 ASP C CA   3  
ATOM 2098  C C    . ASP A 1 27 ? -19.977 -7.265  3.729   1.00 0.00 ? 479 ASP C C    3  
ATOM 2099  O O    . ASP A 1 27 ? -20.878 -6.515  4.063   1.00 0.00 ? 479 ASP C O    3  
ATOM 2100  C CB   . ASP A 1 27 ? -20.678 -9.598  3.267   1.00 0.00 ? 479 ASP C CB   3  
ATOM 2101  C CG   . ASP A 1 27 ? -22.081 -9.471  3.846   1.00 0.00 ? 479 ASP C CG   3  
ATOM 2102  O OD1  . ASP A 1 27 ? -22.227 -9.010  5.005   1.00 0.00 ? 479 ASP C OD1  3  
ATOM 2103  O OD2  . ASP A 1 27 ? -23.041 -9.828  3.140   1.00 0.00 ? 479 ASP C OD2  3  
ATOM 2104  H H    . ASP A 1 27 ? -18.532 -9.386  1.886   1.00 0.00 ? 479 ASP C H    3  
ATOM 2105  H HA   . ASP A 1 27 ? -20.952 -7.931  1.968   1.00 0.00 ? 479 ASP C HA   3  
ATOM 2106  H HB2  . ASP A 1 27 ? -20.681 -10.370 2.514   1.00 0.00 ? 479 ASP C HB2  3  
ATOM 2107  H HB3  . ASP A 1 27 ? -20.002 -9.877  4.061   1.00 0.00 ? 479 ASP C HB3  3  
ATOM 2108  N N    . LEU A 1 28 ? -18.771 -7.204  4.252   1.00 0.00 ? 480 LEU C N    3  
ATOM 2109  C CA   . LEU A 1 28 ? -18.451 -6.262  5.302   1.00 0.00 ? 480 LEU C CA   3  
ATOM 2110  C C    . LEU A 1 28 ? -18.461 -4.841  4.788   1.00 0.00 ? 480 LEU C C    3  
ATOM 2111  O O    . LEU A 1 28 ? -18.634 -3.904  5.548   1.00 0.00 ? 480 LEU C O    3  
ATOM 2112  C CB   . LEU A 1 28 ? -17.110 -6.580  5.960   1.00 0.00 ? 480 LEU C CB   3  
ATOM 2113  C CG   . LEU A 1 28 ? -17.180 -7.364  7.264   1.00 0.00 ? 480 LEU C CG   3  
ATOM 2114  C CD1  . LEU A 1 28 ? -18.256 -6.809  8.180   1.00 0.00 ? 480 LEU C CD1  3  
ATOM 2115  C CD2  . LEU A 1 28 ? -17.438 -8.800  6.983   1.00 0.00 ? 480 LEU C CD2  3  
ATOM 2116  H H    . LEU A 1 28 ? -18.081 -7.804  3.915   1.00 0.00 ? 480 LEU C H    3  
ATOM 2117  H HA   . LEU A 1 28 ? -19.226 -6.345  6.047   1.00 0.00 ? 480 LEU C HA   3  
ATOM 2118  H HB2  . LEU A 1 28 ? -16.527 -7.158  5.258   1.00 0.00 ? 480 LEU C HB2  3  
ATOM 2119  H HB3  . LEU A 1 28 ? -16.589 -5.663  6.143   1.00 0.00 ? 480 LEU C HB3  3  
ATOM 2120  H HG   . LEU A 1 28 ? -16.232 -7.284  7.777   1.00 0.00 ? 480 LEU C HG   3  
ATOM 2121  H HD11 . LEU A 1 28 ? -19.228 -7.096  7.806   1.00 0.00 ? 480 LEU C HD11 3  
ATOM 2122  H HD12 . LEU A 1 28 ? -18.188 -5.732  8.205   1.00 0.00 ? 480 LEU C HD12 3  
ATOM 2123  H HD13 . LEU A 1 28 ? -18.123 -7.203  9.175   1.00 0.00 ? 480 LEU C HD13 3  
ATOM 2124  H HD21 . LEU A 1 28 ? -16.622 -9.196  6.401   1.00 0.00 ? 480 LEU C HD21 3  
ATOM 2125  H HD22 . LEU A 1 28 ? -18.360 -8.873  6.424   1.00 0.00 ? 480 LEU C HD22 3  
ATOM 2126  H HD23 . LEU A 1 28 ? -17.523 -9.337  7.914   1.00 0.00 ? 480 LEU C HD23 3  
ATOM 2127  N N    . GLN A 1 29 ? -18.268 -4.678  3.504   1.00 0.00 ? 481 GLN C N    3  
ATOM 2128  C CA   . GLN A 1 29 ? -18.339 -3.372  2.912   1.00 0.00 ? 481 GLN C CA   3  
ATOM 2129  C C    . GLN A 1 29 ? -19.784 -3.060  2.560   1.00 0.00 ? 481 GLN C C    3  
ATOM 2130  O O    . GLN A 1 29 ? -20.164 -1.903  2.399   1.00 0.00 ? 481 GLN C O    3  
ATOM 2131  C CB   . GLN A 1 29 ? -17.440 -3.286  1.680   1.00 0.00 ? 481 GLN C CB   3  
ATOM 2132  C CG   . GLN A 1 29 ? -15.984 -3.582  1.983   1.00 0.00 ? 481 GLN C CG   3  
ATOM 2133  C CD   . GLN A 1 29 ? -15.061 -3.277  0.828   1.00 0.00 ? 481 GLN C CD   3  
ATOM 2134  O OE1  . GLN A 1 29 ? -14.814 -4.124  -0.034  1.00 0.00 ? 481 GLN C OE1  3  
ATOM 2135  N NE2  . GLN A 1 29 ? -14.531 -2.070  0.807   1.00 0.00 ? 481 GLN C NE2  3  
ATOM 2136  H H    . GLN A 1 29 ? -18.064 -5.457  2.939   1.00 0.00 ? 481 GLN C H    3  
ATOM 2137  H HA   . GLN A 1 29 ? -17.998 -2.660  3.650   1.00 0.00 ? 481 GLN C HA   3  
ATOM 2138  H HB2  . GLN A 1 29 ? -17.788 -3.995  0.943   1.00 0.00 ? 481 GLN C HB2  3  
ATOM 2139  H HB3  . GLN A 1 29 ? -17.507 -2.293  1.271   1.00 0.00 ? 481 GLN C HB3  3  
ATOM 2140  H HG2  . GLN A 1 29 ? -15.678 -2.987  2.830   1.00 0.00 ? 481 GLN C HG2  3  
ATOM 2141  H HG3  . GLN A 1 29 ? -15.893 -4.627  2.231   1.00 0.00 ? 481 GLN C HG3  3  
ATOM 2142  H HE21 . GLN A 1 29 ? -14.763 -1.445  1.529   1.00 0.00 ? 481 GLN C HE21 3  
ATOM 2143  H HE22 . GLN A 1 29 ? -13.920 -1.841  0.078   1.00 0.00 ? 481 GLN C HE22 3  
ATOM 2144  N N    . LEU A 1 30 ? -20.588 -4.113  2.461   1.00 0.00 ? 482 LEU C N    3  
ATOM 2145  C CA   . LEU A 1 30 ? -21.990 -3.992  2.130   1.00 0.00 ? 482 LEU C CA   3  
ATOM 2146  C C    . LEU A 1 30 ? -22.832 -3.747  3.385   1.00 0.00 ? 482 LEU C C    3  
ATOM 2147  O O    . LEU A 1 30 ? -23.662 -2.837  3.417   1.00 0.00 ? 482 LEU C O    3  
ATOM 2148  C CB   . LEU A 1 30 ? -22.481 -5.265  1.427   1.00 0.00 ? 482 LEU C CB   3  
ATOM 2149  C CG   . LEU A 1 30 ? -21.618 -5.783  0.273   1.00 0.00 ? 482 LEU C CG   3  
ATOM 2150  C CD1  . LEU A 1 30 ? -22.320 -6.907  -0.469  1.00 0.00 ? 482 LEU C CD1  3  
ATOM 2151  C CD2  . LEU A 1 30 ? -21.237 -4.664  -0.677  1.00 0.00 ? 482 LEU C CD2  3  
ATOM 2152  H H    . LEU A 1 30 ? -20.220 -5.009  2.610   1.00 0.00 ? 482 LEU C H    3  
ATOM 2153  H HA   . LEU A 1 30 ? -22.107 -3.156  1.457   1.00 0.00 ? 482 LEU C HA   3  
ATOM 2154  H HB2  . LEU A 1 30 ? -22.551 -6.047  2.170   1.00 0.00 ? 482 LEU C HB2  3  
ATOM 2155  H HB3  . LEU A 1 30 ? -23.468 -5.074  1.048   1.00 0.00 ? 482 LEU C HB3  3  
ATOM 2156  H HG   . LEU A 1 30 ? -20.706 -6.192  0.686   1.00 0.00 ? 482 LEU C HG   3  
ATOM 2157  H HD11 . LEU A 1 30 ? -23.264 -6.550  -0.855  1.00 0.00 ? 482 LEU C HD11 3  
ATOM 2158  H HD12 . LEU A 1 30 ? -22.496 -7.730  0.208   1.00 0.00 ? 482 LEU C HD12 3  
ATOM 2159  H HD13 . LEU A 1 30 ? -21.700 -7.242  -1.286  1.00 0.00 ? 482 LEU C HD13 3  
ATOM 2160  H HD21 . LEU A 1 30 ? -20.667 -3.924  -0.132  1.00 0.00 ? 482 LEU C HD21 3  
ATOM 2161  H HD22 . LEU A 1 30 ? -22.130 -4.212  -1.085  1.00 0.00 ? 482 LEU C HD22 3  
ATOM 2162  H HD23 . LEU A 1 30 ? -20.632 -5.066  -1.473  1.00 0.00 ? 482 LEU C HD23 3  
ATOM 2163  N N    . THR A 1 31 ? -22.619 -4.560  4.413   1.00 0.00 ? 483 THR C N    3  
ATOM 2164  C CA   . THR A 1 31 ? -23.386 -4.447  5.640   1.00 0.00 ? 483 THR C CA   3  
ATOM 2165  C C    . THR A 1 31 ? -22.614 -3.696  6.716   1.00 0.00 ? 483 THR C C    3  
ATOM 2166  O O    . THR A 1 31 ? -23.208 -3.002  7.546   1.00 0.00 ? 483 THR C O    3  
ATOM 2167  C CB   . THR A 1 31 ? -23.773 -5.834  6.179   1.00 0.00 ? 483 THR C CB   3  
ATOM 2168  O OG1  . THR A 1 31 ? -22.594 -6.630  6.360   1.00 0.00 ? 483 THR C OG1  3  
ATOM 2169  C CG2  . THR A 1 31 ? -24.718 -6.535  5.223   1.00 0.00 ? 483 THR C CG2  3  
ATOM 2170  H H    . THR A 1 31 ? -21.932 -5.272  4.348   1.00 0.00 ? 483 THR C H    3  
ATOM 2171  H HA   . THR A 1 31 ? -24.294 -3.907  5.417   1.00 0.00 ? 483 THR C HA   3  
ATOM 2172  H HB   . THR A 1 31 ? -24.266 -5.710  7.132   1.00 0.00 ? 483 THR C HB   3  
ATOM 2173  H HG1  . THR A 1 31 ? -22.599 -7.380  5.741   1.00 0.00 ? 483 THR C HG1  3  
ATOM 2174  H HG21 . THR A 1 31 ? -24.244 -6.642  4.260   1.00 0.00 ? 483 THR C HG21 3  
ATOM 2175  H HG22 . THR A 1 31 ? -25.622 -5.952  5.119   1.00 0.00 ? 483 THR C HG22 3  
ATOM 2176  H HG23 . THR A 1 31 ? -24.963 -7.511  5.613   1.00 0.00 ? 483 THR C HG23 3  
ATOM 2177  N N    . ARG A 1 32 ? -21.281 -3.840  6.694   1.00 0.00 ? 484 ARG C N    3  
ATOM 2178  C CA   . ARG A 1 32 ? -20.404 -3.219  7.682   1.00 0.00 ? 484 ARG C CA   3  
ATOM 2179  C C    . ARG A 1 32 ? -20.704 -3.753  9.081   1.00 0.00 ? 484 ARG C C    3  
ATOM 2180  O O    . ARG A 1 32 ? -20.391 -3.113  10.093  1.00 0.00 ? 484 ARG C O    3  
ATOM 2181  C CB   . ARG A 1 32 ? -20.535 -1.702  7.633   1.00 0.00 ? 484 ARG C CB   3  
ATOM 2182  C CG   . ARG A 1 32 ? -20.360 -1.124  6.242   1.00 0.00 ? 484 ARG C CG   3  
ATOM 2183  C CD   . ARG A 1 32 ? -20.498 0.382   6.241   1.00 0.00 ? 484 ARG C CD   3  
ATOM 2184  N NE   . ARG A 1 32 ? -21.801 0.825   6.754   1.00 0.00 ? 484 ARG C NE   3  
ATOM 2185  C CZ   . ARG A 1 32 ? -22.300 2.058   6.600   1.00 0.00 ? 484 ARG C CZ   3  
ATOM 2186  N NH1  . ARG A 1 32 ? -21.632 2.974   5.897   1.00 0.00 ? 484 ARG C NH1  3  
ATOM 2187  N NH2  . ARG A 1 32 ? -23.473 2.369   7.135   1.00 0.00 ? 484 ARG C NH2  3  
ATOM 2188  H H    . ARG A 1 32 ? -20.867 -4.370  5.983   1.00 0.00 ? 484 ARG C H    3  
ATOM 2189  H HA   . ARG A 1 32 ? -19.390 -3.486  7.424   1.00 0.00 ? 484 ARG C HA   3  
ATOM 2190  H HB2  . ARG A 1 32 ? -21.509 -1.422  7.996   1.00 0.00 ? 484 ARG C HB2  3  
ATOM 2191  H HB3  . ARG A 1 32 ? -19.781 -1.277  8.273   1.00 0.00 ? 484 ARG C HB3  3  
ATOM 2192  H HG2  . ARG A 1 32 ? -19.378 -1.385  5.881   1.00 0.00 ? 484 ARG C HG2  3  
ATOM 2193  H HG3  . ARG A 1 32 ? -21.109 -1.548  5.590   1.00 0.00 ? 484 ARG C HG3  3  
ATOM 2194  H HD2  . ARG A 1 32 ? -19.716 0.792   6.862   1.00 0.00 ? 484 ARG C HD2  3  
ATOM 2195  H HD3  . ARG A 1 32 ? -20.379 0.731   5.227   1.00 0.00 ? 484 ARG C HD3  3  
ATOM 2196  H HE   . ARG A 1 32 ? -22.329 0.161   7.257   1.00 0.00 ? 484 ARG C HE   3  
ATOM 2197  H HH11 . ARG A 1 32 ? -20.752 2.756   5.472   1.00 0.00 ? 484 ARG C HH11 3  
ATOM 2198  H HH12 . ARG A 1 32 ? -22.008 3.899   5.785   1.00 0.00 ? 484 ARG C HH12 3  
ATOM 2199  H HH21 . ARG A 1 32 ? -23.996 1.687   7.655   1.00 0.00 ? 484 ARG C HH21 3  
ATOM 2200  H HH22 . ARG A 1 32 ? -23.859 3.289   7.025   1.00 0.00 ? 484 ARG C HH22 3  
ATOM 2201  N N    . SER A 1 33 ? -21.288 -4.944  9.126   1.00 0.00 ? 485 SER C N    3  
ATOM 2202  C CA   . SER A 1 33 ? -21.659 -5.579  10.369  1.00 0.00 ? 485 SER C CA   3  
ATOM 2203  C C    . SER A 1 33 ? -21.296 -7.050  10.329  1.00 0.00 ? 485 SER C C    3  
ATOM 2204  O O    . SER A 1 33 ? -21.960 -7.830  9.652   1.00 0.00 ? 485 SER C O    3  
ATOM 2205  C CB   . SER A 1 33 ? -23.164 -5.431  10.601  1.00 0.00 ? 485 SER C CB   3  
ATOM 2206  O OG   . SER A 1 33 ? -23.560 -6.005  11.842  1.00 0.00 ? 485 SER C OG   3  
ATOM 2207  H H    . SER A 1 33 ? -21.475 -5.415  8.284   1.00 0.00 ? 485 SER C H    3  
ATOM 2208  H HA   . SER A 1 33 ? -21.129 -5.098  11.173  1.00 0.00 ? 485 SER C HA   3  
ATOM 2209  H HB2  . SER A 1 33 ? -23.437 -4.390  10.590  1.00 0.00 ? 485 SER C HB2  3  
ATOM 2210  H HB3  . SER A 1 33 ? -23.690 -5.939  9.806   1.00 0.00 ? 485 SER C HB3  3  
ATOM 2211  H HG   . SER A 1 33 ? -23.134 -5.538  12.571  1.00 0.00 ? 485 SER C HG   3  
ATOM 2212  N N    . VAL A 1 34 ? -20.238 -7.430  11.046  1.00 0.00 ? 486 VAL C N    3  
ATOM 2213  C CA   . VAL A 1 34 ? -19.813 -8.823  11.089  1.00 0.00 ? 486 VAL C CA   3  
ATOM 2214  C C    . VAL A 1 34 ? -20.934 -9.739  11.579  1.00 0.00 ? 486 VAL C C    3  
ATOM 2215  O O    . VAL A 1 34 ? -21.025 -10.902 11.168  1.00 0.00 ? 486 VAL C O    3  
ATOM 2216  C CB   . VAL A 1 34 ? -18.553 -9.034  11.966  1.00 0.00 ? 486 VAL C CB   3  
ATOM 2217  C CG1  . VAL A 1 34 ? -17.399 -8.200  11.466  1.00 0.00 ? 486 VAL C CG1  3  
ATOM 2218  C CG2  . VAL A 1 34 ? -18.827 -8.748  13.432  1.00 0.00 ? 486 VAL C CG2  3  
ATOM 2219  H H    . VAL A 1 34 ? -19.715 -6.758  11.536  1.00 0.00 ? 486 VAL C H    3  
ATOM 2220  H HA   . VAL A 1 34 ? -19.569 -9.103  10.076  1.00 0.00 ? 486 VAL C HA   3  
ATOM 2221  H HB   . VAL A 1 34 ? -18.267 -10.069 11.876  1.00 0.00 ? 486 VAL C HB   3  
ATOM 2222  H HG11 . VAL A 1 34 ? -17.690 -7.160  11.434  1.00 0.00 ? 486 VAL C HG11 3  
ATOM 2223  H HG12 . VAL A 1 34 ? -17.122 -8.528  10.474  1.00 0.00 ? 486 VAL C HG12 3  
ATOM 2224  H HG13 . VAL A 1 34 ? -16.556 -8.317  12.131  1.00 0.00 ? 486 VAL C HG13 3  
ATOM 2225  H HG21 . VAL A 1 34 ? -19.607 -9.406  13.783  1.00 0.00 ? 486 VAL C HG21 3  
ATOM 2226  H HG22 . VAL A 1 34 ? -19.137 -7.719  13.550  1.00 0.00 ? 486 VAL C HG22 3  
ATOM 2227  H HG23 . VAL A 1 34 ? -17.926 -8.927  13.998  1.00 0.00 ? 486 VAL C HG23 3  
ATOM 2228  N N    . GLU A 1 35 ? -21.794 -9.207  12.442  1.00 0.00 ? 487 GLU C N    3  
ATOM 2229  C CA   . GLU A 1 35 ? -22.910 -9.962  12.964  1.00 0.00 ? 487 GLU C CA   3  
ATOM 2230  C C    . GLU A 1 35 ? -23.859 -10.330 11.834  1.00 0.00 ? 487 GLU C C    3  
ATOM 2231  O O    . GLU A 1 35 ? -24.273 -11.489 11.709  1.00 0.00 ? 487 GLU C O    3  
ATOM 2232  C CB   . GLU A 1 35 ? -23.634 -9.160  14.040  1.00 0.00 ? 487 GLU C CB   3  
ATOM 2233  C CG   . GLU A 1 35 ? -24.746 -9.920  14.734  1.00 0.00 ? 487 GLU C CG   3  
ATOM 2234  C CD   . GLU A 1 35 ? -25.347 -9.138  15.875  1.00 0.00 ? 487 GLU C CD   3  
ATOM 2235  O OE1  . GLU A 1 35 ? -24.803 -9.206  16.994  1.00 0.00 ? 487 GLU C OE1  3  
ATOM 2236  O OE2  . GLU A 1 35 ? -26.366 -8.443  15.656  1.00 0.00 ? 487 GLU C OE2  3  
ATOM 2237  H H    . GLU A 1 35 ? -21.667 -8.280  12.732  1.00 0.00 ? 487 GLU C H    3  
ATOM 2238  H HA   . GLU A 1 35 ? -22.523 -10.871 13.401  1.00 0.00 ? 487 GLU C HA   3  
ATOM 2239  H HB2  . GLU A 1 35 ? -22.917 -8.852  14.787  1.00 0.00 ? 487 GLU C HB2  3  
ATOM 2240  H HB3  . GLU A 1 35 ? -24.061 -8.279  13.583  1.00 0.00 ? 487 GLU C HB3  3  
ATOM 2241  H HG2  . GLU A 1 35 ? -25.523 -10.132 14.013  1.00 0.00 ? 487 GLU C HG2  3  
ATOM 2242  H HG3  . GLU A 1 35 ? -24.348 -10.847 15.119  1.00 0.00 ? 487 GLU C HG3  3  
ATOM 2243  N N    . ILE A 1 36 ? -24.182 -9.349  10.996  1.00 0.00 ? 488 ILE C N    3  
ATOM 2244  C CA   . ILE A 1 36 ? -25.043 -9.593  9.857   1.00 0.00 ? 488 ILE C CA   3  
ATOM 2245  C C    . ILE A 1 36 ? -24.331 -10.482 8.860   1.00 0.00 ? 488 ILE C C    3  
ATOM 2246  O O    . ILE A 1 36 ? -24.867 -11.466 8.449   1.00 0.00 ? 488 ILE C O    3  
ATOM 2247  C CB   . ILE A 1 36 ? -25.487 -8.294  9.153   1.00 0.00 ? 488 ILE C CB   3  
ATOM 2248  C CG1  . ILE A 1 36 ? -26.146 -7.339  10.155  1.00 0.00 ? 488 ILE C CG1  3  
ATOM 2249  C CG2  . ILE A 1 36 ? -26.451 -8.614  8.012   1.00 0.00 ? 488 ILE C CG2  3  
ATOM 2250  C CD1  . ILE A 1 36 ? -26.673 -6.062  9.531   1.00 0.00 ? 488 ILE C CD1  3  
ATOM 2251  H H    . ILE A 1 36 ? -23.829 -8.446  11.151  1.00 0.00 ? 488 ILE C H    3  
ATOM 2252  H HA   . ILE A 1 36 ? -25.922 -10.111 10.215  1.00 0.00 ? 488 ILE C HA   3  
ATOM 2253  H HB   . ILE A 1 36 ? -24.609 -7.828  8.728   1.00 0.00 ? 488 ILE C HB   3  
ATOM 2254  H HG12 . ILE A 1 36 ? -26.976 -7.842  10.625  1.00 0.00 ? 488 ILE C HG12 3  
ATOM 2255  H HG13 . ILE A 1 36 ? -25.422 -7.067  10.909  1.00 0.00 ? 488 ILE C HG13 3  
ATOM 2256  H HG21 . ILE A 1 36 ? -27.325 -9.111  8.409   1.00 0.00 ? 488 ILE C HG21 3  
ATOM 2257  H HG22 . ILE A 1 36 ? -25.963 -9.260  7.298   1.00 0.00 ? 488 ILE C HG22 3  
ATOM 2258  H HG23 . ILE A 1 36 ? -26.750 -7.698  7.525   1.00 0.00 ? 488 ILE C HG23 3  
ATOM 2259  H HD11 . ILE A 1 36 ? -27.420 -6.304  8.788   1.00 0.00 ? 488 ILE C HD11 3  
ATOM 2260  H HD12 . ILE A 1 36 ? -25.860 -5.527  9.061   1.00 0.00 ? 488 ILE C HD12 3  
ATOM 2261  H HD13 . ILE A 1 36 ? -27.116 -5.442  10.297  1.00 0.00 ? 488 ILE C HD13 3  
ATOM 2262  N N    . THR A 1 37 ? -23.109 -10.105 8.489   1.00 0.00 ? 489 THR C N    3  
ATOM 2263  C CA   . THR A 1 37 ? -22.273 -10.875 7.571   1.00 0.00 ? 489 THR C CA   3  
ATOM 2264  C C    . THR A 1 37 ? -22.262 -12.375 7.902   1.00 0.00 ? 489 THR C C    3  
ATOM 2265  O O    . THR A 1 37 ? -22.429 -13.201 7.017   1.00 0.00 ? 489 THR C O    3  
ATOM 2266  C CB   . THR A 1 37 ? -20.832 -10.348 7.590   1.00 0.00 ? 489 THR C CB   3  
ATOM 2267  O OG1  . THR A 1 37 ? -20.835 -8.952  7.285   1.00 0.00 ? 489 THR C OG1  3  
ATOM 2268  C CG2  . THR A 1 37 ? -19.965 -11.085 6.582   1.00 0.00 ? 489 THR C CG2  3  
ATOM 2269  H H    . THR A 1 37 ? -22.756 -9.253  8.811   1.00 0.00 ? 489 THR C H    3  
ATOM 2270  H HA   . THR A 1 37 ? -22.663 -10.737 6.573   1.00 0.00 ? 489 THR C HA   3  
ATOM 2271  H HB   . THR A 1 37 ? -20.429 -10.499 8.581   1.00 0.00 ? 489 THR C HB   3  
ATOM 2272  H HG1  . THR A 1 37 ? -21.304 -8.823  6.442   1.00 0.00 ? 489 THR C HG1  3  
ATOM 2273  H HG21 . THR A 1 37 ? -19.893 -12.126 6.859   1.00 0.00 ? 489 THR C HG21 3  
ATOM 2274  H HG22 . THR A 1 37 ? -18.980 -10.642 6.570   1.00 0.00 ? 489 THR C HG22 3  
ATOM 2275  H HG23 . THR A 1 37 ? -20.408 -11.002 5.602   1.00 0.00 ? 489 THR C HG23 3  
ATOM 2276  N N    . THR A 1 38 ? -22.083 -12.718 9.174   1.00 0.00 ? 490 THR C N    3  
ATOM 2277  C CA   . THR A 1 38 ? -22.062 -14.119 9.573   1.00 0.00 ? 490 THR C CA   3  
ATOM 2278  C C    . THR A 1 38 ? -23.406 -14.778 9.267   1.00 0.00 ? 490 THR C C    3  
ATOM 2279  O O    . THR A 1 38 ? -23.462 -15.868 8.694   1.00 0.00 ? 490 THR C O    3  
ATOM 2280  C CB   . THR A 1 38 ? -21.742 -14.272 11.068  1.00 0.00 ? 490 THR C CB   3  
ATOM 2281  O OG1  . THR A 1 38 ? -20.549 -13.537 11.394  1.00 0.00 ? 490 THR C OG1  3  
ATOM 2282  C CG2  . THR A 1 38 ? -21.533 -15.732 11.410  1.00 0.00 ? 490 THR C CG2  3  
ATOM 2283  H H    . THR A 1 38 ? -21.971 -12.022 9.853   1.00 0.00 ? 490 THR C H    3  
ATOM 2284  H HA   . THR A 1 38 ? -21.296 -14.627 9.001   1.00 0.00 ? 490 THR C HA   3  
ATOM 2285  H HB   . THR A 1 38 ? -22.571 -13.889 11.647  1.00 0.00 ? 490 THR C HB   3  
ATOM 2286  H HG1  . THR A 1 38 ? -20.681 -12.598 11.204  1.00 0.00 ? 490 THR C HG1  3  
ATOM 2287  H HG21 . THR A 1 38 ? -20.750 -16.131 10.779  1.00 0.00 ? 490 THR C HG21 3  
ATOM 2288  H HG22 . THR A 1 38 ? -22.450 -16.277 11.235  1.00 0.00 ? 490 THR C HG22 3  
ATOM 2289  H HG23 . THR A 1 38 ? -21.245 -15.825 12.446  1.00 0.00 ? 490 THR C HG23 3  
ATOM 2290  N N    . ASP A 1 39 ? -24.483 -14.090 9.624   1.00 0.00 ? 491 ASP C N    3  
ATOM 2291  C CA   . ASP A 1 39 ? -25.832 -14.573 9.347   1.00 0.00 ? 491 ASP C CA   3  
ATOM 2292  C C    . ASP A 1 39 ? -26.072 -14.563 7.849   1.00 0.00 ? 491 ASP C C    3  
ATOM 2293  O O    . ASP A 1 39 ? -26.714 -15.447 7.300   1.00 0.00 ? 491 ASP C O    3  
ATOM 2294  C CB   . ASP A 1 39 ? -26.864 -13.692 10.050  1.00 0.00 ? 491 ASP C CB   3  
ATOM 2295  C CG   . ASP A 1 39 ? -28.287 -14.086 9.724   1.00 0.00 ? 491 ASP C CG   3  
ATOM 2296  O OD1  . ASP A 1 39 ? -28.649 -15.265 9.936   1.00 0.00 ? 491 ASP C OD1  3  
ATOM 2297  O OD2  . ASP A 1 39 ? -29.060 -13.210 9.280   1.00 0.00 ? 491 ASP C OD2  3  
ATOM 2298  H H    . ASP A 1 39 ? -24.367 -13.225 10.074  1.00 0.00 ? 491 ASP C H    3  
ATOM 2299  H HA   . ASP A 1 39 ? -25.916 -15.587 9.709   1.00 0.00 ? 491 ASP C HA   3  
ATOM 2300  H HB2  . ASP A 1 39 ? -26.724 -13.767 11.117  1.00 0.00 ? 491 ASP C HB2  3  
ATOM 2301  H HB3  . ASP A 1 39 ? -26.713 -12.667 9.746   1.00 0.00 ? 491 ASP C HB3  3  
ATOM 2302  N N    . ASN A 1 40 ? -25.519 -13.556 7.208   1.00 0.00 ? 492 ASN C N    3  
ATOM 2303  C CA   . ASN A 1 40 ? -25.577 -13.389 5.778   1.00 0.00 ? 492 ASN C CA   3  
ATOM 2304  C C    . ASN A 1 40 ? -25.004 -14.622 5.086   1.00 0.00 ? 492 ASN C C    3  
ATOM 2305  O O    . ASN A 1 40 ? -25.626 -15.192 4.193   1.00 0.00 ? 492 ASN C O    3  
ATOM 2306  C CB   . ASN A 1 40 ? -24.804 -12.123 5.368   1.00 0.00 ? 492 ASN C CB   3  
ATOM 2307  C CG   . ASN A 1 40 ? -25.707 -10.970 5.006   1.00 0.00 ? 492 ASN C CG   3  
ATOM 2308  O OD1  . ASN A 1 40 ? -26.854 -11.161 4.595   1.00 0.00 ? 492 ASN C OD1  3  
ATOM 2309  N ND2  . ASN A 1 40 ? -25.188 -9.767  5.116   1.00 0.00 ? 492 ASN C ND2  3  
ATOM 2310  H H    . ASN A 1 40 ? -25.053 -12.873 7.740   1.00 0.00 ? 492 ASN C H    3  
ATOM 2311  H HA   . ASN A 1 40 ? -26.614 -13.262 5.506   1.00 0.00 ? 492 ASN C HA   3  
ATOM 2312  H HB2  . ASN A 1 40 ? -24.217 -11.803 6.218   1.00 0.00 ? 492 ASN C HB2  3  
ATOM 2313  H HB3  . ASN A 1 40 ? -24.137 -12.323 4.548   1.00 0.00 ? 492 ASN C HB3  3  
ATOM 2314  H HD21 . ASN A 1 40 ? -24.250 -9.690  5.417   1.00 0.00 ? 492 ASN C HD21 3  
ATOM 2315  H HD22 . ASN A 1 40 ? -25.743 -8.995  4.897   1.00 0.00 ? 492 ASN C HD22 3  
ATOM 2316  N N    . ILE A 1 41 ? -23.813 -15.040 5.525   1.00 0.00 ? 493 ILE C N    3  
ATOM 2317  C CA   . ILE A 1 41 ? -23.171 -16.249 5.007   1.00 0.00 ? 493 ILE C CA   3  
ATOM 2318  C C    . ILE A 1 41 ? -24.124 -17.429 5.143   1.00 0.00 ? 493 ILE C C    3  
ATOM 2319  O O    . ILE A 1 41 ? -24.317 -18.208 4.208   1.00 0.00 ? 493 ILE C O    3  
ATOM 2320  C CB   . ILE A 1 41 ? -21.884 -16.592 5.806   1.00 0.00 ? 493 ILE C CB   3  
ATOM 2321  C CG1  . ILE A 1 41 ? -20.904 -15.429 5.800   1.00 0.00 ? 493 ILE C CG1  3  
ATOM 2322  C CG2  . ILE A 1 41 ? -21.217 -17.836 5.241   1.00 0.00 ? 493 ILE C CG2  3  
ATOM 2323  C CD1  . ILE A 1 41 ? -19.794 -15.582 6.821   1.00 0.00 ? 493 ILE C CD1  3  
ATOM 2324  H H    . ILE A 1 41 ? -23.350 -14.510 6.215   1.00 0.00 ? 493 ILE C H    3  
ATOM 2325  H HA   . ILE A 1 41 ? -22.915 -16.089 3.971   1.00 0.00 ? 493 ILE C HA   3  
ATOM 2326  H HB   . ILE A 1 41 ? -22.170 -16.800 6.828   1.00 0.00 ? 493 ILE C HB   3  
ATOM 2327  H HG12 . ILE A 1 41 ? -20.453 -15.349 4.823   1.00 0.00 ? 493 ILE C HG12 3  
ATOM 2328  H HG13 . ILE A 1 41 ? -21.437 -14.520 6.021   1.00 0.00 ? 493 ILE C HG13 3  
ATOM 2329  H HG21 . ILE A 1 41 ? -20.950 -17.659 4.209   1.00 0.00 ? 493 ILE C HG21 3  
ATOM 2330  H HG22 . ILE A 1 41 ? -21.900 -18.670 5.300   1.00 0.00 ? 493 ILE C HG22 3  
ATOM 2331  H HG23 . ILE A 1 41 ? -20.327 -18.052 5.810   1.00 0.00 ? 493 ILE C HG23 3  
ATOM 2332  H HD11 . ILE A 1 41 ? -19.227 -16.472 6.604   1.00 0.00 ? 493 ILE C HD11 3  
ATOM 2333  H HD12 . ILE A 1 41 ? -20.228 -15.673 7.804   1.00 0.00 ? 493 ILE C HD12 3  
ATOM 2334  H HD13 . ILE A 1 41 ? -19.146 -14.720 6.793   1.00 0.00 ? 493 ILE C HD13 3  
ATOM 2335  N N    . LEU A 1 42 ? -24.730 -17.521 6.317   1.00 0.00 ? 494 LEU C N    3  
ATOM 2336  C CA   . LEU A 1 42 ? -25.649 -18.593 6.662   1.00 0.00 ? 494 LEU C CA   3  
ATOM 2337  C C    . LEU A 1 42 ? -26.923 -18.561 5.805   1.00 0.00 ? 494 LEU C C    3  
ATOM 2338  O O    . LEU A 1 42 ? -27.496 -19.609 5.503   1.00 0.00 ? 494 LEU C O    3  
ATOM 2339  C CB   . LEU A 1 42 ? -25.993 -18.504 8.149   1.00 0.00 ? 494 LEU C CB   3  
ATOM 2340  C CG   . LEU A 1 42 ? -24.811 -18.707 9.103   1.00 0.00 ? 494 LEU C CG   3  
ATOM 2341  C CD1  . LEU A 1 42 ? -25.193 -18.343 10.528  1.00 0.00 ? 494 LEU C CD1  3  
ATOM 2342  C CD2  . LEU A 1 42 ? -24.309 -20.141 9.029   1.00 0.00 ? 494 LEU C CD2  3  
ATOM 2343  H H    . LEU A 1 42 ? -24.548 -16.831 6.992   1.00 0.00 ? 494 LEU C H    3  
ATOM 2344  H HA   . LEU A 1 42 ? -25.142 -19.529 6.484   1.00 0.00 ? 494 LEU C HA   3  
ATOM 2345  H HB2  . LEU A 1 42 ? -26.415 -17.528 8.336   1.00 0.00 ? 494 LEU C HB2  3  
ATOM 2346  H HB3  . LEU A 1 42 ? -26.739 -19.248 8.375   1.00 0.00 ? 494 LEU C HB3  3  
ATOM 2347  H HG   . LEU A 1 42 ? -24.003 -18.056 8.801   1.00 0.00 ? 494 LEU C HG   3  
ATOM 2348  H HD11 . LEU A 1 42 ? -26.088 -18.876 10.810  1.00 0.00 ? 494 LEU C HD11 3  
ATOM 2349  H HD12 . LEU A 1 42 ? -25.361 -17.278 10.595  1.00 0.00 ? 494 LEU C HD12 3  
ATOM 2350  H HD13 . LEU A 1 42 ? -24.387 -18.617 11.192  1.00 0.00 ? 494 LEU C HD13 3  
ATOM 2351  H HD21 . LEU A 1 42 ? -23.896 -20.329 8.050   1.00 0.00 ? 494 LEU C HD21 3  
ATOM 2352  H HD22 . LEU A 1 42 ? -25.132 -20.817 9.207   1.00 0.00 ? 494 LEU C HD22 3  
ATOM 2353  H HD23 . LEU A 1 42 ? -23.548 -20.296 9.779   1.00 0.00 ? 494 LEU C HD23 3  
ATOM 2354  N N    . GLU A 1 43 ? -27.366 -17.368 5.424   1.00 0.00 ? 495 GLU C N    3  
ATOM 2355  C CA   . GLU A 1 43 ? -28.545 -17.232 4.562   1.00 0.00 ? 495 GLU C CA   3  
ATOM 2356  C C    . GLU A 1 43 ? -28.206 -17.623 3.134   1.00 0.00 ? 495 GLU C C    3  
ATOM 2357  O O    . GLU A 1 43 ? -29.086 -17.932 2.334   1.00 0.00 ? 495 GLU C O    3  
ATOM 2358  C CB   . GLU A 1 43 ? -29.074 -15.797 4.559   1.00 0.00 ? 495 GLU C CB   3  
ATOM 2359  C CG   . GLU A 1 43 ? -29.554 -15.289 5.899   1.00 0.00 ? 495 GLU C CG   3  
ATOM 2360  C CD   . GLU A 1 43 ? -30.286 -13.975 5.772   1.00 0.00 ? 495 GLU C CD   3  
ATOM 2361  O OE1  . GLU A 1 43 ? -29.635 -12.945 5.509   1.00 0.00 ? 495 GLU C OE1  3  
ATOM 2362  O OE2  . GLU A 1 43 ? -31.530 -13.964 5.912   1.00 0.00 ? 495 GLU C OE2  3  
ATOM 2363  H H    . GLU A 1 43 ? -26.905 -16.559 5.742   1.00 0.00 ? 495 GLU C H    3  
ATOM 2364  H HA   . GLU A 1 43 ? -29.313 -17.893 4.935   1.00 0.00 ? 495 GLU C HA   3  
ATOM 2365  H HB2  . GLU A 1 43 ? -28.287 -15.140 4.220   1.00 0.00 ? 495 GLU C HB2  3  
ATOM 2366  H HB3  . GLU A 1 43 ? -29.897 -15.738 3.862   1.00 0.00 ? 495 GLU C HB3  3  
ATOM 2367  H HG2  . GLU A 1 43 ? -30.224 -16.018 6.332   1.00 0.00 ? 495 GLU C HG2  3  
ATOM 2368  H HG3  . GLU A 1 43 ? -28.702 -15.151 6.548   1.00 0.00 ? 495 GLU C HG3  3  
ATOM 2369  N N    . GLY A 1 44 ? -26.926 -17.614 2.827   1.00 0.00 ? 496 GLY C N    3  
ATOM 2370  C CA   . GLY A 1 44 ? -26.486 -17.902 1.486   1.00 0.00 ? 496 GLY C CA   3  
ATOM 2371  C C    . GLY A 1 44 ? -26.204 -16.635 0.722   1.00 0.00 ? 496 GLY C C    3  
ATOM 2372  O O    . GLY A 1 44 ? -26.205 -16.624 -0.508  1.00 0.00 ? 496 GLY C O    3  
ATOM 2373  H H    . GLY A 1 44 ? -26.267 -17.418 3.527   1.00 0.00 ? 496 GLY C H    3  
ATOM 2374  H HA2  . GLY A 1 44 ? -25.590 -18.500 1.528   1.00 0.00 ? 496 GLY C HA2  3  
ATOM 2375  H HA3  . GLY A 1 44 ? -27.256 -18.454 0.972   1.00 0.00 ? 496 GLY C HA3  3  
ATOM 2376  N N    . ARG A 1 45 ? -25.972 -15.557 1.464   1.00 0.00 ? 497 ARG C N    3  
ATOM 2377  C CA   . ARG A 1 45 ? -25.670 -14.259 0.881   1.00 0.00 ? 497 ARG C CA   3  
ATOM 2378  C C    . ARG A 1 45 ? -24.321 -14.311 0.178   1.00 0.00 ? 497 ARG C C    3  
ATOM 2379  O O    . ARG A 1 45 ? -24.148 -13.763 -0.910  1.00 0.00 ? 497 ARG C O    3  
ATOM 2380  C CB   . ARG A 1 45 ? -25.647 -13.196 1.979   1.00 0.00 ? 497 ARG C CB   3  
ATOM 2381  C CG   . ARG A 1 45 ? -25.638 -11.769 1.483   1.00 0.00 ? 497 ARG C CG   3  
ATOM 2382  C CD   . ARG A 1 45 ? -27.018 -11.350 1.041   1.00 0.00 ? 497 ARG C CD   3  
ATOM 2383  N NE   . ARG A 1 45 ? -28.011 -11.572 2.099   1.00 0.00 ? 497 ARG C NE   3  
ATOM 2384  C CZ   . ARG A 1 45 ? -29.290 -11.889 1.882   1.00 0.00 ? 497 ARG C CZ   3  
ATOM 2385  N NH1  . ARG A 1 45 ? -29.745 -12.013 0.637   1.00 0.00 ? 497 ARG C NH1  3  
ATOM 2386  N NH2  . ARG A 1 45 ? -30.107 -12.106 2.910   1.00 0.00 ? 497 ARG C NH2  3  
ATOM 2387  H H    . ARG A 1 45 ? -26.010 -15.639 2.442   1.00 0.00 ? 497 ARG C H    3  
ATOM 2388  H HA   . ARG A 1 45 ? -26.441 -14.018 0.164   1.00 0.00 ? 497 ARG C HA   3  
ATOM 2389  H HB2  . ARG A 1 45 ? -26.528 -13.323 2.590   1.00 0.00 ? 497 ARG C HB2  3  
ATOM 2390  H HB3  . ARG A 1 45 ? -24.781 -13.346 2.602   1.00 0.00 ? 497 ARG C HB3  3  
ATOM 2391  H HG2  . ARG A 1 45 ? -25.312 -11.119 2.282   1.00 0.00 ? 497 ARG C HG2  3  
ATOM 2392  H HG3  . ARG A 1 45 ? -24.957 -11.689 0.648   1.00 0.00 ? 497 ARG C HG3  3  
ATOM 2393  H HD2  . ARG A 1 45 ? -26.991 -10.302 0.796   1.00 0.00 ? 497 ARG C HD2  3  
ATOM 2394  H HD3  . ARG A 1 45 ? -27.295 -11.922 0.171   1.00 0.00 ? 497 ARG C HD3  3  
ATOM 2395  H HE   . ARG A 1 45 ? -27.689 -11.488 3.031   1.00 0.00 ? 497 ARG C HE   3  
ATOM 2396  H HH11 . ARG A 1 45 ? -29.135 -11.871 -0.146  1.00 0.00 ? 497 ARG C HH11 3  
ATOM 2397  H HH12 . ARG A 1 45 ? -30.706 -12.253 0.465   1.00 0.00 ? 497 ARG C HH12 3  
ATOM 2398  H HH21 . ARG A 1 45 ? -29.776 -12.038 3.863   1.00 0.00 ? 497 ARG C HH21 3  
ATOM 2399  H HH22 . ARG A 1 45 ? -31.069 -12.346 2.754   1.00 0.00 ? 497 ARG C HH22 3  
ATOM 2400  N N    . ILE A 1 46 ? -23.369 -14.976 0.813   1.00 0.00 ? 498 ILE C N    3  
ATOM 2401  C CA   . ILE A 1 46 ? -22.042 -15.139 0.254   1.00 0.00 ? 498 ILE C CA   3  
ATOM 2402  C C    . ILE A 1 46 ? -21.881 -16.558 -0.264  1.00 0.00 ? 498 ILE C C    3  
ATOM 2403  O O    . ILE A 1 46 ? -21.901 -17.515 0.515   1.00 0.00 ? 498 ILE C O    3  
ATOM 2404  C CB   . ILE A 1 46 ? -20.914 -14.851 1.292   1.00 0.00 ? 498 ILE C CB   3  
ATOM 2405  C CG1  . ILE A 1 46 ? -20.968 -13.403 1.805   1.00 0.00 ? 498 ILE C CG1  3  
ATOM 2406  C CG2  . ILE A 1 46 ? -19.549 -15.140 0.690   1.00 0.00 ? 498 ILE C CG2  3  
ATOM 2407  C CD1  . ILE A 1 46 ? -21.982 -13.169 2.899   1.00 0.00 ? 498 ILE C CD1  3  
ATOM 2408  H H    . ILE A 1 46 ? -23.568 -15.380 1.681   1.00 0.00 ? 498 ILE C H    3  
ATOM 2409  H HA   . ILE A 1 46 ? -21.940 -14.449 -0.573  1.00 0.00 ? 498 ILE C HA   3  
ATOM 2410  H HB   . ILE A 1 46 ? -21.053 -15.522 2.127   1.00 0.00 ? 498 ILE C HB   3  
ATOM 2411  H HG12 . ILE A 1 46 ? -20.002 -13.138 2.200   1.00 0.00 ? 498 ILE C HG12 3  
ATOM 2412  H HG13 . ILE A 1 46 ? -21.207 -12.746 0.981   1.00 0.00 ? 498 ILE C HG13 3  
ATOM 2413  H HG21 . ILE A 1 46 ? -19.410 -14.533 -0.191  1.00 0.00 ? 498 ILE C HG21 3  
ATOM 2414  H HG22 . ILE A 1 46 ? -19.489 -16.184 0.421   1.00 0.00 ? 498 ILE C HG22 3  
ATOM 2415  H HG23 . ILE A 1 46 ? -18.781 -14.909 1.412   1.00 0.00 ? 498 ILE C HG23 3  
ATOM 2416  H HD11 . ILE A 1 46 ? -21.715 -13.747 3.770   1.00 0.00 ? 498 ILE C HD11 3  
ATOM 2417  H HD12 . ILE A 1 46 ? -22.952 -13.481 2.548   1.00 0.00 ? 498 ILE C HD12 3  
ATOM 2418  H HD13 . ILE A 1 46 ? -22.008 -12.121 3.152   1.00 0.00 ? 498 ILE C HD13 3  
ATOM 2419  N N    . GLN A 1 47 ? -21.747 -16.694 -1.567  1.00 0.00 ? 499 GLN C N    3  
ATOM 2420  C CA   . GLN A 1 47 ? -21.583 -17.998 -2.181  1.00 0.00 ? 499 GLN C CA   3  
ATOM 2421  C C    . GLN A 1 47 ? -20.291 -18.052 -2.980  1.00 0.00 ? 499 GLN C C    3  
ATOM 2422  O O    . GLN A 1 47 ? -19.768 -17.017 -3.405  1.00 0.00 ? 499 GLN C O    3  
ATOM 2423  C CB   . GLN A 1 47 ? -22.778 -18.323 -3.078  1.00 0.00 ? 499 GLN C CB   3  
ATOM 2424  C CG   . GLN A 1 47 ? -24.096 -18.396 -2.329  1.00 0.00 ? 499 GLN C CG   3  
ATOM 2425  C CD   . GLN A 1 47 ? -25.277 -18.690 -3.230  1.00 0.00 ? 499 GLN C CD   3  
ATOM 2426  O OE1  . GLN A 1 47 ? -25.145 -19.362 -4.252  1.00 0.00 ? 499 GLN C OE1  3  
ATOM 2427  N NE2  . GLN A 1 47 ? -26.435 -18.186 -2.861  1.00 0.00 ? 499 GLN C NE2  3  
ATOM 2428  H H    . GLN A 1 47 ? -21.756 -15.897 -2.140  1.00 0.00 ? 499 GLN C H    3  
ATOM 2429  H HA   . GLN A 1 47 ? -21.531 -18.732 -1.390  1.00 0.00 ? 499 GLN C HA   3  
ATOM 2430  H HB2  . GLN A 1 47 ? -22.863 -17.560 -3.838  1.00 0.00 ? 499 GLN C HB2  3  
ATOM 2431  H HB3  . GLN A 1 47 ? -22.608 -19.277 -3.556  1.00 0.00 ? 499 GLN C HB3  3  
ATOM 2432  H HG2  . GLN A 1 47 ? -24.031 -19.176 -1.586  1.00 0.00 ? 499 GLN C HG2  3  
ATOM 2433  H HG3  . GLN A 1 47 ? -24.266 -17.448 -1.837  1.00 0.00 ? 499 GLN C HG3  3  
ATOM 2434  H HE21 . GLN A 1 47 ? -26.464 -17.652 -2.031  1.00 0.00 ? 499 GLN C HE21 3  
ATOM 2435  H HE22 . GLN A 1 47 ? -27.224 -18.357 -3.419  1.00 0.00 ? 499 GLN C HE22 3  
ATOM 2436  N N    . VAL A 1 48 ? -19.777 -19.251 -3.171  1.00 0.00 ? 500 VAL C N    3  
ATOM 2437  C CA   . VAL A 1 48 ? -18.545 -19.447 -3.912  1.00 0.00 ? 500 VAL C CA   3  
ATOM 2438  C C    . VAL A 1 48 ? -18.815 -20.261 -5.171  1.00 0.00 ? 500 VAL C C    3  
ATOM 2439  O O    . VAL A 1 48 ? -19.184 -21.433 -5.088  1.00 0.00 ? 500 VAL C O    3  
ATOM 2440  C CB   . VAL A 1 48 ? -17.483 -20.186 -3.062  1.00 0.00 ? 500 VAL C CB   3  
ATOM 2441  C CG1  . VAL A 1 48 ? -16.146 -20.234 -3.790  1.00 0.00 ? 500 VAL C CG1  3  
ATOM 2442  C CG2  . VAL A 1 48 ? -17.329 -19.532 -1.700  1.00 0.00 ? 500 VAL C CG2  3  
ATOM 2443  H H    . VAL A 1 48 ? -20.240 -20.037 -2.809  1.00 0.00 ? 500 VAL C H    3  
ATOM 2444  H HA   . VAL A 1 48 ? -18.154 -18.478 -4.185  1.00 0.00 ? 500 VAL C HA   3  
ATOM 2445  H HB   . VAL A 1 48 ? -17.819 -21.202 -2.915  1.00 0.00 ? 500 VAL C HB   3  
ATOM 2446  H HG11 . VAL A 1 48 ? -16.265 -20.755 -4.729  1.00 0.00 ? 500 VAL C HG11 3  
ATOM 2447  H HG12 . VAL A 1 48 ? -15.421 -20.752 -3.181  1.00 0.00 ? 500 VAL C HG12 3  
ATOM 2448  H HG13 . VAL A 1 48 ? -15.803 -19.227 -3.979  1.00 0.00 ? 500 VAL C HG13 3  
ATOM 2449  H HG21 . VAL A 1 48 ? -18.272 -19.566 -1.174  1.00 0.00 ? 500 VAL C HG21 3  
ATOM 2450  H HG22 . VAL A 1 48 ? -17.029 -18.502 -1.829  1.00 0.00 ? 500 VAL C HG22 3  
ATOM 2451  H HG23 . VAL A 1 48 ? -16.577 -20.055 -1.129  1.00 0.00 ? 500 VAL C HG23 3  
ATOM 2452  N N    . PRO A 1 49 ? -18.673 -19.653 -6.353  1.00 0.00 ? 501 PRO C N    3  
ATOM 2453  C CA   . PRO A 1 49 ? -18.877 -20.344 -7.619  1.00 0.00 ? 501 PRO C CA   3  
ATOM 2454  C C    . PRO A 1 49 ? -17.745 -21.322 -7.908  1.00 0.00 ? 501 PRO C C    3  
ATOM 2455  O O    . PRO A 1 49 ? -16.598 -20.916 -8.120  1.00 0.00 ? 501 PRO C O    3  
ATOM 2456  C CB   . PRO A 1 49 ? -18.894 -19.215 -8.668  1.00 0.00 ? 501 PRO C CB   3  
ATOM 2457  C CG   . PRO A 1 49 ? -18.953 -17.946 -7.882  1.00 0.00 ? 501 PRO C CG   3  
ATOM 2458  C CD   . PRO A 1 49 ? -18.321 -18.247 -6.559  1.00 0.00 ? 501 PRO C CD   3  
ATOM 2459  H HA   . PRO A 1 49 ? -19.818 -20.870 -7.631  1.00 0.00 ? 501 PRO C HA   3  
ATOM 2460  H HB2  . PRO A 1 49 ? -17.996 -19.267 -9.267  1.00 0.00 ? 501 PRO C HB2  3  
ATOM 2461  H HB3  . PRO A 1 49 ? -19.761 -19.324 -9.304  1.00 0.00 ? 501 PRO C HB3  3  
ATOM 2462  H HG2  . PRO A 1 49 ? -18.401 -17.170 -8.394  1.00 0.00 ? 501 PRO C HG2  3  
ATOM 2463  H HG3  . PRO A 1 49 ? -19.982 -17.644 -7.747  1.00 0.00 ? 501 PRO C HG3  3  
ATOM 2464  H HD2  . PRO A 1 49 ? -17.250 -18.121 -6.612  1.00 0.00 ? 501 PRO C HD2  3  
ATOM 2465  H HD3  . PRO A 1 49 ? -18.747 -17.623 -5.788  1.00 0.00 ? 501 PRO C HD3  3  
ATOM 2466  N N    . PHE A 1 50 ? -18.059 -22.600 -7.896  1.00 0.00 ? 502 PHE C N    3  
ATOM 2467  C CA   . PHE A 1 50 ? -17.073 -23.626 -8.170  1.00 0.00 ? 502 PHE C CA   3  
ATOM 2468  C C    . PHE A 1 50 ? -17.203 -24.091 -9.605  1.00 0.00 ? 502 PHE C C    3  
ATOM 2469  O O    . PHE A 1 50 ? -18.309 -24.102 -10.152 1.00 0.00 ? 502 PHE C O    3  
ATOM 2470  C CB   . PHE A 1 50 ? -17.243 -24.815 -7.217  1.00 0.00 ? 502 PHE C CB   3  
ATOM 2471  C CG   . PHE A 1 50 ? -16.941 -24.495 -5.781  1.00 0.00 ? 502 PHE C CG   3  
ATOM 2472  C CD1  . PHE A 1 50 ? -15.641 -24.240 -5.375  1.00 0.00 ? 502 PHE C CD1  3  
ATOM 2473  C CD2  . PHE A 1 50 ? -17.951 -24.460 -4.837  1.00 0.00 ? 502 PHE C CD2  3  
ATOM 2474  C CE1  . PHE A 1 50 ? -15.357 -23.956 -4.055  1.00 0.00 ? 502 PHE C CE1  3  
ATOM 2475  C CE2  . PHE A 1 50 ? -17.674 -24.174 -3.514  1.00 0.00 ? 502 PHE C CE2  3  
ATOM 2476  C CZ   . PHE A 1 50 ? -16.374 -23.922 -3.124  1.00 0.00 ? 502 PHE C CZ   3  
ATOM 2477  H H    . PHE A 1 50 ? -18.985 -22.867 -7.713  1.00 0.00 ? 502 PHE C H    3  
ATOM 2478  H HA   . PHE A 1 50 ? -16.095 -23.193 -8.025  1.00 0.00 ? 502 PHE C HA   3  
ATOM 2479  H HB2  . PHE A 1 50 ? -18.262 -25.165 -7.270  1.00 0.00 ? 502 PHE C HB2  3  
ATOM 2480  H HB3  . PHE A 1 50 ? -16.580 -25.609 -7.528  1.00 0.00 ? 502 PHE C HB3  3  
ATOM 2481  H HD1  . PHE A 1 50 ? -14.845 -24.266 -6.103  1.00 0.00 ? 502 PHE C HD1  3  
ATOM 2482  H HD2  . PHE A 1 50 ? -18.968 -24.656 -5.142  1.00 0.00 ? 502 PHE C HD2  3  
ATOM 2483  H HE1  . PHE A 1 50 ? -14.339 -23.760 -3.752  1.00 0.00 ? 502 PHE C HE1  3  
ATOM 2484  H HE2  . PHE A 1 50 ? -18.472 -24.149 -2.787  1.00 0.00 ? 502 PHE C HE2  3  
ATOM 2485  H HZ   . PHE A 1 50 ? -16.153 -23.700 -2.090  1.00 0.00 ? 502 PHE C HZ   3  
ATOM 2486  N N    . PRO A 1 51 ? -16.081 -24.464 -10.248 1.00 0.00 ? 503 PRO C N    3  
ATOM 2487  C CA   . PRO A 1 51 ? -16.098 -24.948 -11.628 1.00 0.00 ? 503 PRO C CA   3  
ATOM 2488  C C    . PRO A 1 51 ? -17.052 -26.121 -11.782 1.00 0.00 ? 503 PRO C C    3  
ATOM 2489  O O    . PRO A 1 51 ? -16.905 -27.154 -11.119 1.00 0.00 ? 503 PRO C O    3  
ATOM 2490  C CB   . PRO A 1 51 ? -14.658 -25.404 -11.862 1.00 0.00 ? 503 PRO C CB   3  
ATOM 2491  C CG   . PRO A 1 51 ? -13.852 -24.607 -10.898 1.00 0.00 ? 503 PRO C CG   3  
ATOM 2492  C CD   . PRO A 1 51 ? -14.720 -24.432 -9.688  1.00 0.00 ? 503 PRO C CD   3  
ATOM 2493  H HA   . PRO A 1 51 ? -16.361 -24.168 -12.327 1.00 0.00 ? 503 PRO C HA   3  
ATOM 2494  H HB2  . PRO A 1 51 ? -14.577 -26.464 -11.665 1.00 0.00 ? 503 PRO C HB2  3  
ATOM 2495  H HB3  . PRO A 1 51 ? -14.371 -25.197 -12.881 1.00 0.00 ? 503 PRO C HB3  3  
ATOM 2496  H HG2  . PRO A 1 51 ? -12.951 -25.142 -10.640 1.00 0.00 ? 503 PRO C HG2  3  
ATOM 2497  H HG3  . PRO A 1 51 ? -13.611 -23.647 -11.328 1.00 0.00 ? 503 PRO C HG3  3  
ATOM 2498  H HD2  . PRO A 1 51 ? -14.567 -25.243 -8.992  1.00 0.00 ? 503 PRO C HD2  3  
ATOM 2499  H HD3  . PRO A 1 51 ? -14.517 -23.482 -9.216  1.00 0.00 ? 503 PRO C HD3  3  
ATOM 2500  N N    . THR A 1 52 ? -18.024 -25.964 -12.645 1.00 0.00 ? 504 THR C N    3  
ATOM 2501  C CA   . THR A 1 52 ? -19.030 -26.975 -12.855 1.00 0.00 ? 504 THR C CA   3  
ATOM 2502  C C    . THR A 1 52 ? -19.617 -26.847 -14.256 1.00 0.00 ? 504 THR C C    3  
ATOM 2503  O O    . THR A 1 52 ? -19.234 -27.643 -15.132 1.00 0.00 ? 504 THR C O    3  
ATOM 2504  C CB   . THR A 1 52 ? -20.157 -26.864 -11.790 1.00 0.00 ? 504 THR C CB   3  
ATOM 2505  O OG1  . THR A 1 52 ? -19.598 -27.027 -10.475 1.00 0.00 ? 504 THR C OG1  3  
ATOM 2506  C CG2  . THR A 1 52 ? -21.229 -27.921 -12.016 1.00 0.00 ? 504 THR C CG2  3  
ATOM 2507  O OXT  . THR A 1 52 ? -20.432 -25.929 -14.481 1.00 0.00 ? 504 THR C OXT  3  
ATOM 2508  H H    . THR A 1 52 ? -18.075 -25.133 -13.167 1.00 0.00 ? 504 THR C H    3  
ATOM 2509  H HA   . THR A 1 52 ? -18.559 -27.941 -12.756 1.00 0.00 ? 504 THR C HA   3  
ATOM 2510  H HB   . THR A 1 52 ? -20.606 -25.881 -11.853 1.00 0.00 ? 504 THR C HB   3  
ATOM 2511  H HG1  . THR A 1 52 ? -18.640 -26.901 -10.531 1.00 0.00 ? 504 THR C HG1  3  
ATOM 2512  H HG21 . THR A 1 52 ? -20.788 -28.904 -11.933 1.00 0.00 ? 504 THR C HG21 3  
ATOM 2513  H HG22 . THR A 1 52 ? -21.652 -27.797 -13.001 1.00 0.00 ? 504 THR C HG22 3  
ATOM 2514  H HG23 . THR A 1 52 ? -22.005 -27.811 -11.272 1.00 0.00 ? 504 THR C HG23 3  
ATOM 2515  N N    . SER A 1 1  ? -10.883 5.853   9.480   1.00 0.00 ? 453 SER C N    4  
ATOM 2516  C CA   . SER A 1 1  ? -10.191 4.562   9.427   1.00 0.00 ? 453 SER C CA   4  
ATOM 2517  C C    . SER A 1 1  ? -11.118 3.478   8.889   1.00 0.00 ? 453 SER C C    4  
ATOM 2518  O O    . SER A 1 1  ? -12.227 3.296   9.385   1.00 0.00 ? 453 SER C O    4  
ATOM 2519  C CB   . SER A 1 1  ? -9.679  4.188   10.817  1.00 0.00 ? 453 SER C CB   4  
ATOM 2520  O OG   . SER A 1 1  ? -8.793  5.181   11.316  1.00 0.00 ? 453 SER C OG   4  
ATOM 2521  H H1   . SER A 1 1  ? -11.733 5.774   10.072  1.00 0.00 ? 453 SER C H1   4  
ATOM 2522  H H2   . SER A 1 1  ? -11.164 6.143   8.523   1.00 0.00 ? 453 SER C H2   4  
ATOM 2523  H H3   . SER A 1 1  ? -10.255 6.575   9.882   1.00 0.00 ? 453 SER C H3   4  
ATOM 2524  H HA   . SER A 1 1  ? -9.351  4.663   8.756   1.00 0.00 ? 453 SER C HA   4  
ATOM 2525  H HB2  . SER A 1 1  ? -10.516 4.096   11.494  1.00 0.00 ? 453 SER C HB2  4  
ATOM 2526  H HB3  . SER A 1 1  ? -9.153  3.246   10.763  1.00 0.00 ? 453 SER C HB3  4  
ATOM 2527  H HG   . SER A 1 1  ? -7.897  4.976   11.012  1.00 0.00 ? 453 SER C HG   4  
ATOM 2528  N N    . ASN A 1 2  ? -10.667 2.773   7.862   1.00 0.00 ? 454 ASN C N    4  
ATOM 2529  C CA   . ASN A 1 2  ? -11.450 1.696   7.268   1.00 0.00 ? 454 ASN C CA   4  
ATOM 2530  C C    . ASN A 1 2  ? -10.782 0.352   7.506   1.00 0.00 ? 454 ASN C C    4  
ATOM 2531  O O    . ASN A 1 2  ? -11.246 -0.681  7.021   1.00 0.00 ? 454 ASN C O    4  
ATOM 2532  C CB   . ASN A 1 2  ? -11.650 1.919   5.759   1.00 0.00 ? 454 ASN C CB   4  
ATOM 2533  C CG   . ASN A 1 2  ? -12.584 3.078   5.433   1.00 0.00 ? 454 ASN C CG   4  
ATOM 2534  O OD1  . ASN A 1 2  ? -12.649 4.072   6.158   1.00 0.00 ? 454 ASN C OD1  4  
ATOM 2535  N ND2  . ASN A 1 2  ? -13.308 2.958   4.339   1.00 0.00 ? 454 ASN C ND2  4  
ATOM 2536  H H    . ASN A 1 2  ? -9.780  2.981   7.492   1.00 0.00 ? 454 ASN C H    4  
ATOM 2537  H HA   . ASN A 1 2  ? -12.416 1.689   7.750   1.00 0.00 ? 454 ASN C HA   4  
ATOM 2538  H HB2  . ASN A 1 2  ? -10.693 2.122   5.303   1.00 0.00 ? 454 ASN C HB2  4  
ATOM 2539  H HB3  . ASN A 1 2  ? -12.061 1.018   5.325   1.00 0.00 ? 454 ASN C HB3  4  
ATOM 2540  H HD21 . ASN A 1 2  ? -13.203 2.141   3.804   1.00 0.00 ? 454 ASN C HD21 4  
ATOM 2541  H HD22 . ASN A 1 2  ? -13.926 3.682   4.107   1.00 0.00 ? 454 ASN C HD22 4  
ATOM 2542  N N    . SER A 1 3  ? -9.699  0.368   8.276   1.00 0.00 ? 455 SER C N    4  
ATOM 2543  C CA   . SER A 1 3  ? -8.944  -0.842  8.577   1.00 0.00 ? 455 SER C CA   4  
ATOM 2544  C C    . SER A 1 3  ? -9.763  -1.826  9.413   1.00 0.00 ? 455 SER C C    4  
ATOM 2545  O O    . SER A 1 3  ? -9.426  -3.005  9.495   1.00 0.00 ? 455 SER C O    4  
ATOM 2546  C CB   . SER A 1 3  ? -7.642  -0.489  9.296   1.00 0.00 ? 455 SER C CB   4  
ATOM 2547  O OG   . SER A 1 3  ? -6.820  0.339   8.483   1.00 0.00 ? 455 SER C OG   4  
ATOM 2548  H H    . SER A 1 3  ? -9.390  1.220   8.650   1.00 0.00 ? 455 SER C H    4  
ATOM 2549  H HA   . SER A 1 3  ? -8.700  -1.315  7.637   1.00 0.00 ? 455 SER C HA   4  
ATOM 2550  H HB2  . SER A 1 3  ? -7.869  0.038   10.210  1.00 0.00 ? 455 SER C HB2  4  
ATOM 2551  H HB3  . SER A 1 3  ? -7.104  -1.397  9.527   1.00 0.00 ? 455 SER C HB3  4  
ATOM 2552  H HG   . SER A 1 3  ? -5.998  -0.133  8.284   1.00 0.00 ? 455 SER C HG   4  
ATOM 2553  N N    . GLN A 1 4  ? -10.850 -1.341  10.019  1.00 0.00 ? 456 GLN C N    4  
ATOM 2554  C CA   . GLN A 1 4  ? -11.724 -2.190  10.826  1.00 0.00 ? 456 GLN C CA   4  
ATOM 2555  C C    . GLN A 1 4  ? -12.275 -3.355  10.005  1.00 0.00 ? 456 GLN C C    4  
ATOM 2556  O O    . GLN A 1 4  ? -12.563 -4.419  10.550  1.00 0.00 ? 456 GLN C O    4  
ATOM 2557  C CB   . GLN A 1 4  ? -12.878 -1.386  11.436  1.00 0.00 ? 456 GLN C CB   4  
ATOM 2558  C CG   . GLN A 1 4  ? -13.733 -0.644  10.423  1.00 0.00 ? 456 GLN C CG   4  
ATOM 2559  C CD   . GLN A 1 4  ? -15.035 -0.142  11.024  1.00 0.00 ? 456 GLN C CD   4  
ATOM 2560  O OE1  . GLN A 1 4  ? -15.597 -0.763  11.928  1.00 0.00 ? 456 GLN C OE1  4  
ATOM 2561  N NE2  . GLN A 1 4  ? -15.517 0.978   10.536  1.00 0.00 ? 456 GLN C NE2  4  
ATOM 2562  H H    . GLN A 1 4  ? -11.055 -0.387  9.931   1.00 0.00 ? 456 GLN C H    4  
ATOM 2563  H HA   . GLN A 1 4  ? -11.125 -2.597  11.625  1.00 0.00 ? 456 GLN C HA   4  
ATOM 2564  H HB2  . GLN A 1 4  ? -13.519 -2.063  11.979  1.00 0.00 ? 456 GLN C HB2  4  
ATOM 2565  H HB3  . GLN A 1 4  ? -12.470 -0.665  12.128  1.00 0.00 ? 456 GLN C HB3  4  
ATOM 2566  H HG2  . GLN A 1 4  ? -13.175 0.203   10.050  1.00 0.00 ? 456 GLN C HG2  4  
ATOM 2567  H HG3  . GLN A 1 4  ? -13.961 -1.314  9.608   1.00 0.00 ? 456 GLN C HG3  4  
ATOM 2568  H HE21 . GLN A 1 4  ? -15.014 1.426   9.820   1.00 0.00 ? 456 GLN C HE21 4  
ATOM 2569  H HE22 . GLN A 1 4  ? -16.353 1.326   10.906  1.00 0.00 ? 456 GLN C HE22 4  
ATOM 2570  N N    . LEU A 1 5  ? -12.402 -3.151  8.691   1.00 0.00 ? 457 LEU C N    4  
ATOM 2571  C CA   . LEU A 1 5  ? -12.902 -4.187  7.796   1.00 0.00 ? 457 LEU C CA   4  
ATOM 2572  C C    . LEU A 1 5  ? -12.037 -5.431  7.891   1.00 0.00 ? 457 LEU C C    4  
ATOM 2573  O O    . LEU A 1 5  ? -12.544 -6.553  7.883   1.00 0.00 ? 457 LEU C O    4  
ATOM 2574  C CB   . LEU A 1 5  ? -12.921 -3.687  6.349   1.00 0.00 ? 457 LEU C CB   4  
ATOM 2575  C CG   . LEU A 1 5  ? -13.831 -2.493  6.061   1.00 0.00 ? 457 LEU C CG   4  
ATOM 2576  C CD1  . LEU A 1 5  ? -13.714 -2.091  4.611   1.00 0.00 ? 457 LEU C CD1  4  
ATOM 2577  C CD2  . LEU A 1 5  ? -15.267 -2.832  6.380   1.00 0.00 ? 457 LEU C CD2  4  
ATOM 2578  H H    . LEU A 1 5  ? -12.146 -2.278  8.317   1.00 0.00 ? 457 LEU C H    4  
ATOM 2579  H HA   . LEU A 1 5  ? -13.907 -4.435  8.096   1.00 0.00 ? 457 LEU C HA   4  
ATOM 2580  H HB2  . LEU A 1 5  ? -11.913 -3.412  6.075   1.00 0.00 ? 457 LEU C HB2  4  
ATOM 2581  H HB3  . LEU A 1 5  ? -13.232 -4.505  5.715   1.00 0.00 ? 457 LEU C HB3  4  
ATOM 2582  H HG   . LEU A 1 5  ? -13.532 -1.656  6.673   1.00 0.00 ? 457 LEU C HG   4  
ATOM 2583  H HD11 . LEU A 1 5  ? -14.028 -2.921  3.995   1.00 0.00 ? 457 LEU C HD11 4  
ATOM 2584  H HD12 . LEU A 1 5  ? -12.692 -1.834  4.387   1.00 0.00 ? 457 LEU C HD12 4  
ATOM 2585  H HD13 . LEU A 1 5  ? -14.357 -1.244  4.423   1.00 0.00 ? 457 LEU C HD13 4  
ATOM 2586  H HD21 . LEU A 1 5  ? -15.330 -3.220  7.386   1.00 0.00 ? 457 LEU C HD21 4  
ATOM 2587  H HD22 . LEU A 1 5  ? -15.617 -3.571  5.675   1.00 0.00 ? 457 LEU C HD22 4  
ATOM 2588  H HD23 . LEU A 1 5  ? -15.871 -1.943  6.295   1.00 0.00 ? 457 LEU C HD23 4  
ATOM 2589  N N    . ASN A 1 6  ? -10.733 -5.218  8.009   1.00 0.00 ? 458 ASN C N    4  
ATOM 2590  C CA   . ASN A 1 6  ? -9.773  -6.307  8.088   1.00 0.00 ? 458 ASN C CA   4  
ATOM 2591  C C    . ASN A 1 6  ? -10.050 -7.169  9.301   1.00 0.00 ? 458 ASN C C    4  
ATOM 2592  O O    . ASN A 1 6  ? -10.169 -8.382  9.186   1.00 0.00 ? 458 ASN C O    4  
ATOM 2593  C CB   . ASN A 1 6  ? -8.339  -5.766  8.156   1.00 0.00 ? 458 ASN C CB   4  
ATOM 2594  C CG   . ASN A 1 6  ? -7.981  -4.885  6.974   1.00 0.00 ? 458 ASN C CG   4  
ATOM 2595  O OD1  . ASN A 1 6  ? -8.493  -5.064  5.870   1.00 0.00 ? 458 ASN C OD1  4  
ATOM 2596  N ND2  . ASN A 1 6  ? -7.111  -3.925  7.200   1.00 0.00 ? 458 ASN C ND2  4  
ATOM 2597  H H    . ASN A 1 6  ? -10.407 -4.294  8.053   1.00 0.00 ? 458 ASN C H    4  
ATOM 2598  H HA   . ASN A 1 6  ? -9.880  -6.910  7.201   1.00 0.00 ? 458 ASN C HA   4  
ATOM 2599  H HB2  . ASN A 1 6  ? -8.225  -5.183  9.056   1.00 0.00 ? 458 ASN C HB2  4  
ATOM 2600  H HB3  . ASN A 1 6  ? -7.650  -6.598  8.184   1.00 0.00 ? 458 ASN C HB3  4  
ATOM 2601  H HD21 . ASN A 1 6  ? -6.744  -3.833  8.108   1.00 0.00 ? 458 ASN C HD21 4  
ATOM 2602  H HD22 . ASN A 1 6  ? -6.860  -3.340  6.454   1.00 0.00 ? 458 ASN C HD22 4  
ATOM 2603  N N    . ALA A 1 7  ? -10.173 -6.529  10.458  1.00 0.00 ? 459 ALA C N    4  
ATOM 2604  C CA   . ALA A 1 7  ? -10.432 -7.233  11.709  1.00 0.00 ? 459 ALA C CA   4  
ATOM 2605  C C    . ALA A 1 7  ? -11.791 -7.919  11.691  1.00 0.00 ? 459 ALA C C    4  
ATOM 2606  O O    . ALA A 1 7  ? -11.904 -9.088  12.065  1.00 0.00 ? 459 ALA C O    4  
ATOM 2607  C CB   . ALA A 1 7  ? -10.340 -6.272  12.881  1.00 0.00 ? 459 ALA C CB   4  
ATOM 2608  H H    . ALA A 1 7  ? -10.082 -5.553  10.471  1.00 0.00 ? 459 ALA C H    4  
ATOM 2609  H HA   . ALA A 1 7  ? -9.668  -7.990  11.833  1.00 0.00 ? 459 ALA C HA   4  
ATOM 2610  H HB1  . ALA A 1 7  ? -10.474 -6.816  13.806  1.00 0.00 ? 459 ALA C HB1  4  
ATOM 2611  H HB2  . ALA A 1 7  ? -11.111 -5.520  12.792  1.00 0.00 ? 459 ALA C HB2  4  
ATOM 2612  H HB3  . ALA A 1 7  ? -9.372  -5.795  12.882  1.00 0.00 ? 459 ALA C HB3  4  
ATOM 2613  N N    . MET A 1 8  ? -12.821 -7.199  11.242  1.00 0.00 ? 460 MET C N    4  
ATOM 2614  C CA   . MET A 1 8  ? -14.168 -7.754  11.197  1.00 0.00 ? 460 MET C CA   4  
ATOM 2615  C C    . MET A 1 8  ? -14.211 -9.002  10.325  1.00 0.00 ? 460 MET C C    4  
ATOM 2616  O O    . MET A 1 8  ? -14.746 -10.032 10.729  1.00 0.00 ? 460 MET C O    4  
ATOM 2617  C CB   . MET A 1 8  ? -15.185 -6.718  10.702  1.00 0.00 ? 460 MET C CB   4  
ATOM 2618  C CG   . MET A 1 8  ? -15.245 -5.453  11.551  1.00 0.00 ? 460 MET C CG   4  
ATOM 2619  S SD   . MET A 1 8  ? -16.720 -4.461  11.236  1.00 0.00 ? 460 MET C SD   4  
ATOM 2620  C CE   . MET A 1 8  ? -16.417 -3.938  9.562   1.00 0.00 ? 460 MET C CE   4  
ATOM 2621  H H    . MET A 1 8  ? -12.671 -6.276  10.938  1.00 0.00 ? 460 MET C H    4  
ATOM 2622  H HA   . MET A 1 8  ? -14.429 -8.041  12.205  1.00 0.00 ? 460 MET C HA   4  
ATOM 2623  H HB2  . MET A 1 8  ? -14.943 -6.440  9.689   1.00 0.00 ? 460 MET C HB2  4  
ATOM 2624  H HB3  . MET A 1 8  ? -16.162 -7.170  10.705  1.00 0.00 ? 460 MET C HB3  4  
ATOM 2625  H HG2  . MET A 1 8  ? -15.225 -5.724  12.594  1.00 0.00 ? 460 MET C HG2  4  
ATOM 2626  H HG3  . MET A 1 8  ? -14.380 -4.853  11.314  1.00 0.00 ? 460 MET C HG3  4  
ATOM 2627  H HE1  . MET A 1 8  ? -16.216 -4.806  8.950   1.00 0.00 ? 460 MET C HE1  4  
ATOM 2628  H HE2  . MET A 1 8  ? -15.568 -3.272  9.543   1.00 0.00 ? 460 MET C HE2  4  
ATOM 2629  H HE3  . MET A 1 8  ? -17.290 -3.429  9.185   1.00 0.00 ? 460 MET C HE3  4  
ATOM 2630  N N    . ALA A 1 9  ? -13.621 -8.914  9.139   1.00 0.00 ? 461 ALA C N    4  
ATOM 2631  C CA   . ALA A 1 9  ? -13.574 -10.047 8.229   1.00 0.00 ? 461 ALA C CA   4  
ATOM 2632  C C    . ALA A 1 9  ? -12.669 -11.140 8.780   1.00 0.00 ? 461 ALA C C    4  
ATOM 2633  O O    . ALA A 1 9  ? -12.910 -12.329 8.570   1.00 0.00 ? 461 ALA C O    4  
ATOM 2634  C CB   . ALA A 1 9  ? -13.088 -9.604  6.860   1.00 0.00 ? 461 ALA C CB   4  
ATOM 2635  H H    . ALA A 1 9  ? -13.210 -8.062  8.866   1.00 0.00 ? 461 ALA C H    4  
ATOM 2636  H HA   . ALA A 1 9  ? -14.575 -10.438 8.126   1.00 0.00 ? 461 ALA C HA   4  
ATOM 2637  H HB1  . ALA A 1 9  ? -13.083 -10.448 6.188   1.00 0.00 ? 461 ALA C HB1  4  
ATOM 2638  H HB2  . ALA A 1 9  ? -12.087 -9.205  6.945   1.00 0.00 ? 461 ALA C HB2  4  
ATOM 2639  H HB3  . ALA A 1 9  ? -13.747 -8.841  6.475   1.00 0.00 ? 461 ALA C HB3  4  
ATOM 2640  N N    . HIS A 1 10 ? -11.635 -10.722 9.496   1.00 0.00 ? 462 HIS C N    4  
ATOM 2641  C CA   . HIS A 1 10 ? -10.674 -11.639 10.090  1.00 0.00 ? 462 HIS C CA   4  
ATOM 2642  C C    . HIS A 1 10 ? -11.363 -12.575 11.075  1.00 0.00 ? 462 HIS C C    4  
ATOM 2643  O O    . HIS A 1 10 ? -11.268 -13.785 10.945  1.00 0.00 ? 462 HIS C O    4  
ATOM 2644  C CB   . HIS A 1 10 ? -9.555  -10.847 10.784  1.00 0.00 ? 462 HIS C CB   4  
ATOM 2645  C CG   . HIS A 1 10 ? -8.413  -11.677 11.276  1.00 0.00 ? 462 HIS C CG   4  
ATOM 2646  N ND1  . HIS A 1 10 ? -7.409  -12.142 10.457  1.00 0.00 ? 462 HIS C ND1  4  
ATOM 2647  C CD2  . HIS A 1 10 ? -8.115  -12.117 12.514  1.00 0.00 ? 462 HIS C CD2  4  
ATOM 2648  C CE1  . HIS A 1 10 ? -6.548  -12.835 11.174  1.00 0.00 ? 462 HIS C CE1  4  
ATOM 2649  N NE2  . HIS A 1 10 ? -6.953  -12.833 12.426  1.00 0.00 ? 462 HIS C NE2  4  
ATOM 2650  H H    . HIS A 1 10 ? -11.515 -9.757  9.629   1.00 0.00 ? 462 HIS C H    4  
ATOM 2651  H HA   . HIS A 1 10 ? -10.243 -12.227 9.296   1.00 0.00 ? 462 HIS C HA   4  
ATOM 2652  H HB2  . HIS A 1 10 ? -9.156  -10.124 10.090  1.00 0.00 ? 462 HIS C HB2  4  
ATOM 2653  H HB3  . HIS A 1 10 ? -9.975  -10.324 11.631  1.00 0.00 ? 462 HIS C HB3  4  
ATOM 2654  H HD1  . HIS A 1 10 ? -7.338  -11.993 9.489   1.00 0.00 ? 462 HIS C HD1  4  
ATOM 2655  H HD2  . HIS A 1 10 ? -8.687  -11.919 13.409  1.00 0.00 ? 462 HIS C HD2  4  
ATOM 2656  H HE1  . HIS A 1 10 ? -5.663  -13.325 10.798  1.00 0.00 ? 462 HIS C HE1  4  
ATOM 2657  H HE2  . HIS A 1 10 ? -6.385  -13.074 13.193  1.00 0.00 ? 462 HIS C HE2  4  
ATOM 2658  N N    . GLN A 1 11 ? -12.079 -12.000 12.041  1.00 0.00 ? 463 GLN C N    4  
ATOM 2659  C CA   . GLN A 1 11 ? -12.786 -12.793 13.056  1.00 0.00 ? 463 GLN C CA   4  
ATOM 2660  C C    . GLN A 1 11 ? -13.767 -13.770 12.420  1.00 0.00 ? 463 GLN C C    4  
ATOM 2661  O O    . GLN A 1 11 ? -13.902 -14.909 12.877  1.00 0.00 ? 463 GLN C O    4  
ATOM 2662  C CB   . GLN A 1 11 ? -13.522 -11.891 14.052  1.00 0.00 ? 463 GLN C CB   4  
ATOM 2663  C CG   . GLN A 1 11 ? -12.697 -11.474 15.267  1.00 0.00 ? 463 GLN C CG   4  
ATOM 2664  C CD   . GLN A 1 11 ? -11.496 -10.622 14.919  1.00 0.00 ? 463 GLN C CD   4  
ATOM 2665  O OE1  . GLN A 1 11 ? -11.585 -9.398  14.865  1.00 0.00 ? 463 GLN C OE1  4  
ATOM 2666  N NE2  . GLN A 1 11 ? -10.364 -11.256 14.702  1.00 0.00 ? 463 GLN C NE2  4  
ATOM 2667  H H    . GLN A 1 11 ? -12.142 -11.017 12.070  1.00 0.00 ? 463 GLN C H    4  
ATOM 2668  H HA   . GLN A 1 11 ? -12.043 -13.367 13.592  1.00 0.00 ? 463 GLN C HA   4  
ATOM 2669  H HB2  . GLN A 1 11 ? -13.836 -10.994 13.538  1.00 0.00 ? 463 GLN C HB2  4  
ATOM 2670  H HB3  . GLN A 1 11 ? -14.400 -12.413 14.405  1.00 0.00 ? 463 GLN C HB3  4  
ATOM 2671  H HG2  . GLN A 1 11 ? -13.327 -10.913 15.937  1.00 0.00 ? 463 GLN C HG2  4  
ATOM 2672  H HG3  . GLN A 1 11 ? -12.350 -12.368 15.768  1.00 0.00 ? 463 GLN C HG3  4  
ATOM 2673  H HE21 . GLN A 1 11 ? -10.355 -12.234 14.777  1.00 0.00 ? 463 GLN C HE21 4  
ATOM 2674  H HE22 . GLN A 1 11 ? -9.573  -10.718 14.490  1.00 0.00 ? 463 GLN C HE22 4  
ATOM 2675  N N    . ILE A 1 12 ? -14.442 -13.329 11.366  1.00 0.00 ? 464 ILE C N    4  
ATOM 2676  C CA   . ILE A 1 12 ? -15.396 -14.177 10.667  1.00 0.00 ? 464 ILE C CA   4  
ATOM 2677  C C    . ILE A 1 12 ? -14.683 -15.320 9.961   1.00 0.00 ? 464 ILE C C    4  
ATOM 2678  O O    . ILE A 1 12 ? -15.082 -16.472 10.083  1.00 0.00 ? 464 ILE C O    4  
ATOM 2679  C CB   . ILE A 1 12 ? -16.222 -13.384 9.637   1.00 0.00 ? 464 ILE C CB   4  
ATOM 2680  C CG1  . ILE A 1 12 ? -16.941 -12.224 10.320  1.00 0.00 ? 464 ILE C CG1  4  
ATOM 2681  C CG2  . ILE A 1 12 ? -17.227 -14.300 8.948   1.00 0.00 ? 464 ILE C CG2  4  
ATOM 2682  C CD1  . ILE A 1 12 ? -17.683 -11.315 9.366   1.00 0.00 ? 464 ILE C CD1  4  
ATOM 2683  H H    . ILE A 1 12 ? -14.301 -12.409 11.056  1.00 0.00 ? 464 ILE C H    4  
ATOM 2684  H HA   . ILE A 1 12 ? -16.070 -14.592 11.403  1.00 0.00 ? 464 ILE C HA   4  
ATOM 2685  H HB   . ILE A 1 12 ? -15.550 -12.992 8.890   1.00 0.00 ? 464 ILE C HB   4  
ATOM 2686  H HG12 . ILE A 1 12 ? -17.655 -12.619 11.026  1.00 0.00 ? 464 ILE C HG12 4  
ATOM 2687  H HG13 . ILE A 1 12 ? -16.213 -11.628 10.849  1.00 0.00 ? 464 ILE C HG13 4  
ATOM 2688  H HG21 . ILE A 1 12 ? -17.910 -14.699 9.682   1.00 0.00 ? 464 ILE C HG21 4  
ATOM 2689  H HG22 . ILE A 1 12 ? -16.705 -15.114 8.464   1.00 0.00 ? 464 ILE C HG22 4  
ATOM 2690  H HG23 . ILE A 1 12 ? -17.779 -13.736 8.211   1.00 0.00 ? 464 ILE C HG23 4  
ATOM 2691  H HD11 . ILE A 1 12 ? -16.997 -10.931 8.628   1.00 0.00 ? 464 ILE C HD11 4  
ATOM 2692  H HD12 . ILE A 1 12 ? -18.112 -10.491 9.919   1.00 0.00 ? 464 ILE C HD12 4  
ATOM 2693  H HD13 . ILE A 1 12 ? -18.469 -11.870 8.875   1.00 0.00 ? 464 ILE C HD13 4  
ATOM 2694  N N    . GLN A 1 13 ? -13.616 -14.998 9.240   1.00 0.00 ? 465 GLN C N    4  
ATOM 2695  C CA   . GLN A 1 13 ? -12.839 -16.003 8.515   1.00 0.00 ? 465 GLN C CA   4  
ATOM 2696  C C    . GLN A 1 13 ? -12.245 -17.020 9.498   1.00 0.00 ? 465 GLN C C    4  
ATOM 2697  O O    . GLN A 1 13 ? -12.125 -18.207 9.190   1.00 0.00 ? 465 GLN C O    4  
ATOM 2698  C CB   . GLN A 1 13 ? -11.736 -15.317 7.688   1.00 0.00 ? 465 GLN C CB   4  
ATOM 2699  C CG   . GLN A 1 13 ? -11.111 -16.193 6.598   1.00 0.00 ? 465 GLN C CG   4  
ATOM 2700  C CD   . GLN A 1 13 ? -10.058 -17.146 7.124   1.00 0.00 ? 465 GLN C CD   4  
ATOM 2701  O OE1  . GLN A 1 13 ? -9.367  -16.851 8.097   1.00 0.00 ? 465 GLN C OE1  4  
ATOM 2702  N NE2  . GLN A 1 13 ? -9.929  -18.288 6.484   1.00 0.00 ? 465 GLN C NE2  4  
ATOM 2703  H H    . GLN A 1 13 ? -13.345 -14.053 9.185   1.00 0.00 ? 465 GLN C H    4  
ATOM 2704  H HA   . GLN A 1 13 ? -13.512 -16.519 7.847   1.00 0.00 ? 465 GLN C HA   4  
ATOM 2705  H HB2  . GLN A 1 13 ? -12.153 -14.440 7.215   1.00 0.00 ? 465 GLN C HB2  4  
ATOM 2706  H HB3  . GLN A 1 13 ? -10.951 -15.008 8.365   1.00 0.00 ? 465 GLN C HB3  4  
ATOM 2707  H HG2  . GLN A 1 13 ? -11.891 -16.773 6.132   1.00 0.00 ? 465 GLN C HG2  4  
ATOM 2708  H HG3  . GLN A 1 13 ? -10.655 -15.551 5.860   1.00 0.00 ? 465 GLN C HG3  4  
ATOM 2709  H HE21 . GLN A 1 13 ? -10.513 -18.455 5.713   1.00 0.00 ? 465 GLN C HE21 4  
ATOM 2710  H HE22 . GLN A 1 13 ? -9.257  -18.929 6.797   1.00 0.00 ? 465 GLN C HE22 4  
ATOM 2711  N N    . GLU A 1 14 ? -11.888 -16.537 10.686  1.00 0.00 ? 466 GLU C N    4  
ATOM 2712  C CA   . GLU A 1 14 ? -11.365 -17.387 11.750  1.00 0.00 ? 466 GLU C CA   4  
ATOM 2713  C C    . GLU A 1 14 ? -12.400 -18.435 12.165  1.00 0.00 ? 466 GLU C C    4  
ATOM 2714  O O    . GLU A 1 14 ? -12.055 -19.566 12.519  1.00 0.00 ? 466 GLU C O    4  
ATOM 2715  C CB   . GLU A 1 14 ? -10.992 -16.529 12.962  1.00 0.00 ? 466 GLU C CB   4  
ATOM 2716  C CG   . GLU A 1 14 ? -9.801  -15.618 12.743  1.00 0.00 ? 466 GLU C CG   4  
ATOM 2717  C CD   . GLU A 1 14 ? -8.514  -16.380 12.562  1.00 0.00 ? 466 GLU C CD   4  
ATOM 2718  O OE1  . GLU A 1 14 ? -8.021  -16.956 13.546  1.00 0.00 ? 466 GLU C OE1  4  
ATOM 2719  O OE2  . GLU A 1 14 ? -7.984  -16.397 11.437  1.00 0.00 ? 466 GLU C OE2  4  
ATOM 2720  H H    . GLU A 1 14 ? -11.969 -15.572 10.849  1.00 0.00 ? 466 GLU C H    4  
ATOM 2721  H HA   . GLU A 1 14 ? -10.480 -17.884 11.386  1.00 0.00 ? 466 GLU C HA   4  
ATOM 2722  H HB2  . GLU A 1 14 ? -11.841 -15.909 13.212  1.00 0.00 ? 466 GLU C HB2  4  
ATOM 2723  H HB3  . GLU A 1 14 ? -10.778 -17.175 13.797  1.00 0.00 ? 466 GLU C HB3  4  
ATOM 2724  H HG2  . GLU A 1 14 ? -9.977  -15.030 11.854  1.00 0.00 ? 466 GLU C HG2  4  
ATOM 2725  H HG3  . GLU A 1 14 ? -9.700  -14.962 13.595  1.00 0.00 ? 466 GLU C HG3  4  
ATOM 2726  N N    . MET A 1 15 ? -13.666 -18.052 12.108  1.00 0.00 ? 467 MET C N    4  
ATOM 2727  C CA   . MET A 1 15 ? -14.753 -18.935 12.485  1.00 0.00 ? 467 MET C CA   4  
ATOM 2728  C C    . MET A 1 15 ? -15.228 -19.758 11.300  1.00 0.00 ? 467 MET C C    4  
ATOM 2729  O O    . MET A 1 15 ? -15.529 -20.943 11.435  1.00 0.00 ? 467 MET C O    4  
ATOM 2730  C CB   . MET A 1 15 ? -15.927 -18.131 13.036  1.00 0.00 ? 467 MET C CB   4  
ATOM 2731  C CG   . MET A 1 15 ? -15.625 -17.365 14.308  1.00 0.00 ? 467 MET C CG   4  
ATOM 2732  S SD   . MET A 1 15 ? -17.090 -16.572 15.001  1.00 0.00 ? 467 MET C SD   4  
ATOM 2733  C CE   . MET A 1 15 ? -17.573 -15.490 13.653  1.00 0.00 ? 467 MET C CE   4  
ATOM 2734  H H    . MET A 1 15 ? -13.878 -17.144 11.799  1.00 0.00 ? 467 MET C H    4  
ATOM 2735  H HA   . MET A 1 15 ? -14.395 -19.597 13.257  1.00 0.00 ? 467 MET C HA   4  
ATOM 2736  H HB2  . MET A 1 15 ? -16.234 -17.419 12.285  1.00 0.00 ? 467 MET C HB2  4  
ATOM 2737  H HB3  . MET A 1 15 ? -16.746 -18.803 13.229  1.00 0.00 ? 467 MET C HB3  4  
ATOM 2738  H HG2  . MET A 1 15 ? -15.222 -18.051 15.037  1.00 0.00 ? 467 MET C HG2  4  
ATOM 2739  H HG3  . MET A 1 15 ? -14.891 -16.605 14.085  1.00 0.00 ? 467 MET C HG3  4  
ATOM 2740  H HE1  . MET A 1 15 ? -17.789 -16.081 12.774  1.00 0.00 ? 467 MET C HE1  4  
ATOM 2741  H HE2  . MET A 1 15 ? -16.766 -14.805 13.439  1.00 0.00 ? 467 MET C HE2  4  
ATOM 2742  H HE3  . MET A 1 15 ? -18.452 -14.933 13.938  1.00 0.00 ? 467 MET C HE3  4  
ATOM 2743  N N    . PHE A 1 16 ? -15.295 -19.128 10.145  1.00 0.00 ? 468 PHE C N    4  
ATOM 2744  C CA   . PHE A 1 16 ? -15.801 -19.764 8.947   1.00 0.00 ? 468 PHE C CA   4  
ATOM 2745  C C    . PHE A 1 16 ? -14.739 -19.855 7.853   1.00 0.00 ? 468 PHE C C    4  
ATOM 2746  O O    . PHE A 1 16 ? -14.636 -18.971 7.006   1.00 0.00 ? 468 PHE C O    4  
ATOM 2747  C CB   . PHE A 1 16 ? -17.031 -19.008 8.430   1.00 0.00 ? 468 PHE C CB   4  
ATOM 2748  C CG   . PHE A 1 16 ? -18.223 -19.111 9.336   1.00 0.00 ? 468 PHE C CG   4  
ATOM 2749  C CD1  . PHE A 1 16 ? -18.394 -18.220 10.385  1.00 0.00 ? 468 PHE C CD1  4  
ATOM 2750  C CD2  . PHE A 1 16 ? -19.169 -20.100 9.143   1.00 0.00 ? 468 PHE C CD2  4  
ATOM 2751  C CE1  . PHE A 1 16 ? -19.487 -18.319 11.222  1.00 0.00 ? 468 PHE C CE1  4  
ATOM 2752  C CE2  . PHE A 1 16 ? -20.262 -20.204 9.977   1.00 0.00 ? 468 PHE C CE2  4  
ATOM 2753  C CZ   . PHE A 1 16 ? -20.422 -19.312 11.018  1.00 0.00 ? 468 PHE C CZ   4  
ATOM 2754  H H    . PHE A 1 16 ? -14.996 -18.191 10.090  1.00 0.00 ? 468 PHE C H    4  
ATOM 2755  H HA   . PHE A 1 16 ? -16.110 -20.763 9.214   1.00 0.00 ? 468 PHE C HA   4  
ATOM 2756  H HB2  . PHE A 1 16 ? -16.781 -17.961 8.336   1.00 0.00 ? 468 PHE C HB2  4  
ATOM 2757  H HB3  . PHE A 1 16 ? -17.308 -19.389 7.461   1.00 0.00 ? 468 PHE C HB3  4  
ATOM 2758  H HD1  . PHE A 1 16 ? -17.662 -17.443 10.544  1.00 0.00 ? 468 PHE C HD1  4  
ATOM 2759  H HD2  . PHE A 1 16 ? -19.045 -20.799 8.330   1.00 0.00 ? 468 PHE C HD2  4  
ATOM 2760  H HE1  . PHE A 1 16 ? -19.608 -17.619 12.036  1.00 0.00 ? 468 PHE C HE1  4  
ATOM 2761  H HE2  . PHE A 1 16 ? -20.994 -20.981 9.815   1.00 0.00 ? 468 PHE C HE2  4  
ATOM 2762  H HZ   . PHE A 1 16 ? -21.277 -19.391 11.673  1.00 0.00 ? 468 PHE C HZ   4  
ATOM 2763  N N    . PRO A 1 17 ? -13.921 -20.925 7.867   1.00 0.00 ? 469 PRO C N    4  
ATOM 2764  C CA   . PRO A 1 17 ? -12.890 -21.150 6.843   1.00 0.00 ? 469 PRO C CA   4  
ATOM 2765  C C    . PRO A 1 17 ? -13.497 -21.392 5.457   1.00 0.00 ? 469 PRO C C    4  
ATOM 2766  O O    . PRO A 1 17 ? -12.807 -21.294 4.435   1.00 0.00 ? 469 PRO C O    4  
ATOM 2767  C CB   . PRO A 1 17 ? -12.174 -22.415 7.329   1.00 0.00 ? 469 PRO C CB   4  
ATOM 2768  C CG   . PRO A 1 17 ? -13.147 -23.082 8.227   1.00 0.00 ? 469 PRO C CG   4  
ATOM 2769  C CD   . PRO A 1 17 ? -13.906 -21.980 8.892   1.00 0.00 ? 469 PRO C CD   4  
ATOM 2770  H HA   . PRO A 1 17 ? -12.194 -20.330 6.805   1.00 0.00 ? 469 PRO C HA   4  
ATOM 2771  H HB2  . PRO A 1 17 ? -11.925 -23.037 6.483   1.00 0.00 ? 469 PRO C HB2  4  
ATOM 2772  H HB3  . PRO A 1 17 ? -11.275 -22.145 7.859   1.00 0.00 ? 469 PRO C HB3  4  
ATOM 2773  H HG2  . PRO A 1 17 ? -13.815 -23.693 7.643   1.00 0.00 ? 469 PRO C HG2  4  
ATOM 2774  H HG3  . PRO A 1 17 ? -12.627 -23.677 8.960   1.00 0.00 ? 469 PRO C HG3  4  
ATOM 2775  H HD2  . PRO A 1 17 ? -14.906 -22.302 9.140   1.00 0.00 ? 469 PRO C HD2  4  
ATOM 2776  H HD3  . PRO A 1 17 ? -13.382 -21.643 9.773   1.00 0.00 ? 469 PRO C HD3  4  
ATOM 2777  N N    . GLN A 1 18 ? -14.790 -21.700 5.437   1.00 0.00 ? 470 GLN C N    4  
ATOM 2778  C CA   . GLN A 1 18 ? -15.516 -21.978 4.201   1.00 0.00 ? 470 GLN C CA   4  
ATOM 2779  C C    . GLN A 1 18 ? -15.638 -20.737 3.312   1.00 0.00 ? 470 GLN C C    4  
ATOM 2780  O O    . GLN A 1 18 ? -15.720 -20.848 2.090   1.00 0.00 ? 470 GLN C O    4  
ATOM 2781  C CB   . GLN A 1 18 ? -16.911 -22.535 4.514   1.00 0.00 ? 470 GLN C CB   4  
ATOM 2782  C CG   . GLN A 1 18 ? -17.739 -21.651 5.439   1.00 0.00 ? 470 GLN C CG   4  
ATOM 2783  C CD   . GLN A 1 18 ? -19.167 -22.139 5.600   1.00 0.00 ? 470 GLN C CD   4  
ATOM 2784  O OE1  . GLN A 1 18 ? -19.446 -23.333 5.494   1.00 0.00 ? 470 GLN C OE1  4  
ATOM 2785  N NE2  . GLN A 1 18 ? -20.076 -21.221 5.871   1.00 0.00 ? 470 GLN C NE2  4  
ATOM 2786  H H    . GLN A 1 18 ? -15.267 -21.750 6.292   1.00 0.00 ? 470 GLN C H    4  
ATOM 2787  H HA   . GLN A 1 18 ? -14.964 -22.730 3.661   1.00 0.00 ? 470 GLN C HA   4  
ATOM 2788  H HB2  . GLN A 1 18 ? -17.453 -22.653 3.587   1.00 0.00 ? 470 GLN C HB2  4  
ATOM 2789  H HB3  . GLN A 1 18 ? -16.802 -23.504 4.980   1.00 0.00 ? 470 GLN C HB3  4  
ATOM 2790  H HG2  . GLN A 1 18 ? -17.271 -21.629 6.411   1.00 0.00 ? 470 GLN C HG2  4  
ATOM 2791  H HG3  . GLN A 1 18 ? -17.756 -20.652 5.029   1.00 0.00 ? 470 GLN C HG3  4  
ATOM 2792  H HE21 . GLN A 1 18 ? -19.790 -20.289 5.960   1.00 0.00 ? 470 GLN C HE21 4  
ATOM 2793  H HE22 . GLN A 1 18 ? -21.013 -21.507 5.963   1.00 0.00 ? 470 GLN C HE22 4  
ATOM 2794  N N    . VAL A 1 19 ? -15.637 -19.565 3.916   1.00 0.00 ? 471 VAL C N    4  
ATOM 2795  C CA   . VAL A 1 19 ? -15.788 -18.335 3.159   1.00 0.00 ? 471 VAL C CA   4  
ATOM 2796  C C    . VAL A 1 19 ? -14.442 -17.609 2.997   1.00 0.00 ? 471 VAL C C    4  
ATOM 2797  O O    . VAL A 1 19 ? -13.732 -17.371 3.976   1.00 0.00 ? 471 VAL C O    4  
ATOM 2798  C CB   . VAL A 1 19 ? -16.846 -17.394 3.805   1.00 0.00 ? 471 VAL C CB   4  
ATOM 2799  C CG1  . VAL A 1 19 ? -16.455 -17.002 5.222   1.00 0.00 ? 471 VAL C CG1  4  
ATOM 2800  C CG2  . VAL A 1 19 ? -17.079 -16.159 2.942   1.00 0.00 ? 471 VAL C CG2  4  
ATOM 2801  H H    . VAL A 1 19 ? -15.513 -19.516 4.888   1.00 0.00 ? 471 VAL C H    4  
ATOM 2802  H HA   . VAL A 1 19 ? -16.145 -18.614 2.178   1.00 0.00 ? 471 VAL C HA   4  
ATOM 2803  H HB   . VAL A 1 19 ? -17.777 -17.939 3.865   1.00 0.00 ? 471 VAL C HB   4  
ATOM 2804  H HG11 . VAL A 1 19 ? -15.488 -16.521 5.206   1.00 0.00 ? 471 VAL C HG11 4  
ATOM 2805  H HG12 . VAL A 1 19 ? -16.409 -17.886 5.841   1.00 0.00 ? 471 VAL C HG12 4  
ATOM 2806  H HG13 . VAL A 1 19 ? -17.189 -16.320 5.622   1.00 0.00 ? 471 VAL C HG13 4  
ATOM 2807  H HG21 . VAL A 1 19 ? -17.443 -16.462 1.971   1.00 0.00 ? 471 VAL C HG21 4  
ATOM 2808  H HG22 . VAL A 1 19 ? -16.152 -15.620 2.827   1.00 0.00 ? 471 VAL C HG22 4  
ATOM 2809  H HG23 . VAL A 1 19 ? -17.810 -15.522 3.417   1.00 0.00 ? 471 VAL C HG23 4  
ATOM 2810  N N    . PRO A 1 20 ? -14.054 -17.305 1.741   1.00 0.00 ? 472 PRO C N    4  
ATOM 2811  C CA   . PRO A 1 20 ? -12.813 -16.577 1.442   1.00 0.00 ? 472 PRO C CA   4  
ATOM 2812  C C    . PRO A 1 20 ? -12.770 -15.213 2.121   1.00 0.00 ? 472 PRO C C    4  
ATOM 2813  O O    . PRO A 1 20 ? -13.761 -14.481 2.138   1.00 0.00 ? 472 PRO C O    4  
ATOM 2814  C CB   . PRO A 1 20 ? -12.853 -16.406 -0.078  1.00 0.00 ? 472 PRO C CB   4  
ATOM 2815  C CG   . PRO A 1 20 ? -13.731 -17.503 -0.550  1.00 0.00 ? 472 PRO C CG   4  
ATOM 2816  C CD   . PRO A 1 20 ? -14.774 -17.671 0.515   1.00 0.00 ? 472 PRO C CD   4  
ATOM 2817  H HA   . PRO A 1 20 ? -11.941 -17.147 1.725   1.00 0.00 ? 472 PRO C HA   4  
ATOM 2818  H HB2  . PRO A 1 20 ? -13.259 -15.437 -0.323  1.00 0.00 ? 472 PRO C HB2  4  
ATOM 2819  H HB3  . PRO A 1 20 ? -11.855 -16.499 -0.482  1.00 0.00 ? 472 PRO C HB3  4  
ATOM 2820  H HG2  . PRO A 1 20 ? -14.187 -17.232 -1.490  1.00 0.00 ? 472 PRO C HG2  4  
ATOM 2821  H HG3  . PRO A 1 20 ? -13.155 -18.410 -0.656  1.00 0.00 ? 472 PRO C HG3  4  
ATOM 2822  H HD2  . PRO A 1 20 ? -15.608 -17.009 0.344   1.00 0.00 ? 472 PRO C HD2  4  
ATOM 2823  H HD3  . PRO A 1 20 ? -15.103 -18.699 0.556   1.00 0.00 ? 472 PRO C HD3  4  
ATOM 2824  N N    . TYR A 1 21 ? -11.603 -14.881 2.645   1.00 0.00 ? 473 TYR C N    4  
ATOM 2825  C CA   . TYR A 1 21 ? -11.365 -13.642 3.391   1.00 0.00 ? 473 TYR C CA   4  
ATOM 2826  C C    . TYR A 1 21 ? -11.842 -12.407 2.613   1.00 0.00 ? 473 TYR C C    4  
ATOM 2827  O O    . TYR A 1 21 ? -12.486 -11.516 3.172   1.00 0.00 ? 473 TYR C O    4  
ATOM 2828  C CB   . TYR A 1 21 ? -9.865  -13.526 3.681   1.00 0.00 ? 473 TYR C CB   4  
ATOM 2829  C CG   . TYR A 1 21 ? -9.496  -12.593 4.816   1.00 0.00 ? 473 TYR C CG   4  
ATOM 2830  C CD1  . TYR A 1 21 ? -9.539  -11.214 4.663   1.00 0.00 ? 473 TYR C CD1  4  
ATOM 2831  C CD2  . TYR A 1 21 ? -9.085  -13.104 6.036   1.00 0.00 ? 473 TYR C CD2  4  
ATOM 2832  C CE1  . TYR A 1 21 ? -9.183  -10.372 5.699   1.00 0.00 ? 473 TYR C CE1  4  
ATOM 2833  C CE2  . TYR A 1 21 ? -8.732  -12.272 7.073   1.00 0.00 ? 473 TYR C CE2  4  
ATOM 2834  C CZ   . TYR A 1 21 ? -8.781  -10.910 6.902   1.00 0.00 ? 473 TYR C CZ   4  
ATOM 2835  O OH   . TYR A 1 21 ? -8.421  -10.083 7.937   1.00 0.00 ? 473 TYR C OH   4  
ATOM 2836  H H    . TYR A 1 21 ? -10.851 -15.502 2.524   1.00 0.00 ? 473 TYR C H    4  
ATOM 2837  H HA   . TYR A 1 21 ? -11.897 -13.697 4.327   1.00 0.00 ? 473 TYR C HA   4  
ATOM 2838  H HB2  . TYR A 1 21 ? -9.479  -14.502 3.929   1.00 0.00 ? 473 TYR C HB2  4  
ATOM 2839  H HB3  . TYR A 1 21 ? -9.368  -13.173 2.788   1.00 0.00 ? 473 TYR C HB3  4  
ATOM 2840  H HD1  . TYR A 1 21 ? -9.855  -10.799 3.718   1.00 0.00 ? 473 TYR C HD1  4  
ATOM 2841  H HD2  . TYR A 1 21 ? -9.044  -14.175 6.172   1.00 0.00 ? 473 TYR C HD2  4  
ATOM 2842  H HE1  . TYR A 1 21 ? -9.222  -9.302  5.564   1.00 0.00 ? 473 TYR C HE1  4  
ATOM 2843  H HE2  . TYR A 1 21 ? -8.416  -12.690 8.016   1.00 0.00 ? 473 TYR C HE2  4  
ATOM 2844  H HH   . TYR A 1 21 ? -9.110  -9.418  8.074   1.00 0.00 ? 473 TYR C HH   4  
ATOM 2845  N N    . HIS A 1 22 ? -11.537 -12.372 1.330   1.00 0.00 ? 474 HIS C N    4  
ATOM 2846  C CA   . HIS A 1 22 ? -11.875 -11.231 0.490   1.00 0.00 ? 474 HIS C CA   4  
ATOM 2847  C C    . HIS A 1 22 ? -13.379 -11.139 0.255   1.00 0.00 ? 474 HIS C C    4  
ATOM 2848  O O    . HIS A 1 22 ? -13.930 -10.042 0.167   1.00 0.00 ? 474 HIS C O    4  
ATOM 2849  C CB   . HIS A 1 22 ? -11.136 -11.322 -0.837  1.00 0.00 ? 474 HIS C CB   4  
ATOM 2850  C CG   . HIS A 1 22 ? -11.009 -10.013 -1.556  1.00 0.00 ? 474 HIS C CG   4  
ATOM 2851  N ND1  . HIS A 1 22 ? -9.825  -9.317  -1.644  1.00 0.00 ? 474 HIS C ND1  4  
ATOM 2852  C CD2  . HIS A 1 22 ? -11.920 -9.280  -2.235  1.00 0.00 ? 474 HIS C CD2  4  
ATOM 2853  C CE1  . HIS A 1 22 ? -10.014 -8.218  -2.346  1.00 0.00 ? 474 HIS C CE1  4  
ATOM 2854  N NE2  . HIS A 1 22 ? -11.275 -8.171  -2.715  1.00 0.00 ? 474 HIS C NE2  4  
ATOM 2855  H H    . HIS A 1 22 ? -11.067 -13.138 0.933   1.00 0.00 ? 474 HIS C H    4  
ATOM 2856  H HA   . HIS A 1 22 ? -11.561 -10.331 1.003   1.00 0.00 ? 474 HIS C HA   4  
ATOM 2857  H HB2  . HIS A 1 22 ? -10.147 -11.703 -0.651  1.00 0.00 ? 474 HIS C HB2  4  
ATOM 2858  H HB3  . HIS A 1 22 ? -11.662 -12.009 -1.483  1.00 0.00 ? 474 HIS C HB3  4  
ATOM 2859  H HD1  . HIS A 1 22 ? -8.966  -9.591  -1.249  1.00 0.00 ? 474 HIS C HD1  4  
ATOM 2860  H HD2  . HIS A 1 22 ? -12.963 -9.525  -2.368  1.00 0.00 ? 474 HIS C HD2  4  
ATOM 2861  H HE1  . HIS A 1 22 ? -9.261  -7.481  -2.581  1.00 0.00 ? 474 HIS C HE1  4  
ATOM 2862  H HE2  . HIS A 1 22 ? -11.626 -7.582  -3.422  1.00 0.00 ? 474 HIS C HE2  4  
ATOM 2863  N N    . LEU A 1 23 ? -14.045 -12.286 0.161   1.00 0.00 ? 475 LEU C N    4  
ATOM 2864  C CA   . LEU A 1 23 ? -15.486 -12.294 -0.027  1.00 0.00 ? 475 LEU C CA   4  
ATOM 2865  C C    . LEU A 1 23 ? -16.171 -11.788 1.223   1.00 0.00 ? 475 LEU C C    4  
ATOM 2866  O O    . LEU A 1 23 ? -17.266 -11.227 1.163   1.00 0.00 ? 475 LEU C O    4  
ATOM 2867  C CB   . LEU A 1 23 ? -16.002 -13.688 -0.396  1.00 0.00 ? 475 LEU C CB   4  
ATOM 2868  C CG   . LEU A 1 23 ? -15.621 -14.194 -1.791  1.00 0.00 ? 475 LEU C CG   4  
ATOM 2869  C CD1  . LEU A 1 23 ? -16.365 -15.475 -2.116  1.00 0.00 ? 475 LEU C CD1  4  
ATOM 2870  C CD2  . LEU A 1 23 ? -15.901 -13.136 -2.846  1.00 0.00 ? 475 LEU C CD2  4  
ATOM 2871  H H    . LEU A 1 23 ? -13.564 -13.137 0.228   1.00 0.00 ? 475 LEU C H    4  
ATOM 2872  H HA   . LEU A 1 23 ? -15.711 -11.611 -0.832  1.00 0.00 ? 475 LEU C HA   4  
ATOM 2873  H HB2  . LEU A 1 23 ? -15.623 -14.389 0.332   1.00 0.00 ? 475 LEU C HB2  4  
ATOM 2874  H HB3  . LEU A 1 23 ? -17.078 -13.674 -0.325  1.00 0.00 ? 475 LEU C HB3  4  
ATOM 2875  H HG   . LEU A 1 23 ? -14.564 -14.414 -1.806  1.00 0.00 ? 475 LEU C HG   4  
ATOM 2876  H HD11 . LEU A 1 23 ? -16.128 -15.780 -3.123  1.00 0.00 ? 475 LEU C HD11 4  
ATOM 2877  H HD12 . LEU A 1 23 ? -17.429 -15.305 -2.033  1.00 0.00 ? 475 LEU C HD12 4  
ATOM 2878  H HD13 . LEU A 1 23 ? -16.070 -16.250 -1.428  1.00 0.00 ? 475 LEU C HD13 4  
ATOM 2879  H HD21 . LEU A 1 23 ? -16.940 -12.844 -2.798  1.00 0.00 ? 475 LEU C HD21 4  
ATOM 2880  H HD22 . LEU A 1 23 ? -15.687 -13.541 -3.824  1.00 0.00 ? 475 LEU C HD22 4  
ATOM 2881  H HD23 . LEU A 1 23 ? -15.274 -12.274 -2.672  1.00 0.00 ? 475 LEU C HD23 4  
ATOM 2882  N N    . VAL A 1 24 ? -15.508 -11.972 2.356   1.00 0.00 ? 476 VAL C N    4  
ATOM 2883  C CA   . VAL A 1 24 ? -16.014 -11.469 3.613   1.00 0.00 ? 476 VAL C CA   4  
ATOM 2884  C C    . VAL A 1 24 ? -15.861 -9.953  3.624   1.00 0.00 ? 476 VAL C C    4  
ATOM 2885  O O    . VAL A 1 24 ? -16.820 -9.225  3.850   1.00 0.00 ? 476 VAL C O    4  
ATOM 2886  C CB   . VAL A 1 24 ? -15.263 -12.080 4.823   1.00 0.00 ? 476 VAL C CB   4  
ATOM 2887  C CG1  . VAL A 1 24 ? -15.918 -11.667 6.126   1.00 0.00 ? 476 VAL C CG1  4  
ATOM 2888  C CG2  . VAL A 1 24 ? -15.209 -13.591 4.722   1.00 0.00 ? 476 VAL C CG2  4  
ATOM 2889  H H    . VAL A 1 24 ? -14.651 -12.457 2.332   1.00 0.00 ? 476 VAL C H    4  
ATOM 2890  H HA   . VAL A 1 24 ? -17.064 -11.721 3.681   1.00 0.00 ? 476 VAL C HA   4  
ATOM 2891  H HB   . VAL A 1 24 ? -14.250 -11.702 4.817   1.00 0.00 ? 476 VAL C HB   4  
ATOM 2892  H HG11 . VAL A 1 24 ? -15.871 -10.594 6.227   1.00 0.00 ? 476 VAL C HG11 4  
ATOM 2893  H HG12 . VAL A 1 24 ? -15.398 -12.130 6.952   1.00 0.00 ? 476 VAL C HG12 4  
ATOM 2894  H HG13 . VAL A 1 24 ? -16.950 -11.983 6.126   1.00 0.00 ? 476 VAL C HG13 4  
ATOM 2895  H HG21 . VAL A 1 24 ? -14.693 -13.874 3.817   1.00 0.00 ? 476 VAL C HG21 4  
ATOM 2896  H HG22 . VAL A 1 24 ? -16.213 -13.987 4.704   1.00 0.00 ? 476 VAL C HG22 4  
ATOM 2897  H HG23 . VAL A 1 24 ? -14.680 -13.991 5.576   1.00 0.00 ? 476 VAL C HG23 4  
ATOM 2898  N N    . LEU A 1 25 ? -14.640 -9.493  3.327   1.00 0.00 ? 477 LEU C N    4  
ATOM 2899  C CA   . LEU A 1 25 ? -14.323 -8.060  3.222   1.00 0.00 ? 477 LEU C CA   4  
ATOM 2900  C C    . LEU A 1 25 ? -15.327 -7.347  2.321   1.00 0.00 ? 477 LEU C C    4  
ATOM 2901  O O    . LEU A 1 25 ? -15.737 -6.216  2.594   1.00 0.00 ? 477 LEU C O    4  
ATOM 2902  C CB   . LEU A 1 25 ? -12.916 -7.891  2.638   1.00 0.00 ? 477 LEU C CB   4  
ATOM 2903  C CG   . LEU A 1 25 ? -11.749 -8.170  3.579   1.00 0.00 ? 477 LEU C CG   4  
ATOM 2904  C CD1  . LEU A 1 25 ? -10.442 -8.174  2.804   1.00 0.00 ? 477 LEU C CD1  4  
ATOM 2905  C CD2  . LEU A 1 25 ? -11.696 -7.128  4.682   1.00 0.00 ? 477 LEU C CD2  4  
ATOM 2906  H H    . LEU A 1 25 ? -13.917 -10.144 3.178   1.00 0.00 ? 477 LEU C H    4  
ATOM 2907  H HA   . LEU A 1 25 ? -14.359 -7.619  4.209   1.00 0.00 ? 477 LEU C HA   4  
ATOM 2908  H HB2  . LEU A 1 25 ? -12.830 -8.568  1.801   1.00 0.00 ? 477 LEU C HB2  4  
ATOM 2909  H HB3  . LEU A 1 25 ? -12.816 -6.888  2.260   1.00 0.00 ? 477 LEU C HB3  4  
ATOM 2910  H HG   . LEU A 1 25 ? -11.877 -9.141  4.033   1.00 0.00 ? 477 LEU C HG   4  
ATOM 2911  H HD11 . LEU A 1 25 ? -10.302 -7.214  2.331   1.00 0.00 ? 477 LEU C HD11 4  
ATOM 2912  H HD12 . LEU A 1 25 ? -10.471 -8.947  2.049   1.00 0.00 ? 477 LEU C HD12 4  
ATOM 2913  H HD13 . LEU A 1 25 ? -9.624  -8.364  3.482   1.00 0.00 ? 477 LEU C HD13 4  
ATOM 2914  H HD21 . LEU A 1 25 ? -12.606 -7.168  5.261   1.00 0.00 ? 477 LEU C HD21 4  
ATOM 2915  H HD22 . LEU A 1 25 ? -11.589 -6.146  4.245   1.00 0.00 ? 477 LEU C HD22 4  
ATOM 2916  H HD23 . LEU A 1 25 ? -10.853 -7.329  5.325   1.00 0.00 ? 477 LEU C HD23 4  
ATOM 2917  N N    . GLN A 1 26 ? -15.710 -8.023  1.249   1.00 0.00 ? 478 GLN C N    4  
ATOM 2918  C CA   . GLN A 1 26 ? -16.666 -7.511  0.296   1.00 0.00 ? 478 GLN C CA   4  
ATOM 2919  C C    . GLN A 1 26 ? -17.988 -7.159  0.985   1.00 0.00 ? 478 GLN C C    4  
ATOM 2920  O O    . GLN A 1 26 ? -18.483 -6.037  0.861   1.00 0.00 ? 478 GLN C O    4  
ATOM 2921  C CB   . GLN A 1 26 ? -16.904 -8.558  -0.788  1.00 0.00 ? 478 GLN C CB   4  
ATOM 2922  C CG   . GLN A 1 26 ? -17.821 -8.110  -1.901  1.00 0.00 ? 478 GLN C CG   4  
ATOM 2923  C CD   . GLN A 1 26 ? -18.109 -9.217  -2.902  1.00 0.00 ? 478 GLN C CD   4  
ATOM 2924  O OE1  . GLN A 1 26 ? -18.307 -8.962  -4.089  1.00 0.00 ? 478 GLN C OE1  4  
ATOM 2925  N NE2  . GLN A 1 26 ? -18.151 -10.450 -2.427  1.00 0.00 ? 478 GLN C NE2  4  
ATOM 2926  H H    . GLN A 1 26 ? -15.323 -8.909  1.087   1.00 0.00 ? 478 GLN C H    4  
ATOM 2927  H HA   . GLN A 1 26 ? -16.253 -6.624  -0.158  1.00 0.00 ? 478 GLN C HA   4  
ATOM 2928  H HB2  . GLN A 1 26 ? -15.953 -8.827  -1.224  1.00 0.00 ? 478 GLN C HB2  4  
ATOM 2929  H HB3  . GLN A 1 26 ? -17.333 -9.435  -0.326  1.00 0.00 ? 478 GLN C HB3  4  
ATOM 2930  H HG2  . GLN A 1 26 ? -18.752 -7.782  -1.465  1.00 0.00 ? 478 GLN C HG2  4  
ATOM 2931  H HG3  . GLN A 1 26 ? -17.354 -7.286  -2.418  1.00 0.00 ? 478 GLN C HG3  4  
ATOM 2932  H HE21 . GLN A 1 26 ? -17.999 -10.586 -1.469  1.00 0.00 ? 478 GLN C HE21 4  
ATOM 2933  H HE22 . GLN A 1 26 ? -18.333 -11.183 -3.056  1.00 0.00 ? 478 GLN C HE22 4  
ATOM 2934  N N    . ASP A 1 27 ? -18.531 -8.113  1.738   1.00 0.00 ? 479 ASP C N    4  
ATOM 2935  C CA   . ASP A 1 27 ? -19.818 -7.933  2.418   1.00 0.00 ? 479 ASP C CA   4  
ATOM 2936  C C    . ASP A 1 27 ? -19.717 -6.895  3.520   1.00 0.00 ? 479 ASP C C    4  
ATOM 2937  O O    . ASP A 1 27 ? -20.674 -6.194  3.808   1.00 0.00 ? 479 ASP C O    4  
ATOM 2938  C CB   . ASP A 1 27 ? -20.306 -9.251  3.005   1.00 0.00 ? 479 ASP C CB   4  
ATOM 2939  C CG   . ASP A 1 27 ? -21.753 -9.184  3.474   1.00 0.00 ? 479 ASP C CG   4  
ATOM 2940  O OD1  . ASP A 1 27 ? -21.999 -8.824  4.649   1.00 0.00 ? 479 ASP C OD1  4  
ATOM 2941  O OD2  . ASP A 1 27 ? -22.648 -9.500  2.665   1.00 0.00 ? 479 ASP C OD2  4  
ATOM 2942  H H    . ASP A 1 27 ? -18.051 -8.963  1.847   1.00 0.00 ? 479 ASP C H    4  
ATOM 2943  H HA   . ASP A 1 27 ? -20.537 -7.591  1.686   1.00 0.00 ? 479 ASP C HA   4  
ATOM 2944  H HB2  . ASP A 1 27 ? -20.221 -10.022 2.256   1.00 0.00 ? 479 ASP C HB2  4  
ATOM 2945  H HB3  . ASP A 1 27 ? -19.684 -9.507  3.850   1.00 0.00 ? 479 ASP C HB3  4  
ATOM 2946  N N    . LEU A 1 28 ? -18.544 -6.779  4.110   1.00 0.00 ? 480 LEU C N    4  
ATOM 2947  C CA   . LEU A 1 28 ? -18.320 -5.829  5.188   1.00 0.00 ? 480 LEU C CA   4  
ATOM 2948  C C    . LEU A 1 28 ? -18.394 -4.405  4.684   1.00 0.00 ? 480 LEU C C    4  
ATOM 2949  O O    . LEU A 1 28 ? -18.579 -3.478  5.453   1.00 0.00 ? 480 LEU C O    4  
ATOM 2950  C CB   . LEU A 1 28 ? -16.984 -6.080  5.893   1.00 0.00 ? 480 LEU C CB   4  
ATOM 2951  C CG   . LEU A 1 28 ? -17.030 -7.017  7.102   1.00 0.00 ? 480 LEU C CG   4  
ATOM 2952  C CD1  . LEU A 1 28 ? -18.087 -6.568  8.088   1.00 0.00 ? 480 LEU C CD1  4  
ATOM 2953  C CD2  . LEU A 1 28 ? -17.302 -8.418  6.671   1.00 0.00 ? 480 LEU C CD2  4  
ATOM 2954  H H    . LEU A 1 28 ? -17.809 -7.341  3.807   1.00 0.00 ? 480 LEU C H    4  
ATOM 2955  H HA   . LEU A 1 28 ? -19.119 -5.971  5.899   1.00 0.00 ? 480 LEU C HA   4  
ATOM 2956  H HB2  . LEU A 1 28 ? -16.290 -6.484  5.175   1.00 0.00 ? 480 LEU C HB2  4  
ATOM 2957  H HB3  . LEU A 1 28 ? -16.596 -5.140  6.220   1.00 0.00 ? 480 LEU C HB3  4  
ATOM 2958  H HG   . LEU A 1 28 ? -16.073 -6.995  7.602   1.00 0.00 ? 480 LEU C HG   4  
ATOM 2959  H HD11 . LEU A 1 28 ? -19.065 -6.773  7.680   1.00 0.00 ? 480 LEU C HD11 4  
ATOM 2960  H HD12 . LEU A 1 28 ? -17.987 -5.508  8.266   1.00 0.00 ? 480 LEU C HD12 4  
ATOM 2961  H HD13 . LEU A 1 28 ? -17.965 -7.105  9.016   1.00 0.00 ? 480 LEU C HD13 4  
ATOM 2962  H HD21 . LEU A 1 28 ? -16.522 -8.745  6.001   1.00 0.00 ? 480 LEU C HD21 4  
ATOM 2963  H HD22 . LEU A 1 28 ? -18.256 -8.442  6.158   1.00 0.00 ? 480 LEU C HD22 4  
ATOM 2964  H HD23 . LEU A 1 28 ? -17.333 -9.062  7.538   1.00 0.00 ? 480 LEU C HD23 4  
ATOM 2965  N N    . GLN A 1 29 ? -18.234 -4.238  3.398   1.00 0.00 ? 481 GLN C N    4  
ATOM 2966  C CA   . GLN A 1 29 ? -18.373 -2.944  2.791   1.00 0.00 ? 481 GLN C CA   4  
ATOM 2967  C C    . GLN A 1 29 ? -19.820 -2.725  2.377   1.00 0.00 ? 481 GLN C C    4  
ATOM 2968  O O    . GLN A 1 29 ? -20.268 -1.593  2.197   1.00 0.00 ? 481 GLN C O    4  
ATOM 2969  C CB   . GLN A 1 29 ? -17.443 -2.822  1.601   1.00 0.00 ? 481 GLN C CB   4  
ATOM 2970  C CG   . GLN A 1 29 ? -15.985 -2.888  1.985   1.00 0.00 ? 481 GLN C CG   4  
ATOM 2971  C CD   . GLN A 1 29 ? -15.052 -2.845  0.799   1.00 0.00 ? 481 GLN C CD   4  
ATOM 2972  O OE1  . GLN A 1 29 ? -15.358 -2.256  -0.241  1.00 0.00 ? 481 GLN C OE1  4  
ATOM 2973  N NE2  . GLN A 1 29 ? -13.905 -3.468  0.949   1.00 0.00 ? 481 GLN C NE2  4  
ATOM 2974  H H    . GLN A 1 29 ? -18.002 -5.007  2.836   1.00 0.00 ? 481 GLN C H    4  
ATOM 2975  H HA   . GLN A 1 29 ? -18.101 -2.202  3.529   1.00 0.00 ? 481 GLN C HA   4  
ATOM 2976  H HB2  . GLN A 1 29 ? -17.651 -3.624  0.908   1.00 0.00 ? 481 GLN C HB2  4  
ATOM 2977  H HB3  . GLN A 1 29 ? -17.621 -1.880  1.114   1.00 0.00 ? 481 GLN C HB3  4  
ATOM 2978  H HG2  . GLN A 1 29 ? -15.760 -2.052  2.630   1.00 0.00 ? 481 GLN C HG2  4  
ATOM 2979  H HG3  . GLN A 1 29 ? -15.818 -3.806  2.524   1.00 0.00 ? 481 GLN C HG3  4  
ATOM 2980  H HE21 . GLN A 1 29 ? -13.731 -3.915  1.805   1.00 0.00 ? 481 GLN C HE21 4  
ATOM 2981  H HE22 . GLN A 1 29 ? -13.266 -3.456  0.209   1.00 0.00 ? 481 GLN C HE22 4  
ATOM 2982  N N    . LEU A 1 30 ? -20.548 -3.823  2.245   1.00 0.00 ? 482 LEU C N    4  
ATOM 2983  C CA   . LEU A 1 30 ? -21.939 -3.784  1.851   1.00 0.00 ? 482 LEU C CA   4  
ATOM 2984  C C    . LEU A 1 30 ? -22.835 -3.596  3.072   1.00 0.00 ? 482 LEU C C    4  
ATOM 2985  O O    . LEU A 1 30 ? -23.698 -2.714  3.096   1.00 0.00 ? 482 LEU C O    4  
ATOM 2986  C CB   . LEU A 1 30 ? -22.319 -5.087  1.139   1.00 0.00 ? 482 LEU C CB   4  
ATOM 2987  C CG   . LEU A 1 30 ? -21.355 -5.577  0.055   1.00 0.00 ? 482 LEU C CG   4  
ATOM 2988  C CD1  . LEU A 1 30 ? -21.926 -6.780  -0.668  1.00 0.00 ? 482 LEU C CD1  4  
ATOM 2989  C CD2  . LEU A 1 30 ? -21.019 -4.468  -0.923  1.00 0.00 ? 482 LEU C CD2  4  
ATOM 2990  H H    . LEU A 1 30 ? -20.139 -4.694  2.420   1.00 0.00 ? 482 LEU C H    4  
ATOM 2991  H HA   . LEU A 1 30 ? -22.077 -2.958  1.171   1.00 0.00 ? 482 LEU C HA   4  
ATOM 2992  H HB2  . LEU A 1 30 ? -22.403 -5.862  1.887   1.00 0.00 ? 482 LEU C HB2  4  
ATOM 2993  H HB3  . LEU A 1 30 ? -23.286 -4.949  0.690   1.00 0.00 ? 482 LEU C HB3  4  
ATOM 2994  H HG   . LEU A 1 30 ? -20.436 -5.890  0.531   1.00 0.00 ? 482 LEU C HG   4  
ATOM 2995  H HD11 . LEU A 1 30 ? -22.857 -6.506  -1.143  1.00 0.00 ? 482 LEU C HD11 4  
ATOM 2996  H HD12 . LEU A 1 30 ? -22.105 -7.575  0.041   1.00 0.00 ? 482 LEU C HD12 4  
ATOM 2997  H HD13 . LEU A 1 30 ? -21.226 -7.117  -1.417  1.00 0.00 ? 482 LEU C HD13 4  
ATOM 2998  H HD21 . LEU A 1 30 ? -20.535 -3.663  -0.388  1.00 0.00 ? 482 LEU C HD21 4  
ATOM 2999  H HD22 . LEU A 1 30 ? -21.923 -4.106  -1.387  1.00 0.00 ? 482 LEU C HD22 4  
ATOM 3000  H HD23 . LEU A 1 30 ? -20.348 -4.851  -1.677  1.00 0.00 ? 482 LEU C HD23 4  
ATOM 3001  N N    . THR A 1 31 ? -22.630 -4.422  4.085   1.00 0.00 ? 483 THR C N    4  
ATOM 3002  C CA   . THR A 1 31 ? -23.441 -4.368  5.280   1.00 0.00 ? 483 THR C CA   4  
ATOM 3003  C C    . THR A 1 31 ? -22.767 -3.559  6.372   1.00 0.00 ? 483 THR C C    4  
ATOM 3004  O O    . THR A 1 31 ? -23.442 -2.965  7.217   1.00 0.00 ? 483 THR C O    4  
ATOM 3005  C CB   . THR A 1 31 ? -23.742 -5.780  5.808   1.00 0.00 ? 483 THR C CB   4  
ATOM 3006  O OG1  . THR A 1 31 ? -22.513 -6.490  6.015   1.00 0.00 ? 483 THR C OG1  4  
ATOM 3007  C CG2  . THR A 1 31 ? -24.615 -6.541  4.826   1.00 0.00 ? 483 THR C CG2  4  
ATOM 3008  H H    . THR A 1 31 ? -21.910 -5.101  4.032   1.00 0.00 ? 483 THR C H    4  
ATOM 3009  H HA   . THR A 1 31 ? -24.378 -3.897  5.027   1.00 0.00 ? 483 THR C HA   4  
ATOM 3010  H HB   . THR A 1 31 ? -24.266 -5.695  6.750   1.00 0.00 ? 483 THR C HB   4  
ATOM 3011  H HG1  . THR A 1 31 ? -22.468 -7.257  5.419   1.00 0.00 ? 483 THR C HG1  4  
ATOM 3012  H HG21 . THR A 1 31 ? -24.102 -6.628  3.881   1.00 0.00 ? 483 THR C HG21 4  
ATOM 3013  H HG22 . THR A 1 31 ? -25.546 -6.011  4.685   1.00 0.00 ? 483 THR C HG22 4  
ATOM 3014  H HG23 . THR A 1 31 ? -24.817 -7.526  5.219   1.00 0.00 ? 483 THR C HG23 4  
ATOM 3015  N N    . ARG A 1 32 ? -21.424 -3.543  6.354   1.00 0.00 ? 484 ARG C N    4  
ATOM 3016  C CA   . ARG A 1 32 ? -20.632 -2.822  7.349   1.00 0.00 ? 484 ARG C CA   4  
ATOM 3017  C C    . ARG A 1 32 ? -20.824 -3.428  8.735   1.00 0.00 ? 484 ARG C C    4  
ATOM 3018  O O    . ARG A 1 32 ? -20.494 -2.811  9.745   1.00 0.00 ? 484 ARG C O    4  
ATOM 3019  C CB   . ARG A 1 32 ? -20.995 -1.332  7.357   1.00 0.00 ? 484 ARG C CB   4  
ATOM 3020  C CG   . ARG A 1 32 ? -20.792 -0.635  6.021   1.00 0.00 ? 484 ARG C CG   4  
ATOM 3021  C CD   . ARG A 1 32 ? -19.319 -0.440  5.707   1.00 0.00 ? 484 ARG C CD   4  
ATOM 3022  N NE   . ARG A 1 32 ? -19.113 0.013   4.333   1.00 0.00 ? 484 ARG C NE   4  
ATOM 3023  C CZ   . ARG A 1 32 ? -17.934 0.373   3.823   1.00 0.00 ? 484 ARG C CZ   4  
ATOM 3024  N NH1  . ARG A 1 32 ? -16.852 0.404   4.592   1.00 0.00 ? 484 ARG C NH1  4  
ATOM 3025  N NH2  . ARG A 1 32 ? -17.842 0.712   2.542   1.00 0.00 ? 484 ARG C NH2  4  
ATOM 3026  H H    . ARG A 1 32 ? -20.947 -4.031  5.652   1.00 0.00 ? 484 ARG C H    4  
ATOM 3027  H HA   . ARG A 1 32 ? -19.593 -2.926  7.073   1.00 0.00 ? 484 ARG C HA   4  
ATOM 3028  H HB2  . ARG A 1 32 ? -22.031 -1.226  7.641   1.00 0.00 ? 484 ARG C HB2  4  
ATOM 3029  H HB3  . ARG A 1 32 ? -20.376 -0.845  8.089   1.00 0.00 ? 484 ARG C HB3  4  
ATOM 3030  H HG2  . ARG A 1 32 ? -21.234 -1.238  5.242   1.00 0.00 ? 484 ARG C HG2  4  
ATOM 3031  H HG3  . ARG A 1 32 ? -21.277 0.327   6.051   1.00 0.00 ? 484 ARG C HG3  4  
ATOM 3032  H HD2  . ARG A 1 32 ? -18.913 0.297   6.384   1.00 0.00 ? 484 ARG C HD2  4  
ATOM 3033  H HD3  . ARG A 1 32 ? -18.804 -1.380  5.847   1.00 0.00 ? 484 ARG C HD3  4  
ATOM 3034  H HE   . ARG A 1 32 ? -19.904 0.026   3.750   1.00 0.00 ? 484 ARG C HE   4  
ATOM 3035  H HH11 . ARG A 1 32 ? -16.905 0.162   5.565   1.00 0.00 ? 484 ARG C HH11 4  
ATOM 3036  H HH12 . ARG A 1 32 ? -15.965 0.673   4.203   1.00 0.00 ? 484 ARG C HH12 4  
ATOM 3037  H HH21 . ARG A 1 32 ? -18.652 0.701   1.948   1.00 0.00 ? 484 ARG C HH21 4  
ATOM 3038  H HH22 . ARG A 1 32 ? -16.956 0.977   2.152   1.00 0.00 ? 484 ARG C HH22 4  
ATOM 3039  N N    . SER A 1 33 ? -21.332 -4.652  8.772   1.00 0.00 ? 485 SER C N    4  
ATOM 3040  C CA   . SER A 1 33 ? -21.601 -5.319  10.022  1.00 0.00 ? 485 SER C CA   4  
ATOM 3041  C C    . SER A 1 33 ? -21.167 -6.767  9.970   1.00 0.00 ? 485 SER C C    4  
ATOM 3042  O O    . SER A 1 33 ? -21.790 -7.581  9.291   1.00 0.00 ? 485 SER C O    4  
ATOM 3043  C CB   . SER A 1 33 ? -23.088 -5.251  10.345  1.00 0.00 ? 485 SER C CB   4  
ATOM 3044  O OG   . SER A 1 33 ? -23.368 -5.845  11.606  1.00 0.00 ? 485 SER C OG   4  
ATOM 3045  H H    . SER A 1 33 ? -21.527 -5.121  7.931   1.00 0.00 ? 485 SER C H    4  
ATOM 3046  H HA   . SER A 1 33 ? -21.055 -4.814  10.800  1.00 0.00 ? 485 SER C HA   4  
ATOM 3047  H HB2  . SER A 1 33 ? -23.416 -4.226  10.351  1.00 0.00 ? 485 SER C HB2  4  
ATOM 3048  H HB3  . SER A 1 33 ? -23.635 -5.790  9.585   1.00 0.00 ? 485 SER C HB3  4  
ATOM 3049  H HG   . SER A 1 33 ? -23.768 -5.186  12.188  1.00 0.00 ? 485 SER C HG   4  
ATOM 3050  N N    . VAL A 1 34 ? -20.098 -7.087  10.692  1.00 0.00 ? 486 VAL C N    4  
ATOM 3051  C CA   . VAL A 1 34 ? -19.608 -8.461  10.782  1.00 0.00 ? 486 VAL C CA   4  
ATOM 3052  C C    . VAL A 1 34 ? -20.717 -9.399  11.276  1.00 0.00 ? 486 VAL C C    4  
ATOM 3053  O O    . VAL A 1 34 ? -20.815 -10.553 10.840  1.00 0.00 ? 486 VAL C O    4  
ATOM 3054  C CB   . VAL A 1 34 ? -18.333 -8.567  11.696  1.00 0.00 ? 486 VAL C CB   4  
ATOM 3055  C CG1  . VAL A 1 34 ? -18.174 -7.329  12.552  1.00 0.00 ? 486 VAL C CG1  4  
ATOM 3056  C CG2  . VAL A 1 34 ? -18.360 -9.808  12.580  1.00 0.00 ? 486 VAL C CG2  4  
ATOM 3057  H H    . VAL A 1 34 ? -19.618 -6.374  11.164  1.00 0.00 ? 486 VAL C H    4  
ATOM 3058  H HA   . VAL A 1 34 ? -19.335 -8.764  9.782   1.00 0.00 ? 486 VAL C HA   4  
ATOM 3059  H HB   . VAL A 1 34 ? -17.469 -8.633  11.050  1.00 0.00 ? 486 VAL C HB   4  
ATOM 3060  H HG11 . VAL A 1 34 ? -19.089 -7.142  13.091  1.00 0.00 ? 486 VAL C HG11 4  
ATOM 3061  H HG12 . VAL A 1 34 ? -17.938 -6.488  11.914  1.00 0.00 ? 486 VAL C HG12 4  
ATOM 3062  H HG13 . VAL A 1 34 ? -17.365 -7.484  13.250  1.00 0.00 ? 486 VAL C HG13 4  
ATOM 3063  H HG21 . VAL A 1 34 ? -18.424 -10.692 11.963  1.00 0.00 ? 486 VAL C HG21 4  
ATOM 3064  H HG22 . VAL A 1 34 ? -19.218 -9.764  13.235  1.00 0.00 ? 486 VAL C HG22 4  
ATOM 3065  H HG23 . VAL A 1 34 ? -17.458 -9.848  13.173  1.00 0.00 ? 486 VAL C HG23 4  
ATOM 3066  N N    . GLU A 1 35 ? -21.565 -8.884  12.157  1.00 0.00 ? 487 GLU C N    4  
ATOM 3067  C CA   . GLU A 1 35 ? -22.680 -9.646  12.684  1.00 0.00 ? 487 GLU C CA   4  
ATOM 3068  C C    . GLU A 1 35 ? -23.644 -10.042 11.574  1.00 0.00 ? 487 GLU C C    4  
ATOM 3069  O O    . GLU A 1 35 ? -24.109 -11.192 11.521  1.00 0.00 ? 487 GLU C O    4  
ATOM 3070  C CB   . GLU A 1 35 ? -23.399 -8.857  13.769  1.00 0.00 ? 487 GLU C CB   4  
ATOM 3071  C CG   . GLU A 1 35 ? -22.589 -8.725  15.039  1.00 0.00 ? 487 GLU C CG   4  
ATOM 3072  C CD   . GLU A 1 35 ? -22.278 -10.071 15.653  1.00 0.00 ? 487 GLU C CD   4  
ATOM 3073  O OE1  . GLU A 1 35 ? -23.094 -10.560 16.462  1.00 0.00 ? 487 GLU C OE1  4  
ATOM 3074  O OE2  . GLU A 1 35 ? -21.223 -10.658 15.322  1.00 0.00 ? 487 GLU C OE2  4  
ATOM 3075  H H    . GLU A 1 35 ? -21.433 -7.963  12.463  1.00 0.00 ? 487 GLU C H    4  
ATOM 3076  H HA   . GLU A 1 35 ? -22.277 -10.548 13.120  1.00 0.00 ? 487 GLU C HA   4  
ATOM 3077  H HB2  . GLU A 1 35 ? -23.616 -7.867  13.397  1.00 0.00 ? 487 GLU C HB2  4  
ATOM 3078  H HB3  . GLU A 1 35 ? -24.327 -9.355  14.008  1.00 0.00 ? 487 GLU C HB3  4  
ATOM 3079  H HG2  . GLU A 1 35 ? -21.658 -8.227  14.809  1.00 0.00 ? 487 GLU C HG2  4  
ATOM 3080  H HG3  . GLU A 1 35 ? -23.147 -8.139  15.752  1.00 0.00 ? 487 GLU C HG3  4  
ATOM 3081  N N    . ILE A 1 36 ? -23.941 -9.102  10.680  1.00 0.00 ? 488 ILE C N    4  
ATOM 3082  C CA   . ILE A 1 36 ? -24.808 -9.396  9.552   1.00 0.00 ? 488 ILE C CA   4  
ATOM 3083  C C    . ILE A 1 36 ? -24.093 -10.323 8.595   1.00 0.00 ? 488 ILE C C    4  
ATOM 3084  O O    . ILE A 1 36 ? -24.615 -11.340 8.241   1.00 0.00 ? 488 ILE C O    4  
ATOM 3085  C CB   . ILE A 1 36 ? -25.254 -8.130  8.791   1.00 0.00 ? 488 ILE C CB   4  
ATOM 3086  C CG1  . ILE A 1 36 ? -25.923 -7.136  9.748   1.00 0.00 ? 488 ILE C CG1  4  
ATOM 3087  C CG2  . ILE A 1 36 ? -26.211 -8.504  7.660   1.00 0.00 ? 488 ILE C CG2  4  
ATOM 3088  C CD1  . ILE A 1 36 ? -26.395 -5.860  9.078   1.00 0.00 ? 488 ILE C CD1  4  
ATOM 3089  H H    . ILE A 1 36 ? -23.565 -8.201  10.783  1.00 0.00 ? 488 ILE C H    4  
ATOM 3090  H HA   . ILE A 1 36 ? -25.685 -9.901  9.933   1.00 0.00 ? 488 ILE C HA   4  
ATOM 3091  H HB   . ILE A 1 36 ? -24.377 -7.682  8.353   1.00 0.00 ? 488 ILE C HB   4  
ATOM 3092  H HG12 . ILE A 1 36 ? -26.786 -7.608  10.196  1.00 0.00 ? 488 ILE C HG12 4  
ATOM 3093  H HG13 . ILE A 1 36 ? -25.224 -6.867  10.526  1.00 0.00 ? 488 ILE C HG13 4  
ATOM 3094  H HG21 . ILE A 1 36 ? -27.082 -8.992  8.072   1.00 0.00 ? 488 ILE C HG21 4  
ATOM 3095  H HG22 . ILE A 1 36 ? -25.713 -9.175  6.976   1.00 0.00 ? 488 ILE C HG22 4  
ATOM 3096  H HG23 . ILE A 1 36 ? -26.514 -7.611  7.134   1.00 0.00 ? 488 ILE C HG23 4  
ATOM 3097  H HD11 . ILE A 1 36 ? -27.118 -6.100  8.312   1.00 0.00 ? 488 ILE C HD11 4  
ATOM 3098  H HD12 . ILE A 1 36 ? -25.552 -5.355  8.630   1.00 0.00 ? 488 ILE C HD12 4  
ATOM 3099  H HD13 . ILE A 1 36 ? -26.852 -5.215  9.814   1.00 0.00 ? 488 ILE C HD13 4  
ATOM 3100  N N    . THR A 1 37 ? -22.883 -9.942  8.200   1.00 0.00 ? 489 THR C N    4  
ATOM 3101  C CA   . THR A 1 37 ? -22.030 -10.733 7.321   1.00 0.00 ? 489 THR C CA   4  
ATOM 3102  C C    . THR A 1 37 ? -21.977 -12.215 7.740   1.00 0.00 ? 489 THR C C    4  
ATOM 3103  O O    . THR A 1 37 ? -22.091 -13.101 6.899   1.00 0.00 ? 489 THR C O    4  
ATOM 3104  C CB   . THR A 1 37 ? -20.610 -10.149 7.313   1.00 0.00 ? 489 THR C CB   4  
ATOM 3105  O OG1  . THR A 1 37 ? -20.674 -8.759  6.991   1.00 0.00 ? 489 THR C OG1  4  
ATOM 3106  C CG2  . THR A 1 37 ? -19.724 -10.853 6.300   1.00 0.00 ? 489 THR C CG2  4  
ATOM 3107  H H    . THR A 1 37 ? -22.544 -9.070  8.480   1.00 0.00 ? 489 THR C H    4  
ATOM 3108  H HA   . THR A 1 37 ? -22.425 -10.663 6.319   1.00 0.00 ? 489 THR C HA   4  
ATOM 3109  H HB   . THR A 1 37 ? -20.186 -10.271 8.299   1.00 0.00 ? 489 THR C HB   4  
ATOM 3110  H HG1  . THR A 1 37 ? -21.119 -8.659  6.131   1.00 0.00 ? 489 THR C HG1  4  
ATOM 3111  H HG21 . THR A 1 37 ? -20.190 -10.812 5.327   1.00 0.00 ? 489 THR C HG21 4  
ATOM 3112  H HG22 . THR A 1 37 ? -19.574 -11.879 6.594   1.00 0.00 ? 489 THR C HG22 4  
ATOM 3113  H HG23 . THR A 1 37 ? -18.771 -10.340 6.259   1.00 0.00 ? 489 THR C HG23 4  
ATOM 3114  N N    . THR A 1 38 ? -21.825 -12.475 9.036   1.00 0.00 ? 490 THR C N    4  
ATOM 3115  C CA   . THR A 1 38 ? -21.779 -13.846 9.527   1.00 0.00 ? 490 THR C CA   4  
ATOM 3116  C C    . THR A 1 38 ? -23.115 -14.550 9.266   1.00 0.00 ? 490 THR C C    4  
ATOM 3117  O O    . THR A 1 38 ? -23.153 -15.682 8.773   1.00 0.00 ? 490 THR C O    4  
ATOM 3118  C CB   . THR A 1 38 ? -21.451 -13.898 11.037  1.00 0.00 ? 490 THR C CB   4  
ATOM 3119  O OG1  . THR A 1 38 ? -20.268 -13.130 11.310  1.00 0.00 ? 490 THR C OG1  4  
ATOM 3120  C CG2  . THR A 1 38 ? -21.224 -15.334 11.480  1.00 0.00 ? 490 THR C CG2  4  
ATOM 3121  H H    . THR A 1 38 ? -21.745 -11.733 9.670   1.00 0.00 ? 490 THR C H    4  
ATOM 3122  H HA   . THR A 1 38 ? -21.003 -14.368 8.985   1.00 0.00 ? 490 THR C HA   4  
ATOM 3123  H HB   . THR A 1 38 ? -22.283 -13.487 11.590  1.00 0.00 ? 490 THR C HB   4  
ATOM 3124  H HG1  . THR A 1 38 ? -20.398 -12.216 11.024  1.00 0.00 ? 490 THR C HG1  4  
ATOM 3125  H HG21 . THR A 1 38 ? -20.435 -15.771 10.881  1.00 0.00 ? 490 THR C HG21 4  
ATOM 3126  H HG22 . THR A 1 38 ? -22.133 -15.901 11.347  1.00 0.00 ? 490 THR C HG22 4  
ATOM 3127  H HG23 . THR A 1 38 ? -20.936 -15.350 12.520  1.00 0.00 ? 490 THR C HG23 4  
ATOM 3128  N N    . ASP A 1 39 ? -24.206 -13.856 9.569   1.00 0.00 ? 491 ASP C N    4  
ATOM 3129  C CA   . ASP A 1 39 ? -25.552 -14.388 9.338   1.00 0.00 ? 491 ASP C CA   4  
ATOM 3130  C C    . ASP A 1 39 ? -25.802 -14.481 7.846   1.00 0.00 ? 491 ASP C C    4  
ATOM 3131  O O    . ASP A 1 39 ? -26.449 -15.405 7.362   1.00 0.00 ? 491 ASP C O    4  
ATOM 3132  C CB   . ASP A 1 39 ? -26.598 -13.480 9.993   1.00 0.00 ? 491 ASP C CB   4  
ATOM 3133  C CG   . ASP A 1 39 ? -28.010 -14.007 9.843   1.00 0.00 ? 491 ASP C CG   4  
ATOM 3134  O OD1  . ASP A 1 39 ? -28.350 -15.005 10.514  1.00 0.00 ? 491 ASP C OD1  4  
ATOM 3135  O OD2  . ASP A 1 39 ? -28.799 -13.406 9.077   1.00 0.00 ? 491 ASP C OD2  4  
ATOM 3136  H H    . ASP A 1 39 ? -24.105 -12.952 9.942   1.00 0.00 ? 491 ASP C H    4  
ATOM 3137  H HA   . ASP A 1 39 ? -25.608 -15.377 9.770   1.00 0.00 ? 491 ASP C HA   4  
ATOM 3138  H HB2  . ASP A 1 39 ? -26.380 -13.390 11.046  1.00 0.00 ? 491 ASP C HB2  4  
ATOM 3139  H HB3  . ASP A 1 39 ? -26.547 -12.503 9.536   1.00 0.00 ? 491 ASP C HB3  4  
ATOM 3140  N N    . ASN A 1 40 ? -25.259 -13.514 7.133   1.00 0.00 ? 492 ASN C N    4  
ATOM 3141  C CA   . ASN A 1 40 ? -25.327 -13.447 5.696   1.00 0.00 ? 492 ASN C CA   4  
ATOM 3142  C C    . ASN A 1 40 ? -24.757 -14.722 5.087   1.00 0.00 ? 492 ASN C C    4  
ATOM 3143  O O    . ASN A 1 40 ? -25.392 -15.367 4.258   1.00 0.00 ? 492 ASN C O    4  
ATOM 3144  C CB   . ASN A 1 40 ? -24.552 -12.209 5.188   1.00 0.00 ? 492 ASN C CB   4  
ATOM 3145  C CG   . ASN A 1 40 ? -25.454 -11.037 4.878   1.00 0.00 ? 492 ASN C CG   4  
ATOM 3146  O OD1  . ASN A 1 40 ? -26.649 -11.202 4.631   1.00 0.00 ? 492 ASN C OD1  4  
ATOM 3147  N ND2  . ASN A 1 40 ? -24.881 -9.851  4.845   1.00 0.00 ? 492 ASN C ND2  4  
ATOM 3148  H H    . ASN A 1 40 ? -24.791 -12.793 7.612   1.00 0.00 ? 492 ASN C H    4  
ATOM 3149  H HA   . ASN A 1 40 ? -26.364 -13.336 5.424   1.00 0.00 ? 492 ASN C HA   4  
ATOM 3150  H HB2  . ASN A 1 40 ? -23.883 -11.887 5.972   1.00 0.00 ? 492 ASN C HB2  4  
ATOM 3151  H HB3  . ASN A 1 40 ? -23.969 -12.445 4.318   1.00 0.00 ? 492 ASN C HB3  4  
ATOM 3152  H HD21 . ASN A 1 40 ? -23.913 -9.786  5.018   1.00 0.00 ? 492 ASN C HD21 4  
ATOM 3153  H HD22 . ASN A 1 40 ? -25.439 -9.075  4.647   1.00 0.00 ? 492 ASN C HD22 4  
ATOM 3154  N N    . ILE A 1 41 ? -23.561 -15.091 5.526   1.00 0.00 ? 493 ILE C N    4  
ATOM 3155  C CA   . ILE A 1 41 ? -22.910 -16.312 5.069   1.00 0.00 ? 493 ILE C CA   4  
ATOM 3156  C C    . ILE A 1 41 ? -23.787 -17.529 5.367   1.00 0.00 ? 493 ILE C C    4  
ATOM 3157  O O    . ILE A 1 41 ? -24.019 -18.372 4.501   1.00 0.00 ? 493 ILE C O    4  
ATOM 3158  C CB   . ILE A 1 41 ? -21.546 -16.511 5.773   1.00 0.00 ? 493 ILE C CB   4  
ATOM 3159  C CG1  . ILE A 1 41 ? -20.629 -15.334 5.504   1.00 0.00 ? 493 ILE C CG1  4  
ATOM 3160  C CG2  . ILE A 1 41 ? -20.885 -17.800 5.312   1.00 0.00 ? 493 ILE C CG2  4  
ATOM 3161  C CD1  . ILE A 1 41 ? -19.441 -15.273 6.433   1.00 0.00 ? 493 ILE C CD1  4  
ATOM 3162  H H    . ILE A 1 41 ? -23.092 -14.516 6.173   1.00 0.00 ? 493 ILE C H    4  
ATOM 3163  H HA   . ILE A 1 41 ? -22.754 -16.225 4.004   1.00 0.00 ? 493 ILE C HA   4  
ATOM 3164  H HB   . ILE A 1 41 ? -21.721 -16.580 6.837   1.00 0.00 ? 493 ILE C HB   4  
ATOM 3165  H HG12 . ILE A 1 41 ? -20.259 -15.398 4.493   1.00 0.00 ? 493 ILE C HG12 4  
ATOM 3166  H HG13 . ILE A 1 41 ? -21.191 -14.423 5.620   1.00 0.00 ? 493 ILE C HG13 4  
ATOM 3167  H HG21 . ILE A 1 41 ? -20.736 -17.761 4.245   1.00 0.00 ? 493 ILE C HG21 4  
ATOM 3168  H HG22 . ILE A 1 41 ? -21.518 -18.639 5.561   1.00 0.00 ? 493 ILE C HG22 4  
ATOM 3169  H HG23 . ILE A 1 41 ? -19.930 -17.907 5.805   1.00 0.00 ? 493 ILE C HG23 4  
ATOM 3170  H HD11 . ILE A 1 41 ? -19.763 -14.911 7.399   1.00 0.00 ? 493 ILE C HD11 4  
ATOM 3171  H HD12 . ILE A 1 41 ? -18.691 -14.611 6.028   1.00 0.00 ? 493 ILE C HD12 4  
ATOM 3172  H HD13 . ILE A 1 41 ? -19.027 -16.263 6.553   1.00 0.00 ? 493 ILE C HD13 4  
ATOM 3173  N N    . LEU A 1 42 ? -24.270 -17.595 6.597   1.00 0.00 ? 494 LEU C N    4  
ATOM 3174  C CA   . LEU A 1 42 ? -25.102 -18.699 7.065   1.00 0.00 ? 494 LEU C CA   4  
ATOM 3175  C C    . LEU A 1 42 ? -26.383 -18.847 6.242   1.00 0.00 ? 494 LEU C C    4  
ATOM 3176  O O    . LEU A 1 42 ? -26.793 -19.962 5.916   1.00 0.00 ? 494 LEU C O    4  
ATOM 3177  C CB   . LEU A 1 42 ? -25.426 -18.500 8.544   1.00 0.00 ? 494 LEU C CB   4  
ATOM 3178  C CG   . LEU A 1 42 ? -24.233 -18.652 9.488   1.00 0.00 ? 494 LEU C CG   4  
ATOM 3179  C CD1  . LEU A 1 42 ? -24.557 -18.100 10.860  1.00 0.00 ? 494 LEU C CD1  4  
ATOM 3180  C CD2  . LEU A 1 42 ? -23.820 -20.113 9.588   1.00 0.00 ? 494 LEU C CD2  4  
ATOM 3181  H H    . LEU A 1 42 ? -24.057 -16.870 7.226   1.00 0.00 ? 494 LEU C H    4  
ATOM 3182  H HA   . LEU A 1 42 ? -24.527 -19.604 6.961   1.00 0.00 ? 494 LEU C HA   4  
ATOM 3183  H HB2  . LEU A 1 42 ? -25.833 -17.506 8.666   1.00 0.00 ? 494 LEU C HB2  4  
ATOM 3184  H HB3  . LEU A 1 42 ? -26.180 -19.214 8.832   1.00 0.00 ? 494 LEU C HB3  4  
ATOM 3185  H HG   . LEU A 1 42 ? -23.397 -18.094 9.093   1.00 0.00 ? 494 LEU C HG   4  
ATOM 3186  H HD11 . LEU A 1 42 ? -25.434 -18.593 11.252  1.00 0.00 ? 494 LEU C HD11 4  
ATOM 3187  H HD12 . LEU A 1 42 ? -24.736 -17.037 10.785  1.00 0.00 ? 494 LEU C HD12 4  
ATOM 3188  H HD13 . LEU A 1 42 ? -23.719 -18.276 11.518  1.00 0.00 ? 494 LEU C HD13 4  
ATOM 3189  H HD21 . LEU A 1 42 ? -22.998 -20.205 10.281  1.00 0.00 ? 494 LEU C HD21 4  
ATOM 3190  H HD22 . LEU A 1 42 ? -23.511 -20.468 8.615   1.00 0.00 ? 494 LEU C HD22 4  
ATOM 3191  H HD23 . LEU A 1 42 ? -24.654 -20.702 9.938   1.00 0.00 ? 494 LEU C HD23 4  
ATOM 3192  N N    . GLU A 1 43 ? -27.000 -17.727 5.896   1.00 0.00 ? 495 GLU C N    4  
ATOM 3193  C CA   . GLU A 1 43 ? -28.221 -17.740 5.095   1.00 0.00 ? 495 GLU C CA   4  
ATOM 3194  C C    . GLU A 1 43 ? -27.934 -18.128 3.648   1.00 0.00 ? 495 GLU C C    4  
ATOM 3195  O O    . GLU A 1 43 ? -28.831 -18.559 2.917   1.00 0.00 ? 495 GLU C O    4  
ATOM 3196  C CB   . GLU A 1 43 ? -28.903 -16.377 5.133   1.00 0.00 ? 495 GLU C CB   4  
ATOM 3197  C CG   . GLU A 1 43 ? -29.548 -16.047 6.464   1.00 0.00 ? 495 GLU C CG   4  
ATOM 3198  C CD   . GLU A 1 43 ? -30.639 -17.023 6.840   1.00 0.00 ? 495 GLU C CD   4  
ATOM 3199  O OE1  . GLU A 1 43 ? -31.422 -17.418 5.952   1.00 0.00 ? 495 GLU C OE1  4  
ATOM 3200  O OE2  . GLU A 1 43 ? -30.731 -17.385 8.031   1.00 0.00 ? 495 GLU C OE2  4  
ATOM 3201  H H    . GLU A 1 43 ? -26.631 -16.866 6.197   1.00 0.00 ? 495 GLU C H    4  
ATOM 3202  H HA   . GLU A 1 43 ? -28.891 -18.472 5.523   1.00 0.00 ? 495 GLU C HA   4  
ATOM 3203  H HB2  . GLU A 1 43 ? -28.167 -15.617 4.919   1.00 0.00 ? 495 GLU C HB2  4  
ATOM 3204  H HB3  . GLU A 1 43 ? -29.667 -16.350 4.371   1.00 0.00 ? 495 GLU C HB3  4  
ATOM 3205  H HG2  . GLU A 1 43 ? -28.791 -16.064 7.233   1.00 0.00 ? 495 GLU C HG2  4  
ATOM 3206  H HG3  . GLU A 1 43 ? -29.976 -15.058 6.403   1.00 0.00 ? 495 GLU C HG3  4  
ATOM 3207  N N    . GLY A 1 44 ? -26.686 -17.980 3.246   1.00 0.00 ? 496 GLY C N    4  
ATOM 3208  C CA   . GLY A 1 44 ? -26.308 -18.288 1.888   1.00 0.00 ? 496 GLY C CA   4  
ATOM 3209  C C    . GLY A 1 44 ? -26.241 -17.049 1.032   1.00 0.00 ? 496 GLY C C    4  
ATOM 3210  O O    . GLY A 1 44 ? -26.337 -17.121 -0.194  1.00 0.00 ? 496 GLY C O    4  
ATOM 3211  H H    . GLY A 1 44 ? -26.011 -17.668 3.884   1.00 0.00 ? 496 GLY C H    4  
ATOM 3212  H HA2  . GLY A 1 44 ? -25.340 -18.767 1.893   1.00 0.00 ? 496 GLY C HA2  4  
ATOM 3213  H HA3  . GLY A 1 44 ? -27.033 -18.966 1.464   1.00 0.00 ? 496 GLY C HA3  4  
ATOM 3214  N N    . ARG A 1 45 ? -26.092 -15.906 1.680   1.00 0.00 ? 497 ARG C N    4  
ATOM 3215  C CA   . ARG A 1 45 ? -25.984 -14.632 0.988   1.00 0.00 ? 497 ARG C CA   4  
ATOM 3216  C C    . ARG A 1 45 ? -24.660 -14.561 0.259   1.00 0.00 ? 497 ARG C C    4  
ATOM 3217  O O    . ARG A 1 45 ? -24.573 -14.064 -0.864  1.00 0.00 ? 497 ARG C O    4  
ATOM 3218  C CB   . ARG A 1 45 ? -26.082 -13.482 1.991   1.00 0.00 ? 497 ARG C CB   4  
ATOM 3219  C CG   . ARG A 1 45 ? -26.059 -12.103 1.362   1.00 0.00 ? 497 ARG C CG   4  
ATOM 3220  C CD   . ARG A 1 45 ? -27.254 -11.891 0.456   1.00 0.00 ? 497 ARG C CD   4  
ATOM 3221  N NE   . ARG A 1 45 ? -28.519 -12.057 1.171   1.00 0.00 ? 497 ARG C NE   4  
ATOM 3222  C CZ   . ARG A 1 45 ? -29.723 -11.955 0.608   1.00 0.00 ? 497 ARG C CZ   4  
ATOM 3223  N NH1  . ARG A 1 45 ? -29.838 -11.668 -0.682  1.00 0.00 ? 497 ARG C NH1  4  
ATOM 3224  N NH2  . ARG A 1 45 ? -30.813 -12.145 1.342   1.00 0.00 ? 497 ARG C NH2  4  
ATOM 3225  H H    . ARG A 1 45 ? -26.053 -15.916 2.663   1.00 0.00 ? 497 ARG C H    4  
ATOM 3226  H HA   . ARG A 1 45 ? -26.793 -14.557 0.277   1.00 0.00 ? 497 ARG C HA   4  
ATOM 3227  H HB2  . ARG A 1 45 ? -26.998 -13.585 2.550   1.00 0.00 ? 497 ARG C HB2  4  
ATOM 3228  H HB3  . ARG A 1 45 ? -25.246 -13.555 2.673   1.00 0.00 ? 497 ARG C HB3  4  
ATOM 3229  H HG2  . ARG A 1 45 ? -26.078 -11.361 2.146   1.00 0.00 ? 497 ARG C HG2  4  
ATOM 3230  H HG3  . ARG A 1 45 ? -25.154 -11.999 0.784   1.00 0.00 ? 497 ARG C HG3  4  
ATOM 3231  H HD2  . ARG A 1 45 ? -27.199 -10.893 0.058   1.00 0.00 ? 497 ARG C HD2  4  
ATOM 3232  H HD3  . ARG A 1 45 ? -27.209 -12.605 -0.354  1.00 0.00 ? 497 ARG C HD3  4  
ATOM 3233  H HE   . ARG A 1 45 ? -28.461 -12.259 2.134   1.00 0.00 ? 497 ARG C HE   4  
ATOM 3234  H HH11 . ARG A 1 45 ? -29.020 -11.524 -1.243  1.00 0.00 ? 497 ARG C HH11 4  
ATOM 3235  H HH12 . ARG A 1 45 ? -30.741 -11.593 -1.111  1.00 0.00 ? 497 ARG C HH12 4  
ATOM 3236  H HH21 . ARG A 1 45 ? -30.731 -12.366 2.321   1.00 0.00 ? 497 ARG C HH21 4  
ATOM 3237  H HH22 . ARG A 1 45 ? -31.726 -12.074 0.934   1.00 0.00 ? 497 ARG C HH22 4  
ATOM 3238  N N    . ILE A 1 46 ? -23.637 -15.070 0.906   1.00 0.00 ? 498 ILE C N    4  
ATOM 3239  C CA   . ILE A 1 46 ? -22.314 -15.099 0.340   1.00 0.00 ? 498 ILE C CA   4  
ATOM 3240  C C    . ILE A 1 46 ? -22.023 -16.493 -0.168  1.00 0.00 ? 498 ILE C C    4  
ATOM 3241  O O    . ILE A 1 46 ? -22.044 -17.461 0.597   1.00 0.00 ? 498 ILE C O    4  
ATOM 3242  C CB   . ILE A 1 46 ? -21.243 -14.678 1.373   1.00 0.00 ? 498 ILE C CB   4  
ATOM 3243  C CG1  . ILE A 1 46 ? -21.567 -13.287 1.924   1.00 0.00 ? 498 ILE C CG1  4  
ATOM 3244  C CG2  . ILE A 1 46 ? -19.856 -14.693 0.741   1.00 0.00 ? 498 ILE C CG2  4  
ATOM 3245  C CD1  . ILE A 1 46 ? -20.627 -12.815 3.009   1.00 0.00 ? 498 ILE C CD1  4  
ATOM 3246  H H    . ILE A 1 46 ? -23.785 -15.457 1.792   1.00 0.00 ? 498 ILE C H    4  
ATOM 3247  H HA   . ILE A 1 46 ? -22.289 -14.406 -0.490  1.00 0.00 ? 498 ILE C HA   4  
ATOM 3248  H HB   . ILE A 1 46 ? -21.254 -15.390 2.185   1.00 0.00 ? 498 ILE C HB   4  
ATOM 3249  H HG12 . ILE A 1 46 ? -21.520 -12.572 1.116   1.00 0.00 ? 498 ILE C HG12 4  
ATOM 3250  H HG13 . ILE A 1 46 ? -22.567 -13.298 2.328   1.00 0.00 ? 498 ILE C HG13 4  
ATOM 3251  H HG21 . ILE A 1 46 ? -19.834 -14.001 -0.088  1.00 0.00 ? 498 ILE C HG21 4  
ATOM 3252  H HG22 . ILE A 1 46 ? -19.631 -15.688 0.388   1.00 0.00 ? 498 ILE C HG22 4  
ATOM 3253  H HG23 . ILE A 1 46 ? -19.124 -14.397 1.478   1.00 0.00 ? 498 ILE C HG23 4  
ATOM 3254  H HD11 . ILE A 1 46 ? -19.620 -12.764 2.620   1.00 0.00 ? 498 ILE C HD11 4  
ATOM 3255  H HD12 . ILE A 1 46 ? -20.657 -13.506 3.838   1.00 0.00 ? 498 ILE C HD12 4  
ATOM 3256  H HD13 . ILE A 1 46 ? -20.931 -11.836 3.350   1.00 0.00 ? 498 ILE C HD13 4  
ATOM 3257  N N    . GLN A 1 47 ? -21.788 -16.597 -1.454  1.00 0.00 ? 499 GLN C N    4  
ATOM 3258  C CA   . GLN A 1 47 ? -21.532 -17.871 -2.086  1.00 0.00 ? 499 GLN C CA   4  
ATOM 3259  C C    . GLN A 1 47 ? -20.160 -18.401 -1.713  1.00 0.00 ? 499 GLN C C    4  
ATOM 3260  O O    . GLN A 1 47 ? -19.135 -17.806 -2.060  1.00 0.00 ? 499 GLN C O    4  
ATOM 3261  C CB   . GLN A 1 47 ? -21.644 -17.746 -3.599  1.00 0.00 ? 499 GLN C CB   4  
ATOM 3262  C CG   . GLN A 1 47 ? -21.475 -19.059 -4.339  1.00 0.00 ? 499 GLN C CG   4  
ATOM 3263  C CD   . GLN A 1 47 ? -21.504 -18.883 -5.837  1.00 0.00 ? 499 GLN C CD   4  
ATOM 3264  O OE1  . GLN A 1 47 ? -22.149 -17.971 -6.354  1.00 0.00 ? 499 GLN C OE1  4  
ATOM 3265  N NE2  . GLN A 1 47 ? -20.806 -19.744 -6.543  1.00 0.00 ? 499 GLN C NE2  4  
ATOM 3266  H H    . GLN A 1 47 ? -21.788 -15.782 -2.000  1.00 0.00 ? 499 GLN C H    4  
ATOM 3267  H HA   . GLN A 1 47 ? -22.279 -18.569 -1.742  1.00 0.00 ? 499 GLN C HA   4  
ATOM 3268  H HB2  . GLN A 1 47 ? -22.615 -17.345 -3.844  1.00 0.00 ? 499 GLN C HB2  4  
ATOM 3269  H HB3  . GLN A 1 47 ? -20.884 -17.063 -3.950  1.00 0.00 ? 499 GLN C HB3  4  
ATOM 3270  H HG2  . GLN A 1 47 ? -20.527 -19.496 -4.062  1.00 0.00 ? 499 GLN C HG2  4  
ATOM 3271  H HG3  . GLN A 1 47 ? -22.275 -19.726 -4.051  1.00 0.00 ? 499 GLN C HG3  4  
ATOM 3272  H HE21 . GLN A 1 47 ? -20.310 -20.441 -6.066  1.00 0.00 ? 499 GLN C HE21 4  
ATOM 3273  H HE22 . GLN A 1 47 ? -20.813 -19.656 -7.521  1.00 0.00 ? 499 GLN C HE22 4  
ATOM 3274  N N    . VAL A 1 48 ? -20.146 -19.508 -1.005  1.00 0.00 ? 500 VAL C N    4  
ATOM 3275  C CA   . VAL A 1 48 ? -18.910 -20.143 -0.625  1.00 0.00 ? 500 VAL C CA   4  
ATOM 3276  C C    . VAL A 1 48 ? -18.430 -21.044 -1.755  1.00 0.00 ? 500 VAL C C    4  
ATOM 3277  O O    . VAL A 1 48 ? -19.241 -21.584 -2.509  1.00 0.00 ? 500 VAL C O    4  
ATOM 3278  C CB   . VAL A 1 48 ? -19.058 -20.970 0.683   1.00 0.00 ? 500 VAL C CB   4  
ATOM 3279  C CG1  . VAL A 1 48 ? -19.303 -20.057 1.879   1.00 0.00 ? 500 VAL C CG1  4  
ATOM 3280  C CG2  . VAL A 1 48 ? -20.176 -21.999 0.556   1.00 0.00 ? 500 VAL C CG2  4  
ATOM 3281  H H    . VAL A 1 48 ? -20.994 -19.923 -0.741  1.00 0.00 ? 500 VAL C H    4  
ATOM 3282  H HA   . VAL A 1 48 ? -18.178 -19.365 -0.462  1.00 0.00 ? 500 VAL C HA   4  
ATOM 3283  H HB   . VAL A 1 48 ? -18.131 -21.494 0.849   1.00 0.00 ? 500 VAL C HB   4  
ATOM 3284  H HG11 . VAL A 1 48 ? -20.217 -19.499 1.735   1.00 0.00 ? 500 VAL C HG11 4  
ATOM 3285  H HG12 . VAL A 1 48 ? -18.478 -19.367 1.981   1.00 0.00 ? 500 VAL C HG12 4  
ATOM 3286  H HG13 . VAL A 1 48 ? -19.384 -20.653 2.775   1.00 0.00 ? 500 VAL C HG13 4  
ATOM 3287  H HG21 . VAL A 1 48 ? -19.957 -22.670 -0.261  1.00 0.00 ? 500 VAL C HG21 4  
ATOM 3288  H HG22 . VAL A 1 48 ? -21.111 -21.494 0.365   1.00 0.00 ? 500 VAL C HG22 4  
ATOM 3289  H HG23 . VAL A 1 48 ? -20.253 -22.563 1.474   1.00 0.00 ? 500 VAL C HG23 4  
ATOM 3290  N N    . PRO A 1 49 ? -17.117 -21.196 -1.915  1.00 0.00 ? 501 PRO C N    4  
ATOM 3291  C CA   . PRO A 1 49 ? -16.563 -22.029 -2.951  1.00 0.00 ? 501 PRO C CA   4  
ATOM 3292  C C    . PRO A 1 49 ? -16.518 -23.490 -2.533  1.00 0.00 ? 501 PRO C C    4  
ATOM 3293  O O    . PRO A 1 49 ? -16.578 -23.818 -1.342  1.00 0.00 ? 501 PRO C O    4  
ATOM 3294  C CB   . PRO A 1 49 ? -15.158 -21.475 -3.128  1.00 0.00 ? 501 PRO C CB   4  
ATOM 3295  C CG   . PRO A 1 49 ? -14.786 -20.962 -1.784  1.00 0.00 ? 501 PRO C CG   4  
ATOM 3296  C CD   . PRO A 1 49 ? -16.071 -20.573 -1.094  1.00 0.00 ? 501 PRO C CD   4  
ATOM 3297  H HA   . PRO A 1 49 ? -17.109 -21.931 -3.873  1.00 0.00 ? 501 PRO C HA   4  
ATOM 3298  H HB2  . PRO A 1 49 ? -14.495 -22.265 -3.449  1.00 0.00 ? 501 PRO C HB2  4  
ATOM 3299  H HB3  . PRO A 1 49 ? -15.169 -20.683 -3.861  1.00 0.00 ? 501 PRO C HB3  4  
ATOM 3300  H HG2  . PRO A 1 49 ? -14.286 -21.739 -1.227  1.00 0.00 ? 501 PRO C HG2  4  
ATOM 3301  H HG3  . PRO A 1 49 ? -14.142 -20.103 -1.889  1.00 0.00 ? 501 PRO C HG3  4  
ATOM 3302  H HD2  . PRO A 1 49 ? -16.093 -20.976 -0.093  1.00 0.00 ? 501 PRO C HD2  4  
ATOM 3303  H HD3  . PRO A 1 49 ? -16.182 -19.499 -1.076  1.00 0.00 ? 501 PRO C HD3  4  
ATOM 3304  N N    . PHE A 1 50 ? -16.425 -24.356 -3.505  1.00 0.00 ? 502 PHE C N    4  
ATOM 3305  C CA   . PHE A 1 50 ? -16.369 -25.775 -3.260  1.00 0.00 ? 502 PHE C CA   4  
ATOM 3306  C C    . PHE A 1 50 ? -15.116 -26.338 -3.900  1.00 0.00 ? 502 PHE C C    4  
ATOM 3307  O O    . PHE A 1 50 ? -14.567 -25.721 -4.819  1.00 0.00 ? 502 PHE C O    4  
ATOM 3308  C CB   . PHE A 1 50 ? -17.615 -26.464 -3.835  1.00 0.00 ? 502 PHE C CB   4  
ATOM 3309  C CG   . PHE A 1 50 ? -18.906 -25.920 -3.293  1.00 0.00 ? 502 PHE C CG   4  
ATOM 3310  C CD1  . PHE A 1 50 ? -19.517 -24.839 -3.898  1.00 0.00 ? 502 PHE C CD1  4  
ATOM 3311  C CD2  . PHE A 1 50 ? -19.503 -26.487 -2.185  1.00 0.00 ? 502 PHE C CD2  4  
ATOM 3312  C CE1  . PHE A 1 50 ? -20.702 -24.329 -3.407  1.00 0.00 ? 502 PHE C CE1  4  
ATOM 3313  C CE2  . PHE A 1 50 ? -20.689 -25.983 -1.688  1.00 0.00 ? 502 PHE C CE2  4  
ATOM 3314  C CZ   . PHE A 1 50 ? -21.289 -24.901 -2.300  1.00 0.00 ? 502 PHE C CZ   4  
ATOM 3315  H H    . PHE A 1 50 ? -16.382 -24.033 -4.429  1.00 0.00 ? 502 PHE C H    4  
ATOM 3316  H HA   . PHE A 1 50 ? -16.339 -25.927 -2.195  1.00 0.00 ? 502 PHE C HA   4  
ATOM 3317  H HB2  . PHE A 1 50 ? -17.626 -26.340 -4.906  1.00 0.00 ? 502 PHE C HB2  4  
ATOM 3318  H HB3  . PHE A 1 50 ? -17.573 -27.518 -3.602  1.00 0.00 ? 502 PHE C HB3  4  
ATOM 3319  H HD1  . PHE A 1 50 ? -19.049 -24.395 -4.762  1.00 0.00 ? 502 PHE C HD1  4  
ATOM 3320  H HD2  . PHE A 1 50 ? -19.035 -27.333 -1.706  1.00 0.00 ? 502 PHE C HD2  4  
ATOM 3321  H HE1  . PHE A 1 50 ? -21.168 -23.482 -3.891  1.00 0.00 ? 502 PHE C HE1  4  
ATOM 3322  H HE2  . PHE A 1 50 ? -21.145 -26.434 -0.820  1.00 0.00 ? 502 PHE C HE2  4  
ATOM 3323  H HZ   . PHE A 1 50 ? -22.217 -24.507 -1.913  1.00 0.00 ? 502 PHE C HZ   4  
ATOM 3324  N N    . PRO A 1 51 ? -14.614 -27.488 -3.416  1.00 0.00 ? 503 PRO C N    4  
ATOM 3325  C CA   . PRO A 1 51 ? -13.437 -28.127 -4.002  1.00 0.00 ? 503 PRO C CA   4  
ATOM 3326  C C    . PRO A 1 51 ? -13.656 -28.405 -5.484  1.00 0.00 ? 503 PRO C C    4  
ATOM 3327  O O    . PRO A 1 51 ? -14.604 -29.097 -5.868  1.00 0.00 ? 503 PRO C O    4  
ATOM 3328  C CB   . PRO A 1 51 ? -13.313 -29.443 -3.224  1.00 0.00 ? 503 PRO C CB   4  
ATOM 3329  C CG   . PRO A 1 51 ? -14.020 -29.189 -1.938  1.00 0.00 ? 503 PRO C CG   4  
ATOM 3330  C CD   . PRO A 1 51 ? -15.136 -28.240 -2.261  1.00 0.00 ? 503 PRO C CD   4  
ATOM 3331  H HA   . PRO A 1 51 ? -12.547 -27.528 -3.869  1.00 0.00 ? 503 PRO C HA   4  
ATOM 3332  H HB2  . PRO A 1 51 ? -13.782 -30.239 -3.784  1.00 0.00 ? 503 PRO C HB2  4  
ATOM 3333  H HB3  . PRO A 1 51 ? -12.271 -29.674 -3.062  1.00 0.00 ? 503 PRO C HB3  4  
ATOM 3334  H HG2  . PRO A 1 51 ? -14.414 -30.116 -1.547  1.00 0.00 ? 503 PRO C HG2  4  
ATOM 3335  H HG3  . PRO A 1 51 ? -13.342 -28.740 -1.228  1.00 0.00 ? 503 PRO C HG3  4  
ATOM 3336  H HD2  . PRO A 1 51 ? -16.031 -28.784 -2.528  1.00 0.00 ? 503 PRO C HD2  4  
ATOM 3337  H HD3  . PRO A 1 51 ? -15.326 -27.582 -1.427  1.00 0.00 ? 503 PRO C HD3  4  
ATOM 3338  N N    . THR A 1 52 ? -12.796 -27.861 -6.310  1.00 0.00 ? 504 THR C N    4  
ATOM 3339  C CA   . THR A 1 52 ? -12.910 -28.012 -7.740  1.00 0.00 ? 504 THR C CA   4  
ATOM 3340  C C    . THR A 1 52 ? -11.538 -27.888 -8.389  1.00 0.00 ? 504 THR C C    4  
ATOM 3341  O O    . THR A 1 52 ? -10.970 -28.932 -8.779  1.00 0.00 ? 504 THR C O    4  
ATOM 3342  C CB   . THR A 1 52 ? -13.877 -26.957 -8.339  1.00 0.00 ? 504 THR C CB   4  
ATOM 3343  O OG1  . THR A 1 52 ? -15.177 -27.088 -7.730  1.00 0.00 ? 504 THR C OG1  4  
ATOM 3344  C CG2  . THR A 1 52 ? -14.008 -27.133 -9.844  1.00 0.00 ? 504 THR C CG2  4  
ATOM 3345  O OXT  . THR A 1 52 ? -11.014 -26.758 -8.470  1.00 0.00 ? 504 THR C OXT  4  
ATOM 3346  H H    . THR A 1 52 ? -12.048 -27.336 -5.950  1.00 0.00 ? 504 THR C H    4  
ATOM 3347  H HA   . THR A 1 52 ? -13.306 -28.996 -7.943  1.00 0.00 ? 504 THR C HA   4  
ATOM 3348  H HB   . THR A 1 52 ? -13.489 -25.970 -8.130  1.00 0.00 ? 504 THR C HB   4  
ATOM 3349  H HG1  . THR A 1 52 ? -15.113 -27.725 -7.004  1.00 0.00 ? 504 THR C HG1  4  
ATOM 3350  H HG21 . THR A 1 52 ? -14.410 -28.113 -10.059 1.00 0.00 ? 504 THR C HG21 4  
ATOM 3351  H HG22 . THR A 1 52 ? -13.036 -27.035 -10.303 1.00 0.00 ? 504 THR C HG22 4  
ATOM 3352  H HG23 . THR A 1 52 ? -14.669 -26.378 -10.239 1.00 0.00 ? 504 THR C HG23 4  
ATOM 3353  N N    . SER A 1 1  ? -10.155 2.959   5.771   1.00 0.00 ? 453 SER C N    5  
ATOM 3354  C CA   . SER A 1 1  ? -11.286 2.306   5.101   1.00 0.00 ? 453 SER C CA   5  
ATOM 3355  C C    . SER A 1 1  ? -10.963 0.854   4.752   1.00 0.00 ? 453 SER C C    5  
ATOM 3356  O O    . SER A 1 1  ? -11.664 0.232   3.953   1.00 0.00 ? 453 SER C O    5  
ATOM 3357  C CB   . SER A 1 1  ? -11.641 3.077   3.835   1.00 0.00 ? 453 SER C CB   5  
ATOM 3358  O OG   . SER A 1 1  ? -11.881 4.449   4.123   1.00 0.00 ? 453 SER C OG   5  
ATOM 3359  H H1   . SER A 1 1  ? -9.315  2.935   5.162   1.00 0.00 ? 453 SER C H1   5  
ATOM 3360  H H2   . SER A 1 1  ? -9.938  2.484   6.668   1.00 0.00 ? 453 SER C H2   5  
ATOM 3361  H H3   . SER A 1 1  ? -10.394 3.951   5.970   1.00 0.00 ? 453 SER C H3   5  
ATOM 3362  H HA   . SER A 1 1  ? -12.133 2.321   5.770   1.00 0.00 ? 453 SER C HA   5  
ATOM 3363  H HB2  . SER A 1 1  ? -10.826 3.007   3.132   1.00 0.00 ? 453 SER C HB2  5  
ATOM 3364  H HB3  . SER A 1 1  ? -12.531 2.652   3.396   1.00 0.00 ? 453 SER C HB3  5  
ATOM 3365  H HG   . SER A 1 1  ? -12.780 4.672   3.848   1.00 0.00 ? 453 SER C HG   5  
ATOM 3366  N N    . ASN A 1 2  ? -9.916  0.308   5.358   1.00 0.00 ? 454 ASN C N    5  
ATOM 3367  C CA   . ASN A 1 2  ? -9.515  -1.062  5.074   1.00 0.00 ? 454 ASN C CA   5  
ATOM 3368  C C    . ASN A 1 2  ? -9.109  -1.793  6.346   1.00 0.00 ? 454 ASN C C    5  
ATOM 3369  O O    . ASN A 1 2  ? -9.558  -2.907  6.593   1.00 0.00 ? 454 ASN C O    5  
ATOM 3370  C CB   . ASN A 1 2  ? -8.359  -1.082  4.067   1.00 0.00 ? 454 ASN C CB   5  
ATOM 3371  C CG   . ASN A 1 2  ? -7.929  -2.491  3.686   1.00 0.00 ? 454 ASN C CG   5  
ATOM 3372  O OD1  . ASN A 1 2  ? -8.737  -3.423  3.673   1.00 0.00 ? 454 ASN C OD1  5  
ATOM 3373  N ND2  . ASN A 1 2  ? -6.661  -2.653  3.376   1.00 0.00 ? 454 ASN C ND2  5  
ATOM 3374  H H    . ASN A 1 2  ? -9.400  0.830   6.009   1.00 0.00 ? 454 ASN C H    5  
ATOM 3375  H HA   . ASN A 1 2  ? -10.362 -1.568  4.638   1.00 0.00 ? 454 ASN C HA   5  
ATOM 3376  H HB2  . ASN A 1 2  ? -8.666  -0.568  3.169   1.00 0.00 ? 454 ASN C HB2  5  
ATOM 3377  H HB3  . ASN A 1 2  ? -7.510  -0.569  4.496   1.00 0.00 ? 454 ASN C HB3  5  
ATOM 3378  H HD21 . ASN A 1 2  ? -6.070  -1.870  3.408   1.00 0.00 ? 454 ASN C HD21 5  
ATOM 3379  H HD22 . ASN A 1 2  ? -6.357  -3.548  3.108   1.00 0.00 ? 454 ASN C HD22 5  
ATOM 3380  N N    . SER A 1 3  ? -8.272  -1.149  7.156   1.00 0.00 ? 455 SER C N    5  
ATOM 3381  C CA   . SER A 1 3  ? -7.763  -1.745  8.392   1.00 0.00 ? 455 SER C CA   5  
ATOM 3382  C C    . SER A 1 3  ? -8.895  -2.278  9.280   1.00 0.00 ? 455 SER C C    5  
ATOM 3383  O O    . SER A 1 3  ? -8.837  -3.419  9.748   1.00 0.00 ? 455 SER C O    5  
ATOM 3384  C CB   . SER A 1 3  ? -6.921  -0.725  9.159   1.00 0.00 ? 455 SER C CB   5  
ATOM 3385  O OG   . SER A 1 3  ? -5.877  -0.213  8.343   1.00 0.00 ? 455 SER C OG   5  
ATOM 3386  H H    . SER A 1 3  ? -7.974  -0.245  6.919   1.00 0.00 ? 455 SER C H    5  
ATOM 3387  H HA   . SER A 1 3  ? -7.129  -2.573  8.113   1.00 0.00 ? 455 SER C HA   5  
ATOM 3388  H HB2  . SER A 1 3  ? -7.550  0.094   9.476   1.00 0.00 ? 455 SER C HB2  5  
ATOM 3389  H HB3  . SER A 1 3  ? -6.486  -1.201  10.026  1.00 0.00 ? 455 SER C HB3  5  
ATOM 3390  H HG   . SER A 1 3  ? -5.156  -0.858  8.308   1.00 0.00 ? 455 SER C HG   5  
ATOM 3391  N N    . GLN A 1 4  ? -9.922  -1.464  9.494   1.00 0.00 ? 456 GLN C N    5  
ATOM 3392  C CA   . GLN A 1 4  ? -11.046 -1.869  10.329  1.00 0.00 ? 456 GLN C CA   5  
ATOM 3393  C C    . GLN A 1 4  ? -11.824 -3.012  9.693   1.00 0.00 ? 456 GLN C C    5  
ATOM 3394  O O    . GLN A 1 4  ? -12.146 -3.994  10.356  1.00 0.00 ? 456 GLN C O    5  
ATOM 3395  C CB   . GLN A 1 4  ? -11.975 -0.691  10.609  1.00 0.00 ? 456 GLN C CB   5  
ATOM 3396  C CG   . GLN A 1 4  ? -11.351 0.388   11.474  1.00 0.00 ? 456 GLN C CG   5  
ATOM 3397  C CD   . GLN A 1 4  ? -10.915 -0.137  12.827  1.00 0.00 ? 456 GLN C CD   5  
ATOM 3398  O OE1  . GLN A 1 4  ? -11.501 -1.080  13.363  1.00 0.00 ? 456 GLN C OE1  5  
ATOM 3399  N NE2  . GLN A 1 4  ? -9.882  0.462   13.386  1.00 0.00 ? 456 GLN C NE2  5  
ATOM 3400  H H    . GLN A 1 4  ? -9.924  -0.571  9.085   1.00 0.00 ? 456 GLN C H    5  
ATOM 3401  H HA   . GLN A 1 4  ? -10.640 -2.216  11.267  1.00 0.00 ? 456 GLN C HA   5  
ATOM 3402  H HB2  . GLN A 1 4  ? -12.263 -0.246  9.669   1.00 0.00 ? 456 GLN C HB2  5  
ATOM 3403  H HB3  . GLN A 1 4  ? -12.859 -1.057  11.108  1.00 0.00 ? 456 GLN C HB3  5  
ATOM 3404  H HG2  . GLN A 1 4  ? -10.487 0.788   10.965  1.00 0.00 ? 456 GLN C HG2  5  
ATOM 3405  H HG3  . GLN A 1 4  ? -12.076 1.173   11.625  1.00 0.00 ? 456 GLN C HG3  5  
ATOM 3406  H HE21 . GLN A 1 4  ? -9.458  1.204   12.899  1.00 0.00 ? 456 GLN C HE21 5  
ATOM 3407  H HE22 . GLN A 1 4  ? -9.583  0.148   14.264  1.00 0.00 ? 456 GLN C HE22 5  
ATOM 3408  N N    . LEU A 1 5  ? -12.106 -2.888  8.400   1.00 0.00 ? 457 LEU C N    5  
ATOM 3409  C CA   . LEU A 1 5  ? -12.857 -3.911  7.679   1.00 0.00 ? 457 LEU C CA   5  
ATOM 3410  C C    . LEU A 1 5  ? -12.119 -5.236  7.701   1.00 0.00 ? 457 LEU C C    5  
ATOM 3411  O O    . LEU A 1 5  ? -12.714 -6.289  7.939   1.00 0.00 ? 457 LEU C O    5  
ATOM 3412  C CB   . LEU A 1 5  ? -13.107 -3.488  6.232   1.00 0.00 ? 457 LEU C CB   5  
ATOM 3413  C CG   . LEU A 1 5  ? -13.840 -2.162  6.035   1.00 0.00 ? 457 LEU C CG   5  
ATOM 3414  C CD1  . LEU A 1 5  ? -14.175 -1.960  4.580   1.00 0.00 ? 457 LEU C CD1  5  
ATOM 3415  C CD2  . LEU A 1 5  ? -15.097 -2.106  6.883   1.00 0.00 ? 457 LEU C CD2  5  
ATOM 3416  H H    . LEU A 1 5  ? -11.800 -2.091  7.918   1.00 0.00 ? 457 LEU C H    5  
ATOM 3417  H HA   . LEU A 1 5  ? -13.807 -4.033  8.175   1.00 0.00 ? 457 LEU C HA   5  
ATOM 3418  H HB2  . LEU A 1 5  ? -12.151 -3.419  5.734   1.00 0.00 ? 457 LEU C HB2  5  
ATOM 3419  H HB3  . LEU A 1 5  ? -13.685 -4.265  5.752   1.00 0.00 ? 457 LEU C HB3  5  
ATOM 3420  H HG   . LEU A 1 5  ? -13.191 -1.355  6.340   1.00 0.00 ? 457 LEU C HG   5  
ATOM 3421  H HD11 . LEU A 1 5  ? -14.780 -2.786  4.235   1.00 0.00 ? 457 LEU C HD11 5  
ATOM 3422  H HD12 . LEU A 1 5  ? -13.264 -1.909  4.002   1.00 0.00 ? 457 LEU C HD12 5  
ATOM 3423  H HD13 . LEU A 1 5  ? -14.728 -1.041  4.469   1.00 0.00 ? 457 LEU C HD13 5  
ATOM 3424  H HD21 . LEU A 1 5  ? -14.819 -2.142  7.925   1.00 0.00 ? 457 LEU C HD21 5  
ATOM 3425  H HD22 . LEU A 1 5  ? -15.729 -2.950  6.647   1.00 0.00 ? 457 LEU C HD22 5  
ATOM 3426  H HD23 . LEU A 1 5  ? -15.630 -1.188  6.682   1.00 0.00 ? 457 LEU C HD23 5  
ATOM 3427  N N    . ASN A 1 6  ? -10.818 -5.175  7.464   1.00 0.00 ? 458 ASN C N    5  
ATOM 3428  C CA   . ASN A 1 6  ? -9.980  -6.360  7.456   1.00 0.00 ? 458 ASN C CA   5  
ATOM 3429  C C    . ASN A 1 6  ? -9.988  -7.037  8.816   1.00 0.00 ? 458 ASN C C    5  
ATOM 3430  O O    . ASN A 1 6  ? -10.079 -8.255  8.909   1.00 0.00 ? 458 ASN C O    5  
ATOM 3431  C CB   . ASN A 1 6  ? -8.549  -6.007  7.047   1.00 0.00 ? 458 ASN C CB   5  
ATOM 3432  C CG   . ASN A 1 6  ? -7.637  -7.219  7.010   1.00 0.00 ? 458 ASN C CG   5  
ATOM 3433  O OD1  . ASN A 1 6  ? -7.019  -7.576  8.012   1.00 0.00 ? 458 ASN C OD1  5  
ATOM 3434  N ND2  . ASN A 1 6  ? -7.531  -7.847  5.854   1.00 0.00 ? 458 ASN C ND2  5  
ATOM 3435  H H    . ASN A 1 6  ? -10.406 -4.300  7.279   1.00 0.00 ? 458 ASN C H    5  
ATOM 3436  H HA   . ASN A 1 6  ? -10.390 -7.044  6.731   1.00 0.00 ? 458 ASN C HA   5  
ATOM 3437  H HB2  . ASN A 1 6  ? -8.561  -5.561  6.064   1.00 0.00 ? 458 ASN C HB2  5  
ATOM 3438  H HB3  . ASN A 1 6  ? -8.145  -5.297  7.755   1.00 0.00 ? 458 ASN C HB3  5  
ATOM 3439  H HD21 . ASN A 1 6  ? -8.038  -7.501  5.085   1.00 0.00 ? 458 ASN C HD21 5  
ATOM 3440  H HD22 . ASN A 1 6  ? -6.949  -8.637  5.809   1.00 0.00 ? 458 ASN C HD22 5  
ATOM 3441  N N    . ALA A 1 7  ? -9.912  -6.235  9.868   1.00 0.00 ? 459 ALA C N    5  
ATOM 3442  C CA   . ALA A 1 7  ? -9.913  -6.756  11.226  1.00 0.00 ? 459 ALA C CA   5  
ATOM 3443  C C    . ALA A 1 7  ? -11.260 -7.395  11.560  1.00 0.00 ? 459 ALA C C    5  
ATOM 3444  O O    . ALA A 1 7  ? -11.315 -8.457  12.191  1.00 0.00 ? 459 ALA C O    5  
ATOM 3445  C CB   . ALA A 1 7  ? -9.586  -5.648  12.217  1.00 0.00 ? 459 ALA C CB   5  
ATOM 3446  H H    . ALA A 1 7  ? -9.853  -5.266  9.727   1.00 0.00 ? 459 ALA C H    5  
ATOM 3447  H HA   . ALA A 1 7  ? -9.141  -7.513  11.288  1.00 0.00 ? 459 ALA C HA   5  
ATOM 3448  H HB1  . ALA A 1 7  ? -9.538  -6.061  13.213  1.00 0.00 ? 459 ALA C HB1  5  
ATOM 3449  H HB2  . ALA A 1 7  ? -10.353 -4.890  12.178  1.00 0.00 ? 459 ALA C HB2  5  
ATOM 3450  H HB3  . ALA A 1 7  ? -8.633  -5.208  11.964  1.00 0.00 ? 459 ALA C HB3  5  
ATOM 3451  N N    . MET A 1 8  ? -12.345 -6.745  11.129  1.00 0.00 ? 460 MET C N    5  
ATOM 3452  C CA   . MET A 1 8  ? -13.687 -7.265  11.355  1.00 0.00 ? 460 MET C CA   5  
ATOM 3453  C C    . MET A 1 8  ? -13.876 -8.589  10.637  1.00 0.00 ? 460 MET C C    5  
ATOM 3454  O O    . MET A 1 8  ? -14.316 -9.577  11.232  1.00 0.00 ? 460 MET C O    5  
ATOM 3455  C CB   . MET A 1 8  ? -14.747 -6.270  10.881  1.00 0.00 ? 460 MET C CB   5  
ATOM 3456  C CG   . MET A 1 8  ? -14.784 -4.969  11.665  1.00 0.00 ? 460 MET C CG   5  
ATOM 3457  S SD   . MET A 1 8  ? -16.377 -4.133  11.539  1.00 0.00 ? 460 MET C SD   5  
ATOM 3458  C CE   . MET A 1 8  ? -16.478 -3.858  9.778   1.00 0.00 ? 460 MET C CE   5  
ATOM 3459  H H    . MET A 1 8  ? -12.240 -5.891  10.654  1.00 0.00 ? 460 MET C H    5  
ATOM 3460  H HA   . MET A 1 8  ? -13.807 -7.423  12.416  1.00 0.00 ? 460 MET C HA   5  
ATOM 3461  H HB2  . MET A 1 8  ? -14.558 -6.038  9.843   1.00 0.00 ? 460 MET C HB2  5  
ATOM 3462  H HB3  . MET A 1 8  ? -15.714 -6.738  10.952  1.00 0.00 ? 460 MET C HB3  5  
ATOM 3463  H HG2  . MET A 1 8  ? -14.584 -5.180  12.704  1.00 0.00 ? 460 MET C HG2  5  
ATOM 3464  H HG3  . MET A 1 8  ? -14.021 -4.311  11.274  1.00 0.00 ? 460 MET C HG3  5  
ATOM 3465  H HE1  . MET A 1 8  ? -16.259 -4.779  9.252   1.00 0.00 ? 460 MET C HE1  5  
ATOM 3466  H HE2  . MET A 1 8  ? -15.767 -3.101  9.492   1.00 0.00 ? 460 MET C HE2  5  
ATOM 3467  H HE3  . MET A 1 8  ? -17.476 -3.534  9.526   1.00 0.00 ? 460 MET C HE3  5  
ATOM 3468  N N    . ALA A 1 9  ? -13.530 -8.609  9.356   1.00 0.00 ? 461 ALA C N    5  
ATOM 3469  C CA   . ALA A 1 9  ? -13.639 -9.813  8.549   1.00 0.00 ? 461 ALA C CA   5  
ATOM 3470  C C    . ALA A 1 9  ? -12.752 -10.909 9.112   1.00 0.00 ? 461 ALA C C    5  
ATOM 3471  O O    . ALA A 1 9  ? -13.090 -12.089 9.049   1.00 0.00 ? 461 ALA C O    5  
ATOM 3472  C CB   . ALA A 1 9  ? -13.258 -9.517  7.111   1.00 0.00 ? 461 ALA C CB   5  
ATOM 3473  H H    . ALA A 1 9  ? -13.194 -7.784  8.936   1.00 0.00 ? 461 ALA C H    5  
ATOM 3474  H HA   . ALA A 1 9  ? -14.667 -10.142 8.571   1.00 0.00 ? 461 ALA C HA   5  
ATOM 3475  H HB1  . ALA A 1 9  ? -13.382 -10.410 6.516   1.00 0.00 ? 461 ALA C HB1  5  
ATOM 3476  H HB2  . ALA A 1 9  ? -12.226 -9.200  7.072   1.00 0.00 ? 461 ALA C HB2  5  
ATOM 3477  H HB3  . ALA A 1 9  ? -13.892 -8.733  6.724   1.00 0.00 ? 461 ALA C HB3  5  
ATOM 3478  N N    . HIS A 1 10 ? -11.623 -10.499 9.677   1.00 0.00 ? 462 HIS C N    5  
ATOM 3479  C CA   . HIS A 1 10 ? -10.673 -11.421 10.272  1.00 0.00 ? 462 HIS C CA   5  
ATOM 3480  C C    . HIS A 1 10 ? -11.346 -12.242 11.358  1.00 0.00 ? 462 HIS C C    5  
ATOM 3481  O O    . HIS A 1 10 ? -11.139 -13.442 11.445  1.00 0.00 ? 462 HIS C O    5  
ATOM 3482  C CB   . HIS A 1 10 ? -9.488  -10.654 10.864  1.00 0.00 ? 462 HIS C CB   5  
ATOM 3483  C CG   . HIS A 1 10 ? -8.224  -11.450 10.933  1.00 0.00 ? 462 HIS C CG   5  
ATOM 3484  N ND1  . HIS A 1 10 ? -7.980  -12.413 11.887  1.00 0.00 ? 462 HIS C ND1  5  
ATOM 3485  C CD2  . HIS A 1 10 ? -7.128  -11.417 10.148  1.00 0.00 ? 462 HIS C CD2  5  
ATOM 3486  C CE1  . HIS A 1 10 ? -6.788  -12.937 11.682  1.00 0.00 ? 462 HIS C CE1  5  
ATOM 3487  N NE2  . HIS A 1 10 ? -6.250  -12.352 10.633  1.00 0.00 ? 462 HIS C NE2  5  
ATOM 3488  H H    . HIS A 1 10 ? -11.418 -9.539  9.681   1.00 0.00 ? 462 HIS C H    5  
ATOM 3489  H HA   . HIS A 1 10 ? -10.312 -12.084 9.505   1.00 0.00 ? 462 HIS C HA   5  
ATOM 3490  H HB2  . HIS A 1 10 ? -9.294  -9.783  10.257  1.00 0.00 ? 462 HIS C HB2  5  
ATOM 3491  H HB3  . HIS A 1 10 ? -9.739  -10.338 11.865  1.00 0.00 ? 462 HIS C HB3  5  
ATOM 3492  H HD1  . HIS A 1 10 ? -8.578  -12.668 12.624  1.00 0.00 ? 462 HIS C HD1  5  
ATOM 3493  H HD2  . HIS A 1 10 ? -6.972  -10.758 9.306   1.00 0.00 ? 462 HIS C HD2  5  
ATOM 3494  H HE1  . HIS A 1 10 ? -6.330  -13.717 12.274  1.00 0.00 ? 462 HIS C HE1  5  
ATOM 3495  H HE2  . HIS A 1 10 ? -5.298  -12.402 10.399  1.00 0.00 ? 462 HIS C HE2  5  
ATOM 3496  N N    . GLN A 1 11 ? -12.172 -11.585 12.171  1.00 0.00 ? 463 GLN C N    5  
ATOM 3497  C CA   . GLN A 1 11 ? -12.865 -12.259 13.271  1.00 0.00 ? 463 GLN C CA   5  
ATOM 3498  C C    . GLN A 1 11 ? -13.836 -13.293 12.733  1.00 0.00 ? 463 GLN C C    5  
ATOM 3499  O O    . GLN A 1 11 ? -13.892 -14.418 13.225  1.00 0.00 ? 463 GLN C O    5  
ATOM 3500  C CB   . GLN A 1 11 ? -13.615 -11.250 14.150  1.00 0.00 ? 463 GLN C CB   5  
ATOM 3501  C CG   . GLN A 1 11 ? -12.756 -10.106 14.674  1.00 0.00 ? 463 GLN C CG   5  
ATOM 3502  C CD   . GLN A 1 11 ? -11.468 -10.584 15.312  1.00 0.00 ? 463 GLN C CD   5  
ATOM 3503  O OE1  . GLN A 1 11 ? -11.423 -10.886 16.503  1.00 0.00 ? 463 GLN C OE1  5  
ATOM 3504  N NE2  . GLN A 1 11 ? -10.410 -10.623 14.530  1.00 0.00 ? 463 GLN C NE2  5  
ATOM 3505  H H    . GLN A 1 11 ? -12.329 -10.627 12.021  1.00 0.00 ? 463 GLN C H    5  
ATOM 3506  H HA   . GLN A 1 11 ? -12.124 -12.770 13.872  1.00 0.00 ? 463 GLN C HA   5  
ATOM 3507  H HB2  . GLN A 1 11 ? -14.422 -10.824 13.573  1.00 0.00 ? 463 GLN C HB2  5  
ATOM 3508  H HB3  . GLN A 1 11 ? -14.033 -11.774 14.996  1.00 0.00 ? 463 GLN C HB3  5  
ATOM 3509  H HG2  . GLN A 1 11 ? -12.508 -9.451  13.852  1.00 0.00 ? 463 GLN C HG2  5  
ATOM 3510  H HG3  . GLN A 1 11 ? -13.322 -9.555  15.410  1.00 0.00 ? 463 GLN C HG3  5  
ATOM 3511  H HE21 . GLN A 1 11 ? -10.516 -10.337 13.599  1.00 0.00 ? 463 GLN C HE21 5  
ATOM 3512  H HE22 . GLN A 1 11 ? -9.561  -10.947 14.903  1.00 0.00 ? 463 GLN C HE22 5  
ATOM 3513  N N    . ILE A 1 12 ? -14.593 -12.909 11.715  1.00 0.00 ? 464 ILE C N    5  
ATOM 3514  C CA   . ILE A 1 12 ? -15.540 -13.820 11.094  1.00 0.00 ? 464 ILE C CA   5  
ATOM 3515  C C    . ILE A 1 12 ? -14.805 -15.009 10.493  1.00 0.00 ? 464 ILE C C    5  
ATOM 3516  O O    . ILE A 1 12 ? -15.215 -16.150 10.662  1.00 0.00 ? 464 ILE C O    5  
ATOM 3517  C CB   . ILE A 1 12 ? -16.360 -13.129 9.985   1.00 0.00 ? 464 ILE C CB   5  
ATOM 3518  C CG1  . ILE A 1 12 ? -17.090 -11.897 10.534  1.00 0.00 ? 464 ILE C CG1  5  
ATOM 3519  C CG2  . ILE A 1 12 ? -17.361 -14.112 9.374   1.00 0.00 ? 464 ILE C CG2  5  
ATOM 3520  C CD1  . ILE A 1 12 ? -17.753 -11.077 9.455   1.00 0.00 ? 464 ILE C CD1  5  
ATOM 3521  H H    . ILE A 1 12 ? -14.514 -11.993 11.375  1.00 0.00 ? 464 ILE C H    5  
ATOM 3522  H HA   . ILE A 1 12 ? -16.218 -14.176 11.857  1.00 0.00 ? 464 ILE C HA   5  
ATOM 3523  H HB   . ILE A 1 12 ? -15.678 -12.816 9.207   1.00 0.00 ? 464 ILE C HB   5  
ATOM 3524  H HG12 . ILE A 1 12 ? -17.859 -12.220 11.221  1.00 0.00 ? 464 ILE C HG12 5  
ATOM 3525  H HG13 . ILE A 1 12 ? -16.397 -11.261 11.061  1.00 0.00 ? 464 ILE C HG13 5  
ATOM 3526  H HG21 . ILE A 1 12 ? -17.921 -13.616 8.594   1.00 0.00 ? 464 ILE C HG21 5  
ATOM 3527  H HG22 . ILE A 1 12 ? -18.038 -14.457 10.140  1.00 0.00 ? 464 ILE C HG22 5  
ATOM 3528  H HG23 . ILE A 1 12 ? -16.832 -14.958 8.957   1.00 0.00 ? 464 ILE C HG23 5  
ATOM 3529  H HD11 . ILE A 1 12 ? -17.014 -10.767 8.733   1.00 0.00 ? 464 ILE C HD11 5  
ATOM 3530  H HD12 . ILE A 1 12 ? -18.211 -10.204 9.894   1.00 0.00 ? 464 ILE C HD12 5  
ATOM 3531  H HD13 . ILE A 1 12 ? -18.508 -11.672 8.963   1.00 0.00 ? 464 ILE C HD13 5  
ATOM 3532  N N    . GLN A 1 13 ? -13.699 -14.726 9.815   1.00 0.00 ? 465 GLN C N    5  
ATOM 3533  C CA   . GLN A 1 13 ? -12.890 -15.759 9.178   1.00 0.00 ? 465 GLN C CA   5  
ATOM 3534  C C    . GLN A 1 13 ? -12.338 -16.735 10.215  1.00 0.00 ? 465 GLN C C    5  
ATOM 3535  O O    . GLN A 1 13 ? -12.140 -17.917 9.930   1.00 0.00 ? 465 GLN C O    5  
ATOM 3536  C CB   . GLN A 1 13 ? -11.738 -15.127 8.409   1.00 0.00 ? 465 GLN C CB   5  
ATOM 3537  C CG   . GLN A 1 13 ? -11.065 -16.077 7.436   1.00 0.00 ? 465 GLN C CG   5  
ATOM 3538  C CD   . GLN A 1 13 ? -11.988 -16.470 6.301   1.00 0.00 ? 465 GLN C CD   5  
ATOM 3539  O OE1  . GLN A 1 13 ? -12.847 -15.697 5.886   1.00 0.00 ? 465 GLN C OE1  5  
ATOM 3540  N NE2  . GLN A 1 13 ? -11.823 -17.669 5.796   1.00 0.00 ? 465 GLN C NE2  5  
ATOM 3541  H H    . GLN A 1 13 ? -13.422 -13.786 9.728   1.00 0.00 ? 465 GLN C H    5  
ATOM 3542  H HA   . GLN A 1 13 ? -13.520 -16.300 8.486   1.00 0.00 ? 465 GLN C HA   5  
ATOM 3543  H HB2  . GLN A 1 13 ? -12.111 -14.279 7.854   1.00 0.00 ? 465 GLN C HB2  5  
ATOM 3544  H HB3  . GLN A 1 13 ? -10.998 -14.786 9.119   1.00 0.00 ? 465 GLN C HB3  5  
ATOM 3545  H HG2  . GLN A 1 13 ? -10.189 -15.601 7.026   1.00 0.00 ? 465 GLN C HG2  5  
ATOM 3546  H HG3  . GLN A 1 13 ? -10.774 -16.970 7.969   1.00 0.00 ? 465 GLN C HG3  5  
ATOM 3547  H HE21 . GLN A 1 13 ? -11.122 -18.242 6.170   1.00 0.00 ? 465 GLN C HE21 5  
ATOM 3548  H HE22 . GLN A 1 13 ? -12.420 -17.942 5.065   1.00 0.00 ? 465 GLN C HE22 5  
ATOM 3549  N N    . GLU A 1 14 ? -12.080 -16.229 11.412  1.00 0.00 ? 466 GLU C N    5  
ATOM 3550  C CA   . GLU A 1 14 ? -11.584 -17.049 12.504  1.00 0.00 ? 466 GLU C CA   5  
ATOM 3551  C C    . GLU A 1 14 ? -12.660 -18.024 12.965  1.00 0.00 ? 466 GLU C C    5  
ATOM 3552  O O    . GLU A 1 14 ? -12.365 -19.123 13.430  1.00 0.00 ? 466 GLU C O    5  
ATOM 3553  C CB   . GLU A 1 14 ? -11.141 -16.166 13.671  1.00 0.00 ? 466 GLU C CB   5  
ATOM 3554  C CG   . GLU A 1 14 ? -9.919  -15.319 13.373  1.00 0.00 ? 466 GLU C CG   5  
ATOM 3555  C CD   . GLU A 1 14 ? -8.723  -16.143 12.967  1.00 0.00 ? 466 GLU C CD   5  
ATOM 3556  O OE1  . GLU A 1 14 ? -7.992  -16.620 13.858  1.00 0.00 ? 466 GLU C OE1  5  
ATOM 3557  O OE2  . GLU A 1 14 ? -8.500  -16.314 11.750  1.00 0.00 ? 466 GLU C OE2  5  
ATOM 3558  H H    . GLU A 1 14 ? -12.219 -15.271 11.569  1.00 0.00 ? 466 GLU C H    5  
ATOM 3559  H HA   . GLU A 1 14 ? -10.735 -17.608 12.144  1.00 0.00 ? 466 GLU C HA   5  
ATOM 3560  H HB2  . GLU A 1 14 ? -11.953 -15.500 13.923  1.00 0.00 ? 466 GLU C HB2  5  
ATOM 3561  H HB3  . GLU A 1 14 ? -10.927 -16.784 14.524  1.00 0.00 ? 466 GLU C HB3  5  
ATOM 3562  H HG2  . GLU A 1 14 ? -10.156 -14.641 12.566  1.00 0.00 ? 466 GLU C HG2  5  
ATOM 3563  H HG3  . GLU A 1 14 ? -9.666  -14.752 14.258  1.00 0.00 ? 466 GLU C HG3  5  
ATOM 3564  N N    . MET A 1 15 ? -13.907 -17.614 12.827  1.00 0.00 ? 467 MET C N    5  
ATOM 3565  C CA   . MET A 1 15 ? -15.025 -18.437 13.220  1.00 0.00 ? 467 MET C CA   5  
ATOM 3566  C C    . MET A 1 15 ? -15.477 -19.328 12.072  1.00 0.00 ? 467 MET C C    5  
ATOM 3567  O O    . MET A 1 15 ? -15.818 -20.492 12.278  1.00 0.00 ? 467 MET C O    5  
ATOM 3568  C CB   . MET A 1 15 ? -16.188 -17.565 13.688  1.00 0.00 ? 467 MET C CB   5  
ATOM 3569  C CG   . MET A 1 15 ? -15.874 -16.719 14.909  1.00 0.00 ? 467 MET C CG   5  
ATOM 3570  S SD   . MET A 1 15 ? -17.292 -15.756 15.475  1.00 0.00 ? 467 MET C SD   5  
ATOM 3571  C CE   . MET A 1 15 ? -17.558 -14.682 14.067  1.00 0.00 ? 467 MET C CE   5  
ATOM 3572  H H    . MET A 1 15 ? -14.078 -16.725 12.448  1.00 0.00 ? 467 MET C H    5  
ATOM 3573  H HA   . MET A 1 15 ? -14.709 -19.062 14.042  1.00 0.00 ? 467 MET C HA   5  
ATOM 3574  H HB2  . MET A 1 15 ? -16.467 -16.904 12.883  1.00 0.00 ? 467 MET C HB2  5  
ATOM 3575  H HB3  . MET A 1 15 ? -17.026 -18.204 13.922  1.00 0.00 ? 467 MET C HB3  5  
ATOM 3576  H HG2  . MET A 1 15 ? -15.554 -17.369 15.709  1.00 0.00 ? 467 MET C HG2  5  
ATOM 3577  H HG3  . MET A 1 15 ? -15.074 -16.040 14.656  1.00 0.00 ? 467 MET C HG3  5  
ATOM 3578  H HE1  . MET A 1 15 ? -18.386 -14.022 14.273  1.00 0.00 ? 467 MET C HE1  5  
ATOM 3579  H HE2  . MET A 1 15 ? -17.780 -15.277 13.193  1.00 0.00 ? 467 MET C HE2  5  
ATOM 3580  H HE3  . MET A 1 15 ? -16.667 -14.097 13.889  1.00 0.00 ? 467 MET C HE3  5  
ATOM 3581  N N    . PHE A 1 16 ? -15.464 -18.785 10.866  1.00 0.00 ? 468 PHE C N    5  
ATOM 3582  C CA   . PHE A 1 16 ? -15.917 -19.509 9.690   1.00 0.00 ? 468 PHE C CA   5  
ATOM 3583  C C    . PHE A 1 16 ? -14.844 -19.568 8.603   1.00 0.00 ? 468 PHE C C    5  
ATOM 3584  O O    . PHE A 1 16 ? -14.844 -18.759 7.682   1.00 0.00 ? 468 PHE C O    5  
ATOM 3585  C CB   . PHE A 1 16 ? -17.192 -18.873 9.132   1.00 0.00 ? 468 PHE C CB   5  
ATOM 3586  C CG   . PHE A 1 16 ? -18.402 -19.109 9.979   1.00 0.00 ? 468 PHE C CG   5  
ATOM 3587  C CD1  . PHE A 1 16 ? -18.682 -18.286 11.051  1.00 0.00 ? 468 PHE C CD1  5  
ATOM 3588  C CD2  . PHE A 1 16 ? -19.256 -20.162 9.706   1.00 0.00 ? 468 PHE C CD2  5  
ATOM 3589  C CE1  . PHE A 1 16 ? -19.792 -18.505 11.837  1.00 0.00 ? 468 PHE C CE1  5  
ATOM 3590  C CE2  . PHE A 1 16 ? -20.369 -20.386 10.487  1.00 0.00 ? 468 PHE C CE2  5  
ATOM 3591  C CZ   . PHE A 1 16 ? -20.638 -19.555 11.555  1.00 0.00 ? 468 PHE C CZ   5  
ATOM 3592  H H    . PHE A 1 16 ? -15.145 -17.861 10.756  1.00 0.00 ? 468 PHE C H    5  
ATOM 3593  H HA   . PHE A 1 16 ? -16.149 -20.516 10.000  1.00 0.00 ? 468 PHE C HA   5  
ATOM 3594  H HB2  . PHE A 1 16 ? -17.045 -17.805 9.063   1.00 0.00 ? 468 PHE C HB2  5  
ATOM 3595  H HB3  . PHE A 1 16 ? -17.385 -19.263 8.145   1.00 0.00 ? 468 PHE C HB3  5  
ATOM 3596  H HD1  . PHE A 1 16 ? -18.020 -17.462 11.273  1.00 0.00 ? 468 PHE C HD1  5  
ATOM 3597  H HD2  . PHE A 1 16 ? -19.047 -20.810 8.868   1.00 0.00 ? 468 PHE C HD2  5  
ATOM 3598  H HE1  . PHE A 1 16 ? -19.996 -17.850 12.670  1.00 0.00 ? 468 PHE C HE1  5  
ATOM 3599  H HE2  . PHE A 1 16 ? -21.029 -21.209 10.263  1.00 0.00 ? 468 PHE C HE2  5  
ATOM 3600  H HZ   . PHE A 1 16 ? -21.509 -19.728 12.169  1.00 0.00 ? 468 PHE C HZ   5  
ATOM 3601  N N    . PRO A 1 17 ? -13.914 -20.531 8.702   1.00 0.00 ? 469 PRO C N    5  
ATOM 3602  C CA   . PRO A 1 17 ? -12.868 -20.728 7.695   1.00 0.00 ? 469 PRO C CA   5  
ATOM 3603  C C    . PRO A 1 17 ? -13.425 -21.375 6.424   1.00 0.00 ? 469 PRO C C    5  
ATOM 3604  O O    . PRO A 1 17 ? -12.702 -21.599 5.451   1.00 0.00 ? 469 PRO C O    5  
ATOM 3605  C CB   . PRO A 1 17 ? -11.894 -21.679 8.388   1.00 0.00 ? 469 PRO C CB   5  
ATOM 3606  C CG   . PRO A 1 17 ? -12.748 -22.449 9.323   1.00 0.00 ? 469 PRO C CG   5  
ATOM 3607  C CD   . PRO A 1 17 ? -13.781 -21.482 9.817   1.00 0.00 ? 469 PRO C CD   5  
ATOM 3608  H HA   . PRO A 1 17 ? -12.372 -19.803 7.460   1.00 0.00 ? 469 PRO C HA   5  
ATOM 3609  H HB2  . PRO A 1 17 ? -11.428 -22.321 7.654   1.00 0.00 ? 469 PRO C HB2  5  
ATOM 3610  H HB3  . PRO A 1 17 ? -11.142 -21.114 8.916   1.00 0.00 ? 469 PRO C HB3  5  
ATOM 3611  H HG2  . PRO A 1 17 ? -13.221 -23.263 8.795   1.00 0.00 ? 469 PRO C HG2  5  
ATOM 3612  H HG3  . PRO A 1 17 ? -12.157 -22.820 10.143  1.00 0.00 ? 469 PRO C HG3  5  
ATOM 3613  H HD2  . PRO A 1 17 ? -14.713 -21.984 10.019  1.00 0.00 ? 469 PRO C HD2  5  
ATOM 3614  H HD3  . PRO A 1 17 ? -13.421 -20.974 10.700  1.00 0.00 ? 469 PRO C HD3  5  
ATOM 3615  N N    . GLN A 1 18 ? -14.711 -21.702 6.462   1.00 0.00 ? 470 GLN C N    5  
ATOM 3616  C CA   . GLN A 1 18 ? -15.389 -22.334 5.338   1.00 0.00 ? 470 GLN C CA   5  
ATOM 3617  C C    . GLN A 1 18 ? -15.637 -21.358 4.185   1.00 0.00 ? 470 GLN C C    5  
ATOM 3618  O O    . GLN A 1 18 ? -15.926 -21.778 3.064   1.00 0.00 ? 470 GLN C O    5  
ATOM 3619  C CB   . GLN A 1 18 ? -16.715 -22.959 5.788   1.00 0.00 ? 470 GLN C CB   5  
ATOM 3620  C CG   . GLN A 1 18 ? -17.667 -21.989 6.471   1.00 0.00 ? 470 GLN C CG   5  
ATOM 3621  C CD   . GLN A 1 18 ? -19.029 -22.607 6.731   1.00 0.00 ? 470 GLN C CD   5  
ATOM 3622  O OE1  . GLN A 1 18 ? -19.151 -23.822 6.880   1.00 0.00 ? 470 GLN C OE1  5  
ATOM 3623  N NE2  . GLN A 1 18 ? -20.056 -21.778 6.803   1.00 0.00 ? 470 GLN C NE2  5  
ATOM 3624  H H    . GLN A 1 18 ? -15.211 -21.519 7.286   1.00 0.00 ? 470 GLN C H    5  
ATOM 3625  H HA   . GLN A 1 18 ? -14.749 -23.124 4.978   1.00 0.00 ? 470 GLN C HA   5  
ATOM 3626  H HB2  . GLN A 1 18 ? -17.217 -23.361 4.922   1.00 0.00 ? 470 GLN C HB2  5  
ATOM 3627  H HB3  . GLN A 1 18 ? -16.504 -23.765 6.474   1.00 0.00 ? 470 GLN C HB3  5  
ATOM 3628  H HG2  . GLN A 1 18 ? -17.239 -21.682 7.414   1.00 0.00 ? 470 GLN C HG2  5  
ATOM 3629  H HG3  . GLN A 1 18 ? -17.791 -21.129 5.833   1.00 0.00 ? 470 GLN C HG3  5  
ATOM 3630  H HE21 . GLN A 1 18 ? -19.898 -20.820 6.690   1.00 0.00 ? 470 GLN C HE21 5  
ATOM 3631  H HE22 . GLN A 1 18 ? -20.948 -22.163 6.973   1.00 0.00 ? 470 GLN C HE22 5  
ATOM 3632  N N    . VAL A 1 19 ? -15.532 -20.065 4.456   1.00 0.00 ? 471 VAL C N    5  
ATOM 3633  C CA   . VAL A 1 19 ? -15.767 -19.063 3.433   1.00 0.00 ? 471 VAL C CA   5  
ATOM 3634  C C    . VAL A 1 19 ? -14.461 -18.377 3.018   1.00 0.00 ? 471 VAL C C    5  
ATOM 3635  O O    . VAL A 1 19 ? -13.454 -18.459 3.727   1.00 0.00 ? 471 VAL C O    5  
ATOM 3636  C CB   . VAL A 1 19 ? -16.787 -17.996 3.899   1.00 0.00 ? 471 VAL C CB   5  
ATOM 3637  C CG1  . VAL A 1 19 ? -18.100 -18.638 4.309   1.00 0.00 ? 471 VAL C CG1  5  
ATOM 3638  C CG2  . VAL A 1 19 ? -16.217 -17.155 5.022   1.00 0.00 ? 471 VAL C CG2  5  
ATOM 3639  H H    . VAL A 1 19 ? -15.282 -19.770 5.357   1.00 0.00 ? 471 VAL C H    5  
ATOM 3640  H HA   . VAL A 1 19 ? -16.177 -19.571 2.572   1.00 0.00 ? 471 VAL C HA   5  
ATOM 3641  H HB   . VAL A 1 19 ? -16.985 -17.348 3.061   1.00 0.00 ? 471 VAL C HB   5  
ATOM 3642  H HG11 . VAL A 1 19 ? -17.938 -19.265 5.171   1.00 0.00 ? 471 VAL C HG11 5  
ATOM 3643  H HG12 . VAL A 1 19 ? -18.478 -19.238 3.494   1.00 0.00 ? 471 VAL C HG12 5  
ATOM 3644  H HG13 . VAL A 1 19 ? -18.817 -17.868 4.552   1.00 0.00 ? 471 VAL C HG13 5  
ATOM 3645  H HG21 . VAL A 1 19 ? -15.348 -16.630 4.654   1.00 0.00 ? 471 VAL C HG21 5  
ATOM 3646  H HG22 . VAL A 1 19 ? -15.936 -17.793 5.845   1.00 0.00 ? 471 VAL C HG22 5  
ATOM 3647  H HG23 . VAL A 1 19 ? -16.957 -16.440 5.348   1.00 0.00 ? 471 VAL C HG23 5  
ATOM 3648  N N    . PRO A 1 20 ? -14.458 -17.720 1.848   1.00 0.00 ? 472 PRO C N    5  
ATOM 3649  C CA   . PRO A 1 20 ? -13.297 -16.990 1.343   1.00 0.00 ? 472 PRO C CA   5  
ATOM 3650  C C    . PRO A 1 20 ? -13.138 -15.635 2.024   1.00 0.00 ? 472 PRO C C    5  
ATOM 3651  O O    . PRO A 1 20 ? -14.123 -14.965 2.347   1.00 0.00 ? 472 PRO C O    5  
ATOM 3652  C CB   . PRO A 1 20 ? -13.607 -16.798 -0.150  1.00 0.00 ? 472 PRO C CB   5  
ATOM 3653  C CG   . PRO A 1 20 ? -14.864 -17.566 -0.398  1.00 0.00 ? 472 PRO C CG   5  
ATOM 3654  C CD   . PRO A 1 20 ? -15.567 -17.645 0.918   1.00 0.00 ? 472 PRO C CD   5  
ATOM 3655  H HA   . PRO A 1 20 ? -12.388 -17.562 1.457   1.00 0.00 ? 472 PRO C HA   5  
ATOM 3656  H HB2  . PRO A 1 20 ? -13.740 -15.747 -0.351  1.00 0.00 ? 472 PRO C HB2  5  
ATOM 3657  H HB3  . PRO A 1 20 ? -12.788 -17.179 -0.741  1.00 0.00 ? 472 PRO C HB3  5  
ATOM 3658  H HG2  . PRO A 1 20 ? -15.473 -17.047 -1.123  1.00 0.00 ? 472 PRO C HG2  5  
ATOM 3659  H HG3  . PRO A 1 20 ? -14.618 -18.556 -0.752  1.00 0.00 ? 472 PRO C HG3  5  
ATOM 3660  H HD2  . PRO A 1 20 ? -16.159 -16.761 1.102   1.00 0.00 ? 472 PRO C HD2  5  
ATOM 3661  H HD3  . PRO A 1 20 ? -16.178 -18.533 0.975   1.00 0.00 ? 472 PRO C HD3  5  
ATOM 3662  N N    . TYR A 1 21 ? -11.901 -15.222 2.193   1.00 0.00 ? 473 TYR C N    5  
ATOM 3663  C CA   . TYR A 1 21 ? -11.579 -13.996 2.911   1.00 0.00 ? 473 TYR C CA   5  
ATOM 3664  C C    . TYR A 1 21 ? -12.001 -12.741 2.134   1.00 0.00 ? 473 TYR C C    5  
ATOM 3665  O O    . TYR A 1 21 ? -12.538 -11.796 2.718   1.00 0.00 ? 473 TYR C O    5  
ATOM 3666  C CB   . TYR A 1 21 ? -10.080 -13.953 3.209   1.00 0.00 ? 473 TYR C CB   5  
ATOM 3667  C CG   . TYR A 1 21 ? -9.706  -13.024 4.340   1.00 0.00 ? 473 TYR C CG   5  
ATOM 3668  C CD1  . TYR A 1 21 ? -10.151 -13.272 5.625   1.00 0.00 ? 473 TYR C CD1  5  
ATOM 3669  C CD2  . TYR A 1 21 ? -8.900  -11.915 4.126   1.00 0.00 ? 473 TYR C CD2  5  
ATOM 3670  C CE1  . TYR A 1 21 ? -9.814  -12.446 6.672   1.00 0.00 ? 473 TYR C CE1  5  
ATOM 3671  C CE2  . TYR A 1 21 ? -8.551  -11.080 5.176   1.00 0.00 ? 473 TYR C CE2  5  
ATOM 3672  C CZ   . TYR A 1 21 ? -9.014  -11.354 6.447   1.00 0.00 ? 473 TYR C CZ   5  
ATOM 3673  O OH   . TYR A 1 21 ? -8.670  -10.534 7.498   1.00 0.00 ? 473 TYR C OH   5  
ATOM 3674  H H    . TYR A 1 21 ? -11.171 -15.762 1.819   1.00 0.00 ? 473 TYR C H    5  
ATOM 3675  H HA   . TYR A 1 21 ? -12.113 -14.016 3.848   1.00 0.00 ? 473 TYR C HA   5  
ATOM 3676  H HB2  . TYR A 1 21 ? -9.745  -14.944 3.474   1.00 0.00 ? 473 TYR C HB2  5  
ATOM 3677  H HB3  . TYR A 1 21 ? -9.556  -13.626 2.322   1.00 0.00 ? 473 TYR C HB3  5  
ATOM 3678  H HD1  . TYR A 1 21 ? -10.782 -14.131 5.801   1.00 0.00 ? 473 TYR C HD1  5  
ATOM 3679  H HD2  . TYR A 1 21 ? -8.544  -11.706 3.128   1.00 0.00 ? 473 TYR C HD2  5  
ATOM 3680  H HE1  . TYR A 1 21 ? -10.177 -12.663 7.663   1.00 0.00 ? 473 TYR C HE1  5  
ATOM 3681  H HE2  . TYR A 1 21 ? -7.924  -10.219 4.994   1.00 0.00 ? 473 TYR C HE2  5  
ATOM 3682  H HH   . TYR A 1 21 ? -8.749  -9.613  7.231   1.00 0.00 ? 473 TYR C HH   5  
ATOM 3683  N N    . HIS A 1 22 ? -11.775 -12.739 0.818   1.00 0.00 ? 474 HIS C N    5  
ATOM 3684  C CA   . HIS A 1 22 ? -12.087 -11.552 -0.006  1.00 0.00 ? 474 HIS C CA   5  
ATOM 3685  C C    . HIS A 1 22 ? -13.575 -11.260 0.001   1.00 0.00 ? 474 HIS C C    5  
ATOM 3686  O O    . HIS A 1 22 ? -13.989 -10.099 0.005   1.00 0.00 ? 474 HIS C O    5  
ATOM 3687  C CB   . HIS A 1 22 ? -11.651 -11.723 -1.470  1.00 0.00 ? 474 HIS C CB   5  
ATOM 3688  C CG   . HIS A 1 22 ? -10.258 -12.220 -1.687  1.00 0.00 ? 474 HIS C CG   5  
ATOM 3689  N ND1  . HIS A 1 22 ? -9.146  -11.683 -1.076  1.00 0.00 ? 474 HIS C ND1  5  
ATOM 3690  C CD2  . HIS A 1 22 ? -9.806  -13.217 -2.472  1.00 0.00 ? 474 HIS C CD2  5  
ATOM 3691  C CE1  . HIS A 1 22 ? -8.072  -12.332 -1.476  1.00 0.00 ? 474 HIS C CE1  5  
ATOM 3692  N NE2  . HIS A 1 22 ? -8.444  -13.269 -2.325  1.00 0.00 ? 474 HIS C NE2  5  
ATOM 3693  H H    . HIS A 1 22 ? -11.400 -13.545 0.397   1.00 0.00 ? 474 HIS C H    5  
ATOM 3694  H HA   . HIS A 1 22 ? -11.570 -10.701 0.421   1.00 0.00 ? 474 HIS C HA   5  
ATOM 3695  H HB2  . HIS A 1 22 ? -12.320 -12.420 -1.947  1.00 0.00 ? 474 HIS C HB2  5  
ATOM 3696  H HB3  . HIS A 1 22 ? -11.742 -10.768 -1.966  1.00 0.00 ? 474 HIS C HB3  5  
ATOM 3697  H HD1  . HIS A 1 22 ? -9.145  -10.921 -0.454  1.00 0.00 ? 474 HIS C HD1  5  
ATOM 3698  H HD2  . HIS A 1 22 ? -10.416 -13.849 -3.103  1.00 0.00 ? 474 HIS C HD2  5  
ATOM 3699  H HE1  . HIS A 1 22 ? -7.059  -12.130 -1.161  1.00 0.00 ? 474 HIS C HE1  5  
ATOM 3700  H HE2  . HIS A 1 22 ? -7.833  -13.766 -2.910  1.00 0.00 ? 474 HIS C HE2  5  
ATOM 3701  N N    . LEU A 1 23 ? -14.383 -12.311 -0.009  1.00 0.00 ? 475 LEU C N    5  
ATOM 3702  C CA   . LEU A 1 23 ? -15.822 -12.146 -0.068  1.00 0.00 ? 475 LEU C CA   5  
ATOM 3703  C C    . LEU A 1 23 ? -16.348 -11.516 1.205   1.00 0.00 ? 475 LEU C C    5  
ATOM 3704  O O    . LEU A 1 23 ? -17.236 -10.665 1.164   1.00 0.00 ? 475 LEU C O    5  
ATOM 3705  C CB   . LEU A 1 23 ? -16.525 -13.475 -0.341  1.00 0.00 ? 475 LEU C CB   5  
ATOM 3706  C CG   . LEU A 1 23 ? -16.052 -14.247 -1.578  1.00 0.00 ? 475 LEU C CG   5  
ATOM 3707  C CD1  . LEU A 1 23 ? -17.082 -15.283 -1.982  1.00 0.00 ? 475 LEU C CD1  5  
ATOM 3708  C CD2  . LEU A 1 23 ? -15.737 -13.308 -2.742  1.00 0.00 ? 475 LEU C CD2  5  
ATOM 3709  H H    . LEU A 1 23 ? -14.003 -13.214 0.026   1.00 0.00 ? 475 LEU C H    5  
ATOM 3710  H HA   . LEU A 1 23 ? -16.033 -11.471 -0.886  1.00 0.00 ? 475 LEU C HA   5  
ATOM 3711  H HB2  . LEU A 1 23 ? -16.388 -14.108 0.525   1.00 0.00 ? 475 LEU C HB2  5  
ATOM 3712  H HB3  . LEU A 1 23 ? -17.579 -13.276 -0.452  1.00 0.00 ? 475 LEU C HB3  5  
ATOM 3713  H HG   . LEU A 1 23 ? -15.147 -14.777 -1.324  1.00 0.00 ? 475 LEU C HG   5  
ATOM 3714  H HD11 . LEU A 1 23 ? -18.005 -14.788 -2.245  1.00 0.00 ? 475 LEU C HD11 5  
ATOM 3715  H HD12 . LEU A 1 23 ? -17.258 -15.956 -1.157  1.00 0.00 ? 475 LEU C HD12 5  
ATOM 3716  H HD13 . LEU A 1 23 ? -16.717 -15.841 -2.831  1.00 0.00 ? 475 LEU C HD13 5  
ATOM 3717  H HD21 . LEU A 1 23 ? -16.592 -12.683 -2.948  1.00 0.00 ? 475 LEU C HD21 5  
ATOM 3718  H HD22 . LEU A 1 23 ? -15.496 -13.894 -3.616  1.00 0.00 ? 475 LEU C HD22 5  
ATOM 3719  H HD23 . LEU A 1 23 ? -14.885 -12.693 -2.485  1.00 0.00 ? 475 LEU C HD23 5  
ATOM 3720  N N    . VAL A 1 24 ? -15.784 -11.924 2.333   1.00 0.00 ? 476 VAL C N    5  
ATOM 3721  C CA   . VAL A 1 24 ? -16.165 -11.359 3.616   1.00 0.00 ? 476 VAL C CA   5  
ATOM 3722  C C    . VAL A 1 24 ? -15.788 -9.878  3.646   1.00 0.00 ? 476 VAL C C    5  
ATOM 3723  O O    . VAL A 1 24 ? -16.600 -9.027  3.987   1.00 0.00 ? 476 VAL C O    5  
ATOM 3724  C CB   . VAL A 1 24 ? -15.475 -12.099 4.789   1.00 0.00 ? 476 VAL C CB   5  
ATOM 3725  C CG1  . VAL A 1 24 ? -15.946 -11.553 6.125   1.00 0.00 ? 476 VAL C CG1  5  
ATOM 3726  C CG2  . VAL A 1 24 ? -15.742 -13.592 4.707   1.00 0.00 ? 476 VAL C CG2  5  
ATOM 3727  H H    . VAL A 1 24 ? -15.096 -12.624 2.302   1.00 0.00 ? 476 VAL C H    5  
ATOM 3728  H HA   . VAL A 1 24 ? -17.236 -11.452 3.721   1.00 0.00 ? 476 VAL C HA   5  
ATOM 3729  H HB   . VAL A 1 24 ? -14.409 -11.939 4.711   1.00 0.00 ? 476 VAL C HB   5  
ATOM 3730  H HG11 . VAL A 1 24 ? -17.015 -11.684 6.209   1.00 0.00 ? 476 VAL C HG11 5  
ATOM 3731  H HG12 . VAL A 1 24 ? -15.705 -10.503 6.188   1.00 0.00 ? 476 VAL C HG12 5  
ATOM 3732  H HG13 . VAL A 1 24 ? -15.454 -12.085 6.925   1.00 0.00 ? 476 VAL C HG13 5  
ATOM 3733  H HG21 . VAL A 1 24 ? -16.806 -13.769 4.745   1.00 0.00 ? 476 VAL C HG21 5  
ATOM 3734  H HG22 . VAL A 1 24 ? -15.264 -14.088 5.539   1.00 0.00 ? 476 VAL C HG22 5  
ATOM 3735  H HG23 . VAL A 1 24 ? -15.344 -13.977 3.779   1.00 0.00 ? 476 VAL C HG23 5  
ATOM 3736  N N    . LEU A 1 25 ? -14.553 -9.591  3.242   1.00 0.00 ? 477 LEU C N    5  
ATOM 3737  C CA   . LEU A 1 25 ? -14.046 -8.221  3.153   1.00 0.00 ? 477 LEU C CA   5  
ATOM 3738  C C    . LEU A 1 25 ? -14.960 -7.360  2.287   1.00 0.00 ? 477 LEU C C    5  
ATOM 3739  O O    . LEU A 1 25 ? -15.241 -6.205  2.616   1.00 0.00 ? 477 LEU C O    5  
ATOM 3740  C CB   . LEU A 1 25 ? -12.635 -8.243  2.553   1.00 0.00 ? 477 LEU C CB   5  
ATOM 3741  C CG   . LEU A 1 25 ? -11.531 -8.795  3.451   1.00 0.00 ? 477 LEU C CG   5  
ATOM 3742  C CD1  . LEU A 1 25 ? -10.235 -8.923  2.677   1.00 0.00 ? 477 LEU C CD1  5  
ATOM 3743  C CD2  . LEU A 1 25 ? -11.328 -7.901  4.658   1.00 0.00 ? 477 LEU C CD2  5  
ATOM 3744  H H    . LEU A 1 25 ? -13.952 -10.329 3.000   1.00 0.00 ? 477 LEU C H    5  
ATOM 3745  H HA   . LEU A 1 25 ? -14.010 -7.790  4.146   1.00 0.00 ? 477 LEU C HA   5  
ATOM 3746  H HB2  . LEU A 1 25 ? -12.671 -8.859  1.667   1.00 0.00 ? 477 LEU C HB2  5  
ATOM 3747  H HB3  . LEU A 1 25 ? -12.364 -7.248  2.250   1.00 0.00 ? 477 LEU C HB3  5  
ATOM 3748  H HG   . LEU A 1 25 ? -11.813 -9.777  3.801   1.00 0.00 ? 477 LEU C HG   5  
ATOM 3749  H HD11 . LEU A 1 25 ? -9.962  -7.963  2.266   1.00 0.00 ? 477 LEU C HD11 5  
ATOM 3750  H HD12 . LEU A 1 25 ? -10.364 -9.637  1.877   1.00 0.00 ? 477 LEU C HD12 5  
ATOM 3751  H HD13 . LEU A 1 25 ? -9.454  -9.266  3.340   1.00 0.00 ? 477 LEU C HD13 5  
ATOM 3752  H HD21 . LEU A 1 25 ? -12.238 -7.859  5.237   1.00 0.00 ? 477 LEU C HD21 5  
ATOM 3753  H HD22 . LEU A 1 25 ? -11.063 -6.905  4.330   1.00 0.00 ? 477 LEU C HD22 5  
ATOM 3754  H HD23 . LEU A 1 25 ? -10.533 -8.305  5.265   1.00 0.00 ? 477 LEU C HD23 5  
ATOM 3755  N N    . GLN A 1 26 ? -15.415 -7.930  1.184   1.00 0.00 ? 478 GLN C N    5  
ATOM 3756  C CA   . GLN A 1 26 ? -16.311 -7.251  0.275   1.00 0.00 ? 478 GLN C CA   5  
ATOM 3757  C C    . GLN A 1 26 ? -17.631 -6.930  0.965   1.00 0.00 ? 478 GLN C C    5  
ATOM 3758  O O    . GLN A 1 26 ? -18.083 -5.786  0.958   1.00 0.00 ? 478 GLN C O    5  
ATOM 3759  C CB   . GLN A 1 26 ? -16.573 -8.127  -0.948  1.00 0.00 ? 478 GLN C CB   5  
ATOM 3760  C CG   . GLN A 1 26 ? -17.529 -7.510  -1.950  1.00 0.00 ? 478 GLN C CG   5  
ATOM 3761  C CD   . GLN A 1 26 ? -17.921 -8.464  -3.068  1.00 0.00 ? 478 GLN C CD   5  
ATOM 3762  O OE1  . GLN A 1 26 ? -18.191 -8.040  -4.195  1.00 0.00 ? 478 GLN C OE1  5  
ATOM 3763  N NE2  . GLN A 1 26 ? -17.972 -9.750  -2.766  1.00 0.00 ? 478 GLN C NE2  5  
ATOM 3764  H H    . GLN A 1 26 ? -15.129 -8.842  0.964   1.00 0.00 ? 478 GLN C H    5  
ATOM 3765  H HA   . GLN A 1 26 ? -15.844 -6.333  -0.043  1.00 0.00 ? 478 GLN C HA   5  
ATOM 3766  H HB2  . GLN A 1 26 ? -15.634 -8.314  -1.447  1.00 0.00 ? 478 GLN C HB2  5  
ATOM 3767  H HB3  . GLN A 1 26 ? -16.986 -9.067  -0.616  1.00 0.00 ? 478 GLN C HB3  5  
ATOM 3768  H HG2  . GLN A 1 26 ? -18.421 -7.209  -1.425  1.00 0.00 ? 478 GLN C HG2  5  
ATOM 3769  H HG3  . GLN A 1 26 ? -17.054 -6.642  -2.381  1.00 0.00 ? 478 GLN C HG3  5  
ATOM 3770  H HE21 . GLN A 1 26 ? -17.759 -10.022 -1.849  1.00 0.00 ? 478 GLN C HE21 5  
ATOM 3771  H HE22 . GLN A 1 26 ? -18.223 -10.385 -3.473  1.00 0.00 ? 478 GLN C HE22 5  
ATOM 3772  N N    . ASP A 1 27 ? -18.229 -7.942  1.585   1.00 0.00 ? 479 ASP C N    5  
ATOM 3773  C CA   . ASP A 1 27 ? -19.531 -7.788  2.234   1.00 0.00 ? 479 ASP C CA   5  
ATOM 3774  C C    . ASP A 1 27 ? -19.483 -6.776  3.364   1.00 0.00 ? 479 ASP C C    5  
ATOM 3775  O O    . ASP A 1 27 ? -20.476 -6.142  3.675   1.00 0.00 ? 479 ASP C O    5  
ATOM 3776  C CB   . ASP A 1 27 ? -20.046 -9.117  2.760   1.00 0.00 ? 479 ASP C CB   5  
ATOM 3777  C CG   . ASP A 1 27 ? -21.457 -8.994  3.302   1.00 0.00 ? 479 ASP C CG   5  
ATOM 3778  O OD1  . ASP A 1 27 ? -22.401 -8.935  2.487   1.00 0.00 ? 479 ASP C OD1  5  
ATOM 3779  O OD2  . ASP A 1 27 ? -21.626 -8.954  4.539   1.00 0.00 ? 479 ASP C OD2  5  
ATOM 3780  H H    . ASP A 1 27 ? -17.785 -8.819  1.613   1.00 0.00 ? 479 ASP C H    5  
ATOM 3781  H HA   . ASP A 1 27 ? -20.218 -7.427  1.484   1.00 0.00 ? 479 ASP C HA   5  
ATOM 3782  H HB2  . ASP A 1 27 ? -20.040 -9.840  1.960   1.00 0.00 ? 479 ASP C HB2  5  
ATOM 3783  H HB3  . ASP A 1 27 ? -19.402 -9.458  3.555   1.00 0.00 ? 479 ASP C HB3  5  
ATOM 3784  N N    . LEU A 1 28 ? -18.327 -6.612  3.959   1.00 0.00 ? 480 LEU C N    5  
ATOM 3785  C CA   . LEU A 1 28 ? -18.168 -5.658  5.040   1.00 0.00 ? 480 LEU C CA   5  
ATOM 3786  C C    . LEU A 1 28 ? -18.347 -4.212  4.564   1.00 0.00 ? 480 LEU C C    5  
ATOM 3787  O O    . LEU A 1 28 ? -18.524 -3.308  5.367   1.00 0.00 ? 480 LEU C O    5  
ATOM 3788  C CB   . LEU A 1 28 ? -16.842 -5.859  5.783   1.00 0.00 ? 480 LEU C CB   5  
ATOM 3789  C CG   . LEU A 1 28 ? -16.934 -6.640  7.103   1.00 0.00 ? 480 LEU C CG   5  
ATOM 3790  C CD1  . LEU A 1 28 ? -18.097 -6.151  7.950   1.00 0.00 ? 480 LEU C CD1  5  
ATOM 3791  C CD2  . LEU A 1 28 ? -17.081 -8.105  6.836   1.00 0.00 ? 480 LEU C CD2  5  
ATOM 3792  H H    . LEU A 1 28 ? -17.569 -7.155  3.671   1.00 0.00 ? 480 LEU C H    5  
ATOM 3793  H HA   . LEU A 1 28 ? -18.975 -5.859  5.730   1.00 0.00 ? 480 LEU C HA   5  
ATOM 3794  H HB2  . LEU A 1 28 ? -16.178 -6.402  5.131   1.00 0.00 ? 480 LEU C HB2  5  
ATOM 3795  H HB3  . LEU A 1 28 ? -16.396 -4.910  5.981   1.00 0.00 ? 480 LEU C HB3  5  
ATOM 3796  H HG   . LEU A 1 28 ? -16.025 -6.490  7.666   1.00 0.00 ? 480 LEU C HG   5  
ATOM 3797  H HD11 . LEU A 1 28 ? -19.026 -6.498  7.520   1.00 0.00 ? 480 LEU C HD11 5  
ATOM 3798  H HD12 . LEU A 1 28 ? -18.095 -5.073  7.981   1.00 0.00 ? 480 LEU C HD12 5  
ATOM 3799  H HD13 . LEU A 1 28 ? -18.001 -6.542  8.954   1.00 0.00 ? 480 LEU C HD13 5  
ATOM 3800  H HD21 . LEU A 1 28 ? -16.214 -8.464  6.304   1.00 0.00 ? 480 LEU C HD21 5  
ATOM 3801  H HD22 . LEU A 1 28 ? -17.967 -8.253  6.232   1.00 0.00 ? 480 LEU C HD22 5  
ATOM 3802  H HD23 . LEU A 1 28 ? -17.182 -8.632  7.774   1.00 0.00 ? 480 LEU C HD23 5  
ATOM 3803  N N    . GLN A 1 29 ? -18.282 -4.002  3.255   1.00 0.00 ? 481 GLN C N    5  
ATOM 3804  C CA   . GLN A 1 29 ? -18.592 -2.701  2.678   1.00 0.00 ? 481 GLN C CA   5  
ATOM 3805  C C    . GLN A 1 29 ? -20.078 -2.634  2.345   1.00 0.00 ? 481 GLN C C    5  
ATOM 3806  O O    . GLN A 1 29 ? -20.675 -1.559  2.293   1.00 0.00 ? 481 GLN C O    5  
ATOM 3807  C CB   . GLN A 1 29 ? -17.777 -2.465  1.414   1.00 0.00 ? 481 GLN C CB   5  
ATOM 3808  C CG   . GLN A 1 29 ? -16.485 -1.711  1.639   1.00 0.00 ? 481 GLN C CG   5  
ATOM 3809  C CD   . GLN A 1 29 ? -16.713 -0.266  2.076   1.00 0.00 ? 481 GLN C CD   5  
ATOM 3810  O OE1  . GLN A 1 29 ? -17.734 0.345   1.753   1.00 0.00 ? 481 GLN C OE1  5  
ATOM 3811  N NE2  . GLN A 1 29 ? -15.751 0.296   2.777   1.00 0.00 ? 481 GLN C NE2  5  
ATOM 3812  H H    . GLN A 1 29 ? -18.013 -4.734  2.658   1.00 0.00 ? 481 GLN C H    5  
ATOM 3813  H HA   . GLN A 1 29 ? -18.350 -1.942  3.406   1.00 0.00 ? 481 GLN C HA   5  
ATOM 3814  H HB2  . GLN A 1 29 ? -17.535 -3.422  0.976   1.00 0.00 ? 481 GLN C HB2  5  
ATOM 3815  H HB3  . GLN A 1 29 ? -18.380 -1.905  0.714   1.00 0.00 ? 481 GLN C HB3  5  
ATOM 3816  H HG2  . GLN A 1 29 ? -15.920 -2.218  2.408   1.00 0.00 ? 481 GLN C HG2  5  
ATOM 3817  H HG3  . GLN A 1 29 ? -15.925 -1.716  0.721   1.00 0.00 ? 481 GLN C HG3  5  
ATOM 3818  H HE21 . GLN A 1 29 ? -14.951 -0.238  2.970   1.00 0.00 ? 481 GLN C HE21 5  
ATOM 3819  H HE22 . GLN A 1 29 ? -15.869 1.220   3.081   1.00 0.00 ? 481 GLN C HE22 5  
ATOM 3820  N N    . LEU A 1 30 ? -20.655 -3.801  2.121   1.00 0.00 ? 482 LEU C N    5  
ATOM 3821  C CA   . LEU A 1 30 ? -22.050 -3.945  1.765   1.00 0.00 ? 482 LEU C CA   5  
ATOM 3822  C C    . LEU A 1 30 ? -22.953 -3.871  2.991   1.00 0.00 ? 482 LEU C C    5  
ATOM 3823  O O    . LEU A 1 30 ? -23.905 -3.090  3.028   1.00 0.00 ? 482 LEU C O    5  
ATOM 3824  C CB   . LEU A 1 30 ? -22.256 -5.281  1.065   1.00 0.00 ? 482 LEU C CB   5  
ATOM 3825  C CG   . LEU A 1 30 ? -21.914 -5.334  -0.430  1.00 0.00 ? 482 LEU C CG   5  
ATOM 3826  C CD1  . LEU A 1 30 ? -20.496 -4.863  -0.706  1.00 0.00 ? 482 LEU C CD1  5  
ATOM 3827  C CD2  . LEU A 1 30 ? -22.101 -6.736  -0.941  1.00 0.00 ? 482 LEU C CD2  5  
ATOM 3828  H H    . LEU A 1 30 ? -20.120 -4.616  2.191   1.00 0.00 ? 482 LEU C H    5  
ATOM 3829  H HA   . LEU A 1 30 ? -22.311 -3.161  1.073   1.00 0.00 ? 482 LEU C HA   5  
ATOM 3830  H HB2  . LEU A 1 30 ? -21.650 -6.015  1.571   1.00 0.00 ? 482 LEU C HB2  5  
ATOM 3831  H HB3  . LEU A 1 30 ? -23.290 -5.562  1.181   1.00 0.00 ? 482 LEU C HB3  5  
ATOM 3832  H HG   . LEU A 1 30 ? -22.587 -4.689  -0.965  1.00 0.00 ? 482 LEU C HG   5  
ATOM 3833  H HD11 . LEU A 1 30 ? -19.796 -5.496  -0.179  1.00 0.00 ? 482 LEU C HD11 5  
ATOM 3834  H HD12 . LEU A 1 30 ? -20.381 -3.842  -0.369  1.00 0.00 ? 482 LEU C HD12 5  
ATOM 3835  H HD13 . LEU A 1 30 ? -20.300 -4.915  -1.767  1.00 0.00 ? 482 LEU C HD13 5  
ATOM 3836  H HD21 . LEU A 1 30 ? -23.126 -7.034  -0.781  1.00 0.00 ? 482 LEU C HD21 5  
ATOM 3837  H HD22 . LEU A 1 30 ? -21.438 -7.393  -0.395  1.00 0.00 ? 482 LEU C HD22 5  
ATOM 3838  H HD23 . LEU A 1 30 ? -21.868 -6.769  -1.993  1.00 0.00 ? 482 LEU C HD23 5  
ATOM 3839  N N    . THR A 1 31 ? -22.656 -4.690  3.989   1.00 0.00 ? 483 THR C N    5  
ATOM 3840  C CA   . THR A 1 31 ? -23.460 -4.742  5.187   1.00 0.00 ? 483 THR C CA   5  
ATOM 3841  C C    . THR A 1 31 ? -22.834 -3.909  6.289   1.00 0.00 ? 483 THR C C    5  
ATOM 3842  O O    . THR A 1 31 ? -23.542 -3.286  7.083   1.00 0.00 ? 483 THR C O    5  
ATOM 3843  C CB   . THR A 1 31 ? -23.621 -6.190  5.679   1.00 0.00 ? 483 THR C CB   5  
ATOM 3844  O OG1  . THR A 1 31 ? -22.331 -6.771  5.873   1.00 0.00 ? 483 THR C OG1  5  
ATOM 3845  C CG2  . THR A 1 31 ? -24.405 -7.018  4.678   1.00 0.00 ? 483 THR C CG2  5  
ATOM 3846  H H    . THR A 1 31 ? -21.864 -5.282  3.926   1.00 0.00 ? 483 THR C H    5  
ATOM 3847  H HA   . THR A 1 31 ? -24.440 -4.348  4.956   1.00 0.00 ? 483 THR C HA   5  
ATOM 3848  H HB   . THR A 1 31 ? -24.153 -6.181  6.620   1.00 0.00 ? 483 THR C HB   5  
ATOM 3849  H HG1  . THR A 1 31 ? -22.214 -7.520  5.258   1.00 0.00 ? 483 THR C HG1  5  
ATOM 3850  H HG21 . THR A 1 31 ? -23.897 -7.003  3.724   1.00 0.00 ? 483 THR C HG21 5  
ATOM 3851  H HG22 . THR A 1 31 ? -25.396 -6.605  4.564   1.00 0.00 ? 483 THR C HG22 5  
ATOM 3852  H HG23 . THR A 1 31 ? -24.476 -8.038  5.029   1.00 0.00 ? 483 THR C HG23 5  
ATOM 3853  N N    . ARG A 1 32 ? -21.490 -3.902  6.329   1.00 0.00 ? 484 ARG C N    5  
ATOM 3854  C CA   . ARG A 1 32 ? -20.729 -3.169  7.334   1.00 0.00 ? 484 ARG C CA   5  
ATOM 3855  C C    . ARG A 1 32 ? -21.043 -3.673  8.739   1.00 0.00 ? 484 ARG C C    5  
ATOM 3856  O O    . ARG A 1 32 ? -20.786 -2.990  9.729   1.00 0.00 ? 484 ARG C O    5  
ATOM 3857  C CB   . ARG A 1 32 ? -21.012 -1.681  7.222   1.00 0.00 ? 484 ARG C CB   5  
ATOM 3858  C CG   . ARG A 1 32 ? -20.748 -1.126  5.844   1.00 0.00 ? 484 ARG C CG   5  
ATOM 3859  C CD   . ARG A 1 32 ? -21.244 0.289   5.717   1.00 0.00 ? 484 ARG C CD   5  
ATOM 3860  N NE   . ARG A 1 32 ? -22.681 0.392   5.988   1.00 0.00 ? 484 ARG C NE   5  
ATOM 3861  C CZ   . ARG A 1 32 ? -23.599 0.778   5.095   1.00 0.00 ? 484 ARG C CZ   5  
ATOM 3862  N NH1  . ARG A 1 32 ? -23.242 1.087   3.852   1.00 0.00 ? 484 ARG C NH1  5  
ATOM 3863  N NH2  . ARG A 1 32 ? -24.878 0.847   5.448   1.00 0.00 ? 484 ARG C NH2  5  
ATOM 3864  H H    . ARG A 1 32 ? -20.990 -4.401  5.649   1.00 0.00 ? 484 ARG C H    5  
ATOM 3865  H HA   . ARG A 1 32 ? -19.680 -3.335  7.135   1.00 0.00 ? 484 ARG C HA   5  
ATOM 3866  H HB2  . ARG A 1 32 ? -22.046 -1.499  7.468   1.00 0.00 ? 484 ARG C HB2  5  
ATOM 3867  H HB3  . ARG A 1 32 ? -20.382 -1.164  7.922   1.00 0.00 ? 484 ARG C HB3  5  
ATOM 3868  H HG2  . ARG A 1 32 ? -19.684 -1.143  5.663   1.00 0.00 ? 484 ARG C HG2  5  
ATOM 3869  H HG3  . ARG A 1 32 ? -21.249 -1.744  5.113   1.00 0.00 ? 484 ARG C HG3  5  
ATOM 3870  H HD2  . ARG A 1 32 ? -20.704 0.899   6.424   1.00 0.00 ? 484 ARG C HD2  5  
ATOM 3871  H HD3  . ARG A 1 32 ? -21.046 0.628   4.714   1.00 0.00 ? 484 ARG C HD3  5  
ATOM 3872  H HE   . ARG A 1 32 ? -22.975 0.162   6.899   1.00 0.00 ? 484 ARG C HE   5  
ATOM 3873  H HH11 . ARG A 1 32 ? -22.282 1.035   3.564   1.00 0.00 ? 484 ARG C HH11 5  
ATOM 3874  H HH12 . ARG A 1 32 ? -23.929 1.381   3.181   1.00 0.00 ? 484 ARG C HH12 5  
ATOM 3875  H HH21 . ARG A 1 32 ? -25.166 0.614   6.381   1.00 0.00 ? 484 ARG C HH21 5  
ATOM 3876  H HH22 . ARG A 1 32 ? -25.578 1.133   4.785   1.00 0.00 ? 484 ARG C HH22 5  
ATOM 3877  N N    . SER A 1 33 ? -21.575 -4.877  8.815   1.00 0.00 ? 485 SER C N    5  
ATOM 3878  C CA   . SER A 1 33 ? -21.952 -5.463  10.075  1.00 0.00 ? 485 SER C CA   5  
ATOM 3879  C C    . SER A 1 33 ? -21.531 -6.914  10.108  1.00 0.00 ? 485 SER C C    5  
ATOM 3880  O O    . SER A 1 33 ? -22.148 -7.744  9.452   1.00 0.00 ? 485 SER C O    5  
ATOM 3881  C CB   . SER A 1 33 ? -23.470 -5.363  10.264  1.00 0.00 ? 485 SER C CB   5  
ATOM 3882  O OG   . SER A 1 33 ? -23.853 -5.673  11.597  1.00 0.00 ? 485 SER C OG   5  
ATOM 3883  H H    . SER A 1 33 ? -21.713 -5.393  7.991   1.00 0.00 ? 485 SER C H    5  
ATOM 3884  H HA   . SER A 1 33 ? -21.461 -4.921  10.863  1.00 0.00 ? 485 SER C HA   5  
ATOM 3885  H HB2  . SER A 1 33 ? -23.806 -4.370  10.020  1.00 0.00 ? 485 SER C HB2  5  
ATOM 3886  H HB3  . SER A 1 33 ? -23.949 -6.067  9.598   1.00 0.00 ? 485 SER C HB3  5  
ATOM 3887  H HG   . SER A 1 33 ? -24.784 -5.441  11.713  1.00 0.00 ? 485 SER C HG   5  
ATOM 3888  N N    . VAL A 1 34 ? -20.478 -7.228  10.873  1.00 0.00 ? 486 VAL C N    5  
ATOM 3889  C CA   . VAL A 1 34 ? -19.989 -8.599  10.959  1.00 0.00 ? 486 VAL C CA   5  
ATOM 3890  C C    . VAL A 1 34 ? -21.087 -9.546  11.422  1.00 0.00 ? 486 VAL C C    5  
ATOM 3891  O O    . VAL A 1 34 ? -21.095 -10.721 11.062  1.00 0.00 ? 486 VAL C O    5  
ATOM 3892  C CB   . VAL A 1 34 ? -18.755 -8.740  11.882  1.00 0.00 ? 486 VAL C CB   5  
ATOM 3893  C CG1  . VAL A 1 34 ? -17.675 -7.769  11.485  1.00 0.00 ? 486 VAL C CG1  5  
ATOM 3894  C CG2  . VAL A 1 34 ? -19.115 -8.580  13.347  1.00 0.00 ? 486 VAL C CG2  5  
ATOM 3895  H H    . VAL A 1 34 ? -20.015 -6.523  11.379  1.00 0.00 ? 486 VAL C H    5  
ATOM 3896  H HA   . VAL A 1 34 ? -19.699 -8.888  9.961   1.00 0.00 ? 486 VAL C HA   5  
ATOM 3897  H HB   . VAL A 1 34 ? -18.360 -9.732  11.746  1.00 0.00 ? 486 VAL C HB   5  
ATOM 3898  H HG11 . VAL A 1 34 ? -18.058 -6.760  11.535  1.00 0.00 ? 486 VAL C HG11 5  
ATOM 3899  H HG12 . VAL A 1 34 ? -17.351 -7.985  10.478  1.00 0.00 ? 486 VAL C HG12 5  
ATOM 3900  H HG13 . VAL A 1 34 ? -16.840 -7.868  12.163  1.00 0.00 ? 486 VAL C HG13 5  
ATOM 3901  H HG21 . VAL A 1 34 ? -19.511 -7.591  13.522  1.00 0.00 ? 486 VAL C HG21 5  
ATOM 3902  H HG22 . VAL A 1 34 ? -18.225 -8.730  13.942  1.00 0.00 ? 486 VAL C HG22 5  
ATOM 3903  H HG23 . VAL A 1 34 ? -19.852 -9.321  13.613  1.00 0.00 ? 486 VAL C HG23 5  
ATOM 3904  N N    . GLU A 1 35 ? -22.022 -9.019  12.209  1.00 0.00 ? 487 GLU C N    5  
ATOM 3905  C CA   . GLU A 1 35 ? -23.151 -9.793  12.676  1.00 0.00 ? 487 GLU C CA   5  
ATOM 3906  C C    . GLU A 1 35 ? -23.954 -10.294 11.487  1.00 0.00 ? 487 GLU C C    5  
ATOM 3907  O O    . GLU A 1 35 ? -24.283 -11.479 11.402  1.00 0.00 ? 487 GLU C O    5  
ATOM 3908  C CB   . GLU A 1 35 ? -24.028 -8.945  13.598  1.00 0.00 ? 487 GLU C CB   5  
ATOM 3909  C CG   . GLU A 1 35 ? -23.305 -8.449  14.839  1.00 0.00 ? 487 GLU C CG   5  
ATOM 3910  C CD   . GLU A 1 35 ? -24.173 -7.568  15.706  1.00 0.00 ? 487 GLU C CD   5  
ATOM 3911  O OE1  . GLU A 1 35 ? -24.952 -8.104  16.517  1.00 0.00 ? 487 GLU C OE1  5  
ATOM 3912  O OE2  . GLU A 1 35 ? -24.079 -6.327  15.584  1.00 0.00 ? 487 GLU C OE2  5  
ATOM 3913  H H    . GLU A 1 35 ? -21.938 -8.081  12.477  1.00 0.00 ? 487 GLU C H    5  
ATOM 3914  H HA   . GLU A 1 35 ? -22.773 -10.642 13.226  1.00 0.00 ? 487 GLU C HA   5  
ATOM 3915  H HB2  . GLU A 1 35 ? -24.384 -8.088  13.047  1.00 0.00 ? 487 GLU C HB2  5  
ATOM 3916  H HB3  . GLU A 1 35 ? -24.877 -9.536  13.913  1.00 0.00 ? 487 GLU C HB3  5  
ATOM 3917  H HG2  . GLU A 1 35 ? -22.991 -9.301  15.423  1.00 0.00 ? 487 GLU C HG2  5  
ATOM 3918  H HG3  . GLU A 1 35 ? -22.437 -7.885  14.532  1.00 0.00 ? 487 GLU C HG3  5  
ATOM 3919  N N    . ILE A 1 36 ? -24.236 -9.393  10.552  1.00 0.00 ? 488 ILE C N    5  
ATOM 3920  C CA   . ILE A 1 36 ? -24.957 -9.753  9.346   1.00 0.00 ? 488 ILE C CA   5  
ATOM 3921  C C    . ILE A 1 36 ? -24.060 -10.556 8.437   1.00 0.00 ? 488 ILE C C    5  
ATOM 3922  O O    . ILE A 1 36 ? -24.467 -11.547 7.906   1.00 0.00 ? 488 ILE C O    5  
ATOM 3923  C CB   . ILE A 1 36 ? -25.454 -8.517  8.567   1.00 0.00 ? 488 ILE C CB   5  
ATOM 3924  C CG1  . ILE A 1 36 ? -26.322 -7.626  9.459   1.00 0.00 ? 488 ILE C CG1  5  
ATOM 3925  C CG2  . ILE A 1 36 ? -26.220 -8.950  7.318   1.00 0.00 ? 488 ILE C CG2  5  
ATOM 3926  C CD1  . ILE A 1 36 ? -26.780 -6.348  8.781   1.00 0.00 ? 488 ILE C CD1  5  
ATOM 3927  H H    . ILE A 1 36 ? -23.940 -8.467  10.675  1.00 0.00 ? 488 ILE C H    5  
ATOM 3928  H HA   . ILE A 1 36 ? -25.811 -10.352 9.627   1.00 0.00 ? 488 ILE C HA   5  
ATOM 3929  H HB   . ILE A 1 36 ? -24.589 -7.966  8.239   1.00 0.00 ? 488 ILE C HB   5  
ATOM 3930  H HG12 . ILE A 1 36 ? -27.202 -8.175  9.755   1.00 0.00 ? 488 ILE C HG12 5  
ATOM 3931  H HG13 . ILE A 1 36 ? -25.761 -7.353  10.340  1.00 0.00 ? 488 ILE C HG13 5  
ATOM 3932  H HG21 . ILE A 1 36 ? -27.054 -9.573  7.604   1.00 0.00 ? 488 ILE C HG21 5  
ATOM 3933  H HG22 . ILE A 1 36 ? -25.558 -9.508  6.666   1.00 0.00 ? 488 ILE C HG22 5  
ATOM 3934  H HG23 . ILE A 1 36 ? -26.582 -8.075  6.798   1.00 0.00 ? 488 ILE C HG23 5  
ATOM 3935  H HD11 . ILE A 1 36 ? -27.390 -6.594  7.925   1.00 0.00 ? 488 ILE C HD11 5  
ATOM 3936  H HD12 . ILE A 1 36 ? -25.917 -5.784  8.459   1.00 0.00 ? 488 ILE C HD12 5  
ATOM 3937  H HD13 . ILE A 1 36 ? -27.356 -5.759  9.478   1.00 0.00 ? 488 ILE C HD13 5  
ATOM 3938  N N    . THR A 1 37 ? -22.830 -10.113 8.283   1.00 0.00 ? 489 THR C N    5  
ATOM 3939  C CA   . THR A 1 37 ? -21.857 -10.781 7.428   1.00 0.00 ? 489 THR C CA   5  
ATOM 3940  C C    . THR A 1 37 ? -21.644 -12.251 7.830   1.00 0.00 ? 489 THR C C    5  
ATOM 3941  O O    . THR A 1 37 ? -21.226 -13.059 7.026   1.00 0.00 ? 489 THR C O    5  
ATOM 3942  C CB   . THR A 1 37 ? -20.512 -10.033 7.443   1.00 0.00 ? 489 THR C CB   5  
ATOM 3943  O OG1  . THR A 1 37 ? -20.739 -8.645  7.197   1.00 0.00 ? 489 THR C OG1  5  
ATOM 3944  C CG2  . THR A 1 37 ? -19.562 -10.569 6.383   1.00 0.00 ? 489 THR C CG2  5  
ATOM 3945  H H    . THR A 1 37 ? -22.558 -9.288  8.738   1.00 0.00 ? 489 THR C H    5  
ATOM 3946  H HA   . THR A 1 37 ? -22.254 -10.759 6.424   1.00 0.00 ? 489 THR C HA   5  
ATOM 3947  H HB   . THR A 1 37 ? -20.064 -10.157 8.416   1.00 0.00 ? 489 THR C HB   5  
ATOM 3948  H HG1  . THR A 1 37 ? -21.068 -8.546  6.289   1.00 0.00 ? 489 THR C HG1  5  
ATOM 3949  H HG21 . THR A 1 37 ? -18.636 -10.014 6.425   1.00 0.00 ? 489 THR C HG21 5  
ATOM 3950  H HG22 . THR A 1 37 ? -20.008 -10.449 5.408   1.00 0.00 ? 489 THR C HG22 5  
ATOM 3951  H HG23 . THR A 1 37 ? -19.366 -11.615 6.568   1.00 0.00 ? 489 THR C HG23 5  
ATOM 3952  N N    . THR A 1 38 ? -21.928 -12.584 9.071   1.00 0.00 ? 490 THR C N    5  
ATOM 3953  C CA   . THR A 1 38 ? -21.820 -13.957 9.507   1.00 0.00 ? 490 THR C CA   5  
ATOM 3954  C C    . THR A 1 38 ? -23.171 -14.651 9.357   1.00 0.00 ? 490 THR C C    5  
ATOM 3955  O O    . THR A 1 38 ? -23.254 -15.817 8.960   1.00 0.00 ? 490 THR C O    5  
ATOM 3956  C CB   . THR A 1 38 ? -21.356 -14.044 10.970  1.00 0.00 ? 490 THR C CB   5  
ATOM 3957  O OG1  . THR A 1 38 ? -20.186 -13.232 11.159  1.00 0.00 ? 490 THR C OG1  5  
ATOM 3958  C CG2  . THR A 1 38 ? -21.033 -15.478 11.332  1.00 0.00 ? 490 THR C CG2  5  
ATOM 3959  H H    . THR A 1 38 ? -22.214 -11.893 9.703   1.00 0.00 ? 490 THR C H    5  
ATOM 3960  H HA   . THR A 1 38 ? -21.100 -14.461 8.878   1.00 0.00 ? 490 THR C HA   5  
ATOM 3961  H HB   . THR A 1 38 ? -22.148 -13.686 11.614  1.00 0.00 ? 490 THR C HB   5  
ATOM 3962  H HG1  . THR A 1 38 ? -20.326 -12.375 10.733  1.00 0.00 ? 490 THR C HG1  5  
ATOM 3963  H HG21 . THR A 1 38 ? -20.298 -15.861 10.638  1.00 0.00 ? 490 THR C HG21 5  
ATOM 3964  H HG22 . THR A 1 38 ? -21.931 -16.075 11.273  1.00 0.00 ? 490 THR C HG22 5  
ATOM 3965  H HG23 . THR A 1 38 ? -20.635 -15.517 12.336  1.00 0.00 ? 490 THR C HG23 5  
ATOM 3966  N N    . ASP A 1 39 ? -24.226 -13.908 9.644   1.00 0.00 ? 491 ASP C N    5  
ATOM 3967  C CA   . ASP A 1 39 ? -25.589 -14.425 9.561   1.00 0.00 ? 491 ASP C CA   5  
ATOM 3968  C C    . ASP A 1 39 ? -26.000 -14.629 8.112   1.00 0.00 ? 491 ASP C C    5  
ATOM 3969  O O    . ASP A 1 39 ? -26.686 -15.595 7.780   1.00 0.00 ? 491 ASP C O    5  
ATOM 3970  C CB   . ASP A 1 39 ? -26.555 -13.460 10.248  1.00 0.00 ? 491 ASP C CB   5  
ATOM 3971  C CG   . ASP A 1 39 ? -27.992 -13.925 10.195  1.00 0.00 ? 491 ASP C CG   5  
ATOM 3972  O OD1  . ASP A 1 39 ? -28.352 -14.842 10.961  1.00 0.00 ? 491 ASP C OD1  5  
ATOM 3973  O OD2  . ASP A 1 39 ? -28.769 -13.370 9.394   1.00 0.00 ? 491 ASP C OD2  5  
ATOM 3974  H H    . ASP A 1 39 ? -24.085 -12.974 9.912   1.00 0.00 ? 491 ASP C H    5  
ATOM 3975  H HA   . ASP A 1 39 ? -25.623 -15.379 10.069  1.00 0.00 ? 491 ASP C HA   5  
ATOM 3976  H HB2  . ASP A 1 39 ? -26.268 -13.355 11.283  1.00 0.00 ? 491 ASP C HB2  5  
ATOM 3977  H HB3  . ASP A 1 39 ? -26.489 -12.497 9.764   1.00 0.00 ? 491 ASP C HB3  5  
ATOM 3978  N N    . ASN A 1 40 ? -25.560 -13.721 7.248   1.00 0.00 ? 492 ASN C N    5  
ATOM 3979  C CA   . ASN A 1 40 ? -25.862 -13.794 5.837   1.00 0.00 ? 492 ASN C CA   5  
ATOM 3980  C C    . ASN A 1 40 ? -25.266 -15.073 5.236   1.00 0.00 ? 492 ASN C C    5  
ATOM 3981  O O    . ASN A 1 40 ? -25.849 -15.688 4.344   1.00 0.00 ? 492 ASN C O    5  
ATOM 3982  C CB   . ASN A 1 40 ? -25.424 -12.494 5.068   1.00 0.00 ? 492 ASN C CB   5  
ATOM 3983  C CG   . ASN A 1 40 ? -23.944 -12.237 4.969   1.00 0.00 ? 492 ASN C CG   5  
ATOM 3984  O OD1  . ASN A 1 40 ? -23.134 -13.131 5.041   1.00 0.00 ? 492 ASN C OD1  5  
ATOM 3985  N ND2  . ASN A 1 40 ? -23.605 -10.976 4.770   1.00 0.00 ? 492 ASN C ND2  5  
ATOM 3986  H H    . ASN A 1 40 ? -25.017 -12.972 7.584   1.00 0.00 ? 492 ASN C H    5  
ATOM 3987  H HA   . ASN A 1 40 ? -26.938 -13.866 5.773   1.00 0.00 ? 492 ASN C HA   5  
ATOM 3988  H HB2  . ASN A 1 40 ? -25.802 -12.506 4.064   1.00 0.00 ? 492 ASN C HB2  5  
ATOM 3989  H HB3  . ASN A 1 40 ? -25.835 -11.640 5.589   1.00 0.00 ? 492 ASN C HB3  5  
ATOM 3990  H HD21 . ASN A 1 40 ? -24.322 -10.311 4.703   1.00 0.00 ? 492 ASN C HD21 5  
ATOM 3991  H HD22 . ASN A 1 40 ? -22.657 -10.736 4.688   1.00 0.00 ? 492 ASN C HD22 5  
ATOM 3992  N N    . ILE A 1 41 ? -24.117 -15.484 5.764   1.00 0.00 ? 493 ILE C N    5  
ATOM 3993  C CA   . ILE A 1 41 ? -23.481 -16.731 5.361   1.00 0.00 ? 493 ILE C CA   5  
ATOM 3994  C C    . ILE A 1 41 ? -24.367 -17.900 5.760   1.00 0.00 ? 493 ILE C C    5  
ATOM 3995  O O    . ILE A 1 41 ? -24.677 -18.774 4.951   1.00 0.00 ? 493 ILE C O    5  
ATOM 3996  C CB   . ILE A 1 41 ? -22.114 -16.932 6.066   1.00 0.00 ? 493 ILE C CB   5  
ATOM 3997  C CG1  . ILE A 1 41 ? -21.153 -15.797 5.759   1.00 0.00 ? 493 ILE C CG1  5  
ATOM 3998  C CG2  . ILE A 1 41 ? -21.495 -18.262 5.668   1.00 0.00 ? 493 ILE C CG2  5  
ATOM 3999  C CD1  . ILE A 1 41 ? -19.875 -15.860 6.582   1.00 0.00 ? 493 ILE C CD1  5  
ATOM 4000  H H    . ILE A 1 41 ? -23.673 -14.912 6.429   1.00 0.00 ? 493 ILE C H    5  
ATOM 4001  H HA   . ILE A 1 41 ? -23.339 -16.714 4.291   1.00 0.00 ? 493 ILE C HA   5  
ATOM 4002  H HB   . ILE A 1 41 ? -22.292 -16.955 7.133   1.00 0.00 ? 493 ILE C HB   5  
ATOM 4003  H HG12 . ILE A 1 41 ? -20.886 -15.828 4.715   1.00 0.00 ? 493 ILE C HG12 5  
ATOM 4004  H HG13 . ILE A 1 41 ? -21.641 -14.861 5.975   1.00 0.00 ? 493 ILE C HG13 5  
ATOM 4005  H HG21 . ILE A 1 41 ? -20.550 -18.380 6.176   1.00 0.00 ? 493 ILE C HG21 5  
ATOM 4006  H HG22 . ILE A 1 41 ? -21.335 -18.273 4.601   1.00 0.00 ? 493 ILE C HG22 5  
ATOM 4007  H HG23 . ILE A 1 41 ? -22.161 -19.066 5.944   1.00 0.00 ? 493 ILE C HG23 5  
ATOM 4008  H HD11 . ILE A 1 41 ? -19.346 -16.775 6.365   1.00 0.00 ? 493 ILE C HD11 5  
ATOM 4009  H HD12 . ILE A 1 41 ? -20.129 -15.842 7.632   1.00 0.00 ? 493 ILE C HD12 5  
ATOM 4010  H HD13 . ILE A 1 41 ? -19.249 -15.012 6.353   1.00 0.00 ? 493 ILE C HD13 5  
ATOM 4011  N N    . LEU A 1 42 ? -24.781 -17.879 7.015   1.00 0.00 ? 494 LEU C N    5  
ATOM 4012  C CA   . LEU A 1 42 ? -25.596 -18.926 7.608   1.00 0.00 ? 494 LEU C CA   5  
ATOM 4013  C C    . LEU A 1 42 ? -26.930 -19.105 6.881   1.00 0.00 ? 494 LEU C C    5  
ATOM 4014  O O    . LEU A 1 42 ? -27.465 -20.211 6.819   1.00 0.00 ? 494 LEU C O    5  
ATOM 4015  C CB   . LEU A 1 42 ? -25.801 -18.621 9.090   1.00 0.00 ? 494 LEU C CB   5  
ATOM 4016  C CG   . LEU A 1 42 ? -24.522 -18.665 9.930   1.00 0.00 ? 494 LEU C CG   5  
ATOM 4017  C CD1  . LEU A 1 42 ? -24.761 -18.114 11.319  1.00 0.00 ? 494 LEU C CD1  5  
ATOM 4018  C CD2  . LEU A 1 42 ? -23.983 -20.084 10.008  1.00 0.00 ? 494 LEU C CD2  5  
ATOM 4019  H H    . LEU A 1 42 ? -24.521 -17.116 7.578   1.00 0.00 ? 494 LEU C H    5  
ATOM 4020  H HA   . LEU A 1 42 ? -25.042 -19.849 7.526   1.00 0.00 ? 494 LEU C HA   5  
ATOM 4021  H HB2  . LEU A 1 42 ? -26.228 -17.631 9.171   1.00 0.00 ? 494 LEU C HB2  5  
ATOM 4022  H HB3  . LEU A 1 42 ? -26.500 -19.329 9.501   1.00 0.00 ? 494 LEU C HB3  5  
ATOM 4023  H HG   . LEU A 1 42 ? -23.770 -18.050 9.457   1.00 0.00 ? 494 LEU C HG   5  
ATOM 4024  H HD11 . LEU A 1 42 ? -25.588 -18.635 11.777  1.00 0.00 ? 494 LEU C HD11 5  
ATOM 4025  H HD12 . LEU A 1 42 ? -24.980 -17.059 11.255  1.00 0.00 ? 494 LEU C HD12 5  
ATOM 4026  H HD13 . LEU A 1 42 ? -23.871 -18.260 11.912  1.00 0.00 ? 494 LEU C HD13 5  
ATOM 4027  H HD21 . LEU A 1 42 ? -23.737 -20.433 9.017   1.00 0.00 ? 494 LEU C HD21 5  
ATOM 4028  H HD22 . LEU A 1 42 ? -24.733 -20.729 10.441  1.00 0.00 ? 494 LEU C HD22 5  
ATOM 4029  H HD23 . LEU A 1 42 ? -23.097 -20.099 10.625  1.00 0.00 ? 494 LEU C HD23 5  
ATOM 4030  N N    . GLU A 1 43 ? -27.455 -18.024 6.320   1.00 0.00 ? 495 GLU C N    5  
ATOM 4031  C CA   . GLU A 1 43 ? -28.699 -18.096 5.551   1.00 0.00 ? 495 GLU C CA   5  
ATOM 4032  C C    . GLU A 1 43 ? -28.458 -18.782 4.208   1.00 0.00 ? 495 GLU C C    5  
ATOM 4033  O O    . GLU A 1 43 ? -29.395 -19.237 3.552   1.00 0.00 ? 495 GLU C O    5  
ATOM 4034  C CB   . GLU A 1 43 ? -29.263 -16.702 5.298   1.00 0.00 ? 495 GLU C CB   5  
ATOM 4035  C CG   . GLU A 1 43 ? -29.587 -15.918 6.549   1.00 0.00 ? 495 GLU C CG   5  
ATOM 4036  C CD   . GLU A 1 43 ? -30.154 -14.560 6.227   1.00 0.00 ? 495 GLU C CD   5  
ATOM 4037  O OE1  . GLU A 1 43 ? -29.511 -13.808 5.468   1.00 0.00 ? 495 GLU C OE1  5  
ATOM 4038  O OE2  . GLU A 1 43 ? -31.253 -14.235 6.710   1.00 0.00 ? 495 GLU C OE2  5  
ATOM 4039  H H    . GLU A 1 43 ? -27.007 -17.157 6.437   1.00 0.00 ? 495 GLU C H    5  
ATOM 4040  H HA   . GLU A 1 43 ? -29.413 -18.672 6.120   1.00 0.00 ? 495 GLU C HA   5  
ATOM 4041  H HB2  . GLU A 1 43 ? -28.542 -16.137 4.727   1.00 0.00 ? 495 GLU C HB2  5  
ATOM 4042  H HB3  . GLU A 1 43 ? -30.168 -16.797 4.716   1.00 0.00 ? 495 GLU C HB3  5  
ATOM 4043  H HG2  . GLU A 1 43 ? -30.313 -16.469 7.130   1.00 0.00 ? 495 GLU C HG2  5  
ATOM 4044  H HG3  . GLU A 1 43 ? -28.682 -15.789 7.126   1.00 0.00 ? 495 GLU C HG3  5  
ATOM 4045  N N    . GLY A 1 44 ? -27.197 -18.854 3.812   1.00 0.00 ? 496 GLY C N    5  
ATOM 4046  C CA   . GLY A 1 44 ? -26.849 -19.437 2.536   1.00 0.00 ? 496 GLY C CA   5  
ATOM 4047  C C    . GLY A 1 44 ? -26.767 -18.387 1.454   1.00 0.00 ? 496 GLY C C    5  
ATOM 4048  O O    . GLY A 1 44 ? -26.794 -18.700 0.263   1.00 0.00 ? 496 GLY C O    5  
ATOM 4049  H H    . GLY A 1 44 ? -26.488 -18.519 4.403   1.00 0.00 ? 496 GLY C H    5  
ATOM 4050  H HA2  . GLY A 1 44 ? -25.891 -19.930 2.622   1.00 0.00 ? 496 GLY C HA2  5  
ATOM 4051  H HA3  . GLY A 1 44 ? -27.594 -20.162 2.261   1.00 0.00 ? 496 GLY C HA3  5  
ATOM 4052  N N    . ARG A 1 45 ? -26.674 -17.138 1.879   1.00 0.00 ? 497 ARG C N    5  
ATOM 4053  C CA   . ARG A 1 45 ? -26.589 -16.007 0.971   1.00 0.00 ? 497 ARG C CA   5  
ATOM 4054  C C    . ARG A 1 45 ? -25.213 -15.975 0.317   1.00 0.00 ? 497 ARG C C    5  
ATOM 4055  O O    . ARG A 1 45 ? -25.073 -15.644 -0.858  1.00 0.00 ? 497 ARG C O    5  
ATOM 4056  C CB   . ARG A 1 45 ? -26.857 -14.715 1.768   1.00 0.00 ? 497 ARG C CB   5  
ATOM 4057  C CG   . ARG A 1 45 ? -26.934 -13.421 0.958   1.00 0.00 ? 497 ARG C CG   5  
ATOM 4058  C CD   . ARG A 1 45 ? -25.558 -12.873 0.636   1.00 0.00 ? 497 ARG C CD   5  
ATOM 4059  N NE   . ARG A 1 45 ? -25.609 -11.508 0.123   1.00 0.00 ? 497 ARG C NE   5  
ATOM 4060  C CZ   . ARG A 1 45 ? -24.827 -10.519 0.566   1.00 0.00 ? 497 ARG C CZ   5  
ATOM 4061  N NH1  . ARG A 1 45 ? -23.931 -10.757 1.513   1.00 0.00 ? 497 ARG C NH1  5  
ATOM 4062  N NH2  . ARG A 1 45 ? -24.941 -9.297  0.061   1.00 0.00 ? 497 ARG C NH2  5  
ATOM 4063  H H    . ARG A 1 45 ? -26.663 -16.968 2.845   1.00 0.00 ? 497 ARG C H    5  
ATOM 4064  H HA   . ARG A 1 45 ? -27.344 -16.117 0.209   1.00 0.00 ? 497 ARG C HA   5  
ATOM 4065  H HB2  . ARG A 1 45 ? -27.791 -14.829 2.296   1.00 0.00 ? 497 ARG C HB2  5  
ATOM 4066  H HB3  . ARG A 1 45 ? -26.063 -14.611 2.500   1.00 0.00 ? 497 ARG C HB3  5  
ATOM 4067  H HG2  . ARG A 1 45 ? -27.458 -13.615 0.035   1.00 0.00 ? 497 ARG C HG2  5  
ATOM 4068  H HG3  . ARG A 1 45 ? -27.476 -12.689 1.538   1.00 0.00 ? 497 ARG C HG3  5  
ATOM 4069  H HD2  . ARG A 1 45 ? -24.966 -12.887 1.538   1.00 0.00 ? 497 ARG C HD2  5  
ATOM 4070  H HD3  . ARG A 1 45 ? -25.099 -13.512 -0.104  1.00 0.00 ? 497 ARG C HD3  5  
ATOM 4071  H HE   . ARG A 1 45 ? -26.270 -11.322 -0.583  1.00 0.00 ? 497 ARG C HE   5  
ATOM 4072  H HH11 . ARG A 1 45 ? -23.825 -11.666 1.907   1.00 0.00 ? 497 ARG C HH11 5  
ATOM 4073  H HH12 . ARG A 1 45 ? -23.342 -10.005 1.864   1.00 0.00 ? 497 ARG C HH12 5  
ATOM 4074  H HH21 . ARG A 1 45 ? -25.611 -9.101  -0.659  1.00 0.00 ? 497 ARG C HH21 5  
ATOM 4075  H HH22 . ARG A 1 45 ? -24.359 -8.555  0.404   1.00 0.00 ? 497 ARG C HH22 5  
ATOM 4076  N N    . ILE A 1 46 ? -24.203 -16.330 1.084   1.00 0.00 ? 498 ILE C N    5  
ATOM 4077  C CA   . ILE A 1 46 ? -22.846 -16.348 0.585   1.00 0.00 ? 498 ILE C CA   5  
ATOM 4078  C C    . ILE A 1 46 ? -22.367 -17.776 0.428   1.00 0.00 ? 498 ILE C C    5  
ATOM 4079  O O    . ILE A 1 46 ? -22.087 -18.464 1.412   1.00 0.00 ? 498 ILE C O    5  
ATOM 4080  C CB   . ILE A 1 46 ? -21.884 -15.557 1.507   1.00 0.00 ? 498 ILE C CB   5  
ATOM 4081  C CG1  . ILE A 1 46 ? -22.355 -14.104 1.609   1.00 0.00 ? 498 ILE C CG1  5  
ATOM 4082  C CG2  . ILE A 1 46 ? -20.455 -15.625 0.976   1.00 0.00 ? 498 ILE C CG2  5  
ATOM 4083  C CD1  . ILE A 1 46 ? -21.554 -13.251 2.565   1.00 0.00 ? 498 ILE C CD1  5  
ATOM 4084  H H    . ILE A 1 46 ? -24.379 -16.608 2.008   1.00 0.00 ? 498 ILE C H    5  
ATOM 4085  H HA   . ILE A 1 46 ? -22.849 -15.877 -0.389  1.00 0.00 ? 498 ILE C HA   5  
ATOM 4086  H HB   . ILE A 1 46 ? -21.905 -16.005 2.489   1.00 0.00 ? 498 ILE C HB   5  
ATOM 4087  H HG12 . ILE A 1 46 ? -22.296 -13.645 0.634   1.00 0.00 ? 498 ILE C HG12 5  
ATOM 4088  H HG13 . ILE A 1 46 ? -23.381 -14.098 1.937   1.00 0.00 ? 498 ILE C HG13 5  
ATOM 4089  H HG21 . ILE A 1 46 ? -20.417 -15.179 -0.006  1.00 0.00 ? 498 ILE C HG21 5  
ATOM 4090  H HG22 . ILE A 1 46 ? -20.141 -16.657 0.916   1.00 0.00 ? 498 ILE C HG22 5  
ATOM 4091  H HG23 . ILE A 1 46 ? -19.799 -15.086 1.644   1.00 0.00 ? 498 ILE C HG23 5  
ATOM 4092  H HD11 . ILE A 1 46 ? -22.028 -12.281 2.650   1.00 0.00 ? 498 ILE C HD11 5  
ATOM 4093  H HD12 . ILE A 1 46 ? -20.546 -13.136 2.202   1.00 0.00 ? 498 ILE C HD12 5  
ATOM 4094  H HD13 . ILE A 1 46 ? -21.545 -13.720 3.538   1.00 0.00 ? 498 ILE C HD13 5  
ATOM 4095  N N    . GLN A 1 47 ? -22.310 -18.226 -0.805  1.00 0.00 ? 499 GLN C N    5  
ATOM 4096  C CA   . GLN A 1 47 ? -21.888 -19.575 -1.104  1.00 0.00 ? 499 GLN C CA   5  
ATOM 4097  C C    . GLN A 1 47 ? -20.421 -19.593 -1.476  1.00 0.00 ? 499 GLN C C    5  
ATOM 4098  O O    . GLN A 1 47 ? -19.851 -18.562 -1.852  1.00 0.00 ? 499 GLN C O    5  
ATOM 4099  C CB   . GLN A 1 47 ? -22.715 -20.151 -2.255  1.00 0.00 ? 499 GLN C CB   5  
ATOM 4100  C CG   . GLN A 1 47 ? -24.216 -20.135 -2.017  1.00 0.00 ? 499 GLN C CG   5  
ATOM 4101  C CD   . GLN A 1 47 ? -24.987 -20.648 -3.215  1.00 0.00 ? 499 GLN C CD   5  
ATOM 4102  O OE1  . GLN A 1 47 ? -25.334 -19.883 -4.116  1.00 0.00 ? 499 GLN C OE1  5  
ATOM 4103  N NE2  . GLN A 1 47 ? -25.267 -21.935 -3.235  1.00 0.00 ? 499 GLN C NE2  5  
ATOM 4104  H H    . GLN A 1 47 ? -22.551 -17.625 -1.542  1.00 0.00 ? 499 GLN C H    5  
ATOM 4105  H HA   . GLN A 1 47 ? -22.040 -20.181 -0.224  1.00 0.00 ? 499 GLN C HA   5  
ATOM 4106  H HB2  . GLN A 1 47 ? -22.509 -19.580 -3.148  1.00 0.00 ? 499 GLN C HB2  5  
ATOM 4107  H HB3  . GLN A 1 47 ? -22.410 -21.174 -2.419  1.00 0.00 ? 499 GLN C HB3  5  
ATOM 4108  H HG2  . GLN A 1 47 ? -24.442 -20.759 -1.167  1.00 0.00 ? 499 GLN C HG2  5  
ATOM 4109  H HG3  . GLN A 1 47 ? -24.526 -19.120 -1.815  1.00 0.00 ? 499 GLN C HG3  5  
ATOM 4110  H HE21 . GLN A 1 47 ? -24.967 -22.491 -2.480  1.00 0.00 ? 499 GLN C HE21 5  
ATOM 4111  H HE22 . GLN A 1 47 ? -25.763 -22.293 -4.001  1.00 0.00 ? 499 GLN C HE22 5  
ATOM 4112  N N    . VAL A 1 48 ? -19.815 -20.756 -1.367  1.00 0.00 ? 500 VAL C N    5  
ATOM 4113  C CA   . VAL A 1 48 ? -18.423 -20.929 -1.724  1.00 0.00 ? 500 VAL C CA   5  
ATOM 4114  C C    . VAL A 1 48 ? -18.290 -20.991 -3.244  1.00 0.00 ? 500 VAL C C    5  
ATOM 4115  O O    . VAL A 1 48 ? -18.934 -21.822 -3.891  1.00 0.00 ? 500 VAL C O    5  
ATOM 4116  C CB   . VAL A 1 48 ? -17.842 -22.224 -1.106  1.00 0.00 ? 500 VAL C CB   5  
ATOM 4117  C CG1  . VAL A 1 48 ? -16.368 -22.380 -1.456  1.00 0.00 ? 500 VAL C CG1  5  
ATOM 4118  C CG2  . VAL A 1 48 ? -18.037 -22.229 0.403   1.00 0.00 ? 500 VAL C CG2  5  
ATOM 4119  H H    . VAL A 1 48 ? -20.321 -21.530 -1.043  1.00 0.00 ? 500 VAL C H    5  
ATOM 4120  H HA   . VAL A 1 48 ? -17.871 -20.084 -1.344  1.00 0.00 ? 500 VAL C HA   5  
ATOM 4121  H HB   . VAL A 1 48 ? -18.374 -23.065 -1.520  1.00 0.00 ? 500 VAL C HB   5  
ATOM 4122  H HG11 . VAL A 1 48 ? -15.818 -21.529 -1.084  1.00 0.00 ? 500 VAL C HG11 5  
ATOM 4123  H HG12 . VAL A 1 48 ? -16.257 -22.438 -2.528  1.00 0.00 ? 500 VAL C HG12 5  
ATOM 4124  H HG13 . VAL A 1 48 ? -15.984 -23.282 -1.005  1.00 0.00 ? 500 VAL C HG13 5  
ATOM 4125  H HG21 . VAL A 1 48 ? -19.092 -22.173 0.629   1.00 0.00 ? 500 VAL C HG21 5  
ATOM 4126  H HG22 . VAL A 1 48 ? -17.530 -21.381 0.835   1.00 0.00 ? 500 VAL C HG22 5  
ATOM 4127  H HG23 . VAL A 1 48 ? -17.629 -23.141 0.814   1.00 0.00 ? 500 VAL C HG23 5  
ATOM 4128  N N    . PRO A 1 49 ? -17.480 -20.094 -3.835  1.00 0.00 ? 501 PRO C N    5  
ATOM 4129  C CA   . PRO A 1 49 ? -17.272 -20.053 -5.281  1.00 0.00 ? 501 PRO C CA   5  
ATOM 4130  C C    . PRO A 1 49 ? -16.576 -21.302 -5.792  1.00 0.00 ? 501 PRO C C    5  
ATOM 4131  O O    . PRO A 1 49 ? -15.825 -21.958 -5.061  1.00 0.00 ? 501 PRO C O    5  
ATOM 4132  C CB   . PRO A 1 49 ? -16.373 -18.826 -5.490  1.00 0.00 ? 501 PRO C CB   5  
ATOM 4133  C CG   . PRO A 1 49 ? -16.479 -18.049 -4.228  1.00 0.00 ? 501 PRO C CG   5  
ATOM 4134  C CD   . PRO A 1 49 ? -16.707 -19.057 -3.151  1.00 0.00 ? 501 PRO C CD   5  
ATOM 4135  H HA   . PRO A 1 49 ? -18.203 -19.916 -5.811  1.00 0.00 ? 501 PRO C HA   5  
ATOM 4136  H HB2  . PRO A 1 49 ? -15.359 -19.149 -5.673  1.00 0.00 ? 501 PRO C HB2  5  
ATOM 4137  H HB3  . PRO A 1 49 ? -16.730 -18.255 -6.334  1.00 0.00 ? 501 PRO C HB3  5  
ATOM 4138  H HG2  . PRO A 1 49 ? -15.561 -17.508 -4.051  1.00 0.00 ? 501 PRO C HG2  5  
ATOM 4139  H HG3  . PRO A 1 49 ? -17.313 -17.368 -4.286  1.00 0.00 ? 501 PRO C HG3  5  
ATOM 4140  H HD2  . PRO A 1 49 ? -15.764 -19.452 -2.801  1.00 0.00 ? 501 PRO C HD2  5  
ATOM 4141  H HD3  . PRO A 1 49 ? -17.268 -18.618 -2.341  1.00 0.00 ? 501 PRO C HD3  5  
ATOM 4142  N N    . PHE A 1 50 ? -16.813 -21.618 -7.043  1.00 0.00 ? 502 PHE C N    5  
ATOM 4143  C CA   . PHE A 1 50 ? -16.241 -22.797 -7.660  1.00 0.00 ? 502 PHE C CA   5  
ATOM 4144  C C    . PHE A 1 50 ? -15.183 -22.396 -8.683  1.00 0.00 ? 502 PHE C C    5  
ATOM 4145  O O    . PHE A 1 50 ? -15.155 -21.244 -9.119  1.00 0.00 ? 502 PHE C O    5  
ATOM 4146  C CB   . PHE A 1 50 ? -17.343 -23.630 -8.327  1.00 0.00 ? 502 PHE C CB   5  
ATOM 4147  C CG   . PHE A 1 50 ? -18.372 -24.144 -7.362  1.00 0.00 ? 502 PHE C CG   5  
ATOM 4148  C CD1  . PHE A 1 50 ? -19.483 -23.385 -7.052  1.00 0.00 ? 502 PHE C CD1  5  
ATOM 4149  C CD2  . PHE A 1 50 ? -18.227 -25.385 -6.765  1.00 0.00 ? 502 PHE C CD2  5  
ATOM 4150  C CE1  . PHE A 1 50 ? -20.434 -23.849 -6.167  1.00 0.00 ? 502 PHE C CE1  5  
ATOM 4151  C CE2  . PHE A 1 50 ? -19.173 -25.857 -5.876  1.00 0.00 ? 502 PHE C CE2  5  
ATOM 4152  C CZ   . PHE A 1 50 ? -20.278 -25.087 -5.576  1.00 0.00 ? 502 PHE C CZ   5  
ATOM 4153  H H    . PHE A 1 50 ? -17.382 -21.026 -7.580  1.00 0.00 ? 502 PHE C H    5  
ATOM 4154  H HA   . PHE A 1 50 ? -15.785 -23.384 -6.880  1.00 0.00 ? 502 PHE C HA   5  
ATOM 4155  H HB2  . PHE A 1 50 ? -17.850 -23.022 -9.059  1.00 0.00 ? 502 PHE C HB2  5  
ATOM 4156  H HB3  . PHE A 1 50 ? -16.894 -24.479 -8.821  1.00 0.00 ? 502 PHE C HB3  5  
ATOM 4157  H HD1  . PHE A 1 50 ? -19.596 -22.418 -7.515  1.00 0.00 ? 502 PHE C HD1  5  
ATOM 4158  H HD2  . PHE A 1 50 ? -17.361 -25.988 -6.999  1.00 0.00 ? 502 PHE C HD2  5  
ATOM 4159  H HE1  . PHE A 1 50 ? -21.297 -23.243 -5.934  1.00 0.00 ? 502 PHE C HE1  5  
ATOM 4160  H HE2  . PHE A 1 50 ? -19.049 -26.826 -5.415  1.00 0.00 ? 502 PHE C HE2  5  
ATOM 4161  H HZ   . PHE A 1 50 ? -21.021 -25.453 -4.882  1.00 0.00 ? 502 PHE C HZ   5  
ATOM 4162  N N    . PRO A 1 51 ? -14.272 -23.323 -9.054  1.00 0.00 ? 503 PRO C N    5  
ATOM 4163  C CA   . PRO A 1 51 ? -13.239 -23.053 -10.064 1.00 0.00 ? 503 PRO C CA   5  
ATOM 4164  C C    . PRO A 1 51 ? -13.860 -22.610 -11.382 1.00 0.00 ? 503 PRO C C    5  
ATOM 4165  O O    . PRO A 1 51 ? -14.699 -23.316 -11.954 1.00 0.00 ? 503 PRO C O    5  
ATOM 4166  C CB   . PRO A 1 51 ? -12.545 -24.410 -10.234 1.00 0.00 ? 503 PRO C CB   5  
ATOM 4167  C CG   . PRO A 1 51 ? -12.802 -25.124 -8.955  1.00 0.00 ? 503 PRO C CG   5  
ATOM 4168  C CD   . PRO A 1 51 ? -14.169 -24.690 -8.515  1.00 0.00 ? 503 PRO C CD   5  
ATOM 4169  H HA   . PRO A 1 51 ? -12.531 -22.312 -9.724  1.00 0.00 ? 503 PRO C HA   5  
ATOM 4170  H HB2  . PRO A 1 51 ? -12.975 -24.935 -11.074 1.00 0.00 ? 503 PRO C HB2  5  
ATOM 4171  H HB3  . PRO A 1 51 ? -11.488 -24.265 -10.398 1.00 0.00 ? 503 PRO C HB3  5  
ATOM 4172  H HG2  . PRO A 1 51 ? -12.780 -26.191 -9.119  1.00 0.00 ? 503 PRO C HG2  5  
ATOM 4173  H HG3  . PRO A 1 51 ? -12.065 -24.840 -8.219  1.00 0.00 ? 503 PRO C HG3  5  
ATOM 4174  H HD2  . PRO A 1 51 ? -14.923 -25.334 -8.940  1.00 0.00 ? 503 PRO C HD2  5  
ATOM 4175  H HD3  . PRO A 1 51 ? -14.236 -24.686 -7.438  1.00 0.00 ? 503 PRO C HD3  5  
ATOM 4176  N N    . THR A 1 52 ? -13.461 -21.447 -11.854 1.00 0.00 ? 504 THR C N    5  
ATOM 4177  C CA   . THR A 1 52 ? -14.005 -20.900 -13.070 1.00 0.00 ? 504 THR C CA   5  
ATOM 4178  C C    . THR A 1 52 ? -13.031 -19.889 -13.693 1.00 0.00 ? 504 THR C C    5  
ATOM 4179  O O    . THR A 1 52 ? -12.447 -20.203 -14.748 1.00 0.00 ? 504 THR C O    5  
ATOM 4180  C CB   . THR A 1 52 ? -15.418 -20.266 -12.826 1.00 0.00 ? 504 THR C CB   5  
ATOM 4181  O OG1  . THR A 1 52 ? -15.942 -19.703 -14.036 1.00 0.00 ? 504 THR C OG1  5  
ATOM 4182  C CG2  . THR A 1 52 ? -15.381 -19.198 -11.734 1.00 0.00 ? 504 THR C CG2  5  
ATOM 4183  O OXT  . THR A 1 52 ? -12.815 -18.811 -13.104 1.00 0.00 ? 504 THR C OXT  5  
ATOM 4184  H H    . THR A 1 52 ? -12.776 -20.936 -11.372 1.00 0.00 ? 504 THR C H    5  
ATOM 4185  H HA   . THR A 1 52 ? -14.121 -21.723 -13.763 1.00 0.00 ? 504 THR C HA   5  
ATOM 4186  H HB   . THR A 1 52 ? -16.083 -21.058 -12.506 1.00 0.00 ? 504 THR C HB   5  
ATOM 4187  H HG1  . THR A 1 52 ? -16.118 -18.764 -13.890 1.00 0.00 ? 504 THR C HG1  5  
ATOM 4188  H HG21 . THR A 1 52 ? -14.695 -18.416 -12.020 1.00 0.00 ? 504 THR C HG21 5  
ATOM 4189  H HG22 . THR A 1 52 ? -15.053 -19.644 -10.805 1.00 0.00 ? 504 THR C HG22 5  
ATOM 4190  H HG23 . THR A 1 52 ? -16.369 -18.782 -11.604 1.00 0.00 ? 504 THR C HG23 5  
ATOM 4191  N N    . SER A 1 1  ? -11.046 3.574   7.498   1.00 0.00 ? 453 SER C N    6  
ATOM 4192  C CA   . SER A 1 1  ? -9.808  2.815   7.298   1.00 0.00 ? 453 SER C CA   6  
ATOM 4193  C C    . SER A 1 1  ? -10.120 1.379   6.890   1.00 0.00 ? 453 SER C C    6  
ATOM 4194  O O    . SER A 1 1  ? -10.841 0.663   7.593   1.00 0.00 ? 453 SER C O    6  
ATOM 4195  C CB   . SER A 1 1  ? -8.979  2.830   8.581   1.00 0.00 ? 453 SER C CB   6  
ATOM 4196  O OG   . SER A 1 1  ? -8.734  4.161   9.007   1.00 0.00 ? 453 SER C OG   6  
ATOM 4197  H H1   . SER A 1 1  ? -11.637 3.109   8.216   1.00 0.00 ? 453 SER C H1   6  
ATOM 4198  H H2   . SER A 1 1  ? -11.585 3.628   6.612   1.00 0.00 ? 453 SER C H2   6  
ATOM 4199  H H3   . SER A 1 1  ? -10.822 4.536   7.820   1.00 0.00 ? 453 SER C H3   6  
ATOM 4200  H HA   . SER A 1 1  ? -9.246  3.288   6.508   1.00 0.00 ? 453 SER C HA   6  
ATOM 4201  H HB2  . SER A 1 1  ? -9.514  2.310   9.361   1.00 0.00 ? 453 SER C HB2  6  
ATOM 4202  H HB3  . SER A 1 1  ? -8.035  2.342   8.404   1.00 0.00 ? 453 SER C HB3  6  
ATOM 4203  H HG   . SER A 1 1  ? -8.131  4.145   9.759   1.00 0.00 ? 453 SER C HG   6  
ATOM 4204  N N    . ASN A 1 2  ? -9.563  0.954   5.762   1.00 0.00 ? 454 ASN C N    6  
ATOM 4205  C CA   . ASN A 1 2  ? -9.784  -0.395  5.242   1.00 0.00 ? 454 ASN C CA   6  
ATOM 4206  C C    . ASN A 1 2  ? -9.217  -1.450  6.196   1.00 0.00 ? 454 ASN C C    6  
ATOM 4207  O O    . ASN A 1 2  ? -9.670  -2.594  6.215   1.00 0.00 ? 454 ASN C O    6  
ATOM 4208  C CB   . ASN A 1 2  ? -9.165  -0.532  3.841   1.00 0.00 ? 454 ASN C CB   6  
ATOM 4209  C CG   . ASN A 1 2  ? -9.374  -1.907  3.226   1.00 0.00 ? 454 ASN C CG   6  
ATOM 4210  O OD1  . ASN A 1 2  ? -10.402 -2.174  2.599   1.00 0.00 ? 454 ASN C OD1  6  
ATOM 4211  N ND2  . ASN A 1 2  ? -8.395  -2.773  3.373   1.00 0.00 ? 454 ASN C ND2  6  
ATOM 4212  H H    . ASN A 1 2  ? -8.979  1.567   5.261   1.00 0.00 ? 454 ASN C H    6  
ATOM 4213  H HA   . ASN A 1 2  ? -10.852 -0.543  5.166   1.00 0.00 ? 454 ASN C HA   6  
ATOM 4214  H HB2  . ASN A 1 2  ? -9.611  0.202   3.186   1.00 0.00 ? 454 ASN C HB2  6  
ATOM 4215  H HB3  . ASN A 1 2  ? -8.104  -0.346  3.909   1.00 0.00 ? 454 ASN C HB3  6  
ATOM 4216  H HD21 . ASN A 1 2  ? -7.594  -2.484  3.863   1.00 0.00 ? 454 ASN C HD21 6  
ATOM 4217  H HD22 . ASN A 1 2  ? -8.502  -3.670  2.993   1.00 0.00 ? 454 ASN C HD22 6  
ATOM 4218  N N    . SER A 1 3  ? -8.239  -1.043  7.002   1.00 0.00 ? 455 SER C N    6  
ATOM 4219  C CA   . SER A 1 3  ? -7.624  -1.929  7.986   1.00 0.00 ? 455 SER C CA   6  
ATOM 4220  C C    . SER A 1 3  ? -8.672  -2.472  8.963   1.00 0.00 ? 455 SER C C    6  
ATOM 4221  O O    . SER A 1 3  ? -8.571  -3.611  9.428   1.00 0.00 ? 455 SER C O    6  
ATOM 4222  C CB   . SER A 1 3  ? -6.528  -1.188  8.749   1.00 0.00 ? 455 SER C CB   6  
ATOM 4223  O OG   . SER A 1 3  ? -5.558  -0.654  7.857   1.00 0.00 ? 455 SER C OG   6  
ATOM 4224  H H    . SER A 1 3  ? -7.913  -0.122  6.927   1.00 0.00 ? 455 SER C H    6  
ATOM 4225  H HA   . SER A 1 3  ? -7.181  -2.756  7.452   1.00 0.00 ? 455 SER C HA   6  
ATOM 4226  H HB2  . SER A 1 3  ? -6.966  -0.377  9.311   1.00 0.00 ? 455 SER C HB2  6  
ATOM 4227  H HB3  . SER A 1 3  ? -6.037  -1.871  9.427   1.00 0.00 ? 455 SER C HB3  6  
ATOM 4228  H HG   . SER A 1 3  ? -4.682  -0.774  8.249   1.00 0.00 ? 455 SER C HG   6  
ATOM 4229  N N    . GLN A 1 4  ? -9.685  -1.655  9.258   1.00 0.00 ? 456 GLN C N    6  
ATOM 4230  C CA   . GLN A 1 4  ? -10.757 -2.064  10.153  1.00 0.00 ? 456 GLN C CA   6  
ATOM 4231  C C    . GLN A 1 4  ? -11.631 -3.103  9.476   1.00 0.00 ? 456 GLN C C    6  
ATOM 4232  O O    . GLN A 1 4  ? -12.066 -4.066  10.100  1.00 0.00 ? 456 GLN C O    6  
ATOM 4233  C CB   . GLN A 1 4  ? -11.596 -0.861  10.587  1.00 0.00 ? 456 GLN C CB   6  
ATOM 4234  C CG   . GLN A 1 4  ? -10.836 0.139   11.443  1.00 0.00 ? 456 GLN C CG   6  
ATOM 4235  C CD   . GLN A 1 4  ? -10.260 -0.493  12.697  1.00 0.00 ? 456 GLN C CD   6  
ATOM 4236  O OE1  . GLN A 1 4  ? -9.130  -0.978  12.697  1.00 0.00 ? 456 GLN C OE1  6  
ATOM 4237  N NE2  . GLN A 1 4  ? -11.027 -0.486  13.769  1.00 0.00 ? 456 GLN C NE2  6  
ATOM 4238  H H    . GLN A 1 4  ? -9.712  -0.762  8.856   1.00 0.00 ? 456 GLN C H    6  
ATOM 4239  H HA   . GLN A 1 4  ? -10.304 -2.509  11.027  1.00 0.00 ? 456 GLN C HA   6  
ATOM 4240  H HB2  . GLN A 1 4  ? -11.952 -0.349  9.704   1.00 0.00 ? 456 GLN C HB2  6  
ATOM 4241  H HB3  . GLN A 1 4  ? -12.445 -1.216  11.153  1.00 0.00 ? 456 GLN C HB3  6  
ATOM 4242  H HG2  . GLN A 1 4  ? -10.027 0.553   10.861  1.00 0.00 ? 456 GLN C HG2  6  
ATOM 4243  H HG3  . GLN A 1 4  ? -11.512 0.928   11.733  1.00 0.00 ? 456 GLN C HG3  6  
ATOM 4244  H HE21 . GLN A 1 4  ? -11.916 -0.076  13.704  1.00 0.00 ? 456 GLN C HE21 6  
ATOM 4245  H HE22 . GLN A 1 4  ? -10.687 -0.900  14.593  1.00 0.00 ? 456 GLN C HE22 6  
ATOM 4246  N N    . LEU A 1 5  ? -11.867 -2.907  8.185   1.00 0.00 ? 457 LEU C N    6  
ATOM 4247  C CA   . LEU A 1 5  ? -12.641 -3.848  7.388   1.00 0.00 ? 457 LEU C CA   6  
ATOM 4248  C C    . LEU A 1 5  ? -11.953 -5.199  7.366   1.00 0.00 ? 457 LEU C C    6  
ATOM 4249  O O    . LEU A 1 5  ? -12.602 -6.243  7.481   1.00 0.00 ? 457 LEU C O    6  
ATOM 4250  C CB   . LEU A 1 5  ? -12.821 -3.321  5.958   1.00 0.00 ? 457 LEU C CB   6  
ATOM 4251  C CG   . LEU A 1 5  ? -13.912 -2.259  5.746   1.00 0.00 ? 457 LEU C CG   6  
ATOM 4252  C CD1  . LEU A 1 5  ? -15.279 -2.847  5.995   1.00 0.00 ? 457 LEU C CD1  6  
ATOM 4253  C CD2  . LEU A 1 5  ? -13.695 -1.052  6.634   1.00 0.00 ? 457 LEU C CD2  6  
ATOM 4254  H H    . LEU A 1 5  ? -11.514 -2.103  7.750   1.00 0.00 ? 457 LEU C H    6  
ATOM 4255  H HA   . LEU A 1 5  ? -13.610 -3.955  7.850   1.00 0.00 ? 457 LEU C HA   6  
ATOM 4256  H HB2  . LEU A 1 5  ? -11.880 -2.900  5.637   1.00 0.00 ? 457 LEU C HB2  6  
ATOM 4257  H HB3  . LEU A 1 5  ? -13.047 -4.163  5.322   1.00 0.00 ? 457 LEU C HB3  6  
ATOM 4258  H HG   . LEU A 1 5  ? -13.874 -1.931  4.719   1.00 0.00 ? 457 LEU C HG   6  
ATOM 4259  H HD11 . LEU A 1 5  ? -15.336 -3.213  7.009   1.00 0.00 ? 457 LEU C HD11 6  
ATOM 4260  H HD12 . LEU A 1 5  ? -15.453 -3.663  5.308   1.00 0.00 ? 457 LEU C HD12 6  
ATOM 4261  H HD13 . LEU A 1 5  ? -16.030 -2.087  5.846   1.00 0.00 ? 457 LEU C HD13 6  
ATOM 4262  H HD21 . LEU A 1 5  ? -12.745 -0.596  6.397   1.00 0.00 ? 457 LEU C HD21 6  
ATOM 4263  H HD22 . LEU A 1 5  ? -13.700 -1.368  7.670   1.00 0.00 ? 457 LEU C HD22 6  
ATOM 4264  H HD23 . LEU A 1 5  ? -14.492 -0.343  6.466   1.00 0.00 ? 457 LEU C HD23 6  
ATOM 4265  N N    . ASN A 1 6  ? -10.629 -5.170  7.228   1.00 0.00 ? 458 ASN C N    6  
ATOM 4266  C CA   . ASN A 1 6  ? -9.827  -6.386  7.254   1.00 0.00 ? 458 ASN C CA   6  
ATOM 4267  C C    . ASN A 1 6  ? -10.025 -7.104  8.570   1.00 0.00 ? 458 ASN C C    6  
ATOM 4268  O O    . ASN A 1 6  ? -10.248 -8.306  8.596   1.00 0.00 ? 458 ASN C O    6  
ATOM 4269  C CB   . ASN A 1 6  ? -8.336  -6.075  7.077   1.00 0.00 ? 458 ASN C CB   6  
ATOM 4270  C CG   . ASN A 1 6  ? -7.990  -5.513  5.717   1.00 0.00 ? 458 ASN C CG   6  
ATOM 4271  O OD1  . ASN A 1 6  ? -8.637  -5.817  4.717   1.00 0.00 ? 458 ASN C OD1  6  
ATOM 4272  N ND2  . ASN A 1 6  ? -6.955  -4.703  5.668   1.00 0.00 ? 458 ASN C ND2  6  
ATOM 4273  H H    . ASN A 1 6  ? -10.184 -4.304  7.095   1.00 0.00 ? 458 ASN C H    6  
ATOM 4274  H HA   . ASN A 1 6  ? -10.155 -7.024  6.447   1.00 0.00 ? 458 ASN C HA   6  
ATOM 4275  H HB2  . ASN A 1 6  ? -8.040  -5.355  7.822   1.00 0.00 ? 458 ASN C HB2  6  
ATOM 4276  H HB3  . ASN A 1 6  ? -7.772  -6.985  7.226   1.00 0.00 ? 458 ASN C HB3  6  
ATOM 4277  H HD21 . ASN A 1 6  ? -6.472  -4.515  6.503   1.00 0.00 ? 458 ASN C HD21 6  
ATOM 4278  H HD22 . ASN A 1 6  ? -6.703  -4.318  4.803   1.00 0.00 ? 458 ASN C HD22 6  
ATOM 4279  N N    . ALA A 1 7  ? -9.952  -6.345  9.661   1.00 0.00 ? 459 ALA C N    6  
ATOM 4280  C CA   . ALA A 1 7  ? -10.114 -6.889  11.004  1.00 0.00 ? 459 ALA C CA   6  
ATOM 4281  C C    . ALA A 1 7  ? -11.488 -7.515  11.186  1.00 0.00 ? 459 ALA C C    6  
ATOM 4282  O O    . ALA A 1 7  ? -11.606 -8.624  11.696  1.00 0.00 ? 459 ALA C O    6  
ATOM 4283  C CB   . ALA A 1 7  ? -9.886  -5.802  12.047  1.00 0.00 ? 459 ALA C CB   6  
ATOM 4284  H H    . ALA A 1 7  ? -9.780  -5.384  9.557   1.00 0.00 ? 459 ALA C H    6  
ATOM 4285  H HA   . ALA A 1 7  ? -9.365  -7.657  11.150  1.00 0.00 ? 459 ALA C HA   6  
ATOM 4286  H HB1  . ALA A 1 7  ? -8.911  -5.359  11.899  1.00 0.00 ? 459 ALA C HB1  6  
ATOM 4287  H HB2  . ALA A 1 7  ? -9.939  -6.234  13.034  1.00 0.00 ? 459 ALA C HB2  6  
ATOM 4288  H HB3  . ALA A 1 7  ? -10.647 -5.041  11.943  1.00 0.00 ? 459 ALA C HB3  6  
ATOM 4289  N N    . MET A 1 8  ? -12.526 -6.808  10.750  1.00 0.00 ? 460 MET C N    6  
ATOM 4290  C CA   . MET A 1 8  ? -13.884 -7.304  10.882  1.00 0.00 ? 460 MET C CA   6  
ATOM 4291  C C    . MET A 1 8  ? -14.062 -8.624  10.131  1.00 0.00 ? 460 MET C C    6  
ATOM 4292  O O    . MET A 1 8  ? -14.623 -9.582  10.662  1.00 0.00 ? 460 MET C O    6  
ATOM 4293  C CB   . MET A 1 8  ? -14.898 -6.261  10.400  1.00 0.00 ? 460 MET C CB   6  
ATOM 4294  C CG   . MET A 1 8  ? -14.841 -4.942  11.168  1.00 0.00 ? 460 MET C CG   6  
ATOM 4295  S SD   . MET A 1 8  ? -16.405 -4.042  11.134  1.00 0.00 ? 460 MET C SD   6  
ATOM 4296  C CE   . MET A 1 8  ? -16.596 -3.774  9.386   1.00 0.00 ? 460 MET C CE   6  
ATOM 4297  H H    . MET A 1 8  ? -12.376 -5.928  10.338  1.00 0.00 ? 460 MET C H    6  
ATOM 4298  H HA   . MET A 1 8  ? -14.055 -7.490  11.934  1.00 0.00 ? 460 MET C HA   6  
ATOM 4299  H HB2  . MET A 1 8  ? -14.717 -6.059  9.353   1.00 0.00 ? 460 MET C HB2  6  
ATOM 4300  H HB3  . MET A 1 8  ? -15.888 -6.670  10.506  1.00 0.00 ? 460 MET C HB3  6  
ATOM 4301  H HG2  . MET A 1 8  ? -14.583 -5.145  12.195  1.00 0.00 ? 460 MET C HG2  6  
ATOM 4302  H HG3  . MET A 1 8  ? -14.079 -4.315  10.718  1.00 0.00 ? 460 MET C HG3  6  
ATOM 4303  H HE1  . MET A 1 8  ? -16.403 -4.702  8.867   1.00 0.00 ? 460 MET C HE1  6  
ATOM 4304  H HE2  . MET A 1 8  ? -15.904 -3.015  9.053   1.00 0.00 ? 460 MET C HE2  6  
ATOM 4305  H HE3  . MET A 1 8  ? -17.611 -3.460  9.187   1.00 0.00 ? 460 MET C HE3  6  
ATOM 4306  N N    . ALA A 1 9  ? -13.561 -8.672  8.903   1.00 0.00 ? 461 ALA C N    6  
ATOM 4307  C CA   . ALA A 1 9  ? -13.631 -9.883  8.093   1.00 0.00 ? 461 ALA C CA   6  
ATOM 4308  C C    . ALA A 1 9  ? -12.749 -10.983 8.688   1.00 0.00 ? 461 ALA C C    6  
ATOM 4309  O O    . ALA A 1 9  ? -13.082 -12.167 8.632   1.00 0.00 ? 461 ALA C O    6  
ATOM 4310  C CB   . ALA A 1 9  ? -13.205 -9.580  6.665   1.00 0.00 ? 461 ALA C CB   6  
ATOM 4311  H H    . ALA A 1 9  ? -13.139 -7.869  8.525   1.00 0.00 ? 461 ALA C H    6  
ATOM 4312  H HA   . ALA A 1 9  ? -14.658 -10.221 8.081   1.00 0.00 ? 461 ALA C HA   6  
ATOM 4313  H HB1  . ALA A 1 9  ? -13.340 -10.459 6.053   1.00 0.00 ? 461 ALA C HB1  6  
ATOM 4314  H HB2  . ALA A 1 9  ? -12.164 -9.289  6.654   1.00 0.00 ? 461 ALA C HB2  6  
ATOM 4315  H HB3  . ALA A 1 9  ? -13.806 -8.771  6.274   1.00 0.00 ? 461 ALA C HB3  6  
ATOM 4316  N N    . HIS A 1 10 ? -11.634 -10.567 9.268   1.00 0.00 ? 462 HIS C N    6  
ATOM 4317  C CA   . HIS A 1 10 ? -10.667 -11.472 9.880   1.00 0.00 ? 462 HIS C CA   6  
ATOM 4318  C C    . HIS A 1 10 ? -11.304 -12.292 10.993  1.00 0.00 ? 462 HIS C C    6  
ATOM 4319  O O    . HIS A 1 10 ? -11.143 -13.506 11.041  1.00 0.00 ? 462 HIS C O    6  
ATOM 4320  C CB   . HIS A 1 10 ? -9.470  -10.665 10.413  1.00 0.00 ? 462 HIS C CB   6  
ATOM 4321  C CG   . HIS A 1 10 ? -8.360  -11.488 10.988  1.00 0.00 ? 462 HIS C CG   6  
ATOM 4322  N ND1  . HIS A 1 10 ? -7.412  -12.131 10.221  1.00 0.00 ? 462 HIS C ND1  6  
ATOM 4323  C CD2  . HIS A 1 10 ? -8.042  -11.755 12.269  1.00 0.00 ? 462 HIS C CD2  6  
ATOM 4324  C CE1  . HIS A 1 10 ? -6.564  -12.757 11.012  1.00 0.00 ? 462 HIS C CE1  6  
ATOM 4325  N NE2  . HIS A 1 10 ? -6.925  -12.544 12.257  1.00 0.00 ? 462 HIS C NE2  6  
ATOM 4326  H H    . HIS A 1 10 ? -11.449 -9.600  9.285   1.00 0.00 ? 462 HIS C H    6  
ATOM 4327  H HA   . HIS A 1 10 ? -10.310 -12.153 9.128   1.00 0.00 ? 462 HIS C HA   6  
ATOM 4328  H HB2  . HIS A 1 10 ? -9.055  -10.082 9.606   1.00 0.00 ? 462 HIS C HB2  6  
ATOM 4329  H HB3  . HIS A 1 10 ? -9.821  -9.993  11.183  1.00 0.00 ? 462 HIS C HB3  6  
ATOM 4330  H HD1  . HIS A 1 10 ? -7.362  -12.135 9.237   1.00 0.00 ? 462 HIS C HD1  6  
ATOM 4331  H HD2  . HIS A 1 10 ? -8.569  -11.394 13.141  1.00 0.00 ? 462 HIS C HD2  6  
ATOM 4332  H HE1  . HIS A 1 10 ? -5.714  -13.343 10.693  1.00 0.00 ? 462 HIS C HE1  6  
ATOM 4333  H HE2  . HIS A 1 10 ? -6.368  -12.746 13.044  1.00 0.00 ? 462 HIS C HE2  6  
ATOM 4334  N N    . GLN A 1 11 ? -12.043 -11.632 11.868  1.00 0.00 ? 463 GLN C N    6  
ATOM 4335  C CA   . GLN A 1 11 ? -12.666 -12.307 13.001  1.00 0.00 ? 463 GLN C CA   6  
ATOM 4336  C C    . GLN A 1 11 ? -13.832 -13.197 12.591  1.00 0.00 ? 463 GLN C C    6  
ATOM 4337  O O    . GLN A 1 11 ? -14.171 -14.148 13.301  1.00 0.00 ? 463 GLN C O    6  
ATOM 4338  C CB   . GLN A 1 11 ? -13.061 -11.310 14.090  1.00 0.00 ? 463 GLN C CB   6  
ATOM 4339  C CG   . GLN A 1 11 ? -12.035 -11.232 15.212  1.00 0.00 ? 463 GLN C CG   6  
ATOM 4340  C CD   . GLN A 1 11 ? -10.628 -10.952 14.705  1.00 0.00 ? 463 GLN C CD   6  
ATOM 4341  O OE1  . GLN A 1 11 ? -10.431 -10.208 13.747  1.00 0.00 ? 463 GLN C OE1  6  
ATOM 4342  N NE2  . GLN A 1 11 ? -9.649  -11.585 15.308  1.00 0.00 ? 463 GLN C NE2  6  
ATOM 4343  H H    . GLN A 1 11 ? -12.166 -10.662 11.758  1.00 0.00 ? 463 GLN C H    6  
ATOM 4344  H HA   . GLN A 1 11 ? -11.907 -12.959 13.412  1.00 0.00 ? 463 GLN C HA   6  
ATOM 4345  H HB2  . GLN A 1 11 ? -13.164 -10.328 13.648  1.00 0.00 ? 463 GLN C HB2  6  
ATOM 4346  H HB3  . GLN A 1 11 ? -14.008 -11.607 14.514  1.00 0.00 ? 463 GLN C HB3  6  
ATOM 4347  H HG2  . GLN A 1 11 ? -12.319 -10.440 15.889  1.00 0.00 ? 463 GLN C HG2  6  
ATOM 4348  H HG3  . GLN A 1 11 ? -12.031 -12.172 15.743  1.00 0.00 ? 463 GLN C HG3  6  
ATOM 4349  H HE21 . GLN A 1 11 ? -9.870  -12.195 16.047  1.00 0.00 ? 463 GLN C HE21 6  
ATOM 4350  H HE22 . GLN A 1 11 ? -8.737  -11.432 14.981  1.00 0.00 ? 463 GLN C HE22 6  
ATOM 4351  N N    . ILE A 1 12 ? -14.448 -12.904 11.459  1.00 0.00 ? 464 ILE C N    6  
ATOM 4352  C CA   . ILE A 1 12 ? -15.500 -13.763 10.947  1.00 0.00 ? 464 ILE C CA   6  
ATOM 4353  C C    . ILE A 1 12 ? -14.895 -15.054 10.422  1.00 0.00 ? 464 ILE C C    6  
ATOM 4354  O O    . ILE A 1 12 ? -15.415 -16.139 10.668  1.00 0.00 ? 464 ILE C O    6  
ATOM 4355  C CB   . ILE A 1 12 ? -16.319 -13.090 9.829   1.00 0.00 ? 464 ILE C CB   6  
ATOM 4356  C CG1  . ILE A 1 12 ? -17.066 -11.875 10.375  1.00 0.00 ? 464 ILE C CG1  6  
ATOM 4357  C CG2  . ILE A 1 12 ? -17.305 -14.089 9.209   1.00 0.00 ? 464 ILE C CG2  6  
ATOM 4358  C CD1  . ILE A 1 12 ? -17.884 -11.158 9.330   1.00 0.00 ? 464 ILE C CD1  6  
ATOM 4359  H H    . ILE A 1 12 ? -14.200 -12.094 10.964  1.00 0.00 ? 464 ILE C H    6  
ATOM 4360  H HA   . ILE A 1 12 ? -16.161 -14.004 11.767  1.00 0.00 ? 464 ILE C HA   6  
ATOM 4361  H HB   . ILE A 1 12 ? -15.637 -12.767 9.058   1.00 0.00 ? 464 ILE C HB   6  
ATOM 4362  H HG12 . ILE A 1 12 ? -17.737 -12.196 11.157  1.00 0.00 ? 464 ILE C HG12 6  
ATOM 4363  H HG13 . ILE A 1 12 ? -16.365 -11.167 10.794  1.00 0.00 ? 464 ILE C HG13 6  
ATOM 4364  H HG21 . ILE A 1 12 ? -17.992 -14.433 9.968   1.00 0.00 ? 464 ILE C HG21 6  
ATOM 4365  H HG22 . ILE A 1 12 ? -16.763 -14.935 8.808   1.00 0.00 ? 464 ILE C HG22 6  
ATOM 4366  H HG23 . ILE A 1 12 ? -17.855 -13.605 8.416   1.00 0.00 ? 464 ILE C HG23 6  
ATOM 4367  H HD11 . ILE A 1 12 ? -18.673 -11.809 8.981   1.00 0.00 ? 464 ILE C HD11 6  
ATOM 4368  H HD12 . ILE A 1 12 ? -17.245 -10.894 8.500   1.00 0.00 ? 464 ILE C HD12 6  
ATOM 4369  H HD13 . ILE A 1 12 ? -18.312 -10.264 9.751   1.00 0.00 ? 464 ILE C HD13 6  
ATOM 4370  N N    . GLN A 1 13 ? -13.769 -14.938 9.720   1.00 0.00 ? 465 GLN C N    6  
ATOM 4371  C CA   . GLN A 1 13 ? -13.084 -16.107 9.181   1.00 0.00 ? 465 GLN C CA   6  
ATOM 4372  C C    . GLN A 1 13 ? -12.534 -16.971 10.316  1.00 0.00 ? 465 GLN C C    6  
ATOM 4373  O O    . GLN A 1 13 ? -12.271 -18.160 10.141  1.00 0.00 ? 465 GLN C O    6  
ATOM 4374  C CB   . GLN A 1 13 ? -11.952 -15.702 8.243   1.00 0.00 ? 465 GLN C CB   6  
ATOM 4375  C CG   . GLN A 1 13 ? -11.388 -16.877 7.453   1.00 0.00 ? 465 GLN C CG   6  
ATOM 4376  C CD   . GLN A 1 13 ? -10.175 -16.516 6.635   1.00 0.00 ? 465 GLN C CD   6  
ATOM 4377  O OE1  . GLN A 1 13 ? -10.282 -16.143 5.469   1.00 0.00 ? 465 GLN C OE1  6  
ATOM 4378  N NE2  . GLN A 1 13 ? -9.011  -16.629 7.237   1.00 0.00 ? 465 GLN C NE2  6  
ATOM 4379  H H    . GLN A 1 13 ? -13.397 -14.044 9.553   1.00 0.00 ? 465 GLN C H    6  
ATOM 4380  H HA   . GLN A 1 13 ? -13.811 -16.686 8.629   1.00 0.00 ? 465 GLN C HA   6  
ATOM 4381  H HB2  . GLN A 1 13 ? -12.314 -14.957 7.548   1.00 0.00 ? 465 GLN C HB2  6  
ATOM 4382  H HB3  . GLN A 1 13 ? -11.152 -15.278 8.835   1.00 0.00 ? 465 GLN C HB3  6  
ATOM 4383  H HG2  . GLN A 1 13 ? -11.114 -17.658 8.144   1.00 0.00 ? 465 GLN C HG2  6  
ATOM 4384  H HG3  . GLN A 1 13 ? -12.155 -17.244 6.788   1.00 0.00 ? 465 GLN C HG3  6  
ATOM 4385  H HE21 . GLN A 1 13 ? -9.001  -16.939 8.168   1.00 0.00 ? 465 GLN C HE21 6  
ATOM 4386  H HE22 . GLN A 1 13 ? -8.206  -16.397 6.730   1.00 0.00 ? 465 GLN C HE22 6  
ATOM 4387  N N    . GLU A 1 14 ? -12.355 -16.361 11.478  1.00 0.00 ? 466 GLU C N    6  
ATOM 4388  C CA   . GLU A 1 14 ? -11.903 -17.076 12.657  1.00 0.00 ? 466 GLU C CA   6  
ATOM 4389  C C    . GLU A 1 14 ? -13.011 -17.994 13.164  1.00 0.00 ? 466 GLU C C    6  
ATOM 4390  O O    . GLU A 1 14 ? -12.762 -18.954 13.888  1.00 0.00 ? 466 GLU C O    6  
ATOM 4391  C CB   . GLU A 1 14 ? -11.481 -16.087 13.742  1.00 0.00 ? 466 GLU C CB   6  
ATOM 4392  C CG   . GLU A 1 14 ? -10.262 -15.258 13.365  1.00 0.00 ? 466 GLU C CG   6  
ATOM 4393  C CD   . GLU A 1 14 ? -8.999  -16.084 13.272  1.00 0.00 ? 466 GLU C CD   6  
ATOM 4394  O OE1  . GLU A 1 14 ? -8.829  -16.816 12.276  1.00 0.00 ? 466 GLU C OE1  6  
ATOM 4395  O OE2  . GLU A 1 14 ? -8.165  -16.006 14.197  1.00 0.00 ? 466 GLU C OE2  6  
ATOM 4396  H H    . GLU A 1 14 ? -12.522 -15.397 11.542  1.00 0.00 ? 466 GLU C H    6  
ATOM 4397  H HA   . GLU A 1 14 ? -11.052 -17.679 12.374  1.00 0.00 ? 466 GLU C HA   6  
ATOM 4398  H HB2  . GLU A 1 14 ? -12.302 -15.412 13.936  1.00 0.00 ? 466 GLU C HB2  6  
ATOM 4399  H HB3  . GLU A 1 14 ? -11.253 -16.631 14.644  1.00 0.00 ? 466 GLU C HB3  6  
ATOM 4400  H HG2  . GLU A 1 14 ? -10.441 -14.803 12.400  1.00 0.00 ? 466 GLU C HG2  6  
ATOM 4401  H HG3  . GLU A 1 14 ? -10.121 -14.487 14.109  1.00 0.00 ? 466 GLU C HG3  6  
ATOM 4402  N N    . MET A 1 15 ? -14.240 -17.677 12.775  1.00 0.00 ? 467 MET C N    6  
ATOM 4403  C CA   . MET A 1 15 ? -15.391 -18.486 13.116  1.00 0.00 ? 467 MET C CA   6  
ATOM 4404  C C    . MET A 1 15 ? -15.745 -19.388 11.945  1.00 0.00 ? 467 MET C C    6  
ATOM 4405  O O    . MET A 1 15 ? -16.159 -20.533 12.122  1.00 0.00 ? 467 MET C O    6  
ATOM 4406  C CB   . MET A 1 15 ? -16.592 -17.598 13.447  1.00 0.00 ? 467 MET C CB   6  
ATOM 4407  C CG   . MET A 1 15 ? -16.366 -16.636 14.599  1.00 0.00 ? 467 MET C CG   6  
ATOM 4408  S SD   . MET A 1 15 ? -17.871 -15.760 15.083  1.00 0.00 ? 467 MET C SD   6  
ATOM 4409  C CE   . MET A 1 15 ? -18.290 -14.913 13.559  1.00 0.00 ? 467 MET C CE   6  
ATOM 4410  H H    . MET A 1 15 ? -14.376 -16.869 12.237  1.00 0.00 ? 467 MET C H    6  
ATOM 4411  H HA   . MET A 1 15 ? -15.144 -19.090 13.976  1.00 0.00 ? 467 MET C HA   6  
ATOM 4412  H HB2  . MET A 1 15 ? -16.839 -17.018 12.572  1.00 0.00 ? 467 MET C HB2  6  
ATOM 4413  H HB3  . MET A 1 15 ? -17.429 -18.230 13.693  1.00 0.00 ? 467 MET C HB3  6  
ATOM 4414  H HG2  . MET A 1 15 ? -16.005 -17.194 15.447  1.00 0.00 ? 467 MET C HG2  6  
ATOM 4415  H HG3  . MET A 1 15 ? -15.623 -15.911 14.304  1.00 0.00 ? 467 MET C HG3  6  
ATOM 4416  H HE1  . MET A 1 15 ? -18.435 -15.638 12.772  1.00 0.00 ? 467 MET C HE1  6  
ATOM 4417  H HE2  . MET A 1 15 ? -17.490 -14.241 13.288  1.00 0.00 ? 467 MET C HE2  6  
ATOM 4418  H HE3  . MET A 1 15 ? -19.199 -14.350 13.701  1.00 0.00 ? 467 MET C HE3  6  
ATOM 4419  N N    . PHE A 1 16 ? -15.567 -18.860 10.740  1.00 0.00 ? 468 PHE C N    6  
ATOM 4420  C CA   . PHE A 1 16 ? -15.887 -19.572 9.521   1.00 0.00 ? 468 PHE C CA   6  
ATOM 4421  C C    . PHE A 1 16 ? -14.703 -19.596 8.558   1.00 0.00 ? 468 PHE C C    6  
ATOM 4422  O O    . PHE A 1 16 ? -14.622 -18.781 7.645   1.00 0.00 ? 468 PHE C O    6  
ATOM 4423  C CB   . PHE A 1 16 ? -17.096 -18.930 8.836   1.00 0.00 ? 468 PHE C CB   6  
ATOM 4424  C CG   . PHE A 1 16 ? -18.391 -19.170 9.545   1.00 0.00 ? 468 PHE C CG   6  
ATOM 4425  C CD1  . PHE A 1 16 ? -18.829 -18.298 10.522  1.00 0.00 ? 468 PHE C CD1  6  
ATOM 4426  C CD2  . PHE A 1 16 ? -19.169 -20.270 9.236   1.00 0.00 ? 468 PHE C CD2  6  
ATOM 4427  C CE1  . PHE A 1 16 ? -20.020 -18.520 11.175  1.00 0.00 ? 468 PHE C CE1  6  
ATOM 4428  C CE2  . PHE A 1 16 ? -20.360 -20.497 9.887   1.00 0.00 ? 468 PHE C CE2  6  
ATOM 4429  C CZ   . PHE A 1 16 ? -20.788 -19.619 10.858  1.00 0.00 ? 468 PHE C CZ   6  
ATOM 4430  H H    . PHE A 1 16 ? -15.209 -17.951 10.670  1.00 0.00 ? 468 PHE C H    6  
ATOM 4431  H HA   . PHE A 1 16 ? -16.141 -20.587 9.787   1.00 0.00 ? 468 PHE C HA   6  
ATOM 4432  H HB2  . PHE A 1 16 ? -16.942 -17.864 8.792   1.00 0.00 ? 468 PHE C HB2  6  
ATOM 4433  H HB3  . PHE A 1 16 ? -17.182 -19.310 7.831   1.00 0.00 ? 468 PHE C HB3  6  
ATOM 4434  H HD1  . PHE A 1 16 ? -18.231 -17.436 10.775  1.00 0.00 ? 468 PHE C HD1  6  
ATOM 4435  H HD2  . PHE A 1 16 ? -18.833 -20.958 8.472   1.00 0.00 ? 468 PHE C HD2  6  
ATOM 4436  H HE1  . PHE A 1 16 ? -20.352 -17.828 11.934  1.00 0.00 ? 468 PHE C HE1  6  
ATOM 4437  H HE2  . PHE A 1 16 ? -20.960 -21.360 9.635   1.00 0.00 ? 468 PHE C HE2  6  
ATOM 4438  H HZ   . PHE A 1 16 ? -21.721 -19.792 11.372  1.00 0.00 ? 468 PHE C HZ   6  
ATOM 4439  N N    . PRO A 1 17 ? -13.756 -20.524 8.761   1.00 0.00 ? 469 PRO C N    6  
ATOM 4440  C CA   . PRO A 1 17 ? -12.605 -20.689 7.873   1.00 0.00 ? 469 PRO C CA   6  
ATOM 4441  C C    . PRO A 1 17 ? -13.025 -21.310 6.546   1.00 0.00 ? 469 PRO C C    6  
ATOM 4442  O O    . PRO A 1 17 ? -12.261 -21.344 5.584   1.00 0.00 ? 469 PRO C O    6  
ATOM 4443  C CB   . PRO A 1 17 ? -11.687 -21.661 8.633   1.00 0.00 ? 469 PRO C CB   6  
ATOM 4444  C CG   . PRO A 1 17 ? -12.249 -21.739 10.013  1.00 0.00 ? 469 PRO C CG   6  
ATOM 4445  C CD   . PRO A 1 17 ? -13.707 -21.448 9.887   1.00 0.00 ? 469 PRO C CD   6  
ATOM 4446  H HA   . PRO A 1 17 ? -12.098 -19.751 7.711   1.00 0.00 ? 469 PRO C HA   6  
ATOM 4447  H HB2  . PRO A 1 17 ? -11.705 -22.626 8.147   1.00 0.00 ? 469 PRO C HB2  6  
ATOM 4448  H HB3  . PRO A 1 17 ? -10.678 -21.277 8.641   1.00 0.00 ? 469 PRO C HB3  6  
ATOM 4449  H HG2  . PRO A 1 17 ? -12.096 -22.727 10.421  1.00 0.00 ? 469 PRO C HG2  6  
ATOM 4450  H HG3  . PRO A 1 17 ? -11.776 -20.996 10.636  1.00 0.00 ? 469 PRO C HG3  6  
ATOM 4451  H HD2  . PRO A 1 17 ? -14.272 -22.343 9.681   1.00 0.00 ? 469 PRO C HD2  6  
ATOM 4452  H HD3  . PRO A 1 17 ? -14.064 -20.964 10.779  1.00 0.00 ? 469 PRO C HD3  6  
ATOM 4453  N N    . GLN A 1 18 ? -14.256 -21.795 6.524   1.00 0.00 ? 470 GLN C N    6  
ATOM 4454  C CA   . GLN A 1 18 ? -14.833 -22.453 5.357   1.00 0.00 ? 470 GLN C CA   6  
ATOM 4455  C C    . GLN A 1 18 ? -15.159 -21.455 4.240   1.00 0.00 ? 470 GLN C C    6  
ATOM 4456  O O    . GLN A 1 18 ? -15.410 -21.852 3.103   1.00 0.00 ? 470 GLN C O    6  
ATOM 4457  C CB   . GLN A 1 18 ? -16.104 -23.208 5.765   1.00 0.00 ? 470 GLN C CB   6  
ATOM 4458  C CG   . GLN A 1 18 ? -17.199 -22.307 6.326   1.00 0.00 ? 470 GLN C CG   6  
ATOM 4459  C CD   . GLN A 1 18 ? -18.395 -23.078 6.864   1.00 0.00 ? 470 GLN C CD   6  
ATOM 4460  O OE1  . GLN A 1 18 ? -18.259 -24.203 7.342   1.00 0.00 ? 470 GLN C OE1  6  
ATOM 4461  N NE2  . GLN A 1 18 ? -19.571 -22.477 6.787   1.00 0.00 ? 470 GLN C NE2  6  
ATOM 4462  H H    . GLN A 1 18 ? -14.790 -21.712 7.340   1.00 0.00 ? 470 GLN C H    6  
ATOM 4463  H HA   . GLN A 1 18 ? -14.115 -23.165 4.987   1.00 0.00 ? 470 GLN C HA   6  
ATOM 4464  H HB2  . GLN A 1 18 ? -16.499 -23.721 4.900   1.00 0.00 ? 470 GLN C HB2  6  
ATOM 4465  H HB3  . GLN A 1 18 ? -15.848 -23.938 6.518   1.00 0.00 ? 470 GLN C HB3  6  
ATOM 4466  H HG2  . GLN A 1 18 ? -16.785 -21.715 7.127   1.00 0.00 ? 470 GLN C HG2  6  
ATOM 4467  H HG3  . GLN A 1 18 ? -17.536 -21.653 5.535   1.00 0.00 ? 470 GLN C HG3  6  
ATOM 4468  H HE21 . GLN A 1 18 ? -19.616 -21.579 6.390   1.00 0.00 ? 470 GLN C HE21 6  
ATOM 4469  H HE22 . GLN A 1 18 ? -20.358 -22.947 7.137   1.00 0.00 ? 470 GLN C HE22 6  
ATOM 4470  N N    . VAL A 1 19 ? -15.158 -20.170 4.563   1.00 0.00 ? 471 VAL C N    6  
ATOM 4471  C CA   . VAL A 1 19 ? -15.499 -19.157 3.588   1.00 0.00 ? 471 VAL C CA   6  
ATOM 4472  C C    . VAL A 1 19 ? -14.262 -18.360 3.156   1.00 0.00 ? 471 VAL C C    6  
ATOM 4473  O O    . VAL A 1 19 ? -13.248 -18.341 3.858   1.00 0.00 ? 471 VAL C O    6  
ATOM 4474  C CB   . VAL A 1 19 ? -16.575 -18.184 4.129   1.00 0.00 ? 471 VAL C CB   6  
ATOM 4475  C CG1  . VAL A 1 19 ? -17.771 -18.942 4.673   1.00 0.00 ? 471 VAL C CG1  6  
ATOM 4476  C CG2  . VAL A 1 19 ? -15.995 -17.259 5.179   1.00 0.00 ? 471 VAL C CG2  6  
ATOM 4477  H H    . VAL A 1 19 ? -14.913 -19.892 5.469   1.00 0.00 ? 471 VAL C H    6  
ATOM 4478  H HA   . VAL A 1 19 ? -15.905 -19.664 2.726   1.00 0.00 ? 471 VAL C HA   6  
ATOM 4479  H HB   . VAL A 1 19 ? -16.914 -17.583 3.301   1.00 0.00 ? 471 VAL C HB   6  
ATOM 4480  H HG11 . VAL A 1 19 ? -18.517 -18.238 5.010   1.00 0.00 ? 471 VAL C HG11 6  
ATOM 4481  H HG12 . VAL A 1 19 ? -17.458 -19.559 5.502   1.00 0.00 ? 471 VAL C HG12 6  
ATOM 4482  H HG13 . VAL A 1 19 ? -18.188 -19.565 3.895   1.00 0.00 ? 471 VAL C HG13 6  
ATOM 4483  H HG21 . VAL A 1 19 ? -15.219 -16.661 4.721   1.00 0.00 ? 471 VAL C HG21 6  
ATOM 4484  H HG22 . VAL A 1 19 ? -15.578 -17.841 5.985   1.00 0.00 ? 471 VAL C HG22 6  
ATOM 4485  H HG23 . VAL A 1 19 ? -16.771 -16.612 5.558   1.00 0.00 ? 471 VAL C HG23 6  
ATOM 4486  N N    . PRO A 1 20 ? -14.328 -17.714 1.979   1.00 0.00 ? 472 PRO C N    6  
ATOM 4487  C CA   . PRO A 1 20 ? -13.246 -16.886 1.458   1.00 0.00 ? 472 PRO C CA   6  
ATOM 4488  C C    . PRO A 1 20 ? -13.210 -15.515 2.121   1.00 0.00 ? 472 PRO C C    6  
ATOM 4489  O O    . PRO A 1 20 ? -14.253 -14.918 2.412   1.00 0.00 ? 472 PRO C O    6  
ATOM 4490  C CB   . PRO A 1 20 ? -13.584 -16.738 -0.036  1.00 0.00 ? 472 PRO C CB   6  
ATOM 4491  C CG   . PRO A 1 20 ? -14.767 -17.615 -0.262  1.00 0.00 ? 472 PRO C CG   6  
ATOM 4492  C CD   . PRO A 1 20 ? -15.448 -17.744 1.062   1.00 0.00 ? 472 PRO C CD   6  
ATOM 4493  H HA   . PRO A 1 20 ? -12.287 -17.369 1.570   1.00 0.00 ? 472 PRO C HA   6  
ATOM 4494  H HB2  . PRO A 1 20 ? -13.811 -15.705 -0.252  1.00 0.00 ? 472 PRO C HB2  6  
ATOM 4495  H HB3  . PRO A 1 20 ? -12.742 -17.056 -0.632  1.00 0.00 ? 472 PRO C HB3  6  
ATOM 4496  H HG2  . PRO A 1 20 ? -15.427 -17.161 -0.984  1.00 0.00 ? 472 PRO C HG2  6  
ATOM 4497  H HG3  . PRO A 1 20 ? -14.436 -18.583 -0.608  1.00 0.00 ? 472 PRO C HG3  6  
ATOM 4498  H HD2  . PRO A 1 20 ? -16.115 -16.914 1.246   1.00 0.00 ? 472 PRO C HD2  6  
ATOM 4499  H HD3  . PRO A 1 20 ? -15.975 -18.681 1.129   1.00 0.00 ? 472 PRO C HD3  6  
ATOM 4500  N N    . TYR A 1 21 ? -12.011 -15.016 2.320   1.00 0.00 ? 473 TYR C N    6  
ATOM 4501  C CA   . TYR A 1 21 ? -11.785 -13.732 2.973   1.00 0.00 ? 473 TYR C CA   6  
ATOM 4502  C C    . TYR A 1 21 ? -12.387 -12.588 2.146   1.00 0.00 ? 473 TYR C C    6  
ATOM 4503  O O    . TYR A 1 21 ? -13.002 -11.670 2.694   1.00 0.00 ? 473 TYR C O    6  
ATOM 4504  C CB   . TYR A 1 21 ? -10.279 -13.517 3.139   1.00 0.00 ? 473 TYR C CB   6  
ATOM 4505  C CG   . TYR A 1 21 ? -9.881  -12.594 4.275   1.00 0.00 ? 473 TYR C CG   6  
ATOM 4506  C CD1  . TYR A 1 21 ? -10.010 -11.216 4.168   1.00 0.00 ? 473 TYR C CD1  6  
ATOM 4507  C CD2  . TYR A 1 21 ? -9.345  -13.112 5.444   1.00 0.00 ? 473 TYR C CD2  6  
ATOM 4508  C CE1  . TYR A 1 21 ? -9.615  -10.383 5.200   1.00 0.00 ? 473 TYR C CE1  6  
ATOM 4509  C CE2  . TYR A 1 21 ? -8.957  -12.291 6.477   1.00 0.00 ? 473 TYR C CE2  6  
ATOM 4510  C CZ   . TYR A 1 21 ? -9.091  -10.930 6.351   1.00 0.00 ? 473 TYR C CZ   6  
ATOM 4511  O OH   . TYR A 1 21 ? -8.682  -10.108 7.378   1.00 0.00 ? 473 TYR C OH   6  
ATOM 4512  H H    . TYR A 1 21 ? -11.235 -15.532 2.013   1.00 0.00 ? 473 TYR C H    6  
ATOM 4513  H HA   . TYR A 1 21 ? -12.248 -13.755 3.947   1.00 0.00 ? 473 TYR C HA   6  
ATOM 4514  H HB2  . TYR A 1 21 ? -9.810  -14.471 3.318   1.00 0.00 ? 473 TYR C HB2  6  
ATOM 4515  H HB3  . TYR A 1 21 ? -9.886  -13.102 2.222   1.00 0.00 ? 473 TYR C HB3  6  
ATOM 4516  H HD1  . TYR A 1 21 ? -10.427 -10.794 3.266   1.00 0.00 ? 473 TYR C HD1  6  
ATOM 4517  H HD2  . TYR A 1 21 ? -9.240  -14.182 5.543   1.00 0.00 ? 473 TYR C HD2  6  
ATOM 4518  H HE1  . TYR A 1 21 ? -9.723  -9.314  5.103   1.00 0.00 ? 473 TYR C HE1  6  
ATOM 4519  H HE2  . TYR A 1 21 ? -8.545  -12.717 7.381   1.00 0.00 ? 473 TYR C HE2  6  
ATOM 4520  H HH   . TYR A 1 21 ? -9.394  -9.494  7.607   1.00 0.00 ? 473 TYR C HH   6  
ATOM 4521  N N    . HIS A 1 22 ? -12.221 -12.670 0.817   1.00 0.00 ? 474 HIS C N    6  
ATOM 4522  C CA   . HIS A 1 22 ? -12.707 -11.625 -0.108  1.00 0.00 ? 474 HIS C CA   6  
ATOM 4523  C C    . HIS A 1 22 ? -14.183 -11.343 0.078   1.00 0.00 ? 474 HIS C C    6  
ATOM 4524  O O    . HIS A 1 22 ? -14.586 -10.203 0.275   1.00 0.00 ? 474 HIS C O    6  
ATOM 4525  C CB   . HIS A 1 22 ? -12.502 -12.029 -1.572  1.00 0.00 ? 474 HIS C CB   6  
ATOM 4526  C CG   . HIS A 1 22 ? -11.089 -12.194 -2.002  1.00 0.00 ? 474 HIS C CG   6  
ATOM 4527  N ND1  . HIS A 1 22 ? -10.100 -11.279 -1.732  1.00 0.00 ? 474 HIS C ND1  6  
ATOM 4528  C CD2  . HIS A 1 22 ? -10.507 -13.183 -2.704  1.00 0.00 ? 474 HIS C CD2  6  
ATOM 4529  C CE1  . HIS A 1 22 ? -8.965  -11.698 -2.251  1.00 0.00 ? 474 HIS C CE1  6  
ATOM 4530  N NE2  . HIS A 1 22 ? -9.184  -12.856 -2.847  1.00 0.00 ? 474 HIS C NE2  6  
ATOM 4531  H H    . HIS A 1 22 ? -11.752 -13.454 0.455   1.00 0.00 ? 474 HIS C H    6  
ATOM 4532  H HA   . HIS A 1 22 ? -12.149 -10.722 0.082   1.00 0.00 ? 474 HIS C HA   6  
ATOM 4533  H HB2  . HIS A 1 22 ? -12.998 -12.971 -1.741  1.00 0.00 ? 474 HIS C HB2  6  
ATOM 4534  H HB3  . HIS A 1 22 ? -12.957 -11.281 -2.203  1.00 0.00 ? 474 HIS C HB3  6  
ATOM 4535  H HD1  . HIS A 1 22 ? -10.212 -10.443 -1.225  1.00 0.00 ? 474 HIS C HD1  6  
ATOM 4536  H HD2  . HIS A 1 22 ? -11.007 -14.063 -3.085  1.00 0.00 ? 474 HIS C HD2  6  
ATOM 4537  H HE1  . HIS A 1 22 ? -8.018  -11.184 -2.198  1.00 0.00 ? 474 HIS C HE1  6  
ATOM 4538  H HE2  . HIS A 1 22 ? -8.479  -13.477 -3.136  1.00 0.00 ? 474 HIS C HE2  6  
ATOM 4539  N N    . LEU A 1 23 ? -14.980 -12.395 0.017   1.00 0.00 ? 475 LEU C N    6  
ATOM 4540  C CA   . LEU A 1 23 ? -16.427 -12.269 0.050   1.00 0.00 ? 475 LEU C CA   6  
ATOM 4541  C C    . LEU A 1 23 ? -16.899 -11.672 1.361   1.00 0.00 ? 475 LEU C C    6  
ATOM 4542  O O    . LEU A 1 23 ? -17.829 -10.862 1.386   1.00 0.00 ? 475 LEU C O    6  
ATOM 4543  C CB   . LEU A 1 23 ? -17.079 -13.624 -0.188  1.00 0.00 ? 475 LEU C CB   6  
ATOM 4544  C CG   . LEU A 1 23 ? -16.497 -14.451 -1.344  1.00 0.00 ? 475 LEU C CG   6  
ATOM 4545  C CD1  . LEU A 1 23 ? -17.373 -15.649 -1.634  1.00 0.00 ? 475 LEU C CD1  6  
ATOM 4546  C CD2  . LEU A 1 23 ? -16.306 -13.604 -2.598  1.00 0.00 ? 475 LEU C CD2  6  
ATOM 4547  H H    . LEU A 1 23 ? -14.586 -13.287 -0.045  1.00 0.00 ? 475 LEU C H    6  
ATOM 4548  H HA   . LEU A 1 23 ? -16.713 -11.604 -0.752  1.00 0.00 ? 475 LEU C HA   6  
ATOM 4549  H HB2  . LEU A 1 23 ? -16.992 -14.204 0.719   1.00 0.00 ? 475 LEU C HB2  6  
ATOM 4550  H HB3  . LEU A 1 23 ? -18.125 -13.461 -0.388  1.00 0.00 ? 475 LEU C HB3  6  
ATOM 4551  H HG   . LEU A 1 23 ? -15.530 -14.824 -1.042  1.00 0.00 ? 475 LEU C HG   6  
ATOM 4552  H HD11 . LEU A 1 23 ? -18.363 -15.314 -1.908  1.00 0.00 ? 475 LEU C HD11 6  
ATOM 4553  H HD12 . LEU A 1 23 ? -17.434 -16.272 -0.753  1.00 0.00 ? 475 LEU C HD12 6  
ATOM 4554  H HD13 . LEU A 1 23 ? -16.947 -16.218 -2.448  1.00 0.00 ? 475 LEU C HD13 6  
ATOM 4555  H HD21 . LEU A 1 23 ? -15.617 -12.798 -2.382  1.00 0.00 ? 475 LEU C HD21 6  
ATOM 4556  H HD22 . LEU A 1 23 ? -17.254 -13.198 -2.914  1.00 0.00 ? 475 LEU C HD22 6  
ATOM 4557  H HD23 . LEU A 1 23 ? -15.892 -14.220 -3.384  1.00 0.00 ? 475 LEU C HD23 6  
ATOM 4558  N N    . VAL A 1 24 ? -16.254 -12.068 2.442   1.00 0.00 ? 476 VAL C N    6  
ATOM 4559  C CA   . VAL A 1 24 ? -16.582 -11.551 3.753   1.00 0.00 ? 476 VAL C CA   6  
ATOM 4560  C C    . VAL A 1 24 ? -16.237 -10.068 3.827   1.00 0.00 ? 476 VAL C C    6  
ATOM 4561  O O    . VAL A 1 24 ? -17.089 -9.238  4.133   1.00 0.00 ? 476 VAL C O    6  
ATOM 4562  C CB   . VAL A 1 24 ? -15.821 -12.320 4.857   1.00 0.00 ? 476 VAL C CB   6  
ATOM 4563  C CG1  . VAL A 1 24 ? -16.155 -11.770 6.229   1.00 0.00 ? 476 VAL C CG1  6  
ATOM 4564  C CG2  . VAL A 1 24 ? -16.149 -13.800 4.791   1.00 0.00 ? 476 VAL C CG2  6  
ATOM 4565  H H    . VAL A 1 24 ? -15.534 -12.727 2.355   1.00 0.00 ? 476 VAL C H    6  
ATOM 4566  H HA   . VAL A 1 24 ? -17.644 -11.676 3.909   1.00 0.00 ? 476 VAL C HA   6  
ATOM 4567  H HB   . VAL A 1 24 ? -14.762 -12.200 4.688   1.00 0.00 ? 476 VAL C HB   6  
ATOM 4568  H HG11 . VAL A 1 24 ? -17.216 -11.865 6.408   1.00 0.00 ? 476 VAL C HG11 6  
ATOM 4569  H HG12 . VAL A 1 24 ? -15.873 -10.728 6.275   1.00 0.00 ? 476 VAL C HG12 6  
ATOM 4570  H HG13 . VAL A 1 24 ? -15.611 -12.322 6.980   1.00 0.00 ? 476 VAL C HG13 6  
ATOM 4571  H HG21 . VAL A 1 24 ? -17.209 -13.940 4.928   1.00 0.00 ? 476 VAL C HG21 6  
ATOM 4572  H HG22 . VAL A 1 24 ? -15.611 -14.322 5.570   1.00 0.00 ? 476 VAL C HG22 6  
ATOM 4573  H HG23 . VAL A 1 24 ? -15.856 -14.190 3.828   1.00 0.00 ? 476 VAL C HG23 6  
ATOM 4574  N N    . LEU A 1 25 ? -14.988 -9.746  3.500   1.00 0.00 ? 477 LEU C N    6  
ATOM 4575  C CA   . LEU A 1 25 ? -14.491 -8.370  3.510   1.00 0.00 ? 477 LEU C CA   6  
ATOM 4576  C C    . LEU A 1 25 ? -15.395 -7.484  2.658   1.00 0.00 ? 477 LEU C C    6  
ATOM 4577  O O    . LEU A 1 25 ? -15.740 -6.365  3.046   1.00 0.00 ? 477 LEU C O    6  
ATOM 4578  C CB   . LEU A 1 25 ? -13.063 -8.353  2.949   1.00 0.00 ? 477 LEU C CB   6  
ATOM 4579  C CG   . LEU A 1 25 ? -12.097 -7.333  3.550   1.00 0.00 ? 477 LEU C CG   6  
ATOM 4580  C CD1  . LEU A 1 25 ? -10.730 -7.455  2.902   1.00 0.00 ? 477 LEU C CD1  6  
ATOM 4581  C CD2  . LEU A 1 25 ? -12.626 -5.920  3.404   1.00 0.00 ? 477 LEU C CD2  6  
ATOM 4582  H H    . LEU A 1 25 ? -14.367 -10.462 3.238   1.00 0.00 ? 477 LEU C H    6  
ATOM 4583  H HA   . LEU A 1 25 ? -14.487 -8.000  4.526   1.00 0.00 ? 477 LEU C HA   6  
ATOM 4584  H HB2  . LEU A 1 25 ? -12.637 -9.334  3.092   1.00 0.00 ? 477 LEU C HB2  6  
ATOM 4585  H HB3  . LEU A 1 25 ? -13.127 -8.166  1.887   1.00 0.00 ? 477 LEU C HB3  6  
ATOM 4586  H HG   . LEU A 1 25 ? -11.989 -7.547  4.602   1.00 0.00 ? 477 LEU C HG   6  
ATOM 4587  H HD11 . LEU A 1 25 ? -10.816 -7.273  1.841   1.00 0.00 ? 477 LEU C HD11 6  
ATOM 4588  H HD12 . LEU A 1 25 ? -10.342 -8.449  3.065   1.00 0.00 ? 477 LEU C HD12 6  
ATOM 4589  H HD13 . LEU A 1 25 ? -10.059 -6.730  3.338   1.00 0.00 ? 477 LEU C HD13 6  
ATOM 4590  H HD21 . LEU A 1 25 ? -13.568 -5.843  3.928   1.00 0.00 ? 477 LEU C HD21 6  
ATOM 4591  H HD22 . LEU A 1 25 ? -12.776 -5.699  2.358   1.00 0.00 ? 477 LEU C HD22 6  
ATOM 4592  H HD23 . LEU A 1 25 ? -11.919 -5.223  3.827   1.00 0.00 ? 477 LEU C HD23 6  
ATOM 4593  N N    . GLN A 1 26 ? -15.770 -8.005  1.502   1.00 0.00 ? 478 GLN C N    6  
ATOM 4594  C CA   . GLN A 1 26 ? -16.638 -7.314  0.576   1.00 0.00 ? 478 GLN C CA   6  
ATOM 4595  C C    . GLN A 1 26 ? -17.923 -6.859  1.257   1.00 0.00 ? 478 GLN C C    6  
ATOM 4596  O O    . GLN A 1 26 ? -18.247 -5.674  1.250   1.00 0.00 ? 478 GLN C O    6  
ATOM 4597  C CB   . GLN A 1 26 ? -16.980 -8.225  -0.598  1.00 0.00 ? 478 GLN C CB   6  
ATOM 4598  C CG   . GLN A 1 26 ? -17.908 -7.587  -1.604  1.00 0.00 ? 478 GLN C CG   6  
ATOM 4599  C CD   . GLN A 1 26 ? -18.365 -8.544  -2.686  1.00 0.00 ? 478 GLN C CD   6  
ATOM 4600  O OE1  . GLN A 1 26 ? -18.607 -8.137  -3.821  1.00 0.00 ? 478 GLN C OE1  6  
ATOM 4601  N NE2  . GLN A 1 26 ? -18.502 -9.814  -2.346  1.00 0.00 ? 478 GLN C NE2  6  
ATOM 4602  H H    . GLN A 1 26 ? -15.434 -8.894  1.259   1.00 0.00 ? 478 GLN C H    6  
ATOM 4603  H HA   . GLN A 1 26 ? -16.112 -6.450  0.202   1.00 0.00 ? 478 GLN C HA   6  
ATOM 4604  H HB2  . GLN A 1 26 ? -16.066 -8.500  -1.104  1.00 0.00 ? 478 GLN C HB2  6  
ATOM 4605  H HB3  . GLN A 1 26 ? -17.453 -9.118  -0.216  1.00 0.00 ? 478 GLN C HB3  6  
ATOM 4606  H HG2  . GLN A 1 26 ? -18.776 -7.220  -1.078  1.00 0.00 ? 478 GLN C HG2  6  
ATOM 4607  H HG3  . GLN A 1 26 ? -17.392 -6.758  -2.065  1.00 0.00 ? 478 GLN C HG3  6  
ATOM 4608  H HE21 . GLN A 1 26 ? -18.304 -10.073 -1.423  1.00 0.00 ? 478 GLN C HE21 6  
ATOM 4609  H HE22 . GLN A 1 26 ? -18.808 -10.445 -3.033  1.00 0.00 ? 478 GLN C HE22 6  
ATOM 4610  N N    . ASP A 1 27 ? -18.641 -7.799  1.866   1.00 0.00 ? 479 ASP C N    6  
ATOM 4611  C CA   . ASP A 1 27 ? -19.919 -7.481  2.502   1.00 0.00 ? 479 ASP C CA   6  
ATOM 4612  C C    . ASP A 1 27 ? -19.735 -6.545  3.671   1.00 0.00 ? 479 ASP C C    6  
ATOM 4613  O O    . ASP A 1 27 ? -20.616 -5.768  3.993   1.00 0.00 ? 479 ASP C O    6  
ATOM 4614  C CB   . ASP A 1 27 ? -20.649 -8.733  2.963   1.00 0.00 ? 479 ASP C CB   6  
ATOM 4615  C CG   . ASP A 1 27 ? -22.036 -8.407  3.494   1.00 0.00 ? 479 ASP C CG   6  
ATOM 4616  O OD1  . ASP A 1 27 ? -22.887 -7.961  2.696   1.00 0.00 ? 479 ASP C OD1  6  
ATOM 4617  O OD2  . ASP A 1 27 ? -22.285 -8.600  4.701   1.00 0.00 ? 479 ASP C OD2  6  
ATOM 4618  H H    . ASP A 1 27 ? -18.302 -8.721  1.898   1.00 0.00 ? 479 ASP C H    6  
ATOM 4619  H HA   . ASP A 1 27 ? -20.527 -6.981  1.762   1.00 0.00 ? 479 ASP C HA   6  
ATOM 4620  H HB2  . ASP A 1 27 ? -20.741 -9.415  2.133   1.00 0.00 ? 479 ASP C HB2  6  
ATOM 4621  H HB3  . ASP A 1 27 ? -20.081 -9.203  3.750   1.00 0.00 ? 479 ASP C HB3  6  
ATOM 4622  N N    . LEU A 1 28 ? -18.585 -6.606  4.295   1.00 0.00 ? 480 LEU C N    6  
ATOM 4623  C CA   . LEU A 1 28 ? -18.292 -5.739  5.415   1.00 0.00 ? 480 LEU C CA   6  
ATOM 4624  C C    . LEU A 1 28 ? -18.220 -4.284  4.987   1.00 0.00 ? 480 LEU C C    6  
ATOM 4625  O O    . LEU A 1 28 ? -18.431 -3.390  5.788   1.00 0.00 ? 480 LEU C O    6  
ATOM 4626  C CB   . LEU A 1 28 ? -17.010 -6.158  6.133   1.00 0.00 ? 480 LEU C CB   6  
ATOM 4627  C CG   . LEU A 1 28 ? -17.201 -7.017  7.380   1.00 0.00 ? 480 LEU C CG   6  
ATOM 4628  C CD1  . LEU A 1 28 ? -18.333 -6.486  8.238   1.00 0.00 ? 480 LEU C CD1  6  
ATOM 4629  C CD2  . LEU A 1 28 ? -17.478 -8.425  6.995   1.00 0.00 ? 480 LEU C CD2  6  
ATOM 4630  H H    . LEU A 1 28 ? -17.920 -7.256  3.997   1.00 0.00 ? 480 LEU C H    6  
ATOM 4631  H HA   . LEU A 1 28 ? -19.117 -5.835  6.103   1.00 0.00 ? 480 LEU C HA   6  
ATOM 4632  H HB2  . LEU A 1 28 ? -16.411 -6.721  5.434   1.00 0.00 ? 480 LEU C HB2  6  
ATOM 4633  H HB3  . LEU A 1 28 ? -16.459 -5.281  6.407   1.00 0.00 ? 480 LEU C HB3  6  
ATOM 4634  H HG   . LEU A 1 28 ? -16.296 -6.998  7.968   1.00 0.00 ? 480 LEU C HG   6  
ATOM 4635  H HD11 . LEU A 1 28 ? -19.277 -6.739  7.780   1.00 0.00 ? 480 LEU C HD11 6  
ATOM 4636  H HD12 . LEU A 1 28 ? -18.251 -5.412  8.321   1.00 0.00 ? 480 LEU C HD12 6  
ATOM 4637  H HD13 . LEU A 1 28 ? -18.280 -6.929  9.219   1.00 0.00 ? 480 LEU C HD13 6  
ATOM 4638  H HD21 . LEU A 1 28 ? -16.629 -8.826  6.463   1.00 0.00 ? 480 LEU C HD21 6  
ATOM 4639  H HD22 . LEU A 1 28 ? -18.349 -8.433  6.352   1.00 0.00 ? 480 LEU C HD22 6  
ATOM 4640  H HD23 . LEU A 1 28 ? -17.669 -9.009  7.881   1.00 0.00 ? 480 LEU C HD23 6  
ATOM 4641  N N    . GLN A 1 29 ? -17.925 -4.049  3.727   1.00 0.00 ? 481 GLN C N    6  
ATOM 4642  C CA   . GLN A 1 29 ? -17.898 -2.697  3.209   1.00 0.00 ? 481 GLN C CA   6  
ATOM 4643  C C    . GLN A 1 29 ? -19.313 -2.277  2.827   1.00 0.00 ? 481 GLN C C    6  
ATOM 4644  O O    . GLN A 1 29 ? -19.630 -1.089  2.740   1.00 0.00 ? 481 GLN C O    6  
ATOM 4645  C CB   . GLN A 1 29 ? -16.968 -2.605  2.002   1.00 0.00 ? 481 GLN C CB   6  
ATOM 4646  C CG   . GLN A 1 29 ? -15.527 -2.956  2.321   1.00 0.00 ? 481 GLN C CG   6  
ATOM 4647  C CD   . GLN A 1 29 ? -14.596 -2.732  1.152   1.00 0.00 ? 481 GLN C CD   6  
ATOM 4648  O OE1  . GLN A 1 29 ? -14.989 -2.859  -0.008  1.00 0.00 ? 481 GLN C OE1  6  
ATOM 4649  N NE2  . GLN A 1 29 ? -13.356 -2.392  1.447   1.00 0.00 ? 481 GLN C NE2  6  
ATOM 4650  H H    . GLN A 1 29 ? -17.719 -4.800  3.125   1.00 0.00 ? 481 GLN C H    6  
ATOM 4651  H HA   . GLN A 1 29 ? -17.533 -2.046  3.993   1.00 0.00 ? 481 GLN C HA   6  
ATOM 4652  H HB2  . GLN A 1 29 ? -17.319 -3.283  1.238   1.00 0.00 ? 481 GLN C HB2  6  
ATOM 4653  H HB3  . GLN A 1 29 ? -16.993 -1.600  1.618   1.00 0.00 ? 481 GLN C HB3  6  
ATOM 4654  H HG2  . GLN A 1 29 ? -15.196 -2.342  3.146   1.00 0.00 ? 481 GLN C HG2  6  
ATOM 4655  H HG3  . GLN A 1 29 ? -15.483 -3.994  2.608   1.00 0.00 ? 481 GLN C HG3  6  
ATOM 4656  H HE21 . GLN A 1 29 ? -13.110 -2.308  2.393   1.00 0.00 ? 481 GLN C HE21 6  
ATOM 4657  H HE22 . GLN A 1 29 ? -12.731 -2.225  0.714   1.00 0.00 ? 481 GLN C HE22 6  
ATOM 4658  N N    . LEU A 1 30 ? -20.152 -3.275  2.620   1.00 0.00 ? 482 LEU C N    6  
ATOM 4659  C CA   . LEU A 1 30 ? -21.535 -3.087  2.260   1.00 0.00 ? 482 LEU C CA   6  
ATOM 4660  C C    . LEU A 1 30 ? -22.418 -2.901  3.492   1.00 0.00 ? 482 LEU C C    6  
ATOM 4661  O O    . LEU A 1 30 ? -23.175 -1.937  3.583   1.00 0.00 ? 482 LEU C O    6  
ATOM 4662  C CB   . LEU A 1 30 ? -22.016 -4.295  1.471   1.00 0.00 ? 482 LEU C CB   6  
ATOM 4663  C CG   . LEU A 1 30 ? -21.721 -4.298  -0.032  1.00 0.00 ? 482 LEU C CG   6  
ATOM 4664  C CD1  . LEU A 1 30 ? -20.257 -4.010  -0.328  1.00 0.00 ? 482 LEU C CD1  6  
ATOM 4665  C CD2  . LEU A 1 30 ? -22.120 -5.623  -0.622  1.00 0.00 ? 482 LEU C CD2  6  
ATOM 4666  H H    . LEU A 1 30 ? -19.827 -4.193  2.702   1.00 0.00 ? 482 LEU C H    6  
ATOM 4667  H HA   . LEU A 1 30 ? -21.610 -2.221  1.620   1.00 0.00 ? 482 LEU C HA   6  
ATOM 4668  H HB2  . LEU A 1 30 ? -21.558 -5.173  1.902   1.00 0.00 ? 482 LEU C HB2  6  
ATOM 4669  H HB3  . LEU A 1 30 ? -23.082 -4.374  1.606   1.00 0.00 ? 482 LEU C HB3  6  
ATOM 4670  H HG   . LEU A 1 30 ? -22.311 -3.530  -0.499  1.00 0.00 ? 482 LEU C HG   6  
ATOM 4671  H HD11 . LEU A 1 30 ? -19.642 -4.762  0.141   1.00 0.00 ? 482 LEU C HD11 6  
ATOM 4672  H HD12 . LEU A 1 30 ? -19.996 -3.037  0.060   1.00 0.00 ? 482 LEU C HD12 6  
ATOM 4673  H HD13 . LEU A 1 30 ? -20.096 -4.026  -1.396  1.00 0.00 ? 482 LEU C HD13 6  
ATOM 4674  H HD21 . LEU A 1 30 ? -23.175 -5.778  -0.460  1.00 0.00 ? 482 LEU C HD21 6  
ATOM 4675  H HD22 . LEU A 1 30 ? -21.555 -6.402  -0.130  1.00 0.00 ? 482 LEU C HD22 6  
ATOM 4676  H HD23 . LEU A 1 30 ? -21.906 -5.627  -1.680  1.00 0.00 ? 482 LEU C HD23 6  
ATOM 4677  N N    . THR A 1 31 ? -22.313 -3.825  4.440   1.00 0.00 ? 483 THR C N    6  
ATOM 4678  C CA   . THR A 1 31 ? -23.154 -3.793  5.626   1.00 0.00 ? 483 THR C CA   6  
ATOM 4679  C C    . THR A 1 31 ? -22.423 -3.208  6.827   1.00 0.00 ? 483 THR C C    6  
ATOM 4680  O O    . THR A 1 31 ? -23.040 -2.575  7.683   1.00 0.00 ? 483 THR C O    6  
ATOM 4681  C CB   . THR A 1 31 ? -23.650 -5.210  5.990   1.00 0.00 ? 483 THR C CB   6  
ATOM 4682  O OG1  . THR A 1 31 ? -22.527 -6.087  6.167   1.00 0.00 ? 483 THR C OG1  6  
ATOM 4683  C CG2  . THR A 1 31 ? -24.556 -5.762  4.903   1.00 0.00 ? 483 THR C CG2  6  
ATOM 4684  H H    . THR A 1 31 ? -21.654 -4.557  4.345   1.00 0.00 ? 483 THR C H    6  
ATOM 4685  H HA   . THR A 1 31 ? -24.015 -3.182  5.408   1.00 0.00 ? 483 THR C HA   6  
ATOM 4686  H HB   . THR A 1 31 ? -24.204 -5.157  6.916   1.00 0.00 ? 483 THR C HB   6  
ATOM 4687  H HG1  . THR A 1 31 ? -22.592 -6.838  5.555   1.00 0.00 ? 483 THR C HG1  6  
ATOM 4688  H HG21 . THR A 1 31 ? -24.011 -5.811  3.974   1.00 0.00 ? 483 THR C HG21 6  
ATOM 4689  H HG22 . THR A 1 31 ? -25.412 -5.115  4.786   1.00 0.00 ? 483 THR C HG22 6  
ATOM 4690  H HG23 . THR A 1 31 ? -24.887 -6.753  5.181   1.00 0.00 ? 483 THR C HG23 6  
ATOM 4691  N N    . ARG A 1 32 ? -21.098 -3.417  6.882   1.00 0.00 ? 484 ARG C N    6  
ATOM 4692  C CA   . ARG A 1 32 ? -20.276 -2.986  8.015   1.00 0.00 ? 484 ARG C CA   6  
ATOM 4693  C C    . ARG A 1 32 ? -20.711 -3.685  9.293   1.00 0.00 ? 484 ARG C C    6  
ATOM 4694  O O    . ARG A 1 32 ? -20.390 -3.251  10.402  1.00 0.00 ? 484 ARG C O    6  
ATOM 4695  C CB   . ARG A 1 32 ? -20.307 -1.466  8.205   1.00 0.00 ? 484 ARG C CB   6  
ATOM 4696  C CG   . ARG A 1 32 ? -19.539 -0.675  7.156   1.00 0.00 ? 484 ARG C CG   6  
ATOM 4697  C CD   . ARG A 1 32 ? -20.272 -0.615  5.833   1.00 0.00 ? 484 ARG C CD   6  
ATOM 4698  N NE   . ARG A 1 32 ? -21.575 0.035   5.961   1.00 0.00 ? 484 ARG C NE   6  
ATOM 4699  C CZ   . ARG A 1 32 ? -22.125 0.808   5.027   1.00 0.00 ? 484 ARG C CZ   6  
ATOM 4700  N NH1  . ARG A 1 32 ? -21.482 1.039   3.884   1.00 0.00 ? 484 ARG C NH1  6  
ATOM 4701  N NH2  . ARG A 1 32 ? -23.319 1.344   5.238   1.00 0.00 ? 484 ARG C NH2  6  
ATOM 4702  H H    . ARG A 1 32 ? -20.651 -3.866  6.137   1.00 0.00 ? 484 ARG C H    6  
ATOM 4703  H HA   . ARG A 1 32 ? -19.261 -3.287  7.799   1.00 0.00 ? 484 ARG C HA   6  
ATOM 4704  H HB2  . ARG A 1 32 ? -21.333 -1.136  8.185   1.00 0.00 ? 484 ARG C HB2  6  
ATOM 4705  H HB3  . ARG A 1 32 ? -19.888 -1.246  9.171   1.00 0.00 ? 484 ARG C HB3  6  
ATOM 4706  H HG2  . ARG A 1 32 ? -19.396 0.328   7.517   1.00 0.00 ? 484 ARG C HG2  6  
ATOM 4707  H HG3  . ARG A 1 32 ? -18.580 -1.146  7.008   1.00 0.00 ? 484 ARG C HG3  6  
ATOM 4708  H HD2  . ARG A 1 32 ? -19.671 -0.064  5.127   1.00 0.00 ? 484 ARG C HD2  6  
ATOM 4709  H HD3  . ARG A 1 32 ? -20.418 -1.622  5.472   1.00 0.00 ? 484 ARG C HD3  6  
ATOM 4710  H HE   . ARG A 1 32 ? -22.071 -0.120  6.797   1.00 0.00 ? 484 ARG C HE   6  
ATOM 4711  H HH11 . ARG A 1 32 ? -20.581 0.631   3.714   1.00 0.00 ? 484 ARG C HH11 6  
ATOM 4712  H HH12 . ARG A 1 32 ? -21.885 1.625   3.177   1.00 0.00 ? 484 ARG C HH12 6  
ATOM 4713  H HH21 . ARG A 1 32 ? -23.808 1.166   6.098   1.00 0.00 ? 484 ARG C HH21 6  
ATOM 4714  H HH22 . ARG A 1 32 ? -23.748 1.933   4.547   1.00 0.00 ? 484 ARG C HH22 6  
ATOM 4715  N N    . SER A 1 33 ? -21.419 -4.779  9.133   1.00 0.00 ? 485 SER C N    6  
ATOM 4716  C CA   . SER A 1 33 ? -21.915 -5.525  10.247  1.00 0.00 ? 485 SER C CA   6  
ATOM 4717  C C    . SER A 1 33 ? -21.475 -6.961  10.147  1.00 0.00 ? 485 SER C C    6  
ATOM 4718  O O    . SER A 1 33 ? -22.040 -7.731  9.371   1.00 0.00 ? 485 SER C O    6  
ATOM 4719  C CB   . SER A 1 33 ? -23.440 -5.460  10.287  1.00 0.00 ? 485 SER C CB   6  
ATOM 4720  O OG   . SER A 1 33 ? -23.953 -6.137  11.424  1.00 0.00 ? 485 SER C OG   6  
ATOM 4721  H H    . SER A 1 33 ? -21.608 -5.101  8.224   1.00 0.00 ? 485 SER C H    6  
ATOM 4722  H HA   . SER A 1 33 ? -21.526 -5.091  11.151  1.00 0.00 ? 485 SER C HA   6  
ATOM 4723  H HB2  . SER A 1 33 ? -23.765 -4.433  10.310  1.00 0.00 ? 485 SER C HB2  6  
ATOM 4724  H HB3  . SER A 1 33 ? -23.834 -5.934  9.401   1.00 0.00 ? 485 SER C HB3  6  
ATOM 4725  H HG   . SER A 1 33 ? -24.250 -5.486  12.071  1.00 0.00 ? 485 SER C HG   6  
ATOM 4726  N N    . VAL A 1 34 ? -20.451 -7.327  10.914  1.00 0.00 ? 486 VAL C N    6  
ATOM 4727  C CA   . VAL A 1 34 ? -19.992 -8.699  10.931  1.00 0.00 ? 486 VAL C CA   6  
ATOM 4728  C C    . VAL A 1 34 ? -21.119 -9.638  11.361  1.00 0.00 ? 486 VAL C C    6  
ATOM 4729  O O    . VAL A 1 34 ? -21.124 -10.817 11.014  1.00 0.00 ? 486 VAL C O    6  
ATOM 4730  C CB   . VAL A 1 34 ? -18.751 -8.908  11.839  1.00 0.00 ? 486 VAL C CB   6  
ATOM 4731  C CG1  . VAL A 1 34 ? -17.617 -8.001  11.422  1.00 0.00 ? 486 VAL C CG1  6  
ATOM 4732  C CG2  . VAL A 1 34 ? -19.078 -8.710  13.301  1.00 0.00 ? 486 VAL C CG2  6  
ATOM 4733  H H    . VAL A 1 34 ? -19.982 -6.657  11.459  1.00 0.00 ? 486 VAL C H    6  
ATOM 4734  H HA   . VAL A 1 34 ? -19.718 -8.947  9.916   1.00 0.00 ? 486 VAL C HA   6  
ATOM 4735  H HB   . VAL A 1 34 ? -18.419 -9.923  11.705  1.00 0.00 ? 486 VAL C HB   6  
ATOM 4736  H HG11 . VAL A 1 34 ? -17.951 -6.973  11.432  1.00 0.00 ? 486 VAL C HG11 6  
ATOM 4737  H HG12 . VAL A 1 34 ? -17.291 -8.264  10.426  1.00 0.00 ? 486 VAL C HG12 6  
ATOM 4738  H HG13 . VAL A 1 34 ? -16.793 -8.115  12.109  1.00 0.00 ? 486 VAL C HG13 6  
ATOM 4739  H HG21 . VAL A 1 34 ? -18.210 -8.975  13.888  1.00 0.00 ? 486 VAL C HG21 6  
ATOM 4740  H HG22 . VAL A 1 34 ? -19.908 -9.343  13.572  1.00 0.00 ? 486 VAL C HG22 6  
ATOM 4741  H HG23 . VAL A 1 34 ? -19.331 -7.676  13.478  1.00 0.00 ? 486 VAL C HG23 6  
ATOM 4742  N N    . GLU A 1 35 ? -22.081 -9.101  12.112  1.00 0.00 ? 487 GLU C N    6  
ATOM 4743  C CA   . GLU A 1 35 ? -23.237 -9.871  12.525  1.00 0.00 ? 487 GLU C CA   6  
ATOM 4744  C C    . GLU A 1 35 ? -24.056 -10.266 11.318  1.00 0.00 ? 487 GLU C C    6  
ATOM 4745  O O    . GLU A 1 35 ? -24.421 -11.434 11.161  1.00 0.00 ? 487 GLU C O    6  
ATOM 4746  C CB   . GLU A 1 35 ? -24.100 -9.086  13.508  1.00 0.00 ? 487 GLU C CB   6  
ATOM 4747  C CG   . GLU A 1 35 ? -23.429 -8.847  14.840  1.00 0.00 ? 487 GLU C CG   6  
ATOM 4748  C CD   . GLU A 1 35 ? -22.844 -10.115 15.412  1.00 0.00 ? 487 GLU C CD   6  
ATOM 4749  O OE1  . GLU A 1 35 ? -23.597 -11.097 15.598  1.00 0.00 ? 487 GLU C OE1  6  
ATOM 4750  O OE2  . GLU A 1 35 ? -21.621 -10.146 15.660  1.00 0.00 ? 487 GLU C OE2  6  
ATOM 4751  H H    . GLU A 1 35 ? -22.002 -8.161  12.390  1.00 0.00 ? 487 GLU C H    6  
ATOM 4752  H HA   . GLU A 1 35 ? -22.878 -10.767 13.009  1.00 0.00 ? 487 GLU C HA   6  
ATOM 4753  H HB2  . GLU A 1 35 ? -24.341 -8.128  13.074  1.00 0.00 ? 487 GLU C HB2  6  
ATOM 4754  H HB3  . GLU A 1 35 ? -25.014 -9.633  13.683  1.00 0.00 ? 487 GLU C HB3  6  
ATOM 4755  H HG2  . GLU A 1 35 ? -22.635 -8.129  14.707  1.00 0.00 ? 487 GLU C HG2  6  
ATOM 4756  H HG3  . GLU A 1 35 ? -24.157 -8.455  15.535  1.00 0.00 ? 487 GLU C HG3  6  
ATOM 4757  N N    . ILE A 1 36 ? -24.329 -9.292  10.456  1.00 0.00 ? 488 ILE C N    6  
ATOM 4758  C CA   . ILE A 1 36 ? -25.076 -9.551  9.245   1.00 0.00 ? 488 ILE C CA   6  
ATOM 4759  C C    . ILE A 1 36 ? -24.275 -10.440 8.325   1.00 0.00 ? 488 ILE C C    6  
ATOM 4760  O O    . ILE A 1 36 ? -24.721 -11.478 7.969   1.00 0.00 ? 488 ILE C O    6  
ATOM 4761  C CB   . ILE A 1 36 ? -25.451 -8.256  8.494   1.00 0.00 ? 488 ILE C CB   6  
ATOM 4762  C CG1  . ILE A 1 36 ? -26.233 -7.314  9.412   1.00 0.00 ? 488 ILE C CG1  6  
ATOM 4763  C CG2  . ILE A 1 36 ? -26.266 -8.584  7.245   1.00 0.00 ? 488 ILE C CG2  6  
ATOM 4764  C CD1  . ILE A 1 36 ? -26.694 -6.041  8.735   1.00 0.00 ? 488 ILE C CD1  6  
ATOM 4765  H H    . ILE A 1 36 ? -24.014 -8.380  10.640  1.00 0.00 ? 488 ILE C H    6  
ATOM 4766  H HA   . ILE A 1 36 ? -25.986 -10.064 9.520   1.00 0.00 ? 488 ILE C HA   6  
ATOM 4767  H HB   . ILE A 1 36 ? -24.537 -7.781  8.179   1.00 0.00 ? 488 ILE C HB   6  
ATOM 4768  H HG12 . ILE A 1 36 ? -27.107 -7.826  9.783   1.00 0.00 ? 488 ILE C HG12 6  
ATOM 4769  H HG13 . ILE A 1 36 ? -25.606 -7.037  10.247  1.00 0.00 ? 488 ILE C HG13 6  
ATOM 4770  H HG21 . ILE A 1 36 ? -27.173 -9.094  7.531   1.00 0.00 ? 488 ILE C HG21 6  
ATOM 4771  H HG22 . ILE A 1 36 ? -25.685 -9.217  6.592   1.00 0.00 ? 488 ILE C HG22 6  
ATOM 4772  H HG23 . ILE A 1 36 ? -26.515 -7.666  6.730   1.00 0.00 ? 488 ILE C HG23 6  
ATOM 4773  H HD11 . ILE A 1 36 ? -27.301 -6.291  7.879   1.00 0.00 ? 488 ILE C HD11 6  
ATOM 4774  H HD12 . ILE A 1 36 ? -25.835 -5.471  8.415   1.00 0.00 ? 488 ILE C HD12 6  
ATOM 4775  H HD13 . ILE A 1 36 ? -27.277 -5.458  9.430   1.00 0.00 ? 488 ILE C HD13 6  
ATOM 4776  N N    . THR A 1 37 ? -23.075 -10.003 7.968   1.00 0.00 ? 489 THR C N    6  
ATOM 4777  C CA   . THR A 1 37 ? -22.165 -10.754 7.104   1.00 0.00 ? 489 THR C CA   6  
ATOM 4778  C C    . THR A 1 37 ? -22.078 -12.248 7.480   1.00 0.00 ? 489 THR C C    6  
ATOM 4779  O O    . THR A 1 37 ? -22.144 -13.114 6.609   1.00 0.00 ? 489 THR C O    6  
ATOM 4780  C CB   . THR A 1 37 ? -20.764 -10.133 7.157   1.00 0.00 ? 489 THR C CB   6  
ATOM 4781  O OG1  . THR A 1 37 ? -20.866 -8.724  6.926   1.00 0.00 ? 489 THR C OG1  6  
ATOM 4782  C CG2  . THR A 1 37 ? -19.850 -10.745 6.111   1.00 0.00 ? 489 THR C CG2  6  
ATOM 4783  H H    . THR A 1 37 ? -22.784 -9.120  8.267   1.00 0.00 ? 489 THR C H    6  
ATOM 4784  H HA   . THR A 1 37 ? -22.526 -10.671 6.090   1.00 0.00 ? 489 THR C HA   6  
ATOM 4785  H HB   . THR A 1 37 ? -20.347 -10.307 8.140   1.00 0.00 ? 489 THR C HB   6  
ATOM 4786  H HG1  . THR A 1 37 ? -21.367 -8.579  6.105   1.00 0.00 ? 489 THR C HG1  6  
ATOM 4787  H HG21 . THR A 1 37 ? -20.301 -10.643 5.136   1.00 0.00 ? 489 THR C HG21 6  
ATOM 4788  H HG22 . THR A 1 37 ? -19.692 -11.789 6.333   1.00 0.00 ? 489 THR C HG22 6  
ATOM 4789  H HG23 . THR A 1 37 ? -18.904 -10.223 6.124   1.00 0.00 ? 489 THR C HG23 6  
ATOM 4790  N N    . THR A 1 38 ? -21.955 -12.548 8.770   1.00 0.00 ? 490 THR C N    6  
ATOM 4791  C CA   . THR A 1 38 ? -21.864 -13.931 9.214   1.00 0.00 ? 490 THR C CA   6  
ATOM 4792  C C    . THR A 1 38 ? -23.203 -14.646 9.020   1.00 0.00 ? 490 THR C C    6  
ATOM 4793  O O    . THR A 1 38 ? -23.256 -15.771 8.512   1.00 0.00 ? 490 THR C O    6  
ATOM 4794  C CB   . THR A 1 38 ? -21.434 -14.022 10.687  1.00 0.00 ? 490 THR C CB   6  
ATOM 4795  O OG1  . THR A 1 38 ? -20.223 -13.280 10.882  1.00 0.00 ? 490 THR C OG1  6  
ATOM 4796  C CG2  . THR A 1 38 ? -21.200 -15.463 11.081  1.00 0.00 ? 490 THR C CG2  6  
ATOM 4797  H H    . THR A 1 38 ? -21.928 -11.829 9.436   1.00 0.00 ? 490 THR C H    6  
ATOM 4798  H HA   . THR A 1 38 ? -21.122 -14.428 8.604   1.00 0.00 ? 490 THR C HA   6  
ATOM 4799  H HB   . THR A 1 38 ? -22.215 -13.608 11.309  1.00 0.00 ? 490 THR C HB   6  
ATOM 4800  H HG1  . THR A 1 38 ? -20.413 -12.336 10.811  1.00 0.00 ? 490 THR C HG1  6  
ATOM 4801  H HG21 . THR A 1 38 ? -20.460 -15.894 10.419  1.00 0.00 ? 490 THR C HG21 6  
ATOM 4802  H HG22 . THR A 1 38 ? -22.124 -16.016 10.997  1.00 0.00 ? 490 THR C HG22 6  
ATOM 4803  H HG23 . THR A 1 38 ? -20.841 -15.508 12.099  1.00 0.00 ? 490 THR C HG23 6  
ATOM 4804  N N    . ASP A 1 39 ? -24.279 -13.976 9.403   1.00 0.00 ? 491 ASP C N    6  
ATOM 4805  C CA   . ASP A 1 39 ? -25.626 -14.521 9.238   1.00 0.00 ? 491 ASP C CA   6  
ATOM 4806  C C    . ASP A 1 39 ? -25.949 -14.619 7.754   1.00 0.00 ? 491 ASP C C    6  
ATOM 4807  O O    . ASP A 1 39 ? -26.633 -15.533 7.306   1.00 0.00 ? 491 ASP C O    6  
ATOM 4808  C CB   . ASP A 1 39 ? -26.639 -13.625 9.948   1.00 0.00 ? 491 ASP C CB   6  
ATOM 4809  C CG   . ASP A 1 39 ? -28.051 -14.148 9.858   1.00 0.00 ? 491 ASP C CG   6  
ATOM 4810  O OD1  . ASP A 1 39 ? -28.360 -15.155 10.529  1.00 0.00 ? 491 ASP C OD1  6  
ATOM 4811  O OD2  . ASP A 1 39 ? -28.866 -13.540 9.140   1.00 0.00 ? 491 ASP C OD2  6  
ATOM 4812  H H    . ASP A 1 39 ? -24.170 -13.081 9.797   1.00 0.00 ? 491 ASP C H    6  
ATOM 4813  H HA   . ASP A 1 39 ? -25.650 -15.512 9.672   1.00 0.00 ? 491 ASP C HA   6  
ATOM 4814  H HB2  . ASP A 1 39 ? -26.373 -13.551 10.992  1.00 0.00 ? 491 ASP C HB2  6  
ATOM 4815  H HB3  . ASP A 1 39 ? -26.608 -12.640 9.507   1.00 0.00 ? 491 ASP C HB3  6  
ATOM 4816  N N    . ASN A 1 40 ? -25.414 -13.667 7.014   1.00 0.00 ? 492 ASN C N    6  
ATOM 4817  C CA   . ASN A 1 40 ? -25.522 -13.590 5.571   1.00 0.00 ? 492 ASN C CA   6  
ATOM 4818  C C    . ASN A 1 40 ? -24.996 -14.877 4.963   1.00 0.00 ? 492 ASN C C    6  
ATOM 4819  O O    . ASN A 1 40 ? -25.628 -15.482 4.100   1.00 0.00 ? 492 ASN C O    6  
ATOM 4820  C CB   . ASN A 1 40 ? -24.698 -12.387 5.064   1.00 0.00 ? 492 ASN C CB   6  
ATOM 4821  C CG   . ASN A 1 40 ? -25.532 -11.295 4.439   1.00 0.00 ? 492 ASN C CG   6  
ATOM 4822  O OD1  . ASN A 1 40 ? -26.585 -11.549 3.862   1.00 0.00 ? 492 ASN C OD1  6  
ATOM 4823  N ND2  . ASN A 1 40 ? -25.050 -10.064 4.540   1.00 0.00 ? 492 ASN C ND2  6  
ATOM 4824  H H    . ASN A 1 40 ? -24.920 -12.955 7.477   1.00 0.00 ? 492 ASN C H    6  
ATOM 4825  H HA   . ASN A 1 40 ? -26.559 -13.439 5.315   1.00 0.00 ? 492 ASN C HA   6  
ATOM 4826  H HB2  . ASN A 1 40 ? -24.194 -11.948 5.908   1.00 0.00 ? 492 ASN C HB2  6  
ATOM 4827  H HB3  . ASN A 1 40 ? -23.954 -12.708 4.358   1.00 0.00 ? 492 ASN C HB3  6  
ATOM 4828  H HD21 . ASN A 1 40 ? -24.192 -9.930  5.004   1.00 0.00 ? 492 ASN C HD21 6  
ATOM 4829  H HD22 . ASN A 1 40 ? -25.567 -9.327  4.157   1.00 0.00 ? 492 ASN C HD22 6  
ATOM 4830  N N    . ILE A 1 41 ? -23.828 -15.297 5.438   1.00 0.00 ? 493 ILE C N    6  
ATOM 4831  C CA   . ILE A 1 41 ? -23.217 -16.543 5.002   1.00 0.00 ? 493 ILE C CA   6  
ATOM 4832  C C    . ILE A 1 41 ? -24.149 -17.711 5.307   1.00 0.00 ? 493 ILE C C    6  
ATOM 4833  O O    . ILE A 1 41 ? -24.438 -18.542 4.445   1.00 0.00 ? 493 ILE C O    6  
ATOM 4834  C CB   . ILE A 1 41 ? -21.882 -16.801 5.748   1.00 0.00 ? 493 ILE C CB   6  
ATOM 4835  C CG1  . ILE A 1 41 ? -20.905 -15.653 5.542   1.00 0.00 ? 493 ILE C CG1  6  
ATOM 4836  C CG2  . ILE A 1 41 ? -21.260 -18.111 5.299   1.00 0.00 ? 493 ILE C CG2  6  
ATOM 4837  C CD1  . ILE A 1 41 ? -19.695 -15.719 6.456   1.00 0.00 ? 493 ILE C CD1  6  
ATOM 4838  H H    . ILE A 1 41 ? -23.357 -14.744 6.101   1.00 0.00 ? 493 ILE C H    6  
ATOM 4839  H HA   . ILE A 1 41 ? -23.031 -16.480 3.940   1.00 0.00 ? 493 ILE C HA   6  
ATOM 4840  H HB   . ILE A 1 41 ? -22.103 -16.881 6.804   1.00 0.00 ? 493 ILE C HB   6  
ATOM 4841  H HG12 . ILE A 1 41 ? -20.556 -15.664 4.521   1.00 0.00 ? 493 ILE C HG12 6  
ATOM 4842  H HG13 . ILE A 1 41 ? -21.415 -14.724 5.732   1.00 0.00 ? 493 ILE C HG13 6  
ATOM 4843  H HG21 . ILE A 1 41 ? -21.964 -18.916 5.450   1.00 0.00 ? 493 ILE C HG21 6  
ATOM 4844  H HG22 . ILE A 1 41 ? -20.371 -18.298 5.881   1.00 0.00 ? 493 ILE C HG22 6  
ATOM 4845  H HG23 . ILE A 1 41 ? -21.004 -18.044 4.254   1.00 0.00 ? 493 ILE C HG23 6  
ATOM 4846  H HD11 . ILE A 1 41 ? -19.132 -16.616 6.249   1.00 0.00 ? 493 ILE C HD11 6  
ATOM 4847  H HD12 . ILE A 1 41 ? -20.028 -15.740 7.483   1.00 0.00 ? 493 ILE C HD12 6  
ATOM 4848  H HD13 . ILE A 1 41 ? -19.071 -14.853 6.300   1.00 0.00 ? 493 ILE C HD13 6  
ATOM 4849  N N    . LEU A 1 42 ? -24.625 -17.738 6.541   1.00 0.00 ? 494 LEU C N    6  
ATOM 4850  C CA   . LEU A 1 42 ? -25.479 -18.803 7.048   1.00 0.00 ? 494 LEU C CA   6  
ATOM 4851  C C    . LEU A 1 42 ? -26.837 -18.860 6.347   1.00 0.00 ? 494 LEU C C    6  
ATOM 4852  O O    . LEU A 1 42 ? -27.484 -19.903 6.335   1.00 0.00 ? 494 LEU C O    6  
ATOM 4853  C CB   . LEU A 1 42 ? -25.643 -18.644 8.555   1.00 0.00 ? 494 LEU C CB   6  
ATOM 4854  C CG   . LEU A 1 42 ? -24.372 -18.905 9.365   1.00 0.00 ? 494 LEU C CG   6  
ATOM 4855  C CD1  . LEU A 1 42 ? -24.505 -18.358 10.773  1.00 0.00 ? 494 LEU C CD1  6  
ATOM 4856  C CD2  . LEU A 1 42 ? -24.063 -20.395 9.401   1.00 0.00 ? 494 LEU C CD2  6  
ATOM 4857  H H    . LEU A 1 42 ? -24.385 -17.004 7.149   1.00 0.00 ? 494 LEU C H    6  
ATOM 4858  H HA   . LEU A 1 42 ? -24.968 -19.735 6.862   1.00 0.00 ? 494 LEU C HA   6  
ATOM 4859  H HB2  . LEU A 1 42 ? -25.973 -17.634 8.753   1.00 0.00 ? 494 LEU C HB2  6  
ATOM 4860  H HB3  . LEU A 1 42 ? -26.406 -19.326 8.894   1.00 0.00 ? 494 LEU C HB3  6  
ATOM 4861  H HG   . LEU A 1 42 ? -23.542 -18.402 8.891   1.00 0.00 ? 494 LEU C HG   6  
ATOM 4862  H HD11 . LEU A 1 42 ? -25.362 -18.804 11.256  1.00 0.00 ? 494 LEU C HD11 6  
ATOM 4863  H HD12 . LEU A 1 42 ? -24.624 -17.285 10.731  1.00 0.00 ? 494 LEU C HD12 6  
ATOM 4864  H HD13 . LEU A 1 42 ? -23.611 -18.599 11.329  1.00 0.00 ? 494 LEU C HD13 6  
ATOM 4865  H HD21 . LEU A 1 42 ? -23.900 -20.753 8.395   1.00 0.00 ? 494 LEU C HD21 6  
ATOM 4866  H HD22 . LEU A 1 42 ? -24.892 -20.924 9.842   1.00 0.00 ? 494 LEU C HD22 6  
ATOM 4867  H HD23 . LEU A 1 42 ? -23.174 -20.564 9.990   1.00 0.00 ? 494 LEU C HD23 6  
ATOM 4868  N N    . GLU A 1 43 ? -27.269 -17.746 5.767   1.00 0.00 ? 495 GLU C N    6  
ATOM 4869  C CA   . GLU A 1 43 ? -28.526 -17.721 5.016   1.00 0.00 ? 495 GLU C CA   6  
ATOM 4870  C C    . GLU A 1 43 ? -28.313 -18.227 3.601   1.00 0.00 ? 495 GLU C C    6  
ATOM 4871  O O    . GLU A 1 43 ? -29.253 -18.322 2.815   1.00 0.00 ? 495 GLU C O    6  
ATOM 4872  C CB   . GLU A 1 43 ? -29.122 -16.317 4.956   1.00 0.00 ? 495 GLU C CB   6  
ATOM 4873  C CG   . GLU A 1 43 ? -29.613 -15.785 6.281   1.00 0.00 ? 495 GLU C CG   6  
ATOM 4874  C CD   . GLU A 1 43 ? -30.433 -14.530 6.117   1.00 0.00 ? 495 GLU C CD   6  
ATOM 4875  O OE1  . GLU A 1 43 ? -29.866 -13.490 5.732   1.00 0.00 ? 495 GLU C OE1  6  
ATOM 4876  O OE2  . GLU A 1 43 ? -31.659 -14.582 6.357   1.00 0.00 ? 495 GLU C OE2  6  
ATOM 4877  H H    . GLU A 1 43 ? -26.746 -16.920 5.858   1.00 0.00 ? 495 GLU C H    6  
ATOM 4878  H HA   . GLU A 1 43 ? -29.220 -18.376 5.519   1.00 0.00 ? 495 GLU C HA   6  
ATOM 4879  H HB2  . GLU A 1 43 ? -28.369 -15.639 4.583   1.00 0.00 ? 495 GLU C HB2  6  
ATOM 4880  H HB3  . GLU A 1 43 ? -29.953 -16.325 4.265   1.00 0.00 ? 495 GLU C HB3  6  
ATOM 4881  H HG2  . GLU A 1 43 ? -30.223 -16.538 6.755   1.00 0.00 ? 495 GLU C HG2  6  
ATOM 4882  H HG3  . GLU A 1 43 ? -28.760 -15.563 6.907   1.00 0.00 ? 495 GLU C HG3  6  
ATOM 4883  N N    . GLY A 1 44 ? -27.070 -18.539 3.278   1.00 0.00 ? 496 GLY C N    6  
ATOM 4884  C CA   . GLY A 1 44 ? -26.752 -18.999 1.952   1.00 0.00 ? 496 GLY C CA   6  
ATOM 4885  C C    . GLY A 1 44 ? -26.619 -17.851 0.984   1.00 0.00 ? 496 GLY C C    6  
ATOM 4886  O O    . GLY A 1 44 ? -26.672 -18.041 -0.228  1.00 0.00 ? 496 GLY C O    6  
ATOM 4887  H H    . GLY A 1 44 ? -26.361 -18.464 3.953   1.00 0.00 ? 496 GLY C H    6  
ATOM 4888  H HA2  . GLY A 1 44 ? -25.819 -19.544 1.985   1.00 0.00 ? 496 GLY C HA2  6  
ATOM 4889  H HA3  . GLY A 1 44 ? -27.532 -19.657 1.608   1.00 0.00 ? 496 GLY C HA3  6  
ATOM 4890  N N    . ARG A 1 45 ? -26.455 -16.652 1.527   1.00 0.00 ? 497 ARG C N    6  
ATOM 4891  C CA   . ARG A 1 45 ? -26.295 -15.457 0.717   1.00 0.00 ? 497 ARG C CA   6  
ATOM 4892  C C    . ARG A 1 45 ? -24.910 -15.439 0.104   1.00 0.00 ? 497 ARG C C    6  
ATOM 4893  O O    . ARG A 1 45 ? -24.728 -15.043 -1.047  1.00 0.00 ? 497 ARG C O    6  
ATOM 4894  C CB   . ARG A 1 45 ? -26.535 -14.198 1.585   1.00 0.00 ? 497 ARG C CB   6  
ATOM 4895  C CG   . ARG A 1 45 ? -26.517 -12.870 0.824   1.00 0.00 ? 497 ARG C CG   6  
ATOM 4896  C CD   . ARG A 1 45 ? -25.099 -12.381 0.586   1.00 0.00 ? 497 ARG C CD   6  
ATOM 4897  N NE   . ARG A 1 45 ? -25.056 -11.112 -0.131  1.00 0.00 ? 497 ARG C NE   6  
ATOM 4898  C CZ   . ARG A 1 45 ? -24.463 -10.018 0.330   1.00 0.00 ? 497 ARG C CZ   6  
ATOM 4899  N NH1  . ARG A 1 45 ? -23.932 -10.015 1.540   1.00 0.00 ? 497 ARG C NH1  6  
ATOM 4900  N NH2  . ARG A 1 45 ? -24.416 -8.921  -0.412  1.00 0.00 ? 497 ARG C NH2  6  
ATOM 4901  H H    . ARG A 1 45 ? -26.445 -16.570 2.504   1.00 0.00 ? 497 ARG C H    6  
ATOM 4902  H HA   . ARG A 1 45 ? -27.027 -15.486 -0.074  1.00 0.00 ? 497 ARG C HA   6  
ATOM 4903  H HB2  . ARG A 1 45 ? -27.497 -14.294 2.064   1.00 0.00 ? 497 ARG C HB2  6  
ATOM 4904  H HB3  . ARG A 1 45 ? -25.769 -14.158 2.358   1.00 0.00 ? 497 ARG C HB3  6  
ATOM 4905  H HG2  . ARG A 1 45 ? -27.002 -13.008 -0.130  1.00 0.00 ? 497 ARG C HG2  6  
ATOM 4906  H HG3  . ARG A 1 45 ? -27.053 -12.130 1.400   1.00 0.00 ? 497 ARG C HG3  6  
ATOM 4907  H HD2  . ARG A 1 45 ? -24.611 -12.261 1.541   1.00 0.00 ? 497 ARG C HD2  6  
ATOM 4908  H HD3  . ARG A 1 45 ? -24.572 -13.128 0.010   1.00 0.00 ? 497 ARG C HD3  6  
ATOM 4909  H HE   . ARG A 1 45 ? -25.478 -11.090 -1.020  1.00 0.00 ? 497 ARG C HE   6  
ATOM 4910  H HH11 . ARG A 1 45 ? -23.971 -10.827 2.118   1.00 0.00 ? 497 ARG C HH11 6  
ATOM 4911  H HH12 . ARG A 1 45 ? -23.484 -9.182  1.904   1.00 0.00 ? 497 ARG C HH12 6  
ATOM 4912  H HH21 . ARG A 1 45 ? -24.826 -8.904  -1.329  1.00 0.00 ? 497 ARG C HH21 6  
ATOM 4913  H HH22 . ARG A 1 45 ? -23.971 -8.094  -0.062  1.00 0.00 ? 497 ARG C HH22 6  
ATOM 4914  N N    . ILE A 1 46 ? -23.943 -15.881 0.874   1.00 0.00 ? 498 ILE C N    6  
ATOM 4915  C CA   . ILE A 1 46 ? -22.573 -15.911 0.424   1.00 0.00 ? 498 ILE C CA   6  
ATOM 4916  C C    . ILE A 1 46 ? -22.169 -17.335 0.086   1.00 0.00 ? 498 ILE C C    6  
ATOM 4917  O O    . ILE A 1 46 ? -21.992 -18.171 0.977   1.00 0.00 ? 498 ILE C O    6  
ATOM 4918  C CB   . ILE A 1 46 ? -21.610 -15.319 1.487   1.00 0.00 ? 498 ILE C CB   6  
ATOM 4919  C CG1  . ILE A 1 46 ? -21.994 -13.863 1.788   1.00 0.00 ? 498 ILE C CG1  6  
ATOM 4920  C CG2  . ILE A 1 46 ? -20.166 -15.403 1.008   1.00 0.00 ? 498 ILE C CG2  6  
ATOM 4921  C CD1  . ILE A 1 46 ? -21.165 -13.212 2.878   1.00 0.00 ? 498 ILE C CD1  6  
ATOM 4922  H H    . ILE A 1 46 ? -24.163 -16.216 1.769   1.00 0.00 ? 498 ILE C H    6  
ATOM 4923  H HA   . ILE A 1 46 ? -22.508 -15.309 -0.470  1.00 0.00 ? 498 ILE C HA   6  
ATOM 4924  H HB   . ILE A 1 46 ? -21.702 -15.901 2.392   1.00 0.00 ? 498 ILE C HB   6  
ATOM 4925  H HG12 . ILE A 1 46 ? -21.873 -13.276 0.890   1.00 0.00 ? 498 ILE C HG12 6  
ATOM 4926  H HG13 . ILE A 1 46 ? -23.028 -13.835 2.091   1.00 0.00 ? 498 ILE C HG13 6  
ATOM 4927  H HG21 . ILE A 1 46 ? -20.062 -14.847 0.089   1.00 0.00 ? 498 ILE C HG21 6  
ATOM 4928  H HG22 . ILE A 1 46 ? -19.901 -16.436 0.839   1.00 0.00 ? 498 ILE C HG22 6  
ATOM 4929  H HG23 . ILE A 1 46 ? -19.515 -14.981 1.760   1.00 0.00 ? 498 ILE C HG23 6  
ATOM 4930  H HD11 . ILE A 1 46 ? -20.121 -13.237 2.601   1.00 0.00 ? 498 ILE C HD11 6  
ATOM 4931  H HD12 . ILE A 1 46 ? -21.306 -13.746 3.805   1.00 0.00 ? 498 ILE C HD12 6  
ATOM 4932  H HD13 . ILE A 1 46 ? -21.479 -12.187 3.004   1.00 0.00 ? 498 ILE C HD13 6  
ATOM 4933  N N    . GLN A 1 47 ? -22.064 -17.611 -1.198  1.00 0.00 ? 499 GLN C N    6  
ATOM 4934  C CA   . GLN A 1 47 ? -21.683 -18.927 -1.671  1.00 0.00 ? 499 GLN C CA   6  
ATOM 4935  C C    . GLN A 1 47 ? -20.179 -19.095 -1.585  1.00 0.00 ? 499 GLN C C    6  
ATOM 4936  O O    . GLN A 1 47 ? -19.429 -18.157 -1.860  1.00 0.00 ? 499 GLN C O    6  
ATOM 4937  C CB   . GLN A 1 47 ? -22.147 -19.157 -3.121  1.00 0.00 ? 499 GLN C CB   6  
ATOM 4938  C CG   . GLN A 1 47 ? -23.661 -19.142 -3.323  1.00 0.00 ? 499 GLN C CG   6  
ATOM 4939  C CD   . GLN A 1 47 ? -24.263 -17.752 -3.238  1.00 0.00 ? 499 GLN C CD   6  
ATOM 4940  O OE1  . GLN A 1 47 ? -23.618 -16.759 -3.568  1.00 0.00 ? 499 GLN C OE1  6  
ATOM 4941  N NE2  . GLN A 1 47 ? -25.497 -17.674 -2.797  1.00 0.00 ? 499 GLN C NE2  6  
ATOM 4942  H H    . GLN A 1 47 ? -22.246 -16.902 -1.853  1.00 0.00 ? 499 GLN C H    6  
ATOM 4943  H HA   . GLN A 1 47 ? -22.154 -19.660 -1.032  1.00 0.00 ? 499 GLN C HA   6  
ATOM 4944  H HB2  . GLN A 1 47 ? -21.723 -18.385 -3.744  1.00 0.00 ? 499 GLN C HB2  6  
ATOM 4945  H HB3  . GLN A 1 47 ? -21.773 -20.113 -3.454  1.00 0.00 ? 499 GLN C HB3  6  
ATOM 4946  H HG2  . GLN A 1 47 ? -23.884 -19.550 -4.297  1.00 0.00 ? 499 GLN C HG2  6  
ATOM 4947  H HG3  . GLN A 1 47 ? -24.116 -19.762 -2.564  1.00 0.00 ? 499 GLN C HG3  6  
ATOM 4948  H HE21 . GLN A 1 47 ? -25.954 -18.508 -2.550  1.00 0.00 ? 499 GLN C HE21 6  
ATOM 4949  H HE22 . GLN A 1 47 ? -25.916 -16.791 -2.732  1.00 0.00 ? 499 GLN C HE22 6  
ATOM 4950  N N    . VAL A 1 48 ? -19.741 -20.271 -1.204  1.00 0.00 ? 500 VAL C N    6  
ATOM 4951  C CA   . VAL A 1 48 ? -18.329 -20.547 -1.088  1.00 0.00 ? 500 VAL C CA   6  
ATOM 4952  C C    . VAL A 1 48 ? -17.780 -21.196 -2.364  1.00 0.00 ? 500 VAL C C    6  
ATOM 4953  O O    . VAL A 1 48 ? -18.159 -22.314 -2.721  1.00 0.00 ? 500 VAL C O    6  
ATOM 4954  C CB   . VAL A 1 48 ? -18.015 -21.434 0.142   1.00 0.00 ? 500 VAL C CB   6  
ATOM 4955  C CG1  . VAL A 1 48 ? -18.218 -20.645 1.422   1.00 0.00 ? 500 VAL C CG1  6  
ATOM 4956  C CG2  . VAL A 1 48 ? -18.886 -22.681 0.156   1.00 0.00 ? 500 VAL C CG2  6  
ATOM 4957  H H    . VAL A 1 48 ? -20.384 -20.982 -0.995  1.00 0.00 ? 500 VAL C H    6  
ATOM 4958  H HA   . VAL A 1 48 ? -17.833 -19.599 -0.946  1.00 0.00 ? 500 VAL C HA   6  
ATOM 4959  H HB   . VAL A 1 48 ? -16.982 -21.736 0.087   1.00 0.00 ? 500 VAL C HB   6  
ATOM 4960  H HG11 . VAL A 1 48 ? -19.256 -20.360 1.513   1.00 0.00 ? 500 VAL C HG11 6  
ATOM 4961  H HG12 . VAL A 1 48 ? -17.606 -19.758 1.396   1.00 0.00 ? 500 VAL C HG12 6  
ATOM 4962  H HG13 . VAL A 1 48 ? -17.937 -21.253 2.270   1.00 0.00 ? 500 VAL C HG13 6  
ATOM 4963  H HG21 . VAL A 1 48 ? -18.715 -23.249 -0.747  1.00 0.00 ? 500 VAL C HG21 6  
ATOM 4964  H HG22 . VAL A 1 48 ? -19.925 -22.395 0.215   1.00 0.00 ? 500 VAL C HG22 6  
ATOM 4965  H HG23 . VAL A 1 48 ? -18.631 -23.284 1.014   1.00 0.00 ? 500 VAL C HG23 6  
ATOM 4966  N N    . PRO A 1 49 ? -16.916 -20.479 -3.095  1.00 0.00 ? 501 PRO C N    6  
ATOM 4967  C CA   . PRO A 1 49 ? -16.290 -20.998 -4.300  1.00 0.00 ? 501 PRO C CA   6  
ATOM 4968  C C    . PRO A 1 49 ? -15.129 -21.931 -3.975  1.00 0.00 ? 501 PRO C C    6  
ATOM 4969  O O    . PRO A 1 49 ? -14.615 -21.939 -2.851  1.00 0.00 ? 501 PRO C O    6  
ATOM 4970  C CB   . PRO A 1 49 ? -15.767 -19.738 -5.022  1.00 0.00 ? 501 PRO C CB   6  
ATOM 4971  C CG   . PRO A 1 49 ? -16.210 -18.576 -4.191  1.00 0.00 ? 501 PRO C CG   6  
ATOM 4972  C CD   . PRO A 1 49 ? -16.494 -19.113 -2.824  1.00 0.00 ? 501 PRO C CD   6  
ATOM 4973  H HA   . PRO A 1 49 ? -17.004 -21.509 -4.930  1.00 0.00 ? 501 PRO C HA   6  
ATOM 4974  H HB2  . PRO A 1 49 ? -14.690 -19.783 -5.086  1.00 0.00 ? 501 PRO C HB2  6  
ATOM 4975  H HB3  . PRO A 1 49 ? -16.184 -19.692 -6.017  1.00 0.00 ? 501 PRO C HB3  6  
ATOM 4976  H HG2  . PRO A 1 49 ? -15.426 -17.836 -4.145  1.00 0.00 ? 501 PRO C HG2  6  
ATOM 4977  H HG3  . PRO A 1 49 ? -17.106 -18.145 -4.616  1.00 0.00 ? 501 PRO C HG3  6  
ATOM 4978  H HD2  . PRO A 1 49 ? -15.604 -19.097 -2.213  1.00 0.00 ? 501 PRO C HD2  6  
ATOM 4979  H HD3  . PRO A 1 49 ? -17.286 -18.545 -2.363  1.00 0.00 ? 501 PRO C HD3  6  
ATOM 4980  N N    . PHE A 1 50 ? -14.723 -22.705 -4.953  1.00 0.00 ? 502 PHE C N    6  
ATOM 4981  C CA   . PHE A 1 50 ? -13.614 -23.624 -4.793  1.00 0.00 ? 502 PHE C CA   6  
ATOM 4982  C C    . PHE A 1 50 ? -12.567 -23.354 -5.862  1.00 0.00 ? 502 PHE C C    6  
ATOM 4983  O O    . PHE A 1 50 ? -12.917 -23.089 -7.013  1.00 0.00 ? 502 PHE C O    6  
ATOM 4984  C CB   . PHE A 1 50 ? -14.098 -25.084 -4.849  1.00 0.00 ? 502 PHE C CB   6  
ATOM 4985  C CG   . PHE A 1 50 ? -15.029 -25.386 -5.992  1.00 0.00 ? 502 PHE C CG   6  
ATOM 4986  C CD1  . PHE A 1 50 ? -16.386 -25.153 -5.865  1.00 0.00 ? 502 PHE C CD1  6  
ATOM 4987  C CD2  . PHE A 1 50 ? -14.550 -25.905 -7.183  1.00 0.00 ? 502 PHE C CD2  6  
ATOM 4988  C CE1  . PHE A 1 50 ? -17.253 -25.429 -6.903  1.00 0.00 ? 502 PHE C CE1  6  
ATOM 4989  C CE2  . PHE A 1 50 ? -15.411 -26.183 -8.228  1.00 0.00 ? 502 PHE C CE2  6  
ATOM 4990  C CZ   . PHE A 1 50 ? -16.764 -25.945 -8.087  1.00 0.00 ? 502 PHE C CZ   6  
ATOM 4991  H H    . PHE A 1 50 ? -15.176 -22.654 -5.825  1.00 0.00 ? 502 PHE C H    6  
ATOM 4992  H HA   . PHE A 1 50 ? -13.187 -23.436 -3.822  1.00 0.00 ? 502 PHE C HA   6  
ATOM 4993  H HB2  . PHE A 1 50 ? -13.241 -25.732 -4.947  1.00 0.00 ? 502 PHE C HB2  6  
ATOM 4994  H HB3  . PHE A 1 50 ? -14.611 -25.319 -3.928  1.00 0.00 ? 502 PHE C HB3  6  
ATOM 4995  H HD1  . PHE A 1 50 ? -16.760 -24.745 -4.937  1.00 0.00 ? 502 PHE C HD1  6  
ATOM 4996  H HD2  . PHE A 1 50 ? -13.493 -26.091 -7.292  1.00 0.00 ? 502 PHE C HD2  6  
ATOM 4997  H HE1  . PHE A 1 50 ? -18.312 -25.242 -6.790  1.00 0.00 ? 502 PHE C HE1  6  
ATOM 4998  H HE2  . PHE A 1 50 ? -15.026 -26.586 -9.152  1.00 0.00 ? 502 PHE C HE2  6  
ATOM 4999  H HZ   . PHE A 1 50 ? -17.439 -26.161 -8.902  1.00 0.00 ? 502 PHE C HZ   6  
ATOM 5000  N N    . PRO A 1 51 ? -11.269 -23.383 -5.497  1.00 0.00 ? 503 PRO C N    6  
ATOM 5001  C CA   . PRO A 1 51 ? -10.184 -23.109 -6.444  1.00 0.00 ? 503 PRO C CA   6  
ATOM 5002  C C    . PRO A 1 51 ? -10.268 -23.993 -7.682  1.00 0.00 ? 503 PRO C C    6  
ATOM 5003  O O    . PRO A 1 51 ? -10.212 -25.225 -7.588  1.00 0.00 ? 503 PRO C O    6  
ATOM 5004  C CB   . PRO A 1 51 ? -8.921  -23.431 -5.641  1.00 0.00 ? 503 PRO C CB   6  
ATOM 5005  C CG   . PRO A 1 51 ? -9.324  -23.255 -4.220  1.00 0.00 ? 503 PRO C CG   6  
ATOM 5006  C CD   . PRO A 1 51 ? -10.764 -23.669 -4.143  1.00 0.00 ? 503 PRO C CD   6  
ATOM 5007  H HA   . PRO A 1 51 ? -10.173 -22.072 -6.743  1.00 0.00 ? 503 PRO C HA   6  
ATOM 5008  H HB2  . PRO A 1 51 ? -8.614  -24.447 -5.844  1.00 0.00 ? 503 PRO C HB2  6  
ATOM 5009  H HB3  . PRO A 1 51 ? -8.130  -22.749 -5.915  1.00 0.00 ? 503 PRO C HB3  6  
ATOM 5010  H HG2  . PRO A 1 51 ? -8.719  -23.886 -3.586  1.00 0.00 ? 503 PRO C HG2  6  
ATOM 5011  H HG3  . PRO A 1 51 ? -9.217  -22.220 -3.934  1.00 0.00 ? 503 PRO C HG3  6  
ATOM 5012  H HD2  . PRO A 1 51 ? -10.843 -24.721 -3.914  1.00 0.00 ? 503 PRO C HD2  6  
ATOM 5013  H HD3  . PRO A 1 51 ? -11.284 -23.078 -3.403  1.00 0.00 ? 503 PRO C HD3  6  
ATOM 5014  N N    . THR A 1 52 ? -10.385 -23.350 -8.830  1.00 0.00 ? 504 THR C N    6  
ATOM 5015  C CA   . THR A 1 52 ? -10.512 -24.008 -10.119 1.00 0.00 ? 504 THR C CA   6  
ATOM 5016  C C    . THR A 1 52 ? -10.358 -22.968 -11.230 1.00 0.00 ? 504 THR C C    6  
ATOM 5017  O O    . THR A 1 52 ? -9.330  -22.991 -11.934 1.00 0.00 ? 504 THR C O    6  
ATOM 5018  C CB   . THR A 1 52 ? -11.885 -24.736 -10.280 1.00 0.00 ? 504 THR C CB   6  
ATOM 5019  O OG1  . THR A 1 52 ? -11.991 -25.819 -9.339  1.00 0.00 ? 504 THR C OG1  6  
ATOM 5020  C CG2  . THR A 1 52 ? -12.049 -25.284 -11.691 1.00 0.00 ? 504 THR C CG2  6  
ATOM 5021  O OXT  . THR A 1 52 ? -11.254 -22.105 -11.367 1.00 0.00 ? 504 THR C OXT  6  
ATOM 5022  H H    . THR A 1 52 ? -10.374 -22.368 -8.816  1.00 0.00 ? 504 THR C H    6  
ATOM 5023  H HA   . THR A 1 52 ? -9.717  -24.734 -10.205 1.00 0.00 ? 504 THR C HA   6  
ATOM 5024  H HB   . THR A 1 52 ? -12.678 -24.026 -10.086 1.00 0.00 ? 504 THR C HB   6  
ATOM 5025  H HG1  . THR A 1 52 ? -11.526 -25.569 -8.526  1.00 0.00 ? 504 THR C HG1  6  
ATOM 5026  H HG21 . THR A 1 52 ? -11.250 -25.981 -11.901 1.00 0.00 ? 504 THR C HG21 6  
ATOM 5027  H HG22 . THR A 1 52 ? -12.010 -24.471 -12.400 1.00 0.00 ? 504 THR C HG22 6  
ATOM 5028  H HG23 . THR A 1 52 ? -13.000 -25.790 -11.774 1.00 0.00 ? 504 THR C HG23 6  
ATOM 5029  N N    . SER A 1 1  ? -9.853  -2.103  0.874   1.00 0.00 ? 453 SER C N    7  
ATOM 5030  C CA   . SER A 1 1  ? -9.747  -2.794  2.156   1.00 0.00 ? 453 SER C CA   7  
ATOM 5031  C C    . SER A 1 1  ? -9.315  -1.824  3.255   1.00 0.00 ? 453 SER C C    7  
ATOM 5032  O O    . SER A 1 1  ? -8.137  -1.477  3.362   1.00 0.00 ? 453 SER C O    7  
ATOM 5033  C CB   . SER A 1 1  ? -8.751  -3.942  2.031   1.00 0.00 ? 453 SER C CB   7  
ATOM 5034  O OG   . SER A 1 1  ? -9.077  -4.776  0.926   1.00 0.00 ? 453 SER C OG   7  
ATOM 5035  H H1   . SER A 1 1  ? -8.948  -1.660  0.627   1.00 0.00 ? 453 SER C H1   7  
ATOM 5036  H H2   . SER A 1 1  ? -10.584 -1.366  0.920   1.00 0.00 ? 453 SER C H2   7  
ATOM 5037  H H3   . SER A 1 1  ? -10.106 -2.780  0.129   1.00 0.00 ? 453 SER C H3   7  
ATOM 5038  H HA   . SER A 1 1  ? -10.718 -3.194  2.407   1.00 0.00 ? 453 SER C HA   7  
ATOM 5039  H HB2  . SER A 1 1  ? -7.759  -3.539  1.886   1.00 0.00 ? 453 SER C HB2  7  
ATOM 5040  H HB3  . SER A 1 1  ? -8.773  -4.534  2.933   1.00 0.00 ? 453 SER C HB3  7  
ATOM 5041  H HG   . SER A 1 1  ? -8.271  -4.966  0.427   1.00 0.00 ? 453 SER C HG   7  
ATOM 5042  N N    . ASN A 1 2  ? -10.274 -1.368  4.050   1.00 0.00 ? 454 ASN C N    7  
ATOM 5043  C CA   . ASN A 1 2  ? -9.984  -0.443  5.146   1.00 0.00 ? 454 ASN C CA   7  
ATOM 5044  C C    . ASN A 1 2  ? -9.450  -1.214  6.347   1.00 0.00 ? 454 ASN C C    7  
ATOM 5045  O O    . ASN A 1 2  ? -9.812  -2.371  6.553   1.00 0.00 ? 454 ASN C O    7  
ATOM 5046  C CB   . ASN A 1 2  ? -11.239 0.342   5.547   1.00 0.00 ? 454 ASN C CB   7  
ATOM 5047  C CG   . ASN A 1 2  ? -11.841 1.158   4.411   1.00 0.00 ? 454 ASN C CG   7  
ATOM 5048  O OD1  . ASN A 1 2  ? -13.058 1.344   4.349   1.00 0.00 ? 454 ASN C OD1  7  
ATOM 5049  N ND2  . ASN A 1 2  ? -11.006 1.658   3.516   1.00 0.00 ? 454 ASN C ND2  7  
ATOM 5050  H H    . ASN A 1 2  ? -11.197 -1.661  3.899   1.00 0.00 ? 454 ASN C H    7  
ATOM 5051  H HA   . ASN A 1 2  ? -9.226  0.245   4.807   1.00 0.00 ? 454 ASN C HA   7  
ATOM 5052  H HB2  . ASN A 1 2  ? -11.987 -0.352  5.893   1.00 0.00 ? 454 ASN C HB2  7  
ATOM 5053  H HB3  . ASN A 1 2  ? -10.986 1.015   6.352   1.00 0.00 ? 454 ASN C HB3  7  
ATOM 5054  H HD21 . ASN A 1 2  ? -10.043 1.487   3.620   1.00 0.00 ? 454 ASN C HD21 7  
ATOM 5055  H HD22 . ASN A 1 2  ? -11.380 2.188   2.781   1.00 0.00 ? 454 ASN C HD22 7  
ATOM 5056  N N    . SER A 1 3  ? -8.608  -0.565  7.137   1.00 0.00 ? 455 SER C N    7  
ATOM 5057  C CA   . SER A 1 3  ? -7.966  -1.189  8.298   1.00 0.00 ? 455 SER C CA   7  
ATOM 5058  C C    . SER A 1 3  ? -8.957  -1.928  9.213   1.00 0.00 ? 455 SER C C    7  
ATOM 5059  O O    . SER A 1 3  ? -8.764  -3.114  9.514   1.00 0.00 ? 455 SER C O    7  
ATOM 5060  C CB   . SER A 1 3  ? -7.194  -0.139  9.091   1.00 0.00 ? 455 SER C CB   7  
ATOM 5061  O OG   . SER A 1 3  ? -6.239  0.513   8.264   1.00 0.00 ? 455 SER C OG   7  
ATOM 5062  H H    . SER A 1 3  ? -8.398  0.375   6.939   1.00 0.00 ? 455 SER C H    7  
ATOM 5063  H HA   . SER A 1 3  ? -7.259  -1.912  7.920   1.00 0.00 ? 455 SER C HA   7  
ATOM 5064  H HB2  . SER A 1 3  ? -7.881  0.598   9.478   1.00 0.00 ? 455 SER C HB2  7  
ATOM 5065  H HB3  . SER A 1 3  ? -6.675  -0.615  9.910   1.00 0.00 ? 455 SER C HB3  7  
ATOM 5066  H HG   . SER A 1 3  ? -5.697  1.098   8.808   1.00 0.00 ? 455 SER C HG   7  
ATOM 5067  N N    . GLN A 1 4  ? -10.018 -1.249  9.635   1.00 0.00 ? 456 GLN C N    7  
ATOM 5068  C CA   . GLN A 1 4  ? -10.984 -1.866  10.540  1.00 0.00 ? 456 GLN C CA   7  
ATOM 5069  C C    . GLN A 1 4  ? -11.784 -2.961  9.845   1.00 0.00 ? 456 GLN C C    7  
ATOM 5070  O O    . GLN A 1 4  ? -12.192 -3.931  10.477  1.00 0.00 ? 456 GLN C O    7  
ATOM 5071  C CB   . GLN A 1 4  ? -11.917 -0.827  11.177  1.00 0.00 ? 456 GLN C CB   7  
ATOM 5072  C CG   . GLN A 1 4  ? -12.827 -0.099  10.203  1.00 0.00 ? 456 GLN C CG   7  
ATOM 5073  C CD   . GLN A 1 4  ? -13.773 0.849   10.911  1.00 0.00 ? 456 GLN C CD   7  
ATOM 5074  O OE1  . GLN A 1 4  ? -14.167 0.613   12.054  1.00 0.00 ? 456 GLN C OE1  7  
ATOM 5075  N NE2  . GLN A 1 4  ? -14.147 1.921   10.247  1.00 0.00 ? 456 GLN C NE2  7  
ATOM 5076  H H    . GLN A 1 4  ? -10.149 -0.322  9.338   1.00 0.00 ? 456 GLN C H    7  
ATOM 5077  H HA   . GLN A 1 4  ? -10.412 -2.333  11.327  1.00 0.00 ? 456 GLN C HA   7  
ATOM 5078  H HB2  . GLN A 1 4  ? -12.541 -1.326  11.902  1.00 0.00 ? 456 GLN C HB2  7  
ATOM 5079  H HB3  . GLN A 1 4  ? -11.314 -0.092  11.690  1.00 0.00 ? 456 GLN C HB3  7  
ATOM 5080  H HG2  . GLN A 1 4  ? -12.222 0.465   9.511   1.00 0.00 ? 456 GLN C HG2  7  
ATOM 5081  H HG3  . GLN A 1 4  ? -13.407 -0.830  9.663   1.00 0.00 ? 456 GLN C HG3  7  
ATOM 5082  H HE21 . GLN A 1 4  ? -13.801 2.054   9.336   1.00 0.00 ? 456 GLN C HE21 7  
ATOM 5083  H HE22 . GLN A 1 4  ? -14.755 2.552   10.687  1.00 0.00 ? 456 GLN C HE22 7  
ATOM 5084  N N    . LEU A 1 5  ? -11.988 -2.817  8.541   1.00 0.00 ? 457 LEU C N    7  
ATOM 5085  C CA   . LEU A 1 5  ? -12.715 -3.823  7.782   1.00 0.00 ? 457 LEU C CA   7  
ATOM 5086  C C    . LEU A 1 5  ? -11.890 -5.089  7.691   1.00 0.00 ? 457 LEU C C    7  
ATOM 5087  O O    . LEU A 1 5  ? -12.409 -6.192  7.844   1.00 0.00 ? 457 LEU C O    7  
ATOM 5088  C CB   . LEU A 1 5  ? -13.063 -3.324  6.384   1.00 0.00 ? 457 LEU C CB   7  
ATOM 5089  C CG   . LEU A 1 5  ? -13.975 -2.102  6.312   1.00 0.00 ? 457 LEU C CG   7  
ATOM 5090  C CD1  . LEU A 1 5  ? -14.360 -1.824  4.881   1.00 0.00 ? 457 LEU C CD1  7  
ATOM 5091  C CD2  . LEU A 1 5  ? -15.212 -2.298  7.167   1.00 0.00 ? 457 LEU C CD2  7  
ATOM 5092  H H    . LEU A 1 5  ? -11.634 -2.027  8.083   1.00 0.00 ? 457 LEU C H    7  
ATOM 5093  H HA   . LEU A 1 5  ? -13.627 -4.044  8.317   1.00 0.00 ? 457 LEU C HA   7  
ATOM 5094  H HB2  . LEU A 1 5  ? -12.139 -3.083  5.876   1.00 0.00 ? 457 LEU C HB2  7  
ATOM 5095  H HB3  . LEU A 1 5  ? -13.541 -4.132  5.849   1.00 0.00 ? 457 LEU C HB3  7  
ATOM 5096  H HG   . LEU A 1 5  ? -13.442 -1.243  6.689   1.00 0.00 ? 457 LEU C HG   7  
ATOM 5097  H HD11 . LEU A 1 5  ? -15.013 -0.965  4.845   1.00 0.00 ? 457 LEU C HD11 7  
ATOM 5098  H HD12 . LEU A 1 5  ? -14.877 -2.684  4.481   1.00 0.00 ? 457 LEU C HD12 7  
ATOM 5099  H HD13 . LEU A 1 5  ? -13.472 -1.631  4.298   1.00 0.00 ? 457 LEU C HD13 7  
ATOM 5100  H HD21 . LEU A 1 5  ? -14.912 -2.410  8.198   1.00 0.00 ? 457 LEU C HD21 7  
ATOM 5101  H HD22 . LEU A 1 5  ? -15.738 -3.181  6.843   1.00 0.00 ? 457 LEU C HD22 7  
ATOM 5102  H HD23 . LEU A 1 5  ? -15.857 -1.438  7.071   1.00 0.00 ? 457 LEU C HD23 7  
ATOM 5103  N N    . ASN A 1 6  ? -10.596 -4.917  7.449   1.00 0.00 ? 458 ASN C N    7  
ATOM 5104  C CA   . ASN A 1 6  ? -9.663  -6.034  7.392   1.00 0.00 ? 458 ASN C CA   7  
ATOM 5105  C C    . ASN A 1 6  ? -9.673  -6.775  8.709   1.00 0.00 ? 458 ASN C C    7  
ATOM 5106  O O    . ASN A 1 6  ? -9.677  -8.004  8.747   1.00 0.00 ? 458 ASN C O    7  
ATOM 5107  C CB   . ASN A 1 6  ? -8.240  -5.547  7.093   1.00 0.00 ? 458 ASN C CB   7  
ATOM 5108  C CG   . ASN A 1 6  ? -8.045  -5.112  5.655   1.00 0.00 ? 458 ASN C CG   7  
ATOM 5109  O OD1  . ASN A 1 6  ? -8.972  -4.655  4.996   1.00 0.00 ? 458 ASN C OD1  7  
ATOM 5110  N ND2  . ASN A 1 6  ? -6.829  -5.251  5.161   1.00 0.00 ? 458 ASN C ND2  7  
ATOM 5111  H H    . ASN A 1 6  ? -10.257 -4.006  7.290   1.00 0.00 ? 458 ASN C H    7  
ATOM 5112  H HA   . ASN A 1 6  ? -9.982  -6.702  6.607   1.00 0.00 ? 458 ASN C HA   7  
ATOM 5113  H HB2  . ASN A 1 6  ? -8.013  -4.708  7.733   1.00 0.00 ? 458 ASN C HB2  7  
ATOM 5114  H HB3  . ASN A 1 6  ? -7.548  -6.348  7.304   1.00 0.00 ? 458 ASN C HB3  7  
ATOM 5115  H HD21 . ASN A 1 6  ? -6.130  -5.619  5.743   1.00 0.00 ? 458 ASN C HD21 7  
ATOM 5116  H HD22 . ASN A 1 6  ? -6.669  -4.987  4.229   1.00 0.00 ? 458 ASN C HD22 7  
ATOM 5117  N N    . ALA A 1 7  ? -9.686  -6.015  9.795   1.00 0.00 ? 459 ALA C N    7  
ATOM 5118  C CA   . ALA A 1 7  ? -9.730  -6.581  11.124  1.00 0.00 ? 459 ALA C CA   7  
ATOM 5119  C C    . ALA A 1 7  ? -11.000 -7.395  11.313  1.00 0.00 ? 459 ALA C C    7  
ATOM 5120  O O    . ALA A 1 7  ? -10.938 -8.576  11.640  1.00 0.00 ? 459 ALA C O    7  
ATOM 5121  C CB   . ALA A 1 7  ? -9.638  -5.482  12.175  1.00 0.00 ? 459 ALA C CB   7  
ATOM 5122  H H    . ALA A 1 7  ? -9.666  -5.037  9.692   1.00 0.00 ? 459 ALA C H    7  
ATOM 5123  H HA   . ALA A 1 7  ? -8.876  -7.233  11.238  1.00 0.00 ? 459 ALA C HA   7  
ATOM 5124  H HB1  . ALA A 1 7  ? -9.618  -5.926  13.159  1.00 0.00 ? 459 ALA C HB1  7  
ATOM 5125  H HB2  . ALA A 1 7  ? -10.495 -4.832  12.090  1.00 0.00 ? 459 ALA C HB2  7  
ATOM 5126  H HB3  . ALA A 1 7  ? -8.736  -4.910  12.019  1.00 0.00 ? 459 ALA C HB3  7  
ATOM 5127  N N    . MET A 1 8  ? -12.149 -6.764  11.061  1.00 0.00 ? 460 MET C N    7  
ATOM 5128  C CA   . MET A 1 8  ? -13.444 -7.418  11.232  1.00 0.00 ? 460 MET C CA   7  
ATOM 5129  C C    . MET A 1 8  ? -13.559 -8.676  10.378  1.00 0.00 ? 460 MET C C    7  
ATOM 5130  O O    . MET A 1 8  ? -14.077 -9.702  10.834  1.00 0.00 ? 460 MET C O    7  
ATOM 5131  C CB   . MET A 1 8  ? -14.586 -6.459  10.898  1.00 0.00 ? 460 MET C CB   7  
ATOM 5132  C CG   . MET A 1 8  ? -14.670 -5.244  11.811  1.00 0.00 ? 460 MET C CG   7  
ATOM 5133  S SD   . MET A 1 8  ? -16.315 -4.499  11.824  1.00 0.00 ? 460 MET C SD   7  
ATOM 5134  C CE   . MET A 1 8  ? -16.476 -4.001  10.116  1.00 0.00 ? 460 MET C CE   7  
ATOM 5135  H H    . MET A 1 8  ? -12.130 -5.830  10.755  1.00 0.00 ? 460 MET C H    7  
ATOM 5136  H HA   . MET A 1 8  ? -13.527 -7.704  12.269  1.00 0.00 ? 460 MET C HA   7  
ATOM 5137  H HB2  . MET A 1 8  ? -14.465 -6.116  9.881   1.00 0.00 ? 460 MET C HB2  7  
ATOM 5138  H HB3  . MET A 1 8  ? -15.516 -6.997  10.966  1.00 0.00 ? 460 MET C HB3  7  
ATOM 5139  H HG2  . MET A 1 8  ? -14.413 -5.538  12.816  1.00 0.00 ? 460 MET C HG2  7  
ATOM 5140  H HG3  . MET A 1 8  ? -13.964 -4.504  11.459  1.00 0.00 ? 460 MET C HG3  7  
ATOM 5141  H HE1  . MET A 1 8  ? -16.193 -4.819  9.467   1.00 0.00 ? 460 MET C HE1  7  
ATOM 5142  H HE2  . MET A 1 8  ? -15.840 -3.151  9.928   1.00 0.00 ? 460 MET C HE2  7  
ATOM 5143  H HE3  . MET A 1 8  ? -17.504 -3.730  9.918   1.00 0.00 ? 460 MET C HE3  7  
ATOM 5144  N N    . ALA A 1 9  ? -13.076 -8.595  9.143   1.00 0.00 ? 461 ALA C N    7  
ATOM 5145  C CA   . ALA A 1 9  ? -13.108 -9.725  8.230   1.00 0.00 ? 461 ALA C CA   7  
ATOM 5146  C C    . ALA A 1 9  ? -12.327 -10.909 8.797   1.00 0.00 ? 461 ALA C C    7  
ATOM 5147  O O    . ALA A 1 9  ? -12.684 -12.066 8.572   1.00 0.00 ? 461 ALA C O    7  
ATOM 5148  C CB   . ALA A 1 9  ? -12.558 -9.321  6.871   1.00 0.00 ? 461 ALA C CB   7  
ATOM 5149  H H    . ALA A 1 9  ? -12.698 -7.742  8.831   1.00 0.00 ? 461 ALA C H    7  
ATOM 5150  H HA   . ALA A 1 9  ? -14.140 -10.019 8.103   1.00 0.00 ? 461 ALA C HA   7  
ATOM 5151  H HB1  . ALA A 1 9  ? -12.662 -10.144 6.181   1.00 0.00 ? 461 ALA C HB1  7  
ATOM 5152  H HB2  . ALA A 1 9  ? -11.513 -9.064  6.968   1.00 0.00 ? 461 ALA C HB2  7  
ATOM 5153  H HB3  . ALA A 1 9  ? -13.103 -8.465  6.498   1.00 0.00 ? 461 ALA C HB3  7  
ATOM 5154  N N    . HIS A 1 10 ? -11.265 -10.610 9.544   1.00 0.00 ? 462 HIS C N    7  
ATOM 5155  C CA   . HIS A 1 10 ? -10.451 -11.650 10.158  1.00 0.00 ? 462 HIS C CA   7  
ATOM 5156  C C    . HIS A 1 10 ? -11.220 -12.389 11.244  1.00 0.00 ? 462 HIS C C    7  
ATOM 5157  O O    . HIS A 1 10 ? -11.157 -13.606 11.322  1.00 0.00 ? 462 HIS C O    7  
ATOM 5158  C CB   . HIS A 1 10 ? -9.142  -11.086 10.724  1.00 0.00 ? 462 HIS C CB   7  
ATOM 5159  C CG   . HIS A 1 10 ? -7.998  -11.111 9.755   1.00 0.00 ? 462 HIS C CG   7  
ATOM 5160  N ND1  . HIS A 1 10 ? -7.122  -12.166 9.661   1.00 0.00 ? 462 HIS C ND1  7  
ATOM 5161  C CD2  . HIS A 1 10 ? -7.588  -10.209 8.833   1.00 0.00 ? 462 HIS C CD2  7  
ATOM 5162  C CE1  . HIS A 1 10 ? -6.227  -11.917 8.732   1.00 0.00 ? 462 HIS C CE1  7  
ATOM 5163  N NE2  . HIS A 1 10 ? -6.483  -10.737 8.208   1.00 0.00 ? 462 HIS C NE2  7  
ATOM 5164  H H    . HIS A 1 10 ? -11.035 -9.667  9.690   1.00 0.00 ? 462 HIS C H    7  
ATOM 5165  H HA   . HIS A 1 10 ? -10.208 -12.361 9.382   1.00 0.00 ? 462 HIS C HA   7  
ATOM 5166  H HB2  . HIS A 1 10 ? -9.300  -10.060 11.022  1.00 0.00 ? 462 HIS C HB2  7  
ATOM 5167  H HB3  . HIS A 1 10 ? -8.857  -11.665 11.590  1.00 0.00 ? 462 HIS C HB3  7  
ATOM 5168  H HD1  . HIS A 1 10 ? -7.153  -12.987 10.206  1.00 0.00 ? 462 HIS C HD1  7  
ATOM 5169  H HD2  . HIS A 1 10 ? -8.043  -9.251  8.626   1.00 0.00 ? 462 HIS C HD2  7  
ATOM 5170  H HE1  . HIS A 1 10 ? -5.417  -12.573 8.444   1.00 0.00 ? 462 HIS C HE1  7  
ATOM 5171  H HE2  . HIS A 1 10 ? -6.140  -10.443 7.336   1.00 0.00 ? 462 HIS C HE2  7  
ATOM 5172  N N    . GLN A 1 11 ? -11.963 -11.649 12.075  1.00 0.00 ? 463 GLN C N    7  
ATOM 5173  C CA   . GLN A 1 11 ? -12.751 -12.274 13.148  1.00 0.00 ? 463 GLN C CA   7  
ATOM 5174  C C    . GLN A 1 11 ? -13.725 -13.297 12.584  1.00 0.00 ? 463 GLN C C    7  
ATOM 5175  O O    . GLN A 1 11 ? -13.852 -14.402 13.113  1.00 0.00 ? 463 GLN C O    7  
ATOM 5176  C CB   . GLN A 1 11 ? -13.520 -11.234 13.981  1.00 0.00 ? 463 GLN C CB   7  
ATOM 5177  C CG   . GLN A 1 11 ? -12.694 -10.523 15.050  1.00 0.00 ? 463 GLN C CG   7  
ATOM 5178  C CD   . GLN A 1 11 ? -11.740 -9.496  14.484  1.00 0.00 ? 463 GLN C CD   7  
ATOM 5179  O OE1  . GLN A 1 11 ? -12.096 -8.329  14.319  1.00 0.00 ? 463 GLN C OE1  7  
ATOM 5180  N NE2  . GLN A 1 11 ? -10.524 -9.909  14.201  1.00 0.00 ? 463 GLN C NE2  7  
ATOM 5181  H H    . GLN A 1 11 ? -11.981 -10.673 11.963  1.00 0.00 ? 463 GLN C H    7  
ATOM 5182  H HA   . GLN A 1 11 ? -12.060 -12.800 13.795  1.00 0.00 ? 463 GLN C HA   7  
ATOM 5183  H HB2  . GLN A 1 11 ? -13.914 -10.483 13.311  1.00 0.00 ? 463 GLN C HB2  7  
ATOM 5184  H HB3  . GLN A 1 11 ? -14.347 -11.729 14.468  1.00 0.00 ? 463 GLN C HB3  7  
ATOM 5185  H HG2  . GLN A 1 11 ? -13.365 -10.022 15.729  1.00 0.00 ? 463 GLN C HG2  7  
ATOM 5186  H HG3  . GLN A 1 11 ? -12.125 -11.263 15.592  1.00 0.00 ? 463 GLN C HG3  7  
ATOM 5187  H HE21 . GLN A 1 11 ? -10.301 -10.850 14.371  1.00 0.00 ? 463 GLN C HE21 7  
ATOM 5188  H HE22 . GLN A 1 11 ? -9.892  -9.259  13.828  1.00 0.00 ? 463 GLN C HE22 7  
ATOM 5189  N N    . ILE A 1 12 ? -14.408 -12.932 11.506  1.00 0.00 ? 464 ILE C N    7  
ATOM 5190  C CA   . ILE A 1 12 ? -15.340 -13.845 10.872  1.00 0.00 ? 464 ILE C CA   7  
ATOM 5191  C C    . ILE A 1 12 ? -14.598 -15.020 10.257  1.00 0.00 ? 464 ILE C C    7  
ATOM 5192  O O    . ILE A 1 12 ? -15.031 -16.148 10.372  1.00 0.00 ? 464 ILE C O    7  
ATOM 5193  C CB   . ILE A 1 12 ? -16.188 -13.159 9.788   1.00 0.00 ? 464 ILE C CB   7  
ATOM 5194  C CG1  . ILE A 1 12 ? -16.946 -11.960 10.370  1.00 0.00 ? 464 ILE C CG1  7  
ATOM 5195  C CG2  . ILE A 1 12 ? -17.171 -14.161 9.176   1.00 0.00 ? 464 ILE C CG2  7  
ATOM 5196  C CD1  . ILE A 1 12 ? -17.680 -11.159 9.323   1.00 0.00 ? 464 ILE C CD1  7  
ATOM 5197  H H    . ILE A 1 12 ? -14.285 -12.030 11.137  1.00 0.00 ? 464 ILE C H    7  
ATOM 5198  H HA   . ILE A 1 12 ? -16.003 -14.224 11.636  1.00 0.00 ? 464 ILE C HA   7  
ATOM 5199  H HB   . ILE A 1 12 ? -15.526 -12.814 9.008   1.00 0.00 ? 464 ILE C HB   7  
ATOM 5200  H HG12 . ILE A 1 12 ? -17.675 -12.317 11.083  1.00 0.00 ? 464 ILE C HG12 7  
ATOM 5201  H HG13 . ILE A 1 12 ? -16.260 -11.300 10.878  1.00 0.00 ? 464 ILE C HG13 7  
ATOM 5202  H HG21 . ILE A 1 12 ? -17.778 -14.594 9.961   1.00 0.00 ? 464 ILE C HG21 7  
ATOM 5203  H HG22 . ILE A 1 12 ? -16.624 -14.948 8.675   1.00 0.00 ? 464 ILE C HG22 7  
ATOM 5204  H HG23 . ILE A 1 12 ? -17.808 -13.655 8.467   1.00 0.00 ? 464 ILE C HG23 7  
ATOM 5205  H HD11 . ILE A 1 12 ? -18.441 -11.774 8.865   1.00 0.00 ? 464 ILE C HD11 7  
ATOM 5206  H HD12 . ILE A 1 12 ? -16.980 -10.832 8.568   1.00 0.00 ? 464 ILE C HD12 7  
ATOM 5207  H HD13 . ILE A 1 12 ? -18.138 -10.300 9.782   1.00 0.00 ? 464 ILE C HD13 7  
ATOM 5208  N N    . GLN A 1 13 ? -13.462 -14.746 9.626   1.00 0.00 ? 465 GLN C N    7  
ATOM 5209  C CA   . GLN A 1 13 ? -12.651 -15.797 9.009   1.00 0.00 ? 465 GLN C CA   7  
ATOM 5210  C C    . GLN A 1 13 ? -12.150 -16.786 10.066  1.00 0.00 ? 465 GLN C C    7  
ATOM 5211  O O    . GLN A 1 13 ? -11.985 -17.976 9.796   1.00 0.00 ? 465 GLN C O    7  
ATOM 5212  C CB   . GLN A 1 13 ? -11.471 -15.176 8.250   1.00 0.00 ? 465 GLN C CB   7  
ATOM 5213  C CG   . GLN A 1 13 ? -10.559 -16.189 7.563   1.00 0.00 ? 465 GLN C CG   7  
ATOM 5214  C CD   . GLN A 1 13 ? -11.294 -17.090 6.580   1.00 0.00 ? 465 GLN C CD   7  
ATOM 5215  O OE1  . GLN A 1 13 ? -10.907 -18.237 6.369   1.00 0.00 ? 465 GLN C OE1  7  
ATOM 5216  N NE2  . GLN A 1 13 ? -12.345 -16.580 5.964   1.00 0.00 ? 465 GLN C NE2  7  
ATOM 5217  H H    . GLN A 1 13 ? -13.160 -13.813 9.568   1.00 0.00 ? 465 GLN C H    7  
ATOM 5218  H HA   . GLN A 1 13 ? -13.278 -16.328 8.308   1.00 0.00 ? 465 GLN C HA   7  
ATOM 5219  H HB2  . GLN A 1 13 ? -11.857 -14.505 7.498   1.00 0.00 ? 465 GLN C HB2  7  
ATOM 5220  H HB3  . GLN A 1 13 ? -10.876 -14.609 8.952   1.00 0.00 ? 465 GLN C HB3  7  
ATOM 5221  H HG2  . GLN A 1 13 ? -9.791  -15.656 7.025   1.00 0.00 ? 465 GLN C HG2  7  
ATOM 5222  H HG3  . GLN A 1 13 ? -10.101 -16.808 8.321   1.00 0.00 ? 465 GLN C HG3  7  
ATOM 5223  H HE21 . GLN A 1 13 ? -12.601 -15.656 6.161   1.00 0.00 ? 465 GLN C HE21 7  
ATOM 5224  H HE22 . GLN A 1 13 ? -12.833 -17.158 5.334   1.00 0.00 ? 465 GLN C HE22 7  
ATOM 5225  N N    . GLU A 1 14 ? -11.919 -16.284 11.263  1.00 0.00 ? 466 GLU C N    7  
ATOM 5226  C CA   . GLU A 1 14 ? -11.476 -17.107 12.370  1.00 0.00 ? 466 GLU C CA   7  
ATOM 5227  C C    . GLU A 1 14 ? -12.604 -18.002 12.873  1.00 0.00 ? 466 GLU C C    7  
ATOM 5228  O O    . GLU A 1 14 ? -12.362 -19.066 13.443  1.00 0.00 ? 466 GLU C O    7  
ATOM 5229  C CB   . GLU A 1 14 ? -10.942 -16.224 13.494  1.00 0.00 ? 466 GLU C CB   7  
ATOM 5230  C CG   . GLU A 1 14 ? -9.630  -15.542 13.148  1.00 0.00 ? 466 GLU C CG   7  
ATOM 5231  C CD   . GLU A 1 14 ? -8.563  -16.525 12.722  1.00 0.00 ? 466 GLU C CD   7  
ATOM 5232  O OE1  . GLU A 1 14 ? -7.821  -17.013 13.591  1.00 0.00 ? 466 GLU C OE1  7  
ATOM 5233  O OE2  . GLU A 1 14 ? -8.458  -16.810 11.512  1.00 0.00 ? 466 GLU C OE2  7  
ATOM 5234  H H    . GLU A 1 14 ? -12.033 -15.318 11.405  1.00 0.00 ? 466 GLU C H    7  
ATOM 5235  H HA   . GLU A 1 14 ? -10.675 -17.733 12.011  1.00 0.00 ? 466 GLU C HA   7  
ATOM 5236  H HB2  . GLU A 1 14 ? -11.674 -15.459 13.703  1.00 0.00 ? 466 GLU C HB2  7  
ATOM 5237  H HB3  . GLU A 1 14 ? -10.797 -16.815 14.380  1.00 0.00 ? 466 GLU C HB3  7  
ATOM 5238  H HG2  . GLU A 1 14 ? -9.805  -14.851 12.334  1.00 0.00 ? 466 GLU C HG2  7  
ATOM 5239  H HG3  . GLU A 1 14 ? -9.280  -15.000 14.014  1.00 0.00 ? 466 GLU C HG3  7  
ATOM 5240  N N    . MET A 1 15 ? -13.829 -17.566 12.663  1.00 0.00 ? 467 MET C N    7  
ATOM 5241  C CA   . MET A 1 15 ? -14.986 -18.338 13.068  1.00 0.00 ? 467 MET C CA   7  
ATOM 5242  C C    . MET A 1 15 ? -15.461 -19.217 11.917  1.00 0.00 ? 467 MET C C    7  
ATOM 5243  O O    . MET A 1 15 ? -15.903 -20.345 12.121  1.00 0.00 ? 467 MET C O    7  
ATOM 5244  C CB   . MET A 1 15 ? -16.113 -17.409 13.519  1.00 0.00 ? 467 MET C CB   7  
ATOM 5245  C CG   . MET A 1 15 ? -15.751 -16.528 14.704  1.00 0.00 ? 467 MET C CG   7  
ATOM 5246  S SD   . MET A 1 15 ? -17.121 -15.484 15.254  1.00 0.00 ? 467 MET C SD   7  
ATOM 5247  C CE   . MET A 1 15 ? -17.420 -14.492 13.790  1.00 0.00 ? 467 MET C CE   7  
ATOM 5248  H H    . MET A 1 15 ? -13.964 -16.700 12.225  1.00 0.00 ? 467 MET C H    7  
ATOM 5249  H HA   . MET A 1 15 ? -14.696 -18.968 13.895  1.00 0.00 ? 467 MET C HA   7  
ATOM 5250  H HB2  . MET A 1 15 ? -16.380 -16.767 12.693  1.00 0.00 ? 467 MET C HB2  7  
ATOM 5251  H HB3  . MET A 1 15 ? -16.969 -18.006 13.787  1.00 0.00 ? 467 MET C HB3  7  
ATOM 5252  H HG2  . MET A 1 15 ? -15.448 -17.159 15.525  1.00 0.00 ? 467 MET C HG2  7  
ATOM 5253  H HG3  . MET A 1 15 ? -14.924 -15.892 14.421  1.00 0.00 ? 467 MET C HG3  7  
ATOM 5254  H HE1  . MET A 1 15 ? -17.662 -15.136 12.959  1.00 0.00 ? 467 MET C HE1  7  
ATOM 5255  H HE2  . MET A 1 15 ? -16.535 -13.920 13.560  1.00 0.00 ? 467 MET C HE2  7  
ATOM 5256  H HE3  . MET A 1 15 ? -18.245 -13.819 13.976  1.00 0.00 ? 467 MET C HE3  7  
ATOM 5257  N N    . PHE A 1 16 ? -15.353 -18.690 10.710  1.00 0.00 ? 468 PHE C N    7  
ATOM 5258  C CA   . PHE A 1 16 ? -15.778 -19.380 9.508   1.00 0.00 ? 468 PHE C CA   7  
ATOM 5259  C C    . PHE A 1 16 ? -14.623 -19.518 8.516   1.00 0.00 ? 468 PHE C C    7  
ATOM 5260  O O    . PHE A 1 16 ? -14.540 -18.776 7.543   1.00 0.00 ? 468 PHE C O    7  
ATOM 5261  C CB   . PHE A 1 16 ? -16.952 -18.633 8.842   1.00 0.00 ? 468 PHE C CB   7  
ATOM 5262  C CG   . PHE A 1 16 ? -18.271 -18.813 9.539   1.00 0.00 ? 468 PHE C CG   7  
ATOM 5263  C CD1  . PHE A 1 16 ? -18.432 -18.433 10.855  1.00 0.00 ? 468 PHE C CD1  7  
ATOM 5264  C CD2  . PHE A 1 16 ? -19.348 -19.373 8.873   1.00 0.00 ? 468 PHE C CD2  7  
ATOM 5265  C CE1  . PHE A 1 16 ? -19.633 -18.612 11.501  1.00 0.00 ? 468 PHE C CE1  7  
ATOM 5266  C CE2  . PHE A 1 16 ? -20.556 -19.552 9.512   1.00 0.00 ? 468 PHE C CE2  7  
ATOM 5267  C CZ   . PHE A 1 16 ? -20.700 -19.172 10.829  1.00 0.00 ? 468 PHE C CZ   7  
ATOM 5268  H H    . PHE A 1 16 ? -14.970 -17.791 10.616  1.00 0.00 ? 468 PHE C H    7  
ATOM 5269  H HA   . PHE A 1 16 ? -16.112 -20.367 9.793   1.00 0.00 ? 468 PHE C HA   7  
ATOM 5270  H HB2  . PHE A 1 16 ? -16.732 -17.577 8.828   1.00 0.00 ? 468 PHE C HB2  7  
ATOM 5271  H HB3  . PHE A 1 16 ? -17.058 -18.983 7.826   1.00 0.00 ? 468 PHE C HB3  7  
ATOM 5272  H HD1  . PHE A 1 16 ? -17.597 -17.991 11.380  1.00 0.00 ? 468 PHE C HD1  7  
ATOM 5273  H HD2  . PHE A 1 16 ? -19.238 -19.663 7.841   1.00 0.00 ? 468 PHE C HD2  7  
ATOM 5274  H HE1  . PHE A 1 16 ? -19.737 -18.304 12.530  1.00 0.00 ? 468 PHE C HE1  7  
ATOM 5275  H HE2  . PHE A 1 16 ? -21.388 -19.990 8.981   1.00 0.00 ? 468 PHE C HE2  7  
ATOM 5276  H HZ   . PHE A 1 16 ? -21.644 -19.315 11.335  1.00 0.00 ? 468 PHE C HZ   7  
ATOM 5277  N N    . PRO A 1 17 ? -13.702 -20.467 8.763   1.00 0.00 ? 469 PRO C N    7  
ATOM 5278  C CA   . PRO A 1 17 ? -12.574 -20.726 7.867   1.00 0.00 ? 469 PRO C CA   7  
ATOM 5279  C C    . PRO A 1 17 ? -13.046 -21.392 6.585   1.00 0.00 ? 469 PRO C C    7  
ATOM 5280  O O    . PRO A 1 17 ? -12.311 -21.496 5.602   1.00 0.00 ? 469 PRO C O    7  
ATOM 5281  C CB   . PRO A 1 17 ? -11.684 -21.697 8.663   1.00 0.00 ? 469 PRO C CB   7  
ATOM 5282  C CG   . PRO A 1 17 ? -12.225 -21.682 10.051  1.00 0.00 ? 469 PRO C CG   7  
ATOM 5283  C CD   . PRO A 1 17 ? -13.672 -21.332 9.934   1.00 0.00 ? 469 PRO C CD   7  
ATOM 5284  H HA   . PRO A 1 17 ? -12.035 -19.820 7.651   1.00 0.00 ? 469 PRO C HA   7  
ATOM 5285  H HB2  . PRO A 1 17 ? -11.750 -22.682 8.226   1.00 0.00 ? 469 PRO C HB2  7  
ATOM 5286  H HB3  . PRO A 1 17 ? -10.660 -21.354 8.635   1.00 0.00 ? 469 PRO C HB3  7  
ATOM 5287  H HG2  . PRO A 1 17 ? -12.113 -22.657 10.502  1.00 0.00 ? 469 PRO C HG2  7  
ATOM 5288  H HG3  . PRO A 1 17 ? -11.710 -20.937 10.633  1.00 0.00 ? 469 PRO C HG3  7  
ATOM 5289  H HD2  . PRO A 1 17 ? -14.280 -22.210 9.785   1.00 0.00 ? 469 PRO C HD2  7  
ATOM 5290  H HD3  . PRO A 1 17 ? -13.992 -20.787 10.805  1.00 0.00 ? 469 PRO C HD3  7  
ATOM 5291  N N    . GLN A 1 18 ? -14.284 -21.838 6.623   1.00 0.00 ? 470 GLN C N    7  
ATOM 5292  C CA   . GLN A 1 18 ? -14.910 -22.523 5.512   1.00 0.00 ? 470 GLN C CA   7  
ATOM 5293  C C    . GLN A 1 18 ? -15.310 -21.553 4.400   1.00 0.00 ? 470 GLN C C    7  
ATOM 5294  O O    . GLN A 1 18 ? -15.581 -21.969 3.274   1.00 0.00 ? 470 GLN C O    7  
ATOM 5295  C CB   . GLN A 1 18 ? -16.121 -23.311 6.013   1.00 0.00 ? 470 GLN C CB   7  
ATOM 5296  C CG   . GLN A 1 18 ? -17.181 -22.458 6.692   1.00 0.00 ? 470 GLN C CG   7  
ATOM 5297  C CD   . GLN A 1 18 ? -18.142 -23.281 7.532   1.00 0.00 ? 470 GLN C CD   7  
ATOM 5298  O OE1  . GLN A 1 18 ? -17.767 -24.314 8.084   1.00 0.00 ? 470 GLN C OE1  7  
ATOM 5299  N NE2  . GLN A 1 18 ? -19.376 -22.835 7.636   1.00 0.00 ? 470 GLN C NE2  7  
ATOM 5300  H H    . GLN A 1 18 ? -14.791 -21.699 7.449   1.00 0.00 ? 470 GLN C H    7  
ATOM 5301  H HA   . GLN A 1 18 ? -14.194 -23.219 5.113   1.00 0.00 ? 470 GLN C HA   7  
ATOM 5302  H HB2  . GLN A 1 18 ? -16.579 -23.811 5.173   1.00 0.00 ? 470 GLN C HB2  7  
ATOM 5303  H HB3  . GLN A 1 18 ? -15.783 -24.056 6.719   1.00 0.00 ? 470 GLN C HB3  7  
ATOM 5304  H HG2  . GLN A 1 18 ? -16.693 -21.738 7.331   1.00 0.00 ? 470 GLN C HG2  7  
ATOM 5305  H HG3  . GLN A 1 18 ? -17.740 -21.940 5.928   1.00 0.00 ? 470 GLN C HG3  7  
ATOM 5306  H HE21 . GLN A 1 18 ? -19.616 -22.001 7.170   1.00 0.00 ? 470 GLN C HE21 7  
ATOM 5307  H HE22 . GLN A 1 18 ? -20.013 -23.353 8.174   1.00 0.00 ? 470 GLN C HE22 7  
ATOM 5308  N N    . VAL A 1 19 ? -15.338 -20.267 4.715   1.00 0.00 ? 471 VAL C N    7  
ATOM 5309  C CA   . VAL A 1 19 ? -15.693 -19.264 3.737   1.00 0.00 ? 471 VAL C CA   7  
ATOM 5310  C C    . VAL A 1 19 ? -14.458 -18.451 3.343   1.00 0.00 ? 471 VAL C C    7  
ATOM 5311  O O    . VAL A 1 19 ? -13.478 -18.394 4.095   1.00 0.00 ? 471 VAL C O    7  
ATOM 5312  C CB   . VAL A 1 19 ? -16.802 -18.315 4.263   1.00 0.00 ? 471 VAL C CB   7  
ATOM 5313  C CG1  . VAL A 1 19 ? -17.968 -19.103 4.834   1.00 0.00 ? 471 VAL C CG1  7  
ATOM 5314  C CG2  . VAL A 1 19 ? -16.255 -17.332 5.283   1.00 0.00 ? 471 VAL C CG2  7  
ATOM 5315  H H    . VAL A 1 19 ? -15.102 -19.980 5.620   1.00 0.00 ? 471 VAL C H    7  
ATOM 5316  H HA   . VAL A 1 19 ? -16.065 -19.778 2.865   1.00 0.00 ? 471 VAL C HA   7  
ATOM 5317  H HB   . VAL A 1 19 ? -17.171 -17.753 3.421   1.00 0.00 ? 471 VAL C HB   7  
ATOM 5318  H HG11 . VAL A 1 19 ? -17.614 -19.738 5.633   1.00 0.00 ? 471 VAL C HG11 7  
ATOM 5319  H HG12 . VAL A 1 19 ? -18.407 -19.710 4.056   1.00 0.00 ? 471 VAL C HG12 7  
ATOM 5320  H HG13 . VAL A 1 19 ? -18.708 -18.420 5.220   1.00 0.00 ? 471 VAL C HG13 7  
ATOM 5321  H HG21 . VAL A 1 19 ? -15.815 -17.873 6.108   1.00 0.00 ? 471 VAL C HG21 7  
ATOM 5322  H HG22 . VAL A 1 19 ? -17.056 -16.704 5.644   1.00 0.00 ? 471 VAL C HG22 7  
ATOM 5323  H HG23 . VAL A 1 19 ? -15.502 -16.721 4.807   1.00 0.00 ? 471 VAL C HG23 7  
ATOM 5324  N N    . PRO A 1 20 ? -14.479 -17.822 2.164   1.00 0.00 ? 472 PRO C N    7  
ATOM 5325  C CA   . PRO A 1 20 ? -13.360 -17.031 1.671   1.00 0.00 ? 472 PRO C CA   7  
ATOM 5326  C C    . PRO A 1 20 ? -13.269 -15.676 2.356   1.00 0.00 ? 472 PRO C C    7  
ATOM 5327  O O    . PRO A 1 20 ? -14.253 -14.936 2.436   1.00 0.00 ? 472 PRO C O    7  
ATOM 5328  C CB   . PRO A 1 20 ? -13.661 -16.844 0.177   1.00 0.00 ? 472 PRO C CB   7  
ATOM 5329  C CG   . PRO A 1 20 ? -14.885 -17.657 -0.093  1.00 0.00 ? 472 PRO C CG   7  
ATOM 5330  C CD   . PRO A 1 20 ? -15.584 -17.825 1.220   1.00 0.00 ? 472 PRO C CD   7  
ATOM 5331  H HA   . PRO A 1 20 ? -12.424 -17.558 1.790   1.00 0.00 ? 472 PRO C HA   7  
ATOM 5332  H HB2  . PRO A 1 20 ? -13.831 -15.797 -0.024  1.00 0.00 ? 472 PRO C HB2  7  
ATOM 5333  H HB3  . PRO A 1 20 ? -12.823 -17.191 -0.408  1.00 0.00 ? 472 PRO C HB3  7  
ATOM 5334  H HG2  . PRO A 1 20 ? -15.521 -17.139 -0.793  1.00 0.00 ? 472 PRO C HG2  7  
ATOM 5335  H HG3  . PRO A 1 20 ? -14.594 -18.620 -0.487  1.00 0.00 ? 472 PRO C HG3  7  
ATOM 5336  H HD2  . PRO A 1 20 ? -16.254 -17.000 1.412   1.00 0.00 ? 472 PRO C HD2  7  
ATOM 5337  H HD3  . PRO A 1 20 ? -16.115 -18.761 1.251   1.00 0.00 ? 472 PRO C HD3  7  
ATOM 5338  N N    . TYR A 1 21 ? -12.080 -15.359 2.827   1.00 0.00 ? 473 TYR C N    7  
ATOM 5339  C CA   . TYR A 1 21 ? -11.809 -14.104 3.515   1.00 0.00 ? 473 TYR C CA   7  
ATOM 5340  C C    . TYR A 1 21 ? -12.131 -12.901 2.629   1.00 0.00 ? 473 TYR C C    7  
ATOM 5341  O O    . TYR A 1 21 ? -12.642 -11.886 3.111   1.00 0.00 ? 473 TYR C O    7  
ATOM 5342  C CB   . TYR A 1 21 ? -10.338 -14.059 3.957   1.00 0.00 ? 473 TYR C CB   7  
ATOM 5343  C CG   . TYR A 1 21 ? -9.889  -12.718 4.500   1.00 0.00 ? 473 TYR C CG   7  
ATOM 5344  C CD1  . TYR A 1 21 ? -10.042 -12.401 5.840   1.00 0.00 ? 473 TYR C CD1  7  
ATOM 5345  C CD2  . TYR A 1 21 ? -9.310  -11.769 3.665   1.00 0.00 ? 473 TYR C CD2  7  
ATOM 5346  C CE1  . TYR A 1 21 ? -9.635  -11.178 6.331   1.00 0.00 ? 473 TYR C CE1  7  
ATOM 5347  C CE2  . TYR A 1 21 ? -8.900  -10.548 4.149   1.00 0.00 ? 473 TYR C CE2  7  
ATOM 5348  C CZ   . TYR A 1 21 ? -9.063  -10.255 5.480   1.00 0.00 ? 473 TYR C CZ   7  
ATOM 5349  O OH   . TYR A 1 21 ? -8.658  -9.032  5.964   1.00 0.00 ? 473 TYR C OH   7  
ATOM 5350  H H    . TYR A 1 21 ? -11.346 -15.998 2.695   1.00 0.00 ? 473 TYR C H    7  
ATOM 5351  H HA   . TYR A 1 21 ? -12.435 -14.066 4.393   1.00 0.00 ? 473 TYR C HA   7  
ATOM 5352  H HB2  . TYR A 1 21 ? -10.180 -14.794 4.732   1.00 0.00 ? 473 TYR C HB2  7  
ATOM 5353  H HB3  . TYR A 1 21 ? -9.712  -14.301 3.111   1.00 0.00 ? 473 TYR C HB3  7  
ATOM 5354  H HD1  . TYR A 1 21 ? -10.491 -13.125 6.504   1.00 0.00 ? 473 TYR C HD1  7  
ATOM 5355  H HD2  . TYR A 1 21 ? -9.184  -12.001 2.617   1.00 0.00 ? 473 TYR C HD2  7  
ATOM 5356  H HE1  . TYR A 1 21 ? -9.761  -10.948 7.378   1.00 0.00 ? 473 TYR C HE1  7  
ATOM 5357  H HE2  . TYR A 1 21 ? -8.453  -9.825  3.481   1.00 0.00 ? 473 TYR C HE2  7  
ATOM 5358  H HH   . TYR A 1 21 ? -9.034  -8.339  5.409   1.00 0.00 ? 473 TYR C HH   7  
ATOM 5359  N N    . HIS A 1 22 ? -11.831 -13.024 1.335   1.00 0.00 ? 474 HIS C N    7  
ATOM 5360  C CA   . HIS A 1 22 ? -12.067 -11.934 0.378   1.00 0.00 ? 474 HIS C CA   7  
ATOM 5361  C C    . HIS A 1 22 ? -13.513 -11.489 0.417   1.00 0.00 ? 474 HIS C C    7  
ATOM 5362  O O    . HIS A 1 22 ? -13.806 -10.321 0.644   1.00 0.00 ? 474 HIS C O    7  
ATOM 5363  C CB   . HIS A 1 22 ? -11.737 -12.356 -1.063  1.00 0.00 ? 474 HIS C CB   7  
ATOM 5364  C CG   . HIS A 1 22 ? -10.363 -12.903 -1.277  1.00 0.00 ? 474 HIS C CG   7  
ATOM 5365  N ND1  . HIS A 1 22 ? -9.211  -12.249 -0.900  1.00 0.00 ? 474 HIS C ND1  7  
ATOM 5366  C CD2  . HIS A 1 22 ? -9.968  -14.062 -1.839  1.00 0.00 ? 474 HIS C CD2  7  
ATOM 5367  C CE1  . HIS A 1 22 ? -8.167  -12.986 -1.222  1.00 0.00 ? 474 HIS C CE1  7  
ATOM 5368  N NE2  . HIS A 1 22 ? -8.599  -14.093 -1.792  1.00 0.00 ? 474 HIS C NE2  7  
ATOM 5369  H H    . HIS A 1 22 ? -11.438 -13.870 1.023   1.00 0.00 ? 474 HIS C H    7  
ATOM 5370  H HA   . HIS A 1 22 ? -11.436 -11.102 0.655   1.00 0.00 ? 474 HIS C HA   7  
ATOM 5371  H HB2  . HIS A 1 22 ? -12.436 -13.120 -1.368  1.00 0.00 ? 474 HIS C HB2  7  
ATOM 5372  H HB3  . HIS A 1 22 ? -11.858 -11.498 -1.709  1.00 0.00 ? 474 HIS C HB3  7  
ATOM 5373  H HD1  . HIS A 1 22 ? -9.163  -11.362 -0.473  1.00 0.00 ? 474 HIS C HD1  7  
ATOM 5374  H HD2  . HIS A 1 22 ? -10.624 -14.815 -2.254  1.00 0.00 ? 474 HIS C HD2  7  
ATOM 5375  H HE1  . HIS A 1 22 ? -7.132  -12.729 -1.044  1.00 0.00 ? 474 HIS C HE1  7  
ATOM 5376  H HE2  . HIS A 1 22 ? -8.052  -14.894 -1.951  1.00 0.00 ? 474 HIS C HE2  7  
ATOM 5377  N N    . LEU A 1 23 ? -14.416 -12.443 0.222   1.00 0.00 ? 475 LEU C N    7  
ATOM 5378  C CA   . LEU A 1 23 ? -15.841 -12.160 0.149   1.00 0.00 ? 475 LEU C CA   7  
ATOM 5379  C C    . LEU A 1 23 ? -16.348 -11.577 1.458   1.00 0.00 ? 475 LEU C C    7  
ATOM 5380  O O    . LEU A 1 23 ? -17.260 -10.750 1.463   1.00 0.00 ? 475 LEU C O    7  
ATOM 5381  C CB   . LEU A 1 23 ? -16.625 -13.426 -0.201  1.00 0.00 ? 475 LEU C CB   7  
ATOM 5382  C CG   . LEU A 1 23 ? -16.076 -14.268 -1.364  1.00 0.00 ? 475 LEU C CG   7  
ATOM 5383  C CD1  . LEU A 1 23 ? -17.097 -15.303 -1.799  1.00 0.00 ? 475 LEU C CD1  7  
ATOM 5384  C CD2  . LEU A 1 23 ? -15.655 -13.396 -2.544  1.00 0.00 ? 475 LEU C CD2  7  
ATOM 5385  H H    . LEU A 1 23 ? -14.118 -13.370 0.131   1.00 0.00 ? 475 LEU C H    7  
ATOM 5386  H HA   . LEU A 1 23 ? -15.992 -11.432 -0.634  1.00 0.00 ? 475 LEU C HA   7  
ATOM 5387  H HB2  . LEU A 1 23 ? -16.658 -14.051 0.679   1.00 0.00 ? 475 LEU C HB2  7  
ATOM 5388  H HB3  . LEU A 1 23 ? -17.632 -13.133 -0.446  1.00 0.00 ? 475 LEU C HB3  7  
ATOM 5389  H HG   . LEU A 1 23 ? -15.204 -14.801 -1.016  1.00 0.00 ? 475 LEU C HG   7  
ATOM 5390  H HD11 . LEU A 1 23 ? -17.977 -14.802 -2.175  1.00 0.00 ? 475 LEU C HD11 7  
ATOM 5391  H HD12 . LEU A 1 23 ? -17.368 -15.918 -0.954  1.00 0.00 ? 475 LEU C HD12 7  
ATOM 5392  H HD13 . LEU A 1 23 ? -16.675 -15.922 -2.577  1.00 0.00 ? 475 LEU C HD13 7  
ATOM 5393  H HD21 . LEU A 1 23 ? -14.875 -12.720 -2.225  1.00 0.00 ? 475 LEU C HD21 7  
ATOM 5394  H HD22 . LEU A 1 23 ? -16.502 -12.831 -2.904  1.00 0.00 ? 475 LEU C HD22 7  
ATOM 5395  H HD23 . LEU A 1 23 ? -15.276 -14.027 -3.335  1.00 0.00 ? 475 LEU C HD23 7  
ATOM 5396  N N    . VAL A 1 24 ? -15.758 -12.014 2.560   1.00 0.00 ? 476 VAL C N    7  
ATOM 5397  C CA   . VAL A 1 24 ? -16.114 -11.498 3.869   1.00 0.00 ? 476 VAL C CA   7  
ATOM 5398  C C    . VAL A 1 24 ? -15.803 -10.006 3.942   1.00 0.00 ? 476 VAL C C    7  
ATOM 5399  O O    . VAL A 1 24 ? -16.686 -9.192  4.182   1.00 0.00 ? 476 VAL C O    7  
ATOM 5400  C CB   . VAL A 1 24 ? -15.352 -12.239 4.996   1.00 0.00 ? 476 VAL C CB   7  
ATOM 5401  C CG1  . VAL A 1 24 ? -15.671 -11.637 6.351   1.00 0.00 ? 476 VAL C CG1  7  
ATOM 5402  C CG2  . VAL A 1 24 ? -15.691 -13.718 4.983   1.00 0.00 ? 476 VAL C CG2  7  
ATOM 5403  H H    . VAL A 1 24 ? -15.066 -12.704 2.487   1.00 0.00 ? 476 VAL C H    7  
ATOM 5404  H HA   . VAL A 1 24 ? -17.175 -11.645 4.014   1.00 0.00 ? 476 VAL C HA   7  
ATOM 5405  H HB   . VAL A 1 24 ? -14.292 -12.133 4.816   1.00 0.00 ? 476 VAL C HB   7  
ATOM 5406  H HG11 . VAL A 1 24 ? -16.723 -11.750 6.559   1.00 0.00 ? 476 VAL C HG11 7  
ATOM 5407  H HG12 . VAL A 1 24 ? -15.414 -10.587 6.347   1.00 0.00 ? 476 VAL C HG12 7  
ATOM 5408  H HG13 . VAL A 1 24 ? -15.095 -12.145 7.112   1.00 0.00 ? 476 VAL C HG13 7  
ATOM 5409  H HG21 . VAL A 1 24 ? -15.418 -14.142 4.028   1.00 0.00 ? 476 VAL C HG21 7  
ATOM 5410  H HG22 . VAL A 1 24 ? -16.751 -13.846 5.143   1.00 0.00 ? 476 VAL C HG22 7  
ATOM 5411  H HG23 . VAL A 1 24 ? -15.145 -14.220 5.768   1.00 0.00 ? 476 VAL C HG23 7  
ATOM 5412  N N    . LEU A 1 25 ? -14.543 -9.662  3.693   1.00 0.00 ? 477 LEU C N    7  
ATOM 5413  C CA   . LEU A 1 25 ? -14.087 -8.273  3.712   1.00 0.00 ? 477 LEU C CA   7  
ATOM 5414  C C    . LEU A 1 25 ? -14.923 -7.450  2.737   1.00 0.00 ? 477 LEU C C    7  
ATOM 5415  O O    . LEU A 1 25 ? -15.370 -6.347  3.054   1.00 0.00 ? 477 LEU C O    7  
ATOM 5416  C CB   . LEU A 1 25 ? -12.603 -8.234  3.304   1.00 0.00 ? 477 LEU C CB   7  
ATOM 5417  C CG   . LEU A 1 25 ? -11.751 -7.109  3.896   1.00 0.00 ? 477 LEU C CG   7  
ATOM 5418  C CD1  . LEU A 1 25 ? -10.311 -7.246  3.437   1.00 0.00 ? 477 LEU C CD1  7  
ATOM 5419  C CD2  . LEU A 1 25 ? -12.295 -5.744  3.521   1.00 0.00 ? 477 LEU C CD2  7  
ATOM 5420  H H    . LEU A 1 25 ? -13.892 -10.367 3.484   1.00 0.00 ? 477 LEU C H    7  
ATOM 5421  H HA   . LEU A 1 25 ? -14.205 -7.868  4.708   1.00 0.00 ? 477 LEU C HA   7  
ATOM 5422  H HB2  . LEU A 1 25 ? -12.157 -9.172  3.599   1.00 0.00 ? 477 LEU C HB2  7  
ATOM 5423  H HB3  . LEU A 1 25 ? -12.553 -8.164  2.227   1.00 0.00 ? 477 LEU C HB3  7  
ATOM 5424  H HG   . LEU A 1 25 ? -11.770 -7.197  4.970   1.00 0.00 ? 477 LEU C HG   7  
ATOM 5425  H HD11 . LEU A 1 25 ? -10.268 -7.170  2.362   1.00 0.00 ? 477 LEU C HD11 7  
ATOM 5426  H HD12 . LEU A 1 25 ? -9.928  -8.209  3.744   1.00 0.00 ? 477 LEU C HD12 7  
ATOM 5427  H HD13 . LEU A 1 25 ? -9.714  -6.461  3.878   1.00 0.00 ? 477 LEU C HD13 7  
ATOM 5428  H HD21 . LEU A 1 25 ? -13.305 -5.655  3.897   1.00 0.00 ? 477 LEU C HD21 7  
ATOM 5429  H HD22 . LEU A 1 25 ? -12.300 -5.641  2.447   1.00 0.00 ? 477 LEU C HD22 7  
ATOM 5430  H HD23 . LEU A 1 25 ? -11.678 -4.975  3.960   1.00 0.00 ? 477 LEU C HD23 7  
ATOM 5431  N N    . GLN A 1 26 ? -15.132 -8.009  1.561   1.00 0.00 ? 478 GLN C N    7  
ATOM 5432  C CA   . GLN A 1 26 ? -15.930 -7.380  0.525   1.00 0.00 ? 478 GLN C CA   7  
ATOM 5433  C C    . GLN A 1 26 ? -17.336 -7.037  1.026   1.00 0.00 ? 478 GLN C C    7  
ATOM 5434  O O    . GLN A 1 26 ? -17.828 -5.934  0.794   1.00 0.00 ? 478 GLN C O    7  
ATOM 5435  C CB   . GLN A 1 26 ? -16.008 -8.293  -0.702  1.00 0.00 ? 478 GLN C CB   7  
ATOM 5436  C CG   . GLN A 1 26 ? -14.724 -8.336  -1.518  1.00 0.00 ? 478 GLN C CG   7  
ATOM 5437  C CD   . GLN A 1 26 ? -14.747 -9.390  -2.618  1.00 0.00 ? 478 GLN C CD   7  
ATOM 5438  O OE1  . GLN A 1 26 ? -13.703 -9.924  -3.004  1.00 0.00 ? 478 GLN C OE1  7  
ATOM 5439  N NE2  . GLN A 1 26 ? -15.922 -9.701  -3.122  1.00 0.00 ? 478 GLN C NE2  7  
ATOM 5440  H H    . GLN A 1 26 ? -14.722 -8.883  1.382   1.00 0.00 ? 478 GLN C H    7  
ATOM 5441  H HA   . GLN A 1 26 ? -15.432 -6.467  0.243   1.00 0.00 ? 478 GLN C HA   7  
ATOM 5442  H HB2  . GLN A 1 26 ? -16.227 -9.297  -0.370  1.00 0.00 ? 478 GLN C HB2  7  
ATOM 5443  H HB3  . GLN A 1 26 ? -16.808 -7.958  -1.341  1.00 0.00 ? 478 GLN C HB3  7  
ATOM 5444  H HG2  . GLN A 1 26 ? -14.573 -7.369  -1.976  1.00 0.00 ? 478 GLN C HG2  7  
ATOM 5445  H HG3  . GLN A 1 26 ? -13.899 -8.548  -0.854  1.00 0.00 ? 478 GLN C HG3  7  
ATOM 5446  H HE21 . GLN A 1 26 ? -16.719 -9.245  -2.772  1.00 0.00 ? 478 GLN C HE21 7  
ATOM 5447  H HE22 . GLN A 1 26 ? -15.962 -10.380 -3.830  1.00 0.00 ? 478 GLN C HE22 7  
ATOM 5448  N N    . ASP A 1 27 ? -17.961 -7.971  1.736   1.00 0.00 ? 479 ASP C N    7  
ATOM 5449  C CA   . ASP A 1 27 ? -19.324 -7.766  2.241   1.00 0.00 ? 479 ASP C CA   7  
ATOM 5450  C C    . ASP A 1 27 ? -19.343 -6.785  3.401   1.00 0.00 ? 479 ASP C C    7  
ATOM 5451  O O    . ASP A 1 27 ? -20.357 -6.159  3.671   1.00 0.00 ? 479 ASP C O    7  
ATOM 5452  C CB   . ASP A 1 27 ? -19.954 -9.081  2.673   1.00 0.00 ? 479 ASP C CB   7  
ATOM 5453  C CG   . ASP A 1 27 ? -21.425 -8.925  3.021   1.00 0.00 ? 479 ASP C CG   7  
ATOM 5454  O OD1  . ASP A 1 27 ? -22.252 -8.846  2.085   1.00 0.00 ? 479 ASP C OD1  7  
ATOM 5455  O OD2  . ASP A 1 27 ? -21.760 -8.877  4.224   1.00 0.00 ? 479 ASP C OD2  7  
ATOM 5456  H H    . ASP A 1 27 ? -17.502 -8.817  1.928   1.00 0.00 ? 479 ASP C H    7  
ATOM 5457  H HA   . ASP A 1 27 ? -19.912 -7.348  1.432   1.00 0.00 ? 479 ASP C HA   7  
ATOM 5458  H HB2  . ASP A 1 27 ? -19.859 -9.795  1.872   1.00 0.00 ? 479 ASP C HB2  7  
ATOM 5459  H HB3  . ASP A 1 27 ? -19.433 -9.452  3.543   1.00 0.00 ? 479 ASP C HB3  7  
ATOM 5460  N N    . LEU A 1 28 ? -18.220 -6.641  4.080   1.00 0.00 ? 480 LEU C N    7  
ATOM 5461  C CA   . LEU A 1 28 ? -18.122 -5.689  5.175   1.00 0.00 ? 480 LEU C CA   7  
ATOM 5462  C C    . LEU A 1 28 ? -18.271 -4.252  4.670   1.00 0.00 ? 480 LEU C C    7  
ATOM 5463  O O    . LEU A 1 28 ? -18.497 -3.332  5.445   1.00 0.00 ? 480 LEU C O    7  
ATOM 5464  C CB   . LEU A 1 28 ? -16.824 -5.874  5.976   1.00 0.00 ? 480 LEU C CB   7  
ATOM 5465  C CG   . LEU A 1 28 ? -16.945 -6.685  7.274   1.00 0.00 ? 480 LEU C CG   7  
ATOM 5466  C CD1  . LEU A 1 28 ? -18.129 -6.220  8.100   1.00 0.00 ? 480 LEU C CD1  7  
ATOM 5467  C CD2  . LEU A 1 28 ? -17.075 -8.147  6.971   1.00 0.00 ? 480 LEU C CD2  7  
ATOM 5468  H H    . LEU A 1 28 ? -17.447 -7.193  3.854   1.00 0.00 ? 480 LEU C H    7  
ATOM 5469  H HA   . LEU A 1 28 ? -18.960 -5.887  5.825   1.00 0.00 ? 480 LEU C HA   7  
ATOM 5470  H HB2  . LEU A 1 28 ? -16.108 -6.373  5.345   1.00 0.00 ? 480 LEU C HB2  7  
ATOM 5471  H HB3  . LEU A 1 28 ? -16.427 -4.912  6.218   1.00 0.00 ? 480 LEU C HB3  7  
ATOM 5472  H HG   . LEU A 1 28 ? -16.052 -6.542  7.863   1.00 0.00 ? 480 LEU C HG   7  
ATOM 5473  H HD11 . LEU A 1 28 ? -19.046 -6.540  7.627   1.00 0.00 ? 480 LEU C HD11 7  
ATOM 5474  H HD12 . LEU A 1 28 ? -18.119 -5.142  8.173   1.00 0.00 ? 480 LEU C HD12 7  
ATOM 5475  H HD13 . LEU A 1 28 ? -18.068 -6.649  9.089   1.00 0.00 ? 480 LEU C HD13 7  
ATOM 5476  H HD21 . LEU A 1 28 ? -17.206 -8.696  7.890   1.00 0.00 ? 480 LEU C HD21 7  
ATOM 5477  H HD22 . LEU A 1 28 ? -16.184 -8.489  6.465   1.00 0.00 ? 480 LEU C HD22 7  
ATOM 5478  H HD23 . LEU A 1 28 ? -17.938 -8.288  6.335   1.00 0.00 ? 480 LEU C HD23 7  
ATOM 5479  N N    . GLN A 1 29 ? -18.134 -4.072  3.365   1.00 0.00 ? 481 GLN C N    7  
ATOM 5480  C CA   . GLN A 1 29 ? -18.395 -2.792  2.740   1.00 0.00 ? 481 GLN C CA   7  
ATOM 5481  C C    . GLN A 1 29 ? -19.871 -2.690  2.384   1.00 0.00 ? 481 GLN C C    7  
ATOM 5482  O O    . GLN A 1 29 ? -20.439 -1.602  2.324   1.00 0.00 ? 481 GLN C O    7  
ATOM 5483  C CB   . GLN A 1 29 ? -17.550 -2.635  1.481   1.00 0.00 ? 481 GLN C CB   7  
ATOM 5484  C CG   . GLN A 1 29 ? -16.221 -1.958  1.718   1.00 0.00 ? 481 GLN C CG   7  
ATOM 5485  C CD   . GLN A 1 29 ? -16.355 -0.457  1.897   1.00 0.00 ? 481 GLN C CD   7  
ATOM 5486  O OE1  . GLN A 1 29 ? -16.279 0.305   0.931   1.00 0.00 ? 481 GLN C OE1  7  
ATOM 5487  N NE2  . GLN A 1 29 ? -16.559 -0.020  3.124   1.00 0.00 ? 481 GLN C NE2  7  
ATOM 5488  H H    . GLN A 1 29 ? -17.833 -4.823  2.809   1.00 0.00 ? 481 GLN C H    7  
ATOM 5489  H HA   . GLN A 1 29 ? -18.138 -2.014  3.441   1.00 0.00 ? 481 GLN C HA   7  
ATOM 5490  H HB2  . GLN A 1 29 ? -17.362 -3.613  1.067   1.00 0.00 ? 481 GLN C HB2  7  
ATOM 5491  H HB3  . GLN A 1 29 ? -18.105 -2.051  0.763   1.00 0.00 ? 481 GLN C HB3  7  
ATOM 5492  H HG2  . GLN A 1 29 ? -15.773 -2.373  2.608   1.00 0.00 ? 481 GLN C HG2  7  
ATOM 5493  H HG3  . GLN A 1 29 ? -15.584 -2.151  0.873   1.00 0.00 ? 481 GLN C HG3  7  
ATOM 5494  H HE21 . GLN A 1 29 ? -16.611 -0.677  3.848   1.00 0.00 ? 481 GLN C HE21 7  
ATOM 5495  H HE22 . GLN A 1 29 ? -16.648 0.945   3.261   1.00 0.00 ? 481 GLN C HE22 7  
ATOM 5496  N N    . LEU A 1 30 ? -20.479 -3.842  2.171   1.00 0.00 ? 482 LEU C N    7  
ATOM 5497  C CA   . LEU A 1 30 ? -21.875 -3.945  1.795   1.00 0.00 ? 482 LEU C CA   7  
ATOM 5498  C C    . LEU A 1 30 ? -22.791 -3.840  3.008   1.00 0.00 ? 482 LEU C C    7  
ATOM 5499  O O    . LEU A 1 30 ? -23.703 -3.012  3.041   1.00 0.00 ? 482 LEU C O    7  
ATOM 5500  C CB   . LEU A 1 30 ? -22.121 -5.284  1.087   1.00 0.00 ? 482 LEU C CB   7  
ATOM 5501  C CG   . LEU A 1 30 ? -21.754 -5.368  -0.405  1.00 0.00 ? 482 LEU C CG   7  
ATOM 5502  C CD1  . LEU A 1 30 ? -22.705 -4.543  -1.231  1.00 0.00 ? 482 LEU C CD1  7  
ATOM 5503  C CD2  . LEU A 1 30 ? -20.323 -4.925  -0.656  1.00 0.00 ? 482 LEU C CD2  7  
ATOM 5504  H H    . LEU A 1 30 ? -19.974 -4.675  2.270   1.00 0.00 ? 482 LEU C H    7  
ATOM 5505  H HA   . LEU A 1 30 ? -22.101 -3.146  1.108   1.00 0.00 ? 482 LEU C HA   7  
ATOM 5506  H HB2  . LEU A 1 30 ? -21.555 -6.040  1.611   1.00 0.00 ? 482 LEU C HB2  7  
ATOM 5507  H HB3  . LEU A 1 30 ? -23.166 -5.522  1.189   1.00 0.00 ? 482 LEU C HB3  7  
ATOM 5508  H HG   . LEU A 1 30 ? -21.845 -6.396  -0.719  1.00 0.00 ? 482 LEU C HG   7  
ATOM 5509  H HD11 . LEU A 1 30 ? -22.632 -3.508  -0.936  1.00 0.00 ? 482 LEU C HD11 7  
ATOM 5510  H HD12 . LEU A 1 30 ? -23.713 -4.895  -1.069  1.00 0.00 ? 482 LEU C HD12 7  
ATOM 5511  H HD13 . LEU A 1 30 ? -22.448 -4.644  -2.273  1.00 0.00 ? 482 LEU C HD13 7  
ATOM 5512  H HD21 . LEU A 1 30 ? -19.644 -5.573  -0.122  1.00 0.00 ? 482 LEU C HD21 7  
ATOM 5513  H HD22 . LEU A 1 30 ? -20.195 -3.910  -0.311  1.00 0.00 ? 482 LEU C HD22 7  
ATOM 5514  H HD23 . LEU A 1 30 ? -20.111 -4.973  -1.713  1.00 0.00 ? 482 LEU C HD23 7  
ATOM 5515  N N    . THR A 1 31 ? -22.547 -4.674  4.007   1.00 0.00 ? 483 THR C N    7  
ATOM 5516  C CA   . THR A 1 31 ? -23.391 -4.715  5.182   1.00 0.00 ? 483 THR C CA   7  
ATOM 5517  C C    . THR A 1 31 ? -22.771 -3.945  6.341   1.00 0.00 ? 483 THR C C    7  
ATOM 5518  O O    . THR A 1 31 ? -23.488 -3.408  7.193   1.00 0.00 ? 483 THR C O    7  
ATOM 5519  C CB   . THR A 1 31 ? -23.648 -6.165  5.615   1.00 0.00 ? 483 THR C CB   7  
ATOM 5520  O OG1  . THR A 1 31 ? -22.400 -6.843  5.765   1.00 0.00 ? 483 THR C OG1  7  
ATOM 5521  C CG2  . THR A 1 31 ? -24.504 -6.895  4.588   1.00 0.00 ? 483 THR C CG2  7  
ATOM 5522  H H    . THR A 1 31 ? -21.771 -5.290  3.960   1.00 0.00 ? 483 THR C H    7  
ATOM 5523  H HA   . THR A 1 31 ? -24.339 -4.265  4.929   1.00 0.00 ? 483 THR C HA   7  
ATOM 5524  H HB   . THR A 1 31 ? -24.167 -6.160  6.564   1.00 0.00 ? 483 THR C HB   7  
ATOM 5525  H HG1  . THR A 1 31 ? -22.306 -7.519  5.068   1.00 0.00 ? 483 THR C HG1  7  
ATOM 5526  H HG21 . THR A 1 31 ? -24.003 -6.883  3.631   1.00 0.00 ? 483 THR C HG21 7  
ATOM 5527  H HG22 . THR A 1 31 ? -25.460 -6.404  4.499   1.00 0.00 ? 483 THR C HG22 7  
ATOM 5528  H HG23 . THR A 1 31 ? -24.649 -7.918  4.903   1.00 0.00 ? 483 THR C HG23 7  
ATOM 5529  N N    . ARG A 1 32 ? -21.428 -3.900  6.371   1.00 0.00 ? 484 ARG C N    7  
ATOM 5530  C CA   . ARG A 1 32 ? -20.683 -3.209  7.424   1.00 0.00 ? 484 ARG C CA   7  
ATOM 5531  C C    . ARG A 1 32 ? -20.992 -3.799  8.799   1.00 0.00 ? 484 ARG C C    7  
ATOM 5532  O O    . ARG A 1 32 ? -20.779 -3.160  9.823   1.00 0.00 ? 484 ARG C O    7  
ATOM 5533  C CB   . ARG A 1 32 ? -20.999 -1.722  7.411   1.00 0.00 ? 484 ARG C CB   7  
ATOM 5534  C CG   . ARG A 1 32 ? -20.801 -1.059  6.065   1.00 0.00 ? 484 ARG C CG   7  
ATOM 5535  C CD   . ARG A 1 32 ? -21.187 0.395   6.131   1.00 0.00 ? 484 ARG C CD   7  
ATOM 5536  N NE   . ARG A 1 32 ? -21.127 1.050   4.823   1.00 0.00 ? 484 ARG C NE   7  
ATOM 5537  C CZ   . ARG A 1 32 ? -21.168 2.375   4.647   1.00 0.00 ? 484 ARG C CZ   7  
ATOM 5538  N NH1  . ARG A 1 32 ? -21.236 3.184   5.696   1.00 0.00 ? 484 ARG C NH1  7  
ATOM 5539  N NH2  . ARG A 1 32 ? -21.140 2.884   3.424   1.00 0.00 ? 484 ARG C NH2  7  
ATOM 5540  H H    . ARG A 1 32 ? -20.918 -4.338  5.662   1.00 0.00 ? 484 ARG C H    7  
ATOM 5541  H HA   . ARG A 1 32 ? -19.631 -3.341  7.221   1.00 0.00 ? 484 ARG C HA   7  
ATOM 5542  H HB2  . ARG A 1 32 ? -22.024 -1.578  7.708   1.00 0.00 ? 484 ARG C HB2  7  
ATOM 5543  H HB3  . ARG A 1 32 ? -20.353 -1.236  8.122   1.00 0.00 ? 484 ARG C HB3  7  
ATOM 5544  H HG2  . ARG A 1 32 ? -19.763 -1.138  5.786   1.00 0.00 ? 484 ARG C HG2  7  
ATOM 5545  H HG3  . ARG A 1 32 ? -21.416 -1.559  5.330   1.00 0.00 ? 484 ARG C HG3  7  
ATOM 5546  H HD2  . ARG A 1 32 ? -22.196 0.458   6.509   1.00 0.00 ? 484 ARG C HD2  7  
ATOM 5547  H HD3  . ARG A 1 32 ? -20.513 0.894   6.810   1.00 0.00 ? 484 ARG C HD3  7  
ATOM 5548  H HE   . ARG A 1 32 ? -21.064 0.464   4.036   1.00 0.00 ? 484 ARG C HE   7  
ATOM 5549  H HH11 . ARG A 1 32 ? -21.259 2.813   6.627   1.00 0.00 ? 484 ARG C HH11 7  
ATOM 5550  H HH12 . ARG A 1 32 ? -21.269 4.180   5.570   1.00 0.00 ? 484 ARG C HH12 7  
ATOM 5551  H HH21 . ARG A 1 32 ? -21.086 2.280   2.625   1.00 0.00 ? 484 ARG C HH21 7  
ATOM 5552  H HH22 . ARG A 1 32 ? -21.177 3.877   3.283   1.00 0.00 ? 484 ARG C HH22 7  
ATOM 5553  N N    . SER A 1 33 ? -21.472 -5.026  8.810   1.00 0.00 ? 485 SER C N    7  
ATOM 5554  C CA   . SER A 1 33 ? -21.845 -5.687  10.035  1.00 0.00 ? 485 SER C CA   7  
ATOM 5555  C C    . SER A 1 33 ? -21.366 -7.111  10.027  1.00 0.00 ? 485 SER C C    7  
ATOM 5556  O O    . SER A 1 33 ? -21.907 -7.927  9.305   1.00 0.00 ? 485 SER C O    7  
ATOM 5557  C CB   . SER A 1 33 ? -23.365 -5.675  10.189  1.00 0.00 ? 485 SER C CB   7  
ATOM 5558  O OG   . SER A 1 33 ? -23.773 -6.405  11.338  1.00 0.00 ? 485 SER C OG   7  
ATOM 5559  H H    . SER A 1 33 ? -21.575 -5.509  7.960   1.00 0.00 ? 485 SER C H    7  
ATOM 5560  H HA   . SER A 1 33 ? -21.404 -5.156  10.860  1.00 0.00 ? 485 SER C HA   7  
ATOM 5561  H HB2  . SER A 1 33 ? -23.717 -4.661  10.270  1.00 0.00 ? 485 SER C HB2  7  
ATOM 5562  H HB3  . SER A 1 33 ? -23.809 -6.132  9.318   1.00 0.00 ? 485 SER C HB3  7  
ATOM 5563  H HG   . SER A 1 33 ? -23.580 -5.887  12.130  1.00 0.00 ? 485 SER C HG   7  
ATOM 5564  N N    . VAL A 1 34 ? -20.357 -7.422  10.838  1.00 0.00 ? 486 VAL C N    7  
ATOM 5565  C CA   . VAL A 1 34 ? -19.850 -8.782  10.901  1.00 0.00 ? 486 VAL C CA   7  
ATOM 5566  C C    . VAL A 1 34 ? -20.944 -9.747  11.338  1.00 0.00 ? 486 VAL C C    7  
ATOM 5567  O O    . VAL A 1 34 ? -20.932 -10.925 10.973  1.00 0.00 ? 486 VAL C O    7  
ATOM 5568  C CB   . VAL A 1 34 ? -18.623 -8.922  11.838  1.00 0.00 ? 486 VAL C CB   7  
ATOM 5569  C CG1  . VAL A 1 34 ? -17.552 -7.931  11.472  1.00 0.00 ? 486 VAL C CG1  7  
ATOM 5570  C CG2  . VAL A 1 34 ? -19.000 -8.794  13.302  1.00 0.00 ? 486 VAL C CG2  7  
ATOM 5571  H H    . VAL A 1 34 ? -19.947 -6.731  11.397  1.00 0.00 ? 486 VAL C H    7  
ATOM 5572  H HA   . VAL A 1 34 ? -19.546 -9.047  9.899   1.00 0.00 ? 486 VAL C HA   7  
ATOM 5573  H HB   . VAL A 1 34 ? -18.215 -9.908  11.686  1.00 0.00 ? 486 VAL C HB   7  
ATOM 5574  H HG11 . VAL A 1 34 ? -17.950 -6.929  11.534  1.00 0.00 ? 486 VAL C HG11 7  
ATOM 5575  H HG12 . VAL A 1 34 ? -17.210 -8.125  10.467  1.00 0.00 ? 486 VAL C HG12 7  
ATOM 5576  H HG13 . VAL A 1 34 ? -16.726 -8.032  12.162  1.00 0.00 ? 486 VAL C HG13 7  
ATOM 5577  H HG21 . VAL A 1 34 ? -19.741 -9.541  13.543  1.00 0.00 ? 486 VAL C HG21 7  
ATOM 5578  H HG22 . VAL A 1 34 ? -19.397 -7.808  13.490  1.00 0.00 ? 486 VAL C HG22 7  
ATOM 5579  H HG23 . VAL A 1 34 ? -18.118 -8.958  13.903  1.00 0.00 ? 486 VAL C HG23 7  
ATOM 5580  N N    . GLU A 1 35 ? -21.899 -9.232  12.106  1.00 0.00 ? 487 GLU C N    7  
ATOM 5581  C CA   . GLU A 1 35 ? -23.016 -10.025 12.559  1.00 0.00 ? 487 GLU C CA   7  
ATOM 5582  C C    . GLU A 1 35 ? -23.852 -10.451 11.363  1.00 0.00 ? 487 GLU C C    7  
ATOM 5583  O O    . GLU A 1 35 ? -24.165 -11.634 11.204  1.00 0.00 ? 487 GLU C O    7  
ATOM 5584  C CB   . GLU A 1 35 ? -23.856 -9.239  13.568  1.00 0.00 ? 487 GLU C CB   7  
ATOM 5585  C CG   . GLU A 1 35 ? -23.061 -8.761  14.776  1.00 0.00 ? 487 GLU C CG   7  
ATOM 5586  C CD   . GLU A 1 35 ? -23.916 -8.068  15.814  1.00 0.00 ? 487 GLU C CD   7  
ATOM 5587  O OE1  . GLU A 1 35 ? -24.486 -8.766  16.676  1.00 0.00 ? 487 GLU C OE1  7  
ATOM 5588  O OE2  . GLU A 1 35 ? -24.014 -6.823  15.782  1.00 0.00 ? 487 GLU C OE2  7  
ATOM 5589  H H    . GLU A 1 35 ? -21.845 -8.287  12.367  1.00 0.00 ? 487 GLU C H    7  
ATOM 5590  H HA   . GLU A 1 35 ? -22.621 -10.912 13.035  1.00 0.00 ? 487 GLU C HA   7  
ATOM 5591  H HB2  . GLU A 1 35 ? -24.278 -8.374  13.074  1.00 0.00 ? 487 GLU C HB2  7  
ATOM 5592  H HB3  . GLU A 1 35 ? -24.662 -9.869  13.920  1.00 0.00 ? 487 GLU C HB3  7  
ATOM 5593  H HG2  . GLU A 1 35 ? -22.587 -9.614  15.239  1.00 0.00 ? 487 GLU C HG2  7  
ATOM 5594  H HG3  . GLU A 1 35 ? -22.299 -8.073  14.440  1.00 0.00 ? 487 GLU C HG3  7  
ATOM 5595  N N    . ILE A 1 36 ? -24.180 -9.491  10.502  1.00 0.00 ? 488 ILE C N    7  
ATOM 5596  C CA   . ILE A 1 36 ? -24.929 -9.793  9.296   1.00 0.00 ? 488 ILE C CA   7  
ATOM 5597  C C    . ILE A 1 36 ? -24.060 -10.566 8.323   1.00 0.00 ? 488 ILE C C    7  
ATOM 5598  O O    . ILE A 1 36 ? -24.482 -11.541 7.783   1.00 0.00 ? 488 ILE C O    7  
ATOM 5599  C CB   . ILE A 1 36 ? -25.453 -8.521  8.585   1.00 0.00 ? 488 ILE C CB   7  
ATOM 5600  C CG1  . ILE A 1 36 ? -26.338 -7.695  9.527   1.00 0.00 ? 488 ILE C CG1  7  
ATOM 5601  C CG2  . ILE A 1 36 ? -26.216 -8.895  7.314   1.00 0.00 ? 488 ILE C CG2  7  
ATOM 5602  C CD1  . ILE A 1 36 ? -26.850 -6.405  8.919   1.00 0.00 ? 488 ILE C CD1  7  
ATOM 5603  H H    . ILE A 1 36 ? -23.913 -8.565  10.688  1.00 0.00 ? 488 ILE C H    7  
ATOM 5604  H HA   . ILE A 1 36 ? -25.775 -10.406 9.571   1.00 0.00 ? 488 ILE C HA   7  
ATOM 5605  H HB   . ILE A 1 36 ? -24.601 -7.938  8.286   1.00 0.00 ? 488 ILE C HB   7  
ATOM 5606  H HG12 . ILE A 1 36 ? -27.195 -8.286  9.811   1.00 0.00 ? 488 ILE C HG12 7  
ATOM 5607  H HG13 . ILE A 1 36 ? -25.772 -7.445  10.413  1.00 0.00 ? 488 ILE C HG13 7  
ATOM 5608  H HG21 . ILE A 1 36 ? -27.046 -9.535  7.568   1.00 0.00 ? 488 ILE C HG21 7  
ATOM 5609  H HG22 . ILE A 1 36 ? -25.551 -9.413  6.636   1.00 0.00 ? 488 ILE C HG22 7  
ATOM 5610  H HG23 . ILE A 1 36 ? -26.583 -7.998  6.838   1.00 0.00 ? 488 ILE C HG23 7  
ATOM 5611  H HD11 . ILE A 1 36 ? -27.450 -6.629  8.049   1.00 0.00 ? 488 ILE C HD11 7  
ATOM 5612  H HD12 . ILE A 1 36 ? -26.013 -5.786  8.629   1.00 0.00 ? 488 ILE C HD12 7  
ATOM 5613  H HD13 . ILE A 1 36 ? -27.452 -5.878  9.645   1.00 0.00 ? 488 ILE C HD13 7  
ATOM 5614  N N    . THR A 1 37 ? -22.831 -10.116 8.137   1.00 0.00 ? 489 THR C N    7  
ATOM 5615  C CA   . THR A 1 37 ? -21.892 -10.749 7.209   1.00 0.00 ? 489 THR C CA   7  
ATOM 5616  C C    . THR A 1 37 ? -21.714 -12.251 7.489   1.00 0.00 ? 489 THR C C    7  
ATOM 5617  O O    . THR A 1 37 ? -21.449 -13.018 6.590   1.00 0.00 ? 489 THR C O    7  
ATOM 5618  C CB   . THR A 1 37 ? -20.517 -10.043 7.243   1.00 0.00 ? 489 THR C CB   7  
ATOM 5619  O OG1  . THR A 1 37 ? -20.690 -8.645  7.011   1.00 0.00 ? 489 THR C OG1  7  
ATOM 5620  C CG2  . THR A 1 37 ? -19.570 -10.601 6.193   1.00 0.00 ? 489 THR C CG2  7  
ATOM 5621  H H    . THR A 1 37 ? -22.536 -9.313  8.622   1.00 0.00 ? 489 THR C H    7  
ATOM 5622  H HA   . THR A 1 37 ? -22.309 -10.640 6.220   1.00 0.00 ? 489 THR C HA   7  
ATOM 5623  H HB   . THR A 1 37 ? -20.087 -10.193 8.223   1.00 0.00 ? 489 THR C HB   7  
ATOM 5624  H HG1  . THR A 1 37 ? -21.105 -8.521  6.144   1.00 0.00 ? 489 THR C HG1  7  
ATOM 5625  H HG21 . THR A 1 37 ? -20.022 -10.507 5.216   1.00 0.00 ? 489 THR C HG21 7  
ATOM 5626  H HG22 . THR A 1 37 ? -19.366 -11.640 6.401   1.00 0.00 ? 489 THR C HG22 7  
ATOM 5627  H HG23 . THR A 1 37 ? -18.650 -10.035 6.216   1.00 0.00 ? 489 THR C HG23 7  
ATOM 5628  N N    . THR A 1 38 ? -21.871 -12.658 8.731   1.00 0.00 ? 490 THR C N    7  
ATOM 5629  C CA   . THR A 1 38 ? -21.746 -14.062 9.070   1.00 0.00 ? 490 THR C CA   7  
ATOM 5630  C C    . THR A 1 38 ? -23.099 -14.754 8.952   1.00 0.00 ? 490 THR C C    7  
ATOM 5631  O O    . THR A 1 38 ? -23.203 -15.873 8.443   1.00 0.00 ? 490 THR C O    7  
ATOM 5632  C CB   . THR A 1 38 ? -21.218 -14.243 10.500  1.00 0.00 ? 490 THR C CB   7  
ATOM 5633  O OG1  . THR A 1 38 ? -20.055 -13.432 10.702  1.00 0.00 ? 490 THR C OG1  7  
ATOM 5634  C CG2  . THR A 1 38 ? -20.866 -15.688 10.739  1.00 0.00 ? 490 THR C CG2  7  
ATOM 5635  H H    . THR A 1 38 ? -22.079 -12.007 9.430   1.00 0.00 ? 490 THR C H    7  
ATOM 5636  H HA   . THR A 1 38 ? -21.058 -14.537 8.382   1.00 0.00 ? 490 THR C HA   7  
ATOM 5637  H HB   . THR A 1 38 ? -21.985 -13.947 11.201  1.00 0.00 ? 490 THR C HB   7  
ATOM 5638  H HG1  . THR A 1 38 ? -20.262 -12.514 10.479  1.00 0.00 ? 490 THR C HG1  7  
ATOM 5639  H HG21 . THR A 1 38 ? -20.174 -16.013 9.970   1.00 0.00 ? 490 THR C HG21 7  
ATOM 5640  H HG22 . THR A 1 38 ? -21.761 -16.289 10.695  1.00 0.00 ? 490 THR C HG22 7  
ATOM 5641  H HG23 . THR A 1 38 ? -20.402 -15.794 11.708  1.00 0.00 ? 490 THR C HG23 7  
ATOM 5642  N N    . ASP A 1 39 ? -24.136 -14.067 9.396   1.00 0.00 ? 491 ASP C N    7  
ATOM 5643  C CA   . ASP A 1 39 ? -25.481 -14.625 9.383   1.00 0.00 ? 491 ASP C CA   7  
ATOM 5644  C C    . ASP A 1 39 ? -26.024 -14.667 7.965   1.00 0.00 ? 491 ASP C C    7  
ATOM 5645  O O    . ASP A 1 39 ? -26.781 -15.566 7.606   1.00 0.00 ? 491 ASP C O    7  
ATOM 5646  C CB   . ASP A 1 39 ? -26.401 -13.807 10.288  1.00 0.00 ? 491 ASP C CB   7  
ATOM 5647  C CG   . ASP A 1 39 ? -27.726 -14.490 10.547  1.00 0.00 ? 491 ASP C CG   7  
ATOM 5648  O OD1  . ASP A 1 39 ? -27.733 -15.552 11.206  1.00 0.00 ? 491 ASP C OD1  7  
ATOM 5649  O OD2  . ASP A 1 39 ? -28.764 -13.960 10.125  1.00 0.00 ? 491 ASP C OD2  7  
ATOM 5650  H H    . ASP A 1 39 ? -23.995 -13.155 9.729   1.00 0.00 ? 491 ASP C H    7  
ATOM 5651  H HA   . ASP A 1 39 ? -25.427 -15.637 9.759   1.00 0.00 ? 491 ASP C HA   7  
ATOM 5652  H HB2  . ASP A 1 39 ? -25.910 -13.642 11.235  1.00 0.00 ? 491 ASP C HB2  7  
ATOM 5653  H HB3  . ASP A 1 39 ? -26.595 -12.853 9.820   1.00 0.00 ? 491 ASP C HB3  7  
ATOM 5654  N N    . ASN A 1 40 ? -25.604 -13.706 7.150   1.00 0.00 ? 492 ASN C N    7  
ATOM 5655  C CA   . ASN A 1 40 ? -26.025 -13.643 5.771   1.00 0.00 ? 492 ASN C CA   7  
ATOM 5656  C C    . ASN A 1 40 ? -25.505 -14.867 5.012   1.00 0.00 ? 492 ASN C C    7  
ATOM 5657  O O    . ASN A 1 40 ? -26.187 -15.414 4.146   1.00 0.00 ? 492 ASN C O    7  
ATOM 5658  C CB   . ASN A 1 40 ? -25.630 -12.282 5.078   1.00 0.00 ? 492 ASN C CB   7  
ATOM 5659  C CG   . ASN A 1 40 ? -24.160 -12.067 4.774   1.00 0.00 ? 492 ASN C CG   7  
ATOM 5660  O OD1  . ASN A 1 40 ? -23.399 -12.990 4.599   1.00 0.00 ? 492 ASN C OD1  7  
ATOM 5661  N ND2  . ASN A 1 40 ? -23.780 -10.802 4.681   1.00 0.00 ? 492 ASN C ND2  7  
ATOM 5662  H H    . ASN A 1 40 ? -25.000 -13.011 7.499   1.00 0.00 ? 492 ASN C H    7  
ATOM 5663  H HA   . ASN A 1 40 ? -27.103 -13.700 5.799   1.00 0.00 ? 492 ASN C HA   7  
ATOM 5664  H HB2  . ASN A 1 40 ? -26.151 -12.177 4.145   1.00 0.00 ? 492 ASN C HB2  7  
ATOM 5665  H HB3  . ASN A 1 40 ? -25.923 -11.471 5.733   1.00 0.00 ? 492 ASN C HB3  7  
ATOM 5666  H HD21 . ASN A 1 40 ? -24.454 -10.105 4.814   1.00 0.00 ? 492 ASN C HD21 7  
ATOM 5667  H HD22 . ASN A 1 40 ? -22.840 -10.599 4.472   1.00 0.00 ? 492 ASN C HD22 7  
ATOM 5668  N N    . ILE A 1 41 ? -24.308 -15.320 5.385   1.00 0.00 ? 493 ILE C N    7  
ATOM 5669  C CA   . ILE A 1 41 ? -23.721 -16.515 4.804   1.00 0.00 ? 493 ILE C CA   7  
ATOM 5670  C C    . ILE A 1 41 ? -24.579 -17.716 5.159   1.00 0.00 ? 493 ILE C C    7  
ATOM 5671  O O    . ILE A 1 41 ? -24.918 -18.538 4.309   1.00 0.00 ? 493 ILE C O    7  
ATOM 5672  C CB   . ILE A 1 41 ? -22.295 -16.774 5.355   1.00 0.00 ? 493 ILE C CB   7  
ATOM 5673  C CG1  . ILE A 1 41 ? -21.378 -15.594 5.092   1.00 0.00 ? 493 ILE C CG1  7  
ATOM 5674  C CG2  . ILE A 1 41 ? -21.711 -18.034 4.744   1.00 0.00 ? 493 ILE C CG2  7  
ATOM 5675  C CD1  . ILE A 1 41 ? -20.052 -15.693 5.826   1.00 0.00 ? 493 ILE C CD1  7  
ATOM 5676  H H    . ILE A 1 41 ? -23.799 -14.814 6.053   1.00 0.00 ? 493 ILE C H    7  
ATOM 5677  H HA   . ILE A 1 41 ? -23.676 -16.388 3.731   1.00 0.00 ? 493 ILE C HA   7  
ATOM 5678  H HB   . ILE A 1 41 ? -22.371 -16.921 6.425   1.00 0.00 ? 493 ILE C HB   7  
ATOM 5679  H HG12 . ILE A 1 41 ? -21.175 -15.530 4.034   1.00 0.00 ? 493 ILE C HG12 7  
ATOM 5680  H HG13 . ILE A 1 41 ? -21.870 -14.692 5.415   1.00 0.00 ? 493 ILE C HG13 7  
ATOM 5681  H HG21 . ILE A 1 41 ? -21.632 -17.910 3.675   1.00 0.00 ? 493 ILE C HG21 7  
ATOM 5682  H HG22 . ILE A 1 41 ? -22.354 -18.874 4.965   1.00 0.00 ? 493 ILE C HG22 7  
ATOM 5683  H HG23 . ILE A 1 41 ? -20.732 -18.208 5.160   1.00 0.00 ? 493 ILE C HG23 7  
ATOM 5684  H HD11 . ILE A 1 41 ? -19.516 -16.566 5.494   1.00 0.00 ? 493 ILE C HD11 7  
ATOM 5685  H HD12 . ILE A 1 41 ? -20.240 -15.778 6.885   1.00 0.00 ? 493 ILE C HD12 7  
ATOM 5686  H HD13 . ILE A 1 41 ? -19.463 -14.809 5.639   1.00 0.00 ? 493 ILE C HD13 7  
ATOM 5687  N N    . LEU A 1 42 ? -24.941 -17.783 6.427   1.00 0.00 ? 494 LEU C N    7  
ATOM 5688  C CA   . LEU A 1 42 ? -25.741 -18.869 6.969   1.00 0.00 ? 494 LEU C CA   7  
ATOM 5689  C C    . LEU A 1 42 ? -27.124 -18.945 6.315   1.00 0.00 ? 494 LEU C C    7  
ATOM 5690  O O    . LEU A 1 42 ? -27.738 -20.010 6.267   1.00 0.00 ? 494 LEU C O    7  
ATOM 5691  C CB   . LEU A 1 42 ? -25.858 -18.702 8.484   1.00 0.00 ? 494 LEU C CB   7  
ATOM 5692  C CG   . LEU A 1 42 ? -24.552 -18.916 9.256   1.00 0.00 ? 494 LEU C CG   7  
ATOM 5693  C CD1  . LEU A 1 42 ? -24.669 -18.399 10.675  1.00 0.00 ? 494 LEU C CD1  7  
ATOM 5694  C CD2  . LEU A 1 42 ? -24.175 -20.389 9.258   1.00 0.00 ? 494 LEU C CD2  7  
ATOM 5695  H H    . LEU A 1 42 ? -24.653 -17.066 7.032   1.00 0.00 ? 494 LEU C H    7  
ATOM 5696  H HA   . LEU A 1 42 ? -25.219 -19.791 6.767   1.00 0.00 ? 494 LEU C HA   7  
ATOM 5697  H HB2  . LEU A 1 42 ? -26.209 -17.699 8.685   1.00 0.00 ? 494 LEU C HB2  7  
ATOM 5698  H HB3  . LEU A 1 42 ? -26.588 -19.400 8.856   1.00 0.00 ? 494 LEU C HB3  7  
ATOM 5699  H HG   . LEU A 1 42 ? -23.760 -18.368 8.766   1.00 0.00 ? 494 LEU C HG   7  
ATOM 5700  H HD11 . LEU A 1 42 ? -25.527 -18.845 11.153  1.00 0.00 ? 494 LEU C HD11 7  
ATOM 5701  H HD12 . LEU A 1 42 ? -24.774 -17.323 10.661  1.00 0.00 ? 494 LEU C HD12 7  
ATOM 5702  H HD13 . LEU A 1 42 ? -23.776 -18.660 11.223  1.00 0.00 ? 494 LEU C HD13 7  
ATOM 5703  H HD21 . LEU A 1 42 ? -23.271 -20.529 9.831   1.00 0.00 ? 494 LEU C HD21 7  
ATOM 5704  H HD22 . LEU A 1 42 ? -24.012 -20.721 8.243   1.00 0.00 ? 494 LEU C HD22 7  
ATOM 5705  H HD23 . LEU A 1 42 ? -24.974 -20.965 9.699   1.00 0.00 ? 494 LEU C HD23 7  
ATOM 5706  N N    . GLU A 1 43 ? -27.600 -17.819 5.806   1.00 0.00 ? 495 GLU C N    7  
ATOM 5707  C CA   . GLU A 1 43 ? -28.887 -17.780 5.125   1.00 0.00 ? 495 GLU C CA   7  
ATOM 5708  C C    . GLU A 1 43 ? -28.731 -18.105 3.643   1.00 0.00 ? 495 GLU C C    7  
ATOM 5709  O O    . GLU A 1 43 ? -29.718 -18.196 2.914   1.00 0.00 ? 495 GLU C O    7  
ATOM 5710  C CB   . GLU A 1 43 ? -29.551 -16.416 5.281   1.00 0.00 ? 495 GLU C CB   7  
ATOM 5711  C CG   . GLU A 1 43 ? -29.868 -16.041 6.712   1.00 0.00 ? 495 GLU C CG   7  
ATOM 5712  C CD   . GLU A 1 43 ? -30.753 -14.824 6.797   1.00 0.00 ? 495 GLU C CD   7  
ATOM 5713  O OE1  . GLU A 1 43 ? -30.238 -13.697 6.710   1.00 0.00 ? 495 GLU C OE1  7  
ATOM 5714  O OE2  . GLU A 1 43 ? -31.981 -14.991 6.940   1.00 0.00 ? 495 GLU C OE2  7  
ATOM 5715  H H    . GLU A 1 43 ? -27.082 -16.991 5.905   1.00 0.00 ? 495 GLU C H    7  
ATOM 5716  H HA   . GLU A 1 43 ? -29.519 -18.529 5.577   1.00 0.00 ? 495 GLU C HA   7  
ATOM 5717  H HB2  . GLU A 1 43 ? -28.891 -15.663 4.876   1.00 0.00 ? 495 GLU C HB2  7  
ATOM 5718  H HB3  . GLU A 1 43 ? -30.470 -16.411 4.717   1.00 0.00 ? 495 GLU C HB3  7  
ATOM 5719  H HG2  . GLU A 1 43 ? -30.373 -16.870 7.186   1.00 0.00 ? 495 GLU C HG2  7  
ATOM 5720  H HG3  . GLU A 1 43 ? -28.945 -15.835 7.233   1.00 0.00 ? 495 GLU C HG3  7  
ATOM 5721  N N    . GLY A 1 44 ? -27.492 -18.273 3.205   1.00 0.00 ? 496 GLY C N    7  
ATOM 5722  C CA   . GLY A 1 44 ? -27.231 -18.572 1.809   1.00 0.00 ? 496 GLY C CA   7  
ATOM 5723  C C    . GLY A 1 44 ? -27.257 -17.329 0.946   1.00 0.00 ? 496 GLY C C    7  
ATOM 5724  O O    . GLY A 1 44 ? -27.418 -17.409 -0.270  1.00 0.00 ? 496 GLY C O    7  
ATOM 5725  H H    . GLY A 1 44 ? -26.743 -18.202 3.836   1.00 0.00 ? 496 GLY C H    7  
ATOM 5726  H HA2  . GLY A 1 44 ? -26.258 -19.035 1.726   1.00 0.00 ? 496 GLY C HA2  7  
ATOM 5727  H HA3  . GLY A 1 44 ? -27.977 -19.261 1.452   1.00 0.00 ? 496 GLY C HA3  7  
ATOM 5728  N N    . ARG A 1 45 ? -27.109 -16.179 1.584   1.00 0.00 ? 497 ARG C N    7  
ATOM 5729  C CA   . ARG A 1 45 ? -27.102 -14.899 0.889   1.00 0.00 ? 497 ARG C CA   7  
ATOM 5730  C C    . ARG A 1 45 ? -25.847 -14.759 0.052   1.00 0.00 ? 497 ARG C C    7  
ATOM 5731  O O    . ARG A 1 45 ? -25.880 -14.234 -1.059  1.00 0.00 ? 497 ARG C O    7  
ATOM 5732  C CB   . ARG A 1 45 ? -27.178 -13.760 1.906   1.00 0.00 ? 497 ARG C CB   7  
ATOM 5733  C CG   . ARG A 1 45 ? -26.991 -12.366 1.319   1.00 0.00 ? 497 ARG C CG   7  
ATOM 5734  C CD   . ARG A 1 45 ? -28.092 -12.013 0.333   1.00 0.00 ? 497 ARG C CD   7  
ATOM 5735  N NE   . ARG A 1 45 ? -27.896 -10.682 -0.236  1.00 0.00 ? 497 ARG C NE   7  
ATOM 5736  C CZ   . ARG A 1 45 ? -28.705 -9.640  -0.024  1.00 0.00 ? 497 ARG C CZ   7  
ATOM 5737  N NH1  . ARG A 1 45 ? -29.787 -9.771  0.740   1.00 0.00 ? 497 ARG C NH1  7  
ATOM 5738  N NH2  . ARG A 1 45 ? -28.435 -8.467  -0.576  1.00 0.00 ? 497 ARG C NH2  7  
ATOM 5739  H H    . ARG A 1 45 ? -26.996 -16.188 2.561   1.00 0.00 ? 497 ARG C H    7  
ATOM 5740  H HA   . ARG A 1 45 ? -27.968 -14.858 0.247   1.00 0.00 ? 497 ARG C HA   7  
ATOM 5741  H HB2  . ARG A 1 45 ? -28.139 -13.796 2.396   1.00 0.00 ? 497 ARG C HB2  7  
ATOM 5742  H HB3  . ARG A 1 45 ? -26.401 -13.924 2.644   1.00 0.00 ? 497 ARG C HB3  7  
ATOM 5743  H HG2  . ARG A 1 45 ? -27.001 -11.645 2.122   1.00 0.00 ? 497 ARG C HG2  7  
ATOM 5744  H HG3  . ARG A 1 45 ? -26.039 -12.327 0.812   1.00 0.00 ? 497 ARG C HG3  7  
ATOM 5745  H HD2  . ARG A 1 45 ? -28.087 -12.740 -0.464  1.00 0.00 ? 497 ARG C HD2  7  
ATOM 5746  H HD3  . ARG A 1 45 ? -29.041 -12.044 0.845   1.00 0.00 ? 497 ARG C HD3  7  
ATOM 5747  H HE   . ARG A 1 45 ? -27.105 -10.564 -0.811  1.00 0.00 ? 497 ARG C HE   7  
ATOM 5748  H HH11 . ARG A 1 45 ? -30.015 -10.650 1.165   1.00 0.00 ? 497 ARG C HH11 7  
ATOM 5749  H HH12 . ARG A 1 45 ? -30.387 -8.980  0.903   1.00 0.00 ? 497 ARG C HH12 7  
ATOM 5750  H HH21 . ARG A 1 45 ? -27.627 -8.345  -1.158  1.00 0.00 ? 497 ARG C HH21 7  
ATOM 5751  H HH22 . ARG A 1 45 ? -29.040 -7.681  -0.416  1.00 0.00 ? 497 ARG C HH22 7  
ATOM 5752  N N    . ILE A 1 46 ? -24.746 -15.233 0.592   1.00 0.00 ? 498 ILE C N    7  
ATOM 5753  C CA   . ILE A 1 46 ? -23.476 -15.149 -0.080  1.00 0.00 ? 498 ILE C CA   7  
ATOM 5754  C C    . ILE A 1 46 ? -22.991 -16.532 -0.467  1.00 0.00 ? 498 ILE C C    7  
ATOM 5755  O O    . ILE A 1 46 ? -22.461 -17.282 0.360   1.00 0.00 ? 498 ILE C O    7  
ATOM 5756  C CB   . ILE A 1 46 ? -22.426 -14.427 0.797   1.00 0.00 ? 498 ILE C CB   7  
ATOM 5757  C CG1  . ILE A 1 46 ? -22.877 -12.987 1.051   1.00 0.00 ? 498 ILE C CG1  7  
ATOM 5758  C CG2  . ILE A 1 46 ? -21.054 -14.450 0.131   1.00 0.00 ? 498 ILE C CG2  7  
ATOM 5759  C CD1  . ILE A 1 46 ? -22.046 -12.250 2.067   1.00 0.00 ? 498 ILE C CD1  7  
ATOM 5760  H H    . ILE A 1 46 ? -24.795 -15.667 1.470   1.00 0.00 ? 498 ILE C H    7  
ATOM 5761  H HA   . ILE A 1 46 ? -23.621 -14.570 -0.981  1.00 0.00 ? 498 ILE C HA   7  
ATOM 5762  H HB   . ILE A 1 46 ? -22.356 -14.944 1.742   1.00 0.00 ? 498 ILE C HB   7  
ATOM 5763  H HG12 . ILE A 1 46 ? -22.828 -12.435 0.124   1.00 0.00 ? 498 ILE C HG12 7  
ATOM 5764  H HG13 . ILE A 1 46 ? -23.897 -13.000 1.399   1.00 0.00 ? 498 ILE C HG13 7  
ATOM 5765  H HG21 . ILE A 1 46 ? -21.116 -13.966 -0.831  1.00 0.00 ? 498 ILE C HG21 7  
ATOM 5766  H HG22 . ILE A 1 46 ? -20.734 -15.473 0.001   1.00 0.00 ? 498 ILE C HG22 7  
ATOM 5767  H HG23 . ILE A 1 46 ? -20.346 -13.925 0.754   1.00 0.00 ? 498 ILE C HG23 7  
ATOM 5768  H HD11 . ILE A 1 46 ? -22.325 -11.208 2.067   1.00 0.00 ? 498 ILE C HD11 7  
ATOM 5769  H HD12 . ILE A 1 46 ? -20.997 -12.352 1.836   1.00 0.00 ? 498 ILE C HD12 7  
ATOM 5770  H HD13 . ILE A 1 46 ? -22.249 -12.663 3.049   1.00 0.00 ? 498 ILE C HD13 7  
ATOM 5771  N N    . GLN A 1 47 ? -23.206 -16.871 -1.716  1.00 0.00 ? 499 GLN C N    7  
ATOM 5772  C CA   . GLN A 1 47 ? -22.816 -18.146 -2.251  1.00 0.00 ? 499 GLN C CA   7  
ATOM 5773  C C    . GLN A 1 47 ? -22.445 -17.974 -3.712  1.00 0.00 ? 499 GLN C C    7  
ATOM 5774  O O    . GLN A 1 47 ? -23.313 -17.811 -4.560  1.00 0.00 ? 499 GLN C O    7  
ATOM 5775  C CB   . GLN A 1 47 ? -23.969 -19.147 -2.117  1.00 0.00 ? 499 GLN C CB   7  
ATOM 5776  C CG   . GLN A 1 47 ? -23.603 -20.574 -2.493  1.00 0.00 ? 499 GLN C CG   7  
ATOM 5777  C CD   . GLN A 1 47 ? -22.667 -21.218 -1.487  1.00 0.00 ? 499 GLN C CD   7  
ATOM 5778  O OE1  . GLN A 1 47 ? -22.698 -20.900 -0.298  1.00 0.00 ? 499 GLN C OE1  7  
ATOM 5779  N NE2  . GLN A 1 47 ? -21.838 -22.129 -1.951  1.00 0.00 ? 499 GLN C NE2  7  
ATOM 5780  H H    . GLN A 1 47 ? -23.645 -16.229 -2.317  1.00 0.00 ? 499 GLN C H    7  
ATOM 5781  H HA   . GLN A 1 47 ? -21.962 -18.506 -1.699  1.00 0.00 ? 499 GLN C HA   7  
ATOM 5782  H HB2  . GLN A 1 47 ? -24.310 -19.147 -1.092  1.00 0.00 ? 499 GLN C HB2  7  
ATOM 5783  H HB3  . GLN A 1 47 ? -24.780 -18.827 -2.755  1.00 0.00 ? 499 GLN C HB3  7  
ATOM 5784  H HG2  . GLN A 1 47 ? -24.505 -21.160 -2.553  1.00 0.00 ? 499 GLN C HG2  7  
ATOM 5785  H HG3  . GLN A 1 47 ? -23.117 -20.558 -3.457  1.00 0.00 ? 499 GLN C HG3  7  
ATOM 5786  H HE21 . GLN A 1 47 ? -21.869 -22.338 -2.909  1.00 0.00 ? 499 GLN C HE21 7  
ATOM 5787  H HE22 . GLN A 1 47 ? -21.228 -22.567 -1.322  1.00 0.00 ? 499 GLN C HE22 7  
ATOM 5788  N N    . VAL A 1 48 ? -21.162 -17.963 -3.996  1.00 0.00 ? 500 VAL C N    7  
ATOM 5789  C CA   . VAL A 1 48 ? -20.687 -17.807 -5.353  1.00 0.00 ? 500 VAL C CA   7  
ATOM 5790  C C    . VAL A 1 48 ? -19.515 -18.737 -5.605  1.00 0.00 ? 500 VAL C C    7  
ATOM 5791  O O    . VAL A 1 48 ? -18.791 -19.087 -4.671  1.00 0.00 ? 500 VAL C O    7  
ATOM 5792  C CB   . VAL A 1 48 ? -20.251 -16.347 -5.645  1.00 0.00 ? 500 VAL C CB   7  
ATOM 5793  C CG1  . VAL A 1 48 ? -21.455 -15.419 -5.713  1.00 0.00 ? 500 VAL C CG1  7  
ATOM 5794  C CG2  . VAL A 1 48 ? -19.262 -15.858 -4.598  1.00 0.00 ? 500 VAL C CG2  7  
ATOM 5795  H H    . VAL A 1 48 ? -20.504 -18.060 -3.278  1.00 0.00 ? 500 VAL C H    7  
ATOM 5796  H HA   . VAL A 1 48 ? -21.498 -18.063 -6.017  1.00 0.00 ? 500 VAL C HA   7  
ATOM 5797  H HB   . VAL A 1 48 ? -19.761 -16.338 -6.604  1.00 0.00 ? 500 VAL C HB   7  
ATOM 5798  H HG11 . VAL A 1 48 ? -21.993 -15.463 -4.778  1.00 0.00 ? 500 VAL C HG11 7  
ATOM 5799  H HG12 . VAL A 1 48 ? -22.105 -15.726 -6.517  1.00 0.00 ? 500 VAL C HG12 7  
ATOM 5800  H HG13 . VAL A 1 48 ? -21.119 -14.408 -5.886  1.00 0.00 ? 500 VAL C HG13 7  
ATOM 5801  H HG21 . VAL A 1 48 ? -18.381 -16.483 -4.615  1.00 0.00 ? 500 VAL C HG21 7  
ATOM 5802  H HG22 . VAL A 1 48 ? -19.719 -15.909 -3.620  1.00 0.00 ? 500 VAL C HG22 7  
ATOM 5803  H HG23 . VAL A 1 48 ? -18.983 -14.838 -4.814  1.00 0.00 ? 500 VAL C HG23 7  
ATOM 5804  N N    . PRO A 1 49 ? -19.321 -19.179 -6.857  1.00 0.00 ? 501 PRO C N    7  
ATOM 5805  C CA   . PRO A 1 49 ? -18.197 -20.039 -7.217  1.00 0.00 ? 501 PRO C CA   7  
ATOM 5806  C C    . PRO A 1 49 ? -16.872 -19.295 -7.096  1.00 0.00 ? 501 PRO C C    7  
ATOM 5807  O O    . PRO A 1 49 ? -16.574 -18.391 -7.888  1.00 0.00 ? 501 PRO C O    7  
ATOM 5808  C CB   . PRO A 1 49 ? -18.471 -20.418 -8.685  1.00 0.00 ? 501 PRO C CB   7  
ATOM 5809  C CG   . PRO A 1 49 ? -19.896 -20.044 -8.924  1.00 0.00 ? 501 PRO C CG   7  
ATOM 5810  C CD   . PRO A 1 49 ? -20.177 -18.890 -8.011  1.00 0.00 ? 501 PRO C CD   7  
ATOM 5811  H HA   . PRO A 1 49 ? -18.168 -20.928 -6.605  1.00 0.00 ? 501 PRO C HA   7  
ATOM 5812  H HB2  . PRO A 1 49 ? -17.803 -19.868 -9.330  1.00 0.00 ? 501 PRO C HB2  7  
ATOM 5813  H HB3  . PRO A 1 49 ? -18.315 -21.478 -8.819  1.00 0.00 ? 501 PRO C HB3  7  
ATOM 5814  H HG2  . PRO A 1 49 ? -20.030 -19.749 -9.954  1.00 0.00 ? 501 PRO C HG2  7  
ATOM 5815  H HG3  . PRO A 1 49 ? -20.539 -20.877 -8.685  1.00 0.00 ? 501 PRO C HG3  7  
ATOM 5816  H HD2  . PRO A 1 49 ? -19.891 -17.960 -8.479  1.00 0.00 ? 501 PRO C HD2  7  
ATOM 5817  H HD3  . PRO A 1 49 ? -21.219 -18.878 -7.731  1.00 0.00 ? 501 PRO C HD3  7  
ATOM 5818  N N    . PHE A 1 50 ? -16.101 -19.651 -6.091  1.00 0.00 ? 502 PHE C N    7  
ATOM 5819  C CA   . PHE A 1 50 ? -14.819 -19.023 -5.851  1.00 0.00 ? 502 PHE C CA   7  
ATOM 5820  C C    . PHE A 1 50 ? -13.687 -20.020 -6.058  1.00 0.00 ? 502 PHE C C    7  
ATOM 5821  O O    . PHE A 1 50 ? -13.903 -21.237 -5.962  1.00 0.00 ? 502 PHE C O    7  
ATOM 5822  C CB   . PHE A 1 50 ? -14.758 -18.434 -4.430  1.00 0.00 ? 502 PHE C CB   7  
ATOM 5823  C CG   . PHE A 1 50 ? -15.023 -19.429 -3.335  1.00 0.00 ? 502 PHE C CG   7  
ATOM 5824  C CD1  . PHE A 1 50 ? -16.306 -19.648 -2.891  1.00 0.00 ? 502 PHE C CD1  7  
ATOM 5825  C CD2  . PHE A 1 50 ? -13.984 -20.137 -2.748  1.00 0.00 ? 502 PHE C CD2  7  
ATOM 5826  C CE1  . PHE A 1 50 ? -16.565 -20.553 -1.882  1.00 0.00 ? 502 PHE C CE1  7  
ATOM 5827  C CE2  . PHE A 1 50 ? -14.231 -21.046 -1.739  1.00 0.00 ? 502 PHE C CE2  7  
ATOM 5828  C CZ   . PHE A 1 50 ? -15.525 -21.254 -1.305  1.00 0.00 ? 502 PHE C CZ   7  
ATOM 5829  H H    . PHE A 1 50 ? -16.401 -20.368 -5.492  1.00 0.00 ? 502 PHE C H    7  
ATOM 5830  H HA   . PHE A 1 50 ? -14.719 -18.221 -6.559  1.00 0.00 ? 502 PHE C HA   7  
ATOM 5831  H HB2  . PHE A 1 50 ? -13.776 -18.020 -4.265  1.00 0.00 ? 502 PHE C HB2  7  
ATOM 5832  H HB3  . PHE A 1 50 ? -15.489 -17.644 -4.348  1.00 0.00 ? 502 PHE C HB3  7  
ATOM 5833  H HD1  . PHE A 1 50 ? -17.114 -19.097 -3.354  1.00 0.00 ? 502 PHE C HD1  7  
ATOM 5834  H HD2  . PHE A 1 50 ? -12.972 -19.975 -3.088  1.00 0.00 ? 502 PHE C HD2  7  
ATOM 5835  H HE1  . PHE A 1 50 ? -17.578 -20.714 -1.545  1.00 0.00 ? 502 PHE C HE1  7  
ATOM 5836  H HE2  . PHE A 1 50 ? -13.415 -21.593 -1.289  1.00 0.00 ? 502 PHE C HE2  7  
ATOM 5837  H HZ   . PHE A 1 50 ? -15.722 -21.964 -0.514  1.00 0.00 ? 502 PHE C HZ   7  
ATOM 5838  N N    . PRO A 1 51 ? -12.472 -19.529 -6.374  1.00 0.00 ? 503 PRO C N    7  
ATOM 5839  C CA   . PRO A 1 51 ? -11.299 -20.387 -6.552  1.00 0.00 ? 503 PRO C CA   7  
ATOM 5840  C C    . PRO A 1 51 ? -11.031 -21.218 -5.305  1.00 0.00 ? 503 PRO C C    7  
ATOM 5841  O O    . PRO A 1 51 ? -10.920 -20.678 -4.197  1.00 0.00 ? 503 PRO C O    7  
ATOM 5842  C CB   . PRO A 1 51 ? -10.154 -19.391 -6.777  1.00 0.00 ? 503 PRO C CB   7  
ATOM 5843  C CG   . PRO A 1 51 ? -10.818 -18.160 -7.276  1.00 0.00 ? 503 PRO C CG   7  
ATOM 5844  C CD   . PRO A 1 51 ? -12.153 -18.107 -6.595  1.00 0.00 ? 503 PRO C CD   7  
ATOM 5845  H HA   . PRO A 1 51 ? -11.403 -21.035 -7.409  1.00 0.00 ? 503 PRO C HA   7  
ATOM 5846  H HB2  . PRO A 1 51 ? -9.641  -19.213 -5.843  1.00 0.00 ? 503 PRO C HB2  7  
ATOM 5847  H HB3  . PRO A 1 51 ? -9.463  -19.788 -7.504  1.00 0.00 ? 503 PRO C HB3  7  
ATOM 5848  H HG2  . PRO A 1 51 ? -10.227 -17.294 -7.015  1.00 0.00 ? 503 PRO C HG2  7  
ATOM 5849  H HG3  . PRO A 1 51 ? -10.945 -18.221 -8.346  1.00 0.00 ? 503 PRO C HG3  7  
ATOM 5850  H HD2  . PRO A 1 51 ? -12.077 -17.575 -5.657  1.00 0.00 ? 503 PRO C HD2  7  
ATOM 5851  H HD3  . PRO A 1 51 ? -12.884 -17.641 -7.238  1.00 0.00 ? 503 PRO C HD3  7  
ATOM 5852  N N    . THR A 1 52 ? -10.926 -22.516 -5.481  1.00 0.00 ? 504 THR C N    7  
ATOM 5853  C CA   . THR A 1 52 ? -10.707 -23.413 -4.378  1.00 0.00 ? 504 THR C CA   7  
ATOM 5854  C C    . THR A 1 52 ? -9.827  -24.581 -4.817  1.00 0.00 ? 504 THR C C    7  
ATOM 5855  O O    . THR A 1 52 ? -8.925  -24.971 -4.050  1.00 0.00 ? 504 THR C O    7  
ATOM 5856  C CB   . THR A 1 52 ? -12.056 -23.921 -3.782  1.00 0.00 ? 504 THR C CB   7  
ATOM 5857  O OG1  . THR A 1 52 ? -11.821 -24.764 -2.647  1.00 0.00 ? 504 THR C OG1  7  
ATOM 5858  C CG2  . THR A 1 52 ? -12.873 -24.681 -4.822  1.00 0.00 ? 504 THR C CG2  7  
ATOM 5859  O OXT  . THR A 1 52 ? -10.006 -25.069 -5.957  1.00 0.00 ? 504 THR C OXT  7  
ATOM 5860  H H    . THR A 1 52 ? -10.986 -22.891 -6.386  1.00 0.00 ? 504 THR C H    7  
ATOM 5861  H HA   . THR A 1 52 ? -10.183 -22.862 -3.611  1.00 0.00 ? 504 THR C HA   7  
ATOM 5862  H HB   . THR A 1 52 ? -12.625 -23.061 -3.460  1.00 0.00 ? 504 THR C HB   7  
ATOM 5863  H HG1  . THR A 1 52 ? -12.434 -25.510 -2.677  1.00 0.00 ? 504 THR C HG1  7  
ATOM 5864  H HG21 . THR A 1 52 ? -12.306 -25.530 -5.174  1.00 0.00 ? 504 THR C HG21 7  
ATOM 5865  H HG22 . THR A 1 52 ? -13.094 -24.027 -5.653  1.00 0.00 ? 504 THR C HG22 7  
ATOM 5866  H HG23 . THR A 1 52 ? -13.796 -25.022 -4.377  1.00 0.00 ? 504 THR C HG23 7  
ATOM 5867  N N    . SER A 1 1  ? -8.382  2.340   3.483   1.00 0.00 ? 453 SER C N    8  
ATOM 5868  C CA   . SER A 1 1  ? -9.545  2.298   4.377   1.00 0.00 ? 453 SER C CA   8  
ATOM 5869  C C    . SER A 1 1  ? -10.014 0.859   4.605   1.00 0.00 ? 453 SER C C    8  
ATOM 5870  O O    . SER A 1 1  ? -11.135 0.625   5.071   1.00 0.00 ? 453 SER C O    8  
ATOM 5871  C CB   . SER A 1 1  ? -10.675 3.126   3.778   1.00 0.00 ? 453 SER C CB   8  
ATOM 5872  O OG   . SER A 1 1  ? -10.238 4.447   3.496   1.00 0.00 ? 453 SER C OG   8  
ATOM 5873  H H1   . SER A 1 1  ? -8.613  1.888   2.575   1.00 0.00 ? 453 SER C H1   8  
ATOM 5874  H H2   . SER A 1 1  ? -7.574  1.850   3.913   1.00 0.00 ? 453 SER C H2   8  
ATOM 5875  H H3   . SER A 1 1  ? -8.115  3.328   3.306   1.00 0.00 ? 453 SER C H3   8  
ATOM 5876  H HA   . SER A 1 1  ? -9.257  2.728   5.325   1.00 0.00 ? 453 SER C HA   8  
ATOM 5877  H HB2  . SER A 1 1  ? -11.010 2.667   2.861   1.00 0.00 ? 453 SER C HB2  8  
ATOM 5878  H HB3  . SER A 1 1  ? -11.496 3.175   4.478   1.00 0.00 ? 453 SER C HB3  8  
ATOM 5879  H HG   . SER A 1 1  ? -11.009 5.028   3.461   1.00 0.00 ? 453 SER C HG   8  
ATOM 5880  N N    . ASN A 1 2  ? -9.149  -0.107  4.303   1.00 0.00 ? 454 ASN C N    8  
ATOM 5881  C CA   . ASN A 1 2  ? -9.506  -1.516  4.442   1.00 0.00 ? 454 ASN C CA   8  
ATOM 5882  C C    . ASN A 1 2  ? -9.018  -2.096  5.757   1.00 0.00 ? 454 ASN C C    8  
ATOM 5883  O O    . ASN A 1 2  ? -9.344  -3.227  6.090   1.00 0.00 ? 454 ASN C O    8  
ATOM 5884  C CB   . ASN A 1 2  ? -8.954  -2.340  3.274   1.00 0.00 ? 454 ASN C CB   8  
ATOM 5885  C CG   . ASN A 1 2  ? -9.685  -2.086  1.967   1.00 0.00 ? 454 ASN C CG   8  
ATOM 5886  O OD1  . ASN A 1 2  ? -10.212 -0.999  1.734   1.00 0.00 ? 454 ASN C OD1  8  
ATOM 5887  N ND2  . ASN A 1 2  ? -9.723  -3.088  1.110   1.00 0.00 ? 454 ASN C ND2  8  
ATOM 5888  H H    . ASN A 1 2  ? -8.251  0.124   3.979   1.00 0.00 ? 454 ASN C H    8  
ATOM 5889  H HA   . ASN A 1 2  ? -10.583 -1.578  4.423   1.00 0.00 ? 454 ASN C HA   8  
ATOM 5890  H HB2  . ASN A 1 2  ? -7.912  -2.096  3.131   1.00 0.00 ? 454 ASN C HB2  8  
ATOM 5891  H HB3  . ASN A 1 2  ? -9.040  -3.390  3.515   1.00 0.00 ? 454 ASN C HB3  8  
ATOM 5892  H HD21 . ASN A 1 2  ? -9.284  -3.933  1.361   1.00 0.00 ? 454 ASN C HD21 8  
ATOM 5893  H HD22 . ASN A 1 2  ? -10.186 -2.953  0.256   1.00 0.00 ? 454 ASN C HD22 8  
ATOM 5894  N N    . SER A 1 3  ? -8.250  -1.318  6.509   1.00 0.00 ? 455 SER C N    8  
ATOM 5895  C CA   . SER A 1 3  ? -7.707  -1.779  7.785   1.00 0.00 ? 455 SER C CA   8  
ATOM 5896  C C    . SER A 1 3  ? -8.831  -2.196  8.734   1.00 0.00 ? 455 SER C C    8  
ATOM 5897  O O    . SER A 1 3  ? -8.782  -3.273  9.346   1.00 0.00 ? 455 SER C O    8  
ATOM 5898  C CB   . SER A 1 3  ? -6.850  -0.685  8.423   1.00 0.00 ? 455 SER C CB   8  
ATOM 5899  O OG   . SER A 1 3  ? -6.211  -1.148  9.595   1.00 0.00 ? 455 SER C OG   8  
ATOM 5900  H H    . SER A 1 3  ? -8.044  -0.407  6.204   1.00 0.00 ? 455 SER C H    8  
ATOM 5901  H HA   . SER A 1 3  ? -7.086  -2.640  7.585   1.00 0.00 ? 455 SER C HA   8  
ATOM 5902  H HB2  . SER A 1 3  ? -6.093  -0.367  7.722   1.00 0.00 ? 455 SER C HB2  8  
ATOM 5903  H HB3  . SER A 1 3  ? -7.478  0.154   8.678   1.00 0.00 ? 455 SER C HB3  8  
ATOM 5904  H HG   . SER A 1 3  ? -5.364  -0.698  9.681   1.00 0.00 ? 455 SER C HG   8  
ATOM 5905  N N    . GLN A 1 4  ? -9.852  -1.351  8.835   1.00 0.00 ? 456 GLN C N    8  
ATOM 5906  C CA   . GLN A 1 4  ? -11.000 -1.636  9.684   1.00 0.00 ? 456 GLN C CA   8  
ATOM 5907  C C    . GLN A 1 4  ? -11.765 -2.843  9.155   1.00 0.00 ? 456 GLN C C    8  
ATOM 5908  O O    . GLN A 1 4  ? -12.190 -3.704  9.918   1.00 0.00 ? 456 GLN C O    8  
ATOM 5909  C CB   . GLN A 1 4  ? -11.918 -0.418  9.756   1.00 0.00 ? 456 GLN C CB   8  
ATOM 5910  C CG   . GLN A 1 4  ? -11.292 0.784   10.444  1.00 0.00 ? 456 GLN C CG   8  
ATOM 5911  C CD   . GLN A 1 4  ? -12.162 2.020   10.355  1.00 0.00 ? 456 GLN C CD   8  
ATOM 5912  O OE1  . GLN A 1 4  ? -13.388 1.928   10.293  1.00 0.00 ? 456 GLN C OE1  8  
ATOM 5913  N NE2  . GLN A 1 4  ? -11.540 3.181   10.348  1.00 0.00 ? 456 GLN C NE2  8  
ATOM 5914  H H    . GLN A 1 4  ? -9.826  -0.511  8.327   1.00 0.00 ? 456 GLN C H    8  
ATOM 5915  H HA   . GLN A 1 4  ? -10.634 -1.861  10.675  1.00 0.00 ? 456 GLN C HA   8  
ATOM 5916  H HB2  . GLN A 1 4  ? -12.189 -0.129  8.751   1.00 0.00 ? 456 GLN C HB2  8  
ATOM 5917  H HB3  . GLN A 1 4  ? -12.813 -0.689  10.295  1.00 0.00 ? 456 GLN C HB3  8  
ATOM 5918  H HG2  . GLN A 1 4  ? -11.139 0.545   11.486  1.00 0.00 ? 456 GLN C HG2  8  
ATOM 5919  H HG3  . GLN A 1 4  ? -10.339 0.995   9.982   1.00 0.00 ? 456 GLN C HG3  8  
ATOM 5920  H HE21 . GLN A 1 4  ? -10.560 3.186   10.398  1.00 0.00 ? 456 GLN C HE21 8  
ATOM 5921  H HE22 . GLN A 1 4  ? -12.078 3.999   10.292  1.00 0.00 ? 456 GLN C HE22 8  
ATOM 5922  N N    . LEU A 1 5  ? -11.919 -2.899  7.841   1.00 0.00 ? 457 LEU C N    8  
ATOM 5923  C CA   . LEU A 1 5  ? -12.618 -3.998  7.179   1.00 0.00 ? 457 LEU C CA   8  
ATOM 5924  C C    . LEU A 1 5  ? -11.924 -5.323  7.446   1.00 0.00 ? 457 LEU C C    8  
ATOM 5925  O O    . LEU A 1 5  ? -12.565 -6.304  7.841   1.00 0.00 ? 457 LEU C O    8  
ATOM 5926  C CB   . LEU A 1 5  ? -12.697 -3.739  5.671   1.00 0.00 ? 457 LEU C CB   8  
ATOM 5927  C CG   . LEU A 1 5  ? -13.855 -2.854  5.189   1.00 0.00 ? 457 LEU C CG   8  
ATOM 5928  C CD1  . LEU A 1 5  ? -15.159 -3.609  5.256   1.00 0.00 ? 457 LEU C CD1  8  
ATOM 5929  C CD2  . LEU A 1 5  ? -13.956 -1.574  6.001   1.00 0.00 ? 457 LEU C CD2  8  
ATOM 5930  H H    . LEU A 1 5  ? -11.552 -2.180  7.289   1.00 0.00 ? 457 LEU C H    8  
ATOM 5931  H HA   . LEU A 1 5  ? -13.620 -4.044  7.578   1.00 0.00 ? 457 LEU C HA   8  
ATOM 5932  H HB2  . LEU A 1 5  ? -11.771 -3.275  5.364   1.00 0.00 ? 457 LEU C HB2  8  
ATOM 5933  H HB3  . LEU A 1 5  ? -12.777 -4.695  5.174   1.00 0.00 ? 457 LEU C HB3  8  
ATOM 5934  H HG   . LEU A 1 5  ? -13.678 -2.585  4.160   1.00 0.00 ? 457 LEU C HG   8  
ATOM 5935  H HD11 . LEU A 1 5  ? -15.356 -3.896  6.277   1.00 0.00 ? 457 LEU C HD11 8  
ATOM 5936  H HD12 . LEU A 1 5  ? -15.095 -4.492  4.637   1.00 0.00 ? 457 LEU C HD12 8  
ATOM 5937  H HD13 . LEU A 1 5  ? -15.959 -2.979  4.899   1.00 0.00 ? 457 LEU C HD13 8  
ATOM 5938  H HD21 . LEU A 1 5  ? -13.056 -0.992  5.872   1.00 0.00 ? 457 LEU C HD21 8  
ATOM 5939  H HD22 . LEU A 1 5  ? -14.077 -1.823  7.048   1.00 0.00 ? 457 LEU C HD22 8  
ATOM 5940  H HD23 . LEU A 1 5  ? -14.810 -1.005  5.663   1.00 0.00 ? 457 LEU C HD23 8  
ATOM 5941  N N    . ASN A 1 6  ? -10.613 -5.340  7.241   1.00 0.00 ? 458 ASN C N    8  
ATOM 5942  C CA   . ASN A 1 6  ? -9.803  -6.529  7.477   1.00 0.00 ? 458 ASN C CA   8  
ATOM 5943  C C    . ASN A 1 6  ? -9.916  -6.967  8.924   1.00 0.00 ? 458 ASN C C    8  
ATOM 5944  O O    . ASN A 1 6  ? -9.982  -8.158  9.222   1.00 0.00 ? 458 ASN C O    8  
ATOM 5945  C CB   . ASN A 1 6  ? -8.332  -6.263  7.127   1.00 0.00 ? 458 ASN C CB   8  
ATOM 5946  C CG   . ASN A 1 6  ? -8.088  -6.106  5.634   1.00 0.00 ? 458 ASN C CG   8  
ATOM 5947  O OD1  . ASN A 1 6  ? -8.763  -6.721  4.807   1.00 0.00 ? 458 ASN C OD1  8  
ATOM 5948  N ND2  . ASN A 1 6  ? -7.121  -5.279  5.280   1.00 0.00 ? 458 ASN C ND2  8  
ATOM 5949  H H    . ASN A 1 6  ? -10.172 -4.523  6.913   1.00 0.00 ? 458 ASN C H    8  
ATOM 5950  H HA   . ASN A 1 6  ? -10.178 -7.318  6.844   1.00 0.00 ? 458 ASN C HA   8  
ATOM 5951  H HB2  . ASN A 1 6  ? -8.015  -5.354  7.615   1.00 0.00 ? 458 ASN C HB2  8  
ATOM 5952  H HB3  . ASN A 1 6  ? -7.733  -7.084  7.488   1.00 0.00 ? 458 ASN C HB3  8  
ATOM 5953  H HD21 . ASN A 1 6  ? -6.619  -4.819  5.987   1.00 0.00 ? 458 ASN C HD21 8  
ATOM 5954  H HD22 . ASN A 1 6  ? -6.946  -5.151  4.324   1.00 0.00 ? 458 ASN C HD22 8  
ATOM 5955  N N    . ALA A 1 7  ? -9.954  -5.993  9.821   1.00 0.00 ? 459 ALA C N    8  
ATOM 5956  C CA   . ALA A 1 7  ? -10.088 -6.263  11.237  1.00 0.00 ? 459 ALA C CA   8  
ATOM 5957  C C    . ALA A 1 7  ? -11.440 -6.881  11.541  1.00 0.00 ? 459 ALA C C    8  
ATOM 5958  O O    . ALA A 1 7  ? -11.519 -7.864  12.254  1.00 0.00 ? 459 ALA C O    8  
ATOM 5959  C CB   . ALA A 1 7  ? -9.897  -4.988  12.037  1.00 0.00 ? 459 ALA C CB   8  
ATOM 5960  H H    . ALA A 1 7  ? -9.885  -5.062  9.518   1.00 0.00 ? 459 ALA C H    8  
ATOM 5961  H HA   . ALA A 1 7  ? -9.319  -6.967  11.527  1.00 0.00 ? 459 ALA C HA   8  
ATOM 5962  H HB1  . ALA A 1 7  ? -9.935  -5.216  13.091  1.00 0.00 ? 459 ALA C HB1  8  
ATOM 5963  H HB2  . ALA A 1 7  ? -10.683 -4.289  11.792  1.00 0.00 ? 459 ALA C HB2  8  
ATOM 5964  H HB3  . ALA A 1 7  ? -8.941  -4.551  11.797  1.00 0.00 ? 459 ALA C HB3  8  
ATOM 5965  N N    . MET A 1 8  ? -12.498 -6.308  10.976  1.00 0.00 ? 460 MET C N    8  
ATOM 5966  C CA   . MET A 1 8  ? -13.849 -6.797  11.212  1.00 0.00 ? 460 MET C CA   8  
ATOM 5967  C C    . MET A 1 8  ? -14.016 -8.238  10.745  1.00 0.00 ? 460 MET C C    8  
ATOM 5968  O O    . MET A 1 8  ? -14.388 -9.118  11.528  1.00 0.00 ? 460 MET C O    8  
ATOM 5969  C CB   . MET A 1 8  ? -14.883 -5.901  10.522  1.00 0.00 ? 460 MET C CB   8  
ATOM 5970  C CG   . MET A 1 8  ? -14.908 -4.475  11.045  1.00 0.00 ? 460 MET C CG   8  
ATOM 5971  S SD   . MET A 1 8  ? -16.436 -3.602  10.647  1.00 0.00 ? 460 MET C SD   8  
ATOM 5972  C CE   . MET A 1 8  ? -16.438 -3.727  8.869   1.00 0.00 ? 460 MET C CE   8  
ATOM 5973  H H    . MET A 1 8  ? -12.370 -5.532  10.385  1.00 0.00 ? 460 MET C H    8  
ATOM 5974  H HA   . MET A 1 8  ? -14.024 -6.762  12.276  1.00 0.00 ? 460 MET C HA   8  
ATOM 5975  H HB2  . MET A 1 8  ? -14.671 -5.878  9.463   1.00 0.00 ? 460 MET C HB2  8  
ATOM 5976  H HB3  . MET A 1 8  ? -15.861 -6.332  10.661  1.00 0.00 ? 460 MET C HB3  8  
ATOM 5977  H HG2  . MET A 1 8  ? -14.797 -4.496  12.119  1.00 0.00 ? 460 MET C HG2  8  
ATOM 5978  H HG3  . MET A 1 8  ? -14.082 -3.932  10.604  1.00 0.00 ? 460 MET C HG3  8  
ATOM 5979  H HE1  . MET A 1 8  ? -16.330 -4.767  8.592   1.00 0.00 ? 460 MET C HE1  8  
ATOM 5980  H HE2  . MET A 1 8  ? -15.621 -3.153  8.460   1.00 0.00 ? 460 MET C HE2  8  
ATOM 5981  H HE3  . MET A 1 8  ? -17.377 -3.354  8.488   1.00 0.00 ? 460 MET C HE3  8  
ATOM 5982  N N    . ALA A 1 9  ? -13.710 -8.484  9.479   1.00 0.00 ? 461 ALA C N    8  
ATOM 5983  C CA   . ALA A 1 9  ? -13.865 -9.811  8.892   1.00 0.00 ? 461 ALA C CA   8  
ATOM 5984  C C    . ALA A 1 9  ? -12.909 -10.823 9.522   1.00 0.00 ? 461 ALA C C    8  
ATOM 5985  O O    . ALA A 1 9  ? -13.127 -12.034 9.446   1.00 0.00 ? 461 ALA C O    8  
ATOM 5986  C CB   . ALA A 1 9  ? -13.651 -9.745  7.391   1.00 0.00 ? 461 ALA C CB   8  
ATOM 5987  H H    . ALA A 1 9  ? -13.367 -7.751  8.919   1.00 0.00 ? 461 ALA C H    8  
ATOM 5988  H HA   . ALA A 1 9  ? -14.879 -10.137 9.072   1.00 0.00 ? 461 ALA C HA   8  
ATOM 5989  H HB1  . ALA A 1 9  ? -13.821 -10.719 6.958   1.00 0.00 ? 461 ALA C HB1  8  
ATOM 5990  H HB2  . ALA A 1 9  ? -12.637 -9.432  7.184   1.00 0.00 ? 461 ALA C HB2  8  
ATOM 5991  H HB3  . ALA A 1 9  ? -14.341 -9.034  6.960   1.00 0.00 ? 461 ALA C HB3  8  
ATOM 5992  N N    . HIS A 1 10 ? -11.864 -10.316 10.159  1.00 0.00 ? 462 HIS C N    8  
ATOM 5993  C CA   . HIS A 1 10 ? -10.852 -11.149 10.802  1.00 0.00 ? 462 HIS C CA   8  
ATOM 5994  C C    . HIS A 1 10 ? -11.470 -12.075 11.863  1.00 0.00 ? 462 HIS C C    8  
ATOM 5995  O O    . HIS A 1 10 ? -11.078 -13.235 11.976  1.00 0.00 ? 462 HIS C O    8  
ATOM 5996  C CB   . HIS A 1 10 ? -9.761  -10.256 11.417  1.00 0.00 ? 462 HIS C CB   8  
ATOM 5997  C CG   . HIS A 1 10 ? -8.621  -10.987 12.053  1.00 0.00 ? 462 HIS C CG   8  
ATOM 5998  N ND1  . HIS A 1 10 ? -7.778  -11.822 11.362  1.00 0.00 ? 462 HIS C ND1  8  
ATOM 5999  C CD2  . HIS A 1 10 ? -8.185  -10.991 13.329  1.00 0.00 ? 462 HIS C CD2  8  
ATOM 6000  C CE1  . HIS A 1 10 ? -6.872  -12.311 12.184  1.00 0.00 ? 462 HIS C CE1  8  
ATOM 6001  N NE2  . HIS A 1 10 ? -7.095  -11.822 13.385  1.00 0.00 ? 462 HIS C NE2  8  
ATOM 6002  H H    . HIS A 1 10 ? -11.766 -9.340  10.194  1.00 0.00 ? 462 HIS C H    8  
ATOM 6003  H HA   . HIS A 1 10 ? -10.403 -11.763 10.037  1.00 0.00 ? 462 HIS C HA   8  
ATOM 6004  H HB2  . HIS A 1 10 ? -9.348  -9.628  10.644  1.00 0.00 ? 462 HIS C HB2  8  
ATOM 6005  H HB3  . HIS A 1 10 ? -10.215 -9.626  12.170  1.00 0.00 ? 462 HIS C HB3  8  
ATOM 6006  H HD1  . HIS A 1 10 ? -7.832  -12.034 10.402  1.00 0.00 ? 462 HIS C HD1  8  
ATOM 6007  H HD2  . HIS A 1 10 ? -8.609  -10.423 14.146  1.00 0.00 ? 462 HIS C HD2  8  
ATOM 6008  H HE1  . HIS A 1 10 ? -6.080  -12.993 11.916  1.00 0.00 ? 462 HIS C HE1  8  
ATOM 6009  H HE2  . HIS A 1 10 ? -6.722  -12.200 14.215  1.00 0.00 ? 462 HIS C HE2  8  
ATOM 6010  N N    . GLN A 1 11 ? -12.447 -11.568 12.622  1.00 0.00 ? 463 GLN C N    8  
ATOM 6011  C CA   . GLN A 1 11 ? -13.097 -12.384 13.661  1.00 0.00 ? 463 GLN C CA   8  
ATOM 6012  C C    . GLN A 1 11 ? -14.143 -13.312 13.078  1.00 0.00 ? 463 GLN C C    8  
ATOM 6013  O O    . GLN A 1 11 ? -14.559 -14.272 13.726  1.00 0.00 ? 463 GLN C O    8  
ATOM 6014  C CB   . GLN A 1 11 ? -13.706 -11.533 14.784  1.00 0.00 ? 463 GLN C CB   8  
ATOM 6015  C CG   . GLN A 1 11 ? -12.682 -11.028 15.793  1.00 0.00 ? 463 GLN C CG   8  
ATOM 6016  C CD   . GLN A 1 11 ? -11.766 -9.991  15.207  1.00 0.00 ? 463 GLN C CD   8  
ATOM 6017  O OE1  . GLN A 1 11 ? -10.584 -9.927  15.539  1.00 0.00 ? 463 GLN C OE1  8  
ATOM 6018  N NE2  . GLN A 1 11 ? -12.309 -9.147  14.373  1.00 0.00 ? 463 GLN C NE2  8  
ATOM 6019  H H    . GLN A 1 11 ? -12.731 -10.637 12.484  1.00 0.00 ? 463 GLN C H    8  
ATOM 6020  H HA   . GLN A 1 11 ? -12.320 -13.006 14.090  1.00 0.00 ? 463 GLN C HA   8  
ATOM 6021  H HB2  . GLN A 1 11 ? -14.204 -10.682 14.344  1.00 0.00 ? 463 GLN C HB2  8  
ATOM 6022  H HB3  . GLN A 1 11 ? -14.437 -12.129 15.309  1.00 0.00 ? 463 GLN C HB3  8  
ATOM 6023  H HG2  . GLN A 1 11 ? -13.206 -10.589 16.630  1.00 0.00 ? 463 GLN C HG2  8  
ATOM 6024  H HG3  . GLN A 1 11 ? -12.090 -11.862 16.137  1.00 0.00 ? 463 GLN C HG3  8  
ATOM 6025  H HE21 . GLN A 1 11 ? -13.270 -9.225  14.187  1.00 0.00 ? 463 GLN C HE21 8  
ATOM 6026  H HE22 . GLN A 1 11 ? -11.731 -8.481  13.942  1.00 0.00 ? 463 GLN C HE22 8  
ATOM 6027  N N    . ILE A 1 12 ? -14.574 -13.031 11.870  1.00 0.00 ? 464 ILE C N    8  
ATOM 6028  C CA   . ILE A 1 12 ? -15.523 -13.896 11.209  1.00 0.00 ? 464 ILE C CA   8  
ATOM 6029  C C    . ILE A 1 12 ? -14.806 -15.106 10.630  1.00 0.00 ? 464 ILE C C    8  
ATOM 6030  O O    . ILE A 1 12 ? -15.282 -16.228 10.748  1.00 0.00 ? 464 ILE C O    8  
ATOM 6031  C CB   . ILE A 1 12 ? -16.287 -13.175 10.079  1.00 0.00 ? 464 ILE C CB   8  
ATOM 6032  C CG1  . ILE A 1 12 ? -17.041 -11.954 10.621  1.00 0.00 ? 464 ILE C CG1  8  
ATOM 6033  C CG2  . ILE A 1 12 ? -17.259 -14.140 9.403   1.00 0.00 ? 464 ILE C CG2  8  
ATOM 6034  C CD1  . ILE A 1 12 ? -17.807 -11.210 9.552   1.00 0.00 ? 464 ILE C CD1  8  
ATOM 6035  H H    . ILE A 1 12 ? -14.254 -12.226 11.417  1.00 0.00 ? 464 ILE C H    8  
ATOM 6036  H HA   . ILE A 1 12 ? -16.236 -14.234 11.945  1.00 0.00 ? 464 ILE C HA   8  
ATOM 6037  H HB   . ILE A 1 12 ? -15.569 -12.847 9.341   1.00 0.00 ? 464 ILE C HB   8  
ATOM 6038  H HG12 . ILE A 1 12 ? -17.746 -12.277 11.370  1.00 0.00 ? 464 ILE C HG12 8  
ATOM 6039  H HG13 . ILE A 1 12 ? -16.345 -11.264 11.074  1.00 0.00 ? 464 ILE C HG13 8  
ATOM 6040  H HG21 . ILE A 1 12 ? -17.970 -14.501 10.131  1.00 0.00 ? 464 ILE C HG21 8  
ATOM 6041  H HG22 . ILE A 1 12 ? -16.713 -14.977 8.990   1.00 0.00 ? 464 ILE C HG22 8  
ATOM 6042  H HG23 . ILE A 1 12 ? -17.782 -13.624 8.612   1.00 0.00 ? 464 ILE C HG23 8  
ATOM 6043  H HD11 . ILE A 1 12 ? -18.536 -11.871 9.108   1.00 0.00 ? 464 ILE C HD11 8  
ATOM 6044  H HD12 . ILE A 1 12 ? -17.119 -10.873 8.789   1.00 0.00 ? 464 ILE C HD12 8  
ATOM 6045  H HD13 . ILE A 1 12 ? -18.308 -10.360 9.982   1.00 0.00 ? 464 ILE C HD13 8  
ATOM 6046  N N    . GLN A 1 13 ? -13.641 -14.870 10.028  1.00 0.00 ? 465 GLN C N    8  
ATOM 6047  C CA   . GLN A 1 13 ? -12.864 -15.944 9.410   1.00 0.00 ? 465 GLN C CA   8  
ATOM 6048  C C    . GLN A 1 13 ? -12.452 -16.994 10.432  1.00 0.00 ? 465 GLN C C    8  
ATOM 6049  O O    . GLN A 1 13 ? -12.512 -18.187 10.165  1.00 0.00 ? 465 GLN C O    8  
ATOM 6050  C CB   . GLN A 1 13 ? -11.617 -15.404 8.733   1.00 0.00 ? 465 GLN C CB   8  
ATOM 6051  C CG   . GLN A 1 13 ? -10.894 -16.466 7.917   1.00 0.00 ? 465 GLN C CG   8  
ATOM 6052  C CD   . GLN A 1 13 ? -9.560  -16.015 7.377   1.00 0.00 ? 465 GLN C CD   8  
ATOM 6053  O OE1  . GLN A 1 13 ? -9.343  -14.837 7.112   1.00 0.00 ? 465 GLN C OE1  8  
ATOM 6054  N NE2  . GLN A 1 13 ? -8.660  -16.956 7.203   1.00 0.00 ? 465 GLN C NE2  8  
ATOM 6055  H H    . GLN A 1 13 ? -13.302 -13.949 9.987   1.00 0.00 ? 465 GLN C H    8  
ATOM 6056  H HA   . GLN A 1 13 ? -13.488 -16.414 8.663   1.00 0.00 ? 465 GLN C HA   8  
ATOM 6057  H HB2  . GLN A 1 13 ? -11.894 -14.585 8.082   1.00 0.00 ? 465 GLN C HB2  8  
ATOM 6058  H HB3  . GLN A 1 13 ? -10.947 -15.042 9.501   1.00 0.00 ? 465 GLN C HB3  8  
ATOM 6059  H HG2  . GLN A 1 13 ? -10.730 -17.329 8.543   1.00 0.00 ? 465 GLN C HG2  8  
ATOM 6060  H HG3  . GLN A 1 13 ? -11.526 -16.748 7.086   1.00 0.00 ? 465 GLN C HG3  8  
ATOM 6061  H HE21 . GLN A 1 13 ? -8.905  -17.878 7.433   1.00 0.00 ? 465 GLN C HE21 8  
ATOM 6062  H HE22 . GLN A 1 13 ? -7.783  -16.703 6.854   1.00 0.00 ? 465 GLN C HE22 8  
ATOM 6063  N N    . GLU A 1 14 ? -12.032 -16.542 11.603  1.00 0.00 ? 466 GLU C N    8  
ATOM 6064  C CA   . GLU A 1 14 ? -11.614 -17.448 12.662  1.00 0.00 ? 466 GLU C CA   8  
ATOM 6065  C C    . GLU A 1 14 ? -12.776 -18.326 13.130  1.00 0.00 ? 466 GLU C C    8  
ATOM 6066  O O    . GLU A 1 14 ? -12.570 -19.390 13.710  1.00 0.00 ? 466 GLU C O    8  
ATOM 6067  C CB   . GLU A 1 14 ? -11.003 -16.668 13.826  1.00 0.00 ? 466 GLU C CB   8  
ATOM 6068  C CG   . GLU A 1 14 ? -11.764 -15.419 14.190  1.00 0.00 ? 466 GLU C CG   8  
ATOM 6069  C CD   . GLU A 1 14 ? -11.136 -14.670 15.338  1.00 0.00 ? 466 GLU C CD   8  
ATOM 6070  O OE1  . GLU A 1 14 ? -10.152 -13.947 15.109  1.00 0.00 ? 466 GLU C OE1  8  
ATOM 6071  O OE2  . GLU A 1 14 ? -11.628 -14.799 16.478  1.00 0.00 ? 466 GLU C OE2  8  
ATOM 6072  H H    . GLU A 1 14 ? -11.994 -15.576 11.758  1.00 0.00 ? 466 GLU C H    8  
ATOM 6073  H HA   . GLU A 1 14 ? -10.854 -18.093 12.244  1.00 0.00 ? 466 GLU C HA   8  
ATOM 6074  H HB2  . GLU A 1 14 ? -10.966 -17.305 14.694  1.00 0.00 ? 466 GLU C HB2  8  
ATOM 6075  H HB3  . GLU A 1 14 ? -9.999  -16.377 13.560  1.00 0.00 ? 466 GLU C HB3  8  
ATOM 6076  H HG2  . GLU A 1 14 ? -11.781 -14.761 13.326  1.00 0.00 ? 466 GLU C HG2  8  
ATOM 6077  H HG3  . GLU A 1 14 ? -12.773 -15.689 14.459  1.00 0.00 ? 466 GLU C HG3  8  
ATOM 6078  N N    . MET A 1 15 ? -13.994 -17.879 12.860  1.00 0.00 ? 467 MET C N    8  
ATOM 6079  C CA   . MET A 1 15 ? -15.178 -18.646 13.193  1.00 0.00 ? 467 MET C CA   8  
ATOM 6080  C C    . MET A 1 15 ? -15.614 -19.482 11.998  1.00 0.00 ? 467 MET C C    8  
ATOM 6081  O O    . MET A 1 15 ? -16.001 -20.640 12.147  1.00 0.00 ? 467 MET C O    8  
ATOM 6082  C CB   . MET A 1 15 ? -16.325 -17.727 13.616  1.00 0.00 ? 467 MET C CB   8  
ATOM 6083  C CG   . MET A 1 15 ? -16.047 -16.921 14.865  1.00 0.00 ? 467 MET C CG   8  
ATOM 6084  S SD   . MET A 1 15 ? -17.491 -16.002 15.447  1.00 0.00 ? 467 MET C SD   8  
ATOM 6085  C CE   . MET A 1 15 ? -17.824 -14.937 14.044  1.00 0.00 ? 467 MET C CE   8  
ATOM 6086  H H    . MET A 1 15 ? -14.098 -17.010 12.421  1.00 0.00 ? 467 MET C H    8  
ATOM 6087  H HA   . MET A 1 15 ? -14.932 -19.304 14.012  1.00 0.00 ? 467 MET C HA   8  
ATOM 6088  H HB2  . MET A 1 15 ? -16.527 -17.039 12.809  1.00 0.00 ? 467 MET C HB2  8  
ATOM 6089  H HB3  . MET A 1 15 ? -17.203 -18.329 13.786  1.00 0.00 ? 467 MET C HB3  8  
ATOM 6090  H HG2  . MET A 1 15 ? -15.726 -17.593 15.644  1.00 0.00 ? 467 MET C HG2  8  
ATOM 6091  H HG3  . MET A 1 15 ? -15.255 -16.220 14.649  1.00 0.00 ? 467 MET C HG3  8  
ATOM 6092  H HE1  . MET A 1 15 ? -18.000 -15.539 13.165  1.00 0.00 ? 467 MET C HE1  8  
ATOM 6093  H HE2  . MET A 1 15 ? -16.975 -14.290 13.875  1.00 0.00 ? 467 MET C HE2  8  
ATOM 6094  H HE3  . MET A 1 15 ? -18.697 -14.336 14.249  1.00 0.00 ? 467 MET C HE3  8  
ATOM 6095  N N    . PHE A 1 16 ? -15.544 -18.892 10.816  1.00 0.00 ? 468 PHE C N    8  
ATOM 6096  C CA   . PHE A 1 16 ? -15.962 -19.558 9.595   1.00 0.00 ? 468 PHE C CA   8  
ATOM 6097  C C    . PHE A 1 16 ? -14.865 -19.523 8.524   1.00 0.00 ? 468 PHE C C    8  
ATOM 6098  O O    . PHE A 1 16 ? -14.945 -18.751 7.571   1.00 0.00 ? 468 PHE C O    8  
ATOM 6099  C CB   . PHE A 1 16 ? -17.243 -18.910 9.051   1.00 0.00 ? 468 PHE C CB   8  
ATOM 6100  C CG   . PHE A 1 16 ? -18.451 -19.132 9.915   1.00 0.00 ? 468 PHE C CG   8  
ATOM 6101  C CD1  . PHE A 1 16 ? -18.766 -18.245 10.931  1.00 0.00 ? 468 PHE C CD1  8  
ATOM 6102  C CD2  . PHE A 1 16 ? -19.272 -20.228 9.711   1.00 0.00 ? 468 PHE C CD2  8  
ATOM 6103  C CE1  . PHE A 1 16 ? -19.873 -18.446 11.726  1.00 0.00 ? 468 PHE C CE1  8  
ATOM 6104  C CE2  . PHE A 1 16 ? -20.384 -20.435 10.504  1.00 0.00 ? 468 PHE C CE2  8  
ATOM 6105  C CZ   . PHE A 1 16 ? -20.685 -19.542 11.513  1.00 0.00 ? 468 PHE C CZ   8  
ATOM 6106  H H    . PHE A 1 16 ? -15.203 -17.970 10.755  1.00 0.00 ? 468 PHE C H    8  
ATOM 6107  H HA   . PHE A 1 16 ? -16.175 -20.587 9.839   1.00 0.00 ? 468 PHE C HA   8  
ATOM 6108  H HB2  . PHE A 1 16 ? -17.086 -17.844 8.978   1.00 0.00 ? 468 PHE C HB2  8  
ATOM 6109  H HB3  . PHE A 1 16 ? -17.451 -19.299 8.069   1.00 0.00 ? 468 PHE C HB3  8  
ATOM 6110  H HD1  . PHE A 1 16 ? -18.133 -17.386 11.101  1.00 0.00 ? 468 PHE C HD1  8  
ATOM 6111  H HD2  . PHE A 1 16 ? -19.037 -20.927 8.922   1.00 0.00 ? 468 PHE C HD2  8  
ATOM 6112  H HE1  . PHE A 1 16 ? -20.107 -17.745 12.514  1.00 0.00 ? 468 PHE C HE1  8  
ATOM 6113  H HE2  . PHE A 1 16 ? -21.016 -21.294 10.334  1.00 0.00 ? 468 PHE C HE2  8  
ATOM 6114  H HZ   . PHE A 1 16 ? -21.553 -19.700 12.135  1.00 0.00 ? 468 PHE C HZ   8  
ATOM 6115  N N    . PRO A 1 17 ? -13.817 -20.359 8.673   1.00 0.00 ? 469 PRO C N    8  
ATOM 6116  C CA   . PRO A 1 17 ? -12.726 -20.445 7.695   1.00 0.00 ? 469 PRO C CA   8  
ATOM 6117  C C    . PRO A 1 17 ? -13.167 -21.195 6.438   1.00 0.00 ? 469 PRO C C    8  
ATOM 6118  O O    . PRO A 1 17 ? -12.429 -21.288 5.451   1.00 0.00 ? 469 PRO C O    8  
ATOM 6119  C CB   . PRO A 1 17 ? -11.662 -21.250 8.438   1.00 0.00 ? 469 PRO C CB   8  
ATOM 6120  C CG   . PRO A 1 17 ? -12.441 -22.102 9.367   1.00 0.00 ? 469 PRO C CG   8  
ATOM 6121  C CD   . PRO A 1 17 ? -13.596 -21.261 9.816   1.00 0.00 ? 469 PRO C CD   8  
ATOM 6122  H HA   . PRO A 1 17 ? -12.337 -19.471 7.442   1.00 0.00 ? 469 PRO C HA   8  
ATOM 6123  H HB2  . PRO A 1 17 ? -11.094 -21.841 7.734   1.00 0.00 ? 469 PRO C HB2  8  
ATOM 6124  H HB3  . PRO A 1 17 ? -11.005 -20.582 8.973   1.00 0.00 ? 469 PRO C HB3  8  
ATOM 6125  H HG2  . PRO A 1 17 ? -12.794 -22.978 8.846   1.00 0.00 ? 469 PRO C HG2  8  
ATOM 6126  H HG3  . PRO A 1 17 ? -11.830 -22.383 10.210  1.00 0.00 ? 469 PRO C HG3  8  
ATOM 6127  H HD2  . PRO A 1 17 ? -14.465 -21.869 10.008  1.00 0.00 ? 469 PRO C HD2  8  
ATOM 6128  H HD3  . PRO A 1 17 ? -13.323 -20.693 10.692  1.00 0.00 ? 469 PRO C HD3  8  
ATOM 6129  N N    . GLN A 1 18 ? -14.381 -21.731 6.500   1.00 0.00 ? 470 GLN C N    8  
ATOM 6130  C CA   . GLN A 1 18 ? -14.971 -22.492 5.409   1.00 0.00 ? 470 GLN C CA   8  
ATOM 6131  C C    . GLN A 1 18 ? -15.269 -21.613 4.194   1.00 0.00 ? 470 GLN C C    8  
ATOM 6132  O O    . GLN A 1 18 ? -15.347 -22.108 3.065   1.00 0.00 ? 470 GLN C O    8  
ATOM 6133  C CB   . GLN A 1 18 ? -16.253 -23.188 5.883   1.00 0.00 ? 470 GLN C CB   8  
ATOM 6134  C CG   . GLN A 1 18 ? -17.244 -22.257 6.568   1.00 0.00 ? 470 GLN C CG   8  
ATOM 6135  C CD   . GLN A 1 18 ? -18.595 -22.899 6.805   1.00 0.00 ? 470 GLN C CD   8  
ATOM 6136  O OE1  . GLN A 1 18 ? -18.702 -24.111 6.968   1.00 0.00 ? 470 GLN C OE1  8  
ATOM 6137  N NE2  . GLN A 1 18 ? -19.637 -22.087 6.836   1.00 0.00 ? 470 GLN C NE2  8  
ATOM 6138  H H    . GLN A 1 18 ? -14.893 -21.609 7.326   1.00 0.00 ? 470 GLN C H    8  
ATOM 6139  H HA   . GLN A 1 18 ? -14.262 -23.248 5.116   1.00 0.00 ? 470 GLN C HA   8  
ATOM 6140  H HB2  . GLN A 1 18 ? -16.744 -23.632 5.030   1.00 0.00 ? 470 GLN C HB2  8  
ATOM 6141  H HB3  . GLN A 1 18 ? -15.987 -23.969 6.579   1.00 0.00 ? 470 GLN C HB3  8  
ATOM 6142  H HG2  . GLN A 1 18 ? -16.834 -21.956 7.521   1.00 0.00 ? 470 GLN C HG2  8  
ATOM 6143  H HG3  . GLN A 1 18 ? -17.375 -21.386 5.946   1.00 0.00 ? 470 GLN C HG3  8  
ATOM 6144  H HE21 . GLN A 1 18 ? -19.487 -21.128 6.709   1.00 0.00 ? 470 GLN C HE21 8  
ATOM 6145  H HE22 . GLN A 1 18 ? -20.527 -22.479 6.981   1.00 0.00 ? 470 GLN C HE22 8  
ATOM 6146  N N    . VAL A 1 19 ? -15.433 -20.318 4.418   1.00 0.00 ? 471 VAL C N    8  
ATOM 6147  C CA   . VAL A 1 19 ? -15.731 -19.405 3.337   1.00 0.00 ? 471 VAL C CA   8  
ATOM 6148  C C    . VAL A 1 19 ? -14.513 -18.541 3.008   1.00 0.00 ? 471 VAL C C    8  
ATOM 6149  O O    . VAL A 1 19 ? -13.601 -18.405 3.826   1.00 0.00 ? 471 VAL C O    8  
ATOM 6150  C CB   . VAL A 1 19 ? -16.939 -18.494 3.665   1.00 0.00 ? 471 VAL C CB   8  
ATOM 6151  C CG1  . VAL A 1 19 ? -18.155 -19.317 4.047   1.00 0.00 ? 471 VAL C CG1  8  
ATOM 6152  C CG2  . VAL A 1 19 ? -16.593 -17.498 4.754   1.00 0.00 ? 471 VAL C CG2  8  
ATOM 6153  H H    . VAL A 1 19 ? -15.341 -19.962 5.326   1.00 0.00 ? 471 VAL C H    8  
ATOM 6154  H HA   . VAL A 1 19 ? -15.977 -20.000 2.471   1.00 0.00 ? 471 VAL C HA   8  
ATOM 6155  H HB   . VAL A 1 19 ? -17.183 -17.944 2.772   1.00 0.00 ? 471 VAL C HB   8  
ATOM 6156  H HG11 . VAL A 1 19 ? -17.957 -19.843 4.969   1.00 0.00 ? 471 VAL C HG11 8  
ATOM 6157  H HG12 . VAL A 1 19 ? -18.370 -20.031 3.265   1.00 0.00 ? 471 VAL C HG12 8  
ATOM 6158  H HG13 . VAL A 1 19 ? -19.004 -18.665 4.181   1.00 0.00 ? 471 VAL C HG13 8  
ATOM 6159  H HG21 . VAL A 1 19 ? -16.272 -18.024 5.640   1.00 0.00 ? 471 VAL C HG21 8  
ATOM 6160  H HG22 . VAL A 1 19 ? -17.463 -16.898 4.980   1.00 0.00 ? 471 VAL C HG22 8  
ATOM 6161  H HG23 . VAL A 1 19 ? -15.796 -16.860 4.399   1.00 0.00 ? 471 VAL C HG23 8  
ATOM 6162  N N    . PRO A 1 20 ? -14.472 -17.967 1.798   1.00 0.00 ? 472 PRO C N    8  
ATOM 6163  C CA   . PRO A 1 20 ? -13.375 -17.108 1.358   1.00 0.00 ? 472 PRO C CA   8  
ATOM 6164  C C    . PRO A 1 20 ? -13.387 -15.765 2.060   1.00 0.00 ? 472 PRO C C    8  
ATOM 6165  O O    . PRO A 1 20 ? -14.378 -15.028 2.010   1.00 0.00 ? 472 PRO C O    8  
ATOM 6166  C CB   . PRO A 1 20 ? -13.634 -16.921 -0.141  1.00 0.00 ? 472 PRO C CB   8  
ATOM 6167  C CG   . PRO A 1 20 ? -14.660 -17.940 -0.479  1.00 0.00 ? 472 PRO C CG   8  
ATOM 6168  C CD   . PRO A 1 20 ? -15.475 -18.117 0.760   1.00 0.00 ? 472 PRO C CD   8  
ATOM 6169  H HA   . PRO A 1 20 ? -12.415 -17.581 1.505   1.00 0.00 ? 472 PRO C HA   8  
ATOM 6170  H HB2  . PRO A 1 20 ? -13.994 -15.919 -0.324  1.00 0.00 ? 472 PRO C HB2  8  
ATOM 6171  H HB3  . PRO A 1 20 ? -12.719 -17.086 -0.694  1.00 0.00 ? 472 PRO C HB3  8  
ATOM 6172  H HG2  . PRO A 1 20 ? -15.276 -17.589 -1.293  1.00 0.00 ? 472 PRO C HG2  8  
ATOM 6173  H HG3  . PRO A 1 20 ? -14.174 -18.867 -0.740  1.00 0.00 ? 472 PRO C HG3  8  
ATOM 6174  H HD2  . PRO A 1 20 ? -16.231 -17.349 0.847   1.00 0.00 ? 472 PRO C HD2  8  
ATOM 6175  H HD3  . PRO A 1 20 ? -15.919 -19.097 0.792   1.00 0.00 ? 472 PRO C HD3  8  
ATOM 6176  N N    . TYR A 1 21 ? -12.273 -15.451 2.682   1.00 0.00 ? 473 TYR C N    8  
ATOM 6177  C CA   . TYR A 1 21 ? -12.096 -14.217 3.444   1.00 0.00 ? 473 TYR C CA   8  
ATOM 6178  C C    . TYR A 1 21 ? -12.436 -12.971 2.616   1.00 0.00 ? 473 TYR C C    8  
ATOM 6179  O O    . TYR A 1 21 ? -13.024 -12.022 3.129   1.00 0.00 ? 473 TYR C O    8  
ATOM 6180  C CB   . TYR A 1 21 ? -10.654 -14.150 3.953   1.00 0.00 ? 473 TYR C CB   8  
ATOM 6181  C CG   . TYR A 1 21 ? -10.301 -12.906 4.737   1.00 0.00 ? 473 TYR C CG   8  
ATOM 6182  C CD1  . TYR A 1 21 ? -10.992 -12.561 5.891   1.00 0.00 ? 473 TYR C CD1  8  
ATOM 6183  C CD2  . TYR A 1 21 ? -9.252  -12.094 4.335   1.00 0.00 ? 473 TYR C CD2  8  
ATOM 6184  C CE1  . TYR A 1 21 ? -10.647 -11.438 6.618   1.00 0.00 ? 473 TYR C CE1  8  
ATOM 6185  C CE2  . TYR A 1 21 ? -8.906  -10.972 5.053   1.00 0.00 ? 473 TYR C CE2  8  
ATOM 6186  C CZ   . TYR A 1 21 ? -9.603  -10.648 6.192   1.00 0.00 ? 473 TYR C CZ   8  
ATOM 6187  O OH   . TYR A 1 21 ? -9.249  -9.533  6.911   1.00 0.00 ? 473 TYR C OH   8  
ATOM 6188  H H    . TYR A 1 21 ? -11.523 -16.082 2.631   1.00 0.00 ? 473 TYR C H    8  
ATOM 6189  H HA   . TYR A 1 21 ? -12.757 -14.259 4.296   1.00 0.00 ? 473 TYR C HA   8  
ATOM 6190  H HB2  . TYR A 1 21 ? -10.471 -14.998 4.596   1.00 0.00 ? 473 TYR C HB2  8  
ATOM 6191  H HB3  . TYR A 1 21 ? -9.987  -14.207 3.106   1.00 0.00 ? 473 TYR C HB3  8  
ATOM 6192  H HD1  . TYR A 1 21 ? -11.813 -13.182 6.220   1.00 0.00 ? 473 TYR C HD1  8  
ATOM 6193  H HD2  . TYR A 1 21 ? -8.708  -12.347 3.438   1.00 0.00 ? 473 TYR C HD2  8  
ATOM 6194  H HE1  . TYR A 1 21 ? -11.195 -11.184 7.513   1.00 0.00 ? 473 TYR C HE1  8  
ATOM 6195  H HE2  . TYR A 1 21 ? -8.087  -10.351 4.722   1.00 0.00 ? 473 TYR C HE2  8  
ATOM 6196  H HH   . TYR A 1 21 ? -9.435  -9.679  7.847   1.00 0.00 ? 473 TYR C HH   8  
ATOM 6197  N N    . HIS A 1 22 ? -12.093 -12.989 1.335   1.00 0.00 ? 474 HIS C N    8  
ATOM 6198  C CA   . HIS A 1 22 ? -12.345 -11.831 0.474   1.00 0.00 ? 474 HIS C CA   8  
ATOM 6199  C C    . HIS A 1 22 ? -13.840 -11.600 0.236   1.00 0.00 ? 474 HIS C C    8  
ATOM 6200  O O    . HIS A 1 22 ? -14.266 -10.472 0.038   1.00 0.00 ? 474 HIS C O    8  
ATOM 6201  C CB   . HIS A 1 22 ? -11.587 -11.935 -0.862  1.00 0.00 ? 474 HIS C CB   8  
ATOM 6202  C CG   . HIS A 1 22 ? -12.038 -13.040 -1.785  1.00 0.00 ? 474 HIS C CG   8  
ATOM 6203  N ND1  . HIS A 1 22 ? -11.441 -14.279 -1.831  1.00 0.00 ? 474 HIS C ND1  8  
ATOM 6204  C CD2  . HIS A 1 22 ? -13.021 -13.072 -2.716  1.00 0.00 ? 474 HIS C CD2  8  
ATOM 6205  C CE1  . HIS A 1 22 ? -12.035 -15.018 -2.744  1.00 0.00 ? 474 HIS C CE1  8  
ATOM 6206  N NE2  . HIS A 1 22 ? -12.997 -14.311 -3.298  1.00 0.00 ? 474 HIS C NE2  8  
ATOM 6207  H H    . HIS A 1 22 ? -11.654 -13.788 0.971   1.00 0.00 ? 474 HIS C H    8  
ATOM 6208  H HA   . HIS A 1 22 ? -11.972 -10.964 1.007   1.00 0.00 ? 474 HIS C HA   8  
ATOM 6209  H HB2  . HIS A 1 22 ? -11.724 -11.006 -1.390  1.00 0.00 ? 474 HIS C HB2  8  
ATOM 6210  H HB3  . HIS A 1 22 ? -10.535 -12.073 -0.660  1.00 0.00 ? 474 HIS C HB3  8  
ATOM 6211  H HD1  . HIS A 1 22 ? -10.680 -14.576 -1.284  1.00 0.00 ? 474 HIS C HD1  8  
ATOM 6212  H HD2  . HIS A 1 22 ? -13.701 -12.268 -2.952  1.00 0.00 ? 474 HIS C HD2  8  
ATOM 6213  H HE1  . HIS A 1 22 ? -11.777 -16.037 -2.997  1.00 0.00 ? 474 HIS C HE1  8  
ATOM 6214  H HE2  . HIS A 1 22 ? -13.341 -14.488 -4.206  1.00 0.00 ? 474 HIS C HE2  8  
ATOM 6215  N N    . LEU A 1 23 ? -14.634 -12.666 0.267   1.00 0.00 ? 475 LEU C N    8  
ATOM 6216  C CA   . LEU A 1 23 ? -16.075 -12.529 0.084   1.00 0.00 ? 475 LEU C CA   8  
ATOM 6217  C C    . LEU A 1 23 ? -16.691 -11.986 1.352   1.00 0.00 ? 475 LEU C C    8  
ATOM 6218  O O    . LEU A 1 23 ? -17.734 -11.332 1.326   1.00 0.00 ? 475 LEU C O    8  
ATOM 6219  C CB   . LEU A 1 23 ? -16.718 -13.866 -0.279  1.00 0.00 ? 475 LEU C CB   8  
ATOM 6220  C CG   . LEU A 1 23 ? -16.306 -14.475 -1.620  1.00 0.00 ? 475 LEU C CG   8  
ATOM 6221  C CD1  . LEU A 1 23 ? -17.048 -15.764 -1.853  1.00 0.00 ? 475 LEU C CD1  8  
ATOM 6222  C CD2  . LEU A 1 23 ? -16.586 -13.513 -2.755  1.00 0.00 ? 475 LEU C CD2  8  
ATOM 6223  H H    . LEU A 1 23 ? -14.256 -13.554 0.435   1.00 0.00 ? 475 LEU C H    8  
ATOM 6224  H HA   . LEU A 1 23 ? -16.251 -11.818 -0.712  1.00 0.00 ? 475 LEU C HA   8  
ATOM 6225  H HB2  . LEU A 1 23 ? -16.478 -14.575 0.499   1.00 0.00 ? 475 LEU C HB2  8  
ATOM 6226  H HB3  . LEU A 1 23 ? -17.785 -13.724 -0.290  1.00 0.00 ? 475 LEU C HB3  8  
ATOM 6227  H HG   . LEU A 1 23 ? -15.247 -14.688 -1.611  1.00 0.00 ? 475 LEU C HG   8  
ATOM 6228  H HD11 . LEU A 1 23 ? -18.093 -15.543 -2.002  1.00 0.00 ? 475 LEU C HD11 8  
ATOM 6229  H HD12 . LEU A 1 23 ? -16.935 -16.408 -0.994  1.00 0.00 ? 475 LEU C HD12 8  
ATOM 6230  H HD13 . LEU A 1 23 ? -16.655 -16.255 -2.732  1.00 0.00 ? 475 LEU C HD13 8  
ATOM 6231  H HD21 . LEU A 1 23 ? -16.005 -12.613 -2.620  1.00 0.00 ? 475 LEU C HD21 8  
ATOM 6232  H HD22 . LEU A 1 23 ? -17.637 -13.264 -2.763  1.00 0.00 ? 475 LEU C HD22 8  
ATOM 6233  H HD23 . LEU A 1 23 ? -16.320 -13.977 -3.693  1.00 0.00 ? 475 LEU C HD23 8  
ATOM 6234  N N    . VAL A 1 24 ? -16.026 -12.251 2.462   1.00 0.00 ? 476 VAL C N    8  
ATOM 6235  C CA   . VAL A 1 24 ? -16.461 -11.736 3.742   1.00 0.00 ? 476 VAL C CA   8  
ATOM 6236  C C    . VAL A 1 24 ? -16.197 -10.242 3.759   1.00 0.00 ? 476 VAL C C    8  
ATOM 6237  O O    . VAL A 1 24 ? -17.050 -9.448  4.141   1.00 0.00 ? 476 VAL C O    8  
ATOM 6238  C CB   . VAL A 1 24 ? -15.710 -12.417 4.913   1.00 0.00 ? 476 VAL C CB   8  
ATOM 6239  C CG1  . VAL A 1 24 ? -16.258 -11.952 6.248   1.00 0.00 ? 476 VAL C CG1  8  
ATOM 6240  C CG2  . VAL A 1 24 ? -15.799 -13.930 4.799   1.00 0.00 ? 476 VAL C CG2  8  
ATOM 6241  H H    . VAL A 1 24 ? -15.213 -12.799 2.409   1.00 0.00 ? 476 VAL C H    8  
ATOM 6242  H HA   . VAL A 1 24 ? -17.521 -11.916 3.842   1.00 0.00 ? 476 VAL C HA   8  
ATOM 6243  H HB   . VAL A 1 24 ? -14.669 -12.133 4.858   1.00 0.00 ? 476 VAL C HB   8  
ATOM 6244  H HG11 . VAL A 1 24 ? -17.310 -12.188 6.309   1.00 0.00 ? 476 VAL C HG11 8  
ATOM 6245  H HG12 . VAL A 1 24 ? -16.121 -10.887 6.342   1.00 0.00 ? 476 VAL C HG12 8  
ATOM 6246  H HG13 . VAL A 1 24 ? -15.732 -12.454 7.047   1.00 0.00 ? 476 VAL C HG13 8  
ATOM 6247  H HG21 . VAL A 1 24 ? -15.360 -14.248 3.866   1.00 0.00 ? 476 VAL C HG21 8  
ATOM 6248  H HG22 . VAL A 1 24 ? -16.834 -14.234 4.831   1.00 0.00 ? 476 VAL C HG22 8  
ATOM 6249  H HG23 . VAL A 1 24 ? -15.265 -14.385 5.621   1.00 0.00 ? 476 VAL C HG23 8  
ATOM 6250  N N    . LEU A 1 25 ? -15.003 -9.876  3.300   1.00 0.00 ? 477 LEU C N    8  
ATOM 6251  C CA   . LEU A 1 25 ? -14.606 -8.484  3.158   1.00 0.00 ? 477 LEU C CA   8  
ATOM 6252  C C    . LEU A 1 25 ? -15.586 -7.749  2.249   1.00 0.00 ? 477 LEU C C    8  
ATOM 6253  O O    . LEU A 1 25 ? -15.938 -6.594  2.498   1.00 0.00 ? 477 LEU C O    8  
ATOM 6254  C CB   . LEU A 1 25 ? -13.193 -8.421  2.572   1.00 0.00 ? 477 LEU C CB   8  
ATOM 6255  C CG   . LEU A 1 25 ? -12.069 -8.889  3.498   1.00 0.00 ? 477 LEU C CG   8  
ATOM 6256  C CD1  . LEU A 1 25 ? -10.745 -8.919  2.757   1.00 0.00 ? 477 LEU C CD1  8  
ATOM 6257  C CD2  . LEU A 1 25 ? -11.970 -7.986  4.715   1.00 0.00 ? 477 LEU C CD2  8  
ATOM 6258  H H    . LEU A 1 25 ? -14.358 -10.575 3.057   1.00 0.00 ? 477 LEU C H    8  
ATOM 6259  H HA   . LEU A 1 25 ? -14.613 -8.019  4.132   1.00 0.00 ? 477 LEU C HA   8  
ATOM 6260  H HB2  . LEU A 1 25 ? -13.177 -9.046  1.691   1.00 0.00 ? 477 LEU C HB2  8  
ATOM 6261  H HB3  . LEU A 1 25 ? -12.985 -7.413  2.267   1.00 0.00 ? 477 LEU C HB3  8  
ATOM 6262  H HG   . LEU A 1 25 ? -12.284 -9.891  3.838   1.00 0.00 ? 477 LEU C HG   8  
ATOM 6263  H HD11 . LEU A 1 25 ? -10.525 -7.933  2.378   1.00 0.00 ? 477 LEU C HD11 8  
ATOM 6264  H HD12 . LEU A 1 25 ? -10.806 -9.616  1.937   1.00 0.00 ? 477 LEU C HD12 8  
ATOM 6265  H HD13 . LEU A 1 25 ? -9.961  -9.226  3.434   1.00 0.00 ? 477 LEU C HD13 8  
ATOM 6266  H HD21 . LEU A 1 25 ? -11.776 -6.972  4.397   1.00 0.00 ? 477 LEU C HD21 8  
ATOM 6267  H HD22 . LEU A 1 25 ? -11.164 -8.326  5.346   1.00 0.00 ? 477 LEU C HD22 8  
ATOM 6268  H HD23 . LEU A 1 25 ? -12.898 -8.020  5.268   1.00 0.00 ? 477 LEU C HD23 8  
ATOM 6269  N N    . GLN A 1 26 ? -16.024 -8.437  1.196   1.00 0.00 ? 478 GLN C N    8  
ATOM 6270  C CA   . GLN A 1 26 ? -17.007 -7.901  0.270   1.00 0.00 ? 478 GLN C CA   8  
ATOM 6271  C C    . GLN A 1 26 ? -18.284 -7.502  1.003   1.00 0.00 ? 478 GLN C C    8  
ATOM 6272  O O    . GLN A 1 26 ? -18.719 -6.360  0.920   1.00 0.00 ? 478 GLN C O    8  
ATOM 6273  C CB   . GLN A 1 26 ? -17.338 -8.927  -0.817  1.00 0.00 ? 478 GLN C CB   8  
ATOM 6274  C CG   . GLN A 1 26 ? -16.325 -9.001  -1.947  1.00 0.00 ? 478 GLN C CG   8  
ATOM 6275  C CD   . GLN A 1 26 ? -16.721 -10.020 -2.999  1.00 0.00 ? 478 GLN C CD   8  
ATOM 6276  O OE1  . GLN A 1 26 ? -17.910 -10.283 -3.215  1.00 0.00 ? 478 GLN C OE1  8  
ATOM 6277  N NE2  . GLN A 1 26 ? -15.739 -10.601 -3.663  1.00 0.00 ? 478 GLN C NE2  8  
ATOM 6278  H H    . GLN A 1 26 ? -15.660 -9.332  1.036   1.00 0.00 ? 478 GLN C H    8  
ATOM 6279  H HA   . GLN A 1 26 ? -16.583 -7.025  -0.195  1.00 0.00 ? 478 GLN C HA   8  
ATOM 6280  H HB2  . GLN A 1 26 ? -17.388 -9.902  -0.357  1.00 0.00 ? 478 GLN C HB2  8  
ATOM 6281  H HB3  . GLN A 1 26 ? -18.301 -8.697  -1.239  1.00 0.00 ? 478 GLN C HB3  8  
ATOM 6282  H HG2  . GLN A 1 26 ? -16.250 -8.031  -2.416  1.00 0.00 ? 478 GLN C HG2  8  
ATOM 6283  H HG3  . GLN A 1 26 ? -15.365 -9.280  -1.538  1.00 0.00 ? 478 GLN C HG3  8  
ATOM 6284  H HE21 . GLN A 1 26 ? -14.816 -10.340 -3.448  1.00 0.00 ? 478 GLN C HE21 8  
ATOM 6285  H HE22 . GLN A 1 26 ? -15.967 -11.273 -4.337  1.00 0.00 ? 478 GLN C HE22 8  
ATOM 6286  N N    . ASP A 1 27 ? -18.867 -8.445  1.742   1.00 0.00 ? 479 ASP C N    8  
ATOM 6287  C CA   . ASP A 1 27 ? -20.116 -8.182  2.462   1.00 0.00 ? 479 ASP C CA   8  
ATOM 6288  C C    . ASP A 1 27 ? -19.913 -7.132  3.539   1.00 0.00 ? 479 ASP C C    8  
ATOM 6289  O O    . ASP A 1 27 ? -20.815 -6.372  3.840   1.00 0.00 ? 479 ASP C O    8  
ATOM 6290  C CB   . ASP A 1 27 ? -20.681 -9.454  3.086   1.00 0.00 ? 479 ASP C CB   8  
ATOM 6291  C CG   . ASP A 1 27 ? -22.102 -9.255  3.604   1.00 0.00 ? 479 ASP C CG   8  
ATOM 6292  O OD1  . ASP A 1 27 ? -23.051 -9.405  2.801   1.00 0.00 ? 479 ASP C OD1  8  
ATOM 6293  O OD2  . ASP A 1 27 ? -22.276 -8.947  4.811   1.00 0.00 ? 479 ASP C OD2  8  
ATOM 6294  H H    . ASP A 1 27 ? -18.450 -9.332  1.807   1.00 0.00 ? 479 ASP C H    8  
ATOM 6295  H HA   . ASP A 1 27 ? -20.831 -7.798  1.743   1.00 0.00 ? 479 ASP C HA   8  
ATOM 6296  H HB2  . ASP A 1 27 ? -20.687 -10.239 2.345   1.00 0.00 ? 479 ASP C HB2  8  
ATOM 6297  H HB3  . ASP A 1 27 ? -20.052 -9.748  3.911   1.00 0.00 ? 479 ASP C HB3  8  
ATOM 6298  N N    . LEU A 1 28 ? -18.723 -7.085  4.113   1.00 0.00 ? 480 LEU C N    8  
ATOM 6299  C CA   . LEU A 1 28 ? -18.418 -6.088  5.120   1.00 0.00 ? 480 LEU C CA   8  
ATOM 6300  C C    . LEU A 1 28 ? -18.404 -4.685  4.524   1.00 0.00 ? 480 LEU C C    8  
ATOM 6301  O O    . LEU A 1 28 ? -18.543 -3.707  5.237   1.00 0.00 ? 480 LEU C O    8  
ATOM 6302  C CB   . LEU A 1 28 ? -17.103 -6.387  5.838   1.00 0.00 ? 480 LEU C CB   8  
ATOM 6303  C CG   . LEU A 1 28 ? -17.226 -7.049  7.210   1.00 0.00 ? 480 LEU C CG   8  
ATOM 6304  C CD1  . LEU A 1 28 ? -18.334 -6.413  8.029   1.00 0.00 ? 480 LEU C CD1  8  
ATOM 6305  C CD2  . LEU A 1 28 ? -17.480 -8.508  7.062   1.00 0.00 ? 480 LEU C CD2  8  
ATOM 6306  H H    . LEU A 1 28 ? -18.043 -7.742  3.866   1.00 0.00 ? 480 LEU C H    8  
ATOM 6307  H HA   . LEU A 1 28 ? -19.220 -6.125  5.842   1.00 0.00 ? 480 LEU C HA   8  
ATOM 6308  H HB2  . LEU A 1 28 ? -16.521 -7.038  5.206   1.00 0.00 ? 480 LEU C HB2  8  
ATOM 6309  H HB3  . LEU A 1 28 ? -16.563 -5.470  5.953   1.00 0.00 ? 480 LEU C HB3  8  
ATOM 6310  H HG   . LEU A 1 28 ? -16.299 -6.921  7.749   1.00 0.00 ? 480 LEU C HG   8  
ATOM 6311  H HD11 . LEU A 1 28 ? -19.290 -6.745  7.652   1.00 0.00 ? 480 LEU C HD11 8  
ATOM 6312  H HD12 . LEU A 1 28 ? -18.270 -5.338  7.950   1.00 0.00 ? 480 LEU C HD12 8  
ATOM 6313  H HD13 . LEU A 1 28 ? -18.234 -6.707  9.063   1.00 0.00 ? 480 LEU C HD13 8  
ATOM 6314  H HD21 . LEU A 1 28 ? -18.402 -8.633  6.510   1.00 0.00 ? 480 LEU C HD21 8  
ATOM 6315  H HD22 . LEU A 1 28 ? -17.567 -8.953  8.042   1.00 0.00 ? 480 LEU C HD22 8  
ATOM 6316  H HD23 . LEU A 1 28 ? -16.667 -8.962  6.519   1.00 0.00 ? 480 LEU C HD23 8  
ATOM 6317  N N    . GLN A 1 29 ? -18.219 -4.595  3.222   1.00 0.00 ? 481 GLN C N    8  
ATOM 6318  C CA   . GLN A 1 29 ? -18.316 -3.322  2.538   1.00 0.00 ? 481 GLN C CA   8  
ATOM 6319  C C    . GLN A 1 29 ? -19.784 -3.005  2.287   1.00 0.00 ? 481 GLN C C    8  
ATOM 6320  O O    . GLN A 1 29 ? -20.195 -1.847  2.260   1.00 0.00 ? 481 GLN C O    8  
ATOM 6321  C CB   . GLN A 1 29 ? -17.567 -3.368  1.208   1.00 0.00 ? 481 GLN C CB   8  
ATOM 6322  C CG   . GLN A 1 29 ? -16.054 -3.285  1.336   1.00 0.00 ? 481 GLN C CG   8  
ATOM 6323  C CD   . GLN A 1 29 ? -15.565 -1.928  1.825   1.00 0.00 ? 481 GLN C CD   8  
ATOM 6324  O OE1  . GLN A 1 29 ? -14.518 -1.825  2.454   1.00 0.00 ? 481 GLN C OE1  8  
ATOM 6325  N NE2  . GLN A 1 29 ? -16.313 -0.879  1.531   1.00 0.00 ? 481 GLN C NE2  8  
ATOM 6326  H H    . GLN A 1 29 ? -18.005 -5.402  2.706   1.00 0.00 ? 481 GLN C H    8  
ATOM 6327  H HA   . GLN A 1 29 ? -17.878 -2.563  3.170   1.00 0.00 ? 481 GLN C HA   8  
ATOM 6328  H HB2  . GLN A 1 29 ? -17.809 -4.294  0.709   1.00 0.00 ? 481 GLN C HB2  8  
ATOM 6329  H HB3  . GLN A 1 29 ? -17.901 -2.547  0.595   1.00 0.00 ? 481 GLN C HB3  8  
ATOM 6330  H HG2  . GLN A 1 29 ? -15.726 -4.038  2.036   1.00 0.00 ? 481 GLN C HG2  8  
ATOM 6331  H HG3  . GLN A 1 29 ? -15.618 -3.483  0.372   1.00 0.00 ? 481 GLN C HG3  8  
ATOM 6332  H HE21 . GLN A 1 29 ? -17.133 -1.016  1.017   1.00 0.00 ? 481 GLN C HE21 8  
ATOM 6333  H HE22 . GLN A 1 29 ? -16.019 0.002   1.852   1.00 0.00 ? 481 GLN C HE22 8  
ATOM 6334  N N    . LEU A 1 30 ? -20.562 -4.063  2.115   1.00 0.00 ? 482 LEU C N    8  
ATOM 6335  C CA   . LEU A 1 30 ? -21.986 -3.974  1.857   1.00 0.00 ? 482 LEU C CA   8  
ATOM 6336  C C    . LEU A 1 30 ? -22.771 -3.654  3.126   1.00 0.00 ? 482 LEU C C    8  
ATOM 6337  O O    . LEU A 1 30 ? -23.505 -2.665  3.182   1.00 0.00 ? 482 LEU C O    8  
ATOM 6338  C CB   . LEU A 1 30 ? -22.483 -5.305  1.277   1.00 0.00 ? 482 LEU C CB   8  
ATOM 6339  C CG   . LEU A 1 30 ? -22.377 -5.493  -0.244  1.00 0.00 ? 482 LEU C CG   8  
ATOM 6340  C CD1  . LEU A 1 30 ? -23.404 -4.646  -0.950  1.00 0.00 ? 482 LEU C CD1  8  
ATOM 6341  C CD2  . LEU A 1 30 ? -20.984 -5.167  -0.757  1.00 0.00 ? 482 LEU C CD2  8  
ATOM 6342  H H    . LEU A 1 30 ? -20.162 -4.957  2.155   1.00 0.00 ? 482 LEU C H    8  
ATOM 6343  H HA   . LEU A 1 30 ? -22.152 -3.198  1.128   1.00 0.00 ? 482 LEU C HA   8  
ATOM 6344  H HB2  . LEU A 1 30 ? -21.920 -6.098  1.747   1.00 0.00 ? 482 LEU C HB2  8  
ATOM 6345  H HB3  . LEU A 1 30 ? -23.517 -5.419  1.558   1.00 0.00 ? 482 LEU C HB3  8  
ATOM 6346  H HG   . LEU A 1 30 ? -22.584 -6.528  -0.472  1.00 0.00 ? 482 LEU C HG   8  
ATOM 6347  H HD11 . LEU A 1 30 ? -23.233 -3.607  -0.719  1.00 0.00 ? 482 LEU C HD11 8  
ATOM 6348  H HD12 . LEU A 1 30 ? -24.388 -4.935  -0.616  1.00 0.00 ? 482 LEU C HD12 8  
ATOM 6349  H HD13 . LEU A 1 30 ? -23.322 -4.801  -2.013  1.00 0.00 ? 482 LEU C HD13 8  
ATOM 6350  H HD21 . LEU A 1 30 ? -20.265 -5.824  -0.291  1.00 0.00 ? 482 LEU C HD21 8  
ATOM 6351  H HD22 . LEU A 1 30 ? -20.743 -4.143  -0.515  1.00 0.00 ? 482 LEU C HD22 8  
ATOM 6352  H HD23 . LEU A 1 30 ? -20.953 -5.301  -1.828  1.00 0.00 ? 482 LEU C HD23 8  
ATOM 6353  N N    . THR A 1 31 ? -22.608 -4.483  4.144   1.00 0.00 ? 483 THR C N    8  
ATOM 6354  C CA   . THR A 1 31 ? -23.370 -4.342  5.363   1.00 0.00 ? 483 THR C CA   8  
ATOM 6355  C C    . THR A 1 31 ? -22.606 -3.573  6.419   1.00 0.00 ? 483 THR C C    8  
ATOM 6356  O O    . THR A 1 31 ? -23.205 -2.872  7.239   1.00 0.00 ? 483 THR C O    8  
ATOM 6357  C CB   . THR A 1 31 ? -23.770 -5.715  5.929   1.00 0.00 ? 483 THR C CB   8  
ATOM 6358  O OG1  . THR A 1 31 ? -22.597 -6.514  6.141   1.00 0.00 ? 483 THR C OG1  8  
ATOM 6359  C CG2  . THR A 1 31 ? -24.703 -6.433  4.975   1.00 0.00 ? 483 THR C CG2  8  
ATOM 6360  H H    . THR A 1 31 ? -21.946 -5.219  4.081   1.00 0.00 ? 483 THR C H    8  
ATOM 6361  H HA   . THR A 1 31 ? -24.277 -3.801  5.127   1.00 0.00 ? 483 THR C HA   8  
ATOM 6362  H HB   . THR A 1 31 ? -24.276 -5.571  6.873   1.00 0.00 ? 483 THR C HB   8  
ATOM 6363  H HG1  . THR A 1 31 ? -22.595 -7.266  5.525   1.00 0.00 ? 483 THR C HG1  8  
ATOM 6364  H HG21 . THR A 1 31 ? -24.203 -6.581  4.029   1.00 0.00 ? 483 THR C HG21 8  
ATOM 6365  H HG22 . THR A 1 31 ? -25.589 -5.837  4.823   1.00 0.00 ? 483 THR C HG22 8  
ATOM 6366  H HG23 . THR A 1 31 ? -24.978 -7.390  5.392   1.00 0.00 ? 483 THR C HG23 8  
ATOM 6367  N N    . ARG A 1 32 ? -21.272 -3.702  6.397   1.00 0.00 ? 484 ARG C N    8  
ATOM 6368  C CA   . ARG A 1 32 ? -20.413 -3.060  7.380   1.00 0.00 ? 484 ARG C CA   8  
ATOM 6369  C C    . ARG A 1 32 ? -20.761 -3.524  8.791   1.00 0.00 ? 484 ARG C C    8  
ATOM 6370  O O    . ARG A 1 32 ? -20.492 -2.834  9.779   1.00 0.00 ? 484 ARG C O    8  
ATOM 6371  C CB   . ARG A 1 32 ? -20.501 -1.549  7.245   1.00 0.00 ? 484 ARG C CB   8  
ATOM 6372  C CG   . ARG A 1 32 ? -19.968 -1.048  5.918   1.00 0.00 ? 484 ARG C CG   8  
ATOM 6373  C CD   . ARG A 1 32 ? -20.189 0.431   5.740   1.00 0.00 ? 484 ARG C CD   8  
ATOM 6374  N NE   . ARG A 1 32 ? -21.600 0.761   5.552   1.00 0.00 ? 484 ARG C NE   8  
ATOM 6375  C CZ   . ARG A 1 32 ? -22.053 1.648   4.662   1.00 0.00 ? 484 ARG C CZ   8  
ATOM 6376  N NH1  . ARG A 1 32 ? -21.203 2.341   3.903   1.00 0.00 ? 484 ARG C NH1  8  
ATOM 6377  N NH2  . ARG A 1 32 ? -23.357 1.854   4.546   1.00 0.00 ? 484 ARG C NH2  8  
ATOM 6378  H H    . ARG A 1 32 ? -20.849 -4.227  5.689   1.00 0.00 ? 484 ARG C H    8  
ATOM 6379  H HA   . ARG A 1 32 ? -19.399 -3.366  7.164   1.00 0.00 ? 484 ARG C HA   8  
ATOM 6380  H HB2  . ARG A 1 32 ? -21.530 -1.243  7.339   1.00 0.00 ? 484 ARG C HB2  8  
ATOM 6381  H HB3  . ARG A 1 32 ? -19.921 -1.103  8.032   1.00 0.00 ? 484 ARG C HB3  8  
ATOM 6382  H HG2  . ARG A 1 32 ? -18.909 -1.248  5.876   1.00 0.00 ? 484 ARG C HG2  8  
ATOM 6383  H HG3  . ARG A 1 32 ? -20.467 -1.579  5.119   1.00 0.00 ? 484 ARG C HG3  8  
ATOM 6384  H HD2  . ARG A 1 32 ? -19.826 0.935   6.621   1.00 0.00 ? 484 ARG C HD2  8  
ATOM 6385  H HD3  . ARG A 1 32 ? -19.632 0.752   4.876   1.00 0.00 ? 484 ARG C HD3  8  
ATOM 6386  H HE   . ARG A 1 32 ? -22.248 0.283   6.120   1.00 0.00 ? 484 ARG C HE   8  
ATOM 6387  H HH11 . ARG A 1 32 ? -20.212 2.207   3.993   1.00 0.00 ? 484 ARG C HH11 8  
ATOM 6388  H HH12 . ARG A 1 32 ? -21.542 3.000   3.229   1.00 0.00 ? 484 ARG C HH12 8  
ATOM 6389  H HH21 . ARG A 1 32 ? -24.004 1.347   5.125   1.00 0.00 ? 484 ARG C HH21 8  
ATOM 6390  H HH22 . ARG A 1 32 ? -23.711 2.510   3.874   1.00 0.00 ? 484 ARG C HH22 8  
ATOM 6391  N N    . SER A 1 33 ? -21.335 -4.716  8.871   1.00 0.00 ? 485 SER C N    8  
ATOM 6392  C CA   . SER A 1 33 ? -21.731 -5.297  10.127  1.00 0.00 ? 485 SER C CA   8  
ATOM 6393  C C    . SER A 1 33 ? -21.361 -6.766  10.153  1.00 0.00 ? 485 SER C C    8  
ATOM 6394  O O    . SER A 1 33 ? -22.038 -7.582  9.530   1.00 0.00 ? 485 SER C O    8  
ATOM 6395  C CB   . SER A 1 33 ? -23.241 -5.145  10.326  1.00 0.00 ? 485 SER C CB   8  
ATOM 6396  O OG   . SER A 1 33 ? -23.629 -5.503  11.645  1.00 0.00 ? 485 SER C OG   8  
ATOM 6397  H H    . SER A 1 33 ? -21.498 -5.226  8.046   1.00 0.00 ? 485 SER C H    8  
ATOM 6398  H HA   . SER A 1 33 ? -21.218 -4.782  10.919  1.00 0.00 ? 485 SER C HA   8  
ATOM 6399  H HB2  . SER A 1 33 ? -23.538 -4.130  10.130  1.00 0.00 ? 485 SER C HB2  8  
ATOM 6400  H HB3  . SER A 1 33 ? -23.748 -5.799  9.631   1.00 0.00 ? 485 SER C HB3  8  
ATOM 6401  H HG   . SER A 1 33 ? -23.186 -4.917  12.272  1.00 0.00 ? 485 SER C HG   8  
ATOM 6402  N N    . VAL A 1 34 ? -20.283 -7.108  10.864  1.00 0.00 ? 486 VAL C N    8  
ATOM 6403  C CA   . VAL A 1 34 ? -19.847 -8.500  10.965  1.00 0.00 ? 486 VAL C CA   8  
ATOM 6404  C C    . VAL A 1 34 ? -20.970 -9.388  11.497  1.00 0.00 ? 486 VAL C C    8  
ATOM 6405  O O    . VAL A 1 34 ? -21.063 -10.565 11.149  1.00 0.00 ? 486 VAL C O    8  
ATOM 6406  C CB   . VAL A 1 34 ? -18.585 -8.662  11.854  1.00 0.00 ? 486 VAL C CB   8  
ATOM 6407  C CG1  . VAL A 1 34 ? -17.501 -7.709  11.423  1.00 0.00 ? 486 VAL C CG1  8  
ATOM 6408  C CG2  . VAL A 1 34 ? -18.895 -8.490  13.331  1.00 0.00 ? 486 VAL C CG2  8  
ATOM 6409  H H    . VAL A 1 34 ? -19.754 -6.410  11.313  1.00 0.00 ? 486 VAL C H    8  
ATOM 6410  H HA   . VAL A 1 34 ? -19.603 -8.826  9.965   1.00 0.00 ? 486 VAL C HA   8  
ATOM 6411  H HB   . VAL A 1 34 ? -18.210 -9.660  11.709  1.00 0.00 ? 486 VAL C HB   8  
ATOM 6412  H HG11 . VAL A 1 34 ? -17.869 -6.695  11.468  1.00 0.00 ? 486 VAL C HG11 8  
ATOM 6413  H HG12 . VAL A 1 34 ? -17.201 -7.942  10.411  1.00 0.00 ? 486 VAL C HG12 8  
ATOM 6414  H HG13 . VAL A 1 34 ? -16.650 -7.811  12.082  1.00 0.00 ? 486 VAL C HG13 8  
ATOM 6415  H HG21 . VAL A 1 34 ? -19.642 -9.212  13.621  1.00 0.00 ? 486 VAL C HG21 8  
ATOM 6416  H HG22 . VAL A 1 34 ? -19.260 -7.492  13.516  1.00 0.00 ? 486 VAL C HG22 8  
ATOM 6417  H HG23 . VAL A 1 34 ? -17.992 -8.663  13.898  1.00 0.00 ? 486 VAL C HG23 8  
ATOM 6418  N N    . GLU A 1 35 ? -21.827 -8.803  12.324  1.00 0.00 ? 487 GLU C N    8  
ATOM 6419  C CA   . GLU A 1 35 ? -22.963 -9.507  12.885  1.00 0.00 ? 487 GLU C CA   8  
ATOM 6420  C C    . GLU A 1 35 ? -23.895 -9.969  11.775  1.00 0.00 ? 487 GLU C C    8  
ATOM 6421  O O    . GLU A 1 35 ? -24.306 -11.131 11.740  1.00 0.00 ? 487 GLU C O    8  
ATOM 6422  C CB   . GLU A 1 35 ? -23.704 -8.596  13.855  1.00 0.00 ? 487 GLU C CB   8  
ATOM 6423  C CG   . GLU A 1 35 ? -22.853 -8.144  15.028  1.00 0.00 ? 487 GLU C CG   8  
ATOM 6424  C CD   . GLU A 1 35 ? -22.449 -9.290  15.924  1.00 0.00 ? 487 GLU C CD   8  
ATOM 6425  O OE1  . GLU A 1 35 ? -23.201 -9.594  16.876  1.00 0.00 ? 487 GLU C OE1  8  
ATOM 6426  O OE2  . GLU A 1 35 ? -21.385 -9.897  15.687  1.00 0.00 ? 487 GLU C OE2  8  
ATOM 6427  H H    . GLU A 1 35 ? -21.683 -7.865  12.563  1.00 0.00 ? 487 GLU C H    8  
ATOM 6428  H HA   . GLU A 1 35 ? -22.596 -10.370 13.418  1.00 0.00 ? 487 GLU C HA   8  
ATOM 6429  H HB2  . GLU A 1 35 ? -24.040 -7.719  13.322  1.00 0.00 ? 487 GLU C HB2  8  
ATOM 6430  H HB3  . GLU A 1 35 ? -24.562 -9.122  14.242  1.00 0.00 ? 487 GLU C HB3  8  
ATOM 6431  H HG2  . GLU A 1 35 ? -21.959 -7.671  14.650  1.00 0.00 ? 487 GLU C HG2  8  
ATOM 6432  H HG3  . GLU A 1 35 ? -23.415 -7.429  15.612  1.00 0.00 ? 487 GLU C HG3  8  
ATOM 6433  N N    . ILE A 1 36 ? -24.204 -9.063  10.856  1.00 0.00 ? 488 ILE C N    8  
ATOM 6434  C CA   . ILE A 1 36 ? -25.051 -9.397  9.729   1.00 0.00 ? 488 ILE C CA   8  
ATOM 6435  C C    . ILE A 1 36 ? -24.314 -10.344 8.808   1.00 0.00 ? 488 ILE C C    8  
ATOM 6436  O O    . ILE A 1 36 ? -24.818 -11.386 8.483   1.00 0.00 ? 488 ILE C O    8  
ATOM 6437  C CB   . ILE A 1 36 ? -25.478 -8.149  8.925   1.00 0.00 ? 488 ILE C CB   8  
ATOM 6438  C CG1  . ILE A 1 36 ? -26.155 -7.125  9.841   1.00 0.00 ? 488 ILE C CG1  8  
ATOM 6439  C CG2  . ILE A 1 36 ? -26.418 -8.548  7.788   1.00 0.00 ? 488 ILE C CG2  8  
ATOM 6440  C CD1  . ILE A 1 36 ? -26.592 -5.859  9.130   1.00 0.00 ? 488 ILE C CD1  8  
ATOM 6441  H H    . ILE A 1 36 ? -23.847 -8.154  10.939  1.00 0.00 ? 488 ILE C H    8  
ATOM 6442  H HA   . ILE A 1 36 ? -25.936 -9.891  10.106  1.00 0.00 ? 488 ILE C HA   8  
ATOM 6443  H HB   . ILE A 1 36 ? -24.592 -7.715  8.488   1.00 0.00 ? 488 ILE C HB   8  
ATOM 6444  H HG12 . ILE A 1 36 ? -27.031 -7.574  10.282  1.00 0.00 ? 488 ILE C HG12 8  
ATOM 6445  H HG13 . ILE A 1 36 ? -25.465 -6.846  10.625  1.00 0.00 ? 488 ILE C HG13 8  
ATOM 6446  H HG21 . ILE A 1 36 ? -27.299 -9.016  8.200   1.00 0.00 ? 488 ILE C HG21 8  
ATOM 6447  H HG22 . ILE A 1 36 ? -25.914 -9.244  7.133   1.00 0.00 ? 488 ILE C HG22 8  
ATOM 6448  H HG23 . ILE A 1 36 ? -26.703 -7.668  7.231   1.00 0.00 ? 488 ILE C HG23 8  
ATOM 6449  H HD11 . ILE A 1 36 ? -27.307 -6.109  8.360   1.00 0.00 ? 488 ILE C HD11 8  
ATOM 6450  H HD12 . ILE A 1 36 ? -25.733 -5.379  8.682   1.00 0.00 ? 488 ILE C HD12 8  
ATOM 6451  H HD13 . ILE A 1 36 ? -27.051 -5.186  9.840   1.00 0.00 ? 488 ILE C HD13 8  
ATOM 6452  N N    . THR A 1 37 ? -23.108 -9.954  8.408   1.00 0.00 ? 489 THR C N    8  
ATOM 6453  C CA   . THR A 1 37 ? -22.243 -10.750 7.546   1.00 0.00 ? 489 THR C CA   8  
ATOM 6454  C C    . THR A 1 37 ? -22.166 -12.225 7.978   1.00 0.00 ? 489 THR C C    8  
ATOM 6455  O O    . THR A 1 37 ? -22.258 -13.115 7.143   1.00 0.00 ? 489 THR C O    8  
ATOM 6456  C CB   . THR A 1 37 ? -20.831 -10.156 7.520   1.00 0.00 ? 489 THR C CB   8  
ATOM 6457  O OG1  . THR A 1 37 ? -20.908 -8.774  7.163   1.00 0.00 ? 489 THR C OG1  8  
ATOM 6458  C CG2  . THR A 1 37 ? -19.948 -10.883 6.518   1.00 0.00 ? 489 THR C CG2  8  
ATOM 6459  H H    . THR A 1 37 ? -22.784 -9.072  8.675   1.00 0.00 ? 489 THR C H    8  
ATOM 6460  H HA   . THR A 1 37 ? -22.640 -10.698 6.544   1.00 0.00 ? 489 THR C HA   8  
ATOM 6461  H HB   . THR A 1 37 ? -20.401 -10.253 8.507   1.00 0.00 ? 489 THR C HB   8  
ATOM 6462  H HG1  . THR A 1 37 ? -21.352 -8.701  6.303   1.00 0.00 ? 489 THR C HG1  8  
ATOM 6463  H HG21 . THR A 1 37 ? -20.402 -10.835 5.541   1.00 0.00 ? 489 THR C HG21 8  
ATOM 6464  H HG22 . THR A 1 37 ? -19.833 -11.914 6.816   1.00 0.00 ? 489 THR C HG22 8  
ATOM 6465  H HG23 . THR A 1 37 ? -18.978 -10.404 6.488   1.00 0.00 ? 489 THR C HG23 8  
ATOM 6466  N N    . THR A 1 38 ? -22.018 -12.478 9.276   1.00 0.00 ? 490 THR C N    8  
ATOM 6467  C CA   . THR A 1 38 ? -21.929 -13.848 9.760   1.00 0.00 ? 490 THR C CA   8  
ATOM 6468  C C    . THR A 1 38 ? -23.240 -14.598 9.493   1.00 0.00 ? 490 THR C C    8  
ATOM 6469  O O    . THR A 1 38 ? -23.234 -15.735 9.008   1.00 0.00 ? 490 THR C O    8  
ATOM 6470  C CB   . THR A 1 38 ? -21.583 -13.903 11.262  1.00 0.00 ? 490 THR C CB   8  
ATOM 6471  O OG1  . THR A 1 38 ? -20.420 -13.094 11.521  1.00 0.00 ? 490 THR C OG1  8  
ATOM 6472  C CG2  . THR A 1 38 ? -21.291 -15.332 11.679  1.00 0.00 ? 490 THR C CG2  8  
ATOM 6473  H H    . THR A 1 38 ? -21.976 -11.739 9.916   1.00 0.00 ? 490 THR C H    8  
ATOM 6474  H HA   . THR A 1 38 ? -21.142 -14.339 9.206   1.00 0.00 ? 490 THR C HA   8  
ATOM 6475  H HB   . THR A 1 38 ? -22.417 -13.527 11.836  1.00 0.00 ? 490 THR C HB   8  
ATOM 6476  H HG1  . THR A 1 38 ? -20.594 -12.180 11.258  1.00 0.00 ? 490 THR C HG1  8  
ATOM 6477  H HG21 . THR A 1 38 ? -20.497 -15.725 11.054  1.00 0.00 ? 490 THR C HG21 8  
ATOM 6478  H HG22 . THR A 1 38 ? -22.179 -15.933 11.552  1.00 0.00 ? 490 THR C HG22 8  
ATOM 6479  H HG23 . THR A 1 38 ? -20.979 -15.353 12.712  1.00 0.00 ? 490 THR C HG23 8  
ATOM 6480  N N    . ASP A 1 39 ? -24.353 -13.940 9.779   1.00 0.00 ? 491 ASP C N    8  
ATOM 6481  C CA   . ASP A 1 39 ? -25.677 -14.508 9.512   1.00 0.00 ? 491 ASP C CA   8  
ATOM 6482  C C    . ASP A 1 39 ? -25.889 -14.581 8.013   1.00 0.00 ? 491 ASP C C    8  
ATOM 6483  O O    . ASP A 1 39 ? -26.473 -15.524 7.497   1.00 0.00 ? 491 ASP C O    8  
ATOM 6484  C CB   . ASP A 1 39 ? -26.762 -13.641 10.157  1.00 0.00 ? 491 ASP C CB   8  
ATOM 6485  C CG   . ASP A 1 39 ? -28.166 -14.134 9.873   1.00 0.00 ? 491 ASP C CG   8  
ATOM 6486  O OD1  . ASP A 1 39 ? -28.474 -15.301 10.198  1.00 0.00 ? 491 ASP C OD1  8  
ATOM 6487  O OD2  . ASP A 1 39 ? -28.975 -13.349 9.341   1.00 0.00 ? 491 ASP C OD2  8  
ATOM 6488  H H    . ASP A 1 39 ? -24.286 -13.042 10.173  1.00 0.00 ? 491 ASP C H    8  
ATOM 6489  H HA   . ASP A 1 39 ? -25.716 -15.507 9.924   1.00 0.00 ? 491 ASP C HA   8  
ATOM 6490  H HB2  . ASP A 1 39 ? -26.620 -13.621 11.223  1.00 0.00 ? 491 ASP C HB2  8  
ATOM 6491  H HB3  . ASP A 1 39 ? -26.673 -12.634 9.774   1.00 0.00 ? 491 ASP C HB3  8  
ATOM 6492  N N    . ASN A 1 40 ? -25.379 -13.571 7.333   1.00 0.00 ? 492 ASN C N    8  
ATOM 6493  C CA   . ASN A 1 40 ? -25.420 -13.472 5.891   1.00 0.00 ? 492 ASN C CA   8  
ATOM 6494  C C    . ASN A 1 40 ? -24.800 -14.718 5.267   1.00 0.00 ? 492 ASN C C    8  
ATOM 6495  O O    . ASN A 1 40 ? -25.387 -15.340 4.385   1.00 0.00 ? 492 ASN C O    8  
ATOM 6496  C CB   . ASN A 1 40 ? -24.668 -12.209 5.437   1.00 0.00 ? 492 ASN C CB   8  
ATOM 6497  C CG   . ASN A 1 40 ? -25.585 -11.121 4.926   1.00 0.00 ? 492 ASN C CG   8  
ATOM 6498  O OD1  . ASN A 1 40 ? -26.694 -11.390 4.444   1.00 0.00 ? 492 ASN C OD1  8  
ATOM 6499  N ND2  . ASN A 1 40 ? -25.122 -9.892  4.998   1.00 0.00 ? 492 ASN C ND2  8  
ATOM 6500  H H    . ASN A 1 40 ? -24.955 -12.843 7.840   1.00 0.00 ? 492 ASN C H    8  
ATOM 6501  H HA   . ASN A 1 40 ? -26.453 -13.383 5.597   1.00 0.00 ? 492 ASN C HA   8  
ATOM 6502  H HB2  . ASN A 1 40 ? -24.155 -11.802 6.297   1.00 0.00 ? 492 ASN C HB2  8  
ATOM 6503  H HB3  . ASN A 1 40 ? -23.938 -12.442 4.682   1.00 0.00 ? 492 ASN C HB3  8  
ATOM 6504  H HD21 . ASN A 1 40 ? -24.220 -9.751  5.365   1.00 0.00 ? 492 ASN C HD21 8  
ATOM 6505  H HD22 . ASN A 1 40 ? -25.684 -9.159  4.677   1.00 0.00 ? 492 ASN C HD22 8  
ATOM 6506  N N    . ILE A 1 41 ? -23.612 -15.081 5.748   1.00 0.00 ? 493 ILE C N    8  
ATOM 6507  C CA   . ILE A 1 41 ? -22.918 -16.288 5.302   1.00 0.00 ? 493 ILE C CA   8  
ATOM 6508  C C    . ILE A 1 41 ? -23.824 -17.502 5.461   1.00 0.00 ? 493 ILE C C    8  
ATOM 6509  O O    . ILE A 1 41 ? -23.999 -18.298 4.535   1.00 0.00 ? 493 ILE C O    8  
ATOM 6510  C CB   . ILE A 1 41 ? -21.642 -16.540 6.143   1.00 0.00 ? 493 ILE C CB   8  
ATOM 6511  C CG1  . ILE A 1 41 ? -20.669 -15.377 6.032   1.00 0.00 ? 493 ILE C CG1  8  
ATOM 6512  C CG2  . ILE A 1 41 ? -20.966 -17.831 5.719   1.00 0.00 ? 493 ILE C CG2  8  
ATOM 6513  C CD1  . ILE A 1 41 ? -19.535 -15.451 7.033   1.00 0.00 ? 493 ILE C CD1  8  
ATOM 6514  H H    . ILE A 1 41 ? -23.180 -14.510 6.426   1.00 0.00 ? 493 ILE C H    8  
ATOM 6515  H HA   . ILE A 1 41 ? -22.640 -16.163 4.265   1.00 0.00 ? 493 ILE C HA   8  
ATOM 6516  H HB   . ILE A 1 41 ? -21.941 -16.645 7.176   1.00 0.00 ? 493 ILE C HB   8  
ATOM 6517  H HG12 . ILE A 1 41 ? -20.245 -15.363 5.042   1.00 0.00 ? 493 ILE C HG12 8  
ATOM 6518  H HG13 . ILE A 1 41 ? -21.205 -14.459 6.202   1.00 0.00 ? 493 ILE C HG13 8  
ATOM 6519  H HG21 . ILE A 1 41 ? -20.730 -17.775 4.667   1.00 0.00 ? 493 ILE C HG21 8  
ATOM 6520  H HG22 . ILE A 1 41 ? -21.629 -18.664 5.901   1.00 0.00 ? 493 ILE C HG22 8  
ATOM 6521  H HG23 . ILE A 1 41 ? -20.056 -17.960 6.286   1.00 0.00 ? 493 ILE C HG23 8  
ATOM 6522  H HD11 . ILE A 1 41 ? -18.948 -16.339 6.855   1.00 0.00 ? 493 ILE C HD11 8  
ATOM 6523  H HD12 . ILE A 1 41 ? -19.945 -15.494 8.030   1.00 0.00 ? 493 ILE C HD12 8  
ATOM 6524  H HD13 . ILE A 1 41 ? -18.910 -14.577 6.943   1.00 0.00 ? 493 ILE C HD13 8  
ATOM 6525  N N    . LEU A 1 42 ? -24.404 -17.611 6.640   1.00 0.00 ? 494 LEU C N    8  
ATOM 6526  C CA   . LEU A 1 42 ? -25.271 -18.717 7.004   1.00 0.00 ? 494 LEU C CA   8  
ATOM 6527  C C    . LEU A 1 42 ? -26.550 -18.746 6.159   1.00 0.00 ? 494 LEU C C    8  
ATOM 6528  O O    . LEU A 1 42 ? -27.080 -19.813 5.861   1.00 0.00 ? 494 LEU C O    8  
ATOM 6529  C CB   . LEU A 1 42 ? -25.589 -18.622 8.493   1.00 0.00 ? 494 LEU C CB   8  
ATOM 6530  C CG   . LEU A 1 42 ? -24.378 -18.788 9.415   1.00 0.00 ? 494 LEU C CG   8  
ATOM 6531  C CD1  . LEU A 1 42 ? -24.699 -18.331 10.824  1.00 0.00 ? 494 LEU C CD1  8  
ATOM 6532  C CD2  . LEU A 1 42 ? -23.908 -20.234 9.419   1.00 0.00 ? 494 LEU C CD2  8  
ATOM 6533  H H    . LEU A 1 42 ? -24.241 -16.908 7.308   1.00 0.00 ? 494 LEU C H    8  
ATOM 6534  H HA   . LEU A 1 42 ? -24.725 -19.631 6.828   1.00 0.00 ? 494 LEU C HA   8  
ATOM 6535  H HB2  . LEU A 1 42 ? -26.028 -17.652 8.680   1.00 0.00 ? 494 LEU C HB2  8  
ATOM 6536  H HB3  . LEU A 1 42 ? -26.312 -19.378 8.746   1.00 0.00 ? 494 LEU C HB3  8  
ATOM 6537  H HG   . LEU A 1 42 ? -23.569 -18.176 9.045   1.00 0.00 ? 494 LEU C HG   8  
ATOM 6538  H HD11 . LEU A 1 42 ? -25.565 -18.862 11.189  1.00 0.00 ? 494 LEU C HD11 8  
ATOM 6539  H HD12 . LEU A 1 42 ? -24.891 -17.267 10.821  1.00 0.00 ? 494 LEU C HD12 8  
ATOM 6540  H HD13 . LEU A 1 42 ? -23.854 -18.538 11.462  1.00 0.00 ? 494 LEU C HD13 8  
ATOM 6541  H HD21 . LEU A 1 42 ? -23.605 -20.521 8.423   1.00 0.00 ? 494 LEU C HD21 8  
ATOM 6542  H HD22 . LEU A 1 42 ? -24.714 -20.874 9.747   1.00 0.00 ? 494 LEU C HD22 8  
ATOM 6543  H HD23 . LEU A 1 42 ? -23.070 -20.338 10.094  1.00 0.00 ? 494 LEU C HD23 8  
ATOM 6544  N N    . GLU A 1 43 ? -27.033 -17.576 5.774   1.00 0.00 ? 495 GLU C N    8  
ATOM 6545  C CA   . GLU A 1 43 ? -28.216 -17.473 4.922   1.00 0.00 ? 495 GLU C CA   8  
ATOM 6546  C C    . GLU A 1 43 ? -27.876 -17.831 3.480   1.00 0.00 ? 495 GLU C C    8  
ATOM 6547  O O    . GLU A 1 43 ? -28.758 -18.123 2.671   1.00 0.00 ? 495 GLU C O    8  
ATOM 6548  C CB   . GLU A 1 43 ? -28.787 -16.061 4.979   1.00 0.00 ? 495 GLU C CB   8  
ATOM 6549  C CG   . GLU A 1 43 ? -29.379 -15.688 6.323   1.00 0.00 ? 495 GLU C CG   8  
ATOM 6550  C CD   . GLU A 1 43 ? -30.628 -16.472 6.646   1.00 0.00 ? 495 GLU C CD   8  
ATOM 6551  O OE1  . GLU A 1 43 ? -31.710 -16.098 6.150   1.00 0.00 ? 495 GLU C OE1  8  
ATOM 6552  O OE2  . GLU A 1 43 ? -30.542 -17.459 7.411   1.00 0.00 ? 495 GLU C OE2  8  
ATOM 6553  H H    . GLU A 1 43 ? -26.595 -16.754 6.090   1.00 0.00 ? 495 GLU C H    8  
ATOM 6554  H HA   . GLU A 1 43 ? -28.956 -18.164 5.293   1.00 0.00 ? 495 GLU C HA   8  
ATOM 6555  H HB2  . GLU A 1 43 ? -27.998 -15.359 4.751   1.00 0.00 ? 495 GLU C HB2  8  
ATOM 6556  H HB3  . GLU A 1 43 ? -29.560 -15.972 4.231   1.00 0.00 ? 495 GLU C HB3  8  
ATOM 6557  H HG2  . GLU A 1 43 ? -28.644 -15.877 7.091   1.00 0.00 ? 495 GLU C HG2  8  
ATOM 6558  H HG3  . GLU A 1 43 ? -29.620 -14.639 6.310   1.00 0.00 ? 495 GLU C HG3  8  
ATOM 6559  N N    . GLY A 1 44 ? -26.593 -17.807 3.166   1.00 0.00 ? 496 GLY C N    8  
ATOM 6560  C CA   . GLY A 1 44 ? -26.152 -18.113 1.826   1.00 0.00 ? 496 GLY C CA   8  
ATOM 6561  C C    . GLY A 1 44 ? -25.893 -16.868 1.014   1.00 0.00 ? 496 GLY C C    8  
ATOM 6562  O O    . GLY A 1 44 ? -25.980 -16.885 -0.212  1.00 0.00 ? 496 GLY C O    8  
ATOM 6563  H H    . GLY A 1 44 ? -25.937 -17.587 3.860   1.00 0.00 ? 496 GLY C H    8  
ATOM 6564  H HA2  . GLY A 1 44 ? -25.242 -18.691 1.881   1.00 0.00 ? 496 GLY C HA2  8  
ATOM 6565  H HA3  . GLY A 1 44 ? -26.908 -18.699 1.333   1.00 0.00 ? 496 GLY C HA3  8  
ATOM 6566  N N    . ARG A 1 45 ? -25.602 -15.777 1.705   1.00 0.00 ? 497 ARG C N    8  
ATOM 6567  C CA   . ARG A 1 45 ? -25.272 -14.519 1.055   1.00 0.00 ? 497 ARG C CA   8  
ATOM 6568  C C    . ARG A 1 45 ? -23.884 -14.622 0.453   1.00 0.00 ? 497 ARG C C    8  
ATOM 6569  O O    . ARG A 1 45 ? -23.611 -14.086 -0.616  1.00 0.00 ? 497 ARG C O    8  
ATOM 6570  C CB   . ARG A 1 45 ? -25.315 -13.380 2.072   1.00 0.00 ? 497 ARG C CB   8  
ATOM 6571  C CG   . ARG A 1 45 ? -25.102 -12.001 1.484   1.00 0.00 ? 497 ARG C CG   8  
ATOM 6572  C CD   . ARG A 1 45 ? -26.308 -11.554 0.696   1.00 0.00 ? 497 ARG C CD   8  
ATOM 6573  N NE   . ARG A 1 45 ? -27.511 -11.491 1.531   1.00 0.00 ? 497 ARG C NE   8  
ATOM 6574  C CZ   . ARG A 1 45 ? -28.759 -11.480 1.055   1.00 0.00 ? 497 ARG C CZ   8  
ATOM 6575  N NH1  . ARG A 1 45 ? -28.975 -11.503 -0.259  1.00 0.00 ? 497 ARG C NH1  8  
ATOM 6576  N NH2  . ARG A 1 45 ? -29.789 -11.440 1.896   1.00 0.00 ? 497 ARG C NH2  8  
ATOM 6577  H H    . ARG A 1 45 ? -25.617 -15.817 2.687   1.00 0.00 ? 497 ARG C H    8  
ATOM 6578  H HA   . ARG A 1 45 ? -25.996 -14.335 0.274   1.00 0.00 ? 497 ARG C HA   8  
ATOM 6579  H HB2  . ARG A 1 45 ? -26.278 -13.389 2.559   1.00 0.00 ? 497 ARG C HB2  8  
ATOM 6580  H HB3  . ARG A 1 45 ? -24.552 -13.548 2.817   1.00 0.00 ? 497 ARG C HB3  8  
ATOM 6581  H HG2  . ARG A 1 45 ? -24.927 -11.301 2.288   1.00 0.00 ? 497 ARG C HG2  8  
ATOM 6582  H HG3  . ARG A 1 45 ? -24.242 -12.028 0.831   1.00 0.00 ? 497 ARG C HG3  8  
ATOM 6583  H HD2  . ARG A 1 45 ? -26.106 -10.576 0.295   1.00 0.00 ? 497 ARG C HD2  8  
ATOM 6584  H HD3  . ARG A 1 45 ? -26.477 -12.251 -0.112  1.00 0.00 ? 497 ARG C HD3  8  
ATOM 6585  H HE   . ARG A 1 45 ? -27.368 -11.460 2.505   1.00 0.00 ? 497 ARG C HE   8  
ATOM 6586  H HH11 . ARG A 1 45 ? -28.205 -11.531 -0.903  1.00 0.00 ? 497 ARG C HH11 8  
ATOM 6587  H HH12 . ARG A 1 45 ? -29.910 -11.495 -0.620  1.00 0.00 ? 497 ARG C HH12 8  
ATOM 6588  H HH21 . ARG A 1 45 ? -29.639 -11.419 2.890   1.00 0.00 ? 497 ARG C HH21 8  
ATOM 6589  H HH22 . ARG A 1 45 ? -30.733 -11.442 1.555   1.00 0.00 ? 497 ARG C HH22 8  
ATOM 6590  N N    . ILE A 1 46 ? -23.015 -15.317 1.162   1.00 0.00 ? 498 ILE C N    8  
ATOM 6591  C CA   . ILE A 1 46 ? -21.664 -15.550 0.714   1.00 0.00 ? 498 ILE C CA   8  
ATOM 6592  C C    . ILE A 1 46 ? -21.565 -16.958 0.140   1.00 0.00 ? 498 ILE C C    8  
ATOM 6593  O O    . ILE A 1 46 ? -21.549 -17.943 0.881   1.00 0.00 ? 498 ILE C O    8  
ATOM 6594  C CB   . ILE A 1 46 ? -20.619 -15.370 1.868   1.00 0.00 ? 498 ILE C CB   8  
ATOM 6595  C CG1  . ILE A 1 46 ? -20.499 -13.892 2.305   1.00 0.00 ? 498 ILE C CG1  8  
ATOM 6596  C CG2  . ILE A 1 46 ? -19.250 -15.902 1.452   1.00 0.00 ? 498 ILE C CG2  8  
ATOM 6597  C CD1  . ILE A 1 46 ? -21.698 -13.350 3.056   1.00 0.00 ? 498 ILE C CD1  8  
ATOM 6598  H H    . ILE A 1 46 ? -23.298 -15.698 2.019   1.00 0.00 ? 498 ILE C H    8  
ATOM 6599  H HA   . ILE A 1 46 ? -21.446 -14.835 -0.067  1.00 0.00 ? 498 ILE C HA   8  
ATOM 6600  H HB   . ILE A 1 46 ? -20.954 -15.956 2.711   1.00 0.00 ? 498 ILE C HB   8  
ATOM 6601  H HG12 . ILE A 1 46 ? -19.648 -13.792 2.956   1.00 0.00 ? 498 ILE C HG12 8  
ATOM 6602  H HG13 . ILE A 1 46 ? -20.349 -13.277 1.430   1.00 0.00 ? 498 ILE C HG13 8  
ATOM 6603  H HG21 . ILE A 1 46 ? -18.909 -15.373 0.576   1.00 0.00 ? 498 ILE C HG21 8  
ATOM 6604  H HG22 . ILE A 1 46 ? -19.325 -16.957 1.229   1.00 0.00 ? 498 ILE C HG22 8  
ATOM 6605  H HG23 . ILE A 1 46 ? -18.546 -15.753 2.258   1.00 0.00 ? 498 ILE C HG23 8  
ATOM 6606  H HD11 . ILE A 1 46 ? -21.865 -13.939 3.945   1.00 0.00 ? 498 ILE C HD11 8  
ATOM 6607  H HD12 . ILE A 1 46 ? -22.569 -13.399 2.421   1.00 0.00 ? 498 ILE C HD12 8  
ATOM 6608  H HD13 . ILE A 1 46 ? -21.513 -12.322 3.335   1.00 0.00 ? 498 ILE C HD13 8  
ATOM 6609  N N    . GLN A 1 47 ? -21.545 -17.046 -1.173  1.00 0.00 ? 499 GLN C N    8  
ATOM 6610  C CA   . GLN A 1 47 ? -21.453 -18.326 -1.852  1.00 0.00 ? 499 GLN C CA   8  
ATOM 6611  C C    . GLN A 1 47 ? -19.994 -18.722 -2.033  1.00 0.00 ? 499 GLN C C    8  
ATOM 6612  O O    . GLN A 1 47 ? -19.214 -17.984 -2.634  1.00 0.00 ? 499 GLN C O    8  
ATOM 6613  C CB   . GLN A 1 47 ? -22.163 -18.258 -3.212  1.00 0.00 ? 499 GLN C CB   8  
ATOM 6614  C CG   . GLN A 1 47 ? -22.052 -19.529 -4.048  1.00 0.00 ? 499 GLN C CG   8  
ATOM 6615  C CD   . GLN A 1 47 ? -22.703 -20.738 -3.395  1.00 0.00 ? 499 GLN C CD   8  
ATOM 6616  O OE1  . GLN A 1 47 ? -23.679 -20.613 -2.651  1.00 0.00 ? 499 GLN C OE1  8  
ATOM 6617  N NE2  . GLN A 1 47 ? -22.178 -21.913 -3.678  1.00 0.00 ? 499 GLN C NE2  8  
ATOM 6618  H H    . GLN A 1 47 ? -21.593 -16.222 -1.705  1.00 0.00 ? 499 GLN C H    8  
ATOM 6619  H HA   . GLN A 1 47 ? -21.942 -19.065 -1.237  1.00 0.00 ? 499 GLN C HA   8  
ATOM 6620  H HB2  . GLN A 1 47 ? -23.211 -18.060 -3.044  1.00 0.00 ? 499 GLN C HB2  8  
ATOM 6621  H HB3  . GLN A 1 47 ? -21.743 -17.441 -3.782  1.00 0.00 ? 499 GLN C HB3  8  
ATOM 6622  H HG2  . GLN A 1 47 ? -22.525 -19.359 -5.002  1.00 0.00 ? 499 GLN C HG2  8  
ATOM 6623  H HG3  . GLN A 1 47 ? -21.004 -19.743 -4.202  1.00 0.00 ? 499 GLN C HG3  8  
ATOM 6624  H HE21 . GLN A 1 47 ? -21.407 -21.939 -4.289  1.00 0.00 ? 499 GLN C HE21 8  
ATOM 6625  H HE22 . GLN A 1 47 ? -22.571 -22.715 -3.269  1.00 0.00 ? 499 GLN C HE22 8  
ATOM 6626  N N    . VAL A 1 48 ? -19.628 -19.873 -1.501  1.00 0.00 ? 500 VAL C N    8  
ATOM 6627  C CA   . VAL A 1 48 ? -18.262 -20.362 -1.604  1.00 0.00 ? 500 VAL C CA   8  
ATOM 6628  C C    . VAL A 1 48 ? -17.962 -20.847 -3.027  1.00 0.00 ? 500 VAL C C    8  
ATOM 6629  O O    . VAL A 1 48 ? -18.619 -21.762 -3.526  1.00 0.00 ? 500 VAL C O    8  
ATOM 6630  C CB   . VAL A 1 48 ? -18.003 -21.523 -0.610  1.00 0.00 ? 500 VAL C CB   8  
ATOM 6631  C CG1  . VAL A 1 48 ? -16.562 -22.009 -0.707  1.00 0.00 ? 500 VAL C CG1  8  
ATOM 6632  C CG2  . VAL A 1 48 ? -18.324 -21.091 0.811   1.00 0.00 ? 500 VAL C CG2  8  
ATOM 6633  H H    . VAL A 1 48 ? -20.295 -20.410 -1.020  1.00 0.00 ? 500 VAL C H    8  
ATOM 6634  H HA   . VAL A 1 48 ? -17.596 -19.549 -1.357  1.00 0.00 ? 500 VAL C HA   8  
ATOM 6635  H HB   . VAL A 1 48 ? -18.653 -22.345 -0.873  1.00 0.00 ? 500 VAL C HB   8  
ATOM 6636  H HG11 . VAL A 1 48 ? -15.891 -21.199 -0.462  1.00 0.00 ? 500 VAL C HG11 8  
ATOM 6637  H HG12 . VAL A 1 48 ? -16.364 -22.347 -1.713  1.00 0.00 ? 500 VAL C HG12 8  
ATOM 6638  H HG13 . VAL A 1 48 ? -16.409 -22.825 -0.016  1.00 0.00 ? 500 VAL C HG13 8  
ATOM 6639  H HG21 . VAL A 1 48 ? -19.362 -20.800 0.874   1.00 0.00 ? 500 VAL C HG21 8  
ATOM 6640  H HG22 . VAL A 1 48 ? -17.700 -20.253 1.084   1.00 0.00 ? 500 VAL C HG22 8  
ATOM 6641  H HG23 . VAL A 1 48 ? -18.139 -21.912 1.489   1.00 0.00 ? 500 VAL C HG23 8  
ATOM 6642  N N    . PRO A 1 49 ? -16.987 -20.221 -3.712  1.00 0.00 ? 501 PRO C N    8  
ATOM 6643  C CA   . PRO A 1 49 ? -16.582 -20.632 -5.050  1.00 0.00 ? 501 PRO C CA   8  
ATOM 6644  C C    . PRO A 1 49 ? -15.851 -21.966 -5.016  1.00 0.00 ? 501 PRO C C    8  
ATOM 6645  O O    . PRO A 1 49 ? -14.677 -22.043 -4.638  1.00 0.00 ? 501 PRO C O    8  
ATOM 6646  C CB   . PRO A 1 49 ? -15.630 -19.514 -5.517  1.00 0.00 ? 501 PRO C CB   8  
ATOM 6647  C CG   . PRO A 1 49 ? -15.808 -18.410 -4.531  1.00 0.00 ? 501 PRO C CG   8  
ATOM 6648  C CD   . PRO A 1 49 ? -16.222 -19.067 -3.252  1.00 0.00 ? 501 PRO C CD   8  
ATOM 6649  H HA   . PRO A 1 49 ? -17.429 -20.699 -5.716  1.00 0.00 ? 501 PRO C HA   8  
ATOM 6650  H HB2  . PRO A 1 49 ? -14.615 -19.882 -5.517  1.00 0.00 ? 501 PRO C HB2  8  
ATOM 6651  H HB3  . PRO A 1 49 ? -15.902 -19.199 -6.513  1.00 0.00 ? 501 PRO C HB3  8  
ATOM 6652  H HG2  . PRO A 1 49 ? -14.876 -17.882 -4.397  1.00 0.00 ? 501 PRO C HG2  8  
ATOM 6653  H HG3  . PRO A 1 49 ? -16.579 -17.735 -4.871  1.00 0.00 ? 501 PRO C HG3  8  
ATOM 6654  H HD2  . PRO A 1 49 ? -15.356 -19.377 -2.686  1.00 0.00 ? 501 PRO C HD2  8  
ATOM 6655  H HD3  . PRO A 1 49 ? -16.841 -18.398 -2.671  1.00 0.00 ? 501 PRO C HD3  8  
ATOM 6656  N N    . PHE A 1 50 ? -16.546 -23.008 -5.393  1.00 0.00 ? 502 PHE C N    8  
ATOM 6657  C CA   . PHE A 1 50 ? -15.991 -24.343 -5.400  1.00 0.00 ? 502 PHE C CA   8  
ATOM 6658  C C    . PHE A 1 50 ? -15.810 -24.821 -6.830  1.00 0.00 ? 502 PHE C C    8  
ATOM 6659  O O    . PHE A 1 50 ? -16.487 -24.324 -7.734  1.00 0.00 ? 502 PHE C O    8  
ATOM 6660  C CB   . PHE A 1 50 ? -16.910 -25.301 -4.616  1.00 0.00 ? 502 PHE C CB   8  
ATOM 6661  C CG   . PHE A 1 50 ? -18.298 -25.431 -5.185  1.00 0.00 ? 502 PHE C CG   8  
ATOM 6662  C CD1  . PHE A 1 50 ? -18.549 -26.317 -6.209  1.00 0.00 ? 502 PHE C CD1  8  
ATOM 6663  C CD2  . PHE A 1 50 ? -19.344 -24.670 -4.689  1.00 0.00 ? 502 PHE C CD2  8  
ATOM 6664  C CE1  . PHE A 1 50 ? -19.817 -26.449 -6.740  1.00 0.00 ? 502 PHE C CE1  8  
ATOM 6665  C CE2  . PHE A 1 50 ? -20.617 -24.794 -5.214  1.00 0.00 ? 502 PHE C CE2  8  
ATOM 6666  C CZ   . PHE A 1 50 ? -20.852 -25.686 -6.242  1.00 0.00 ? 502 PHE C CZ   8  
ATOM 6667  H H    . PHE A 1 50 ? -17.472 -22.876 -5.691  1.00 0.00 ? 502 PHE C H    8  
ATOM 6668  H HA   . PHE A 1 50 ? -15.028 -24.314 -4.922  1.00 0.00 ? 502 PHE C HA   8  
ATOM 6669  H HB2  . PHE A 1 50 ? -16.466 -26.285 -4.610  1.00 0.00 ? 502 PHE C HB2  8  
ATOM 6670  H HB3  . PHE A 1 50 ? -16.996 -24.947 -3.598  1.00 0.00 ? 502 PHE C HB3  8  
ATOM 6671  H HD1  . PHE A 1 50 ? -17.730 -26.906 -6.593  1.00 0.00 ? 502 PHE C HD1  8  
ATOM 6672  H HD2  . PHE A 1 50 ? -19.158 -23.972 -3.885  1.00 0.00 ? 502 PHE C HD2  8  
ATOM 6673  H HE1  . PHE A 1 50 ? -19.998 -27.149 -7.543  1.00 0.00 ? 502 PHE C HE1  8  
ATOM 6674  H HE2  . PHE A 1 50 ? -21.425 -24.194 -4.822  1.00 0.00 ? 502 PHE C HE2  8  
ATOM 6675  H HZ   . PHE A 1 50 ? -21.844 -25.787 -6.656  1.00 0.00 ? 502 PHE C HZ   8  
ATOM 6676  N N    . PRO A 1 51 ? -14.871 -25.765 -7.066  1.00 0.00 ? 503 PRO C N    8  
ATOM 6677  C CA   . PRO A 1 51 ? -14.658 -26.340 -8.398  1.00 0.00 ? 503 PRO C CA   8  
ATOM 6678  C C    . PRO A 1 51 ? -15.964 -26.866 -8.978  1.00 0.00 ? 503 PRO C C    8  
ATOM 6679  O O    . PRO A 1 51 ? -16.625 -27.723 -8.379  1.00 0.00 ? 503 PRO C O    8  
ATOM 6680  C CB   . PRO A 1 51 ? -13.690 -27.496 -8.131  1.00 0.00 ? 503 PRO C CB   8  
ATOM 6681  C CG   . PRO A 1 51 ? -12.953 -27.088 -6.905  1.00 0.00 ? 503 PRO C CG   8  
ATOM 6682  C CD   . PRO A 1 51 ? -13.937 -26.322 -6.068  1.00 0.00 ? 503 PRO C CD   8  
ATOM 6683  H HA   . PRO A 1 51 ? -14.212 -25.627 -9.078  1.00 0.00 ? 503 PRO C HA   8  
ATOM 6684  H HB2  . PRO A 1 51 ? -14.249 -28.406 -7.974  1.00 0.00 ? 503 PRO C HB2  8  
ATOM 6685  H HB3  . PRO A 1 51 ? -13.023 -27.616 -8.971  1.00 0.00 ? 503 PRO C HB3  8  
ATOM 6686  H HG2  . PRO A 1 51 ? -12.608 -27.963 -6.375  1.00 0.00 ? 503 PRO C HG2  8  
ATOM 6687  H HG3  . PRO A 1 51 ? -12.119 -26.456 -7.173  1.00 0.00 ? 503 PRO C HG3  8  
ATOM 6688  H HD2  . PRO A 1 51 ? -14.450 -26.982 -5.385  1.00 0.00 ? 503 PRO C HD2  8  
ATOM 6689  H HD3  . PRO A 1 51 ? -13.437 -25.532 -5.528  1.00 0.00 ? 503 PRO C HD3  8  
ATOM 6690  N N    . THR A 1 52 ? -16.330 -26.357 -10.130 1.00 0.00 ? 504 THR C N    8  
ATOM 6691  C CA   . THR A 1 52 ? -17.575 -26.718 -10.750 1.00 0.00 ? 504 THR C CA   8  
ATOM 6692  C C    . THR A 1 52 ? -17.435 -26.715 -12.272 1.00 0.00 ? 504 THR C C    8  
ATOM 6693  O O    . THR A 1 52 ? -17.803 -27.726 -12.904 1.00 0.00 ? 504 THR C O    8  
ATOM 6694  C CB   . THR A 1 52 ? -18.726 -25.767 -10.283 1.00 0.00 ? 504 THR C CB   8  
ATOM 6695  O OG1  . THR A 1 52 ? -19.956 -26.086 -10.939 1.00 0.00 ? 504 THR C OG1  8  
ATOM 6696  C CG2  . THR A 1 52 ? -18.376 -24.306 -10.529 1.00 0.00 ? 504 THR C CG2  8  
ATOM 6697  O OXT  . THR A 1 52 ? -16.899 -25.726 -12.829 1.00 0.00 ? 504 THR C OXT  8  
ATOM 6698  H H    . THR A 1 52 ? -15.745 -25.713 -10.581 1.00 0.00 ? 504 THR C H    8  
ATOM 6699  H HA   . THR A 1 52 ? -17.816 -27.720 -10.430 1.00 0.00 ? 504 THR C HA   8  
ATOM 6700  H HB   . THR A 1 52 ? -18.862 -25.910 -9.220  1.00 0.00 ? 504 THR C HB   8  
ATOM 6701  H HG1  . THR A 1 52 ? -20.238 -26.971 -10.674 1.00 0.00 ? 504 THR C HG1  8  
ATOM 6702  H HG21 . THR A 1 52 ? -18.187 -24.154 -11.582 1.00 0.00 ? 504 THR C HG21 8  
ATOM 6703  H HG22 . THR A 1 52 ? -17.494 -24.045 -9.963  1.00 0.00 ? 504 THR C HG22 8  
ATOM 6704  H HG23 . THR A 1 52 ? -19.201 -23.681 -10.218 1.00 0.00 ? 504 THR C HG23 8  
ATOM 6705  N N    . SER A 1 1  ? -6.098  -0.536  3.369   1.00 0.00 ? 453 SER C N    9  
ATOM 6706  C CA   . SER A 1 1  ? -7.214  -1.267  2.740   1.00 0.00 ? 453 SER C CA   9  
ATOM 6707  C C    . SER A 1 1  ? -8.298  -1.597  3.765   1.00 0.00 ? 453 SER C C    9  
ATOM 6708  O O    . SER A 1 1  ? -8.557  -2.769  4.044   1.00 0.00 ? 453 SER C O    9  
ATOM 6709  C CB   . SER A 1 1  ? -6.699  -2.557  2.098   1.00 0.00 ? 453 SER C CB   9  
ATOM 6710  O OG   . SER A 1 1  ? -5.643  -2.292  1.189   1.00 0.00 ? 453 SER C OG   9  
ATOM 6711  H H1   . SER A 1 1  ? -5.694  -1.098  4.144   1.00 0.00 ? 453 SER C H1   9  
ATOM 6712  H H2   . SER A 1 1  ? -6.427  0.374   3.747   1.00 0.00 ? 453 SER C H2   9  
ATOM 6713  H H3   . SER A 1 1  ? -5.353  -0.358  2.666   1.00 0.00 ? 453 SER C H3   9  
ATOM 6714  H HA   . SER A 1 1  ? -7.640  -0.637  1.974   1.00 0.00 ? 453 SER C HA   9  
ATOM 6715  H HB2  . SER A 1 1  ? -6.334  -3.219  2.868   1.00 0.00 ? 453 SER C HB2  9  
ATOM 6716  H HB3  . SER A 1 1  ? -7.506  -3.037  1.564   1.00 0.00 ? 453 SER C HB3  9  
ATOM 6717  H HG   . SER A 1 1  ? -5.809  -1.458  0.727   1.00 0.00 ? 453 SER C HG   9  
ATOM 6718  N N    . ASN A 1 2  ? -8.919  -0.554  4.323   1.00 0.00 ? 454 ASN C N    9  
ATOM 6719  C CA   . ASN A 1 2  ? -9.992  -0.700  5.321   1.00 0.00 ? 454 ASN C CA   9  
ATOM 6720  C C    . ASN A 1 2  ? -9.566  -1.605  6.473   1.00 0.00 ? 454 ASN C C    9  
ATOM 6721  O O    . ASN A 1 2  ? -9.946  -2.778  6.536   1.00 0.00 ? 454 ASN C O    9  
ATOM 6722  C CB   . ASN A 1 2  ? -11.288 -1.219  4.676   1.00 0.00 ? 454 ASN C CB   9  
ATOM 6723  C CG   . ASN A 1 2  ? -11.830 -0.288  3.604   1.00 0.00 ? 454 ASN C CG   9  
ATOM 6724  O OD1  . ASN A 1 2  ? -12.575 0.647   3.893   1.00 0.00 ? 454 ASN C OD1  9  
ATOM 6725  N ND2  . ASN A 1 2  ? -11.470 -0.542  2.362   1.00 0.00 ? 454 ASN C ND2  9  
ATOM 6726  H H    . ASN A 1 2  ? -8.651  0.353   4.058   1.00 0.00 ? 454 ASN C H    9  
ATOM 6727  H HA   . ASN A 1 2  ? -10.179 0.285   5.722   1.00 0.00 ? 454 ASN C HA   9  
ATOM 6728  H HB2  . ASN A 1 2  ? -11.096 -2.180  4.225   1.00 0.00 ? 454 ASN C HB2  9  
ATOM 6729  H HB3  . ASN A 1 2  ? -12.040 -1.333  5.444   1.00 0.00 ? 454 ASN C HB3  9  
ATOM 6730  H HD21 . ASN A 1 2  ? -10.879 -1.306  2.194   1.00 0.00 ? 454 ASN C HD21 9  
ATOM 6731  H HD22 . ASN A 1 2  ? -11.813 0.039   1.652   1.00 0.00 ? 454 ASN C HD22 9  
ATOM 6732  N N    . SER A 1 3  ? -8.772  -1.054  7.377   1.00 0.00 ? 455 SER C N    9  
ATOM 6733  C CA   . SER A 1 3  ? -8.238  -1.799  8.506   1.00 0.00 ? 455 SER C CA   9  
ATOM 6734  C C    . SER A 1 3  ? -9.348  -2.349  9.414   1.00 0.00 ? 455 SER C C    9  
ATOM 6735  O O    . SER A 1 3  ? -9.278  -3.498  9.867   1.00 0.00 ? 455 SER C O    9  
ATOM 6736  C CB   . SER A 1 3  ? -7.295  -0.906  9.307   1.00 0.00 ? 455 SER C CB   9  
ATOM 6737  O OG   . SER A 1 3  ? -6.329  -0.302  8.455   1.00 0.00 ? 455 SER C OG   9  
ATOM 6738  H H    . SER A 1 3  ? -8.530  -0.108  7.285   1.00 0.00 ? 455 SER C H    9  
ATOM 6739  H HA   . SER A 1 3  ? -7.669  -2.626  8.112   1.00 0.00 ? 455 SER C HA   9  
ATOM 6740  H HB2  . SER A 1 3  ? -7.864  -0.128  9.794   1.00 0.00 ? 455 SER C HB2  9  
ATOM 6741  H HB3  . SER A 1 3  ? -6.781  -1.498  10.048  1.00 0.00 ? 455 SER C HB3  9  
ATOM 6742  H HG   . SER A 1 3  ? -5.808  0.323   8.972   1.00 0.00 ? 455 SER C HG   9  
ATOM 6743  N N    . GLN A 1 4  ? -10.377 -1.542  9.649   1.00 0.00 ? 456 GLN C N    9  
ATOM 6744  C CA   . GLN A 1 4  ? -11.474 -1.929  10.533  1.00 0.00 ? 456 GLN C CA   9  
ATOM 6745  C C    . GLN A 1 4  ? -12.279 -3.077  9.914   1.00 0.00 ? 456 GLN C C    9  
ATOM 6746  O O    . GLN A 1 4  ? -12.562 -4.078  10.579  1.00 0.00 ? 456 GLN C O    9  
ATOM 6747  C CB   . GLN A 1 4  ? -12.374 -0.706  10.820  1.00 0.00 ? 456 GLN C CB   9  
ATOM 6748  C CG   . GLN A 1 4  ? -13.280 -0.837  12.048  1.00 0.00 ? 456 GLN C CG   9  
ATOM 6749  C CD   . GLN A 1 4  ? -14.494 -1.715  11.815  1.00 0.00 ? 456 GLN C CD   9  
ATOM 6750  O OE1  . GLN A 1 4  ? -15.002 -1.807  10.701  1.00 0.00 ? 456 GLN C OE1  9  
ATOM 6751  N NE2  . GLN A 1 4  ? -14.978 -2.346  12.865  1.00 0.00 ? 456 GLN C NE2  9  
ATOM 6752  H H    . GLN A 1 4  ? -10.407 -0.665  9.209   1.00 0.00 ? 456 GLN C H    9  
ATOM 6753  H HA   . GLN A 1 4  ? -11.042 -2.271  11.461  1.00 0.00 ? 456 GLN C HA   9  
ATOM 6754  H HB2  . GLN A 1 4  ? -11.743 0.159   10.963  1.00 0.00 ? 456 GLN C HB2  9  
ATOM 6755  H HB3  . GLN A 1 4  ? -13.001 -0.535  9.958   1.00 0.00 ? 456 GLN C HB3  9  
ATOM 6756  H HG2  . GLN A 1 4  ? -12.704 -1.264  12.857  1.00 0.00 ? 456 GLN C HG2  9  
ATOM 6757  H HG3  . GLN A 1 4  ? -13.614 0.149   12.333  1.00 0.00 ? 456 GLN C HG3  9  
ATOM 6758  H HE21 . GLN A 1 4  ? -14.537 -2.212  13.731  1.00 0.00 ? 456 GLN C HE21 9  
ATOM 6759  H HE22 . GLN A 1 4  ? -15.757 -2.926  12.740  1.00 0.00 ? 456 GLN C HE22 9  
ATOM 6760  N N    . LEU A 1 5  ? -12.618 -2.938  8.637   1.00 0.00 ? 457 LEU C N    9  
ATOM 6761  C CA   . LEU A 1 5  ? -13.385 -3.967  7.934   1.00 0.00 ? 457 LEU C CA   9  
ATOM 6762  C C    . LEU A 1 5  ? -12.574 -5.248  7.817   1.00 0.00 ? 457 LEU C C    9  
ATOM 6763  O O    . LEU A 1 5  ? -13.099 -6.349  8.004   1.00 0.00 ? 457 LEU C O    9  
ATOM 6764  C CB   . LEU A 1 5  ? -13.791 -3.490  6.533   1.00 0.00 ? 457 LEU C CB   9  
ATOM 6765  C CG   . LEU A 1 5  ? -14.578 -2.179  6.459   1.00 0.00 ? 457 LEU C CG   9  
ATOM 6766  C CD1  . LEU A 1 5  ? -15.021 -1.912  5.037   1.00 0.00 ? 457 LEU C CD1  9  
ATOM 6767  C CD2  . LEU A 1 5  ? -15.774 -2.207  7.389   1.00 0.00 ? 457 LEU C CD2  9  
ATOM 6768  H H    . LEU A 1 5  ? -12.352 -2.123  8.158   1.00 0.00 ? 457 LEU C H    9  
ATOM 6769  H HA   . LEU A 1 5  ? -14.276 -4.173  8.508   1.00 0.00 ? 457 LEU C HA   9  
ATOM 6770  H HB2  . LEU A 1 5  ? -12.892 -3.374  5.948   1.00 0.00 ? 457 LEU C HB2  9  
ATOM 6771  H HB3  . LEU A 1 5  ? -14.390 -4.266  6.079   1.00 0.00 ? 457 LEU C HB3  9  
ATOM 6772  H HG   . LEU A 1 5  ? -13.933 -1.367  6.762   1.00 0.00 ? 457 LEU C HG   9  
ATOM 6773  H HD11 . LEU A 1 5  ? -15.648 -2.725  4.702   1.00 0.00 ? 457 LEU C HD11 9  
ATOM 6774  H HD12 . LEU A 1 5  ? -14.155 -1.836  4.397   1.00 0.00 ? 457 LEU C HD12 9  
ATOM 6775  H HD13 . LEU A 1 5  ? -15.580 -0.990  5.001   1.00 0.00 ? 457 LEU C HD13 9  
ATOM 6776  H HD21 . LEU A 1 5  ? -16.359 -1.309  7.251   1.00 0.00 ? 457 LEU C HD21 9  
ATOM 6777  H HD22 . LEU A 1 5  ? -15.426 -2.253  8.410   1.00 0.00 ? 457 LEU C HD22 9  
ATOM 6778  H HD23 . LEU A 1 5  ? -16.382 -3.072  7.171   1.00 0.00 ? 457 LEU C HD23 9  
ATOM 6779  N N    . ASN A 1 6  ? -11.291 -5.093  7.516   1.00 0.00 ? 458 ASN C N    9  
ATOM 6780  C CA   . ASN A 1 6  ? -10.390 -6.228  7.364   1.00 0.00 ? 458 ASN C CA   9  
ATOM 6781  C C    . ASN A 1 6  ? -10.288 -7.011  8.665   1.00 0.00 ? 458 ASN C C    9  
ATOM 6782  O O    . ASN A 1 6  ? -10.245 -8.241  8.656   1.00 0.00 ? 458 ASN C O    9  
ATOM 6783  C CB   . ASN A 1 6  ? -9.000  -5.753  6.932   1.00 0.00 ? 458 ASN C CB   9  
ATOM 6784  C CG   . ASN A 1 6  ? -8.077  -6.897  6.557   1.00 0.00 ? 458 ASN C CG   9  
ATOM 6785  O OD1  . ASN A 1 6  ? -7.367  -7.446  7.405   1.00 0.00 ? 458 ASN C OD1  9  
ATOM 6786  N ND2  . ASN A 1 6  ? -8.071  -7.255  5.287   1.00 0.00 ? 458 ASN C ND2  9  
ATOM 6787  H H    . ASN A 1 6  ? -10.938 -4.184  7.384   1.00 0.00 ? 458 ASN C H    9  
ATOM 6788  H HA   . ASN A 1 6  ? -10.793 -6.873  6.600   1.00 0.00 ? 458 ASN C HA   9  
ATOM 6789  H HB2  . ASN A 1 6  ? -9.098  -5.101  6.077   1.00 0.00 ? 458 ASN C HB2  9  
ATOM 6790  H HB3  . ASN A 1 6  ? -8.550  -5.205  7.745   1.00 0.00 ? 458 ASN C HB3  9  
ATOM 6791  H HD21 . ASN A 1 6  ? -8.656  -6.769  4.662   1.00 0.00 ? 458 ASN C HD21 9  
ATOM 6792  H HD22 . ASN A 1 6  ? -7.484  -7.992  5.007   1.00 0.00 ? 458 ASN C HD22 9  
ATOM 6793  N N    . ALA A 1 7  ? -10.263 -6.288  9.779   1.00 0.00 ? 459 ALA C N    9  
ATOM 6794  C CA   . ALA A 1 7  ? -10.181 -6.906  11.094  1.00 0.00 ? 459 ALA C CA   9  
ATOM 6795  C C    . ALA A 1 7  ? -11.430 -7.723  11.390  1.00 0.00 ? 459 ALA C C    9  
ATOM 6796  O O    . ALA A 1 7  ? -11.344 -8.843  11.895  1.00 0.00 ? 459 ALA C O    9  
ATOM 6797  C CB   . ALA A 1 7  ? -9.971  -5.848  12.169  1.00 0.00 ? 459 ALA C CB   9  
ATOM 6798  H H    . ALA A 1 7  ? -10.301 -5.309  9.715   1.00 0.00 ? 459 ALA C H    9  
ATOM 6799  H HA   . ALA A 1 7  ? -9.325  -7.566  11.096  1.00 0.00 ? 459 ALA C HA   9  
ATOM 6800  H HB1  . ALA A 1 7  ? -9.863  -6.328  13.130  1.00 0.00 ? 459 ALA C HB1  9  
ATOM 6801  H HB2  . ALA A 1 7  ? -10.824 -5.185  12.193  1.00 0.00 ? 459 ALA C HB2  9  
ATOM 6802  H HB3  . ALA A 1 7  ? -9.080  -5.279  11.947  1.00 0.00 ? 459 ALA C HB3  9  
ATOM 6803  N N    . MET A 1 8  ? -12.594 -7.168  11.060  1.00 0.00 ? 460 MET C N    9  
ATOM 6804  C CA   . MET A 1 8  ? -13.854 -7.866  11.280  1.00 0.00 ? 460 MET C CA   9  
ATOM 6805  C C    . MET A 1 8  ? -13.912 -9.138  10.448  1.00 0.00 ? 460 MET C C    9  
ATOM 6806  O O    . MET A 1 8  ? -14.245 -10.208 10.957  1.00 0.00 ? 460 MET C O    9  
ATOM 6807  C CB   . MET A 1 8  ? -15.052 -6.962  10.961  1.00 0.00 ? 460 MET C CB   9  
ATOM 6808  C CG   . MET A 1 8  ? -15.114 -5.702  11.808  1.00 0.00 ? 460 MET C CG   9  
ATOM 6809  S SD   . MET A 1 8  ? -16.703 -4.861  11.688  1.00 0.00 ? 460 MET C SD   9  
ATOM 6810  C CE   . MET A 1 8  ? -16.687 -4.383  9.973   1.00 0.00 ? 460 MET C CE   9  
ATOM 6811  H H    . MET A 1 8  ? -12.607 -6.268  10.667  1.00 0.00 ? 460 MET C H    9  
ATOM 6812  H HA   . MET A 1 8  ? -13.893 -8.140  12.324  1.00 0.00 ? 460 MET C HA   9  
ATOM 6813  H HB2  . MET A 1 8  ? -15.011 -6.671  9.924   1.00 0.00 ? 460 MET C HB2  9  
ATOM 6814  H HB3  . MET A 1 8  ? -15.959 -7.520  11.119  1.00 0.00 ? 460 MET C HB3  9  
ATOM 6815  H HG2  . MET A 1 8  ? -14.933 -5.958  12.839  1.00 0.00 ? 460 MET C HG2  9  
ATOM 6816  H HG3  . MET A 1 8  ? -14.346 -5.022  11.464  1.00 0.00 ? 460 MET C HG3  9  
ATOM 6817  H HE1  . MET A 1 8  ? -16.570 -5.260  9.350   1.00 0.00 ? 460 MET C HE1  9  
ATOM 6818  H HE2  . MET A 1 8  ? -15.860 -3.714  9.805   1.00 0.00 ? 460 MET C HE2  9  
ATOM 6819  H HE3  . MET A 1 8  ? -17.613 -3.887  9.726   1.00 0.00 ? 460 MET C HE3  9  
ATOM 6820  N N    . ALA A 1 9  ? -13.563 -9.020  9.170   1.00 0.00 ? 461 ALA C N    9  
ATOM 6821  C CA   . ALA A 1 9  ? -13.547 -10.164 8.267   1.00 0.00 ? 461 ALA C CA   9  
ATOM 6822  C C    . ALA A 1 9  ? -12.551 -11.217 8.745   1.00 0.00 ? 461 ALA C C    9  
ATOM 6823  O O    . ALA A 1 9  ? -12.773 -12.418 8.589   1.00 0.00 ? 461 ALA C O    9  
ATOM 6824  C CB   . ALA A 1 9  ? -13.201 -9.715  6.859   1.00 0.00 ? 461 ALA C CB   9  
ATOM 6825  H H    . ALA A 1 9  ? -13.312 -8.134  8.821   1.00 0.00 ? 461 ALA C H    9  
ATOM 6826  H HA   . ALA A 1 9  ? -14.538 -10.595 8.255   1.00 0.00 ? 461 ALA C HA   9  
ATOM 6827  H HB1  . ALA A 1 9  ? -13.237 -10.562 6.191   1.00 0.00 ? 461 ALA C HB1  9  
ATOM 6828  H HB2  . ALA A 1 9  ? -12.207 -9.292  6.851   1.00 0.00 ? 461 ALA C HB2  9  
ATOM 6829  H HB3  . ALA A 1 9  ? -13.914 -8.970  6.534   1.00 0.00 ? 461 ALA C HB3  9  
ATOM 6830  N N    . HIS A 1 10 ? -11.462 -10.749 9.341   1.00 0.00 ? 462 HIS C N    9  
ATOM 6831  C CA   . HIS A 1 10 ? -10.424 -11.622 9.868   1.00 0.00 ? 462 HIS C CA   9  
ATOM 6832  C C    . HIS A 1 10 ? -10.994 -12.523 10.948  1.00 0.00 ? 462 HIS C C    9  
ATOM 6833  O O    . HIS A 1 10 ? -10.655 -13.699 11.025  1.00 0.00 ? 462 HIS C O    9  
ATOM 6834  C CB   . HIS A 1 10 ? -9.279  -10.785 10.447  1.00 0.00 ? 462 HIS C CB   9  
ATOM 6835  C CG   . HIS A 1 10 ? -7.994  -11.536 10.668  1.00 0.00 ? 462 HIS C CG   9  
ATOM 6836  N ND1  . HIS A 1 10 ? -7.927  -12.798 11.224  1.00 0.00 ? 462 HIS C ND1  9  
ATOM 6837  C CD2  . HIS A 1 10 ? -6.719  -11.184 10.398  1.00 0.00 ? 462 HIS C CD2  9  
ATOM 6838  C CE1  . HIS A 1 10 ? -6.667  -13.180 11.288  1.00 0.00 ? 462 HIS C CE1  9  
ATOM 6839  N NE2  . HIS A 1 10 ? -5.915  -12.221 10.794  1.00 0.00 ? 462 HIS C NE2  9  
ATOM 6840  H H    . HIS A 1 10 ? -11.349 -9.776  9.423   1.00 0.00 ? 462 HIS C H    9  
ATOM 6841  H HA   . HIS A 1 10 ? -10.047 -12.236 9.071   1.00 0.00 ? 462 HIS C HA   9  
ATOM 6842  H HB2  . HIS A 1 10 ? -9.066  -9.971  9.770   1.00 0.00 ? 462 HIS C HB2  9  
ATOM 6843  H HB3  . HIS A 1 10 ? -9.593  -10.378 11.395  1.00 0.00 ? 462 HIS C HB3  9  
ATOM 6844  H HD1  . HIS A 1 10 ? -8.692  -13.339 11.522  1.00 0.00 ? 462 HIS C HD1  9  
ATOM 6845  H HD2  . HIS A 1 10 ? -6.396  -10.253 9.956   1.00 0.00 ? 462 HIS C HD2  9  
ATOM 6846  H HE1  . HIS A 1 10 ? -6.312  -14.121 11.681  1.00 0.00 ? 462 HIS C HE1  9  
ATOM 6847  H HE2  . HIS A 1 10 ? -4.944  -12.146 10.932  1.00 0.00 ? 462 HIS C HE2  9  
ATOM 6848  N N    . GLN A 1 11 ? -11.862 -11.970 11.772  1.00 0.00 ? 463 GLN C N    9  
ATOM 6849  C CA   . GLN A 1 11 ? -12.458 -12.725 12.858  1.00 0.00 ? 463 GLN C CA   9  
ATOM 6850  C C    . GLN A 1 11 ? -13.538 -13.646 12.343  1.00 0.00 ? 463 GLN C C    9  
ATOM 6851  O O    . GLN A 1 11 ? -13.748 -14.732 12.879  1.00 0.00 ? 463 GLN C O    9  
ATOM 6852  C CB   . GLN A 1 11 ? -13.001 -11.786 13.933  1.00 0.00 ? 463 GLN C CB   9  
ATOM 6853  C CG   . GLN A 1 11 ? -11.962 -10.791 14.418  1.00 0.00 ? 463 GLN C CG   9  
ATOM 6854  C CD   . GLN A 1 11 ? -10.633 -11.455 14.733  1.00 0.00 ? 463 GLN C CD   9  
ATOM 6855  O OE1  . GLN A 1 11 ? -10.582 -12.596 15.213  1.00 0.00 ? 463 GLN C OE1  9  
ATOM 6856  N NE2  . GLN A 1 11 ? -9.552  -10.766 14.425  1.00 0.00 ? 463 GLN C NE2  9  
ATOM 6857  H H    . GLN A 1 11 ? -12.109 -11.027 11.649  1.00 0.00 ? 463 GLN C H    9  
ATOM 6858  H HA   . GLN A 1 11 ? -11.677 -13.334 13.295  1.00 0.00 ? 463 GLN C HA   9  
ATOM 6859  H HB2  . GLN A 1 11 ? -13.839 -11.238 13.526  1.00 0.00 ? 463 GLN C HB2  9  
ATOM 6860  H HB3  . GLN A 1 11 ? -13.336 -12.371 14.775  1.00 0.00 ? 463 GLN C HB3  9  
ATOM 6861  H HG2  . GLN A 1 11 ? -11.805 -10.049 13.650  1.00 0.00 ? 463 GLN C HG2  9  
ATOM 6862  H HG3  . GLN A 1 11 ? -12.331 -10.311 15.313  1.00 0.00 ? 463 GLN C HG3  9  
ATOM 6863  H HE21 . GLN A 1 11 ? -9.668  -9.879  14.021  1.00 0.00 ? 463 GLN C HE21 9  
ATOM 6864  H HE22 . GLN A 1 11 ? -8.675  -11.168 14.590  1.00 0.00 ? 463 GLN C HE22 9  
ATOM 6865  N N    . ILE A 1 12 ? -14.215 -13.221 11.288  1.00 0.00 ? 464 ILE C N    9  
ATOM 6866  C CA   . ILE A 1 12 ? -15.233 -14.046 10.675  1.00 0.00 ? 464 ILE C CA   9  
ATOM 6867  C C    . ILE A 1 12 ? -14.606 -15.290 10.063  1.00 0.00 ? 464 ILE C C    9  
ATOM 6868  O O    . ILE A 1 12 ? -15.151 -16.376 10.180  1.00 0.00 ? 464 ILE C O    9  
ATOM 6869  C CB   . ILE A 1 12 ? -16.042 -13.283 9.604   1.00 0.00 ? 464 ILE C CB   9  
ATOM 6870  C CG1  . ILE A 1 12 ? -16.697 -12.054 10.233  1.00 0.00 ? 464 ILE C CG1  9  
ATOM 6871  C CG2  . ILE A 1 12 ? -17.101 -14.197 8.987   1.00 0.00 ? 464 ILE C CG2  9  
ATOM 6872  C CD1  . ILE A 1 12 ? -17.483 -11.201 9.262   1.00 0.00 ? 464 ILE C CD1  9  
ATOM 6873  H H    . ILE A 1 12 ? -14.030 -12.328 10.928  1.00 0.00 ? 464 ILE C H    9  
ATOM 6874  H HA   . ILE A 1 12 ? -15.911 -14.358 11.456  1.00 0.00 ? 464 ILE C HA   9  
ATOM 6875  H HB   . ILE A 1 12 ? -15.367 -12.964 8.823   1.00 0.00 ? 464 ILE C HB   9  
ATOM 6876  H HG12 . ILE A 1 12 ? -17.374 -12.377 11.008  1.00 0.00 ? 464 ILE C HG12 9  
ATOM 6877  H HG13 . ILE A 1 12 ? -15.928 -11.438 10.673  1.00 0.00 ? 464 ILE C HG13 9  
ATOM 6878  H HG21 . ILE A 1 12 ? -17.782 -14.527 9.759   1.00 0.00 ? 464 ILE C HG21 9  
ATOM 6879  H HG22 . ILE A 1 12 ? -16.624 -15.059 8.541   1.00 0.00 ? 464 ILE C HG22 9  
ATOM 6880  H HG23 . ILE A 1 12 ? -17.649 -13.654 8.231   1.00 0.00 ? 464 ILE C HG23 9  
ATOM 6881  H HD11 . ILE A 1 12 ? -18.291 -11.781 8.843   1.00 0.00 ? 464 ILE C HD11 9  
ATOM 6882  H HD12 . ILE A 1 12 ? -16.828 -10.864 8.472   1.00 0.00 ? 464 ILE C HD12 9  
ATOM 6883  H HD13 . ILE A 1 12 ? -17.886 -10.344 9.785   1.00 0.00 ? 464 ILE C HD13 9  
ATOM 6884  N N    . GLN A 1 13 ? -13.437 -15.133 9.442   1.00 0.00 ? 465 GLN C N    9  
ATOM 6885  C CA   . GLN A 1 13 ? -12.742 -16.276 8.858   1.00 0.00 ? 465 GLN C CA   9  
ATOM 6886  C C    . GLN A 1 13 ? -12.208 -17.193 9.959   1.00 0.00 ? 465 GLN C C    9  
ATOM 6887  O O    . GLN A 1 13 ? -11.959 -18.369 9.736   1.00 0.00 ? 465 GLN C O    9  
ATOM 6888  C CB   . GLN A 1 13 ? -11.589 -15.839 7.954   1.00 0.00 ? 465 GLN C CB   9  
ATOM 6889  C CG   . GLN A 1 13 ? -11.025 -16.993 7.130   1.00 0.00 ? 465 GLN C CG   9  
ATOM 6890  C CD   . GLN A 1 13 ? -9.717  -16.670 6.451   1.00 0.00 ? 465 GLN C CD   9  
ATOM 6891  O OE1  . GLN A 1 13 ? -9.684  -16.222 5.307   1.00 0.00 ? 465 GLN C OE1  9  
ATOM 6892  N NE2  . GLN A 1 13 ? -8.631  -16.904 7.145   1.00 0.00 ? 465 GLN C NE2  9  
ATOM 6893  H H    . GLN A 1 13 ? -13.047 -14.234 9.365   1.00 0.00 ? 465 GLN C H    9  
ATOM 6894  H HA   . GLN A 1 13 ? -13.461 -16.829 8.270   1.00 0.00 ? 465 GLN C HA   9  
ATOM 6895  H HB2  . GLN A 1 13 ? -11.933 -15.063 7.284   1.00 0.00 ? 465 GLN C HB2  9  
ATOM 6896  H HB3  . GLN A 1 13 ? -10.794 -15.446 8.574   1.00 0.00 ? 465 GLN C HB3  9  
ATOM 6897  H HG2  . GLN A 1 13 ? -10.867 -17.837 7.784   1.00 0.00 ? 465 GLN C HG2  9  
ATOM 6898  H HG3  . GLN A 1 13 ? -11.750 -17.262 6.375   1.00 0.00 ? 465 GLN C HG3  9  
ATOM 6899  H HE21 . GLN A 1 13 ? -8.728  -17.268 8.053   1.00 0.00 ? 465 GLN C HE21 9  
ATOM 6900  H HE22 . GLN A 1 13 ? -7.764  -16.711 6.737   1.00 0.00 ? 465 GLN C HE22 9  
ATOM 6901  N N    . GLU A 1 14 ? -12.023 -16.641 11.143  1.00 0.00 ? 466 GLU C N    9  
ATOM 6902  C CA   . GLU A 1 14 ? -11.561 -17.421 12.272  1.00 0.00 ? 466 GLU C CA   9  
ATOM 6903  C C    . GLU A 1 14 ? -12.690 -18.276 12.824  1.00 0.00 ? 466 GLU C C    9  
ATOM 6904  O O    . GLU A 1 14 ? -12.460 -19.349 13.383  1.00 0.00 ? 466 GLU C O    9  
ATOM 6905  C CB   . GLU A 1 14 ? -10.994 -16.510 13.350  1.00 0.00 ? 466 GLU C CB   9  
ATOM 6906  C CG   . GLU A 1 14 ? -9.689  -15.853 12.951  1.00 0.00 ? 466 GLU C CG   9  
ATOM 6907  C CD   . GLU A 1 14 ? -8.617  -16.865 12.618  1.00 0.00 ? 466 GLU C CD   9  
ATOM 6908  O OE1  . GLU A 1 14 ? -8.006  -17.415 13.551  1.00 0.00 ? 466 GLU C OE1  9  
ATOM 6909  O OE2  . GLU A 1 14 ? -8.388  -17.122 11.421  1.00 0.00 ? 466 GLU C OE2  9  
ATOM 6910  H H    . GLU A 1 14 ? -12.194 -15.684 11.263  1.00 0.00 ? 466 GLU C H    9  
ATOM 6911  H HA   . GLU A 1 14 ? -10.777 -18.074 11.918  1.00 0.00 ? 466 GLU C HA   9  
ATOM 6912  H HB2  . GLU A 1 14 ? -11.715 -15.733 13.561  1.00 0.00 ? 466 GLU C HB2  9  
ATOM 6913  H HB3  . GLU A 1 14 ? -10.827 -17.084 14.245  1.00 0.00 ? 466 GLU C HB3  9  
ATOM 6914  H HG2  . GLU A 1 14 ? -9.865  -15.243 12.075  1.00 0.00 ? 466 GLU C HG2  9  
ATOM 6915  H HG3  . GLU A 1 14 ? -9.344  -15.234 13.765  1.00 0.00 ? 466 GLU C HG3  9  
ATOM 6916  N N    . MET A 1 15 ? -13.907 -17.791 12.662  1.00 0.00 ? 467 MET C N    9  
ATOM 6917  C CA   . MET A 1 15 ? -15.084 -18.522 13.083  1.00 0.00 ? 467 MET C CA   9  
ATOM 6918  C C    . MET A 1 15 ? -15.549 -19.437 11.958  1.00 0.00 ? 467 MET C C    9  
ATOM 6919  O O    . MET A 1 15 ? -15.977 -20.564 12.192  1.00 0.00 ? 467 MET C O    9  
ATOM 6920  C CB   . MET A 1 15 ? -16.209 -17.556 13.457  1.00 0.00 ? 467 MET C CB   9  
ATOM 6921  C CG   . MET A 1 15 ? -15.890 -16.641 14.627  1.00 0.00 ? 467 MET C CG   9  
ATOM 6922  S SD   . MET A 1 15 ? -17.274 -15.560 15.065  1.00 0.00 ? 467 MET C SD   9  
ATOM 6923  C CE   . MET A 1 15 ? -17.424 -14.565 13.580  1.00 0.00 ? 467 MET C CE   9  
ATOM 6924  H H    . MET A 1 15 ? -14.018 -16.909 12.249  1.00 0.00 ? 467 MET C H    9  
ATOM 6925  H HA   . MET A 1 15 ? -14.824 -19.118 13.944  1.00 0.00 ? 467 MET C HA   9  
ATOM 6926  H HB2  . MET A 1 15 ? -16.429 -16.936 12.599  1.00 0.00 ? 467 MET C HB2  9  
ATOM 6927  H HB3  . MET A 1 15 ? -17.088 -18.129 13.703  1.00 0.00 ? 467 MET C HB3  9  
ATOM 6928  H HG2  . MET A 1 15 ? -15.642 -17.249 15.484  1.00 0.00 ? 467 MET C HG2  9  
ATOM 6929  H HG3  . MET A 1 15 ? -15.040 -16.027 14.365  1.00 0.00 ? 467 MET C HG3  9  
ATOM 6930  H HE1  . MET A 1 15 ? -17.624 -15.206 12.735  1.00 0.00 ? 467 MET C HE1  9  
ATOM 6931  H HE2  . MET A 1 15 ? -16.504 -14.024 13.415  1.00 0.00 ? 467 MET C HE2  9  
ATOM 6932  H HE3  . MET A 1 15 ? -18.236 -13.864 13.699  1.00 0.00 ? 467 MET C HE3  9  
ATOM 6933  N N    . PHE A 1 16 ? -15.457 -18.934 10.738  1.00 0.00 ? 468 PHE C N    9  
ATOM 6934  C CA   . PHE A 1 16 ? -15.873 -19.666 9.556   1.00 0.00 ? 468 PHE C CA   9  
ATOM 6935  C C    . PHE A 1 16 ? -14.753 -19.700 8.507   1.00 0.00 ? 468 PHE C C    9  
ATOM 6936  O O    . PHE A 1 16 ? -14.802 -18.973 7.521   1.00 0.00 ? 468 PHE C O    9  
ATOM 6937  C CB   . PHE A 1 16 ? -17.128 -19.018 8.951   1.00 0.00 ? 468 PHE C CB   9  
ATOM 6938  C CG   . PHE A 1 16 ? -18.360 -19.152 9.802   1.00 0.00 ? 468 PHE C CG   9  
ATOM 6939  C CD1  . PHE A 1 16 ? -18.621 -18.247 10.812  1.00 0.00 ? 468 PHE C CD1  9  
ATOM 6940  C CD2  . PHE A 1 16 ? -19.249 -20.188 9.591   1.00 0.00 ? 468 PHE C CD2  9  
ATOM 6941  C CE1  . PHE A 1 16 ? -19.747 -18.370 11.595  1.00 0.00 ? 468 PHE C CE1  9  
ATOM 6942  C CE2  . PHE A 1 16 ? -20.379 -20.319 10.371  1.00 0.00 ? 468 PHE C CE2  9  
ATOM 6943  C CZ   . PHE A 1 16 ? -20.629 -19.410 11.374  1.00 0.00 ? 468 PHE C CZ   9  
ATOM 6944  H H    . PHE A 1 16 ? -15.098 -18.027 10.618  1.00 0.00 ? 468 PHE C H    9  
ATOM 6945  H HA   . PHE A 1 16 ? -16.109 -20.676 9.852   1.00 0.00 ? 468 PHE C HA   9  
ATOM 6946  H HB2  . PHE A 1 16 ? -16.942 -17.963 8.816   1.00 0.00 ? 468 PHE C HB2  9  
ATOM 6947  H HB3  . PHE A 1 16 ? -17.331 -19.460 7.992   1.00 0.00 ? 468 PHE C HB3  9  
ATOM 6948  H HD1  . PHE A 1 16 ? -17.932 -17.434 10.985  1.00 0.00 ? 468 PHE C HD1  9  
ATOM 6949  H HD2  . PHE A 1 16 ? -19.053 -20.898 8.804   1.00 0.00 ? 468 PHE C HD2  9  
ATOM 6950  H HE1  . PHE A 1 16 ? -19.937 -17.652 12.379  1.00 0.00 ? 468 PHE C HE1  9  
ATOM 6951  H HE2  . PHE A 1 16 ? -21.066 -21.133 10.195  1.00 0.00 ? 468 PHE C HE2  9  
ATOM 6952  H HZ   . PHE A 1 16 ? -21.512 -19.508 11.988  1.00 0.00 ? 468 PHE C HZ   9  
ATOM 6953  N N    . PRO A 1 17 ? -13.719 -20.538 8.721   1.00 0.00 ? 469 PRO C N    9  
ATOM 6954  C CA   . PRO A 1 17 ? -12.591 -20.671 7.782   1.00 0.00 ? 469 PRO C CA   9  
ATOM 6955  C C    . PRO A 1 17 ? -13.036 -21.187 6.415   1.00 0.00 ? 469 PRO C C    9  
ATOM 6956  O O    . PRO A 1 17 ? -12.309 -21.077 5.426   1.00 0.00 ? 469 PRO C O    9  
ATOM 6957  C CB   . PRO A 1 17 ? -11.684 -21.708 8.455   1.00 0.00 ? 469 PRO C CB   9  
ATOM 6958  C CG   . PRO A 1 17 ? -12.085 -21.699 9.885   1.00 0.00 ? 469 PRO C CG   9  
ATOM 6959  C CD   . PRO A 1 17 ? -13.545 -21.382 9.904   1.00 0.00 ? 469 PRO C CD   9  
ATOM 6960  H HA   . PRO A 1 17 ? -12.059 -19.737 7.676   1.00 0.00 ? 469 PRO C HA   9  
ATOM 6961  H HB2  . PRO A 1 17 ? -11.845 -22.676 8.005   1.00 0.00 ? 469 PRO C HB2  9  
ATOM 6962  H HB3  . PRO A 1 17 ? -10.652 -21.415 8.335   1.00 0.00 ? 469 PRO C HB3  9  
ATOM 6963  H HG2  . PRO A 1 17 ? -11.903 -22.665 10.329  1.00 0.00 ? 469 PRO C HG2  9  
ATOM 6964  H HG3  . PRO A 1 17 ? -11.536 -20.934 10.405  1.00 0.00 ? 469 PRO C HG3  9  
ATOM 6965  H HD2  . PRO A 1 17 ? -14.138 -22.278 9.836   1.00 0.00 ? 469 PRO C HD2  9  
ATOM 6966  H HD3  . PRO A 1 17 ? -13.789 -20.829 10.795  1.00 0.00 ? 469 PRO C HD3  9  
ATOM 6967  N N    . GLN A 1 18 ? -14.232 -21.749 6.378   1.00 0.00 ? 470 GLN C N    9  
ATOM 6968  C CA   . GLN A 1 18 ? -14.798 -22.307 5.154   1.00 0.00 ? 470 GLN C CA   9  
ATOM 6969  C C    . GLN A 1 18 ? -15.160 -21.222 4.129   1.00 0.00 ? 470 GLN C C    9  
ATOM 6970  O O    . GLN A 1 18 ? -15.280 -21.508 2.941   1.00 0.00 ? 470 GLN C O    9  
ATOM 6971  C CB   . GLN A 1 18 ? -16.045 -23.145 5.471   1.00 0.00 ? 470 GLN C CB   9  
ATOM 6972  C CG   . GLN A 1 18 ? -17.122 -22.385 6.239   1.00 0.00 ? 470 GLN C CG   9  
ATOM 6973  C CD   . GLN A 1 18 ? -18.446 -23.128 6.294   1.00 0.00 ? 470 GLN C CD   9  
ATOM 6974  O OE1  . GLN A 1 18 ? -18.795 -23.869 5.376   1.00 0.00 ? 470 GLN C OE1  9  
ATOM 6975  N NE2  . GLN A 1 18 ? -19.189 -22.939 7.372   1.00 0.00 ? 470 GLN C NE2  9  
ATOM 6976  H H    . GLN A 1 18 ? -14.740 -21.800 7.216   1.00 0.00 ? 470 GLN C H    9  
ATOM 6977  H HA   . GLN A 1 18 ? -14.057 -22.955 4.717   1.00 0.00 ? 470 GLN C HA   9  
ATOM 6978  H HB2  . GLN A 1 18 ? -16.475 -23.492 4.543   1.00 0.00 ? 470 GLN C HB2  9  
ATOM 6979  H HB3  . GLN A 1 18 ? -15.749 -24.000 6.060   1.00 0.00 ? 470 GLN C HB3  9  
ATOM 6980  H HG2  . GLN A 1 18 ? -16.779 -22.221 7.250   1.00 0.00 ? 470 GLN C HG2  9  
ATOM 6981  H HG3  . GLN A 1 18 ? -17.278 -21.434 5.755   1.00 0.00 ? 470 GLN C HG3  9  
ATOM 6982  H HE21 . GLN A 1 18 ? -18.849 -22.343 8.072   1.00 0.00 ? 470 GLN C HE21 9  
ATOM 6983  H HE22 . GLN A 1 18 ? -20.054 -23.398 7.435   1.00 0.00 ? 470 GLN C HE22 9  
ATOM 6984  N N    . VAL A 1 19 ? -15.317 -19.987 4.582   1.00 0.00 ? 471 VAL C N    9  
ATOM 6985  C CA   . VAL A 1 19 ? -15.751 -18.910 3.704   1.00 0.00 ? 471 VAL C CA   9  
ATOM 6986  C C    . VAL A 1 19 ? -14.565 -18.143 3.102   1.00 0.00 ? 471 VAL C C    9  
ATOM 6987  O O    . VAL A 1 19 ? -13.461 -18.158 3.653   1.00 0.00 ? 471 VAL C O    9  
ATOM 6988  C CB   . VAL A 1 19 ? -16.681 -17.927 4.449   1.00 0.00 ? 471 VAL C CB   9  
ATOM 6989  C CG1  . VAL A 1 19 ? -17.728 -18.683 5.240   1.00 0.00 ? 471 VAL C CG1  9  
ATOM 6990  C CG2  . VAL A 1 19 ? -15.889 -16.994 5.347   1.00 0.00 ? 471 VAL C CG2  9  
ATOM 6991  H H    . VAL A 1 19 ? -15.128 -19.785 5.524   1.00 0.00 ? 471 VAL C H    9  
ATOM 6992  H HA   . VAL A 1 19 ? -16.314 -19.359 2.901   1.00 0.00 ? 471 VAL C HA   9  
ATOM 6993  H HB   . VAL A 1 19 ? -17.192 -17.332 3.709   1.00 0.00 ? 471 VAL C HB   9  
ATOM 6994  H HG11 . VAL A 1 19 ? -17.238 -19.354 5.929   1.00 0.00 ? 471 VAL C HG11 9  
ATOM 6995  H HG12 . VAL A 1 19 ? -18.353 -19.250 4.567   1.00 0.00 ? 471 VAL C HG12 9  
ATOM 6996  H HG13 . VAL A 1 19 ? -18.334 -17.985 5.792   1.00 0.00 ? 471 VAL C HG13 9  
ATOM 6997  H HG21 . VAL A 1 19 ? -15.225 -16.404 4.733   1.00 0.00 ? 471 VAL C HG21 9  
ATOM 6998  H HG22 . VAL A 1 19 ? -15.312 -17.574 6.053   1.00 0.00 ? 471 VAL C HG22 9  
ATOM 6999  H HG23 . VAL A 1 19 ? -16.567 -16.342 5.876   1.00 0.00 ? 471 VAL C HG23 9  
ATOM 7000  N N    . PRO A 1 20 ? -14.777 -17.475 1.949   1.00 0.00 ? 472 PRO C N    9  
ATOM 7001  C CA   . PRO A 1 20 ? -13.747 -16.685 1.282   1.00 0.00 ? 472 PRO C CA   9  
ATOM 7002  C C    . PRO A 1 20 ? -13.561 -15.325 1.940   1.00 0.00 ? 472 PRO C C    9  
ATOM 7003  O O    . PRO A 1 20 ? -14.504 -14.534 2.035   1.00 0.00 ? 472 PRO C O    9  
ATOM 7004  C CB   . PRO A 1 20 ? -14.283 -16.509 -0.150  1.00 0.00 ? 472 PRO C CB   9  
ATOM 7005  C CG   . PRO A 1 20 ? -15.546 -17.304 -0.205  1.00 0.00 ? 472 PRO C CG   9  
ATOM 7006  C CD   . PRO A 1 20 ? -16.026 -17.432 1.208   1.00 0.00 ? 472 PRO C CD   9  
ATOM 7007  H HA   . PRO A 1 20 ? -12.804 -17.209 1.257   1.00 0.00 ? 472 PRO C HA   9  
ATOM 7008  H HB2  . PRO A 1 20 ? -14.468 -15.460 -0.335  1.00 0.00 ? 472 PRO C HB2  9  
ATOM 7009  H HB3  . PRO A 1 20 ? -13.553 -16.877 -0.856  1.00 0.00 ? 472 PRO C HB3  9  
ATOM 7010  H HG2  . PRO A 1 20 ? -16.275 -16.786 -0.805  1.00 0.00 ? 472 PRO C HG2  9  
ATOM 7011  H HG3  . PRO A 1 20 ? -15.337 -18.277 -0.618  1.00 0.00 ? 472 PRO C HG3  9  
ATOM 7012  H HD2  . PRO A 1 20 ? -16.614 -16.574 1.501   1.00 0.00 ? 472 PRO C HD2  9  
ATOM 7013  H HD3  . PRO A 1 20 ? -16.589 -18.340 1.340   1.00 0.00 ? 472 PRO C HD3  9  
ATOM 7014  N N    . TYR A 1 21 ? -12.340 -15.057 2.353   1.00 0.00 ? 473 TYR C N    9  
ATOM 7015  C CA   . TYR A 1 21 ? -11.972 -13.815 3.044   1.00 0.00 ? 473 TYR C CA   9  
ATOM 7016  C C    . TYR A 1 21 ? -12.390 -12.580 2.234   1.00 0.00 ? 473 TYR C C    9  
ATOM 7017  O O    . TYR A 1 21 ? -12.927 -11.617 2.781   1.00 0.00 ? 473 TYR C O    9  
ATOM 7018  C CB   . TYR A 1 21 ? -10.456 -13.799 3.256   1.00 0.00 ? 473 TYR C CB   9  
ATOM 7019  C CG   . TYR A 1 21 ? -9.957  -12.830 4.311   1.00 0.00 ? 473 TYR C CG   9  
ATOM 7020  C CD1  . TYR A 1 21 ? -9.708  -11.497 4.012   1.00 0.00 ? 473 TYR C CD1  9  
ATOM 7021  C CD2  . TYR A 1 21 ? -9.707  -13.264 5.601   1.00 0.00 ? 473 TYR C CD2  9  
ATOM 7022  C CE1  . TYR A 1 21 ? -9.226  -10.630 4.978   1.00 0.00 ? 473 TYR C CE1  9  
ATOM 7023  C CE2  . TYR A 1 21 ? -9.233  -12.410 6.566   1.00 0.00 ? 473 TYR C CE2  9  
ATOM 7024  C CZ   . TYR A 1 21 ? -8.991  -11.096 6.254   1.00 0.00 ? 473 TYR C CZ   9  
ATOM 7025  O OH   . TYR A 1 21 ? -8.502  -10.246 7.220   1.00 0.00 ? 473 TYR C OH   9  
ATOM 7026  H H    . TYR A 1 21 ? -11.645 -15.730 2.185   1.00 0.00 ? 473 TYR C H    9  
ATOM 7027  H HA   . TYR A 1 21 ? -12.462 -13.798 4.004   1.00 0.00 ? 473 TYR C HA   9  
ATOM 7028  H HB2  . TYR A 1 21 ? -10.138 -14.787 3.551   1.00 0.00 ? 473 TYR C HB2  9  
ATOM 7029  H HB3  . TYR A 1 21 ? -9.978  -13.547 2.321   1.00 0.00 ? 473 TYR C HB3  9  
ATOM 7030  H HD1  . TYR A 1 21 ? -9.896  -11.137 3.012   1.00 0.00 ? 473 TYR C HD1  9  
ATOM 7031  H HD2  . TYR A 1 21 ? -9.896  -14.298 5.849   1.00 0.00 ? 473 TYR C HD2  9  
ATOM 7032  H HE1  . TYR A 1 21 ? -9.037  -9.595  4.732   1.00 0.00 ? 473 TYR C HE1  9  
ATOM 7033  H HE2  . TYR A 1 21 ? -9.046  -12.778 7.563   1.00 0.00 ? 473 TYR C HE2  9  
ATOM 7034  H HH   . TYR A 1 21 ? -9.021  -9.433  7.226   1.00 0.00 ? 473 TYR C HH   9  
ATOM 7035  N N    . HIS A 1 22 ? -12.156 -12.635 0.933   1.00 0.00 ? 474 HIS C N    9  
ATOM 7036  C CA   . HIS A 1 22 ? -12.435 -11.518 0.036   1.00 0.00 ? 474 HIS C CA   9  
ATOM 7037  C C    . HIS A 1 22 ? -13.922 -11.211 -0.042  1.00 0.00 ? 474 HIS C C    9  
ATOM 7038  O O    . HIS A 1 22 ? -14.316 -10.055 0.014   1.00 0.00 ? 474 HIS C O    9  
ATOM 7039  C CB   . HIS A 1 22 ? -11.889 -11.825 -1.353  1.00 0.00 ? 474 HIS C CB   9  
ATOM 7040  C CG   . HIS A 1 22 ? -11.803 -10.633 -2.259  1.00 0.00 ? 474 HIS C CG   9  
ATOM 7041  N ND1  . HIS A 1 22 ? -10.782 -9.713  -2.195  1.00 0.00 ? 474 HIS C ND1  9  
ATOM 7042  C CD2  . HIS A 1 22 ? -12.613 -10.221 -3.263  1.00 0.00 ? 474 HIS C CD2  9  
ATOM 7043  C CE1  . HIS A 1 22 ? -10.966 -8.787  -3.115  1.00 0.00 ? 474 HIS C CE1  9  
ATOM 7044  N NE2  . HIS A 1 22 ? -12.070 -9.071  -3.778  1.00 0.00 ? 474 HIS C NE2  9  
ATOM 7045  H H    . HIS A 1 22 ? -11.774 -13.460 0.559   1.00 0.00 ? 474 HIS C H    9  
ATOM 7046  H HA   . HIS A 1 22 ? -11.932 -10.640 0.422   1.00 0.00 ? 474 HIS C HA   9  
ATOM 7047  H HB2  . HIS A 1 22 ? -10.902 -12.241 -1.247  1.00 0.00 ? 474 HIS C HB2  9  
ATOM 7048  H HB3  . HIS A 1 22 ? -12.529 -12.556 -1.824  1.00 0.00 ? 474 HIS C HB3  9  
ATOM 7049  H HD1  . HIS A 1 22 ? -10.025 -9.737  -1.563  1.00 0.00 ? 474 HIS C HD1  9  
ATOM 7050  H HD2  . HIS A 1 22 ? -13.520 -10.708 -3.593  1.00 0.00 ? 474 HIS C HD2  9  
ATOM 7051  H HE1  . HIS A 1 22 ? -10.321 -7.939  -3.297  1.00 0.00 ? 474 HIS C HE1  9  
ATOM 7052  H HE2  . HIS A 1 22 ? -12.308 -8.677  -4.648  1.00 0.00 ? 474 HIS C HE2  9  
ATOM 7053  N N    . LEU A 1 23 ? -14.747 -12.242 -0.171  1.00 0.00 ? 475 LEU C N    9  
ATOM 7054  C CA   . LEU A 1 23 ? -16.189 -12.035 -0.256  1.00 0.00 ? 475 LEU C CA   9  
ATOM 7055  C C    . LEU A 1 23 ? -16.719 -11.511 1.061   1.00 0.00 ? 475 LEU C C    9  
ATOM 7056  O O    . LEU A 1 23 ? -17.697 -10.768 1.099   1.00 0.00 ? 475 LEU C O    9  
ATOM 7057  C CB   . LEU A 1 23 ? -16.920 -13.322 -0.646  1.00 0.00 ? 475 LEU C CB   9  
ATOM 7058  C CG   . LEU A 1 23 ? -16.525 -13.955 -1.984  1.00 0.00 ? 475 LEU C CG   9  
ATOM 7059  C CD1  . LEU A 1 23 ? -17.551 -14.994 -2.399  1.00 0.00 ? 475 LEU C CD1  9  
ATOM 7060  C CD2  . LEU A 1 23 ? -16.370 -12.901 -3.067  1.00 0.00 ? 475 LEU C CD2  9  
ATOM 7061  H H    . LEU A 1 23 ? -14.389 -13.152 -0.202  1.00 0.00 ? 475 LEU C H    9  
ATOM 7062  H HA   . LEU A 1 23 ? -16.376 -11.281 -1.011  1.00 0.00 ? 475 LEU C HA   9  
ATOM 7063  H HB2  . LEU A 1 23 ? -16.747 -14.051 0.133   1.00 0.00 ? 475 LEU C HB2  9  
ATOM 7064  H HB3  . LEU A 1 23 ? -17.974 -13.105 -0.675  1.00 0.00 ? 475 LEU C HB3  9  
ATOM 7065  H HG   . LEU A 1 23 ? -15.577 -14.460 -1.867  1.00 0.00 ? 475 LEU C HG   9  
ATOM 7066  H HD11 . LEU A 1 23 ? -17.250 -15.440 -3.334  1.00 0.00 ? 475 LEU C HD11 9  
ATOM 7067  H HD12 . LEU A 1 23 ? -18.512 -14.516 -2.525  1.00 0.00 ? 475 LEU C HD12 9  
ATOM 7068  H HD13 . LEU A 1 23 ? -17.629 -15.757 -1.641  1.00 0.00 ? 475 LEU C HD13 9  
ATOM 7069  H HD21 . LEU A 1 23 ? -15.579 -12.219 -2.795  1.00 0.00 ? 475 LEU C HD21 9  
ATOM 7070  H HD22 . LEU A 1 23 ? -17.296 -12.356 -3.173  1.00 0.00 ? 475 LEU C HD22 9  
ATOM 7071  H HD23 . LEU A 1 23 ? -16.127 -13.380 -4.003  1.00 0.00 ? 475 LEU C HD23 9  
ATOM 7072  N N    . VAL A 1 24 ? -16.059 -11.890 2.144   1.00 0.00 ? 476 VAL C N    9  
ATOM 7073  C CA   . VAL A 1 24 ? -16.427 -11.393 3.455   1.00 0.00 ? 476 VAL C CA   9  
ATOM 7074  C C    . VAL A 1 24 ? -16.118 -9.903  3.518   1.00 0.00 ? 476 VAL C C    9  
ATOM 7075  O O    . VAL A 1 24 ? -16.955 -9.102  3.914   1.00 0.00 ? 476 VAL C O    9  
ATOM 7076  C CB   . VAL A 1 24 ? -15.684 -12.144 4.587   1.00 0.00 ? 476 VAL C CB   9  
ATOM 7077  C CG1  . VAL A 1 24 ? -16.048 -11.576 5.943   1.00 0.00 ? 476 VAL C CG1  9  
ATOM 7078  C CG2  . VAL A 1 24 ? -16.010 -13.622 4.539   1.00 0.00 ? 476 VAL C CG2  9  
ATOM 7079  H H    . VAL A 1 24 ? -15.299 -12.511 2.050   1.00 0.00 ? 476 VAL C H    9  
ATOM 7080  H HA   . VAL A 1 24 ? -17.493 -11.534 3.577   1.00 0.00 ? 476 VAL C HA   9  
ATOM 7081  H HB   . VAL A 1 24 ? -14.620 -12.025 4.439   1.00 0.00 ? 476 VAL C HB   9  
ATOM 7082  H HG11 . VAL A 1 24 ? -15.550 -12.144 6.715   1.00 0.00 ? 476 VAL C HG11 9  
ATOM 7083  H HG12 . VAL A 1 24 ? -17.116 -11.634 6.085   1.00 0.00 ? 476 VAL C HG12 9  
ATOM 7084  H HG13 . VAL A 1 24 ? -15.731 -10.546 5.996   1.00 0.00 ? 476 VAL C HG13 9  
ATOM 7085  H HG21 . VAL A 1 24 ? -15.491 -14.131 5.338   1.00 0.00 ? 476 VAL C HG21 9  
ATOM 7086  H HG22 . VAL A 1 24 ? -15.695 -14.030 3.589   1.00 0.00 ? 476 VAL C HG22 9  
ATOM 7087  H HG23 . VAL A 1 24 ? -17.074 -13.761 4.655   1.00 0.00 ? 476 VAL C HG23 9  
ATOM 7088  N N    . LEU A 1 25 ? -14.911 -9.548  3.079   1.00 0.00 ? 477 LEU C N    9  
ATOM 7089  C CA   . LEU A 1 25 ? -14.488 -8.151  2.985   1.00 0.00 ? 477 LEU C CA   9  
ATOM 7090  C C    . LEU A 1 25 ? -15.503 -7.349  2.180   1.00 0.00 ? 477 LEU C C    9  
ATOM 7091  O O    . LEU A 1 25 ? -15.823 -6.211  2.521   1.00 0.00 ? 477 LEU C O    9  
ATOM 7092  C CB   . LEU A 1 25 ? -13.118 -8.073  2.297   1.00 0.00 ? 477 LEU C CB   9  
ATOM 7093  C CG   . LEU A 1 25 ? -11.916 -8.540  3.112   1.00 0.00 ? 477 LEU C CG   9  
ATOM 7094  C CD1  . LEU A 1 25 ? -10.652 -8.463  2.275   1.00 0.00 ? 477 LEU C CD1  9  
ATOM 7095  C CD2  . LEU A 1 25 ? -11.765 -7.706  4.372   1.00 0.00 ? 477 LEU C CD2  9  
ATOM 7096  H H    . LEU A 1 25 ? -14.275 -10.249 2.815   1.00 0.00 ? 477 LEU C H    9  
ATOM 7097  H HA   . LEU A 1 25 ? -14.420 -7.734  3.981   1.00 0.00 ? 477 LEU C HA   9  
ATOM 7098  H HB2  . LEU A 1 25 ? -13.168 -8.689  1.412   1.00 0.00 ? 477 LEU C HB2  9  
ATOM 7099  H HB3  . LEU A 1 25 ? -12.942 -7.061  1.981   1.00 0.00 ? 477 LEU C HB3  9  
ATOM 7100  H HG   . LEU A 1 25 ? -12.062 -9.573  3.403   1.00 0.00 ? 477 LEU C HG   9  
ATOM 7101  H HD11 . LEU A 1 25 ? -10.497 -7.444  1.954   1.00 0.00 ? 477 LEU C HD11 9  
ATOM 7102  H HD12 . LEU A 1 25 ? -10.751 -9.102  1.411   1.00 0.00 ? 477 LEU C HD12 9  
ATOM 7103  H HD13 . LEU A 1 25 ? -9.807  -8.784  2.866   1.00 0.00 ? 477 LEU C HD13 9  
ATOM 7104  H HD21 . LEU A 1 25 ? -10.887 -8.029  4.911   1.00 0.00 ? 477 LEU C HD21 9  
ATOM 7105  H HD22 . LEU A 1 25 ? -12.637 -7.836  4.999   1.00 0.00 ? 477 LEU C HD22 9  
ATOM 7106  H HD23 . LEU A 1 25 ? -11.665 -6.666  4.108   1.00 0.00 ? 477 LEU C HD23 9  
ATOM 7107  N N    . GLN A 1 26 ? -16.008 -7.963  1.119   1.00 0.00 ? 478 GLN C N    9  
ATOM 7108  C CA   . GLN A 1 26 ? -16.990 -7.339  0.257   1.00 0.00 ? 478 GLN C CA   9  
ATOM 7109  C C    . GLN A 1 26 ? -18.274 -7.036  1.012   1.00 0.00 ? 478 GLN C C    9  
ATOM 7110  O O    . GLN A 1 26 ? -18.757 -5.912  0.987   1.00 0.00 ? 478 GLN C O    9  
ATOM 7111  C CB   . GLN A 1 26 ? -17.285 -8.227  -0.943  1.00 0.00 ? 478 GLN C CB   9  
ATOM 7112  C CG   . GLN A 1 26 ? -16.100 -8.433  -1.858  1.00 0.00 ? 478 GLN C CG   9  
ATOM 7113  C CD   . GLN A 1 26 ? -16.474 -9.124  -3.148  1.00 0.00 ? 478 GLN C CD   9  
ATOM 7114  O OE1  . GLN A 1 26 ? -15.825 -8.929  -4.176  1.00 0.00 ? 478 GLN C OE1  9  
ATOM 7115  N NE2  . GLN A 1 26 ? -17.528 -9.917  -3.115  1.00 0.00 ? 478 GLN C NE2  9  
ATOM 7116  H H    . GLN A 1 26 ? -15.701 -8.869  0.908   1.00 0.00 ? 478 GLN C H    9  
ATOM 7117  H HA   . GLN A 1 26 ? -16.569 -6.409  -0.097  1.00 0.00 ? 478 GLN C HA   9  
ATOM 7118  H HB2  . GLN A 1 26 ? -17.595 -9.196  -0.581  1.00 0.00 ? 478 GLN C HB2  9  
ATOM 7119  H HB3  . GLN A 1 26 ? -18.089 -7.804  -1.517  1.00 0.00 ? 478 GLN C HB3  9  
ATOM 7120  H HG2  . GLN A 1 26 ? -15.674 -7.470  -2.095  1.00 0.00 ? 478 GLN C HG2  9  
ATOM 7121  H HG3  . GLN A 1 26 ? -15.364 -9.035  -1.345  1.00 0.00 ? 478 GLN C HG3  9  
ATOM 7122  H HE21 . GLN A 1 26 ? -18.013 -10.020 -2.265  1.00 0.00 ? 478 GLN C HE21 9  
ATOM 7123  H HE22 . GLN A 1 26 ? -17.793 -10.374 -3.941  1.00 0.00 ? 478 GLN C HE22 9  
ATOM 7124  N N    . ASP A 1 27 ? -18.817 -8.037  1.701   1.00 0.00 ? 479 ASP C N    9  
ATOM 7125  C CA   . ASP A 1 27 ? -20.062 -7.852  2.454   1.00 0.00 ? 479 ASP C CA   9  
ATOM 7126  C C    . ASP A 1 27 ? -19.873 -6.829  3.560   1.00 0.00 ? 479 ASP C C    9  
ATOM 7127  O O    . ASP A 1 27 ? -20.798 -6.119  3.920   1.00 0.00 ? 479 ASP C O    9  
ATOM 7128  C CB   . ASP A 1 27 ? -20.559 -9.169  3.043   1.00 0.00 ? 479 ASP C CB   9  
ATOM 7129  C CG   . ASP A 1 27 ? -21.994 -9.070  3.553   1.00 0.00 ? 479 ASP C CG   9  
ATOM 7130  O OD1  . ASP A 1 27 ? -22.926 -9.285  2.742   1.00 0.00 ? 479 ASP C OD1  9  
ATOM 7131  O OD2  . ASP A 1 27 ? -22.195 -8.777  4.757   1.00 0.00 ? 479 ASP C OD2  9  
ATOM 7132  H H    . ASP A 1 27 ? -18.378 -8.917  1.703   1.00 0.00 ? 479 ASP C H    9  
ATOM 7133  H HA   . ASP A 1 27 ? -20.806 -7.473  1.768   1.00 0.00 ? 479 ASP C HA   9  
ATOM 7134  H HB2  . ASP A 1 27 ? -20.513 -9.934  2.284   1.00 0.00 ? 479 ASP C HB2  9  
ATOM 7135  H HB3  . ASP A 1 27 ? -19.921 -9.448  3.868   1.00 0.00 ? 479 ASP C HB3  9  
ATOM 7136  N N    . LEU A 1 28 ? -18.659 -6.731  4.073   1.00 0.00 ? 480 LEU C N    9  
ATOM 7137  C CA   . LEU A 1 28 ? -18.351 -5.764  5.111   1.00 0.00 ? 480 LEU C CA   9  
ATOM 7138  C C    . LEU A 1 28 ? -18.294 -4.361  4.537   1.00 0.00 ? 480 LEU C C    9  
ATOM 7139  O O    . LEU A 1 28 ? -18.367 -3.378  5.263   1.00 0.00 ? 480 LEU C O    9  
ATOM 7140  C CB   . LEU A 1 28 ? -17.053 -6.109  5.851   1.00 0.00 ? 480 LEU C CB   9  
ATOM 7141  C CG   . LEU A 1 28 ? -17.208 -6.948  7.123   1.00 0.00 ? 480 LEU C CG   9  
ATOM 7142  C CD1  . LEU A 1 28 ? -18.342 -6.429  7.980   1.00 0.00 ? 480 LEU C CD1  9  
ATOM 7143  C CD2  . LEU A 1 28 ? -17.447 -8.378  6.779   1.00 0.00 ? 480 LEU C CD2  9  
ATOM 7144  H H    . LEU A 1 28 ? -17.956 -7.322  3.740   1.00 0.00 ? 480 LEU C H    9  
ATOM 7145  H HA   . LEU A 1 28 ? -19.169 -5.797  5.816   1.00 0.00 ? 480 LEU C HA   9  
ATOM 7146  H HB2  . LEU A 1 28 ? -16.419 -6.655  5.172   1.00 0.00 ? 480 LEU C HB2  9  
ATOM 7147  H HB3  . LEU A 1 28 ? -16.547 -5.201  6.105   1.00 0.00 ? 480 LEU C HB3  9  
ATOM 7148  H HG   . LEU A 1 28 ? -16.296 -6.886  7.700   1.00 0.00 ? 480 LEU C HG   9  
ATOM 7149  H HD11 . LEU A 1 28 ? -19.285 -6.679  7.516   1.00 0.00 ? 480 LEU C HD11 9  
ATOM 7150  H HD12 . LEU A 1 28 ? -18.262 -5.358  8.075   1.00 0.00 ? 480 LEU C HD12 9  
ATOM 7151  H HD13 . LEU A 1 28 ? -18.291 -6.886  8.958   1.00 0.00 ? 480 LEU C HD13 9  
ATOM 7152  H HD21 . LEU A 1 28 ? -16.612 -8.756  6.211   1.00 0.00 ? 480 LEU C HD21 9  
ATOM 7153  H HD22 . LEU A 1 28 ? -18.349 -8.437  6.186   1.00 0.00 ? 480 LEU C HD22 9  
ATOM 7154  H HD23 . LEU A 1 28 ? -17.562 -8.949  7.689   1.00 0.00 ? 480 LEU C HD23 9  
ATOM 7155  N N    . GLN A 1 29 ? -18.164 -4.276  3.230   1.00 0.00 ? 481 GLN C N    9  
ATOM 7156  C CA   . GLN A 1 29 ? -18.212 -3.006  2.541   1.00 0.00 ? 481 GLN C CA   9  
ATOM 7157  C C    . GLN A 1 29 ? -19.663 -2.651  2.266   1.00 0.00 ? 481 GLN C C    9  
ATOM 7158  O O    . GLN A 1 29 ? -20.007 -1.488  2.059   1.00 0.00 ? 481 GLN C O    9  
ATOM 7159  C CB   . GLN A 1 29 ? -17.449 -3.086  1.218   1.00 0.00 ? 481 GLN C CB   9  
ATOM 7160  C CG   . GLN A 1 29 ? -15.942 -3.207  1.364   1.00 0.00 ? 481 GLN C CG   9  
ATOM 7161  C CD   . GLN A 1 29 ? -15.234 -1.861  1.427   1.00 0.00 ? 481 GLN C CD   9  
ATOM 7162  O OE1  . GLN A 1 29 ? -14.086 -1.739  1.011   1.00 0.00 ? 481 GLN C OE1  9  
ATOM 7163  N NE2  . GLN A 1 29 ? -15.912 -0.850  1.933   1.00 0.00 ? 481 GLN C NE2  9  
ATOM 7164  H H    . GLN A 1 29 ? -18.026 -5.094  2.705   1.00 0.00 ? 481 GLN C H    9  
ATOM 7165  H HA   . GLN A 1 29 ? -17.763 -2.258  3.173   1.00 0.00 ? 481 GLN C HA   9  
ATOM 7166  H HB2  . GLN A 1 29 ? -17.799 -3.947  0.669   1.00 0.00 ? 481 GLN C HB2  9  
ATOM 7167  H HB3  . GLN A 1 29 ? -17.663 -2.198  0.644   1.00 0.00 ? 481 GLN C HB3  9  
ATOM 7168  H HG2  . GLN A 1 29 ? -15.726 -3.748  2.273   1.00 0.00 ? 481 GLN C HG2  9  
ATOM 7169  H HG3  . GLN A 1 29 ? -15.562 -3.759  0.523   1.00 0.00 ? 481 GLN C HG3  9  
ATOM 7170  H HE21 . GLN A 1 29 ? -16.828 -1.005  2.235   1.00 0.00 ? 481 GLN C HE21 9  
ATOM 7171  H HE22 . GLN A 1 29 ? -15.468 0.023   1.991   1.00 0.00 ? 481 GLN C HE22 9  
ATOM 7172  N N    . LEU A 1 30 ? -20.506 -3.674  2.276   1.00 0.00 ? 482 LEU C N    9  
ATOM 7173  C CA   . LEU A 1 30 ? -21.913 -3.525  1.984   1.00 0.00 ? 482 LEU C CA   9  
ATOM 7174  C C    . LEU A 1 30 ? -22.721 -3.300  3.258   1.00 0.00 ? 482 LEU C C    9  
ATOM 7175  O O    . LEU A 1 30 ? -23.434 -2.308  3.387   1.00 0.00 ? 482 LEU C O    9  
ATOM 7176  C CB   . LEU A 1 30 ? -22.431 -4.783  1.275   1.00 0.00 ? 482 LEU C CB   9  
ATOM 7177  C CG   . LEU A 1 30 ? -21.551 -5.346  0.154   1.00 0.00 ? 482 LEU C CG   9  
ATOM 7178  C CD1  . LEU A 1 30 ? -22.247 -6.494  -0.547  1.00 0.00 ? 482 LEU C CD1  9  
ATOM 7179  C CD2  . LEU A 1 30 ? -21.164 -4.266  -0.836  1.00 0.00 ? 482 LEU C CD2  9  
ATOM 7180  H H    . LEU A 1 30 ? -20.165 -4.568  2.481   1.00 0.00 ? 482 LEU C H    9  
ATOM 7181  H HA   . LEU A 1 30 ? -22.038 -2.680  1.326   1.00 0.00 ? 482 LEU C HA   9  
ATOM 7182  H HB2  . LEU A 1 30 ? -22.555 -5.556  2.021   1.00 0.00 ? 482 LEU C HB2  9  
ATOM 7183  H HB3  . LEU A 1 30 ? -23.397 -4.558  0.862   1.00 0.00 ? 482 LEU C HB3  9  
ATOM 7184  H HG   . LEU A 1 30 ? -20.645 -5.736  0.594   1.00 0.00 ? 482 LEU C HG   9  
ATOM 7185  H HD11 . LEU A 1 30 ? -23.170 -6.144  -0.983  1.00 0.00 ? 482 LEU C HD11 9  
ATOM 7186  H HD12 . LEU A 1 30 ? -22.459 -7.276  0.167   1.00 0.00 ? 482 LEU C HD12 9  
ATOM 7187  H HD13 . LEU A 1 30 ? -21.606 -6.883  -1.325  1.00 0.00 ? 482 LEU C HD13 9  
ATOM 7188  H HD21 . LEU A 1 30 ? -20.579 -3.515  -0.322  1.00 0.00 ? 482 LEU C HD21 9  
ATOM 7189  H HD22 . LEU A 1 30 ? -22.051 -3.814  -1.249  1.00 0.00 ? 482 LEU C HD22 9  
ATOM 7190  H HD23 . LEU A 1 30 ? -20.571 -4.702  -1.625  1.00 0.00 ? 482 LEU C HD23 9  
ATOM 7191  N N    . THR A 1 31 ? -22.596 -4.221  4.202   1.00 0.00 ? 483 THR C N    9  
ATOM 7192  C CA   . THR A 1 31 ? -23.369 -4.155  5.424   1.00 0.00 ? 483 THR C CA   9  
ATOM 7193  C C    . THR A 1 31 ? -22.579 -3.486  6.528   1.00 0.00 ? 483 THR C C    9  
ATOM 7194  O O    . THR A 1 31 ? -23.153 -2.856  7.420   1.00 0.00 ? 483 THR C O    9  
ATOM 7195  C CB   . THR A 1 31 ? -23.795 -5.563  5.892   1.00 0.00 ? 483 THR C CB   9  
ATOM 7196  O OG1  . THR A 1 31 ? -22.633 -6.373  6.123   1.00 0.00 ? 483 THR C OG1  9  
ATOM 7197  C CG2  . THR A 1 31 ? -24.683 -6.231  4.852   1.00 0.00 ? 483 THR C CG2  9  
ATOM 7198  H H    . THR A 1 31 ? -21.953 -4.964  4.084   1.00 0.00 ? 483 THR C H    9  
ATOM 7199  H HA   . THR A 1 31 ? -24.261 -3.578  5.229   1.00 0.00 ? 483 THR C HA   9  
ATOM 7200  H HB   . THR A 1 31 ? -24.349 -5.470  6.815   1.00 0.00 ? 483 THR C HB   9  
ATOM 7201  H HG1  . THR A 1 31 ? -22.603 -7.104  5.482   1.00 0.00 ? 483 THR C HG1  9  
ATOM 7202  H HG21 . THR A 1 31 ? -24.137 -6.327  3.925   1.00 0.00 ? 483 THR C HG21 9  
ATOM 7203  H HG22 . THR A 1 31 ? -25.565 -5.629  4.691   1.00 0.00 ? 483 THR C HG22 9  
ATOM 7204  H HG23 . THR A 1 31 ? -24.972 -7.211  5.202   1.00 0.00 ? 483 THR C HG23 9  
ATOM 7205  N N    . ARG A 1 32 ? -21.245 -3.630  6.463   1.00 0.00 ? 484 ARG C N    9  
ATOM 7206  C CA   . ARG A 1 32 ? -20.339 -3.077  7.460   1.00 0.00 ? 484 ARG C CA   9  
ATOM 7207  C C    . ARG A 1 32 ? -20.623 -3.655  8.843   1.00 0.00 ? 484 ARG C C    9  
ATOM 7208  O O    . ARG A 1 32 ? -20.229 -3.086  9.857   1.00 0.00 ? 484 ARG C O    9  
ATOM 7209  C CB   . ARG A 1 32 ? -20.444 -1.561  7.492   1.00 0.00 ? 484 ARG C CB   9  
ATOM 7210  C CG   . ARG A 1 32 ? -20.129 -0.888  6.176   1.00 0.00 ? 484 ARG C CG   9  
ATOM 7211  C CD   . ARG A 1 32 ? -20.368 0.595   6.276   1.00 0.00 ? 484 ARG C CD   9  
ATOM 7212  N NE   . ARG A 1 32 ? -20.027 1.306   5.045   1.00 0.00 ? 484 ARG C NE   9  
ATOM 7213  C CZ   . ARG A 1 32 ? -19.815 2.622   4.982   1.00 0.00 ? 484 ARG C CZ   9  
ATOM 7214  N NH1  . ARG A 1 32 ? -19.924 3.367   6.079   1.00 0.00 ? 484 ARG C NH1  9  
ATOM 7215  N NH2  . ARG A 1 32 ? -19.498 3.191   3.824   1.00 0.00 ? 484 ARG C NH2  9  
ATOM 7216  H H    . ARG A 1 32 ? -20.857 -4.119  5.712   1.00 0.00 ? 484 ARG C H    9  
ATOM 7217  H HA   . ARG A 1 32 ? -19.333 -3.346  7.173   1.00 0.00 ? 484 ARG C HA   9  
ATOM 7218  H HB2  . ARG A 1 32 ? -21.446 -1.286  7.777   1.00 0.00 ? 484 ARG C HB2  9  
ATOM 7219  H HB3  . ARG A 1 32 ? -19.753 -1.194  8.231   1.00 0.00 ? 484 ARG C HB3  9  
ATOM 7220  H HG2  . ARG A 1 32 ? -19.094 -1.065  5.931   1.00 0.00 ? 484 ARG C HG2  9  
ATOM 7221  H HG3  . ARG A 1 32 ? -20.764 -1.298  5.406   1.00 0.00 ? 484 ARG C HG3  9  
ATOM 7222  H HD2  . ARG A 1 32 ? -21.411 0.752   6.497   1.00 0.00 ? 484 ARG C HD2  9  
ATOM 7223  H HD3  . ARG A 1 32 ? -19.766 0.980   7.086   1.00 0.00 ? 484 ARG C HD3  9  
ATOM 7224  H HE   . ARG A 1 32 ? -19.955 0.769   4.225   1.00 0.00 ? 484 ARG C HE   9  
ATOM 7225  H HH11 . ARG A 1 32 ? -20.169 2.947   6.958   1.00 0.00 ? 484 ARG C HH11 9  
ATOM 7226  H HH12 . ARG A 1 32 ? -19.763 4.355   6.046   1.00 0.00 ? 484 ARG C HH12 9  
ATOM 7227  H HH21 . ARG A 1 32 ? -19.419 2.633   2.994   1.00 0.00 ? 484 ARG C HH21 9  
ATOM 7228  H HH22 . ARG A 1 32 ? -19.331 4.179   3.765   1.00 0.00 ? 484 ARG C HH22 9  
ATOM 7229  N N    . SER A 1 33 ? -21.288 -4.797  8.873   1.00 0.00 ? 485 SER C N    9  
ATOM 7230  C CA   . SER A 1 33 ? -21.646 -5.425  10.117  1.00 0.00 ? 485 SER C CA   9  
ATOM 7231  C C    . SER A 1 33 ? -21.273 -6.889  10.100  1.00 0.00 ? 485 SER C C    9  
ATOM 7232  O O    . SER A 1 33 ? -21.921 -7.686  9.430   1.00 0.00 ? 485 SER C O    9  
ATOM 7233  C CB   . SER A 1 33 ? -23.147 -5.284  10.368  1.00 0.00 ? 485 SER C CB   9  
ATOM 7234  O OG   . SER A 1 33 ? -23.497 -5.734  11.674  1.00 0.00 ? 485 SER C OG   9  
ATOM 7235  H H    . SER A 1 33 ? -21.537 -5.237  8.030   1.00 0.00 ? 485 SER C H    9  
ATOM 7236  H HA   . SER A 1 33 ? -21.113 -4.933  10.910  1.00 0.00 ? 485 SER C HA   9  
ATOM 7237  H HB2  . SER A 1 33 ? -23.446 -4.256  10.252  1.00 0.00 ? 485 SER C HB2  9  
ATOM 7238  H HB3  . SER A 1 33 ? -23.678 -5.887  9.647   1.00 0.00 ? 485 SER C HB3  9  
ATOM 7239  H HG   . SER A 1 33 ? -24.070 -5.076  12.093  1.00 0.00 ? 485 SER C HG   9  
ATOM 7240  N N    . VAL A 1 34 ? -20.229 -7.240  10.842  1.00 0.00 ? 486 VAL C N    9  
ATOM 7241  C CA   . VAL A 1 34 ? -19.785 -8.626  10.936  1.00 0.00 ? 486 VAL C CA   9  
ATOM 7242  C C    . VAL A 1 34 ? -20.926 -9.530  11.408  1.00 0.00 ? 486 VAL C C    9  
ATOM 7243  O O    . VAL A 1 34 ? -21.053 -10.669 10.949  1.00 0.00 ? 486 VAL C O    9  
ATOM 7244  C CB   . VAL A 1 34 ? -18.520 -8.784  11.852  1.00 0.00 ? 486 VAL C CB   9  
ATOM 7245  C CG1  . VAL A 1 34 ? -18.396 -7.622  12.810  1.00 0.00 ? 486 VAL C CG1  9  
ATOM 7246  C CG2  . VAL A 1 34 ? -18.532 -10.102 12.625  1.00 0.00 ? 486 VAL C CG2  9  
ATOM 7247  H H    . VAL A 1 34 ? -19.749 -6.546  11.343  1.00 0.00 ? 486 VAL C H    9  
ATOM 7248  H HA   . VAL A 1 34 ? -19.515 -8.931  9.935   1.00 0.00 ? 486 VAL C HA   9  
ATOM 7249  H HB   . VAL A 1 34 ? -17.648 -8.776  11.214  1.00 0.00 ? 486 VAL C HB   9  
ATOM 7250  H HG11 . VAL A 1 34 ? -19.321 -7.497  13.349  1.00 0.00 ? 486 VAL C HG11 9  
ATOM 7251  H HG12 . VAL A 1 34 ? -18.164 -6.728  12.247  1.00 0.00 ? 486 VAL C HG12 9  
ATOM 7252  H HG13 . VAL A 1 34 ? -17.595 -7.823  13.503  1.00 0.00 ? 486 VAL C HG13 9  
ATOM 7253  H HG21 . VAL A 1 34 ? -18.588 -10.925 11.930  1.00 0.00 ? 486 VAL C HG21 9  
ATOM 7254  H HG22 . VAL A 1 34 ? -19.391 -10.126 13.281  1.00 0.00 ? 486 VAL C HG22 9  
ATOM 7255  H HG23 . VAL A 1 34 ? -17.629 -10.185 13.211  1.00 0.00 ? 486 VAL C HG23 9  
ATOM 7256  N N    . GLU A 1 35 ? -21.767 -9.005  12.303  1.00 0.00 ? 487 GLU C N    9  
ATOM 7257  C CA   . GLU A 1 35 ? -22.929 -9.743  12.789  1.00 0.00 ? 487 GLU C CA   9  
ATOM 7258  C C    . GLU A 1 35 ? -23.803 -10.165 11.619  1.00 0.00 ? 487 GLU C C    9  
ATOM 7259  O O    . GLU A 1 35 ? -24.165 -11.337 11.487  1.00 0.00 ? 487 GLU C O    9  
ATOM 7260  C CB   . GLU A 1 35 ? -23.754 -8.883  13.738  1.00 0.00 ? 487 GLU C CB   9  
ATOM 7261  C CG   . GLU A 1 35 ? -23.009 -8.395  14.960  1.00 0.00 ? 487 GLU C CG   9  
ATOM 7262  C CD   . GLU A 1 35 ? -23.872 -7.511  15.821  1.00 0.00 ? 487 GLU C CD   9  
ATOM 7263  O OE1  . GLU A 1 35 ? -24.241 -6.414  15.362  1.00 0.00 ? 487 GLU C OE1  9  
ATOM 7264  O OE2  . GLU A 1 35 ? -24.196 -7.908  16.956  1.00 0.00 ? 487 GLU C OE2  9  
ATOM 7265  H H    . GLU A 1 35 ? -21.599 -8.101  12.643  1.00 0.00 ? 487 GLU C H    9  
ATOM 7266  H HA   . GLU A 1 35 ? -22.582 -10.621 13.311  1.00 0.00 ? 487 GLU C HA   9  
ATOM 7267  H HB2  . GLU A 1 35 ? -24.110 -8.018  13.198  1.00 0.00 ? 487 GLU C HB2  9  
ATOM 7268  H HB3  . GLU A 1 35 ? -24.607 -9.458  14.070  1.00 0.00 ? 487 GLU C HB3  9  
ATOM 7269  H HG2  . GLU A 1 35 ? -22.697 -9.248  15.542  1.00 0.00 ? 487 GLU C HG2  9  
ATOM 7270  H HG3  . GLU A 1 35 ? -22.143 -7.835  14.643  1.00 0.00 ? 487 GLU C HG3  9  
ATOM 7271  N N    . ILE A 1 36 ? -24.125 -9.200  10.758  1.00 0.00 ? 488 ILE C N    9  
ATOM 7272  C CA   . ILE A 1 36 ? -24.949 -9.471  9.595   1.00 0.00 ? 488 ILE C CA   9  
ATOM 7273  C C    . ILE A 1 36 ? -24.204 -10.364 8.633   1.00 0.00 ? 488 ILE C C    9  
ATOM 7274  O O    . ILE A 1 36 ? -24.702 -11.377 8.252   1.00 0.00 ? 488 ILE C O    9  
ATOM 7275  C CB   . ILE A 1 36 ? -25.377 -8.181  8.862   1.00 0.00 ? 488 ILE C CB   9  
ATOM 7276  C CG1  . ILE A 1 36 ? -26.029 -7.199  9.840   1.00 0.00 ? 488 ILE C CG1  9  
ATOM 7277  C CG2  . ILE A 1 36 ? -26.342 -8.517  7.725   1.00 0.00 ? 488 ILE C CG2  9  
ATOM 7278  C CD1  . ILE A 1 36 ? -26.472 -5.899  9.201   1.00 0.00 ? 488 ILE C CD1  9  
ATOM 7279  H H    . ILE A 1 36 ? -23.791 -8.292  10.910  1.00 0.00 ? 488 ILE C H    9  
ATOM 7280  H HA   . ILE A 1 36 ? -25.838 -9.987  9.932   1.00 0.00 ? 488 ILE C HA   9  
ATOM 7281  H HB   . ILE A 1 36 ? -24.493 -7.734  8.432   1.00 0.00 ? 488 ILE C HB   9  
ATOM 7282  H HG12 . ILE A 1 36 ? -26.901 -7.664  10.276  1.00 0.00 ? 488 ILE C HG12 9  
ATOM 7283  H HG13 . ILE A 1 36 ? -25.325 -6.964  10.625  1.00 0.00 ? 488 ILE C HG13 9  
ATOM 7284  H HG21 . ILE A 1 36 ? -27.221 -8.995  8.129   1.00 0.00 ? 488 ILE C HG21 9  
ATOM 7285  H HG22 . ILE A 1 36 ? -25.858 -9.183  7.026   1.00 0.00 ? 488 ILE C HG22 9  
ATOM 7286  H HG23 . ILE A 1 36 ? -26.628 -7.608  7.216   1.00 0.00 ? 488 ILE C HG23 9  
ATOM 7287  H HD11 . ILE A 1 36 ? -27.195 -6.108  8.427   1.00 0.00 ? 488 ILE C HD11 9  
ATOM 7288  H HD12 . ILE A 1 36 ? -25.617 -5.399  8.770   1.00 0.00 ? 488 ILE C HD12 9  
ATOM 7289  H HD13 . ILE A 1 36 ? -26.920 -5.263  9.950   1.00 0.00 ? 488 ILE C HD13 9  
ATOM 7290  N N    . THR A 1 37 ? -22.997 -9.959  8.261   1.00 0.00 ? 489 THR C N    9  
ATOM 7291  C CA   . THR A 1 37 ? -22.133 -10.716 7.365   1.00 0.00 ? 489 THR C CA   9  
ATOM 7292  C C    . THR A 1 37 ? -22.048 -12.205 7.747   1.00 0.00 ? 489 THR C C    9  
ATOM 7293  O O    . THR A 1 37 ? -22.124 -13.072 6.882   1.00 0.00 ? 489 THR C O    9  
ATOM 7294  C CB   . THR A 1 37 ? -20.725 -10.108 7.359   1.00 0.00 ? 489 THR C CB   9  
ATOM 7295  O OG1  . THR A 1 37 ? -20.816 -8.714  7.055   1.00 0.00 ? 489 THR C OG1  9  
ATOM 7296  C CG2  . THR A 1 37 ? -19.835 -10.784 6.332   1.00 0.00 ? 489 THR C CG2  9  
ATOM 7297  H H    . THR A 1 37 ? -22.668 -9.094  8.579   1.00 0.00 ? 489 THR C H    9  
ATOM 7298  H HA   . THR A 1 37 ? -22.534 -10.633 6.366   1.00 0.00 ? 489 THR C HA   9  
ATOM 7299  H HB   . THR A 1 37 ? -20.295 -10.237 8.342   1.00 0.00 ? 489 THR C HB   9  
ATOM 7300  H HG1  . THR A 1 37 ? -21.295 -8.611  6.214   1.00 0.00 ? 489 THR C HG1  9  
ATOM 7301  H HG21 . THR A 1 37 ? -20.309 -10.743 5.363   1.00 0.00 ? 489 THR C HG21 9  
ATOM 7302  H HG22 . THR A 1 37 ? -19.664 -11.811 6.615   1.00 0.00 ? 489 THR C HG22 9  
ATOM 7303  H HG23 . THR A 1 37 ? -18.892 -10.255 6.288   1.00 0.00 ? 489 THR C HG23 9  
ATOM 7304  N N    . THR A 1 38 ? -21.920 -12.495 9.038   1.00 0.00 ? 490 THR C N    9  
ATOM 7305  C CA   . THR A 1 38 ? -21.826 -13.869 9.495   1.00 0.00 ? 490 THR C CA   9  
ATOM 7306  C C    . THR A 1 38 ? -23.141 -14.605 9.247   1.00 0.00 ? 490 THR C C    9  
ATOM 7307  O O    . THR A 1 38 ? -23.152 -15.727 8.733   1.00 0.00 ? 490 THR C O    9  
ATOM 7308  C CB   . THR A 1 38 ? -21.462 -13.949 10.991  1.00 0.00 ? 490 THR C CB   9  
ATOM 7309  O OG1  . THR A 1 38 ? -20.286 -13.163 11.254  1.00 0.00 ? 490 THR C OG1  9  
ATOM 7310  C CG2  . THR A 1 38 ? -21.194 -15.386 11.391  1.00 0.00 ? 490 THR C CG2  9  
ATOM 7311  H H    . THR A 1 38 ? -21.900 -11.771 9.697   1.00 0.00 ? 490 THR C H    9  
ATOM 7312  H HA   . THR A 1 38 ? -21.051 -14.357 8.923   1.00 0.00 ? 490 THR C HA   9  
ATOM 7313  H HB   . THR A 1 38 ? -22.286 -13.568 11.576  1.00 0.00 ? 490 THR C HB   9  
ATOM 7314  H HG1  . THR A 1 38 ? -20.430 -12.260 10.940  1.00 0.00 ? 490 THR C HG1  9  
ATOM 7315  H HG21 . THR A 1 38 ? -20.409 -15.788 10.764  1.00 0.00 ? 490 THR C HG21 9  
ATOM 7316  H HG22 . THR A 1 38 ? -22.095 -15.970 11.261  1.00 0.00 ? 490 THR C HG22 9  
ATOM 7317  H HG23 . THR A 1 38 ? -20.883 -15.422 12.425  1.00 0.00 ? 490 THR C HG23 9  
ATOM 7318  N N    . ASP A 1 39 ? -24.243 -13.956 9.584   1.00 0.00 ? 491 ASP C N    9  
ATOM 7319  C CA   . ASP A 1 39 ? -25.565 -14.540 9.368   1.00 0.00 ? 491 ASP C CA   9  
ATOM 7320  C C    . ASP A 1 39 ? -25.863 -14.556 7.877   1.00 0.00 ? 491 ASP C C    9  
ATOM 7321  O O    . ASP A 1 39 ? -26.537 -15.447 7.370   1.00 0.00 ? 491 ASP C O    9  
ATOM 7322  C CB   . ASP A 1 39 ? -26.630 -13.740 10.122  1.00 0.00 ? 491 ASP C CB   9  
ATOM 7323  C CG   . ASP A 1 39 ? -27.981 -14.423 10.125  1.00 0.00 ? 491 ASP C CG   9  
ATOM 7324  O OD1  . ASP A 1 39 ? -28.079 -15.551 10.644  1.00 0.00 ? 491 ASP C OD1  9  
ATOM 7325  O OD2  . ASP A 1 39 ? -28.947 -13.835 9.617   1.00 0.00 ? 491 ASP C OD2  9  
ATOM 7326  H H    . ASP A 1 39 ? -24.171 -13.058 9.974   1.00 0.00 ? 491 ASP C H    9  
ATOM 7327  H HA   . ASP A 1 39 ? -25.551 -15.557 9.732   1.00 0.00 ? 491 ASP C HA   9  
ATOM 7328  H HB2  . ASP A 1 39 ? -26.313 -13.601 11.144  1.00 0.00 ? 491 ASP C HB2  9  
ATOM 7329  H HB3  . ASP A 1 39 ? -26.737 -12.773 9.652   1.00 0.00 ? 491 ASP C HB3  9  
ATOM 7330  N N    . ASN A 1 40 ? -25.317 -13.562 7.188   1.00 0.00 ? 492 ASN C N    9  
ATOM 7331  C CA   . ASN A 1 40 ? -25.413 -13.429 5.748   1.00 0.00 ? 492 ASN C CA   9  
ATOM 7332  C C    . ASN A 1 40 ? -24.854 -14.676 5.088   1.00 0.00 ? 492 ASN C C    9  
ATOM 7333  O O    . ASN A 1 40 ? -25.479 -15.260 4.204   1.00 0.00 ? 492 ASN C O    9  
ATOM 7334  C CB   . ASN A 1 40 ? -24.637 -12.175 5.272   1.00 0.00 ? 492 ASN C CB   9  
ATOM 7335  C CG   . ASN A 1 40 ? -25.541 -11.014 4.916   1.00 0.00 ? 492 ASN C CG   9  
ATOM 7336  O OD1  . ASN A 1 40 ? -26.703 -11.203 4.559   1.00 0.00 ? 492 ASN C OD1  9  
ATOM 7337  N ND2  . ASN A 1 40 ? -25.004 -9.809  4.969   1.00 0.00 ? 492 ASN C ND2  9  
ATOM 7338  H H    . ASN A 1 40 ? -24.832 -12.868 7.689   1.00 0.00 ? 492 ASN C H    9  
ATOM 7339  H HA   . ASN A 1 40 ? -26.455 -13.308 5.497   1.00 0.00 ? 492 ASN C HA   9  
ATOM 7340  H HB2  . ASN A 1 40 ? -23.998 -11.847 6.078   1.00 0.00 ? 492 ASN C HB2  9  
ATOM 7341  H HB3  . ASN A 1 40 ? -24.016 -12.408 4.427   1.00 0.00 ? 492 ASN C HB3  9  
ATOM 7342  H HD21 . ASN A 1 40 ? -24.056 -9.727  5.225   1.00 0.00 ? 492 ASN C HD21 9  
ATOM 7343  H HD22 . ASN A 1 40 ? -25.564 -9.039  4.757   1.00 0.00 ? 492 ASN C HD22 9  
ATOM 7344  N N    . ILE A 1 41 ? -23.673 -15.084 5.539   1.00 0.00 ? 493 ILE C N    9  
ATOM 7345  C CA   . ILE A 1 41 ? -23.035 -16.306 5.067   1.00 0.00 ? 493 ILE C CA   9  
ATOM 7346  C C    . ILE A 1 41 ? -23.981 -17.483 5.253   1.00 0.00 ? 493 ILE C C    9  
ATOM 7347  O O    . ILE A 1 41 ? -24.223 -18.266 4.334   1.00 0.00 ? 493 ILE C O    9  
ATOM 7348  C CB   . ILE A 1 41 ? -21.754 -16.605 5.882   1.00 0.00 ? 493 ILE C CB   9  
ATOM 7349  C CG1  . ILE A 1 41 ? -20.747 -15.475 5.751   1.00 0.00 ? 493 ILE C CG1  9  
ATOM 7350  C CG2  . ILE A 1 41 ? -21.135 -17.920 5.441   1.00 0.00 ? 493 ILE C CG2  9  
ATOM 7351  C CD1  . ILE A 1 41 ? -19.626 -15.546 6.766   1.00 0.00 ? 493 ILE C CD1  9  
ATOM 7352  H H    . ILE A 1 41 ? -23.205 -14.537 6.211   1.00 0.00 ? 493 ILE C H    9  
ATOM 7353  H HA   . ILE A 1 41 ? -22.778 -16.186 4.025   1.00 0.00 ? 493 ILE C HA   9  
ATOM 7354  H HB   . ILE A 1 41 ? -22.035 -16.701 6.922   1.00 0.00 ? 493 ILE C HB   9  
ATOM 7355  H HG12 . ILE A 1 41 ? -20.311 -15.501 4.766   1.00 0.00 ? 493 ILE C HG12 9  
ATOM 7356  H HG13 . ILE A 1 41 ? -21.262 -14.537 5.886   1.00 0.00 ? 493 ILE C HG13 9  
ATOM 7357  H HG21 . ILE A 1 41 ? -20.795 -17.829 4.420   1.00 0.00 ? 493 ILE C HG21 9  
ATOM 7358  H HG22 . ILE A 1 41 ? -21.873 -18.705 5.508   1.00 0.00 ? 493 ILE C HG22 9  
ATOM 7359  H HG23 . ILE A 1 41 ? -20.298 -18.155 6.081   1.00 0.00 ? 493 ILE C HG23 9  
ATOM 7360  H HD11 . ILE A 1 41 ? -19.047 -16.439 6.609   1.00 0.00 ? 493 ILE C HD11 9  
ATOM 7361  H HD12 . ILE A 1 41 ? -20.047 -15.571 7.760   1.00 0.00 ? 493 ILE C HD12 9  
ATOM 7362  H HD13 . ILE A 1 41 ? -18.991 -14.679 6.671   1.00 0.00 ? 493 ILE C HD13 9  
ATOM 7363  N N    . LEU A 1 42 ? -24.530 -17.565 6.447   1.00 0.00 ? 494 LEU C N    9  
ATOM 7364  C CA   . LEU A 1 42 ? -25.410 -18.647 6.847   1.00 0.00 ? 494 LEU C CA   9  
ATOM 7365  C C    . LEU A 1 42 ? -26.744 -18.628 6.083   1.00 0.00 ? 494 LEU C C    9  
ATOM 7366  O O    . LEU A 1 42 ? -27.453 -19.633 6.040   1.00 0.00 ? 494 LEU C O    9  
ATOM 7367  C CB   . LEU A 1 42 ? -25.622 -18.580 8.356   1.00 0.00 ? 494 LEU C CB   9  
ATOM 7368  C CG   . LEU A 1 42 ? -24.336 -18.737 9.181   1.00 0.00 ? 494 LEU C CG   9  
ATOM 7369  C CD1  . LEU A 1 42 ? -24.577 -18.429 10.644  1.00 0.00 ? 494 LEU C CD1  9  
ATOM 7370  C CD2  . LEU A 1 42 ? -23.764 -20.136 9.018   1.00 0.00 ? 494 LEU C CD2  9  
ATOM 7371  H H    . LEU A 1 42 ? -24.331 -16.861 7.102   1.00 0.00 ? 494 LEU C H    9  
ATOM 7372  H HA   . LEU A 1 42 ? -24.906 -19.573 6.615   1.00 0.00 ? 494 LEU C HA   9  
ATOM 7373  H HB2  . LEU A 1 42 ? -26.065 -17.624 8.591   1.00 0.00 ? 494 LEU C HB2  9  
ATOM 7374  H HB3  . LEU A 1 42 ? -26.307 -19.359 8.648   1.00 0.00 ? 494 LEU C HB3  9  
ATOM 7375  H HG   . LEU A 1 42 ? -23.602 -18.035 8.815   1.00 0.00 ? 494 LEU C HG   9  
ATOM 7376  H HD11 . LEU A 1 42 ? -25.385 -19.040 11.015  1.00 0.00 ? 494 LEU C HD11 9  
ATOM 7377  H HD12 . LEU A 1 42 ? -24.819 -17.383 10.758  1.00 0.00 ? 494 LEU C HD12 9  
ATOM 7378  H HD13 . LEU A 1 42 ? -23.675 -18.652 11.197  1.00 0.00 ? 494 LEU C HD13 9  
ATOM 7379  H HD21 . LEU A 1 42 ? -23.509 -20.305 7.982   1.00 0.00 ? 494 LEU C HD21 9  
ATOM 7380  H HD22 . LEU A 1 42 ? -24.496 -20.864 9.332   1.00 0.00 ? 494 LEU C HD22 9  
ATOM 7381  H HD23 . LEU A 1 42 ? -22.878 -20.234 9.627   1.00 0.00 ? 494 LEU C HD23 9  
ATOM 7382  N N    . GLU A 1 43 ? -27.075 -17.486 5.484   1.00 0.00 ? 495 GLU C N    9  
ATOM 7383  C CA   . GLU A 1 43 ? -28.282 -17.374 4.661   1.00 0.00 ? 495 GLU C CA   9  
ATOM 7384  C C    . GLU A 1 43 ? -27.957 -17.667 3.200   1.00 0.00 ? 495 GLU C C    9  
ATOM 7385  O O    . GLU A 1 43 ? -28.831 -17.603 2.330   1.00 0.00 ? 495 GLU C O    9  
ATOM 7386  C CB   . GLU A 1 43 ? -28.904 -15.978 4.762   1.00 0.00 ? 495 GLU C CB   9  
ATOM 7387  C CG   . GLU A 1 43 ? -29.439 -15.618 6.132   1.00 0.00 ? 495 GLU C CG   9  
ATOM 7388  C CD   . GLU A 1 43 ? -30.289 -14.367 6.098   1.00 0.00 ? 495 GLU C CD   9  
ATOM 7389  O OE1  . GLU A 1 43 ? -29.733 -13.262 5.929   1.00 0.00 ? 495 GLU C OE1  9  
ATOM 7390  O OE2  . GLU A 1 43 ? -31.525 -14.484 6.216   1.00 0.00 ? 495 GLU C OE2  9  
ATOM 7391  H H    . GLU A 1 43 ? -26.504 -16.697 5.610   1.00 0.00 ? 495 GLU C H    9  
ATOM 7392  H HA   . GLU A 1 43 ? -28.995 -18.106 5.015   1.00 0.00 ? 495 GLU C HA   9  
ATOM 7393  H HB2  . GLU A 1 43 ? -28.157 -15.248 4.495   1.00 0.00 ? 495 GLU C HB2  9  
ATOM 7394  H HB3  . GLU A 1 43 ? -29.719 -15.913 4.054   1.00 0.00 ? 495 GLU C HB3  9  
ATOM 7395  H HG2  . GLU A 1 43 ? -30.041 -16.436 6.499   1.00 0.00 ? 495 GLU C HG2  9  
ATOM 7396  H HG3  . GLU A 1 43 ? -28.606 -15.453 6.800   1.00 0.00 ? 495 GLU C HG3  9  
ATOM 7397  N N    . GLY A 1 44 ? -26.697 -17.969 2.930   1.00 0.00 ? 496 GLY C N    9  
ATOM 7398  C CA   . GLY A 1 44 ? -26.276 -18.252 1.574   1.00 0.00 ? 496 GLY C CA   9  
ATOM 7399  C C    . GLY A 1 44 ? -26.031 -16.990 0.774   1.00 0.00 ? 496 GLY C C    9  
ATOM 7400  O O    . GLY A 1 44 ? -26.010 -17.017 -0.454  1.00 0.00 ? 496 GLY C O    9  
ATOM 7401  H H    . GLY A 1 44 ? -26.043 -18.009 3.663   1.00 0.00 ? 496 GLY C H    9  
ATOM 7402  H HA2  . GLY A 1 44 ? -25.364 -18.829 1.604   1.00 0.00 ? 496 GLY C HA2  9  
ATOM 7403  H HA3  . GLY A 1 44 ? -27.042 -18.833 1.084   1.00 0.00 ? 496 GLY C HA3  9  
ATOM 7404  N N    . ARG A 1 45 ? -25.852 -15.876 1.477   1.00 0.00 ? 497 ARG C N    9  
ATOM 7405  C CA   . ARG A 1 45 ? -25.598 -14.594 0.831   1.00 0.00 ? 497 ARG C CA   9  
ATOM 7406  C C    . ARG A 1 45 ? -24.209 -14.590 0.221   1.00 0.00 ? 497 ARG C C    9  
ATOM 7407  O O    . ARG A 1 45 ? -23.978 -14.004 -0.836  1.00 0.00 ? 497 ARG C O    9  
ATOM 7408  C CB   . ARG A 1 45 ? -25.716 -13.459 1.851   1.00 0.00 ? 497 ARG C CB   9  
ATOM 7409  C CG   . ARG A 1 45 ? -25.548 -12.068 1.264   1.00 0.00 ? 497 ARG C CG   9  
ATOM 7410  C CD   . ARG A 1 45 ? -26.696 -11.712 0.337   1.00 0.00 ? 497 ARG C CD   9  
ATOM 7411  N NE   . ARG A 1 45 ? -26.557 -10.366 -0.204  1.00 0.00 ? 497 ARG C NE   9  
ATOM 7412  C CZ   . ARG A 1 45 ? -27.567 -9.518  -0.390  1.00 0.00 ? 497 ARG C CZ   9  
ATOM 7413  N NH1  . ARG A 1 45 ? -28.814 -9.879  -0.100  1.00 0.00 ? 497 ARG C NH1  9  
ATOM 7414  N NH2  . ARG A 1 45 ? -27.329 -8.310  -0.872  1.00 0.00 ? 497 ARG C NH2  9  
ATOM 7415  H H    . ARG A 1 45 ? -25.896 -15.917 2.458   1.00 0.00 ? 497 ARG C H    9  
ATOM 7416  H HA   . ARG A 1 45 ? -26.332 -14.454 0.055   1.00 0.00 ? 497 ARG C HA   9  
ATOM 7417  H HB2  . ARG A 1 45 ? -26.691 -13.512 2.314   1.00 0.00 ? 497 ARG C HB2  9  
ATOM 7418  H HB3  . ARG A 1 45 ? -24.960 -13.601 2.614   1.00 0.00 ? 497 ARG C HB3  9  
ATOM 7419  H HG2  . ARG A 1 45 ? -25.512 -11.349 2.068   1.00 0.00 ? 497 ARG C HG2  9  
ATOM 7420  H HG3  . ARG A 1 45 ? -24.623 -12.034 0.706   1.00 0.00 ? 497 ARG C HG3  9  
ATOM 7421  H HD2  . ARG A 1 45 ? -26.721 -12.418 -0.479  1.00 0.00 ? 497 ARG C HD2  9  
ATOM 7422  H HD3  . ARG A 1 45 ? -27.617 -11.771 0.894   1.00 0.00 ? 497 ARG C HD3  9  
ATOM 7423  H HE   . ARG A 1 45 ? -25.647 -10.076 -0.446  1.00 0.00 ? 497 ARG C HE   9  
ATOM 7424  H HH11 . ARG A 1 45 ? -29.013 -10.798 0.257   1.00 0.00 ? 497 ARG C HH11 9  
ATOM 7425  H HH12 . ARG A 1 45 ? -29.576 -9.241  -0.232  1.00 0.00 ? 497 ARG C HH12 9  
ATOM 7426  H HH21 . ARG A 1 45 ? -26.388 -8.034  -1.100  1.00 0.00 ? 497 ARG C HH21 9  
ATOM 7427  H HH22 . ARG A 1 45 ? -28.080 -7.663  -1.019  1.00 0.00 ? 497 ARG C HH22 9  
ATOM 7428  N N    . ILE A 1 46 ? -23.296 -15.253 0.892   1.00 0.00 ? 498 ILE C N    9  
ATOM 7429  C CA   . ILE A 1 46 ? -21.926 -15.333 0.452   1.00 0.00 ? 498 ILE C CA   9  
ATOM 7430  C C    . ILE A 1 46 ? -21.616 -16.754 0.008   1.00 0.00 ? 498 ILE C C    9  
ATOM 7431  O O    . ILE A 1 46 ? -21.654 -17.686 0.812   1.00 0.00 ? 498 ILE C O    9  
ATOM 7432  C CB   . ILE A 1 46 ? -20.960 -14.901 1.584   1.00 0.00 ? 498 ILE C CB   9  
ATOM 7433  C CG1  . ILE A 1 46 ? -21.244 -13.444 1.979   1.00 0.00 ? 498 ILE C CG1  9  
ATOM 7434  C CG2  . ILE A 1 46 ? -19.511 -15.067 1.150   1.00 0.00 ? 498 ILE C CG2  9  
ATOM 7435  C CD1  . ILE A 1 46 ? -20.480 -12.968 3.197   1.00 0.00 ? 498 ILE C CD1  9  
ATOM 7436  H H    . ILE A 1 46 ? -23.560 -15.726 1.708   1.00 0.00 ? 498 ILE C H    9  
ATOM 7437  H HA   . ILE A 1 46 ? -21.801 -14.665 -0.385  1.00 0.00 ? 498 ILE C HA   9  
ATOM 7438  H HB   . ILE A 1 46 ? -21.132 -15.535 2.440   1.00 0.00 ? 498 ILE C HB   9  
ATOM 7439  H HG12 . ILE A 1 46 ? -20.979 -12.797 1.155   1.00 0.00 ? 498 ILE C HG12 9  
ATOM 7440  H HG13 . ILE A 1 46 ? -22.298 -13.338 2.185   1.00 0.00 ? 498 ILE C HG13 9  
ATOM 7441  H HG21 . ILE A 1 46 ? -19.321 -16.104 0.919   1.00 0.00 ? 498 ILE C HG21 9  
ATOM 7442  H HG22 . ILE A 1 46 ? -18.859 -14.747 1.949   1.00 0.00 ? 498 ILE C HG22 9  
ATOM 7443  H HG23 . ILE A 1 46 ? -19.330 -14.463 0.273   1.00 0.00 ? 498 ILE C HG23 9  
ATOM 7444  H HD11 . ILE A 1 46 ? -19.420 -13.066 3.019   1.00 0.00 ? 498 ILE C HD11 9  
ATOM 7445  H HD12 . ILE A 1 46 ? -20.762 -13.563 4.052   1.00 0.00 ? 498 ILE C HD12 9  
ATOM 7446  H HD13 . ILE A 1 46 ? -20.721 -11.933 3.389   1.00 0.00 ? 498 ILE C HD13 9  
ATOM 7447  N N    . GLN A 1 47 ? -21.340 -16.913 -1.275  1.00 0.00 ? 499 GLN C N    9  
ATOM 7448  C CA   . GLN A 1 47 ? -21.054 -18.220 -1.842  1.00 0.00 ? 499 GLN C CA   9  
ATOM 7449  C C    . GLN A 1 47 ? -19.715 -18.744 -1.345  1.00 0.00 ? 499 GLN C C    9  
ATOM 7450  O O    . GLN A 1 47 ? -18.665 -18.152 -1.610  1.00 0.00 ? 499 GLN C O    9  
ATOM 7451  C CB   . GLN A 1 47 ? -21.052 -18.152 -3.373  1.00 0.00 ? 499 GLN C CB   9  
ATOM 7452  C CG   . GLN A 1 47 ? -20.875 -19.503 -4.052  1.00 0.00 ? 499 GLN C CG   9  
ATOM 7453  C CD   . GLN A 1 47 ? -22.033 -20.446 -3.784  1.00 0.00 ? 499 GLN C CD   9  
ATOM 7454  O OE1  . GLN A 1 47 ? -23.173 -20.015 -3.605  1.00 0.00 ? 499 GLN C OE1  9  
ATOM 7455  N NE2  . GLN A 1 47 ? -21.752 -21.731 -3.743  1.00 0.00 ? 499 GLN C NE2  9  
ATOM 7456  H H    . GLN A 1 47 ? -21.325 -16.127 -1.862  1.00 0.00 ? 499 GLN C H    9  
ATOM 7457  H HA   . GLN A 1 47 ? -21.832 -18.897 -1.525  1.00 0.00 ? 499 GLN C HA   9  
ATOM 7458  H HB2  . GLN A 1 47 ? -21.990 -17.729 -3.703  1.00 0.00 ? 499 GLN C HB2  9  
ATOM 7459  H HB3  . GLN A 1 47 ? -20.247 -17.504 -3.691  1.00 0.00 ? 499 GLN C HB3  9  
ATOM 7460  H HG2  . GLN A 1 47 ? -20.795 -19.349 -5.116  1.00 0.00 ? 499 GLN C HG2  9  
ATOM 7461  H HG3  . GLN A 1 47 ? -19.967 -19.958 -3.685  1.00 0.00 ? 499 GLN C HG3  9  
ATOM 7462  H HE21 . GLN A 1 47 ? -20.821 -22.004 -3.884  1.00 0.00 ? 499 GLN C HE21 9  
ATOM 7463  H HE22 . GLN A 1 47 ? -22.483 -22.363 -3.573  1.00 0.00 ? 499 GLN C HE22 9  
ATOM 7464  N N    . VAL A 1 48 ? -19.755 -19.845 -0.627  1.00 0.00 ? 500 VAL C N    9  
ATOM 7465  C CA   . VAL A 1 48 ? -18.552 -20.458 -0.117  1.00 0.00 ? 500 VAL C CA   9  
ATOM 7466  C C    . VAL A 1 48 ? -17.952 -21.389 -1.169  1.00 0.00 ? 500 VAL C C    9  
ATOM 7467  O O    . VAL A 1 48 ? -18.671 -21.893 -2.041  1.00 0.00 ? 500 VAL C O    9  
ATOM 7468  C CB   . VAL A 1 48 ? -18.812 -21.242 1.197   1.00 0.00 ? 500 VAL C CB   9  
ATOM 7469  C CG1  . VAL A 1 48 ? -19.207 -20.298 2.323   1.00 0.00 ? 500 VAL C CG1  9  
ATOM 7470  C CG2  . VAL A 1 48 ? -19.879 -22.308 0.996   1.00 0.00 ? 500 VAL C CG2  9  
ATOM 7471  H H    . VAL A 1 48 ? -20.619 -20.263 -0.439  1.00 0.00 ? 500 VAL C H    9  
ATOM 7472  H HA   . VAL A 1 48 ? -17.849 -19.666 0.089   1.00 0.00 ? 500 VAL C HA   9  
ATOM 7473  H HB   . VAL A 1 48 ? -17.893 -21.732 1.479   1.00 0.00 ? 500 VAL C HB   9  
ATOM 7474  H HG11 . VAL A 1 48 ? -18.439 -19.550 2.451   1.00 0.00 ? 500 VAL C HG11 9  
ATOM 7475  H HG12 . VAL A 1 48 ? -19.316 -20.859 3.240   1.00 0.00 ? 500 VAL C HG12 9  
ATOM 7476  H HG13 . VAL A 1 48 ? -20.144 -19.814 2.088   1.00 0.00 ? 500 VAL C HG13 9  
ATOM 7477  H HG21 . VAL A 1 48 ? -19.555 -23.003 0.236   1.00 0.00 ? 500 VAL C HG21 9  
ATOM 7478  H HG22 . VAL A 1 48 ? -20.800 -21.838 0.685   1.00 0.00 ? 500 VAL C HG22 9  
ATOM 7479  H HG23 . VAL A 1 48 ? -20.040 -22.837 1.923   1.00 0.00 ? 500 VAL C HG23 9  
ATOM 7480  N N    . PRO A 1 49 ? -16.632 -21.616 -1.122  1.00 0.00 ? 501 PRO C N    9  
ATOM 7481  C CA   . PRO A 1 49 ? -15.954 -22.484 -2.075  1.00 0.00 ? 501 PRO C CA   9  
ATOM 7482  C C    . PRO A 1 49 ? -16.306 -23.950 -1.857  1.00 0.00 ? 501 PRO C C    9  
ATOM 7483  O O    . PRO A 1 49 ? -16.896 -24.321 -0.835  1.00 0.00 ? 501 PRO C O    9  
ATOM 7484  C CB   . PRO A 1 49 ? -14.455 -22.250 -1.793  1.00 0.00 ? 501 PRO C CB   9  
ATOM 7485  C CG   . PRO A 1 49 ? -14.403 -21.062 -0.891  1.00 0.00 ? 501 PRO C CG   9  
ATOM 7486  C CD   . PRO A 1 49 ? -15.698 -21.059 -0.145  1.00 0.00 ? 501 PRO C CD   9  
ATOM 7487  H HA   . PRO A 1 49 ? -16.179 -22.209 -3.094  1.00 0.00 ? 501 PRO C HA   9  
ATOM 7488  H HB2  . PRO A 1 49 ? -14.038 -23.126 -1.317  1.00 0.00 ? 501 PRO C HB2  9  
ATOM 7489  H HB3  . PRO A 1 49 ? -13.938 -22.062 -2.721  1.00 0.00 ? 501 PRO C HB3  9  
ATOM 7490  H HG2  . PRO A 1 49 ? -13.575 -21.157 -0.205  1.00 0.00 ? 501 PRO C HG2  9  
ATOM 7491  H HG3  . PRO A 1 49 ? -14.304 -20.161 -1.476  1.00 0.00 ? 501 PRO C HG3  9  
ATOM 7492  H HD2  . PRO A 1 49 ? -15.632 -21.690 0.729   1.00 0.00 ? 501 PRO C HD2  9  
ATOM 7493  H HD3  . PRO A 1 49 ? -15.976 -20.053 0.130   1.00 0.00 ? 501 PRO C HD3  9  
ATOM 7494  N N    . PHE A 1 50 ? -15.951 -24.770 -2.811  1.00 0.00 ? 502 PHE C N    9  
ATOM 7495  C CA   . PHE A 1 50 ? -16.203 -26.186 -2.730  1.00 0.00 ? 502 PHE C CA   9  
ATOM 7496  C C    . PHE A 1 50 ? -14.932 -26.900 -2.312  1.00 0.00 ? 502 PHE C C    9  
ATOM 7497  O O    . PHE A 1 50 ? -13.835 -26.458 -2.663  1.00 0.00 ? 502 PHE C O    9  
ATOM 7498  C CB   . PHE A 1 50 ? -16.701 -26.724 -4.077  1.00 0.00 ? 502 PHE C CB   9  
ATOM 7499  C CG   . PHE A 1 50 ? -18.048 -26.195 -4.485  1.00 0.00 ? 502 PHE C CG   9  
ATOM 7500  C CD1  . PHE A 1 50 ? -18.156 -25.028 -5.227  1.00 0.00 ? 502 PHE C CD1  9  
ATOM 7501  C CD2  . PHE A 1 50 ? -19.206 -26.863 -4.124  1.00 0.00 ? 502 PHE C CD2  9  
ATOM 7502  C CE1  . PHE A 1 50 ? -19.393 -24.541 -5.600  1.00 0.00 ? 502 PHE C CE1  9  
ATOM 7503  C CE2  . PHE A 1 50 ? -20.446 -26.381 -4.496  1.00 0.00 ? 502 PHE C CE2  9  
ATOM 7504  C CZ   . PHE A 1 50 ? -20.540 -25.219 -5.235  1.00 0.00 ? 502 PHE C CZ   9  
ATOM 7505  H H    . PHE A 1 50 ? -15.480 -24.418 -3.597  1.00 0.00 ? 502 PHE C H    9  
ATOM 7506  H HA   . PHE A 1 50 ? -16.963 -26.347 -1.981  1.00 0.00 ? 502 PHE C HA   9  
ATOM 7507  H HB2  . PHE A 1 50 ? -15.994 -26.455 -4.847  1.00 0.00 ? 502 PHE C HB2  9  
ATOM 7508  H HB3  . PHE A 1 50 ? -16.769 -27.802 -4.021  1.00 0.00 ? 502 PHE C HB3  9  
ATOM 7509  H HD1  . PHE A 1 50 ? -17.259 -24.498 -5.514  1.00 0.00 ? 502 PHE C HD1  9  
ATOM 7510  H HD2  . PHE A 1 50 ? -19.133 -27.773 -3.546  1.00 0.00 ? 502 PHE C HD2  9  
ATOM 7511  H HE1  . PHE A 1 50 ? -19.464 -23.632 -6.178  1.00 0.00 ? 502 PHE C HE1  9  
ATOM 7512  H HE2  . PHE A 1 50 ? -21.341 -26.913 -4.210  1.00 0.00 ? 502 PHE C HE2  9  
ATOM 7513  H HZ   . PHE A 1 50 ? -21.509 -24.839 -5.527  1.00 0.00 ? 502 PHE C HZ   9  
ATOM 7514  N N    . PRO A 1 51 ? -15.060 -27.995 -1.536  1.00 0.00 ? 503 PRO C N    9  
ATOM 7515  C CA   . PRO A 1 51 ? -13.913 -28.779 -1.056  1.00 0.00 ? 503 PRO C CA   9  
ATOM 7516  C C    . PRO A 1 51 ? -12.894 -29.056 -2.161  1.00 0.00 ? 503 PRO C C    9  
ATOM 7517  O O    . PRO A 1 51 ? -13.228 -29.629 -3.206  1.00 0.00 ? 503 PRO C O    9  
ATOM 7518  C CB   . PRO A 1 51 ? -14.564 -30.077 -0.589  1.00 0.00 ? 503 PRO C CB   9  
ATOM 7519  C CG   . PRO A 1 51 ? -15.914 -29.659 -0.132  1.00 0.00 ? 503 PRO C CG   9  
ATOM 7520  C CD   . PRO A 1 51 ? -16.340 -28.551 -1.057  1.00 0.00 ? 503 PRO C CD   9  
ATOM 7521  H HA   . PRO A 1 51 ? -13.423 -28.296 -0.225  1.00 0.00 ? 503 PRO C HA   9  
ATOM 7522  H HB2  . PRO A 1 51 ? -14.620 -30.774 -1.412  1.00 0.00 ? 503 PRO C HB2  9  
ATOM 7523  H HB3  . PRO A 1 51 ? -13.993 -30.504 0.219   1.00 0.00 ? 503 PRO C HB3  9  
ATOM 7524  H HG2  . PRO A 1 51 ? -16.599 -30.490 -0.201  1.00 0.00 ? 503 PRO C HG2  9  
ATOM 7525  H HG3  . PRO A 1 51 ? -15.863 -29.298 0.885   1.00 0.00 ? 503 PRO C HG3  9  
ATOM 7526  H HD2  . PRO A 1 51 ? -16.923 -28.946 -1.876  1.00 0.00 ? 503 PRO C HD2  9  
ATOM 7527  H HD3  . PRO A 1 51 ? -16.905 -27.807 -0.513  1.00 0.00 ? 503 PRO C HD3  9  
ATOM 7528  N N    . THR A 1 52 ? -11.667 -28.645 -1.930  1.00 0.00 ? 504 THR C N    9  
ATOM 7529  C CA   . THR A 1 52 ? -10.619 -28.810 -2.898  1.00 0.00 ? 504 THR C CA   9  
ATOM 7530  C C    . THR A 1 52 ? -9.261  -28.998 -2.199  1.00 0.00 ? 504 THR C C    9  
ATOM 7531  O O    . THR A 1 52 ? -8.743  -30.130 -2.222  1.00 0.00 ? 504 THR C O    9  
ATOM 7532  C CB   . THR A 1 52 ? -10.587 -27.618 -3.917  1.00 0.00 ? 504 THR C CB   9  
ATOM 7533  O OG1  . THR A 1 52 ? -9.511  -27.775 -4.853  1.00 0.00 ? 504 THR C OG1  9  
ATOM 7534  C CG2  . THR A 1 52 ? -10.467 -26.268 -3.212  1.00 0.00 ? 504 THR C CG2  9  
ATOM 7535  O OXT  . THR A 1 52 ? -8.736  -28.035 -1.600  1.00 0.00 ? 504 THR C OXT  9  
ATOM 7536  H H    . THR A 1 52 ? -11.457 -28.214 -1.073  1.00 0.00 ? 504 THR C H    9  
ATOM 7537  H HA   . THR A 1 52 ? -10.837 -29.714 -3.447  1.00 0.00 ? 504 THR C HA   9  
ATOM 7538  H HB   . THR A 1 52 ? -11.520 -27.633 -4.469  1.00 0.00 ? 504 THR C HB   9  
ATOM 7539  H HG1  . THR A 1 52 ? -9.481  -28.694 -5.148  1.00 0.00 ? 504 THR C HG1  9  
ATOM 7540  H HG21 . THR A 1 52 ? -9.556  -26.245 -2.636  1.00 0.00 ? 504 THR C HG21 9  
ATOM 7541  H HG22 . THR A 1 52 ? -11.313 -26.129 -2.557  1.00 0.00 ? 504 THR C HG22 9  
ATOM 7542  H HG23 . THR A 1 52 ? -10.449 -25.478 -3.950  1.00 0.00 ? 504 THR C HG23 9  
ATOM 7543  N N    . SER A 1 1  ? -10.176 1.801   1.559   1.00 0.00 ? 453 SER C N    10 
ATOM 7544  C CA   . SER A 1 1  ? -8.950  2.132   2.295   1.00 0.00 ? 453 SER C CA   10 
ATOM 7545  C C    . SER A 1 1  ? -9.145  1.981   3.807   1.00 0.00 ? 453 SER C C    10 
ATOM 7546  O O    . SER A 1 1  ? -8.307  2.423   4.598   1.00 0.00 ? 453 SER C O    10 
ATOM 7547  C CB   . SER A 1 1  ? -8.514  3.555   1.953   1.00 0.00 ? 453 SER C CB   10 
ATOM 7548  O OG   . SER A 1 1  ? -8.300  3.693   0.552   1.00 0.00 ? 453 SER C OG   10 
ATOM 7549  H H1   . SER A 1 1  ? -10.960 2.408   1.873   1.00 0.00 ? 453 SER C H1   10 
ATOM 7550  H H2   . SER A 1 1  ? -10.432 0.805   1.701   1.00 0.00 ? 453 SER C H2   10 
ATOM 7551  H H3   . SER A 1 1  ? -10.027 1.957   0.543   1.00 0.00 ? 453 SER C H3   10 
ATOM 7552  H HA   . SER A 1 1  ? -8.177  1.446   1.982   1.00 0.00 ? 453 SER C HA   10 
ATOM 7553  H HB2  . SER A 1 1  ? -9.283  4.248   2.258   1.00 0.00 ? 453 SER C HB2  10 
ATOM 7554  H HB3  . SER A 1 1  ? -7.595  3.784   2.471   1.00 0.00 ? 453 SER C HB3  10 
ATOM 7555  H HG   . SER A 1 1  ? -7.553  3.134   0.294   1.00 0.00 ? 453 SER C HG   10 
ATOM 7556  N N    . ASN A 1 2  ? -10.242 1.346   4.207   1.00 0.00 ? 454 ASN C N    10 
ATOM 7557  C CA   . ASN A 1 2  ? -10.525 1.132   5.616   1.00 0.00 ? 454 ASN C CA   10 
ATOM 7558  C C    . ASN A 1 2  ? -9.910  -0.179  6.078   1.00 0.00 ? 454 ASN C C    10 
ATOM 7559  O O    . ASN A 1 2  ? -10.467 -1.256  5.862   1.00 0.00 ? 454 ASN C O    10 
ATOM 7560  C CB   . ASN A 1 2  ? -12.035 1.145   5.874   1.00 0.00 ? 454 ASN C CB   10 
ATOM 7561  C CG   . ASN A 1 2  ? -12.388 0.918   7.332   1.00 0.00 ? 454 ASN C CG   10 
ATOM 7562  O OD1  . ASN A 1 2  ? -11.591 1.189   8.229   1.00 0.00 ? 454 ASN C OD1  10 
ATOM 7563  N ND2  . ASN A 1 2  ? -13.590 0.446   7.577   1.00 0.00 ? 454 ASN C ND2  10 
ATOM 7564  H H    . ASN A 1 2  ? -10.876 0.999   3.544   1.00 0.00 ? 454 ASN C H    10 
ATOM 7565  H HA   . ASN A 1 2  ? -10.066 1.940   6.168   1.00 0.00 ? 454 ASN C HA   10 
ATOM 7566  H HB2  . ASN A 1 2  ? -12.435 2.103   5.578   1.00 0.00 ? 454 ASN C HB2  10 
ATOM 7567  H HB3  . ASN A 1 2  ? -12.501 0.370   5.283   1.00 0.00 ? 454 ASN C HB3  10 
ATOM 7568  H HD21 . ASN A 1 2  ? -14.183 0.270   6.812   1.00 0.00 ? 454 ASN C HD21 10 
ATOM 7569  H HD22 . ASN A 1 2  ? -13.852 0.295   8.511   1.00 0.00 ? 454 ASN C HD22 10 
ATOM 7570  N N    . SER A 1 3  ? -8.757  -0.083  6.703   1.00 0.00 ? 455 SER C N    10 
ATOM 7571  C CA   . SER A 1 3  ? -8.019  -1.246  7.149   1.00 0.00 ? 455 SER C CA   10 
ATOM 7572  C C    . SER A 1 3  ? -8.669  -1.903  8.369   1.00 0.00 ? 455 SER C C    10 
ATOM 7573  O O    . SER A 1 3  ? -8.381  -3.055  8.687   1.00 0.00 ? 455 SER C O    10 
ATOM 7574  C CB   . SER A 1 3  ? -6.579  -0.849  7.450   1.00 0.00 ? 455 SER C CB   10 
ATOM 7575  O OG   . SER A 1 3  ? -6.007  -0.189  6.328   1.00 0.00 ? 455 SER C OG   10 
ATOM 7576  H H    . SER A 1 3  ? -8.379  0.808   6.873   1.00 0.00 ? 455 SER C H    10 
ATOM 7577  H HA   . SER A 1 3  ? -8.014  -1.959  6.339   1.00 0.00 ? 455 SER C HA   10 
ATOM 7578  H HB2  . SER A 1 3  ? -6.560  -0.181  8.299   1.00 0.00 ? 455 SER C HB2  10 
ATOM 7579  H HB3  . SER A 1 3  ? -5.999  -1.733  7.668   1.00 0.00 ? 455 SER C HB3  10 
ATOM 7580  H HG   . SER A 1 3  ? -6.326  -0.612  5.521   1.00 0.00 ? 455 SER C HG   10 
ATOM 7581  N N    . GLN A 1 4  ? -9.562  -1.177  9.033   1.00 0.00 ? 456 GLN C N    10 
ATOM 7582  C CA   . GLN A 1 4  ? -10.238 -1.693  10.217  1.00 0.00 ? 456 GLN C CA   10 
ATOM 7583  C C    . GLN A 1 4  ? -11.165 -2.862  9.841   1.00 0.00 ? 456 GLN C C    10 
ATOM 7584  O O    . GLN A 1 4  ? -11.446 -3.735  10.664  1.00 0.00 ? 456 GLN C O    10 
ATOM 7585  C CB   . GLN A 1 4  ? -11.010 -0.560  10.925  1.00 0.00 ? 456 GLN C CB   10 
ATOM 7586  C CG   . GLN A 1 4  ? -11.343 -0.840  12.393  1.00 0.00 ? 456 GLN C CG   10 
ATOM 7587  C CD   . GLN A 1 4  ? -12.600 -1.666  12.588  1.00 0.00 ? 456 GLN C CD   10 
ATOM 7588  O OE1  . GLN A 1 4  ? -12.685 -2.479  13.513  1.00 0.00 ? 456 GLN C OE1  10 
ATOM 7589  N NE2  . GLN A 1 4  ? -13.597 -1.433  11.757  1.00 0.00 ? 456 GLN C NE2  10 
ATOM 7590  H H    . GLN A 1 4  ? -9.765  -0.268  8.725   1.00 0.00 ? 456 GLN C H    10 
ATOM 7591  H HA   . GLN A 1 4  ? -9.479  -2.071  10.886  1.00 0.00 ? 456 GLN C HA   10 
ATOM 7592  H HB2  . GLN A 1 4  ? -10.414 0.339   10.885  1.00 0.00 ? 456 GLN C HB2  10 
ATOM 7593  H HB3  . GLN A 1 4  ? -11.934 -0.388  10.395  1.00 0.00 ? 456 GLN C HB3  10 
ATOM 7594  H HG2  . GLN A 1 4  ? -10.516 -1.372  12.838  1.00 0.00 ? 456 GLN C HG2  10 
ATOM 7595  H HG3  . GLN A 1 4  ? -11.469 0.106   12.902  1.00 0.00 ? 456 GLN C HG3  10 
ATOM 7596  H HE21 . GLN A 1 4  ? -13.486 -0.743  11.070  1.00 0.00 ? 456 GLN C HE21 10 
ATOM 7597  H HE22 . GLN A 1 4  ? -14.416 -1.966  11.851  1.00 0.00 ? 456 GLN C HE22 10 
ATOM 7598  N N    . LEU A 1 5  ? -11.602 -2.889  8.577   1.00 0.00 ? 457 LEU C N    10 
ATOM 7599  C CA   . LEU A 1 5  ? -12.470 -3.963  8.084   1.00 0.00 ? 457 LEU C CA   10 
ATOM 7600  C C    . LEU A 1 5  ? -11.766 -5.308  8.160   1.00 0.00 ? 457 LEU C C    10 
ATOM 7601  O O    . LEU A 1 5  ? -12.411 -6.350  8.303   1.00 0.00 ? 457 LEU C O    10 
ATOM 7602  C CB   . LEU A 1 5  ? -12.891 -3.708  6.639   1.00 0.00 ? 457 LEU C CB   10 
ATOM 7603  C CG   . LEU A 1 5  ? -13.753 -2.480  6.384   1.00 0.00 ? 457 LEU C CG   10 
ATOM 7604  C CD1  . LEU A 1 5  ? -14.035 -2.352  4.909   1.00 0.00 ? 457 LEU C CD1  10 
ATOM 7605  C CD2  . LEU A 1 5  ? -15.055 -2.562  7.156   1.00 0.00 ? 457 LEU C CD2  10 
ATOM 7606  H H    . LEU A 1 5  ? -11.334 -2.173  7.965   1.00 0.00 ? 457 LEU C H    10 
ATOM 7607  H HA   . LEU A 1 5  ? -13.351 -3.988  8.706   1.00 0.00 ? 457 LEU C HA   10 
ATOM 7608  H HB2  . LEU A 1 5  ? -11.995 -3.614  6.044   1.00 0.00 ? 457 LEU C HB2  10 
ATOM 7609  H HB3  . LEU A 1 5  ? -13.434 -4.576  6.294   1.00 0.00 ? 457 LEU C HB3  10 
ATOM 7610  H HG   . LEU A 1 5  ? -13.222 -1.594  6.706   1.00 0.00 ? 457 LEU C HG   10 
ATOM 7611  H HD11 . LEU A 1 5  ? -14.554 -3.237  4.574   1.00 0.00 ? 457 LEU C HD11 10 
ATOM 7612  H HD12 . LEU A 1 5  ? -13.106 -2.247  4.371   1.00 0.00 ? 457 LEU C HD12 10 
ATOM 7613  H HD13 . LEU A 1 5  ? -14.656 -1.486  4.737   1.00 0.00 ? 457 LEU C HD13 10 
ATOM 7614  H HD21 . LEU A 1 5  ? -15.640 -1.674  6.968   1.00 0.00 ? 457 LEU C HD21 10 
ATOM 7615  H HD22 . LEU A 1 5  ? -14.846 -2.643  8.214   1.00 0.00 ? 457 LEU C HD22 10 
ATOM 7616  H HD23 . LEU A 1 5  ? -15.608 -3.431  6.831   1.00 0.00 ? 457 LEU C HD23 10 
ATOM 7617  N N    . ASN A 1 6  ? -10.441 -5.277  8.062   1.00 0.00 ? 458 ASN C N    10 
ATOM 7618  C CA   . ASN A 1 6  ? -9.632  -6.488  8.096   1.00 0.00 ? 458 ASN C CA   10 
ATOM 7619  C C    . ASN A 1 6  ? -9.866  -7.252  9.382   1.00 0.00 ? 458 ASN C C    10 
ATOM 7620  O O    . ASN A 1 6  ? -10.007 -8.470  9.370   1.00 0.00 ? 458 ASN C O    10 
ATOM 7621  C CB   . ASN A 1 6  ? -8.152  -6.146  7.966   1.00 0.00 ? 458 ASN C CB   10 
ATOM 7622  C CG   . ASN A 1 6  ? -7.298  -7.373  7.739   1.00 0.00 ? 458 ASN C CG   10 
ATOM 7623  O OD1  . ASN A 1 6  ? -7.731  -8.331  7.111   1.00 0.00 ? 458 ASN C OD1  10 
ATOM 7624  N ND2  . ASN A 1 6  ? -6.082  -7.352  8.240   1.00 0.00 ? 458 ASN C ND2  10 
ATOM 7625  H H    . ASN A 1 6  ? -9.992  -4.410  7.960   1.00 0.00 ? 458 ASN C H    10 
ATOM 7626  H HA   . ASN A 1 6  ? -9.920  -7.110  7.265   1.00 0.00 ? 458 ASN C HA   10 
ATOM 7627  H HB2  . ASN A 1 6  ? -8.015  -5.473  7.134   1.00 0.00 ? 458 ASN C HB2  10 
ATOM 7628  H HB3  . ASN A 1 6  ? -7.823  -5.662  8.873   1.00 0.00 ? 458 ASN C HB3  10 
ATOM 7629  H HD21 . ASN A 1 6  ? -5.796  -6.550  8.729   1.00 0.00 ? 458 ASN C HD21 10 
ATOM 7630  H HD22 . ASN A 1 6  ? -5.511  -8.139  8.106   1.00 0.00 ? 458 ASN C HD22 10 
ATOM 7631  N N    . ALA A 1 7  ? -9.924  -6.525  10.487  1.00 0.00 ? 459 ALA C N    10 
ATOM 7632  C CA   . ALA A 1 7  ? -10.152 -7.121  11.793  1.00 0.00 ? 459 ALA C CA   10 
ATOM 7633  C C    . ALA A 1 7  ? -11.553 -7.715  11.868  1.00 0.00 ? 459 ALA C C    10 
ATOM 7634  O O    . ALA A 1 7  ? -11.748 -8.821  12.385  1.00 0.00 ? 459 ALA C O    10 
ATOM 7635  C CB   . ALA A 1 7  ? -9.958  -6.073  12.877  1.00 0.00 ? 459 ALA C CB   10 
ATOM 7636  H H    . ALA A 1 7  ? -9.815  -5.554  10.419  1.00 0.00 ? 459 ALA C H    10 
ATOM 7637  H HA   . ALA A 1 7  ? -9.428  -7.911  11.943  1.00 0.00 ? 459 ALA C HA   10 
ATOM 7638  H HB1  . ALA A 1 7  ? -10.145 -6.515  13.844  1.00 0.00 ? 459 ALA C HB1  10 
ATOM 7639  H HB2  . ALA A 1 7  ? -10.646 -5.257  12.715  1.00 0.00 ? 459 ALA C HB2  10 
ATOM 7640  H HB3  . ALA A 1 7  ? -8.946  -5.702  12.842  1.00 0.00 ? 459 ALA C HB3  10 
ATOM 7641  N N    . MET A 1 8  ? -12.522 -6.980  11.329  1.00 0.00 ? 460 MET C N    10 
ATOM 7642  C CA   . MET A 1 8  ? -13.904 -7.401  11.308  1.00 0.00 ? 460 MET C CA   10 
ATOM 7643  C C    . MET A 1 8  ? -14.060 -8.722  10.560  1.00 0.00 ? 460 MET C C    10 
ATOM 7644  O O    . MET A 1 8  ? -14.614 -9.688  11.088  1.00 0.00 ? 460 MET C O    10 
ATOM 7645  C CB   . MET A 1 8  ? -14.736 -6.314  10.646  1.00 0.00 ? 460 MET C CB   10 
ATOM 7646  C CG   . MET A 1 8  ? -14.589 -4.957  11.325  1.00 0.00 ? 460 MET C CG   10 
ATOM 7647  S SD   . MET A 1 8  ? -15.222 -3.595  10.342  1.00 0.00 ? 460 MET C SD   10 
ATOM 7648  C CE   . MET A 1 8  ? -16.779 -4.267  9.834   1.00 0.00 ? 460 MET C CE   10 
ATOM 7649  H H    . MET A 1 8  ? -12.307 -6.112  10.927  1.00 0.00 ? 460 MET C H    10 
ATOM 7650  H HA   . MET A 1 8  ? -14.238 -7.527  12.328  1.00 0.00 ? 460 MET C HA   10 
ATOM 7651  H HB2  . MET A 1 8  ? -14.446 -6.231  9.609   1.00 0.00 ? 460 MET C HB2  10 
ATOM 7652  H HB3  . MET A 1 8  ? -15.775 -6.603  10.688  1.00 0.00 ? 460 MET C HB3  10 
ATOM 7653  H HG2  . MET A 1 8  ? -15.122 -4.977  12.262  1.00 0.00 ? 460 MET C HG2  10 
ATOM 7654  H HG3  . MET A 1 8  ? -13.540 -4.782  11.517  1.00 0.00 ? 460 MET C HG3  10 
ATOM 7655  H HE1  . MET A 1 8  ? -17.145 -4.900  10.625  1.00 0.00 ? 460 MET C HE1  10 
ATOM 7656  H HE2  . MET A 1 8  ? -16.632 -4.850  8.931   1.00 0.00 ? 460 MET C HE2  10 
ATOM 7657  H HE3  . MET A 1 8  ? -17.480 -3.469  9.644   1.00 0.00 ? 460 MET C HE3  10 
ATOM 7658  N N    . ALA A 1 9  ? -13.547 -8.760  9.337   1.00 0.00 ? 461 ALA C N    10 
ATOM 7659  C CA   . ALA A 1 9  ? -13.613 -9.958  8.516   1.00 0.00 ? 461 ALA C CA   10 
ATOM 7660  C C    . ALA A 1 9  ? -12.790 -11.077 9.133   1.00 0.00 ? 461 ALA C C    10 
ATOM 7661  O O    . ALA A 1 9  ? -13.137 -12.252 9.025   1.00 0.00 ? 461 ALA C O    10 
ATOM 7662  C CB   . ALA A 1 9  ? -13.126 -9.660  7.110   1.00 0.00 ? 461 ALA C CB   10 
ATOM 7663  H H    . ALA A 1 9  ? -13.114 -7.953  8.975   1.00 0.00 ? 461 ALA C H    10 
ATOM 7664  H HA   . ALA A 1 9  ? -14.646 -10.271 8.461   1.00 0.00 ? 461 ALA C HA   10 
ATOM 7665  H HB1  . ALA A 1 9  ? -13.221 -10.547 6.500   1.00 0.00 ? 461 ALA C HB1  10 
ATOM 7666  H HB2  . ALA A 1 9  ? -12.089 -9.358  7.143   1.00 0.00 ? 461 ALA C HB2  10 
ATOM 7667  H HB3  . ALA A 1 9  ? -13.718 -8.866  6.684   1.00 0.00 ? 461 ALA C HB3  10 
ATOM 7668  N N    . HIS A 1 10 ? -11.702 -10.698 9.792   1.00 0.00 ? 462 HIS C N    10 
ATOM 7669  C CA   . HIS A 1 10 ? -10.817 -11.652 10.434  1.00 0.00 ? 462 HIS C CA   10 
ATOM 7670  C C    . HIS A 1 10 ? -11.555 -12.453 11.495  1.00 0.00 ? 462 HIS C C    10 
ATOM 7671  O O    . HIS A 1 10 ? -11.420 -13.660 11.557  1.00 0.00 ? 462 HIS C O    10 
ATOM 7672  C CB   . HIS A 1 10 ? -9.611  -10.933 11.051  1.00 0.00 ? 462 HIS C CB   10 
ATOM 7673  C CG   . HIS A 1 10 ? -8.542  -11.854 11.546  1.00 0.00 ? 462 HIS C CG   10 
ATOM 7674  N ND1  . HIS A 1 10 ? -7.714  -12.563 10.708  1.00 0.00 ? 462 HIS C ND1  10 
ATOM 7675  C CD2  . HIS A 1 10 ? -8.178  -12.186 12.800  1.00 0.00 ? 462 HIS C CD2  10 
ATOM 7676  C CE1  . HIS A 1 10 ? -6.890  -13.296 11.426  1.00 0.00 ? 462 HIS C CE1  10 
ATOM 7677  N NE2  . HIS A 1 10 ? -7.149  -13.087 12.700  1.00 0.00 ? 462 HIS C NE2  10 
ATOM 7678  H H    . HIS A 1 10 ? -11.486 -9.740  9.840   1.00 0.00 ? 462 HIS C H    10 
ATOM 7679  H HA   . HIS A 1 10 ? -10.461 -12.335 9.681   1.00 0.00 ? 462 HIS C HA   10 
ATOM 7680  H HB2  . HIS A 1 10 ? -9.170  -10.286 10.308  1.00 0.00 ? 462 HIS C HB2  10 
ATOM 7681  H HB3  . HIS A 1 10 ? -9.949  -10.335 11.885  1.00 0.00 ? 462 HIS C HB3  10 
ATOM 7682  H HD1  . HIS A 1 10 ? -7.720  -12.520 9.725   1.00 0.00 ? 462 HIS C HD1  10 
ATOM 7683  H HD2  . HIS A 1 10 ? -8.614  -11.798 13.710  1.00 0.00 ? 462 HIS C HD2  10 
ATOM 7684  H HE1  . HIS A 1 10 ? -6.131  -13.957 11.038  1.00 0.00 ? 462 HIS C HE1  10 
ATOM 7685  H HE2  . HIS A 1 10 ? -6.798  -13.636 13.437  1.00 0.00 ? 462 HIS C HE2  10 
ATOM 7686  N N    . GLN A 1 11 ? -12.353 -11.772 12.308  1.00 0.00 ? 463 GLN C N    10 
ATOM 7687  C CA   . GLN A 1 11 ? -13.091 -12.436 13.384  1.00 0.00 ? 463 GLN C CA   10 
ATOM 7688  C C    . GLN A 1 11 ? -14.085 -13.447 12.826  1.00 0.00 ? 463 GLN C C    10 
ATOM 7689  O O    . GLN A 1 11 ? -14.251 -14.536 13.372  1.00 0.00 ? 463 GLN C O    10 
ATOM 7690  C CB   . GLN A 1 11 ? -13.821 -11.414 14.264  1.00 0.00 ? 463 GLN C CB   10 
ATOM 7691  C CG   . GLN A 1 11 ? -12.910 -10.377 14.910  1.00 0.00 ? 463 GLN C CG   10 
ATOM 7692  C CD   . GLN A 1 11 ? -11.712 -11.001 15.597  1.00 0.00 ? 463 GLN C CD   10 
ATOM 7693  O OE1  . GLN A 1 11 ? -11.773 -11.372 16.770  1.00 0.00 ? 463 GLN C OE1  10 
ATOM 7694  N NE2  . GLN A 1 11 ? -10.613 -11.093 14.877  1.00 0.00 ? 463 GLN C NE2  10 
ATOM 7695  H H    . GLN A 1 11 ? -12.457 -10.802 12.180  1.00 0.00 ? 463 GLN C H    10 
ATOM 7696  H HA   . GLN A 1 11 ? -12.373 -12.973 13.992  1.00 0.00 ? 463 GLN C HA   10 
ATOM 7697  H HB2  . GLN A 1 11 ? -14.545 -10.892 13.659  1.00 0.00 ? 463 GLN C HB2  10 
ATOM 7698  H HB3  . GLN A 1 11 ? -14.338 -11.944 15.049  1.00 0.00 ? 463 GLN C HB3  10 
ATOM 7699  H HG2  . GLN A 1 11 ? -12.554 -9.703  14.145  1.00 0.00 ? 463 GLN C HG2  10 
ATOM 7700  H HG3  . GLN A 1 11 ? -13.478 -9.822  15.641  1.00 0.00 ? 463 GLN C HG3  10 
ATOM 7701  H HE21 . GLN A 1 11 ? -10.637 -10.752 13.960  1.00 0.00 ? 463 GLN C HE21 10 
ATOM 7702  H HE22 . GLN A 1 11 ? -9.818  -11.498 15.284  1.00 0.00 ? 463 GLN C HE22 10 
ATOM 7703  N N    . ILE A 1 12 ? -14.737 -13.087 11.733  1.00 0.00 ? 464 ILE C N    10 
ATOM 7704  C CA   . ILE A 1 12 ? -15.696 -13.976 11.103  1.00 0.00 ? 464 ILE C CA   10 
ATOM 7705  C C    . ILE A 1 12 ? -14.992 -15.177 10.485  1.00 0.00 ? 464 ILE C C    10 
ATOM 7706  O O    . ILE A 1 12 ? -15.416 -16.310 10.668  1.00 0.00 ? 464 ILE C O    10 
ATOM 7707  C CB   . ILE A 1 12 ? -16.509 -13.262 10.010  1.00 0.00 ? 464 ILE C CB   10 
ATOM 7708  C CG1  . ILE A 1 12 ? -17.211 -12.025 10.575  1.00 0.00 ? 464 ILE C CG1  10 
ATOM 7709  C CG2  . ILE A 1 12 ? -17.533 -14.221 9.406   1.00 0.00 ? 464 ILE C CG2  10 
ATOM 7710  C CD1  . ILE A 1 12 ? -17.910 -11.213 9.515   1.00 0.00 ? 464 ILE C CD1  10 
ATOM 7711  H H    . ILE A 1 12 ? -14.573 -12.201 11.345  1.00 0.00 ? 464 ILE C H    10 
ATOM 7712  H HA   . ILE A 1 12 ? -16.377 -14.325 11.864  1.00 0.00 ? 464 ILE C HA   10 
ATOM 7713  H HB   . ILE A 1 12 ? -15.830 -12.957 9.228   1.00 0.00 ? 464 ILE C HB   10 
ATOM 7714  H HG12 . ILE A 1 12 ? -17.954 -12.335 11.296  1.00 0.00 ? 464 ILE C HG12 10 
ATOM 7715  H HG13 . ILE A 1 12 ? -16.496 -11.385 11.068  1.00 0.00 ? 464 ILE C HG13 10 
ATOM 7716  H HG21 . ILE A 1 12 ? -17.024 -15.071 8.974   1.00 0.00 ? 464 ILE C HG21 10 
ATOM 7717  H HG22 . ILE A 1 12 ? -18.096 -13.710 8.641   1.00 0.00 ? 464 ILE C HG22 10 
ATOM 7718  H HG23 . ILE A 1 12 ? -18.204 -14.563 10.181  1.00 0.00 ? 464 ILE C HG23 10 
ATOM 7719  H HD11 . ILE A 1 12 ? -18.706 -11.799 9.080   1.00 0.00 ? 464 ILE C HD11 10 
ATOM 7720  H HD12 . ILE A 1 12 ? -17.200 -10.948 8.745   1.00 0.00 ? 464 ILE C HD12 10 
ATOM 7721  H HD13 . ILE A 1 12 ? -18.317 -10.317 9.952   1.00 0.00 ? 464 ILE C HD13 10 
ATOM 7722  N N    . GLN A 1 13 ? -13.902 -14.919 9.769   1.00 0.00 ? 465 GLN C N    10 
ATOM 7723  C CA   . GLN A 1 13 ? -13.143 -15.977 9.102   1.00 0.00 ? 465 GLN C CA   10 
ATOM 7724  C C    . GLN A 1 13 ? -12.521 -16.932 10.125  1.00 0.00 ? 465 GLN C C    10 
ATOM 7725  O O    . GLN A 1 13 ? -12.269 -18.102 9.832   1.00 0.00 ? 465 GLN C O    10 
ATOM 7726  C CB   . GLN A 1 13 ? -12.067 -15.363 8.197   1.00 0.00 ? 465 GLN C CB   10 
ATOM 7727  C CG   . GLN A 1 13 ? -11.404 -16.352 7.244   1.00 0.00 ? 465 GLN C CG   10 
ATOM 7728  C CD   . GLN A 1 13 ? -10.099 -16.915 7.776   1.00 0.00 ? 465 GLN C CD   10 
ATOM 7729  O OE1  . GLN A 1 13 ? -9.376  -16.250 8.525   1.00 0.00 ? 465 GLN C OE1  10 
ATOM 7730  N NE2  . GLN A 1 13 ? -9.785  -18.132 7.391   1.00 0.00 ? 465 GLN C NE2  10 
ATOM 7731  H H    . GLN A 1 13 ? -13.601 -13.986 9.680   1.00 0.00 ? 465 GLN C H    10 
ATOM 7732  H HA   . GLN A 1 13 ? -13.836 -16.536 8.489   1.00 0.00 ? 465 GLN C HA   10 
ATOM 7733  H HB2  . GLN A 1 13 ? -12.514 -14.574 7.609   1.00 0.00 ? 465 GLN C HB2  10 
ATOM 7734  H HB3  . GLN A 1 13 ? -11.299 -14.937 8.829   1.00 0.00 ? 465 GLN C HB3  10 
ATOM 7735  H HG2  . GLN A 1 13 ? -12.083 -17.174 7.076   1.00 0.00 ? 465 GLN C HG2  10 
ATOM 7736  H HG3  . GLN A 1 13 ? -11.211 -15.857 6.303   1.00 0.00 ? 465 GLN C HG3  10 
ATOM 7737  H HE21 . GLN A 1 13 ? -10.401 -18.602 6.788   1.00 0.00 ? 465 GLN C HE21 10 
ATOM 7738  H HE22 . GLN A 1 13 ? -8.946  -18.519 7.718   1.00 0.00 ? 465 GLN C HE22 10 
ATOM 7739  N N    . GLU A 1 14 ? -12.281 -16.425 11.320  1.00 0.00 ? 466 GLU C N    10 
ATOM 7740  C CA   . GLU A 1 14 ? -11.742 -17.229 12.398  1.00 0.00 ? 466 GLU C CA   10 
ATOM 7741  C C    . GLU A 1 14 ? -12.787 -18.206 12.920  1.00 0.00 ? 466 GLU C C    10 
ATOM 7742  O O    . GLU A 1 14 ? -12.454 -19.299 13.388  1.00 0.00 ? 466 GLU C O    10 
ATOM 7743  C CB   . GLU A 1 14 ? -11.227 -16.331 13.512  1.00 0.00 ? 466 GLU C CB   10 
ATOM 7744  C CG   . GLU A 1 14 ? -9.918  -15.649 13.168  1.00 0.00 ? 466 GLU C CG   10 
ATOM 7745  C CD   . GLU A 1 14 ? -8.799  -16.638 12.946  1.00 0.00 ? 466 GLU C CD   10 
ATOM 7746  O OE1  . GLU A 1 14 ? -8.637  -17.115 11.810  1.00 0.00 ? 466 GLU C OE1  10 
ATOM 7747  O OE2  . GLU A 1 14 ? -8.072  -16.938 13.910  1.00 0.00 ? 466 GLU C OE2  10 
ATOM 7748  H H    . GLU A 1 14 ? -12.458 -15.473 11.481  1.00 0.00 ? 466 GLU C H    10 
ATOM 7749  H HA   . GLU A 1 14 ? -10.914 -17.796 11.999  1.00 0.00 ? 466 GLU C HA   10 
ATOM 7750  H HB2  . GLU A 1 14 ? -11.965 -15.565 13.705  1.00 0.00 ? 466 GLU C HB2  10 
ATOM 7751  H HB3  . GLU A 1 14 ? -11.087 -16.912 14.408  1.00 0.00 ? 466 GLU C HB3  10 
ATOM 7752  H HG2  . GLU A 1 14 ? -10.057 -15.080 12.259  1.00 0.00 ? 466 GLU C HG2  10 
ATOM 7753  H HG3  . GLU A 1 14 ? -9.645  -14.985 13.974  1.00 0.00 ? 466 GLU C HG3  10 
ATOM 7754  N N    . MET A 1 15 ? -14.047 -17.811 12.832  1.00 0.00 ? 467 MET C N    10 
ATOM 7755  C CA   . MET A 1 15 ? -15.146 -18.663 13.246  1.00 0.00 ? 467 MET C CA   10 
ATOM 7756  C C    . MET A 1 15 ? -15.581 -19.539 12.085  1.00 0.00 ? 467 MET C C    10 
ATOM 7757  O O    . MET A 1 15 ? -15.845 -20.726 12.248  1.00 0.00 ? 467 MET C O    10 
ATOM 7758  C CB   . MET A 1 15 ? -16.337 -17.824 13.708  1.00 0.00 ? 467 MET C CB   10 
ATOM 7759  C CG   . MET A 1 15 ? -16.045 -16.906 14.878  1.00 0.00 ? 467 MET C CG   10 
ATOM 7760  S SD   . MET A 1 15 ? -17.515 -16.018 15.444  1.00 0.00 ? 467 MET C SD   10 
ATOM 7761  C CE   . MET A 1 15 ? -17.990 -15.136 13.955  1.00 0.00 ? 467 MET C CE   10 
ATOM 7762  H H    . MET A 1 15 ? -14.243 -16.919 12.477  1.00 0.00 ? 467 MET C H    10 
ATOM 7763  H HA   . MET A 1 15 ? -14.810 -19.286 14.060  1.00 0.00 ? 467 MET C HA   10 
ATOM 7764  H HB2  . MET A 1 15 ? -16.667 -17.216 12.881  1.00 0.00 ? 467 MET C HB2  10 
ATOM 7765  H HB3  . MET A 1 15 ? -17.137 -18.490 13.991  1.00 0.00 ? 467 MET C HB3  10 
ATOM 7766  H HG2  . MET A 1 15 ? -15.662 -17.499 15.694  1.00 0.00 ? 467 MET C HG2  10 
ATOM 7767  H HG3  . MET A 1 15 ? -15.300 -16.185 14.575  1.00 0.00 ? 467 MET C HG3  10 
ATOM 7768  H HE1  . MET A 1 15 ? -18.171 -15.839 13.157  1.00 0.00 ? 467 MET C HE1  10 
ATOM 7769  H HE2  . MET A 1 15 ? -17.198 -14.459 13.671  1.00 0.00 ? 467 MET C HE2  10 
ATOM 7770  H HE3  . MET A 1 15 ? -18.891 -14.571 14.148  1.00 0.00 ? 467 MET C HE3  10 
ATOM 7771  N N    . PHE A 1 16 ? -15.649 -18.937 10.911  1.00 0.00 ? 468 PHE C N    10 
ATOM 7772  C CA   . PHE A 1 16 ? -16.074 -19.619 9.710   1.00 0.00 ? 468 PHE C CA   10 
ATOM 7773  C C    . PHE A 1 16 ? -14.996 -19.560 8.636   1.00 0.00 ? 468 PHE C C    10 
ATOM 7774  O O    . PHE A 1 16 ? -15.014 -18.684 7.779   1.00 0.00 ? 468 PHE C O    10 
ATOM 7775  C CB   . PHE A 1 16 ? -17.369 -18.996 9.177   1.00 0.00 ? 468 PHE C CB   10 
ATOM 7776  C CG   . PHE A 1 16 ? -18.559 -19.231 10.055  1.00 0.00 ? 468 PHE C CG   10 
ATOM 7777  C CD1  . PHE A 1 16 ? -18.850 -18.363 11.093  1.00 0.00 ? 468 PHE C CD1  10 
ATOM 7778  C CD2  . PHE A 1 16 ? -19.384 -20.320 9.846   1.00 0.00 ? 468 PHE C CD2  10 
ATOM 7779  C CE1  . PHE A 1 16 ? -19.942 -18.577 11.905  1.00 0.00 ? 468 PHE C CE1  10 
ATOM 7780  C CE2  . PHE A 1 16 ? -20.480 -20.541 10.654  1.00 0.00 ? 468 PHE C CE2  10 
ATOM 7781  C CZ   . PHE A 1 16 ? -20.760 -19.667 11.687  1.00 0.00 ? 468 PHE C CZ   10 
ATOM 7782  H H    . PHE A 1 16 ? -15.399 -17.987 10.844  1.00 0.00 ? 468 PHE C H    10 
ATOM 7783  H HA   . PHE A 1 16 ? -16.265 -20.650 9.963   1.00 0.00 ? 468 PHE C HA   10 
ATOM 7784  H HB2  . PHE A 1 16 ? -17.230 -17.929 9.095   1.00 0.00 ? 468 PHE C HB2  10 
ATOM 7785  H HB3  . PHE A 1 16 ? -17.584 -19.395 8.200   1.00 0.00 ? 468 PHE C HB3  10 
ATOM 7786  H HD1  . PHE A 1 16 ? -18.211 -17.510 11.266  1.00 0.00 ? 468 PHE C HD1  10 
ATOM 7787  H HD2  . PHE A 1 16 ? -19.165 -21.003 9.039   1.00 0.00 ? 468 PHE C HD2  10 
ATOM 7788  H HE1  . PHE A 1 16 ? -20.157 -17.889 12.708  1.00 0.00 ? 468 PHE C HE1  10 
ATOM 7789  H HE2  . PHE A 1 16 ? -21.116 -21.393 10.478  1.00 0.00 ? 468 PHE C HE2  10 
ATOM 7790  H HZ   . PHE A 1 16 ? -21.616 -19.835 12.321  1.00 0.00 ? 468 PHE C HZ   10 
ATOM 7791  N N    . PRO A 1 17 ? -14.026 -20.485 8.678   1.00 0.00 ? 469 PRO C N    10 
ATOM 7792  C CA   . PRO A 1 17 ? -12.956 -20.550 7.684   1.00 0.00 ? 469 PRO C CA   10 
ATOM 7793  C C    . PRO A 1 17 ? -13.459 -21.089 6.343   1.00 0.00 ? 469 PRO C C    10 
ATOM 7794  O O    . PRO A 1 17 ? -12.720 -21.145 5.356   1.00 0.00 ? 469 PRO C O    10 
ATOM 7795  C CB   . PRO A 1 17 ? -11.966 -21.526 8.306   1.00 0.00 ? 469 PRO C CB   10 
ATOM 7796  C CG   . PRO A 1 17 ? -12.806 -22.403 9.151   1.00 0.00 ? 469 PRO C CG   10 
ATOM 7797  C CD   . PRO A 1 17 ? -13.868 -21.514 9.717   1.00 0.00 ? 469 PRO C CD   10 
ATOM 7798  H HA   . PRO A 1 17 ? -12.489 -19.590 7.549   1.00 0.00 ? 469 PRO C HA   10 
ATOM 7799  H HB2  . PRO A 1 17 ? -11.467 -22.080 7.528   1.00 0.00 ? 469 PRO C HB2  10 
ATOM 7800  H HB3  . PRO A 1 17 ? -11.240 -20.986 8.897   1.00 0.00 ? 469 PRO C HB3  10 
ATOM 7801  H HG2  . PRO A 1 17 ? -13.251 -23.176 8.542   1.00 0.00 ? 469 PRO C HG2  10 
ATOM 7802  H HG3  . PRO A 1 17 ? -12.215 -22.833 9.943   1.00 0.00 ? 469 PRO C HG3  10 
ATOM 7803  H HD2  . PRO A 1 17 ? -14.785 -22.061 9.870   1.00 0.00 ? 469 PRO C HD2  10 
ATOM 7804  H HD3  . PRO A 1 17 ? -13.528 -21.068 10.638  1.00 0.00 ? 469 PRO C HD3  10 
ATOM 7805  N N    . GLN A 1 18 ? -14.724 -21.491 6.331   1.00 0.00 ? 470 GLN C N    10 
ATOM 7806  C CA   . GLN A 1 18 ? -15.370 -22.028 5.139   1.00 0.00 ? 470 GLN C CA   10 
ATOM 7807  C C    . GLN A 1 18 ? -15.543 -20.954 4.063   1.00 0.00 ? 470 GLN C C    10 
ATOM 7808  O O    . GLN A 1 18 ? -15.570 -21.259 2.871   1.00 0.00 ? 470 GLN C O    10 
ATOM 7809  C CB   . GLN A 1 18 ? -16.733 -22.623 5.505   1.00 0.00 ? 470 GLN C CB   10 
ATOM 7810  C CG   . GLN A 1 18 ? -17.678 -21.625 6.162   1.00 0.00 ? 470 GLN C CG   10 
ATOM 7811  C CD   . GLN A 1 18 ? -19.039 -22.211 6.483   1.00 0.00 ? 470 GLN C CD   10 
ATOM 7812  O OE1  . GLN A 1 18 ? -19.173 -23.407 6.749   1.00 0.00 ? 470 GLN C OE1  10 
ATOM 7813  N NE2  . GLN A 1 18 ? -20.056 -21.371 6.465   1.00 0.00 ? 470 GLN C NE2  10 
ATOM 7814  H H    . GLN A 1 18 ? -15.236 -21.427 7.163   1.00 0.00 ? 470 GLN C H    10 
ATOM 7815  H HA   . GLN A 1 18 ? -14.744 -22.815 4.750   1.00 0.00 ? 470 GLN C HA   10 
ATOM 7816  H HB2  . GLN A 1 18 ? -17.205 -22.993 4.607   1.00 0.00 ? 470 GLN C HB2  10 
ATOM 7817  H HB3  . GLN A 1 18 ? -16.583 -23.445 6.188   1.00 0.00 ? 470 GLN C HB3  10 
ATOM 7818  H HG2  . GLN A 1 18 ? -17.230 -21.279 7.082   1.00 0.00 ? 470 GLN C HG2  10 
ATOM 7819  H HG3  . GLN A 1 18 ? -17.807 -20.788 5.493   1.00 0.00 ? 470 GLN C HG3  10 
ATOM 7820  H HE21 . GLN A 1 18 ? -19.879 -20.431 6.250   1.00 0.00 ? 470 GLN C HE21 10 
ATOM 7821  H HE22 . GLN A 1 18 ? -20.953 -21.719 6.656   1.00 0.00 ? 470 GLN C HE22 10 
ATOM 7822  N N    . VAL A 1 19 ? -15.647 -19.706 4.490   1.00 0.00 ? 471 VAL C N    10 
ATOM 7823  C CA   . VAL A 1 19 ? -15.857 -18.602 3.574   1.00 0.00 ? 471 VAL C CA   10 
ATOM 7824  C C    . VAL A 1 19 ? -14.534 -17.866 3.282   1.00 0.00 ? 471 VAL C C    10 
ATOM 7825  O O    . VAL A 1 19 ? -13.750 -17.592 4.199   1.00 0.00 ? 471 VAL C O    10 
ATOM 7826  C CB   . VAL A 1 19 ? -16.928 -17.612 4.129   1.00 0.00 ? 471 VAL C CB   10 
ATOM 7827  C CG1  . VAL A 1 19 ? -16.513 -17.051 5.478   1.00 0.00 ? 471 VAL C CG1  10 
ATOM 7828  C CG2  . VAL A 1 19 ? -17.219 -16.491 3.139   1.00 0.00 ? 471 VAL C CG2  10 
ATOM 7829  H H    . VAL A 1 19 ? -15.564 -19.519 5.449   1.00 0.00 ? 471 VAL C H    10 
ATOM 7830  H HA   . VAL A 1 19 ? -16.232 -19.019 2.651   1.00 0.00 ? 471 VAL C HA   10 
ATOM 7831  H HB   . VAL A 1 19 ? -17.840 -18.171 4.280   1.00 0.00 ? 471 VAL C HB   10 
ATOM 7832  H HG11 . VAL A 1 19 ? -15.545 -16.579 5.387   1.00 0.00 ? 471 VAL C HG11 10 
ATOM 7833  H HG12 . VAL A 1 19 ? -16.458 -17.852 6.201   1.00 0.00 ? 471 VAL C HG12 10 
ATOM 7834  H HG13 . VAL A 1 19 ? -17.239 -16.320 5.803   1.00 0.00 ? 471 VAL C HG13 10 
ATOM 7835  H HG21 . VAL A 1 19 ? -17.604 -16.912 2.222   1.00 0.00 ? 471 VAL C HG21 10 
ATOM 7836  H HG22 . VAL A 1 19 ? -16.309 -15.949 2.931   1.00 0.00 ? 471 VAL C HG22 10 
ATOM 7837  H HG23 . VAL A 1 19 ? -17.951 -15.819 3.561   1.00 0.00 ? 471 VAL C HG23 10 
ATOM 7838  N N    . PRO A 1 20 ? -14.251 -17.582 1.991   1.00 0.00 ? 472 PRO C N    10 
ATOM 7839  C CA   . PRO A 1 20 ? -13.034 -16.874 1.575   1.00 0.00 ? 472 PRO C CA   10 
ATOM 7840  C C    . PRO A 1 20 ? -12.913 -15.484 2.203   1.00 0.00 ? 472 PRO C C    10 
ATOM 7841  O O    . PRO A 1 20 ? -13.839 -14.669 2.136   1.00 0.00 ? 472 PRO C O    10 
ATOM 7842  C CB   . PRO A 1 20 ? -13.181 -16.755 0.059   1.00 0.00 ? 472 PRO C CB   10 
ATOM 7843  C CG   . PRO A 1 20 ? -14.136 -17.825 -0.314  1.00 0.00 ? 472 PRO C CG   10 
ATOM 7844  C CD   . PRO A 1 20 ? -15.082 -17.948 0.838   1.00 0.00 ? 472 PRO C CD   10 
ATOM 7845  H HA   . PRO A 1 20 ? -12.148 -17.448 1.809   1.00 0.00 ? 472 PRO C HA   10 
ATOM 7846  H HB2  . PRO A 1 20 ? -13.564 -15.777 -0.185  1.00 0.00 ? 472 PRO C HB2  10 
ATOM 7847  H HB3  . PRO A 1 20 ? -12.220 -16.900 -0.412  1.00 0.00 ? 472 PRO C HB3  10 
ATOM 7848  H HG2  . PRO A 1 20 ? -14.666 -17.548 -1.213  1.00 0.00 ? 472 PRO C HG2  10 
ATOM 7849  H HG3  . PRO A 1 20 ? -13.603 -18.752 -0.461  1.00 0.00 ? 472 PRO C HG3  10 
ATOM 7850  H HD2  . PRO A 1 20 ? -15.905 -17.257 0.728   1.00 0.00 ? 472 PRO C HD2  10 
ATOM 7851  H HD3  . PRO A 1 20 ? -15.441 -18.961 0.924   1.00 0.00 ? 472 PRO C HD3  10 
ATOM 7852  N N    . TYR A 1 21 ? -11.748 -15.228 2.772   1.00 0.00 ? 473 TYR C N    10 
ATOM 7853  C CA   . TYR A 1 21 ? -11.427 -13.988 3.486   1.00 0.00 ? 473 TYR C CA   10 
ATOM 7854  C C    . TYR A 1 21 ? -11.760 -12.728 2.660   1.00 0.00 ? 473 TYR C C    10 
ATOM 7855  O O    . TYR A 1 21 ? -12.364 -11.784 3.174   1.00 0.00 ? 473 TYR C O    10 
ATOM 7856  C CB   . TYR A 1 21 ? -9.936  -13.998 3.826   1.00 0.00 ? 473 TYR C CB   10 
ATOM 7857  C CG   . TYR A 1 21 ? -9.533  -13.120 4.987   1.00 0.00 ? 473 TYR C CG   10 
ATOM 7858  C CD1  . TYR A 1 21 ? -9.252  -11.774 4.813   1.00 0.00 ? 473 TYR C CD1  10 
ATOM 7859  C CD2  . TYR A 1 21 ? -9.410  -13.653 6.258   1.00 0.00 ? 473 TYR C CD2  10 
ATOM 7860  C CE1  . TYR A 1 21 ? -8.856  -10.989 5.878   1.00 0.00 ? 473 TYR C CE1  10 
ATOM 7861  C CE2  . TYR A 1 21 ? -9.024  -12.877 7.325   1.00 0.00 ? 473 TYR C CE2  10 
ATOM 7862  C CZ   . TYR A 1 21 ? -8.745  -11.551 7.131   1.00 0.00 ? 473 TYR C CZ   10 
ATOM 7863  O OH   . TYR A 1 21 ? -8.343  -10.783 8.198   1.00 0.00 ? 473 TYR C OH   10 
ATOM 7864  H H    . TYR A 1 21 ? -11.054 -15.920 2.709   1.00 0.00 ? 473 TYR C H    10 
ATOM 7865  H HA   . TYR A 1 21 ? -11.990 -13.968 4.405   1.00 0.00 ? 473 TYR C HA   10 
ATOM 7866  H HB2  . TYR A 1 21 ? -9.642  -15.008 4.070   1.00 0.00 ? 473 TYR C HB2  10 
ATOM 7867  H HB3  . TYR A 1 21 ? -9.382  -13.675 2.957   1.00 0.00 ? 473 TYR C HB3  10 
ATOM 7868  H HD1  . TYR A 1 21 ? -9.343  -11.341 3.827   1.00 0.00 ? 473 TYR C HD1  10 
ATOM 7869  H HD2  . TYR A 1 21 ? -9.627  -14.699 6.411   1.00 0.00 ? 473 TYR C HD2  10 
ATOM 7870  H HE1  . TYR A 1 21 ? -8.641  -9.941  5.727   1.00 0.00 ? 473 TYR C HE1  10 
ATOM 7871  H HE2  . TYR A 1 21 ? -8.936  -13.315 8.308   1.00 0.00 ? 473 TYR C HE2  10 
ATOM 7872  H HH   . TYR A 1 21 ? -8.736  -9.900  8.121   1.00 0.00 ? 473 TYR C HH   10 
ATOM 7873  N N    . HIS A 1 22 ? -11.372 -12.729 1.385   1.00 0.00 ? 474 HIS C N    10 
ATOM 7874  C CA   . HIS A 1 22 ? -11.580 -11.551 0.515   1.00 0.00 ? 474 HIS C CA   10 
ATOM 7875  C C    . HIS A 1 22 ? -13.061 -11.260 0.336   1.00 0.00 ? 474 HIS C C    10 
ATOM 7876  O O    . HIS A 1 22 ? -13.476 -10.102 0.320   1.00 0.00 ? 474 HIS C O    10 
ATOM 7877  C CB   . HIS A 1 22 ? -10.953 -11.748 -0.879  1.00 0.00 ? 474 HIS C CB   10 
ATOM 7878  C CG   . HIS A 1 22 ? -9.606  -12.412 -0.903  1.00 0.00 ? 474 HIS C CG   10 
ATOM 7879  N ND1  . HIS A 1 22 ? -8.544  -12.026 -0.117  1.00 0.00 ? 474 HIS C ND1  10 
ATOM 7880  C CD2  . HIS A 1 22 ? -9.168  -13.462 -1.629  1.00 0.00 ? 474 HIS C CD2  10 
ATOM 7881  C CE1  . HIS A 1 22 ? -7.511  -12.812 -0.357  1.00 0.00 ? 474 HIS C CE1  10 
ATOM 7882  N NE2  . HIS A 1 22 ? -7.863  -13.694 -1.271  1.00 0.00 ? 474 HIS C NE2  10 
ATOM 7883  H H    . HIS A 1 22 ? -10.943 -13.535 1.020   1.00 0.00 ? 474 HIS C H    10 
ATOM 7884  H HA   . HIS A 1 22 ? -11.124 -10.692 0.991   1.00 0.00 ? 474 HIS C HA   10 
ATOM 7885  H HB2  . HIS A 1 22 ? -11.618 -12.355 -1.472  1.00 0.00 ? 474 HIS C HB2  10 
ATOM 7886  H HB3  . HIS A 1 22 ? -10.854 -10.781 -1.352  1.00 0.00 ? 474 HIS C HB3  10 
ATOM 7887  H HD1  . HIS A 1 22 ? -8.538  -11.272 0.513   1.00 0.00 ? 474 HIS C HD1  10 
ATOM 7888  H HD2  . HIS A 1 22 ? -9.750  -14.015 -2.354  1.00 0.00 ? 474 HIS C HD2  10 
ATOM 7889  H HE1  . HIS A 1 22 ? -6.544  -12.743 0.115   1.00 0.00 ? 474 HIS C HE1  10 
ATOM 7890  H HE2  . HIS A 1 22 ? -7.380  -14.536 -1.441  1.00 0.00 ? 474 HIS C HE2  10 
ATOM 7891  N N    . LEU A 1 23 ? -13.856 -12.311 0.209   1.00 0.00 ? 475 LEU C N    10 
ATOM 7892  C CA   . LEU A 1 23 ? -15.283 -12.155 -0.014  1.00 0.00 ? 475 LEU C CA   10 
ATOM 7893  C C    . LEU A 1 23 ? -15.976 -11.694 1.255   1.00 0.00 ? 475 LEU C C    10 
ATOM 7894  O O    . LEU A 1 23 ? -16.965 -10.961 1.196   1.00 0.00 ? 475 LEU C O    10 
ATOM 7895  C CB   . LEU A 1 23 ? -15.896 -13.455 -0.526  1.00 0.00 ? 475 LEU C CB   10 
ATOM 7896  C CG   . LEU A 1 23 ? -15.206 -14.091 -1.743  1.00 0.00 ? 475 LEU C CG   10 
ATOM 7897  C CD1  . LEU A 1 23 ? -16.078 -15.175 -2.339  1.00 0.00 ? 475 LEU C CD1  10 
ATOM 7898  C CD2  . LEU A 1 23 ? -14.838 -13.049 -2.793  1.00 0.00 ? 475 LEU C CD2  10 
ATOM 7899  H H    . LEU A 1 23 ? -13.480 -13.212 0.274   1.00 0.00 ? 475 LEU C H    10 
ATOM 7900  H HA   . LEU A 1 23 ? -15.420 -11.385 -0.764  1.00 0.00 ? 475 LEU C HA   10 
ATOM 7901  H HB2  . LEU A 1 23 ? -15.882 -14.172 0.283   1.00 0.00 ? 475 LEU C HB2  10 
ATOM 7902  H HB3  . LEU A 1 23 ? -16.922 -13.258 -0.786  1.00 0.00 ? 475 LEU C HB3  10 
ATOM 7903  H HG   . LEU A 1 23 ? -14.294 -14.561 -1.408  1.00 0.00 ? 475 LEU C HG   10 
ATOM 7904  H HD11 . LEU A 1 23 ? -15.616 -15.560 -3.236  1.00 0.00 ? 475 LEU C HD11 10 
ATOM 7905  H HD12 . LEU A 1 23 ? -17.051 -14.770 -2.576  1.00 0.00 ? 475 LEU C HD12 10 
ATOM 7906  H HD13 . LEU A 1 23 ? -16.189 -15.975 -1.622  1.00 0.00 ? 475 LEU C HD13 10 
ATOM 7907  H HD21 . LEU A 1 23 ? -14.114 -12.364 -2.376  1.00 0.00 ? 475 LEU C HD21 10 
ATOM 7908  H HD22 . LEU A 1 23 ? -15.721 -12.506 -3.094  1.00 0.00 ? 475 LEU C HD22 10 
ATOM 7909  H HD23 . LEU A 1 23 ? -14.405 -13.545 -3.650  1.00 0.00 ? 475 LEU C HD23 10 
ATOM 7910  N N    . VAL A 1 24 ? -15.457 -12.119 2.401   1.00 0.00 ? 476 VAL C N    10 
ATOM 7911  C CA   . VAL A 1 24 ? -15.975 -11.652 3.680   1.00 0.00 ? 476 VAL C CA   10 
ATOM 7912  C C    . VAL A 1 24 ? -15.773 -10.146 3.754   1.00 0.00 ? 476 VAL C C    10 
ATOM 7913  O O    . VAL A 1 24 ? -16.688 -9.394  4.069   1.00 0.00 ? 476 VAL C O    10 
ATOM 7914  C CB   . VAL A 1 24 ? -15.254 -12.323 4.878   1.00 0.00 ? 476 VAL C CB   10 
ATOM 7915  C CG1  . VAL A 1 24 ? -15.884 -11.900 6.195   1.00 0.00 ? 476 VAL C CG1  10 
ATOM 7916  C CG2  . VAL A 1 24 ? -15.278 -13.830 4.747   1.00 0.00 ? 476 VAL C CG2  10 
ATOM 7917  H H    . VAL A 1 24 ? -14.719 -12.768 2.383   1.00 0.00 ? 476 VAL C H    10 
ATOM 7918  H HA   . VAL A 1 24 ? -17.032 -11.876 3.724   1.00 0.00 ? 476 VAL C HA   10 
ATOM 7919  H HB   . VAL A 1 24 ? -14.224 -11.998 4.877   1.00 0.00 ? 476 VAL C HB   10 
ATOM 7920  H HG11 . VAL A 1 24 ? -16.926 -12.182 6.203   1.00 0.00 ? 476 VAL C HG11 10 
ATOM 7921  H HG12 . VAL A 1 24 ? -15.798 -10.830 6.307   1.00 0.00 ? 476 VAL C HG12 10 
ATOM 7922  H HG13 . VAL A 1 24 ? -15.373 -12.388 7.011   1.00 0.00 ? 476 VAL C HG13 10 
ATOM 7923  H HG21 . VAL A 1 24 ? -14.773 -14.121 3.836   1.00 0.00 ? 476 VAL C HG21 10 
ATOM 7924  H HG22 . VAL A 1 24 ? -16.302 -14.173 4.714   1.00 0.00 ? 476 VAL C HG22 10 
ATOM 7925  H HG23 . VAL A 1 24 ? -14.777 -14.274 5.594   1.00 0.00 ? 476 VAL C HG23 10 
ATOM 7926  N N    . LEU A 1 25 ? -14.561 -9.722  3.407   1.00 0.00 ? 477 LEU C N    10 
ATOM 7927  C CA   . LEU A 1 25 ? -14.197 -8.310  3.353   1.00 0.00 ? 477 LEU C CA   10 
ATOM 7928  C C    . LEU A 1 25 ? -15.119 -7.540  2.409   1.00 0.00 ? 477 LEU C C    10 
ATOM 7929  O O    . LEU A 1 25 ? -15.386 -6.355  2.611   1.00 0.00 ? 477 LEU C O    10 
ATOM 7930  C CB   . LEU A 1 25 ? -12.744 -8.186  2.889   1.00 0.00 ? 477 LEU C CB   10 
ATOM 7931  C CG   . LEU A 1 25 ? -11.685 -8.345  3.972   1.00 0.00 ? 477 LEU C CG   10 
ATOM 7932  C CD1  . LEU A 1 25 ? -10.303 -8.441  3.358   1.00 0.00 ? 477 LEU C CD1  10 
ATOM 7933  C CD2  . LEU A 1 25 ? -11.748 -7.180  4.944   1.00 0.00 ? 477 LEU C CD2  10 
ATOM 7934  H H    . LEU A 1 25 ? -13.877 -10.391 3.185   1.00 0.00 ? 477 LEU C H    10 
ATOM 7935  H HA   . LEU A 1 25 ? -14.288 -7.891  4.346   1.00 0.00 ? 477 LEU C HA   10 
ATOM 7936  H HB2  . LEU A 1 25 ? -12.574 -8.960  2.152   1.00 0.00 ? 477 LEU C HB2  10 
ATOM 7937  H HB3  . LEU A 1 25 ? -12.603 -7.236  2.407   1.00 0.00 ? 477 LEU C HB3  10 
ATOM 7938  H HG   . LEU A 1 25 ? -11.877 -9.254  4.523   1.00 0.00 ? 477 LEU C HG   10 
ATOM 7939  H HD11 . LEU A 1 25 ? -10.087 -7.533  2.815   1.00 0.00 ? 477 LEU C HD11 10 
ATOM 7940  H HD12 . LEU A 1 25 ? -10.267 -9.282  2.681   1.00 0.00 ? 477 LEU C HD12 10 
ATOM 7941  H HD13 . LEU A 1 25 ? -9.569  -8.575  4.139   1.00 0.00 ? 477 LEU C HD13 10 
ATOM 7942  H HD21 . LEU A 1 25 ? -12.707 -7.172  5.440   1.00 0.00 ? 477 LEU C HD21 10 
ATOM 7943  H HD22 . LEU A 1 25 ? -11.614 -6.254  4.404   1.00 0.00 ? 477 LEU C HD22 10 
ATOM 7944  H HD23 . LEU A 1 25 ? -10.965 -7.284  5.676   1.00 0.00 ? 477 LEU C HD23 10 
ATOM 7945  N N    . GLN A 1 26 ? -15.593 -8.218  1.379   1.00 0.00 ? 478 GLN C N    10 
ATOM 7946  C CA   . GLN A 1 26 ? -16.512 -7.619  0.428   1.00 0.00 ? 478 GLN C CA   10 
ATOM 7947  C C    . GLN A 1 26 ? -17.864 -7.336  1.078   1.00 0.00 ? 478 GLN C C    10 
ATOM 7948  O O    . GLN A 1 26 ? -18.403 -6.237  0.951   1.00 0.00 ? 478 GLN C O    10 
ATOM 7949  C CB   . GLN A 1 26 ? -16.691 -8.523  -0.791  1.00 0.00 ? 478 GLN C CB   10 
ATOM 7950  C CG   . GLN A 1 26 ? -15.483 -8.573  -1.707  1.00 0.00 ? 478 GLN C CG   10 
ATOM 7951  C CD   . GLN A 1 26 ? -15.766 -9.305  -3.006  1.00 0.00 ? 478 GLN C CD   10 
ATOM 7952  O OE1  . GLN A 1 26 ? -15.175 -9.003  -4.039  1.00 0.00 ? 478 GLN C OE1  10 
ATOM 7953  N NE2  . GLN A 1 26 ? -16.678 -10.257 -2.965  1.00 0.00 ? 478 GLN C NE2  10 
ATOM 7954  H H    . GLN A 1 26 ? -15.310 -9.148  1.257   1.00 0.00 ? 478 GLN C H    10 
ATOM 7955  H HA   . GLN A 1 26 ? -16.084 -6.682  0.105   1.00 0.00 ? 478 GLN C HA   10 
ATOM 7956  H HB2  . GLN A 1 26 ? -16.883 -9.527  -0.443  1.00 0.00 ? 478 GLN C HB2  10 
ATOM 7957  H HB3  . GLN A 1 26 ? -17.536 -8.190  -1.362  1.00 0.00 ? 478 GLN C HB3  10 
ATOM 7958  H HG2  . GLN A 1 26 ? -15.180 -7.563  -1.941  1.00 0.00 ? 478 GLN C HG2  10 
ATOM 7959  H HG3  . GLN A 1 26 ? -14.677 -9.078  -1.194  1.00 0.00 ? 478 GLN C HG3  10 
ATOM 7960  H HE21 . GLN A 1 26 ? -17.123 -10.441 -2.114  1.00 0.00 ? 478 GLN C HE21 10 
ATOM 7961  H HE22 . GLN A 1 26 ? -16.874 -10.749 -3.791  1.00 0.00 ? 478 GLN C HE22 10 
ATOM 7962  N N    . ASP A 1 27 ? -18.397 -8.321  1.798   1.00 0.00 ? 479 ASP C N    10 
ATOM 7963  C CA   . ASP A 1 27 ? -19.695 -8.161  2.466   1.00 0.00 ? 479 ASP C CA   10 
ATOM 7964  C C    . ASP A 1 27 ? -19.598 -7.130  3.576   1.00 0.00 ? 479 ASP C C    10 
ATOM 7965  O O    . ASP A 1 27 ? -20.564 -6.469  3.900   1.00 0.00 ? 479 ASP C O    10 
ATOM 7966  C CB   . ASP A 1 27 ? -20.192 -9.490  3.037   1.00 0.00 ? 479 ASP C CB   10 
ATOM 7967  C CG   . ASP A 1 27 ? -21.644 -9.419  3.514   1.00 0.00 ? 479 ASP C CG   10 
ATOM 7968  O OD1  . ASP A 1 27 ? -21.886 -9.019  4.679   1.00 0.00 ? 479 ASP C OD1  10 
ATOM 7969  O OD2  . ASP A 1 27 ? -22.546 -9.768  2.721   1.00 0.00 ? 479 ASP C OD2  10 
ATOM 7970  H H    . ASP A 1 27 ? -17.913 -9.171  1.886   1.00 0.00 ? 479 ASP C H    10 
ATOM 7971  H HA   . ASP A 1 27 ? -20.402 -7.810  1.725   1.00 0.00 ? 479 ASP C HA   10 
ATOM 7972  H HB2  . ASP A 1 27 ? -20.115 -10.251 2.277   1.00 0.00 ? 479 ASP C HB2  10 
ATOM 7973  H HB3  . ASP A 1 27 ? -19.569 -9.764  3.877   1.00 0.00 ? 479 ASP C HB3  10 
ATOM 7974  N N    . LEU A 1 28 ? -18.419 -6.982  4.142   1.00 0.00 ? 480 LEU C N    10 
ATOM 7975  C CA   . LEU A 1 28 ? -18.204 -6.003  5.193   1.00 0.00 ? 480 LEU C CA   10 
ATOM 7976  C C    . LEU A 1 28 ? -18.244 -4.574  4.658   1.00 0.00 ? 480 LEU C C    10 
ATOM 7977  O O    . LEU A 1 28 ? -18.393 -3.633  5.418   1.00 0.00 ? 480 LEU C O    10 
ATOM 7978  C CB   . LEU A 1 28 ? -16.910 -6.268  5.966   1.00 0.00 ? 480 LEU C CB   10 
ATOM 7979  C CG   . LEU A 1 28 ? -17.062 -7.093  7.247   1.00 0.00 ? 480 LEU C CG   10 
ATOM 7980  C CD1  . LEU A 1 28 ? -18.271 -6.642  8.047   1.00 0.00 ? 480 LEU C CD1  10 
ATOM 7981  C CD2  . LEU A 1 28 ? -17.175 -8.546  6.926   1.00 0.00 ? 480 LEU C CD2  10 
ATOM 7982  H H    . LEU A 1 28 ? -17.688 -7.560  3.857   1.00 0.00 ? 480 LEU C H    10 
ATOM 7983  H HA   . LEU A 1 28 ? -19.033 -6.109  5.876   1.00 0.00 ? 480 LEU C HA   10 
ATOM 7984  H HB2  . LEU A 1 28 ? -16.233 -6.791  5.314   1.00 0.00 ? 480 LEU C HB2  10 
ATOM 7985  H HB3  . LEU A 1 28 ? -16.463 -5.330  6.221   1.00 0.00 ? 480 LEU C HB3  10 
ATOM 7986  H HG   . LEU A 1 28 ? -16.185 -6.950  7.862   1.00 0.00 ? 480 LEU C HG   10 
ATOM 7987  H HD11 . LEU A 1 28 ? -19.171 -7.010  7.577   1.00 0.00 ? 480 LEU C HD11 10 
ATOM 7988  H HD12 . LEU A 1 28 ? -18.301 -5.563  8.079   1.00 0.00 ? 480 LEU C HD12 10 
ATOM 7989  H HD13 . LEU A 1 28 ? -18.204 -7.031  9.051   1.00 0.00 ? 480 LEU C HD13 10 
ATOM 7990  H HD21 . LEU A 1 28 ? -16.275 -8.873  6.428   1.00 0.00 ? 480 LEU C HD21 10 
ATOM 7991  H HD22 . LEU A 1 28 ? -18.028 -8.689  6.275   1.00 0.00 ? 480 LEU C HD22 10 
ATOM 7992  H HD23 . LEU A 1 28 ? -17.311 -9.102  7.841   1.00 0.00 ? 480 LEU C HD23 10 
ATOM 7993  N N    . GLN A 1 29 ? -18.092 -4.418  3.357   1.00 0.00 ? 481 GLN C N    10 
ATOM 7994  C CA   . GLN A 1 29 ? -18.252 -3.114  2.729   1.00 0.00 ? 481 GLN C CA   10 
ATOM 7995  C C    . GLN A 1 29 ? -19.693 -2.950  2.314   1.00 0.00 ? 481 GLN C C    10 
ATOM 7996  O O    . GLN A 1 29 ? -20.191 -1.847  2.116   1.00 0.00 ? 481 GLN C O    10 
ATOM 7997  C CB   . GLN A 1 29 ? -17.350 -2.988  1.512   1.00 0.00 ? 481 GLN C CB   10 
ATOM 7998  C CG   . GLN A 1 29 ? -15.935 -2.568  1.836   1.00 0.00 ? 481 GLN C CG   10 
ATOM 7999  C CD   . GLN A 1 29 ? -15.837 -1.117  2.291   1.00 0.00 ? 481 GLN C CD   10 
ATOM 8000  O OE1  . GLN A 1 29 ? -16.762 -0.568  2.898   1.00 0.00 ? 481 GLN C OE1  10 
ATOM 8001  N NE2  . GLN A 1 29 ? -14.718 -0.490  2.004   1.00 0.00 ? 481 GLN C NE2  10 
ATOM 8002  H H    . GLN A 1 29 ? -17.878 -5.192  2.793   1.00 0.00 ? 481 GLN C H    10 
ATOM 8003  H HA   . GLN A 1 29 ? -17.990 -2.353  3.451   1.00 0.00 ? 481 GLN C HA   10 
ATOM 8004  H HB2  . GLN A 1 29 ? -17.310 -3.944  1.012   1.00 0.00 ? 481 GLN C HB2  10 
ATOM 8005  H HB3  . GLN A 1 29 ? -17.776 -2.258  0.841   1.00 0.00 ? 481 GLN C HB3  10 
ATOM 8006  H HG2  . GLN A 1 29 ? -15.559 -3.204  2.624   1.00 0.00 ? 481 GLN C HG2  10 
ATOM 8007  H HG3  . GLN A 1 29 ? -15.334 -2.699  0.954   1.00 0.00 ? 481 GLN C HG3  10 
ATOM 8008  H HE21 . GLN A 1 29 ? -14.022 -0.985  1.522   1.00 0.00 ? 481 GLN C HE21 10 
ATOM 8009  H HE22 . GLN A 1 29 ? -14.626 0.447   2.277   1.00 0.00 ? 481 GLN C HE22 10 
ATOM 8010  N N    . LEU A 1 30 ? -20.339 -4.073  2.206   1.00 0.00 ? 482 LEU C N    10 
ATOM 8011  C CA   . LEU A 1 30 ? -21.688 -4.178  1.778   1.00 0.00 ? 482 LEU C CA   10 
ATOM 8012  C C    . LEU A 1 30 ? -22.656 -3.952  2.945   1.00 0.00 ? 482 LEU C C    10 
ATOM 8013  O O    . LEU A 1 30 ? -23.576 -3.138  2.852   1.00 0.00 ? 482 LEU C O    10 
ATOM 8014  C CB   . LEU A 1 30 ? -21.852 -5.560  1.208   1.00 0.00 ? 482 LEU C CB   10 
ATOM 8015  C CG   . LEU A 1 30 ? -23.204 -5.933  0.702   1.00 0.00 ? 482 LEU C CG   10 
ATOM 8016  C CD1  . LEU A 1 30 ? -23.631 -5.000  -0.412  1.00 0.00 ? 482 LEU C CD1  10 
ATOM 8017  C CD2  . LEU A 1 30 ? -23.157 -7.350  0.219   1.00 0.00 ? 482 LEU C CD2  10 
ATOM 8018  H H    . LEU A 1 30 ? -19.878 -4.904  2.433   1.00 0.00 ? 482 LEU C H    10 
ATOM 8019  H HA   . LEU A 1 30 ? -21.874 -3.464  0.995   1.00 0.00 ? 482 LEU C HA   10 
ATOM 8020  H HB2  . LEU A 1 30 ? -21.152 -5.671  0.394   1.00 0.00 ? 482 LEU C HB2  10 
ATOM 8021  H HB3  . LEU A 1 30 ? -21.581 -6.264  1.982   1.00 0.00 ? 482 LEU C HB3  10 
ATOM 8022  H HG   . LEU A 1 30 ? -23.909 -5.872  1.513   1.00 0.00 ? 482 LEU C HG   10 
ATOM 8023  H HD11 . LEU A 1 30 ? -24.593 -5.310  -0.789  1.00 0.00 ? 482 LEU C HD11 10 
ATOM 8024  H HD12 . LEU A 1 30 ? -22.899 -5.040  -1.203  1.00 0.00 ? 482 LEU C HD12 10 
ATOM 8025  H HD13 . LEU A 1 30 ? -23.698 -3.992  -0.031  1.00 0.00 ? 482 LEU C HD13 10 
ATOM 8026  H HD21 . LEU A 1 30 ? -22.813 -7.980  1.026   1.00 0.00 ? 482 LEU C HD21 10 
ATOM 8027  H HD22 . LEU A 1 30 ? -22.457 -7.408  -0.601  1.00 0.00 ? 482 LEU C HD22 10 
ATOM 8028  H HD23 . LEU A 1 30 ? -24.138 -7.663  -0.105  1.00 0.00 ? 482 LEU C HD23 10 
ATOM 8029  N N    . THR A 1 31 ? -22.440 -4.669  4.035   1.00 0.00 ? 483 THR C N    10 
ATOM 8030  C CA   . THR A 1 31 ? -23.293 -4.561  5.196   1.00 0.00 ? 483 THR C CA   10 
ATOM 8031  C C    . THR A 1 31 ? -22.622 -3.756  6.299   1.00 0.00 ? 483 THR C C    10 
ATOM 8032  O O    . THR A 1 31 ? -23.292 -3.036  7.047   1.00 0.00 ? 483 THR C O    10 
ATOM 8033  C CB   . THR A 1 31 ? -23.661 -5.952  5.735   1.00 0.00 ? 483 THR C CB   10 
ATOM 8034  O OG1  . THR A 1 31 ? -22.466 -6.695  6.007   1.00 0.00 ? 483 THR C OG1  10 
ATOM 8035  C CG2  . THR A 1 31 ? -24.511 -6.708  4.731   1.00 0.00 ? 483 THR C CG2  10 
ATOM 8036  H H    . THR A 1 31 ? -21.685 -5.310  4.064   1.00 0.00 ? 483 THR C H    10 
ATOM 8037  H HA   . THR A 1 31 ? -24.203 -4.061  4.898   1.00 0.00 ? 483 THR C HA   10 
ATOM 8038  H HB   . THR A 1 31 ? -24.222 -5.834  6.651   1.00 0.00 ? 483 THR C HB   10 
ATOM 8039  H HG1  . THR A 1 31 ? -22.388 -7.439  5.385   1.00 0.00 ? 483 THR C HG1  10 
ATOM 8040  H HG21 . THR A 1 31 ? -23.962 -6.817  3.807   1.00 0.00 ? 483 THR C HG21 10 
ATOM 8041  H HG22 . THR A 1 31 ? -25.421 -6.160  4.547   1.00 0.00 ? 483 THR C HG22 10 
ATOM 8042  H HG23 . THR A 1 31 ? -24.748 -7.682  5.125   1.00 0.00 ? 483 THR C HG23 10 
ATOM 8043  N N    . ARG A 1 32 ? -21.286 -3.884  6.397   1.00 0.00 ? 484 ARG C N    10 
ATOM 8044  C CA   . ARG A 1 32 ? -20.495 -3.186  7.412   1.00 0.00 ? 484 ARG C CA   10 
ATOM 8045  C C    . ARG A 1 32 ? -20.835 -3.675  8.818   1.00 0.00 ? 484 ARG C C    10 
ATOM 8046  O O    . ARG A 1 32 ? -20.564 -3.000  9.809   1.00 0.00 ? 484 ARG C O    10 
ATOM 8047  C CB   . ARG A 1 32 ? -20.687 -1.681  7.294   1.00 0.00 ? 484 ARG C CB   10 
ATOM 8048  C CG   . ARG A 1 32 ? -19.982 -1.072  6.097   1.00 0.00 ? 484 ARG C CG   10 
ATOM 8049  C CD   . ARG A 1 32 ? -20.685 0.176   5.615   1.00 0.00 ? 484 ARG C CD   10 
ATOM 8050  N NE   . ARG A 1 32 ? -20.883 1.152   6.682   1.00 0.00 ? 484 ARG C NE   10 
ATOM 8051  C CZ   . ARG A 1 32 ? -22.016 1.830   6.873   1.00 0.00 ? 484 ARG C CZ   10 
ATOM 8052  N NH1  . ARG A 1 32 ? -23.066 1.617   6.083   1.00 0.00 ? 484 ARG C NH1  10 
ATOM 8053  N NH2  . ARG A 1 32 ? -22.103 2.713   7.857   1.00 0.00 ? 484 ARG C NH2  10 
ATOM 8054  H H    . ARG A 1 32 ? -20.815 -4.467  5.768   1.00 0.00 ? 484 ARG C H    10 
ATOM 8055  H HA   . ARG A 1 32 ? -19.459 -3.414  7.216   1.00 0.00 ? 484 ARG C HA   10 
ATOM 8056  H HB2  . ARG A 1 32 ? -21.740 -1.463  7.215   1.00 0.00 ? 484 ARG C HB2  10 
ATOM 8057  H HB3  . ARG A 1 32 ? -20.297 -1.222  8.184   1.00 0.00 ? 484 ARG C HB3  10 
ATOM 8058  H HG2  . ARG A 1 32 ? -18.973 -0.815  6.382   1.00 0.00 ? 484 ARG C HG2  10 
ATOM 8059  H HG3  . ARG A 1 32 ? -19.958 -1.797  5.296   1.00 0.00 ? 484 ARG C HG3  10 
ATOM 8060  H HD2  . ARG A 1 32 ? -20.092 0.625   4.834   1.00 0.00 ? 484 ARG C HD2  10 
ATOM 8061  H HD3  . ARG A 1 32 ? -21.644 -0.113  5.218   1.00 0.00 ? 484 ARG C HD3  10 
ATOM 8062  H HE   . ARG A 1 32 ? -20.118 1.311   7.283   1.00 0.00 ? 484 ARG C HE   10 
ATOM 8063  H HH11 . ARG A 1 32 ? -23.019 0.946   5.336   1.00 0.00 ? 484 ARG C HH11 10 
ATOM 8064  H HH12 . ARG A 1 32 ? -23.921 2.120   6.230   1.00 0.00 ? 484 ARG C HH12 10 
ATOM 8065  H HH21 . ARG A 1 32 ? -21.323 2.877   8.465   1.00 0.00 ? 484 ARG C HH21 10 
ATOM 8066  H HH22 . ARG A 1 32 ? -22.951 3.233   8.003   1.00 0.00 ? 484 ARG C HH22 10 
ATOM 8067  N N    . SER A 1 33 ? -21.408 -4.863  8.891   1.00 0.00 ? 485 SER C N    10 
ATOM 8068  C CA   . SER A 1 33 ? -21.785 -5.451  10.153  1.00 0.00 ? 485 SER C CA   10 
ATOM 8069  C C    . SER A 1 33 ? -21.419 -6.924  10.159  1.00 0.00 ? 485 SER C C    10 
ATOM 8070  O O    . SER A 1 33 ? -22.021 -7.712  9.430   1.00 0.00 ? 485 SER C O    10 
ATOM 8071  C CB   . SER A 1 33 ? -23.285 -5.288  10.376  1.00 0.00 ? 485 SER C CB   10 
ATOM 8072  O OG   . SER A 1 33 ? -23.637 -5.529  11.732  1.00 0.00 ? 485 SER C OG   10 
ATOM 8073  H H    . SER A 1 33 ? -21.579 -5.366  8.065   1.00 0.00 ? 485 SER C H    10 
ATOM 8074  H HA   . SER A 1 33 ? -21.250 -4.945  10.937  1.00 0.00 ? 485 SER C HA   10 
ATOM 8075  H HB2  . SER A 1 33 ? -23.592 -4.296  10.097  1.00 0.00 ? 485 SER C HB2  10 
ATOM 8076  H HB3  . SER A 1 33 ? -23.805 -6.003  9.756   1.00 0.00 ? 485 SER C HB3  10 
ATOM 8077  H HG   . SER A 1 33 ? -24.587 -5.390  11.846  1.00 0.00 ? 485 SER C HG   10 
ATOM 8078  N N    . VAL A 1 34 ? -20.440 -7.303  10.983  1.00 0.00 ? 486 VAL C N    10 
ATOM 8079  C CA   . VAL A 1 34 ? -19.993 -8.684  11.036  1.00 0.00 ? 486 VAL C CA   10 
ATOM 8080  C C    . VAL A 1 34 ? -21.117 -9.616  11.474  1.00 0.00 ? 486 VAL C C    10 
ATOM 8081  O O    . VAL A 1 34 ? -21.159 -10.780 11.074  1.00 0.00 ? 486 VAL C O    10 
ATOM 8082  C CB   . VAL A 1 34 ? -18.757 -8.881  11.947  1.00 0.00 ? 486 VAL C CB   10 
ATOM 8083  C CG1  . VAL A 1 34 ? -17.613 -8.000  11.499  1.00 0.00 ? 486 VAL C CG1  10 
ATOM 8084  C CG2  . VAL A 1 34 ? -19.080 -8.635  13.407  1.00 0.00 ? 486 VAL C CG2  10 
ATOM 8085  H H    . VAL A 1 34 ? -20.008 -6.643  11.564  1.00 0.00 ? 486 VAL C H    10 
ATOM 8086  H HA   . VAL A 1 34 ? -19.715 -8.956  10.028  1.00 0.00 ? 486 VAL C HA   10 
ATOM 8087  H HB   . VAL A 1 34 ? -18.437 -9.904  11.845  1.00 0.00 ? 486 VAL C HB   10 
ATOM 8088  H HG11 . VAL A 1 34 ? -17.933 -6.970  11.492  1.00 0.00 ? 486 VAL C HG11 10 
ATOM 8089  H HG12 . VAL A 1 34 ? -17.304 -8.291  10.505  1.00 0.00 ? 486 VAL C HG12 10 
ATOM 8090  H HG13 . VAL A 1 34 ? -16.783 -8.113  12.181  1.00 0.00 ? 486 VAL C HG13 10 
ATOM 8091  H HG21 . VAL A 1 34 ? -18.204 -8.854  13.998  1.00 0.00 ? 486 VAL C HG21 10 
ATOM 8092  H HG22 . VAL A 1 34 ? -19.889 -9.284  13.705  1.00 0.00 ? 486 VAL C HG22 10 
ATOM 8093  H HG23 . VAL A 1 34 ? -19.366 -7.605  13.547  1.00 0.00 ? 486 VAL C HG23 10 
ATOM 8094  N N    . GLU A 1 35 ? -22.034 -9.097  12.283  1.00 0.00 ? 487 GLU C N    10 
ATOM 8095  C CA   . GLU A 1 35 ? -23.169 -9.875  12.725  1.00 0.00 ? 487 GLU C CA   10 
ATOM 8096  C C    . GLU A 1 35 ? -24.053 -10.233 11.542  1.00 0.00 ? 487 GLU C C    10 
ATOM 8097  O O    . GLU A 1 35 ? -24.527 -11.367 11.432  1.00 0.00 ? 487 GLU C O    10 
ATOM 8098  C CB   . GLU A 1 35 ? -23.962 -9.129  13.793  1.00 0.00 ? 487 GLU C CB   10 
ATOM 8099  C CG   . GLU A 1 35 ? -23.219 -8.994  15.110  1.00 0.00 ? 487 GLU C CG   10 
ATOM 8100  C CD   . GLU A 1 35 ? -22.866 -10.338 15.716  1.00 0.00 ? 487 GLU C CD   10 
ATOM 8101  O OE1  . GLU A 1 35 ? -23.715 -10.916 16.426  1.00 0.00 ? 487 GLU C OE1  10 
ATOM 8102  O OE2  . GLU A 1 35 ? -21.732 -10.827 15.489  1.00 0.00 ? 487 GLU C OE2  10 
ATOM 8103  H H    . GLU A 1 35 ? -21.936 -8.169  12.589  1.00 0.00 ? 487 GLU C H    10 
ATOM 8104  H HA   . GLU A 1 35 ? -22.784 -10.790 13.151  1.00 0.00 ? 487 GLU C HA   10 
ATOM 8105  H HB2  . GLU A 1 35 ? -24.192 -8.139  13.429  1.00 0.00 ? 487 GLU C HB2  10 
ATOM 8106  H HB3  . GLU A 1 35 ? -24.882 -9.660  13.979  1.00 0.00 ? 487 GLU C HB3  10 
ATOM 8107  H HG2  . GLU A 1 35 ? -22.307 -8.443  14.939  1.00 0.00 ? 487 GLU C HG2  10 
ATOM 8108  H HG3  . GLU A 1 35 ? -23.842 -8.452  15.807  1.00 0.00 ? 487 GLU C HG3  10 
ATOM 8109  N N    . ILE A 1 36 ? -24.252 -9.273  10.640  1.00 0.00 ? 488 ILE C N    10 
ATOM 8110  C CA   . ILE A 1 36 ? -25.029 -9.527  9.443   1.00 0.00 ? 488 ILE C CA   10 
ATOM 8111  C C    . ILE A 1 36 ? -24.256 -10.449 8.531   1.00 0.00 ? 488 ILE C C    10 
ATOM 8112  O O    . ILE A 1 36 ? -24.756 -11.451 8.134   1.00 0.00 ? 488 ILE C O    10 
ATOM 8113  C CB   . ILE A 1 36 ? -25.373 -8.237  8.667   1.00 0.00 ? 488 ILE C CB   10 
ATOM 8114  C CG1  . ILE A 1 36 ? -26.076 -7.229  9.577   1.00 0.00 ? 488 ILE C CG1  10 
ATOM 8115  C CG2  . ILE A 1 36 ? -26.257 -8.567  7.467   1.00 0.00 ? 488 ILE C CG2  10 
ATOM 8116  C CD1  . ILE A 1 36 ? -26.442 -5.930  8.884   1.00 0.00 ? 488 ILE C CD1  10 
ATOM 8117  H H    . ILE A 1 36 ? -23.862 -8.387  10.786  1.00 0.00 ? 488 ILE C H    10 
ATOM 8118  H HA   . ILE A 1 36 ? -25.949 -10.013 9.737   1.00 0.00 ? 488 ILE C HA   10 
ATOM 8119  H HB   . ILE A 1 36 ? -24.453 -7.820  8.295   1.00 0.00 ? 488 ILE C HB   10 
ATOM 8120  H HG12 . ILE A 1 36 ? -26.987 -7.670  9.950   1.00 0.00 ? 488 ILE C HG12 10 
ATOM 8121  H HG13 . ILE A 1 36 ? -25.429 -6.994  10.410  1.00 0.00 ? 488 ILE C HG13 10 
ATOM 8122  H HG21 . ILE A 1 36 ? -27.177 -9.014  7.811   1.00 0.00 ? 488 ILE C HG21 10 
ATOM 8123  H HG22 . ILE A 1 36 ? -25.740 -9.259  6.819   1.00 0.00 ? 488 ILE C HG22 10 
ATOM 8124  H HG23 . ILE A 1 36 ? -26.478 -7.661  6.923   1.00 0.00 ? 488 ILE C HG23 10 
ATOM 8125  H HD11 . ILE A 1 36 ? -27.096 -6.139  8.050   1.00 0.00 ? 488 ILE C HD11 10 
ATOM 8126  H HD12 . ILE A 1 36 ? -25.545 -5.447  8.524   1.00 0.00 ? 488 ILE C HD12 10 
ATOM 8127  H HD13 . ILE A 1 36 ? -26.947 -5.279  9.581   1.00 0.00 ? 488 ILE C HD13 10 
ATOM 8128  N N    . THR A 1 37 ? -23.016 -10.079 8.226   1.00 0.00 ? 489 THR C N    10 
ATOM 8129  C CA   . THR A 1 37 ? -22.122 -10.866 7.384   1.00 0.00 ? 489 THR C CA   10 
ATOM 8130  C C    . THR A 1 37 ? -22.094 -12.351 7.789   1.00 0.00 ? 489 THR C C    10 
ATOM 8131  O O    . THR A 1 37 ? -22.199 -13.228 6.937   1.00 0.00 ? 489 THR C O    10 
ATOM 8132  C CB   . THR A 1 37 ? -20.698 -10.287 7.444   1.00 0.00 ? 489 THR C CB   10 
ATOM 8133  O OG1  . THR A 1 37 ? -20.747 -8.889  7.154   1.00 0.00 ? 489 THR C OG1  10 
ATOM 8134  C CG2  . THR A 1 37 ? -19.776 -10.967 6.444   1.00 0.00 ? 489 THR C CG2  10 
ATOM 8135  H H    . THR A 1 37 ? -22.683 -9.222  8.554   1.00 0.00 ? 489 THR C H    10 
ATOM 8136  H HA   . THR A 1 37 ? -22.471 -10.788 6.365   1.00 0.00 ? 489 THR C HA   10 
ATOM 8137  H HB   . THR A 1 37 ? -20.310 -10.436 8.441   1.00 0.00 ? 489 THR C HB   10 
ATOM 8138  H HG1  . THR A 1 37 ? -21.120 -8.773  6.263   1.00 0.00 ? 489 THR C HG1  10 
ATOM 8139  H HG21 . THR A 1 37 ? -18.816 -10.469 6.459   1.00 0.00 ? 489 THR C HG21 10 
ATOM 8140  H HG22 . THR A 1 37 ? -20.204 -10.896 5.455   1.00 0.00 ? 489 THR C HG22 10 
ATOM 8141  H HG23 . THR A 1 37 ? -19.650 -12.005 6.712   1.00 0.00 ? 489 THR C HG23 10 
ATOM 8142  N N    . THR A 1 38 ? -21.972 -12.627 9.085   1.00 0.00 ? 490 THR C N    10 
ATOM 8143  C CA   . THR A 1 38 ? -21.952 -14.003 9.557   1.00 0.00 ? 490 THR C CA   10 
ATOM 8144  C C    . THR A 1 38 ? -23.304 -14.671 9.299   1.00 0.00 ? 490 THR C C    10 
ATOM 8145  O O    . THR A 1 38 ? -23.368 -15.788 8.779   1.00 0.00 ? 490 THR C O    10 
ATOM 8146  C CB   . THR A 1 38 ? -21.604 -14.089 11.054  1.00 0.00 ? 490 THR C CB   10 
ATOM 8147  O OG1  . THR A 1 38 ? -20.417 -13.323 11.319  1.00 0.00 ? 490 THR C OG1  10 
ATOM 8148  C CG2  . THR A 1 38 ? -21.361 -15.531 11.454  1.00 0.00 ? 490 THR C CG2  10 
ATOM 8149  H H    . THR A 1 38 ? -21.893 -11.895 9.733   1.00 0.00 ? 490 THR C H    10 
ATOM 8150  H HA   . THR A 1 38 ? -21.197 -14.533 8.994   1.00 0.00 ? 490 THR C HA   10 
ATOM 8151  H HB   . THR A 1 38 ? -22.427 -13.694 11.629  1.00 0.00 ? 490 THR C HB   10 
ATOM 8152  H HG1  . THR A 1 38 ? -20.620 -12.381 11.246  1.00 0.00 ? 490 THR C HG1  10 
ATOM 8153  H HG21 . THR A 1 38 ? -20.571 -15.942 10.840  1.00 0.00 ? 490 THR C HG21 10 
ATOM 8154  H HG22 . THR A 1 38 ? -22.266 -16.104 11.307  1.00 0.00 ? 490 THR C HG22 10 
ATOM 8155  H HG23 . THR A 1 38 ? -21.070 -15.575 12.494  1.00 0.00 ? 490 THR C HG23 10 
ATOM 8156  N N    . ASP A 1 39 ? -24.379 -13.967 9.641   1.00 0.00 ? 491 ASP C N    10 
ATOM 8157  C CA   . ASP A 1 39 ? -25.741 -14.453 9.386   1.00 0.00 ? 491 ASP C CA   10 
ATOM 8158  C C    . ASP A 1 39 ? -25.943 -14.606 7.891   1.00 0.00 ? 491 ASP C C    10 
ATOM 8159  O O    . ASP A 1 39 ? -26.570 -15.548 7.420   1.00 0.00 ? 491 ASP C O    10 
ATOM 8160  C CB   . ASP A 1 39 ? -26.765 -13.462 9.955   1.00 0.00 ? 491 ASP C CB   10 
ATOM 8161  C CG   . ASP A 1 39 ? -28.190 -13.781 9.549   1.00 0.00 ? 491 ASP C CG   10 
ATOM 8162  O OD1  . ASP A 1 39 ? -28.791 -14.697 10.150  1.00 0.00 ? 491 ASP C OD1  10 
ATOM 8163  O OD2  . ASP A 1 39 ? -28.722 -13.103 8.638   1.00 0.00 ? 491 ASP C OD2  10 
ATOM 8164  H H    . ASP A 1 39 ? -24.257 -13.088 10.064  1.00 0.00 ? 491 ASP C H    10 
ATOM 8165  H HA   . ASP A 1 39 ? -25.862 -15.417 9.863   1.00 0.00 ? 491 ASP C HA   10 
ATOM 8166  H HB2  . ASP A 1 39 ? -26.710 -13.477 11.033  1.00 0.00 ? 491 ASP C HB2  10 
ATOM 8167  H HB3  . ASP A 1 39 ? -26.524 -12.469 9.604   1.00 0.00 ? 491 ASP C HB3  10 
ATOM 8168  N N    . ASN A 1 40 ? -25.377 -13.669 7.166   1.00 0.00 ? 492 ASN C N    10 
ATOM 8169  C CA   . ASN A 1 40 ? -25.401 -13.642 5.730   1.00 0.00 ? 492 ASN C CA   10 
ATOM 8170  C C    . ASN A 1 40 ? -24.828 -14.932 5.166   1.00 0.00 ? 492 ASN C C    10 
ATOM 8171  O O    . ASN A 1 40 ? -25.452 -15.586 4.335   1.00 0.00 ? 492 ASN C O    10 
ATOM 8172  C CB   . ASN A 1 40 ? -24.620 -12.416 5.215   1.00 0.00 ? 492 ASN C CB   10 
ATOM 8173  C CG   . ASN A 1 40 ? -25.506 -11.217 4.990   1.00 0.00 ? 492 ASN C CG   10 
ATOM 8174  O OD1  . ASN A 1 40 ? -26.724 -11.347 4.848   1.00 0.00 ? 492 ASN C OD1  10 
ATOM 8175  N ND2  . ASN A 1 40 ? -24.906 -10.049 4.918   1.00 0.00 ? 492 ASN C ND2  10 
ATOM 8176  H H    . ASN A 1 40 ? -24.919 -12.937 7.638   1.00 0.00 ? 492 ASN C H    10 
ATOM 8177  H HA   . ASN A 1 40 ? -26.431 -13.536 5.432   1.00 0.00 ? 492 ASN C HA   10 
ATOM 8178  H HB2  . ASN A 1 40 ? -23.902 -12.130 5.972   1.00 0.00 ? 492 ASN C HB2  10 
ATOM 8179  H HB3  . ASN A 1 40 ? -24.092 -12.638 4.309   1.00 0.00 ? 492 ASN C HB3  10 
ATOM 8180  H HD21 . ASN A 1 40 ? -23.926 -10.012 5.008   1.00 0.00 ? 492 ASN C HD21 10 
ATOM 8181  H HD22 . ASN A 1 40 ? -25.460 -9.258  4.771   1.00 0.00 ? 492 ASN C HD22 10 
ATOM 8182  N N    . ILE A 1 41 ? -23.650 -15.309 5.644   1.00 0.00 ? 493 ILE C N    10 
ATOM 8183  C CA   . ILE A 1 41 ? -23.007 -16.555 5.231   1.00 0.00 ? 493 ILE C CA   10 
ATOM 8184  C C    . ILE A 1 41 ? -23.944 -17.734 5.489   1.00 0.00 ? 493 ILE C C    10 
ATOM 8185  O O    . ILE A 1 41 ? -24.184 -18.572 4.616   1.00 0.00 ? 493 ILE C O    10 
ATOM 8186  C CB   . ILE A 1 41 ? -21.710 -16.806 6.042   1.00 0.00 ? 493 ILE C CB   10 
ATOM 8187  C CG1  . ILE A 1 41 ? -20.739 -15.649 5.902   1.00 0.00 ? 493 ILE C CG1  10 
ATOM 8188  C CG2  . ILE A 1 41 ? -21.044 -18.102 5.610   1.00 0.00 ? 493 ILE C CG2  10 
ATOM 8189  C CD1  . ILE A 1 41 ? -19.609 -15.700 6.907   1.00 0.00 ? 493 ILE C CD1  10 
ATOM 8190  H H    . ILE A 1 41 ? -23.190 -14.726 6.291   1.00 0.00 ? 493 ILE C H    10 
ATOM 8191  H HA   . ILE A 1 41 ? -22.770 -16.483 4.179   1.00 0.00 ? 493 ILE C HA   10 
ATOM 8192  H HB   . ILE A 1 41 ? -21.984 -16.905 7.083   1.00 0.00 ? 493 ILE C HB   10 
ATOM 8193  H HG12 . ILE A 1 41 ? -20.309 -15.665 4.914   1.00 0.00 ? 493 ILE C HG12 10 
ATOM 8194  H HG13 . ILE A 1 41 ? -21.272 -14.724 6.046   1.00 0.00 ? 493 ILE C HG13 10 
ATOM 8195  H HG21 . ILE A 1 41 ? -20.784 -18.037 4.564   1.00 0.00 ? 493 ILE C HG21 10 
ATOM 8196  H HG22 . ILE A 1 41 ? -21.724 -18.926 5.765   1.00 0.00 ? 493 ILE C HG22 10 
ATOM 8197  H HG23 . ILE A 1 41 ? -20.151 -18.256 6.196   1.00 0.00 ? 493 ILE C HG23 10 
ATOM 8198  H HD11 . ILE A 1 41 ? -19.032 -16.600 6.757   1.00 0.00 ? 493 ILE C HD11 10 
ATOM 8199  H HD12 . ILE A 1 41 ? -20.022 -15.711 7.905   1.00 0.00 ? 493 ILE C HD12 10 
ATOM 8200  H HD13 . ILE A 1 41 ? -18.974 -14.837 6.791   1.00 0.00 ? 493 ILE C HD13 10 
ATOM 8201  N N    . LEU A 1 42 ? -24.478 -17.762 6.693   1.00 0.00 ? 494 LEU C N    10 
ATOM 8202  C CA   . LEU A 1 42 ? -25.342 -18.829 7.161   1.00 0.00 ? 494 LEU C CA   10 
ATOM 8203  C C    . LEU A 1 42 ? -26.634 -18.931 6.346   1.00 0.00 ? 494 LEU C C    10 
ATOM 8204  O O    . LEU A 1 42 ? -27.132 -20.024 6.102   1.00 0.00 ? 494 LEU C O    10 
ATOM 8205  C CB   . LEU A 1 42 ? -25.641 -18.611 8.642   1.00 0.00 ? 494 LEU C CB   10 
ATOM 8206  C CG   . LEU A 1 42 ? -24.411 -18.658 9.555   1.00 0.00 ? 494 LEU C CG   10 
ATOM 8207  C CD1  . LEU A 1 42 ? -24.748 -18.172 10.952  1.00 0.00 ? 494 LEU C CD1  10 
ATOM 8208  C CD2  . LEU A 1 42 ? -23.839 -20.065 9.602   1.00 0.00 ? 494 LEU C CD2  10 
ATOM 8209  H H    . LEU A 1 42 ? -24.279 -17.019 7.307   1.00 0.00 ? 494 LEU C H    10 
ATOM 8210  H HA   . LEU A 1 42 ? -24.799 -19.756 7.057   1.00 0.00 ? 494 LEU C HA   10 
ATOM 8211  H HB2  . LEU A 1 42 ? -26.106 -17.642 8.750   1.00 0.00 ? 494 LEU C HB2  10 
ATOM 8212  H HB3  . LEU A 1 42 ? -26.338 -19.363 8.974   1.00 0.00 ? 494 LEU C HB3  10 
ATOM 8213  H HG   . LEU A 1 42 ? -23.653 -18.003 9.153   1.00 0.00 ? 494 LEU C HG   10 
ATOM 8214  H HD11 . LEU A 1 42 ? -25.512 -18.800 11.381  1.00 0.00 ? 494 LEU C HD11 10 
ATOM 8215  H HD12 . LEU A 1 42 ? -25.099 -17.152 10.902  1.00 0.00 ? 494 LEU C HD12 10 
ATOM 8216  H HD13 . LEU A 1 42 ? -23.860 -18.215 11.566  1.00 0.00 ? 494 LEU C HD13 10 
ATOM 8217  H HD21 . LEU A 1 42 ? -23.512 -20.355 8.615   1.00 0.00 ? 494 LEU C HD21 10 
ATOM 8218  H HD22 . LEU A 1 42 ? -24.599 -20.753 9.942   1.00 0.00 ? 494 LEU C HD22 10 
ATOM 8219  H HD23 . LEU A 1 42 ? -23.000 -20.091 10.281  1.00 0.00 ? 494 LEU C HD23 10 
ATOM 8220  N N    . GLU A 1 43 ? -27.161 -17.803 5.916   1.00 0.00 ? 495 GLU C N    10 
ATOM 8221  C CA   . GLU A 1 43 ? -28.391 -17.797 5.136   1.00 0.00 ? 495 GLU C CA   10 
ATOM 8222  C C    . GLU A 1 43 ? -28.125 -18.000 3.648   1.00 0.00 ? 495 GLU C C    10 
ATOM 8223  O O    . GLU A 1 43 ? -29.050 -17.979 2.833   1.00 0.00 ? 495 GLU C O    10 
ATOM 8224  C CB   . GLU A 1 43 ? -29.163 -16.511 5.372   1.00 0.00 ? 495 GLU C CB   10 
ATOM 8225  C CG   . GLU A 1 43 ? -29.690 -16.388 6.787   1.00 0.00 ? 495 GLU C CG   10 
ATOM 8226  C CD   . GLU A 1 43 ? -30.553 -17.567 7.183   1.00 0.00 ? 495 GLU C CD   10 
ATOM 8227  O OE1  . GLU A 1 43 ? -31.612 -17.769 6.554   1.00 0.00 ? 495 GLU C OE1  10 
ATOM 8228  O OE2  . GLU A 1 43 ? -30.182 -18.299 8.130   1.00 0.00 ? 495 GLU C OE2  10 
ATOM 8229  H H    . GLU A 1 43 ? -26.729 -16.949 6.140   1.00 0.00 ? 495 GLU C H    10 
ATOM 8230  H HA   . GLU A 1 43 ? -28.991 -18.624 5.486   1.00 0.00 ? 495 GLU C HA   10 
ATOM 8231  H HB2  . GLU A 1 43 ? -28.513 -15.672 5.174   1.00 0.00 ? 495 GLU C HB2  10 
ATOM 8232  H HB3  . GLU A 1 43 ? -30.001 -16.477 4.693   1.00 0.00 ? 495 GLU C HB3  10 
ATOM 8233  H HG2  . GLU A 1 43 ? -28.852 -16.327 7.465   1.00 0.00 ? 495 GLU C HG2  10 
ATOM 8234  H HG3  . GLU A 1 43 ? -30.275 -15.486 6.858   1.00 0.00 ? 495 GLU C HG3  10 
ATOM 8235  N N    . GLY A 1 44 ? -26.867 -18.190 3.296   1.00 0.00 ? 496 GLY C N    10 
ATOM 8236  C CA   . GLY A 1 44 ? -26.513 -18.436 1.909   1.00 0.00 ? 496 GLY C CA   10 
ATOM 8237  C C    . GLY A 1 44 ? -26.413 -17.166 1.097   1.00 0.00 ? 496 GLY C C    10 
ATOM 8238  O O    . GLY A 1 44 ? -26.501 -17.196 -0.129  1.00 0.00 ? 496 GLY C O    10 
ATOM 8239  H H    . GLY A 1 44 ? -26.170 -18.165 3.986   1.00 0.00 ? 496 GLY C H    10 
ATOM 8240  H HA2  . GLY A 1 44 ? -25.562 -18.947 1.877   1.00 0.00 ? 496 GLY C HA2  10 
ATOM 8241  H HA3  . GLY A 1 44 ? -27.264 -19.074 1.466   1.00 0.00 ? 496 GLY C HA3  10 
ATOM 8242  N N    . ARG A 1 45 ? -26.229 -16.050 1.781   1.00 0.00 ? 497 ARG C N    10 
ATOM 8243  C CA   . ARG A 1 45 ? -26.086 -14.758 1.124   1.00 0.00 ? 497 ARG C CA   10 
ATOM 8244  C C    . ARG A 1 45 ? -24.780 -14.712 0.365   1.00 0.00 ? 497 ARG C C    10 
ATOM 8245  O O    . ARG A 1 45 ? -24.688 -14.126 -0.712  1.00 0.00 ? 497 ARG C O    10 
ATOM 8246  C CB   . ARG A 1 45 ? -26.116 -13.637 2.158   1.00 0.00 ? 497 ARG C CB   10 
ATOM 8247  C CG   . ARG A 1 45 ? -25.944 -12.229 1.584   1.00 0.00 ? 497 ARG C CG   10 
ATOM 8248  C CD   . ARG A 1 45 ? -27.189 -11.748 0.837   1.00 0.00 ? 497 ARG C CD   10 
ATOM 8249  N NE   . ARG A 1 45 ? -27.471 -12.534 -0.373  1.00 0.00 ? 497 ARG C NE   10 
ATOM 8250  C CZ   . ARG A 1 45 ? -28.625 -13.176 -0.602  1.00 0.00 ? 497 ARG C CZ   10 
ATOM 8251  N NH1  . ARG A 1 45 ? -29.594 -13.157 0.311   1.00 0.00 ? 497 ARG C NH1  10 
ATOM 8252  N NH2  . ARG A 1 45 ? -28.801 -13.839 -1.736  1.00 0.00 ? 497 ARG C NH2  10 
ATOM 8253  H H    . ARG A 1 45 ? -26.182 -16.093 2.763   1.00 0.00 ? 497 ARG C H    10 
ATOM 8254  H HA   . ARG A 1 45 ? -26.908 -14.631 0.434   1.00 0.00 ? 497 ARG C HA   10 
ATOM 8255  H HB2  . ARG A 1 45 ? -27.058 -13.675 2.683   1.00 0.00 ? 497 ARG C HB2  10 
ATOM 8256  H HB3  . ARG A 1 45 ? -25.313 -13.817 2.864   1.00 0.00 ? 497 ARG C HB3  10 
ATOM 8257  H HG2  . ARG A 1 45 ? -25.745 -11.547 2.397   1.00 0.00 ? 497 ARG C HG2  10 
ATOM 8258  H HG3  . ARG A 1 45 ? -25.104 -12.233 0.906   1.00 0.00 ? 497 ARG C HG3  10 
ATOM 8259  H HD2  . ARG A 1 45 ? -28.036 -11.813 1.500   1.00 0.00 ? 497 ARG C HD2  10 
ATOM 8260  H HD3  . ARG A 1 45 ? -27.040 -10.716 0.553   1.00 0.00 ? 497 ARG C HD3  10 
ATOM 8261  H HE   . ARG A 1 45 ? -26.760 -12.572 -1.055  1.00 0.00 ? 497 ARG C HE   10 
ATOM 8262  H HH11 . ARG A 1 45 ? -29.472 -12.667 1.178   1.00 0.00 ? 497 ARG C HH11 10 
ATOM 8263  H HH12 . ARG A 1 45 ? -30.460 -13.634 0.145   1.00 0.00 ? 497 ARG C HH12 10 
ATOM 8264  H HH21 . ARG A 1 45 ? -28.072 -13.860 -2.427  1.00 0.00 ? 497 ARG C HH21 10 
ATOM 8265  H HH22 . ARG A 1 45 ? -29.659 -14.329 -1.915  1.00 0.00 ? 497 ARG C HH22 10 
ATOM 8266  N N    . ILE A 1 46 ? -23.772 -15.332 0.938   1.00 0.00 ? 498 ILE C N    10 
ATOM 8267  C CA   . ILE A 1 46 ? -22.472 -15.392 0.325   1.00 0.00 ? 498 ILE C CA   10 
ATOM 8268  C C    . ILE A 1 46 ? -22.229 -16.792 -0.198  1.00 0.00 ? 498 ILE C C    10 
ATOM 8269  O O    . ILE A 1 46 ? -21.895 -17.701 0.565   1.00 0.00 ? 498 ILE C O    10 
ATOM 8270  C CB   . ILE A 1 46 ? -21.352 -15.004 1.324   1.00 0.00 ? 498 ILE C CB   10 
ATOM 8271  C CG1  . ILE A 1 46 ? -21.652 -13.636 1.945   1.00 0.00 ? 498 ILE C CG1  10 
ATOM 8272  C CG2  . ILE A 1 46 ? -19.994 -14.985 0.622   1.00 0.00 ? 498 ILE C CG2  10 
ATOM 8273  C CD1  . ILE A 1 46 ? -20.700 -13.237 3.051   1.00 0.00 ? 498 ILE C CD1  10 
ATOM 8274  H H    . ILE A 1 46 ? -23.917 -15.775 1.800   1.00 0.00 ? 498 ILE C H    10 
ATOM 8275  H HA   . ILE A 1 46 ? -22.457 -14.697 -0.501  1.00 0.00 ? 498 ILE C HA   10 
ATOM 8276  H HB   . ILE A 1 46 ? -21.320 -15.748 2.105   1.00 0.00 ? 498 ILE C HB   10 
ATOM 8277  H HG12 . ILE A 1 46 ? -21.593 -12.883 1.175   1.00 0.00 ? 498 ILE C HG12 10 
ATOM 8278  H HG13 . ILE A 1 46 ? -22.651 -13.651 2.350   1.00 0.00 ? 498 ILE C HG13 10 
ATOM 8279  H HG21 . ILE A 1 46 ? -20.012 -14.260 -0.177  1.00 0.00 ? 498 ILE C HG21 10 
ATOM 8280  H HG22 . ILE A 1 46 ? -19.784 -15.963 0.216   1.00 0.00 ? 498 ILE C HG22 10 
ATOM 8281  H HG23 . ILE A 1 46 ? -19.228 -14.718 1.334   1.00 0.00 ? 498 ILE C HG23 10 
ATOM 8282  H HD11 . ILE A 1 46 ? -19.692 -13.192 2.664   1.00 0.00 ? 498 ILE C HD11 10 
ATOM 8283  H HD12 . ILE A 1 46 ? -20.750 -13.963 3.848   1.00 0.00 ? 498 ILE C HD12 10 
ATOM 8284  H HD13 . ILE A 1 46 ? -20.981 -12.267 3.435   1.00 0.00 ? 498 ILE C HD13 10 
ATOM 8285  N N    . GLN A 1 47 ? -22.432 -16.972 -1.483  1.00 0.00 ? 499 GLN C N    10 
ATOM 8286  C CA   . GLN A 1 47 ? -22.240 -18.261 -2.104  1.00 0.00 ? 499 GLN C CA   10 
ATOM 8287  C C    . GLN A 1 47 ? -20.943 -18.268 -2.876  1.00 0.00 ? 499 GLN C C    10 
ATOM 8288  O O    . GLN A 1 47 ? -20.694 -17.382 -3.702  1.00 0.00 ? 499 GLN C O    10 
ATOM 8289  C CB   . GLN A 1 47 ? -23.416 -18.605 -3.018  1.00 0.00 ? 499 GLN C CB   10 
ATOM 8290  C CG   . GLN A 1 47 ? -23.285 -19.955 -3.696  1.00 0.00 ? 499 GLN C CG   10 
ATOM 8291  C CD   . GLN A 1 47 ? -24.523 -20.342 -4.469  1.00 0.00 ? 499 GLN C CD   10 
ATOM 8292  O OE1  . GLN A 1 47 ? -25.256 -19.486 -4.968  1.00 0.00 ? 499 GLN C OE1  10 
ATOM 8293  N NE2  . GLN A 1 47 ? -24.763 -21.631 -4.580  1.00 0.00 ? 499 GLN C NE2  10 
ATOM 8294  H H    . GLN A 1 47 ? -22.710 -16.209 -2.036  1.00 0.00 ? 499 GLN C H    10 
ATOM 8295  H HA   . GLN A 1 47 ? -22.180 -18.997 -1.317  1.00 0.00 ? 499 GLN C HA   10 
ATOM 8296  H HB2  . GLN A 1 47 ? -24.325 -18.607 -2.432  1.00 0.00 ? 499 GLN C HB2  10 
ATOM 8297  H HB3  . GLN A 1 47 ? -23.494 -17.848 -3.784  1.00 0.00 ? 499 GLN C HB3  10 
ATOM 8298  H HG2  . GLN A 1 47 ? -22.450 -19.920 -4.379  1.00 0.00 ? 499 GLN C HG2  10 
ATOM 8299  H HG3  . GLN A 1 47 ? -23.099 -20.704 -2.940  1.00 0.00 ? 499 GLN C HG3  10 
ATOM 8300  H HE21 . GLN A 1 47 ? -24.137 -22.260 -4.160  1.00 0.00 ? 499 GLN C HE21 10 
ATOM 8301  H HE22 . GLN A 1 47 ? -25.553 -21.915 -5.084  1.00 0.00 ? 499 GLN C HE22 10 
ATOM 8302  N N    . VAL A 1 48 ? -20.111 -19.247 -2.605  1.00 0.00 ? 500 VAL C N    10 
ATOM 8303  C CA   . VAL A 1 48 ? -18.818 -19.326 -3.227  1.00 0.00 ? 500 VAL C CA   10 
ATOM 8304  C C    . VAL A 1 48 ? -18.631 -20.658 -3.942  1.00 0.00 ? 500 VAL C C    10 
ATOM 8305  O O    . VAL A 1 48 ? -19.269 -21.654 -3.590  1.00 0.00 ? 500 VAL C O    10 
ATOM 8306  C CB   . VAL A 1 48 ? -17.695 -19.152 -2.178  1.00 0.00 ? 500 VAL C CB   10 
ATOM 8307  C CG1  . VAL A 1 48 ? -17.885 -17.860 -1.409  1.00 0.00 ? 500 VAL C CG1  10 
ATOM 8308  C CG2  . VAL A 1 48 ? -17.642 -20.341 -1.222  1.00 0.00 ? 500 VAL C CG2  10 
ATOM 8309  H H    . VAL A 1 48 ? -20.368 -19.946 -1.965  1.00 0.00 ? 500 VAL C H    10 
ATOM 8310  H HA   . VAL A 1 48 ? -18.742 -18.520 -3.938  1.00 0.00 ? 500 VAL C HA   10 
ATOM 8311  H HB   . VAL A 1 48 ? -16.757 -19.097 -2.704  1.00 0.00 ? 500 VAL C HB   10 
ATOM 8312  H HG11 . VAL A 1 48 ? -18.817 -17.895 -0.865  1.00 0.00 ? 500 VAL C HG11 10 
ATOM 8313  H HG12 . VAL A 1 48 ? -17.906 -17.031 -2.100  1.00 0.00 ? 500 VAL C HG12 10 
ATOM 8314  H HG13 . VAL A 1 48 ? -17.069 -17.732 -0.717  1.00 0.00 ? 500 VAL C HG13 10 
ATOM 8315  H HG21 . VAL A 1 48 ? -17.440 -21.242 -1.779  1.00 0.00 ? 500 VAL C HG21 10 
ATOM 8316  H HG22 . VAL A 1 48 ? -18.590 -20.438 -0.715  1.00 0.00 ? 500 VAL C HG22 10 
ATOM 8317  H HG23 . VAL A 1 48 ? -16.859 -20.184 -0.495  1.00 0.00 ? 500 VAL C HG23 10 
ATOM 8318  N N    . PRO A 1 49 ? -17.778 -20.692 -4.976  1.00 0.00 ? 501 PRO C N    10 
ATOM 8319  C CA   . PRO A 1 49 ? -17.448 -21.921 -5.676  1.00 0.00 ? 501 PRO C CA   10 
ATOM 8320  C C    . PRO A 1 49 ? -16.508 -22.770 -4.830  1.00 0.00 ? 501 PRO C C    10 
ATOM 8321  O O    . PRO A 1 49 ? -15.787 -22.243 -3.974  1.00 0.00 ? 501 PRO C O    10 
ATOM 8322  C CB   . PRO A 1 49 ? -16.732 -21.444 -6.955  1.00 0.00 ? 501 PRO C CB   10 
ATOM 8323  C CG   . PRO A 1 49 ? -16.889 -19.957 -6.972  1.00 0.00 ? 501 PRO C CG   10 
ATOM 8324  C CD   . PRO A 1 49 ? -17.080 -19.543 -5.550  1.00 0.00 ? 501 PRO C CD   10 
ATOM 8325  H HA   . PRO A 1 49 ? -18.331 -22.489 -5.927  1.00 0.00 ? 501 PRO C HA   10 
ATOM 8326  H HB2  . PRO A 1 49 ? -15.693 -21.729 -6.911  1.00 0.00 ? 501 PRO C HB2  10 
ATOM 8327  H HB3  . PRO A 1 49 ? -17.197 -21.898 -7.819  1.00 0.00 ? 501 PRO C HB3  10 
ATOM 8328  H HG2  . PRO A 1 49 ? -16.001 -19.499 -7.377  1.00 0.00 ? 501 PRO C HG2  10 
ATOM 8329  H HG3  . PRO A 1 49 ? -17.753 -19.685 -7.561  1.00 0.00 ? 501 PRO C HG3  10 
ATOM 8330  H HD2  . PRO A 1 49 ? -16.124 -19.394 -5.070  1.00 0.00 ? 501 PRO C HD2  10 
ATOM 8331  H HD3  . PRO A 1 49 ? -17.683 -18.651 -5.495  1.00 0.00 ? 501 PRO C HD3  10 
ATOM 8332  N N    . PHE A 1 50 ? -16.498 -24.061 -5.064  1.00 0.00 ? 502 PHE C N    10 
ATOM 8333  C CA   . PHE A 1 50 ? -15.682 -24.954 -4.272  1.00 0.00 ? 502 PHE C CA   10 
ATOM 8334  C C    . PHE A 1 50 ? -14.444 -25.350 -5.044  1.00 0.00 ? 502 PHE C C    10 
ATOM 8335  O O    . PHE A 1 50 ? -14.551 -25.878 -6.157  1.00 0.00 ? 502 PHE C O    10 
ATOM 8336  C CB   . PHE A 1 50 ? -16.482 -26.198 -3.880  1.00 0.00 ? 502 PHE C CB   10 
ATOM 8337  C CG   . PHE A 1 50 ? -17.740 -25.888 -3.124  1.00 0.00 ? 502 PHE C CG   10 
ATOM 8338  C CD1  . PHE A 1 50 ? -17.687 -25.482 -1.801  1.00 0.00 ? 502 PHE C CD1  10 
ATOM 8339  C CD2  . PHE A 1 50 ? -18.978 -26.000 -3.737  1.00 0.00 ? 502 PHE C CD2  10 
ATOM 8340  C CE1  . PHE A 1 50 ? -18.844 -25.195 -1.104  1.00 0.00 ? 502 PHE C CE1  10 
ATOM 8341  C CE2  . PHE A 1 50 ? -20.137 -25.715 -3.046  1.00 0.00 ? 502 PHE C CE2  10 
ATOM 8342  C CZ   . PHE A 1 50 ? -20.070 -25.311 -1.727  1.00 0.00 ? 502 PHE C CZ   10 
ATOM 8343  H H    . PHE A 1 50 ? -17.031 -24.427 -5.805  1.00 0.00 ? 502 PHE C H    10 
ATOM 8344  H HA   . PHE A 1 50 ? -15.389 -24.430 -3.376  1.00 0.00 ? 502 PHE C HA   10 
ATOM 8345  H HB2  . PHE A 1 50 ? -16.756 -26.737 -4.774  1.00 0.00 ? 502 PHE C HB2  10 
ATOM 8346  H HB3  . PHE A 1 50 ? -15.865 -26.831 -3.260  1.00 0.00 ? 502 PHE C HB3  10 
ATOM 8347  H HD1  . PHE A 1 50 ? -16.728 -25.390 -1.313  1.00 0.00 ? 502 PHE C HD1  10 
ATOM 8348  H HD2  . PHE A 1 50 ? -19.032 -26.315 -4.767  1.00 0.00 ? 502 PHE C HD2  10 
ATOM 8349  H HE1  . PHE A 1 50 ? -18.788 -24.880 -0.073  1.00 0.00 ? 502 PHE C HE1  10 
ATOM 8350  H HE2  . PHE A 1 50 ? -21.095 -25.807 -3.535  1.00 0.00 ? 502 PHE C HE2  10 
ATOM 8351  H HZ   . PHE A 1 50 ? -20.977 -25.088 -1.185  1.00 0.00 ? 502 PHE C HZ   10 
ATOM 8352  N N    . PRO A 1 51 ? -13.243 -25.078 -4.484  1.00 0.00 ? 503 PRO C N    10 
ATOM 8353  C CA   . PRO A 1 51 ? -11.983 -25.442 -5.128  1.00 0.00 ? 503 PRO C CA   10 
ATOM 8354  C C    . PRO A 1 51 ? -11.989 -26.910 -5.511  1.00 0.00 ? 503 PRO C C    10 
ATOM 8355  O O    . PRO A 1 51 ? -12.121 -27.790 -4.655  1.00 0.00 ? 503 PRO C O    10 
ATOM 8356  C CB   . PRO A 1 51 ? -10.938 -25.174 -4.043  1.00 0.00 ? 503 PRO C CB   10 
ATOM 8357  C CG   . PRO A 1 51 ? -11.552 -24.123 -3.186  1.00 0.00 ? 503 PRO C CG   10 
ATOM 8358  C CD   . PRO A 1 51 ? -13.031 -24.395 -3.194  1.00 0.00 ? 503 PRO C CD   10 
ATOM 8359  H HA   . PRO A 1 51 ? -11.785 -24.837 -6.000  1.00 0.00 ? 503 PRO C HA   10 
ATOM 8360  H HB2  . PRO A 1 51 ? -10.752 -26.081 -3.487  1.00 0.00 ? 503 PRO C HB2  10 
ATOM 8361  H HB3  . PRO A 1 51 ? -10.021 -24.825 -4.497  1.00 0.00 ? 503 PRO C HB3  10 
ATOM 8362  H HG2  . PRO A 1 51 ? -11.163 -24.192 -2.182  1.00 0.00 ? 503 PRO C HG2  10 
ATOM 8363  H HG3  . PRO A 1 51 ? -11.350 -23.146 -3.602  1.00 0.00 ? 503 PRO C HG3  10 
ATOM 8364  H HD2  . PRO A 1 51 ? -13.302 -25.033 -2.368  1.00 0.00 ? 503 PRO C HD2  10 
ATOM 8365  H HD3  . PRO A 1 51 ? -13.583 -23.466 -3.155  1.00 0.00 ? 503 PRO C HD3  10 
ATOM 8366  N N    . THR A 1 52 ? -11.835 -27.170 -6.785  1.00 0.00 ? 504 THR C N    10 
ATOM 8367  C CA   . THR A 1 52 ? -11.929 -28.507 -7.298  1.00 0.00 ? 504 THR C CA   10 
ATOM 8368  C C    . THR A 1 52 ? -11.009 -28.678 -8.506  1.00 0.00 ? 504 THR C C    10 
ATOM 8369  O O    . THR A 1 52 ? -11.333 -28.146 -9.587  1.00 0.00 ? 504 THR C O    10 
ATOM 8370  C CB   . THR A 1 52 ? -13.403 -28.832 -7.683  1.00 0.00 ? 504 THR C CB   10 
ATOM 8371  O OG1  . THR A 1 52 ? -14.248 -28.695 -6.528  1.00 0.00 ? 504 THR C OG1  10 
ATOM 8372  C CG2  . THR A 1 52 ? -13.529 -30.245 -8.238  1.00 0.00 ? 504 THR C CG2  10 
ATOM 8373  O OXT  . THR A 1 52 ? -9.954  -29.325 -8.361  1.00 0.00 ? 504 THR C OXT  10 
ATOM 8374  H H    . THR A 1 52 ? -11.646 -26.436 -7.407  1.00 0.00 ? 504 THR C H    10 
ATOM 8375  H HA   . THR A 1 52 ? -11.620 -29.189 -6.519  1.00 0.00 ? 504 THR C HA   10 
ATOM 8376  H HB   . THR A 1 52 ? -13.738 -28.123 -8.427  1.00 0.00 ? 504 THR C HB   10 
ATOM 8377  H HG1  . THR A 1 52 ? -14.374 -27.752 -6.352  1.00 0.00 ? 504 THR C HG1  10 
ATOM 8378  H HG21 . THR A 1 52 ? -13.199 -30.954 -7.494  1.00 0.00 ? 504 THR C HG21 10 
ATOM 8379  H HG22 . THR A 1 52 ? -12.919 -30.339 -9.122  1.00 0.00 ? 504 THR C HG22 10 
ATOM 8380  H HG23 . THR A 1 52 ? -14.562 -30.441 -8.489  1.00 0.00 ? 504 THR C HG23 10 
ATOM 8381  N N    . SER A 1 1  ? -8.986  2.493   2.465   1.00 0.00 ? 453 SER C N    11 
ATOM 8382  C CA   . SER A 1 1  ? -8.200  2.021   3.614   1.00 0.00 ? 453 SER C CA   11 
ATOM 8383  C C    . SER A 1 1  ? -8.592  0.587   3.973   1.00 0.00 ? 453 SER C C    11 
ATOM 8384  O O    . SER A 1 1  ? -7.769  -0.324  3.905   1.00 0.00 ? 453 SER C O    11 
ATOM 8385  C CB   . SER A 1 1  ? -8.417  2.950   4.806   1.00 0.00 ? 453 SER C CB   11 
ATOM 8386  O OG   . SER A 1 1  ? -8.196  4.303   4.436   1.00 0.00 ? 453 SER C OG   11 
ATOM 8387  H H1   . SER A 1 1  ? -10.002 2.444   2.680   1.00 0.00 ? 453 SER C H1   11 
ATOM 8388  H H2   . SER A 1 1  ? -8.789  1.913   1.625   1.00 0.00 ? 453 SER C H2   11 
ATOM 8389  H H3   . SER A 1 1  ? -8.742  3.482   2.256   1.00 0.00 ? 453 SER C H3   11 
ATOM 8390  H HA   . SER A 1 1  ? -7.156  2.035   3.335   1.00 0.00 ? 453 SER C HA   11 
ATOM 8391  H HB2  . SER A 1 1  ? -9.432  2.849   5.158   1.00 0.00 ? 453 SER C HB2  11 
ATOM 8392  H HB3  . SER A 1 1  ? -7.731  2.687   5.597   1.00 0.00 ? 453 SER C HB3  11 
ATOM 8393  H HG   . SER A 1 1  ? -7.354  4.601   4.800   1.00 0.00 ? 453 SER C HG   11 
ATOM 8394  N N    . ASN A 1 2  ? -9.864  0.401   4.355   1.00 0.00 ? 454 ASN C N    11 
ATOM 8395  C CA   . ASN A 1 2  ? -10.414 -0.923  4.686   1.00 0.00 ? 454 ASN C CA   11 
ATOM 8396  C C    . ASN A 1 2  ? -9.731  -1.521  5.917   1.00 0.00 ? 454 ASN C C    11 
ATOM 8397  O O    . ASN A 1 2  ? -9.752  -2.735  6.126   1.00 0.00 ? 454 ASN C O    11 
ATOM 8398  C CB   . ASN A 1 2  ? -10.300 -1.892  3.485   1.00 0.00 ? 454 ASN C CB   11 
ATOM 8399  C CG   . ASN A 1 2  ? -11.049 -1.406  2.245   1.00 0.00 ? 454 ASN C CG   11 
ATOM 8400  O OD1  . ASN A 1 2  ? -11.138 -0.205  1.977   1.00 0.00 ? 454 ASN C OD1  11 
ATOM 8401  N ND2  . ASN A 1 2  ? -11.590 -2.329  1.481   1.00 0.00 ? 454 ASN C ND2  11 
ATOM 8402  H H    . ASN A 1 2  ? -10.461 1.177   4.416   1.00 0.00 ? 454 ASN C H    11 
ATOM 8403  H HA   . ASN A 1 2  ? -11.460 -0.785  4.916   1.00 0.00 ? 454 ASN C HA   11 
ATOM 8404  H HB2  . ASN A 1 2  ? -9.258  -2.006  3.225   1.00 0.00 ? 454 ASN C HB2  11 
ATOM 8405  H HB3  . ASN A 1 2  ? -10.698 -2.854  3.770   1.00 0.00 ? 454 ASN C HB3  11 
ATOM 8406  H HD21 . ASN A 1 2  ? -11.485 -3.269  1.741   1.00 0.00 ? 454 ASN C HD21 11 
ATOM 8407  H HD22 . ASN A 1 2  ? -12.084 -2.043  0.681   1.00 0.00 ? 454 ASN C HD22 11 
ATOM 8408  N N    . SER A 1 3  ? -9.165  -0.651  6.750   1.00 0.00 ? 455 SER C N    11 
ATOM 8409  C CA   . SER A 1 3  ? -8.445  -1.067  7.946   1.00 0.00 ? 455 SER C CA   11 
ATOM 8410  C C    . SER A 1 3  ? -9.361  -1.830  8.909   1.00 0.00 ? 455 SER C C    11 
ATOM 8411  O O    . SER A 1 3  ? -8.993  -2.886  9.433   1.00 0.00 ? 455 SER C O    11 
ATOM 8412  C CB   . SER A 1 3  ? -7.864  0.159   8.639   1.00 0.00 ? 455 SER C CB   11 
ATOM 8413  O OG   . SER A 1 3  ? -7.248  1.019   7.695   1.00 0.00 ? 455 SER C OG   11 
ATOM 8414  H H    . SER A 1 3  ? -9.234  0.307   6.554   1.00 0.00 ? 455 SER C H    11 
ATOM 8415  H HA   . SER A 1 3  ? -7.636  -1.714  7.642   1.00 0.00 ? 455 SER C HA   11 
ATOM 8416  H HB2  . SER A 1 3  ? -8.655  0.695   9.142   1.00 0.00 ? 455 SER C HB2  11 
ATOM 8417  H HB3  . SER A 1 3  ? -7.124  -0.153  9.361   1.00 0.00 ? 455 SER C HB3  11 
ATOM 8418  H HG   . SER A 1 3  ? -6.460  0.586   7.345   1.00 0.00 ? 455 SER C HG   11 
ATOM 8419  N N    . GLN A 1 4  ? -10.556 -1.297  9.126   1.00 0.00 ? 456 GLN C N    11 
ATOM 8420  C CA   . GLN A 1 4  ? -11.518 -1.924  10.013  1.00 0.00 ? 456 GLN C CA   11 
ATOM 8421  C C    . GLN A 1 4  ? -12.085 -3.174  9.366   1.00 0.00 ? 456 GLN C C    11 
ATOM 8422  O O    . GLN A 1 4  ? -12.278 -4.193  10.026  1.00 0.00 ? 456 GLN C O    11 
ATOM 8423  C CB   . GLN A 1 4  ? -12.651 -0.953  10.355  1.00 0.00 ? 456 GLN C CB   11 
ATOM 8424  C CG   . GLN A 1 4  ? -12.184 0.312   11.056  1.00 0.00 ? 456 GLN C CG   11 
ATOM 8425  C CD   . GLN A 1 4  ? -11.536 0.028   12.396  1.00 0.00 ? 456 GLN C CD   11 
ATOM 8426  O OE1  . GLN A 1 4  ? -11.880 -0.940  13.072  1.00 0.00 ? 456 GLN C OE1  11 
ATOM 8427  N NE2  . GLN A 1 4  ? -10.603 0.866   12.788  1.00 0.00 ? 456 GLN C NE2  11 
ATOM 8428  H H    . GLN A 1 4  ? -10.799 -0.464  8.667   1.00 0.00 ? 456 GLN C H    11 
ATOM 8429  H HA   . GLN A 1 4  ? -11.005 -2.199  10.922  1.00 0.00 ? 456 GLN C HA   11 
ATOM 8430  H HB2  . GLN A 1 4  ? -13.155 -0.670  9.445   1.00 0.00 ? 456 GLN C HB2  11 
ATOM 8431  H HB3  . GLN A 1 4  ? -13.354 -1.457  11.001  1.00 0.00 ? 456 GLN C HB3  11 
ATOM 8432  H HG2  . GLN A 1 4  ? -11.467 0.816   10.426  1.00 0.00 ? 456 GLN C HG2  11 
ATOM 8433  H HG3  . GLN A 1 4  ? -13.038 0.952   11.214  1.00 0.00 ? 456 GLN C HG3  11 
ATOM 8434  H HE21 . GLN A 1 4  ? -10.377 1.620   12.203  1.00 0.00 ? 456 GLN C HE21 11 
ATOM 8435  H HE22 . GLN A 1 4  ? -10.168 0.702   13.652  1.00 0.00 ? 456 GLN C HE22 11 
ATOM 8436  N N    . LEU A 1 5  ? -12.328 -3.092  8.059   1.00 0.00 ? 457 LEU C N    11 
ATOM 8437  C CA   . LEU A 1 5  ? -12.865 -4.213  7.292   1.00 0.00 ? 457 LEU C CA   11 
ATOM 8438  C C    . LEU A 1 5  ? -11.982 -5.442  7.430   1.00 0.00 ? 457 LEU C C    11 
ATOM 8439  O O    . LEU A 1 5  ? -12.478 -6.548  7.653   1.00 0.00 ? 457 LEU C O    11 
ATOM 8440  C CB   . LEU A 1 5  ? -13.006 -3.837  5.818   1.00 0.00 ? 457 LEU C CB   11 
ATOM 8441  C CG   . LEU A 1 5  ? -14.013 -2.730  5.507   1.00 0.00 ? 457 LEU C CG   11 
ATOM 8442  C CD1  . LEU A 1 5  ? -13.988 -2.404  4.039   1.00 0.00 ? 457 LEU C CD1  11 
ATOM 8443  C CD2  . LEU A 1 5  ? -15.405 -3.156  5.906   1.00 0.00 ? 457 LEU C CD2  11 
ATOM 8444  H H    . LEU A 1 5  ? -12.139 -2.246  7.599   1.00 0.00 ? 457 LEU C H    11 
ATOM 8445  H HA   . LEU A 1 5  ? -13.841 -4.443  7.688   1.00 0.00 ? 457 LEU C HA   11 
ATOM 8446  H HB2  . LEU A 1 5  ? -12.038 -3.522  5.459   1.00 0.00 ? 457 LEU C HB2  11 
ATOM 8447  H HB3  . LEU A 1 5  ? -13.302 -4.721  5.274   1.00 0.00 ? 457 LEU C HB3  11 
ATOM 8448  H HG   . LEU A 1 5  ? -13.758 -1.840  6.061   1.00 0.00 ? 457 LEU C HG   11 
ATOM 8449  H HD11 . LEU A 1 5  ? -14.280 -3.283  3.484   1.00 0.00 ? 457 LEU C HD11 11 
ATOM 8450  H HD12 . LEU A 1 5  ? -12.992 -2.103  3.752   1.00 0.00 ? 457 LEU C HD12 11 
ATOM 8451  H HD13 . LEU A 1 5  ? -14.684 -1.604  3.839   1.00 0.00 ? 457 LEU C HD13 11 
ATOM 8452  H HD21 . LEU A 1 5  ? -15.718 -3.964  5.262   1.00 0.00 ? 457 LEU C HD21 11 
ATOM 8453  H HD22 . LEU A 1 5  ? -16.082 -2.323  5.797   1.00 0.00 ? 457 LEU C HD22 11 
ATOM 8454  H HD23 . LEU A 1 5  ? -15.398 -3.493  6.930   1.00 0.00 ? 457 LEU C HD23 11 
ATOM 8455  N N    . ASN A 1 6  ? -10.674 -5.236  7.309   1.00 0.00 ? 458 ASN C N    11 
ATOM 8456  C CA   . ASN A 1 6  ? -9.700  -6.322  7.430   1.00 0.00 ? 458 ASN C CA   11 
ATOM 8457  C C    . ASN A 1 6  ? -9.867  -7.059  8.743   1.00 0.00 ? 458 ASN C C    11 
ATOM 8458  O O    . ASN A 1 6  ? -9.943  -8.283  8.768   1.00 0.00 ? 458 ASN C O    11 
ATOM 8459  C CB   . ASN A 1 6  ? -8.267  -5.790  7.314   1.00 0.00 ? 458 ASN C CB   11 
ATOM 8460  C CG   . ASN A 1 6  ? -7.910  -5.374  5.906   1.00 0.00 ? 458 ASN C CG   11 
ATOM 8461  O OD1  . ASN A 1 6  ? -8.401  -5.948  4.936   1.00 0.00 ? 458 ASN C OD1  11 
ATOM 8462  N ND2  . ASN A 1 6  ? -7.055  -4.376  5.782   1.00 0.00 ? 458 ASN C ND2  11 
ATOM 8463  H H    . ASN A 1 6  ? -10.352 -4.326  7.124   1.00 0.00 ? 458 ASN C H    11 
ATOM 8464  H HA   . ASN A 1 6  ? -9.879  -7.016  6.623   1.00 0.00 ? 458 ASN C HA   11 
ATOM 8465  H HB2  . ASN A 1 6  ? -8.158  -4.930  7.959   1.00 0.00 ? 458 ASN C HB2  11 
ATOM 8466  H HB3  . ASN A 1 6  ? -7.578  -6.558  7.630   1.00 0.00 ? 458 ASN C HB3  11 
ATOM 8467  H HD21 . ASN A 1 6  ? -6.698  -3.961  6.598   1.00 0.00 ? 458 ASN C HD21 11 
ATOM 8468  H HD22 . ASN A 1 6  ? -6.815  -4.082  4.877   1.00 0.00 ? 458 ASN C HD22 11 
ATOM 8469  N N    . ALA A 1 7  ? -9.948  -6.304  9.825   1.00 0.00 ? 459 ALA C N    11 
ATOM 8470  C CA   . ALA A 1 7  ? -10.103 -6.877  11.153  1.00 0.00 ? 459 ALA C CA   11 
ATOM 8471  C C    . ALA A 1 7  ? -11.452 -7.568  11.297  1.00 0.00 ? 459 ALA C C    11 
ATOM 8472  O O    . ALA A 1 7  ? -11.529 -8.686  11.799  1.00 0.00 ? 459 ALA C O    11 
ATOM 8473  C CB   . ALA A 1 7  ? -9.941  -5.802  12.212  1.00 0.00 ? 459 ALA C CB   11 
ATOM 8474  H H    . ALA A 1 7  ? -9.906  -5.329  9.728   1.00 0.00 ? 459 ALA C H    11 
ATOM 8475  H HA   . ALA A 1 7  ? -9.327  -7.618  11.298  1.00 0.00 ? 459 ALA C HA   11 
ATOM 8476  H HB1  . ALA A 1 7  ? -10.707 -5.052  12.082  1.00 0.00 ? 459 ALA C HB1  11 
ATOM 8477  H HB2  . ALA A 1 7  ? -8.968  -5.344  12.114  1.00 0.00 ? 459 ALA C HB2  11 
ATOM 8478  H HB3  . ALA A 1 7  ? -10.035 -6.244  13.192  1.00 0.00 ? 459 ALA C HB3  11 
ATOM 8479  N N    . MET A 1 8  ? -12.511 -6.909  10.837  1.00 0.00 ? 460 MET C N    11 
ATOM 8480  C CA   . MET A 1 8  ? -13.849 -7.465  10.936  1.00 0.00 ? 460 MET C CA   11 
ATOM 8481  C C    . MET A 1 8  ? -13.940 -8.808  10.220  1.00 0.00 ? 460 MET C C    11 
ATOM 8482  O O    . MET A 1 8  ? -14.460 -9.782  10.770  1.00 0.00 ? 460 MET C O    11 
ATOM 8483  C CB   . MET A 1 8  ? -14.891 -6.488  10.392  1.00 0.00 ? 460 MET C CB   11 
ATOM 8484  C CG   . MET A 1 8  ? -14.930 -5.159  11.138  1.00 0.00 ? 460 MET C CG   11 
ATOM 8485  S SD   . MET A 1 8  ? -16.530 -4.334  11.027  1.00 0.00 ? 460 MET C SD   11 
ATOM 8486  C CE   . MET A 1 8  ? -16.616 -4.012  9.278   1.00 0.00 ? 460 MET C CE   11 
ATOM 8487  H H    . MET A 1 8  ? -12.392 -6.026  10.421  1.00 0.00 ? 460 MET C H    11 
ATOM 8488  H HA   . MET A 1 8  ? -14.048 -7.630  11.986  1.00 0.00 ? 460 MET C HA   11 
ATOM 8489  H HB2  . MET A 1 8  ? -14.680 -6.297  9.350   1.00 0.00 ? 460 MET C HB2  11 
ATOM 8490  H HB3  . MET A 1 8  ? -15.864 -6.944  10.466  1.00 0.00 ? 460 MET C HB3  11 
ATOM 8491  H HG2  . MET A 1 8  ? -14.700 -5.333  12.177  1.00 0.00 ? 460 MET C HG2  11 
ATOM 8492  H HG3  . MET A 1 8  ? -14.181 -4.510  10.705  1.00 0.00 ? 460 MET C HG3  11 
ATOM 8493  H HE1  . MET A 1 8  ? -16.338 -4.911  8.744   1.00 0.00 ? 460 MET C HE1  11 
ATOM 8494  H HE2  . MET A 1 8  ? -15.943 -3.207  9.023   1.00 0.00 ? 460 MET C HE2  11 
ATOM 8495  H HE3  . MET A 1 8  ? -17.629 -3.741  9.019   1.00 0.00 ? 460 MET C HE3  11 
ATOM 8496  N N    . ALA A 1 9  ? -13.416 -8.864  9.003   1.00 0.00 ? 461 ALA C N    11 
ATOM 8497  C CA   . ALA A 1 9  ? -13.406 -10.100 8.242   1.00 0.00 ? 461 ALA C CA   11 
ATOM 8498  C C    . ALA A 1 9  ? -12.479 -11.116 8.894   1.00 0.00 ? 461 ALA C C    11 
ATOM 8499  O O    . ALA A 1 9  ? -12.730 -12.316 8.854   1.00 0.00 ? 461 ALA C O    11 
ATOM 8500  C CB   . ALA A 1 9  ? -12.978 -9.842  6.809   1.00 0.00 ? 461 ALA C CB   11 
ATOM 8501  H H    . ALA A 1 9  ? -13.032 -8.050  8.604   1.00 0.00 ? 461 ALA C H    11 
ATOM 8502  H HA   . ALA A 1 9  ? -14.411 -10.498 8.233   1.00 0.00 ? 461 ALA C HA   11 
ATOM 8503  H HB1  . ALA A 1 9  ? -13.003 -10.766 6.251   1.00 0.00 ? 461 ALA C HB1  11 
ATOM 8504  H HB2  . ALA A 1 9  ? -11.975 -9.441  6.799   1.00 0.00 ? 461 ALA C HB2  11 
ATOM 8505  H HB3  . ALA A 1 9  ? -13.655 -9.131  6.355   1.00 0.00 ? 461 ALA C HB3  11 
ATOM 8506  N N    . HIS A 1 10 ? -11.412 -10.618 9.508   1.00 0.00 ? 462 HIS C N    11 
ATOM 8507  C CA   . HIS A 1 10 ? -10.441 -11.465 10.188  1.00 0.00 ? 462 HIS C CA   11 
ATOM 8508  C C    . HIS A 1 10 ? -11.111 -12.247 11.316  1.00 0.00 ? 462 HIS C C    11 
ATOM 8509  O O    . HIS A 1 10 ? -10.939 -13.454 11.415  1.00 0.00 ? 462 HIS C O    11 
ATOM 8510  C CB   . HIS A 1 10 ? -9.270  -10.620 10.725  1.00 0.00 ? 462 HIS C CB   11 
ATOM 8511  C CG   . HIS A 1 10 ? -8.168  -11.417 11.365  1.00 0.00 ? 462 HIS C CG   11 
ATOM 8512  N ND1  . HIS A 1 10 ? -7.124  -11.968 10.658  1.00 0.00 ? 462 HIS C ND1  11 
ATOM 8513  C CD2  . HIS A 1 10 ? -7.956  -11.745 12.655  1.00 0.00 ? 462 HIS C CD2  11 
ATOM 8514  C CE1  . HIS A 1 10 ? -6.321  -12.606 11.486  1.00 0.00 ? 462 HIS C CE1  11 
ATOM 8515  N NE2  . HIS A 1 10 ? -6.803  -12.487 12.705  1.00 0.00 ? 462 HIS C NE2  11 
ATOM 8516  H H    . HIS A 1 10 ? -11.272 -9.646  9.503   1.00 0.00 ? 462 HIS C H    11 
ATOM 8517  H HA   . HIS A 1 10 ? -10.059 -12.170 9.466   1.00 0.00 ? 462 HIS C HA   11 
ATOM 8518  H HB2  . HIS A 1 10 ? -8.838  -10.062 9.910   1.00 0.00 ? 462 HIS C HB2  11 
ATOM 8519  H HB3  . HIS A 1 10 ? -9.651  -9.927  11.461  1.00 0.00 ? 462 HIS C HB3  11 
ATOM 8520  H HD1  . HIS A 1 10 ? -6.980  -11.892 9.689   1.00 0.00 ? 462 HIS C HD1  11 
ATOM 8521  H HD2  . HIS A 1 10 ? -8.578  -11.456 13.489  1.00 0.00 ? 462 HIS C HD2  11 
ATOM 8522  H HE1  . HIS A 1 10 ? -5.420  -13.137 11.211  1.00 0.00 ? 462 HIS C HE1  11 
ATOM 8523  H HE2  . HIS A 1 10 ? -6.306  -12.709 13.526  1.00 0.00 ? 462 HIS C HE2  11 
ATOM 8524  N N    . GLN A 1 11 ? -11.881 -11.550 12.152  1.00 0.00 ? 463 GLN C N    11 
ATOM 8525  C CA   . GLN A 1 11 ? -12.594 -12.192 13.264  1.00 0.00 ? 463 GLN C CA   11 
ATOM 8526  C C    . GLN A 1 11 ? -13.553 -13.260 12.759  1.00 0.00 ? 463 GLN C C    11 
ATOM 8527  O O    . GLN A 1 11 ? -13.593 -14.367 13.297  1.00 0.00 ? 463 GLN C O    11 
ATOM 8528  C CB   . GLN A 1 11 ? -13.352 -11.158 14.107  1.00 0.00 ? 463 GLN C CB   11 
ATOM 8529  C CG   . GLN A 1 11 ? -12.556 -10.586 15.277  1.00 0.00 ? 463 GLN C CG   11 
ATOM 8530  C CD   . GLN A 1 11 ? -11.270 -9.907  14.855  1.00 0.00 ? 463 GLN C CD   11 
ATOM 8531  O OE1  . GLN A 1 11 ? -11.251 -8.718  14.565  1.00 0.00 ? 463 GLN C OE1  11 
ATOM 8532  N NE2  . GLN A 1 11 ? -10.181 -10.653 14.842  1.00 0.00 ? 463 GLN C NE2  11 
ATOM 8533  H H    . GLN A 1 11 ? -11.974 -10.578 12.018  1.00 0.00 ? 463 GLN C H    11 
ATOM 8534  H HA   . GLN A 1 11 ? -11.855 -12.680 13.890  1.00 0.00 ? 463 GLN C HA   11 
ATOM 8535  H HB2  . GLN A 1 11 ? -13.642 -10.338 13.467  1.00 0.00 ? 463 GLN C HB2  11 
ATOM 8536  H HB3  . GLN A 1 11 ? -14.243 -11.623 14.501  1.00 0.00 ? 463 GLN C HB3  11 
ATOM 8537  H HG2  . GLN A 1 11 ? -13.168 -9.861  15.791  1.00 0.00 ? 463 GLN C HG2  11 
ATOM 8538  H HG3  . GLN A 1 11 ? -12.314 -11.392 15.954  1.00 0.00 ? 463 GLN C HG3  11 
ATOM 8539  H HE21 . GLN A 1 11 ? -10.263 -11.595 15.108  1.00 0.00 ? 463 GLN C HE21 11 
ATOM 8540  H HE22 . GLN A 1 11 ? -9.340  -10.231 14.569  1.00 0.00 ? 463 GLN C HE22 11 
ATOM 8541  N N    . ILE A 1 12 ? -14.316 -12.936 11.720  1.00 0.00 ? 464 ILE C N    11 
ATOM 8542  C CA   . ILE A 1 12 ? -15.242 -13.901 11.147  1.00 0.00 ? 464 ILE C CA   11 
ATOM 8543  C C    . ILE A 1 12 ? -14.485 -15.093 10.589  1.00 0.00 ? 464 ILE C C    11 
ATOM 8544  O O    . ILE A 1 12 ? -14.881 -16.224 10.794  1.00 0.00 ? 464 ILE C O    11 
ATOM 8545  C CB   . ILE A 1 12 ? -16.114 -13.297 10.027  1.00 0.00 ? 464 ILE C CB   11 
ATOM 8546  C CG1  . ILE A 1 12 ? -16.910 -12.103 10.544  1.00 0.00 ? 464 ILE C CG1  11 
ATOM 8547  C CG2  . ILE A 1 12 ? -17.062 -14.358 9.466   1.00 0.00 ? 464 ILE C CG2  11 
ATOM 8548  C CD1  . ILE A 1 12 ? -17.691 -11.402 9.459   1.00 0.00 ? 464 ILE C CD1  11 
ATOM 8549  H H    . ILE A 1 12 ? -14.256 -12.034 11.335  1.00 0.00 ? 464 ILE C H    11 
ATOM 8550  H HA   . ILE A 1 12 ? -15.889 -14.245 11.942  1.00 0.00 ? 464 ILE C HA   11 
ATOM 8551  H HB   . ILE A 1 12 ? -15.462 -12.972 9.230   1.00 0.00 ? 464 ILE C HB   11 
ATOM 8552  H HG12 . ILE A 1 12 ? -17.612 -12.444 11.289  1.00 0.00 ? 464 ILE C HG12 11 
ATOM 8553  H HG13 . ILE A 1 12 ? -16.243 -11.384 10.996  1.00 0.00 ? 464 ILE C HG13 11 
ATOM 8554  H HG21 . ILE A 1 12 ? -17.668 -14.758 10.267  1.00 0.00 ? 464 ILE C HG21 11 
ATOM 8555  H HG22 . ILE A 1 12 ? -16.486 -15.155 9.019   1.00 0.00 ? 464 ILE C HG22 11 
ATOM 8556  H HG23 . ILE A 1 12 ? -17.700 -13.909 8.721   1.00 0.00 ? 464 ILE C HG23 11 
ATOM 8557  H HD11 . ILE A 1 12 ? -18.438 -12.073 9.062   1.00 0.00 ? 464 ILE C HD11 11 
ATOM 8558  H HD12 . ILE A 1 12 ? -17.017 -11.108 8.668   1.00 0.00 ? 464 ILE C HD12 11 
ATOM 8559  H HD13 . ILE A 1 12 ? -18.169 -10.527 9.865   1.00 0.00 ? 464 ILE C HD13 11 
ATOM 8560  N N    . GLN A 1 13 ? -13.375 -14.826 9.905   1.00 0.00 ? 465 GLN C N    11 
ATOM 8561  C CA   . GLN A 1 13 ? -12.557 -15.886 9.314   1.00 0.00 ? 465 GLN C CA   11 
ATOM 8562  C C    . GLN A 1 13 ? -12.032 -16.833 10.394  1.00 0.00 ? 465 GLN C C    11 
ATOM 8563  O O    . GLN A 1 13 ? -11.801 -18.016 10.145  1.00 0.00 ? 465 GLN C O    11 
ATOM 8564  C CB   . GLN A 1 13 ? -11.377 -15.287 8.550   1.00 0.00 ? 465 GLN C CB   11 
ATOM 8565  C CG   . GLN A 1 13 ? -10.694 -16.281 7.629   1.00 0.00 ? 465 GLN C CG   11 
ATOM 8566  C CD   . GLN A 1 13 ? -11.563 -16.635 6.444   1.00 0.00 ? 465 GLN C CD   11 
ATOM 8567  O OE1  . GLN A 1 13 ? -12.332 -15.810 5.964   1.00 0.00 ? 465 GLN C OE1  11 
ATOM 8568  N NE2  . GLN A 1 13 ? -11.460 -17.861 5.974   1.00 0.00 ? 465 GLN C NE2  11 
ATOM 8569  H H    . GLN A 1 13 ? -13.106 -13.888 9.781   1.00 0.00 ? 465 GLN C H    11 
ATOM 8570  H HA   . GLN A 1 13 ? -13.176 -16.444 8.628   1.00 0.00 ? 465 GLN C HA   11 
ATOM 8571  H HB2  . GLN A 1 13 ? -11.731 -14.459 7.953   1.00 0.00 ? 465 GLN C HB2  11 
ATOM 8572  H HB3  . GLN A 1 13 ? -10.650 -14.925 9.260   1.00 0.00 ? 465 GLN C HB3  11 
ATOM 8573  H HG2  . GLN A 1 13 ? -9.769  -15.855 7.272   1.00 0.00 ? 465 GLN C HG2  11 
ATOM 8574  H HG3  . GLN A 1 13 ? -10.485 -17.183 8.185   1.00 0.00 ? 465 GLN C HG3  11 
ATOM 8575  H HE21 . GLN A 1 13 ? -10.831 -18.478 6.402   1.00 0.00 ? 465 GLN C HE21 11 
ATOM 8576  H HE22 . GLN A 1 13 ? -12.043 -18.105 5.219   1.00 0.00 ? 465 GLN C HE22 11 
ATOM 8577  N N    . GLU A 1 14 ? -11.840 -16.299 11.587  1.00 0.00 ? 466 GLU C N    11 
ATOM 8578  C CA   . GLU A 1 14 ? -11.355 -17.073 12.710  1.00 0.00 ? 466 GLU C CA   11 
ATOM 8579  C C    . GLU A 1 14 ? -12.433 -18.028 13.219  1.00 0.00 ? 466 GLU C C    11 
ATOM 8580  O O    . GLU A 1 14 ? -12.132 -19.066 13.808  1.00 0.00 ? 466 GLU C O    11 
ATOM 8581  C CB   . GLU A 1 14 ? -10.897 -16.134 13.824  1.00 0.00 ? 466 GLU C CB   11 
ATOM 8582  C CG   . GLU A 1 14 ? -9.719  -15.256 13.436  1.00 0.00 ? 466 GLU C CG   11 
ATOM 8583  C CD   . GLU A 1 14 ? -8.495  -16.052 13.039  1.00 0.00 ? 466 GLU C CD   11 
ATOM 8584  O OE1  . GLU A 1 14 ? -8.414  -16.503 11.878  1.00 0.00 ? 466 GLU C OE1  11 
ATOM 8585  O OE2  . GLU A 1 14 ? -7.602  -16.229 13.890  1.00 0.00 ? 466 GLU C OE2  11 
ATOM 8586  H H    . GLU A 1 14 ? -12.024 -15.343 11.716  1.00 0.00 ? 466 GLU C H    11 
ATOM 8587  H HA   . GLU A 1 14 ? -10.509 -17.653 12.375  1.00 0.00 ? 466 GLU C HA   11 
ATOM 8588  H HB2  . GLU A 1 14 ? -11.722 -15.488 14.087  1.00 0.00 ? 466 GLU C HB2  11 
ATOM 8589  H HB3  . GLU A 1 14 ? -10.622 -16.710 14.690  1.00 0.00 ? 466 GLU C HB3  11 
ATOM 8590  H HG2  . GLU A 1 14 ? -10.009 -14.638 12.600  1.00 0.00 ? 466 GLU C HG2  11 
ATOM 8591  H HG3  . GLU A 1 14 ? -9.466  -14.626 14.275  1.00 0.00 ? 466 GLU C HG3  11 
ATOM 8592  N N    . MET A 1 15 ? -13.685 -17.674 12.978  1.00 0.00 ? 467 MET C N    11 
ATOM 8593  C CA   . MET A 1 15 ? -14.812 -18.490 13.397  1.00 0.00 ? 467 MET C CA   11 
ATOM 8594  C C    . MET A 1 15 ? -15.328 -19.340 12.233  1.00 0.00 ? 467 MET C C    11 
ATOM 8595  O O    . MET A 1 15 ? -15.720 -20.493 12.415  1.00 0.00 ? 467 MET C O    11 
ATOM 8596  C CB   . MET A 1 15 ? -15.937 -17.597 13.922  1.00 0.00 ? 467 MET C CB   11 
ATOM 8597  C CG   . MET A 1 15 ? -15.545 -16.733 15.109  1.00 0.00 ? 467 MET C CG   11 
ATOM 8598  S SD   . MET A 1 15 ? -16.923 -15.752 15.745  1.00 0.00 ? 467 MET C SD   11 
ATOM 8599  C CE   . MET A 1 15 ? -17.285 -14.705 14.334  1.00 0.00 ? 467 MET C CE   11 
ATOM 8600  H H    . MET A 1 15 ? -13.859 -16.833 12.504  1.00 0.00 ? 467 MET C H    11 
ATOM 8601  H HA   . MET A 1 15 ? -14.480 -19.142 14.190  1.00 0.00 ? 467 MET C HA   11 
ATOM 8602  H HB2  . MET A 1 15 ? -16.255 -16.941 13.126  1.00 0.00 ? 467 MET C HB2  11 
ATOM 8603  H HB3  . MET A 1 15 ? -16.766 -18.220 14.214  1.00 0.00 ? 467 MET C HB3  11 
ATOM 8604  H HG2  . MET A 1 15 ? -15.178 -17.371 15.897  1.00 0.00 ? 467 MET C HG2  11 
ATOM 8605  H HG3  . MET A 1 15 ? -14.758 -16.062 14.797  1.00 0.00 ? 467 MET C HG3  11 
ATOM 8606  H HE1  . MET A 1 15 ? -17.562 -15.318 13.490  1.00 0.00 ? 467 MET C HE1  11 
ATOM 8607  H HE2  . MET A 1 15 ? -16.410 -14.124 14.085  1.00 0.00 ? 467 MET C HE2  11 
ATOM 8608  H HE3  . MET A 1 15 ? -18.101 -14.041 14.579  1.00 0.00 ? 467 MET C HE3  11 
ATOM 8609  N N    . PHE A 1 16 ? -15.327 -18.754 11.044  1.00 0.00 ? 468 PHE C N    11 
ATOM 8610  C CA   . PHE A 1 16 ? -15.802 -19.410 9.833   1.00 0.00 ? 468 PHE C CA   11 
ATOM 8611  C C    . PHE A 1 16 ? -14.699 -19.444 8.766   1.00 0.00 ? 468 PHE C C    11 
ATOM 8612  O O    . PHE A 1 16 ? -14.666 -18.599 7.879   1.00 0.00 ? 468 PHE C O    11 
ATOM 8613  C CB   . PHE A 1 16 ? -17.037 -18.670 9.266   1.00 0.00 ? 468 PHE C CB   11 
ATOM 8614  C CG   . PHE A 1 16 ? -18.297 -18.814 10.086  1.00 0.00 ? 468 PHE C CG   11 
ATOM 8615  C CD1  . PHE A 1 16 ? -18.357 -18.345 11.384  1.00 0.00 ? 468 PHE C CD1  11 
ATOM 8616  C CD2  . PHE A 1 16 ? -19.422 -19.414 9.546   1.00 0.00 ? 468 PHE C CD2  11 
ATOM 8617  C CE1  . PHE A 1 16 ? -19.506 -18.478 12.134  1.00 0.00 ? 468 PHE C CE1  11 
ATOM 8618  C CE2  . PHE A 1 16 ? -20.577 -19.550 10.289  1.00 0.00 ? 468 PHE C CE2  11 
ATOM 8619  C CZ   . PHE A 1 16 ? -20.619 -19.084 11.586  1.00 0.00 ? 468 PHE C CZ   11 
ATOM 8620  H H    . PHE A 1 16 ? -14.993 -17.831 10.969  1.00 0.00 ? 468 PHE C H    11 
ATOM 8621  H HA   . PHE A 1 16 ? -16.085 -20.421 10.085  1.00 0.00 ? 468 PHE C HA   11 
ATOM 8622  H HB2  . PHE A 1 16 ? -16.811 -17.617 9.201   1.00 0.00 ? 468 PHE C HB2  11 
ATOM 8623  H HB3  . PHE A 1 16 ? -17.240 -19.045 8.274   1.00 0.00 ? 468 PHE C HB3  11 
ATOM 8624  H HD1  . PHE A 1 16 ? -17.485 -17.872 11.812  1.00 0.00 ? 468 PHE C HD1  11 
ATOM 8625  H HD2  . PHE A 1 16 ? -19.393 -19.772 8.530   1.00 0.00 ? 468 PHE C HD2  11 
ATOM 8626  H HE1  . PHE A 1 16 ? -19.534 -18.106 13.148  1.00 0.00 ? 468 PHE C HE1  11 
ATOM 8627  H HE2  . PHE A 1 16 ? -21.445 -20.024 9.855   1.00 0.00 ? 468 PHE C HE2  11 
ATOM 8628  H HZ   . PHE A 1 16 ? -21.522 -19.188 12.170  1.00 0.00 ? 468 PHE C HZ   11 
ATOM 8629  N N    . PRO A 1 17 ? -13.771 -20.410 8.850   1.00 0.00 ? 469 PRO C N    11 
ATOM 8630  C CA   . PRO A 1 17 ? -12.683 -20.550 7.871   1.00 0.00 ? 469 PRO C CA   11 
ATOM 8631  C C    . PRO A 1 17 ? -13.174 -21.125 6.538   1.00 0.00 ? 469 PRO C C    11 
ATOM 8632  O O    . PRO A 1 17 ? -12.430 -21.182 5.552   1.00 0.00 ? 469 PRO C O    11 
ATOM 8633  C CB   . PRO A 1 17 ? -11.732 -21.529 8.552   1.00 0.00 ? 469 PRO C CB   11 
ATOM 8634  C CG   . PRO A 1 17 ? -12.615 -22.352 9.413   1.00 0.00 ? 469 PRO C CG   11 
ATOM 8635  C CD   . PRO A 1 17 ? -13.678 -21.420 9.916   1.00 0.00 ? 469 PRO C CD   11 
ATOM 8636  H HA   . PRO A 1 17 ? -12.184 -19.610 7.711   1.00 0.00 ? 469 PRO C HA   11 
ATOM 8637  H HB2  . PRO A 1 17 ? -11.232 -22.129 7.804   1.00 0.00 ? 469 PRO C HB2  11 
ATOM 8638  H HB3  . PRO A 1 17 ? -11.004 -20.986 9.136   1.00 0.00 ? 469 PRO C HB3  11 
ATOM 8639  H HG2  . PRO A 1 17 ? -13.056 -23.143 8.829   1.00 0.00 ? 469 PRO C HG2  11 
ATOM 8640  H HG3  . PRO A 1 17 ? -12.050 -22.757 10.238  1.00 0.00 ? 469 PRO C HG3  11 
ATOM 8641  H HD2  . PRO A 1 17 ? -14.615 -21.940 10.046  1.00 0.00 ? 469 PRO C HD2  11 
ATOM 8642  H HD3  . PRO A 1 17 ? -13.364 -20.961 10.838  1.00 0.00 ? 469 PRO C HD3  11 
ATOM 8643  N N    . GLN A 1 18 ? -14.429 -21.549 6.529   1.00 0.00 ? 470 GLN C N    11 
ATOM 8644  C CA   . GLN A 1 18 ? -15.060 -22.143 5.354   1.00 0.00 ? 470 GLN C CA   11 
ATOM 8645  C C    . GLN A 1 18 ? -15.299 -21.115 4.245   1.00 0.00 ? 470 GLN C C    11 
ATOM 8646  O O    . GLN A 1 18 ? -15.413 -21.475 3.078   1.00 0.00 ? 470 GLN C O    11 
ATOM 8647  C CB   . GLN A 1 18 ? -16.391 -22.783 5.752   1.00 0.00 ? 470 GLN C CB   11 
ATOM 8648  C CG   . GLN A 1 18 ? -17.352 -21.811 6.422   1.00 0.00 ? 470 GLN C CG   11 
ATOM 8649  C CD   . GLN A 1 18 ? -18.660 -22.451 6.835   1.00 0.00 ? 470 GLN C CD   11 
ATOM 8650  O OE1  . GLN A 1 18 ? -18.718 -23.642 7.144   1.00 0.00 ? 470 GLN C OE1  11 
ATOM 8651  N NE2  . GLN A 1 18 ? -19.717 -21.664 6.848   1.00 0.00 ? 470 GLN C NE2  11 
ATOM 8652  H H    . GLN A 1 18 ? -14.947 -21.468 7.357   1.00 0.00 ? 470 GLN C H    11 
ATOM 8653  H HA   . GLN A 1 18 ? -14.409 -22.915 4.980   1.00 0.00 ? 470 GLN C HA   11 
ATOM 8654  H HB2  . GLN A 1 18 ? -16.868 -23.170 4.864   1.00 0.00 ? 470 GLN C HB2  11 
ATOM 8655  H HB3  . GLN A 1 18 ? -16.200 -23.599 6.433   1.00 0.00 ? 470 GLN C HB3  11 
ATOM 8656  H HG2  . GLN A 1 18 ? -16.875 -21.409 7.305   1.00 0.00 ? 470 GLN C HG2  11 
ATOM 8657  H HG3  . GLN A 1 18 ? -17.559 -21.008 5.732   1.00 0.00 ? 470 GLN C HG3  11 
ATOM 8658  H HE21 . GLN A 1 18 ? -19.603 -20.726 6.595   1.00 0.00 ? 470 GLN C HE21 11 
ATOM 8659  H HE22 . GLN A 1 18 ? -20.579 -22.048 7.125   1.00 0.00 ? 470 GLN C HE22 11 
ATOM 8660  N N    . VAL A 1 19 ? -15.367 -19.851 4.607   1.00 0.00 ? 471 VAL C N    11 
ATOM 8661  C CA   . VAL A 1 19 ? -15.660 -18.806 3.642   1.00 0.00 ? 471 VAL C CA   11 
ATOM 8662  C C    . VAL A 1 19 ? -14.395 -18.018 3.265   1.00 0.00 ? 471 VAL C C    11 
ATOM 8663  O O    . VAL A 1 19 ? -13.596 -17.672 4.128   1.00 0.00 ? 471 VAL C O    11 
ATOM 8664  C CB   . VAL A 1 19 ? -16.768 -17.848 4.178   1.00 0.00 ? 471 VAL C CB   11 
ATOM 8665  C CG1  . VAL A 1 19 ? -16.382 -17.255 5.523   1.00 0.00 ? 471 VAL C CG1  11 
ATOM 8666  C CG2  . VAL A 1 19 ? -17.085 -16.748 3.174   1.00 0.00 ? 471 VAL C CG2  11 
ATOM 8667  H H    . VAL A 1 19 ? -15.197 -19.606 5.542   1.00 0.00 ? 471 VAL C H    11 
ATOM 8668  H HA   . VAL A 1 19 ? -16.039 -19.290 2.754   1.00 0.00 ? 471 VAL C HA   11 
ATOM 8669  H HB   . VAL A 1 19 ? -17.666 -18.433 4.326   1.00 0.00 ? 471 VAL C HB   11 
ATOM 8670  H HG11 . VAL A 1 19 ? -16.275 -18.050 6.248   1.00 0.00 ? 471 VAL C HG11 11 
ATOM 8671  H HG12 . VAL A 1 19 ? -17.152 -16.571 5.848   1.00 0.00 ? 471 VAL C HG12 11 
ATOM 8672  H HG13 . VAL A 1 19 ? -15.446 -16.727 5.427   1.00 0.00 ? 471 VAL C HG13 11 
ATOM 8673  H HG21 . VAL A 1 19 ? -17.457 -17.189 2.262   1.00 0.00 ? 471 VAL C HG21 11 
ATOM 8674  H HG22 . VAL A 1 19 ? -16.188 -16.185 2.963   1.00 0.00 ? 471 VAL C HG22 11 
ATOM 8675  H HG23 . VAL A 1 19 ? -17.835 -16.091 3.587   1.00 0.00 ? 471 VAL C HG23 11 
ATOM 8676  N N    . PRO A 1 20 ? -14.173 -17.786 1.947   1.00 0.00 ? 472 PRO C N    11 
ATOM 8677  C CA   . PRO A 1 20 ? -13.031 -16.998 1.453   1.00 0.00 ? 472 PRO C CA   11 
ATOM 8678  C C    . PRO A 1 20 ? -12.985 -15.591 2.052   1.00 0.00 ? 472 PRO C C    11 
ATOM 8679  O O    . PRO A 1 20 ? -13.981 -14.865 2.044   1.00 0.00 ? 472 PRO C O    11 
ATOM 8680  C CB   . PRO A 1 20 ? -13.282 -16.922 -0.053  1.00 0.00 ? 472 PRO C CB   11 
ATOM 8681  C CG   . PRO A 1 20 ? -14.079 -18.137 -0.347  1.00 0.00 ? 472 PRO C CG   11 
ATOM 8682  C CD   . PRO A 1 20 ? -14.984 -18.317 0.836   1.00 0.00 ? 472 PRO C CD   11 
ATOM 8683  H HA   . PRO A 1 20 ? -12.093 -17.497 1.639   1.00 0.00 ? 472 PRO C HA   11 
ATOM 8684  H HB2  . PRO A 1 20 ? -13.828 -16.020 -0.285  1.00 0.00 ? 472 PRO C HB2  11 
ATOM 8685  H HB3  . PRO A 1 20 ? -12.341 -16.929 -0.583  1.00 0.00 ? 472 PRO C HB3  11 
ATOM 8686  H HG2  . PRO A 1 20 ? -14.653 -17.995 -1.249  1.00 0.00 ? 472 PRO C HG2  11 
ATOM 8687  H HG3  . PRO A 1 20 ? -13.422 -18.989 -0.445  1.00 0.00 ? 472 PRO C HG3  11 
ATOM 8688  H HD2  . PRO A 1 20 ? -15.893 -17.746 0.712   1.00 0.00 ? 472 PRO C HD2  11 
ATOM 8689  H HD3  . PRO A 1 20 ? -15.205 -19.362 0.986   1.00 0.00 ? 472 PRO C HD3  11 
ATOM 8690  N N    . TYR A 1 21 ? -11.806 -15.220 2.530   1.00 0.00 ? 473 TYR C N    11 
ATOM 8691  C CA   . TYR A 1 21 ? -11.558 -13.939 3.206   1.00 0.00 ? 473 TYR C CA   11 
ATOM 8692  C C    . TYR A 1 21 ? -12.104 -12.743 2.407   1.00 0.00 ? 473 TYR C C    11 
ATOM 8693  O O    . TYR A 1 21 ? -12.796 -11.884 2.956   1.00 0.00 ? 473 TYR C O    11 
ATOM 8694  C CB   . TYR A 1 21 ? -10.051 -13.779 3.425   1.00 0.00 ? 473 TYR C CB   11 
ATOM 8695  C CG   . TYR A 1 21 ? -9.661  -12.825 4.532   1.00 0.00 ? 473 TYR C CG   11 
ATOM 8696  C CD1  . TYR A 1 21 ? -9.468  -11.472 4.288   1.00 0.00 ? 473 TYR C CD1  11 
ATOM 8697  C CD2  . TYR A 1 21 ? -9.460  -13.291 5.820   1.00 0.00 ? 473 TYR C CD2  11 
ATOM 8698  C CE1  . TYR A 1 21 ? -9.086  -10.613 5.302   1.00 0.00 ? 473 TYR C CE1  11 
ATOM 8699  C CE2  . TYR A 1 21 ? -9.085  -12.443 6.837   1.00 0.00 ? 473 TYR C CE2  11 
ATOM 8700  C CZ   . TYR A 1 21 ? -8.898  -11.106 6.576   1.00 0.00 ? 473 TYR C CZ   11 
ATOM 8701  O OH   . TYR A 1 21 ? -8.508  -10.263 7.592   1.00 0.00 ? 473 TYR C OH   11 
ATOM 8702  H H    . TYR A 1 21 ? -11.056 -15.845 2.433   1.00 0.00 ? 473 TYR C H    11 
ATOM 8703  H HA   . TYR A 1 21 ? -12.045 -13.970 4.169   1.00 0.00 ? 473 TYR C HA   11 
ATOM 8704  H HB2  . TYR A 1 21 ? -9.628  -14.742 3.664   1.00 0.00 ? 473 TYR C HB2  11 
ATOM 8705  H HB3  . TYR A 1 21 ? -9.608  -13.421 2.510   1.00 0.00 ? 473 TYR C HB3  11 
ATOM 8706  H HD1  . TYR A 1 21 ? -9.619  -11.092 3.289   1.00 0.00 ? 473 TYR C HD1  11 
ATOM 8707  H HD2  . TYR A 1 21 ? -9.607  -14.339 6.023   1.00 0.00 ? 473 TYR C HD2  11 
ATOM 8708  H HE1  . TYR A 1 21 ? -8.940  -9.562  5.097   1.00 0.00 ? 473 TYR C HE1  11 
ATOM 8709  H HE2  . TYR A 1 21 ? -8.937  -12.829 7.834   1.00 0.00 ? 473 TYR C HE2  11 
ATOM 8710  H HH   . TYR A 1 21 ? -9.096  -9.494  7.621   1.00 0.00 ? 473 TYR C HH   11 
ATOM 8711  N N    . HIS A 1 22 ? -11.803 -12.698 1.111   1.00 0.00 ? 474 HIS C N    11 
ATOM 8712  C CA   . HIS A 1 22 ? -12.250 -11.581 0.264   1.00 0.00 ? 474 HIS C CA   11 
ATOM 8713  C C    . HIS A 1 22 ? -13.767 -11.552 0.099   1.00 0.00 ? 474 HIS C C    11 
ATOM 8714  O O    . HIS A 1 22 ? -14.350 -10.493 -0.123  1.00 0.00 ? 474 HIS C O    11 
ATOM 8715  C CB   . HIS A 1 22 ? -11.556 -11.584 -1.113  1.00 0.00 ? 474 HIS C CB   11 
ATOM 8716  C CG   . HIS A 1 22 ? -11.788 -12.816 -1.958  1.00 0.00 ? 474 HIS C CG   11 
ATOM 8717  N ND1  . HIS A 1 22 ? -10.870 -13.833 -2.072  1.00 0.00 ? 474 HIS C ND1  11 
ATOM 8718  C CD2  . HIS A 1 22 ? -12.836 -13.177 -2.740  1.00 0.00 ? 474 HIS C CD2  11 
ATOM 8719  C CE1  . HIS A 1 22 ? -11.335 -14.761 -2.880  1.00 0.00 ? 474 HIS C CE1  11 
ATOM 8720  N NE2  . HIS A 1 22 ? -12.527 -14.389 -3.300  1.00 0.00 ? 474 HIS C NE2  11 
ATOM 8721  H H    . HIS A 1 22 ? -11.261 -13.421 0.724   1.00 0.00 ? 474 HIS C H    11 
ATOM 8722  H HA   . HIS A 1 22 ? -11.974 -10.669 0.778   1.00 0.00 ? 474 HIS C HA   11 
ATOM 8723  H HB2  . HIS A 1 22 ? -11.928 -10.741 -1.669  1.00 0.00 ? 474 HIS C HB2  11 
ATOM 8724  H HB3  . HIS A 1 22 ? -10.493 -11.468 -0.968  1.00 0.00 ? 474 HIS C HB3  11 
ATOM 8725  H HD1  . HIS A 1 22 ? -9.990  -13.865 -1.629  1.00 0.00 ? 474 HIS C HD1  11 
ATOM 8726  H HD2  . HIS A 1 22 ? -13.745 -12.614 -2.892  1.00 0.00 ? 474 HIS C HD2  11 
ATOM 8727  H HE1  . HIS A 1 22 ? -10.826 -15.675 -3.151  1.00 0.00 ? 474 HIS C HE1  11 
ATOM 8728  H HE2  . HIS A 1 22 ? -12.977 -14.770 -4.087  1.00 0.00 ? 474 HIS C HE2  11 
ATOM 8729  N N    . LEU A 1 23 ? -14.406 -12.703 0.216   1.00 0.00 ? 475 LEU C N    11 
ATOM 8730  C CA   . LEU A 1 23 ? -15.848 -12.762 0.096   1.00 0.00 ? 475 LEU C CA   11 
ATOM 8731  C C    . LEU A 1 23 ? -16.491 -12.253 1.365   1.00 0.00 ? 475 LEU C C    11 
ATOM 8732  O O    . LEU A 1 23 ? -17.614 -11.751 1.348   1.00 0.00 ? 475 LEU C O    11 
ATOM 8733  C CB   . LEU A 1 23 ? -16.322 -14.175 -0.218  1.00 0.00 ? 475 LEU C CB   11 
ATOM 8734  C CG   . LEU A 1 23 ? -16.018 -14.683 -1.628  1.00 0.00 ? 475 LEU C CG   11 
ATOM 8735  C CD1  . LEU A 1 23 ? -16.661 -16.031 -1.852  1.00 0.00 ? 475 LEU C CD1  11 
ATOM 8736  C CD2  . LEU A 1 23 ? -16.495 -13.689 -2.676  1.00 0.00 ? 475 LEU C CD2  11 
ATOM 8737  H H    . LEU A 1 23 ? -13.908 -13.526 0.407   1.00 0.00 ? 475 LEU C H    11 
ATOM 8738  H HA   . LEU A 1 23 ? -16.135 -12.106 -0.712  1.00 0.00 ? 475 LEU C HA   11 
ATOM 8739  H HB2  . LEU A 1 23 ? -15.863 -14.848 0.489   1.00 0.00 ? 475 LEU C HB2  11 
ATOM 8740  H HB3  . LEU A 1 23 ? -17.390 -14.206 -0.073  1.00 0.00 ? 475 LEU C HB3  11 
ATOM 8741  H HG   . LEU A 1 23 ? -14.949 -14.800 -1.737  1.00 0.00 ? 475 LEU C HG   11 
ATOM 8742  H HD11 . LEU A 1 23 ? -16.464 -16.356 -2.860  1.00 0.00 ? 475 LEU C HD11 11 
ATOM 8743  H HD12 . LEU A 1 23 ? -17.727 -15.951 -1.701  1.00 0.00 ? 475 LEU C HD12 11 
ATOM 8744  H HD13 . LEU A 1 23 ? -16.252 -16.747 -1.156  1.00 0.00 ? 475 LEU C HD13 11 
ATOM 8745  H HD21 . LEU A 1 23 ? -15.943 -12.767 -2.577  1.00 0.00 ? 475 LEU C HD21 11 
ATOM 8746  H HD22 . LEU A 1 23 ? -17.547 -13.494 -2.533  1.00 0.00 ? 475 LEU C HD22 11 
ATOM 8747  H HD23 . LEU A 1 23 ? -16.335 -14.102 -3.660  1.00 0.00 ? 475 LEU C HD23 11 
ATOM 8748  N N    . VAL A 1 24 ? -15.760 -12.370 2.460   1.00 0.00 ? 476 VAL C N    11 
ATOM 8749  C CA   . VAL A 1 24 ? -16.219 -11.851 3.733   1.00 0.00 ? 476 VAL C CA   11 
ATOM 8750  C C    . VAL A 1 24 ? -16.110 -10.336 3.691   1.00 0.00 ? 476 VAL C C    11 
ATOM 8751  O O    . VAL A 1 24 ? -17.071 -9.624  3.955   1.00 0.00 ? 476 VAL C O    11 
ATOM 8752  C CB   . VAL A 1 24 ? -15.376 -12.400 4.911   1.00 0.00 ? 476 VAL C CB   11 
ATOM 8753  C CG1  . VAL A 1 24 ? -15.971 -11.982 6.242   1.00 0.00 ? 476 VAL C CG1  11 
ATOM 8754  C CG2  . VAL A 1 24 ? -15.260 -13.911 4.835   1.00 0.00 ? 476 VAL C CG2  11 
ATOM 8755  H H    . VAL A 1 24 ? -14.884 -12.810 2.404   1.00 0.00 ? 476 VAL C H    11 
ATOM 8756  H HA   . VAL A 1 24 ? -17.255 -12.133 3.867   1.00 0.00 ? 476 VAL C HA   11 
ATOM 8757  H HB   . VAL A 1 24 ? -14.383 -11.980 4.841   1.00 0.00 ? 476 VAL C HB   11 
ATOM 8758  H HG11 . VAL A 1 24 ? -16.984 -12.347 6.315   1.00 0.00 ? 476 VAL C HG11 11 
ATOM 8759  H HG12 . VAL A 1 24 ? -15.968 -10.905 6.315   1.00 0.00 ? 476 VAL C HG12 11 
ATOM 8760  H HG13 . VAL A 1 24 ? -15.381 -12.397 7.046   1.00 0.00 ? 476 VAL C HG13 11 
ATOM 8761  H HG21 . VAL A 1 24 ? -14.779 -14.189 3.909   1.00 0.00 ? 476 VAL C HG21 11 
ATOM 8762  H HG22 . VAL A 1 24 ? -16.246 -14.349 4.875   1.00 0.00 ? 476 VAL C HG22 11 
ATOM 8763  H HG23 . VAL A 1 24 ? -14.673 -14.271 5.668   1.00 0.00 ? 476 VAL C HG23 11 
ATOM 8764  N N    . LEU A 1 25 ? -14.922 -9.865  3.302   1.00 0.00 ? 477 LEU C N    11 
ATOM 8765  C CA   . LEU A 1 25 ? -14.640 -8.437  3.128   1.00 0.00 ? 477 LEU C CA   11 
ATOM 8766  C C    . LEU A 1 25 ? -15.699 -7.782  2.248   1.00 0.00 ? 477 LEU C C    11 
ATOM 8767  O O    . LEU A 1 25 ? -16.077 -6.630  2.460   1.00 0.00 ? 477 LEU C O    11 
ATOM 8768  C CB   . LEU A 1 25 ? -13.266 -8.273  2.472   1.00 0.00 ? 477 LEU C CB   11 
ATOM 8769  C CG   . LEU A 1 25 ? -12.051 -8.531  3.362   1.00 0.00 ? 477 LEU C CG   11 
ATOM 8770  C CD1  . LEU A 1 25 ? -10.780 -8.560  2.532   1.00 0.00 ? 477 LEU C CD1  11 
ATOM 8771  C CD2  . LEU A 1 25 ? -11.948 -7.466  4.438   1.00 0.00 ? 477 LEU C CD2  11 
ATOM 8772  H H    . LEU A 1 25 ? -14.197 -10.506 3.132   1.00 0.00 ? 477 LEU C H    11 
ATOM 8773  H HA   . LEU A 1 25 ? -14.636 -7.954  4.095   1.00 0.00 ? 477 LEU C HA   11 
ATOM 8774  H HB2  . LEU A 1 25 ? -13.217 -8.964  1.642   1.00 0.00 ? 477 LEU C HB2  11 
ATOM 8775  H HB3  . LEU A 1 25 ? -13.190 -7.278  2.074   1.00 0.00 ? 477 LEU C HB3  11 
ATOM 8776  H HG   . LEU A 1 25 ? -12.162 -9.492  3.846   1.00 0.00 ? 477 LEU C HG   11 
ATOM 8777  H HD11 . LEU A 1 25 ? -9.931  -8.714  3.179   1.00 0.00 ? 477 LEU C HD11 11 
ATOM 8778  H HD12 . LEU A 1 25 ? -10.668 -7.623  2.009   1.00 0.00 ? 477 LEU C HD12 11 
ATOM 8779  H HD13 . LEU A 1 25 ? -10.833 -9.367  1.815   1.00 0.00 ? 477 LEU C HD13 11 
ATOM 8780  H HD21 . LEU A 1 25 ? -12.835 -7.483  5.052   1.00 0.00 ? 477 LEU C HD21 11 
ATOM 8781  H HD22 . LEU A 1 25 ? -11.849 -6.494  3.976   1.00 0.00 ? 477 LEU C HD22 11 
ATOM 8782  H HD23 . LEU A 1 25 ? -11.082 -7.661  5.053   1.00 0.00 ? 477 LEU C HD23 11 
ATOM 8783  N N    . GLN A 1 26 ? -16.170 -8.538  1.266   1.00 0.00 ? 478 GLN C N    11 
ATOM 8784  C CA   . GLN A 1 26 ? -17.188 -8.087  0.348   1.00 0.00 ? 478 GLN C CA   11 
ATOM 8785  C C    . GLN A 1 26 ? -18.444 -7.633  1.097   1.00 0.00 ? 478 GLN C C    11 
ATOM 8786  O O    . GLN A 1 26 ? -18.868 -6.491  0.965   1.00 0.00 ? 478 GLN C O    11 
ATOM 8787  C CB   . GLN A 1 26 ? -17.532 -9.217  -0.620  1.00 0.00 ? 478 GLN C CB   11 
ATOM 8788  C CG   . GLN A 1 26 ? -18.564 -8.848  -1.665  1.00 0.00 ? 478 GLN C CG   11 
ATOM 8789  C CD   . GLN A 1 26 ? -18.956 -10.025 -2.544  1.00 0.00 ? 478 GLN C CD   11 
ATOM 8790  O OE1  . GLN A 1 26 ? -19.285 -9.853  -3.717  1.00 0.00 ? 478 GLN C OE1  11 
ATOM 8791  N NE2  . GLN A 1 26 ? -18.944 -11.224 -1.981  1.00 0.00 ? 478 GLN C NE2  11 
ATOM 8792  H H    . GLN A 1 26 ? -15.812 -9.442  1.156   1.00 0.00 ? 478 GLN C H    11 
ATOM 8793  H HA   . GLN A 1 26 ? -16.792 -7.255  -0.213  1.00 0.00 ? 478 GLN C HA   11 
ATOM 8794  H HB2  . GLN A 1 26 ? -16.632 -9.522  -1.131  1.00 0.00 ? 478 GLN C HB2  11 
ATOM 8795  H HB3  . GLN A 1 26 ? -17.911 -10.053 -0.051  1.00 0.00 ? 478 GLN C HB3  11 
ATOM 8796  H HG2  . GLN A 1 26 ? -19.444 -8.481  -1.160  1.00 0.00 ? 478 GLN C HG2  11 
ATOM 8797  H HG3  . GLN A 1 26 ? -18.154 -8.068  -2.288  1.00 0.00 ? 478 GLN C HG3  11 
ATOM 8798  H HE21 . GLN A 1 26 ? -18.688 -11.291 -1.036  1.00 0.00 ? 478 GLN C HE21 11 
ATOM 8799  H HE22 . GLN A 1 26 ? -19.189 -12.002 -2.530  1.00 0.00 ? 478 GLN C HE22 11 
ATOM 8800  N N    . ASP A 1 27 ? -19.005 -8.521  1.913   1.00 0.00 ? 479 ASP C N    11 
ATOM 8801  C CA   . ASP A 1 27 ? -20.247 -8.220  2.638   1.00 0.00 ? 479 ASP C CA   11 
ATOM 8802  C C    . ASP A 1 27 ? -20.025 -7.173  3.715   1.00 0.00 ? 479 ASP C C    11 
ATOM 8803  O O    . ASP A 1 27 ? -20.932 -6.428  4.056   1.00 0.00 ? 479 ASP C O    11 
ATOM 8804  C CB   . ASP A 1 27 ? -20.838 -9.475  3.261   1.00 0.00 ? 479 ASP C CB   11 
ATOM 8805  C CG   . ASP A 1 27 ? -22.244 -9.239  3.804   1.00 0.00 ? 479 ASP C CG   11 
ATOM 8806  O OD1  . ASP A 1 27 ? -23.205 -9.341  3.019   1.00 0.00 ? 479 ASP C OD1  11 
ATOM 8807  O OD2  . ASP A 1 27 ? -22.387 -8.945  5.020   1.00 0.00 ? 479 ASP C OD2  11 
ATOM 8808  H H    . ASP A 1 27 ? -18.574 -9.393  2.042   1.00 0.00 ? 479 ASP C H    11 
ATOM 8809  H HA   . ASP A 1 27 ? -20.956 -7.823  1.920   1.00 0.00 ? 479 ASP C HA   11 
ATOM 8810  H HB2  . ASP A 1 27 ? -20.875 -10.257 2.519   1.00 0.00 ? 479 ASP C HB2  11 
ATOM 8811  H HB3  . ASP A 1 27 ? -20.204 -9.788  4.076   1.00 0.00 ? 479 ASP C HB3  11 
ATOM 8812  N N    . LEU A 1 28 ? -18.818 -7.110  4.254   1.00 0.00 ? 480 LEU C N    11 
ATOM 8813  C CA   . LEU A 1 28 ? -18.500 -6.105  5.253   1.00 0.00 ? 480 LEU C CA   11 
ATOM 8814  C C    . LEU A 1 28 ? -18.576 -4.708  4.658   1.00 0.00 ? 480 LEU C C    11 
ATOM 8815  O O    . LEU A 1 28 ? -18.773 -3.736  5.369   1.00 0.00 ? 480 LEU C O    11 
ATOM 8816  C CB   . LEU A 1 28 ? -17.131 -6.347  5.897   1.00 0.00 ? 480 LEU C CB   11 
ATOM 8817  C CG   . LEU A 1 28 ? -17.126 -7.239  7.143   1.00 0.00 ? 480 LEU C CG   11 
ATOM 8818  C CD1  . LEU A 1 28 ? -18.200 -6.804  8.126   1.00 0.00 ? 480 LEU C CD1  11 
ATOM 8819  C CD2  . LEU A 1 28 ? -17.327 -8.667  6.766   1.00 0.00 ? 480 LEU C CD2  11 
ATOM 8820  H H    . LEU A 1 28 ? -18.138 -7.759  3.987   1.00 0.00 ? 480 LEU C H    11 
ATOM 8821  H HA   . LEU A 1 28 ? -19.258 -6.174  6.017   1.00 0.00 ? 480 LEU C HA   11 
ATOM 8822  H HB2  . LEU A 1 28 ? -16.479 -6.784  5.157   1.00 0.00 ? 480 LEU C HB2  11 
ATOM 8823  H HB3  . LEU A 1 28 ? -16.716 -5.399  6.168   1.00 0.00 ? 480 LEU C HB3  11 
ATOM 8824  H HG   . LEU A 1 28 ? -16.169 -7.149  7.637   1.00 0.00 ? 480 LEU C HG   11 
ATOM 8825  H HD11 . LEU A 1 28 ? -19.171 -7.067  7.735   1.00 0.00 ? 480 LEU C HD11 11 
ATOM 8826  H HD12 . LEU A 1 28 ? -18.149 -5.736  8.269   1.00 0.00 ? 480 LEU C HD12 11 
ATOM 8827  H HD13 . LEU A 1 28 ? -18.047 -7.303  9.071   1.00 0.00 ? 480 LEU C HD13 11 
ATOM 8828  H HD21 . LEU A 1 28 ? -16.510 -8.988  6.140   1.00 0.00 ? 480 LEU C HD21 11 
ATOM 8829  H HD22 . LEU A 1 28 ? -18.259 -8.748  6.223   1.00 0.00 ? 480 LEU C HD22 11 
ATOM 8830  H HD23 . LEU A 1 28 ? -17.365 -9.271  7.660   1.00 0.00 ? 480 LEU C HD23 11 
ATOM 8831  N N    . GLN A 1 29 ? -18.421 -4.618  3.356   1.00 0.00 ? 481 GLN C N    11 
ATOM 8832  C CA   . GLN A 1 29 ? -18.562 -3.355  2.666   1.00 0.00 ? 481 GLN C CA   11 
ATOM 8833  C C    . GLN A 1 29 ? -20.031 -3.093  2.380   1.00 0.00 ? 481 GLN C C    11 
ATOM 8834  O O    . GLN A 1 29 ? -20.437 -1.963  2.124   1.00 0.00 ? 481 GLN C O    11 
ATOM 8835  C CB   . GLN A 1 29 ? -17.749 -3.353  1.383   1.00 0.00 ? 481 GLN C CB   11 
ATOM 8836  C CG   . GLN A 1 29 ? -16.260 -3.419  1.633   1.00 0.00 ? 481 GLN C CG   11 
ATOM 8837  C CD   . GLN A 1 29 ? -15.443 -3.413  0.366   1.00 0.00 ? 481 GLN C CD   11 
ATOM 8838  O OE1  . GLN A 1 29 ? -15.849 -2.856  -0.653  1.00 0.00 ? 481 GLN C OE1  11 
ATOM 8839  N NE2  . GLN A 1 29 ? -14.279 -4.026  0.422   1.00 0.00 ? 481 GLN C NE2  11 
ATOM 8840  H H    . GLN A 1 29 ? -18.197 -5.421  2.838   1.00 0.00 ? 481 GLN C H    11 
ATOM 8841  H HA   . GLN A 1 29 ? -18.195 -2.581  3.323   1.00 0.00 ? 481 GLN C HA   11 
ATOM 8842  H HB2  . GLN A 1 29 ? -18.032 -4.205  0.783   1.00 0.00 ? 481 GLN C HB2  11 
ATOM 8843  H HB3  . GLN A 1 29 ? -17.960 -2.450  0.836   1.00 0.00 ? 481 GLN C HB3  11 
ATOM 8844  H HG2  . GLN A 1 29 ? -15.972 -2.569  2.231   1.00 0.00 ? 481 GLN C HG2  11 
ATOM 8845  H HG3  . GLN A 1 29 ? -16.049 -4.325  2.179   1.00 0.00 ? 481 GLN C HG3  11 
ATOM 8846  H HE21 . GLN A 1 29 ? -14.014 -4.448  1.268   1.00 0.00 ? 481 GLN C HE21 11 
ATOM 8847  H HE22 . GLN A 1 29 ? -13.717 -4.029  -0.378  1.00 0.00 ? 481 GLN C HE22 11 
ATOM 8848  N N    . LEU A 1 30 ? -20.812 -4.153  2.417   1.00 0.00 ? 482 LEU C N    11 
ATOM 8849  C CA   . LEU A 1 30 ? -22.237 -4.080  2.202   1.00 0.00 ? 482 LEU C CA   11 
ATOM 8850  C C    . LEU A 1 30 ? -22.979 -3.753  3.502   1.00 0.00 ? 482 LEU C C    11 
ATOM 8851  O O    . LEU A 1 30 ? -23.724 -2.774  3.567   1.00 0.00 ? 482 LEU C O    11 
ATOM 8852  C CB   . LEU A 1 30 ? -22.743 -5.412  1.638   1.00 0.00 ? 482 LEU C CB   11 
ATOM 8853  C CG   . LEU A 1 30 ? -22.666 -5.604  0.113   1.00 0.00 ? 482 LEU C CG   11 
ATOM 8854  C CD1  . LEU A 1 30 ? -23.694 -4.744  -0.583  1.00 0.00 ? 482 LEU C CD1  11 
ATOM 8855  C CD2  . LEU A 1 30 ? -21.279 -5.295  -0.426  1.00 0.00 ? 482 LEU C CD2  11 
ATOM 8856  H H    . LEU A 1 30 ? -20.420 -5.034  2.589   1.00 0.00 ? 482 LEU C H    11 
ATOM 8857  H HA   . LEU A 1 30 ? -22.429 -3.303  1.479   1.00 0.00 ? 482 LEU C HA   11 
ATOM 8858  H HB2  . LEU A 1 30 ? -22.174 -6.203  2.101   1.00 0.00 ? 482 LEU C HB2  11 
ATOM 8859  H HB3  . LEU A 1 30 ? -23.773 -5.523  1.938   1.00 0.00 ? 482 LEU C HB3  11 
ATOM 8860  H HG   . LEU A 1 30 ? -22.888 -6.636  -0.109  1.00 0.00 ? 482 LEU C HG   11 
ATOM 8861  H HD11 . LEU A 1 30 ? -23.508 -3.706  -0.354  1.00 0.00 ? 482 LEU C HD11 11 
ATOM 8862  H HD12 . LEU A 1 30 ? -24.677 -5.021  -0.235  1.00 0.00 ? 482 LEU C HD12 11 
ATOM 8863  H HD13 . LEU A 1 30 ? -23.629 -4.900  -1.647  1.00 0.00 ? 482 LEU C HD13 11 
ATOM 8864  H HD21 . LEU A 1 30 ? -20.557 -5.952  0.037   1.00 0.00 ? 482 LEU C HD21 11 
ATOM 8865  H HD22 . LEU A 1 30 ? -21.025 -4.269  -0.203  1.00 0.00 ? 482 LEU C HD22 11 
ATOM 8866  H HD23 . LEU A 1 30 ? -21.265 -5.444  -1.495  1.00 0.00 ? 482 LEU C HD23 11 
ATOM 8867  N N    . THR A 1 31 ? -22.756 -4.557  4.539   1.00 0.00 ? 483 THR C N    11 
ATOM 8868  C CA   . THR A 1 31 ? -23.476 -4.395  5.793   1.00 0.00 ? 483 THR C CA   11 
ATOM 8869  C C    . THR A 1 31 ? -22.642 -3.705  6.866   1.00 0.00 ? 483 THR C C    11 
ATOM 8870  O O    . THR A 1 31 ? -23.187 -3.038  7.748   1.00 0.00 ? 483 THR C O    11 
ATOM 8871  C CB   . THR A 1 31 ? -23.946 -5.755  6.333   1.00 0.00 ? 483 THR C CB   11 
ATOM 8872  O OG1  . THR A 1 31 ? -22.818 -6.630  6.488   1.00 0.00 ? 483 THR C OG1  11 
ATOM 8873  C CG2  . THR A 1 31 ? -24.955 -6.384  5.392   1.00 0.00 ? 483 THR C CG2  11 
ATOM 8874  H H    . THR A 1 31 ? -22.089 -5.287  4.462   1.00 0.00 ? 483 THR C H    11 
ATOM 8875  H HA   . THR A 1 31 ? -24.352 -3.798  5.595   1.00 0.00 ? 483 THR C HA   11 
ATOM 8876  H HB   . THR A 1 31 ? -24.411 -5.603  7.297   1.00 0.00 ? 483 THR C HB   11 
ATOM 8877  H HG1  . THR A 1 31 ? -22.842 -7.335  5.818   1.00 0.00 ? 483 THR C HG1  11 
ATOM 8878  H HG21 . THR A 1 31 ? -25.800 -5.723  5.274   1.00 0.00 ? 483 THR C HG21 11 
ATOM 8879  H HG22 . THR A 1 31 ? -25.289 -7.325  5.804   1.00 0.00 ? 483 THR C HG22 11 
ATOM 8880  H HG23 . THR A 1 31 ? -24.493 -6.555  4.432   1.00 0.00 ? 483 THR C HG23 11 
ATOM 8881  N N    . ARG A 1 32 ? -21.314 -3.861  6.784   1.00 0.00 ? 484 ARG C N    11 
ATOM 8882  C CA   . ARG A 1 32 ? -20.388 -3.300  7.773   1.00 0.00 ? 484 ARG C CA   11 
ATOM 8883  C C    . ARG A 1 32 ? -20.637 -3.892  9.163   1.00 0.00 ? 484 ARG C C    11 
ATOM 8884  O O    . ARG A 1 32 ? -20.236 -3.317  10.175  1.00 0.00 ? 484 ARG C O    11 
ATOM 8885  C CB   . ARG A 1 32 ? -20.466 -1.766  7.824   1.00 0.00 ? 484 ARG C CB   11 
ATOM 8886  C CG   . ARG A 1 32 ? -20.076 -1.060  6.532   1.00 0.00 ? 484 ARG C CG   11 
ATOM 8887  C CD   . ARG A 1 32 ? -21.252 -0.929  5.576   1.00 0.00 ? 484 ARG C CD   11 
ATOM 8888  N NE   . ARG A 1 32 ? -20.869 -0.275  4.327   1.00 0.00 ? 484 ARG C NE   11 
ATOM 8889  C CZ   . ARG A 1 32 ? -21.556 0.708   3.736   1.00 0.00 ? 484 ARG C CZ   11 
ATOM 8890  N NH1  . ARG A 1 32 ? -22.655 1.196   4.305   1.00 0.00 ? 484 ARG C NH1  11 
ATOM 8891  N NH2  . ARG A 1 32 ? -21.137 1.209   2.578   1.00 0.00 ? 484 ARG C NH2  11 
ATOM 8892  H H    . ARG A 1 32 ? -20.934 -4.359  6.032   1.00 0.00 ? 484 ARG C H    11 
ATOM 8893  H HA   . ARG A 1 32 ? -19.392 -3.586  7.465   1.00 0.00 ? 484 ARG C HA   11 
ATOM 8894  H HB2  . ARG A 1 32 ? -21.476 -1.477  8.069   1.00 0.00 ? 484 ARG C HB2  11 
ATOM 8895  H HB3  . ARG A 1 32 ? -19.807 -1.428  8.605   1.00 0.00 ? 484 ARG C HB3  11 
ATOM 8896  H HG2  . ARG A 1 32 ? -19.710 -0.076  6.769   1.00 0.00 ? 484 ARG C HG2  11 
ATOM 8897  H HG3  . ARG A 1 32 ? -19.295 -1.630  6.053   1.00 0.00 ? 484 ARG C HG3  11 
ATOM 8898  H HD2  . ARG A 1 32 ? -21.628 -1.916  5.353   1.00 0.00 ? 484 ARG C HD2  11 
ATOM 8899  H HD3  . ARG A 1 32 ? -22.026 -0.352  6.054   1.00 0.00 ? 484 ARG C HD3  11 
ATOM 8900  H HE   . ARG A 1 32 ? -20.046 -0.602  3.895   1.00 0.00 ? 484 ARG C HE   11 
ATOM 8901  H HH11 . ARG A 1 32 ? -22.981 0.836   5.182   1.00 0.00 ? 484 ARG C HH11 11 
ATOM 8902  H HH12 . ARG A 1 32 ? -23.165 1.942   3.866   1.00 0.00 ? 484 ARG C HH12 11 
ATOM 8903  H HH21 . ARG A 1 32 ? -20.309 0.854   2.136   1.00 0.00 ? 484 ARG C HH21 11 
ATOM 8904  H HH22 . ARG A 1 32 ? -21.642 1.954   2.134   1.00 0.00 ? 484 ARG C HH22 11 
ATOM 8905  N N    . SER A 1 33 ? -21.273 -5.050  9.203   1.00 0.00 ? 485 SER C N    11 
ATOM 8906  C CA   . SER A 1 33 ? -21.579 -5.703  10.455  1.00 0.00 ? 485 SER C CA   11 
ATOM 8907  C C    . SER A 1 33 ? -21.230 -7.169  10.383  1.00 0.00 ? 485 SER C C    11 
ATOM 8908  O O    . SER A 1 33 ? -21.908 -7.930  9.699   1.00 0.00 ? 485 SER C O    11 
ATOM 8909  C CB   . SER A 1 33 ? -23.065 -5.554  10.787  1.00 0.00 ? 485 SER C CB   11 
ATOM 8910  O OG   . SER A 1 33 ? -23.379 -6.165  12.032  1.00 0.00 ? 485 SER C OG   11 
ATOM 8911  H H    . SER A 1 33 ? -21.540 -5.483  8.362   1.00 0.00 ? 485 SER C H    11 
ATOM 8912  H HA   . SER A 1 33 ? -20.999 -5.238  11.233  1.00 0.00 ? 485 SER C HA   11 
ATOM 8913  H HB2  . SER A 1 33 ? -23.328 -4.511  10.825  1.00 0.00 ? 485 SER C HB2  11 
ATOM 8914  H HB3  . SER A 1 33 ? -23.645 -6.034  10.013  1.00 0.00 ? 485 SER C HB3  11 
ATOM 8915  H HG   . SER A 1 33 ? -23.682 -5.490  12.653  1.00 0.00 ? 485 SER C HG   11 
ATOM 8916  N N    . VAL A 1 34 ? -20.173 -7.568  11.085  1.00 0.00 ? 486 VAL C N    11 
ATOM 8917  C CA   . VAL A 1 34 ? -19.761 -8.967  11.110  1.00 0.00 ? 486 VAL C CA   11 
ATOM 8918  C C    . VAL A 1 34 ? -20.890 -9.863  11.611  1.00 0.00 ? 486 VAL C C    11 
ATOM 8919  O O    . VAL A 1 34 ? -20.996 -11.028 11.222  1.00 0.00 ? 486 VAL C O    11 
ATOM 8920  C CB   . VAL A 1 34 ? -18.501 -9.187  11.982  1.00 0.00 ? 486 VAL C CB   11 
ATOM 8921  C CG1  . VAL A 1 34 ? -17.388 -8.275  11.544  1.00 0.00 ? 486 VAL C CG1  11 
ATOM 8922  C CG2  . VAL A 1 34 ? -18.791 -9.002  13.461  1.00 0.00 ? 486 VAL C CG2  11 
ATOM 8923  H H    . VAL A 1 34 ? -19.639 -6.908  11.576  1.00 0.00 ? 486 VAL C H    11 
ATOM 8924  H HA   . VAL A 1 34 ? -19.527 -9.246  10.094  1.00 0.00 ? 486 VAL C HA   11 
ATOM 8925  H HB   . VAL A 1 34 ? -18.171 -10.200 11.831  1.00 0.00 ? 486 VAL C HB   11 
ATOM 8926  H HG11 . VAL A 1 34 ? -17.717 -7.248  11.600  1.00 0.00 ? 486 VAL C HG11 11 
ATOM 8927  H HG12 . VAL A 1 34 ? -17.115 -8.510  10.524  1.00 0.00 ? 486 VAL C HG12 11 
ATOM 8928  H HG13 . VAL A 1 34 ? -16.532 -8.414  12.187  1.00 0.00 ? 486 VAL C HG13 11 
ATOM 8929  H HG21 . VAL A 1 34 ? -19.543 -9.713  13.768  1.00 0.00 ? 486 VAL C HG21 11 
ATOM 8930  H HG22 . VAL A 1 34 ? -19.146 -7.997  13.638  1.00 0.00 ? 486 VAL C HG22 11 
ATOM 8931  H HG23 . VAL A 1 34 ? -17.884 -9.174  14.021  1.00 0.00 ? 486 VAL C HG23 11 
ATOM 8932  N N    . GLU A 1 35 ? -21.738 -9.300  12.460  1.00 0.00 ? 487 GLU C N    11 
ATOM 8933  C CA   . GLU A 1 35 ? -22.872 -10.008 13.005  1.00 0.00 ? 487 GLU C CA   11 
ATOM 8934  C C    . GLU A 1 35 ? -23.835 -10.366 11.885  1.00 0.00 ? 487 GLU C C    11 
ATOM 8935  O O    . GLU A 1 35 ? -24.312 -11.499 11.796  1.00 0.00 ? 487 GLU C O    11 
ATOM 8936  C CB   . GLU A 1 35 ? -23.566 -9.132  14.043  1.00 0.00 ? 487 GLU C CB   11 
ATOM 8937  C CG   . GLU A 1 35 ? -22.637 -8.661  15.151  1.00 0.00 ? 487 GLU C CG   11 
ATOM 8938  C CD   . GLU A 1 35 ? -23.238 -7.563  15.993  1.00 0.00 ? 487 GLU C CD   11 
ATOM 8939  O OE1  . GLU A 1 35 ? -23.980 -7.874  16.946  1.00 0.00 ? 487 GLU C OE1  11 
ATOM 8940  O OE2  . GLU A 1 35 ? -22.959 -6.380  15.715  1.00 0.00 ? 487 GLU C OE2  11 
ATOM 8941  H H    . GLU A 1 35 ? -21.587 -8.368  12.724  1.00 0.00 ? 487 GLU C H    11 
ATOM 8942  H HA   . GLU A 1 35 ? -22.522 -10.914 13.475  1.00 0.00 ? 487 GLU C HA   11 
ATOM 8943  H HB2  . GLU A 1 35 ? -23.976 -8.262  13.549  1.00 0.00 ? 487 GLU C HB2  11 
ATOM 8944  H HB3  . GLU A 1 35 ? -24.372 -9.693  14.493  1.00 0.00 ? 487 GLU C HB3  11 
ATOM 8945  H HG2  . GLU A 1 35 ? -22.410 -9.500  15.792  1.00 0.00 ? 487 GLU C HG2  11 
ATOM 8946  H HG3  . GLU A 1 35 ? -21.724 -8.295  14.704  1.00 0.00 ? 487 GLU C HG3  11 
ATOM 8947  N N    . ILE A 1 36 ? -24.106 -9.401  11.022  1.00 0.00 ? 488 ILE C N    11 
ATOM 8948  C CA   . ILE A 1 36 ? -24.987 -9.628  9.896   1.00 0.00 ? 488 ILE C CA   11 
ATOM 8949  C C    . ILE A 1 36 ? -24.293 -10.492 8.861   1.00 0.00 ? 488 ILE C C    11 
ATOM 8950  O O    . ILE A 1 36 ? -24.840 -11.470 8.430   1.00 0.00 ? 488 ILE C O    11 
ATOM 8951  C CB   . ILE A 1 36 ? -25.439 -8.311  9.238   1.00 0.00 ? 488 ILE C CB   11 
ATOM 8952  C CG1  . ILE A 1 36 ? -26.073 -7.382  10.281  1.00 0.00 ? 488 ILE C CG1  11 
ATOM 8953  C CG2  . ILE A 1 36 ? -26.428 -8.599  8.116   1.00 0.00 ? 488 ILE C CG2  11 
ATOM 8954  C CD1  . ILE A 1 36 ? -26.565 -6.066  9.715   1.00 0.00 ? 488 ILE C CD1  11 
ATOM 8955  H H    . ILE A 1 36 ? -23.697 -8.517  11.146  1.00 0.00 ? 488 ILE C H    11 
ATOM 8956  H HA   . ILE A 1 36 ? -25.860 -10.153 10.258  1.00 0.00 ? 488 ILE C HA   11 
ATOM 8957  H HB   . ILE A 1 36 ? -24.571 -7.835  8.808   1.00 0.00 ? 488 ILE C HB   11 
ATOM 8958  H HG12 . ILE A 1 36 ? -26.916 -7.883  10.730  1.00 0.00 ? 488 ILE C HG12 11 
ATOM 8959  H HG13 . ILE A 1 36 ? -25.343 -7.163  11.047  1.00 0.00 ? 488 ILE C HG13 11 
ATOM 8960  H HG21 . ILE A 1 36 ? -25.966 -9.246  7.385   1.00 0.00 ? 488 ILE C HG21 11 
ATOM 8961  H HG22 . ILE A 1 36 ? -26.714 -7.671  7.644   1.00 0.00 ? 488 ILE C HG22 11 
ATOM 8962  H HG23 . ILE A 1 36 ? -27.304 -9.080  8.523   1.00 0.00 ? 488 ILE C HG23 11 
ATOM 8963  H HD11 . ILE A 1 36 ? -27.315 -6.255  8.962   1.00 0.00 ? 488 ILE C HD11 11 
ATOM 8964  H HD12 . ILE A 1 36 ? -25.738 -5.531  9.273   1.00 0.00 ? 488 ILE C HD12 11 
ATOM 8965  H HD13 . ILE A 1 36 ? -26.994 -5.472  10.509  1.00 0.00 ? 488 ILE C HD13 11 
ATOM 8966  N N    . THR A 1 37 ? -23.079 -10.101 8.484   1.00 0.00 ? 489 THR C N    11 
ATOM 8967  C CA   . THR A 1 37 ? -22.252 -10.833 7.528   1.00 0.00 ? 489 THR C CA   11 
ATOM 8968  C C    . THR A 1 37 ? -22.236 -12.346 7.801   1.00 0.00 ? 489 THR C C    11 
ATOM 8969  O O    . THR A 1 37 ? -22.386 -13.139 6.884   1.00 0.00 ? 489 THR C O    11 
ATOM 8970  C CB   . THR A 1 37 ? -20.815 -10.290 7.549   1.00 0.00 ? 489 THR C CB   11 
ATOM 8971  O OG1  . THR A 1 37 ? -20.836 -8.892  7.245   1.00 0.00 ? 489 THR C OG1  11 
ATOM 8972  C CG2  . THR A 1 37 ? -19.933 -11.010 6.541   1.00 0.00 ? 489 THR C CG2  11 
ATOM 8973  H H    . THR A 1 37 ? -22.720 -9.262  8.834   1.00 0.00 ? 489 THR C H    11 
ATOM 8974  H HA   . THR A 1 37 ? -22.656 -10.659 6.543   1.00 0.00 ? 489 THR C HA   11 
ATOM 8975  H HB   . THR A 1 37 ? -20.414 -10.439 8.541   1.00 0.00 ? 489 THR C HB   11 
ATOM 8976  H HG1  . THR A 1 37 ? -21.359 -8.761  6.434   1.00 0.00 ? 489 THR C HG1  11 
ATOM 8977  H HG21 . THR A 1 37 ? -20.398 -10.980 5.570   1.00 0.00 ? 489 THR C HG21 11 
ATOM 8978  H HG22 . THR A 1 37 ? -19.793 -12.035 6.846   1.00 0.00 ? 489 THR C HG22 11 
ATOM 8979  H HG23 . THR A 1 37 ? -18.975 -10.510 6.495   1.00 0.00 ? 489 THR C HG23 11 
ATOM 8980  N N    . THR A 1 38 ? -22.074 -12.738 9.058   1.00 0.00 ? 490 THR C N    11 
ATOM 8981  C CA   . THR A 1 38 ? -22.053 -14.149 9.409   1.00 0.00 ? 490 THR C CA   11 
ATOM 8982  C C    . THR A 1 38 ? -23.403 -14.805 9.091   1.00 0.00 ? 490 THR C C    11 
ATOM 8983  O O    . THR A 1 38 ? -23.457 -15.874 8.475   1.00 0.00 ? 490 THR C O    11 
ATOM 8984  C CB   . THR A 1 38 ? -21.708 -14.345 10.892  1.00 0.00 ? 490 THR C CB   11 
ATOM 8985  O OG1  . THR A 1 38 ? -20.478 -13.666 11.191  1.00 0.00 ? 490 THR C OG1  11 
ATOM 8986  C CG2  . THR A 1 38 ? -21.549 -15.818 11.198  1.00 0.00 ? 490 THR C CG2  11 
ATOM 8987  H H    . THR A 1 38 ? -21.972 -12.069 9.766   1.00 0.00 ? 490 THR C H    11 
ATOM 8988  H HA   . THR A 1 38 ? -21.294 -14.639 8.812   1.00 0.00 ? 490 THR C HA   11 
ATOM 8989  H HB   . THR A 1 38 ? -22.501 -13.936 11.500  1.00 0.00 ? 490 THR C HB   11 
ATOM 8990  H HG1  . THR A 1 38 ? -20.644 -12.716 11.269  1.00 0.00 ? 490 THR C HG1  11 
ATOM 8991  H HG21 . THR A 1 38 ? -20.792 -16.231 10.545  1.00 0.00 ? 490 THR C HG21 11 
ATOM 8992  H HG22 . THR A 1 38 ? -22.489 -16.324 11.029  1.00 0.00 ? 490 THR C HG22 11 
ATOM 8993  H HG23 . THR A 1 38 ? -21.246 -15.945 12.227  1.00 0.00 ? 490 THR C HG23 11 
ATOM 8994  N N    . ASP A 1 39 ? -24.488 -14.143 9.485   1.00 0.00 ? 491 ASP C N    11 
ATOM 8995  C CA   . ASP A 1 39 ? -25.840 -14.634 9.180   1.00 0.00 ? 491 ASP C CA   11 
ATOM 8996  C C    . ASP A 1 39 ? -26.062 -14.565 7.683   1.00 0.00 ? 491 ASP C C    11 
ATOM 8997  O O    . ASP A 1 39 ? -26.699 -15.429 7.084   1.00 0.00 ? 491 ASP C O    11 
ATOM 8998  C CB   . ASP A 1 39 ? -26.895 -13.793 9.905   1.00 0.00 ? 491 ASP C CB   11 
ATOM 8999  C CG   . ASP A 1 39 ? -28.317 -14.235 9.591   1.00 0.00 ? 491 ASP C CG   11 
ATOM 9000  O OD1  . ASP A 1 39 ? -28.767 -15.253 10.154  1.00 0.00 ? 491 ASP C OD1  11 
ATOM 9001  O OD2  . ASP A 1 39 ? -28.996 -13.553 8.786   1.00 0.00 ? 491 ASP C OD2  11 
ATOM 9002  H H    . ASP A 1 39 ? -24.377 -13.302 9.978   1.00 0.00 ? 491 ASP C H    11 
ATOM 9003  H HA   . ASP A 1 39 ? -25.912 -15.664 9.498   1.00 0.00 ? 491 ASP C HA   11 
ATOM 9004  H HB2  . ASP A 1 39 ? -26.742 -13.869 10.971  1.00 0.00 ? 491 ASP C HB2  11 
ATOM 9005  H HB3  . ASP A 1 39 ? -26.785 -12.760 9.607   1.00 0.00 ? 491 ASP C HB3  11 
ATOM 9006  N N    . ASN A 1 40 ? -25.502 -13.529 7.093   1.00 0.00 ? 492 ASN C N    11 
ATOM 9007  C CA   . ASN A 1 40 ? -25.542 -13.303 5.673   1.00 0.00 ? 492 ASN C CA   11 
ATOM 9008  C C    . ASN A 1 40 ? -24.955 -14.500 4.931   1.00 0.00 ? 492 ASN C C    11 
ATOM 9009  O O    . ASN A 1 40 ? -25.549 -15.005 3.979   1.00 0.00 ? 492 ASN C O    11 
ATOM 9010  C CB   . ASN A 1 40 ? -24.780 -12.007 5.325   1.00 0.00 ? 492 ASN C CB   11 
ATOM 9011  C CG   . ASN A 1 40 ? -25.703 -10.845 5.055   1.00 0.00 ? 492 ASN C CG   11 
ATOM 9012  O OD1  . ASN A 1 40 ? -26.864 -11.029 4.693   1.00 0.00 ? 492 ASN C OD1  11 
ATOM 9013  N ND2  . ASN A 1 40 ? -25.189 -9.644  5.186   1.00 0.00 ? 492 ASN C ND2  11 
ATOM 9014  H H    . ASN A 1 40 ? -25.041 -12.870 7.660   1.00 0.00 ? 492 ASN C H    11 
ATOM 9015  H HA   . ASN A 1 40 ? -26.577 -13.172 5.397   1.00 0.00 ? 492 ASN C HA   11 
ATOM 9016  H HB2  . ASN A 1 40 ? -24.181 -11.736 6.183   1.00 0.00 ? 492 ASN C HB2  11 
ATOM 9017  H HB3  . ASN A 1 40 ? -24.131 -12.150 4.481   1.00 0.00 ? 492 ASN C HB3  11 
ATOM 9018  H HD21 . ASN A 1 40 ? -24.238 -9.564  5.442   1.00 0.00 ? 492 ASN C HD21 11 
ATOM 9019  H HD22 . ASN A 1 40 ? -25.763 -8.870  5.023   1.00 0.00 ? 492 ASN C HD22 11 
ATOM 9020  N N    . ILE A 1 41 ? -23.790 -14.965 5.387   1.00 0.00 ? 493 ILE C N    11 
ATOM 9021  C CA   . ILE A 1 41 ? -23.142 -16.147 4.813   1.00 0.00 ? 493 ILE C CA   11 
ATOM 9022  C C    . ILE A 1 41 ? -24.091 -17.340 4.890   1.00 0.00 ? 493 ILE C C    11 
ATOM 9023  O O    . ILE A 1 41 ? -24.291 -18.070 3.914   1.00 0.00 ? 493 ILE C O    11 
ATOM 9024  C CB   . ILE A 1 41 ? -21.848 -16.519 5.591   1.00 0.00 ? 493 ILE C CB   11 
ATOM 9025  C CG1  . ILE A 1 41 ? -20.875 -15.351 5.638   1.00 0.00 ? 493 ILE C CG1  11 
ATOM 9026  C CG2  . ILE A 1 41 ? -21.175 -17.730 4.960   1.00 0.00 ? 493 ILE C CG2  11 
ATOM 9027  C CD1  . ILE A 1 41 ? -19.744 -15.552 6.627   1.00 0.00 ? 493 ILE C CD1  11 
ATOM 9028  H H    . ILE A 1 41 ? -23.344 -14.488 6.125   1.00 0.00 ? 493 ILE C H    11 
ATOM 9029  H HA   . ILE A 1 41 ? -22.893 -15.936 3.784   1.00 0.00 ? 493 ILE C HA   11 
ATOM 9030  H HB   . ILE A 1 41 ? -22.129 -16.781 6.601   1.00 0.00 ? 493 ILE C HB   11 
ATOM 9031  H HG12 . ILE A 1 41 ? -20.445 -15.206 4.659   1.00 0.00 ? 493 ILE C HG12 11 
ATOM 9032  H HG13 . ILE A 1 41 ? -21.413 -14.462 5.925   1.00 0.00 ? 493 ILE C HG13 11 
ATOM 9033  H HG21 . ILE A 1 41 ? -20.274 -17.962 5.510   1.00 0.00 ? 493 ILE C HG21 11 
ATOM 9034  H HG22 . ILE A 1 41 ? -20.922 -17.503 3.935   1.00 0.00 ? 493 ILE C HG22 11 
ATOM 9035  H HG23 . ILE A 1 41 ? -21.846 -18.574 4.990   1.00 0.00 ? 493 ILE C HG23 11 
ATOM 9036  H HD11 . ILE A 1 41 ? -19.164 -16.418 6.344   1.00 0.00 ? 493 ILE C HD11 11 
ATOM 9037  H HD12 . ILE A 1 41 ? -20.157 -15.716 7.610   1.00 0.00 ? 493 ILE C HD12 11 
ATOM 9038  H HD13 . ILE A 1 41 ? -19.111 -14.681 6.646   1.00 0.00 ? 493 ILE C HD13 11 
ATOM 9039  N N    . LEU A 1 42 ? -24.681 -17.508 6.063   1.00 0.00 ? 494 LEU C N    11 
ATOM 9040  C CA   . LEU A 1 42 ? -25.597 -18.606 6.345   1.00 0.00 ? 494 LEU C CA   11 
ATOM 9041  C C    . LEU A 1 42 ? -26.834 -18.566 5.437   1.00 0.00 ? 494 LEU C C    11 
ATOM 9042  O O    . LEU A 1 42 ? -27.325 -19.609 4.998   1.00 0.00 ? 494 LEU C O    11 
ATOM 9043  C CB   . LEU A 1 42 ? -25.994 -18.558 7.823   1.00 0.00 ? 494 LEU C CB   11 
ATOM 9044  C CG   . LEU A 1 42 ? -24.835 -18.748 8.812   1.00 0.00 ? 494 LEU C CG   11 
ATOM 9045  C CD1  . LEU A 1 42 ? -25.262 -18.417 10.231  1.00 0.00 ? 494 LEU C CD1  11 
ATOM 9046  C CD2  . LEU A 1 42 ? -24.296 -20.169 8.737   1.00 0.00 ? 494 LEU C CD2  11 
ATOM 9047  H H    . LEU A 1 42 ? -24.491 -16.862 6.779   1.00 0.00 ? 494 LEU C H    11 
ATOM 9048  H HA   . LEU A 1 42 ? -25.066 -19.529 6.162   1.00 0.00 ? 494 LEU C HA   11 
ATOM 9049  H HB2  . LEU A 1 42 ? -26.451 -17.598 8.016   1.00 0.00 ? 494 LEU C HB2  11 
ATOM 9050  H HB3  . LEU A 1 42 ? -26.726 -19.328 8.010   1.00 0.00 ? 494 LEU C HB3  11 
ATOM 9051  H HG   . LEU A 1 42 ? -24.034 -18.074 8.542   1.00 0.00 ? 494 LEU C HG   11 
ATOM 9052  H HD11 . LEU A 1 42 ? -26.168 -18.951 10.474  1.00 0.00 ? 494 LEU C HD11 11 
ATOM 9053  H HD12 . LEU A 1 42 ? -25.425 -17.352 10.321  1.00 0.00 ? 494 LEU C HD12 11 
ATOM 9054  H HD13 . LEU A 1 42 ? -24.478 -18.711 10.913  1.00 0.00 ? 494 LEU C HD13 11 
ATOM 9055  H HD21 . LEU A 1 42 ? -23.891 -20.350 7.753   1.00 0.00 ? 494 LEU C HD21 11 
ATOM 9056  H HD22 . LEU A 1 42 ? -25.096 -20.867 8.931   1.00 0.00 ? 494 LEU C HD22 11 
ATOM 9057  H HD23 . LEU A 1 42 ? -23.520 -20.298 9.476   1.00 0.00 ? 494 LEU C HD23 11 
ATOM 9058  N N    . GLU A 1 43 ? -27.321 -17.369 5.148   1.00 0.00 ? 495 GLU C N    11 
ATOM 9059  C CA   . GLU A 1 43 ? -28.486 -17.204 4.278   1.00 0.00 ? 495 GLU C CA   11 
ATOM 9060  C C    . GLU A 1 43 ? -28.116 -17.362 2.804   1.00 0.00 ? 495 GLU C C    11 
ATOM 9061  O O    . GLU A 1 43 ? -28.987 -17.529 1.946   1.00 0.00 ? 495 GLU C O    11 
ATOM 9062  C CB   . GLU A 1 43 ? -29.143 -15.850 4.515   1.00 0.00 ? 495 GLU C CB   11 
ATOM 9063  C CG   . GLU A 1 43 ? -29.767 -15.721 5.885   1.00 0.00 ? 495 GLU C CG   11 
ATOM 9064  C CD   . GLU A 1 43 ? -30.814 -16.779 6.141   1.00 0.00 ? 495 GLU C CD   11 
ATOM 9065  O OE1  . GLU A 1 43 ? -31.925 -16.675 5.581   1.00 0.00 ? 495 GLU C OE1  11 
ATOM 9066  O OE2  . GLU A 1 43 ? -30.537 -17.727 6.902   1.00 0.00 ? 495 GLU C OE2  11 
ATOM 9067  H H    . GLU A 1 43 ? -26.902 -16.573 5.545   1.00 0.00 ? 495 GLU C H    11 
ATOM 9068  H HA   . GLU A 1 43 ? -29.193 -17.979 4.537   1.00 0.00 ? 495 GLU C HA   11 
ATOM 9069  H HB2  . GLU A 1 43 ? -28.397 -15.077 4.404   1.00 0.00 ? 495 GLU C HB2  11 
ATOM 9070  H HB3  . GLU A 1 43 ? -29.916 -15.703 3.774   1.00 0.00 ? 495 GLU C HB3  11 
ATOM 9071  H HG2  . GLU A 1 43 ? -28.993 -15.814 6.632   1.00 0.00 ? 495 GLU C HG2  11 
ATOM 9072  H HG3  . GLU A 1 43 ? -30.230 -14.750 5.968   1.00 0.00 ? 495 GLU C HG3  11 
ATOM 9073  N N    . GLY A 1 44 ? -26.828 -17.318 2.517   1.00 0.00 ? 496 GLY C N    11 
ATOM 9074  C CA   . GLY A 1 44 ? -26.370 -17.479 1.154   1.00 0.00 ? 496 GLY C CA   11 
ATOM 9075  C C    . GLY A 1 44 ? -26.065 -16.165 0.472   1.00 0.00 ? 496 GLY C C    11 
ATOM 9076  O O    . GLY A 1 44 ? -25.968 -16.105 -0.755  1.00 0.00 ? 496 GLY C O    11 
ATOM 9077  H H    . GLY A 1 44 ? -26.180 -17.180 3.241   1.00 0.00 ? 496 GLY C H    11 
ATOM 9078  H HA2  . GLY A 1 44 ? -25.474 -18.082 1.161   1.00 0.00 ? 496 GLY C HA2  11 
ATOM 9079  H HA3  . GLY A 1 44 ? -27.131 -17.995 0.592   1.00 0.00 ? 496 GLY C HA3  11 
ATOM 9080  N N    . ARG A 1 45 ? -25.914 -15.111 1.267   1.00 0.00 ? 497 ARG C N    11 
ATOM 9081  C CA   . ARG A 1 45 ? -25.551 -13.796 0.747   1.00 0.00 ? 497 ARG C CA   11 
ATOM 9082  C C    . ARG A 1 45 ? -24.164 -13.875 0.126   1.00 0.00 ? 497 ARG C C    11 
ATOM 9083  O O    . ARG A 1 45 ? -23.886 -13.261 -0.905  1.00 0.00 ? 497 ARG C O    11 
ATOM 9084  C CB   . ARG A 1 45 ? -25.560 -12.770 1.884   1.00 0.00 ? 497 ARG C CB   11 
ATOM 9085  C CG   . ARG A 1 45 ? -25.178 -11.361 1.470   1.00 0.00 ? 497 ARG C CG   11 
ATOM 9086  C CD   . ARG A 1 45 ? -26.257 -10.717 0.628   1.00 0.00 ? 497 ARG C CD   11 
ATOM 9087  N NE   . ARG A 1 45 ? -27.519 -10.573 1.362   1.00 0.00 ? 497 ARG C NE   11 
ATOM 9088  C CZ   . ARG A 1 45 ? -28.680 -10.242 0.794   1.00 0.00 ? 497 ARG C CZ   11 
ATOM 9089  N NH1  . ARG A 1 45 ? -28.735 -9.983  -0.509  1.00 0.00 ? 497 ARG C NH1  11 
ATOM 9090  N NH2  . ARG A 1 45 ? -29.782 -10.161 1.529   1.00 0.00 ? 497 ARG C NH2  11 
ATOM 9091  H H    . ARG A 1 45 ? -26.054 -15.219 2.234   1.00 0.00 ? 497 ARG C H    11 
ATOM 9092  H HA   . ARG A 1 45 ? -26.269 -13.513 -0.007  1.00 0.00 ? 497 ARG C HA   11 
ATOM 9093  H HB2  . ARG A 1 45 ? -26.550 -12.734 2.309   1.00 0.00 ? 497 ARG C HB2  11 
ATOM 9094  H HB3  . ARG A 1 45 ? -24.868 -13.095 2.646   1.00 0.00 ? 497 ARG C HB3  11 
ATOM 9095  H HG2  . ARG A 1 45 ? -25.028 -10.764 2.358   1.00 0.00 ? 497 ARG C HG2  11 
ATOM 9096  H HG3  . ARG A 1 45 ? -24.261 -11.399 0.902   1.00 0.00 ? 497 ARG C HG3  11 
ATOM 9097  H HD2  . ARG A 1 45 ? -25.910 -9.743  0.329   1.00 0.00 ? 497 ARG C HD2  11 
ATOM 9098  H HD3  . ARG A 1 45 ? -26.425 -11.326 -0.247  1.00 0.00 ? 497 ARG C HD3  11 
ATOM 9099  H HE   . ARG A 1 45 ? -27.490 -10.739 2.331   1.00 0.00 ? 497 ARG C HE   11 
ATOM 9100  H HH11 . ARG A 1 45 ? -27.907 -10.031 -1.072  1.00 0.00 ? 497 ARG C HH11 11 
ATOM 9101  H HH12 . ARG A 1 45 ? -29.606 -9.737  -0.944  1.00 0.00 ? 497 ARG C HH12 11 
ATOM 9102  H HH21 . ARG A 1 45 ? -29.755 -10.342 2.517   1.00 0.00 ? 497 ARG C HH21 11 
ATOM 9103  H HH22 . ARG A 1 45 ? -30.662 -9.928  1.101   1.00 0.00 ? 497 ARG C HH22 11 
ATOM 9104  N N    . ILE A 1 46 ? -23.306 -14.644 0.770   1.00 0.00 ? 498 ILE C N    11 
ATOM 9105  C CA   . ILE A 1 46 ? -21.971 -14.883 0.292   1.00 0.00 ? 498 ILE C CA   11 
ATOM 9106  C C    . ILE A 1 46 ? -21.922 -16.269 -0.328  1.00 0.00 ? 498 ILE C C    11 
ATOM 9107  O O    . ILE A 1 46 ? -22.400 -17.239 0.271   1.00 0.00 ? 498 ILE C O    11 
ATOM 9108  C CB   . ILE A 1 46 ? -20.910 -14.794 1.436   1.00 0.00 ? 498 ILE C CB   11 
ATOM 9109  C CG1  . ILE A 1 46 ? -20.816 -13.371 2.019   1.00 0.00 ? 498 ILE C CG1  11 
ATOM 9110  C CG2  . ILE A 1 46 ? -19.548 -15.246 0.940   1.00 0.00 ? 498 ILE C CG2  11 
ATOM 9111  C CD1  . ILE A 1 46 ? -21.961 -12.987 2.931   1.00 0.00 ? 498 ILE C CD1  11 
ATOM 9112  H H    . ILE A 1 46 ? -23.589 -15.079 1.598   1.00 0.00 ? 498 ILE C H    11 
ATOM 9113  H HA   . ILE A 1 46 ? -21.740 -14.144 -0.460  1.00 0.00 ? 498 ILE C HA   11 
ATOM 9114  H HB   . ILE A 1 46 ? -21.214 -15.473 2.220   1.00 0.00 ? 498 ILE C HB   11 
ATOM 9115  H HG12 . ILE A 1 46 ? -19.908 -13.291 2.593   1.00 0.00 ? 498 ILE C HG12 11 
ATOM 9116  H HG13 . ILE A 1 46 ? -20.784 -12.660 1.207   1.00 0.00 ? 498 ILE C HG13 11 
ATOM 9117  H HG21 . ILE A 1 46 ? -19.274 -14.659 0.078   1.00 0.00 ? 498 ILE C HG21 11 
ATOM 9118  H HG22 . ILE A 1 46 ? -19.592 -16.290 0.667   1.00 0.00 ? 498 ILE C HG22 11 
ATOM 9119  H HG23 . ILE A 1 46 ? -18.814 -15.106 1.720   1.00 0.00 ? 498 ILE C HG23 11 
ATOM 9120  H HD11 . ILE A 1 46 ? -22.014 -13.682 3.756   1.00 0.00 ? 498 ILE C HD11 11 
ATOM 9121  H HD12 . ILE A 1 46 ? -22.885 -13.016 2.374   1.00 0.00 ? 498 ILE C HD12 11 
ATOM 9122  H HD13 . ILE A 1 46 ? -21.799 -11.990 3.311   1.00 0.00 ? 498 ILE C HD13 11 
ATOM 9123  N N    . GLN A 1 47 ? -21.374 -16.361 -1.518  1.00 0.00 ? 499 GLN C N    11 
ATOM 9124  C CA   . GLN A 1 47 ? -21.295 -17.631 -2.218  1.00 0.00 ? 499 GLN C CA   11 
ATOM 9125  C C    . GLN A 1 47 ? -20.223 -18.521 -1.615  1.00 0.00 ? 499 GLN C C    11 
ATOM 9126  O O    . GLN A 1 47 ? -19.029 -18.221 -1.689  1.00 0.00 ? 499 GLN C O    11 
ATOM 9127  C CB   . GLN A 1 47 ? -21.030 -17.414 -3.704  1.00 0.00 ? 499 GLN C CB   11 
ATOM 9128  C CG   . GLN A 1 47 ? -22.101 -16.588 -4.395  1.00 0.00 ? 499 GLN C CG   11 
ATOM 9129  C CD   . GLN A 1 47 ? -23.480 -17.202 -4.274  1.00 0.00 ? 499 GLN C CD   11 
ATOM 9130  O OE1  . GLN A 1 47 ? -23.632 -18.422 -4.207  1.00 0.00 ? 499 GLN C OE1  11 
ATOM 9131  N NE2  . GLN A 1 47 ? -24.495 -16.366 -4.237  1.00 0.00 ? 499 GLN C NE2  11 
ATOM 9132  H H    . GLN A 1 47 ? -21.007 -15.554 -1.938  1.00 0.00 ? 499 GLN C H    11 
ATOM 9133  H HA   . GLN A 1 47 ? -22.249 -18.121 -2.106  1.00 0.00 ? 499 GLN C HA   11 
ATOM 9134  H HB2  . GLN A 1 47 ? -20.083 -16.907 -3.818  1.00 0.00 ? 499 GLN C HB2  11 
ATOM 9135  H HB3  . GLN A 1 47 ? -20.975 -18.374 -4.193  1.00 0.00 ? 499 GLN C HB3  11 
ATOM 9136  H HG2  . GLN A 1 47 ? -22.123 -15.605 -3.951  1.00 0.00 ? 499 GLN C HG2  11 
ATOM 9137  H HG3  . GLN A 1 47 ? -21.851 -16.505 -5.441  1.00 0.00 ? 499 GLN C HG3  11 
ATOM 9138  H HE21 . GLN A 1 47 ? -24.304 -15.403 -4.291  1.00 0.00 ? 499 GLN C HE21 11 
ATOM 9139  H HE22 . GLN A 1 47 ? -25.398 -16.734 -4.156  1.00 0.00 ? 499 GLN C HE22 11 
ATOM 9140  N N    . VAL A 1 48 ? -20.657 -19.612 -1.017  1.00 0.00 ? 500 VAL C N    11 
ATOM 9141  C CA   . VAL A 1 48 ? -19.752 -20.555 -0.395  1.00 0.00 ? 500 VAL C CA   11 
ATOM 9142  C C    . VAL A 1 48 ? -18.976 -21.328 -1.456  1.00 0.00 ? 500 VAL C C    11 
ATOM 9143  O O    . VAL A 1 48 ? -19.400 -21.394 -2.615  1.00 0.00 ? 500 VAL C O    11 
ATOM 9144  C CB   . VAL A 1 48 ? -20.505 -21.549 0.524   1.00 0.00 ? 500 VAL C CB   11 
ATOM 9145  C CG1  . VAL A 1 48 ? -21.014 -20.851 1.781   1.00 0.00 ? 500 VAL C CG1  11 
ATOM 9146  C CG2  . VAL A 1 48 ? -21.649 -22.211 -0.228  1.00 0.00 ? 500 VAL C CG2  11 
ATOM 9147  H H    . VAL A 1 48 ? -21.619 -19.798 -1.009  1.00 0.00 ? 500 VAL C H    11 
ATOM 9148  H HA   . VAL A 1 48 ? -19.054 -19.992 0.207   1.00 0.00 ? 500 VAL C HA   11 
ATOM 9149  H HB   . VAL A 1 48 ? -19.809 -22.317 0.826   1.00 0.00 ? 500 VAL C HB   11 
ATOM 9150  H HG11 . VAL A 1 48 ? -21.697 -20.060 1.516   1.00 0.00 ? 500 VAL C HG11 11 
ATOM 9151  H HG12 . VAL A 1 48 ? -20.179 -20.435 2.324   1.00 0.00 ? 500 VAL C HG12 11 
ATOM 9152  H HG13 . VAL A 1 48 ? -21.523 -21.571 2.407   1.00 0.00 ? 500 VAL C HG13 11 
ATOM 9153  H HG21 . VAL A 1 48 ? -21.263 -22.695 -1.114  1.00 0.00 ? 500 VAL C HG21 11 
ATOM 9154  H HG22 . VAL A 1 48 ? -22.376 -21.466 -0.510  1.00 0.00 ? 500 VAL C HG22 11 
ATOM 9155  H HG23 . VAL A 1 48 ? -22.117 -22.948 0.408   1.00 0.00 ? 500 VAL C HG23 11 
ATOM 9156  N N    . PRO A 1 49 ? -17.826 -21.913 -1.082  1.00 0.00 ? 501 PRO C N    11 
ATOM 9157  C CA   . PRO A 1 49 ? -16.991 -22.675 -2.008  1.00 0.00 ? 501 PRO C CA   11 
ATOM 9158  C C    . PRO A 1 49 ? -17.736 -23.853 -2.617  1.00 0.00 ? 501 PRO C C    11 
ATOM 9159  O O    . PRO A 1 49 ? -18.219 -24.743 -1.905  1.00 0.00 ? 501 PRO C O    11 
ATOM 9160  C CB   . PRO A 1 49 ? -15.834 -23.170 -1.135  1.00 0.00 ? 501 PRO C CB   11 
ATOM 9161  C CG   . PRO A 1 49 ? -15.820 -22.248 0.025   1.00 0.00 ? 501 PRO C CG   11 
ATOM 9162  C CD   . PRO A 1 49 ? -17.249 -21.883 0.266   1.00 0.00 ? 501 PRO C CD   11 
ATOM 9163  H HA   . PRO A 1 49 ? -16.608 -22.048 -2.799  1.00 0.00 ? 501 PRO C HA   11 
ATOM 9164  H HB2  . PRO A 1 49 ? -16.019 -24.190 -0.831  1.00 0.00 ? 501 PRO C HB2  11 
ATOM 9165  H HB3  . PRO A 1 49 ? -14.911 -23.116 -1.693  1.00 0.00 ? 501 PRO C HB3  11 
ATOM 9166  H HG2  . PRO A 1 49 ? -15.408 -22.748 0.889   1.00 0.00 ? 501 PRO C HG2  11 
ATOM 9167  H HG3  . PRO A 1 49 ? -15.243 -21.366 -0.211  1.00 0.00 ? 501 PRO C HG3  11 
ATOM 9168  H HD2  . PRO A 1 49 ? -17.722 -22.620 0.895   1.00 0.00 ? 501 PRO C HD2  11 
ATOM 9169  H HD3  . PRO A 1 49 ? -17.324 -20.897 0.700   1.00 0.00 ? 501 PRO C HD3  11 
ATOM 9170  N N    . PHE A 1 50 ? -17.842 -23.836 -3.918  1.00 0.00 ? 502 PHE C N    11 
ATOM 9171  C CA   . PHE A 1 50 ? -18.499 -24.883 -4.660  1.00 0.00 ? 502 PHE C CA   11 
ATOM 9172  C C    . PHE A 1 50 ? -17.592 -25.305 -5.810  1.00 0.00 ? 502 PHE C C    11 
ATOM 9173  O O    . PHE A 1 50 ? -16.990 -24.449 -6.464  1.00 0.00 ? 502 PHE C O    11 
ATOM 9174  C CB   . PHE A 1 50 ? -19.846 -24.374 -5.197  1.00 0.00 ? 502 PHE C CB   11 
ATOM 9175  C CG   . PHE A 1 50 ? -20.712 -25.433 -5.827  1.00 0.00 ? 502 PHE C CG   11 
ATOM 9176  C CD1  . PHE A 1 50 ? -21.558 -26.206 -5.048  1.00 0.00 ? 502 PHE C CD1  11 
ATOM 9177  C CD2  . PHE A 1 50 ? -20.690 -25.645 -7.196  1.00 0.00 ? 502 PHE C CD2  11 
ATOM 9178  C CE1  . PHE A 1 50 ? -22.361 -27.170 -5.620  1.00 0.00 ? 502 PHE C CE1  11 
ATOM 9179  C CE2  . PHE A 1 50 ? -21.491 -26.610 -7.775  1.00 0.00 ? 502 PHE C CE2  11 
ATOM 9180  C CZ   . PHE A 1 50 ? -22.327 -27.373 -6.985  1.00 0.00 ? 502 PHE C CZ   11 
ATOM 9181  H H    . PHE A 1 50 ? -17.454 -23.080 -4.411  1.00 0.00 ? 502 PHE C H    11 
ATOM 9182  H HA   . PHE A 1 50 ? -18.663 -25.722 -3.999  1.00 0.00 ? 502 PHE C HA   11 
ATOM 9183  H HB2  . PHE A 1 50 ? -20.404 -23.939 -4.382  1.00 0.00 ? 502 PHE C HB2  11 
ATOM 9184  H HB3  . PHE A 1 50 ? -19.659 -23.613 -5.938  1.00 0.00 ? 502 PHE C HB3  11 
ATOM 9185  H HD1  . PHE A 1 50 ? -21.583 -26.048 -3.979  1.00 0.00 ? 502 PHE C HD1  11 
ATOM 9186  H HD2  . PHE A 1 50 ? -20.035 -25.048 -7.814  1.00 0.00 ? 502 PHE C HD2  11 
ATOM 9187  H HE1  . PHE A 1 50 ? -23.014 -27.767 -5.001  1.00 0.00 ? 502 PHE C HE1  11 
ATOM 9188  H HE2  . PHE A 1 50 ? -21.462 -26.768 -8.843  1.00 0.00 ? 502 PHE C HE2  11 
ATOM 9189  H HZ   . PHE A 1 50 ? -22.956 -28.126 -7.434  1.00 0.00 ? 502 PHE C HZ   11 
ATOM 9190  N N    . PRO A 1 51 ? -17.446 -26.624 -6.052  1.00 0.00 ? 503 PRO C N    11 
ATOM 9191  C CA   . PRO A 1 51 ? -16.595 -27.135 -7.126  1.00 0.00 ? 503 PRO C CA   11 
ATOM 9192  C C    . PRO A 1 51 ? -16.937 -26.501 -8.472  1.00 0.00 ? 503 PRO C C    11 
ATOM 9193  O O    . PRO A 1 51 ? -18.078 -26.582 -8.947  1.00 0.00 ? 503 PRO C O    11 
ATOM 9194  C CB   . PRO A 1 51 ? -16.889 -28.646 -7.146  1.00 0.00 ? 503 PRO C CB   11 
ATOM 9195  C CG   . PRO A 1 51 ? -18.110 -28.821 -6.306  1.00 0.00 ? 503 PRO C CG   11 
ATOM 9196  C CD   . PRO A 1 51 ? -18.087 -27.708 -5.307  1.00 0.00 ? 503 PRO C CD   11 
ATOM 9197  H HA   . PRO A 1 51 ? -15.551 -26.970 -6.909  1.00 0.00 ? 503 PRO C HA   11 
ATOM 9198  H HB2  . PRO A 1 51 ? -17.061 -28.968 -8.162  1.00 0.00 ? 503 PRO C HB2  11 
ATOM 9199  H HB3  . PRO A 1 51 ? -16.049 -29.184 -6.733  1.00 0.00 ? 503 PRO C HB3  11 
ATOM 9200  H HG2  . PRO A 1 51 ? -18.991 -28.750 -6.926  1.00 0.00 ? 503 PRO C HG2  11 
ATOM 9201  H HG3  . PRO A 1 51 ? -18.076 -29.776 -5.804  1.00 0.00 ? 503 PRO C HG3  11 
ATOM 9202  H HD2  . PRO A 1 51 ? -19.092 -27.440 -5.017  1.00 0.00 ? 503 PRO C HD2  11 
ATOM 9203  H HD3  . PRO A 1 51 ? -17.499 -27.982 -4.444  1.00 0.00 ? 503 PRO C HD3  11 
ATOM 9204  N N    . THR A 1 52 ? -15.955 -25.879 -9.080  1.00 0.00 ? 504 THR C N    11 
ATOM 9205  C CA   . THR A 1 52 ? -16.141 -25.212 -10.339 1.00 0.00 ? 504 THR C CA   11 
ATOM 9206  C C    . THR A 1 52 ? -14.833 -25.210 -11.111 1.00 0.00 ? 504 THR C C    11 
ATOM 9207  O O    . THR A 1 52 ? -13.796 -25.577 -10.512 1.00 0.00 ? 504 THR C O    11 
ATOM 9208  C CB   . THR A 1 52 ? -16.648 -23.756 -10.136 1.00 0.00 ? 504 THR C CB   11 
ATOM 9209  O OG1  . THR A 1 52 ? -16.951 -23.157 -11.402 1.00 0.00 ? 504 THR C OG1  11 
ATOM 9210  C CG2  . THR A 1 52 ? -15.609 -22.908 -9.412  1.00 0.00 ? 504 THR C CG2  11 
ATOM 9211  O OXT  . THR A 1 52 ? -14.839 -24.865 -12.310 1.00 0.00 ? 504 THR C OXT  11 
ATOM 9212  H H    . THR A 1 52 ? -15.064 -25.865 -8.670  1.00 0.00 ? 504 THR C H    11 
ATOM 9213  H HA   . THR A 1 52 ? -16.880 -25.761 -10.901 1.00 0.00 ? 504 THR C HA   11 
ATOM 9214  H HB   . THR A 1 52 ? -17.548 -23.788 -9.535  1.00 0.00 ? 504 THR C HB   11 
ATOM 9215  H HG1  . THR A 1 52 ? -16.327 -23.491 -12.059 1.00 0.00 ? 504 THR C HG1  11 
ATOM 9216  H HG21 . THR A 1 52 ? -14.698 -22.881 -9.991  1.00 0.00 ? 504 THR C HG21 11 
ATOM 9217  H HG22 . THR A 1 52 ? -15.406 -23.339 -8.443  1.00 0.00 ? 504 THR C HG22 11 
ATOM 9218  H HG23 . THR A 1 52 ? -15.987 -21.903 -9.287  1.00 0.00 ? 504 THR C HG23 11 
ATOM 9219  N N    . SER A 1 1  ? -11.978 3.020   8.089   1.00 0.00 ? 453 SER C N    12 
ATOM 9220  C CA   . SER A 1 1  ? -12.968 1.935   8.128   1.00 0.00 ? 453 SER C CA   12 
ATOM 9221  C C    . SER A 1 1  ? -12.418 0.670   7.457   1.00 0.00 ? 453 SER C C    12 
ATOM 9222  O O    . SER A 1 1  ? -12.667 -0.442  7.920   1.00 0.00 ? 453 SER C O    12 
ATOM 9223  C CB   . SER A 1 1  ? -14.267 2.383   7.436   1.00 0.00 ? 453 SER C CB   12 
ATOM 9224  O OG   . SER A 1 1  ? -15.317 1.444   7.628   1.00 0.00 ? 453 SER C OG   12 
ATOM 9225  H H1   . SER A 1 1  ? -11.744 3.268   7.112   1.00 0.00 ? 453 SER C H1   12 
ATOM 9226  H H2   . SER A 1 1  ? -11.107 2.724   8.574   1.00 0.00 ? 453 SER C H2   12 
ATOM 9227  H H3   . SER A 1 1  ? -12.352 3.862   8.570   1.00 0.00 ? 453 SER C H3   12 
ATOM 9228  H HA   . SER A 1 1  ? -13.180 1.709   9.163   1.00 0.00 ? 453 SER C HA   12 
ATOM 9229  H HB2  . SER A 1 1  ? -14.577 3.332   7.843   1.00 0.00 ? 453 SER C HB2  12 
ATOM 9230  H HB3  . SER A 1 1  ? -14.085 2.491   6.377   1.00 0.00 ? 453 SER C HB3  12 
ATOM 9231  H HG   . SER A 1 1  ? -15.585 1.457   8.557   1.00 0.00 ? 453 SER C HG   12 
ATOM 9232  N N    . ASN A 1 2  ? -11.641 0.852   6.384   1.00 0.00 ? 454 ASN C N    12 
ATOM 9233  C CA   . ASN A 1 2  ? -11.094 -0.267  5.609   1.00 0.00 ? 454 ASN C CA   12 
ATOM 9234  C C    . ASN A 1 2  ? -10.245 -1.198  6.473   1.00 0.00 ? 454 ASN C C    12 
ATOM 9235  O O    . ASN A 1 2  ? -10.389 -2.422  6.409   1.00 0.00 ? 454 ASN C O    12 
ATOM 9236  C CB   . ASN A 1 2  ? -10.263 0.252   4.429   1.00 0.00 ? 454 ASN C CB   12 
ATOM 9237  C CG   . ASN A 1 2  ? -9.762  -0.867  3.530   1.00 0.00 ? 454 ASN C CG   12 
ATOM 9238  O OD1  . ASN A 1 2  ? -10.410 -1.901  3.388   1.00 0.00 ? 454 ASN C OD1  12 
ATOM 9239  N ND2  . ASN A 1 2  ? -8.612  -0.666  2.919   1.00 0.00 ? 454 ASN C ND2  12 
ATOM 9240  H H    . ASN A 1 2  ? -11.419 1.763   6.099   1.00 0.00 ? 454 ASN C H    12 
ATOM 9241  H HA   . ASN A 1 2  ? -11.927 -0.829  5.218   1.00 0.00 ? 454 ASN C HA   12 
ATOM 9242  H HB2  . ASN A 1 2  ? -10.869 0.919   3.835   1.00 0.00 ? 454 ASN C HB2  12 
ATOM 9243  H HB3  . ASN A 1 2  ? -9.408  0.794   4.809   1.00 0.00 ? 454 ASN C HB3  12 
ATOM 9244  H HD21 . ASN A 1 2  ? -8.142  0.180   3.072   1.00 0.00 ? 454 ASN C HD21 12 
ATOM 9245  H HD22 . ASN A 1 2  ? -8.269  -1.377  2.333   1.00 0.00 ? 454 ASN C HD22 12 
ATOM 9246  N N    . SER A 1 3  ? -9.377  -0.626  7.287   1.00 0.00 ? 455 SER C N    12 
ATOM 9247  C CA   . SER A 1 3  ? -8.520  -1.417  8.152   1.00 0.00 ? 455 SER C CA   12 
ATOM 9248  C C    . SER A 1 3  ? -9.350  -2.217  9.164   1.00 0.00 ? 455 SER C C    12 
ATOM 9249  O O    . SER A 1 3  ? -9.008  -3.353  9.506   1.00 0.00 ? 455 SER C O    12 
ATOM 9250  C CB   . SER A 1 3  ? -7.499  -0.519  8.853   1.00 0.00 ? 455 SER C CB   12 
ATOM 9251  O OG   . SER A 1 3  ? -8.110  0.666   9.334   1.00 0.00 ? 455 SER C OG   12 
ATOM 9252  H H    . SER A 1 3  ? -9.305  0.354   7.312   1.00 0.00 ? 455 SER C H    12 
ATOM 9253  H HA   . SER A 1 3  ? -7.991  -2.118  7.524   1.00 0.00 ? 455 SER C HA   12 
ATOM 9254  H HB2  . SER A 1 3  ? -7.067  -1.050  9.689   1.00 0.00 ? 455 SER C HB2  12 
ATOM 9255  H HB3  . SER A 1 3  ? -6.718  -0.251  8.156   1.00 0.00 ? 455 SER C HB3  12 
ATOM 9256  H HG   . SER A 1 3  ? -7.419  1.304   9.553   1.00 0.00 ? 455 SER C HG   12 
ATOM 9257  N N    . GLN A 1 4  ? -10.450 -1.629  9.621   1.00 0.00 ? 456 GLN C N    12 
ATOM 9258  C CA   . GLN A 1 4  ? -11.335 -2.303  10.550  1.00 0.00 ? 456 GLN C CA   12 
ATOM 9259  C C    . GLN A 1 4  ? -12.061 -3.446  9.851   1.00 0.00 ? 456 GLN C C    12 
ATOM 9260  O O    . GLN A 1 4  ? -12.233 -4.520  10.421  1.00 0.00 ? 456 GLN C O    12 
ATOM 9261  C CB   . GLN A 1 4  ? -12.341 -1.321  11.158  1.00 0.00 ? 456 GLN C CB   12 
ATOM 9262  C CG   . GLN A 1 4  ? -13.309 -1.965  12.139  1.00 0.00 ? 456 GLN C CG   12 
ATOM 9263  C CD   . GLN A 1 4  ? -14.241 -0.965  12.788  1.00 0.00 ? 456 GLN C CD   12 
ATOM 9264  O OE1  . GLN A 1 4  ? -14.577 0.068   12.201  1.00 0.00 ? 456 GLN C OE1  12 
ATOM 9265  N NE2  . GLN A 1 4  ? -14.667 -1.264  13.997  1.00 0.00 ? 456 GLN C NE2  12 
ATOM 9266  H H    . GLN A 1 4  ? -10.664 -0.718  9.328   1.00 0.00 ? 456 GLN C H    12 
ATOM 9267  H HA   . GLN A 1 4  ? -10.726 -2.717  11.342  1.00 0.00 ? 456 GLN C HA   12 
ATOM 9268  H HB2  . GLN A 1 4  ? -11.802 -0.544  11.678  1.00 0.00 ? 456 GLN C HB2  12 
ATOM 9269  H HB3  . GLN A 1 4  ? -12.916 -0.875  10.360  1.00 0.00 ? 456 GLN C HB3  12 
ATOM 9270  H HG2  . GLN A 1 4  ? -13.904 -2.693  11.611  1.00 0.00 ? 456 GLN C HG2  12 
ATOM 9271  H HG3  . GLN A 1 4  ? -12.740 -2.460  12.912  1.00 0.00 ? 456 GLN C HG3  12 
ATOM 9272  H HE21 . GLN A 1 4  ? -14.362 -2.103  14.403  1.00 0.00 ? 456 GLN C HE21 12 
ATOM 9273  H HE22 . GLN A 1 4  ? -15.274 -0.638  14.448  1.00 0.00 ? 456 GLN C HE22 12 
ATOM 9274  N N    . LEU A 1 5  ? -12.465 -3.211  8.601   1.00 0.00 ? 457 LEU C N    12 
ATOM 9275  C CA   . LEU A 1 5  ? -13.149 -4.231  7.802   1.00 0.00 ? 457 LEU C CA   12 
ATOM 9276  C C    . LEU A 1 5  ? -12.292 -5.481  7.705   1.00 0.00 ? 457 LEU C C    12 
ATOM 9277  O O    . LEU A 1 5  ? -12.784 -6.601  7.847   1.00 0.00 ? 457 LEU C O    12 
ATOM 9278  C CB   . LEU A 1 5  ? -13.437 -3.714  6.391   1.00 0.00 ? 457 LEU C CB   12 
ATOM 9279  C CG   . LEU A 1 5  ? -14.219 -2.407  6.293   1.00 0.00 ? 457 LEU C CG   12 
ATOM 9280  C CD1  . LEU A 1 5  ? -14.443 -2.046  4.854   1.00 0.00 ? 457 LEU C CD1  12 
ATOM 9281  C CD2  . LEU A 1 5  ? -15.541 -2.509  7.014   1.00 0.00 ? 457 LEU C CD2  12 
ATOM 9282  H H    . LEU A 1 5  ? -12.307 -2.324  8.207   1.00 0.00 ? 457 LEU C H    12 
ATOM 9283  H HA   . LEU A 1 5  ? -14.080 -4.472  8.288   1.00 0.00 ? 457 LEU C HA   12 
ATOM 9284  H HB2  . LEU A 1 5  ? -12.492 -3.576  5.888   1.00 0.00 ? 457 LEU C HB2  12 
ATOM 9285  H HB3  . LEU A 1 5  ? -13.992 -4.476  5.865   1.00 0.00 ? 457 LEU C HB3  12 
ATOM 9286  H HG   . LEU A 1 5  ? -13.644 -1.615  6.752   1.00 0.00 ? 457 LEU C HG   12 
ATOM 9287  H HD11 . LEU A 1 5  ? -15.020 -2.827  4.382   1.00 0.00 ? 457 LEU C HD11 12 
ATOM 9288  H HD12 . LEU A 1 5  ? -13.490 -1.946  4.353   1.00 0.00 ? 457 LEU C HD12 12 
ATOM 9289  H HD13 . LEU A 1 5  ? -14.985 -1.114  4.796   1.00 0.00 ? 457 LEU C HD13 12 
ATOM 9290  H HD21 . LEU A 1 5  ? -15.361 -2.704  8.057   1.00 0.00 ? 457 LEU C HD21 12 
ATOM 9291  H HD22 . LEU A 1 5  ? -16.119 -3.312  6.583   1.00 0.00 ? 457 LEU C HD22 12 
ATOM 9292  H HD23 . LEU A 1 5  ? -16.078 -1.579  6.903   1.00 0.00 ? 457 LEU C HD23 12 
ATOM 9293  N N    . ASN A 1 6  ? -11.003 -5.274  7.479   1.00 0.00 ? 458 ASN C N    12 
ATOM 9294  C CA   . ASN A 1 6  ? -10.048 -6.370  7.362   1.00 0.00 ? 458 ASN C CA   12 
ATOM 9295  C C    . ASN A 1 6  ? -9.935  -7.152  8.662   1.00 0.00 ? 458 ASN C C    12 
ATOM 9296  O O    . ASN A 1 6  ? -9.840  -8.379  8.654   1.00 0.00 ? 458 ASN C O    12 
ATOM 9297  C CB   . ASN A 1 6  ? -8.677  -5.850  6.920   1.00 0.00 ? 458 ASN C CB   12 
ATOM 9298  C CG   . ASN A 1 6  ? -8.609  -5.586  5.424   1.00 0.00 ? 458 ASN C CG   12 
ATOM 9299  O OD1  . ASN A 1 6  ? -8.258  -6.472  4.648   1.00 0.00 ? 458 ASN C OD1  12 
ATOM 9300  N ND2  . ASN A 1 6  ? -8.945  -4.380  5.008   1.00 0.00 ? 458 ASN C ND2  12 
ATOM 9301  H H    . ASN A 1 6  ? -10.685 -4.350  7.387   1.00 0.00 ? 458 ASN C H    12 
ATOM 9302  H HA   . ASN A 1 6  ? -10.422 -7.040  6.602   1.00 0.00 ? 458 ASN C HA   12 
ATOM 9303  H HB2  . ASN A 1 6  ? -8.466  -4.927  7.439   1.00 0.00 ? 458 ASN C HB2  12 
ATOM 9304  H HB3  . ASN A 1 6  ? -7.924  -6.581  7.173   1.00 0.00 ? 458 ASN C HB3  12 
ATOM 9305  H HD21 . ASN A 1 6  ? -9.223  -3.711  5.673   1.00 0.00 ? 458 ASN C HD21 12 
ATOM 9306  H HD22 . ASN A 1 6  ? -8.909  -4.197  4.045   1.00 0.00 ? 458 ASN C HD22 12 
ATOM 9307  N N    . ALA A 1 7  ? -9.962  -6.442  9.778   1.00 0.00 ? 459 ALA C N    12 
ATOM 9308  C CA   . ALA A 1 7  ? -9.898  -7.082  11.084  1.00 0.00 ? 459 ALA C CA   12 
ATOM 9309  C C    . ALA A 1 7  ? -11.179 -7.861  11.357  1.00 0.00 ? 459 ALA C C    12 
ATOM 9310  O O    . ALA A 1 7  ? -11.142 -8.973  11.895  1.00 0.00 ? 459 ALA C O    12 
ATOM 9311  C CB   . ALA A 1 7  ? -9.659  -6.045  12.172  1.00 0.00 ? 459 ALA C CB   12 
ATOM 9312  H H    . ALA A 1 7  ? -10.026 -5.465  9.722   1.00 0.00 ? 459 ALA C H    12 
ATOM 9313  H HA   . ALA A 1 7  ? -9.069  -7.777  11.081  1.00 0.00 ? 459 ALA C HA   12 
ATOM 9314  H HB1  . ALA A 1 7  ? -9.566  -6.541  13.126  1.00 0.00 ? 459 ALA C HB1  12 
ATOM 9315  H HB2  . ALA A 1 7  ? -10.491 -5.357  12.204  1.00 0.00 ? 459 ALA C HB2  12 
ATOM 9316  H HB3  . ALA A 1 7  ? -8.750  -5.502  11.958  1.00 0.00 ? 459 ALA C HB3  12 
ATOM 9317  N N    . MET A 1 8  ? -12.307 -7.277  10.966  1.00 0.00 ? 460 MET C N    12 
ATOM 9318  C CA   . MET A 1 8  ? -13.599 -7.912  11.148  1.00 0.00 ? 460 MET C CA   12 
ATOM 9319  C C    . MET A 1 8  ? -13.702 -9.185  10.317  1.00 0.00 ? 460 MET C C    12 
ATOM 9320  O O    . MET A 1 8  ? -14.103 -10.237 10.826  1.00 0.00 ? 460 MET C O    12 
ATOM 9321  C CB   . MET A 1 8  ? -14.729 -6.954  10.781  1.00 0.00 ? 460 MET C CB   12 
ATOM 9322  C CG   . MET A 1 8  ? -14.809 -5.721  11.669  1.00 0.00 ? 460 MET C CG   12 
ATOM 9323  S SD   . MET A 1 8  ? -16.431 -4.936  11.629  1.00 0.00 ? 460 MET C SD   12 
ATOM 9324  C CE   . MET A 1 8  ? -16.496 -4.397  9.932   1.00 0.00 ? 460 MET C CE   12 
ATOM 9325  H H    . MET A 1 8  ? -12.270 -6.386  10.550  1.00 0.00 ? 460 MET C H    12 
ATOM 9326  H HA   . MET A 1 8  ? -13.692 -8.174  12.192  1.00 0.00 ? 460 MET C HA   12 
ATOM 9327  H HB2  . MET A 1 8  ? -14.592 -6.634  9.759   1.00 0.00 ? 460 MET C HB2  12 
ATOM 9328  H HB3  . MET A 1 8  ? -15.664 -7.482  10.848  1.00 0.00 ? 460 MET C HB3  12 
ATOM 9329  H HG2  . MET A 1 8  ? -14.582 -5.999  12.686  1.00 0.00 ? 460 MET C HG2  12 
ATOM 9330  H HG3  . MET A 1 8  ? -14.079 -5.003  11.318  1.00 0.00 ? 460 MET C HG3  12 
ATOM 9331  H HE1  . MET A 1 8  ? -16.275 -5.228  9.276   1.00 0.00 ? 460 MET C HE1  12 
ATOM 9332  H HE2  . MET A 1 8  ? -15.773 -3.615  9.785   1.00 0.00 ? 460 MET C HE2  12 
ATOM 9333  H HE3  . MET A 1 8  ? -17.488 -4.023  9.715   1.00 0.00 ? 460 MET C HE3  12 
ATOM 9334  N N    . ALA A 1 9  ? -13.334 -9.083  9.043   1.00 0.00 ? 461 ALA C N    12 
ATOM 9335  C CA   . ALA A 1 9  ? -13.349 -10.226 8.139   1.00 0.00 ? 461 ALA C CA   12 
ATOM 9336  C C    . ALA A 1 9  ? -12.457 -11.335 8.672   1.00 0.00 ? 461 ALA C C    12 
ATOM 9337  O O    . ALA A 1 9  ? -12.830 -12.506 8.660   1.00 0.00 ? 461 ALA C O    12 
ATOM 9338  C CB   . ALA A 1 9  ? -12.898 -9.807  6.752   1.00 0.00 ? 461 ALA C CB   12 
ATOM 9339  H H    . ALA A 1 9  ? -13.054 -8.207  8.693   1.00 0.00 ? 461 ALA C H    12 
ATOM 9340  H HA   . ALA A 1 9  ? -14.363 -10.589 8.076   1.00 0.00 ? 461 ALA C HA   12 
ATOM 9341  H HB1  . ALA A 1 9  ? -12.936 -10.659 6.089   1.00 0.00 ? 461 ALA C HB1  12 
ATOM 9342  H HB2  . ALA A 1 9  ? -11.887 -9.431  6.799   1.00 0.00 ? 461 ALA C HB2  12 
ATOM 9343  H HB3  . ALA A 1 9  ? -13.553 -9.033  6.380   1.00 0.00 ? 461 ALA C HB3  12 
ATOM 9344  N N    . HIS A 1 10 ? -11.281 -10.946 9.156   1.00 0.00 ? 462 HIS C N    12 
ATOM 9345  C CA   . HIS A 1 10 ? -10.332 -11.885 9.736   1.00 0.00 ? 462 HIS C CA   12 
ATOM 9346  C C    . HIS A 1 10 ? -10.969 -12.645 10.893  1.00 0.00 ? 462 HIS C C    12 
ATOM 9347  O O    . HIS A 1 10 ? -10.827 -13.853 10.999  1.00 0.00 ? 462 HIS C O    12 
ATOM 9348  C CB   . HIS A 1 10 ? -9.069  -11.140 10.205  1.00 0.00 ? 462 HIS C CB   12 
ATOM 9349  C CG   . HIS A 1 10 ? -8.076  -11.988 10.952  1.00 0.00 ? 462 HIS C CG   12 
ATOM 9350  N ND1  . HIS A 1 10 ? -7.196  -12.847 10.337  1.00 0.00 ? 462 HIS C ND1  12 
ATOM 9351  C CD2  . HIS A 1 10 ? -7.834  -12.097 12.277  1.00 0.00 ? 462 HIS C CD2  12 
ATOM 9352  C CE1  . HIS A 1 10 ? -6.459  -13.449 11.248  1.00 0.00 ? 462 HIS C CE1  12 
ATOM 9353  N NE2  . HIS A 1 10 ? -6.827  -13.011 12.432  1.00 0.00 ? 462 HIS C NE2  12 
ATOM 9354  H H    . HIS A 1 10 ? -11.045 -9.992  9.115   1.00 0.00 ? 462 HIS C H    12 
ATOM 9355  H HA   . HIS A 1 10 ? -10.054 -12.592 8.971   1.00 0.00 ? 462 HIS C HA   12 
ATOM 9356  H HB2  . HIS A 1 10 ? -8.564  -10.735 9.340   1.00 0.00 ? 462 HIS C HB2  12 
ATOM 9357  H HB3  . HIS A 1 10 ? -9.365  -10.326 10.850  1.00 0.00 ? 462 HIS C HB3  12 
ATOM 9358  H HD1  . HIS A 1 10 ? -7.126  -13.007 9.369   1.00 0.00 ? 462 HIS C HD1  12 
ATOM 9359  H HD2  . HIS A 1 10 ? -8.339  -11.551 13.061  1.00 0.00 ? 462 HIS C HD2  12 
ATOM 9360  H HE1  . HIS A 1 10 ? -5.685  -14.175 11.055  1.00 0.00 ? 462 HIS C HE1  12 
ATOM 9361  H HE2  . HIS A 1 10 ? -6.347  -13.194 13.273  1.00 0.00 ? 462 HIS C HE2  12 
ATOM 9362  N N    . GLN A 1 11 ? -11.690 -11.923 11.738  1.00 0.00 ? 463 GLN C N    12 
ATOM 9363  C CA   . GLN A 1 11 ? -12.344 -12.514 12.899  1.00 0.00 ? 463 GLN C CA   12 
ATOM 9364  C C    . GLN A 1 11 ? -13.456 -13.474 12.481  1.00 0.00 ? 463 GLN C C    12 
ATOM 9365  O O    . GLN A 1 11 ? -13.643 -14.521 13.099  1.00 0.00 ? 463 GLN C O    12 
ATOM 9366  C CB   . GLN A 1 11 ? -12.895 -11.420 13.810  1.00 0.00 ? 463 GLN C CB   12 
ATOM 9367  C CG   . GLN A 1 11 ? -12.255 -11.380 15.188  1.00 0.00 ? 463 GLN C CG   12 
ATOM 9368  C CD   . GLN A 1 11 ? -10.744 -11.196 15.148  1.00 0.00 ? 463 GLN C CD   12 
ATOM 9369  O OE1  . GLN A 1 11 ? -10.031 -11.696 16.015  1.00 0.00 ? 463 GLN C OE1  12 
ATOM 9370  N NE2  . GLN A 1 11 ? -10.251 -10.459 14.164  1.00 0.00 ? 463 GLN C NE2  12 
ATOM 9371  H H    . GLN A 1 11 ? -11.793 -10.960 11.572  1.00 0.00 ? 463 GLN C H    12 
ATOM 9372  H HA   . GLN A 1 11 ? -11.600 -13.081 13.444  1.00 0.00 ? 463 GLN C HA   12 
ATOM 9373  H HB2  . GLN A 1 11 ? -12.742 -10.461 13.337  1.00 0.00 ? 463 GLN C HB2  12 
ATOM 9374  H HB3  . GLN A 1 11 ? -13.953 -11.584 13.935  1.00 0.00 ? 463 GLN C HB3  12 
ATOM 9375  H HG2  . GLN A 1 11 ? -12.682 -10.561 15.745  1.00 0.00 ? 463 GLN C HG2  12 
ATOM 9376  H HG3  . GLN A 1 11 ? -12.474 -12.308 15.695  1.00 0.00 ? 463 GLN C HG3  12 
ATOM 9377  H HE21 . GLN A 1 11 ? -10.874 -10.065 13.513  1.00 0.00 ? 463 GLN C HE21 12 
ATOM 9378  H HE22 . GLN A 1 11 ? -9.279  -10.338 14.121  1.00 0.00 ? 463 GLN C HE22 12 
ATOM 9379  N N    . ILE A 1 12 ? -14.192 -13.120 11.436  1.00 0.00 ? 464 ILE C N    12 
ATOM 9380  C CA   . ILE A 1 12 ? -15.237 -13.993 10.927  1.00 0.00 ? 464 ILE C CA   12 
ATOM 9381  C C    . ILE A 1 12 ? -14.624 -15.260 10.337  1.00 0.00 ? 464 ILE C C    12 
ATOM 9382  O O    . ILE A 1 12 ? -15.101 -16.362 10.586  1.00 0.00 ? 464 ILE C O    12 
ATOM 9383  C CB   . ILE A 1 12 ? -16.107 -13.300 9.851   1.00 0.00 ? 464 ILE C CB   12 
ATOM 9384  C CG1  . ILE A 1 12 ? -16.837 -12.087 10.439  1.00 0.00 ? 464 ILE C CG1  12 
ATOM 9385  C CG2  . ILE A 1 12 ? -17.112 -14.287 9.258   1.00 0.00 ? 464 ILE C CG2  12 
ATOM 9386  C CD1  . ILE A 1 12 ? -17.634 -11.320 9.407   1.00 0.00 ? 464 ILE C CD1  12 
ATOM 9387  H H    . ILE A 1 12 ? -14.035 -12.252 11.003  1.00 0.00 ? 464 ILE C H    12 
ATOM 9388  H HA   . ILE A 1 12 ? -15.870 -14.271 11.758  1.00 0.00 ? 464 ILE C HA   12 
ATOM 9389  H HB   . ILE A 1 12 ? -15.455 -12.968 9.056   1.00 0.00 ? 464 ILE C HB   12 
ATOM 9390  H HG12 . ILE A 1 12 ? -17.522 -12.425 11.200  1.00 0.00 ? 464 ILE C HG12 12 
ATOM 9391  H HG13 . ILE A 1 12 ? -16.129 -11.408 10.888  1.00 0.00 ? 464 ILE C HG13 12 
ATOM 9392  H HG21 . ILE A 1 12 ? -16.587 -15.117 8.808   1.00 0.00 ? 464 ILE C HG21 12 
ATOM 9393  H HG22 . ILE A 1 12 ? -17.706 -13.787 8.510   1.00 0.00 ? 464 ILE C HG22 12 
ATOM 9394  H HG23 . ILE A 1 12 ? -17.759 -14.654 10.043  1.00 0.00 ? 464 ILE C HG23 12 
ATOM 9395  H HD11 . ILE A 1 12 ? -18.400 -11.959 8.996   1.00 0.00 ? 464 ILE C HD11 12 
ATOM 9396  H HD12 . ILE A 1 12 ? -16.975 -10.998 8.614   1.00 0.00 ? 464 ILE C HD12 12 
ATOM 9397  H HD13 . ILE A 1 12 ? -18.090 -10.458 9.864   1.00 0.00 ? 464 ILE C HD13 12 
ATOM 9398  N N    . GLN A 1 13 ? -13.542 -15.089 9.578   1.00 0.00 ? 465 GLN C N    12 
ATOM 9399  C CA   . GLN A 1 13 ? -12.844 -16.212 8.947   1.00 0.00 ? 465 GLN C CA   12 
ATOM 9400  C C    . GLN A 1 13 ? -12.277 -17.161 10.004  1.00 0.00 ? 465 GLN C C    12 
ATOM 9401  O O    . GLN A 1 13 ? -12.073 -18.346 9.750   1.00 0.00 ? 465 GLN C O    12 
ATOM 9402  C CB   . GLN A 1 13 ? -11.717 -15.702 8.059   1.00 0.00 ? 465 GLN C CB   12 
ATOM 9403  C CG   . GLN A 1 13 ? -11.139 -16.758 7.130   1.00 0.00 ? 465 GLN C CG   12 
ATOM 9404  C CD   . GLN A 1 13 ? -9.926  -16.263 6.379   1.00 0.00 ? 465 GLN C CD   12 
ATOM 9405  O OE1  . GLN A 1 13 ? -9.792  -15.074 6.109   1.00 0.00 ? 465 GLN C OE1  12 
ATOM 9406  N NE2  . GLN A 1 13 ? -9.032  -17.166 6.042   1.00 0.00 ? 465 GLN C NE2  12 
ATOM 9407  H H    . GLN A 1 13 ? -13.206 -14.177 9.426   1.00 0.00 ? 465 GLN C H    12 
ATOM 9408  H HA   . GLN A 1 13 ? -13.558 -16.750 8.339   1.00 0.00 ? 465 GLN C HA   12 
ATOM 9409  H HB2  . GLN A 1 13 ? -12.090 -14.884 7.457   1.00 0.00 ? 465 GLN C HB2  12 
ATOM 9410  H HB3  . GLN A 1 13 ? -10.923 -15.338 8.697   1.00 0.00 ? 465 GLN C HB3  12 
ATOM 9411  H HG2  . GLN A 1 13 ? -10.854 -17.618 7.717   1.00 0.00 ? 465 GLN C HG2  12 
ATOM 9412  H HG3  . GLN A 1 13 ? -11.897 -17.045 6.416   1.00 0.00 ? 465 GLN C HG3  12 
ATOM 9413  H HE21 . GLN A 1 13 ? -9.193  -18.101 6.293   1.00 0.00 ? 465 GLN C HE21 12 
ATOM 9414  H HE22 . GLN A 1 13 ? -8.238  -16.866 5.552   1.00 0.00 ? 465 GLN C HE22 12 
ATOM 9415  N N    . GLU A 1 14 ? -12.009 -16.622 11.186  1.00 0.00 ? 466 GLU C N    12 
ATOM 9416  C CA   . GLU A 1 14 ? -11.530 -17.412 12.306  1.00 0.00 ? 466 GLU C CA   12 
ATOM 9417  C C    . GLU A 1 14 ? -12.585 -18.434 12.714  1.00 0.00 ? 466 GLU C C    12 
ATOM 9418  O O    . GLU A 1 14 ? -12.266 -19.523 13.191  1.00 0.00 ? 466 GLU C O    12 
ATOM 9419  C CB   . GLU A 1 14 ? -11.201 -16.492 13.484  1.00 0.00 ? 466 GLU C CB   12 
ATOM 9420  C CG   . GLU A 1 14 ? -9.990  -15.607 13.255  1.00 0.00 ? 466 GLU C CG   12 
ATOM 9421  C CD   . GLU A 1 14 ? -8.691  -16.377 13.284  1.00 0.00 ? 466 GLU C CD   12 
ATOM 9422  O OE1  . GLU A 1 14 ? -8.318  -16.965 12.255  1.00 0.00 ? 466 GLU C OE1  12 
ATOM 9423  O OE2  . GLU A 1 14 ? -8.036  -16.397 14.346  1.00 0.00 ? 466 GLU C OE2  12 
ATOM 9424  H H    . GLU A 1 14 ? -12.131 -15.656 11.305  1.00 0.00 ? 466 GLU C H    12 
ATOM 9425  H HA   . GLU A 1 14 ? -10.632 -17.928 11.999  1.00 0.00 ? 466 GLU C HA   12 
ATOM 9426  H HB2  . GLU A 1 14 ? -12.052 -15.851 13.664  1.00 0.00 ? 466 GLU C HB2  12 
ATOM 9427  H HB3  . GLU A 1 14 ? -11.025 -17.087 14.362  1.00 0.00 ? 466 GLU C HB3  12 
ATOM 9428  H HG2  . GLU A 1 14 ? -10.085 -15.140 12.283  1.00 0.00 ? 466 GLU C HG2  12 
ATOM 9429  H HG3  . GLU A 1 14 ? -9.960  -14.845 14.021  1.00 0.00 ? 466 GLU C HG3  12 
ATOM 9430  N N    . MET A 1 15 ? -13.842 -18.074 12.502  1.00 0.00 ? 467 MET C N    12 
ATOM 9431  C CA   . MET A 1 15 ? -14.956 -18.938 12.830  1.00 0.00 ? 467 MET C CA   12 
ATOM 9432  C C    . MET A 1 15 ? -15.416 -19.706 11.594  1.00 0.00 ? 467 MET C C    12 
ATOM 9433  O O    . MET A 1 15 ? -15.778 -20.878 11.676  1.00 0.00 ? 467 MET C O    12 
ATOM 9434  C CB   . MET A 1 15 ? -16.118 -18.107 13.379  1.00 0.00 ? 467 MET C CB   12 
ATOM 9435  C CG   . MET A 1 15 ? -15.764 -17.271 14.595  1.00 0.00 ? 467 MET C CG   12 
ATOM 9436  S SD   . MET A 1 15 ? -17.171 -16.339 15.240  1.00 0.00 ? 467 MET C SD   12 
ATOM 9437  C CE   . MET A 1 15 ? -17.565 -15.285 13.843  1.00 0.00 ? 467 MET C CE   12 
ATOM 9438  H H    . MET A 1 15 ? -14.025 -17.197 12.106  1.00 0.00 ? 467 MET C H    12 
ATOM 9439  H HA   . MET A 1 15 ? -14.635 -19.638 13.586  1.00 0.00 ? 467 MET C HA   12 
ATOM 9440  H HB2  . MET A 1 15 ? -16.460 -17.442 12.602  1.00 0.00 ? 467 MET C HB2  12 
ATOM 9441  H HB3  . MET A 1 15 ? -16.921 -18.774 13.646  1.00 0.00 ? 467 MET C HB3  12 
ATOM 9442  H HG2  . MET A 1 15 ? -15.399 -17.928 15.370  1.00 0.00 ? 467 MET C HG2  12 
ATOM 9443  H HG3  . MET A 1 15 ? -14.986 -16.576 14.318  1.00 0.00 ? 467 MET C HG3  12 
ATOM 9444  H HE1  . MET A 1 15 ? -17.810 -15.895 12.986  1.00 0.00 ? 467 MET C HE1  12 
ATOM 9445  H HE2  . MET A 1 15 ? -16.713 -14.664 13.611  1.00 0.00 ? 467 MET C HE2  12 
ATOM 9446  H HE3  . MET A 1 15 ? -18.409 -14.658 14.091  1.00 0.00 ? 467 MET C HE3  12 
ATOM 9447  N N    . PHE A 1 16 ? -15.403 -19.030 10.455  1.00 0.00 ? 468 PHE C N    12 
ATOM 9448  C CA   . PHE A 1 16 ? -15.836 -19.619 9.198   1.00 0.00 ? 468 PHE C CA   12 
ATOM 9449  C C    . PHE A 1 16 ? -14.745 -19.502 8.133   1.00 0.00 ? 468 PHE C C    12 
ATOM 9450  O O    . PHE A 1 16 ? -14.736 -18.557 7.350   1.00 0.00 ? 468 PHE C O    12 
ATOM 9451  C CB   . PHE A 1 16 ? -17.117 -18.934 8.705   1.00 0.00 ? 468 PHE C CB   12 
ATOM 9452  C CG   . PHE A 1 16 ? -18.321 -19.187 9.569   1.00 0.00 ? 468 PHE C CG   12 
ATOM 9453  C CD1  . PHE A 1 16 ? -18.584 -18.386 10.668  1.00 0.00 ? 468 PHE C CD1  12 
ATOM 9454  C CD2  . PHE A 1 16 ? -19.187 -20.225 9.280   1.00 0.00 ? 468 PHE C CD2  12 
ATOM 9455  C CE1  . PHE A 1 16 ? -19.688 -18.618 11.460  1.00 0.00 ? 468 PHE C CE1  12 
ATOM 9456  C CE2  . PHE A 1 16 ? -20.293 -20.462 10.068  1.00 0.00 ? 468 PHE C CE2  12 
ATOM 9457  C CZ   . PHE A 1 16 ? -20.546 -19.657 11.160  1.00 0.00 ? 468 PHE C CZ   12 
ATOM 9458  H H    . PHE A 1 16 ? -15.092 -18.099 10.453  1.00 0.00 ? 468 PHE C H    12 
ATOM 9459  H HA   . PHE A 1 16 ? -16.047 -20.663 9.375   1.00 0.00 ? 468 PHE C HA   12 
ATOM 9460  H HB2  . PHE A 1 16 ? -16.953 -17.867 8.680   1.00 0.00 ? 468 PHE C HB2  12 
ATOM 9461  H HB3  . PHE A 1 16 ? -17.340 -19.275 7.706   1.00 0.00 ? 468 PHE C HB3  12 
ATOM 9462  H HD1  . PHE A 1 16 ? -17.913 -17.573 10.904  1.00 0.00 ? 468 PHE C HD1  12 
ATOM 9463  H HD2  . PHE A 1 16 ? -18.990 -20.855 8.426   1.00 0.00 ? 468 PHE C HD2  12 
ATOM 9464  H HE1  . PHE A 1 16 ? -19.882 -17.985 12.314  1.00 0.00 ? 468 PHE C HE1  12 
ATOM 9465  H HE2  . PHE A 1 16 ? -20.962 -21.275 9.830   1.00 0.00 ? 468 PHE C HE2  12 
ATOM 9466  H HZ   . PHE A 1 16 ? -21.412 -19.840 11.781  1.00 0.00 ? 468 PHE C HZ   12 
ATOM 9467  N N    . PRO A 1 17 ? -13.796 -20.449 8.109   1.00 0.00 ? 469 PRO C N    12 
ATOM 9468  C CA   . PRO A 1 17 ? -12.700 -20.451 7.132   1.00 0.00 ? 469 PRO C CA   12 
ATOM 9469  C C    . PRO A 1 17 ? -13.158 -20.855 5.727   1.00 0.00 ? 469 PRO C C    12 
ATOM 9470  O O    . PRO A 1 17 ? -12.413 -20.714 4.757   1.00 0.00 ? 469 PRO C O    12 
ATOM 9471  C CB   . PRO A 1 17 ? -11.740 -21.498 7.692   1.00 0.00 ? 469 PRO C CB   12 
ATOM 9472  C CG   . PRO A 1 17 ? -12.616 -22.425 8.447   1.00 0.00 ? 469 PRO C CG   12 
ATOM 9473  C CD   . PRO A 1 17 ? -13.680 -21.569 9.058   1.00 0.00 ? 469 PRO C CD   12 
ATOM 9474  H HA   . PRO A 1 17 ? -12.208 -19.495 7.101   1.00 0.00 ? 469 PRO C HA   12 
ATOM 9475  H HB2  . PRO A 1 17 ? -11.235 -21.998 6.880   1.00 0.00 ? 469 PRO C HB2  12 
ATOM 9476  H HB3  . PRO A 1 17 ? -11.018 -21.022 8.339   1.00 0.00 ? 469 PRO C HB3  12 
ATOM 9477  H HG2  . PRO A 1 17 ? -13.054 -23.144 7.772   1.00 0.00 ? 469 PRO C HG2  12 
ATOM 9478  H HG3  . PRO A 1 17 ? -12.049 -22.924 9.218   1.00 0.00 ? 469 PRO C HG3  12 
ATOM 9479  H HD2  . PRO A 1 17 ? -14.609 -22.112 9.141   1.00 0.00 ? 469 PRO C HD2  12 
ATOM 9480  H HD3  . PRO A 1 17 ? -13.361 -21.210 10.024  1.00 0.00 ? 469 PRO C HD3  12 
ATOM 9481  N N    . GLN A 1 18 ? -14.383 -21.361 5.629   1.00 0.00 ? 470 GLN C N    12 
ATOM 9482  C CA   . GLN A 1 18 ? -14.938 -21.808 4.353   1.00 0.00 ? 470 GLN C CA   12 
ATOM 9483  C C    . GLN A 1 18 ? -15.120 -20.641 3.379   1.00 0.00 ? 470 GLN C C    12 
ATOM 9484  O O    . GLN A 1 18 ? -14.938 -20.793 2.166   1.00 0.00 ? 470 GLN C O    12 
ATOM 9485  C CB   . GLN A 1 18 ? -16.283 -22.510 4.570   1.00 0.00 ? 470 GLN C CB   12 
ATOM 9486  C CG   . GLN A 1 18 ? -17.369 -21.588 5.109   1.00 0.00 ? 470 GLN C CG   12 
ATOM 9487  C CD   . GLN A 1 18 ? -18.723 -22.255 5.209   1.00 0.00 ? 470 GLN C CD   12 
ATOM 9488  O OE1  . GLN A 1 18 ? -19.047 -23.155 4.435   1.00 0.00 ? 470 GLN C OE1  12 
ATOM 9489  N NE2  . GLN A 1 18 ? -19.521 -21.814 6.159   1.00 0.00 ? 470 GLN C NE2  12 
ATOM 9490  H H    . GLN A 1 18 ? -14.923 -21.447 6.445   1.00 0.00 ? 470 GLN C H    12 
ATOM 9491  H HA   . GLN A 1 18 ? -14.246 -22.514 3.920   1.00 0.00 ? 470 GLN C HA   12 
ATOM 9492  H HB2  . GLN A 1 18 ? -16.620 -22.916 3.628   1.00 0.00 ? 470 GLN C HB2  12 
ATOM 9493  H HB3  . GLN A 1 18 ? -16.146 -23.318 5.271   1.00 0.00 ? 470 GLN C HB3  12 
ATOM 9494  H HG2  . GLN A 1 18 ? -17.081 -21.245 6.090   1.00 0.00 ? 470 GLN C HG2  12 
ATOM 9495  H HG3  . GLN A 1 18 ? -17.452 -20.739 4.447   1.00 0.00 ? 470 GLN C HG3  12 
ATOM 9496  H HE21 . GLN A 1 18 ? -19.198 -21.092 6.736   1.00 0.00 ? 470 GLN C HE21 12 
ATOM 9497  H HE22 . GLN A 1 18 ? -20.408 -22.220 6.248   1.00 0.00 ? 470 GLN C HE22 12 
ATOM 9498  N N    . VAL A 1 19 ? -15.465 -19.482 3.911   1.00 0.00 ? 471 VAL C N    12 
ATOM 9499  C CA   . VAL A 1 19 ? -15.728 -18.321 3.092   1.00 0.00 ? 471 VAL C CA   12 
ATOM 9500  C C    . VAL A 1 19 ? -14.443 -17.528 2.826   1.00 0.00 ? 471 VAL C C    12 
ATOM 9501  O O    . VAL A 1 19 ? -13.724 -17.154 3.756   1.00 0.00 ? 471 VAL C O    12 
ATOM 9502  C CB   . VAL A 1 19 ? -16.823 -17.411 3.723   1.00 0.00 ? 471 VAL C CB   12 
ATOM 9503  C CG1  . VAL A 1 19 ? -16.456 -16.994 5.136   1.00 0.00 ? 471 VAL C CG1  12 
ATOM 9504  C CG2  . VAL A 1 19 ? -17.093 -16.193 2.849   1.00 0.00 ? 471 VAL C CG2  12 
ATOM 9505  H H    . VAL A 1 19 ? -15.525 -19.402 4.886   1.00 0.00 ? 471 VAL C H    12 
ATOM 9506  H HA   . VAL A 1 19 ? -16.101 -18.684 2.145   1.00 0.00 ? 471 VAL C HA   12 
ATOM 9507  H HB   . VAL A 1 19 ? -17.736 -17.989 3.781   1.00 0.00 ? 471 VAL C HB   12 
ATOM 9508  H HG11 . VAL A 1 19 ? -15.497 -16.497 5.129   1.00 0.00 ? 471 VAL C HG11 12 
ATOM 9509  H HG12 . VAL A 1 19 ? -16.403 -17.871 5.767   1.00 0.00 ? 471 VAL C HG12 12 
ATOM 9510  H HG13 . VAL A 1 19 ? -17.207 -16.320 5.520   1.00 0.00 ? 471 VAL C HG13 12 
ATOM 9511  H HG21 . VAL A 1 19 ? -17.845 -15.575 3.317   1.00 0.00 ? 471 VAL C HG21 12 
ATOM 9512  H HG22 . VAL A 1 19 ? -17.445 -16.516 1.880   1.00 0.00 ? 471 VAL C HG22 12 
ATOM 9513  H HG23 . VAL A 1 19 ? -16.182 -15.625 2.730   1.00 0.00 ? 471 VAL C HG23 12 
ATOM 9514  N N    . PRO A 1 20 ? -14.119 -17.314 1.534   1.00 0.00 ? 472 PRO C N    12 
ATOM 9515  C CA   . PRO A 1 20 ? -12.932 -16.557 1.117   1.00 0.00 ? 472 PRO C CA   12 
ATOM 9516  C C    . PRO A 1 20 ? -12.852 -15.181 1.761   1.00 0.00 ? 472 PRO C C    12 
ATOM 9517  O O    . PRO A 1 20 ? -13.839 -14.444 1.809   1.00 0.00 ? 472 PRO C O    12 
ATOM 9518  C CB   . PRO A 1 20 ? -13.110 -16.426 -0.393  1.00 0.00 ? 472 PRO C CB   12 
ATOM 9519  C CG   . PRO A 1 20 ? -13.918 -17.611 -0.764  1.00 0.00 ? 472 PRO C CG   12 
ATOM 9520  C CD   . PRO A 1 20 ? -14.869 -17.825 0.376   1.00 0.00 ? 472 PRO C CD   12 
ATOM 9521  H HA   . PRO A 1 20 ? -12.026 -17.100 1.330   1.00 0.00 ? 472 PRO C HA   12 
ATOM 9522  H HB2  . PRO A 1 20 ? -13.625 -15.504 -0.620  1.00 0.00 ? 472 PRO C HB2  12 
ATOM 9523  H HB3  . PRO A 1 20 ? -12.145 -16.439 -0.879  1.00 0.00 ? 472 PRO C HB3  12 
ATOM 9524  H HG2  . PRO A 1 20 ? -14.456 -17.420 -1.679  1.00 0.00 ? 472 PRO C HG2  12 
ATOM 9525  H HG3  . PRO A 1 20 ? -13.273 -18.470 -0.877  1.00 0.00 ? 472 PRO C HG3  12 
ATOM 9526  H HD2  . PRO A 1 20 ? -15.779 -17.263 0.225   1.00 0.00 ? 472 PRO C HD2  12 
ATOM 9527  H HD3  . PRO A 1 20 ? -15.084 -18.877 0.489   1.00 0.00 ? 472 PRO C HD3  12 
ATOM 9528  N N    . TYR A 1 21 ? -11.657 -14.842 2.214   1.00 0.00 ? 473 TYR C N    12 
ATOM 9529  C CA   . TYR A 1 21 ? -11.374 -13.588 2.910   1.00 0.00 ? 473 TYR C CA   12 
ATOM 9530  C C    . TYR A 1 21 ? -11.923 -12.366 2.157   1.00 0.00 ? 473 TYR C C    12 
ATOM 9531  O O    . TYR A 1 21 ? -12.561 -11.499 2.756   1.00 0.00 ? 473 TYR C O    12 
ATOM 9532  C CB   . TYR A 1 21 ? -9.858  -13.464 3.111   1.00 0.00 ? 473 TYR C CB   12 
ATOM 9533  C CG   . TYR A 1 21 ? -9.407  -12.231 3.862   1.00 0.00 ? 473 TYR C CG   12 
ATOM 9534  C CD1  . TYR A 1 21 ? -9.673  -12.076 5.216   1.00 0.00 ? 473 TYR C CD1  12 
ATOM 9535  C CD2  . TYR A 1 21 ? -8.686  -11.237 3.218   1.00 0.00 ? 473 TYR C CD2  12 
ATOM 9536  C CE1  . TYR A 1 21 ? -9.234  -10.961 5.904   1.00 0.00 ? 473 TYR C CE1  12 
ATOM 9537  C CE2  . TYR A 1 21 ? -8.248  -10.121 3.897   1.00 0.00 ? 473 TYR C CE2  12 
ATOM 9538  C CZ   . TYR A 1 21 ? -8.523  -9.986  5.237   1.00 0.00 ? 473 TYR C CZ   12 
ATOM 9539  O OH   . TYR A 1 21 ? -8.075  -8.876  5.917   1.00 0.00 ? 473 TYR C OH   12 
ATOM 9540  H H    . TYR A 1 21 ? -10.917 -15.469 2.069   1.00 0.00 ? 473 TYR C H    12 
ATOM 9541  H HA   . TYR A 1 21 ? -11.843 -13.637 3.880   1.00 0.00 ? 473 TYR C HA   12 
ATOM 9542  H HB2  . TYR A 1 21 ? -9.511  -14.324 3.664   1.00 0.00 ? 473 TYR C HB2  12 
ATOM 9543  H HB3  . TYR A 1 21 ? -9.380  -13.457 2.142   1.00 0.00 ? 473 TYR C HB3  12 
ATOM 9544  H HD1  . TYR A 1 21 ? -10.232 -12.840 5.735   1.00 0.00 ? 473 TYR C HD1  12 
ATOM 9545  H HD2  . TYR A 1 21 ? -8.472  -11.344 2.165   1.00 0.00 ? 473 TYR C HD2  12 
ATOM 9546  H HE1  . TYR A 1 21 ? -9.451  -10.856 6.958   1.00 0.00 ? 473 TYR C HE1  12 
ATOM 9547  H HE2  . TYR A 1 21 ? -7.692  -9.359  3.374   1.00 0.00 ? 473 TYR C HE2  12 
ATOM 9548  H HH   . TYR A 1 21 ? -8.227  -8.088  5.371   1.00 0.00 ? 473 TYR C HH   12 
ATOM 9549  N N    . HIS A 1 22 ? -11.698 -12.311 0.848   1.00 0.00 ? 474 HIS C N    12 
ATOM 9550  C CA   . HIS A 1 22 ? -12.158 -11.164 0.056   1.00 0.00 ? 474 HIS C CA   12 
ATOM 9551  C C    . HIS A 1 22 ? -13.681 -11.134 -0.074  1.00 0.00 ? 474 HIS C C    12 
ATOM 9552  O O    . HIS A 1 22 ? -14.273 -10.071 -0.174  1.00 0.00 ? 474 HIS C O    12 
ATOM 9553  C CB   . HIS A 1 22 ? -11.488 -11.108 -1.331  1.00 0.00 ? 474 HIS C CB   12 
ATOM 9554  C CG   . HIS A 1 22 ? -11.919 -12.173 -2.309  1.00 0.00 ? 474 HIS C CG   12 
ATOM 9555  N ND1  . HIS A 1 22 ? -11.283 -13.388 -2.436  1.00 0.00 ? 474 HIS C ND1  12 
ATOM 9556  C CD2  . HIS A 1 22 ? -12.927 -12.188 -3.216  1.00 0.00 ? 474 HIS C CD2  12 
ATOM 9557  C CE1  . HIS A 1 22 ? -11.878 -14.100 -3.375  1.00 0.00 ? 474 HIS C CE1  12 
ATOM 9558  N NE2  . HIS A 1 22 ? -12.876 -13.398 -3.860  1.00 0.00 ? 474 HIS C NE2  12 
ATOM 9559  H H    . HIS A 1 22 ? -11.212 -13.045 0.415   1.00 0.00 ? 474 HIS C H    12 
ATOM 9560  H HA   . HIS A 1 22 ? -11.876 -10.275 0.606   1.00 0.00 ? 474 HIS C HA   12 
ATOM 9561  H HB2  . HIS A 1 22 ? -11.731 -10.158 -1.774  1.00 0.00 ? 474 HIS C HB2  12 
ATOM 9562  H HB3  . HIS A 1 22 ? -10.418 -11.175 -1.208  1.00 0.00 ? 474 HIS C HB3  12 
ATOM 9563  H HD1  . HIS A 1 22 ? -10.497 -13.688 -1.924  1.00 0.00 ? 474 HIS C HD1  12 
ATOM 9564  H HD2  . HIS A 1 22 ? -13.639 -11.395 -3.396  1.00 0.00 ? 474 HIS C HD2  12 
ATOM 9565  H HE1  . HIS A 1 22 ? -11.598 -15.095 -3.687  1.00 0.00 ? 474 HIS C HE1  12 
ATOM 9566  H HE2  . HIS A 1 22 ? -13.476 -13.694 -4.583  1.00 0.00 ? 474 HIS C HE2  12 
ATOM 9567  N N    . LEU A 1 23 ? -14.316 -12.302 -0.057  1.00 0.00 ? 475 LEU C N    12 
ATOM 9568  C CA   . LEU A 1 23 ? -15.765 -12.354 -0.155  1.00 0.00 ? 475 LEU C CA   12 
ATOM 9569  C C    . LEU A 1 23 ? -16.386 -11.871 1.136   1.00 0.00 ? 475 LEU C C    12 
ATOM 9570  O O    . LEU A 1 23 ? -17.509 -11.372 1.151   1.00 0.00 ? 475 LEU C O    12 
ATOM 9571  C CB   . LEU A 1 23 ? -16.255 -13.761 -0.508  1.00 0.00 ? 475 LEU C CB   12 
ATOM 9572  C CG   . LEU A 1 23 ? -15.992 -14.219 -1.950  1.00 0.00 ? 475 LEU C CG   12 
ATOM 9573  C CD1  . LEU A 1 23 ? -16.604 -15.586 -2.196  1.00 0.00 ? 475 LEU C CD1  12 
ATOM 9574  C CD2  . LEU A 1 23 ? -16.544 -13.207 -2.946  1.00 0.00 ? 475 LEU C CD2  12 
ATOM 9575  H H    . LEU A 1 23 ? -13.811 -13.135 0.050   1.00 0.00 ? 475 LEU C H    12 
ATOM 9576  H HA   . LEU A 1 23 ? -16.057 -11.674 -0.940  1.00 0.00 ? 475 LEU C HA   12 
ATOM 9577  H HB2  . LEU A 1 23 ? -15.775 -14.461 0.162   1.00 0.00 ? 475 LEU C HB2  12 
ATOM 9578  H HB3  . LEU A 1 23 ? -17.318 -13.799 -0.332  1.00 0.00 ? 475 LEU C HB3  12 
ATOM 9579  H HG   . LEU A 1 23 ? -14.926 -14.299 -2.106  1.00 0.00 ? 475 LEU C HG   12 
ATOM 9580  H HD11 . LEU A 1 23 ? -17.673 -15.533 -2.057  1.00 0.00 ? 475 LEU C HD11 12 
ATOM 9581  H HD12 . LEU A 1 23 ? -16.188 -16.298 -1.498  1.00 0.00 ? 475 LEU C HD12 12 
ATOM 9582  H HD13 . LEU A 1 23 ? -16.387 -15.901 -3.205  1.00 0.00 ? 475 LEU C HD13 12 
ATOM 9583  H HD21 . LEU A 1 23 ? -16.013 -12.273 -2.845  1.00 0.00 ? 475 LEU C HD21 12 
ATOM 9584  H HD22 . LEU A 1 23 ? -17.595 -13.047 -2.751  1.00 0.00 ? 475 LEU C HD22 12 
ATOM 9585  H HD23 . LEU A 1 23 ? -16.419 -13.587 -3.949  1.00 0.00 ? 475 LEU C HD23 12 
ATOM 9586  N N    . VAL A 1 24 ? -15.633 -12.004 2.218   1.00 0.00 ? 476 VAL C N    12 
ATOM 9587  C CA   . VAL A 1 24 ? -16.074 -11.511 3.508   1.00 0.00 ? 476 VAL C CA   12 
ATOM 9588  C C    . VAL A 1 24 ? -15.939 -9.994  3.515   1.00 0.00 ? 476 VAL C C    12 
ATOM 9589  O O    . VAL A 1 24 ? -16.863 -9.278  3.890   1.00 0.00 ? 476 VAL C O    12 
ATOM 9590  C CB   . VAL A 1 24 ? -15.244 -12.114 4.672   1.00 0.00 ? 476 VAL C CB   12 
ATOM 9591  C CG1  . VAL A 1 24 ? -15.848 -11.738 6.012   1.00 0.00 ? 476 VAL C CG1  12 
ATOM 9592  C CG2  . VAL A 1 24 ? -15.141 -13.621 4.543   1.00 0.00 ? 476 VAL C CG2  12 
ATOM 9593  H H    . VAL A 1 24 ? -14.757 -12.439 2.136   1.00 0.00 ? 476 VAL C H    12 
ATOM 9594  H HA   . VAL A 1 24 ? -17.113 -11.777 3.636   1.00 0.00 ? 476 VAL C HA   12 
ATOM 9595  H HB   . VAL A 1 24 ? -14.247 -11.700 4.623   1.00 0.00 ? 476 VAL C HB   12 
ATOM 9596  H HG11 . VAL A 1 24 ? -16.872 -12.073 6.053   1.00 0.00 ? 476 VAL C HG11 12 
ATOM 9597  H HG12 . VAL A 1 24 ? -15.810 -10.668 6.137   1.00 0.00 ? 476 VAL C HG12 12 
ATOM 9598  H HG13 . VAL A 1 24 ? -15.284 -12.213 6.804   1.00 0.00 ? 476 VAL C HG13 12 
ATOM 9599  H HG21 . VAL A 1 24 ? -14.657 -13.872 3.611   1.00 0.00 ? 476 VAL C HG21 12 
ATOM 9600  H HG22 . VAL A 1 24 ? -16.133 -14.052 4.560   1.00 0.00 ? 476 VAL C HG22 12 
ATOM 9601  H HG23 . VAL A 1 24 ? -14.565 -14.014 5.366   1.00 0.00 ? 476 VAL C HG23 12 
ATOM 9602  N N    . LEU A 1 25 ? -14.776 -9.517  3.056   1.00 0.00 ? 477 LEU C N    12 
ATOM 9603  C CA   . LEU A 1 25 ? -14.504 -8.084  2.923   1.00 0.00 ? 477 LEU C CA   12 
ATOM 9604  C C    . LEU A 1 25 ? -15.595 -7.414  2.104   1.00 0.00 ? 477 LEU C C    12 
ATOM 9605  O O    . LEU A 1 25 ? -16.050 -6.320  2.432   1.00 0.00 ? 477 LEU C O    12 
ATOM 9606  C CB   . LEU A 1 25 ? -13.151 -7.878  2.234   1.00 0.00 ? 477 LEU C CB   12 
ATOM 9607  C CG   . LEU A 1 25 ? -11.912 -8.259  3.040   1.00 0.00 ? 477 LEU C CG   12 
ATOM 9608  C CD1  . LEU A 1 25 ? -10.661 -8.093  2.196   1.00 0.00 ? 477 LEU C CD1  12 
ATOM 9609  C CD2  . LEU A 1 25 ? -11.811 -7.413  4.296   1.00 0.00 ? 477 LEU C CD2  12 
ATOM 9610  H H    . LEU A 1 25 ? -14.072 -10.153 2.803   1.00 0.00 ? 477 LEU C H    12 
ATOM 9611  H HA   . LEU A 1 25 ? -14.479 -7.637  3.909   1.00 0.00 ? 477 LEU C HA   12 
ATOM 9612  H HB2  . LEU A 1 25 ? -13.150 -8.473  1.333   1.00 0.00 ? 477 LEU C HB2  12 
ATOM 9613  H HB3  . LEU A 1 25 ? -13.063 -6.846  1.947   1.00 0.00 ? 477 LEU C HB3  12 
ATOM 9614  H HG   . LEU A 1 25 ? -11.983 -9.296  3.335   1.00 0.00 ? 477 LEU C HG   12 
ATOM 9615  H HD11 . LEU A 1 25 ? -10.574 -7.064  1.879   1.00 0.00 ? 477 LEU C HD11 12 
ATOM 9616  H HD12 . LEU A 1 25 ? -10.723 -8.732  1.328   1.00 0.00 ? 477 LEU C HD12 12 
ATOM 9617  H HD13 . LEU A 1 25 ? -9.794  -8.363  2.779   1.00 0.00 ? 477 LEU C HD13 12 
ATOM 9618  H HD21 . LEU A 1 25 ? -12.669 -7.595  4.926   1.00 0.00 ? 477 LEU C HD21 12 
ATOM 9619  H HD22 . LEU A 1 25 ? -11.780 -6.367  4.025   1.00 0.00 ? 477 LEU C HD22 12 
ATOM 9620  H HD23 . LEU A 1 25 ? -10.910 -7.675  4.828   1.00 0.00 ? 477 LEU C HD23 12 
ATOM 9621  N N    . GLN A 1 26 ? -16.005 -8.092  1.038   1.00 0.00 ? 478 GLN C N    12 
ATOM 9622  C CA   . GLN A 1 26 ? -17.057 -7.621  0.164   1.00 0.00 ? 478 GLN C CA   12 
ATOM 9623  C C    . GLN A 1 26 ? -18.311 -7.270  0.961   1.00 0.00 ? 478 GLN C C    12 
ATOM 9624  O O    . GLN A 1 26 ? -18.809 -6.154  0.882   1.00 0.00 ? 478 GLN C O    12 
ATOM 9625  C CB   . GLN A 1 26 ? -17.390 -8.701  -0.861  1.00 0.00 ? 478 GLN C CB   12 
ATOM 9626  C CG   . GLN A 1 26 ? -18.449 -8.289  -1.863  1.00 0.00 ? 478 GLN C CG   12 
ATOM 9627  C CD   . GLN A 1 26 ? -18.978 -9.454  -2.681  1.00 0.00 ? 478 GLN C CD   12 
ATOM 9628  O OE1  . GLN A 1 26 ? -19.350 -9.293  -3.845  1.00 0.00 ? 478 GLN C OE1  12 
ATOM 9629  N NE2  . GLN A 1 26 ? -19.040 -10.627 -2.077  1.00 0.00 ? 478 GLN C NE2  12 
ATOM 9630  H H    . GLN A 1 26 ? -15.567 -8.942  0.822   1.00 0.00 ? 478 GLN C H    12 
ATOM 9631  H HA   . GLN A 1 26 ? -16.704 -6.744  -0.355  1.00 0.00 ? 478 GLN C HA   12 
ATOM 9632  H HB2  . GLN A 1 26 ? -16.491 -8.955  -1.403  1.00 0.00 ? 478 GLN C HB2  12 
ATOM 9633  H HB3  . GLN A 1 26 ? -17.741 -9.577  -0.337  1.00 0.00 ? 478 GLN C HB3  12 
ATOM 9634  H HG2  . GLN A 1 26 ? -19.269 -7.843  -1.324  1.00 0.00 ? 478 GLN C HG2  12 
ATOM 9635  H HG3  . GLN A 1 26 ? -18.018 -7.560  -2.531  1.00 0.00 ? 478 GLN C HG3  12 
ATOM 9636  H HE21 . GLN A 1 26 ? -18.745 -10.688 -1.144  1.00 0.00 ? 478 GLN C HE21 12 
ATOM 9637  H HE22 . GLN A 1 26 ? -19.391 -11.391 -2.581  1.00 0.00 ? 478 GLN C HE22 12 
ATOM 9638  N N    . ASP A 1 27 ? -18.794 -8.226  1.748   1.00 0.00 ? 479 ASP C N    12 
ATOM 9639  C CA   . ASP A 1 27 ? -20.016 -8.036  2.531   1.00 0.00 ? 479 ASP C CA   12 
ATOM 9640  C C    . ASP A 1 27 ? -19.823 -6.977  3.601   1.00 0.00 ? 479 ASP C C    12 
ATOM 9641  O O    . ASP A 1 27 ? -20.736 -6.234  3.911   1.00 0.00 ? 479 ASP C O    12 
ATOM 9642  C CB   . ASP A 1 27 ? -20.457 -9.343  3.172   1.00 0.00 ? 479 ASP C CB   12 
ATOM 9643  C CG   . ASP A 1 27 ? -21.862 -9.264  3.752   1.00 0.00 ? 479 ASP C CG   12 
ATOM 9644  O OD1  . ASP A 1 27 ? -22.024 -8.744  4.880   1.00 0.00 ? 479 ASP C OD1  12 
ATOM 9645  O OD2  . ASP A 1 27 ? -22.810 -9.728  3.078   1.00 0.00 ? 479 ASP C OD2  12 
ATOM 9646  H H    . ASP A 1 27 ? -18.315 -9.079  1.815   1.00 0.00 ? 479 ASP C H    12 
ATOM 9647  H HA   . ASP A 1 27 ? -20.792 -7.699  1.857   1.00 0.00 ? 479 ASP C HA   12 
ATOM 9648  H HB2  . ASP A 1 27 ? -20.436 -10.124 2.427   1.00 0.00 ? 479 ASP C HB2  12 
ATOM 9649  H HB3  . ASP A 1 27 ? -19.771 -9.591  3.966   1.00 0.00 ? 479 ASP C HB3  12 
ATOM 9650  N N    . LEU A 1 28 ? -18.625 -6.890  4.146   1.00 0.00 ? 480 LEU C N    12 
ATOM 9651  C CA   . LEU A 1 28 ? -18.335 -5.899  5.168   1.00 0.00 ? 480 LEU C CA   12 
ATOM 9652  C C    . LEU A 1 28 ? -18.328 -4.508  4.573   1.00 0.00 ? 480 LEU C C    12 
ATOM 9653  O O    . LEU A 1 28 ? -18.494 -3.523  5.277   1.00 0.00 ? 480 LEU C O    12 
ATOM 9654  C CB   . LEU A 1 28 ? -17.018 -6.190  5.897   1.00 0.00 ? 480 LEU C CB   12 
ATOM 9655  C CG   . LEU A 1 28 ? -17.127 -7.062  7.152   1.00 0.00 ? 480 LEU C CG   12 
ATOM 9656  C CD1  . LEU A 1 28 ? -18.259 -6.593  8.049   1.00 0.00 ? 480 LEU C CD1  12 
ATOM 9657  C CD2  . LEU A 1 28 ? -17.327 -8.494  6.782   1.00 0.00 ? 480 LEU C CD2  12 
ATOM 9658  H H    . LEU A 1 28 ? -17.921 -7.497  3.847   1.00 0.00 ? 480 LEU C H    12 
ATOM 9659  H HA   . LEU A 1 28 ? -19.143 -5.946  5.880   1.00 0.00 ? 480 LEU C HA   12 
ATOM 9660  H HB2  . LEU A 1 28 ? -16.352 -6.682  5.207   1.00 0.00 ? 480 LEU C HB2  12 
ATOM 9661  H HB3  . LEU A 1 28 ? -16.568 -5.261  6.173   1.00 0.00 ? 480 LEU C HB3  12 
ATOM 9662  H HG   . LEU A 1 28 ? -16.207 -6.985  7.715   1.00 0.00 ? 480 LEU C HG   12 
ATOM 9663  H HD11 . LEU A 1 28 ? -19.206 -6.831  7.586   1.00 0.00 ? 480 LEU C HD11 12 
ATOM 9664  H HD12 . LEU A 1 28 ? -18.187 -5.525  8.190   1.00 0.00 ? 480 LEU C HD12 12 
ATOM 9665  H HD13 . LEU A 1 28 ? -18.192 -7.090  9.005   1.00 0.00 ? 480 LEU C HD13 12 
ATOM 9666  H HD21 . LEU A 1 28 ? -16.486 -8.832  6.197   1.00 0.00 ? 480 LEU C HD21 12 
ATOM 9667  H HD22 . LEU A 1 28 ? -18.234 -8.573  6.196   1.00 0.00 ? 480 LEU C HD22 12 
ATOM 9668  H HD23 . LEU A 1 28 ? -17.411 -9.088  7.679   1.00 0.00 ? 480 LEU C HD23 12 
ATOM 9669  N N    . GLN A 1 29 ? -18.136 -4.436  3.275   1.00 0.00 ? 481 GLN C N    12 
ATOM 9670  C CA   . GLN A 1 29 ? -18.215 -3.184  2.568   1.00 0.00 ? 481 GLN C CA   12 
ATOM 9671  C C    . GLN A 1 29 ? -19.669 -2.845  2.296   1.00 0.00 ? 481 GLN C C    12 
ATOM 9672  O O    . GLN A 1 29 ? -20.021 -1.688  2.059   1.00 0.00 ? 481 GLN C O    12 
ATOM 9673  C CB   . GLN A 1 29 ? -17.426 -3.258  1.262   1.00 0.00 ? 481 GLN C CB   12 
ATOM 9674  C CG   . GLN A 1 29 ? -15.927 -3.185  1.461   1.00 0.00 ? 481 GLN C CG   12 
ATOM 9675  C CD   . GLN A 1 29 ? -15.442 -1.771  1.732   1.00 0.00 ? 481 GLN C CD   12 
ATOM 9676  O OE1  . GLN A 1 29 ? -16.190 -0.922  2.226   1.00 0.00 ? 481 GLN C OE1  12 
ATOM 9677  N NE2  . GLN A 1 29 ? -14.184 -1.518  1.448   1.00 0.00 ? 481 GLN C NE2  12 
ATOM 9678  H H    . GLN A 1 29 ? -17.922 -5.255  2.775   1.00 0.00 ? 481 GLN C H    12 
ATOM 9679  H HA   . GLN A 1 29 ? -17.784 -2.423  3.196   1.00 0.00 ? 481 GLN C HA   12 
ATOM 9680  H HB2  . GLN A 1 29 ? -17.658 -4.190  0.767   1.00 0.00 ? 481 GLN C HB2  12 
ATOM 9681  H HB3  . GLN A 1 29 ? -17.725 -2.440  0.627   1.00 0.00 ? 481 GLN C HB3  12 
ATOM 9682  H HG2  . GLN A 1 29 ? -15.656 -3.808  2.301   1.00 0.00 ? 481 GLN C HG2  12 
ATOM 9683  H HG3  . GLN A 1 29 ? -15.442 -3.552  0.572   1.00 0.00 ? 481 GLN C HG3  12 
ATOM 9684  H HE21 . GLN A 1 29 ? -13.636 -2.250  1.089   1.00 0.00 ? 481 GLN C HE21 12 
ATOM 9685  H HE22 . GLN A 1 29 ? -13.843 -0.614  1.611   1.00 0.00 ? 481 GLN C HE22 12 
ATOM 9686  N N    . LEU A 1 30 ? -20.509 -3.866  2.349   1.00 0.00 ? 482 LEU C N    12 
ATOM 9687  C CA   . LEU A 1 30 ? -21.920 -3.722  2.090   1.00 0.00 ? 482 LEU C CA   12 
ATOM 9688  C C    . LEU A 1 30 ? -22.695 -3.481  3.389   1.00 0.00 ? 482 LEU C C    12 
ATOM 9689  O O    . LEU A 1 30 ? -23.393 -2.476  3.532   1.00 0.00 ? 482 LEU C O    12 
ATOM 9690  C CB   . LEU A 1 30 ? -22.460 -4.988  1.407   1.00 0.00 ? 482 LEU C CB   12 
ATOM 9691  C CG   . LEU A 1 30 ? -21.624 -5.550  0.251   1.00 0.00 ? 482 LEU C CG   12 
ATOM 9692  C CD1  . LEU A 1 30 ? -22.360 -6.679  -0.448  1.00 0.00 ? 482 LEU C CD1  12 
ATOM 9693  C CD2  . LEU A 1 30 ? -21.241 -4.461  -0.733  1.00 0.00 ? 482 LEU C CD2  12 
ATOM 9694  H H    . LEU A 1 30 ? -20.166 -4.757  2.568   1.00 0.00 ? 482 LEU C H    12 
ATOM 9695  H HA   . LEU A 1 30 ? -22.062 -2.883  1.427   1.00 0.00 ? 482 LEU C HA   12 
ATOM 9696  H HB2  . LEU A 1 30 ? -22.547 -5.758  2.160   1.00 0.00 ? 482 LEU C HB2  12 
ATOM 9697  H HB3  . LEU A 1 30 ? -23.443 -4.772  1.035   1.00 0.00 ? 482 LEU C HB3  12 
ATOM 9698  H HG   . LEU A 1 30 ? -20.713 -5.965  0.660   1.00 0.00 ? 482 LEU C HG   12 
ATOM 9699  H HD11 . LEU A 1 30 ? -23.289 -6.308  -0.853  1.00 0.00 ? 482 LEU C HD11 12 
ATOM 9700  H HD12 . LEU A 1 30 ? -22.568 -7.467  0.261   1.00 0.00 ? 482 LEU C HD12 12 
ATOM 9701  H HD13 . LEU A 1 30 ? -21.748 -7.067  -1.249  1.00 0.00 ? 482 LEU C HD13 12 
ATOM 9702  H HD21 . LEU A 1 30 ? -20.611 -3.743  -0.229  1.00 0.00 ? 482 LEU C HD21 12 
ATOM 9703  H HD22 . LEU A 1 30 ? -22.132 -3.972  -1.098  1.00 0.00 ? 482 LEU C HD22 12 
ATOM 9704  H HD23 . LEU A 1 30 ? -20.698 -4.899  -1.556  1.00 0.00 ? 482 LEU C HD23 12 
ATOM 9705  N N    . THR A 1 31 ? -22.548 -4.392  4.338   1.00 0.00 ? 483 THR C N    12 
ATOM 9706  C CA   . THR A 1 31 ? -23.303 -4.327  5.569   1.00 0.00 ? 483 THR C CA   12 
ATOM 9707  C C    . THR A 1 31 ? -22.535 -3.603  6.659   1.00 0.00 ? 483 THR C C    12 
ATOM 9708  O O    . THR A 1 31 ? -23.124 -2.860  7.445   1.00 0.00 ? 483 THR C O    12 
ATOM 9709  C CB   . THR A 1 31 ? -23.667 -5.737  6.067   1.00 0.00 ? 483 THR C CB   12 
ATOM 9710  O OG1  . THR A 1 31 ? -22.471 -6.500  6.264   1.00 0.00 ? 483 THR C OG1  12 
ATOM 9711  C CG2  . THR A 1 31 ? -24.564 -6.446  5.066   1.00 0.00 ? 483 THR C CG2  12 
ATOM 9712  H H    . THR A 1 31 ? -21.901 -5.133  4.218   1.00 0.00 ? 483 THR C H    12 
ATOM 9713  H HA   . THR A 1 31 ? -24.220 -3.793  5.371   1.00 0.00 ? 483 THR C HA   12 
ATOM 9714  H HB   . THR A 1 31 ? -24.192 -5.648  7.008   1.00 0.00 ? 483 THR C HB   12 
ATOM 9715  H HG1  . THR A 1 31 ? -22.464 -7.270  5.664   1.00 0.00 ? 483 THR C HG1  12 
ATOM 9716  H HG21 . THR A 1 31 ? -24.052 -6.524  4.118   1.00 0.00 ? 483 THR C HG21 12 
ATOM 9717  H HG22 . THR A 1 31 ? -25.476 -5.883  4.938   1.00 0.00 ? 483 THR C HG22 12 
ATOM 9718  H HG23 . THR A 1 31 ? -24.797 -7.435  5.431   1.00 0.00 ? 483 THR C HG23 12 
ATOM 9719  N N    . ARG A 1 32 ? -21.211 -3.807  6.687   1.00 0.00 ? 484 ARG C N    12 
ATOM 9720  C CA   . ARG A 1 32 ? -20.348 -3.238  7.715   1.00 0.00 ? 484 ARG C CA   12 
ATOM 9721  C C    . ARG A 1 32 ? -20.694 -3.799  9.088   1.00 0.00 ? 484 ARG C C    12 
ATOM 9722  O O    . ARG A 1 32 ? -20.372 -3.206  10.117  1.00 0.00 ? 484 ARG C O    12 
ATOM 9723  C CB   . ARG A 1 32 ? -20.441 -1.721  7.722   1.00 0.00 ? 484 ARG C CB   12 
ATOM 9724  C CG   . ARG A 1 32 ? -19.941 -1.074  6.454   1.00 0.00 ? 484 ARG C CG   12 
ATOM 9725  C CD   . ARG A 1 32 ? -20.128 0.418   6.496   1.00 0.00 ? 484 ARG C CD   12 
ATOM 9726  N NE   . ARG A 1 32 ? -19.394 1.037   7.605   1.00 0.00 ? 484 ARG C NE   12 
ATOM 9727  C CZ   . ARG A 1 32 ? -19.274 2.353   7.788   1.00 0.00 ? 484 ARG C CZ   12 
ATOM 9728  N NH1  . ARG A 1 32 ? -19.820 3.202   6.919   1.00 0.00 ? 484 ARG C NH1  12 
ATOM 9729  N NH2  . ARG A 1 32 ? -18.610 2.818   8.840   1.00 0.00 ? 484 ARG C NH2  12 
ATOM 9730  H H    . ARG A 1 32 ? -20.799 -4.353  5.988   1.00 0.00 ? 484 ARG C H    12 
ATOM 9731  H HA   . ARG A 1 32 ? -19.333 -3.518  7.472   1.00 0.00 ? 484 ARG C HA   12 
ATOM 9732  H HB2  . ARG A 1 32 ? -21.469 -1.432  7.866   1.00 0.00 ? 484 ARG C HB2  12 
ATOM 9733  H HB3  . ARG A 1 32 ? -19.851 -1.354  8.544   1.00 0.00 ? 484 ARG C HB3  12 
ATOM 9734  H HG2  . ARG A 1 32 ? -18.893 -1.295  6.341   1.00 0.00 ? 484 ARG C HG2  12 
ATOM 9735  H HG3  . ARG A 1 32 ? -20.491 -1.477  5.615   1.00 0.00 ? 484 ARG C HG3  12 
ATOM 9736  H HD2  . ARG A 1 32 ? -19.782 0.834   5.563   1.00 0.00 ? 484 ARG C HD2  12 
ATOM 9737  H HD3  . ARG A 1 32 ? -21.182 0.618   6.616   1.00 0.00 ? 484 ARG C HD3  12 
ATOM 9738  H HE   . ARG A 1 32 ? -18.978 0.424   8.257   1.00 0.00 ? 484 ARG C HE   12 
ATOM 9739  H HH11 . ARG A 1 32 ? -20.325 2.860   6.120   1.00 0.00 ? 484 ARG C HH11 12 
ATOM 9740  H HH12 . ARG A 1 32 ? -19.731 4.193   7.051   1.00 0.00 ? 484 ARG C HH12 12 
ATOM 9741  H HH21 . ARG A 1 32 ? -18.195 2.185   9.500   1.00 0.00 ? 484 ARG C HH21 12 
ATOM 9742  H HH22 . ARG A 1 32 ? -18.521 3.806   8.994   1.00 0.00 ? 484 ARG C HH22 12 
ATOM 9743  N N    . SER A 1 33 ? -21.329 -4.958  9.099   1.00 0.00 ? 485 SER C N    12 
ATOM 9744  C CA   . SER A 1 33 ? -21.727 -5.589  10.332  1.00 0.00 ? 485 SER C CA   12 
ATOM 9745  C C    . SER A 1 33 ? -21.434 -7.069  10.279  1.00 0.00 ? 485 SER C C    12 
ATOM 9746  O O    . SER A 1 33 ? -22.112 -7.806  9.571   1.00 0.00 ? 485 SER C O    12 
ATOM 9747  C CB   . SER A 1 33 ? -23.219 -5.375  10.580  1.00 0.00 ? 485 SER C CB   12 
ATOM 9748  O OG   . SER A 1 33 ? -23.594 -5.842  11.869  1.00 0.00 ? 485 SER C OG   12 
ATOM 9749  H H    . SER A 1 33 ? -21.532 -5.406  8.248   1.00 0.00 ? 485 SER C H    12 
ATOM 9750  H HA   . SER A 1 33 ? -21.170 -5.141  11.135  1.00 0.00 ? 485 SER C HA   12 
ATOM 9751  H HB2  . SER A 1 33 ? -23.463 -4.332  10.492  1.00 0.00 ? 485 SER C HB2  12 
ATOM 9752  H HB3  . SER A 1 33 ? -23.776 -5.932  9.841   1.00 0.00 ? 485 SER C HB3  12 
ATOM 9753  H HG   . SER A 1 33 ? -23.236 -5.237  12.532  1.00 0.00 ? 485 SER C HG   12 
ATOM 9754  N N    . VAL A 1 34 ? -20.433 -7.511  11.036  1.00 0.00 ? 486 VAL C N    12 
ATOM 9755  C CA   . VAL A 1 34 ? -20.066 -8.915  11.053  1.00 0.00 ? 486 VAL C CA   12 
ATOM 9756  C C    . VAL A 1 34 ? -21.215 -9.781  11.547  1.00 0.00 ? 486 VAL C C    12 
ATOM 9757  O O    . VAL A 1 34 ? -21.323 -10.949 11.179  1.00 0.00 ? 486 VAL C O    12 
ATOM 9758  C CB   . VAL A 1 34 ? -18.810 -9.182  11.906  1.00 0.00 ? 486 VAL C CB   12 
ATOM 9759  C CG1  . VAL A 1 34 ? -17.673 -8.308  11.454  1.00 0.00 ? 486 VAL C CG1  12 
ATOM 9760  C CG2  . VAL A 1 34 ? -19.077 -8.991  13.385  1.00 0.00 ? 486 VAL C CG2  12 
ATOM 9761  H H    . VAL A 1 34 ? -19.926 -6.877  11.587  1.00 0.00 ? 486 VAL C H    12 
ATOM 9762  H HA   . VAL A 1 34 ? -19.846 -9.197  10.033  1.00 0.00 ? 486 VAL C HA   12 
ATOM 9763  H HB   . VAL A 1 34 ? -18.520 -10.206 11.747  1.00 0.00 ? 486 VAL C HB   12 
ATOM 9764  H HG11 . VAL A 1 34 ? -16.812 -8.490  12.079  1.00 0.00 ? 486 VAL C HG11 12 
ATOM 9765  H HG12 . VAL A 1 34 ? -17.964 -7.270  11.534  1.00 0.00 ? 486 VAL C HG12 12 
ATOM 9766  H HG13 . VAL A 1 34 ? -17.428 -8.536  10.429  1.00 0.00 ? 486 VAL C HG13 12 
ATOM 9767  H HG21 . VAL A 1 34 ? -19.896 -9.628  13.684  1.00 0.00 ? 486 VAL C HG21 12 
ATOM 9768  H HG22 . VAL A 1 34 ? -19.319 -7.960  13.583  1.00 0.00 ? 486 VAL C HG22 12 
ATOM 9769  H HG23 . VAL A 1 34 ? -18.188 -9.272  13.932  1.00 0.00 ? 486 VAL C HG23 12 
ATOM 9770  N N    . GLU A 1 35 ? -22.074 -9.201  12.375  1.00 0.00 ? 487 GLU C N    12 
ATOM 9771  C CA   . GLU A 1 35 ? -23.235 -9.903  12.884  1.00 0.00 ? 487 GLU C CA   12 
ATOM 9772  C C    . GLU A 1 35 ? -24.170 -10.246 11.744  1.00 0.00 ? 487 GLU C C    12 
ATOM 9773  O O    . GLU A 1 35 ? -24.763 -11.328 11.711  1.00 0.00 ? 487 GLU C O    12 
ATOM 9774  C CB   . GLU A 1 35 ? -23.949 -9.058  13.931  1.00 0.00 ? 487 GLU C CB   12 
ATOM 9775  C CG   . GLU A 1 35 ? -23.098 -8.771  15.149  1.00 0.00 ? 487 GLU C CG   12 
ATOM 9776  C CD   . GLU A 1 35 ? -22.625 -10.040 15.822  1.00 0.00 ? 487 GLU C CD   12 
ATOM 9777  O OE1  . GLU A 1 35 ? -23.369 -10.577 16.665  1.00 0.00 ? 487 GLU C OE1  12 
ATOM 9778  O OE2  . GLU A 1 35 ? -21.515 -10.509 15.506  1.00 0.00 ? 487 GLU C OE2  12 
ATOM 9779  H H    . GLU A 1 35 ? -21.914 -8.273  12.650  1.00 0.00 ? 487 GLU C H    12 
ATOM 9780  H HA   . GLU A 1 35 ? -22.894 -10.822 13.341  1.00 0.00 ? 487 GLU C HA   12 
ATOM 9781  H HB2  . GLU A 1 35 ? -24.234 -8.117  13.484  1.00 0.00 ? 487 GLU C HB2  12 
ATOM 9782  H HB3  . GLU A 1 35 ? -24.838 -9.579  14.253  1.00 0.00 ? 487 GLU C HB3  12 
ATOM 9783  H HG2  . GLU A 1 35 ? -22.234 -8.199  14.843  1.00 0.00 ? 487 GLU C HG2  12 
ATOM 9784  H HG3  . GLU A 1 35 ? -23.679 -8.199  15.855  1.00 0.00 ? 487 GLU C HG3  12 
ATOM 9785  N N    . ILE A 1 36 ? -24.287 -9.324  10.802  1.00 0.00 ? 488 ILE C N    12 
ATOM 9786  C CA   . ILE A 1 36 ? -25.082 -9.559  9.624   1.00 0.00 ? 488 ILE C CA   12 
ATOM 9787  C C    . ILE A 1 36 ? -24.317 -10.470 8.690   1.00 0.00 ? 488 ILE C C    12 
ATOM 9788  O O    . ILE A 1 36 ? -24.785 -11.520 8.361   1.00 0.00 ? 488 ILE C O    12 
ATOM 9789  C CB   . ILE A 1 36 ? -25.432 -8.247  8.886   1.00 0.00 ? 488 ILE C CB   12 
ATOM 9790  C CG1  . ILE A 1 36 ? -26.126 -7.265  9.836   1.00 0.00 ? 488 ILE C CG1  12 
ATOM 9791  C CG2  . ILE A 1 36 ? -26.318 -8.539  7.685   1.00 0.00 ? 488 ILE C CG2  12 
ATOM 9792  C CD1  . ILE A 1 36 ? -26.516 -5.950  9.186   1.00 0.00 ? 488 ILE C CD1  12 
ATOM 9793  H H    . ILE A 1 36 ? -23.817 -8.469  10.904  1.00 0.00 ? 488 ILE C H    12 
ATOM 9794  H HA   . ILE A 1 36 ? -25.996 -10.050 9.926   1.00 0.00 ? 488 ILE C HA   12 
ATOM 9795  H HB   . ILE A 1 36 ? -24.512 -7.813  8.525   1.00 0.00 ? 488 ILE C HB   12 
ATOM 9796  H HG12 . ILE A 1 36 ? -27.028 -7.721  10.216  1.00 0.00 ? 488 ILE C HG12 12 
ATOM 9797  H HG13 . ILE A 1 36 ? -25.468 -7.046  10.662  1.00 0.00 ? 488 ILE C HG13 12 
ATOM 9798  H HG21 . ILE A 1 36 ? -27.225 -9.020  8.017   1.00 0.00 ? 488 ILE C HG21 12 
ATOM 9799  H HG22 . ILE A 1 36 ? -25.794 -9.191  7.001   1.00 0.00 ? 488 ILE C HG22 12 
ATOM 9800  H HG23 . ILE A 1 36 ? -26.563 -7.614  7.184   1.00 0.00 ? 488 ILE C HG23 12 
ATOM 9801  H HD11 . ILE A 1 36 ? -27.185 -6.143  8.359   1.00 0.00 ? 488 ILE C HD11 12 
ATOM 9802  H HD12 . ILE A 1 36 ? -25.632 -5.449  8.824   1.00 0.00 ? 488 ILE C HD12 12 
ATOM 9803  H HD13 . ILE A 1 36 ? -27.013 -5.324  9.911   1.00 0.00 ? 488 ILE C HD13 12 
ATOM 9804  N N    . THR A 1 37 ? -23.113 -10.042 8.304   1.00 0.00 ? 489 THR C N    12 
ATOM 9805  C CA   . THR A 1 37 ? -22.208 -10.799 7.434   1.00 0.00 ? 489 THR C CA   12 
ATOM 9806  C C    . THR A 1 37 ? -22.152 -12.299 7.786   1.00 0.00 ? 489 THR C C    12 
ATOM 9807  O O    . THR A 1 37 ? -22.235 -13.141 6.902   1.00 0.00 ? 489 THR C O    12 
ATOM 9808  C CB   . THR A 1 37 ? -20.789 -10.212 7.519   1.00 0.00 ? 489 THR C CB   12 
ATOM 9809  O OG1  . THR A 1 37 ? -20.842 -8.806  7.273   1.00 0.00 ? 489 THR C OG1  12 
ATOM 9810  C CG2  . THR A 1 37 ? -19.860 -10.859 6.507   1.00 0.00 ? 489 THR C CG2  12 
ATOM 9811  H H    . THR A 1 37 ? -22.822 -9.152  8.580   1.00 0.00 ? 489 THR C H    12 
ATOM 9812  H HA   . THR A 1 37 ? -22.552 -10.684 6.418   1.00 0.00 ? 489 THR C HA   12 
ATOM 9813  H HB   . THR A 1 37 ? -20.408 -10.390 8.513   1.00 0.00 ? 489 THR C HB   12 
ATOM 9814  H HG1  . THR A 1 37 ? -21.256 -8.661  6.402   1.00 0.00 ? 489 THR C HG1  12 
ATOM 9815  H HG21 . THR A 1 37 ? -18.900 -10.363 6.545   1.00 0.00 ? 489 THR C HG21 12 
ATOM 9816  H HG22 . THR A 1 37 ? -20.279 -10.757 5.519   1.00 0.00 ? 489 THR C HG22 12 
ATOM 9817  H HG23 . THR A 1 37 ? -19.735 -11.905 6.744   1.00 0.00 ? 489 THR C HG23 12 
ATOM 9818  N N    . THR A 1 38 ? -22.029 -12.629 9.069   1.00 0.00 ? 490 THR C N    12 
ATOM 9819  C CA   . THR A 1 38 ? -21.959 -14.027 9.474   1.00 0.00 ? 490 THR C CA   12 
ATOM 9820  C C    . THR A 1 38 ? -23.276 -14.741 9.162   1.00 0.00 ? 490 THR C C    12 
ATOM 9821  O O    . THR A 1 38 ? -23.284 -15.839 8.596   1.00 0.00 ? 490 THR C O    12 
ATOM 9822  C CB   . THR A 1 38 ? -21.617 -14.175 10.972  1.00 0.00 ? 490 THR C CB   12 
ATOM 9823  O OG1  . THR A 1 38 ? -20.439 -13.408 11.276  1.00 0.00 ? 490 THR C OG1  12 
ATOM 9824  C CG2  . THR A 1 38 ? -21.359 -15.631 11.311  1.00 0.00 ? 490 THR C CG2  12 
ATOM 9825  H H    . THR A 1 38 ? -21.995 -11.926 9.752   1.00 0.00 ? 490 THR C H    12 
ATOM 9826  H HA   . THR A 1 38 ? -21.178 -14.497 8.893   1.00 0.00 ? 490 THR C HA   12 
ATOM 9827  H HB   . THR A 1 38 ? -22.443 -13.812 11.565  1.00 0.00 ? 490 THR C HB   12 
ATOM 9828  H HG1  . THR A 1 38 ? -20.600 -12.480 11.064  1.00 0.00 ? 490 THR C HG1  12 
ATOM 9829  H HG21 . THR A 1 38 ? -20.568 -16.007 10.677  1.00 0.00 ? 490 THR C HG21 12 
ATOM 9830  H HG22 . THR A 1 38 ? -22.259 -16.204 11.144  1.00 0.00 ? 490 THR C HG22 12 
ATOM 9831  H HG23 . THR A 1 38 ? -21.062 -15.716 12.346  1.00 0.00 ? 490 THR C HG23 12 
ATOM 9832  N N    . ASP A 1 39 ? -24.387 -14.097 9.503   1.00 0.00 ? 491 ASP C N    12 
ATOM 9833  C CA   . ASP A 1 39 ? -25.715 -14.640 9.205   1.00 0.00 ? 491 ASP C CA   12 
ATOM 9834  C C    . ASP A 1 39 ? -25.922 -14.633 7.704   1.00 0.00 ? 491 ASP C C    12 
ATOM 9835  O O    . ASP A 1 39 ? -26.545 -15.522 7.143   1.00 0.00 ? 491 ASP C O    12 
ATOM 9836  C CB   . ASP A 1 39 ? -26.800 -13.800 9.882   1.00 0.00 ? 491 ASP C CB   12 
ATOM 9837  C CG   . ASP A 1 39 ? -28.200 -14.290 9.562   1.00 0.00 ? 491 ASP C CG   12 
ATOM 9838  O OD1  . ASP A 1 39 ? -28.666 -15.255 10.212  1.00 0.00 ? 491 ASP C OD1  12 
ATOM 9839  O OD2  . ASP A 1 39 ? -28.846 -13.711 8.667   1.00 0.00 ? 491 ASP C OD2  12 
ATOM 9840  H H    . ASP A 1 39 ? -24.315 -13.226 9.952   1.00 0.00 ? 491 ASP C H    12 
ATOM 9841  H HA   . ASP A 1 39 ? -25.762 -15.658 9.564   1.00 0.00 ? 491 ASP C HA   12 
ATOM 9842  H HB2  . ASP A 1 39 ? -26.660 -13.827 10.951  1.00 0.00 ? 491 ASP C HB2  12 
ATOM 9843  H HB3  . ASP A 1 39 ? -26.712 -12.778 9.542   1.00 0.00 ? 491 ASP C HB3  12 
ATOM 9844  N N    . ASN A 1 40 ? -25.371 -13.614 7.078   1.00 0.00 ? 492 ASN C N    12 
ATOM 9845  C CA   . ASN A 1 40 ? -25.396 -13.429 5.645   1.00 0.00 ? 492 ASN C CA   12 
ATOM 9846  C C    . ASN A 1 40 ? -24.776 -14.631 4.947   1.00 0.00 ? 492 ASN C C    12 
ATOM 9847  O O    . ASN A 1 40 ? -25.350 -15.179 4.006   1.00 0.00 ? 492 ASN C O    12 
ATOM 9848  C CB   . ASN A 1 40 ? -24.650 -12.132 5.288   1.00 0.00 ? 492 ASN C CB   12 
ATOM 9849  C CG   . ASN A 1 40 ? -25.572 -10.944 5.183   1.00 0.00 ? 492 ASN C CG   12 
ATOM 9850  O OD1  . ASN A 1 40 ? -26.675 -10.951 5.725   1.00 0.00 ? 492 ASN C OD1  12 
ATOM 9851  N ND2  . ASN A 1 40 ? -25.123 -9.906  4.511   1.00 0.00 ? 492 ASN C ND2  12 
ATOM 9852  H H    . ASN A 1 40 ? -24.926 -12.927 7.624   1.00 0.00 ? 492 ASN C H    12 
ATOM 9853  H HA   . ASN A 1 40 ? -26.427 -13.322 5.348   1.00 0.00 ? 492 ASN C HA   12 
ATOM 9854  H HB2  . ASN A 1 40 ? -23.947 -11.916 6.080   1.00 0.00 ? 492 ASN C HB2  12 
ATOM 9855  H HB3  . ASN A 1 40 ? -24.108 -12.237 4.367   1.00 0.00 ? 492 ASN C HB3  12 
ATOM 9856  H HD21 . ASN A 1 40 ? -24.215 -9.951  4.110   1.00 0.00 ? 492 ASN C HD21 12 
ATOM 9857  H HD22 . ASN A 1 40 ? -25.696 -9.117  4.441   1.00 0.00 ? 492 ASN C HD22 12 
ATOM 9858  N N    . ILE A 1 41 ? -23.608 -15.048 5.426   1.00 0.00 ? 493 ILE C N    12 
ATOM 9859  C CA   . ILE A 1 41 ? -22.938 -16.234 4.905   1.00 0.00 ? 493 ILE C CA   12 
ATOM 9860  C C    . ILE A 1 41 ? -23.873 -17.436 5.009   1.00 0.00 ? 493 ILE C C    12 
ATOM 9861  O O    . ILE A 1 41 ? -24.120 -18.146 4.031   1.00 0.00 ? 493 ILE C O    12 
ATOM 9862  C CB   . ILE A 1 41 ? -21.660 -16.564 5.726   1.00 0.00 ? 493 ILE C CB   12 
ATOM 9863  C CG1  . ILE A 1 41 ? -20.681 -15.403 5.719   1.00 0.00 ? 493 ILE C CG1  12 
ATOM 9864  C CG2  . ILE A 1 41 ? -20.986 -17.821 5.195   1.00 0.00 ? 493 ILE C CG2  12 
ATOM 9865  C CD1  . ILE A 1 41 ? -19.577 -15.544 6.746   1.00 0.00 ? 493 ILE C CD1  12 
ATOM 9866  H H    . ILE A 1 41 ? -23.174 -14.530 6.144   1.00 0.00 ? 493 ILE C H    12 
ATOM 9867  H HA   . ILE A 1 41 ? -22.670 -16.049 3.876   1.00 0.00 ? 493 ILE C HA   12 
ATOM 9868  H HB   . ILE A 1 41 ? -21.963 -16.755 6.747   1.00 0.00 ? 493 ILE C HB   12 
ATOM 9869  H HG12 . ILE A 1 41 ? -20.225 -15.333 4.744   1.00 0.00 ? 493 ILE C HG12 12 
ATOM 9870  H HG13 . ILE A 1 41 ? -21.217 -14.493 5.929   1.00 0.00 ? 493 ILE C HG13 12 
ATOM 9871  H HG21 . ILE A 1 41 ? -20.696 -17.662 4.168   1.00 0.00 ? 493 ILE C HG21 12 
ATOM 9872  H HG22 . ILE A 1 41 ? -21.673 -18.651 5.255   1.00 0.00 ? 493 ILE C HG22 12 
ATOM 9873  H HG23 . ILE A 1 41 ? -20.109 -18.034 5.789   1.00 0.00 ? 493 ILE C HG23 12 
ATOM 9874  H HD11 . ILE A 1 41 ? -19.003 -16.435 6.540   1.00 0.00 ? 493 ILE C HD11 12 
ATOM 9875  H HD12 . ILE A 1 41 ? -20.015 -15.627 7.728   1.00 0.00 ? 493 ILE C HD12 12 
ATOM 9876  H HD13 . ILE A 1 41 ? -18.934 -14.680 6.712   1.00 0.00 ? 493 ILE C HD13 12 
ATOM 9877  N N    . LEU A 1 42 ? -24.403 -17.623 6.204   1.00 0.00 ? 494 LEU C N    12 
ATOM 9878  C CA   . LEU A 1 42 ? -25.285 -18.735 6.528   1.00 0.00 ? 494 LEU C CA   12 
ATOM 9879  C C    . LEU A 1 42 ? -26.589 -18.693 5.722   1.00 0.00 ? 494 LEU C C    12 
ATOM 9880  O O    . LEU A 1 42 ? -27.135 -19.735 5.355   1.00 0.00 ? 494 LEU C O    12 
ATOM 9881  C CB   . LEU A 1 42 ? -25.582 -18.705 8.028   1.00 0.00 ? 494 LEU C CB   12 
ATOM 9882  C CG   . LEU A 1 42 ? -24.359 -18.857 8.938   1.00 0.00 ? 494 LEU C CG   12 
ATOM 9883  C CD1  . LEU A 1 42 ? -24.709 -18.516 10.377  1.00 0.00 ? 494 LEU C CD1  12 
ATOM 9884  C CD2  . LEU A 1 42 ? -23.800 -20.269 8.847   1.00 0.00 ? 494 LEU C CD2  12 
ATOM 9885  H H    . LEU A 1 42 ? -24.187 -16.976 6.913   1.00 0.00 ? 494 LEU C H    12 
ATOM 9886  H HA   . LEU A 1 42 ? -24.764 -19.652 6.301   1.00 0.00 ? 494 LEU C HA   12 
ATOM 9887  H HB2  . LEU A 1 42 ? -26.053 -17.760 8.254   1.00 0.00 ? 494 LEU C HB2  12 
ATOM 9888  H HB3  . LEU A 1 42 ? -26.278 -19.494 8.260   1.00 0.00 ? 494 LEU C HB3  12 
ATOM 9889  H HG   . LEU A 1 42 ? -23.592 -18.172 8.613   1.00 0.00 ? 494 LEU C HG   12 
ATOM 9890  H HD11 . LEU A 1 42 ? -25.531 -19.133 10.706  1.00 0.00 ? 494 LEU C HD11 12 
ATOM 9891  H HD12 . LEU A 1 42 ? -24.984 -17.473 10.441  1.00 0.00 ? 494 LEU C HD12 12 
ATOM 9892  H HD13 . LEU A 1 42 ? -23.847 -18.696 11.003  1.00 0.00 ? 494 LEU C HD13 12 
ATOM 9893  H HD21 . LEU A 1 42 ? -24.566 -20.979 9.128   1.00 0.00 ? 494 LEU C HD21 12 
ATOM 9894  H HD22 . LEU A 1 42 ? -22.959 -20.366 9.519   1.00 0.00 ? 494 LEU C HD22 12 
ATOM 9895  H HD23 . LEU A 1 42 ? -23.478 -20.466 7.836   1.00 0.00 ? 494 LEU C HD23 12 
ATOM 9896  N N    . GLU A 1 43 ? -27.071 -17.489 5.444   1.00 0.00 ? 495 GLU C N    12 
ATOM 9897  C CA   . GLU A 1 43 ? -28.295 -17.284 4.710   1.00 0.00 ? 495 GLU C CA   12 
ATOM 9898  C C    . GLU A 1 43 ? -28.090 -17.550 3.216   1.00 0.00 ? 495 GLU C C    12 
ATOM 9899  O O    . GLU A 1 43 ? -29.043 -17.789 2.479   1.00 0.00 ? 495 GLU C O    12 
ATOM 9900  C CB   . GLU A 1 43 ? -28.758 -15.849 4.935   1.00 0.00 ? 495 GLU C CB   12 
ATOM 9901  C CG   . GLU A 1 43 ? -30.090 -15.521 4.326   1.00 0.00 ? 495 GLU C CG   12 
ATOM 9902  C CD   . GLU A 1 43 ? -31.208 -16.375 4.879   1.00 0.00 ? 495 GLU C CD   12 
ATOM 9903  O OE1  . GLU A 1 43 ? -31.478 -16.288 6.089   1.00 0.00 ? 495 GLU C OE1  12 
ATOM 9904  O OE2  . GLU A 1 43 ? -31.816 -17.142 4.107   1.00 0.00 ? 495 GLU C OE2  12 
ATOM 9905  H H    . GLU A 1 43 ? -26.598 -16.689 5.759   1.00 0.00 ? 495 GLU C H    12 
ATOM 9906  H HA   . GLU A 1 43 ? -29.043 -17.954 5.097   1.00 0.00 ? 495 GLU C HA   12 
ATOM 9907  H HB2  . GLU A 1 43 ? -28.824 -15.668 5.998   1.00 0.00 ? 495 GLU C HB2  12 
ATOM 9908  H HB3  . GLU A 1 43 ? -28.019 -15.185 4.515   1.00 0.00 ? 495 GLU C HB3  12 
ATOM 9909  H HG2  . GLU A 1 43 ? -30.306 -14.485 4.524   1.00 0.00 ? 495 GLU C HG2  12 
ATOM 9910  H HG3  . GLU A 1 43 ? -30.016 -15.684 3.264   1.00 0.00 ? 495 GLU C HG3  12 
ATOM 9911  N N    . GLY A 1 44 ? -26.846 -17.527 2.784   1.00 0.00 ? 496 GLY C N    12 
ATOM 9912  C CA   . GLY A 1 44 ? -26.553 -17.747 1.384   1.00 0.00 ? 496 GLY C CA   12 
ATOM 9913  C C    . GLY A 1 44 ? -26.341 -16.451 0.640   1.00 0.00 ? 496 GLY C C    12 
ATOM 9914  O O    . GLY A 1 44 ? -26.396 -16.411 -0.585  1.00 0.00 ? 496 GLY C O    12 
ATOM 9915  H H    . GLY A 1 44 ? -26.117 -17.366 3.421   1.00 0.00 ? 496 GLY C H    12 
ATOM 9916  H HA2  . GLY A 1 44 ? -25.662 -18.350 1.302   1.00 0.00 ? 496 GLY C HA2  12 
ATOM 9917  H HA3  . GLY A 1 44 ? -27.379 -18.278 0.932   1.00 0.00 ? 496 GLY C HA3  12 
ATOM 9918  N N    . ARG A 1 45 ? -26.109 -15.384 1.385   1.00 0.00 ? 497 ARG C N    12 
ATOM 9919  C CA   . ARG A 1 45 ? -25.837 -14.082 0.803   1.00 0.00 ? 497 ARG C CA   12 
ATOM 9920  C C    . ARG A 1 45 ? -24.468 -14.102 0.156   1.00 0.00 ? 497 ARG C C    12 
ATOM 9921  O O    . ARG A 1 45 ? -24.245 -13.490 -0.886  1.00 0.00 ? 497 ARG C O    12 
ATOM 9922  C CB   . ARG A 1 45 ? -25.883 -13.000 1.885   1.00 0.00 ? 497 ARG C CB   12 
ATOM 9923  C CG   . ARG A 1 45 ? -25.600 -11.576 1.393   1.00 0.00 ? 497 ARG C CG   12 
ATOM 9924  C CD   . ARG A 1 45 ? -26.710 -11.038 0.486   1.00 0.00 ? 497 ARG C CD   12 
ATOM 9925  N NE   . ARG A 1 45 ? -26.729 -11.682 -0.837  1.00 0.00 ? 497 ARG C NE   12 
ATOM 9926  C CZ   . ARG A 1 45 ? -27.774 -11.654 -1.675  1.00 0.00 ? 497 ARG C CZ   12 
ATOM 9927  N NH1  . ARG A 1 45 ? -28.883 -11.006 -1.341  1.00 0.00 ? 497 ARG C NH1  12 
ATOM 9928  N NH2  . ARG A 1 45 ? -27.701 -12.266 -2.846  1.00 0.00 ? 497 ARG C NH2  12 
ATOM 9929  H H    . ARG A 1 45 ? -26.121 -15.474 2.365   1.00 0.00 ? 497 ARG C H    12 
ATOM 9930  H HA   . ARG A 1 45 ? -26.586 -13.874 0.054   1.00 0.00 ? 497 ARG C HA   12 
ATOM 9931  H HB2  . ARG A 1 45 ? -26.862 -13.010 2.343   1.00 0.00 ? 497 ARG C HB2  12 
ATOM 9932  H HB3  . ARG A 1 45 ? -25.143 -13.252 2.637   1.00 0.00 ? 497 ARG C HB3  12 
ATOM 9933  H HG2  . ARG A 1 45 ? -25.505 -10.924 2.247   1.00 0.00 ? 497 ARG C HG2  12 
ATOM 9934  H HG3  . ARG A 1 45 ? -24.671 -11.582 0.841   1.00 0.00 ? 497 ARG C HG3  12 
ATOM 9935  H HD2  . ARG A 1 45 ? -27.662 -11.210 0.967   1.00 0.00 ? 497 ARG C HD2  12 
ATOM 9936  H HD3  . ARG A 1 45 ? -26.564 -9.976  0.357   1.00 0.00 ? 497 ARG C HD3  12 
ATOM 9937  H HE   . ARG A 1 45 ? -25.910 -12.158 -1.110  1.00 0.00 ? 497 ARG C HE   12 
ATOM 9938  H HH11 . ARG A 1 45 ? -28.957 -10.523 -0.464  1.00 0.00 ? 497 ARG C HH11 12 
ATOM 9939  H HH12 . ARG A 1 45 ? -29.673 -10.998 -1.962  1.00 0.00 ? 497 ARG C HH12 12 
ATOM 9940  H HH21 . ARG A 1 45 ? -26.870 -12.756 -3.117  1.00 0.00 ? 497 ARG C HH21 12 
ATOM 9941  H HH22 . ARG A 1 45 ? -28.476 -12.238 -3.482  1.00 0.00 ? 497 ARG C HH22 12 
ATOM 9942  N N    . ILE A 1 46 ? -23.563 -14.824 0.788   1.00 0.00 ? 498 ILE C N    12 
ATOM 9943  C CA   . ILE A 1 46 ? -22.213 -14.963 0.307   1.00 0.00 ? 498 ILE C CA   12 
ATOM 9944  C C    . ILE A 1 46 ? -21.988 -16.396 -0.142  1.00 0.00 ? 498 ILE C C    12 
ATOM 9945  O O    . ILE A 1 46 ? -22.255 -17.343 0.611   1.00 0.00 ? 498 ILE C O    12 
ATOM 9946  C CB   . ILE A 1 46 ? -21.185 -14.606 1.408   1.00 0.00 ? 498 ILE C CB   12 
ATOM 9947  C CG1  . ILE A 1 46 ? -21.482 -13.218 1.978   1.00 0.00 ? 498 ILE C CG1  12 
ATOM 9948  C CG2  . ILE A 1 46 ? -19.772 -14.656 0.848   1.00 0.00 ? 498 ILE C CG2  12 
ATOM 9949  C CD1  . ILE A 1 46 ? -20.646 -12.856 3.183   1.00 0.00 ? 498 ILE C CD1  12 
ATOM 9950  H H    . ILE A 1 46 ? -23.820 -15.293 1.605   1.00 0.00 ? 498 ILE C H    12 
ATOM 9951  H HA   . ILE A 1 46 ? -22.075 -14.296 -0.531  1.00 0.00 ? 498 ILE C HA   12 
ATOM 9952  H HB   . ILE A 1 46 ? -21.263 -15.336 2.198   1.00 0.00 ? 498 ILE C HB   12 
ATOM 9953  H HG12 . ILE A 1 46 ? -21.296 -12.477 1.214   1.00 0.00 ? 498 ILE C HG12 12 
ATOM 9954  H HG13 . ILE A 1 46 ? -22.521 -13.175 2.265   1.00 0.00 ? 498 ILE C HG13 12 
ATOM 9955  H HG21 . ILE A 1 46 ? -19.683 -13.949 0.037   1.00 0.00 ? 498 ILE C HG21 12 
ATOM 9956  H HG22 . ILE A 1 46 ? -19.562 -15.652 0.483   1.00 0.00 ? 498 ILE C HG22 12 
ATOM 9957  H HG23 . ILE A 1 46 ? -19.068 -14.401 1.626   1.00 0.00 ? 498 ILE C HG23 12 
ATOM 9958  H HD11 . ILE A 1 46 ? -19.598 -12.878 2.916   1.00 0.00 ? 498 ILE C HD11 12 
ATOM 9959  H HD12 . ILE A 1 46 ? -20.833 -13.563 3.975   1.00 0.00 ? 498 ILE C HD12 12 
ATOM 9960  H HD13 . ILE A 1 46 ? -20.911 -11.865 3.519   1.00 0.00 ? 498 ILE C HD13 12 
ATOM 9961  N N    . GLN A 1 47 ? -21.528 -16.556 -1.361  1.00 0.00 ? 499 GLN C N    12 
ATOM 9962  C CA   . GLN A 1 47 ? -21.277 -17.868 -1.909  1.00 0.00 ? 499 GLN C CA   12 
ATOM 9963  C C    . GLN A 1 47 ? -20.007 -18.471 -1.322  1.00 0.00 ? 499 GLN C C    12 
ATOM 9964  O O    . GLN A 1 47 ? -18.990 -17.789 -1.176  1.00 0.00 ? 499 GLN C O    12 
ATOM 9965  C CB   . GLN A 1 47 ? -21.166 -17.802 -3.435  1.00 0.00 ? 499 GLN C CB   12 
ATOM 9966  C CG   . GLN A 1 47 ? -20.035 -16.912 -3.942  1.00 0.00 ? 499 GLN C CG   12 
ATOM 9967  C CD   . GLN A 1 47 ? -19.879 -16.964 -5.448  1.00 0.00 ? 499 GLN C CD   12 
ATOM 9968  O OE1  . GLN A 1 47 ? -20.848 -17.176 -6.179  1.00 0.00 ? 499 GLN C OE1  12 
ATOM 9969  N NE2  . GLN A 1 47 ? -18.663 -16.778 -5.923  1.00 0.00 ? 499 GLN C NE2  12 
ATOM 9970  H H    . GLN A 1 47 ? -21.358 -15.763 -1.912  1.00 0.00 ? 499 GLN C H    12 
ATOM 9971  H HA   . GLN A 1 47 ? -22.113 -18.501 -1.651  1.00 0.00 ? 499 GLN C HA   12 
ATOM 9972  H HB2  . GLN A 1 47 ? -20.998 -18.799 -3.807  1.00 0.00 ? 499 GLN C HB2  12 
ATOM 9973  H HB3  . GLN A 1 47 ? -22.097 -17.430 -3.835  1.00 0.00 ? 499 GLN C HB3  12 
ATOM 9974  H HG2  . GLN A 1 47 ? -20.238 -15.892 -3.653  1.00 0.00 ? 499 GLN C HG2  12 
ATOM 9975  H HG3  . GLN A 1 47 ? -19.109 -17.235 -3.487  1.00 0.00 ? 499 GLN C HG3  12 
ATOM 9976  H HE21 . GLN A 1 47 ? -17.935 -16.614 -5.288  1.00 0.00 ? 499 GLN C HE21 12 
ATOM 9977  H HE22 . GLN A 1 47 ? -18.533 -16.810 -6.896  1.00 0.00 ? 499 GLN C HE22 12 
ATOM 9978  N N    . VAL A 1 48 ? -20.076 -19.737 -0.969  1.00 0.00 ? 500 VAL C N    12 
ATOM 9979  C CA   . VAL A 1 48 ? -18.923 -20.443 -0.466  1.00 0.00 ? 500 VAL C CA   12 
ATOM 9980  C C    . VAL A 1 48 ? -18.421 -21.406 -1.532  1.00 0.00 ? 500 VAL C C    12 
ATOM 9981  O O    . VAL A 1 48 ? -19.009 -22.464 -1.748  1.00 0.00 ? 500 VAL C O    12 
ATOM 9982  C CB   . VAL A 1 48 ? -19.257 -21.233 0.824   1.00 0.00 ? 500 VAL C CB   12 
ATOM 9983  C CG1  . VAL A 1 48 ? -18.034 -21.988 1.324   1.00 0.00 ? 500 VAL C CG1  12 
ATOM 9984  C CG2  . VAL A 1 48 ? -19.787 -20.298 1.903   1.00 0.00 ? 500 VAL C CG2  12 
ATOM 9985  H H    . VAL A 1 48 ? -20.928 -20.217 -1.052  1.00 0.00 ? 500 VAL C H    12 
ATOM 9986  H HA   . VAL A 1 48 ? -18.152 -19.720 -0.241  1.00 0.00 ? 500 VAL C HA   12 
ATOM 9987  H HB   . VAL A 1 48 ? -20.026 -21.954 0.590   1.00 0.00 ? 500 VAL C HB   12 
ATOM 9988  H HG11 . VAL A 1 48 ? -17.244 -21.288 1.548   1.00 0.00 ? 500 VAL C HG11 12 
ATOM 9989  H HG12 . VAL A 1 48 ? -17.700 -22.678 0.563   1.00 0.00 ? 500 VAL C HG12 12 
ATOM 9990  H HG13 . VAL A 1 48 ? -18.293 -22.537 2.218   1.00 0.00 ? 500 VAL C HG13 12 
ATOM 9991  H HG21 . VAL A 1 48 ? -20.679 -19.805 1.545   1.00 0.00 ? 500 VAL C HG21 12 
ATOM 9992  H HG22 . VAL A 1 48 ? -19.036 -19.557 2.138   1.00 0.00 ? 500 VAL C HG22 12 
ATOM 9993  H HG23 . VAL A 1 48 ? -20.020 -20.868 2.789   1.00 0.00 ? 500 VAL C HG23 12 
ATOM 9994  N N    . PRO A 1 49 ? -17.344 -21.040 -2.239  1.00 0.00 ? 501 PRO C N    12 
ATOM 9995  C CA   . PRO A 1 49 ? -16.773 -21.867 -3.285  1.00 0.00 ? 501 PRO C CA   12 
ATOM 9996  C C    . PRO A 1 49 ? -15.866 -22.948 -2.723  1.00 0.00 ? 501 PRO C C    12 
ATOM 9997  O O    . PRO A 1 49 ? -14.833 -22.653 -2.114  1.00 0.00 ? 501 PRO C O    12 
ATOM 9998  C CB   . PRO A 1 49 ? -15.950 -20.873 -4.136  1.00 0.00 ? 501 PRO C CB   12 
ATOM 9999  C CG   . PRO A 1 49 ? -16.143 -19.529 -3.495  1.00 0.00 ? 501 PRO C CG   12 
ATOM 10000 C CD   . PRO A 1 49 ? -16.612 -19.790 -2.096  1.00 0.00 ? 501 PRO C CD   12 
ATOM 10001 H HA   . PRO A 1 49 ? -17.536 -22.318 -3.898  1.00 0.00 ? 501 PRO C HA   12 
ATOM 10002 H HB2  . PRO A 1 49 ? -14.912 -21.167 -4.126  1.00 0.00 ? 501 PRO C HB2  12 
ATOM 10003 H HB3  . PRO A 1 49 ? -16.318 -20.880 -5.152  1.00 0.00 ? 501 PRO C HB3  12 
ATOM 10004 H HG2  . PRO A 1 49 ? -15.207 -18.991 -3.482  1.00 0.00 ? 501 PRO C HG2  12 
ATOM 10005 H HG3  . PRO A 1 49 ? -16.889 -18.968 -4.041  1.00 0.00 ? 501 PRO C HG3  12 
ATOM 10006 H HD2  . PRO A 1 49 ? -15.770 -19.907 -1.428  1.00 0.00 ? 501 PRO C HD2  12 
ATOM 10007 H HD3  . PRO A 1 49 ? -17.259 -18.993 -1.764  1.00 0.00 ? 501 PRO C HD3  12 
ATOM 10008 N N    . PHE A 1 50 ? -16.259 -24.189 -2.908  1.00 0.00 ? 502 PHE C N    12 
ATOM 10009 C CA   . PHE A 1 50 ? -15.458 -25.307 -2.463  1.00 0.00 ? 502 PHE C CA   12 
ATOM 10010 C C    . PHE A 1 50 ? -14.436 -25.649 -3.534  1.00 0.00 ? 502 PHE C C    12 
ATOM 10011 O O    . PHE A 1 50 ? -14.666 -25.361 -4.714  1.00 0.00 ? 502 PHE C O    12 
ATOM 10012 C CB   . PHE A 1 50 ? -16.340 -26.521 -2.152  1.00 0.00 ? 502 PHE C CB   12 
ATOM 10013 C CG   . PHE A 1 50 ? -17.200 -26.340 -0.935  1.00 0.00 ? 502 PHE C CG   12 
ATOM 10014 C CD1  . PHE A 1 50 ? -18.441 -25.744 -1.034  1.00 0.00 ? 502 PHE C CD1  12 
ATOM 10015 C CD2  . PHE A 1 50 ? -16.764 -26.767 0.309   1.00 0.00 ? 502 PHE C CD2  12 
ATOM 10016 C CE1  . PHE A 1 50 ? -19.237 -25.574 0.081   1.00 0.00 ? 502 PHE C CE1  12 
ATOM 10017 C CE2  . PHE A 1 50 ? -17.554 -26.603 1.428   1.00 0.00 ? 502 PHE C CE2  12 
ATOM 10018 C CZ   . PHE A 1 50 ? -18.792 -26.004 1.314   1.00 0.00 ? 502 PHE C CZ   12 
ATOM 10019 H H    . PHE A 1 50 ? -17.110 -24.359 -3.369  1.00 0.00 ? 502 PHE C H    12 
ATOM 10020 H HA   . PHE A 1 50 ? -14.945 -25.002 -1.565  1.00 0.00 ? 502 PHE C HA   12 
ATOM 10021 H HB2  . PHE A 1 50 ? -16.992 -26.708 -2.991  1.00 0.00 ? 502 PHE C HB2  12 
ATOM 10022 H HB3  . PHE A 1 50 ? -15.712 -27.384 -1.992  1.00 0.00 ? 502 PHE C HB3  12 
ATOM 10023 H HD1  . PHE A 1 50 ? -18.783 -25.407 -2.001  1.00 0.00 ? 502 PHE C HD1  12 
ATOM 10024 H HD2  . PHE A 1 50 ? -15.795 -27.236 0.398   1.00 0.00 ? 502 PHE C HD2  12 
ATOM 10025 H HE1  . PHE A 1 50 ? -20.205 -25.105 -0.013  1.00 0.00 ? 502 PHE C HE1  12 
ATOM 10026 H HE2  . PHE A 1 50 ? -17.202 -26.940 2.393   1.00 0.00 ? 502 PHE C HE2  12 
ATOM 10027 H HZ   . PHE A 1 50 ? -19.412 -25.872 2.190   1.00 0.00 ? 502 PHE C HZ   12 
ATOM 10028 N N    . PRO A 1 51 ? -13.286 -26.248 -3.147  1.00 0.00 ? 503 PRO C N    12 
ATOM 10029 C CA   . PRO A 1 51 ? -12.222 -26.610 -4.092  1.00 0.00 ? 503 PRO C CA   12 
ATOM 10030 C C    . PRO A 1 51 ? -12.765 -27.328 -5.316  1.00 0.00 ? 503 PRO C C    12 
ATOM 10031 O O    . PRO A 1 51 ? -13.422 -28.369 -5.209  1.00 0.00 ? 503 PRO C O    12 
ATOM 10032 C CB   . PRO A 1 51 ? -11.337 -27.540 -3.271  1.00 0.00 ? 503 PRO C CB   12 
ATOM 10033 C CG   . PRO A 1 51 ? -11.501 -27.059 -1.877  1.00 0.00 ? 503 PRO C CG   12 
ATOM 10034 C CD   . PRO A 1 51 ? -12.933 -26.613 -1.761  1.00 0.00 ? 503 PRO C CD   12 
ATOM 10035 H HA   . PRO A 1 51 ? -11.656 -25.746 -4.402  1.00 0.00 ? 503 PRO C HA   12 
ATOM 10036 H HB2  . PRO A 1 51 ? -11.676 -28.560 -3.387  1.00 0.00 ? 503 PRO C HB2  12 
ATOM 10037 H HB3  . PRO A 1 51 ? -10.313 -27.453 -3.602  1.00 0.00 ? 503 PRO C HB3  12 
ATOM 10038 H HG2  . PRO A 1 51 ? -11.300 -27.861 -1.185  1.00 0.00 ? 503 PRO C HG2  12 
ATOM 10039 H HG3  . PRO A 1 51 ? -10.834 -26.229 -1.695  1.00 0.00 ? 503 PRO C HG3  12 
ATOM 10040 H HD2  . PRO A 1 51 ? -13.553 -27.422 -1.404  1.00 0.00 ? 503 PRO C HD2  12 
ATOM 10041 H HD3  . PRO A 1 51 ? -13.008 -25.758 -1.108  1.00 0.00 ? 503 PRO C HD3  12 
ATOM 10042 N N    . THR A 1 52 ? -12.496 -26.771 -6.470  1.00 0.00 ? 504 THR C N    12 
ATOM 10043 C CA   . THR A 1 52 ? -12.982 -27.309 -7.707  1.00 0.00 ? 504 THR C CA   12 
ATOM 10044 C C    . THR A 1 52 ? -11.852 -27.375 -8.738  1.00 0.00 ? 504 THR C C    12 
ATOM 10045 O O    . THR A 1 52 ? -11.446 -28.499 -9.100  1.00 0.00 ? 504 THR C O    12 
ATOM 10046 C CB   . THR A 1 52 ? -14.207 -26.487 -8.234  1.00 0.00 ? 504 THR C CB   12 
ATOM 10047 O OG1  . THR A 1 52 ? -14.653 -26.987 -9.503  1.00 0.00 ? 504 THR C OG1  12 
ATOM 10048 C CG2  . THR A 1 52 ? -13.880 -25.000 -8.349  1.00 0.00 ? 504 THR C CG2  12 
ATOM 10049 O OXT  . THR A 1 52 ? -11.330 -26.310 -9.134  1.00 0.00 ? 504 THR C OXT  12 
ATOM 10050 H H    . THR A 1 52 ? -11.943 -25.961 -6.494  1.00 0.00 ? 504 THR C H    12 
ATOM 10051 H HA   . THR A 1 52 ? -13.314 -28.319 -7.505  1.00 0.00 ? 504 THR C HA   12 
ATOM 10052 H HB   . THR A 1 52 ? -15.012 -26.604 -7.522  1.00 0.00 ? 504 THR C HB   12 
ATOM 10053 H HG1  . THR A 1 52 ? -15.357 -27.634 -9.353  1.00 0.00 ? 504 THR C HG1  12 
ATOM 10054 H HG21 . THR A 1 52 ? -13.057 -24.864 -9.036  1.00 0.00 ? 504 THR C HG21 12 
ATOM 10055 H HG22 . THR A 1 52 ? -13.605 -24.617 -7.378  1.00 0.00 ? 504 THR C HG22 12 
ATOM 10056 H HG23 . THR A 1 52 ? -14.747 -24.467 -8.712  1.00 0.00 ? 504 THR C HG23 12 
ATOM 10057 N N    . SER A 1 1  ? -8.107  2.979   4.873   1.00 0.00 ? 453 SER C N    13 
ATOM 10058 C CA   . SER A 1 1  ? -8.948  3.098   6.073   1.00 0.00 ? 453 SER C CA   13 
ATOM 10059 C C    . SER A 1 1  ? -9.840  1.863   6.263   1.00 0.00 ? 453 SER C C    13 
ATOM 10060 O O    . SER A 1 1  ? -10.876 1.934   6.922   1.00 0.00 ? 453 SER C O    13 
ATOM 10061 C CB   . SER A 1 1  ? -9.806  4.360   5.972   1.00 0.00 ? 453 SER C CB   13 
ATOM 10062 O OG   . SER A 1 1  ? -8.993  5.511   5.778   1.00 0.00 ? 453 SER C OG   13 
ATOM 10063 H H1   . SER A 1 1  ? -8.698  2.799   4.036   1.00 0.00 ? 453 SER C H1   13 
ATOM 10064 H H2   . SER A 1 1  ? -7.417  2.208   4.976   1.00 0.00 ? 453 SER C H2   13 
ATOM 10065 H H3   . SER A 1 1  ? -7.592  3.868   4.720   1.00 0.00 ? 453 SER C H3   13 
ATOM 10066 H HA   . SER A 1 1  ? -8.299  3.185   6.930   1.00 0.00 ? 453 SER C HA   13 
ATOM 10067 H HB2  . SER A 1 1  ? -10.484 4.266   5.137   1.00 0.00 ? 453 SER C HB2  13 
ATOM 10068 H HB3  . SER A 1 1  ? -10.372 4.482   6.883   1.00 0.00 ? 453 SER C HB3  13 
ATOM 10069 H HG   . SER A 1 1  ? -8.546  5.726   6.607   1.00 0.00 ? 453 SER C HG   13 
ATOM 10070 N N    . ASN A 1 2  ? -9.421  0.724   5.712   1.00 0.00 ? 454 ASN C N    13 
ATOM 10071 C CA   . ASN A 1 2  ? -10.204 -0.514  5.811   1.00 0.00 ? 454 ASN C CA   13 
ATOM 10072 C C    . ASN A 1 2  ? -9.753  -1.374  6.983   1.00 0.00 ? 454 ASN C C    13 
ATOM 10073 O O    . ASN A 1 2  ? -10.123 -2.543  7.076   1.00 0.00 ? 454 ASN C O    13 
ATOM 10074 C CB   . ASN A 1 2  ? -10.113 -1.324  4.517   1.00 0.00 ? 454 ASN C CB   13 
ATOM 10075 C CG   . ASN A 1 2  ? -11.137 -0.908  3.483   1.00 0.00 ? 454 ASN C CG   13 
ATOM 10076 O OD1  . ASN A 1 2  ? -11.572 0.245   3.440   1.00 0.00 ? 454 ASN C OD1  13 
ATOM 10077 N ND2  . ASN A 1 2  ? -11.524 -1.843  2.643   1.00 0.00 ? 454 ASN C ND2  13 
ATOM 10078 H H    . ASN A 1 2  ? -8.563  0.702   5.230   1.00 0.00 ? 454 ASN C H    13 
ATOM 10079 H HA   . ASN A 1 2  ? -11.234 -0.233  5.966   1.00 0.00 ? 454 ASN C HA   13 
ATOM 10080 H HB2  . ASN A 1 2  ? -9.131  -1.198  4.088   1.00 0.00 ? 454 ASN C HB2  13 
ATOM 10081 H HB3  . ASN A 1 2  ? -10.266 -2.369  4.748   1.00 0.00 ? 454 ASN C HB3  13 
ATOM 10082 H HD21 . ASN A 1 2  ? -11.131 -2.738  2.732   1.00 0.00 ? 454 ASN C HD21 13 
ATOM 10083 H HD22 . ASN A 1 2  ? -12.199 -1.619  1.961   1.00 0.00 ? 454 ASN C HD22 13 
ATOM 10084 N N    . SER A 1 3  ? -8.978  -0.787  7.882   1.00 0.00 ? 455 SER C N    13 
ATOM 10085 C CA   . SER A 1 3  ? -8.453  -1.503  9.040   1.00 0.00 ? 455 SER C CA   13 
ATOM 10086 C C    . SER A 1 3  ? -9.571  -2.124  9.885   1.00 0.00 ? 455 SER C C    13 
ATOM 10087 O O    . SER A 1 3  ? -9.414  -3.223  10.422  1.00 0.00 ? 455 SER C O    13 
ATOM 10088 C CB   . SER A 1 3  ? -7.604  -0.563  9.888   1.00 0.00 ? 455 SER C CB   13 
ATOM 10089 O OG   . SER A 1 3  ? -6.581  0.029   9.102   1.00 0.00 ? 455 SER C OG   13 
ATOM 10090 H H    . SER A 1 3  ? -8.739  0.154   7.765   1.00 0.00 ? 455 SER C H    13 
ATOM 10091 H HA   . SER A 1 3  ? -7.822  -2.299  8.673   1.00 0.00 ? 455 SER C HA   13 
ATOM 10092 H HB2  . SER A 1 3  ? -8.228  0.219   10.294  1.00 0.00 ? 455 SER C HB2  13 
ATOM 10093 H HB3  . SER A 1 3  ? -7.147  -1.118  10.695  1.00 0.00 ? 455 SER C HB3  13 
ATOM 10094 H HG   . SER A 1 3  ? -5.725  -0.287  9.422   1.00 0.00 ? 455 SER C HG   13 
ATOM 10095 N N    . GLN A 1 4  ? -10.700 -1.430  9.987   1.00 0.00 ? 456 GLN C N    13 
ATOM 10096 C CA   . GLN A 1 4  ? -11.824 -1.927  10.765  1.00 0.00 ? 456 GLN C CA   13 
ATOM 10097 C C    . GLN A 1 4  ? -12.499 -3.086  10.040  1.00 0.00 ? 456 GLN C C    13 
ATOM 10098 O O    . GLN A 1 4  ? -12.799 -4.116  10.643  1.00 0.00 ? 456 GLN C O    13 
ATOM 10099 C CB   . GLN A 1 4  ? -12.855 -0.816  11.054  1.00 0.00 ? 456 GLN C CB   13 
ATOM 10100 C CG   . GLN A 1 4  ? -12.307 0.407   11.795  1.00 0.00 ? 456 GLN C CG   13 
ATOM 10101 C CD   . GLN A 1 4  ? -11.526 1.359   10.900  1.00 0.00 ? 456 GLN C CD   13 
ATOM 10102 O OE1  . GLN A 1 4  ? -10.307 1.240   10.748  1.00 0.00 ? 456 GLN C OE1  13 
ATOM 10103 N NE2  . GLN A 1 4  ? -12.217 2.310   10.307  1.00 0.00 ? 456 GLN C NE2  13 
ATOM 10104 H H    . GLN A 1 4  ? -10.779 -0.568  9.526   1.00 0.00 ? 456 GLN C H    13 
ATOM 10105 H HA   . GLN A 1 4  ? -11.431 -2.293  11.704  1.00 0.00 ? 456 GLN C HA   13 
ATOM 10106 H HB2  . GLN A 1 4  ? -13.277 -0.481  10.121  1.00 0.00 ? 456 GLN C HB2  13 
ATOM 10107 H HB3  . GLN A 1 4  ? -13.648 -1.239  11.652  1.00 0.00 ? 456 GLN C HB3  13 
ATOM 10108 H HG2  . GLN A 1 4  ? -13.134 0.948   12.226  1.00 0.00 ? 456 GLN C HG2  13 
ATOM 10109 H HG3  . GLN A 1 4  ? -11.655 0.064   12.586  1.00 0.00 ? 456 GLN C HG3  13 
ATOM 10110 H HE21 . GLN A 1 4  ? -13.186 2.353   10.469  1.00 0.00 ? 456 GLN C HE21 13 
ATOM 10111 H HE22 . GLN A 1 4  ? -11.740 2.943   9.732   1.00 0.00 ? 456 GLN C HE22 13 
ATOM 10112 N N    . LEU A 1 5  ? -12.718 -2.917  8.739   1.00 0.00 ? 457 LEU C N    13 
ATOM 10113 C CA   . LEU A 1 5  ? -13.359 -3.951  7.928   1.00 0.00 ? 457 LEU C CA   13 
ATOM 10114 C C    . LEU A 1 5  ? -12.517 -5.216  7.904   1.00 0.00 ? 457 LEU C C    13 
ATOM 10115 O O    . LEU A 1 5  ? -13.037 -6.318  8.084   1.00 0.00 ? 457 LEU C O    13 
ATOM 10116 C CB   . LEU A 1 5  ? -13.597 -3.462  6.493   1.00 0.00 ? 457 LEU C CB   13 
ATOM 10117 C CG   . LEU A 1 5  ? -14.416 -2.175  6.340   1.00 0.00 ? 457 LEU C CG   13 
ATOM 10118 C CD1  . LEU A 1 5  ? -14.746 -1.928  4.887   1.00 0.00 ? 457 LEU C CD1  13 
ATOM 10119 C CD2  . LEU A 1 5  ? -15.682 -2.230  7.171   1.00 0.00 ? 457 LEU C CD2  13 
ATOM 10120 H H    . LEU A 1 5  ? -12.445 -2.075  8.315   1.00 0.00 ? 457 LEU C H    13 
ATOM 10121 H HA   . LEU A 1 5  ? -14.313 -4.182  8.381   1.00 0.00 ? 457 LEU C HA   13 
ATOM 10122 H HB2  . LEU A 1 5  ? -12.635 -3.302  6.031   1.00 0.00 ? 457 LEU C HB2  13 
ATOM 10123 H HB3  . LEU A 1 5  ? -14.106 -4.248  5.953   1.00 0.00 ? 457 LEU C HB3  13 
ATOM 10124 H HG   . LEU A 1 5  ? -13.823 -1.343  6.685   1.00 0.00 ? 457 LEU C HG   13 
ATOM 10125 H HD11 . LEU A 1 5  ? -15.318 -2.761  4.506   1.00 0.00 ? 457 LEU C HD11 13 
ATOM 10126 H HD12 . LEU A 1 5  ? -13.830 -1.827  4.322   1.00 0.00 ? 457 LEU C HD12 13 
ATOM 10127 H HD13 . LEU A 1 5  ? -15.327 -1.022  4.800   1.00 0.00 ? 457 LEU C HD13 13 
ATOM 10128 H HD21 . LEU A 1 5  ? -15.418 -2.299  8.216   1.00 0.00 ? 457 LEU C HD21 13 
ATOM 10129 H HD22 . LEU A 1 5  ? -16.262 -3.096  6.889   1.00 0.00 ? 457 LEU C HD22 13 
ATOM 10130 H HD23 . LEU A 1 5  ? -16.263 -1.336  7.005   1.00 0.00 ? 457 LEU C HD23 13 
ATOM 10131 N N    . ASN A 1 6  ? -11.213 -5.048  7.699   1.00 0.00 ? 458 ASN C N    13 
ATOM 10132 C CA   . ASN A 1 6  ? -10.282 -6.177  7.660   1.00 0.00 ? 458 ASN C CA   13 
ATOM 10133 C C    . ASN A 1 6  ? -10.282 -6.920  8.986   1.00 0.00 ? 458 ASN C C    13 
ATOM 10134 O O    . ASN A 1 6  ? -10.230 -8.149  9.020   1.00 0.00 ? 458 ASN C O    13 
ATOM 10135 C CB   . ASN A 1 6  ? -8.856  -5.709  7.326   1.00 0.00 ? 458 ASN C CB   13 
ATOM 10136 C CG   . ASN A 1 6  ? -8.715  -5.174  5.909   1.00 0.00 ? 458 ASN C CG   13 
ATOM 10137 O OD1  . ASN A 1 6  ? -9.426  -5.590  4.996   1.00 0.00 ? 458 ASN C OD1  13 
ATOM 10138 N ND2  . ASN A 1 6  ? -7.791  -4.255  5.714   1.00 0.00 ? 458 ASN C ND2  13 
ATOM 10139 H H    . ASN A 1 6  ? -10.867 -4.137  7.564   1.00 0.00 ? 458 ASN C H    13 
ATOM 10140 H HA   . ASN A 1 6  ? -10.618 -6.852  6.885   1.00 0.00 ? 458 ASN C HA   13 
ATOM 10141 H HB2  . ASN A 1 6  ? -8.576  -4.923  8.012   1.00 0.00 ? 458 ASN C HB2  13 
ATOM 10142 H HB3  . ASN A 1 6  ? -8.178  -6.540  7.447   1.00 0.00 ? 458 ASN C HB3  13 
ATOM 10143 H HD21 . ASN A 1 6  ? -7.248  -3.966  6.480   1.00 0.00 ? 458 ASN C HD21 13 
ATOM 10144 H HD22 . ASN A 1 6  ? -7.676  -3.893  4.812   1.00 0.00 ? 458 ASN C HD22 13 
ATOM 10145 N N    . ALA A 1 7  ? -10.357 -6.169  10.078  1.00 0.00 ? 459 ALA C N    13 
ATOM 10146 C CA   . ALA A 1 7  ? -10.376 -6.751  11.410  1.00 0.00 ? 459 ALA C CA   13 
ATOM 10147 C C    . ALA A 1 7  ? -11.651 -7.553  11.634  1.00 0.00 ? 459 ALA C C    13 
ATOM 10148 O O    . ALA A 1 7  ? -11.602 -8.682  12.126  1.00 0.00 ? 459 ALA C O    13 
ATOM 10149 C CB   . ALA A 1 7  ? -10.236 -5.668  12.465  1.00 0.00 ? 459 ALA C CB   13 
ATOM 10150 H H    . ALA A 1 7  ? -10.398 -5.192  9.984   1.00 0.00 ? 459 ALA C H    13 
ATOM 10151 H HA   . ALA A 1 7  ? -9.527  -7.415  11.490  1.00 0.00 ? 459 ALA C HA   13 
ATOM 10152 H HB1  . ALA A 1 7  ? -10.209 -6.122  13.444  1.00 0.00 ? 459 ALA C HB1  13 
ATOM 10153 H HB2  . ALA A 1 7  ? -11.079 -4.995  12.403  1.00 0.00 ? 459 ALA C HB2  13 
ATOM 10154 H HB3  . ALA A 1 7  ? -9.323  -5.117  12.296  1.00 0.00 ? 459 ALA C HB3  13 
ATOM 10155 N N    . MET A 1 8  ? -12.791 -6.968  11.269  1.00 0.00 ? 460 MET C N    13 
ATOM 10156 C CA   . MET A 1 8  ? -14.078 -7.636  11.427  1.00 0.00 ? 460 MET C CA   13 
ATOM 10157 C C    . MET A 1 8  ? -14.137 -8.899  10.585  1.00 0.00 ? 460 MET C C    13 
ATOM 10158 O O    . MET A 1 8  ? -14.479 -9.975  11.082  1.00 0.00 ? 460 MET C O    13 
ATOM 10159 C CB   . MET A 1 8  ? -15.233 -6.705  11.045  1.00 0.00 ? 460 MET C CB   13 
ATOM 10160 C CG   . MET A 1 8  ? -15.348 -5.464  11.914  1.00 0.00 ? 460 MET C CG   13 
ATOM 10161 S SD   . MET A 1 8  ? -16.893 -4.577  11.651  1.00 0.00 ? 460 MET C SD   13 
ATOM 10162 C CE   . MET A 1 8  ? -16.684 -4.060  9.957   1.00 0.00 ? 460 MET C CE   13 
ATOM 10163 H H    . MET A 1 8  ? -12.767 -6.061  10.890  1.00 0.00 ? 460 MET C H    13 
ATOM 10164 H HA   . MET A 1 8  ? -14.180 -7.908  12.466  1.00 0.00 ? 460 MET C HA   13 
ATOM 10165 H HB2  . MET A 1 8  ? -15.108 -6.392  10.020  1.00 0.00 ? 460 MET C HB2  13 
ATOM 10166 H HB3  . MET A 1 8  ? -16.156 -7.254  11.118  1.00 0.00 ? 460 MET C HB3  13 
ATOM 10167 H HG2  . MET A 1 8  ? -15.281 -5.748  12.951  1.00 0.00 ? 460 MET C HG2  13 
ATOM 10168 H HG3  . MET A 1 8  ? -14.532 -4.800  11.663  1.00 0.00 ? 460 MET C HG3  13 
ATOM 10169 H HE1  . MET A 1 8  ? -16.539 -4.926  9.325   1.00 0.00 ? 460 MET C HE1  13 
ATOM 10170 H HE2  . MET A 1 8  ? -15.817 -3.423  9.893   1.00 0.00 ? 460 MET C HE2  13 
ATOM 10171 H HE3  . MET A 1 8  ? -17.559 -3.518  9.632   1.00 0.00 ? 460 MET C HE3  13 
ATOM 10172 N N    . ALA A 1 9  ? -13.780 -8.769  9.315   1.00 0.00 ? 461 ALA C N    13 
ATOM 10173 C CA   . ALA A 1 9  ? -13.791 -9.893  8.393   1.00 0.00 ? 461 ALA C CA   13 
ATOM 10174 C C    . ALA A 1 9  ? -12.833 -10.982 8.849   1.00 0.00 ? 461 ALA C C    13 
ATOM 10175 O O    . ALA A 1 9  ? -13.083 -12.171 8.646   1.00 0.00 ? 461 ALA C O    13 
ATOM 10176 C CB   . ALA A 1 9  ? -13.430 -9.427  6.995   1.00 0.00 ? 461 ALA C CB   13 
ATOM 10177 H H    . ALA A 1 9  ? -13.501 -7.885  8.981   1.00 0.00 ? 461 ALA C H    13 
ATOM 10178 H HA   . ALA A 1 9  ? -14.793 -10.295 8.367   1.00 0.00 ? 461 ALA C HA   13 
ATOM 10179 H HB1  . ALA A 1 9  ? -13.487 -10.260 6.311   1.00 0.00 ? 461 ALA C HB1  13 
ATOM 10180 H HB2  . ALA A 1 9  ? -12.426 -9.030  6.999   1.00 0.00 ? 461 ALA C HB2  13 
ATOM 10181 H HB3  . ALA A 1 9  ? -14.120 -8.656  6.684   1.00 0.00 ? 461 ALA C HB3  13 
ATOM 10182 N N    . HIS A 1 10 ? -11.741 -10.567 9.477   1.00 0.00 ? 462 HIS C N    13 
ATOM 10183 C CA   . HIS A 1 10 ? -10.745 -11.497 9.979   1.00 0.00 ? 462 HIS C CA   13 
ATOM 10184 C C    . HIS A 1 10 ? -11.365 -12.436 10.999  1.00 0.00 ? 462 HIS C C    13 
ATOM 10185 O O    . HIS A 1 10 ? -11.109 -13.630 10.977  1.00 0.00 ? 462 HIS C O    13 
ATOM 10186 C CB   . HIS A 1 10 ? -9.576  -10.742 10.620  1.00 0.00 ? 462 HIS C CB   13 
ATOM 10187 C CG   . HIS A 1 10 ? -8.327  -11.563 10.781  1.00 0.00 ? 462 HIS C CG   13 
ATOM 10188 N ND1  . HIS A 1 10 ? -8.325  -12.938 10.939  1.00 0.00 ? 462 HIS C ND1  13 
ATOM 10189 C CD2  . HIS A 1 10 ? -7.030  -11.194 10.782  1.00 0.00 ? 462 HIS C CD2  13 
ATOM 10190 C CE1  . HIS A 1 10 ? -7.086  -13.366 11.027  1.00 0.00 ? 462 HIS C CE1  13 
ATOM 10191 N NE2  . HIS A 1 10 ? -6.281  -12.330 10.933  1.00 0.00 ? 462 HIS C NE2  13 
ATOM 10192 H H    . HIS A 1 10 ? -11.597 -9.602  9.594   1.00 0.00 ? 462 HIS C H    13 
ATOM 10193 H HA   . HIS A 1 10 ? -10.373 -12.078 9.152   1.00 0.00 ? 462 HIS C HA   13 
ATOM 10194 H HB2  . HIS A 1 10 ? -9.330  -9.889  10.005  1.00 0.00 ? 462 HIS C HB2  13 
ATOM 10195 H HB3  . HIS A 1 10 ? -9.877  -10.396 11.597  1.00 0.00 ? 462 HIS C HB3  13 
ATOM 10196 H HD1  . HIS A 1 10 ? -9.119  -13.521 10.981  1.00 0.00 ? 462 HIS C HD1  13 
ATOM 10197 H HD2  . HIS A 1 10 ? -6.652  -10.185 10.683  1.00 0.00 ? 462 HIS C HD2  13 
ATOM 10198 H HE1  . HIS A 1 10 ? -6.779  -14.393 11.155  1.00 0.00 ? 462 HIS C HE1  13 
ATOM 10199 H HE2  . HIS A 1 10 ? -5.320  -12.393 10.737  1.00 0.00 ? 462 HIS C HE2  13 
ATOM 10200 N N    . GLN A 1 11 ? -12.196 -11.888 11.874  1.00 0.00 ? 463 GLN C N    13 
ATOM 10201 C CA   . GLN A 1 11 ? -12.819 -12.677 12.937  1.00 0.00 ? 463 GLN C CA   13 
ATOM 10202 C C    . GLN A 1 11 ? -13.825 -13.649 12.364  1.00 0.00 ? 463 GLN C C    13 
ATOM 10203 O O    . GLN A 1 11 ? -14.005 -14.753 12.882  1.00 0.00 ? 463 GLN C O    13 
ATOM 10204 C CB   . GLN A 1 11 ? -13.485 -11.763 13.968  1.00 0.00 ? 463 GLN C CB   13 
ATOM 10205 C CG   . GLN A 1 11 ? -12.606 -10.597 14.389  1.00 0.00 ? 463 GLN C CG   13 
ATOM 10206 C CD   . GLN A 1 11 ? -11.184 -11.020 14.713  1.00 0.00 ? 463 GLN C CD   13 
ATOM 10207 O OE1  . GLN A 1 11 ? -10.944 -12.109 15.232  1.00 0.00 ? 463 GLN C OE1  13 
ATOM 10208 N NE2  . GLN A 1 11 ? -10.234 -10.182 14.363  1.00 0.00 ? 463 GLN C NE2  13 
ATOM 10209 H H    . GLN A 1 11 ? -12.402 -10.930 11.804  1.00 0.00 ? 463 GLN C H    13 
ATOM 10210 H HA   . GLN A 1 11 ? -12.039 -13.244 13.426  1.00 0.00 ? 463 GLN C HA   13 
ATOM 10211 H HB2  . GLN A 1 11 ? -14.397 -11.369 13.546  1.00 0.00 ? 463 GLN C HB2  13 
ATOM 10212 H HB3  . GLN A 1 11 ? -13.724 -12.343 14.845  1.00 0.00 ? 463 GLN C HB3  13 
ATOM 10213 H HG2  . GLN A 1 11 ? -12.575 -9.877  13.583  1.00 0.00 ? 463 GLN C HG2  13 
ATOM 10214 H HG3  . GLN A 1 11 ? -13.039 -10.135 15.264  1.00 0.00 ? 463 GLN C HG3  13 
ATOM 10215 H HE21 . GLN A 1 11 ? -10.492 -9.341  13.924  1.00 0.00 ? 463 GLN C HE21 13 
ATOM 10216 H HE22 . GLN A 1 11 ? -9.304  -10.440 14.532  1.00 0.00 ? 463 GLN C HE22 13 
ATOM 10217 N N    . ILE A 1 12 ? -14.470 -13.243 11.287  1.00 0.00 ? 464 ILE C N    13 
ATOM 10218 C CA   . ILE A 1 12 ? -15.418 -14.103 10.608  1.00 0.00 ? 464 ILE C CA   13 
ATOM 10219 C C    . ILE A 1 12 ? -14.683 -15.261 9.962   1.00 0.00 ? 464 ILE C C    13 
ATOM 10220 O O    . ILE A 1 12 ? -15.143 -16.388 9.993   1.00 0.00 ? 464 ILE C O    13 
ATOM 10221 C CB   . ILE A 1 12 ? -16.219 -13.338 9.540   1.00 0.00 ? 464 ILE C CB   13 
ATOM 10222 C CG1  . ILE A 1 12 ? -16.876 -12.114 10.169  1.00 0.00 ? 464 ILE C CG1  13 
ATOM 10223 C CG2  . ILE A 1 12 ? -17.270 -14.249 8.914   1.00 0.00 ? 464 ILE C CG2  13 
ATOM 10224 C CD1  . ILE A 1 12 ? -17.594 -11.223 9.186   1.00 0.00 ? 464 ILE C CD1  13 
ATOM 10225 H H    . ILE A 1 12 ? -14.308 -12.338 10.947  1.00 0.00 ? 464 ILE C H    13 
ATOM 10226 H HA   . ILE A 1 12 ? -16.105 -14.493 11.345  1.00 0.00 ? 464 ILE C HA   13 
ATOM 10227 H HB   . ILE A 1 12 ? -15.538 -13.016 8.766   1.00 0.00 ? 464 ILE C HB   13 
ATOM 10228 H HG12 . ILE A 1 12 ? -17.598 -12.445 10.901  1.00 0.00 ? 464 ILE C HG12 13 
ATOM 10229 H HG13 . ILE A 1 12 ? -16.118 -11.526 10.662  1.00 0.00 ? 464 ILE C HG13 13 
ATOM 10230 H HG21 . ILE A 1 12 ? -16.791 -15.113 8.475   1.00 0.00 ? 464 ILE C HG21 13 
ATOM 10231 H HG22 . ILE A 1 12 ? -17.804 -13.705 8.149   1.00 0.00 ? 464 ILE C HG22 13 
ATOM 10232 H HG23 . ILE A 1 12 ? -17.963 -14.572 9.677   1.00 0.00 ? 464 ILE C HG23 13 
ATOM 10233 H HD11 . ILE A 1 12 ? -16.906 -10.913 8.413   1.00 0.00 ? 464 ILE C HD11 13 
ATOM 10234 H HD12 . ILE A 1 12 ? -17.967 -10.350 9.703   1.00 0.00 ? 464 ILE C HD12 13 
ATOM 10235 H HD13 . ILE A 1 12 ? -18.417 -11.763 8.742   1.00 0.00 ? 464 ILE C HD13 13 
ATOM 10236 N N    . GLN A 1 13 ? -13.519 -14.970 9.399   1.00 0.00 ? 465 GLN C N    13 
ATOM 10237 C CA   . GLN A 1 13 ? -12.684 -15.993 8.780   1.00 0.00 ? 465 GLN C CA   13 
ATOM 10238 C C    . GLN A 1 13 ? -12.160 -16.965 9.847   1.00 0.00 ? 465 GLN C C    13 
ATOM 10239 O O    . GLN A 1 13 ? -11.857 -18.121 9.558   1.00 0.00 ? 465 GLN C O    13 
ATOM 10240 C CB   . GLN A 1 13 ? -11.520 -15.337 8.029   1.00 0.00 ? 465 GLN C CB   13 
ATOM 10241 C CG   . GLN A 1 13 ? -10.625 -16.312 7.267   1.00 0.00 ? 465 GLN C CG   13 
ATOM 10242 C CD   . GLN A 1 13 ? -11.365 -17.123 6.208   1.00 0.00 ? 465 GLN C CD   13 
ATOM 10243 O OE1  . GLN A 1 13 ? -10.994 -18.256 5.915   1.00 0.00 ? 465 GLN C OE1  13 
ATOM 10244 N NE2  . GLN A 1 13 ? -12.405 -16.551 5.625   1.00 0.00 ? 465 GLN C NE2  13 
ATOM 10245 H H    . GLN A 1 13 ? -13.215 -14.035 9.390   1.00 0.00 ? 465 GLN C H    13 
ATOM 10246 H HA   . GLN A 1 13 ? -13.295 -16.541 8.079   1.00 0.00 ? 465 GLN C HA   13 
ATOM 10247 H HB2  . GLN A 1 13 ? -11.920 -14.625 7.324   1.00 0.00 ? 465 GLN C HB2  13 
ATOM 10248 H HB3  . GLN A 1 13 ? -10.908 -14.810 8.749   1.00 0.00 ? 465 GLN C HB3  13 
ATOM 10249 H HG2  . GLN A 1 13 ? -9.845  -15.750 6.775   1.00 0.00 ? 465 GLN C HG2  13 
ATOM 10250 H HG3  . GLN A 1 13 ? -10.178 -16.994 7.975   1.00 0.00 ? 465 GLN C HG3  13 
ATOM 10251 H HE21 . GLN A 1 13 ? -12.652 -15.643 5.896   1.00 0.00 ? 465 GLN C HE21 13 
ATOM 10252 H HE22 . GLN A 1 13 ? -12.890 -17.068 4.943   1.00 0.00 ? 465 GLN C HE22 13 
ATOM 10253 N N    . GLU A 1 14 ? -12.057 -16.481 11.079  1.00 0.00 ? 466 GLU C N    13 
ATOM 10254 C CA   . GLU A 1 14 ? -11.620 -17.305 12.194  1.00 0.00 ? 466 GLU C CA   13 
ATOM 10255 C C    . GLU A 1 14 ? -12.730 -18.273 12.600  1.00 0.00 ? 466 GLU C C    13 
ATOM 10256 O O    . GLU A 1 14 ? -12.466 -19.397 13.028  1.00 0.00 ? 466 GLU C O    13 
ATOM 10257 C CB   . GLU A 1 14 ? -11.229 -16.427 13.387  1.00 0.00 ? 466 GLU C CB   13 
ATOM 10258 C CG   . GLU A 1 14 ? -10.114 -15.436 13.095  1.00 0.00 ? 466 GLU C CG   13 
ATOM 10259 C CD   . GLU A 1 14 ? -8.842  -16.096 12.615  1.00 0.00 ? 466 GLU C CD   13 
ATOM 10260 O OE1  . GLU A 1 14 ? -8.025  -16.509 13.463  1.00 0.00 ? 466 GLU C OE1  13 
ATOM 10261 O OE2  . GLU A 1 14 ? -8.647  -16.193 11.388  1.00 0.00 ? 466 GLU C OE2  13 
ATOM 10262 H H    . GLU A 1 14 ? -12.271 -15.538 11.242  1.00 0.00 ? 466 GLU C H    13 
ATOM 10263 H HA   . GLU A 1 14 ? -10.758 -17.872 11.874  1.00 0.00 ? 466 GLU C HA   13 
ATOM 10264 H HB2  . GLU A 1 14 ? -12.098 -15.868 13.699  1.00 0.00 ? 466 GLU C HB2  13 
ATOM 10265 H HB3  . GLU A 1 14 ? -10.916 -17.060 14.199  1.00 0.00 ? 466 GLU C HB3  13 
ATOM 10266 H HG2  . GLU A 1 14 ? -10.453 -14.757 12.324  1.00 0.00 ? 466 GLU C HG2  13 
ATOM 10267 H HG3  . GLU A 1 14 ? -9.899  -14.878 13.995  1.00 0.00 ? 466 GLU C HG3  13 
ATOM 10268 N N    . MET A 1 15 ? -13.971 -17.825 12.456  1.00 0.00 ? 467 MET C N    13 
ATOM 10269 C CA   . MET A 1 15 ? -15.128 -18.640 12.793  1.00 0.00 ? 467 MET C CA   13 
ATOM 10270 C C    . MET A 1 15 ? -15.523 -19.528 11.622  1.00 0.00 ? 467 MET C C    13 
ATOM 10271 O O    . MET A 1 15 ? -15.741 -20.725 11.781  1.00 0.00 ? 467 MET C O    13 
ATOM 10272 C CB   . MET A 1 15 ? -16.320 -17.753 13.167  1.00 0.00 ? 467 MET C CB   13 
ATOM 10273 C CG   . MET A 1 15 ? -16.114 -16.904 14.405  1.00 0.00 ? 467 MET C CG   13 
ATOM 10274 S SD   . MET A 1 15 ? -17.572 -15.917 14.822  1.00 0.00 ? 467 MET C SD   13 
ATOM 10275 C CE   . MET A 1 15 ? -17.709 -14.867 13.375  1.00 0.00 ? 467 MET C CE   13 
ATOM 10276 H H    . MET A 1 15 ? -14.114 -16.917 12.115  1.00 0.00 ? 467 MET C H    13 
ATOM 10277 H HA   . MET A 1 15 ? -14.874 -19.259 13.638  1.00 0.00 ? 467 MET C HA   13 
ATOM 10278 H HB2  . MET A 1 15 ? -16.525 -17.090 12.341  1.00 0.00 ? 467 MET C HB2  13 
ATOM 10279 H HB3  . MET A 1 15 ? -17.179 -18.384 13.327  1.00 0.00 ? 467 MET C HB3  13 
ATOM 10280 H HG2  . MET A 1 15 ? -15.886 -17.553 15.237  1.00 0.00 ? 467 MET C HG2  13 
ATOM 10281 H HG3  . MET A 1 15 ? -15.284 -16.238 14.231  1.00 0.00 ? 467 MET C HG3  13 
ATOM 10282 H HE1  . MET A 1 15 ? -17.838 -15.478 12.495  1.00 0.00 ? 467 MET C HE1  13 
ATOM 10283 H HE2  . MET A 1 15 ? -16.811 -14.275 13.277  1.00 0.00 ? 467 MET C HE2  13 
ATOM 10284 H HE3  . MET A 1 15 ? -18.560 -14.212 13.487  1.00 0.00 ? 467 MET C HE3  13 
ATOM 10285 N N    . PHE A 1 16 ? -15.605 -18.930 10.449  1.00 0.00 ? 468 PHE C N    13 
ATOM 10286 C CA   . PHE A 1 16 ? -16.034 -19.622 9.255   1.00 0.00 ? 468 PHE C CA   13 
ATOM 10287 C C    . PHE A 1 16 ? -14.983 -19.527 8.151   1.00 0.00 ? 468 PHE C C    13 
ATOM 10288 O O    . PHE A 1 16 ? -15.085 -18.689 7.255   1.00 0.00 ? 468 PHE C O    13 
ATOM 10289 C CB   . PHE A 1 16 ? -17.362 -19.034 8.761   1.00 0.00 ? 468 PHE C CB   13 
ATOM 10290 C CG   . PHE A 1 16 ? -18.493 -19.184 9.740   1.00 0.00 ? 468 PHE C CG   13 
ATOM 10291 C CD1  . PHE A 1 16 ? -19.282 -20.318 9.735   1.00 0.00 ? 468 PHE C CD1  13 
ATOM 10292 C CD2  . PHE A 1 16 ? -18.765 -18.190 10.662  1.00 0.00 ? 468 PHE C CD2  13 
ATOM 10293 C CE1  . PHE A 1 16 ? -20.321 -20.459 10.632  1.00 0.00 ? 468 PHE C CE1  13 
ATOM 10294 C CE2  . PHE A 1 16 ? -19.802 -18.326 11.561  1.00 0.00 ? 468 PHE C CE2  13 
ATOM 10295 C CZ   . PHE A 1 16 ? -20.580 -19.461 11.548  1.00 0.00 ? 468 PHE C CZ   13 
ATOM 10296 H H    . PHE A 1 16 ? -15.360 -17.982 10.373  1.00 0.00 ? 468 PHE C H    13 
ATOM 10297 H HA   . PHE A 1 16 ? -16.189 -20.660 9.506   1.00 0.00 ? 468 PHE C HA   13 
ATOM 10298 H HB2  . PHE A 1 16 ? -17.222 -17.978 8.586   1.00 0.00 ? 468 PHE C HB2  13 
ATOM 10299 H HB3  . PHE A 1 16 ? -17.643 -19.507 7.837   1.00 0.00 ? 468 PHE C HB3  13 
ATOM 10300 H HD1  . PHE A 1 16 ? -19.080 -21.101 9.020   1.00 0.00 ? 468 PHE C HD1  13 
ATOM 10301 H HD2  . PHE A 1 16 ? -18.155 -17.299 10.674  1.00 0.00 ? 468 PHE C HD2  13 
ATOM 10302 H HE1  . PHE A 1 16 ? -20.930 -21.350 10.617  1.00 0.00 ? 468 PHE C HE1  13 
ATOM 10303 H HE2  . PHE A 1 16 ? -20.002 -17.541 12.276  1.00 0.00 ? 468 PHE C HE2  13 
ATOM 10304 H HZ   . PHE A 1 16 ? -21.392 -19.566 12.251  1.00 0.00 ? 468 PHE C HZ   13 
ATOM 10305 N N    . PRO A 1 17 ? -13.951 -20.383 8.208   1.00 0.00 ? 469 PRO C N    13 
ATOM 10306 C CA   . PRO A 1 17 ? -12.894 -20.420 7.201   1.00 0.00 ? 469 PRO C CA   13 
ATOM 10307 C C    . PRO A 1 17 ? -13.376 -21.077 5.918   1.00 0.00 ? 469 PRO C C    13 
ATOM 10308 O O    . PRO A 1 17 ? -12.657 -21.142 4.923   1.00 0.00 ? 469 PRO C O    13 
ATOM 10309 C CB   . PRO A 1 17 ? -11.792 -21.281 7.845   1.00 0.00 ? 469 PRO C CB   13 
ATOM 10310 C CG   . PRO A 1 17 ? -12.230 -21.505 9.253   1.00 0.00 ? 469 PRO C CG   13 
ATOM 10311 C CD   . PRO A 1 17 ? -13.717 -21.353 9.266   1.00 0.00 ? 469 PRO C CD   13 
ATOM 10312 H HA   . PRO A 1 17 ? -12.519 -19.432 7.002   1.00 0.00 ? 469 PRO C HA   13 
ATOM 10313 H HB2  . PRO A 1 17 ? -11.704 -22.212 7.306   1.00 0.00 ? 469 PRO C HB2  13 
ATOM 10314 H HB3  . PRO A 1 17 ? -10.852 -20.749 7.806   1.00 0.00 ? 469 PRO C HB3  13 
ATOM 10315 H HG2  . PRO A 1 17 ? -11.953 -22.498 9.575   1.00 0.00 ? 469 PRO C HG2  13 
ATOM 10316 H HG3  . PRO A 1 17 ? -11.779 -20.764 9.893   1.00 0.00 ? 469 PRO C HG3  13 
ATOM 10317 H HD2  . PRO A 1 17 ? -14.212 -22.286 9.055   1.00 0.00 ? 469 PRO C HD2  13 
ATOM 10318 H HD3  . PRO A 1 17 ? -14.037 -20.953 10.211  1.00 0.00 ? 469 PRO C HD3  13 
ATOM 10319 N N    . GLN A 1 18 ? -14.604 -21.567 5.963   1.00 0.00 ? 470 GLN C N    13 
ATOM 10320 C CA   . GLN A 1 18 ? -15.218 -22.245 4.835   1.00 0.00 ? 470 GLN C CA   13 
ATOM 10321 C C    . GLN A 1 18 ? -15.421 -21.298 3.644   1.00 0.00 ? 470 GLN C C    13 
ATOM 10322 O O    . GLN A 1 18 ? -15.456 -21.741 2.497   1.00 0.00 ? 470 GLN C O    13 
ATOM 10323 C CB   . GLN A 1 18 ? -16.554 -22.872 5.249   1.00 0.00 ? 470 GLN C CB   13 
ATOM 10324 C CG   . GLN A 1 18 ? -17.590 -21.865 5.722   1.00 0.00 ? 470 GLN C CG   13 
ATOM 10325 C CD   . GLN A 1 18 ? -18.930 -22.499 6.032   1.00 0.00 ? 470 GLN C CD   13 
ATOM 10326 O OE1  . GLN A 1 18 ? -19.302 -23.515 5.444   1.00 0.00 ? 470 GLN C OE1  13 
ATOM 10327 N NE2  . GLN A 1 18 ? -19.673 -21.896 6.940   1.00 0.00 ? 470 GLN C NE2  13 
ATOM 10328 H H    . GLN A 1 18 ? -15.101 -21.472 6.802   1.00 0.00 ? 470 GLN C H    13 
ATOM 10329 H HA   . GLN A 1 18 ? -14.551 -23.034 4.529   1.00 0.00 ? 470 GLN C HA   13 
ATOM 10330 H HB2  . GLN A 1 18 ? -16.965 -23.406 4.405   1.00 0.00 ? 470 GLN C HB2  13 
ATOM 10331 H HB3  . GLN A 1 18 ? -16.375 -23.573 6.050   1.00 0.00 ? 470 GLN C HB3  13 
ATOM 10332 H HG2  . GLN A 1 18 ? -17.222 -21.381 6.614   1.00 0.00 ? 470 GLN C HG2  13 
ATOM 10333 H HG3  . GLN A 1 18 ? -17.725 -21.131 4.944   1.00 0.00 ? 470 GLN C HG3  13 
ATOM 10334 H HE21 . GLN A 1 18 ? -19.331 -21.082 7.361   1.00 0.00 ? 470 GLN C HE21 13 
ATOM 10335 H HE22 . GLN A 1 18 ? -20.547 -22.291 7.158   1.00 0.00 ? 470 GLN C HE22 13 
ATOM 10336 N N    . VAL A 1 19 ? -15.555 -20.003 3.917   1.00 0.00 ? 471 VAL C N    13 
ATOM 10337 C CA   . VAL A 1 19 ? -15.751 -19.031 2.857   1.00 0.00 ? 471 VAL C CA   13 
ATOM 10338 C C    . VAL A 1 19 ? -14.465 -18.235 2.606   1.00 0.00 ? 471 VAL C C    13 
ATOM 10339 O O    . VAL A 1 19 ? -13.597 -18.148 3.480   1.00 0.00 ? 471 VAL C O    13 
ATOM 10340 C CB   . VAL A 1 19 ? -16.909 -18.049 3.169   1.00 0.00 ? 471 VAL C CB   13 
ATOM 10341 C CG1  . VAL A 1 19 ? -18.203 -18.792 3.438   1.00 0.00 ? 471 VAL C CG1  13 
ATOM 10342 C CG2  . VAL A 1 19 ? -16.555 -17.141 4.327   1.00 0.00 ? 471 VAL C CG2  13 
ATOM 10343 H H    . VAL A 1 19 ? -15.512 -19.692 4.843   1.00 0.00 ? 471 VAL C H    13 
ATOM 10344 H HA   . VAL A 1 19 ? -16.000 -19.578 1.961   1.00 0.00 ? 471 VAL C HA   13 
ATOM 10345 H HB   . VAL A 1 19 ? -17.060 -17.435 2.296   1.00 0.00 ? 471 VAL C HB   13 
ATOM 10346 H HG11 . VAL A 1 19 ? -18.110 -19.355 4.353   1.00 0.00 ? 471 VAL C HG11 13 
ATOM 10347 H HG12 . VAL A 1 19 ? -18.408 -19.465 2.619   1.00 0.00 ? 471 VAL C HG12 13 
ATOM 10348 H HG13 . VAL A 1 19 ? -19.014 -18.083 3.532   1.00 0.00 ? 471 VAL C HG13 13 
ATOM 10349 H HG21 . VAL A 1 19 ? -15.692 -16.553 4.050   1.00 0.00 ? 471 VAL C HG21 13 
ATOM 10350 H HG22 . VAL A 1 19 ? -16.326 -17.736 5.198   1.00 0.00 ? 471 VAL C HG22 13 
ATOM 10351 H HG23 . VAL A 1 19 ? -17.385 -16.485 4.540   1.00 0.00 ? 471 VAL C HG23 13 
ATOM 10352 N N    . PRO A 1 20 ? -14.326 -17.654 1.408   1.00 0.00 ? 472 PRO C N    13 
ATOM 10353 C CA   . PRO A 1 20 ? -13.150 -16.864 1.038   1.00 0.00 ? 472 PRO C CA   13 
ATOM 10354 C C    . PRO A 1 20 ? -13.101 -15.544 1.786   1.00 0.00 ? 472 PRO C C    13 
ATOM 10355 O O    . PRO A 1 20 ? -14.088 -14.801 1.827   1.00 0.00 ? 472 PRO C O    13 
ATOM 10356 C CB   . PRO A 1 20 ? -13.338 -16.607 -0.467  1.00 0.00 ? 472 PRO C CB   13 
ATOM 10357 C CG   . PRO A 1 20 ? -14.421 -17.539 -0.883  1.00 0.00 ? 472 PRO C CG   13 
ATOM 10358 C CD   . PRO A 1 20 ? -15.290 -17.711 0.321   1.00 0.00 ? 472 PRO C CD   13 
ATOM 10359 H HA   . PRO A 1 20 ? -12.233 -17.411 1.204   1.00 0.00 ? 472 PRO C HA   13 
ATOM 10360 H HB2  . PRO A 1 20 ? -13.623 -15.577 -0.625  1.00 0.00 ? 472 PRO C HB2  13 
ATOM 10361 H HB3  . PRO A 1 20 ? -12.418 -16.815 -0.992  1.00 0.00 ? 472 PRO C HB3  13 
ATOM 10362 H HG2  . PRO A 1 20 ? -14.982 -17.112 -1.700  1.00 0.00 ? 472 PRO C HG2  13 
ATOM 10363 H HG3  . PRO A 1 20 ? -13.989 -18.485 -1.171  1.00 0.00 ? 472 PRO C HG3  13 
ATOM 10364 H HD2  . PRO A 1 20 ? -16.005 -16.906 0.408   1.00 0.00 ? 472 PRO C HD2  13 
ATOM 10365 H HD3  . PRO A 1 20 ? -15.792 -18.665 0.302   1.00 0.00 ? 472 PRO C HD3  13 
ATOM 10366 N N    . TYR A 1 21 ? -11.946 -15.249 2.350   1.00 0.00 ? 473 TYR C N    13 
ATOM 10367 C CA   . TYR A 1 21 ? -11.733 -14.035 3.137   1.00 0.00 ? 473 TYR C CA   13 
ATOM 10368 C C    . TYR A 1 21 ? -12.100 -12.768 2.349   1.00 0.00 ? 473 TYR C C    13 
ATOM 10369 O O    . TYR A 1 21 ? -12.683 -11.836 2.902   1.00 0.00 ? 473 TYR C O    13 
ATOM 10370 C CB   . TYR A 1 21 ? -10.275 -13.978 3.620   1.00 0.00 ? 473 TYR C CB   13 
ATOM 10371 C CG   . TYR A 1 21 ? -9.907  -12.717 4.375   1.00 0.00 ? 473 TYR C CG   13 
ATOM 10372 C CD1  . TYR A 1 21 ? -10.541 -12.381 5.567   1.00 0.00 ? 473 TYR C CD1  13 
ATOM 10373 C CD2  . TYR A 1 21 ? -8.918  -11.868 3.899   1.00 0.00 ? 473 TYR C CD2  13 
ATOM 10374 C CE1  . TYR A 1 21 ? -10.198 -11.234 6.257   1.00 0.00 ? 473 TYR C CE1  13 
ATOM 10375 C CE2  . TYR A 1 21 ? -8.570  -10.722 4.581   1.00 0.00 ? 473 TYR C CE2  13 
ATOM 10376 C CZ   . TYR A 1 21 ? -9.212  -10.408 5.759   1.00 0.00 ? 473 TYR C CZ   13 
ATOM 10377 O OH   . TYR A 1 21 ? -8.867  -9.260  6.441   1.00 0.00 ? 473 TYR C OH   13 
ATOM 10378 H H    . TYR A 1 21 ? -11.197 -15.876 2.234   1.00 0.00 ? 473 TYR C H    13 
ATOM 10379 H HA   . TYR A 1 21 ? -12.377 -14.096 4.000   1.00 0.00 ? 473 TYR C HA   13 
ATOM 10380 H HB2  . TYR A 1 21 ? -10.089 -14.815 4.275   1.00 0.00 ? 473 TYR C HB2  13 
ATOM 10381 H HB3  . TYR A 1 21 ? -9.621  -14.054 2.762   1.00 0.00 ? 473 TYR C HB3  13 
ATOM 10382 H HD1  . TYR A 1 21 ? -11.313 -13.030 5.953   1.00 0.00 ? 473 TYR C HD1  13 
ATOM 10383 H HD2  . TYR A 1 21 ? -8.418  -12.114 2.974   1.00 0.00 ? 473 TYR C HD2  13 
ATOM 10384 H HE1  . TYR A 1 21 ? -10.700 -10.989 7.181   1.00 0.00 ? 473 TYR C HE1  13 
ATOM 10385 H HE2  . TYR A 1 21 ? -7.798  -10.078 4.191   1.00 0.00 ? 473 TYR C HE2  13 
ATOM 10386 H HH   . TYR A 1 21 ? -8.838  -9.447  7.387   1.00 0.00 ? 473 TYR C HH   13 
ATOM 10387 N N    . HIS A 1 22 ? -11.785 -12.746 1.057   1.00 0.00 ? 474 HIS C N    13 
ATOM 10388 C CA   . HIS A 1 22 ? -12.080 -11.575 0.230   1.00 0.00 ? 474 HIS C CA   13 
ATOM 10389 C C    . HIS A 1 22 ? -13.582 -11.362 0.057   1.00 0.00 ? 474 HIS C C    13 
ATOM 10390 O O    . HIS A 1 22 ? -14.035 -10.233 -0.019  1.00 0.00 ? 474 HIS C O    13 
ATOM 10391 C CB   . HIS A 1 22 ? -11.367 -11.634 -1.140  1.00 0.00 ? 474 HIS C CB   13 
ATOM 10392 C CG   . HIS A 1 22 ? -11.807 -12.748 -2.060  1.00 0.00 ? 474 HIS C CG   13 
ATOM 10393 N ND1  . HIS A 1 22 ? -11.143 -13.949 -2.166  1.00 0.00 ? 474 HIS C ND1  13 
ATOM 10394 C CD2  . HIS A 1 22 ? -12.841 -12.823 -2.929  1.00 0.00 ? 474 HIS C CD2  13 
ATOM 10395 C CE1  . HIS A 1 22 ? -11.746 -14.710 -3.054  1.00 0.00 ? 474 HIS C CE1  13 
ATOM 10396 N NE2  . HIS A 1 22 ? -12.781 -14.052 -3.534  1.00 0.00 ? 474 HIS C NE2  13 
ATOM 10397 H H    . HIS A 1 22 ? -11.335 -13.524 0.664   1.00 0.00 ? 474 HIS C H    13 
ATOM 10398 H HA   . HIS A 1 22 ? -11.703 -10.715 0.771   1.00 0.00 ? 474 HIS C HA   13 
ATOM 10399 H HB2  . HIS A 1 22 ? -11.563 -10.707 -1.651  1.00 0.00 ? 474 HIS C HB2  13 
ATOM 10400 H HB3  . HIS A 1 22 ? -10.304 -11.728 -0.979  1.00 0.00 ? 474 HIS C HB3  13 
ATOM 10401 H HD1  . HIS A 1 22 ? -10.328 -14.203 -1.670  1.00 0.00 ? 474 HIS C HD1  13 
ATOM 10402 H HD2  . HIS A 1 22 ? -13.579 -12.055 -3.112  1.00 0.00 ? 474 HIS C HD2  13 
ATOM 10403 H HE1  . HIS A 1 22 ? -11.445 -15.705 -3.342  1.00 0.00 ? 474 HIS C HE1  13 
ATOM 10404 H HE2  . HIS A 1 22 ? -13.233 -14.279 -4.379  1.00 0.00 ? 474 HIS C HE2  13 
ATOM 10405 N N    . LEU A 1 23 ? -14.356 -12.444 0.008   1.00 0.00 ? 475 LEU C N    13 
ATOM 10406 C CA   . LEU A 1 23 ? -15.804 -12.317 -0.123  1.00 0.00 ? 475 LEU C CA   13 
ATOM 10407 C C    . LEU A 1 23 ? -16.383 -11.788 1.169   1.00 0.00 ? 475 LEU C C    13 
ATOM 10408 O O    . LEU A 1 23 ? -17.424 -11.131 1.177   1.00 0.00 ? 475 LEU C O    13 
ATOM 10409 C CB   . LEU A 1 23 ? -16.458 -13.653 -0.488  1.00 0.00 ? 475 LEU C CB   13 
ATOM 10410 C CG   . LEU A 1 23 ? -16.155 -14.195 -1.888  1.00 0.00 ? 475 LEU C CG   13 
ATOM 10411 C CD1  . LEU A 1 23 ? -16.995 -15.422 -2.173  1.00 0.00 ? 475 LEU C CD1  13 
ATOM 10412 C CD2  . LEU A 1 23 ? -16.410 -13.134 -2.943  1.00 0.00 ? 475 LEU C CD2  13 
ATOM 10413 H H    . LEU A 1 23 ? -13.958 -13.337 0.080   1.00 0.00 ? 475 LEU C H    13 
ATOM 10414 H HA   . LEU A 1 23 ? -16.009 -11.593 -0.902  1.00 0.00 ? 475 LEU C HA   13 
ATOM 10415 H HB2  . LEU A 1 23 ? -16.135 -14.389 0.234   1.00 0.00 ? 475 LEU C HB2  13 
ATOM 10416 H HB3  . LEU A 1 23 ? -17.526 -13.538 -0.396  1.00 0.00 ? 475 LEU C HB3  13 
ATOM 10417 H HG   . LEU A 1 23 ? -15.114 -14.481 -1.940  1.00 0.00 ? 475 LEU C HG   13 
ATOM 10418 H HD11 . LEU A 1 23 ? -18.036 -15.136 -2.211  1.00 0.00 ? 475 LEU C HD11 13 
ATOM 10419 H HD12 . LEU A 1 23 ? -16.850 -16.150 -1.388  1.00 0.00 ? 475 LEU C HD12 13 
ATOM 10420 H HD13 . LEU A 1 23 ? -16.704 -15.848 -3.120  1.00 0.00 ? 475 LEU C HD13 13 
ATOM 10421 H HD21 . LEU A 1 23 ? -15.741 -12.300 -2.787  1.00 0.00 ? 475 LEU C HD21 13 
ATOM 10422 H HD22 . LEU A 1 23 ? -17.431 -12.795 -2.870  1.00 0.00 ? 475 LEU C HD22 13 
ATOM 10423 H HD23 . LEU A 1 23 ? -16.240 -13.553 -3.923  1.00 0.00 ? 475 LEU C HD23 13 
ATOM 10424 N N    . VAL A 1 24 ? -15.692 -12.066 2.258   1.00 0.00 ? 476 VAL C N    13 
ATOM 10425 C CA   . VAL A 1 24 ? -16.094 -11.562 3.551   1.00 0.00 ? 476 VAL C CA   13 
ATOM 10426 C C    . VAL A 1 24 ? -15.832 -10.067 3.579   1.00 0.00 ? 476 VAL C C    13 
ATOM 10427 O O    . VAL A 1 24 ? -16.693 -9.280  3.946   1.00 0.00 ? 476 VAL C O    13 
ATOM 10428 C CB   . VAL A 1 24 ? -15.321 -12.251 4.701   1.00 0.00 ? 476 VAL C CB   13 
ATOM 10429 C CG1  . VAL A 1 24 ? -15.860 -11.813 6.048   1.00 0.00 ? 476 VAL C CG1  13 
ATOM 10430 C CG2  . VAL A 1 24 ? -15.394 -13.762 4.570   1.00 0.00 ? 476 VAL C CG2  13 
ATOM 10431 H H    . VAL A 1 24 ? -14.881 -12.614 2.180   1.00 0.00 ? 476 VAL C H    13 
ATOM 10432 H HA   . VAL A 1 24 ? -17.153 -11.743 3.672   1.00 0.00 ? 476 VAL C HA   13 
ATOM 10433 H HB   . VAL A 1 24 ? -14.285 -11.954 4.640   1.00 0.00 ? 476 VAL C HB   13 
ATOM 10434 H HG11 . VAL A 1 24 ? -16.903 -12.084 6.125   1.00 0.00 ? 476 VAL C HG11 13 
ATOM 10435 H HG12 . VAL A 1 24 ? -15.757 -10.743 6.143   1.00 0.00 ? 476 VAL C HG12 13 
ATOM 10436 H HG13 . VAL A 1 24 ? -15.302 -12.299 6.832   1.00 0.00 ? 476 VAL C HG13 13 
ATOM 10437 H HG21 . VAL A 1 24 ? -14.960 -14.063 3.628   1.00 0.00 ? 476 VAL C HG21 13 
ATOM 10438 H HG22 . VAL A 1 24 ? -16.426 -14.077 4.608   1.00 0.00 ? 476 VAL C HG22 13 
ATOM 10439 H HG23 . VAL A 1 24 ? -14.847 -14.221 5.382   1.00 0.00 ? 476 VAL C HG23 13 
ATOM 10440 N N    . LEU A 1 25 ? -14.634 -9.689  3.142   1.00 0.00 ? 477 LEU C N    13 
ATOM 10441 C CA   . LEU A 1 25 ? -14.242 -8.290  3.027   1.00 0.00 ? 477 LEU C CA   13 
ATOM 10442 C C    . LEU A 1 25 ? -15.241 -7.531  2.163   1.00 0.00 ? 477 LEU C C    13 
ATOM 10443 O O    . LEU A 1 25 ? -15.648 -6.421  2.497   1.00 0.00 ? 477 LEU C O    13 
ATOM 10444 C CB   . LEU A 1 25 ? -12.849 -8.199  2.399   1.00 0.00 ? 477 LEU C CB   13 
ATOM 10445 C CG   . LEU A 1 25 ? -11.691 -8.696  3.258   1.00 0.00 ? 477 LEU C CG   13 
ATOM 10446 C CD1  . LEU A 1 25 ? -10.393 -8.648  2.474   1.00 0.00 ? 477 LEU C CD1  13 
ATOM 10447 C CD2  . LEU A 1 25 ? -11.574 -7.861  4.519   1.00 0.00 ? 477 LEU C CD2  13 
ATOM 10448 H H    . LEU A 1 25 ? -13.981 -10.380 2.895   1.00 0.00 ? 477 LEU C H    13 
ATOM 10449 H HA   . LEU A 1 25 ? -14.222 -7.845  4.012   1.00 0.00 ? 477 LEU C HA   13 
ATOM 10450 H HB2  . LEU A 1 25 ? -12.861 -8.787  1.492   1.00 0.00 ? 477 LEU C HB2  13 
ATOM 10451 H HB3  . LEU A 1 25 ? -12.655 -7.178  2.126   1.00 0.00 ? 477 LEU C HB3  13 
ATOM 10452 H HG   . LEU A 1 25 ? -11.874 -9.722  3.544   1.00 0.00 ? 477 LEU C HG   13 
ATOM 10453 H HD11 . LEU A 1 25 ? -10.170 -7.625  2.212   1.00 0.00 ? 477 LEU C HD11 13 
ATOM 10454 H HD12 . LEU A 1 25 ? -10.490 -9.237  1.575   1.00 0.00 ? 477 LEU C HD12 13 
ATOM 10455 H HD13 . LEU A 1 25 ? -9.592  -9.046  3.080   1.00 0.00 ? 477 LEU C HD13 13 
ATOM 10456 H HD21 . LEU A 1 25 ? -12.483 -7.946  5.095   1.00 0.00 ? 477 LEU C HD21 13 
ATOM 10457 H HD22 . LEU A 1 25 ? -11.410 -6.829  4.253   1.00 0.00 ? 477 LEU C HD22 13 
ATOM 10458 H HD23 . LEU A 1 25 ? -10.742 -8.218  5.108   1.00 0.00 ? 477 LEU C HD23 13 
ATOM 10459 N N    . GLN A 1 26 ? -15.638 -8.151  1.060   1.00 0.00 ? 478 GLN C N    13 
ATOM 10460 C CA   . GLN A 1 26 ? -16.597 -7.561  0.146   1.00 0.00 ? 478 GLN C CA   13 
ATOM 10461 C C    . GLN A 1 26 ? -17.930 -7.298  0.828   1.00 0.00 ? 478 GLN C C    13 
ATOM 10462 O O    . GLN A 1 26 ? -18.542 -6.253  0.613   1.00 0.00 ? 478 GLN C O    13 
ATOM 10463 C CB   . GLN A 1 26 ? -16.794 -8.449  -1.074  1.00 0.00 ? 478 GLN C CB   13 
ATOM 10464 C CG   . GLN A 1 26 ? -15.611 -8.466  -2.018  1.00 0.00 ? 478 GLN C CG   13 
ATOM 10465 C CD   . GLN A 1 26 ? -15.936 -9.106  -3.351  1.00 0.00 ? 478 GLN C CD   13 
ATOM 10466 O OE1  . GLN A 1 26 ? -15.328 -8.777  -4.371  1.00 0.00 ? 478 GLN C OE1  13 
ATOM 10467 N NE2  . GLN A 1 26 ? -16.901 -10.002 -3.360  1.00 0.00 ? 478 GLN C NE2  13 
ATOM 10468 H H    . GLN A 1 26 ? -15.264 -9.034  0.850   1.00 0.00 ? 478 GLN C H    13 
ATOM 10469 H HA   . GLN A 1 26 ? -16.189 -6.615  -0.182  1.00 0.00 ? 478 GLN C HA   13 
ATOM 10470 H HB2  . GLN A 1 26 ? -16.957 -9.461  -0.732  1.00 0.00 ? 478 GLN C HB2  13 
ATOM 10471 H HB3  . GLN A 1 26 ? -17.664 -8.130  -1.620  1.00 0.00 ? 478 GLN C HB3  13 
ATOM 10472 H HG2  . GLN A 1 26 ? -15.291 -7.450  -2.195  1.00 0.00 ? 478 GLN C HG2  13 
ATOM 10473 H HG3  . GLN A 1 26 ? -14.806 -9.020  -1.557  1.00 0.00 ? 478 GLN C HG3  13 
ATOM 10474 H HE21 . GLN A 1 26 ? -17.361 -10.211 -2.516  1.00 0.00 ? 478 GLN C HE21 13 
ATOM 10475 H HE22 . GLN A 1 26 ? -17.128 -10.430 -4.213  1.00 0.00 ? 478 GLN C HE22 13 
ATOM 10476 N N    . ASP A 1 27 ? -18.380 -8.235  1.657   1.00 0.00 ? 479 ASP C N    13 
ATOM 10477 C CA   . ASP A 1 27 ? -19.643 -8.056  2.367   1.00 0.00 ? 479 ASP C CA   13 
ATOM 10478 C C    . ASP A 1 27 ? -19.487 -6.992  3.442   1.00 0.00 ? 479 ASP C C    13 
ATOM 10479 O O    . ASP A 1 27 ? -20.411 -6.270  3.739   1.00 0.00 ? 479 ASP C O    13 
ATOM 10480 C CB   . ASP A 1 27 ? -20.133 -9.363  2.989   1.00 0.00 ? 479 ASP C CB   13 
ATOM 10481 C CG   . ASP A 1 27 ? -21.578 -9.270  3.487   1.00 0.00 ? 479 ASP C CG   13 
ATOM 10482 O OD1  . ASP A 1 27 ? -21.805 -8.739  4.603   1.00 0.00 ? 479 ASP C OD1  13 
ATOM 10483 O OD2  . ASP A 1 27 ? -22.491 -9.731  2.764   1.00 0.00 ? 479 ASP C OD2  13 
ATOM 10484 H H    . ASP A 1 27 ? -17.859 -9.055  1.795   1.00 0.00 ? 479 ASP C H    13 
ATOM 10485 H HA   . ASP A 1 27 ? -20.372 -7.712  1.644   1.00 0.00 ? 479 ASP C HA   13 
ATOM 10486 H HB2  . ASP A 1 27 ? -20.073 -10.149 2.251   1.00 0.00 ? 479 ASP C HB2  13 
ATOM 10487 H HB3  . ASP A 1 27 ? -19.498 -9.612  3.824   1.00 0.00 ? 479 ASP C HB3  13 
ATOM 10488 N N    . LEU A 1 28 ? -18.299 -6.886  4.005   1.00 0.00 ? 480 LEU C N    13 
ATOM 10489 C CA   . LEU A 1 28 ? -18.024 -5.860  5.005   1.00 0.00 ? 480 LEU C CA   13 
ATOM 10490 C C    . LEU A 1 28 ? -17.940 -4.478  4.362   1.00 0.00 ? 480 LEU C C    13 
ATOM 10491 O O    . LEU A 1 28 ? -18.038 -3.465  5.034   1.00 0.00 ? 480 LEU C O    13 
ATOM 10492 C CB   . LEU A 1 28 ? -16.750 -6.165  5.806   1.00 0.00 ? 480 LEU C CB   13 
ATOM 10493 C CG   . LEU A 1 28 ? -16.944 -6.967  7.096   1.00 0.00 ? 480 LEU C CG   13 
ATOM 10494 C CD1  . LEU A 1 28 ? -18.077 -6.398  7.919   1.00 0.00 ? 480 LEU C CD1  13 
ATOM 10495 C CD2  . LEU A 1 28 ? -17.212 -8.403  6.787   1.00 0.00 ? 480 LEU C CD2  13 
ATOM 10496 H H    . LEU A 1 28 ? -17.599 -7.517  3.751   1.00 0.00 ? 480 LEU C H    13 
ATOM 10497 H HA   . LEU A 1 28 ? -18.865 -5.856  5.682   1.00 0.00 ? 480 LEU C HA   13 
ATOM 10498 H HB2  . LEU A 1 28 ? -16.078 -6.717  5.173   1.00 0.00 ? 480 LEU C HB2  13 
ATOM 10499 H HB3  . LEU A 1 28 ? -16.273 -5.240  6.054   1.00 0.00 ? 480 LEU C HB3  13 
ATOM 10500 H HG   . LEU A 1 28 ? -16.041 -6.910  7.687   1.00 0.00 ? 480 LEU C HG   13 
ATOM 10501 H HD11 . LEU A 1 28 ? -19.019 -6.654  7.456   1.00 0.00 ? 480 LEU C HD11 13 
ATOM 10502 H HD12 . LEU A 1 28 ? -17.985 -5.324  7.971   1.00 0.00 ? 480 LEU C HD12 13 
ATOM 10503 H HD13 . LEU A 1 28 ? -18.043 -6.814  8.916   1.00 0.00 ? 480 LEU C HD13 13 
ATOM 10504 H HD21 . LEU A 1 28 ? -16.372 -8.818  6.251   1.00 0.00 ? 480 LEU C HD21 13 
ATOM 10505 H HD22 . LEU A 1 28 ? -18.101 -8.460  6.173   1.00 0.00 ? 480 LEU C HD22 13 
ATOM 10506 H HD23 . LEU A 1 28 ? -17.364 -8.943  7.709   1.00 0.00 ? 480 LEU C HD23 13 
ATOM 10507 N N    . GLN A 1 29 ? -17.760 -4.454  3.059   1.00 0.00 ? 481 GLN C N    13 
ATOM 10508 C CA   . GLN A 1 29 ? -17.772 -3.214  2.301   1.00 0.00 ? 481 GLN C CA   13 
ATOM 10509 C C    . GLN A 1 29 ? -19.203 -2.918  1.893   1.00 0.00 ? 481 GLN C C    13 
ATOM 10510 O O    . GLN A 1 29 ? -19.572 -1.789  1.575   1.00 0.00 ? 481 GLN C O    13 
ATOM 10511 C CB   . GLN A 1 29 ? -16.911 -3.359  1.046   1.00 0.00 ? 481 GLN C CB   13 
ATOM 10512 C CG   . GLN A 1 29 ? -15.417 -3.422  1.302   1.00 0.00 ? 481 GLN C CG   13 
ATOM 10513 C CD   . GLN A 1 29 ? -14.749 -2.056  1.283   1.00 0.00 ? 481 GLN C CD   13 
ATOM 10514 O OE1  . GLN A 1 29 ? -13.589 -1.928  0.901   1.00 0.00 ? 481 GLN C OE1  13 
ATOM 10515 N NE2  . GLN A 1 29 ? -15.464 -1.031  1.694   1.00 0.00 ? 481 GLN C NE2  13 
ATOM 10516 H H    . GLN A 1 29 ? -17.613 -5.301  2.582   1.00 0.00 ? 481 GLN C H    13 
ATOM 10517 H HA   . GLN A 1 29 ? -17.385 -2.422  2.920   1.00 0.00 ? 481 GLN C HA   13 
ATOM 10518 H HB2  . GLN A 1 29 ? -17.201 -4.266  0.536   1.00 0.00 ? 481 GLN C HB2  13 
ATOM 10519 H HB3  . GLN A 1 29 ? -17.108 -2.520  0.399   1.00 0.00 ? 481 GLN C HB3  13 
ATOM 10520 H HG2  . GLN A 1 29 ? -15.251 -3.869  2.272   1.00 0.00 ? 481 GLN C HG2  13 
ATOM 10521 H HG3  . GLN A 1 29 ? -14.966 -4.040  0.546   1.00 0.00 ? 481 GLN C HG3  13 
ATOM 10522 H HE21 . GLN A 1 29 ? -16.385 -1.190  1.991   1.00 0.00 ? 481 GLN C HE21 13 
ATOM 10523 H HE22 . GLN A 1 29 ? -15.045 -0.147  1.689   1.00 0.00 ? 481 GLN C HE22 13 
ATOM 10524 N N    . LEU A 1 30 ? -19.989 -3.964  1.928   1.00 0.00 ? 482 LEU C N    13 
ATOM 10525 C CA   . LEU A 1 30 ? -21.351 -3.973  1.500   1.00 0.00 ? 482 LEU C CA   13 
ATOM 10526 C C    . LEU A 1 30 ? -22.317 -3.679  2.656   1.00 0.00 ? 482 LEU C C    13 
ATOM 10527 O O    . LEU A 1 30 ? -23.188 -2.818  2.546   1.00 0.00 ? 482 LEU C O    13 
ATOM 10528 C CB   . LEU A 1 30 ? -21.602 -5.344  0.939   1.00 0.00 ? 482 LEU C CB   13 
ATOM 10529 C CG   . LEU A 1 30 ? -22.985 -5.663  0.490   1.00 0.00 ? 482 LEU C CG   13 
ATOM 10530 C CD1  . LEU A 1 30 ? -23.390 -4.777  -0.672  1.00 0.00 ? 482 LEU C CD1  13 
ATOM 10531 C CD2  . LEU A 1 30 ? -23.032 -7.108  0.104   1.00 0.00 ? 482 LEU C CD2  13 
ATOM 10532 H H    . LEU A 1 30 ? -19.627 -4.807  2.270   1.00 0.00 ? 482 LEU C H    13 
ATOM 10533 H HA   . LEU A 1 30 ? -21.486 -3.257  0.708   1.00 0.00 ? 482 LEU C HA   13 
ATOM 10534 H HB2  . LEU A 1 30 ? -20.942 -5.486  0.099   1.00 0.00 ? 482 LEU C HB2  13 
ATOM 10535 H HB3  . LEU A 1 30 ? -21.327 -6.055  1.703   1.00 0.00 ? 482 LEU C HB3  13 
ATOM 10536 H HG   . LEU A 1 30 ? -23.662 -5.507  1.313   1.00 0.00 ? 482 LEU C HG   13 
ATOM 10537 H HD11 . LEU A 1 30 ? -22.695 -4.923  -1.484  1.00 0.00 ? 482 LEU C HD11 13 
ATOM 10538 H HD12 . LEU A 1 30 ? -23.372 -3.743  -0.360  1.00 0.00 ? 482 LEU C HD12 13 
ATOM 10539 H HD13 . LEU A 1 30 ? -24.385 -5.043  -0.997  1.00 0.00 ? 482 LEU C HD13 13 
ATOM 10540 H HD21 . LEU A 1 30 ? -22.712 -7.701  0.950   1.00 0.00 ? 482 LEU C HD21 13 
ATOM 10541 H HD22 . LEU A 1 30 ? -22.349 -7.263  -0.717  1.00 0.00 ? 482 LEU C HD22 13 
ATOM 10542 H HD23 . LEU A 1 30 ? -24.034 -7.382  -0.184  1.00 0.00 ? 482 LEU C HD23 13 
ATOM 10543 N N    . THR A 1 31 ? -22.165 -4.401  3.755   1.00 0.00 ? 483 THR C N    13 
ATOM 10544 C CA   . THR A 1 31 ? -23.027 -4.235  4.910   1.00 0.00 ? 483 THR C CA   13 
ATOM 10545 C C    . THR A 1 31 ? -22.309 -3.472  6.014   1.00 0.00 ? 483 THR C C    13 
ATOM 10546 O O    . THR A 1 31 ? -22.938 -2.739  6.786   1.00 0.00 ? 483 THR C O    13 
ATOM 10547 C CB   . THR A 1 31 ? -23.483 -5.602  5.468   1.00 0.00 ? 483 THR C CB   13 
ATOM 10548 O OG1  . THR A 1 31 ? -22.336 -6.376  5.842   1.00 0.00 ? 483 THR C OG1  13 
ATOM 10549 C CG2  . THR A 1 31 ? -24.297 -6.368  4.436   1.00 0.00 ? 483 THR C CG2  13 
ATOM 10550 H H    . THR A 1 31 ? -21.447 -5.081  3.797   1.00 0.00 ? 483 THR C H    13 
ATOM 10551 H HA   . THR A 1 31 ? -23.902 -3.680  4.606   1.00 0.00 ? 483 THR C HA   13 
ATOM 10552 H HB   . THR A 1 31 ? -24.094 -5.433  6.343   1.00 0.00 ? 483 THR C HB   13 
ATOM 10553 H HG1  . THR A 1 31 ? -22.262 -7.162  5.269   1.00 0.00 ? 483 THR C HG1  13 
ATOM 10554 H HG21 . THR A 1 31 ? -25.187 -5.807  4.191   1.00 0.00 ? 483 THR C HG21 13 
ATOM 10555 H HG22 . THR A 1 31 ? -24.577 -7.330  4.840   1.00 0.00 ? 483 THR C HG22 13 
ATOM 10556 H HG23 . THR A 1 31 ? -23.704 -6.511  3.546   1.00 0.00 ? 483 THR C HG23 13 
ATOM 10557 N N    . ARG A 1 32 ? -20.979 -3.644  6.069   1.00 0.00 ? 484 ARG C N    13 
ATOM 10558 C CA   . ARG A 1 32 ? -20.135 -3.026  7.085   1.00 0.00 ? 484 ARG C CA   13 
ATOM 10559 C C    . ARG A 1 32 ? -20.478 -3.522  8.483   1.00 0.00 ? 484 ARG C C    13 
ATOM 10560 O O    . ARG A 1 32 ? -20.156 -2.873  9.481   1.00 0.00 ? 484 ARG C O    13 
ATOM 10561 C CB   . ARG A 1 32 ? -20.225 -1.518  7.020   1.00 0.00 ? 484 ARG C CB   13 
ATOM 10562 C CG   . ARG A 1 32 ? -19.703 -0.937  5.732   1.00 0.00 ? 484 ARG C CG   13 
ATOM 10563 C CD   . ARG A 1 32 ? -19.609 0.560   5.815   1.00 0.00 ? 484 ARG C CD   13 
ATOM 10564 N NE   . ARG A 1 32 ? -18.733 0.989   6.910   1.00 0.00 ? 484 ARG C NE   13 
ATOM 10565 C CZ   . ARG A 1 32 ? -17.884 2.014   6.846   1.00 0.00 ? 484 ARG C CZ   13 
ATOM 10566 N NH1  . ARG A 1 32 ? -17.779 2.730   5.729   1.00 0.00 ? 484 ARG C NH1  13 
ATOM 10567 N NH2  . ARG A 1 32 ? -17.147 2.325   7.902   1.00 0.00 ? 484 ARG C NH2  13 
ATOM 10568 H H    . ARG A 1 32 ? -20.544 -4.197  5.392   1.00 0.00 ? 484 ARG C H    13 
ATOM 10569 H HA   . ARG A 1 32 ? -19.117 -3.312  6.867   1.00 0.00 ? 484 ARG C HA   13 
ATOM 10570 H HB2  . ARG A 1 32 ? -21.256 -1.221  7.133   1.00 0.00 ? 484 ARG C HB2  13 
ATOM 10571 H HB3  . ARG A 1 32 ? -19.650 -1.113  7.832   1.00 0.00 ? 484 ARG C HB3  13 
ATOM 10572 H HG2  . ARG A 1 32 ? -18.724 -1.342  5.540   1.00 0.00 ? 484 ARG C HG2  13 
ATOM 10573 H HG3  . ARG A 1 32 ? -20.373 -1.206  4.929   1.00 0.00 ? 484 ARG C HG3  13 
ATOM 10574 H HD2  . ARG A 1 32 ? -19.219 0.925   4.879   1.00 0.00 ? 484 ARG C HD2  13 
ATOM 10575 H HD3  . ARG A 1 32 ? -20.599 0.952   5.979   1.00 0.00 ? 484 ARG C HD3  13 
ATOM 10576 H HE   . ARG A 1 32 ? -18.789 0.478   7.751   1.00 0.00 ? 484 ARG C HE   13 
ATOM 10577 H HH11 . ARG A 1 32 ? -18.337 2.507   4.927   1.00 0.00 ? 484 ARG C HH11 13 
ATOM 10578 H HH12 . ARG A 1 32 ? -17.140 3.504   5.677   1.00 0.00 ? 484 ARG C HH12 13 
ATOM 10579 H HH21 . ARG A 1 32 ? -17.225 1.791   8.751   1.00 0.00 ? 484 ARG C HH21 13 
ATOM 10580 H HH22 . ARG A 1 32 ? -16.509 3.098   7.873   1.00 0.00 ? 484 ARG C HH22 13 
ATOM 10581 N N    . SER A 1 33 ? -21.096 -4.687  8.554   1.00 0.00 ? 485 SER C N    13 
ATOM 10582 C CA   . SER A 1 33 ? -21.495 -5.250  9.817   1.00 0.00 ? 485 SER C CA   13 
ATOM 10583 C C    . SER A 1 33 ? -21.176 -6.730  9.858   1.00 0.00 ? 485 SER C C    13 
ATOM 10584 O O    . SER A 1 33 ? -21.858 -7.528  9.228   1.00 0.00 ? 485 SER C O    13 
ATOM 10585 C CB   . SER A 1 33 ? -22.994 -5.039  10.039  1.00 0.00 ? 485 SER C CB   13 
ATOM 10586 O OG   . SER A 1 33 ? -23.378 -5.382  11.365  1.00 0.00 ? 485 SER C OG   13 
ATOM 10587 H H    . SER A 1 33 ? -21.285 -5.187  7.729   1.00 0.00 ? 485 SER C H    13 
ATOM 10588 H HA   . SER A 1 33 ? -20.952 -4.747  10.599  1.00 0.00 ? 485 SER C HA   13 
ATOM 10589 H HB2  . SER A 1 33 ? -23.252 -4.011  9.850   1.00 0.00 ? 485 SER C HB2  13 
ATOM 10590 H HB3  . SER A 1 33 ? -23.538 -5.669  9.352   1.00 0.00 ? 485 SER C HB3  13 
ATOM 10591 H HG   . SER A 1 33 ? -22.586 -5.502  11.914  1.00 0.00 ? 485 SER C HG   13 
ATOM 10592 N N    . VAL A 1 34 ? -20.132 -7.088  10.602  1.00 0.00 ? 486 VAL C N    13 
ATOM 10593 C CA   . VAL A 1 34 ? -19.737 -8.490  10.762  1.00 0.00 ? 486 VAL C CA   13 
ATOM 10594 C C    . VAL A 1 34 ? -20.901 -9.328  11.289  1.00 0.00 ? 486 VAL C C    13 
ATOM 10595 O O    . VAL A 1 34 ? -21.065 -10.494 10.914  1.00 0.00 ? 486 VAL C O    13 
ATOM 10596 C CB   . VAL A 1 34 ? -18.479 -8.637  11.687  1.00 0.00 ? 486 VAL C CB   13 
ATOM 10597 C CG1  . VAL A 1 34 ? -18.405 -7.507  12.687  1.00 0.00 ? 486 VAL C CG1  13 
ATOM 10598 C CG2  . VAL A 1 34 ? -18.466 -9.978  12.418  1.00 0.00 ? 486 VAL C CG2  13 
ATOM 10599 H H    . VAL A 1 34 ? -19.615 -6.393  11.055  1.00 0.00 ? 486 VAL C H    13 
ATOM 10600 H HA   . VAL A 1 34 ? -19.477 -8.856  9.779   1.00 0.00 ? 486 VAL C HA   13 
ATOM 10601 H HB   . VAL A 1 34 ? -17.600 -8.588  11.063  1.00 0.00 ? 486 VAL C HB   13 
ATOM 10602 H HG11 . VAL A 1 34 ? -19.339 -7.433  13.219  1.00 0.00 ? 486 VAL C HG11 13 
ATOM 10603 H HG12 . VAL A 1 34 ? -18.203 -6.585  12.160  1.00 0.00 ? 486 VAL C HG12 13 
ATOM 10604 H HG13 . VAL A 1 34 ? -17.604 -7.702  13.384  1.00 0.00 ? 486 VAL C HG13 13 
ATOM 10605 H HG21 . VAL A 1 34 ? -18.484 -10.781 11.698  1.00 0.00 ? 486 VAL C HG21 13 
ATOM 10606 H HG22 . VAL A 1 34 ? -19.333 -10.047 13.056  1.00 0.00 ? 486 VAL C HG22 13 
ATOM 10607 H HG23 . VAL A 1 34 ? -17.570 -10.052 13.018  1.00 0.00 ? 486 VAL C HG23 13 
ATOM 10608 N N    . GLU A 1 35 ? -21.718 -8.717  12.137  1.00 0.00 ? 487 GLU C N    13 
ATOM 10609 C CA   . GLU A 1 35 ? -22.890 -9.368  12.689  1.00 0.00 ? 487 GLU C CA   13 
ATOM 10610 C C    . GLU A 1 35 ? -23.809 -9.824  11.561  1.00 0.00 ? 487 GLU C C    13 
ATOM 10611 O O    . GLU A 1 35 ? -24.316 -10.948 11.569  1.00 0.00 ? 487 GLU C O    13 
ATOM 10612 C CB   . GLU A 1 35 ? -23.644 -8.416  13.628  1.00 0.00 ? 487 GLU C CB   13 
ATOM 10613 C CG   . GLU A 1 35 ? -22.751 -7.681  14.621  1.00 0.00 ? 487 GLU C CG   13 
ATOM 10614 C CD   . GLU A 1 35 ? -22.277 -6.330  14.105  1.00 0.00 ? 487 GLU C CD   13 
ATOM 10615 O OE1  . GLU A 1 35 ? -21.477 -6.289  13.146  1.00 0.00 ? 487 GLU C OE1  13 
ATOM 10616 O OE2  . GLU A 1 35 ? -22.701 -5.301  14.654  1.00 0.00 ? 487 GLU C OE2  13 
ATOM 10617 H H    . GLU A 1 35 ? -21.517 -7.789  12.409  1.00 0.00 ? 487 GLU C H    13 
ATOM 10618 H HA   . GLU A 1 35 ? -22.563 -10.231 13.249  1.00 0.00 ? 487 GLU C HA   13 
ATOM 10619 H HB2  . GLU A 1 35 ? -24.159 -7.677  13.030  1.00 0.00 ? 487 GLU C HB2  13 
ATOM 10620 H HB3  . GLU A 1 35 ? -24.374 -8.986  14.183  1.00 0.00 ? 487 GLU C HB3  13 
ATOM 10621 H HG2  . GLU A 1 35 ? -23.305 -7.530  15.533  1.00 0.00 ? 487 GLU C HG2  13 
ATOM 10622 H HG3  . GLU A 1 35 ? -21.887 -8.296  14.826  1.00 0.00 ? 487 GLU C HG3  13 
ATOM 10623 N N    . ILE A 1 36 ? -24.005 -8.949  10.580  1.00 0.00 ? 488 ILE C N    13 
ATOM 10624 C CA   . ILE A 1 36 ? -24.825 -9.276  9.434   1.00 0.00 ? 488 ILE C CA   13 
ATOM 10625 C C    . ILE A 1 36 ? -24.079 -10.229 8.525   1.00 0.00 ? 488 ILE C C    13 
ATOM 10626 O O    . ILE A 1 36 ? -24.582 -11.255 8.198   1.00 0.00 ? 488 ILE C O    13 
ATOM 10627 C CB   . ILE A 1 36 ? -25.234 -8.025  8.626   1.00 0.00 ? 488 ILE C CB   13 
ATOM 10628 C CG1  . ILE A 1 36 ? -25.911 -6.995  9.538   1.00 0.00 ? 488 ILE C CG1  13 
ATOM 10629 C CG2  . ILE A 1 36 ? -26.166 -8.416  7.482   1.00 0.00 ? 488 ILE C CG2  13 
ATOM 10630 C CD1  . ILE A 1 36 ? -26.351 -5.734  8.822   1.00 0.00 ? 488 ILE C CD1  13 
ATOM 10631 H H    . ILE A 1 36 ? -23.577 -8.067  10.631  1.00 0.00 ? 488 ILE C H    13 
ATOM 10632 H HA   . ILE A 1 36 ? -25.720 -9.765  9.794   1.00 0.00 ? 488 ILE C HA   13 
ATOM 10633 H HB   . ILE A 1 36 ? -24.340 -7.600  8.199   1.00 0.00 ? 488 ILE C HB   13 
ATOM 10634 H HG12 . ILE A 1 36 ? -26.787 -7.442  9.984   1.00 0.00 ? 488 ILE C HG12 13 
ATOM 10635 H HG13 . ILE A 1 36 ? -25.223 -6.712  10.322  1.00 0.00 ? 488 ILE C HG13 13 
ATOM 10636 H HG21 . ILE A 1 36 ? -27.059 -8.872  7.883   1.00 0.00 ? 488 ILE C HG21 13 
ATOM 10637 H HG22 . ILE A 1 36 ? -25.665 -9.119  6.833   1.00 0.00 ? 488 ILE C HG22 13 
ATOM 10638 H HG23 . ILE A 1 36 ? -26.434 -7.534  6.919   1.00 0.00 ? 488 ILE C HG23 13 
ATOM 10639 H HD11 . ILE A 1 36 ? -27.075 -5.988  8.061   1.00 0.00 ? 488 ILE C HD11 13 
ATOM 10640 H HD12 . ILE A 1 36 ? -25.495 -5.263  8.360   1.00 0.00 ? 488 ILE C HD12 13 
ATOM 10641 H HD13 . ILE A 1 36 ? -26.798 -5.053  9.531   1.00 0.00 ? 488 ILE C HD13 13 
ATOM 10642 N N    . THR A 1 37 ? -22.862 -9.857  8.142   1.00 0.00 ? 489 THR C N    13 
ATOM 10643 C CA   . THR A 1 37 ? -21.992 -10.664 7.284   1.00 0.00 ? 489 THR C CA   13 
ATOM 10644 C C    . THR A 1 37 ? -21.944 -12.142 7.713   1.00 0.00 ? 489 THR C C    13 
ATOM 10645 O O    . THR A 1 37 ? -22.054 -13.038 6.879   1.00 0.00 ? 489 THR C O    13 
ATOM 10646 C CB   . THR A 1 37 ? -20.570 -10.084 7.295   1.00 0.00 ? 489 THR C CB   13 
ATOM 10647 O OG1  . THR A 1 37 ? -20.624 -8.690  6.987   1.00 0.00 ? 489 THR C OG1  13 
ATOM 10648 C CG2  . THR A 1 37 ? -19.679 -10.783 6.283   1.00 0.00 ? 489 THR C CG2  13 
ATOM 10649 H H    . THR A 1 37 ? -22.526 -8.983  8.421   1.00 0.00 ? 489 THR C H    13 
ATOM 10650 H HA   . THR A 1 37 ? -22.368 -10.603 6.274   1.00 0.00 ? 489 THR C HA   13 
ATOM 10651 H HB   . THR A 1 37 ? -20.154 -10.218 8.284   1.00 0.00 ? 489 THR C HB   13 
ATOM 10652 H HG1  . THR A 1 37 ? -21.046 -8.581  6.117   1.00 0.00 ? 489 THR C HG1  13 
ATOM 10653 H HG21 . THR A 1 37 ? -18.726 -10.270 6.244   1.00 0.00 ? 489 THR C HG21 13 
ATOM 10654 H HG22 . THR A 1 37 ? -20.146 -10.751 5.310   1.00 0.00 ? 489 THR C HG22 13 
ATOM 10655 H HG23 . THR A 1 37 ? -19.525 -11.809 6.581   1.00 0.00 ? 489 THR C HG23 13 
ATOM 10656 N N    . THR A 1 38 ? -21.800 -12.390 9.005   1.00 0.00 ? 490 THR C N    13 
ATOM 10657 C CA   . THR A 1 38 ? -21.732 -13.747 9.505   1.00 0.00 ? 490 THR C CA   13 
ATOM 10658 C C    . THR A 1 38 ? -23.081 -14.446 9.349   1.00 0.00 ? 490 THR C C    13 
ATOM 10659 O O    . THR A 1 38 ? -23.150 -15.591 8.891   1.00 0.00 ? 490 THR C O    13 
ATOM 10660 C CB   . THR A 1 38 ? -21.288 -13.780 10.979  1.00 0.00 ? 490 THR C CB   13 
ATOM 10661 O OG1  . THR A 1 38 ? -20.094 -12.998 11.136  1.00 0.00 ? 490 THR C OG1  13 
ATOM 10662 C CG2  . THR A 1 38 ? -21.007 -15.207 11.410  1.00 0.00 ? 490 THR C CG2  13 
ATOM 10663 H H    . THR A 1 38 ? -21.744 -11.643 9.639   1.00 0.00 ? 490 THR C H    13 
ATOM 10664 H HA   . THR A 1 38 ? -21.002 -14.282 8.913   1.00 0.00 ? 490 THR C HA   13 
ATOM 10665 H HB   . THR A 1 38 ? -22.073 -13.369 11.598  1.00 0.00 ? 490 THR C HB   13 
ATOM 10666 H HG1  . THR A 1 38 ? -20.334 -12.061 11.151  1.00 0.00 ? 490 THR C HG1  13 
ATOM 10667 H HG21 . THR A 1 38 ? -20.266 -15.634 10.748  1.00 0.00 ? 490 THR C HG21 13 
ATOM 10668 H HG22 . THR A 1 38 ? -21.917 -15.787 11.355  1.00 0.00 ? 490 THR C HG22 13 
ATOM 10669 H HG23 . THR A 1 38 ? -20.632 -15.213 12.422  1.00 0.00 ? 490 THR C HG23 13 
ATOM 10670 N N    . ASP A 1 39 ? -24.149 -13.746 9.703   1.00 0.00 ? 491 ASP C N    13 
ATOM 10671 C CA   . ASP A 1 39 ? -25.499 -14.286 9.559   1.00 0.00 ? 491 ASP C CA   13 
ATOM 10672 C C    . ASP A 1 39 ? -25.824 -14.406 8.078   1.00 0.00 ? 491 ASP C C    13 
ATOM 10673 O O    . ASP A 1 39 ? -26.518 -15.317 7.651   1.00 0.00 ? 491 ASP C O    13 
ATOM 10674 C CB   . ASP A 1 39 ? -26.516 -13.380 10.256  1.00 0.00 ? 491 ASP C CB   13 
ATOM 10675 C CG   . ASP A 1 39 ? -27.910 -13.971 10.283  1.00 0.00 ? 491 ASP C CG   13 
ATOM 10676 O OD1  . ASP A 1 39 ? -28.157 -14.871 11.119  1.00 0.00 ? 491 ASP C OD1  13 
ATOM 10677 O OD2  . ASP A 1 39 ? -28.768 -13.533 9.490   1.00 0.00 ? 491 ASP C OD2  13 
ATOM 10678 H H    . ASP A 1 39 ? -24.030 -12.837 10.062  1.00 0.00 ? 491 ASP C H    13 
ATOM 10679 H HA   . ASP A 1 39 ? -25.522 -15.270 10.005  1.00 0.00 ? 491 ASP C HA   13 
ATOM 10680 H HB2  . ASP A 1 39 ? -26.198 -13.211 11.274  1.00 0.00 ? 491 ASP C HB2  13 
ATOM 10681 H HB3  . ASP A 1 39 ? -26.556 -12.434 9.737   1.00 0.00 ? 491 ASP C HB3  13 
ATOM 10682 N N    . ASN A 1 40 ? -25.280 -13.477 7.311   1.00 0.00 ? 492 ASN C N    13 
ATOM 10683 C CA   . ASN A 1 40 ? -25.401 -13.446 5.868   1.00 0.00 ? 492 ASN C CA   13 
ATOM 10684 C C    . ASN A 1 40 ? -24.918 -14.770 5.293   1.00 0.00 ? 492 ASN C C    13 
ATOM 10685 O O    . ASN A 1 40 ? -25.589 -15.391 4.471   1.00 0.00 ? 492 ASN C O    13 
ATOM 10686 C CB   . ASN A 1 40 ? -24.573 -12.268 5.293   1.00 0.00 ? 492 ASN C CB   13 
ATOM 10687 C CG   . ASN A 1 40 ? -25.424 -11.106 4.829   1.00 0.00 ? 492 ASN C CG   13 
ATOM 10688 O OD1  . ASN A 1 40 ? -26.586 -11.275 4.478   1.00 0.00 ? 492 ASN C OD1  13 
ATOM 10689 N ND2  . ASN A 1 40 ? -24.839 -9.922  4.791   1.00 0.00 ? 492 ASN C ND2  13 
ATOM 10690 H H    . ASN A 1 40 ? -24.776 -12.757 7.751   1.00 0.00 ? 492 ASN C H    13 
ATOM 10691 H HA   . ASN A 1 40 ? -26.440 -13.293 5.628   1.00 0.00 ? 492 ASN C HA   13 
ATOM 10692 H HB2  . ASN A 1 40 ? -23.937 -11.890 6.079   1.00 0.00 ? 492 ASN C HB2  13 
ATOM 10693 H HB3  . ASN A 1 40 ? -23.949 -12.592 4.481   1.00 0.00 ? 492 ASN C HB3  13 
ATOM 10694 H HD21 . ASN A 1 40 ? -23.893 -9.857  5.052   1.00 0.00 ? 492 ASN C HD21 13 
ATOM 10695 H HD22 . ASN A 1 40 ? -25.370 -9.150  4.516   1.00 0.00 ? 492 ASN C HD22 13 
ATOM 10696 N N    . ILE A 1 41 ? -23.754 -15.206 5.752   1.00 0.00 ? 493 ILE C N    13 
ATOM 10697 C CA   . ILE A 1 41 ? -23.186 -16.481 5.342   1.00 0.00 ? 493 ILE C CA   13 
ATOM 10698 C C    . ILE A 1 41 ? -24.141 -17.619 5.697   1.00 0.00 ? 493 ILE C C    13 
ATOM 10699 O O    . ILE A 1 41 ? -24.476 -18.457 4.862   1.00 0.00 ? 493 ILE C O    13 
ATOM 10700 C CB   . ILE A 1 41 ? -21.843 -16.748 6.069   1.00 0.00 ? 493 ILE C CB   13 
ATOM 10701 C CG1  . ILE A 1 41 ? -20.847 -15.634 5.803   1.00 0.00 ? 493 ILE C CG1  13 
ATOM 10702 C CG2  . ILE A 1 41 ? -21.258 -18.092 5.657   1.00 0.00 ? 493 ILE C CG2  13 
ATOM 10703 C CD1  . ILE A 1 41 ? -19.625 -15.698 6.692   1.00 0.00 ? 493 ILE C CD1  13 
ATOM 10704 H H    . ILE A 1 41 ? -23.253 -14.642 6.386   1.00 0.00 ? 493 ILE C H    13 
ATOM 10705 H HA   . ILE A 1 41 ? -23.019 -16.449 4.276   1.00 0.00 ? 493 ILE C HA   13 
ATOM 10706 H HB   . ILE A 1 41 ? -22.043 -16.785 7.132   1.00 0.00 ? 493 ILE C HB   13 
ATOM 10707 H HG12 . ILE A 1 41 ? -20.519 -15.689 4.777   1.00 0.00 ? 493 ILE C HG12 13 
ATOM 10708 H HG13 . ILE A 1 41 ? -21.332 -14.687 5.971   1.00 0.00 ? 493 ILE C HG13 13 
ATOM 10709 H HG21 . ILE A 1 41 ? -21.072 -18.086 4.593   1.00 0.00 ? 493 ILE C HG21 13 
ATOM 10710 H HG22 . ILE A 1 41 ? -21.955 -18.879 5.900   1.00 0.00 ? 493 ILE C HG22 13 
ATOM 10711 H HG23 . ILE A 1 41 ? -20.330 -18.254 6.185   1.00 0.00 ? 493 ILE C HG23 13 
ATOM 10712 H HD11 . ILE A 1 41 ? -19.094 -16.620 6.511   1.00 0.00 ? 493 ILE C HD11 13 
ATOM 10713 H HD12 . ILE A 1 41 ? -19.937 -15.665 7.724   1.00 0.00 ? 493 ILE C HD12 13 
ATOM 10714 H HD13 . ILE A 1 41 ? -18.979 -14.859 6.487   1.00 0.00 ? 493 ILE C HD13 13 
ATOM 10715 N N    . LEU A 1 42 ? -24.584 -17.609 6.942   1.00 0.00 ? 494 LEU C N    13 
ATOM 10716 C CA   . LEU A 1 42 ? -25.449 -18.644 7.490   1.00 0.00 ? 494 LEU C CA   13 
ATOM 10717 C C    . LEU A 1 42 ? -26.809 -18.704 6.786   1.00 0.00 ? 494 LEU C C    13 
ATOM 10718 O O    . LEU A 1 42 ? -27.404 -19.775 6.663   1.00 0.00 ? 494 LEU C O    13 
ATOM 10719 C CB   . LEU A 1 42 ? -25.612 -18.412 8.990   1.00 0.00 ? 494 LEU C CB   13 
ATOM 10720 C CG   . LEU A 1 42 ? -24.307 -18.491 9.788   1.00 0.00 ? 494 LEU C CG   13 
ATOM 10721 C CD1  . LEU A 1 42 ? -24.503 -17.991 11.204  1.00 0.00 ? 494 LEU C CD1  13 
ATOM 10722 C CD2  . LEU A 1 42 ? -23.771 -19.914 9.794   1.00 0.00 ? 494 LEU C CD2  13 
ATOM 10723 H H    . LEU A 1 42 ? -24.316 -16.866 7.526   1.00 0.00 ? 494 LEU C H    13 
ATOM 10724 H HA   . LEU A 1 42 ? -24.951 -19.591 7.347   1.00 0.00 ? 494 LEU C HA   13 
ATOM 10725 H HB2  . LEU A 1 42 ? -26.043 -17.431 9.133   1.00 0.00 ? 494 LEU C HB2  13 
ATOM 10726 H HB3  . LEU A 1 42 ? -26.295 -19.148 9.383   1.00 0.00 ? 494 LEU C HB3  13 
ATOM 10727 H HG   . LEU A 1 42 ? -23.569 -17.859 9.316   1.00 0.00 ? 494 LEU C HG   13 
ATOM 10728 H HD11 . LEU A 1 42 ? -25.277 -18.566 11.687  1.00 0.00 ? 494 LEU C HD11 13 
ATOM 10729 H HD12 . LEU A 1 42 ? -24.779 -16.947 11.183  1.00 0.00 ? 494 LEU C HD12 13 
ATOM 10730 H HD13 . LEU A 1 42 ? -23.577 -18.104 11.748  1.00 0.00 ? 494 LEU C HD13 13 
ATOM 10731 H HD21 . LEU A 1 42 ? -23.560 -20.225 8.783   1.00 0.00 ? 494 LEU C HD21 13 
ATOM 10732 H HD22 . LEU A 1 42 ? -24.510 -20.573 10.227  1.00 0.00 ? 494 LEU C HD22 13 
ATOM 10733 H HD23 . LEU A 1 42 ? -22.865 -19.954 10.380  1.00 0.00 ? 494 LEU C HD23 13 
ATOM 10734 N N    . GLU A 1 43 ? -27.292 -17.563 6.331   1.00 0.00 ? 495 GLU C N    13 
ATOM 10735 C CA   . GLU A 1 43 ? -28.555 -17.501 5.601   1.00 0.00 ? 495 GLU C CA   13 
ATOM 10736 C C    . GLU A 1 43 ? -28.386 -18.002 4.175   1.00 0.00 ? 495 GLU C C    13 
ATOM 10737 O O    . GLU A 1 43 ? -29.359 -18.339 3.503   1.00 0.00 ? 495 GLU C O    13 
ATOM 10738 C CB   . GLU A 1 43 ? -29.099 -16.074 5.592   1.00 0.00 ? 495 GLU C CB   13 
ATOM 10739 C CG   . GLU A 1 43 ? -29.597 -15.607 6.943   1.00 0.00 ? 495 GLU C CG   13 
ATOM 10740 C CD   . GLU A 1 43 ? -30.841 -16.342 7.388   1.00 0.00 ? 495 GLU C CD   13 
ATOM 10741 O OE1  . GLU A 1 43 ? -30.730 -17.507 7.832   1.00 0.00 ? 495 GLU C OE1  13 
ATOM 10742 O OE2  . GLU A 1 43 ? -31.942 -15.754 7.302   1.00 0.00 ? 495 GLU C OE2  13 
ATOM 10743 H H    . GLU A 1 43 ? -26.798 -16.729 6.505   1.00 0.00 ? 495 GLU C H    13 
ATOM 10744 H HA   . GLU A 1 43 ? -29.263 -18.137 6.111   1.00 0.00 ? 495 GLU C HA   13 
ATOM 10745 H HB2  . GLU A 1 43 ? -28.315 -15.406 5.271   1.00 0.00 ? 495 GLU C HB2  13 
ATOM 10746 H HB3  . GLU A 1 43 ? -29.919 -16.018 4.890   1.00 0.00 ? 495 GLU C HB3  13 
ATOM 10747 H HG2  . GLU A 1 43 ? -28.820 -15.769 7.675   1.00 0.00 ? 495 GLU C HG2  13 
ATOM 10748 H HG3  . GLU A 1 43 ? -29.822 -14.553 6.883   1.00 0.00 ? 495 GLU C HG3  13 
ATOM 10749 N N    . GLY A 1 44 ? -27.146 -18.069 3.728   1.00 0.00 ? 496 GLY C N    13 
ATOM 10750 C CA   . GLY A 1 44 ? -26.870 -18.520 2.384   1.00 0.00 ? 496 GLY C CA   13 
ATOM 10751 C C    . GLY A 1 44 ? -26.656 -17.371 1.436   1.00 0.00 ? 496 GLY C C    13 
ATOM 10752 O O    . GLY A 1 44 ? -26.635 -17.553 0.219   1.00 0.00 ? 496 GLY C O    13 
ATOM 10753 H H    . GLY A 1 44 ? -26.407 -17.817 4.321   1.00 0.00 ? 496 GLY C H    13 
ATOM 10754 H HA2  . GLY A 1 44 ? -25.982 -19.136 2.394   1.00 0.00 ? 496 GLY C HA2  13 
ATOM 10755 H HA3  . GLY A 1 44 ? -27.700 -19.110 2.033   1.00 0.00 ? 496 GLY C HA3  13 
ATOM 10756 N N    . ARG A 1 45 ? -26.500 -16.180 1.998   1.00 0.00 ? 497 ARG C N    13 
ATOM 10757 C CA   . ARG A 1 45 ? -26.265 -14.983 1.216   1.00 0.00 ? 497 ARG C CA   13 
ATOM 10758 C C    . ARG A 1 45 ? -24.887 -15.068 0.588   1.00 0.00 ? 497 ARG C C    13 
ATOM 10759 O O    . ARG A 1 45 ? -24.695 -14.734 -0.579  1.00 0.00 ? 497 ARG C O    13 
ATOM 10760 C CB   . ARG A 1 45 ? -26.379 -13.745 2.117   1.00 0.00 ? 497 ARG C CB   13 
ATOM 10761 C CG   . ARG A 1 45 ? -26.648 -12.438 1.382   1.00 0.00 ? 497 ARG C CG   13 
ATOM 10762 C CD   . ARG A 1 45 ? -25.405 -11.873 0.717   1.00 0.00 ? 497 ARG C CD   13 
ATOM 10763 N NE   . ARG A 1 45 ? -25.726 -10.703 -0.091  1.00 0.00 ? 497 ARG C NE   13 
ATOM 10764 C CZ   . ARG A 1 45 ? -25.666 -9.445  0.341   1.00 0.00 ? 497 ARG C CZ   13 
ATOM 10765 N NH1  . ARG A 1 45 ? -25.195 -9.166  1.555   1.00 0.00 ? 497 ARG C NH1  13 
ATOM 10766 N NH2  . ARG A 1 45 ? -26.047 -8.459  -0.455  1.00 0.00 ? 497 ARG C NH2  13 
ATOM 10767 H H    . ARG A 1 45 ? -26.540 -16.108 2.977   1.00 0.00 ? 497 ARG C H    13 
ATOM 10768 H HA   . ARG A 1 45 ? -27.011 -14.930 0.436   1.00 0.00 ? 497 ARG C HA   13 
ATOM 10769 H HB2  . ARG A 1 45 ? -27.185 -13.910 2.818   1.00 0.00 ? 497 ARG C HB2  13 
ATOM 10770 H HB3  . ARG A 1 45 ? -25.454 -13.644 2.678   1.00 0.00 ? 497 ARG C HB3  13 
ATOM 10771 H HG2  . ARG A 1 45 ? -27.394 -12.615 0.622   1.00 0.00 ? 497 ARG C HG2  13 
ATOM 10772 H HG3  . ARG A 1 45 ? -27.027 -11.715 2.090   1.00 0.00 ? 497 ARG C HG3  13 
ATOM 10773 H HD2  . ARG A 1 45 ? -24.696 -11.593 1.482   1.00 0.00 ? 497 ARG C HD2  13 
ATOM 10774 H HD3  . ARG A 1 45 ? -24.972 -12.632 0.082   1.00 0.00 ? 497 ARG C HD3  13 
ATOM 10775 H HE   . ARG A 1 45 ? -26.028 -10.872 -1.015  1.00 0.00 ? 497 ARG C HE   13 
ATOM 10776 H HH11 . ARG A 1 45 ? -24.872 -9.894  2.163   1.00 0.00 ? 497 ARG C HH11 13 
ATOM 10777 H HH12 . ARG A 1 45 ? -25.162 -8.214  1.872   1.00 0.00 ? 497 ARG C HH12 13 
ATOM 10778 H HH21 . ARG A 1 45 ? -26.375 -8.652  -1.385  1.00 0.00 ? 497 ARG C HH21 13 
ATOM 10779 H HH22 . ARG A 1 45 ? -26.020 -7.509  -0.132  1.00 0.00 ? 497 ARG C HH22 13 
ATOM 10780 N N    . ILE A 1 46 ? -23.939 -15.533 1.369   1.00 0.00 ? 498 ILE C N    13 
ATOM 10781 C CA   . ILE A 1 46 ? -22.591 -15.730 0.896   1.00 0.00 ? 498 ILE C CA   13 
ATOM 10782 C C    . ILE A 1 46 ? -22.388 -17.205 0.630   1.00 0.00 ? 498 ILE C C    13 
ATOM 10783 O O    . ILE A 1 46 ? -22.388 -18.016 1.556   1.00 0.00 ? 498 ILE C O    13 
ATOM 10784 C CB   . ILE A 1 46 ? -21.540 -15.222 1.913   1.00 0.00 ? 498 ILE C CB   13 
ATOM 10785 C CG1  . ILE A 1 46 ? -21.760 -13.731 2.189   1.00 0.00 ? 498 ILE C CG1  13 
ATOM 10786 C CG2  . ILE A 1 46 ? -20.126 -15.467 1.389   1.00 0.00 ? 498 ILE C CG2  13 
ATOM 10787 C CD1  . ILE A 1 46 ? -20.826 -13.145 3.228   1.00 0.00 ? 498 ILE C CD1  13 
ATOM 10788 H H    . ILE A 1 46 ? -24.160 -15.773 2.294   1.00 0.00 ? 498 ILE C H    13 
ATOM 10789 H HA   . ILE A 1 46 ? -22.477 -15.186 -0.031  1.00 0.00 ? 498 ILE C HA   13 
ATOM 10790 H HB   . ILE A 1 46 ? -21.660 -15.774 2.832   1.00 0.00 ? 498 ILE C HB   13 
ATOM 10791 H HG12 . ILE A 1 46 ? -21.614 -13.180 1.273   1.00 0.00 ? 498 ILE C HG12 13 
ATOM 10792 H HG13 . ILE A 1 46 ? -22.772 -13.587 2.530   1.00 0.00 ? 498 ILE C HG13 13 
ATOM 10793 H HG21 . ILE A 1 46 ? -19.982 -16.525 1.227   1.00 0.00 ? 498 ILE C HG21 13 
ATOM 10794 H HG22 . ILE A 1 46 ? -19.410 -15.110 2.113   1.00 0.00 ? 498 ILE C HG22 13 
ATOM 10795 H HG23 . ILE A 1 46 ? -19.993 -14.936 0.457   1.00 0.00 ? 498 ILE C HG23 13 
ATOM 10796 H HD11 . ILE A 1 46 ? -21.038 -12.092 3.347   1.00 0.00 ? 498 ILE C HD11 13 
ATOM 10797 H HD12 . ILE A 1 46 ? -19.803 -13.273 2.910   1.00 0.00 ? 498 ILE C HD12 13 
ATOM 10798 H HD13 . ILE A 1 46 ? -20.976 -13.649 4.171   1.00 0.00 ? 498 ILE C HD13 13 
ATOM 10799 N N    . GLN A 1 47 ? -22.251 -17.551 -0.633  1.00 0.00 ? 499 GLN C N    13 
ATOM 10800 C CA   . GLN A 1 47 ? -22.140 -18.939 -1.034  1.00 0.00 ? 499 GLN C CA   13 
ATOM 10801 C C    . GLN A 1 47 ? -20.818 -19.549 -0.590  1.00 0.00 ? 499 GLN C C    13 
ATOM 10802 O O    . GLN A 1 47 ? -19.750 -18.963 -0.784  1.00 0.00 ? 499 GLN C O    13 
ATOM 10803 C CB   . GLN A 1 47 ? -22.323 -19.074 -2.544  1.00 0.00 ? 499 GLN C CB   13 
ATOM 10804 C CG   . GLN A 1 47 ? -22.415 -20.512 -3.029  1.00 0.00 ? 499 GLN C CG   13 
ATOM 10805 C CD   . GLN A 1 47 ? -22.807 -20.607 -4.486  1.00 0.00 ? 499 GLN C CD   13 
ATOM 10806 O OE1  . GLN A 1 47 ? -23.528 -19.749 -5.005  1.00 0.00 ? 499 GLN C OE1  13 
ATOM 10807 N NE2  . GLN A 1 47 ? -22.339 -21.637 -5.157  1.00 0.00 ? 499 GLN C NE2  13 
ATOM 10808 H H    . GLN A 1 47 ? -22.214 -16.846 -1.317  1.00 0.00 ? 499 GLN C H    13 
ATOM 10809 H HA   . GLN A 1 47 ? -22.940 -19.472 -0.545  1.00 0.00 ? 499 GLN C HA   13 
ATOM 10810 H HB2  . GLN A 1 47 ? -23.226 -18.561 -2.832  1.00 0.00 ? 499 GLN C HB2  13 
ATOM 10811 H HB3  . GLN A 1 47 ? -21.483 -18.606 -3.036  1.00 0.00 ? 499 GLN C HB3  13 
ATOM 10812 H HG2  . GLN A 1 47 ? -21.452 -20.984 -2.900  1.00 0.00 ? 499 GLN C HG2  13 
ATOM 10813 H HG3  . GLN A 1 47 ? -23.153 -21.033 -2.436  1.00 0.00 ? 499 GLN C HG3  13 
ATOM 10814 H HE21 . GLN A 1 47 ? -21.768 -22.280 -4.679  1.00 0.00 ? 499 GLN C HE21 13 
ATOM 10815 H HE22 . GLN A 1 47 ? -22.582 -21.729 -6.101  1.00 0.00 ? 499 GLN C HE22 13 
ATOM 10816 N N    . VAL A 1 48 ? -20.907 -20.722 0.005   1.00 0.00 ? 500 VAL C N    13 
ATOM 10817 C CA   . VAL A 1 48 ? -19.743 -21.432 0.494   1.00 0.00 ? 500 VAL C CA   13 
ATOM 10818 C C    . VAL A 1 48 ? -19.141 -22.312 -0.602  1.00 0.00 ? 500 VAL C C    13 
ATOM 10819 O O    . VAL A 1 48 ? -19.835 -23.154 -1.177  1.00 0.00 ? 500 VAL C O    13 
ATOM 10820 C CB   . VAL A 1 48 ? -20.110 -22.327 1.705   1.00 0.00 ? 500 VAL C CB   13 
ATOM 10821 C CG1  . VAL A 1 48 ? -18.882 -23.053 2.232   1.00 0.00 ? 500 VAL C CG1  13 
ATOM 10822 C CG2  . VAL A 1 48 ? -20.764 -21.501 2.803   1.00 0.00 ? 500 VAL C CG2  13 
ATOM 10823 H H    . VAL A 1 48 ? -21.792 -21.132 0.119   1.00 0.00 ? 500 VAL C H    13 
ATOM 10824 H HA   . VAL A 1 48 ? -19.017 -20.704 0.819   1.00 0.00 ? 500 VAL C HA   13 
ATOM 10825 H HB   . VAL A 1 48 ? -20.820 -23.069 1.369   1.00 0.00 ? 500 VAL C HB   13 
ATOM 10826 H HG11 . VAL A 1 48 ? -18.143 -22.330 2.547   1.00 0.00 ? 500 VAL C HG11 13 
ATOM 10827 H HG12 . VAL A 1 48 ? -18.468 -23.675 1.452   1.00 0.00 ? 500 VAL C HG12 13 
ATOM 10828 H HG13 . VAL A 1 48 ? -19.162 -23.671 3.073   1.00 0.00 ? 500 VAL C HG13 13 
ATOM 10829 H HG21 . VAL A 1 48 ? -21.657 -21.033 2.419   1.00 0.00 ? 500 VAL C HG21 13 
ATOM 10830 H HG22 . VAL A 1 48 ? -20.076 -20.742 3.142   1.00 0.00 ? 500 VAL C HG22 13 
ATOM 10831 H HG23 . VAL A 1 48 ? -21.022 -22.147 3.631   1.00 0.00 ? 500 VAL C HG23 13 
ATOM 10832 N N    . PRO A 1 49 ? -17.853 -22.116 -0.927  1.00 0.00 ? 501 PRO C N    13 
ATOM 10833 C CA   . PRO A 1 49 ? -17.157 -22.938 -1.903  1.00 0.00 ? 501 PRO C CA   13 
ATOM 10834 C C    . PRO A 1 49 ? -16.786 -24.288 -1.305  1.00 0.00 ? 501 PRO C C    13 
ATOM 10835 O O    . PRO A 1 49 ? -16.422 -24.378 -0.129  1.00 0.00 ? 501 PRO C O    13 
ATOM 10836 C CB   . PRO A 1 49 ? -15.882 -22.136 -2.231  1.00 0.00 ? 501 PRO C CB   13 
ATOM 10837 C CG   . PRO A 1 49 ? -16.019 -20.839 -1.502  1.00 0.00 ? 501 PRO C CG   13 
ATOM 10838 C CD   . PRO A 1 49 ? -16.979 -21.083 -0.380  1.00 0.00 ? 501 PRO C CD   13 
ATOM 10839 H HA   . PRO A 1 49 ? -17.743 -23.085 -2.797  1.00 0.00 ? 501 PRO C HA   13 
ATOM 10840 H HB2  . PRO A 1 49 ? -15.016 -22.686 -1.896  1.00 0.00 ? 501 PRO C HB2  13 
ATOM 10841 H HB3  . PRO A 1 49 ? -15.821 -21.980 -3.299  1.00 0.00 ? 501 PRO C HB3  13 
ATOM 10842 H HG2  . PRO A 1 49 ? -15.060 -20.536 -1.111  1.00 0.00 ? 501 PRO C HG2  13 
ATOM 10843 H HG3  . PRO A 1 49 ? -16.405 -20.083 -2.168  1.00 0.00 ? 501 PRO C HG3  13 
ATOM 10844 H HD2  . PRO A 1 49 ? -16.456 -21.445 0.493   1.00 0.00 ? 501 PRO C HD2  13 
ATOM 10845 H HD3  . PRO A 1 49 ? -17.529 -20.182 -0.157  1.00 0.00 ? 501 PRO C HD3  13 
ATOM 10846 N N    . PHE A 1 50 ? -16.877 -25.327 -2.097  1.00 0.00 ? 502 PHE C N    13 
ATOM 10847 C CA   . PHE A 1 50 ? -16.558 -26.655 -1.630  1.00 0.00 ? 502 PHE C CA   13 
ATOM 10848 C C    . PHE A 1 50 ? -15.397 -27.222 -2.420  1.00 0.00 ? 502 PHE C C    13 
ATOM 10849 O O    . PHE A 1 50 ? -15.188 -26.838 -3.574  1.00 0.00 ? 502 PHE C O    13 
ATOM 10850 C CB   . PHE A 1 50 ? -17.775 -27.582 -1.750  1.00 0.00 ? 502 PHE C CB   13 
ATOM 10851 C CG   . PHE A 1 50 ? -18.933 -27.178 -0.884  1.00 0.00 ? 502 PHE C CG   13 
ATOM 10852 C CD1  . PHE A 1 50 ? -18.841 -27.249 0.497   1.00 0.00 ? 502 PHE C CD1  13 
ATOM 10853 C CD2  . PHE A 1 50 ? -20.115 -26.733 -1.450  1.00 0.00 ? 502 PHE C CD2  13 
ATOM 10854 C CE1  . PHE A 1 50 ? -19.906 -26.883 1.297   1.00 0.00 ? 502 PHE C CE1  13 
ATOM 10855 C CE2  . PHE A 1 50 ? -21.183 -26.366 -0.655  1.00 0.00 ? 502 PHE C CE2  13 
ATOM 10856 C CZ   . PHE A 1 50 ? -21.078 -26.441 0.720   1.00 0.00 ? 502 PHE C CZ   13 
ATOM 10857 H H    . PHE A 1 50 ? -17.152 -25.202 -3.033  1.00 0.00 ? 502 PHE C H    13 
ATOM 10858 H HA   . PHE A 1 50 ? -16.276 -26.581 -0.592  1.00 0.00 ? 502 PHE C HA   13 
ATOM 10859 H HB2  . PHE A 1 50 ? -18.115 -27.587 -2.774  1.00 0.00 ? 502 PHE C HB2  13 
ATOM 10860 H HB3  . PHE A 1 50 ? -17.483 -28.583 -1.470  1.00 0.00 ? 502 PHE C HB3  13 
ATOM 10861 H HD1  . PHE A 1 50 ? -17.923 -27.594 0.950   1.00 0.00 ? 502 PHE C HD1  13 
ATOM 10862 H HD2  . PHE A 1 50 ? -20.199 -26.673 -2.525  1.00 0.00 ? 502 PHE C HD2  13 
ATOM 10863 H HE1  . PHE A 1 50 ? -19.822 -26.943 2.372   1.00 0.00 ? 502 PHE C HE1  13 
ATOM 10864 H HE2  . PHE A 1 50 ? -22.099 -26.022 -1.109  1.00 0.00 ? 502 PHE C HE2  13 
ATOM 10865 H HZ   . PHE A 1 50 ? -21.912 -26.154 1.341   1.00 0.00 ? 502 PHE C HZ   13 
ATOM 10866 N N    . PRO A 1 51 ? -14.600 -28.113 -1.803  1.00 0.00 ? 503 PRO C N    13 
ATOM 10867 C CA   . PRO A 1 51 ? -13.490 -28.767 -2.487  1.00 0.00 ? 503 PRO C CA   13 
ATOM 10868 C C    . PRO A 1 51 ? -13.988 -29.543 -3.699  1.00 0.00 ? 503 PRO C C    13 
ATOM 10869 O O    . PRO A 1 51 ? -14.881 -30.390 -3.581  1.00 0.00 ? 503 PRO C O    13 
ATOM 10870 C CB   . PRO A 1 51 ? -12.925 -29.730 -1.433  1.00 0.00 ? 503 PRO C CB   13 
ATOM 10871 C CG   . PRO A 1 51 ? -13.381 -29.178 -0.127  1.00 0.00 ? 503 PRO C CG   13 
ATOM 10872 C CD   . PRO A 1 51 ? -14.707 -28.532 -0.393  1.00 0.00 ? 503 PRO C CD   13 
ATOM 10873 H HA   . PRO A 1 51 ? -12.735 -28.058 -2.789  1.00 0.00 ? 503 PRO C HA   13 
ATOM 10874 H HB2  . PRO A 1 51 ? -13.319 -30.721 -1.601  1.00 0.00 ? 503 PRO C HB2  13 
ATOM 10875 H HB3  . PRO A 1 51 ? -11.847 -29.750 -1.497  1.00 0.00 ? 503 PRO C HB3  13 
ATOM 10876 H HG2  . PRO A 1 51 ? -13.489 -29.975 0.593   1.00 0.00 ? 503 PRO C HG2  13 
ATOM 10877 H HG3  . PRO A 1 51 ? -12.672 -28.445 0.228   1.00 0.00 ? 503 PRO C HG3  13 
ATOM 10878 H HD2  . PRO A 1 51 ? -15.508 -29.244 -0.260  1.00 0.00 ? 503 PRO C HD2  13 
ATOM 10879 H HD3  . PRO A 1 51 ? -14.845 -27.677 0.254   1.00 0.00 ? 503 PRO C HD3  13 
ATOM 10880 N N    . THR A 1 52 ? -13.443 -29.233 -4.855  1.00 0.00 ? 504 THR C N    13 
ATOM 10881 C CA   . THR A 1 52 ? -13.840 -29.878 -6.085  1.00 0.00 ? 504 THR C CA   13 
ATOM 10882 C C    . THR A 1 52 ? -12.699 -29.813 -7.101  1.00 0.00 ? 504 THR C C    13 
ATOM 10883 O O    . THR A 1 52 ? -11.960 -30.810 -7.230  1.00 0.00 ? 504 THR C O    13 
ATOM 10884 C CB   . THR A 1 52 ? -15.119 -29.221 -6.677  1.00 0.00 ? 504 THR C CB   13 
ATOM 10885 O OG1  . THR A 1 52 ? -16.188 -29.280 -5.716  1.00 0.00 ? 504 THR C OG1  13 
ATOM 10886 C CG2  . THR A 1 52 ? -15.555 -29.926 -7.955  1.00 0.00 ? 504 THR C CG2  13 
ATOM 10887 O OXT  . THR A 1 52 ? -12.529 -28.762 -7.741  1.00 0.00 ? 504 THR C OXT  13 
ATOM 10888 H H    . THR A 1 52 ? -12.743 -28.546 -4.888  1.00 0.00 ? 504 THR C H    13 
ATOM 10889 H HA   . THR A 1 52 ? -14.055 -30.914 -5.864  1.00 0.00 ? 504 THR C HA   13 
ATOM 10890 H HB   . THR A 1 52 ? -14.912 -28.182 -6.895  1.00 0.00 ? 504 THR C HB   13 
ATOM 10891 H HG1  . THR A 1 52 ? -15.860 -29.748 -4.932  1.00 0.00 ? 504 THR C HG1  13 
ATOM 10892 H HG21 . THR A 1 52 ? -16.438 -29.446 -8.348  1.00 0.00 ? 504 THR C HG21 13 
ATOM 10893 H HG22 . THR A 1 52 ? -15.773 -30.962 -7.738  1.00 0.00 ? 504 THR C HG22 13 
ATOM 10894 H HG23 . THR A 1 52 ? -14.760 -29.872 -8.685  1.00 0.00 ? 504 THR C HG23 13 
ATOM 10895 N N    . SER A 1 1  ? -11.185 4.188   4.482   1.00 0.00 ? 453 SER C N    14 
ATOM 10896 C CA   . SER A 1 1  ? -10.243 3.106   4.806   1.00 0.00 ? 453 SER C CA   14 
ATOM 10897 C C    . SER A 1 1  ? -11.003 1.810   5.062   1.00 0.00 ? 453 SER C C    14 
ATOM 10898 O O    . SER A 1 1  ? -12.123 1.829   5.578   1.00 0.00 ? 453 SER C O    14 
ATOM 10899 C CB   . SER A 1 1  ? -9.408  3.485   6.035   1.00 0.00 ? 453 SER C CB   14 
ATOM 10900 O OG   . SER A 1 1  ? -8.499  2.451   6.385   1.00 0.00 ? 453 SER C OG   14 
ATOM 10901 H H1   . SER A 1 1  ? -10.673 5.066   4.262   1.00 0.00 ? 453 SER C H1   14 
ATOM 10902 H H2   . SER A 1 1  ? -11.821 4.359   5.285   1.00 0.00 ? 453 SER C H2   14 
ATOM 10903 H H3   . SER A 1 1  ? -11.757 3.919   3.661   1.00 0.00 ? 453 SER C H3   14 
ATOM 10904 H HA   . SER A 1 1  ? -9.588  2.962   3.960   1.00 0.00 ? 453 SER C HA   14 
ATOM 10905 H HB2  . SER A 1 1  ? -8.845  4.383   5.822   1.00 0.00 ? 453 SER C HB2  14 
ATOM 10906 H HB3  . SER A 1 1  ? -10.067 3.666   6.869   1.00 0.00 ? 453 SER C HB3  14 
ATOM 10907 H HG   . SER A 1 1  ? -8.084  2.666   7.230   1.00 0.00 ? 453 SER C HG   14 
ATOM 10908 N N    . ASN A 1 2  ? -10.393 0.690   4.704   1.00 0.00 ? 454 ASN C N    14 
ATOM 10909 C CA   . ASN A 1 2  ? -11.015 -0.618  4.883   1.00 0.00 ? 454 ASN C CA   14 
ATOM 10910 C C    . ASN A 1 2  ? -10.258 -1.437  5.915   1.00 0.00 ? 454 ASN C C    14 
ATOM 10911 O O    . ASN A 1 2  ? -10.581 -2.596  6.156   1.00 0.00 ? 454 ASN C O    14 
ATOM 10912 C CB   . ASN A 1 2  ? -11.061 -1.383  3.553   1.00 0.00 ? 454 ASN C CB   14 
ATOM 10913 C CG   . ASN A 1 2  ? -11.971 -0.738  2.529   1.00 0.00 ? 454 ASN C CG   14 
ATOM 10914 O OD1  . ASN A 1 2  ? -12.991 -0.143  2.872   1.00 0.00 ? 454 ASN C OD1  14 
ATOM 10915 N ND2  . ASN A 1 2  ? -11.609 -0.848  1.266   1.00 0.00 ? 454 ASN C ND2  14 
ATOM 10916 H H    . ASN A 1 2  ? -9.495  0.739   4.305   1.00 0.00 ? 454 ASN C H    14 
ATOM 10917 H HA   . ASN A 1 2  ? -12.025 -0.462  5.231   1.00 0.00 ? 454 ASN C HA   14 
ATOM 10918 H HB2  . ASN A 1 2  ? -10.066 -1.425  3.138   1.00 0.00 ? 454 ASN C HB2  14 
ATOM 10919 H HB3  . ASN A 1 2  ? -11.410 -2.388  3.737   1.00 0.00 ? 454 ASN C HB3  14 
ATOM 10920 H HD21 . ASN A 1 2  ? -10.784 -1.336  1.057   1.00 0.00 ? 454 ASN C HD21 14 
ATOM 10921 H HD22 . ASN A 1 2  ? -12.177 -0.430  0.586   1.00 0.00 ? 454 ASN C HD22 14 
ATOM 10922 N N    . SER A 1 3  ? -9.264  -0.819  6.542   1.00 0.00 ? 455 SER C N    14 
ATOM 10923 C CA   . SER A 1 3  ? -8.423  -1.497  7.525   1.00 0.00 ? 455 SER C CA   14 
ATOM 10924 C C    . SER A 1 3  ? -9.239  -2.063  8.695   1.00 0.00 ? 455 SER C C    14 
ATOM 10925 O O    . SER A 1 3  ? -8.909  -3.119  9.242   1.00 0.00 ? 455 SER C O    14 
ATOM 10926 C CB   . SER A 1 3  ? -7.359  -0.539  8.038   1.00 0.00 ? 455 SER C CB   14 
ATOM 10927 O OG   . SER A 1 3  ? -6.624  0.016   6.958   1.00 0.00 ? 455 SER C OG   14 
ATOM 10928 H H    . SER A 1 3  ? -9.077  0.123   6.334   1.00 0.00 ? 455 SER C H    14 
ATOM 10929 H HA   . SER A 1 3  ? -7.931  -2.315  7.022   1.00 0.00 ? 455 SER C HA   14 
ATOM 10930 H HB2  . SER A 1 3  ? -7.833  0.262   8.586   1.00 0.00 ? 455 SER C HB2  14 
ATOM 10931 H HB3  . SER A 1 3  ? -6.678  -1.069  8.687   1.00 0.00 ? 455 SER C HB3  14 
ATOM 10932 H HG   . SER A 1 3  ? -5.865  0.500   7.309   1.00 0.00 ? 455 SER C HG   14 
ATOM 10933 N N    . GLN A 1 4  ? -10.302 -1.371  9.070   1.00 0.00 ? 456 GLN C N    14 
ATOM 10934 C CA   . GLN A 1 4  ? -11.137 -1.819  10.171  1.00 0.00 ? 456 GLN C CA   14 
ATOM 10935 C C    . GLN A 1 4  ? -12.059 -2.936  9.705   1.00 0.00 ? 456 GLN C C    14 
ATOM 10936 O O    . GLN A 1 4  ? -12.420 -3.822  10.478  1.00 0.00 ? 456 GLN C O    14 
ATOM 10937 C CB   . GLN A 1 4  ? -11.941 -0.656  10.741  1.00 0.00 ? 456 GLN C CB   14 
ATOM 10938 C CG   . GLN A 1 4  ? -11.088 0.554   11.094  1.00 0.00 ? 456 GLN C CG   14 
ATOM 10939 C CD   . GLN A 1 4  ? -11.911 1.746   11.519  1.00 0.00 ? 456 GLN C CD   14 
ATOM 10940 O OE1  . GLN A 1 4  ? -13.049 1.914   11.088  1.00 0.00 ? 456 GLN C OE1  14 
ATOM 10941 N NE2  . GLN A 1 4  ? -11.338 2.589   12.349  1.00 0.00 ? 456 GLN C NE2  14 
ATOM 10942 H H    . GLN A 1 4  ? -10.539 -0.546  8.591   1.00 0.00 ? 456 GLN C H    14 
ATOM 10943 H HA   . GLN A 1 4  ? -10.486 -2.207  10.941  1.00 0.00 ? 456 GLN C HA   14 
ATOM 10944 H HB2  . GLN A 1 4  ? -12.684 -0.353  10.021  1.00 0.00 ? 456 GLN C HB2  14 
ATOM 10945 H HB3  . GLN A 1 4  ? -12.442 -0.987  11.639  1.00 0.00 ? 456 GLN C HB3  14 
ATOM 10946 H HG2  . GLN A 1 4  ? -10.426 0.288   11.903  1.00 0.00 ? 456 GLN C HG2  14 
ATOM 10947 H HG3  . GLN A 1 4  ? -10.503 0.827   10.228  1.00 0.00 ? 456 GLN C HG3  14 
ATOM 10948 H HE21 . GLN A 1 4  ? -10.421 2.402   12.642  1.00 0.00 ? 456 GLN C HE21 14 
ATOM 10949 H HE22 . GLN A 1 4  ? -11.849 3.372   12.644  1.00 0.00 ? 456 GLN C HE22 14 
ATOM 10950 N N    . LEU A 1 5  ? -12.419 -2.899  8.425   1.00 0.00 ? 457 LEU C N    14 
ATOM 10951 C CA   . LEU A 1 5  ? -13.256 -3.933  7.838   1.00 0.00 ? 457 LEU C CA   14 
ATOM 10952 C C    . LEU A 1 5  ? -12.467 -5.227  7.734   1.00 0.00 ? 457 LEU C C    14 
ATOM 10953 O O    . LEU A 1 5  ? -12.977 -6.306  8.036   1.00 0.00 ? 457 LEU C O    14 
ATOM 10954 C CB   . LEU A 1 5  ? -13.748 -3.520  6.445   1.00 0.00 ? 457 LEU C CB   14 
ATOM 10955 C CG   . LEU A 1 5  ? -14.488 -2.183  6.357   1.00 0.00 ? 457 LEU C CG   14 
ATOM 10956 C CD1  . LEU A 1 5  ? -15.045 -1.980  4.966   1.00 0.00 ? 457 LEU C CD1  14 
ATOM 10957 C CD2  . LEU A 1 5  ? -15.593 -2.102  7.393   1.00 0.00 ? 457 LEU C CD2  14 
ATOM 10958 H H    . LEU A 1 5  ? -12.111 -2.155  7.866   1.00 0.00 ? 457 LEU C H    14 
ATOM 10959 H HA   . LEU A 1 5  ? -14.106 -4.088  8.484   1.00 0.00 ? 457 LEU C HA   14 
ATOM 10960 H HB2  . LEU A 1 5  ? -12.891 -3.472  5.790   1.00 0.00 ? 457 LEU C HB2  14 
ATOM 10961 H HB3  . LEU A 1 5  ? -14.409 -4.294  6.082   1.00 0.00 ? 457 LEU C HB3  14 
ATOM 10962 H HG   . LEU A 1 5  ? -13.787 -1.386  6.548   1.00 0.00 ? 457 LEU C HG   14 
ATOM 10963 H HD11 . LEU A 1 5  ? -15.726 -2.785  4.734   1.00 0.00 ? 457 LEU C HD11 14 
ATOM 10964 H HD12 . LEU A 1 5  ? -14.236 -1.971  4.251   1.00 0.00 ? 457 LEU C HD12 14 
ATOM 10965 H HD13 . LEU A 1 5  ? -15.574 -1.039  4.927   1.00 0.00 ? 457 LEU C HD13 14 
ATOM 10966 H HD21 . LEU A 1 5  ? -15.157 -2.129  8.380   1.00 0.00 ? 457 LEU C HD21 14 
ATOM 10967 H HD22 . LEU A 1 5  ? -16.263 -2.941  7.270   1.00 0.00 ? 457 LEU C HD22 14 
ATOM 10968 H HD23 . LEU A 1 5  ? -16.141 -1.181  7.264   1.00 0.00 ? 457 LEU C HD23 14 
ATOM 10969 N N    . ASN A 1 6  ? -11.214 -5.102  7.310   1.00 0.00 ? 458 ASN C N    14 
ATOM 10970 C CA   . ASN A 1 6  ? -10.311 -6.242  7.181   1.00 0.00 ? 458 ASN C CA   14 
ATOM 10971 C C    . ASN A 1 6  ? -10.138 -6.940  8.517   1.00 0.00 ? 458 ASN C C    14 
ATOM 10972 O O    . ASN A 1 6  ? -10.149 -8.171  8.593   1.00 0.00 ? 458 ASN C O    14 
ATOM 10973 C CB   . ASN A 1 6  ? -8.945  -5.801  6.648   1.00 0.00 ? 458 ASN C CB   14 
ATOM 10974 C CG   . ASN A 1 6  ? -8.969  -5.405  5.179   1.00 0.00 ? 458 ASN C CG   14 
ATOM 10975 O OD1  . ASN A 1 6  ? -9.986  -4.954  4.654   1.00 0.00 ? 458 ASN C OD1  14 
ATOM 10976 N ND2  . ASN A 1 6  ? -7.842  -5.565  4.510   1.00 0.00 ? 458 ASN C ND2  14 
ATOM 10977 H H    . ASN A 1 6  ? -10.888 -4.207  7.058   1.00 0.00 ? 458 ASN C H    14 
ATOM 10978 H HA   . ASN A 1 6  ? -10.753 -6.936  6.482   1.00 0.00 ? 458 ASN C HA   14 
ATOM 10979 H HB2  . ASN A 1 6  ? -8.601  -4.955  7.221   1.00 0.00 ? 458 ASN C HB2  14 
ATOM 10980 H HB3  . ASN A 1 6  ? -8.248  -6.615  6.768   1.00 0.00 ? 458 ASN C HB3  14 
ATOM 10981 H HD21 . ASN A 1 6  ? -7.066  -5.923  4.991   1.00 0.00 ? 458 ASN C HD21 14 
ATOM 10982 H HD22 . ASN A 1 6  ? -7.826  -5.327  3.558   1.00 0.00 ? 458 ASN C HD22 14 
ATOM 10983 N N    . ALA A 1 7  ? -9.983  -6.146  9.568   1.00 0.00 ? 459 ALA C N    14 
ATOM 10984 C CA   . ALA A 1 7  ? -9.841  -6.673  10.913  1.00 0.00 ? 459 ALA C CA   14 
ATOM 10985 C C    . ALA A 1 7  ? -11.077 -7.475  11.298  1.00 0.00 ? 459 ALA C C    14 
ATOM 10986 O O    . ALA A 1 7  ? -10.976 -8.594  11.809  1.00 0.00 ? 459 ALA C O    14 
ATOM 10987 C CB   . ALA A 1 7  ? -9.612  -5.538  11.900  1.00 0.00 ? 459 ALA C CB   14 
ATOM 10988 H H    . ALA A 1 7  ? -9.960  -5.175  9.431   1.00 0.00 ? 459 ALA C H    14 
ATOM 10989 H HA   . ALA A 1 7  ? -8.979  -7.323  10.931  1.00 0.00 ? 459 ALA C HA   14 
ATOM 10990 H HB1  . ALA A 1 7  ? -9.402  -5.947  12.877  1.00 0.00 ? 459 ALA C HB1  14 
ATOM 10991 H HB2  . ALA A 1 7  ? -10.498 -4.923  11.950  1.00 0.00 ? 459 ALA C HB2  14 
ATOM 10992 H HB3  . ALA A 1 7  ? -8.775  -4.938  11.573  1.00 0.00 ? 459 ALA C HB3  14 
ATOM 10993 N N    . MET A 1 8  ? -12.247 -6.905  11.017  1.00 0.00 ? 460 MET C N    14 
ATOM 10994 C CA   . MET A 1 8  ? -13.513 -7.555  11.314  1.00 0.00 ? 460 MET C CA   14 
ATOM 10995 C C    . MET A 1 8  ? -13.667 -8.847  10.518  1.00 0.00 ? 460 MET C C    14 
ATOM 10996 O O    . MET A 1 8  ? -14.172 -9.843  11.031  1.00 0.00 ? 460 MET C O    14 
ATOM 10997 C CB   . MET A 1 8  ? -14.679 -6.624  11.013  1.00 0.00 ? 460 MET C CB   14 
ATOM 10998 C CG   . MET A 1 8  ? -14.725 -5.378  11.882  1.00 0.00 ? 460 MET C CG   14 
ATOM 10999 S SD   . MET A 1 8  ? -16.340 -4.581  11.852  1.00 0.00 ? 460 MET C SD   14 
ATOM 11000 C CE   . MET A 1 8  ? -16.511 -4.250  10.108  1.00 0.00 ? 460 MET C CE   14 
ATOM 11001 H H    . MET A 1 8  ? -12.260 -6.015  10.602  1.00 0.00 ? 460 MET C H    14 
ATOM 11002 H HA   . MET A 1 8  ? -13.521 -7.793  12.367  1.00 0.00 ? 460 MET C HA   14 
ATOM 11003 H HB2  . MET A 1 8  ? -14.614 -6.317  9.980   1.00 0.00 ? 460 MET C HB2  14 
ATOM 11004 H HB3  . MET A 1 8  ? -15.598 -7.167  11.150  1.00 0.00 ? 460 MET C HB3  14 
ATOM 11005 H HG2  . MET A 1 8  ? -14.488 -5.648  12.899  1.00 0.00 ? 460 MET C HG2  14 
ATOM 11006 H HG3  . MET A 1 8  ? -13.991 -4.675  11.511  1.00 0.00 ? 460 MET C HG3  14 
ATOM 11007 H HE1  . MET A 1 8  ? -16.395 -5.169  9.548   1.00 0.00 ? 460 MET C HE1  14 
ATOM 11008 H HE2  . MET A 1 8  ? -15.754 -3.547  9.803   1.00 0.00 ? 460 MET C HE2  14 
ATOM 11009 H HE3  . MET A 1 8  ? -17.490 -3.836  9.913   1.00 0.00 ? 460 MET C HE3  14 
ATOM 11010 N N    . ALA A 1 9  ? -13.229 -8.820  9.265   1.00 0.00 ? 461 ALA C N    14 
ATOM 11011 C CA   . ALA A 1 9  ? -13.294 -9.990  8.404   1.00 0.00 ? 461 ALA C CA   14 
ATOM 11012 C C    . ALA A 1 9  ? -12.530 -11.154 9.016   1.00 0.00 ? 461 ALA C C    14 
ATOM 11013 O O    . ALA A 1 9  ? -12.967 -12.299 8.945   1.00 0.00 ? 461 ALA C O    14 
ATOM 11014 C CB   . ALA A 1 9  ? -12.747 -9.663  7.029   1.00 0.00 ? 461 ALA C CB   14 
ATOM 11015 H H    . ALA A 1 9  ? -12.866 -7.982  8.902   1.00 0.00 ? 461 ALA C H    14 
ATOM 11016 H HA   . ALA A 1 9  ? -14.331 -10.269 8.300   1.00 0.00 ? 461 ALA C HA   14 
ATOM 11017 H HB1  . ALA A 1 9  ? -12.830 -10.530 6.391   1.00 0.00 ? 461 ALA C HB1  14 
ATOM 11018 H HB2  . ALA A 1 9  ? -11.708 -9.377  7.113   1.00 0.00 ? 461 ALA C HB2  14 
ATOM 11019 H HB3  . ALA A 1 9  ? -13.313 -8.847  6.603   1.00 0.00 ? 461 ALA C HB3  14 
ATOM 11020 N N    . HIS A 1 10 ? -11.395 -10.852 9.637   1.00 0.00 ? 462 HIS C N    14 
ATOM 11021 C CA   . HIS A 1 10 ? -10.592 -11.879 10.295  1.00 0.00 ? 462 HIS C CA   14 
ATOM 11022 C C    . HIS A 1 10 ? -11.346 -12.493 11.467  1.00 0.00 ? 462 HIS C C    14 
ATOM 11023 O O    . HIS A 1 10 ? -11.173 -13.668 11.776  1.00 0.00 ? 462 HIS C O    14 
ATOM 11024 C CB   . HIS A 1 10 ? -9.250  -11.320 10.774  1.00 0.00 ? 462 HIS C CB   14 
ATOM 11025 C CG   . HIS A 1 10 ? -8.228  -11.176 9.692   1.00 0.00 ? 462 HIS C CG   14 
ATOM 11026 N ND1  . HIS A 1 10 ? -7.519  -12.240 9.184   1.00 0.00 ? 462 HIS C ND1  14 
ATOM 11027 C CD2  . HIS A 1 10 ? -7.792  -10.088 9.023   1.00 0.00 ? 462 HIS C CD2  14 
ATOM 11028 C CE1  . HIS A 1 10 ? -6.694  -11.815 8.253   1.00 0.00 ? 462 HIS C CE1  14 
ATOM 11029 N NE2  . HIS A 1 10 ? -6.838  -10.510 8.134   1.00 0.00 ? 462 HIS C NE2  14 
ATOM 11030 H H    . HIS A 1 10 ? -11.096 -9.917  9.652   1.00 0.00 ? 462 HIS C H    14 
ATOM 11031 H HA   . HIS A 1 10 ? -10.403 -12.654 9.568   1.00 0.00 ? 462 HIS C HA   14 
ATOM 11032 H HB2  . HIS A 1 10 ? -9.413  -10.342 11.201  1.00 0.00 ? 462 HIS C HB2  14 
ATOM 11033 H HB3  . HIS A 1 10 ? -8.847  -11.974 11.532  1.00 0.00 ? 462 HIS C HB3  14 
ATOM 11034 H HD1  . HIS A 1 10 ? -7.603  -13.178 9.470   1.00 0.00 ? 462 HIS C HD1  14 
ATOM 11035 H HD2  . HIS A 1 10 ? -8.133  -9.072  9.162   1.00 0.00 ? 462 HIS C HD2  14 
ATOM 11036 H HE1  . HIS A 1 10 ? -6.016  -12.430 7.682   1.00 0.00 ? 462 HIS C HE1  14 
ATOM 11037 H HE2  . HIS A 1 10 ? -6.166  -9.922  7.719   1.00 0.00 ? 462 HIS C HE2  14 
ATOM 11038 N N    . GLN A 1 11 ? -12.205 -11.696 12.098  1.00 0.00 ? 463 GLN C N    14 
ATOM 11039 C CA   . GLN A 1 11 ? -12.982 -12.163 13.243  1.00 0.00 ? 463 GLN C CA   14 
ATOM 11040 C C    . GLN A 1 11 ? -14.052 -13.150 12.793  1.00 0.00 ? 463 GLN C C    14 
ATOM 11041 O O    . GLN A 1 11 ? -14.477 -14.014 13.554  1.00 0.00 ? 463 GLN C O    14 
ATOM 11042 C CB   . GLN A 1 11 ? -13.625 -10.988 13.988  1.00 0.00 ? 463 GLN C CB   14 
ATOM 11043 C CG   . GLN A 1 11 ? -12.641 -9.912  14.434  1.00 0.00 ? 463 GLN C CG   14 
ATOM 11044 C CD   . GLN A 1 11 ? -11.446 -10.478 15.175  1.00 0.00 ? 463 GLN C CD   14 
ATOM 11045 O OE1  . GLN A 1 11 ? -11.475 -10.650 16.391  1.00 0.00 ? 463 GLN C OE1  14 
ATOM 11046 N NE2  . GLN A 1 11 ? -10.381 -10.754 14.447  1.00 0.00 ? 463 GLN C NE2  14 
ATOM 11047 H H    . GLN A 1 11 ? -12.326 -10.773 11.783  1.00 0.00 ? 463 GLN C H    14 
ATOM 11048 H HA   . GLN A 1 11 ? -12.302 -12.677 13.910  1.00 0.00 ? 463 GLN C HA   14 
ATOM 11049 H HB2  . GLN A 1 11 ? -14.355 -10.526 13.340  1.00 0.00 ? 463 GLN C HB2  14 
ATOM 11050 H HB3  . GLN A 1 11 ? -14.129 -11.370 14.862  1.00 0.00 ? 463 GLN C HB3  14 
ATOM 11051 H HG2  . GLN A 1 11 ? -12.282 -9.385  13.561  1.00 0.00 ? 463 GLN C HG2  14 
ATOM 11052 H HG3  . GLN A 1 11 ? -13.154 -9.219  15.083  1.00 0.00 ? 463 GLN C HG3  14 
ATOM 11053 H HE21 . GLN A 1 11 ? -10.423 -10.575 13.484  1.00 0.00 ? 463 GLN C HE21 14 
ATOM 11054 H HE22 . GLN A 1 11 ? -9.596  -11.133 14.893  1.00 0.00 ? 463 GLN C HE22 14 
ATOM 11055 N N    . ILE A 1 12 ? -14.499 -13.004 11.565  1.00 0.00 ? 464 ILE C N    14 
ATOM 11056 C CA   . ILE A 1 12 ? -15.445 -13.940 10.995  1.00 0.00 ? 464 ILE C CA   14 
ATOM 11057 C C    . ILE A 1 12 ? -14.702 -15.142 10.445  1.00 0.00 ? 464 ILE C C    14 
ATOM 11058 O O    . ILE A 1 12 ? -15.180 -16.265 10.520  1.00 0.00 ? 464 ILE C O    14 
ATOM 11059 C CB   . ILE A 1 12 ? -16.277 -13.300 9.870   1.00 0.00 ? 464 ILE C CB   14 
ATOM 11060 C CG1  . ILE A 1 12 ? -17.021 -12.076 10.396  1.00 0.00 ? 464 ILE C CG1  14 
ATOM 11061 C CG2  . ILE A 1 12 ? -17.264 -14.315 9.288   1.00 0.00 ? 464 ILE C CG2  14 
ATOM 11062 C CD1  . ILE A 1 12 ? -17.789 -11.344 9.328   1.00 0.00 ? 464 ILE C CD1  14 
ATOM 11063 H H    . ILE A 1 12 ? -14.199 -12.237 11.033  1.00 0.00 ? 464 ILE C H    14 
ATOM 11064 H HA   . ILE A 1 12 ? -16.111 -14.267 11.780  1.00 0.00 ? 464 ILE C HA   14 
ATOM 11065 H HB   . ILE A 1 12 ? -15.604 -12.993 9.085   1.00 0.00 ? 464 ILE C HB   14 
ATOM 11066 H HG12 . ILE A 1 12 ? -17.722 -12.391 11.151  1.00 0.00 ? 464 ILE C HG12 14 
ATOM 11067 H HG13 . ILE A 1 12 ? -16.321 -11.383 10.840  1.00 0.00 ? 464 ILE C HG13 14 
ATOM 11068 H HG21 . ILE A 1 12 ? -17.936 -14.648 10.065  1.00 0.00 ? 464 ILE C HG21 14 
ATOM 11069 H HG22 . ILE A 1 12 ? -16.722 -15.165 8.894   1.00 0.00 ? 464 ILE C HG22 14 
ATOM 11070 H HG23 . ILE A 1 12 ? -17.831 -13.851 8.495   1.00 0.00 ? 464 ILE C HG23 14 
ATOM 11071 H HD11 . ILE A 1 12 ? -18.234 -10.458 9.749   1.00 0.00 ? 464 ILE C HD11 14 
ATOM 11072 H HD12 . ILE A 1 12 ? -18.565 -11.987 8.940   1.00 0.00 ? 464 ILE C HD12 14 
ATOM 11073 H HD13 . ILE A 1 12 ? -17.118 -11.067 8.529   1.00 0.00 ? 464 ILE C HD13 14 
ATOM 11074 N N    . GLN A 1 13 ? -13.516 -14.890 9.917   1.00 0.00 ? 465 GLN C N    14 
ATOM 11075 C CA   . GLN A 1 13 ? -12.682 -15.934 9.338   1.00 0.00 ? 465 GLN C CA   14 
ATOM 11076 C C    . GLN A 1 13 ? -12.333 -16.998 10.375  1.00 0.00 ? 465 GLN C C    14 
ATOM 11077 O O    . GLN A 1 13 ? -12.314 -18.189 10.077  1.00 0.00 ? 465 GLN C O    14 
ATOM 11078 C CB   . GLN A 1 13 ? -11.402 -15.335 8.796   1.00 0.00 ? 465 GLN C CB   14 
ATOM 11079 C CG   . GLN A 1 13 ? -10.593 -16.309 7.967   1.00 0.00 ? 465 GLN C CG   14 
ATOM 11080 C CD   . GLN A 1 13 ? -9.225  -15.791 7.617   1.00 0.00 ? 465 GLN C CD   14 
ATOM 11081 O OE1  . GLN A 1 13 ? -9.011  -14.587 7.485   1.00 0.00 ? 465 GLN C OE1  14 
ATOM 11082 N NE2  . GLN A 1 13 ? -8.291  -16.697 7.463   1.00 0.00 ? 465 GLN C NE2  14 
ATOM 11083 H H    . GLN A 1 13 ? -13.193 -13.964 9.901   1.00 0.00 ? 465 GLN C H    14 
ATOM 11084 H HA   . GLN A 1 13 ? -13.225 -16.393 8.528   1.00 0.00 ? 465 GLN C HA   14 
ATOM 11085 H HB2  . GLN A 1 13 ? -11.644 -14.476 8.185   1.00 0.00 ? 465 GLN C HB2  14 
ATOM 11086 H HB3  . GLN A 1 13 ? -10.800 -15.017 9.639   1.00 0.00 ? 465 GLN C HB3  14 
ATOM 11087 H HG2  . GLN A 1 13 ? -10.478 -17.225 8.527   1.00 0.00 ? 465 GLN C HG2  14 
ATOM 11088 H HG3  . GLN A 1 13 ? -11.132 -16.516 7.053   1.00 0.00 ? 465 GLN C HG3  14 
ATOM 11089 H HE21 . GLN A 1 13 ? -8.541  -17.640 7.582   1.00 0.00 ? 465 GLN C HE21 14 
ATOM 11090 H HE22 . GLN A 1 13 ? -7.386  -16.404 7.246   1.00 0.00 ? 465 GLN C HE22 14 
ATOM 11091 N N    . GLU A 1 14 ? -12.044 -16.558 11.588  1.00 0.00 ? 466 GLU C N    14 
ATOM 11092 C CA   . GLU A 1 14 ? -11.714 -17.470 12.667  1.00 0.00 ? 466 GLU C CA   14 
ATOM 11093 C C    . GLU A 1 14 ? -12.931 -18.298 13.075  1.00 0.00 ? 466 GLU C C    14 
ATOM 11094 O O    . GLU A 1 14 ? -12.800 -19.346 13.704  1.00 0.00 ? 466 GLU C O    14 
ATOM 11095 C CB   . GLU A 1 14 ? -11.150 -16.707 13.855  1.00 0.00 ? 466 GLU C CB   14 
ATOM 11096 C CG   . GLU A 1 14 ? -11.988 -15.532 14.276  1.00 0.00 ? 466 GLU C CG   14 
ATOM 11097 C CD   . GLU A 1 14 ? -11.446 -14.852 15.509  1.00 0.00 ? 466 GLU C CD   14 
ATOM 11098 O OE1  . GLU A 1 14 ? -10.290 -14.388 15.473  1.00 0.00 ? 466 GLU C OE1  14 
ATOM 11099 O OE2  . GLU A 1 14 ? -12.165 -14.796 16.524  1.00 0.00 ? 466 GLU C OE2  14 
ATOM 11100 H H    . GLU A 1 14 ? -12.040 -15.592 11.763  1.00 0.00 ? 466 GLU C H    14 
ATOM 11101 H HA   . GLU A 1 14 ? -10.957 -18.144 12.300  1.00 0.00 ? 466 GLU C HA   14 
ATOM 11102 H HB2  . GLU A 1 14 ? -11.061 -17.376 14.694  1.00 0.00 ? 466 GLU C HB2  14 
ATOM 11103 H HB3  . GLU A 1 14 ? -10.171 -16.333 13.596  1.00 0.00 ? 466 GLU C HB3  14 
ATOM 11104 H HG2  . GLU A 1 14 ? -11.999 -14.824 13.456  1.00 0.00 ? 466 GLU C HG2  14 
ATOM 11105 H HG3  . GLU A 1 14 ? -12.995 -15.871 14.473  1.00 0.00 ? 466 GLU C HG3  14 
ATOM 11106 N N    . MET A 1 15 ? -14.109 -17.819 12.712  1.00 0.00 ? 467 MET C N    14 
ATOM 11107 C CA   . MET A 1 15 ? -15.338 -18.532 12.987  1.00 0.00 ? 467 MET C CA   14 
ATOM 11108 C C    . MET A 1 15 ? -15.716 -19.408 11.800  1.00 0.00 ? 467 MET C C    14 
ATOM 11109 O O    . MET A 1 15 ? -16.207 -20.525 11.966  1.00 0.00 ? 467 MET C O    14 
ATOM 11110 C CB   . MET A 1 15 ? -16.480 -17.557 13.292  1.00 0.00 ? 467 MET C CB   14 
ATOM 11111 C CG   . MET A 1 15 ? -16.276 -16.723 14.546  1.00 0.00 ? 467 MET C CG   14 
ATOM 11112 S SD   . MET A 1 15 ? -17.741 -15.759 14.991  1.00 0.00 ? 467 MET C SD   14 
ATOM 11113 C CE   . MET A 1 15 ? -17.908 -14.688 13.566  1.00 0.00 ? 467 MET C CE   14 
ATOM 11114 H H    . MET A 1 15 ? -14.154 -16.960 12.244  1.00 0.00 ? 467 MET C H    14 
ATOM 11115 H HA   . MET A 1 15 ? -15.173 -19.160 13.848  1.00 0.00 ? 467 MET C HA   14 
ATOM 11116 H HB2  . MET A 1 15 ? -16.588 -16.883 12.457  1.00 0.00 ? 467 MET C HB2  14 
ATOM 11117 H HB3  . MET A 1 15 ? -17.393 -18.120 13.403  1.00 0.00 ? 467 MET C HB3  14 
ATOM 11118 H HG2  . MET A 1 15 ? -16.034 -17.385 15.363  1.00 0.00 ? 467 MET C HG2  14 
ATOM 11119 H HG3  . MET A 1 15 ? -15.453 -16.046 14.380  1.00 0.00 ? 467 MET C HG3  14 
ATOM 11120 H HE1  . MET A 1 15 ? -17.981 -15.285 12.669  1.00 0.00 ? 467 MET C HE1  14 
ATOM 11121 H HE2  . MET A 1 15 ? -17.048 -14.041 13.503  1.00 0.00 ? 467 MET C HE2  14 
ATOM 11122 H HE3  . MET A 1 15 ? -18.799 -14.087 13.670  1.00 0.00 ? 467 MET C HE3  14 
ATOM 11123 N N    . PHE A 1 16 ? -15.484 -18.891 10.601  1.00 0.00 ? 468 PHE C N    14 
ATOM 11124 C CA   . PHE A 1 16 ? -15.812 -19.594 9.374   1.00 0.00 ? 468 PHE C CA   14 
ATOM 11125 C C    . PHE A 1 16 ? -14.657 -19.543 8.368   1.00 0.00 ? 468 PHE C C    14 
ATOM 11126 O O    . PHE A 1 16 ? -14.671 -18.735 7.443   1.00 0.00 ? 468 PHE C O    14 
ATOM 11127 C CB   . PHE A 1 16 ? -17.076 -18.998 8.739   1.00 0.00 ? 468 PHE C CB   14 
ATOM 11128 C CG   . PHE A 1 16 ? -18.336 -19.298 9.497   1.00 0.00 ? 468 PHE C CG   14 
ATOM 11129 C CD1  . PHE A 1 16 ? -18.743 -18.485 10.539  1.00 0.00 ? 468 PHE C CD1  14 
ATOM 11130 C CD2  . PHE A 1 16 ? -19.107 -20.398 9.171   1.00 0.00 ? 468 PHE C CD2  14 
ATOM 11131 C CE1  . PHE A 1 16 ? -19.896 -18.762 11.240  1.00 0.00 ? 468 PHE C CE1  14 
ATOM 11132 C CE2  . PHE A 1 16 ? -20.263 -20.681 9.869   1.00 0.00 ? 468 PHE C CE2  14 
ATOM 11133 C CZ   . PHE A 1 16 ? -20.657 -19.860 10.906  1.00 0.00 ? 468 PHE C CZ   14 
ATOM 11134 H H    . PHE A 1 16 ? -15.083 -17.996 10.532  1.00 0.00 ? 468 PHE C H    14 
ATOM 11135 H HA   . PHE A 1 16 ? -16.008 -20.624 9.626   1.00 0.00 ? 468 PHE C HA   14 
ATOM 11136 H HB2  . PHE A 1 16 ? -16.969 -17.924 8.698   1.00 0.00 ? 468 PHE C HB2  14 
ATOM 11137 H HB3  . PHE A 1 16 ? -17.185 -19.376 7.737   1.00 0.00 ? 468 PHE C HB3  14 
ATOM 11138 H HD1  . PHE A 1 16 ? -18.147 -17.624 10.801  1.00 0.00 ? 468 PHE C HD1  14 
ATOM 11139 H HD2  . PHE A 1 16 ? -18.799 -21.038 8.357   1.00 0.00 ? 468 PHE C HD2  14 
ATOM 11140 H HE1  . PHE A 1 16 ? -20.200 -18.115 12.050  1.00 0.00 ? 468 PHE C HE1  14 
ATOM 11141 H HE2  . PHE A 1 16 ? -20.856 -21.544 9.603   1.00 0.00 ? 468 PHE C HE2  14 
ATOM 11142 H HZ   . PHE A 1 16 ? -21.561 -20.077 11.456  1.00 0.00 ? 468 PHE C HZ   14 
ATOM 11143 N N    . PRO A 1 17 ? -13.632 -20.402 8.542   1.00 0.00 ? 469 PRO C N    14 
ATOM 11144 C CA   . PRO A 1 17 ? -12.484 -20.473 7.621   1.00 0.00 ? 469 PRO C CA   14 
ATOM 11145 C C    . PRO A 1 17 ? -12.884 -21.074 6.275   1.00 0.00 ? 469 PRO C C    14 
ATOM 11146 O O    . PRO A 1 17 ? -12.132 -21.021 5.301   1.00 0.00 ? 469 PRO C O    14 
ATOM 11147 C CB   . PRO A 1 17 ? -11.520 -21.417 8.339   1.00 0.00 ? 469 PRO C CB   14 
ATOM 11148 C CG   . PRO A 1 17 ? -12.395 -22.251 9.196   1.00 0.00 ? 469 PRO C CG   14 
ATOM 11149 C CD   . PRO A 1 17 ? -13.491 -21.347 9.661   1.00 0.00 ? 469 PRO C CD   14 
ATOM 11150 H HA   . PRO A 1 17 ? -12.016 -19.509 7.484   1.00 0.00 ? 469 PRO C HA   14 
ATOM 11151 H HB2  . PRO A 1 17 ? -10.990 -22.016 7.613   1.00 0.00 ? 469 PRO C HB2  14 
ATOM 11152 H HB3  . PRO A 1 17 ? -10.819 -20.848 8.927   1.00 0.00 ? 469 PRO C HB3  14 
ATOM 11153 H HG2  . PRO A 1 17 ? -12.802 -23.063 8.616   1.00 0.00 ? 469 PRO C HG2  14 
ATOM 11154 H HG3  . PRO A 1 17 ? -11.838 -22.629 10.038  1.00 0.00 ? 469 PRO C HG3  14 
ATOM 11155 H HD2  . PRO A 1 17 ? -14.403 -21.901 9.823   1.00 0.00 ? 469 PRO C HD2  14 
ATOM 11156 H HD3  . PRO A 1 17 ? -13.192 -20.827 10.558  1.00 0.00 ? 469 PRO C HD3  14 
ATOM 11157 N N    . GLN A 1 18 ? -14.080 -21.657 6.244   1.00 0.00 ? 470 GLN C N    14 
ATOM 11158 C CA   . GLN A 1 18 ? -14.617 -22.285 5.048   1.00 0.00 ? 470 GLN C CA   14 
ATOM 11159 C C    . GLN A 1 18 ? -14.855 -21.264 3.938   1.00 0.00 ? 470 GLN C C    14 
ATOM 11160 O O    . GLN A 1 18 ? -14.714 -21.576 2.753   1.00 0.00 ? 470 GLN C O    14 
ATOM 11161 C CB   . GLN A 1 18 ? -15.926 -23.018 5.375   1.00 0.00 ? 470 GLN C CB   14 
ATOM 11162 C CG   . GLN A 1 18 ? -16.971 -22.135 6.047   1.00 0.00 ? 470 GLN C CG   14 
ATOM 11163 C CD   . GLN A 1 18 ? -18.308 -22.824 6.231   1.00 0.00 ? 470 GLN C CD   14 
ATOM 11164 O OE1  . GLN A 1 18 ? -18.380 -24.043 6.373   1.00 0.00 ? 470 GLN C OE1  14 
ATOM 11165 N NE2  . GLN A 1 18 ? -19.378 -22.045 6.238   1.00 0.00 ? 470 GLN C NE2  14 
ATOM 11166 H H    . GLN A 1 18 ? -14.611 -21.667 7.066   1.00 0.00 ? 470 GLN C H    14 
ATOM 11167 H HA   . GLN A 1 18 ? -13.896 -23.009 4.702   1.00 0.00 ? 470 GLN C HA   14 
ATOM 11168 H HB2  . GLN A 1 18 ? -16.349 -23.403 4.459   1.00 0.00 ? 470 GLN C HB2  14 
ATOM 11169 H HB3  . GLN A 1 18 ? -15.707 -23.843 6.036   1.00 0.00 ? 470 GLN C HB3  14 
ATOM 11170 H HG2  . GLN A 1 18 ? -16.601 -21.838 7.017   1.00 0.00 ? 470 GLN C HG2  14 
ATOM 11171 H HG3  . GLN A 1 18 ? -17.113 -21.257 5.435   1.00 0.00 ? 470 GLN C HG3  14 
ATOM 11172 H HE21 . GLN A 1 18 ? -19.254 -21.081 6.129   1.00 0.00 ? 470 GLN C HE21 14 
ATOM 11173 H HE22 . GLN A 1 18 ? -20.259 -22.463 6.358   1.00 0.00 ? 470 GLN C HE22 14 
ATOM 11174 N N    . VAL A 1 19 ? -15.196 -20.043 4.322   1.00 0.00 ? 471 VAL C N    14 
ATOM 11175 C CA   . VAL A 1 19 ? -15.491 -19.015 3.355   1.00 0.00 ? 471 VAL C CA   14 
ATOM 11176 C C    . VAL A 1 19 ? -14.227 -18.252 2.964   1.00 0.00 ? 471 VAL C C    14 
ATOM 11177 O O    . VAL A 1 19 ? -13.241 -18.247 3.704   1.00 0.00 ? 471 VAL C O    14 
ATOM 11178 C CB   . VAL A 1 19 ? -16.559 -18.021 3.874   1.00 0.00 ? 471 VAL C CB   14 
ATOM 11179 C CG1  . VAL A 1 19 ? -17.772 -18.759 4.406   1.00 0.00 ? 471 VAL C CG1  14 
ATOM 11180 C CG2  . VAL A 1 19 ? -15.981 -17.095 4.926   1.00 0.00 ? 471 VAL C CG2  14 
ATOM 11181 H H    . VAL A 1 19 ? -15.233 -19.823 5.276   1.00 0.00 ? 471 VAL C H    14 
ATOM 11182 H HA   . VAL A 1 19 ? -15.885 -19.506 2.478   1.00 0.00 ? 471 VAL C HA   14 
ATOM 11183 H HB   . VAL A 1 19 ? -16.883 -17.423 3.038   1.00 0.00 ? 471 VAL C HB   14 
ATOM 11184 H HG11 . VAL A 1 19 ? -17.497 -19.313 5.291   1.00 0.00 ? 471 VAL C HG11 14 
ATOM 11185 H HG12 . VAL A 1 19 ? -18.136 -19.443 3.654   1.00 0.00 ? 471 VAL C HG12 14 
ATOM 11186 H HG13 . VAL A 1 19 ? -18.544 -18.048 4.652   1.00 0.00 ? 471 VAL C HG13 14 
ATOM 11187 H HG21 . VAL A 1 19 ? -15.185 -16.518 4.479   1.00 0.00 ? 471 VAL C HG21 14 
ATOM 11188 H HG22 . VAL A 1 19 ? -15.595 -17.677 5.748   1.00 0.00 ? 471 VAL C HG22 14 
ATOM 11189 H HG23 . VAL A 1 19 ? -16.753 -16.428 5.281   1.00 0.00 ? 471 VAL C HG23 14 
ATOM 11190 N N    . PRO A 1 20 ? -14.235 -17.619 1.791   1.00 0.00 ? 472 PRO C N    14 
ATOM 11191 C CA   . PRO A 1 20 ? -13.106 -16.844 1.296   1.00 0.00 ? 472 PRO C CA   14 
ATOM 11192 C C    . PRO A 1 20 ? -12.987 -15.497 1.992   1.00 0.00 ? 472 PRO C C    14 
ATOM 11193 O O    . PRO A 1 20 ? -13.944 -14.717 2.034   1.00 0.00 ? 472 PRO C O    14 
ATOM 11194 C CB   . PRO A 1 20 ? -13.430 -16.636 -0.190  1.00 0.00 ? 472 PRO C CB   14 
ATOM 11195 C CG   . PRO A 1 20 ? -14.603 -17.510 -0.458  1.00 0.00 ? 472 PRO C CG   14 
ATOM 11196 C CD   . PRO A 1 20 ? -15.329 -17.619 0.839   1.00 0.00 ? 472 PRO C CD   14 
ATOM 11197 H HA   . PRO A 1 20 ? -12.179 -17.387 1.393   1.00 0.00 ? 472 PRO C HA   14 
ATOM 11198 H HB2  . PRO A 1 20 ? -13.665 -15.596 -0.365  1.00 0.00 ? 472 PRO C HB2  14 
ATOM 11199 H HB3  . PRO A 1 20 ? -12.580 -16.920 -0.793  1.00 0.00 ? 472 PRO C HB3  14 
ATOM 11200 H HG2  . PRO A 1 20 ? -15.233 -17.062 -1.209  1.00 0.00 ? 472 PRO C HG2  14 
ATOM 11201 H HG3  . PRO A 1 20 ? -14.261 -18.482 -0.779  1.00 0.00 ? 472 PRO C HG3  14 
ATOM 11202 H HD2  . PRO A 1 20 ? -15.977 -16.768 0.997   1.00 0.00 ? 472 PRO C HD2  14 
ATOM 11203 H HD3  . PRO A 1 20 ? -15.888 -18.539 0.888   1.00 0.00 ? 472 PRO C HD3  14 
ATOM 11204 N N    . TYR A 1 21 ? -11.802 -15.229 2.501   1.00 0.00 ? 473 TYR C N    14 
ATOM 11205 C CA   . TYR A 1 21 ? -11.491 -13.984 3.205   1.00 0.00 ? 473 TYR C CA   14 
ATOM 11206 C C    . TYR A 1 21 ? -11.892 -12.745 2.380   1.00 0.00 ? 473 TYR C C    14 
ATOM 11207 O O    . TYR A 1 21 ? -12.424 -11.776 2.921   1.00 0.00 ? 473 TYR C O    14 
ATOM 11208 C CB   . TYR A 1 21 ? -9.986  -13.971 3.556   1.00 0.00 ? 473 TYR C CB   14 
ATOM 11209 C CG   . TYR A 1 21 ? -9.411  -12.628 3.959   1.00 0.00 ? 473 TYR C CG   14 
ATOM 11210 C CD1  . TYR A 1 21 ? -9.725  -12.040 5.180   1.00 0.00 ? 473 TYR C CD1  14 
ATOM 11211 C CD2  . TYR A 1 21 ? -8.532  -11.962 3.117   1.00 0.00 ? 473 TYR C CD2  14 
ATOM 11212 C CE1  . TYR A 1 21 ? -9.179  -10.819 5.543   1.00 0.00 ? 473 TYR C CE1  14 
ATOM 11213 C CE2  . TYR A 1 21 ? -7.984  -10.749 3.469   1.00 0.00 ? 473 TYR C CE2  14 
ATOM 11214 C CZ   . TYR A 1 21 ? -8.307  -10.178 4.679   1.00 0.00 ? 473 TYR C CZ   14 
ATOM 11215 O OH   . TYR A 1 21 ? -7.763  -8.956  5.021   1.00 0.00 ? 473 TYR C OH   14 
ATOM 11216 H H    . TYR A 1 21 ? -11.096 -15.902 2.403   1.00 0.00 ? 473 TYR C H    14 
ATOM 11217 H HA   . TYR A 1 21 ? -12.057 -13.980 4.124   1.00 0.00 ? 473 TYR C HA   14 
ATOM 11218 H HB2  . TYR A 1 21 ? -9.817  -14.649 4.379   1.00 0.00 ? 473 TYR C HB2  14 
ATOM 11219 H HB3  . TYR A 1 21 ? -9.429  -14.326 2.700   1.00 0.00 ? 473 TYR C HB3  14 
ATOM 11220 H HD1  . TYR A 1 21 ? -10.408 -12.545 5.848   1.00 0.00 ? 473 TYR C HD1  14 
ATOM 11221 H HD2  . TYR A 1 21 ? -8.278  -12.408 2.166   1.00 0.00 ? 473 TYR C HD2  14 
ATOM 11222 H HE1  . TYR A 1 21 ? -9.435  -10.377 6.496   1.00 0.00 ? 473 TYR C HE1  14 
ATOM 11223 H HE2  . TYR A 1 21 ? -7.304  -10.251 2.795   1.00 0.00 ? 473 TYR C HE2  14 
ATOM 11224 H HH   . TYR A 1 21 ? -7.382  -8.999  5.907   1.00 0.00 ? 473 TYR C HH   14 
ATOM 11225 N N    . HIS A 1 22 ? -11.671 -12.801 1.069   1.00 0.00 ? 474 HIS C N    14 
ATOM 11226 C CA   . HIS A 1 22 ? -12.005 -11.672 0.186   1.00 0.00 ? 474 HIS C CA   14 
ATOM 11227 C C    . HIS A 1 22 ? -13.516 -11.447 0.057   1.00 0.00 ? 474 HIS C C    14 
ATOM 11228 O O    . HIS A 1 22 ? -13.953 -10.335 -0.202  1.00 0.00 ? 474 HIS C O    14 
ATOM 11229 C CB   . HIS A 1 22 ? -11.358 -11.821 -1.206  1.00 0.00 ? 474 HIS C CB   14 
ATOM 11230 C CG   . HIS A 1 22 ? -11.727 -13.076 -1.966  1.00 0.00 ? 474 HIS C CG   14 
ATOM 11231 N ND1  . HIS A 1 22 ? -10.875 -14.144 -2.114  1.00 0.00 ? 474 HIS C ND1  14 
ATOM 11232 C CD2  . HIS A 1 22 ? -12.855 -13.412 -2.641  1.00 0.00 ? 474 HIS C CD2  14 
ATOM 11233 C CE1  . HIS A 1 22 ? -11.453 -15.077 -2.840  1.00 0.00 ? 474 HIS C CE1  14 
ATOM 11234 N NE2  . HIS A 1 22 ? -12.654 -14.658 -3.172  1.00 0.00 ? 474 HIS C NE2  14 
ATOM 11235 H H    . HIS A 1 22 ? -11.260 -13.610 0.693   1.00 0.00 ? 474 HIS C H    14 
ATOM 11236 H HA   . HIS A 1 22 ? -11.600 -10.781 0.653   1.00 0.00 ? 474 HIS C HA   14 
ATOM 11237 H HB2  . HIS A 1 22 ? -11.673 -10.983 -1.805  1.00 0.00 ? 474 HIS C HB2  14 
ATOM 11238 H HB3  . HIS A 1 22 ? -10.283 -11.795 -1.099  1.00 0.00 ? 474 HIS C HB3  14 
ATOM 11239 H HD1  . HIS A 1 22 ? -9.964  -14.212 -1.742  1.00 0.00 ? 474 HIS C HD1  14 
ATOM 11240 H HD2  . HIS A 1 22 ? -13.746 -12.807 -2.742  1.00 0.00 ? 474 HIS C HD2  14 
ATOM 11241 H HE1  . HIS A 1 22 ? -11.015 -16.025 -3.115  1.00 0.00 ? 474 HIS C HE1  14 
ATOM 11242 H HE2  . HIS A 1 22 ? -13.249 -15.108 -3.819  1.00 0.00 ? 474 HIS C HE2  14 
ATOM 11243 N N    . LEU A 1 23 ? -14.316 -12.492 0.234   1.00 0.00 ? 475 LEU C N    14 
ATOM 11244 C CA   . LEU A 1 23 ? -15.767 -12.334 0.151   1.00 0.00 ? 475 LEU C CA   14 
ATOM 11245 C C    . LEU A 1 23 ? -16.296 -11.767 1.446   1.00 0.00 ? 475 LEU C C    14 
ATOM 11246 O O    . LEU A 1 23 ? -17.345 -11.123 1.478   1.00 0.00 ? 475 LEU C O    14 
ATOM 11247 C CB   . LEU A 1 23 ? -16.462 -13.660 -0.174  1.00 0.00 ? 475 LEU C CB   14 
ATOM 11248 C CG   . LEU A 1 23 ? -16.306 -14.174 -1.611  1.00 0.00 ? 475 LEU C CG   14 
ATOM 11249 C CD1  . LEU A 1 23 ? -17.136 -15.420 -1.815  1.00 0.00 ? 475 LEU C CD1  14 
ATOM 11250 C CD2  . LEU A 1 23 ? -16.724 -13.111 -2.609  1.00 0.00 ? 475 LEU C CD2  14 
ATOM 11251 H H    . LEU A 1 23 ? -13.940 -13.372 0.443   1.00 0.00 ? 475 LEU C H    14 
ATOM 11252 H HA   . LEU A 1 23 ? -15.979 -11.618 -0.634  1.00 0.00 ? 475 LEU C HA   14 
ATOM 11253 H HB2  . LEU A 1 23 ? -16.073 -14.411 0.495   1.00 0.00 ? 475 LEU C HB2  14 
ATOM 11254 H HB3  . LEU A 1 23 ? -17.515 -13.540 0.026   1.00 0.00 ? 475 LEU C HB3  14 
ATOM 11255 H HG   . LEU A 1 23 ? -15.271 -14.422 -1.792  1.00 0.00 ? 475 LEU C HG   14 
ATOM 11256 H HD11 . LEU A 1 23 ? -18.179 -15.145 -1.828  1.00 0.00 ? 475 LEU C HD11 14 
ATOM 11257 H HD12 . LEU A 1 23 ? -16.957 -16.113 -1.007  1.00 0.00 ? 475 LEU C HD12 14 
ATOM 11258 H HD13 . LEU A 1 23 ? -16.874 -15.882 -2.755  1.00 0.00 ? 475 LEU C HD13 14 
ATOM 11259 H HD21 . LEU A 1 23 ? -16.070 -12.257 -2.524  1.00 0.00 ? 475 LEU C HD21 14 
ATOM 11260 H HD22 . LEU A 1 23 ? -17.740 -12.807 -2.405  1.00 0.00 ? 475 LEU C HD22 14 
ATOM 11261 H HD23 . LEU A 1 23 ? -16.664 -13.513 -3.609  1.00 0.00 ? 475 LEU C HD23 14 
ATOM 11262 N N    . VAL A 1 24 ? -15.552 -11.993 2.513   1.00 0.00 ? 476 VAL C N    14 
ATOM 11263 C CA   . VAL A 1 24 ? -15.914 -11.454 3.806   1.00 0.00 ? 476 VAL C CA   14 
ATOM 11264 C C    . VAL A 1 24 ? -15.661 -9.956  3.784   1.00 0.00 ? 476 VAL C C    14 
ATOM 11265 O O    . VAL A 1 24 ? -16.515 -9.163  4.165   1.00 0.00 ? 476 VAL C O    14 
ATOM 11266 C CB   . VAL A 1 24 ? -15.099 -12.110 4.947   1.00 0.00 ? 476 VAL C CB   14 
ATOM 11267 C CG1  . VAL A 1 24 ? -15.623 -11.674 6.301   1.00 0.00 ? 476 VAL C CG1  14 
ATOM 11268 C CG2  . VAL A 1 24 ? -15.129 -13.622 4.830   1.00 0.00 ? 476 VAL C CG2  14 
ATOM 11269 H H    . VAL A 1 24 ? -14.734 -12.531 2.419   1.00 0.00 ? 476 VAL C H    14 
ATOM 11270 H HA   . VAL A 1 24 ? -16.968 -11.638 3.967   1.00 0.00 ? 476 VAL C HA   14 
ATOM 11271 H HB   . VAL A 1 24 ? -14.073 -11.784 4.862   1.00 0.00 ? 476 VAL C HB   14 
ATOM 11272 H HG11 . VAL A 1 24 ? -16.668 -11.939 6.385   1.00 0.00 ? 476 VAL C HG11 14 
ATOM 11273 H HG12 . VAL A 1 24 ? -15.511 -10.606 6.403   1.00 0.00 ? 476 VAL C HG12 14 
ATOM 11274 H HG13 . VAL A 1 24 ? -15.064 -12.171 7.079   1.00 0.00 ? 476 VAL C HG13 14 
ATOM 11275 H HG21 . VAL A 1 24 ? -14.694 -13.919 3.887   1.00 0.00 ? 476 VAL C HG21 14 
ATOM 11276 H HG22 . VAL A 1 24 ? -16.153 -13.967 4.878   1.00 0.00 ? 476 VAL C HG22 14 
ATOM 11277 H HG23 . VAL A 1 24 ? -14.564 -14.059 5.640   1.00 0.00 ? 476 VAL C HG23 14 
ATOM 11278 N N    . LEU A 1 25 ? -14.483 -9.586  3.288   1.00 0.00 ? 477 LEU C N    14 
ATOM 11279 C CA   . LEU A 1 25 ? -14.091 -8.188  3.113   1.00 0.00 ? 477 LEU C CA   14 
ATOM 11280 C C    . LEU A 1 25 ? -15.139 -7.442  2.300   1.00 0.00 ? 477 LEU C C    14 
ATOM 11281 O O    . LEU A 1 25 ? -15.508 -6.309  2.618   1.00 0.00 ? 477 LEU C O    14 
ATOM 11282 C CB   . LEU A 1 25 ? -12.759 -8.134  2.364   1.00 0.00 ? 477 LEU C CB   14 
ATOM 11283 C CG   . LEU A 1 25 ? -11.555 -8.722  3.077   1.00 0.00 ? 477 LEU C CG   14 
ATOM 11284 C CD1  . LEU A 1 25 ? -10.336 -8.658  2.181   1.00 0.00 ? 477 LEU C CD1  14 
ATOM 11285 C CD2  . LEU A 1 25 ? -11.295 -7.983  4.372   1.00 0.00 ? 477 LEU C CD2  14 
ATOM 11286 H H    . LEU A 1 25 ? -13.840 -10.285 3.035   1.00 0.00 ? 477 LEU C H    14 
ATOM 11287 H HA   . LEU A 1 25 ? -13.986 -7.716  4.081   1.00 0.00 ? 477 LEU C HA   14 
ATOM 11288 H HB2  . LEU A 1 25 ? -12.887 -8.678  1.440   1.00 0.00 ? 477 LEU C HB2  14 
ATOM 11289 H HB3  . LEU A 1 25 ? -12.539 -7.113  2.114   1.00 0.00 ? 477 LEU C HB3  14 
ATOM 11290 H HG   . LEU A 1 25 ? -11.748 -9.759  3.311   1.00 0.00 ? 477 LEU C HG   14 
ATOM 11291 H HD11 . LEU A 1 25 ? -10.089 -7.625  1.985   1.00 0.00 ? 477 LEU C HD11 14 
ATOM 11292 H HD12 . LEU A 1 25 ? -10.546 -9.158  1.248   1.00 0.00 ? 477 LEU C HD12 14 
ATOM 11293 H HD13 . LEU A 1 25 ? -9.503  -9.140  2.670   1.00 0.00 ? 477 LEU C HD13 14 
ATOM 11294 H HD21 . LEU A 1 25 ? -12.154 -8.077  5.019   1.00 0.00 ? 477 LEU C HD21 14 
ATOM 11295 H HD22 . LEU A 1 25 ? -11.115 -6.939  4.160   1.00 0.00 ? 477 LEU C HD22 14 
ATOM 11296 H HD23 . LEU A 1 25 ? -10.429 -8.407  4.859   1.00 0.00 ? 477 LEU C HD23 14 
ATOM 11297 N N    . GLN A 1 26 ? -15.601 -8.092  1.251   1.00 0.00 ? 478 GLN C N    14 
ATOM 11298 C CA   . GLN A 1 26 ? -16.593 -7.533  0.365   1.00 0.00 ? 478 GLN C CA   14 
ATOM 11299 C C    . GLN A 1 26 ? -17.908 -7.253  1.083   1.00 0.00 ? 478 GLN C C    14 
ATOM 11300 O O    . GLN A 1 26 ? -18.448 -6.162  0.967   1.00 0.00 ? 478 GLN C O    14 
ATOM 11301 C CB   . GLN A 1 26 ? -16.804 -8.452  -0.828  1.00 0.00 ? 478 GLN C CB   14 
ATOM 11302 C CG   . GLN A 1 26 ? -15.781 -8.254  -1.931  1.00 0.00 ? 478 GLN C CG   14 
ATOM 11303 C CD   . GLN A 1 26 ? -15.930 -9.258  -3.047  1.00 0.00 ? 478 GLN C CD   14 
ATOM 11304 O OE1  . GLN A 1 26 ? -16.675 -9.043  -3.999  1.00 0.00 ? 478 GLN C OE1  14 
ATOM 11305 N NE2  . GLN A 1 26 ? -15.215 -10.355 -2.939  1.00 0.00 ? 478 GLN C NE2  14 
ATOM 11306 H H    . GLN A 1 26 ? -15.250 -8.988  1.061   1.00 0.00 ? 478 GLN C H    14 
ATOM 11307 H HA   . GLN A 1 26 ? -16.203 -6.594  0.003   1.00 0.00 ? 478 GLN C HA   14 
ATOM 11308 H HB2  . GLN A 1 26 ? -16.733 -9.475  -0.487  1.00 0.00 ? 478 GLN C HB2  14 
ATOM 11309 H HB3  . GLN A 1 26 ? -17.787 -8.295  -1.238  1.00 0.00 ? 478 GLN C HB3  14 
ATOM 11310 H HG2  . GLN A 1 26 ? -15.900 -7.263  -2.344  1.00 0.00 ? 478 GLN C HG2  14 
ATOM 11311 H HG3  . GLN A 1 26 ? -14.793 -8.351  -1.507  1.00 0.00 ? 478 GLN C HG3  14 
ATOM 11312 H HE21 . GLN A 1 26 ? -14.636 -10.446 -2.153  1.00 0.00 ? 478 GLN C HE21 14 
ATOM 11313 H HE22 . GLN A 1 26 ? -15.291 -11.033 -3.648  1.00 0.00 ? 478 GLN C HE22 14 
ATOM 11314 N N    . ASP A 1 27 ? -18.407 -8.222  1.846   1.00 0.00 ? 479 ASP C N    14 
ATOM 11315 C CA   . ASP A 1 27 ? -19.684 -8.039  2.549   1.00 0.00 ? 479 ASP C CA   14 
ATOM 11316 C C    . ASP A 1 27 ? -19.552 -6.999  3.646   1.00 0.00 ? 479 ASP C C    14 
ATOM 11317 O O    . ASP A 1 27 ? -20.490 -6.283  3.938   1.00 0.00 ? 479 ASP C O    14 
ATOM 11318 C CB   . ASP A 1 27 ? -20.197 -9.346  3.139   1.00 0.00 ? 479 ASP C CB   14 
ATOM 11319 C CG   . ASP A 1 27 ? -21.650 -9.242  3.610   1.00 0.00 ? 479 ASP C CG   14 
ATOM 11320 O OD1  . ASP A 1 27 ? -21.889 -8.799  4.759   1.00 0.00 ? 479 ASP C OD1  14 
ATOM 11321 O OD2  . ASP A 1 27 ? -22.557 -9.601  2.827   1.00 0.00 ? 479 ASP C OD2  14 
ATOM 11322 H H    . ASP A 1 27 ? -17.915 -9.065  1.943   1.00 0.00 ? 479 ASP C H    14 
ATOM 11323 H HA   . ASP A 1 27 ? -20.404 -7.675  1.828   1.00 0.00 ? 479 ASP C HA   14 
ATOM 11324 H HB2  . ASP A 1 27 ? -20.131 -10.121 2.392   1.00 0.00 ? 479 ASP C HB2  14 
ATOM 11325 H HB3  . ASP A 1 27 ? -19.581 -9.612  3.983   1.00 0.00 ? 479 ASP C HB3  14 
ATOM 11326 N N    . LEU A 1 28 ? -18.372 -6.901  4.231   1.00 0.00 ? 480 LEU C N    14 
ATOM 11327 C CA   . LEU A 1 28 ? -18.128 -5.914  5.270   1.00 0.00 ? 480 LEU C CA   14 
ATOM 11328 C C    . LEU A 1 28 ? -18.116 -4.522  4.674   1.00 0.00 ? 480 LEU C C    14 
ATOM 11329 O O    . LEU A 1 28 ? -18.397 -3.541  5.348   1.00 0.00 ? 480 LEU C O    14 
ATOM 11330 C CB   . LEU A 1 28 ? -16.827 -6.198  6.032   1.00 0.00 ? 480 LEU C CB   14 
ATOM 11331 C CG   . LEU A 1 28 ? -16.971 -6.988  7.337   1.00 0.00 ? 480 LEU C CG   14 
ATOM 11332 C CD1  . LEU A 1 28 ? -18.137 -6.478  8.160   1.00 0.00 ? 480 LEU C CD1  14 
ATOM 11333 C CD2  . LEU A 1 28 ? -17.148 -8.443  7.052   1.00 0.00 ? 480 LEU C CD2  14 
ATOM 11334 H H    . LEU A 1 28 ? -17.653 -7.499  3.955   1.00 0.00 ? 480 LEU C H    14 
ATOM 11335 H HA   . LEU A 1 28 ? -18.958 -5.973  5.959   1.00 0.00 ? 480 LEU C HA   14 
ATOM 11336 H HB2  . LEU A 1 28 ? -16.178 -6.759  5.382   1.00 0.00 ? 480 LEU C HB2  14 
ATOM 11337 H HB3  . LEU A 1 28 ? -16.342 -5.270  6.249   1.00 0.00 ? 480 LEU C HB3  14 
ATOM 11338 H HG   . LEU A 1 28 ? -16.072 -6.866  7.923   1.00 0.00 ? 480 LEU C HG   14 
ATOM 11339 H HD11 . LEU A 1 28 ? -19.063 -6.787  7.697   1.00 0.00 ? 480 LEU C HD11 14 
ATOM 11340 H HD12 . LEU A 1 28 ? -18.100 -5.400  8.209   1.00 0.00 ? 480 LEU C HD12 14 
ATOM 11341 H HD13 . LEU A 1 28 ? -18.081 -6.889  9.157   1.00 0.00 ? 480 LEU C HD13 14 
ATOM 11342 H HD21 . LEU A 1 28 ? -16.295 -8.806  6.501   1.00 0.00 ? 480 LEU C HD21 14 
ATOM 11343 H HD22 . LEU A 1 28 ? -18.047 -8.568  6.463   1.00 0.00 ? 480 LEU C HD22 14 
ATOM 11344 H HD23 . LEU A 1 28 ? -17.238 -8.980  7.986   1.00 0.00 ? 480 LEU C HD23 14 
ATOM 11345 N N    . GLN A 1 29 ? -17.790 -4.448  3.401   1.00 0.00 ? 481 GLN C N    14 
ATOM 11346 C CA   . GLN A 1 29 ? -17.841 -3.211  2.674   1.00 0.00 ? 481 GLN C CA   14 
ATOM 11347 C C    . GLN A 1 29 ? -19.290 -2.872  2.346   1.00 0.00 ? 481 GLN C C    14 
ATOM 11348 O O    . GLN A 1 29 ? -19.623 -1.726  2.046   1.00 0.00 ? 481 GLN C O    14 
ATOM 11349 C CB   . GLN A 1 29 ? -17.033 -3.334  1.393   1.00 0.00 ? 481 GLN C CB   14 
ATOM 11350 C CG   . GLN A 1 29 ? -15.946 -2.301  1.254   1.00 0.00 ? 481 GLN C CG   14 
ATOM 11351 C CD   . GLN A 1 29 ? -16.488 -0.885  1.204   1.00 0.00 ? 481 GLN C CD   14 
ATOM 11352 O OE1  . GLN A 1 29 ? -16.810 -0.367  0.136   1.00 0.00 ? 481 GLN C OE1  14 
ATOM 11353 N NE2  . GLN A 1 29 ? -16.584 -0.252  2.353   1.00 0.00 ? 481 GLN C NE2  14 
ATOM 11354 H H    . GLN A 1 29 ? -17.482 -5.253  2.930   1.00 0.00 ? 481 GLN C H    14 
ATOM 11355 H HA   . GLN A 1 29 ? -17.418 -2.434  3.290   1.00 0.00 ? 481 GLN C HA   14 
ATOM 11356 H HB2  . GLN A 1 29 ? -16.575 -4.312  1.366   1.00 0.00 ? 481 GLN C HB2  14 
ATOM 11357 H HB3  . GLN A 1 29 ? -17.703 -3.238  0.552   1.00 0.00 ? 481 GLN C HB3  14 
ATOM 11358 H HG2  . GLN A 1 29 ? -15.281 -2.386  2.101   1.00 0.00 ? 481 GLN C HG2  14 
ATOM 11359 H HG3  . GLN A 1 29 ? -15.404 -2.504  0.349   1.00 0.00 ? 481 GLN C HG3  14 
ATOM 11360 H HE21 . GLN A 1 29 ? -16.304 -0.721  3.165   1.00 0.00 ? 481 GLN C HE21 14 
ATOM 11361 H HE22 . GLN A 1 29 ? -16.927 0.666   2.352   1.00 0.00 ? 481 GLN C HE22 14 
ATOM 11362 N N    . LEU A 1 30 ? -20.140 -3.885  2.396   1.00 0.00 ? 482 LEU C N    14 
ATOM 11363 C CA   . LEU A 1 30 ? -21.541 -3.736  2.079   1.00 0.00 ? 482 LEU C CA   14 
ATOM 11364 C C    . LEU A 1 30 ? -22.374 -3.490  3.340   1.00 0.00 ? 482 LEU C C    14 
ATOM 11365 O O    . LEU A 1 30 ? -23.142 -2.533  3.407   1.00 0.00 ? 482 LEU C O    14 
ATOM 11366 C CB   . LEU A 1 30 ? -22.053 -4.997  1.373   1.00 0.00 ? 482 LEU C CB   14 
ATOM 11367 C CG   . LEU A 1 30 ? -21.194 -5.533  0.223   1.00 0.00 ? 482 LEU C CG   14 
ATOM 11368 C CD1  . LEU A 1 30 ? -21.893 -6.676  -0.489  1.00 0.00 ? 482 LEU C CD1  14 
ATOM 11369 C CD2  . LEU A 1 30 ? -20.826 -4.430  -0.750  1.00 0.00 ? 482 LEU C CD2  14 
ATOM 11370 H H    . LEU A 1 30 ? -19.813 -4.771  2.653   1.00 0.00 ? 482 LEU C H    14 
ATOM 11371 H HA   . LEU A 1 30 ? -21.650 -2.895  1.410   1.00 0.00 ? 482 LEU C HA   14 
ATOM 11372 H HB2  . LEU A 1 30 ? -22.144 -5.780  2.112   1.00 0.00 ? 482 LEU C HB2  14 
ATOM 11373 H HB3  . LEU A 1 30 ? -23.033 -4.786  0.986   1.00 0.00 ? 482 LEU C HB3  14 
ATOM 11374 H HG   . LEU A 1 30 ? -20.278 -5.928  0.641   1.00 0.00 ? 482 LEU C HG   14 
ATOM 11375 H HD11 . LEU A 1 30 ? -22.820 -6.320  -0.917  1.00 0.00 ? 482 LEU C HD11 14 
ATOM 11376 H HD12 . LEU A 1 30 ? -22.105 -7.465  0.216   1.00 0.00 ? 482 LEU C HD12 14 
ATOM 11377 H HD13 . LEU A 1 30 ? -21.256 -7.055  -1.274  1.00 0.00 ? 482 LEU C HD13 14 
ATOM 11378 H HD21 . LEU A 1 30 ? -20.232 -3.692  -0.230  1.00 0.00 ? 482 LEU C HD21 14 
ATOM 11379 H HD22 . LEU A 1 30 ? -21.723 -3.970  -1.135  1.00 0.00 ? 482 LEU C HD22 14 
ATOM 11380 H HD23 . LEU A 1 30 ? -20.249 -4.848  -1.562  1.00 0.00 ? 482 LEU C HD23 14 
ATOM 11381 N N    . THR A 1 31 ? -22.208 -4.349  4.338   1.00 0.00 ? 483 THR C N    14 
ATOM 11382 C CA   . THR A 1 31 ? -23.014 -4.276  5.547   1.00 0.00 ? 483 THR C CA   14 
ATOM 11383 C C    . THR A 1 31 ? -22.299 -3.549  6.673   1.00 0.00 ? 483 THR C C    14 
ATOM 11384 O O    . THR A 1 31 ? -22.939 -2.878  7.484   1.00 0.00 ? 483 THR C O    14 
ATOM 11385 C CB   . THR A 1 31 ? -23.407 -5.682  6.034   1.00 0.00 ? 483 THR C CB   14 
ATOM 11386 O OG1  . THR A 1 31 ? -22.227 -6.473  6.225   1.00 0.00 ? 483 THR C OG1  14 
ATOM 11387 C CG2  . THR A 1 31 ? -24.320 -6.366  5.032   1.00 0.00 ? 483 THR C CG2  14 
ATOM 11388 H H    . THR A 1 31 ? -21.522 -5.059  4.269   1.00 0.00 ? 483 THR C H    14 
ATOM 11389 H HA   . THR A 1 31 ? -23.921 -3.741  5.309   1.00 0.00 ? 483 THR C HA   14 
ATOM 11390 H HB   . THR A 1 31 ? -23.926 -5.590  6.976   1.00 0.00 ? 483 THR C HB   14 
ATOM 11391 H HG1  . THR A 1 31 ? -22.202 -7.192  5.571   1.00 0.00 ? 483 THR C HG1  14 
ATOM 11392 H HG21 . THR A 1 31 ? -23.815 -6.443  4.082   1.00 0.00 ? 483 THR C HG21 14 
ATOM 11393 H HG22 . THR A 1 31 ? -25.225 -5.789  4.916   1.00 0.00 ? 483 THR C HG22 14 
ATOM 11394 H HG23 . THR A 1 31 ? -24.568 -7.355  5.389   1.00 0.00 ? 483 THR C HG23 14 
ATOM 11395 N N    . ARG A 1 32 ? -20.966 -3.683  6.717   1.00 0.00 ? 484 ARG C N    14 
ATOM 11396 C CA   . ARG A 1 32 ? -20.148 -3.088  7.773   1.00 0.00 ? 484 ARG C CA   14 
ATOM 11397 C C    . ARG A 1 32 ? -20.468 -3.708  9.139   1.00 0.00 ? 484 ARG C C    14 
ATOM 11398 O O    . ARG A 1 32 ? -20.145 -3.140  10.180  1.00 0.00 ? 484 ARG C O    14 
ATOM 11399 C CB   . ARG A 1 32 ? -20.348 -1.576  7.824   1.00 0.00 ? 484 ARG C CB   14 
ATOM 11400 C CG   . ARG A 1 32 ? -19.901 -0.840  6.575   1.00 0.00 ? 484 ARG C CG   14 
ATOM 11401 C CD   . ARG A 1 32 ? -20.380 0.594   6.608   1.00 0.00 ? 484 ARG C CD   14 
ATOM 11402 N NE   . ARG A 1 32 ? -19.856 1.392   5.495   1.00 0.00 ? 484 ARG C NE   14 
ATOM 11403 C CZ   . ARG A 1 32 ? -20.543 2.358   4.868   1.00 0.00 ? 484 ARG C CZ   14 
ATOM 11404 N NH1  . ARG A 1 32 ? -21.801 2.626   5.217   1.00 0.00 ? 484 ARG C NH1  14 
ATOM 11405 N NH2  . ARG A 1 32 ? -19.969 3.053   3.895   1.00 0.00 ? 484 ARG C NH2  14 
ATOM 11406 H H    . ARG A 1 32 ? -20.512 -4.186  6.011   1.00 0.00 ? 484 ARG C H    14 
ATOM 11407 H HA   . ARG A 1 32 ? -19.115 -3.292  7.538   1.00 0.00 ? 484 ARG C HA   14 
ATOM 11408 H HB2  . ARG A 1 32 ? -21.393 -1.367  7.978   1.00 0.00 ? 484 ARG C HB2  14 
ATOM 11409 H HB3  . ARG A 1 32 ? -19.786 -1.195  8.659   1.00 0.00 ? 484 ARG C HB3  14 
ATOM 11410 H HG2  . ARG A 1 32 ? -18.823 -0.852  6.529   1.00 0.00 ? 484 ARG C HG2  14 
ATOM 11411 H HG3  . ARG A 1 32 ? -20.309 -1.334  5.706   1.00 0.00 ? 484 ARG C HG3  14 
ATOM 11412 H HD2  . ARG A 1 32 ? -21.458 0.583   6.556   1.00 0.00 ? 484 ARG C HD2  14 
ATOM 11413 H HD3  . ARG A 1 32 ? -20.069 1.034   7.541   1.00 0.00 ? 484 ARG C HD3  14 
ATOM 11414 H HE   . ARG A 1 32 ? -18.929 1.205   5.213   1.00 0.00 ? 484 ARG C HE   14 
ATOM 11415 H HH11 . ARG A 1 32 ? -22.249 2.115   5.953   1.00 0.00 ? 484 ARG C HH11 14 
ATOM 11416 H HH12 . ARG A 1 32 ? -22.323 3.341   4.738   1.00 0.00 ? 484 ARG C HH12 14 
ATOM 11417 H HH21 . ARG A 1 32 ? -19.019 2.862   3.623   1.00 0.00 ? 484 ARG C HH21 14 
ATOM 11418 H HH22 . ARG A 1 32 ? -20.475 3.777   3.418   1.00 0.00 ? 484 ARG C HH22 14 
ATOM 11419 N N    . SER A 1 33 ? -21.085 -4.884  9.126   1.00 0.00 ? 485 SER C N    14 
ATOM 11420 C CA   . SER A 1 33 ? -21.461 -5.557  10.355  1.00 0.00 ? 485 SER C CA   14 
ATOM 11421 C C    . SER A 1 33 ? -21.151 -7.037  10.266  1.00 0.00 ? 485 SER C C    14 
ATOM 11422 O O    . SER A 1 33 ? -21.766 -7.752  9.478   1.00 0.00 ? 485 SER C O    14 
ATOM 11423 C CB   . SER A 1 33 ? -22.952 -5.368  10.624  1.00 0.00 ? 485 SER C CB   14 
ATOM 11424 O OG   . SER A 1 33 ? -23.311 -5.861  11.908  1.00 0.00 ? 485 SER C OG   14 
ATOM 11425 H H    . SER A 1 33 ? -21.289 -5.314  8.266   1.00 0.00 ? 485 SER C H    14 
ATOM 11426 H HA   . SER A 1 33 ? -20.900 -5.122  11.164  1.00 0.00 ? 485 SER C HA   14 
ATOM 11427 H HB2  . SER A 1 33 ? -23.211 -4.326  10.553  1.00 0.00 ? 485 SER C HB2  14 
ATOM 11428 H HB3  . SER A 1 33 ? -23.509 -5.918  9.880   1.00 0.00 ? 485 SER C HB3  14 
ATOM 11429 H HG   . SER A 1 33 ? -24.063 -5.352  12.240  1.00 0.00 ? 485 SER C HG   14 
ATOM 11430 N N    . VAL A 1 34 ? -20.211 -7.508  11.087  1.00 0.00 ? 486 VAL C N    14 
ATOM 11431 C CA   . VAL A 1 34 ? -19.837 -8.909  11.075  1.00 0.00 ? 486 VAL C CA   14 
ATOM 11432 C C    . VAL A 1 34 ? -21.001 -9.794  11.497  1.00 0.00 ? 486 VAL C C    14 
ATOM 11433 O O    . VAL A 1 34 ? -21.120 -10.932 11.042  1.00 0.00 ? 486 VAL C O    14 
ATOM 11434 C CB   . VAL A 1 34 ? -18.606 -9.207  11.962  1.00 0.00 ? 486 VAL C CB   14 
ATOM 11435 C CG1  . VAL A 1 34 ? -17.434 -8.360  11.547  1.00 0.00 ? 486 VAL C CG1  14 
ATOM 11436 C CG2  . VAL A 1 34 ? -18.905 -9.017  13.437  1.00 0.00 ? 486 VAL C CG2  14 
ATOM 11437 H H    . VAL A 1 34 ? -19.759 -6.900  11.710  1.00 0.00 ? 486 VAL C H    14 
ATOM 11438 H HA   . VAL A 1 34 ? -19.586 -9.154  10.054  1.00 0.00 ? 486 VAL C HA   14 
ATOM 11439 H HB   . VAL A 1 34 ? -18.334 -10.238 11.805  1.00 0.00 ? 486 VAL C HB   14 
ATOM 11440 H HG11 . VAL A 1 34 ? -17.689 -7.316  11.653  1.00 0.00 ? 486 VAL C HG11 14 
ATOM 11441 H HG12 . VAL A 1 34 ? -17.186 -8.569  10.515  1.00 0.00 ? 486 VAL C HG12 14 
ATOM 11442 H HG13 . VAL A 1 34 ? -16.587 -8.589  12.175  1.00 0.00 ? 486 VAL C HG13 14 
ATOM 11443 H HG21 . VAL A 1 34 ? -19.742 -9.640  13.716  1.00 0.00 ? 486 VAL C HG21 14 
ATOM 11444 H HG22 . VAL A 1 34 ? -19.137 -7.981  13.631  1.00 0.00 ? 486 VAL C HG22 14 
ATOM 11445 H HG23 . VAL A 1 34 ? -18.035 -9.310  14.006  1.00 0.00 ? 486 VAL C HG23 14 
ATOM 11446 N N    . GLU A 1 35 ? -21.865 -9.262  12.358  1.00 0.00 ? 487 GLU C N    14 
ATOM 11447 C CA   . GLU A 1 35 ? -23.039 -9.990  12.796  1.00 0.00 ? 487 GLU C CA   14 
ATOM 11448 C C    . GLU A 1 35 ? -23.927 -10.298 11.605  1.00 0.00 ? 487 GLU C C    14 
ATOM 11449 O O    . GLU A 1 35 ? -24.471 -11.399 11.487  1.00 0.00 ? 487 GLU C O    14 
ATOM 11450 C CB   . GLU A 1 35 ? -23.818 -9.185  13.837  1.00 0.00 ? 487 GLU C CB   14 
ATOM 11451 C CG   . GLU A 1 35 ? -23.050 -8.937  15.125  1.00 0.00 ? 487 GLU C CG   14 
ATOM 11452 C CD   . GLU A 1 35 ? -22.636 -10.220 15.810  1.00 0.00 ? 487 GLU C CD   14 
ATOM 11453 O OE1  . GLU A 1 35 ? -23.520 -10.954 16.287  1.00 0.00 ? 487 GLU C OE1  14 
ATOM 11454 O OE2  . GLU A 1 35 ? -21.422 -10.501 15.873  1.00 0.00 ? 487 GLU C OE2  14 
ATOM 11455 H H    . GLU A 1 35 ? -21.697 -8.359  12.706  1.00 0.00 ? 487 GLU C H    14 
ATOM 11456 H HA   . GLU A 1 35 ? -22.713 -10.920 13.238  1.00 0.00 ? 487 GLU C HA   14 
ATOM 11457 H HB2  . GLU A 1 35 ? -24.078 -8.227  13.411  1.00 0.00 ? 487 GLU C HB2  14 
ATOM 11458 H HB3  . GLU A 1 35 ? -24.725 -9.717  14.082  1.00 0.00 ? 487 GLU C HB3  14 
ATOM 11459 H HG2  . GLU A 1 35 ? -22.162 -8.368  14.897  1.00 0.00 ? 487 GLU C HG2  14 
ATOM 11460 H HG3  . GLU A 1 35 ? -23.675 -8.369  15.800  1.00 0.00 ? 487 GLU C HG3  14 
ATOM 11461 N N    . ILE A 1 36 ? -24.054 -9.329  10.711  1.00 0.00 ? 488 ILE C N    14 
ATOM 11462 C CA   . ILE A 1 36 ? -24.841 -9.514  9.518   1.00 0.00 ? 488 ILE C CA   14 
ATOM 11463 C C    . ILE A 1 36 ? -24.093 -10.397 8.544   1.00 0.00 ? 488 ILE C C    14 
ATOM 11464 O O    . ILE A 1 36 ? -24.607 -11.385 8.121   1.00 0.00 ? 488 ILE C O    14 
ATOM 11465 C CB   . ILE A 1 36 ? -25.189 -8.177  8.827   1.00 0.00 ? 488 ILE C CB   14 
ATOM 11466 C CG1  . ILE A 1 36 ? -25.863 -7.221  9.821   1.00 0.00 ? 488 ILE C CG1  14 
ATOM 11467 C CG2  . ILE A 1 36 ? -26.099 -8.425  7.629   1.00 0.00 ? 488 ILE C CG2  14 
ATOM 11468 C CD1  . ILE A 1 36 ? -26.247 -5.882  9.220   1.00 0.00 ? 488 ILE C CD1  14 
ATOM 11469 H H    . ILE A 1 36 ? -23.596 -8.476  10.862  1.00 0.00 ? 488 ILE C H    14 
ATOM 11470 H HA   . ILE A 1 36 ? -25.760 -10.010 9.800   1.00 0.00 ? 488 ILE C HA   14 
ATOM 11471 H HB   . ILE A 1 36 ? -24.271 -7.741  8.468   1.00 0.00 ? 488 ILE C HB   14 
ATOM 11472 H HG12 . ILE A 1 36 ? -26.763 -7.681  10.197  1.00 0.00 ? 488 ILE C HG12 14 
ATOM 11473 H HG13 . ILE A 1 36 ? -25.189 -7.036  10.644  1.00 0.00 ? 488 ILE C HG13 14 
ATOM 11474 H HG21 . ILE A 1 36 ? -27.000 -8.917  7.959   1.00 0.00 ? 488 ILE C HG21 14 
ATOM 11475 H HG22 . ILE A 1 36 ? -25.588 -9.050  6.913   1.00 0.00 ? 488 ILE C HG22 14 
ATOM 11476 H HG23 . ILE A 1 36 ? -26.351 -7.481  7.168   1.00 0.00 ? 488 ILE C HG23 14 
ATOM 11477 H HD11 . ILE A 1 36 ? -26.718 -5.272  9.976   1.00 0.00 ? 488 ILE C HD11 14 
ATOM 11478 H HD12 . ILE A 1 36 ? -26.938 -6.040  8.403   1.00 0.00 ? 488 ILE C HD12 14 
ATOM 11479 H HD13 . ILE A 1 36 ? -25.364 -5.383  8.852   1.00 0.00 ? 488 ILE C HD13 14 
ATOM 11480 N N    . THR A 1 37 ? -22.863 -10.013 8.217   1.00 0.00 ? 489 THR C N    14 
ATOM 11481 C CA   . THR A 1 37 ? -21.992 -10.759 7.307   1.00 0.00 ? 489 THR C CA   14 
ATOM 11482 C C    . THR A 1 37 ? -21.961 -12.268 7.614   1.00 0.00 ? 489 THR C C    14 
ATOM 11483 O O    . THR A 1 37 ? -22.091 -13.089 6.709   1.00 0.00 ? 489 THR C O    14 
ATOM 11484 C CB   . THR A 1 37 ? -20.564 -10.195 7.369   1.00 0.00 ? 489 THR C CB   14 
ATOM 11485 O OG1  . THR A 1 37 ? -20.600 -8.792  7.108   1.00 0.00 ? 489 THR C OG1  14 
ATOM 11486 C CG2  . THR A 1 37 ? -19.656 -10.867 6.352   1.00 0.00 ? 489 THR C CG2  14 
ATOM 11487 H H    . THR A 1 37 ? -22.518 -9.172  8.573   1.00 0.00 ? 489 THR C H    14 
ATOM 11488 H HA   . THR A 1 37 ? -22.361 -10.614 6.302   1.00 0.00 ? 489 THR C HA   14 
ATOM 11489 H HB   . THR A 1 37 ? -20.173 -10.365 8.361   1.00 0.00 ? 489 THR C HB   14 
ATOM 11490 H HG1  . THR A 1 37 ? -21.047 -8.647  6.257   1.00 0.00 ? 489 THR C HG1  14 
ATOM 11491 H HG21 . THR A 1 37 ? -20.121 -10.830 5.380   1.00 0.00 ? 489 THR C HG21 14 
ATOM 11492 H HG22 . THR A 1 37 ? -19.483 -11.893 6.638   1.00 0.00 ? 489 THR C HG22 14 
ATOM 11493 H HG23 . THR A 1 37 ? -18.716 -10.334 6.317   1.00 0.00 ? 489 THR C HG23 14 
ATOM 11494 N N    . THR A 1 38 ? -21.805 -12.627 8.884   1.00 0.00 ? 490 THR C N    14 
ATOM 11495 C CA   . THR A 1 38 ? -21.757 -14.030 9.267   1.00 0.00 ? 490 THR C CA   14 
ATOM 11496 C C    . THR A 1 38 ? -23.097 -14.708 8.986   1.00 0.00 ? 490 THR C C    14 
ATOM 11497 O O    . THR A 1 38 ? -23.147 -15.796 8.404   1.00 0.00 ? 490 THR C O    14 
ATOM 11498 C CB   . THR A 1 38 ? -21.386 -14.193 10.752  1.00 0.00 ? 490 THR C CB   14 
ATOM 11499 O OG1  . THR A 1 38 ? -20.197 -13.441 11.033  1.00 0.00 ? 490 THR C OG1  14 
ATOM 11500 C CG2  . THR A 1 38 ? -21.138 -15.654 11.075  1.00 0.00 ? 490 THR C CG2  14 
ATOM 11501 H H    . THR A 1 38 ? -21.722 -11.940 9.577   1.00 0.00 ? 490 THR C H    14 
ATOM 11502 H HA   . THR A 1 38 ? -20.999 -14.509 8.665   1.00 0.00 ? 490 THR C HA   14 
ATOM 11503 H HB   . THR A 1 38 ? -22.197 -13.826 11.364  1.00 0.00 ? 490 THR C HB   14 
ATOM 11504 H HG1  . THR A 1 38 ? -20.432 -12.515 11.171  1.00 0.00 ? 490 THR C HG1  14 
ATOM 11505 H HG21 . THR A 1 38 ? -20.358 -16.033 10.426  1.00 0.00 ? 490 THR C HG21 14 
ATOM 11506 H HG22 . THR A 1 38 ? -22.045 -16.219 10.916  1.00 0.00 ? 490 THR C HG22 14 
ATOM 11507 H HG23 . THR A 1 38 ? -20.828 -15.750 12.105  1.00 0.00 ? 490 THR C HG23 14 
ATOM 11508 N N    . ASP A 1 39 ? -24.176 -14.047 9.376   1.00 0.00 ? 491 ASP C N    14 
ATOM 11509 C CA   . ASP A 1 39 ? -25.523 -14.558 9.123   1.00 0.00 ? 491 ASP C CA   14 
ATOM 11510 C C    . ASP A 1 39 ? -25.782 -14.542 7.628   1.00 0.00 ? 491 ASP C C    14 
ATOM 11511 O O    . ASP A 1 39 ? -26.410 -15.437 7.083   1.00 0.00 ? 491 ASP C O    14 
ATOM 11512 C CB   . ASP A 1 39 ? -26.559 -13.699 9.855   1.00 0.00 ? 491 ASP C CB   14 
ATOM 11513 C CG   . ASP A 1 39 ? -27.985 -14.178 9.657   1.00 0.00 ? 491 ASP C CG   14 
ATOM 11514 O OD1  . ASP A 1 39 ? -28.300 -15.314 10.062  1.00 0.00 ? 491 ASP C OD1  14 
ATOM 11515 O OD2  . ASP A 1 39 ? -28.808 -13.402 9.128   1.00 0.00 ? 491 ASP C OD2  14 
ATOM 11516 H H    . ASP A 1 39 ? -24.067 -13.187 9.836   1.00 0.00 ? 491 ASP C H    14 
ATOM 11517 H HA   . ASP A 1 39 ? -25.577 -15.580 9.476   1.00 0.00 ? 491 ASP C HA   14 
ATOM 11518 H HB2  . ASP A 1 39 ? -26.340 -13.705 10.911  1.00 0.00 ? 491 ASP C HB2  14 
ATOM 11519 H HB3  . ASP A 1 39 ? -26.487 -12.686 9.490   1.00 0.00 ? 491 ASP C HB3  14 
ATOM 11520 N N    . ASN A 1 40 ? -25.251 -13.516 6.980   1.00 0.00 ? 492 ASN C N    14 
ATOM 11521 C CA   . ASN A 1 40 ? -25.325 -13.349 5.545   1.00 0.00 ? 492 ASN C CA   14 
ATOM 11522 C C    . ASN A 1 40 ? -24.780 -14.586 4.852   1.00 0.00 ? 492 ASN C C    14 
ATOM 11523 O O    . ASN A 1 40 ? -25.410 -15.137 3.950   1.00 0.00 ? 492 ASN C O    14 
ATOM 11524 C CB   . ASN A 1 40 ? -24.533 -12.092 5.108   1.00 0.00 ? 492 ASN C CB   14 
ATOM 11525 C CG   . ASN A 1 40 ? -25.408 -10.877 4.898   1.00 0.00 ? 492 ASN C CG   14 
ATOM 11526 O OD1  . ASN A 1 40 ? -26.616 -10.992 4.691   1.00 0.00 ? 492 ASN C OD1  14 
ATOM 11527 N ND2  . ASN A 1 40 ? -24.803 -9.709  4.904   1.00 0.00 ? 492 ASN C ND2  14 
ATOM 11528 H H    . ASN A 1 40 ? -24.790 -12.828 7.508   1.00 0.00 ? 492 ASN C H    14 
ATOM 11529 H HA   . ASN A 1 40 ? -26.362 -13.207 5.289   1.00 0.00 ? 492 ASN C HA   14 
ATOM 11530 H HB2  . ASN A 1 40 ? -23.839 -11.841 5.899   1.00 0.00 ? 492 ASN C HB2  14 
ATOM 11531 H HB3  . ASN A 1 40 ? -23.971 -12.279 4.214   1.00 0.00 ? 492 ASN C HB3  14 
ATOM 11532 H HD21 . ASN A 1 40 ? -23.827 -9.684  5.037   1.00 0.00 ? 492 ASN C HD21 14 
ATOM 11533 H HD22 . ASN A 1 40 ? -25.344 -8.907  4.775   1.00 0.00 ? 492 ASN C HD22 14 
ATOM 11534 N N    . ILE A 1 41 ? -23.610 -15.028 5.300   1.00 0.00 ? 493 ILE C N    14 
ATOM 11535 C CA   . ILE A 1 41 ? -22.982 -16.237 4.784   1.00 0.00 ? 493 ILE C CA   14 
ATOM 11536 C C    . ILE A 1 41 ? -23.936 -17.416 4.915   1.00 0.00 ? 493 ILE C C    14 
ATOM 11537 O O    . ILE A 1 41 ? -24.267 -18.085 3.936   1.00 0.00 ? 493 ILE C O    14 
ATOM 11538 C CB   . ILE A 1 41 ? -21.703 -16.587 5.591   1.00 0.00 ? 493 ILE C CB   14 
ATOM 11539 C CG1  . ILE A 1 41 ? -20.668 -15.476 5.504   1.00 0.00 ? 493 ILE C CG1  14 
ATOM 11540 C CG2  . ILE A 1 41 ? -21.109 -17.904 5.117   1.00 0.00 ? 493 ILE C CG2  14 
ATOM 11541 C CD1  . ILE A 1 41 ? -19.513 -15.650 6.471   1.00 0.00 ? 493 ILE C CD1  14 
ATOM 11542 H H    . ILE A 1 41 ? -23.146 -14.513 5.999   1.00 0.00 ? 493 ILE C H    14 
ATOM 11543 H HA   . ILE A 1 41 ? -22.723 -16.074 3.750   1.00 0.00 ? 493 ILE C HA   14 
ATOM 11544 H HB   . ILE A 1 41 ? -21.990 -16.710 6.626   1.00 0.00 ? 493 ILE C HB   14 
ATOM 11545 H HG12 . ILE A 1 41 ? -20.267 -15.446 4.504   1.00 0.00 ? 493 ILE C HG12 14 
ATOM 11546 H HG13 . ILE A 1 41 ? -21.148 -14.537 5.723   1.00 0.00 ? 493 ILE C HG13 14 
ATOM 11547 H HG21 . ILE A 1 41 ? -20.782 -17.799 4.093   1.00 0.00 ? 493 ILE C HG21 14 
ATOM 11548 H HG22 . ILE A 1 41 ? -21.856 -18.679 5.181   1.00 0.00 ? 493 ILE C HG22 14 
ATOM 11549 H HG23 . ILE A 1 41 ? -20.267 -18.161 5.742   1.00 0.00 ? 493 ILE C HG23 14 
ATOM 11550 H HD11 . ILE A 1 41 ? -18.976 -16.555 6.235   1.00 0.00 ? 493 ILE C HD11 14 
ATOM 11551 H HD12 . ILE A 1 41 ? -19.900 -15.722 7.476   1.00 0.00 ? 493 ILE C HD12 14 
ATOM 11552 H HD13 . ILE A 1 41 ? -18.848 -14.804 6.403   1.00 0.00 ? 493 ILE C HD13 14 
ATOM 11553 N N    . LEU A 1 42 ? -24.378 -17.631 6.135   1.00 0.00 ? 494 LEU C N    14 
ATOM 11554 C CA   . LEU A 1 42 ? -25.235 -18.747 6.500   1.00 0.00 ? 494 LEU C CA   14 
ATOM 11555 C C    . LEU A 1 42 ? -26.557 -18.749 5.730   1.00 0.00 ? 494 LEU C C    14 
ATOM 11556 O O    . LEU A 1 42 ? -27.066 -19.812 5.355   1.00 0.00 ? 494 LEU C O    14 
ATOM 11557 C CB   . LEU A 1 42 ? -25.478 -18.699 8.003   1.00 0.00 ? 494 LEU C CB   14 
ATOM 11558 C CG   . LEU A 1 42 ? -24.216 -18.838 8.860   1.00 0.00 ? 494 LEU C CG   14 
ATOM 11559 C CD1  . LEU A 1 42 ? -24.503 -18.510 10.310  1.00 0.00 ? 494 LEU C CD1  14 
ATOM 11560 C CD2  . LEU A 1 42 ? -23.640 -20.237 8.732   1.00 0.00 ? 494 LEU C CD2  14 
ATOM 11561 H H    . LEU A 1 42 ? -24.114 -16.999 6.842   1.00 0.00 ? 494 LEU C H    14 
ATOM 11562 H HA   . LEU A 1 42 ? -24.702 -19.656 6.271   1.00 0.00 ? 494 LEU C HA   14 
ATOM 11563 H HB2  . LEU A 1 42 ? -25.942 -17.751 8.236   1.00 0.00 ? 494 LEU C HB2  14 
ATOM 11564 H HB3  . LEU A 1 42 ? -26.160 -19.488 8.272   1.00 0.00 ? 494 LEU C HB3  14 
ATOM 11565 H HG   . LEU A 1 42 ? -23.475 -18.139 8.502   1.00 0.00 ? 494 LEU C HG   14 
ATOM 11566 H HD11 . LEU A 1 42 ? -25.297 -19.143 10.676  1.00 0.00 ? 494 LEU C HD11 14 
ATOM 11567 H HD12 . LEU A 1 42 ? -24.792 -17.471 10.390  1.00 0.00 ? 494 LEU C HD12 14 
ATOM 11568 H HD13 . LEU A 1 42 ? -23.610 -18.676 10.893  1.00 0.00 ? 494 LEU C HD13 14 
ATOM 11569 H HD21 . LEU A 1 42 ? -23.342 -20.413 7.709   1.00 0.00 ? 494 LEU C HD21 14 
ATOM 11570 H HD22 . LEU A 1 42 ? -24.388 -20.962 9.016   1.00 0.00 ? 494 LEU C HD22 14 
ATOM 11571 H HD23 . LEU A 1 42 ? -22.781 -20.333 9.379   1.00 0.00 ? 494 LEU C HD23 14 
ATOM 11572 N N    . GLU A 1 43 ? -27.097 -17.570 5.479   1.00 0.00 ? 495 GLU C N    14 
ATOM 11573 C CA   . GLU A 1 43 ? -28.361 -17.440 4.765   1.00 0.00 ? 495 GLU C CA   14 
ATOM 11574 C C    . GLU A 1 43 ? -28.186 -17.633 3.259   1.00 0.00 ? 495 GLU C C    14 
ATOM 11575 O O    . GLU A 1 43 ? -29.165 -17.761 2.525   1.00 0.00 ? 495 GLU C O    14 
ATOM 11576 C CB   . GLU A 1 43 ? -28.996 -16.090 5.058   1.00 0.00 ? 495 GLU C CB   14 
ATOM 11577 C CG   . GLU A 1 43 ? -29.369 -15.905 6.516   1.00 0.00 ? 495 GLU C CG   14 
ATOM 11578 C CD   . GLU A 1 43 ? -30.437 -16.868 6.973   1.00 0.00 ? 495 GLU C CD   14 
ATOM 11579 O OE1  . GLU A 1 43 ? -30.111 -18.035 7.270   1.00 0.00 ? 495 GLU C OE1  14 
ATOM 11580 O OE2  . GLU A 1 43 ? -31.612 -16.456 7.043   1.00 0.00 ? 495 GLU C OE2  14 
ATOM 11581 H H    . GLU A 1 43 ? -26.641 -16.758 5.799   1.00 0.00 ? 495 GLU C H    14 
ATOM 11582 H HA   . GLU A 1 43 ? -29.019 -18.214 5.133   1.00 0.00 ? 495 GLU C HA   14 
ATOM 11583 H HB2  . GLU A 1 43 ? -28.300 -15.311 4.784   1.00 0.00 ? 495 GLU C HB2  14 
ATOM 11584 H HB3  . GLU A 1 43 ? -29.892 -15.988 4.464   1.00 0.00 ? 495 GLU C HB3  14 
ATOM 11585 H HG2  . GLU A 1 43 ? -28.488 -16.059 7.120   1.00 0.00 ? 495 GLU C HG2  14 
ATOM 11586 H HG3  . GLU A 1 43 ? -29.726 -14.899 6.656   1.00 0.00 ? 495 GLU C HG3  14 
ATOM 11587 N N    . GLY A 1 44 ? -26.943 -17.658 2.809   1.00 0.00 ? 496 GLY C N    14 
ATOM 11588 C CA   . GLY A 1 44 ? -26.673 -17.880 1.403   1.00 0.00 ? 496 GLY C CA   14 
ATOM 11589 C C    . GLY A 1 44 ? -26.405 -16.601 0.636   1.00 0.00 ? 496 GLY C C    14 
ATOM 11590 O O    . GLY A 1 44 ? -26.338 -16.617 -0.593  1.00 0.00 ? 496 GLY C O    14 
ATOM 11591 H H    . GLY A 1 44 ? -26.199 -17.531 3.438   1.00 0.00 ? 496 GLY C H    14 
ATOM 11592 H HA2  . GLY A 1 44 ? -25.811 -18.522 1.312   1.00 0.00 ? 496 GLY C HA2  14 
ATOM 11593 H HA3  . GLY A 1 44 ? -27.524 -18.375 0.962   1.00 0.00 ? 496 GLY C HA3  14 
ATOM 11594 N N    . ARG A 1 45 ? -26.248 -15.496 1.353   1.00 0.00 ? 497 ARG C N    14 
ATOM 11595 C CA   . ARG A 1 45 ? -25.950 -14.206 0.729   1.00 0.00 ? 497 ARG C CA   14 
ATOM 11596 C C    . ARG A 1 45 ? -24.596 -14.260 0.047   1.00 0.00 ? 497 ARG C C    14 
ATOM 11597 O O    . ARG A 1 45 ? -24.401 -13.700 -1.030  1.00 0.00 ? 497 ARG C O    14 
ATOM 11598 C CB   . ARG A 1 45 ? -25.951 -13.090 1.779   1.00 0.00 ? 497 ARG C CB   14 
ATOM 11599 C CG   . ARG A 1 45 ? -25.576 -11.699 1.247   1.00 0.00 ? 497 ARG C CG   14 
ATOM 11600 C CD   . ARG A 1 45 ? -26.607 -11.153 0.258   1.00 0.00 ? 497 ARG C CD   14 
ATOM 11601 N NE   . ARG A 1 45 ? -26.583 -11.856 -1.032  1.00 0.00 ? 497 ARG C NE   14 
ATOM 11602 C CZ   . ARG A 1 45 ? -27.633 -11.960 -1.855  1.00 0.00 ? 497 ARG C CZ   14 
ATOM 11603 N NH1  . ARG A 1 45 ? -28.797 -11.413 -1.531  1.00 0.00 ? 497 ARG C NH1  14 
ATOM 11604 N NH2  . ARG A 1 45 ? -27.514 -12.608 -3.005  1.00 0.00 ? 497 ARG C NH2  14 
ATOM 11605 H H    . ARG A 1 45 ? -26.336 -15.544 2.331   1.00 0.00 ? 497 ARG C H    14 
ATOM 11606 H HA   . ARG A 1 45 ? -26.711 -14.000 -0.010  1.00 0.00 ? 497 ARG C HA   14 
ATOM 11607 H HB2  . ARG A 1 45 ? -26.934 -13.028 2.218   1.00 0.00 ? 497 ARG C HB2  14 
ATOM 11608 H HB3  . ARG A 1 45 ? -25.238 -13.360 2.553   1.00 0.00 ? 497 ARG C HB3  14 
ATOM 11609 H HG2  . ARG A 1 45 ? -25.505 -11.016 2.080   1.00 0.00 ? 497 ARG C HG2  14 
ATOM 11610 H HG3  . ARG A 1 45 ? -24.618 -11.765 0.756   1.00 0.00 ? 497 ARG C HG3  14 
ATOM 11611 H HD2  . ARG A 1 45 ? -27.590 -11.257 0.691   1.00 0.00 ? 497 ARG C HD2  14 
ATOM 11612 H HD3  . ARG A 1 45 ? -26.402 -10.107 0.090   1.00 0.00 ? 497 ARG C HD3  14 
ATOM 11613 H HE   . ARG A 1 45 ? -25.728 -12.270 -1.298  1.00 0.00 ? 497 ARG C HE   14 
ATOM 11614 H HH11 . ARG A 1 45 ? -28.905 -10.914 -0.666  1.00 0.00 ? 497 ARG C HH11 14 
ATOM 11615 H HH12 . ARG A 1 45 ? -29.583 -11.492 -2.149  1.00 0.00 ? 497 ARG C HH12 14 
ATOM 11616 H HH21 . ARG A 1 45 ? -26.639 -13.025 -3.271  1.00 0.00 ? 497 ARG C HH21 14 
ATOM 11617 H HH22 . ARG A 1 45 ? -28.302 -12.692 -3.622  1.00 0.00 ? 497 ARG C HH22 14 
ATOM 11618 N N    . ILE A 1 46 ? -23.672 -14.941 0.687   1.00 0.00 ? 498 ILE C N    14 
ATOM 11619 C CA   . ILE A 1 46 ? -22.336 -15.088 0.170   1.00 0.00 ? 498 ILE C CA   14 
ATOM 11620 C C    . ILE A 1 46 ? -22.143 -16.502 -0.346  1.00 0.00 ? 498 ILE C C    14 
ATOM 11621 O O    . ILE A 1 46 ? -22.214 -17.468 0.418   1.00 0.00 ? 498 ILE C O    14 
ATOM 11622 C CB   . ILE A 1 46 ? -21.283 -14.771 1.259   1.00 0.00 ? 498 ILE C CB   14 
ATOM 11623 C CG1  . ILE A 1 46 ? -21.488 -13.345 1.783   1.00 0.00 ? 498 ILE C CG1  14 
ATOM 11624 C CG2  . ILE A 1 46 ? -19.875 -14.939 0.706   1.00 0.00 ? 498 ILE C CG2  14 
ATOM 11625 C CD1  . ILE A 1 46 ? -20.597 -12.976 2.949   1.00 0.00 ? 498 ILE C CD1  14 
ATOM 11626 H H    . ILE A 1 46 ? -23.904 -15.376 1.533   1.00 0.00 ? 498 ILE C H    14 
ATOM 11627 H HA   . ILE A 1 46 ? -22.211 -14.392 -0.645  1.00 0.00 ? 498 ILE C HA   14 
ATOM 11628 H HB   . ILE A 1 46 ? -21.412 -15.467 2.073   1.00 0.00 ? 498 ILE C HB   14 
ATOM 11629 H HG12 . ILE A 1 46 ? -21.288 -12.645 0.985   1.00 0.00 ? 498 ILE C HG12 14 
ATOM 11630 H HG13 . ILE A 1 46 ? -22.515 -13.235 2.098   1.00 0.00 ? 498 ILE C HG13 14 
ATOM 11631 H HG21 . ILE A 1 46 ? -19.732 -14.255 -0.118  1.00 0.00 ? 498 ILE C HG21 14 
ATOM 11632 H HG22 . ILE A 1 46 ? -19.742 -15.954 0.361   1.00 0.00 ? 498 ILE C HG22 14 
ATOM 11633 H HG23 . ILE A 1 46 ? -19.157 -14.723 1.483   1.00 0.00 ? 498 ILE C HG23 14 
ATOM 11634 H HD11 . ILE A 1 46 ? -19.562 -13.072 2.657   1.00 0.00 ? 498 ILE C HD11 14 
ATOM 11635 H HD12 . ILE A 1 46 ? -20.803 -13.636 3.778   1.00 0.00 ? 498 ILE C HD12 14 
ATOM 11636 H HD13 . ILE A 1 46 ? -20.798 -11.959 3.245   1.00 0.00 ? 498 ILE C HD13 14 
ATOM 11637 N N    . GLN A 1 47 ? -21.936 -16.620 -1.644  1.00 0.00 ? 499 GLN C N    14 
ATOM 11638 C CA   . GLN A 1 47 ? -21.757 -17.909 -2.286  1.00 0.00 ? 499 GLN C CA   14 
ATOM 11639 C C    . GLN A 1 47 ? -20.463 -18.570 -1.830  1.00 0.00 ? 499 GLN C C    14 
ATOM 11640 O O    . GLN A 1 47 ? -19.383 -18.000 -1.964  1.00 0.00 ? 499 GLN C O    14 
ATOM 11641 C CB   . GLN A 1 47 ? -21.759 -17.751 -3.812  1.00 0.00 ? 499 GLN C CB   14 
ATOM 11642 C CG   . GLN A 1 47 ? -21.660 -19.069 -4.560  1.00 0.00 ? 499 GLN C CG   14 
ATOM 11643 C CD   . GLN A 1 47 ? -21.628 -18.895 -6.067  1.00 0.00 ? 499 GLN C CD   14 
ATOM 11644 O OE1  . GLN A 1 47 ? -22.204 -17.949 -6.617  1.00 0.00 ? 499 GLN C OE1  14 
ATOM 11645 N NE2  . GLN A 1 47 ? -20.961 -19.803 -6.745  1.00 0.00 ? 499 GLN C NE2  14 
ATOM 11646 H H    . GLN A 1 47 ? -21.903 -15.808 -2.191  1.00 0.00 ? 499 GLN C H    14 
ATOM 11647 H HA   . GLN A 1 47 ? -22.587 -18.537 -2.003  1.00 0.00 ? 499 GLN C HA   14 
ATOM 11648 H HB2  . GLN A 1 47 ? -22.671 -17.259 -4.111  1.00 0.00 ? 499 GLN C HB2  14 
ATOM 11649 H HB3  . GLN A 1 47 ? -20.918 -17.136 -4.098  1.00 0.00 ? 499 GLN C HB3  14 
ATOM 11650 H HG2  . GLN A 1 47 ? -20.754 -19.570 -4.255  1.00 0.00 ? 499 GLN C HG2  14 
ATOM 11651 H HG3  . GLN A 1 47 ? -22.512 -19.680 -4.301  1.00 0.00 ? 499 GLN C HG3  14 
ATOM 11652 H HE21 . GLN A 1 47 ? -20.531 -20.528 -6.241  1.00 0.00 ? 499 GLN C HE21 14 
ATOM 11653 H HE22 . GLN A 1 47 ? -20.915 -19.727 -7.723  1.00 0.00 ? 499 GLN C HE22 14 
ATOM 11654 N N    . VAL A 1 48 ? -20.584 -19.763 -1.284  1.00 0.00 ? 500 VAL C N    14 
ATOM 11655 C CA   . VAL A 1 48 ? -19.435 -20.501 -0.819  1.00 0.00 ? 500 VAL C CA   14 
ATOM 11656 C C    . VAL A 1 48 ? -18.915 -21.442 -1.911  1.00 0.00 ? 500 VAL C C    14 
ATOM 11657 O O    . VAL A 1 48 ? -19.695 -22.175 -2.532  1.00 0.00 ? 500 VAL C O    14 
ATOM 11658 C CB   . VAL A 1 48 ? -19.752 -21.310 0.468   1.00 0.00 ? 500 VAL C CB   14 
ATOM 11659 C CG1  . VAL A 1 48 ? -19.972 -20.373 1.649   1.00 0.00 ? 500 VAL C CG1  14 
ATOM 11660 C CG2  . VAL A 1 48 ? -20.970 -22.207 0.268   1.00 0.00 ? 500 VAL C CG2  14 
ATOM 11661 H H    . VAL A 1 48 ? -21.473 -20.164 -1.196  1.00 0.00 ? 500 VAL C H    14 
ATOM 11662 H HA   . VAL A 1 48 ? -18.670 -19.780 -0.581  1.00 0.00 ? 500 VAL C HA   14 
ATOM 11663 H HB   . VAL A 1 48 ? -18.901 -21.934 0.688   1.00 0.00 ? 500 VAL C HB   14 
ATOM 11664 H HG11 . VAL A 1 48 ? -20.816 -19.729 1.451   1.00 0.00 ? 500 VAL C HG11 14 
ATOM 11665 H HG12 . VAL A 1 48 ? -19.089 -19.770 1.796   1.00 0.00 ? 500 VAL C HG12 14 
ATOM 11666 H HG13 . VAL A 1 48 ? -20.163 -20.955 2.539   1.00 0.00 ? 500 VAL C HG13 14 
ATOM 11667 H HG21 . VAL A 1 48 ? -20.778 -22.899 -0.540  1.00 0.00 ? 500 VAL C HG21 14 
ATOM 11668 H HG22 . VAL A 1 48 ? -21.830 -21.601 0.026   1.00 0.00 ? 500 VAL C HG22 14 
ATOM 11669 H HG23 . VAL A 1 48 ? -21.164 -22.760 1.176   1.00 0.00 ? 500 VAL C HG23 14 
ATOM 11670 N N    . PRO A 1 49 ? -17.602 -21.412 -2.192  1.00 0.00 ? 501 PRO C N    14 
ATOM 11671 C CA   . PRO A 1 49 ? -16.998 -22.279 -3.189  1.00 0.00 ? 501 PRO C CA   14 
ATOM 11672 C C    . PRO A 1 49 ? -16.820 -23.694 -2.661  1.00 0.00 ? 501 PRO C C    14 
ATOM 11673 O O    . PRO A 1 49 ? -16.646 -23.906 -1.452  1.00 0.00 ? 501 PRO C O    14 
ATOM 11674 C CB   . PRO A 1 49 ? -15.625 -21.641 -3.464  1.00 0.00 ? 501 PRO C CB   14 
ATOM 11675 C CG   . PRO A 1 49 ? -15.594 -20.377 -2.664  1.00 0.00 ? 501 PRO C CG   14 
ATOM 11676 C CD   . PRO A 1 49 ? -16.608 -20.537 -1.575  1.00 0.00 ? 501 PRO C CD   14 
ATOM 11677 H HA   . PRO A 1 49 ? -17.579 -22.305 -4.100  1.00 0.00 ? 501 PRO C HA   14 
ATOM 11678 H HB2  . PRO A 1 49 ? -14.846 -22.322 -3.152  1.00 0.00 ? 501 PRO C HB2  14 
ATOM 11679 H HB3  . PRO A 1 49 ? -15.525 -21.440 -4.520  1.00 0.00 ? 501 PRO C HB3  14 
ATOM 11680 H HG2  . PRO A 1 49 ? -14.613 -20.233 -2.240  1.00 0.00 ? 501 PRO C HG2  14 
ATOM 11681 H HG3  . PRO A 1 49 ? -15.852 -19.541 -3.296  1.00 0.00 ? 501 PRO C HG3  14 
ATOM 11682 H HD2  . PRO A 1 49 ? -16.163 -21.006 -0.711  1.00 0.00 ? 501 PRO C HD2  14 
ATOM 11683 H HD3  . PRO A 1 49 ? -17.031 -19.579 -1.322  1.00 0.00 ? 501 PRO C HD3  14 
ATOM 11684 N N    . PHE A 1 50 ? -16.847 -24.654 -3.554  1.00 0.00 ? 502 PHE C N    14 
ATOM 11685 C CA   . PHE A 1 50 ? -16.711 -26.042 -3.179  1.00 0.00 ? 502 PHE C CA   14 
ATOM 11686 C C    . PHE A 1 50 ? -15.291 -26.521 -3.436  1.00 0.00 ? 502 PHE C C    14 
ATOM 11687 O O    . PHE A 1 50 ? -14.660 -26.095 -4.407  1.00 0.00 ? 502 PHE C O    14 
ATOM 11688 C CB   . PHE A 1 50 ? -17.702 -26.910 -3.958  1.00 0.00 ? 502 PHE C CB   14 
ATOM 11689 C CG   . PHE A 1 50 ? -19.142 -26.675 -3.596  1.00 0.00 ? 502 PHE C CG   14 
ATOM 11690 C CD1  . PHE A 1 50 ? -19.840 -25.606 -4.126  1.00 0.00 ? 502 PHE C CD1  14 
ATOM 11691 C CD2  . PHE A 1 50 ? -19.799 -27.533 -2.728  1.00 0.00 ? 502 PHE C CD2  14 
ATOM 11692 C CE1  . PHE A 1 50 ? -21.166 -25.392 -3.800  1.00 0.00 ? 502 PHE C CE1  14 
ATOM 11693 C CE2  . PHE A 1 50 ? -21.122 -27.324 -2.398  1.00 0.00 ? 502 PHE C CE2  14 
ATOM 11694 C CZ   . PHE A 1 50 ? -21.807 -26.253 -2.934  1.00 0.00 ? 502 PHE C CZ   14 
ATOM 11695 H H    . PHE A 1 50 ? -16.941 -24.423 -4.503  1.00 0.00 ? 502 PHE C H    14 
ATOM 11696 H HA   . PHE A 1 50 ? -16.933 -26.121 -2.126  1.00 0.00 ? 502 PHE C HA   14 
ATOM 11697 H HB2  . PHE A 1 50 ? -17.591 -26.707 -5.013  1.00 0.00 ? 502 PHE C HB2  14 
ATOM 11698 H HB3  . PHE A 1 50 ? -17.475 -27.949 -3.773  1.00 0.00 ? 502 PHE C HB3  14 
ATOM 11699 H HD1  . PHE A 1 50 ? -19.335 -24.931 -4.801  1.00 0.00 ? 502 PHE C HD1  14 
ATOM 11700 H HD2  . PHE A 1 50 ? -19.266 -28.372 -2.308  1.00 0.00 ? 502 PHE C HD2  14 
ATOM 11701 H HE1  . PHE A 1 50 ? -21.699 -24.554 -4.220  1.00 0.00 ? 502 PHE C HE1  14 
ATOM 11702 H HE2  . PHE A 1 50 ? -21.624 -27.999 -1.720  1.00 0.00 ? 502 PHE C HE2  14 
ATOM 11703 H HZ   . PHE A 1 50 ? -22.842 -26.089 -2.675  1.00 0.00 ? 502 PHE C HZ   14 
ATOM 11704 N N    . PRO A 1 51 ? -14.757 -27.390 -2.556  1.00 0.00 ? 503 PRO C N    14 
ATOM 11705 C CA   . PRO A 1 51 ? -13.417 -27.956 -2.726  1.00 0.00 ? 503 PRO C CA   14 
ATOM 11706 C C    . PRO A 1 51 ? -13.297 -28.682 -4.059  1.00 0.00 ? 503 PRO C C    14 
ATOM 11707 O O    . PRO A 1 51 ? -14.085 -29.589 -4.358  1.00 0.00 ? 503 PRO C O    14 
ATOM 11708 C CB   . PRO A 1 51 ? -13.292 -28.952 -1.566  1.00 0.00 ? 503 PRO C CB   14 
ATOM 11709 C CG   . PRO A 1 51 ? -14.277 -28.482 -0.553  1.00 0.00 ? 503 PRO C CG   14 
ATOM 11710 C CD   . PRO A 1 51 ? -15.411 -27.875 -1.326  1.00 0.00 ? 503 PRO C CD   14 
ATOM 11711 H HA   . PRO A 1 51 ? -12.649 -27.199 -2.650  1.00 0.00 ? 503 PRO C HA   14 
ATOM 11712 H HB2  . PRO A 1 51 ? -13.529 -29.947 -1.918  1.00 0.00 ? 503 PRO C HB2  14 
ATOM 11713 H HB3  . PRO A 1 51 ? -12.286 -28.932 -1.176  1.00 0.00 ? 503 PRO C HB3  14 
ATOM 11714 H HG2  . PRO A 1 51 ? -14.627 -29.318 0.035   1.00 0.00 ? 503 PRO C HG2  14 
ATOM 11715 H HG3  . PRO A 1 51 ? -13.819 -27.739 0.085   1.00 0.00 ? 503 PRO C HG3  14 
ATOM 11716 H HD2  . PRO A 1 51 ? -16.156 -28.622 -1.553  1.00 0.00 ? 503 PRO C HD2  14 
ATOM 11717 H HD3  . PRO A 1 51 ? -15.845 -27.056 -0.773  1.00 0.00 ? 503 PRO C HD3  14 
ATOM 11718 N N    . THR A 1 52 ? -12.338 -28.279 -4.854  1.00 0.00 ? 504 THR C N    14 
ATOM 11719 C CA   . THR A 1 52 ? -12.154 -28.861 -6.156  1.00 0.00 ? 504 THR C CA   14 
ATOM 11720 C C    . THR A 1 52 ? -10.737 -29.422 -6.293  1.00 0.00 ? 504 THR C C    14 
ATOM 11721 O O    . THR A 1 52 ? -9.777  -28.739 -5.879  1.00 0.00 ? 504 THR C O    14 
ATOM 11722 C CB   . THR A 1 52 ? -12.474 -27.832 -7.287  1.00 0.00 ? 504 THR C CB   14 
ATOM 11723 O OG1  . THR A 1 52 ? -12.454 -28.468 -8.573  1.00 0.00 ? 504 THR C OG1  14 
ATOM 11724 C CG2  . THR A 1 52 ? -11.491 -26.668 -7.284  1.00 0.00 ? 504 THR C CG2  14 
ATOM 11725 O OXT  . THR A 1 52 ? -10.589 -30.554 -6.795  1.00 0.00 ? 504 THR C OXT  14 
ATOM 11726 H H    . THR A 1 52 ? -11.728 -27.568 -4.560  1.00 0.00 ? 504 THR C H    14 
ATOM 11727 H HA   . THR A 1 52 ? -12.851 -29.682 -6.241  1.00 0.00 ? 504 THR C HA   14 
ATOM 11728 H HB   . THR A 1 52 ? -13.468 -27.440 -7.109  1.00 0.00 ? 504 THR C HB   14 
ATOM 11729 H HG1  . THR A 1 52 ? -11.541 -28.693 -8.805  1.00 0.00 ? 504 THR C HG1  14 
ATOM 11730 H HG21 . THR A 1 52 ? -10.489 -27.044 -7.422  1.00 0.00 ? 504 THR C HG21 14 
ATOM 11731 H HG22 . THR A 1 52 ? -11.554 -26.1